2GCOA

Crystal structure of the human rhoc-gppnhp complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
187
Chain Sequence
HHHSSGLVPAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rho-related GTP-binding protein RhoC
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 187
sequence length 193
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcoA01
1OYYA 2JGNA 3WMEA 4US2R 2LKCA 3P26A 4CDGA 1BMFD 1T8UA 1OYWA 2J87A 1Z0DA 2ZSBA 2PJZA 3HU1A 5EE9A 4B2PA 1PLLA 4B71A 2JLWA 1FL9A 3QKSB 3CIOA 3MMPA 1WQ1R 3PV0A 5A0FA 1E2DA 2CNWD 1W44A 5FUXA 4LGMA 4LUCA 1NNEA 1D2EA 2ZU6A 4MH0R 4CGZA 2G6BA 2QY9A 4DLYA 1TQ6A 3DM5A 3DOFA 2AFHE 2IW3A 3MGCA 3N70A 2GCOB 3GD7A 2GKSA 3GMTA 4TMKA 2AL7A 5DI3B 5LB2A 2XXAA 1TUIA 2QP3A 1AQUA 1C9KA 1E1RD 2BIFA 1X8JA 1XCGB 4LJ5A 4C4PA 2W58A 1N25A 4DT1B 4C0AC 5TDHA 3QNUA 2C99A 3EIEA 4CT4B 3NWJA 4RKFA 2IS4A 1T8TA 3CRVA 4BQSA 2RB4A 5JFGA 1GIAA 2CL7X 2RGNA 3ICEA 2BBTA 3R9WA 2HCJB 3IEVA 3LWNA 2ZSFA 3W5IA 2NOAA 3IO5A 1WXQA 4RFSA 2CK3D 4DSNA 5K8TA 3GLIA 1LVGA 4ZKEA 2ORIA 2DFLA 1RVDA 5BN4A 1ZW6A 3U3RA 3PUVA 1KMHB 5DLQC 5FTNA 4MYCA 1Z47A 4PHHA 1ESMA 3TNFA 3DEFA 1NJFA 3QKSA 2ZAOA 4HEJA 4Q47A 5AJWA 1T5IA 1OSNA 2A2ZA 2KJQA 4ITRC 1CJVC 4DCNA 3FPAA 1Z07A 2YWHA 3LV8A 2VHTA 1Q1BA 4QXAA 4ZCLA 2BVNA 5JSZB 1RPZA 3L0PA 1TTTA 3ADDA 3LLUA 3KDSE 3EARA 4OQXA 2OEPA 1I4TD 1TADA 1HQCA 5FR2A 3VR4A 2BKUA 2PEYA 3H84A 4MRRA 4ZO4A 4IDOA 4BGDA 3U3KA 4XVQA 3MD0A 3IPYA 2G9NA 1KAOA 4DT1A 1XB2A 1ZNXA 1E2LA 521PA 5FPKA 3WHLA 3WNBA 2QGNA 3FKSA 1MRNA 3CZQA 2R8RA 4JVSB 4Q01A 2HXSA 3WMFA 3PUYA 1G4AE 3G5UA 4A0FA 2B21A 4HB2A 1FFHA 1RRCA 4QNRA 3GLHB 2HYIC 4NCIA 4PAMA 3UWKA 3AP3A 5TB5A 4L9SA 3EAQA 2BJVA 4PO8A 2AXNA 1D8TA 5AJVB 2X2EA 1SKQA 2I4IA 1U0HC 2QSZA 1IBRA 5DYIA 2A5YB 5G3YA 3X1ZA 4B74A 2RGAA 2ZJ8A 3OEED 2KWIA 4HUTA 2GAAA 4DLTA 3JZMA 4BASA 1P60A 1AS2A 4DB2A 1NMZA 3KB1A 1GUAA 5FPYA 4B75A 1RRGA 3THXB 2FSIA 1A2BA 4WIAA 1G6HA 2ZU0C 3RDPA 5BW8A 1ZU4A 2ZUCA 4PQFA 2AFIE 4W5WA 3EZ6A 1OW3B 4TLBA 1ELOA 1Z6GA 2OT3B 4C3ZA 3LDAA 3OFNA 5FR1A 1ZJ6A 2RGGA 1TF5A 2YINC 3PEUA 4GP7A 3GJ6A 1F2UB 2NQ2C 3P32A 1EFRA 1MV5A 1VYTA 4MA4A 1QBKC 1GAJA 1K5GA 1IN6A 4B32A 4Z54A 6Q21A 1W7AA 3TSWA 3AP2A 1VIAA 3AVXA 1L2TA 1OIWA 5DO9A 1LV7A 4DDVA 4U00A 4A2PA 2ZR0A 4XVUA 2JJ2A 4HAZA 2WMNB 1X8LA 2W6IA 4HLUA 3CRW1 3KXKA 4I1UA 5FI0B 1CBUA 4ZDJA 2GK6A 2WMOB 3MG9A 3BC1A 4PHGA 1A5TA 5UKDA 3GLFA 1XD9A 3I5YA 2H16A 5EE1A 1U0LA 4DSOA 1KY2A 4D2IA 1H8HD 1DAIA 2A5GA 5HZKA 3PQCA 3I32A 1E79A 2GEVA 2Q3HA 3P4XA 2FPLA 1VCOA 1XTSA 1E4VA 3SQWA 1IHUA 1UADA 3AGPA 3SYLA 4XTCS 2KB0A 1CRQA 1DPFA 4JJKA 4TTQA 4K81B 4JLDA 1KO4A 4NTZA 4QRHA 4YC7A 1OJLA 4LPSA 1ZCAA 3QXHA 5C1BA 1NBMA 5DIFA 1GZSA 3E2IA 5BYJA 4TN1A 3CNLA 1E2FA 3A1VA 4TL6A 3NC1C 1SHKA 3ND8A 2PL3A 1T3HA 4GNKA 2HF8A 1QHHB 2QI9C 1SVIA 1U0JA 1DAMA 2NZJA 2CLSA 1QHGA 3SE0A 2QT1A 3F8TA 4FINA 3B1WA 3U60B 1CU1A 1WBDA 4DJTA 3U44A 1S1CA 4CVNA 2XZOA 2O8CA 3KXIA 4OK6A 1CTQA 4D0LB 3RHFA 4Q1CA 5JEDA 2J9RA 3TVDA 2QMHA 3HYTA 4KHZA 1F2TA 2ANBA 2CEAA 2JJ1A 2QMEA 4LYHA 2C2HA 1B0UA 2WPDA 1KI4A 1R0YA 2QAGC 4QHTA 1ZC3A 3AV0B 3N2EA 4II7A 3ICQB 1ZRHA 4Q48A 4BWYA 4Z8XA 3TQFA 2GRJA 3KKPA 5J4YA 4TMVA 3QY0A 1J8YF 2WSSD 2F6RA 1HA3A 1AKEA 1P2TA 2W0SA 4TWZA 1W36D 2ZRMA 1LNZA 1EG7A 1G9XA 3MWLA 1L8QA 4Q1BA 2W0MA 5JCPA 4X8LA 1GRQA 2EFCB 3VNUA 5CB6A 1GL7A 1ZMXA 2P6NA 4CEHA 3RRYA 2C04A 4QJ3A 3OEHA 2YWFA 1G8GA 3KUCA 2OG2A 3K9NA 5TARA 3WY9A 1ZIOA 5C2JB 2VSXA 3NH9A 5E7MA 5H68A 2EYQA 4O2RA 1G18A 1N6KA 1AZTA 5KU1A 4XWOA 2E1RA 3T12A 4EJSA 2VP5A 4BPBA 1PUJA 3L0SA 5DN6A 4DKXA 1E1QA 4KITB 2GDJA 3Q9LA 2N42A 4HAYA 2O8FA 4G5SA 1KY3A 2ZRGA 2BM1A 2W6JD 4QFMA 4GMXA 2AX4A 2HV8A 2BJWA 2P0EA 2W6ID 4W7SA 5EE0A 4F38A 1IJEA 4D26A 4HDOB 1Z0JA 4KCGA 2RGDA 1OH7A 2H5EA 3NHAA 4HAUA 1GNQA 2XX3A 3E70C 1NRJB 4EPYA 1AM4D 1LS1A 3QPVA 2B7BA 3DOEA 