2GCOA

Crystal structure of the human rhoc-gppnhp complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
187
Chain Sequence
HHHSSGLVPAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho-related GTP-binding protein RhoC
total genus 65
structure length 187
sequence length 193
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcoA01
2WJVA 1DAEA 4NONA 1XPOA 1JQJC 3FFBA 3VX3A 2ONJA 221PA 1R5OA 2A78A 2O8BA 4EFLA 1UBCA 3KKNA 2VSFA 1PVOA 1Z0KA 1KK1A 4BLRA 1SXJE 3RLFA 4DVGA 3R9IA 2WWIA 3MWKA 2ZJ2A 3T61A 2FPKA 3AKCA 4Q7KA 1Z28A 1TL7C 1ZM7A 3AH8A 5CDFA 3FOZA 1WA5A 2BCGY 1E9AA 2R6GA 3K9GA 4BZQA 2CHQA 2IUSA 1EFCA 5JI3E 1RKBA 3B60A 3CRMA 4YLGA 1E1RA 1EX7A 1FFHA 2XEXA 2ZS8A 4PANA 4CRWB 5JBQA 1CLUA 3U61B 3R7WA 3LD9A 3H86A 5DO9A 4MH0R 4PAQA 4PO8A 4HDCA 2VHUA 3BH7A 1GL9B 4JSYA 5KPDA 3AM1A 2UZIR 3Q72A 1TUEA 4HLDA 4JIMA 5AJZA 3M6AA 4ESVA 4C2TA 3RWMB 3LXXA 3N2EA 4PQRA 2GXSA 2RKOA 3QIAA 5G40A 2JLXA 3CKLA 4A4DA 1JEDA 3FE2A 1W49A 3EIEA 4ARZB 1EESA 5BN5A 1G64A 3PUZA 5HE9A 1NLZA 4KITB 3V4RA 3LDAA 1J8MF 1AQYA 3WNCA 3EPHA 2VP5A 4LJ7A 3GEHA 2I1VB 5KO2A 1TTTA 4XSHA 4Q18A 2JLUA 3L8ZA 3NG1A 4MUBA 3FWYA 4NHOA 2V9PA 2OAQ1 1KDRA 4E5UA 3PEWA 3KQHA 1S2MA 4GMXA 1XJCA 4LV8B 3VU9A 3V00A 2OAP1 2B8TA 4D4MA 5HE8A 1HQCA 3LY5A 2PLRA 1FZQA 2FZLA 4QXAA 5F98A 1G6OA 2FEMA 4RFVA 4BZPA 1JJVA 1K5GA 2O0KA 2WHXA 1O87A 3I5XA 5JCPA 2XTMA 2KBEA 3HPRA 4U00A 2CLSA 1CBUA 4AKHA 4HB0A 1G5TA 3W5JA 4QJ5A 4TZ6A 4TN1A 2W00A 1Y63A 2WKRA 4L9WA 4NPHA 5EZ5A 4MDEA 4Q9JA 1SGWA 3J81k 1CJTC 1QHNA 2A7QA 4R2HA 3R7WB 2ODBA 5JRZA 5GJVC 5SZJA 1GNPA 2QY9A 2V7QD 3OIYA 3BH0A 4UNQA 2QSYA 3CNOA 1KJZA 4I1SA 5JJIA 4JT4A 4TL6A 3BAFA 3PENA 2ORVA 1IOZA 5EE0A 3KDSE 3SR0A 3GEEA 3PFIA 3TIFA 2JLSA 3MGCA 5CYPA 2Z43A 1XCGB 1E6CA 1XTIA 4JLPA 3U7EB 1TF7A 1OYYA 2HDNB 1N0VC 2ZRHA 5KSZA 4LJYA 1E9DA 2GBLC 1N5LA 2IYYA 2QA5A 4KBFA 5GVRA 2J45A 2OCAA 3QVVA 2WOOA 1F2UA 4I1UA 4NYJR 2YC2C 1ZUHA 3U7FB 2XOKD 5A4JA 3OFND 3I1FA 1IHUA 4DLTA 1P61B 3K0CC 1IY2A 4Q4HA 2H8KA 4YONB 2P5SA 1U9IA 4B73A 1NBME 4V0NA 1W47A 1XB2A 2ZRPA 3WRXC 2FF7A 3KTAB 4TLBA 1M7BA 1T91A 5CJ2A 1CTQA 3GJXC 2ERXA 3ZZ0A 1E1QA 2BOVA 2ZREA 2YOGA 4CIDA 5FPHA 3U2QA 3WNBA 5JLJA 4D25A 4PC1A 4LDJA 1E2IA 3GLHB 3F0TA 2NO0A 3K70B 5SZHB 1E9CA 2TMKA 4OK6A 1NN3A 1RRGA 4XSGA 4Q19A 4URUR 2GJSA 2XB2A 1RJ9B 2ZSEA 4URYR 1NG9A 2KI5A 3OEHA 2ZE8A 5BWMA 1S3GA 2Z0MA 4M53A 1CR1A 4L8GA 2QP4A 1BO6A 2LKDA 5E4FA 4M2LA 1XDBA 1FP6A 1T6NA 1UKVY 2KWIA 4EFMA 1BOFA 1KKLA 4JKYA 4KVAA 1NLYA 2DWPA 3MAAC 4LJ5A 4FWTA 2QAGC 2PCJA 2QE7A 3NHAA 2FU5C 3NH9A 1RYFA 1R0WA 4KFRA 3AF0A 2WSMA 1IQPA 5EE9A 3AP3A 4DEXA 3CH5A 4KVGA 2AKAB 2D74A 2IF2A 1HT1E 4L15A 2HYDA 2J59A 4QNMA 1GSIA 4ZDJA 3P1JA 1WBBA 4BFVA 1VTKA 4Q1CA 4IFEA 4IOJA 2G0TA 2C8VA 3KXIA 2RGEA 3HJNA 2D3WA 2FFAA 4B3DA 3AVOA 3V4FA 2GILA 1XZPA 1Q1BA 1H8HD 3VHLB 1W0JA 1L4UA 3NBZC 4FN5A 4RD4A 2VTKA 5FR2A 5G3YA 3WRYC 1DG3A 1NBMD 2X19A 4FI3C 1VG9B 4NE2A 1VIYA 4WBSA 4FINA 4AK9A 2AX4A 2FFBA 1RRFA 4DIEA 3EZFA 1OPXA 1U99A 1W1WA 1WQ1R 2IC5A 2BBWA 1AN0A 3KFXA 1KYIA 1A82A 5L3VA 4BEJA 5CIQA 1F2TA 2PLFA 2LKCA 1WB9A 1NN0A 5GJCA 1D6JA 4HLUC 1KK0A 3A1WA 1YZQA 1W44A 1UDWA 3H4MA 1HQYE 1MV5A 1LS1A 3EXAA 3VKWA 2UVQA 4WOPA 4A6XA 1M7GA 4PSKA 3EPKA 2V55B 3DL0A 2EVWX 1DVRA 1E2LA 1EG7A 3KUCA 1SKYB 4QJ4A 1DO2A 1JR3A 3C4JA 5L3QA 1SVMA 2WAXA 5KHOC 1VYTA 5J4HA 1U81A 2OBNA 1OKKD 2B92A 3P20A 1E0SA 1NY5A 4Q4JA 4OQMA 4RD2A 2IWRA 4MKFA 1E2EA 4MUAA 4NYIR 2GCOB 1KSGA 5C2JB 4A0RA 4LHWA 2HXYA 2QRZA 4LPSA 5K8UA 3K0SA 2VP4A 3W6PA 1JNYA 4DIDA 2O8CA 1NVVQ 3L8YA 1V5WA 3PQCA 4KYIB 4NCIA 3SNHA 5F9HA 2MMGA 2VP2A 3NDPA 4F4JA 2OBLA 2RB4A 1W2GA 3GCGA 4TQUS 1N0UA 1XRJA 2XJ4A 3CR8A 1I2DA 1NLFA 2ZVQX 3X1YA 3B2EA 1GAJA 1GOTA 2ASEA 1KHTA 2OG2A 2ZITA 4YQFA 3Q5EA 3U7GA 3KQLA 1QRAA 3RVBA 1GL6A 2OSBA 3VNUA 1DAKA 1G4AE 2EFHB 1J7KA 2PX0A 1H65A 2IYXA 3QXXA 2D62A 4EPVA 3BB3A 4WZBE 2GDJA 4FWIB 4GT1A 2BKUA 3LNCA 5CK5A 5BQ5A 1R8QA 2PJZA 2O8EA 4OHZA 2IK8A 1CS4C 1W5SA 3K0AB 3CB4A 3WP0A 1W36B 2KJQA 3OAAD 4ZCLA 4X8LA 2QZ4A 3PVSA 4LJ6A 2JLYA 1ZNYA 2X8AA 121PA 1CKEA 1YR7A 4Q4AA 4TT3D 3K1JA 1MO3A 4LJ8A 1T0HB 1XMIA 1E2JA 2P6NA 3UANA 1XU4A 1U98A 3SE0A 3P4YA 4KHZA 4C30A 2QGZA 2ZRIA 2BBSA 1E3MA 1Z0DA 3GLFA 3U44A 4Q00A 3BRWD 3KQNA 3AQ4A 4WW0A 3RHFA 4A1FA 2BMDA 4R98A 2ZRDA 1K8RA 1YQTA 4DCUA 3EC1A 4EUNA 1KDOA 3ADCA 3PUXA 1A2BA 4JZKA 4UQOA 2FV8A 1NIJA 421PA 4EPRA 1X1SA 3B9QA 3M1IA 1F60A 2F6RA 5D3MA 3WYAA 2I4IA 4DJTA 1X86B 5KU1A 3LH5A 2FFQA 3FMIA 1FW6A 2A30A 1LV7A 3L0PA 5FPTA 2REBA 2AD1A 2Q0HA 1OSNA 2G6BA 5GJBA 1M8PA 5GJWC 5BYJA 1IN7A 4DLWA 4CEIA 1EK0A 8OHMA 4HAUA 4WZAE 2CCKA 3BB1A 4HZUB 1KI1A 2WSSA 4O3MA 4X8OA 1OV4A 2F43A 1HE8B 3LBHA 4EQ6B 2G3YA 2BEKA 4D2IA 2C9CA 1GILA 3EARA 4NP6A 1G5RA 2B21A 1SVIA 2NZ8A 3QI2A 1RVDA 3KJHA 1E2KA 4UJ5A 2V8OA 3OESA 3L0SA 4LV5B 4U02A 5JWOA 3PITA 4DDWA 1HYQA 1XD2B 1GKUB 3ZZTA 1Z6AA 2A5FA 2WPDD 3GLIE 1W48A 4US1R 2YWFA 1ZNXA 1R5BA 5IT5A 3FPAA 2FOLA 1DG1G 1P9RA 3LBIA 3QXCA 4IHQA 5TB5A 2WAYA 3HP1A 2ODNA 5CM8B 5EUQB 1U8AA 2NIPA 1F48A 3A36A 1G19A 4US0R 4JLMA 2ZETA 4YMSA 1QVAA 4EAQA 2DWQA 