2GCOA

Crystal structure of the human rhoc-gppnhp complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
187
Chain Sequence
HHHSSGLVPAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoC
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 65
structure length 187
sequence length 193
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcoA01
3CF0A 4DCSA 4HYYA 2VSXA 1SHKA 2H92A 5KPJA 3B1VA 2DWPA 2R65A 4LC0A 5EP1A 2OSBA 4AWXA 1S2MA 4QFMA 4K8OA 3X1XA 3LX8A 5CLLA 2HT6A 3PXGA 3L82B 4JLBA 4OJQA 2FJUA 2FGJA 2W6IA 3ECCA 3OE7A 3K9LA 1R4AA 4HZUB 4W7SA 2GKSA 3TMKA 1XBTA 1P2SA 3VAAA 2IYZA 1PUJA 1G5RA 3NWJA 4KXFB 2PL3A 2WTUA 1HUQA 4LHVA 4NDZA 1IM2A 4HUQB 4RY2A 1W46A 4D80A 5B30A 4PFSA 1GL7A 2NZ8A 2QGNA 3QNUA 4ZIRA 2MSDB 4M1TA 3W5JA 1ESMA 1PLJA 4I1SA 2ZUDA 1Q57A 3IBYA 1XTKA 2G0TA 1XD9A 1FNNA 4A82A 5FUXA 1TF5A 2F1IA 1IHUA 3H86A 4RFVA 5DNYB 1JAIA 3PUVA 4YMWA 2HT1A 1ZU4A 5HCIA 1CXZA 1YZQA 2J3EA 3CIOA 4BUJA 2REOA 4JKYA 1NY6A 4HAYA 2J7PD 1A82A 1F2UA 4C2UA 1J7KA 3GLIA 4DLTA 2VSOA 1W0JA 4FCVA 2IA5A 3IHWA 3ZVRA 2OXRA 4TYWA 1NG1A 4Q1EA 5FOWA 1MR3F 2H7VA 2CCGA 2W0MA 4OHZA 3LQQA 3FB4A 2BCGY 4R2IA 2CJWB 1XNJA 1IY0A 4RZXA 4HZIA 4Q47A 4WIAA 1QHSA 4PPNA 3PJRA 3R8FA 3KQHA 3W8NA 1D2NA 4Q9IA 5KU1A 1S1MA 1ZYUA 4QBHA 2HYDA 3GFTA 4PZZA 5BN3A 2QAGB 3K0AA 4BFVA 1S3GA 4NBSA 1IXZA 3ND9A 4XSHA 3SJBA 1BOFA 3WYAA 2D2EA 2WOOA 1G64A 3LWNA 3GLFE 3RC8A 3F5FA 2IF0A 4L15A 1U8AA 2AD1A 4O0MA 2WSMA 4IDQA 1OKKA 3B60A 1W4CA 2OCAA 1H8ED 1Z6AA 2A9KA 2VF7A 4TQUS 1NVUQ 3BFVA 4TT3D 4BEJA 1H8HD 1VG0B 1IOZA 2HJVA 3UMSA 4PPGA 2ZR0A 4PZYA 3UMFA 3RLFA 1CJTC 4CW7A 2ZE5A 4KFUA 1COWA 3SJCA 1GZSA 2OLJA 3PENA 3LD9A 3KQUA 4GRAA 1X8LA 4I4LA 4LHWA 3QKRB 2R6GA 1F2TA 1AS3A 1QDEA 4LPKA 4MRSA 3U3RA 5GJCA 3SQXA 2YOGA 1CRPA 3IPYA 2FPKA 4NP6A 4DB2A 3A8TA 4C0SA 2GEDA 4XD7A 1WQ1R 2AXPA 3MFYA 3BH6A 4CEIA 4C0JA 2OCBA 5AUNB 1JPJA 3TH5A 5EP2A 5FOXA 5FH9A 2NPFA 1Z5ZA 4JYCA 3CH4B 3EIEA 5K8IA 3KX2A 3CPJB 1RKBA 2C2HA 2GF9A 2VO1A 2OAQ1 4II7A 1YRAA 1LW7A 3I61A 2WWFA 1XF9A 1R0WA 3KJGA 3NBZC 1KMQA 3SI7A 3UK6A 1II9A 5J4YA 4Q66C 5EXTA 4LI0A 1DO0A 1ZC4A 2IWHA 4CEJA 1YE8A 4HAVA 5E95A 1KI6A 4YDSA 3Q72A 3FOZA 4Q4HA 3TQFA 2NO7A 1MT0A 2JJ8A 2IS1A 1E2DA 3PVSA 4Q4LA 2OBLA 3AVWA 2QRNA 2WWIA 1XEFA 3MWKA 4IEEA 1D8TA 1L8QA 4POAA 4J0QA 3UWOA 2FE4A 3B13B 1GNRA 2PH1A 2XJ4A 3GEIA 3LV8A 2G3YA 3RS3A 1ZM9A 1W7AA 4QHYA 2I4IA 3W6PA 3GLIE 1L7VC 4RD1A 1D6JA 2WMNB 5JSZA 4QG7A 1KZGB 3OEHD 2QTVB 4QBFA 3A36A 4GZLA 3AP2A 1FX0A 4N0DA 3QKUA 2BM0A 2V6JA 1UKZA 2ZSEA 1SKYE 3FKSD 3SHWA 4D81A 4EAQA 1UPTA 3FMIA 1X1RA 2RHMA 3BERA 4ASUD 1SVMA 1XEXB 5G3YA 3AKCA 4NYMR 3DEFA 4P31A 1DG1G 5L3SA 2ANBA 2QROA 3F3YA 3DMNA 4ZI3A 1KIMA 1VKJA 2LKDA 2NO6A 3WBKA 5FR2A 3T12A 4URWR 1UJ2A 3CLVA 1OYYA 2RGDA 5EE9A 4LZZA 3TUJC 2FN4A 4LJYA 1HURA 2ZITA 1G3RA 2HDNB 4NPHA 1KJWA 2GRJA 2J1LA 2GVZC 3WMGA 4GL2A 1V5WA 3H2YA 4L4UA 1Q3TA 4Z51A 1L2TA 2D2FA 2JA1A 2YINC 4KI0A 3Q8XB 2V7QA 3N70A 3C15C 5B58C 4LHXA 5TVKA 1N6OA 3R7WA 1Z08A 1KI1A 3AVUA 4BE7B 4HAUA 1F60A 1N6NA 4IDNA 2QQEA 2IYSA 1PVOA 1HE1C 2C9CA 2C9YA 1U81A 4DJTA 1AGPA 4LJ8A 1GIAA 4F38A 1DAFA 4RZ3A 2HEIA 2DCUA 3AGPA 2VHQA 3HJNA 3PR1A 5DN6A 3IO5A 1XTIA 3VR3A 2XB2A 1RRGA 4XTRA 2C04A 1EFTA 4I1UA 3A1VA 1W44A 4IOMA 4DEXA 1Y3AA 3N2IA 2WBLC 3ETLA 3SEAA 2Z0MA 2O8EB 1R5NA 1GKYA 1M2OB 2XNDA 4U02A 3HDTA 2GK7A 1FQKA 3F8TA 3TAUA 3R9XA 4MYCA 1QG2A 3U4QB 3KXLA 4OK3A 2G77B 3QVUA 1XD2B 4LK2A 2WWGA 3OAAD 3K0FB 1ZU5A 2J7KA 5B64A 1EX6A 1VPLA 2EFCB 2CK3A 1CR2A 4JT4A 4LC1A 4DDTA 4YMTA 3THWB 1JXOA 1SVOA 2OAP1 1VMAA 1Z0IA 4A8JB 1NN3A 5C46F 2P5TB 1J8MF 1G1MA 4EQ6B 2VHCA 3BB4A 2RGXA 2JLZA 2ZAOA 1T5IA 1IN5A 5EUQB 2QG6A 2JDID 4DLUA 2QL6A 2BC9A 3LXRA 2JASA 4L8GA 5CIQA 4DHEA 3RRNA 2CBZA 4Q7JB 1Q12A 5CK4A 1ZUIA 5DGXA 3B1ZA 4DLZA 4YXWD 4CT4B 2JJ1D 1GAJA 3ADCA 2O5VA 3IUYA 2QPOA 3U7GA 1G8YA 4N3NA 1OXVA 3ZGXA 2XZOA 4RZ2A 2P5SA 2OO7A 1WF3A 3ZD7A 5LPNA 3CNOA 4Q48A 1XJQA 1D9ZA 2IYWA 2ZI3A 4M9XA 1GG2A 4Y0AA 4TYPA 4U7DA 2WIBA 3REGA 3GQBA 1TEVA 4OI2A 2FFQA 1JAHA 4WBSA 2ODNA 2OM2A 1U0JA 2V55B 3HU2A 1OF1A 3O47A 1MRNA 2QPTA 4NCKA 1SHZA 3S1AA 5BYJA 1QF9A 1IN4A 3PEWA 1S3SA 1AZTA 2XSZA 221PA 2R6DA 4C0LA 1NRJB 3GMTA 2GXUA 1ZBDA 4XOIA 4PSKA 4D2IA 5JJKA 2FDCA 2NGRA 5AUPB 2A78A 1ZAKA 1K5DA 4RVCA 5KHOC 1A7JA 4G3XA 2GCOA 4KLNA 4M9ZA 2C99A 1FOEB 5F9HA 1XMSA 4PHFA 3TW4A 3A37A 3IGFA 2IX3A 1XD8A 1LS1A 3NDPA 1ZJ6A 4Z1MA 3KQLA 2P65A 4MYHA 4DSTA 1Z83A 4X8LA 1QHIA 2RHDA 5HCNA 4WA7A 2ODWA 2MMCA 3FKQA 1KKLA 3A1TA 1OHHD 1N6HA 1IN6A 3AH8A 1OW3B 4FN5A 3CNNA 4YMSA 2XJ9A 1RFLA 1MABB 4DLSA 2ZYUX 4JJZA 4IXMA 2ZPTX 2OUKA 3BH0A 3D7MA 4GPTA 4RFSA 2FG5A 3LDAA 4H1VA 2BBTA 1RJ9A 3KB1A 2CDNA 2ZS8A 3AEZA 2WVJA 5JBQA 2J7PA 1NP6A 4LYJA 1NKTA 1ZNZA 4TMTA 1W4BA 4BLOA 5AUQA 2P6UA 4LJ4A 3W90A 2FPLA 3B82A 3K0EA 4Q19A 3QE0A 2BEJA 4P32A 1WBBA 2JLRA 5BW8A 1W0KA 2R44A 2EYQA 1KTVA 4NYIQ 5CLQA 1M1YE 5FI1B 2H18A 3K9HA 4Q02A 1ONBA 4UXJA 3GP8A 2FF7A 1KAGA 4NYMQ 3SE0A 2O8CB 2BBWA 1W47A 2VRWA 3AB3A 1KMHB 3ZYCA 2OCYC 4G0NA 1T0HB 4MGYR 4FCWA 2GXQA 3GJ0A 2OLKA 3B85A 1LV7A 1QHNA 4B6FA 5HKKD 1KJZA 4D4JA 