4LHVA 4C9BA 3WBKA 2PT7A 2WAXA 4EFNA 2FU5C 3LBIA 5E4FA 5EZ5A 3R8CA 2FWRA 1FQJA 4JLJA 4JT4A 4Q4AB 1KJWA 3ZIAA 3EW9A 4B6EA 2OBNA 4BZXA 5HZHA 2ZEJA 421PA 1SXJC 1D5CA 3DKVA 1ZYUA 1A2KC 3LFUA 5KNCA 4D25A 1DAEA 1G3IA 1VCNA 2Z4RA 4U7DA 1CR4A 3U7GA 2N1BA 4Q66C 4BRUA 2QMOA 3EXAA 1GNRA 5BWMA 4GOXA 4A4DA 1X8KA 2EQBA 4F93B 1LW7A 5EE3A 3NDPA 3WRYC 3BXZA 2VHQA 2D2FA 5EXSA 2F3TA 1O3YA 2IYTA 3KKOA 3D6TB 4J0QA 1P4SA 3MFYA 1FNMA 4MKIA 4PSKA 4BLOA 2PZGA 4M9ZA 3K0CA 4D0NA 3QF4B 3NBFA 1ZD9A 3QXCA 3BRWD 4HDQB 4JYBA 1RRFA 4OBEA 3GJ7A 3BD9A 4GL2A 3U3OA 4LK2A 1FX0B 2ZRKA 2ZIAA 3A8TA 3FYHA 4CT5A 1E4YA 2CCGA 4B76A 4QHYA 2C03A 4PSAA 2B6HA 2WKPA 4ZKDA 2N46A 5TY0A 1JR6A 2GXSA 2ZI3A 4B43A 2PEZA 2ZRDA 5J4VA 3SZRA 3GEIA 1VG9B 2P5TB 3T1QA 5IHPA 4C7OB 2Q9CA 2VP2A 1GSIA 3GFPA 1RYHA 1RYFA 4AKEA 2JEOA 4EFMA 2LKDA 3PITA 4FD2A 2QMUA 1M6NA 3IIKA 4PZYA 1II9A 1VG8A 4C0HA 2F3RA 3B1XA 3OEHD 3W9YA 4XVRA 3MWKA 4QM7A 3LW7A 1Z0KA 4HLQB 5FI1B 2ZRFA 5CM9C 5FTJA 2ZI7A 3EX7C 2OXCA 1JB1A 4QJ5A 1SVSA 1ZC4A 4EPRA 4B48A 1EESA 3UPUA 1IOZA 1HTWA 1DE0A 3GQBA 3HR7A 5FFMA 3UG6A 3U3JA 1OFIA 1ZM9A 5JBQA 3H0KA 3BH0A 3LY5A 4RVCA 5J4KA 3U5ZB 3K0AA 1ZD1A 2ZE7A 5CB8A 1G7RA 3TH5A 2J1LA 2ZI9A 4GT1A 1G17A 2ZRIA 4PHTA 4KI0A 4RZXA 3QIAA 3B9QA 4IVPA 4NYIR 4OHXA 2BBOA 3REGA 1NSFA 2VEDA 4US0R 2O8BA 1CULC 4YONB 4RKEA 4B2IA 4UXJA 2WKQA 2AKAB 3I92A 2WJIA 4OYHA 4WXRA 2CHGA 4C0BA 1B23P 4DBLC 2IT1A 4LBWA 1ZUNB 1W5TA 2I3BA 4G5OA 4GRAA 4LYAA 3PUZA 4D6PA 2ZITA 3G82C 1RKBA 2IEZA 4A8JC 1R5BA 4CYMA 1KK2A 2EYUA 2O0HA 3CX7A 4Q4HB 3PCRB 4ERNA 1ZU5A 5BQ5A 3B78A 3KJEA 4FXPA 4HSEA 3C15C 1A7JA 3VAAA 3WNDA 1Q3TA 5JZVA 1WDTA 1M7BA 3I73A 5F9FA 1ODFA 1GTVA 2V55B 1PV4A 5JHHB 3H4MA 1NN0A 2CJWB 2EFDB 1NF3A 5K8IA 3AVWA 4DXAA 5TMPA 2GA8A 2OO7A 4TL9A 3K09C 3VQTA 1Z5ZA 3TIFA 5DE3A 2QSYA 2O5VA 1FUUA 4WZ6A 4M1KA 1E9BA 4TTRA 4CW7A 2WIAA 3U7FB 3GJ5A 1OXSC 5CITA 3BWDD 1AK2A 5HPYB 3KKQA 1G8YA 1CR0A 1OH6A 2J0UB 4I1VA 4LBVA 2GEDA 4MITA 5IK2A 5SZKB 1Z83A 2F43B 2IUSA 3BGWA 3IQWA 3M1IA 1HH4A 3IHLA 2AK3A 2Z83A 3DMNA 5KNDA 1XF9A 4P4SA 5BXQC 1QG4A 2YOFA 2ONKA 4TTPA 4DIDA 3BFKA 4GP6A 4QJ4A 4WAUA 4WOPA 1AA9A 2QPOA 3FGNA 4LHZA 1VIYA 2GJ8A 4MGKR 3C14C 2ZJ2A 2EWVA 1CJTC 4AI6A 2JDIA 1R7RA 3M4YA 2A5JA 4L8GA 5FBLB 4HZIA 2BBWA 4TYQA 2GJKA 1MO4A 4BLRA 3S1AA 2CJWA 1AGPA 1M34E 3LH5A 2MMGA 3LNCA 3MWJA 3NKVA 1FNNA 1UDXA 1TEXA 1KSGA 1IJFA 2QM8A 3BAFA 2JLRA 4N1AA 4TLCA 2QP9X 1PLJA 2XB2A 4LCBA 4BRWA 2FF7A 4M1OA 2O8DB 4B73A 5J5CA 1E6CA 4TLAA 4Z51A 4KVAA 1GKYA 1S3SA 1OH8A 1IXSB 4IKEA 4TT3A 1ZD8A 3QQ5A 1KDPA 2F43A 1N5JA 3FFBA 2PCLA 1IN7A 1YZUA 3FHOA 2FMXA 3K9HA 2ZRJA 1EWQA 1BMFA 3K0SA 3OZXA 1MH1A 3QXJA 2CHQA 4OHWA 1RJ9B 4M22A 1W0JD 1US8B 1YR6A 4FCVA 3SJBA 1KDRA 2CNWA 1GL6A 2HJGA 5AUPB 5JS8A 2Q21A 4GPTA 1P9NA 4ON9A 2WKRA 4KU4A 4FMBB 1E2EA 5FL3A 3WMGA 4EPTA 3PUXA 4UNNA 3VX3A 1CR1A 4NCKA 4RJLA 1XTIA 2C95A 3EZ2A 2PX0A 2YOGA 4AG6A 1E1RA 3RS2A 1DO0A 1TPZA 1WBBA 1JR3E 3QF7A 2GF0A 1HT1E 2AWOA 2H1LA 3C5HA 1GKIA 4BFSA 2ZETA 5KTYA 3WBJA 2UZ3A 1EFTA 2VA8A 4Q21A 2C8VA 1W4BA 1XXHA 2UVQA 4EUNA 1G7SA 1EFHA 4IOKA 4JVNA 1OXXK 3JZAA 1T6NA 4DLXA 3KL4A 4PANA 1U8YA 3BB4A 4TZ6A 2EVWX 1FP7A 1CJUC 4M1TA 5B58C 3V4RA 1WA5A 1PVOA 1U90A 1RJ9A 4ZPXA 1O87A 2ZRPA 2FDCA 5HKKD 3M0EA 5CDFE 5JECA 2FPKA 1XMSA 4FMDB 5JWOA 3ND9A 2V1UA 2X1VA 3EC1A 3I3SR 4ZV4A 1E2KA 4XTRA 3WRXC 5AUOB 1YRBA 2AWNA 2NGRA 5H1YA 3ADCA 5GJCA 2WWHA 4R9UC 3SU8A 3T5GA 2F55A 1SVLA 1SVMA 1XCMA 1CJKC 1FTSA 1Z29A 4FMCB 4Z8YA 4PXAA 4MGYR 5HCNA 3W90A 4BFTA 2C9CA 2WM9B 5LBIA 3AVYA 5H8WA 4PZLA 1II8A 5L3SA 1UFQA 4G5QA 5E7JA 2D74A 2WIBA 3LO5A 4JL8A 5FOTA 3ZVRA 2XXAB 4A1FA 1ZP6A 2OAQ1 3HP1A 4KVGA 5AWFC 1E3MA 4D4MA 1I4LD 1NG9A 2R65A 1D2NA 4HYYA 3TBKA 4UNRA 3OIVA 1ZVQA 3QE0A 1P7CA 3PXGA 2RGEA 4MDFA 2R44A 1VYUA 2V9PA 4X8OA 5BN5A 721PA 1GVNB 1KDTA 1WE2A 2GJSA 4EPWA 1N6LA 