1BIFA 4C0KA 3KB1A 1M34E 4LBVA 4HUTA 5C18A 3O8CA 1GFIA 3S1AA 2CEAA 1Z5ZA 2PMDA 1FNNA 4BZXA 4ZKDA 5IK2A 1Z07A 4OHVA 4PTLA 4GRAA 5KSPA 4DRZA 1SZPA 2P6UA 1ZMXA 2R6CA 4M1KA 1MO4A 2D7CA 3K70D 2JLRA 4B2PA 4CDGA 4C0AC 4HZUA 4IDHA 2J0UB 3LW8A 2PT5A 5GVSA 1N6OA 4Q9LA 2IEYA 2IF0A 4B34A 5DYIA 1G41A 1DAIA 4FMBB 1T4GA 1W4CA 4CT5A 2B6HA 3EZ7A 2CNWD 2DR3A 3GJ5A 3KB2A 1KMQA 3QOFA 3RRZA 2JJ2D 1LF5A 1YKSA 2IHBA 1FP7A 2GNOA 2QUZA 2WM9B 3CNNA 3G82C 4QBFA 2BV3A 4OHYA 1A2KC 2JA1A 2W2VA 2P6RA 4ILEA 4M1OA 1RPZA 3D6TB 4F4CA 4Q1EA 3BERA 4OHWA 3TJZA 3B6EA 2F7SA 2ZRAA 3QXJA 4HB4A 1IXRC 3ICEA 2C2HA 4OQNA 4GOJA 3H1TA 1D2NA 1KJWA 1WDTA 4F38A 3GLGE 3F5FA 3PV0A 2PZEA 2VSOA 4LUCA 821PA 1Z06A 2R6FA 3FFAA 1ZVQA 2W2TA 5EUMA 4CEIB 2AKYA 2C96A 3EW9A 2NPFA 1DAMA 3A6PC 3PUYA 3TR5A 5EE3A 3VNVA 3I3SR 3AUYA 4ARZA 4QBIA 2OV2A 3VR1A 3CF6R 5G41A 1CR4A 2ZYWX 3X1ZA 1UDXA 4M1SA 4TL7A 1AGPA 1QHGA 5FBVB 3MRSA 3BGWA 1KSHA 2IYRA 1YZTA 4QL3A 4A8JA 5H8WA 1W7AA 4TYYA 1UEJA 3RANA 1CRQA 4GP6A 2EFCB 3I92A 1Z08A 3LO5A 3BXZA 4HDQB 4BRUA 4FXPA 2ZR7A 1SKQA 2FPLA 2RCNA 3NC1C 5EZ6B 2DFKB 4TTRA 3OE7D 4GDFA 1OKKA 4X8MA 3T34A 3IO3A 2JASA 1G4UR 1E2PA 1NJGA 2QMHA 2WWYA 1XTKA 2IW3A 4HLQB 4KODA 5DH9A 4ZKEA 4TZ0A 1K6MA 2O8CB 1DTSA 2H18A 5FBQB 3RC3A 4TQAA 3U3RA 4MRNA 4TYWA 1ZRHA 4YXWD 4UNRA 4Q5IA 2HLDD 2QAGB 3TVTA 2JLQA 1D9XA 1VCMA 1XTSA 3KX2A 4G3XA 4TYQA 2NG1A 5AUNB 2J7KA 2ECKA 3OF5A 2BM1A 4Q4JB 5KOYA 1LB1B 5SZKB 4B71A 2WKPA 4JLKA 5DHAA 2A5GA 1HE1C 2QMOA 3OIWA 4BWYA 2Z4SA 3LBNA 2ODWA 3QG1A 1G8FA 2QTHA 4A36A 1T9HA 3IKJA 2FPMA 4KO8A 4FW9A 4ZO4A 1NIPA 2H7VA 2BIFA 4HAWA 3QVUA 5FL7D 5AUPB 1AZSC 4W7SA 3Q9LA 3GFOA 3AKYA 4Q4LA 4QG7A 3GFTA 4JJZA 2IYLD 4PC2A 5JI2E 3C41J 1KMHA 5IHPA 4IVQA 1ELOA 2HCBA 4W5WA 3OEEA 2EFDB 2IT1A 1IY1A 1OH5A 1MOZA 3AVWA 2IYQA 2ZYVX 5FH9A 1OXVA 1S0UA 2N1BA 1E32A 2GA8A 2IXFA 5FBWB 2ZRGA 1TQDA 1BH2A 4WZ6A 1F2UB 4TTPA 4CEJA 2Q9CA 2R62A 5B58C 521PA 2XNSA 2VF7A 4C9BA 4IEEA 2RGXA 4IOKA 2ZI6A 3WYGA 1NBMA 4NYIQ 2O8FB 2C04A 1FX0B 2YC4C 3RS4A 5L3SA 1COWA 2SHKA 3FYHA 5JCZA 5DLQC 5TY0A 3U7HB 4XTCS 4BFWA 4FMCB 4OJQA 1XCMA 1S9DA 3CH4B 3X1XA 1P75A 2JJ8A 1J90A 1DE0A 2QNRA 2JJ1D 1Z8FA 2IS1A 1L8QA 1KI6A 4NCHA 4B76A 1BYUA 1KMHB 1P73A 2R65A 4Z8XA 1GKYA 3CONA 1COWD 3NXSA 2IS2A 1ZNWA 4OHXA 5EQTA 1CIPA 3G0HA 1WP9A 2YWGA 1VG1A 2J0VA 4IEIA 3CLVA 3BJIC 3ZIAA 4D80A 2XSZA 5K8IA 1QHXA 4QBGB 3RDPA 2DFLA 5EP1A 5TXGA 3I32A 2AK3A 1ZP6A 3GP8A 2QTFA 3NC0C 2ZJZA 2NZJA 2PZGA 3PEUA 4OI2A 1S96A 5SZIA 1MRSA 1R0ZA 1KI4A 3K8YA 4JMPA 5LD2C 4AKIA 3SI7A 1ZM2A 3CX7A 1XMJA 1KZGB 4G5GA 3MSXA 4N0DA 2O0JA 3AF4A 4WA7A 1CP2A 1AGRA 1QG4A 1MT0A 2YINC 4BLTA 1RRPA 1J2JA 1XMSA 1Z2CA 1N6KA 3TNFA 2QG6A 4F92B 1RJ9A 1T3SA 1KNXA 2CMKA 4XD7A 3H84A 3HU2A 2IUTA 5JS7A 4W9MC 3BD9A 3AGPA 4DLZA 1C1YA 2AR7A 2XNDD 3UKDA 2P5TB 2GCNA 3EPJA 4JLAA 5L3RA 2H57A 1SVKA 2HJGA 5EXSA 3NEJA 1MO6A 3OIVA 3CZPA 1GRRA 4IVRA 3NTUA 2YHSA 3I8XA 4ASUD 2W6IA 2ZI9A 2KBFA 4WXPA 2FGKA 1E4VA 3D31A 3FMFA 4JL6A 1C4OA 3IHWA 2WICA 3B8HA 1S9HA 2BMEA 1E69A 2ZJAA 4A0FA 3SHFA 1Q20A 3N2IA 3QKTA 1Q0UA 3P32A 3AVUA 2GK7A 3AVXA 4NTZA 3A1UA 3KL4A 3EASA 5F2EA 3IPYA 3SHWA 4Q03A 4F91B 1G8HA 4MKGA 2ANCA 1ZIOA 1XXHB 3WMGA 1U0JA 2L0XA 2QQEA 3W8RA 1GRQA 1M2OB 4RFSB 1R6BX 1SVOA 2X1VA 2YKGA 2FSGA 4V02A 2QMUA 2F1IA 2IEZA 1KSFX 4E07A 3SC3A 2F9LA 1IN6A 4JL8A 2RGCA 3DM9B 1E9EA 1U94A 4UXHA 1CEEA 1OHHA 4N1AA 1KI3A 4DWJA 1U9IC 2ZYTX 1ZD9A 3ICQB 1G7RA 2ZJ8A 5FPKA 2O0HA 1MO5A 2QL6A 2RGGA 4LC0A 1BMFA 5FTJA 5JSZB 2GZAA 2QBYA 1SHZA 4CT4B 4OI1A 1OFUX 2DCUA 2ZU6A 5BYKA 3LAWA 3VR2A 4V0LA 1VECA 1TQ6A 3QKUA 2QGNA 2OCBA 5ELXA 4PAMA 4ZCIA 4CYMA 2FNAA 4M0LA 2D06A 4P4UA 1XJ0A 5LBIA 5AK0A 4HAYA 5J4VA 5JHHB 3CX6A 4BFSA 2ZSAA 5HKKD 2JAQA 5FTNA 4O0MA 4RCZA 3UMSA 1A1VA 3RNLA 3MFYA 2QAGA 4LHXA 5BW8A 5LB4A 4MGZR 3DVLA 3MJHA 3NEYA 2O5VA 5C1BA 1XWIA 1GKIA 1QZXA 2VYFA 3QF4A 5EE5B 4BFXA 3RC8A 3LV8A 4V0KA 4POAA 2VP6A 2ZUBA 2VL7A 3H0KA 1E2MA 4G5OA 5KDDA 4CZ2A 4U7DA 4KLNA 4L5BA 1JECA 1JAHA 2CVFA 2EWVA 1KI2A 1RW4A 4XH9B 1J8YF 2GZDA 1KIMA 1YE8A 2IYWA 3EAQA 4HI0E 4JSTA 4JKIA 3TBKA 3IIMA 3AKDA 5JEEA 1NSFA 1NL3A 2FH5B 4HUQA 3CF0A 2W0MA 5B64A 4UNPA 2VH5R 1TNDA 1DOAA 1R8SA 2CLDX 3SYNA 1E98A 3R20A 5E3HA 1CR0A 5KPJA 5FL7A 3TAUA 5L3QB 3I61A 1GDDA 1MKYA 1G8GA 1AIPA 2BVNA 1GL7A 3TMKA 1E2DA 3CR7A 4W5HA 3V9PA 2GRJA 1U0LA 5FPSA 1KKMA 4A0HA 3IEUA 1JAIA 2ZRMA 2ZE7A 3U6KA 2P0EA 1S4QA 1JALA 2P65A 1EFRD 3VTKA 1YVDA 4BQSA 2B7CA 2VLIA 2FMXA 1KO4A 4E09A 3ZS8A 5KNCA 1W36C 1FQKA 4QRHA 1E0AA 4JYCA 3IUYA 2XZPA 2ZIAA 3MD0A 1XEWY 3ZVNA 1Q21A 2N46A 2ONKA 2VA8A 1XTQA 1R0XA 3AP2A 1PLKA 5IF9A 2BDTA 4QNRA 2ZAMA 3QNUA 3DMNA 4IDNA 5DI3A 3FDIA 4MYTA 5BN4A 3THYB 4DUGA 4DDVA 1SXJA 1XEFA 4OI4A 4PAOA 4TL8A 3W34A 1RFLA 2GJAA 4TYPA 2RGAA 3K0FB 2OZEA 4FIDA 4LV6A 2KB0A 4GZLA 4NH0A 4A82A 3U44B 1LW7A 3O47A 3AP1A 4DSUA 2WIBA 4A2WA 2C03A 1B0UA 1F6BA 1ZINA 1D9ZA 3QENA 1NP6A 2XTZA 4JVMA 2DFNA 4LRWA 6Q21A 2NPIA 2WV9A 3C5HA 3EC2A 3O8DA 2ZJBA 4UJ3A 1N6HA 1SQ5A 2Y8EA 3U6BA 3ZVMA 3A37A 4RD1A 1O3YA 4B47A 3AEZA 2RMKA 1II0A 1TQ2A 3P26A 1PUIA 3K0EA 4BECA 5FUXA 3W9YA 3R9WA 4AD8A 