3QF4B 4WOPA 1QHXA 4ZPXA 1KK2A 1U0HC 2VF8A 2WJJA 4A6XA 3TE6A 1W36B 1E99A 1SVWA 2PT5A 4M9SA 1NLYA 2ZXUA 1ESNA 1R2QA 4ABYA 4LOAA 3ZJYA 1R10A 3KXKA 4PQRA 4TT3A 5FL7D 2OFWA 3CKLA 4MGZR 1M7GA 3SDZA 4M1YA 2DFTA 4CRWB 4I1OA 3AVYA 5JLJA 3EIHA 1ZM2A 2RGNC 2ZE8A 2ZRNA 1P7CA 4I99A 4NL4H 1HTWA 2ZRPA 2PCLA 3RAPR 3SU8A 3UATA 2ODBA 2Q9CA 3JVVA 2FA9A 2AK3A 2XTZA 1L4UA 1I2MA 1G41A 1ODFA 2JJ2D 5SZHB 1Z28A 3PITA 2H16A 5L3QB 4KYIB 1GL9B 4UJ5A 4F4IA 1DS6A 1A2BA 4KLZA 2JIZD 2XITA 3DOFA 3THYA 2WJYA 1DADA 1NLZA 1AQYA 4GP7A 4HB0A 4MRPA 2DY1A 2J41A 4Q7MB 2O8BA 4NCIA 2PMDA 4TLBA 4MKFA 1OIXA 1NIPA 3MJHA 1R7RA 5K8TA 5D3QA 2B21A 3BWDD 2GK6A 5KSOA 4JL5A 1WDTA 4IOLA 2OV2A 4ARZB 2FPMA 2WJGA 2Z43A 1XDBA 1KDTA 1JBKA 5KYKA 1AQUA 1C4OA 4NCNA 2ZRHA 2HV8A 3DHWC 2B8WA 2J0VA 3NKVA 3WBJA 2QN6A 4Q21A 1NY5A 1UBFA 4G01B 4UNPA 3RSLA 4BFZA 1T8TA 4BRUA 3IQXA 4DT1B 4D82A 3BAFA 3DZ8A 2B7CA 5FTMA 2GTPA 1I2DA 4JBWA 4RD0A 4IHQA 4NE2A 3IILA 5G53C 2GHIA 2HCBA 3OIYA 3CONA 4HUTA 4KV9A 3AP1A 1G8PA 3KDSE 1VCNA 3DM9B 2RGNA 2QT1A 1OSNA 4OI4A 4A4DA 4UXHA 3RS5A 1S4QA 5IF9A 3FMFA 1M6NA 1E2MA 2F9LA 4HDOB 3WYFA 1GM5A 4LV6A 1DG3A 1NMZA 1LY1A 2BVNA 2EWWA 3OEHA 1OLOA 5BN4A 2D7CA 4GOXA 3NC0C 3T5GA 2FSFA 5AJWA 4AIIA 721PA 1FZQA 3DPUA 3FKSA 4V0LA 3NDBB 4JS0A 1QG4A 2ZVPX 2DB3A 1LVGA 2H17A 3HU3A 2RGEA 3I3SR 3U44A 2VIIA 3MRSA 1S1CA 3U2QA 4FXPA 3KJHA 4IJMA 4FD2A 1CJVC 1AS0A 5AR1A 1EFUA 3NBXX 1YZTA 2G0NA 4S35A 4D4LA 2MSEB 1KI8A 3WHLA 5B2ZA 1TQ4A 4GI7A 5C1BA 5JCPA 1R8QA 2WAYA 4NONA 4CT5A 2V6IA 1CJUC 3VR4A 3HWSA 5AUOB 3OZXA 4PAMA 1YR8A 1QHHA 4B75A 1GTVA 2QPAA 3FMOB 1E2EA 4PHHA 5GJVC 4CEHA 1RVDA 1HE8B 1KKMA 4LPSA 1EK0A 1G5TA 1E2QA 1NL3A 4HI0E 4BASA 4MRVA 3DKVA 2O0HA 2FZLA 3GLFB 1RYFA 4AI6A 4BQSA 3D8BA 2F43B 3B1YA 2Z5FA 5IK2A 1G18A 2FV8A 2QM7A 1TU3A 5FFMA 1D5CA 1KY2A 3TVTA 2ONKA 4C3ZA 5J4HA 3VNVA 1Q1BA 2ZR9A 1OXTA 2ZI7A 4QKQA 2G9NA 4A92A 1CLUA 1CEEA 2AK2A 1KY3A 4JT2A 5J4VA 1ZCAA 5KNBA 1UKVY 5J47A 2IYYA 4MKIA 2ATVA 2CNWD 2J5XA 2ORIA 3FFAA 1BMFD 2KE5A 1WRBA 4JBYA 1ZM4A 621PA 1E94E 4PQYA 1BO6A 1XMJA 2EU8A 1VIYA 4A0FA 2V1UA 521PA 3T1OA 4DSNA 2ZJ5A 5KUTA 4MDFA 3I62A 4D25A 4PPQA 1W4AA 1P5ZB 2W2XA 3E2IA 2P0EA 3R20A 1KSGA 3QPUA 1YRBA 4URVR 4DDUA 3K9NA 4Q18A 2JLVA 1XB2A 4R98A 4NZYA 2IXGA 4Q4JA 1E98A 3U7EB 4JLAA 4BZPA 1KYIA 1EX7A 2PLRA 1GWNA 4LBVA 5JFGA 3GJ4A 5GADl 2GEVA 4W5JA 3TBKA 5TARA 4WAUA 5CB8A 2GJSA 2A30A 1BYIA 3TUZC 1MOZA 3BE4A 3SZRA 4B76A 3EZ6A 1AKEA 1M7HA 1VDZA 3LAWA 1T9HA 3OAAA 4XJXA 2GEUA 2YWEA 3T1VA 4DUGD 5C4MA 2C5LA 3L0PA 2WMOB 5J5CA 2ZJZA 4TL9A 3RC3A 2J45A 1G4UR 2ONJA 3T61A 2IC5A 3KXIA 5LB2A 1CJMA 3MCAA 1DOAA 4ESVA 5EQTA 1WB9A 2FFHA 3VX3A 5AWFC 3WNBA 3PG5A 3SJZA 4R71A 5HTKA 3GLGB 1Z0FA 5FUVA 5AJYA 4FMDB 2FEMA 4AY2A 2LWIA 4DDWA 1DPFA 3DDCA 2JDIA 3KFXA 2RH5A 4HLCA 4RCZA 4DLVA 2BJWA 4JJKA 4U00A 2GWHA 1M7BA 1U0LA 5KDOA 3O8CA 4FW9A 2F3TA 2CL6X 5F3WB 3BFKA 4KFTA 4YXWA 2J0QA 1J90A 4KVGA 2JJ1A 2CVFA 2WIAA 3QVVA 2CLCX 3TW8B 3QKSB 3NC1C 4B3XA 1CRQA 2V9PA 2ZREA 5FPHA 1KSHA 1P75A 3IEUA 1GRRA 2C8VA 2NIPA 3RVBA 1FUUA 3MJRA 4C0BA 4F4CA 4YMVA 2HYIC 4K81B 1XTRA 1VCOA 3CB4A 4NYJQ 4C0KA 3K70C 4V02A 4V0KA 1NBMD 1TUEA 1UDXA 2BOVA 4URXR 4TLAA 2AXNA 1D9XA 4M9QA 3GLHE 1RYHA 1U9IC 3LY5A 5KDDA 2Q3FA 4N0EA 2NO0A 3L2OB 2EWVA 3I5YA 1LF0A 4M1MA 5GJBA 4H1UA 3EWAA 4OQXA 4E22A 2X8AA 3AF0A 2WSSD 4ACAA 3QPVA 4URZR 2EVWX 2ZRJA 1SVSA 3ND8A 1RC8A 1N6RA 4HB3A 121PA 3SBDA 5DH9A 3VHXA 3R9WA 2C95A 2VP0A 4D0LB 1N3BA 2BMJA 4MGKR 1J8YF 1G7RA 2IYLD 4FWIB 4B71A 5TMPA 4IRUB 5KNDA 1GRQA 3OEEA 4QHTA 1KI3A 4EPXA 5HZHA 1R0XA 2FH5B 4GDFA 3SN6A 2BMEA 1SVIA 4HZUA 3AV0B 4DCUA 2A3RA 4P4TA 3LBNA 2Q6TA 1ETUA 5JI2E 1UBGA 1Q0UA 4ZV4A 4HUQA 4TYNA 2IS4A 3VU9B 1OHHA 1G4AE 4D0GA 4TTPA 1P62B 1T4GA 3U60B 1AGRA 4AURA 2VTKA 4F91B 3FDIA 4YMUA 1KSFX 4AK9A 1UBCA 2CEAA 4OHVA 3ZD6A 1CKEA 3AVTA 2PT7A 2XAUA 4JLDA 2GAAA 5CJPA 1OH5A 1II8B 4I81A 1NVVR 4Q03A 2AD5A 4QGFA 4QGAA 5IT5A 2AWNA 1IQPA 2ZSAA 2RGCA 2FX3A 2ZJYA 4B73A 1U9IA 4E03A 1JNYA 3V00A 5FL3A 1X86B 4JVSB 4KSBA 3CNLA 3CM0A 1G8HA 1KI4A 2Q21A 4ZDWA 3X1WA 3NVAA 4MRRA 2AHOA 4QNMA 3WNDA 1E2LA 4P0TA 3EW9A 1XPUA 3H0KA 3IIJA 4US2R 1OH7A 2CHVA 4HAWA 3C4JA 2CJWA 3EIQA 3NH9A 2GDJA 4JYBA 1IXSB 5CIWA 1OV4A 1G16A 5EP3A 2J0UB 1FP7A 4PC2A 3SOPA 3V9PA 4DIDA 1NJGA 5FOTA 2QSZA 2JAQA 1LTQA 3UXMA 1LNZA 3VHLB 4KBFA 4HLQB 3LFUA 2QAGA 3BD9A 4OJKA 1OFIA 2LCFA 4BLSA 3IDQA 5HKKA 2ZS7A 1E0SA 3T34A 3CW2A 2IXFA 4M53A 1N25A 2R6AA 3ICEA 1NSTA 2QTHA 2BMFA 3PQCA 3CX6A 1W36D 2YNMA 5FTJA 2D62A 3D31A 3SC3A 2KBFA 1SXJD 1ZD8A 2QP9X 3AF2A 2C96A 4XIGS 2NMVA 1VYTA 5DHAA 4E09A 3BBPA 2NTYC 1E0JA 1P2TA 3R8CA 1WE2A 1Z3IX 5FBQB 3P4XA 1G3MA 1B23P 1ZW6A 5DLQC 3ADBA 2FGKA 2WJIA 3M6AA 3TAHA 1VHLA 2IT1A 2JLXA 3QKRA 1WXQA 3MGCA 1BIFA 4LBZA 3QXJA 2VHUA 3ADKA 3LVQE 4EPRA 2C77A 5FOSA 4EKDA 4C2TA 1HQYE 2JJ2A 2G88A 4JVLA 2C98A 1GUAA 2P6NA 2DWOA 2JEOA 1JR3D 3OIVA 1E6CA 1Y63A 1KZ7B 2PMKA 2WPDD 3GFOA 2IF2A 3GCGA 4DLRA 1IBRA 4RKEA 1S0UA 2WJHA 3VX4A 2JATA 3NG1A 4MKGA 1ZM7A 1P72A 4A1FA 5J4KA 1E2PA 4RKFA 5C18A 1F3OA 3HPQA 4YLGA 1YKSA 3P1JA 3CZPA 5D3MA 5EE5B 3WY9A 