3REFA 3TMKA 4A2WA 1KO1A 4RFSB 4ZDWA 3OEEA 3GLIB 5EXPA 3IIMA 4RSGA 1VPLA 4LRWA 3VR6A 2ANCA 4DCVA 1HV8A 2DWQA 4N3NA 1M74A 1XP8A 3MRSA 5IDVA 5CIWA 1M7GA 3U7EB 2OUKA 4B33A 1U8ZA 5FBRB 4M2LA 2VBCA 1WMSA 4BLTA 3BB1A 3AKCA 3TK1A 3AVVA 1E0SA 4M1MA 2BMFA 2JJ8A 4AKHA 2HLDD 1YRAA 1Z0IA 2R6AA 1Q1ZA 4Q9LA 3RRNA 2XTNA 4PC1A 1U81A 3VU9A 2FFQA 2Z0MA 2JLQA 3GLIE 5K8LA 2W2XA 4IOMA 3FMOB 5SZIA 4P33A 3QXSA 4DWJA 2BCJQ 1QF9A 4MYHA 1ETUA 3QEJA 3IPXA 2NO1A 3LW8A 3RS7A 1IN4A 1KZ7B 1JXMA 1XEWX 3GFTA 4JBYA 4DSUA 4A2QA 4B47A 3THWB 3EPKA 3O8RA 4PPFA 2IYQA 4LYFA 3SQXA 5EXTA 4JLVA 1G4UR 1VKJA 3TUJC 5K8UA 4TL8A 1PUIA 1E32A 1EK0A 4JLMA 1VTKA 5JWHA 4NCHA 1SXJD 1H8HA 4V02A 1JEEA 1JJVA 2XNDA 4M1YA 4NH0A 3GJ8A 4PPGA 3TQCA 3B6EA 1L4UA 4AWXA 1KK3A 3GPLA 3B85A 1W48A 4DCUA 2NMVA 5DGXA 3LRPA 5JJLA 2OFWA 2D4HA 1NVWQ 3EA5A 4BUJA 4QM6A 4FCTA 2ORVA 2A78A 4F91B 3AVQA 2QQ0A 1G3UA 5E3HA 1UAAA 1J2JA 2GEUA 3PIRA 1E2IA 5GVSA 1IN5A 5TVKA 4DLSA 5AK0A 3CONA 3AQ4A 3ADBA 3NXSA 4PC7A 5EP4A 5JJIA 1Z28A 1IAQA 1WB9A 3SYNA 2CBZA 2XJ9A 4TMZA 4HAWA 2B8TA 3EPHA 4AY2A 3N2IA 4LJ8A 3THWA 1G3QA 1TU3A 1SZPA 5H70A 3U4QA 5FTLA 1XWIA 2D7DA 3RC3A 3M6AA 1IQPA 1QHYA 4JMPA 4M1SA 4DCSA 2ERXA 3D7MA 4QKQA 2ZRAA 3QENA 3LD9A 4KYUA 5EP3A 2BMDA 3VR2A 4EAQA 2Q6TA 3QSYA 2JASA 2WSSA 3IBGA 4OI2A 1QDEA 1D9ZA 1W49A 4RD1A 5CJ2A 2V4ZA 4IDPA 5EP2A 1XEXA 2PJRA 3ZD6A 1CJMA 2R9VA 3GLFB 3DVLA 2C96A 5KDLA 4EKDA 1P62B 5FOWA 4YMVA 3HWSA 3B1VA 2ZYWX 1RZ3A 3PVSA 5JMTA 2P3SA 4IOLA 4C2UA 3GLHE 2WBLC 5ANRB 3W8RA 1AS0A 3VKGA 4F4CA 4I81A 2FJUA 3ADKA 1KNXA 4M4SA 1OHHD 2F1JA 4MQBA 1OXUA 4QHSA 1UBCA 5CLQA 1NN3A 5LPNA 1Q57A 2PMDA 3TVTA 1Z6AA 2G1JA 3OIYA 3LLMA 2HEIA 1COWD 4RZ2A 3A1WA 4RD2A 3WYGA 3B13B 1N5KA 3N5CA 3Q7QA 4LV5B 5DNYB 1GWNA 1N0VC 1Z3IX 4DRZA 5D3MB 2V6IA 3VMFA 4F7WA 1I4DD 1CEEA 2J0VA 4ZIRA 4OI4A 5JI3E 1YQTA 2VHCA 2W6JA 2WZQA 3U44B 1N0WA 2O8CB 1SKYB 2QTVB 4C0JA 4LV8B 4DDTA 2VSOA 3PEWA 5KSYA 1F2TB 3GP8A 1RFLA 2Q9BA 4KLZA 2DWOA 3QBTA 5G3ZA 3ZDQA 3DM9B 4C0SA 2IYYA 1GRNA 1P3JA 1VHLA 2ZSEA 3RYTC 5L3QA 2QROA 3RC8A 1Q3HA 2XNDD 3QVVA 3FMIA 1S9DA 1KGDA 1UBGA 1U9IA 4RD3A 2OCPA 2WWYA 3CPHA 4PC3A 3EPLA 1G3MA 1UKYA 4QBHA 4DLVA 2NZ8A 2PMKA 4RCYA 1L4YA 1T9HA 1MO3A 1R6BX 2A9KA 2VO1A 4HUQA 4C30A 4R71A 1T5LA 1TX4B 2DPXA 2X8AA 1G19A 4CEHB 3VHLB 2QTFA 1N5LA 3GLGB 4AYWA 3DO6A 4Q4JB 1WP9A 3KFXA 4ACAA 3IUYA 2RHMA 4UNQA 5D3MA 2ZS7A 1R8QA 4ACBA 2OLJA 5EQTA 5DHFA 4V0NA 3D8BA 2FN4A 4JZKA 1XMVA 3MCAA 4OJQA 5CLLA 4URYR 4EJSB 5L3RA 2G83A 3DPUA 5KO2A 3EC2A 4O2LA 3R20A 2HYDA 3B5JA 3UMFA 2O8FB 1X3SA 2ZQ5A 1U94A 3K8YA 1HY3A 3TJZA 4MDEA 4LHWA 2JIZA 4D80A 1P9WA 3QKRA 3VNVA 4D82A 3ZVLA 1AQYA 1X1SA 1EFUA 1CP2A 2VHUA 2VRWA 3FMFA 5FTKA 4BEJA 3K53A 4ZI3A 3QKUA 4BECA 2C9OA 3TR5A 1OB5A 4MGZR 1OE0A 4DLWA 4NCNA 4RD6A 3SJAA 1U99A 1DG3A 1MO5A 1R5OA 2A7QA 5FL7D 3HU3A 3K9GA 1TQDA 4AKGA 1KI6B 2PLRA 2QUZA 3C16C 2DR3A 3MLEA 2FH5B 4M21A 4Q4JA 2FEMA 4XWAA 3W6PA 4AIIA 2LWIA 1E98A 5KOYA 2G77B 3HU2A 4OKSA 5E7IA 2UZIR 2GZHA 3ZJYA 2QNRA 1IY0A 1R4AA 4AC9A 1HYQA 4Q9JA 3L43A 3T34A 2IA5A 2QP4A 3NH6A 4FWTA 4XD7D 1JI0A 1N6IA 4ESHA 4W9MC 3O8DA 1KO7A 2REXB 2F1HA 4GSYA 4EFLA 3R7WA 5IF9A 3SEAA 3J81k 5GADl 1F5NA 8OHMA 1QVAA 3P1JA 1ONBA 4I1SA 2FX3A 2IBMA 4IJMA 3NIBA 2ZPTX 4NYIQ 4YMUA 3RS4A 4D81A 1R8SA 2IWHA 3A37A 2CMKA 1KNQA 4L16A 4HAXA 2SHKA 2D62A 2ZR9A 4H1VA 1N6PA 1TF2A 4LBZA 4B3BA 1AZSC 4Q00A 4B6FA 3IQXA 1PZNA 4LJ7A 4A82A 2P67A 1E9AA 1DOAA 3C4JA 1C4OA 3K1JA 4H9GA 5KSZA 4BFZA 2JLVA 4IXMA 4PAQA 5P21A 2QORA 1HQYE 5B30A 4Q19A 1TQ2A 5DHAA 3P20A 1XBTA 4OQLA 1KI6A 3MJHA 2ZRBA 2FZLA 1NIJA 4QGFA 1EX7A 1RIFA 4PX9A 1T91A 3BOSA 2IS6A 2ONJA 5GJWC 3EPJA 1UJ2A 3U6BA 1VCIA 3HPRA 3NBXX 2QPTA 4HB0A 1TEVA 1F48A 4BLSA 4P4TA 2FFAA 1VDZA 1S1MA 3ZVNA 1KYIA 4B2LA 2GBLC 4OI1A 4G3XA 3AM1A 2OCAA 4V0MA 4TLEA 4A36A 3ASZA 1Q20A 3T5DA 4RD4A 2XZPA 3OIUA 