3AVYA 3WMFA 1NKTA 4PSAA 1MABB 2NO9A 2AFHE 4IVPA 5M04A 1NI3A 4IW3B 2GJKA 4XVQA 2CJWB 4KFTA 1UKEA 3K09C 4EPXA 2BM0A 3SU8A 4H1UA 3IDQA 3L43A 1OH7A 5HCIA 1G3QA 2OBMA 2OHFA 3SEAA 2PH1A 1KO5A 3E2IA 3TE6A 2AN9A 3NH6A 3TRFA 2JLWA 4CEJB 2ZRCA 2ZE6A 4FCVA 1DELA 1ANKA 4P4TA 3UMFA 3SBDA 4DDTA 3U60B 1L4YA 3FGNA 2RGDA 3DMDA 4B48A 5JEDA 2C78A 4YDHB 4B75A 2RGBA 3NDBB 2ZPTX 1S1CA 4QJ3A 4TMZA 2B8WA 3ETLA 1AKYA 1F3OA 4KSBA 4JBYA 3GMTA 5DISB 1Z0JA 2BBOA 3CM0A 3TSZA 3G5UA 4I1OA 4R71A 1TPZA 4MYHA 2WWXA 4KLZA 2EFEB 5EJEA 1Z0IA 4M1TA 1AQUA 4ABYA 2QE7D 4NMMA 5FBRB 1UF9A 4QKQA 2ZQ5A 4LOAA 2OESA 4JLBA 4BASA 2RGNA 3PR1A 1W4RA 2QI9C 1EWQA 1NVXQ 5JSZA 2REOA 3O8BA 2FE4A 4MRPA 5KTYA 1PJRA 4OBEA 4AY2A 4IFBA 1TF5A 1N25A 4LYAA 2FSIA 4PPNA 3D7MA 4V03A 2ATVA 2GBLA 3TVDA 3ADDA 1QVRA 2GEDA 3A1TA 4URWR 3FVQA 1G9XA 5G53C 3BFXA 2HT1A 4U5XA 4JLJA 4AC9A 1XNJA 2CCGA 4AG5A 3OEHD 2D4HA 3C5CA 3HPQA 1T8TA 4PHHA 2JATA 3K0CA 4DT1A 2A3RA 1DPFA 3CWQA 1X1RA 4B2IA 1ZC3A 4XWOA 3EG5A 2CE7A 4D82A 1P2VA 3KJEA 2FFHA 4US2R 2D2EA 5FI1B 1GIAA 4QGGA 3FHCB 1BMFD 4RKFA 1XTRA 4NBSA 2WPDA 3LVRE 1YR6A 4C0LA 4GOKA 3VKHA 1I4LD 1SVLA 1TU3A 2JJ1A 5IRCD 4XWKA 2JGNA 3X2SA 1ZM9A 2OXRA 1QHYA 1ZBDA 2ZJYA 2QMEA 1IONA 3AVVA 2BJWA 3NBXX 4LPKA 2R6AA 3AV0B 1A5TA 1R0YA 3BORA 1CF4A 2OCYC 2R44A 4OL0A 4IKEA 4TLCA 3ZGXA 3BFVA 1E79D 1SXJC 2AK2A 1FX0A 1W0JD 1Z6TA 3CPEA 3GJ8A 5JJKA 1QBKC 2WZQA 4BPBA 1D5CA 3RAPR 3T15A 2G0NA 3TKLA 1TF2A 3W3AA 2YZ2A 3E1SA 2BKEA 3QKRA 3UPUA 3HDTA 3RRNA 1UADA 5C4MA 1W0KD 2D2FA 3C14C 1NVUQ 2QU8A 1D2MA 1VHLA 4HAVA 2GAAA 4Q7MB 3UG6A 3RRMA 2QROA 1YZUA 5P21A 4GZMA 2IWHA 4NYMQ 3GLIA 4Z8YA 1T5LA 4X8HA 1G8PA 4PQFA 3TQFA 5IK2D 2IYSA 2ZUDA 3SFZA 3HR7A 3ADBA 2A9KA 4LYHA 2X2EA 2OLKA 5DHFA 3SQWA 2ZR0A 3NHBA 1FOEB 1CJMA 3UWKA 3THXB 4Y0AA 1LVGA 1YHNA 2FSFA 4LHVA 5AWFC 4B3CA 4BFTA 4RZ3A 1YRBA 2JEOA 3CUEF 5CLQA 3WYFA 1G3MA 3SOPA 5JMTA 4G01B 4PPFA 2W6ID 4JJKA 3ZQ6A 3TGPA 1ESMA 4LYJA 621PA 4H9GA 3IQXA 721PA 2VSXA 5E95A 2CJWA 4DLSA 2C9OA 2GXQA 3W8NA 5LPNA 2ODEA 2W2XA 4MRRA 1Q3TA 3SZRA 3EA0A 4TMXA 2JDID 3GLFE 1EFHA 3PIRA 4BRWA 1H8ED 3T5DA 3AVQA 3WBJA 2OXCA 4DZZA 4M4SA 1L7VC 2FA9A 1XPUA 4DCVA 4YMWA 1RYHA 2QT1A 3VAAA 5KNBA 2E9SA 4LJAA 4TMTA 3SJCA 4DDUA 3SS8A 2Q9AA 4XTRA 3VX4A 3LLUA 3T12A 2GAOA 3A1VA 5FL3A 3KQKA 3UIEA 2JDIA 1GG2A 1NKSA 3GJ3A 2CVHA 4D26A 2G1KA 3FKSA 3ND9A 5CK4A 4XVRA 1WE2A 2HCJB 4EPWA 2WWFA 2QTVB 2GHIA 4G5QA 4E03A 3VU9B 1S8FA 1VCIA 2ZVPX 3RS3A 3QKSB 3GLGA 2WKQA 5K8LA 4EPTA 4LX0A 2EQBA 2C98A 2W6JA 3W6NA 4LBYA 3DKPA 2RGNC 5DGXA 1T8UA 2Q6TA 3AF2A 3MCAA 1J99A 1R2QA 4B6FA 3U3OA 3FKSD 4IDPA 1N6RA 1X6VA 1ZYUA 1RZ3A 2QN6A 4HAXA 4DCTA 5J4YA 3EZ6A 4MITA 2ZRLA 4A9AA 3GLHA 3ZJYA 1KI8A 3A58B 4P0TA 1QG2A 5HPYB 3EPLA 4Z1MA 3IBGA 4ZCMA 3THOA 5JWHA 1OXUA 1LY1A 5EXPA 2VO1A 4I81A 5ANRB 2GF0A 4A8JC 2QRNA 1Z47A 3B7GA 4DHEA 4TTQA 2CL0X 4K8OA 1KO7A 1IBRA 4Q1DA 2WVJA 2QT0A 4QBHA 1G3IA 4JS0A 1OIVA 1BS1A 2NO1A 4M8NE 3A1SA 4RSGA 1Z2AA 1Q22A 1IN5A 4C0QC 3LX8A 4FMDB 1N5IA 4M22A 2J3EA 4DSOA 4B3BA 4Q02A 4DKXA 4ACAA 5JFGA 2FJUA 2ZTSA 2FWRA 3PCRB 1T3LA 2FEOA 2DPXA 2F9MA 3JVVA 1NY6A 1OFTA 3T06B 2FSHA 1KZ7B 3EWAA 5C46F 4HAZA 4D4KA 4EDHA 2ZM5A 3IGFA 1QHHA 3ONWA 4PC6A 4OK3A 1KAGA 1OE0A 4PR0A 2ERYA 2IYZA 1LFDB 4N3NA 4YC7A 1GUAA 1JR6A 2ATXA 2WWHA 2IX3A 4RD0A 3W5IA 4TMVA 1OIWA 2BCJQ 2HF9A 5DYGA 2CBZA 4I99A 3L0OA 4A2QA 2F55A 1PUJA 3ZD6A 1P9NA 1HTWA 2G1JA 4DSTA 2ZUCA 5C4GB 2VP9A 1FUKA 3PUVA 5JHGB 2BBTA 3HWSA 1Q57A 1ZC4A 4DSNA 5CB6A 3CNLA 4O2RA 4B44A 2RH5A 1AA9A 2JLZA 3LX5A 3K9NA 4D4LA 5F3WB 1ZU5A 2A2ZA 1G8YA 1KO1A 2YNMA 2Z4RA 2IS4A 2CDNA 4BFYA 1SKYE 2WJHA 3FTQA 1Z22A 4Q48A 3UXMA 2NO6A 1OW3B 4DC9A 1GVNB 1DAHA 1T3HA 2YOHA 2V6JA 3QKSA 3VHXA 1ZAKA 1A7JA 3WMEA 1VG0B 5E7MA 3B1XA 4JBWA 4RD6A 5AUQA 1TMKA 4CVNA 1BKDR 2DWOA 4TYNA 4AYTA 3CRRA 1NSTA 1X3SA 1P6XA 3C8UA 1E2HA 3SYLA 3N70A 1UEIA 2JIZA 3P27A 4P31A 5AJVB 3FHOA 1G7SA 4Q7LA 2G83A 5FOTA 4B35A 3K0AA 1ZM4A 3EIQA 2F1JA 4IDOA 1P2TA 1YZLA 1SULA 2Q3HA 4GNKA 4JYBA 3RSOA 4WXRA 2ZJ5A 3A4LA 5FI0B 1NJFA 1UJ2A 4PHFA 1Q1QA 1P62B 1XF9A 3TH5A 4A2PA 1E9RA 4LZZA 1P60A 2J7PD 1P7CA 3TSWA 1U8YA 3BE4A 3LWNA 1XD9A 1NNEA 1AJEA 3U4QB 4C3ZA 2XNDA 4II7A 1AK2A 5AJWA 4XJXA 4ZDIA 1JR3D 3JVUA 2J5XA 3L82B 3TUZC 1W4AA 3W6OA 4AWXA 5CDFE 4TWZA 4F4IA 1HV8A 3T5GA 2ZSDA 2IXEA 2ANBA 3UWOA 4JVSB 2FZ4A 3ZDQA 5B2ZA 3N5CA 4HZIA 3TSOA 4G0NA 2VBCA 5DSZA 3THXA 3Q8XB 2RAPA 1DEKA 2GJ9A 2GVDC 4G1UC 2VEDA 5AJYA 1F5NA 5HZHA 3THYA 4IRUB 3BIFA 4R9UC 2VHQA 2Z6VA 3X1WA 1IN8A 4KBGA 5KSOA 3IIKA 4K81B 4XOIA 2MSCB 3WXMA 3T1TA 2EW1A 1UPTA 1G7CA 1OXSC 1KI7A 1P2SA 1X8LA 3WBKA 4D81A 3R9XA 2NTYC 1GITA 2J0SA 3CZQA 4PC3A 5CYOA 1VPLA 2IYUA 3CX8A 2V7QA 3K09A 2XOKA 2WWWA 4FCTA 3E5HA 1W5TA 3B1WA 2XXAA 2WIAA 4O2LA 4EJSA 1LNZA 3PEYA 2WSSD 2IXGA 1FMLA 1D8TA 1OXTA 3ADKA 4RVCA 4OI0A 4HATA 2BMJA 4GSYA 2WOJA 2XB4A 2OCPA 2GXAA 1IAQA 3TAHA 2CL7X 3AVTA 3TW8B 5FOXA 1V43A 2I1QA 1Z0FA 2OFXA 4IOLA 3I62A 3ZZUA 2O8EB 1G3UA 3U3MA 2EWWA 3F8TA 5AR1A 3B85A 3AF1A 2CHVA 4D0NA 1AS0A 2NMVA 2ZRBA 3VKGA 2F3RA 4OYHA 2VHJA 1CULC 4NYJQ 5L8VA 4A8JB 3DEFA 2XAUA 3BFKA 