4A0GA 3GJ8A 5TV2A 1IN7A 5KNCA 4OYHA 1W4RA 3D6TB 1RW4A 3TNFA 1EXMA 3KTAB 4M1SA 4A0HA 2F1JA 3NHBA 2W2VA 3CPEA 3W8RA 1JXMA 1CF4A 2FNAA 1XCPA 1IJEA 2KI5A 2HF8A 4MH0R 1ZMXA 1JEDA 4PZLA 3FTQA 3IIMA 1EGAA 3IO3A 3RRZA 4WZAE 3UANA 4AG6A 3EX7C 1KNQA 1Z6YA 4TTQA 1GNPA 3OFND 2YWHA 4W5WA 5E7MA 4JLMA 1NF3A 1P9RA 3T15A 4G5GA 5BXQC 3KUCA 4TMVA 3RHFA 1HY3A 3ASYA 1XPOA 1A4RA 1NVWQ 2X2EA 3BFXA 4TLEA 5G40A 1SZPA 1GFIA 3CUEF 4HDCA 2ODEA 1JJVA 1QBKC 2KB0A 1N6LA 3SJAA 1XJ0A 4WZBE 3X1DA 1XEXA 4UNSA 4B3FX 4JLVA 3SNHA 4YDHB 1S9DA 1WP9A 1M34E 4G1UC 1F6BA 3M4YA 4M2LA 2F1HA 3ZDQA 3UMRA 2CXXA 3DL0A 3LVRE 3PUZA 5G41A 5A5GA 3GFPA 3TVDA 4AC9A 1UDWA 4BLRA 5TDHA 1E1RA 1E1QD 1KO5A 4BEBA 2JGNA 2QE7D 2VA8A 1KDOA 3L43A 2BKEA 4LJ5A 4EIWA 1TF2A 3TKLA 3SBEA 3PUWA 1JJ7A 2R9VA 1GNQA 1ZVQA 4FMCF 4PR0A 3CBQA 4ACBA 2KBEA 2QMUA 3FWYA 2EFHB 1E2JA 3CWQA 2PCJA 4GMDA 4AKEA 1KNXA 1NVXQ 3U3KA 2GZHA 1YVDA 5G3ZA 3RABA 1WCV1 4A8JC 2XXAB 3LW7A 4JVMA 2RAPA 5LDDC 4FMBB 2PZEA 2VLIA 3B5JA 1Z0AA 4FINA 1P2UA 2QP4A 3DMDA 4M21A 4O3MA 2ZS9A 2Z4RA 3SYKA 1BMFA 2W6JD 3ZS9A 1HH4A 4KBGA 3QY0A 5DISB 3A1UA 1KDRA 1G6OA 1KK1A 3D3QA 4B2PA 1IY1A 4PC1A 1G3UA 3X1ZA 1TF7A 2P6RA 1TMKA 1YR9A 2L0XA 1OFUX 1P73A 2Q3MA 6Q21A 2PZGA 2QI9C 3V4RA 2O8EA 3CWZA 1ELOA 3GEHA 2OFXA 3FPAA 2WOJA 2MMGA 4HATA 3LBHA 4PC7A 1GDDA 2GCOB 1OXSC 1HEIA 2GETA 4Q7LA 2ZVQX 3RRMA 4ERNA 3U4QA 4KODA 1NVVQ 2QAJA 1P61B 1TAGA 1XD2A 1ZNWA 4G5RA 4O25A 2W6ID 5EP4A 2AX4A 4CGZA 3EA0A 3K0FA 4DUGA 4GOKA 4ON9A 1U8YA 4B35A 3FE2A 1Z0JA 3CRW1 4P4UA 3THWA 5M04A 4US0R 1W2HA 1N6PA 1OIWA 3QXSA 3SQWA 1R5BA 3K9GA 5FPKA 1KI2A 2WAXA 4A8JA 3N5CA 4QHSA 2ZSBA 4Z54A 1EWRA 4O2LA 2MSCB 2ZR7A 4BZQA 5JEEA 2X1VA 4LHYA 4EQ6A 2O8FB 3RANA 1Z2AA 4D4MA 4M1KA 3QXHA 1G19A 3QIAA 4DRZA 2WICA 4IFEA 1S96A 2QY9A 2VH5R 2ZI5A 3FFBA 4JVNA 3L0IB 1II0A 5DO9A 4TTRA 3MMPA 3ADDA 1FMLA 1E4YA 3DOEA 4MQBA 2Q9AA 4QBGB 1ZNYA 4RD4A 1O87A 2QGZA 2QMOA 4LJ6A 2ZSFA 1W0JD 1G9XA 3ZZUA 4KFRA 1HV8A 2VP5A 4OHWA 4HLUC 1HT2E 3X1YA 3REFA 1TU4A 1P6XA 3AQ4A 1MH1A 1P60A 2RGGA 4LRWA 1N5JA 4YQFA 5JRZA 3IEVA 4DVGA 4OHYA 2CVHA 1E96A 1M74A 1T6NA 2VHTA 3B9QA 4DLYA 4AKIA 1Z0KA 4NCHA 1QHYA 1OFHA 3QXCA 2YVUA 5L3VA 2NOAA 3KUDA 2WWXA 1U2RA 5UKDA 4BFSA 1NN1A 4OL0A 2C03A 2ZI4A 5KSPA 5HPYB 1T0JB 3CRQA 1BYUA 1VYVA 4B43A 1E9EA 4V0NA 1Z29A 3BK7A 2QTFA 3NXSA 4KFSA 5P21A 4C0QC 1TQDA 1UBEA 1KGDA 2ANCA 1DELA 4Q00A 4ZKEA 1TEXA 3I32A 3MSXA 2VYFA 1JQLB 1OKKD 4TL8A 3WHKA 3QEJA 2ERXA 4ITRC 3IPXA 3VFDA 2O0KA 3CF6R 3BORA 3LRPA 2HCJB 1LB1B 5LD2B 3B9PA 3AUXA 2FWRA 4CVNA 3FVQA 5FUWA 2RGBA 2YOHA 4MDEA 1Q44A 2IYRA 2D4HA 5CYPA 1COWD 2FFAA 4MUBA 2B6HA 1P2VA 1DBSA 1XPRA 4D4KA 4C7OB 4TL7A 3T1QA 2GJAA 4QJ4A 4OBEA 2ZRBA 2O0JA 4TMWA 4UNRA 4HAXA 1XFAA 3PEVA 1DAGA 1HT1E 4Q1FA 4PO9A 3VKWA 5GJWC 4HLUA 1DAKA 4HB2A 2OESA 4XD7D 3EARA 4Z8YA 5F9FA 1MABA 1CR1A 2RCNA 1SXJB 1EWQA 1H8EA 5HZKA 2WZQA 2ZQ5A 3OESA 1AM4D 4BFYA 4C4PA 4TLCA 3B7GA 1KO4A 2EQBA 4LHZA 1H8HA 4M4SA 4B3DA 2V3CC 1QRAA 4DB4A 4NYJR 3WRXC 1KSJA 3VKHA 2ZRKA 1JEEA 1BS1A 4DIEA 3CR7A 4JKIA 5J4LA 4TMZA 1IXRC 4Q9JA 1G7TA 1XWIA 4WZ6A 3VTKA 2AFHE 2XX3A 4B74A 4BFUA 3KKPA 2HLDD 4TMXA 4XSGA 2GBLC 1OH8A 1XCGB 1YZNA 4B2IA 2QU8A 4L9SA 4WXRA 2CL0X 4GMXA 3UIEA 3EC2A 1GOTA 4DC9A 5EXXA 1Q22A 1E32A 3TUIC 2O8CA 2CHGA 1T3HA 1XXHB 4IDPA 3J81k 4US1R 1ZNXA 1KMHA 2VSFA 1CR0A 5DI9A 3JVUA 4EJSB 1XTJA 3PUXA 1ZD9A 4EDHA 4F92B 3I8XA 3EPKA 2IUUA 5E3HA 1GILA 3H84A 3EZ2A 3U7HB 3QF4A 3C41J 2IYQA 3MWJA 1JI0A 2X2FA 4HB4A 5BN5A 1RRCA 1UEJA 5FPSA 2GA8A 2NG1A 4JMPA 3AGQA 4KAXA 3PV0A 4JZKA 821PA 3MLEA 3ZLJA 3DKPA 1NG9A 4NKRA 3B1WA 1QHGA 1CTQA 2ZE6A 5JWHA 5LBIA 4W9MC 2O8DB 1DARA 4A0RA 2IWRA 3VR1A 1G3QA 1LFDB 1QZXA 4ZDIA 2XB4A 1E0AA 1CBUA 4TMKA 4IKEA 4LGMA 1FPMA 4P3YA 2JLSA 2GBLA 4NMMA 3GJ7A 3GLHB 1JALA 5L3QA 1ZC3A 4MRNA 1US8B 2PEZA 3NEJA 1JR3A 3MD0A 1AZSC 2WPDA 1TUIA 4ASUA 1X6VA 4BLPA 4QOSA 2ZRDA 2ZRLA 2QRZA 3EZ7A 5EE0A 1CU1A 5DE3A 2PX3A 2V7QD 1YZLA 4JBXA 4DCTA 2ASEA 3A1WA 1XX6A 4QC2A 4Q4AB 3EPLA 4ARZA 1XZPA 4IEIA 4PC6A 3A4MA 4E5UA 4TYYA 2ZRCA 4DT1A 2QEQA 5HR5A 3A58B 5E7IA 3IBGA 1NNEA 2FSGA 2HXYA 3ZVNA 1DAIA 2F3RA 2UZIR 4D0NA 3UPUA 5DN6D 3RS4A 2BHRA 2W2TA 3JZAA 4UQOA 4JIMA 4BLTA 2X77A 1VCIA 5DHFA 1G21E 1O3YA 4YONB 3V4FA 5TXGA 3OFNA 3E5HA 4Q01A 2ORVA 3FHCB 5B57C 4L9WA 4PO8A 2JLWA 5EZ5A 4P4SB 3TLXA 4DSOA 2IEZA 5TY0A 5HE9A 5HE8A 4IW3B 3KB2A 4RZUA 2ZRFA 1CP2A 2QA5A 1ZCBA 1I4DD 3EXAA 3NIBA 3P27A 3QXXA 5DYGA 2BMDA 1P9WA 3B2EA 4LV5B 4ILEA 4PC3A 1Z6TA 3CPHA 1N5IA 2ATXA 3U3MA 4KVAA 1KK3A 4BFTA 1OPXA 4OQNA 2BBSA 2IS6A 4QNRA 1KOFA 1SVLA 1E1QA 4IVQA 2ZUBA 4JLKA 3EASA 2FZ4A 3X2SA 4BGDA 3BH7A 2P3SA 2DPXA 2FFBA 4RSGA 1P3JA 5DI3A 5FBLB 2OG2A 4I1VA 5CB6A 2XZPA 1K5GA 3LQRA 1X1SA 2XZLA 3GLFA 2BBOA 1JB1A 4M0LA 3I73A 1ZRHA 1FTNA 3AM1A 5H8WA 1S9HA 3G5UA 3F0TA 2F43A 2EYUA 2VHJA 4Q9LA 5C2JB 4G5QA 2RKOA 4QXAA 4CZ2A 2OILA 1UKEA 5FPTA 2FMXA 5JHHB 1GL6A 1E79D 4EFNA 2REXB 4V03A 4ZDJA 2GCNA 2IW3A 4ZIRB 4URYR 1ZIPA 1UF9A 3Q5EA 5JMTA 4LBYA 4Q7KA 1DAHA 1IAQA 1XTSA 3CR8A 1N0WA 3BXZA 2AWOA 5AJVB 5SZKB 421PA 1LS6A 2WWHA 2XNSA 2D7DA 3FGNA 3I92A 3RYTC 