4QBGB 1W0KD 3W8NA 2FG5A 1OF1A 4NONA 3KB2A 1T0HB 2R6GA 2OESA 3GCGA 3PG5A 1HE8B 1NIPA 2Z4SA 3Q3JB 4TYPA 3K70B 1OLOA 3DZ8A 3K0AB 4URUR 2IYWA 2ZS8A 1UDWA 2FOLA 1IXRC 2C77A 2DY1A 3CNOA 5DISB 2IWRA 3HYRA 1A1VA 3CH5A 1GP2A 2EW1A 1S3GA 5EUQB 1IN8A 1E0KA 2JIZD 4B3CA 2QZ4A 5KDOA 4DLUA 3B9PA 2O8BB 4TYYA 3TE6A 4ASUD 4PPNA 4TQUS 4UXIA 3UMRA 2X77A 4Q7JB 1Z2CA 3ZVMA 1CXZA 2WWWA 4HZUA 1G21E 3EG5A 1P61B 2ZREA 3HR8A 1XNJA 3RRZA 5CM8B 3QUSA 3EWSA 4MRVA 3A58B 3T06B 3BFXA 3CX8A 2VP4A 3FHTA 2J5XA 4D0GA 4P3YA 4MKHA 4URXR 4Q1FA 2V3CC 2NTYC 2IL1A 4MGIR 2IC5A 2VP9A 2ZR7A 3KQKA 3LXRA 4FIDA 1AJEA 2DB3A 4PAOA 4BFXA 3GEEA 2JATA 1OFTA 1Z6YA 4G5RA 4S2EA 4URZR 5KDDA 3U2QA 3ZGXA 2YHSA 2MMCA 1OFUX 2KBFA 4GBMA 4OHYA 1XPUA 1CKEA 3NG1A 1KSHA 2H57A 4KV9A 2BC9A 4OK3A 4BFYA 4JBWA 3U7HB 1KI1A 2YOHA 1RW4A 2IYSA 4JT2A 1A82A 3QVUA 4V03A 4DHEA 4NP6A 2JCSA 5FOSA 1F3OA 1P72A 1P9RA 1R0WA 2FSHA 1QHXA 3HPQA 1NY6A 3NEYA 1JPJA 5LD2C 4NZYA 1MOZA 4U5XA 2PH1A 4I4LA 1W0JA 2G0NA 3KXLA 5DSZA 3KTAA 5IT5A 1JEDA 1DTSA 2DWPA 2P6RA 2GAOA 2EU8A 4ZCMA 5AUNB 2OBLA 3Q5DA 5B57C 2RMKA 1DAGA 1S9HA 4JLBA 4KODA 4EQ6B 4P4SB 2WV9A 3H86A 3W34A 3QG5A 1ZINA 3SC3A 2ZANA 2OHFA 4MRSA 2J46A 3SHWA 4M9XA 1E2NA 1FZQA 3PR1A 4UXHA 1P6XA 4OJKA 2QL6A 2EFEB 4CRWB 2YJTD 1W4AA 5F3WB 1R0XA 3OE7A 4TQ9A 5JI2E 3Q72A 1Q12A 3A1TA 3S1AB 2WSMA 3GJ0A 4YQFA 5JRJA 3IKJA 2IF0A 4KFSA 4PZZA 5KSPA 2RGNC 4L15A 1G7CA 1XCPA 4ZDIA 1OKKD 3L0IB 1KJZA 3BE4A 621PA 2WOOA 1CIPA 4NYMQ 3AKEA 4JYCA 2BEKA 2IXFA 1Y3AA 2OM2A 2WJGA 3DDCA 2Q3MA 4FW9A 3DZDA 1FPMA 4DEYA 5HKKA 4OI0A 3H2YA 4EIWA 3L82B 4IOJA 3X2SA 4DLRA 4KJZA 1G6OA 1VG0B 4OQNA 2IX3A 3ZD7A 3F5FA 5E95A 4ARZA 3SFZA 4Q9IA 4EQ6A 1DAKA 1TMKA 3LXXA 1YR9A 3THYA 3X1DA 3RLFA 1NP6A 2XB4A 3ZS8A 1ZM2A 2BBSA 5D3QA 5BN3A 3O47A 1JJ7A 2Z6VA 4O25A 5KUTA 2GCNA 2IYXA 3NEJA 2ODNA 2G3YA 4TQAA 1XEWY 3FHCB 2W2VA 4YDHB 4KSCA 3DKPA 4LOAA 3TSOA 3KJIA 1MR3F 2QAGA 3QG1A 1QHSA 1K5DA 2ATXA 1TU4A 1XU4A 2Q9AA 4DDUA 1H65A 2ODWA 3R9IA 2P6UA 4M0LA 3IHWA 2FPMA 4PQYA 2FV8A 1XPRA 1MKYA 3OF5A 3TW4A 1YZGA 2PT5A 4B44A 1EFCA 4NYJQ 2IYVA 2HJVA 3RAPR 2CXXA 3L8YA 3MSXA 4UKDA 2KBEA 5J4LA 1BYUA 1XXHB 2KE5A 2PX3A 2ZJ5A 2VLIA 1MABA 2GF9A 4RY2A 1Q44A 5BYKA 1L7VC 4YMWA 3CR8A 4V0KA 3A1SA 3PJRA 4QL3A 5EE5B 4TMWA 4B3XA 4F4JA 4AKIA 1H8ED 2L0XA 5IRCD 3CO5A 3L2OB 5EZ6B 5HCIA 1DO2A 2KSQA 4LBYA 3PUWA 1EXMA 3RSOA 3IDQA 1ZM3A 4E07A 1DARA 3KQLA 2D3WA 1E0JA 3AF3A 4G1UC 2REOA 2IS2A 1OV4A 2HLDA 2BCGY 1XJ0A 2WVJA 3I62A 1V5WA 3ZS9A 1T4GA 3A36A 1KI3A 3TRFA 3I72A 2JA1A 1N6NA 3QI2A 4B3FX 4ABYA 1HUQA 4H1UA 4YXWD 4Q1DA 4BE7B 1F6BA 3TAUA 3D31A 4KFTA 4MKGA 2JLSA 1N6OA 1II8B 3IO3A 5L3SB 1YR8A 2CE2X 2R6DA 3OE7D 1Q1EA 3WP1B 2AD1A 1DS6A 2ZJAA 1WF3A 5FUWA 1E2GA 3TW8B 2A3RA 4IVQA 1NLZA 3GFOA 3Q7PA 4NL4H 4IDHA 4YMSA 1CS4C 1S2MA 4HLUC 1BO6A 5CYOA 4KLNA 4Q1EA 821PA 2FZ4A 2ZRLA 5JS7A 2W2TA 1SXJA 3T1TA 1FP6A 4NYMR 4FWIB 5FUYA 3I5XA 2GILA 2O8EA 3I8XA 2D06A 3RWOA 2QE7A 3AF0A 2HT6A 2AXPA 4FI3C 4JKYA 2GZDA 5LDDC 1SVKA 3D3QA 1KKMA 1XTKA 4QG7A 3E5HA 1D9XA 1PJRA 3I8SA 4Y0VA 5FTMA 4DVGA 1UM8A 2ZJZA 4Q7KA 2HF9A 2QGZA 4N0EA 1G5RA 1LS6A 1NKSA 4KSBA 3ZZTA 1E94E 2QU8A 2J59A 3FVQA 2RGCA 4TYNA 1OIXA 4KFUA 4JSYA 3OESA 1UF9A 3C5CA 4A6PA 4BZQA 2ZJOA 3BERA 5C4GB 2WAYA 1SHZA 3VU9B 1XTQA 2WJJA 2PCJA 4JLPA 3QBVA 4DEXA 4Q9HA 3F0TA 3KFVA 2QBYA 2H18A 3FE2A 4PO9A 2BKEA 4A0RA 3BH6A 4GZLA 3TSZA 1JECA 2TMKA 1E9DA 2WJHA 2ZRNA 2GJAA 3MUFA 4LJ6A 4NYJR 4HB4A 2H8KA 2VSFA 3MJRA 2YWEA 4G0NA 1X86B 4DSTA 4CEJA 2EWWA 1R10A 3A6PC 4K46A 3O8CA 3LBNA 5CDFA 3B1ZA 4ILEA 4A8JB 2YNMA 4IEEA 1GITA 1M8PA 4Q7LA 1OPXA 3G0HA 2V54A 3CWZA 2ORWA 1YE8A 2MSEB 4QBIA 5KYKA 1Z0FA 3V9PA 4JVLA 2GCPA 3R9XA 2ZUBA 1TUEA 4G5GA 4TSFD 1E9RA 1OFHA 1XZQA 1MRSA 1KAGA 1JXOA 4US1R 4HATA 3SJCA 4QNMA 2PZEA 3SDZA 2KI5A 1N0UA 3GJ4A 3VR5A 2WWGA 3TUIC 4E03A 5GJBA 3CBQA 1U2RA 1YR7A 