4DXAA 5J4LA 1TEXA 5JJLA 1ZJ6A 2F1HA 2OT3B 1T0JB 1TUIA 2PT7A 2YWEA 2GZHA 1ZW6A 2AWNA 1M7HA 3S1AB 1NVWQ 2FX3A 4BGDA 3EIHA 4GBMA 4LGMA 4A0GA 4F7WA 1JJ7A 4DB4A 3I8SA 5FUWA 4KFSA 4IJMA 4TQ9A 2O8FA 4E22A 4DT1B 3LVQE 3OAAA 4JL5A 3RABA 5KNDA 2J46A 1I4DD 1R7RA 3NKVA 5FTMA 3ZVLA 2AFIE 1P4SA 1Q3HA 2VP0A 1Z83A 3L2OB 2DFTA 3DZDA 3FMOB 2GCOA 1SVSA 3R8FA 1RE0A 4QGAA 2PL3A 2C77A 2G9NA 4EFNA 2GCPA 1DS6A 2IHYA 1GP2A 1K5DA 5EP2A 1QHIA 1CU1A 1LS6A 1E2GA 4BFUA 2R2AA 1PV4A 2WJYA 3DZ8A 2ZRFA 1E9FA 3KUDA 1OXXK 3D8BA 4B33A 4LJ4A 5KDLA 3SDZA 1KK2A 4BEBA 3L0IB 5KYKA 1PZNA 1Z6YA 2P67A 5B30A 2HYIC 4EPYA 1Q44A 3AGQA 2W0SA 2OEPA 4OQXA 5JZVA 4D4JA 4J0QA 1G20E 1E1QD 2CHGA 4CEHB 3Q7PA 1JXMA 3DKVA 4GOXA 1OIXA 1M1YE 1VDZA 5EE1A 2IUUA 3KKPA 4C0BA 5CITA 1NRJB 4WAUA 1SXJB 1E96A 4ZDWA 1DADA 1G1MA 4ZPXA 1H8HA 3VR5A 4DCNA 3GLIB 1HURA 3VFDA 2BMFA 1W0KA 3ZIAD 2XTNA 2PBRA 3SYKA 3T1VA 1ETUA 1E2QA 1GNRA 2GVZC 3I72A 5CM9C 4PFSA 3IPXA 3BC1A 2QM7A 3P4XA 4M9QA 4B2LA 3O8RA 2A5YB 2GJ8A 3QY0A 4C2UA 4AKEA 5FTLA 2QSZA 2AL7A 1G3RA 3AVPA 3QF4B 4DEYA 4B32A 1IY0A 4LJ9A 4C4PA 1FTSA 2D7DA 4Q9KA 1P3JA 2DBYA 4A92A 5AUOB 3U4QA 1N6IA 1E0KA 2VQSA 4LY6A 2QPTA 4JVLA 1AKEA 2CK3D 1LF0A 4B74A 2OFOA 5LD2B 2VIIA 3QUSA 3VR6A 3KTAA 2XSZD 1XTJA 1JI0A 2ZS7A 1KDTA 3KXLA 3Q85A 4B3GA 1II9A 4Q1BA 2QEQA 4QHTA 1FUUA 1DBSA 1ZUIA 2V4ZA 3PXGA 3QJYA 1ZM3A 1NMXA 2CK3A 1A4RA 1E2FA 2C99A 2QAJA 4KCGA 3C15C 5E7JA 2X2FA 2EYUA 3ASZA 1MR3F 1SHKA 1Z63A 2VHTA 4WIAA 2W6JD 5D3MB 1QF9A 3B1VA 2DY1A 4A6PA 4TMWA 2H17A 3PEVA 4KYUA 2WMOB 1OF1A 4UNSA 2W83A 4IXMA 2H16A 4GMDA 3RYTC 3CRW1 2NO7A 1OT3A 1W46A 3D3QA 3BBPA 3K9LA 3MWJA 5EXXA 3LLMA 3TR0A 1HT2E 3LQQA 1ESNA 3IQWA 3JZMA 3UMRA 3SQXA 2HJVA 4IXNA 1JBKA 1XXHA 4URZR 3FB4A 3MWLA 4C0SA 5BXQC 1Z29A 4QGHA 2PX3A 4UXJA 1OB5A 3CF2A 3QEOA 1YZKA 2B7BA 2ZI7A 2ZS9A 2GEVA 2QQ0A 4M9SA 2LCFA 3F3YA 4PO1A 3IO5A 4B3XA 3WHKA 1VYUA 3R8CA 5FOSA 2HV8A 4NZYA 2IYVA 2WBLC 4HSEA 3AUXA 1UKYA 3MUFA 4TLEA 2WJGA 5HR5A 4S2EA 4TT3A 3KFVA 5FUYA 4KI0A 5CB8A 4H1VA 5DN6A 3ZVRA 2RHDA 1OLOA 1RRCA 3CW2A 4IDQA 1LTQA 3RS2A 4Z1MD 4ZIRB 2ZRJA 3B78A 3Q3JB 1PLJA 1XP8A 2F3TA 1Q1ZA 1QHSA 1N5KA 3QE0A 1II8B 3KKQA 3FMPB 2BWJA 1OYWA 4KXFB 5J4KA 3CRVA 2R6DA 2ZI4A 5FBLB 1JEEA 1GWNA 5CJPA 3TK1A 3LQRA 1H8EA 4C7OB 4R7ZA 1VHTA 4Q66C 3NIBA 4DLVA 3KKOA 1U2RA 1R4AA 2PJRA 1YRAA 3KXKA 4CF7A 3T1QA 4KV9A 1UBEA 4MRSA 4M21A 4HEJA 3KJGA 1M6NA 3QF7A 3ZQJA 1UKZA 3UK6A 4RKEA 4DLYA 5UKDA 1G291 4MKIA 4GPTA 5DE3A 2ZSFA 4NDZA 1EFRA 4G5SA 3HU1A 2C95A 4A15A 1Z0AA 3GLHE 1R10A 2HLDA 3ZD7A 3NBFA 1IM2A 1EFUA 2BEJA 3MMPA 3ZS9A 3BB4A 1E2NA 1G7TA 1JPNA 2CLCX 3CPJB 3EX7C 5FOWA 3SJAA 5EP3A 4ZI3A 3AB3A 4I4LA 1FL9A 1E94E 3RS5A 3AF3A 4IOMA 4BLPA 1UFQA 1N6NA 1FTNA 4Z51A 3EWSA 4FMCF 4TL9A 2ORIA 2VPPA 2J9RA 1GM5A 3WP1B 1YR9A 3SN6A 1F2TB 3I73A 3K9HA 4Q9IA 1OJLA 1QDEA 4LCBA 2KSQA 1YU9A 2MMCA 2XITA 4RZXA 3RS0A 1CXZA 1MH1A 4UXIA 1NMYA 2AWOA 2CL6X 4R2IA 2I3BA 3THWA 2ZEJA 4P32A 4PZLA 2J1LA 5FTKA 3VR4A 3WNDA 2OUKA 4JLOA 1I4TD 2VF8A 3CIOA 4QM7A 3DPUA 1YZNA 4GI7A 4DB2A 1E9BA 2NQ2C 2Z83A 1M74A 3PG5A 3HU3A 1UAAA 2Q3MA 2PEYA 1IN4A 2CXXA 4RZ2A 3FHTA 2V3CC 2G88A 1OH8A 3GPLA 2REXB 3RSLA 4ZI2A 4BLOA 1NG1A 1ZU4A 4MA4A 1RIFA 3EZ9A 1G18A 3PUWA 3QEJA 4ASUA 5EXTA 4L9SA 1YZGA 3M4YA 3I5YA 4Q4AB 4XIGS 3SJZA 3VR3A 4JBXA 3TW4A 3QQ5A 1KI6B 1NVVR 1G5PA 3H2YA 2QORA 5JECA 4LBWA 1II8A 1WXQA 3B1YA 3U3KA 2H1LA 1HUQA 4MRVA 3IHLA 3BH6A 4HLCA 4HB3A 4Q47A 2J87A 4OQFA 1G17A 2X77A 5TVKA 4PX9A 4V0ME 3K70C 3CO5A 3GEIA 3ECCA 1AS3A 2O8DB 3QSYA 2RHMA 3A4MA 2BHRA 4D0LB 2AXPA 2VHCA 3BK7A 4YDSA 4TLAA 5FOUA 5G3ZA 4QM6A 4MKHA 5FOVA 1SXJD 4B3FX 1AS2A 2DHRA 3GJ0A 3GJ7A 3C16C 3HYTA 1P72A 1XXHE 2EFGA 5TARA 3DOEA 2XGJA 3WY9A 3QPVA 2DB3A 2QENA 3OHMA 1XD2A 1YJ5A 4GP7A 1N6PA 1HH4A 1P2UA 2UZ3A 2F1RA 3ZLJA 4LHYA 1N6LA 4ERNA 3B82A 2E87A 4C0JA 1CJUC 1U0HC 4YMTA 4PZYA 4MDFA 4Q4HB 4RD3A 4AYXA 4KU4A 1CJKC 4Z54A 2ORWA 2J0QA 4NL4H 3IBYA 2PZFA 3GJ6A 4YXWA 1WBDA 5HZKA 5J47A 4ZV4A 3AKEA 2P2LA 4UKDA 5DN6D 4DCSA 2DYKA 5JRJA 3UATA 2WJIA 3E70C 1Y3AA 2OLJA 3LFUA 5HTKA 4L16A 3C7KA 4W5JA 3A8TA 2FDCA 3LXRA 4Q1AA 4OK5A 3IIJA 4BFZA 1FQJA 1GNQA 4NKRA 4WVFA 5KDOA 1BYIA 5TMPA 5E7IA 1KK3A 4RCYA 2V1XA 5IDVA 1KY3A 4PHTA 4Q7JB 5KUTA 1KNQA 4LWZA 1EX6A 2JIZD 5H68A 4M9XA 4Y0VA 1Z3IX 1R5NA 2GEUA 1G21E 1W4BA 3X1DA 4M1MA 4OQLA 2ZR9A 1MRNA 1N2CE 3GLFB 4PPGA 3W3ZB 2GKSA 4JT2A 3BS4A 4B6EA 4MGIR 3OFNA 2K5UA 2ZSBA 1WCV1 1ZD1A 4DLUA 1X8JA 2J7PA 4PHGA 2Q21A 3HR8A 4XVUA 1ZCBA 3B5JA 4ACBA 1CRPA 1XEXB 4TSFA 2MSEB 4P4SA 4RFSA 1W2HA 1S3SA 3KJIA 3QBTA 2QPOA 4AG6A 3MG9A 3QG5A 2FN4A 2CE2X 5FFMA 2OO7A 4LI0A 1KI9A 1N3BA 4ZIRA 3LW7A 1XD8A 5H70A 4URVR 1WMSA 2ZRNA 4DLRA 1RC8A 5LB2A 1VCOA 2AD5A 4PZZA 2PMKA 3BWDD 2GXUA 4FCWA 3TUIC 5DI3B 1DAGA 2R9VA 1TX4B 4URXR 2XX3A 4AIIA 4S35A 1XZQA 4F93B 1XPRA 5GADl 1W36D 4FD2A 5FPYA 4I1VA 5LDDC 3WHLA 1L2TA 2GTPA 1S1MA 4CW7A 4MGYR 3U3JA 1KY2A 5DNYB 3QBVA 4PQYA 4QC2A 5CLLA 4AKGA 5DIFA 1KAOA 1OFIA 4C0HA 2C5LA 1IXZA 1VCNA 1YR8A 3K53A 3T1OA 5D3QA 1ZCAA 4UNNA 2XXAB 1XX6A 4FMDF 1KGDA 4GL2A 4EJSB 4YMVA 2HXSA 1VMAA 4JLNA 1ZD8A 3DDCA 