3SFZA 4B48A 1Z8FA 2PBRA 4LYFA 2QBYA 1F2UB 3H4MA 4PSAA 4AYXA 3GLIB 2DWQA 2UVQA 4PAQA 4V0OA 1AIPA 1FNMA 2GCPA 4MGIR 3WP0A 3QG5A 2XSZD 3WMEA 5J40A 5AK0A 2RB4A 2N42A 4LYHA 3KZ1E 1SKYB 4E07A 4Y0VA 2V54A 3QBTA 3QSYA 1CIPA 3MUFA 4GBMA 2CE7A 3GJ3A 3WNCA 4OK5A 1N6KA 1AKYA 1N6IA 1SVKA 4ZCIA 2QENA 1R5OA 2EFEB 3PEYA 4KYUA 3L8YA 1Q1QA 3K0AB 1YHNA 2FOLA 4KHZA 4XH9B 4Z1MD 3ZIAD 2O52A 3THXA 2REBA 2YKGA 3CX7A 2IYVA 4LJAA 4R2HA 1NN0A 2R6CA 4TZ0A 1E2HA 3C16C 5L3RA 5JJLA 2C9OA 1YR7A 3KFVA 2KJQA 3PIRA 4PQFA 1H65A 3LNCA 2I3BA 4JSYA 1ZUNB 3QUSA 4X8OA 4IVPA 4C0AC 3GLGA 1XRJA 1P4SA 1TQ6A 4S2EA 2AL7A 4XVQA 3HYTA 3BB3A 1T3LA 3OIUA 1Z6GA 3JZMA 3K70B 1N2CE 2HXSA 1SULA 1X3SA 2AR7A 3C5HA 3Q85A 2OHFA 2QAGC 2H5EA 2W00A 1U98A 2YC2C 1KAOA 4PANA 5FTNA 1PLKA 2IXEA 4OK6A 4UNNA 1F2TB 1G5PA 4P33A 1T3SA 4PO1A 3BGWA 3QKSA 2ZRGA 1G6HA 1FMJA 2IHBA 4AKGA 1GKIA 4CF7A 1W0KD 2ZYTX 4BLQA 4AD8A 3L0SA 3MAAC 1ZP6A 3QI2A 2QQ0A 4CEIB 3MWYW 1XEWX 5FUYA 1E2IA 1N5KA 2R8RA 4LJ7A 3AKDA 5C4GB 3IKJA 4JL6A 4QGHA 2A5FA 1J70A 2GAOA 1G17A 2A5DA 5FBWB 4OHXA 2DFNA 2BIFA 4DEYA 4D6PA 1OXXK 1E9BA 4RJLA 2ZI6A 4FI3C 5BYKA 4DCNA 2R62A 3A6PC 2ZM5A 3BJIC 4LUCA 2ZU0C 2GESA 2UZ3A 4CEJB 3HYRA 5SZJA 1KI6B 2DR3A 1W49A 2IK8A 4LDJA 3OIWA 4DKXA 1MKYA 1MV5A 4Q4HB 3LO5A 1NJFA 1UM8A 4ZO4A 2WKPA 2ZI9A 2XTNA 4MKHA 3CH5A 1I4TD 3QBVA 3DO6A 2IHYA 2ZJBA 2GILA 3AVPA 4HAZA 4ZCLA 2BM1A 4EFMA 4MITA 4ESHA 5IDVA 4ZI2A 3ASZA 4F7WA 1GVNB 1A2KC 1Q1ZA 5K8LA 1VHTA 2X19A 3GJ6A 5F98A 3T5DA 4PX9A 4LCBA 5JHGB 5KSZA 3EZ9A 5JSZB 1HYQA 1P9NA 3VU9A 4BFXA 1NIJA 1TL7C 1RE0A 3I8SA 5KTYA 3DVLA 4A2WA 2QMEA 2XOKD 1FX0B 5FBVB 2N46A 4XVUA 3UWKA 4PHTA 2GF0A 3QEOA 1UKYA 3A4NA 3RWMB 3U5ZB 3FHTA 5FL7A 3VKGA 2N1BA 1Z07A 3K53A 3LLMA 4OI0A 1II8A 3W9YA 5JS7A 4TSFD 1JQJC 1A1VA 4BZXA 5L3SB 3HR7A 5D3MB 5JEDA 1CULC 1QVAA 3QQ5A 4NTZA 2GNOA 4D26A 1EFCA 1Q20A 5JRJA 4FIDA 1OFTA 2F1RA 4MUAA 3Q7QA 4UNQA 4FWTA 1E69A 2A5JA 3SHFA 1JPNA 2HLDA 3IIKA 1YZKA 3P20A 2AKYA 1C9KA 4B32A 3CO5A 4Q1BA 2GVDC 2BJVA 3AVQA 4URUR 2JIZA 4B2LA 4B34A 2VQSA 2CL7X 2J0UA 3GLGE 1NI3A 3B6EA 2H57A 2XTMA 3NTUA 3ZVLA 5BWMA 1FUKA 1WBDA 1JR6A 1YQTA 4LX0A 2G1JA 4QRHA 4C0HA 2NZJA 2WWWA 2ZYVX 2IL1A 5TB5A 3R7WB 1IY2A 5FR1A 4GP6A 3A4LA 2C78A 3L8ZA 2YC4C 2ZRMA 4IVRA 1EFRD 4OI1A 4L16A 3I1FA 2JCSA 3GPLA 2BKUA 2A5YB 1HQCA 3SS8A 1AK2A 5DYIA 1OH6A 2BDTA 1CR4A 3U6BA 3PCRB 1SKQA 4DSUA 4ZKDA 2VP2A 4BRWA 3BRWD 4JLJA 1ANKA 1G8GA 1KI9A 2IYUA 3KKQA 1AA9A 1U94A 1RRFA 2GJ8A 4BPBA 4Q1CA 1E9DA 3AVXA 1DAMA 1X8KA 4XWOA 2EW1A 1DO2A 3EPJA 3GJ5A 2CHQA 4RD2A 2OEPA 1RPZA 4AKHA 3I5XA 3TR5A 4B6EA 1YR6A 5KO2A 1A5TA 1QVRA 4PXAA 1GP2A 4WVFA 4BFWA 3ZS8A 1EESA 1IONA 3EC1A 5IK2D 3EA5A 3HR8A 3B78A 3AF4A 3K8YA 4L5BA 3WRYC 1DTSA 1XMIA 1K6MA 5H68A 3SFVA 4EFLA 2XEXA 1PZNA 2ZTSA 2IEYA 4NH0A 5LB4A 3TRFA 2OE2A 4WXPA 5EXSA 2OFOA 5JWOA 2OT3B 3EPHA 3T35A 4R9UC 2GXAA 3C8UA 3KKOA 1Z47A 2ZETA 2OXCA 4R7ZA 2H1LA 1UAAA 4A2PA 2G83A 1U99A 3KTAA 3AUYA 4B3BA 2ECKA 1UEIA 3W5IA 2QZ4A 2HF9A 4M1WA 3W3ZB 1VTKA 2E87A 2GZAA 4W5HA 2P2LA 4N1AA 4EPWA 5GVSA 3TSWA 1VG9B 3ZZTA 1XCMA 5AJXA 2GJKA 2QNRA 3K1JA 4FCTA 3W6NA 5E7JA 2WKQA 1N0VC 1MO5A 4F4JA 4JL8A 4RCYA 3FYHA 2DHRA 4C9BA 1XP8A 4F93B 4LJ9A 2V4ZA 4Q1DA 1NMYA 1PUIA 2Z83A 2JLQA 4NCJA 1G7CA 2B92A 2OBNA 2CNWA 5FTKA 4CDGA 3KQKA 2ZEJA 1G20E 1W2GA 2R6FA 1WMSA 2J59A 1UADA 2CLSA 2AN9A 2ZJAA 3CZQA 5ANRB 4DLWA 3CRMA 3THOA 4TWZA 3KJEA 1NLFA 1VCMA 2D3WA 3AF3A 5CK5A 3S1AB 3CX8A 1WA5A 4BECA 5A0FA 2F6RA 2E9SA 1PLLA 2WM9B 2ZRAA 1G3IA 4PTLA 3EWSA 2QP3A 2ZUCA 5ELXA 4Q9KA 2EFGA 2YWFA 4G5OA 2ZROA 3E1SA 4PHGA 4XWKA 1C1YA 4LY6A 1E3MA 5CITA 2CCKA 4OQFA 1Z2CA 2H8KA 3TJZA 4A36A 3OE7D 2B8TA 1Z6XA 3P26A 1MO4A 1UFQA 1R8SA 1YU9A 2QSYA 2OZEA 4RD6A 4KCGA 1OB2A 1TTTA 3AVOA 2VP9A 4IXNA 2XXAA 1E79A 2J0SA 3AF1A 1TQ2A 1E2FA 3VR6A 4HSEA 3KQNA 2NPIA 3M1IA 1OIVA 1R0ZA 5KDLA 5EXPA 3B8HA 2NO1A 3NHAA 2QUZA 2DBYA 2VP4A 4JLOA 4RFSB 3BS4A 2FSHA 1E2KA 1ZM3A 4TN1A 1E9SA 2QMHA 1G291 3GD7A 3LLUA 4DZZA 1RJ9B 4A6PA 3LBIA 4B47A 4WW0A 3LH5A 4OQMA 1XJCA 2RGAA 2YOFA 4LV8B 4DCVA 2WWYA 2BV3A 2BWJA 2DFKB 3TQCA 2ZANA 3P4YA 4IOKA 3Q3JB 5CYOA 5KOYA 2GXSA 1W48A 1BKDR 1YJ5A 3TSOA 2QM8A 3Q9LA 3U61B 1RRPA 1TADA 3OEED 3QPWA 1GKUB 2FU5C 1RIFA 5FPYA 2ZJ8A 4KJZA 3DM5A 2XGJA 3P32A 3N2EA 1NBMA 2D06A 1AS2A 1E2GA 4EPYA 3ZIAA 1ZIOA 4G5SA 4DBLC 1E2NA 1E0KA 3U6KA 1BH2A 1I4LD 1DVRA 1CJKC 1Z06A 5EJEA 2ZSDA 2B7BA 4QM6A 3ZH9B 2IYTA 2WSSA 2CMKA 1GITA 4ZDKA 4XTCS 2Y8EA 2Q3HA 2IYXA 3W34A 3C7KA 2O8FA 4X8MA 2DYKA 2YV5A 3KJIA 5LD2C 1B0UA 1VECA 3KL4A 4XWAA 1TNDA 3QKTA 3K70D 4GT1A 4B33A 1OE0A 2Q0HA 3RSOA 1IN8A 1NSFA 3U3OA 4XVRA 2DFLA 4M1OA 4LYAA 4MYTA 2BEKA 1FL9A 2AKAB 4QBIA 2ERYA 3EAQA 5JS8A 1S8FA 3CF2A 2J9RA 2PX0A 4QGGA 2G6BA 2E1RA 4OKSA 3QENA 3RDPA 1SQ5A 1ZD1A 5CDFA 4Q1AA 2WHXA 5H70A 4NYIR 5L8VA 4A15A 5BQ5A 1W36C 4H9GA 2YZ2A 2F7SA 5JI3E 5IRCD 1TX4B 2CCJA 4EUNA 3THYB 1SXJC 2VL7A 4MA4A 1LF5A 2WV9A 4LSGA 1N0UA 3TR0A 1ZINA 4QJ3A 2A2ZA 1NKSA 2GZDA 3HPRA 2O8BB 2EFDB 2Q9BA 4DLXA 1MRSA 5DIFA 1E9AA 2IUTA 1G7SA 4JLNA 4O2RA 4X8HA 3BOSA 3QJYA 5FOUA 1W1WA 3HU1A 4TQAA 1GRNA 3NBYC 1E9FA 1PV4A 