2XAUA 5G53C 121PA 4AG5A 3AP1A 2FSFA 1G8HA 4XOIA 1OT3A 1F60A 1OHHA 1P2VA 1JQLB 5EXXA 5FUVA 2XSZD 1R0ZA 5TXGA 4TMTA 1XMIA 1BYIA 4XSHA 1COWA 1II0A 1IY1A 1Z22A 4FMCF 4A0GA 3HJNA 3EZ9A 3RS3A 4DLZA 2BV3A 4EJSC 2RHDA 4OK5A 2HUPA 3KJGA 4KBGA 1U8AA 2WJYA 3QPUA 1KK0A 1E9SA 4MYUA 4PO1A 5CJPA 2V8OA 2IUUA 4Q03A 5J4HA 1W4CA 4IFEA 1LB1B 1AKYA 3E1SA 3IEUA 2YC2C 4UJ3A 1UKZA 3OIWA 4NBSA 3WYFA 3U4QB 4A8JA 5DI9A 1FW6A 4OQFA 1KIMA 3NBZC 4A6XA 3K0EA 4Q18A 3CW2A 2J7PD 5FBVB 2ATVA 2ZS9A 4A9AA 1GKUB 3AH8A 1ESNA 5KSOA 1ZCBA 2IYUA 4AYTA 1YKSA 2QE7D 3BFVA 4YLGA 2QRNA 2I1QA 2IHYA 4KYIB 1X1RA 1ZUIA 2QAJA 1W36B 2CL0X 1QVRA 1E99A 1YZLA 1XEXB 4O0MA 5KHOC 5F2EA 3F3YA 3A4LA 1IY2A 5FOXA 1VCMA 3K09A 2GETA 5FBQB 1T0JB 1Z08A 2X2FA 4C0LA 4JLOA 1ZAKA 4LWZA 3ZZ0A 4LC1A 2FFBA 3AF2A 3GLGA 3B60A 1EWRA 2A5FA 1JR3D 4B3DA 3W5JA 4FCWA 1KSFX 2FGJA 2OFXA 4XSGA 1KKLA 2WWIA 3TR0A 1RE0A 2JLZA 1S96A 1ZM7A 2FE4A 4HLCA 3T1VA 4DUGD 2BM0A 4LHXA 4M9QA 1Q1QA 3K0CC 5HR5A 2GCOA 1W5SA 2EFHB 3GJ3A 4ZIRB 2BOVA 4LI0A 5HE9A 1AIPA 2OAP1 3LAWA 1TNDA 2ZVQX 5DI3A 2J0SA 1Q22A 3B8HA 1BIFA 4Z1MD 2OZEA 2R6CA 3SOPA 4RCZA 3U61B 1FTNA 2GXUA 3UK6A 3VFDA 1KHTA 2ZJYA 2NO7A 2ODBA 3CRQA 4MUAA 2B8WA 1GFIA 1GRRA 4LZZA 2ZVPX 2XZLA 2ZSDA 1N6HA 1NLYA 2NO0A 3OAAD 1NN1A 3ZQJA 5L3QB 2F1IA 2ODEA 4DC9A 4R2HA 4C2TA 2RGXA 4LPKA 4R2IA 5L3VA 3O8BA 5FL7A 3CR7A 4LJAA 4NU0A 1KMHA 4S35A 1S4QA 2HCBA 4E09A 1GILA 1LF5A 2ECKA 4HUQB 2XJ4A 2V1XA 1G7TA 1XTRA 1Y63A 2IXGA 4EDHA 2JAQA 3FTQA 2DHRA 2XNSA 5KPDA 4L9WA 3AVOA 4XD7A 2R62A 5JSZA 1KTVA 2NO9A 2BMJA 2OLKA 5CK5A 3GLFE 1P75A 3A1UA 3SJZA 1EGAA 1FMLA 2OCBA 3K70C 2YC4C 4KXFB 4Y0AA 5JRZA 1XPOA 2AD5A 2Z43A 2J3EA 4LC0A 3UATA 3CNNA 4TYWA 4P4UA 1G291 1XEFA 2XEXA 3CM0A 1E9FA 2IYRA 1JPNA 5DYGA 3AGQA 4PQRA 3Q8XB 4BZPA 1G64A 2OSBA 1IM2A 4UQOA 1NBME 5KPJA 2OFOA 2PZFA 2IYLD 1SVWA 3EASA 3GLHA 1DELA 2B92A 3QKRB 3BIFA 4PHFA 4OL0A 1OXVA 3UWOA 1GOTA 1BH2A 3ECCA 1R2QA 1KOFA 4GI7A 5SZHB 3NVAA 2CVFA 3SHFA 1RC8A 3W6NA 4M53A 1G5TA 1SKYE 3VHXA 2GJ9A 2J45A 2VP6A 4QC2A 2VL7A 3AVUA 3B82A 4GOKA 1U98A 4XH9B 1VMAA 4LHYA 4HLDA 5JCZA 4PFSA 1OB2A 5F98A 1Z63A 2OILA 1NJGA 2ZI4A 3SNHA 1UEIA 4BFUA 2ZYTX 3THXA 1KO8A 4XIGS 3CZPA 3AVTA 1AGRA 3LVRE 2FA9A 1W0KA 2O0KA 2XITA 4JL5A 3EZFA 1Z6TA 3EZ7A 1ANKA 4E22A 2ZI5A 3LQRA 4BLPA 1EX6A 2IS1A 3CWQA 3RS0A 1QHIA 2VHJA 4A92A 2F9MA 3R7WB 2RH5A 1T3SA 2K5UA 4X8HA 1G8PA 5JHGB 1F2UA 4IHQA 4NCJA 1YZKA 1NVUQ 2E9SA 5EJEA 1CF4A 4Q4LA 4M1WA 4KBFA 3GLGE 5AR1A 3RWMB 3UIEA 4X8MA 2MSCB 1XMJA 3FKSD 3NTUA 4AK9A 4OHVA 4ASUA 3I61A 1FMJA 3TGPA 2BHRA 2FFHA 3AKDA 4YDSA 5JWRA 1KO5A 2JLYA 4GOJA 3KQHA 3AUXA 3TLXA 4LJ9A 1Q0UA 2ZE6A 2VP0A 1NLFA 2J0QA 4P31A 3X1YA 4B3GA 5SZJA 3SBEA 1XFAA 5JJKA 3VR3A 3T35A 2ZYUX 3MAAC 4P0TA 2WJVA 3ZQ6A 3K9LA 4PR0A 2DBYA 1M7HA 1JNYA 2P65A 3KZ1E 2XOKA 4QGHA 5G40A 4AD8A 2DFTA 1YZQA 3WP0A 2GVZC 1Q21A 3FKQA 3T15A 3FB4A 4V0OA 4URVR 3UANA 1RRPA 2QPAA 3QJYA 3VR1A 4JL6A 1NY5A 2AR7A 1A4RA 2ZAMA 4JLKA 2EFGA 2CLCX 2ZE8A 3RABA 3FOZA 3LQQA 2B7CA 4GDFA 1W46A 2GESA 3KUDA 2FEOA 3FDIA 4B35A 1E2JA 2GVDC 2ZJBA 2LCFA 1XTJA 2GZAA 4R98A 1XDBA 1UPTA 2VTKA 4IRUB 4JKIA 3AUYA 1QHHA 4HB3A 3OFND 4I1OA 2VH5R 3QEOA 1W4RA 1Z06A 1KK1A 3VKHA 3BH7A 3SI7A 1DAFA 1I2DA 4PC6A 1J99A 1EFRD 1DG1G 1I2MA 5CYPA 3EWAA 2V7QA 3LBHA 4WBSA 2QM7A 3W6OA 1FQKA 2IF2A 1BKDR 2Q0HA 3PENA 4EPVA 5B64A 4V0ME 5FBWB 3CF6R 2XTZA 1FUKA 4HI0E 2FGKA 2IEYA 4UNSA 1E2HA 2RGBA 2JJ2D 4HZUB 4QGAA 1CRPA 4AYXA 1CR2A 5F9HA 4RZUA 1GL9B 2PLFA 1N2CE 4LY6A 1P2UA 4CIDA 4DIEA 1NMYA 2V6JA 1KDOA 2ZI6A 1G5PA 3GEHA 4M9SA 1QRAA 4Q7MB 3RRMA 2IHBA 4IXNA 1JALA 2VF8A 2QG6A 4RZ3A 1JBKA 2ZTSA 1K6MA 2GXAA 4K8OA 3NBYC 1G41A 3CB4A 2ZROA 1NVXQ 1OKKA 4DZZA 1OH5A 3SR0A 1SULA 1E79D 1UKVY 4OQMA 1E2PA 4NPHA 5M04A 1DVRA 2H17A 1G16A 3VTKA 3ASYA 4TLDA 4IFBA 1XJQA 3EIHA 4WA7A 3CF2A 1S8FA 1BS1A 1UBEA 5AJYA 