2UKDA 3CPHA 2KE5A 3ZYCA 1VKJA 2AHOA 5B57C 3OZXA 3RS7A 2CCJA 3GLGB 2NGRA 2Q3FA 2J41A 5BN3A 4KAXA 3RRYA 4AI6A 5HCNA 2JLVA 1DO0A 2YV5A 1IXSB 1E9SA 4Q21A 1GTVA 1UBGA 3KZ1E 2MSDB 3A4NA 4HUQB 4QHYA 4ON9A 1HEIA 5L3SB 2PEZA 4NCKA 4QGFA 1JQLB 4ITRC 4EIWA 3QXSA 2WWGA 2JCSA 4BUJA 1JXOA 2OILA 3W90A 2QP9X 4V0MA 4DUGD 4HLUA 1VG8A 2IYTA 4OJKA 3FKQA 4M9ZA 2ZE5A 1E1RD 3TLXA 4MQBA 3GQBA 3SBEA 4Q1FA 2HUPA 4DBLC 2QPAA 2YVUA 2LWIA 1I2MA 4PO9A 2O8BB 1TQ4A 1TADA 1NN1A 2CNWA 1G6HA 4PXAA 1US8A 5TDHA 2GWHA 1ODFA 2J0UA 1Z6GA 1KDPA 4MGKR 4KJZA 2N42A 3ASYA 5J40A 4RZUA 4LK2A 4CGZA 1SVWA 4RJLA 3SJBA 4XD7D 2GK6A 1Q1EA 2IA5A 4HB2A 4LBZA 5FUVA 1DARA 1FNMA 3ND8A 2GESA 3CBQA 1KJYA 5AJXA 3IEVA 2IBMA 3KQUA 3U5ZB 5CIWA 4JLDA 1P5ZB 3MLEA 3QXHA 1E0JA 1ZIPA 4TMKA 1ZUNB 3NVAA 1EWRA 4NYMR 3OIUA 4AURA 3B13B 2QP3A 3B9PA 2ZRKA 4PC7A 1XFAA 1XJQA 2BJVA 4XWAA 1E4YA 2HF8A 4HYYA 1AZTA 1WF3A 3REFA 1KSJA 3Q7QA 1XEWX 2AXNA 4BE7B 3NBYC 3NWJA 1XCPA 2GF9A 2QM8A 4N0EA 4O25A 2V1UA 2YYZA 5A0FA 2A5JA 3GJ4A 2P3SA 2ZYUX 3TUJC 3OE7A 1UBFA 2YWHA 1GZSA 4L4UA 4D6PA 2XZLA 5FR1A 4MYCA 5F9FA 1NF3A 5J5CA 1KTVA 4LSGA 1VIAA 4CEHA 3UG7A 1J70A 2EYQA 1ONBA 2Q9BA 2ZJOA 3M0EA 3QKRB 2F43B 4EQ6A 1DAFA 4P4SB 3BOSA 4OKSA 2OFWA 1XEXA 3VMFA 3GFPA 4TLDA 2V6IA 4EJSC 3THWB 2EU8A 4RY2A 3HYRA 2VRWA 3DO6A 2C9YA 1JR3E 1X8KA 2R8RA 2O8DA 1KO8A 1KOFA 2FGJA 5JS8A 4P33A 3LA6A 4Q9HA 2IS6A 2BC9A 1TEVA 2WJJA 4M1YA 5H1YA 5JWRA 1JPJA 4QHSA 2JJ2A 3REGA 3VQTA 3EA5A 3B1ZA 3DM5A 4AYWA 5A5GA 2FG5A 2IL1A 4NCNA 2W58A 2YOFA 4NCJA 3IILA 4TSFD 3TQCA 4EKDA 2ZROA 1WRBA 1HY3A 1VYVA 1C9KA 4G5RA 5TV2A 2ZI5A 3I4LA 3QPWA 1EXMA 1HA3A 3RWOA 4BLSA 3T35A 1CR2A 1JB1A 1P9WA 3PJRA 4JLVA 4P3YA 2E1RA 4LHZA 1N0WA 1FPMA 2YJTD 1NN5A 1QHHB 5HKKA 4C7OA 1FMJA 2OE2A 3SFVA 3CWZA 4D0GA 3DOFA 1E99A 1EGAA 2ZAOA 5K8TA 1AM4D 1D2EA 4HDOB 4KFUA 1NMZA 3LRPA 4PSVA 4QOSA 2XJ9A 1MABA 1IJFA 1IJEA 4V0OA 3QPUA 4NU0A 1B23P 4KSCA 1XMVA 4Q01A 1U90A 1EFTA 3EZ2A 3ZH9B 3KKMA 1CJVC 2PCLA 2A5DA 1OFHA 5DI9A 3Q5DA 1Q12A 1PLLA 4ESHA 1G16A 4PPQA 1OH6A 2GETA 3OEED 4YMUA 1T5IA 1OHHD 2WMNB 2ZU0C 2H5EA 4ZDKA 2QBYB 4GFDA 1XBTA 1N5JA 5KSYA 2HT6A 1TAGA 1TU4A 1UM8A 1GRNA 2NOAA 2V54A 3CRQA 3MWYW 4K46A 2WTUA 4JVNA 2ZANA 2Z5FA 3GD7A 4DLXA 2ZI3A 3JZAA 1Z6XA 1ZNZA 4M1WA 3MJRA 1E79A 1U8ZA 2G77B 2XZOA 3K0FA 2ZXUA 2HEIA 1OB2A 2H92A 4B43A 2O52A 3DHWC 4BLQA 4LC1A 4QFMA 4MYUA 1US8B 5EP4A 4LYFA 2OM2A
chains in the Genus database with same CATH superfamily
4Q6BA 5JQGF 1JQJC 3VX3A 4MQEB 2ONJA 3RYFA 3QBJA 4FSXA 2G06A 2G09A 3W5SA 3PFBA 1UBCA 5TMDA 3KKNA 2BL4A 2VSFA 2IZ7A 3D02A 1KK1A 4BLRA 3PR3A 1N7IA 5FP0A 4WKBA 2JFUA 3LUAA 1DC8A 3F96A 3MWKA 1M72A 2ZJ2A 1C9DB 3PL1A 1K8QA 4AY5A 4YH1A 1ZRNA 4F56A 2V59A 1Z28A 4MWSA 2ID4A 4PRYA 1KEVA 4BBAA 4U6SA 4BU1A 1WA5A 2XUOA 1OBHA 3GAMA 4LEIA 2Q4DA 3WLQA 3L0ZA 4C88A 3KC2A 1DQNA 2JHGA 3JYOA 5EZYB 1YD7A 5D8DA 3V2GA 3B60A 3VR4H 3CRMA 1EX7A 1FFHA 2ZS8A 4P34A 1L7PA 4KQKA 1DQYA 1Z2EA 1DWQA 3L8MA 2F1KA 3LD9A 4OLAA 1WKBA 3OQPA 5DO9A 5JALA 2CUZA 2DCMA 2YMMA 1BX3A 2WM8A 3KT8A 4PAQA 2DWUA 3NW9A 2ZYSA 3FI0A 4K6KA 4X20A 2VHUA 4F6LA 1GL9B 5LNK6 3UJNA 2UZIR 2FPIA 3FZQA 3UB4A 2IXDA 5AJZA 3UK1A 1RYBA 4NESA 3RWMB 3N2EA 4YJ3F 3RT7A 3UMGA 2OC4A 1KH1A 1OI2A 2OGTA 2GXSA 2RKOA 3QIAA 5G40A 2PHZA 1BVUA 4NC9A 4A4DA 5FD8A 1TT5B 3FBGA 5FQOA 1WWKA 3ZWPA 3DHVA 4HSGA 3ELUA 1NLZA 5A1JA 1GPJA 4XX1A 3V4RA 1J8MF 3PICA 2FEPA 4GLJA 2HBZA 3O73A 4R83A 3SP1A 3LJKA 5KO2A 1BG6A 5IJ0B 4HXFB 4Q18A 3N2KB 3IT1A 3L4EA 2RGWA 2OCXA 2Y4NA 3L6CA 4LKRA 3FWYA 1HNNA 2Y1GA 4MUBA 4NHOA 4XQCA 3U7IA 4C78A 1SKUA 4CU2A 3L40A 4D3YA 4ETMA 3EDOA 4E46A 4ETIA 2PQ0A 1EGHA 4QOEA 4TS3A 3DZHA 3WK8A 3PXBA 5TJHA 1XTVA 2IYEA 3O84A 4GMXA 4LV8B 2PUFA 2A67A 2HLHA 4QXPA 1QDLB 1WHTA 3V00A 2B8TA 4D4MA 2ROQA 3DNFA 4J6EA 5ALVA 2PLRA 3F71A 4NPCA 1R6DA 1Z37A 3AUJB 4OO3A 2I2XB 4RLFA 1SCAA 1M6VB 3SXUB 5F98A 4RFVA 3EB9A 3R4CA 3FJ1A 4U00A 3QFRA 3TEMA 1V1JA 1V4BA 2L19A 1PCXA 1Z2NX 3H2HA 2W00A 2HY7A 3C39A 1KH2A 4L9WA 4JQSA 1WUHS 2JFFA 1QHNA 3R7WB 3WGQA 2E5WA 2VPZA 5GJVC 5SZJA 1GNPA 2R00C 4IIJA 1TVKB 1X87A 1IK6A 3OIYA 4OH7A 4Q3NA 2ARKA 3EZNA 4XXHA 3VPFA 3MGGA 2BUBA 4O4JA 4EBBA 4FOOA 3C8DA 2ORVA 1IOZA 1DWPA 4C08A 1EFKA 1NBEA 4B87A 3MGCA 4PHCA 2Z43A 3O0DA 4RDIA 3U7EB 4JLPA 1TF7A 1QG0A 1MOQA 1E5TA 5LQSA 3B1JA 4FHDA 3DWGA 4KVFA 3ELYA 2EXXA 3S6JA 2VDOB 1YC5A 2ZRHA 4N8EA 4ZO6A 4LJYA 1E9DA 3HXQA 5EY5B 2IYYA 2BGIA 2QA5A 1KA9H 2ZWPA 3QKIA 1NQAO 1SA0A 3WDKA 1CUZA 1RWQA 1V8PA 1WXEA 4FIZA 4N0QA 3P9YA 3UXYA 4DA0A 2WOOA 1Z2PX 4UM9B 3IULA 5JJCA 1KQ3A 1FU8A 5JYCA 3MT0A 8ADHA 3U7FB 3M83A 2XCIA 3OFND 2PUAA 3DAOA 2QJRA 2MTBA 1T25A 4OIFA 1P61B 2BFOA 3K0CC 5F7JA 1K88A 4FQ8A 1IY2A 2G76A 1IVNA 3NV7A 2H8KA 4Q4HA 3I6QA 4IEFB 2XUQA 1GPH1 2UXDB 4FSDA 3DCYA 1MC8A 1NBME 2QQGA 2R7LA 5FNVF 3RAGA 2X58A 9ABPA 3WZMA 5EMNA 5CLJA 2ZRPA 3HN2A 2FF7A 4TLBA 3WRXC 1M7BA 1C41A 3QVLA 1QNLA 3O3NB 5ILQA 1CTQA 1N3LA 3IPRA 3ZZ1A 2BOVA 1QGED 4HGYA 5AI8A 4MUNA 5FPHA 3U2QA 2X42A 1WB4A 4F1WA 4CKZA 3KETA 1GA6A 2YY5A 4Z0NA 1FSGA 1FTGA 1SURA 3NIFB 4D9MA 1V1RA 1U28A 2QLLA 3R3VA 5JYBA 3FUWA 4OK6A 