4HDQB 2VPPA 3LA6A 1L4YA 3QOFA 4UJ3A 1FW6A 3WXMA 4FMDF 3PFIA 2PLFA 4RD3A 2P67A 3RWOA 3TSZA 5JJIA 4M22A 2F9MA 3CRRA 1SGWA 2YJTD 2KSQA 1KO7A 4YC7A 4B3CA 4EPVA 3AVVA 5EE3A 2YYZA 4FMCB 1NN5A 3TGPA 2VBCA 4GOJA 3WYGA 4EJSC 2ZYWX 1JECA 4C7OA 4QL3A 4DWJA 2K5UA 1KHTA 1KI7A 1X8JA 4C30A 2PEYA 3R9IA 1AN0A 1DAEA 3VR2A 2J87A 3ZQ6A 5JECA 3MWLA 3T06B 4PPFA 2A5GA 2FEOA 5FI0B 3LW8A 4GNKA 4V0MA 3AP3A 2XOKA 2ZRIA 3EZFA 5EUMA 2LKCA 1J2JA 1Q21A 1SXJA 3C14C 3IQWA 1ZUHA 3BIFA 5EE1A 3U44B 3KKNA 2QT0A 3UG7A 3SYNA 1T5LA 1CS4C 1XMVA 1XU4A 4TSFA 2V1XA 1VYUA 3RS7A 3KKMA 1XZQA 5FBRB 1NBME 5IHPA 2GJ9A 1W5SA 3IHLA 2IBMA 3O8RA 1OB5A 4PSVA 2I1QA 4HEJA 2Z4SA 3QF7A 4GZMA 3SR0A 3DZDA 2UKDA 1VG1A 1QHHB 1Z22A 1E9RA 4CEHB 3M0EA 1OYWA 3RS2A 3NEYA 3K09C 2JLUA 5SZIA 3OF5A 4U5XA 4LWZA 2ZJOA 4KO8A 3T1TA 1M8PA 3AKYA 4AYWA 4TZ6A 4NU0A 1XXHA 3UKDA 4B44A 2NO9A 3OHMA 4GFDA 1NMXA 2PZFA 1YZGA 3ZVMA 4QJ5A 3G82C 3A1SA 4EJSA 1PJRA 4TLDA 5CM9C 3LXXA 4IFBA 2Z6VA 1KDPA 1MO3A 4AYTA 1K8RA 8OHMA 5EZ6B 2ZJ2A 1FP6A 2SHKA 2I1VB 3AKEA 3W6OA 4KU4A 1F5NA 4IOJA 1XEWY 4Q5IA 1EFRA 1AJEA 5JZVA 3Q5DA 3FMPB 2R2AA 3GEEA 1OT3A 5CDFE 5JCZA 3W3AA 2IUSA 4HLDA 4KITB 1HA3A 3ONWA 2YWGA 4BWYA 4UXIA 2JLYA 2OBMA 4IDHA 3I4LA 3U7FB 1DEKA 2PJZA 1N5LA 2VP6A 3RNLA 4JSTA 1OJLA 2D74A 3EG5A 4Q9HA 4AG5A 3VMFA 1FFHA 4LBWA 5E4FA 2O8DA 1DE0A 4Q4JB 3UG6A 3WP1B 2ORWA 1IJFA 3Q7PA 4JLPA 1E1RD 1RZ3A 5JWRA 1FTSA 2XNDD 1Q3HA 4OQLA 2OCPA 4CIDA 4QM7A 2J46A 3TIFA 1E4VA 1EG7A 1OXUA 1KO8A 3FHOA 5KPDA 3GLHA 5DI3B 5FOVA 3RS0A 3MG9A 3ZQJA 1US8A 2ZAMA 3O8BA 5A4JA 1EFHA 2CE2X 2V8OA 3L0OA 2CLDX 1GSIA 3K09A 1KK0A 2ZIAA 5DSZA 5KSYA 2CK3D 2FSIA 3WMFA 3QG1A 3H1TA 1KO1A 3K0CC 1KJYA 4M8NE 2W58A 3U3JA 1YZUA 4IDOA 4MYUA 4PAOA 2PJRA 3K0SA 4K46A 1Q1EA 3BC1A 1XTQA 4Q4AA 2IS2A 3VR5A 3I72A 4DDVA 3NBFA 1T91A 4A2QA 2A7QA 2BCJQ 2WJVA 2NQ2C 4TYQA 5GVRA 2AFIE 2QE7A 2ZU6A 3G0HA 2G1KA 2QORA 3HP1A 1D2EA 1Z63A 4CYMA 1W5TA 1V43A 1VIAA 4V0ME 3GJXC 3VNUA 2RMKA 3SYLA 4EPTA 2QBYB 2F55A 3RRYA 2ZE7A 1SXJE 4TL6A 3ZZ0A 3BB1A 1Z0DA 1TPZA 2HUPA 4A9AA 2W0SA 2TMKA 3O8DA 3PEUA 1D2MA 1R0YA 4NHOA 5F2EA 5CJ2A 3VQTA 3TK1A 1R6BX 1J99A 2W83A 2KWIA 2VEDA 3PUYA 4P4SA 5K8UA 1U90A 4B3GA 1VG8A 2YHSA 4GSYA 4UKDA 2HJGA 4TQ9A 2WKRA 1F48A 1U8ZA 4Z8XA 1G8FA 2W6JA 1E9CA 3THXB 4ZCMA 1MO6A 1FQJA 5H1YA 3NH6A 3ICQB 3LX5A 1JR3E 4KSCA 5FTLA 3CRVA 3E70C 4DXAA 1T8UA 5AJZA 3K0CA 3C5CA 1XXHE 3B1XA 5CM8B
chains in the Genus database with same CATH superfamily
4C20A 1ZK0A 5L53A 4HYYA 3HL0A 4F71A 1SHKA 2H92A 2ORYA 3B1VA 4CKZA 2ZM6B 2DWPA 1GNVA 1NWHA 5I6DA 4Y1EA 1DLIA 4DR4B 1EAYA 1UQRA 3L06A 3O1HB 2H2GA 5CLLA 5SYAA 1SUPA 1FSFA 1R16A 1YMQA 2ZQYA 5EZQA 3PXGA 4TVSA 1JMKC 2FJUA 3OIFA 2FGJA 1FU7A 1N1DA 2W6IA 2XUPA 4L7VA 3VDRA 5KU7A 5ABPA 1O6FA 3ZY6A 5HA5A 3EF1A 4WLVA 1P2SA 2IYZA 4UAUA 3ACBA 1HUQA 2H1FA 2C1EA 4CIVA 3RFUA 1IM2A 4RY2A 1PSWA 4KPFC 3W4JA 1EXDA 4GM1A 1RQGA 4D80A 4R05A 5B30A 4LF8B 4JB3A 1PEKE 1ENOA 3IULA 1PWZA 4LVUA 1FFYA 4MS1B 3IBYA 4OKNA 4OLJA 2HADA 2F1IA 3AETB 4L28A 4P80A 3GNQA 1T6XA 4OFBA 4RFVA 3COPA 4DNOA 4Y2RA 3OT5A 3WKAA 5DNYB 3PUVA 3QTBA 3G0CA 1AUOA 1JQ5A 4K9OA 1ZDMA 1ZSVA 5HCIA 3H8WA 3U3ZA 4CNBA 3C3EA 4I5GA 5K3OA 2AR0A 2HHJA 2REOA 1W34A 1HDZA 4R1OA 4XIYA 5DDIP 5EY5B 4A0QA 1F2UA 2EHJA 3A6GA 1PHPA 1U4NA 1LDGA 2VSOA 1XZEA 2IY8A 2IZ5A 3QI7A 4FCVA 2YBDA 4W6ZA 2RG1A 3ZVRA 4F6RB 5LNK1 2YXBA 2OXRA 1G9TA 1NG1A 2C0CA 2P91A 2OD2A 2PGJA 1R3DA 1TCCA 1MR3F 1W5BA 1L3BA 1LNSA 2CCGA 1XELA 2WV7A 1PW5A 1TECE 3FB4A 3LQQA 4DLPA 3ZBQA 1Y6GA 5EWJA 3UJ9A 4HZIA 1WX1A 5F78A 1KYVA 5CNMA 5BWLA 1QHSA 2HK6A 2C97A 3PJRA 1L7MA 1NVDA 1XGKA 4U7GA 3W8NA 3VR5H 3O92A 2OQIA 3GFTA 3RQSA 2TMDA 4BFVA 1J42A 2G8LA 1IXZA 4GW3A 2XDWA 2W8ZA 1EMDA 2D2EA 3LWNA 4LTNA 2CBXA 3GLFE 1TZKA 3O0TA 1UKBA 4TV9F 2Z3ZA 1XTZA 1LDEA 4RE6A 3D2AA 2NZVG 3TEJA 2LGJA 4DM4A 5IM5A 2OZLB 3FYCA 4WINA 1K7CA 4QZVA 1U8AA 4KE7A 2CJXA 4N5HX 2AOVA 2WSMA 1C0EA 5KYNA 4JOQA 2H08A 4JFAA 3RUEA 4C4XA 2DJ5A 1NQAO 2CB9A 4L8FA 3O73A 1RBMA 1S01A 1UDBA 2YW2A 5EPUA 3KZMA 2C31A 2DQKA 4JI7B 2A1TR 3H9BA 1DBRA 1GLGA 4KXMA 2FSVC 2ZSJA 3A6EA 4IFIA 4PPGA 1CJTC 3JQAD 4QTZA 4BUCA 1YR1A 4D9JA 2R0QC 3CISA 1VHWA 3CT6A 3LD9A 3PENA 4MEJA 4JI3B 1X8LA 4XD2A 4AO7A 3BJRA 4U2GA 2VAVA 1AS3A 1QDEA 4LPKA 5GJCA 3HUFA 5DM2A 2PKEA 2X3YA 2YOGA 1W75A 2UVPA 3PPWA 2DOKA 1UR5A 4IUYA 2GEDA 4XD7A 2B1JA 4C6RA 9LDTA 3MS2A 3FUCA 1QYRA 2FKNA 2W5UA 1LLUA 1RI4A 3IKTA 4EAAA 2OCBA 1JPJA 1P74A 2DWCA 3TH5A 5FH9A 4RMGA 1AUXA 3F96A 1H4VB 2P3LA 1PX2A 3ZEAA 3CVWA 2YHIB 5TMDA 5K8IA 3WGLA 1GVHA 2C2HA 3LL7A 2YX1A 5FIUA 3SYRA 2XODA 1LW7A 4EZIA 1P2DA 3KJGA 1R0WA 3L4EA 1NUTA 1VL8A 2BFOA 5DGHA 5C7LO 1DO0A 3KYDA 8GPBA 3TG2A 1FJXA 3F7MA 5BY2A 3Q72A 4S1OA 2PSHA 3GJYA 2NO7A 3CT4A 1WXEA 3D0OA 4TZTA 5IDXA 3C6MA 5HIIA 2O9JA 2R86A 2YUTA 3OECA 3PL5A 3PVSA 4Q4LA 2OBLA 5GWXA 3AVWA 4UZSA 5LMCA 1HMPA 3OQIB 4FBMA 3VHQA 3V1LA 4IEEA 3BWYA 1C81A 2ZP1A 1I1HA 2EBWA 5KYYB 1JQBA 1GV1A 2FE4A 1GT91 1GNRA 2C7GA 2JAHA 3B2NA 4QDTA 3WMRA 3LV8A 2O1WA 3RS3A 4L0DA 2ZFUA 2WU1A 5I7OA 2XCLA 4QHYA 4MR8A 2I4IA 3T7DA 4BBJA 5KCMA 3HB4X 1A96A 5JSZA 