3L0OA 4BEBA 3DMDA 2ASEA 5FPHA 4NHOA 4V0LA 4AURA 1NBMD 2WICA 3BJIC 3AEZA 4IDQA 3V00A 4D4JA 1G8FA 2W83A 1DADA 2ZRCA 3JVVA 4YMTA 2FNAA 3KTAB 4F4IA 1NKTA 1FOEB 2WWXA 2D2EA 1ZIPA 1D2MA 4ZI2A 2CE7A 4D4KA 4P32A 3W3AA 2QA5A 3LVQE 3W3ZB 2O52A 3CKLA 4LX0A 4LDJA 5FOUA 2X19A 5C46F 1VHTA 2YWGA 1JAIA 4R7ZA 2JJ1D 3BORA 1N5IA 1NVVQ 2WPDD 3PEVA 2J7KA 2DFNA 1VG1A 1E9CA 3QOFA 4MYTA 3CLVA 4PSVA 1ZNZA 3C7KA 3GJXC 4M8NE 3AKYA 3ETLA 2A5DA 2XOKD 2NO6A 4Q4AA 3P4YA 2F9LA 5FOVA 1R5NA 4O3MA 4ZCIA 1S0UA 2YVUA 1UEJA 1LTQA 2Q3FA 1T3LA 1G1MA 4CEIB 1YHNA 3Q85A 3SYKA 3K0FB 4D4LA 3KKMA 1H8EA 1TL7C 1YZNA 1QG2A 3B2EA 3NHBA 3LX5A 3B1YA 5FPSA 1QHNA 2XTMA 2Z5FA 4PC2A 1V43A 3FMPB 3PFIA 4IDNA 5FPTA 3CPEA 3SFVA 1KZGB 4ARZB 2WHXA 1KI2A 5DN6D 5L8VA 1XD8A 4NDZA 2OE2A 3THYB 1E1QD 3QF4A 2V7QD 3VX4A 2YYZA 1W2HA 4JBXA 1XX6A 4RD0A 1PLKA 3RS5A 1D6JA 1N6RA 2GXQA 3QPWA 1VYVA 2AK2A 2BEJA 1Z6XA 4JS0A 1NI3A 4I99A 1FX0A 3IIJA 4YXWA 3BB3A 3WXMA 1VECA 1AN0A 1NN5A 4N0DA 3UMSA 2HT1A 2OBMA 1E0AA 1ZNWA 2QAGB 3RNLA 4URWR 1ZNYA 1MO6A 3SN6A 2HXYA 2JLUA 2QN6A 3LA6A 2VYFA 1KI9A 1M1YE 1N3BA 2IXEA 1NSTA 2WWFA 1KI8A 3AF1A 3SS8A 4C7OA 1SGWA 2CCKA 4LSGA 5EUMA 2QT0A 3SBDA 3R8FA 4CEIA 2YV5A 2DCUA 4MRPA 3K0FA 3BK7A 2WTUA 1MT0A 3ZIAD 4WVFA 4Q1AA 3CPJB 3BBPA 1AS3A 3BS4A 3DHWC 1MABB 2IUTA 4LJYA 3FFAA 3V4FA 3EIQA 3AB3A 3CUEF 4IVRA 1IXZA 2ZRHA 1GM5A 4L5BA 2HDNB 5CIQA 4OHZA 3CF0A 2F7SA 3ZYCA 1TAGA 2OCYC 2CL6X 1QZXA 1W2GA 3X1XA 1BOFA 4Q9KA 3FWYA 3OHMA 4W5JA 1LF0A 2ERYA 3C8UA 1XRJA 4BFVA 3L8ZA 3ZZUA 1J7KA 5AUQA 3NDBB 2G88A 2CLDX 3AF4A 2QEQA 2D7CA 2O0JA 4HDCA 1LFDB 2OV2A 3TKLA 1SVOA 2AN9A 5HTKA 3UG7A 3UKDA 2RCNA 2I1VB 1WRBA 1NVVR 2CHVA 2YKGA 2ZYVX 4UJ5A 4JLAA 2C78A 1M2OB 3RVBA 2ZXUA 1ZUHA 2QENA 3IGFA 1E2MA 221PA 1YU9A 4L4UA 1E96A 4W5HA 4Q4HA 4ZDKA 4TMXA 1TQ4A 4JJZA 1NG1A 1YZTA 3ONWA 4KO8A 1C1YA 2C98A 2VIIA 1SQ5A 4FN5A 4G01B 3KKNA 1DAHA 2C5LA 2BMEA 4PTLA 4XWKA 1W36C 2DYKA 4A0HA 1SXJB 4PPQA 3U3MA 2C9YA 1HEIA 4LYJA 2JLXA 1Z0AA 2GWHA 4TSFA 2O8EB 2H7VA 1J8MF 1X6VA 3T1OA 2F1RA 3WYAA 5LB4A 4ESVA 2CVHA 2H92A 1JQJC 4MUBA 1XZPA 2GTPA 3CH4B 1OIVA 5AJZA 1ZM4A 5CK4A 4JVMA 1OXTA 1CLUA 1ZBDA 2YZ2A 1Z8FA 4E5UA 1P5ZB 2CCJA 1XXHE 4GZMA 2XGJA 3DL0A 3K70D 2J0UA 3A4MA 5ELXA 4KAXA 4CF7A 2VQSA 1YJ5A 1E2QA 2XSZA 1IONA 2IK8A 1UBFA 2GHIA 1J70A 2ZSAA 4RFVA 1P2SA 2G0TA 1W1WA 4WZAE 4JLNA 1SXJE 1HT2E 2E87A 1DEKA 2QQEA 5B2ZA 2J41A 4DCTA 4EPXA 3CRMA 3B7GA 2NG1A 3RSLA 2GK7A 4NKRA 2QBYB 1G3RA 1Z2AA 3THOA 3KQNA 5AJXA 1KSJA 4QBFA 3WNCA 2P5SA 1KMQA 2REBA 5G41A 3KJHA 3A4NA 1E9EA 1UKEA 3IBYA 3T61A 3CX6A 4KFRA 3I4LA 3C41J 2MSDB 1NL3A 3AVPA 2J7PA 2QRZA 1XJCA 4LV6A 4CEJB 4GFDA 3UXMA 1LY1A 2UKDA 4GMDA 4NMMA 5C18A 1P73A 1WCV1 1TF7A 5EP1A 2BDTA 2WOJA 3KX2A 1K8RA 5TV2A 4QOSA 4HAVA 2GBLA 4JSTA 1U9IC 3Q5EA 2O8DA 1HURA 1XD2B 2GNOA 3ZLJA 4TZ0A 2CK3A 3RANA 5KNBA 4LJ4A 3MWYW 4TL7A 4MRNA 4CZ2A 1W47A 2DFKB 5J47A 2NIPA 1JR3A 3ZH9B 2ZE5A 4BFWA 4C0KA 5J40A 2Y8EA 3NC0C 3QXXA 1US8A 5HE8A 3JVUA 3WHKA 2AHOA 5JEEA 3HDTA 2PBRA 4DB4A 3P27A 4POAA 4MKFA 1DBSA 2AKYA 2R2AA 5IK2D 2G1KA 2FSGA 2VPPA 4BLQA 5C4MA 5FH9A 4XJXA 4F92B 1GG2A 5LD2B 2R6FA 5A4JA 2IYZA 2ZUDA 4Q5IA 2BWJA 3EA0A 1GDDA 3I1FA 4JIMA 5JLJA 2RKOA 4DUGA 5GJVC 3VKWA 4C0QC 2A30A 1GNPA 3PEYA 4WW0A 2NPFA 2ZM5A 4Z1MA 1HE1C 2P2LA 4WZBE 3CRRA 3KQUA 3TAHA 1J90A 4NE2A 4QGGA 2OXRA 2JDID 3QKTA 3H1TA 3U6KA 4U02A 3OAAA 2W00A 2NPIA 1XD2A 4B34A 1E69A 5DH9A 3X1WA 4IW3B 4IEIA 2CDNA 2RAPA 5A5GA 3LX8A 1NMXA 1JAHA 1G20E 4DDWA 3TUZC 4Q02A 1KI7A 4WXPA 2QTHA 4FMDF 4UNPA 2VF7A 3IILA 5GVRA 4A15A 1YVDA 4TT3D 1KJYA
chains in the Genus database with same CATH superfamily