1NN3A 2CNOA 4NJEA 4XSGA 3ZW7A 4Q19A 1E8MA 4EJ6A 5A9SA 4G36A 1DBIA 1G63A 2ZSEA 5KZMB 4CEHA 2Z0MA 2W6PA 4G84A 1KYXA 2QP4A 3BXXA 5A3QA 4M2LA 1FP6A 1UKVY 1RI2A 1LDNA 4HGPA 4PYLA 1BOFA 4JKYA 3QMPA 5I7FA 4FW8A 3WGUA 2DWPA 3EDMA 1CETA 1TGVA 1Z5GA 2CDRA 3NHAA 1Z7EA 4BQEA 4X7PA 3NH9A 1RYFA 4J1TC 3DPSA 3P9SA 3AF0A 4BKMA 3ZK9A 2F64A 1H6CA 3AIIA 3AP3A 3A3YA 2IF2A 2JF0A 3LLCA 2J3MA 1A71A 2VWQA 4ZI7B 4L15A 2LR0A 4ZAYA 2X6TA 2BGUA 3L02A 5K0JA 4KQXA 4QNMA 2PX5A 3P1JA 1CEQA 2WYUA 2C7BA 1OAKA 3KXIA 4AJPA 2RGEA 3OWOA 1M2GA 3HJNA 2D3WA 4JK3A 4UEQA 2IGTA 4ZGBA 1Y3IA 3LQFA 3AVOA 4FXOA 4AULA 1Q1BA 4GYYA 3I6IA 3VHLB 5ABPA 3VO8A 1W0JA 3H0EA 1L4UA 2IU4A 3NBZC 4NQRA 2WM3A 4N3GA 2ATEA 1NBMD 1QFJA 2OENG 3NKLA 4HL6A 4NE2A 4AK9A 3L6DA 2YCLA 1RYYA 4XJVA 1KVSA 4KYTA 1G0OA 3PLRA 3M3DA 3TM5A 1U99A 1W1WA 2I2CA 2IC5A 4F45A 4WKCA 2QD3A 3HVHA 3I0MA 3ICWA 3QUCA 3HJFA 3Q6MA 3BREA 1GGEA 1NF2A 3D6UA 1R66A 3S2SA 3VOTA 4RTJA 4QEKA 3H2ZA 1F2TA 3CVUA 2ZR8A 3GJRA 2ZZNA 2AFHA 2DULA 4NG5A 3H4MA 3WB9A 4QQKA 1FXWF 4RIFA 1MV5A 5L95A 3U4CA 3OCJA 3GARA 4WOPA 4I5GA 1AO0A 1MW9X 4K0KB 3CKMA 4ZALA 5CEJA 2R3SA 4BPRA 4W5OA 4E30A 2EVWX 3N7UA 4UZFA 5JSUA 1C3VA 1JR3A 2VEOA 3O3OB 1SVMA 1JDSA 1XC7A 4LXXA 1ECGA 1GUDA 1TTHA 5J4HA 5BR7A 4OX9Y 3BL5A 2JVKA 3JQEA 5JXWA 2J5QA 3ESAA 2P79A 2QT9A 4NYIR 2GCOB 2IXAA 4PIPA 5HBRA 2A59A 2HDWA 3UNXA 4A0RA 3T4PA 3KU1A 2EKPA 3DULA 4N6NA 5K8UA 1KDZA 4OQ4A 3W6PA 1JNYA 3ONVA 2O8CA 1NVVQ 2XMCA 1WABA 4BC0A 1V5WA 1FSZA 1EGMB 4NCIA 1E6EA 5F9HA 1I80A 5DMHA 3TOVA 1U7DA 2I4RA 2B4KA 2MMGA 1A3CA 3ABOB 3TL2A 4XVCA 4O4LA 1W2GA 2C82A 4TQUS 3A1EA 3OZEA 5A4MS 3IKMB 3UOWA 3W9SA 1JIJA 3H9JA 2WA2A 2VWGA 2D2XA 3QSGA 2VPQA 1GAJA 2XYQA 4MCIA 2ASEA 4MVJD 5FIUA 2QNBA 4LGCA 3AUFA 3AY6A 1TRHA 3GT7A 1QAQA 3FYUA 1Z8HA 2OGZA 3EZYA 3MINB 3Q40A 4G4SP 5EIFA 3ROXA 4OMCA 1BJTA 5CBPA 2AFHB 5HRCA 1JFVA 1YMUA 2I65A 1DAKA 1G4AE 2DP4E 2EFHB 2X0JA 2IYXA 2ZBPA 1P31A 4H77A 1YR3A 5TPZA 2D62A 3BB3A 1NR7A 3EF3A 4ZVUA 5HUJA 1QMGA 4FWIB 4GT1A 2IH2A 1BHJA 3WC4A 2BKUA 4KQIA 4IQ8A 1PSWA 2FP4B 1T34A 5AVVA 3H4IA 3OQVA 5BPHA 4EY3A 5ICSA 2HH9A 2G40A 3OLVA 3NHMA 2X3UA 5JPCA 3FDZB 1CS4C 4H27A 1HE3A 1QGDA 2KJQA 4HN9A 4BVGA 3ZLBA 3V8VA 4X8LA 3PVSA 5CVVA 1OUMA 5EKXA 2CNLA 3M6VA 3HZOA 3U9TA 1JKJB 8GPBA 3K1JA 3PGMA 1FP2A 2FPGA 4LJ8A 1OTXA 4E2ZA 1T0HB 4ERXA 2P6NA 3DV0B 5JE8A 3UANA 3WV4A 1XU4A 1U98A 3P4YA 4AMYA 3N28A 4GNRA 4O4HB 2LUOA 2QGZA 3H87A 4B1FA 1JG1A 1SUSA 2HJ9A 4P3PA 2XECA 3LDGA 2H85A 3LUFA 4WD3A 3U17A 1ZK1A 3LCJA 5M5BA 1Z0DA 4D0RA 3U44A 3BRWD 4LJLA 1DBPA 3DLCA 5BR1A 5IC4A 4WW0A 1WO8A 1LPBB 5JH7A 3CE9A 2A0FA 1ODIA 4NF2A 5BNZA 5JJBA 1K8RA 5E1BA 3OF3A 2OHOA 4F84A 1YIOA 1F4VA 1YUBA 2M6SA 2ZB8A 1UDCA 1DIBA 1PR4A 3GB9A 1NIJA 421PA 4LI3X 3V1UA 3SX0A 2IDMA 1RYNA 1JJBA 1VFPA 3DEIA 2F6RA 4TWRA 4DCPA 2I6FA 5JNVA 4DJTA 1H66A 4AECA 1AUQA 5AW3A 1BRMA 4MLZA 5A5FA 3QIVA 3UICA 1KAEA 3O26A 4GDMA 4MUFA 2A30A 1OLUA 3FGOA 3K1YA 2ZIVB 3L0PA 4M3NA 1VBKA 1YASA 3GXBA 3S2YA 5GJWC 1IN7A 1I9GA 2JFBA 4CEIA 2BMAA 8OHMA 1G66A 5B6IA 4WKGA 5B1IA 1WSWA 2GQ0A 4O3MA 2HQBA 4NPAA 2F43A 4MRAA 4EQ6B 2K4MA 5TSDA 2BEKA 3IDSA 2HKIA 4OP2A 4ZTZB 3F6RA 5AI0A 3TKAA 3LHFA 2B21A 3BKXA 2GHQA 4X95A 2WIJA 3VZRA 4XZ3A 2RI1A 4UJ5A 2I2AA 2EEZA 4BMVA 3WGGA 4R9VA 5GAJA 3RJ5A 1K7XB 3L0SA 4MO2A 1U9ZA 3LC0A 2AJTA 4XIYA 4DDWA 3UY4A 2UDPA 3BCSA 4E2WA 1AUOA 4MKXA 2WPDD 1RR6A 1E5XA 3GOHA 3WVNA 1VSQA 4US1R 2YNMD 2J85A 5H02A 1J5PA 5C5IA 5IT5A 3GA5A 4QEDA 3ZDCA 3BWYA 1P9RA 2DY0A 4PGFA 4F6RA 4IHQA 3V46A 1EWKA 1J7JA 1PZXA 2C54A 2QQFA 2WAYA 2PGDA 3BCHA 3PQ4A 4KZPA 5HS4A 4CTOA 2A6PA 1WV0A 1TUGA 4YMSA 1A5ZA 1QVAA 4NFYA 3GRZA 4YCJA 3B6IA 3F98A 4FNOA 3RU2A 4LMAA 1GFIA 2JIDA 3KAQA 3STVA 1FBNA 3WWYA 4N3AA 2JGDA 1O9HA 4LDNA 3MBIA 3S1SA 1NI5A 3W3AH 4OG2A 4DRZA 1SZPA 4OSPA 3FOFC 5LKRA 4D9FA 4KDFA 2B25A 3HE3A 5CLGA 4M1KA 5F3RA 4ZVRA 5CA0B 4DV3B 2D7CA 4KR9A 3K70D 2ON6A 2E6UX 4CDGA 3WNQA 4CJXA 1ESZA 2EDCA 4B09A 2NXJA 4EF4A 3LW8A 1N6OA 2GA9A 1PZMA 2IEYA 1WX1A 4OL9A 3KB6A 1FNDA 1HE2A 3PC8A 1K66A 4WN9B 3ZGLA 1G41A 1Q74A 4GYJA 3VZDA 1NX9A 3EZ7A 3GJ5A 2B37A 1WNTA 2FWPA 4O4IF 1KMQA 1PZHA 4MWTA 3SX4A 3QOFA 1SRQA 4RY8A 3KALA 4D98A 3RRZA 3I1IA 2JJ2D 4R2JA 4XQGA 3ZUGA 1Y4UA 1TXGA 1CDDA 3STTA 1FP7A 1U0FA 1NV8A 2FZWA 4UHBA 4BFLA 1JU4A 2AVNA 1EB9A 3ZW8A 4F97A 5B1EA 2JA1A 4JJFA 2VJLA 4X5OA 4W5TA 1KRWA 3OC0A 1YKGA 4M1OA 2VP3A 1JT2A 5LJLA 3L1KA 2H7YA 1FS6A 1SXPA 2YWDA 1KP9A 1JTVA 4Q1EA 4AJ2A 4DCMA 4IF6A 5HF8A 1TJNA 3PTLA 4QO7A 2HN9A 3B6EA 3OU6A 3GNTA 3CLRC 4RIGA 4HB4A 1MIOB 5D1NA 1QLHA 2C2HA 2BF7A 2AG0A 1T9GS 1D2NA 1KJWA 4BO5A 1N9GA 1UMBB 1FYWA 4G0MA 4RKQA 4F38A 2ATIA 2PZEA 2VSOA 4AN0A 2Q4RA 3TI7A 2XYRA 4QELA 3LWZA 4WECA 1WZNA 3DXZA 3JQAD 3OIGA 4FFLA 4Y18A 2P9GA 1W85B 1SCBA 1XK6A 2W2TA 3GG2A 2FPGB 3GPBA 1VZ2A 1DIHA 5HP4A 1RWMA 4CEIB 2PK3A 3WSVA 4GG1A 4YRSA 4RW0A 3IPLA 3UGTA 2CLIB 1I5EA 2YRWA 3CNQS 4XUGB 3RCBA 1TK2A 3AUYA 3ENKA 2PDAA 4MXDA 3LZ6A 1E6WA 2PKRA 3KEQA 4KKXB 4OHRA 3C6BA 1KPIA 1CR4A 3U4MA 4FDMA 1UDXA 1SUIA 4J2OA 4TL7A 2QZZA 5K0SA 5ITWA 3MRSA 3VC1A 4EMTA 3BGWA 1DGQA 4J0IA 1NI4A 