1KZGB 1AQNA 4LTDA 3WNVA 1SOAA 3BRSA 2QTVB 3C3DA 4J29A 2YVLA 3TLAA 3TQIA 2F59A 3R4VA 4QBFA 4EENA 1FDUA 4IY1A 1VBNA 1KC3A 3UZUA 2XVYA 2BM0A 1RZVA 4I9FA 4YRKA 3S2UA 1GKLA 2GBCA 4GYWA 4F21A 1TGYA 2CLMB 2EFYA 3BE8A 3ZWMA 3DEFA 1CUSA 3AOEA 1ES9A 3NOOA 2EW2A 2NADA 2WF6A 3IKVA 4IJVA 5EESA 3DMNA 5T8KA 4ZI3A 5C4IA 3FPGA 2PL5A 4BUZA 3LPNA 2ZWVA 3ZNNA 4I66A 5JRZA 1DRUA 4HHEA 3OC6A 5HBRA 4IMIB 1NE7A 1UJ2A 1REQB 2VBGA 3CLVA 4URWR 3RI3A 2FN4A 1C7IA 5E4YA 1EM8B 1PVVA 4L4ZA 1A0OA 3FCSB 4MAFA 2HDNB 1KJWA 5A4MS 1Y8ZA 2RG7A 5KMGB 4L4UA 4I46A 4B79A 4ER0A 4ZJPA 3IR6A 3PDUA 3R5KA 4BRZA 3WB9A 3TDMA 3JQFA 1ZL2A 4KQWA 3DJFA 4Z51A 4MLPA 1L2TA 4OLHA 1WETA 5ILOA 1R74A 2IVFA 2YINC 3D6FA 2V7QA 1AG9A 3IDZA 3N70A 4FU0A 4RVSA 1P4RA 5DB4A 5A0VA 4LHXA 3IP6A 5TVKA 3R7WA 4B3SB 4P8RA 1QUFA 3OQVA 4V1CB 1P8AA 2Q1TA 1GZ3A 4HEQA 3A6ZA 2DBQA 2QQEA 2IYSA 2HU7A 2JKZA 1ORWA 4N82A 3RKUA 3EQZA 3QVMA 2GT1A 4U7JA 1U81A 4D9NA 4DCCA 2JCYA 4J91A 5A1JA 2JJQA 3EG9B 3FVWA 4Y6RA 5F64A 3ZK8A 2HEIA 1TC2A 4G24A 3AGPA 4OUDA 1WW3A 5F4ZA 3HJNA 2OAGA 1FFCA 4RL6A 4EX6A 3IO5A 1XTIA 3I9OA 2XD4A 3JALA 2RHHA 3D7LA 4HYEA 4NBNA 4NPCA 3V1NA 2O48X 2FXVA 1JYSA 2R87A 4RFLA 3A1VA 4IOMA 2ADOA 1AKRA 2P2NA 3LY9A 3ETLA 3BD8A 1E7WA 5A4DA 2P40A 2Z0MA 3NRCA 3WQHA 3QX9A 3TFQA 1ZUD1 1JU4A 4CMEC 2XGOA 1FP1D 4FFMA 3HDTA 2O3TA 2GK7A 1T6ZA 3F8TA 2FN8A 3N6VA 1W30A 4MV8A 3KOOA 2UYGA 2X6TA 3R9XA 1QG2A 4G0YA 1GU1A 1W4LA 3NJ8A 3OCUA 2CLIB 3OAAD 3M6FA 3LXUX 3STUA 2J7KA 2R85A 3I4CA 1FPQA 3Q88A 3NX4A 1FFGA 2CK3A 3EYAA 3ER9A 3THWB 1A5ZA 4LE2A 1SVOA 3CR3C 2X8WA 3GFBA 3GV0A 5FB3A 9LDBA 1Z0IA 1KP3A 4RK0A 1LPAB 3OZ7A 4EB0A 3T5BA 4O1MA 5C46F 3CTPA 4D96A 1M1YA 4I1PA 1JEJA 1G1MA 3HADA 3QLEA 2WKWA 1DTWA 1MNAA 1VP3A 2FW6A 4HH3C 5IARA 3UWDA 4KLCA 5DSXA 5E6RA 1EH5A 2QL7A 4YP7A 5KVQA 5I7RA 4FB5A 3NB0A 3LXRA 1EXWA 4OYYA 2XQIA 2FMFA 1J2EA 4DMCA 1Q12A 1BKYA 4INZA 3QBEA 5CK4A 3RJZA 2Q8NA 1NF8A 3TM4A 4YXWD 1NDHA 3V34A 3ER8A 3ADCA 1XYYA 2YJNA 3N05A 1HNNA 3ANMA 2XZOA 2GHTA 3HJRA 3CPSA 3E7DA 3Q1KA 5EAIA 1E18A 3ZD7A 5TQ2B 1RCTE 4CTNA 1D9ZA 3M6XA 2JFGA 4RVDA 4DYDA 1O97D 2Q2WA 3SHTA 1KA9H 3G59A 1GG2A 4HX5A 4LRYA 2J6CA 5DOVA 3REGA 3SEQA 3JAWB 3KSUA 4RORA 1TEVA 3KOMA 4LNUB 1IPEA 4KQHA 3VO8A 3B53X 3HKDB 5M29A 4WBSA 2R84A 1NBIA 2OM2A 1U0JA 3O93A 4IZIA 5L45A 5E38A 3DPIA 2MHCA 4NZNA 4I4IA 3DOOA 3VAYA 3ZPXA 1SHZA 2XE8A 1MOSA 4H4CA 5BYJA 1QF9A 2VHEA 3AUKA 1HYHA 1WDWB 4FILA 2AUMA 3EYWA 2PA3A 3CLTC 2GXUA 1FP4A 4BNUA 1RQRA 1J0BA 1AUPA 1TA9A 3ECAA 1S8OA 3OX3A 1ZH6A 2NUPA 4KRXA 3H65A 1EGVB 4PSKA 2JH9A 2P0YA 4QU5A 5AUPB 3T0IA 2A78A 4XARA 4D5GA 4RDIA 1ZAKA 4DV0B 5WRFA 4RVCA 2KM1A 1WHSA 3RG8A 2R97A 3A3OA 4KLNA 1DZ3A 2C99A 1TT5B 4M9ZA 3GLQA 4RF5A 1LJUA 5BT9A 1I6MA 1TCAA 1XMSA 2A3NA 3QU7A 5KYTA 3A37A 3IGFA 2V6BA 4DNPA 1XD8A 3R7NA 5KYXB 3SLKA 1F9AA 1KYQA 4DSTA 2UYOA 1NWCA 3NEPX 5K6RA 4GUAA 1X0VA 1QHIA 1W5EA 2DFPA 2RHDA 3E3LA 1CQIA 4IJUA 4RHEA 5HCNA 3E81A 5LLTA 1I3OA 1H2WA 5K3FA 2GN2A 3OM9A 1KKLA 4AMYA 3VYWA 1ACLA 2R4QA 4EKYA 5IBCA 7REQB 3LCCA 4DAEA 2XJ9A 5BRAA 2AJCA 1RFLA 3DBRA 2BMAA 3FPKA 1DOZA 4AULA 1FE8A 4IXMA 5TEVA 2YZKA 4GPTA 1OLUB 2RKWA 3VDMA 4IHAA 2NYUA 1G21B 1NJ8A 5H02A 4MX8A 5IMSA 3AWDA 5FX2A 4BKUA 3GRUA 1IPFA 2I5PO 4DA8A 4G1VA 4MQLA 2V74B 3RARA 5H4GA 2FLWA 5C0OE 1GTG1 3KSAC 1NKTA 5DHQA 1YJCA 3DMPA 4TV8F 2NT4A 2X5XA 2IE0A 2P6UA 4LJ4A 1O8CA 5D7NA 2XD9A 1S2GA 3Q2OA 5C5CA 5JSUA 3TQQA 1SUCA 3UAVA 4DIUA 2GZ2A 1EZ1A 1IH8A 3N8NA 4IMJB 3OOJA 4FDLA 3FDZA 5K0FA 2H18A 3HJFA 3G2IA 3K8QA 1ONBA 1CQJB 3L18A 3DNMA 2FF7A 4Y2UA 1CE8B 2VF5X 4NYMQ 3WWCA 1AY0A 2IZOA 1YS2X 1JPUA 1QORA 2CNOA 2E55A 3MCWA 4IQ0A 3ZYCA 3H87A 2OCYC 4YO8A 1T0HB 4MGYR 1XI2A 4F3RA 1Z5VA 1RM3A 3NJ4A 2VFAA 3B85A 2HWYA 1LV7A 3P9ZA 1QHNA 3HDGA 3QMVA 3IV7A 3QOXA 1E1YA 2C2MA 1MJ5A 1U2ZA 3I28A 1HNWB 3P9IA 1QHXA 3DV9A 4ZPXA 3G5MA 2VF8A 2DT8A 2WJJA 5BN5B 3TE6A 1P1HA 4A6XA 1JHXA 4JELA 1GARA 3UICA 1ESNA 1WUYA 3KYCA 1NNUA 4ABYA 4E5NA 3E2PA 3KXKA 5BSTA 2I2DA 3S5UA 1GYQA 3EMVA 1PF7E 3LKBA 5KNLA 4REMA 1K92A 3UUFA 4OYRA 4MGZR 4DZRA 1M7GA 3M82A 1UT6A 5DHTA 1OASA 1G5QA 3SDZA 1YRYE 3JQAA 1JTEA 3G0DA 2ZSKA 4D9BA 3VBCA 1FY2A 1E1NA 4ML3A 3DZJA 2QUJA 4NL4H 2ZRPA 4YAUA 5LFAA 5CEEA 2PD3A 2Q9CA 2JD2A 5CVCA 4QNNA 3M4ZA 5EIBD 2G8NA 3T5MA 4JB0A 2R48A 3DE3X 3N2ZB 2QTTA 2XTZA 3K16A 1AGYA 1MXFA 3N59A 2ETVA 3MOSA 1G41A 4BBZA 4ES6A 5JSFA 4QDUA 1ORRA 2OBYA 2PPLA 4QRIA 2H16A 4HYTA 5GM1A 4FLMA 3TRJA 1OAKA 2PRYA 3IELA 1GL9B 1LK5A 4LHEA 3RVNA 3UAWA 3THYA 1SWVA 2XITA 3KQMA 5F51A 3PWTA 3VSEA 2WJYA 1PX0A 3JWIA 1AQYA 1EWVA 5JMOA 2NQTA 1IEVA 2JAPA 3QVXA 4M88A 2PMDA 4BNIA 2OR3A 3BHIA 2O1SA 5GY7A 1IZ8A 1OIXA 3MS4A 1XVVA 1NIPA 1R7RA 1K98A 2AE1A 4FGWA 4DA6A 3E22B 5K8TA 1HSOA 2FZ5A 1PZGA 1U0OC 2QRUA 5LJIA 3ZVKA 4JL5A 1JHYA 3FD8A 3ABZA 3PNQA 4N5MA 4IOLA 4Y6GB 1QS0A 2C94A 4OHBA 4EMSA 4KAAA 2Z43A 4ZXPA 1SKUA 1XDBA 1KDTA 3GY0A 4MS4A 3DMTC 1JIJA 1NULA 5KNCD 4NCNA 3VA7A 3G2MA 2ZRHA 3FSJX 3DHWC 3N2GB 3NKVA 5DWQA 3WBJA 3CCCA 3HRHA 1ILWA 2ZTMA 2YYYA 4G01B 4KPGA 4H31A 4U4AA 3IQXA 4UNPA 1O1YA 3ESDA 4DV3B 2VJYA 1JJFA 3FETA 4P1ZA 4YROA 3DZ8A 