1U0TA 2RHHA 1H2HA 1SOMA 2GLUA 1I5OA 3G1TA 1DV1A 1JV2B 1SCNE 3VISA 2DFDA 4CJXA 4EATA 3DFFA 2F3UA 3CF4G 1BMFD 2B99A 2X0RA 4J1QA 4PFJA 5EZYB 3WRVA 4B2PA 4B71A 4CLXA 1PLLA 1TTQB 2J6IA 2GHRA 4R8MA 1FL9A 1RXUA 4RVHA 4ZOLA 3ZUPA 3ESAA 5DX8A 3OTIA 1NMEA 4JT8A 4LGMA 4S0XA 3UOAB 4YV2A 3CMMA 1NNEA 2BEVA 2Y9PB 2G6BA 4REQB 3IVMA 2UV8A 1BJTA 1TQ6A 3EGXB 4CN8A 2RJOA 3DOFA 1KFEB 1T1JA 5AQEA 2XGMA 4NMHA 5HJ2A 1OXBB 3ZE0B 4S05A 3GD7A 3HDGA 1KYVA 1F8UA 2CBXA 2ZATA 1C7IA 5F3RA 5LKRA 4FFBB 1VLMA 1VLQA 1X8JA 2G8LA 2ZJ4A 3GZJA 4LJ5A 1XEAA 3GJQA 2WFLB 5I9TA 4P3KA 4OXNA 2C99A 3OZ7A 1USVA 1U0FA 1GN8A 5GZ6A 1QIFA 1KQ3A 1X92A 2P3LA 1K2WA 1NUSA 1RJWA 3OUUA 4EG3A 5KOHB 3R9WA 2HCJB 3ER8A 4H3VA 4ND2A 4DSNA 3DBHA 5BSFA 1OYOA 2G04A 1GYPA 4ZKEA 2GERA 2G4LA 3BZWA 4MQLA 2DFLA 1RVDA 5BN4A 1WZIA 1DBVO 2A0FA 2CC2A 1QRSA 1KMHB 1XZNA 2WF7A 3ICWA 1Z6PA 4MVWA 1G8MA 4MUJA 4PHHA 3UJ3X 3TNFA 3L79A 4ZAZA 2P6RA 1NP3A 3MHPA 4J3JA 4Q47A 2BHSA 3JPWA 5KDDA 4B3SB 2C2GA 2OO3A 2QYHA 1Q2XA 3LV8A 4AJOA 1ZRSA 3OOHA 1USKA 1RKQA 1UJ4A 4REQA 1G0NA 3B70A 3O4GA 3SZOA 3BK2A 3G5TA 2W8BB 3LVBA 2BVNA 3OU7A 4ZCLA 2FHSA 5H3CA 5BYBA 3VJMA 1RPZA 2I0FA 1BVHA 3ZJUA 5MGBA 4YIKA 3MYRA 4DR1B 1TRKA 4LKRA 2PGOA 5FR2A 5IAKA 2FSUA 1CUSA 2PEYA 3PYLA 1BHSA 4GX2A 5ALGA 2AEFA 4CIBA 1KKUA 1BWSA 3NFRA 4FGUA 4RGYA 1M10A 2E6KA 3IPYA 2PXXA 2G9NA 3RKUA 4CKCB 3AIIA 3WHLA 4MR7B 3ED5A 5JATA 3DULA 3HP4A 4RF2A 3VVBA 1XK6A 2OORC 1RWNA 1MRNA 1O1YA 1PL6A 3W1WA 2W7TA 1PR1A 3EYWA 4KE7A 3HV2A 4Y8VA 1G98A 1G4AE 1P5JA 1O4VA 2DFVA 1JDSA 1H2WA 3G5UA 3PPVA 2COUA 2YWRA 4BRZA 4YAKA 5GOTA 4QNRA 1RRCA 5MFPA 3UWKA 4B40A 4ZOAA 2PGIA 5KHAA 1KR5A 1DEOA 2JFHA 4DJEC 4BTEA 2VAXA 5ULLA 2X2EA 2PLWA 1SKQA 3V7WA 1P77A 4DV4B 1R4MB 4MA5A 1JA1A 1QANA 2M1XA 2RGAA 2FUNB 2VYNA 5F64A 4B74A 3OEED 4QWWA 3AF5A 1QC5B 1IPFA 1J8DA 2Y99A 1WHSA 2Q46A 3TR6A 4HUTA 1RAIA 3TJRA 2C2OA 3KETA 4NXMB 1P60A 3FTPA 3H5RA 3UPDA 5KQPA 1PEYA 2OK8A 1JFTA 1GUAA 1J7JA 2XB6A 1DX6A 2FSIA 1K89A 5TSDA 1A2BA 5BW8A 2ZU0C 1OFVA 1X7ZB 2ZUCA 1ZISA 3B1JA 2AFIE 3DDHA 3ZHRA 4ZVRA 4W5WA 2H7CA 5JZSA 1WUJS 2JGKA 4P86A 3OT5A 3HFGA 1OW3B 1YIAA 5K6AC 1UBKS 2IKQA 2OHOA 3A05A 4NPAA 2OTCA 5BUCA 2G8NA 2OT3B 1MJGM 4MR7A 1MG5A 3ZC3A 5FR1A 1B93A 2YYYA 4XB6B 2YINC 1A50B 3T0FA 1Q19A 3U7QA 1Y98A 4L0MA 3RE1A 4GP7A 5LDGA 3FETA 5DIZA 2LBPA 3BSWA 3DTVD 1KQOA 1EFRA 1GGKA 1VYTA 4WESB 1QBKC 1K5GA 3HXTA 1IN6A 1I7LA 3I0ZA 4DNXA 4GOOD 1VIAA 4BMCA 3LRXA 1LV7A 1RWMA 3W6UA 4C5BA 3ONVA 4Q4DA 1CQJB 1P4GA 4TTJA 1NLMA 3T7AA 4XVUA 4HAZA 2DKFA 3I28A 1GCGA 3KQWA 1KEKA 3L06A 4MUGA 4UOZA 4I9FA 4HLUA 5MN5A 1U11A 4I3GA 1WB9A 5AI0A 1IIRA 3H5NA 3R1IA 2VJQA 2V7PA 2WMOB 1QC5A 3BC1A 3NASA 1A5TA 4MW0A 4G81A 4PHGA 4R1OA 4RQTA 4R9VA 3PCXA 3H9BA 5EKSA 5ILGA 5TT1A 5DBGA 4EYSA 1U0LA 4DSOA 2Q4RA 4O0LA 4G26A 8ADHA 1MEEA 1Y4AE 1GRCA 3MMZA 5CNKA 5HZKA 2ECQA 5KMGA 1EHIA 4JFAA 2PGDA 2GEVA 2ZJFA 2HI0A 2FPLA 4XLTA 4U3JB 1BWQA 1TXGA 2R84A 1E4VA 3UN1A 1J2RA 1IHUA 4EFNA 3IKMB 4RPLA 4L2IA 2KS6A 4OFXA 1VBFA 4R8RA 3P71T 3SYLA 3DMYA 4DNQA 1CRQA 1WLSA 2QD2A 4D5GA 4UBIA 3JRWA 1BWRA 1QCYA 1MNAA 2IIVA 1YVRA 4R1QA 3OQOA 3GMIA 4FD3A 4UAGA 2OHIA 1ZCAA 3DEYX 2ZKIA 1R5JA 3QXHA 3RSFA 4G5XA 3RQSA 2NV2B 5C1BA 4DYVA 3TECE 2K7FA 2CV0A 1N9ZA 3E2IA 2DWCA 1JDNA 4LF4B 5HUQA 2ZJ0A 3ZGLA 4YJFB 1E2FA 5AK3A 2PD6A 3BFPA 3DZBA 3L0CA 3IDFA 1VE3A 3CH7A 2PL3A 1T3HA 4JOSA 5EJMA 4BFLA 1SVIA 3QLVA 1U0JA 1ZGHA 3SE0A 1F0PA 3ISVA 1Y8AA 2BM8A 3B1WA 4IJQA 1CU1A 3V7YA 3U60B 2EKDA 2XZOA 1ZVMA 5JY6A 5A4FS 3KXIA 1CTQA 4D0LB 1ZZEA 1KS2A 4JDPA 5I7RA 4LSMA 3HYTA 1HDIA 1YRWA 2ANBA 2JJ1A 1WL8A 4O4JA 1N2BA 2Q8PA 3B6IA 4REOA 3RTEA 2WPDA 3SHQA 1KI4A 2Q4DA 4EKNB 5I9LA 2A9VA 1XKXA 1O4WA 2RHLA 3AV0B 4U4AA 4XIIA 3ICQB 1CB7A 3FCSB 1J2UA 1Z8HA 2C3MA 3HDJA 4Q48A 2QMZA 1CK4A 1YFJA 1XMPA 1WUYA 3VGPA 2HCTA 3VR2D 3KKPA 1H69A 4WNYA 4EMUA 1J8YF 4KQGA 4ZMBA 1AKEA 1W36D 5DYWA 1EG7A 3MWLA 3V1YA 3N59A 5IEBA 4DC0A 4G0UA 1XLVA 3BQNB 5HMLA 4ARVA 4R3UC 3T9AA 3H75A 3PA6A 3QLTA 3M3PA 1FRZA 2W0MA 4HH4A 4X8LA 3DHVA 4RVOA 3GT0A 3KCQA 1RM5A 5IVHA 2HSDA 3L49A 