2IYRA 4MAAA 1YZTA 3CEPB 3RSFA 4G8BA 4XYMA 3H13A 5JAQA 2VQFB 3BMNA 5H8WA 2RB5A 4D9BA 3KQUA 3TYXA 1PRYA 3RANA 3ZI7A 4ZK2A 5AVZA 2EFCB 4O33A 4TS1A 3KZVA 3QWBA 1U1DA 3LO5A 4MLPA 4DCJA 3ACDA 2VRBA 5IKEA 1YRYE 2B4TO 2O3QA 3N53A 4HDQB 4FXPA 2ZR7A 1HG1A 2XKAA 3TW8A 3A0RB 3NYWA 1E3WB 4EG0A 1GPKA 1GUYA 2XA1A 4AJOA 1N8SA 3OEWA 5EMKA 3IO3A 4HN4B 1QF6A 2C57A 2JI4A 1G4UR 1E2PA 2JZNA 4KWIA 2QMHA 5CDSA 4MI3A 1F9EA 3VPCA 5KC8A 1K6MA 3AFOA 5FTWA 5ILGA 5FLEX 3OKAA 4KO1S 4G2NA 3FLMA 3VVMA 3FRHA 4QG3A 1D9XA 2MWMA 1XTSA 3KX2A 1CB0A 3A9WA 4TYQA 1SBTA 2J7KA 2A5LA 3EAGA 4XUDA 4Q4JB 3T3DA 3DLBA 4B71A 3V3KA 1PJ3A 2WG0A 2ZDQA 1SCUA 5DHAA 2G28A 3NOVA 4F3NA 4DS3A 2B20A 3ANTA 3H6HA 4UAJA 4UMEA 3SSOA 3OIWA 3PA8A 5E9JA 4PCLA 4U0JA 4LE0A 4BAGA 5F51A 2Q6VA 1TVEA 3KHTA 4QBTA 4ZC8A 1F8YA 1T6ZA 1QYCA 1Q16A 2XNCA 3R40A 4D02A 1AB5A 4DFDA 5KSWB 4A36A 3K15A 2IY9A 1BXRA 1LNSA 3DXYA 3H2SA 5HQ3B 4MEAA 3AHFA 4QARA 1OT5A 3SF8B 1AQNA 4D4HA 3JYNA 2I54A 2WG2A 3NFRA 4XPZA 1PG5A 1KPHA 3A6LA 1Q0HA 4C4SA 4W7SA 3DE2X 1BVYF 2M1XA 2VK2A 3ENVA 1ENYA 3AKYA 4LHSA 3A9SA 4KW7A 2X0DA 4AJEA 1O95A 3MC1A 1T6BY 2Z2KA 5JI2E 2IE0A 1UM9A 4XLLA 5CTAA 3T99A 4INZA 2C0CA 3QXGA 4MW6A 1ELOA 2OCIA 5LFAA 2HW8A 4RESA 1DDGA 4DMLA 1U8XX 3A6DA 3OEEA 2EFDB 2ZIGA 5E1DA 5H5JA 1OH5A 2R7MA 1KKUA 3EIOA 5CH3A 5JDIA 3DDWA 3VPHA 1X94A 1PTJC 2N1BA 1IY8A 4KZKA 4QT0A 1N2SA 4N7BA 4ZA2A 2GA8A 5HCUA 3TQHA 4D9JA 2ZRGA 1TQDA 1K4KA 2FW6A 4L0QA 2R4UA 3I4CA 2Q4EA 4ZJUA 3CV3A 4TV8F 2HIHA 3O9MA 3U4AA 1KP2A 3UMMA 4DUPA 1FRVA 1EQ2A 5IARA 4EG8A 1QGUB 2RGXA 1WMEA 3LDHA 4IOKA 4WNCA 1FZTA 1PJLA 4RA9A 3M81A 1FYVA 1IL0A 1NBMA 4BNFA 2AN1A 5HUQA 3ENNA 4QQFA 4D3FA 4BKPA 3MIIA 2ZTVA 2C04A 2YC4C 5L3SA 4B45A 4ZEVA 2P2DA 4V3CA 3N0TA 3ODGA 3DEHA 1Q7CA 4ABTA 3FIJA 3PXDA 4DLBA 3KSUA 4FMCB 4OJQA 1XCMA 4XUEA 2FZ5A 1QV9A 3T1HB 4RVGA 2OBXA 1MVNA 2A14A 1K7EB 1DE0A 2QNRA 4IDBA 1ZIYA 3WB0A 3G0GA 1U3GA 3ID6C 2Q1XA 1UM9B 5G4KB 2NWQA 3I05A 1TZJA 5IYZF 1ZXBA 3UA4A 1VLVA 2E4WA 1CIPA 1KXZA 5LU9A 3MQFA 4FJ0A 4GF5A 1WP9A 3W79A 1ZGAA 2YWGA 4EATA 4MI9A 5CD1A 2CKDA 3CLVA 3ASVA 3BJIC 5DCWA 4D80A 4E33A 4IJKA 3L6BA 1RXVA 4QBGB 3RDPA 1N8NA 2P3OA 2DFLA 1ZDMA 4PNPA 2WQ6A 3AU9A 3ZYZA 2WDPA 1ZP6A 3CT4A 3PDIA 3GRPA 5CFNA 3CG0A 1ADBA 5BSVA 1OGJA 1VHQA 3T7DA 3F7OA 5JVDA 4M37A 4HWGA 1LBEA 1YI8A 5LD2C 1WW2A 4ND8B 1S7CA 2WV7A 5DTRA 4A5SA 1EUZA 4R5MA 3UO8B 1D03A 2FEAA 4N0DA 1MIOA 2BAGA 3Q11A 4B8YA 3HY4A 2QVXX 4BLTA 1QG4A 1MT0A 5LYYA 2O6LA 3PLAE 1RRPA 3A1NA 4EP1A 4MEBA 1H42A 4IZ6A 1J2JA 5K3AA 4DR5B 4NU8X 2QG6A 1LGYA 1ZW1A 5EEGA 3VZBA 2CMKA 3AUTA 3HU2A 2IUTA 1BN6A 2VNSA 2Y0BA 1A9ZA 1JU9A 2YY7A 1EVKA 1FS5A 4U2KA 3UKDA 1SMKA 3NQ41 2P5TB 1UFOA 3DONA 3PHLA 3Q9UA 4JLAA 1O6FA 4RK0A 3SMQA 2H57A 1MF7A 4CKBB 4KN5A 3DL2A 5EXSA 4M6WB 2VYCA 2CFTA 1CRWG 1NQXA 2V0GA 3V4VB 1VE5A 1M5UA 3FKJA 3T4UA 5ESRA 4GH5A 1KORA 1ODCA 1UPAA 1H9AA 4IVRA 3UHFA 3V8MA 4ZEXA 4EG5A 2W6IA 1QH1B 1VE3A 3BIXA 3NBQA 3OOWA 4FGWA 2YFYA 2W9XA 3WIEA 1I3CA 4WXPA 3ECAA 4X1IB 5IKOA 2WICA 4X61A 3WLKX 4DA9A 5JW6A 1E69A 1RHQA 4LJSA 4LE2A 3QKTA 1Q0UA 2WYVA 3NHLA 2ZG6A 3FETA 2ET6A 6GPBA 3EASA 1OAAA 1FCJA 2B7LA 4S1NA 3ILXA 2FSVC 4K5QA 2ANCA 4BO3A 1U0JA 3HXTA 3TOSA 1MT3A 1W4ZA 1EP1B 1M2OB 1ZWLA 1HRKA 2VK1A 3W8RA 3RIYA 2C94A 4HVAA 3RVLA 4ZI7F 2HMTA 1FMFA 2FMHA 3HBJA 1TJYA 1X1DA 4NH4A 4UUPA 5JC8A 2PQMA 1QFSA 2PNFA 3ANNA 1KSFX 4E07A 3SC3A 5DHRA 2F9LA 3AM3A 4K8RB 3HVKA 2YVAA 4JL8A 3U09A 3DM9B 4KE6A 1TQ8A 3WAKA 4KPUB 1V7PC 3THSA 4URFA 3JYHA 1W581 4IGAA 5K1ZA 5HFJA 5REQA 1JE0A 3EXEB 1ZEJA 1U9IC 1ZD9A 2WKSA 4BNVA 5I7OA 2XA9A 4R7GA 2O0HA 5FPKA 3OFVA 2IBSA 3V8RA 2VYVA 3KR0A 3O91A 4MJXA 2QR2A 2WF6A 3RW9A 1L5HB 2GZAA 4MRMB 2QBYA 1ISFA 5CVDA 3VBEA 1CB7A 4B8WA 4CT4B 4BVAA 1XDUA 3II6X 4ARAA 4PW0A 5EL0A 4FPXA 2PUHA 3LE8A 1A9YA 1O6ZA 2VCEA 2EBFX 4NI5A 3VR2A 2Y27A 3IAXA 5THQA 1VECA 1GQOA 4ZT4A 3QKUA 4F96A 2QGNA 1OLSA 2P3QA 4RK1A 4I3GA 3EDRA 2R1ZA 4XX0B 2D06A 2QMYA 1XJ0A 1VIVA 4RYLA 4QYSA 1W36C 3OI7A 2BMVA 3PKJA 1SOMA 2JAQA 4CG0A 2H07A 3CKYA 4O0MA 4RCZA 3UMSA 3HFJA 2V7WA 3M9WA 3DE6X 3U0BA 1X7WA 3MFYA 4LHXA 3R7AA 2Z04A 1HZJA 2NZYA 3L4SO 1T1GA 3KQOA 3DVLA 1EBFA 2D4AA 3NOXA 1XWIA 4CIXA 2FN8A 1GAWA 5JROA 3O93A 3UC9A 3LV8A 5C32A 1L1QA 4POAA 2VP6A 2ZUBA 3H0KA 3SG0A 4W8HA 1PT7A 3JQFC 4L5BA 4NFLA 1JAHA 2CVFA 4NR0A 3ZDFA 3AILA 2W6MA 2XUFA 3DTVA 3IDFA 1T35A 2RGRA 1C2YA 5SYAA 4RYDA 4E94A 3IIMA 4ECAA 1RWPA 3CH7A 1E8NA 4AP6A 5IT0A 2JIPA 2P8SA 3OLQA 2FH5B 4HUQA 3CF0A 4CTKA 1BMDA 1DB3A 2H48A 4A5OA 3N8HA 2GLUA 1DOAA 2CLDX 2ZP1A 3DVAA 2D5BA 1CR0A 1IXKA 4X84A 3TAUA 5L3QB 3I61A 3IFSA 4ED9A 1GDDA 4MICA 5EIHA 1MKYA 5CG2A 1GL7A 1DJLA 3TMKA 1E2DA 1EUCB 3V9PA 4A0HA 1DKOA 1KKMA 5FPSA 1T5HX 2K87A 3CG4A 2ZE7A 4TUYA 3B5IA 3K16A 4BQSA 1YVDA 4ZJYA 1JSZA 4Q05A 5LXTA 3H1GA 3TW0A 2XLBA 3AXTA 4EJ2A 5ITSA 1RP1A 5KNCA 1TMYA 1RKUA 1TA4A 1V71A 1NPYA 1RD4A 4LYDA 1Y33E 3IUYA 5TQ2A 2ZIAA 3RVJA 4P36A 5KX5F 3W5BA 3ZVNA 1Q21A 3QE9Y 2VA8A 3BN3A 3MA0A 4O4LB 4QBKA 3FOBA 3IXLA 4ZXFA 4E11A 3OJXA 2VTBA 3WL7A 2RE8A 3EXEA 1R0XA 3WZ2A 5EHGA 2IOFA 2UV8A 3QFFA 4QNRA 5TPWA 3ZJVA 5DI3A 1UPXA 