5ERXA 4E32A 1LEHA 2LVBA 5BSUA 3D1JA 3GN1A 4RD0A 3ZY2A 4BXOB 4NE2A 3AR9A 3EEYA 1NXXA 2GHIA 1WTCA 4KQMA 5TT1A 4LZWA 3T5TA 2O2YA 3OCXA 5IJ0B 2AKEA 3FCAA 2V7WA 3KDSE 4L50A 2RGNA 4MCJA 2QT1A 1Y3CE 3QLTA 1H6BA 4OI4A 4TXMA 5LLSA 3O8NA 3RS5A 3HCWA 2RGYA 2II6A 1RLMA 1V0JA 4Q3LA 3WYFA 3GU3A 4F84A 1QQTA 1GM5A 4YQEA 2DFVA 3AINA 1L9XA 4NBKA 4LV6A 4PGGA 4RVHA 3WFJA 2JL1A 5IYZA 1CJSA 2CXUA 1TEZA 3QHAA 1NMZA 1LY1A 2BVNA 2EWWA 3PX2A 4GKVA 4OGLA 3FSGA 3RVPA 1XMQB 3TECE 3E9EA 4O4JF 5M34A 3F5MA 4C6TB 721PA 1FZQA 3TI9A 4R2MA 1B0ZA 1FFXA 1PR5A 2DB3A 3GAMA 2H17A 3HU3A 4MWOA 3PDIB 3RLIA 4PLVA 3UY4A 1IZ9A 2IGTA 5AK4A 5HWSA 3S3TA 3I2IA 3BSWA 4YGYA 2Z8XA 3VH1A 1AS0A 2Z2JA 1TO1E 2W2OA 3K71B 3QX3A 3NBXX 2NYAA 3VI4B 2MSEB 2A67A 4RVFA 1KI8A 4RSMA 5ERYA 4C04A 3DT8A 2WB2A 1TQ4A 2DJIA 3CLRD 2JFOA 4GI7A 5C1BA 4XM0A 1KE1A 2PH5A 1NF2A 4IIJA 4NONA 4ENRA 5B4UA 3BCSA 3O3NB 6ABPA 5LDGA 3VI3B 1DBIA 1YR8A 3DA8A 4KQIA 4B75A 5ECDA 2Y1WA 1BN6A 2Y4NA 3FMOB 1E1CB 4H60A 4CKWB 4CEHA 1VP9A 1RVDA 1HE8B 1KKMA 4RCVA 3RWBA 1CQZA 1QE0A 1NL3A 2IPAB 3JQEA 4UULA 4UVHA 1QIEA 5ECYA 3UENA 2BSQA 4HO1X 1V6CA 3GLFB 1GEGA 1RYFA 1W73A 2EQAA 1PZMA 2XT6A 4JNKA 4TZKA 4EWLA 3U16A 3HGQA 1RJWA 1E3TA 3FOCA 4CV1A 1UBKS 3ZQKA 3EUFA 1SBNE 1G18A 2YMLA 1TU3A 2X0JA 3VNVA 1D5CA 3TVTA 3R6LA 3O2SB 1NA5A 1PFKA 4ZWNA 2C4KA 1K7SN 3HEBA 3GW8A 1CEEA 3FPLA 3GT7A 4JT2A 2GN8A 2CHEA 4MR9B 4X3OA 3FR7A 4NE9A 4RADA 1N2CA 3UHJA 4AMGA 2IYYA 2FJPA 4MKIA 4BIMA 2ORIA 3R1IA 1PGQA 1BMFD 1I1OA 4PYNA 4FFBB 1E4EB 2GN1A 1BO6A 2EU8A 4U9IS 4BVGA 2V1UA 3PNYA 4CKEA 4P35A 3T1OA 4BO0A 4DSNA 4ZVUA 3RC9A 3HV2A 4FFNA 4CF4A 4D25A 1ULUA 1W4AA 3E2IA 3R20A 1Q7GA 4PPQA 5J2UA 4H7KA 3VPSA 5KQSA 3K9NA 1C1DA 1VSBA 3A3YA 1MC5A 1NRWA 4Q18A 1YS1X 3I9KA 4NOKA 1QZTA 4NI5A 4NZYA 4RJIA 4Q4JA 2XKKA 2HMYB 3L7CA 4RQAA 5LOVF 1IPHA 4JLAA 1CIVA 3OZRA 2ZBEA 3OTQA 3U4CA 2JF0A 1JNXX 2PLRA 2ZXFA 3K7EA 4CQMB 1C14A 3T3GA 5JFGA 3FVTA 4MI3A 4W5JA 5DX1A 1YZYA 3UGKA 1R27A 2XMQA 3LG2A 4G0QA 1BH6A 2A30A 2J0EA 1VPWA 2JGDA 4B76A 3EZ6A 2FW8A 2VNHA 4QREA 5F73A 3RBAA 5AKYA 3OAAA 2D7JA 1AUQA 1LBSA 4LSMA 3T1VA 5C4MA 2X4IA 3EODA 1ZG3A 3QMPA 4D9KA 3UJCA 3RYCB 1RJDA 2W4QA 4M60A 5AOAA 1PIWA 2J45A 2UUAB 2B20A 2I33A 2X6RA 3ASVA 2VF4X 4PHCA 2UYQA 1GPWB 3MMXA 3T61A 3DC2A 3STHA 1HRKA 4RA9B 1SQSA 1CJMA 3A28A 3RNOA 2ZLBA 3MCAA 1T4MA 1U7DA 1WB9A 5K2OA 3OPXA 3MILA 3WNBA 5JPIA 2SKCA 1KXZA 1AXRA 1D1SA 1ZL0A 2XF8A 5HTKA 4FMDB 1L7QA 4C2AA 4AY2A 1FS4A 1MUUA 3EBLA 4CLOB 1PQWA 1E5XA 1PVDA 2BJWA 3L93A 3PUJA 4JJKA 5LP6C 4WUVA 1M7BA 1T1SA 1U3TA 2JLBA 1F8FA 5DGDA 4U8GA 2AF4C 3RC2A 1WD5A 5F3WB 2CL6X 4XEHA 1XZMA 3BFKA 4Q9NA 2WG2A 2YJ3A 4YXWA 4B4OA 2CVFA 2OM6A 2QL5A 4F2GA 1Y5IA 3G8AA 4UM7A 1IMJA 2GX6A 3JD2A 2VZEA 2BUBA 4M9CA 2BFDA 4I4TF 2YXEA 3E9MA 3HBNA 3OIGA 4OCZA 4B3XA 4W1RA 1CRQA 5FPHA 4EATA 1Y4AE 4KE8A 3ZDYB 3RVBA 2V0NA 1FUUA 2WU0A 3MJRA 5MHTA 3CMCO 1U8TA 2X4GA 2ZIXA 3NWBA 2HYIC 3OC0A 3K2IA 1VCOA 3CB4A 1A9SA 4NEQA 3FR8A 3MBKA 7YASA 3HJAA 5GOTA 2X22A 4NYJQ 4V0QA 3CLHA 1FVXA 3TWOA 4C0KA 2WIKA 3K4PA 4V0KA 3GMSA 3PE3A 3GGPA 1WL8A 2AXNA 4TLAA 4DBVO 1RYHA 5JVDA 1QVVA 5KDDA 2W2LD 4QXPA 2QVCA 2X0IA 5BVGA 5EJ4A 3I5YA 5IULC 2CV1A 2HA0A 5GJBA 1E0DA 2IEDA 3FYUC 4E22A 3E3NA 5B1HA 3FXAA 4AM8A 3QH4A 4JYAB 3TGWA 2WSSD 3MYYA 4A8PA 1Y4SA 4ACAA 2EVWX 5BUQA 1EFKA 1GZ4A 1SVSA 2W48A 3ND8A 4PZ9A 3MRTA 1RC8A 3SBDA 1MP0A 1R6AA 1SUIA 3FKJA 2C95A 2VP0A 5DH9A 4D0LB 3VSAA 1MX5A 2HGZA 3WIBA 1T6BY 2Q6LA 3S8YA 3GK3A 3A1NA 4AJKA 2MR5A 3VTAA 3IJ5A 3TDKA 5ARDA 4BCCA 2BD0A 5AI9A 3GJTA 4RJKA 2AOXA 4PNZA 2HBQA 4GDFA 1VJCA 3SN6A 1GPKA 1PEYA 1RYDA 4O2AF 3PC3A 1ND6A 2GEFA 4ARSA 4PFKA 3HXMA 4YPFA 2A3RA 1RQPA 1Z74A 2EX0A 2I7VA 3FWHA 3LBNA 5FQOA 3N2LA 1E1KA 4ZV4A 3OTIA 4YEDA 5EYPB 4ZTUB 2YNMC 3LGSA 3OU7A 4KGXA 4BZWA 4DMLA 5I51A 4MS1A 1E7RA 2BEVA 1PD0A 2OKCA 3L41A 3QLVC 4YRGA 4O4JB 4AK9A 1UBCA 3AETA 4OHVA 2IY7A 1L5NA 1CKEA 3AVTA 1ZJYA 2P9QA 2XAUA 2PR2A 2GAAA 5CJPA 5FUMA 2Z57A 1WSAA 2B1QA 2AWNA 1IQPA 2HQ1A 2HCFA 3ABOB 1FBNA 4UARA 1JNYA 3B3QA 4LXTA 2BEWB 3F6YA 4JVSB 5FL3A 3CNLA 4C7VA 2O2IA 3QV1A 1G8HA 1KOJA 1BJKA 4F6RA 5B6IA 4ZDWA 4ZOBA 2HDOA 1E2LA 3A9RA 1O95D 3G6KA 4GVXA 3EW9A 1EGQA 1P29A 1XTUA 4X45A 1NMEA 1G20B 1LPPA 2VK4A 3H0KA 3V32A 3IIJA 4ZJUA 3H7IA 3H5AA 2COKA 3C4JA 1RLUA 3EIQA 3NH9A 2GDJA 3O8LA 4NQRA 1LFAA 1OV4A 3GAZA 3BGOS 3SIXA 2OP0A 1D5WA 1OZ0A 2J0UB 2XI4A 2FWMX 3SOPA 1D2AA 4IGEA 4BVEA 3ELYA 3I2HA 3LIPA 1ZH0A 1PR1A 2CKMA 5FOTA 4DIDA 5CVUA 2BUCA 3KQLA 5A3SA 5JE8A 3AOEC 1VGRA 3AJ9A 2PANA 3UXMA 2P78A 1A9YA 3N7UA 3VHLB 2IPNA 4C1BA 2OQVA 1AU9A 3OA2A 4FYYA 2XGMA 4OQYA 1X9GA 4IFTA 2P77A 4OJKA 5ALFA 3OURA 1RAIA 3JWEA 3MOIA 1PWXA 2LUOA 1UBNA 3IDQA 3UAOA 1QV7A 3TR6A 4FBLA 2OZLA 4GAEA 3T34A 4M53A 1HDRA 1R8YA 1WMDA 2D0OB 4U3JB 2BMFA 1M66A 2YVKA 3R7LA 2PX2A 2XMRA 4REQB 5EMNA 4CIWA 4BLTA 3D31A 3E7XA 3W4IA 4XIGS 2QP9X 3DDOA 5L7TA 4XCXA 4N5IX 3D2CA 4EY7A 1X0XA 5K3SA 5KKAA 3D8UA 3O4RA 2FPXA 2O3QA 3IQIX 1MJNA 1WXWA 3K5WA 4GOND 2FLVA 4R68A 4UTXA 5CPFA 4YVFA 3SF0A 3T3IA 3VC2A 2Y76A 1WE2A 4D8VA 1UK6A 1ZW6A 3ADPA 3HB0A 1B6GA 2P68A 5E9QA 