3MJCA 4M0UA 4MYTA 4DG5A 4BO7A 5BNWA 3AEUA 3R0VA 5IAKA 1XEFA 4ER7A 4DREA 2Q6LA 2I22A 1RI4A 3KUKA 4TYPA 5L45A 2I6TA 4LS3A 2WJ3A 4LV6A 1SHLA 4WOKA 1X0VA 1NQUA 2CZQA 4J7CA 2H2AA 4AZ3B 1RIIA 1VPEA 2C03A 3L5KA 5IH3A 3PRHA 4C03A 1OAOA 3JSAA 1IVSA 4JVMA 3WLIA 4LRWA 2HSEA 4N9QA 6Q21A 5ALFA 3LA8A 3OX4A 2HSWA 2Q3EA 2HRDA 2GBIA 5HF6A 3E7XA 5KWEA 2WV9A 3FFXA 3DZIA 1LEHA 3HL4A 4UJ3A 5AOCA 1PW7A 2OO3A 4WUTA 2OCGA 3NTXA 1SQ5A 1HLGA 3PX2A 3QU4A 1IM8A 3U6BA 3ZVMA 3K6JA 3VO2A 2H2FA 1GNTA 4P2GA 1JI3A 1O3YA 2C83A 1LRKA 2RMKA 4RMIA 1K7SN 5FO1A 1H2FA 1J39A 1TYAE 1O9BA 3K0EA 5G4LA 4RF4A 4M6WA 1A4XA 2F8MA 3W9YA 1PDVA 4C05A 4QDOA 4L2IB 2LW7A 5HEKA 3UMVA 1AHPA 3IB6A 2QX9A 3FUCA 4INOA 4IVPA 2AZMA 3E22B 3PDCA 1OVMA 2O7NA 3RUCA 2GJKA 3WGZA 2EW2A 1XRLA 3AJDA 1UWCA 1UKEA 3FYUB 4NE7A 1MQSA 1ONNA 3COPA 3IDQA 3DOIA 5HCIA 1FFXA 2CVOA 5ERYA 2OBMA 4ZCPA 1Y9AA 2HJWA 3AOEC 3D8RA 2JLWA 4CEJB 2ZRCA 4MR7B 2FN9A 4LTMA 2ZE6A 5DM70 4FCVA 1P2BA 1ANKA 2W8BA 1XDZA 3DD1A 4FYKA 4OFBA 5C3UA 4DRYA 4WESB 1L4YA 5JEDA 2RGDA 3QVMA 5BN3B 3FOCA 5J2TA 3U60B 3LU1A 4IIEA 5TT0A 2C78A 4W5NA 1R9NA 2QXUA 1MAWA 2VAMA 7AT1A 1O8BA 3K8QA 5D7NA 4G1BA 5AVOA 3LYLA 3M5PA 2OZPA 4WADA 1XAJA 2DGDA 4OVKA 1S1CA 5E0KB 2E4XA 1DOZA 3GHHA 3MELA 4JJIA 2B8WA 2AOVA 3KKEA 3OWXA 2BY4A 1F3OA 3NM5A 4LNUB 3Q3EA 1QIEA 5CVTA 4YRCA 1FSSA 2I2DA 3I5AA 1SCJA 2C7GA 2UYHA 4MR8B 4UHEA 4N5IX 1W73A 1EDZA 1GGVA 3ZOZA 3TZLA 3OOSA 1JHVA 3U49A 2MT9A 2BDEA 3KPYA 3I2YX 3HO6A 4JJAA 5EJEA 5C5EA 3PQ5A 2QE7D 1DINA 5FBRB 2XMGA 2PS1A 2YMLA 5DRYA 3J7TA 3OY2A 1VSBA 2H11A 2CNNA 4BMOB 3IRUA 1EWQA 1NVXQ 1C14A 1U4OA 3O8BA 2FE4A 2CHFA 1PJRA 2OZKA 3E8XA 3ELBA 3I9KA 3MT9A 1TF5A 4IFBA 3HFSA 1XUOA 4OMFG 1U6JA 3ZTWA 4B6SA 4EHJA 1HXHA 5HQTA 2FSIA 4MV5A 2B0JA 1GZ3A 1O95C 3L8FA 4PPNA 3MBKA 2ATVA 4WNIA 5FV7A 1NZJA 1QVRA 3WYDA 4CR7A 4FOPA 3FD8A 3ADOA 1G9XA 2JCVA 3QU7A 3TL3A 1VLMA 3U4DA 2HT1A 4MV8A 4R6XA 3IURA 3MCUA 4LVNA 1GU1A 3DWFA 2ICAA 4URHA 2P9ZA 2D4HA 1T8TA 2JATA 5CD9A 1XLVA 4KAAA 2WJAA 4FYVA 3CWQA 2B5VA 1X1RA 2YWXA 5KJFA 4D82A 3ZJ4A 3IQDB 3KJEA 4WXYB 2FFHA 2JRCA 3V8QA 2JI8A 4MUYA 4QGGA 1DX9A 3SQMA 1ZWKA 4MA5A 4S1VA 3K1TA 1IUNA 3HBNA 3K94A 4NBSA 3HKDA 4R4JA 4BNKA 2W6ZA 4ZI7A 5F1OA 3Q0IA 4NBLA 5G0WA 1TU3A 2CVQA 3H75A 1D4ZA 1K3FA 2JGNA 3NC4A 5LZ7A 5B3JC 3X2SA 1PT8A 1TA9A 2Z6QA 2OXRA 3IHKA 2BZ1A 1QCDA 5BSHA 1CUIA 4FZ5A 4IHAA 2R1VB 1IONA 3MTBA 3Q12A 3OKPA 3INTA 3NBXX 4EI8A 1S02A 4NOJA 4I1PA 2GM3A 3AFHA 3LT2A 1A5TA 3N39C 4H7DA 4EHAA 2E37A 1KP3A 1ZVKA 2OCYC 1MZPA 5E9WA 1NQWA 4G9BA 4OL0A 4RV9A 3ZDBA 3IIEA 2XUIA 3SEZA 3BFVA 1EAMA 2VXYA 1SXJC 1TEZA 4TV9B 5HNKA 3GJ8A 5FYDA 2AG5A 2IU6A 1E8DA 5JSYA 2Q7OE 9MHTA 1QBKC 2ZWVA 2NUAB 2G0NA 3DVQX 4IX9A 1TF2A 3T15A 2E2WA 1HDYA 3AR6A 3EUEA 5ESDA 2YZ2A 3QKRA 1XJ5A 2WFZA 4M76B 4HH1A 1CS0A 5JSKA 2X14A 4X92A 2VYNA 1MGPA 1V9SA 1W0KD 3C14C 1NVUQ 3TRIA 4HHEA 1OWMA 4NFSA 5JC1A 1G9SA 1D2MA 3IT0A 5NLLA 2GAAA 4Q7MB 5KBYA 3Q6IA 5ENZA 2IWHA 1YI0A 4XYEA 4NYMQ 2F67A 4ZT7A 3FCSB 4MVYA 4Z8YA 4MV7A 5H81A 4X8HA 4DQXA 4P3XA 2CLHB 2FWAA 3F5QA 4IIJF 2B3TA 2GBCA 4GYWA 4DIOA 1N3IA 3PQ2A 1L4KA 3D0OA 4LZAA 3TIVA 2VZEA 2JJYA 2VQDA 3PA6A 3Q9SA 5DHFA 2SKCA 1ZG3A 3OEYA 3QI7A 3VKUA 4LW8A 5CDUA 2JCXA 1YHNA 1S2NA 4G0WA 2J3LA 5HKBA 4NNPA 3NHRA 1VPTA 3QRWA 2G8NA 4KXQA 3JU3A 1Y6JA 4DAEA 5C7IO 2W6ID 3P8ZA 3QJGA 4JJKA 4K26A 1FDVA 2X3FA 3TGPA 1QSGA 3IQXA 3X3HA 2J6IA 3G6WA 3KQTA 3I2FA 4JH0A 5E95A 4DLSA 1XZIA 2XOXA 2BEVA 1J21A 4MW0A 4PRLA 3QNMA 1ZN9A 1UT6A 3TKYA 3UJ8A 4MRRA 4YRBA 3EA0A 3H2IA 2JDID 1THZA 2ZIEA 3TECE 1H2YA 3PIRA 3SYMA 1H8ED 1ZCZA 2X8BA 3T5DA 3FWNA 1L5NA 3AVQA 3WMWA 4BMYA 3JQ9A 4GWKA 2H9YA 4UBKA 3IAEA 1L7VC 3PFNA 1SELA 4MWZA 1GPMA 1UK7A 3G1WA 4DCVA 4YMWA 3ZV7A 1QBGA 4RVHA 3AFNA 3FSEA 5DX0A 5DJ5A 3IJEB 2JI6A 5JFTA 5AT1A 4EA9A 2D1YA 4AF7A 3P4UA 3HA7A 2YWBA 3LLUA 4FS3A 2C9ZA 1T13A 5DGHA 1L8OA 1E1CA 2QLMA 3FKSA 3R7FA 3S99A 3DYVA 1MX9A 1QO7A 1RYEA 2JFXA 4M36A 3ZHYA 2YXPX 1X92A 1ZI8A 3BPSA 4I5IA 4EPWA 3R3HA 2DLCX 2GHIA 2QTVB 1N8TA 3DE7X 5FLKA 3QWAA 1CJSA 1KVQA 2DBVO 5LOVF 2DPHA 3GLGA 2WKQA 3S8MA 5D51S 3LOQA 5I7HA 5K8LA 2C98A 4MVJP 1DC3A 1NRXA 3FJOA 4KPUA 3S2FA 2COUA 4LBYA 1V4VA 3DKPA 2RGNC 3L6OO 1RMQA 4D42A 2Q6TA 4KO4S 3AF2A 3DOJA 3MCAA 4PX2A 5E4TA 1X42A 1R2QA 3GGOA 5LP6C 2IODA 3U3OA 3ZY2A 2HO5A 2WUEA 3GO4A 3HBMA 3O0TA 3BJEA 1NUTA 2R8XA 1RZ3A 3S70A 5J4YA 1XZJA 3EZ6A 4ISBA 5DWDA 4B0PA 1JFFB 4RH0A 3E2PA 1Z35A 2AIRA 2D3TA 1ZOPA 3O8LA 3LCCA 4P0TA 2GX6A 1QG2A 2NZXA 4D97A 5HPYB 3EPLA 4Z1MA 1MHTA 3IBGA 3G85A 3HDYA 2V8BA 4KDRA 4ZCMA 3MERA 3NOOA 5DOVA 4PICA 1YDFA 3DYIA 4H3VA 1PVDA 1EBUA 5ANRB 3H11A 4I81A 3E7DA 2QRNA 2ENWA 4X85A 1T10A 1TK3A 1HYEA 3WB2A 1QTNA 4R8SA 4TTQA 4X65B 3OQJA 3KOZA 4LRSB 5GPBA 2B1IA 5KKNB 1KO7A 1YA6A 3H83A 1IBRA 1KC1A 1TM2A 1QH1A 4X3OA 1ULTA 1WHSB 2J3DA 2KQUA 4P0QB 3DV9A 2FUKA 1G3IA 2HRBA 1LTKA 2NO1A 4M8NE 4EVSA 4A16A 3G2QA 1QB7A 2HA2A 4JJEA 1PJ4A 1MN6A 5DXJA 4B8ZA 2V5AA 4X66B 1Y1TA 2AHRA 3MGAA 3T7KA 4DG9A 2J3EA 1XP5A 1CK4A 1YDGA 1Y9DA 4TTAA 4Q02A 4B3BA 1YFJA 3A3OA 1TEHA 3WIDA 1M5TA 2QVGA 3GZJA 4WV3A 3MAJA 2FJUA 2D54A