1VHLA 1IOVA 4LJKA 4Q3BA 3NVDA 1TLTA 1MZVA 3TRDA 2VHUA 5A9RA 1BG6A 3N0XA 1FFWA 2C77A 2KHZA 2ZT8A 5FOSA 3KFLA 4S0XA 3SXUB 4EPRA 5HOQA 1A8HA 2G88A 2G9QA 4JVLA 5MFZA 3L6DA 5EKXA 2JI6A 4ZVVA 5CDYA 1WNFA 4YA6A 2OBBA 5KTRA 4WNAA 1IBRA 1S0UA 1F0PA 1GCAA 3AHJA 4MKGA 2O0LA 4J43A 3CVOA 1C80A 1ZM7A 4A1FA 2YHIA 2ZIUB 2I87A 1C7QA 1E2PA 1KY5A 2HSZA 4YRLA 1DPGA 3O9ZA 5D3MA 3CZPA 1CVIA 3A27A 1KZ4A 1H66A 1GQRA 1K27A 3IBFA 3IDFA 2DFDA 3EGWA 2VDUE 4NAVA 4MV3A 4YI3A 3NBQA 5KNCA 1N2EA 3MPUA 2UXCB 3GT0A 3P0HA 3UPTA 1RW4A 2BMVA 3T3HA 3NUZA 3MERA 5HX7A 1E2UA 1V1MB 2NO4A 3KKKA 2F1JA 2VQ6A 1R6TA 2PRSA 1XK7A 1W88A 2XUHA 2L18A 5C1IA 3W8RA 3M7IA 1JXMA 4GXTA 2GERA 4IIBA 1P39A 2WD9A 1YOBA 3DB1A 2QAIA 1JEDA 2Y1EA 1EGHA 3OQIA 3PGMA 1V1JA 2EBFX 1EGAA 1SD5A 2VC2B 5EMLA 4WZAE 5CGQB 3PGXA 1Z6YA 4TTQA 5C3UA 5DM1A 5KYYA 2X2PA 2G08A 2AZDA 1OWMA 1D0SA 2YWHA 1CEXA 3G2KA 3MTDA 4G5XA 1L5HB 1NF3A 4HQFA 4JLMA 3T15A 5MGBA 4E0BA 3KUCA 4LF7B 5H3CA 3B2QA 1ZR2A 1WXXA 4XYBA 4C88A 2J3LA 1Q91A 2PQ0A 3NXKA 2IKQA 5FOQA 1P6UA 1NVWQ 2QTVA 2AVNA 4BOYA 4GVLA 1GFIA 4HDCA 2FQYA 1A3CA 1JJVA 3DLCA 3E5RA 1L6IA 3G02A 4YV0A 2XIQA 4GQIA 1P33A 1L0BA 4HPWA 3SJAA 2I2FA 3X1DA 2HIAA 1XE3A 4UNSA 4WT7A 1ZCFA 4MDYA 3S0JA 1JBEA 3V7NA 4YDHB 4G1UC 5AVOA 3ET4A 3SC6A 4EW1A 3NHMA 4QARA 4G67A 3UMRA 5E2BA 4UCXA 1RBYA 2CXXA 2I2AA 2IP1A 3F98A 4UFPA 1SURA 3ZWBA 3GFPA 4KN8A 1RR6A 4WJZA 1UDWA 1A4XA 2AG0A 2W2PA 3X0DA 1GV0A 3RVQA 2X0KA 1YOVB 2QE7D 1REQA 4TS1A 3U4AA 4BVLA 4C4SA 3PX7A 4AMUA 1FXSA 5AVQA 1EM8A 4UEQA 5LR6A 3B20A 3EEQA 4GLLA 2OV3A 2PFKA 3HVUA 4O02B 4XM2A 2NUAB 1J24A 1GNQA 4FMCF 3HY6A 3CBQA 4PR0A 4ACBA 4YT2A 5KMGA 5T7BA 4N3AA 2QMUA 1ZMTA 1M1ZA 1KAEA 2BFCA 3WHPA 4GMDA 1FNDA 2Y1CA 1B16A 4WKCA 4AKEA 1GO2A 3D3KA 4O2AB 1KH2A 4RPLA 1DEOA 1XCLA 3IUMA 2PGNA 5LZ5A 5EIOA 3RJMA 1QGOA 1CUBA 2FPGB 1KPHA 2J3HA 2C0QA 1X74A 2XQKA 4WDQA 3DONA 2VZ8A 1Y33E 3PFNA 2RAPA 4LYEA 3K2QA 5LDDC 4V1CA 1QMGA 1GCGA 4LCJA 1DJQA 5FULA 1VXOA 4FEYA 1J0EA 4RIHA 2R8EA 3GFRA 4IO1A 5L4NA 3AOGA 1L4MA 3H8JA 2C42A 2QP4A 4KSYA 3K05A 3QVWA 2BFBB 2ZS9A 1XCJA 3GXOA 4O8ZA 5FXMA 1BMFA 1LWOA 3E9YA 3NHKA 5C5EA 2PX4A 2X4LA 3ZS9A 2I7TA 3L1IA 3DDHA 3EG9A 3O21A 4ND5A 3ZIDA 2O06A 3FZGA 2VWGA 1RM4A 2YXPX 1E63A 1NOJA 2P11A 1G6OA 2ZKLA 3A1UA 3BXOA 3D3QA 3GRKA 4G25A 3URMA 4A10A 2F3QA 1TMKA 3O90A 1I9CA 1J56A 1YJAA 2P79A 4WDRA 4KVFA 3TB4A 3TOZA 1YR9A 5J58A 3FX2A 4RWEA 5DCWA 5CURA 1VHQA 2V65A 1P1KA 2PQ2A 1YRHA 2XDAA 4J8PA 5JAHA 2IPXA 2ZRQA 3H9QA 4ZVQA 5JNUA 2C0PA 2PZGA 2QI9C 3ETDA 2HK8A 2GBFA 2OHGA 4K88A 1H69A 3UMGA 5B7QA 4B0PA 1JKIA 3ED1A 4CQMD 2EW8A 4YASA 1QANA 3JS5A 3R3VA 4RK7A 2WJ6A 3H2GA 4K0KB 3LBHA 4AVYA 2GCOB 1G55A 2AMFA 1HEIA 1OXSC 2BFPA 2GETA 2GZSA 5FBZA 1WQ4A 4HQRA 5FBHA 3AM4A 1PJZA 4G5RA 1AVTA 1QRDA 1ZNWA 5EP4A 3OQOA 5BR7A 1NU8A 3GHYA 4CKYA 4CGZA 2QV7A 2HWKA 2WE8A 4HX2A 4RXTA 1LQ2A 4ON9A 4YUAA 5CHYA 5JARA 2Y2UA 3THWA 2JEZA 2DQYA 2H9YA 5CH8A 3HRIA 5M04A 1C8KA 3PJGA 5CAEB 5B7PA 4D3DA 2J4CA 2JIPA 1D2RA 2OFPA 2JIRA 3EEBA 1HO3A 4PNPA 4EP1A 3K9GA 2C3OA 1VC2A 2X0RA 4J0KA 5TVGA 5IJWA 3P0JA 2QWXA 4BS9A 2QR2A 3HXLA 3ULKA 1EWRA 2A84A 3SZLA 2XLCA 3DNPA 4BZQA 2X1VA 1V11B 4LHYA 5IBQA 3RANA 2WHPB 4M1KA 2MYPA 4YGXB 1CEQA 1UMCB 3QIAA 2WICA 3SC4A 3F3MA 2P62A 4D0RA 4OXRA 2ZI5A 4ZVTA 4JVNA 3FOEC 2Q5LA 1UAGA 3DFKA 1ZY2A 2DXIA 1L4GA 3DOEA 2LW7A 3Q0TA 4MQBA 4PYKA 5LDHA 2HLNA 4QBGB 2GOYA 4UOZA 3HVRA 3NP9A 2QR3A 4RD4A 1H85A 5LC1A 3C5VA 2UUPA 2VCYA 1VKOA 3FTCA 1PQYA 1X2BA 1OC2A 2ZSFA 4JR0A 3SX0A 2HGSA 2CJPA 1VE7A 2QN9A 1B41A 1A69A 1HT2E 4CG1A 2BMWA 4P38A 3V4SA 3LXMA 4MPDA 5L4SA 2K7FA 3IKMB 5TQ2A 1DKPA 2BONA 1N5JA 1SVNA 2BGUA 1CCWA 3AV3A 1NUAA 3NM5A 2DF8A 3B9QA 1FYWA 4KE6A 3SBOA 1L4BA 2ISCA 4DCPA 2B69A 5DF1A 1LX7A 1QHYA 1NJ5A 2H52A 2YVUA 3INTA 3WGKA 1Z16A 4GX0A 5IDQA 4RTJA 3JAWA 3MUEA 5UKDA 3WYCA 1NN1A 4OL0A 2C03A 3HKDA 4DE5A 5C35A 1U2EA 1U2GA 1T0JB 1HG1A 4X61A 5KJEA 1BYUA 1BDIA 3T9AA 1YAHA 3VDNB 4ALMA 4V0NA 4KE9A 1J5PA 1Z29A 3D0KA 4C05A 1GKKA 4PG6A 4KFSA 2ZWMA 2ZCUA 3GBVA 3ZWYA 4C0QC 1TQDA 1X7XA 1DELA 1V6AA 1ZI8A 2XGGA 3RYFB 3VOBA 3K31A 4FUTA 3RCBA 3IL2A 1GPMA 1NPYA 1P2GA 3EGIA 2KS6A 1N1MA 1OKKD 1GLVA 2W43A 3L77A 4LZAA 4TXNA 3RSQA 3ZOKA 3QEJA 1VB3A 3NDRA 4ITRC 4CKXA 1P0CA 2D1TA 4N54A 4MB0A 3CF6R 3KC2A 2HUNA 1HM5A 3LUBA 3SVZA 2WC1A 2XT9A 5JYEA 4XGKA 3B9PA 3D7SA 1TT5A 3NIGB 5BVHB 2FWRA 4CVNA 3FVQA 4C3VA 2PZKA 2YOHA 4NNJA 2FFAA 4MUBA 1MV8A 2B6HA 3OE5A 4E3ZA 5KYXA 3EE6A 1XPRA 3Q98A 4K6CA 5M5BA 2GJAA 1WCXA 3WGHA 2PNFA 2ZRBA 2O0JA 3VMMA 1DQPA 2Y0PA 2H7XA 1ICEA 4HAXA 2VG8A 1DAGA 4L08A 4Q39A 4PO9A 3OKAA 4UU1A 3DF9A 5GJWC 2IZZA 5JAZA 3COYA 3TFOA 4OYLA 2V5UA 2OCDA 1EDBA 3EARA 3IAFA 4C7MA 1T26A 4BN0A 5F9FA 1CR1A 4JGBA 4BX0A 1RLOA 1QO0A 4HN9A 1EWQA 2ADFA 5BNZA 1MX1A 1OLUA 3OESA 3ZIUA 4JQCA 2HO4A 3ESCA 3JQBA 4KTTE 1G21A 3ZDEA 1XU9A 3L9XA 3MYRA 1ZRSA 4LHZA 4A03A 4C4PA 3V4VB 4M4SA 1NF9A 1W8IA 4ZO9A 4WN3A 1U31A 1P19A 4EMBA 2ZRKA 4HVLA 1BRTA 2B0JA 4X41A 3L7JA 1DV2A 1GUBA 2HJSA 3ASUA 1TZJA 1MIOB 1Q95A 3K1ZA 1VLHA 3KZKA 4Q9JA 4F6LA 3VTKA 4RKYA 3WK9A 2XX3A 3KKPA 4TMXA 1UWKA 2YMQA 2NU9B