4X24A 2EFCB 2FR8A 4XQGA 3FPHA 1DXOA 3ZTTA 5A0TA 3NWEA 5CB6A 3LDHA 1GL7A 5ITWA 1IHXA 3W78A 2WYUA 2J33A 2YWFA 4J16C 4YJFA 3Q3GE 5JLAA 5TARA 5CFLA 1ZIOA 4QPDA 4J0HA 5TQVA 1LX7A 2J09A 5BOVA 2PSDA 2VSXA 4H08A 1SXQA 5E7MA 5H68A 3EISA 1XXLA 1JU3A 4MUNA 3AFGA 3QE3A 4RNCA 3T12A 2VP5A 5AXCA 4DN6A 1M0SA 4M0DA 3TX6A 5DN6A 3RVQA 2QUAA 3R4CA 1Z4OA 4FYHA 2GDJA 4G4SO 3D8TA 3U1BA 2HRBA 3QV2A 3AEKA 1Q0RA 3UJPA 3AU9A 3S7ZA 1KY3A 5JY1A 2B4KA 2JFNA 2ZRGA 1V6AA 2AZMA 4OYRA 4YCDA 2H9IA 2GK3A 4MWCA 2PTHA 2P0EA 4TKZA 1GLVA 3AFIA 5JC8A 5KIAA 3JASB 2RGDA 4E5KA 5D6OA 2H5EA 1EBFA 4U2CA 1HR0B 1PWXA 1F38A 1R9MA 3K31A 4NH4A 2ISSD 4CKXA 4W5OA 1IEQA 1WMDA 2FPGA 2XX3A 4S2UA 3TLAA 3E70C 1NRJB 1U1GA 1QUEA 3MJCA 4L8VA 4KIWA 3D3JA 3S1LA 4YRMA 3QU5A 1CETA 2QR5A 4QXPA 4LHVA 4DA4A 3LO8A 2HHJA 3FNEA 4ONEA 2ZGVA 1PTJA 4JITA 2WAXA 1YMVA 2P62A 4G4IA 1RZUA 3KHSA 4MLDA 3D1LA 5E4FA 5BNFA 4KOEC 1I2ZA 5EZ5A 2JEZA 2P1DA 2YY7A 1DWOA 1FQJA 3EW9A 4IYRA 5M34A 421PA 4EENA 3PDIA 4M0CA 1QBGA 2ZBFA 5E6UB 3AHHA 4D99A 2OHXA 3EFOB 3C6KA 5DTMA 1ZYUA 2XCSB 1HNXB 4CM5A 3E7XA 1AB6A 2NT3A 3HYLA 3JYPA 1IY9A 4ZZ3A 1G3IA 4D25A 4EUSA 2I99A 2Z4RA 2PKRA 1CR4A 4U7DA 5ECDA 2QMOA 3AUAA 3H83A 5BWMA 4ISBA 1QO0D 1T1EA 3UH0A 5KCZA 3ZXIA 4RJIA 1I3MA 1LW7A 1VPTA 2XV1A 3L8GA 4DCJA 4YJ3B 4QA9A 2R0QC 3VU0A 2OVBA 2WP0A 3QK7A 2VHQA 2C9DA 1AOXA 1OPRA 1VSUA 3O9MA 3ZXUB 4MKIA 2IYTA 3VR6H 2W8ZA 4KWTA 5ES4B 4N8SA 3VAZA 2BDEA 1GZ4A 4GPD1 3QSGA 4AY3A 4IH9A 3GEBA 3NBFA 4FGWA 4YYEA 4EP1A 3L7BA 3A14A 1DDGA 4RH1A 2DBVO 3BRWD 3CVYA 3RS8A 1YOVA 4TM7A 4E5VA 4KO4S 5DHTA 1GYQA 1ZI6A 3CNBA 2ZRKA 2ZIAA 1WV1A 3A8TA 3EDCA 1E4YA 4OQQA 1XTUA 1QS0B 2J9XB 4QHYA 4B76A 3PB3A 2AE2A 3AEXA 5C52B 5BSVA 1YWGO 5CHEA 2WKPA 4LC9A 1JDJA 4ZKDA 1T5BA 5L4NA 2RKWA 4HEA6 1WKVA 5CT5A 3IT3A 5GONF 5TPZA 2GRUA 1P0CA 2P5TB 5IC6A 2VP2A 3BULA 4U7HA 1GSIA 1RYFA 2XYHA 2Z5GA 1Z16A 1YNOA 3GRRA 4KRGA 1NF2A 3HA3A 4AKEA 3DV0B 3LKVA 3IP8A 4FD2A 3SEZA 2PKYX 3IIKA 5CT6A 2ZBQA 3A9TA 4JODA 4JUDX 4FHGA 4C0HA 3B1XA 3OEHD 2IDZA 4Q0MA 3W9YA 1Z0KA 2MSLA 3M33A 4HLQB 1ATZA 2ZRFA 5FTJA 1GNLA 2ZI7A 1ZOIA 2HJHA 2OXCA 3AEQA 1YFZA 1A71A 5IM4A 5BQFA 1PK7A 2G6TA 3MQ2A 3WB9A 1EESA 1HTWA 4JBGA 4ES6A 3PGMA 1XRRA 1KA9H 3LXMA 4DJAA 1A9RA 1K4YA 8ATCA 2R00C 1ZH4A 4HR7A 5JBQA 1LBHA 1FDUA 3NS7A 4R1TA 2WKWA 2BGKA 1SZDA 5KKAA 2IRWA 3LP6A 4FPXA 1XG5A 3ROTA 3HJBA 3S2FA 5CB8A 3RRBA 1OGJA 2TMYA 1V8FA 2DQYA 2QX7A 1R0BA 2ZRIA 4KI0A 4PN3A 1QGZA 3UAXA 1QS0A 1RYBA 5C37A 3ORRA 4X1KA 2Y1LA 4OHXA 5TIIA 2BBOA 2EP5A 2R47A 2IP1A 4YJGA 4FFVA 1RJEA 1AURA 2O8BA 4AZSA 4S1NA 3RSGA 1QZ3A 3FI0A 1Z5GA 4RKEA 3IR6A 4HBZA 2WKQA 4LTDA 4WK0B 3I92A 5FWXA 2WJIA 1G59A 5YASA 3GROA 3RFFA 4OYHA 4C0BA 5A4IS 3FCXA 2DH5A 4YTEA 2I3BA 4LYAA 4GRAA 5F5NA 1K6JA 1RKBA 1WXXA 3EDOA 4QUJA 5TQ2B 4CYMA 1C7QA 3R3XA 3IRVA 2EYUA 3ETGA 3CX7A 4CHGA 3UY4A 2PSJA 4EA9A 2IP2A 1DJOA 1RQLA 4WPGA 4TSKA 3B78A 2XCUA 4FXPA 4H1HA 1ESCA 3FYDA 4HSEA 3AR5A 4M98A 1A7JA 1UJCA 2JH3A 4XR9A 3WNDA 1M7BA 3GNTA 1GTG1 2V55B 3F98A 4ZPJA 5AJWA 3H4MA 5DVZA 4F3NA 5AJZA 3RJ9A 1NN0A 4OLBA 5IT0A 4AS1A 1C9MA 4EMBA 4FJ0A 3TLEA 2FR0A 1XL1A 1Z74A 2W2LA 2Y68A 4GI1A 4WUVA 3ROMA 3UK0A 3RGWS 3D5EA 1HL7A 3K09C 3N8HA 5FUBA 1L5RA 1MNQA 2PFKA 5JARA 3NYIA 1NW5A 4AECA 1U8TA 2HGZA 2O5VA 5CT8A 4HWRA 4KIFA 2B20A 4TTRA 2LE0A 2WIAA 1GLGA 2VHZA 5ESDA 4F6LA 2EFYA 4UUQA 5ISMA 2WSBA 1X14A 3E9YA 1TW3A 3D2BA 1OH6A 1ESDA 4LQLA 1BRTA 4LBVA 2GEDA 2QI9F 3O9VA 5IK2A 5SZKB 3IQWA 3BGWA 1M1YA 2AT1A 1L7EA 1WVMA 2IUSA 2WAAA 4JA2A 1X7DA 4UZSA 2Y0BA 5DJ5A 3IHLA 1ISJA 1LRKA 1SXHA 4RVNA 2YW2A 3D0RA 4XIYA 2I7XA 1JYSA 1LNSA 2FPOA 2YHAA 2YOFA 2HRZA 3LIIA 3RUHA 1N33B 1T2VA 3GOHA 4ARIA 4Y67A 4WAUA 1GT6A 3P9PA 3ZHOA 5TQ2A 1XZBA 1AA9A 4CMEC 3FGNA 3V8MA 1VIYA 2Z2XA 3IBCA 4D9NA 4F6RB 4NOMA 1Z25A 4Z99A 5MN4A 3R3YA 4FFLA 1PT8A 3DDOA 4HVAA 3HXKA 4D44A 4KMOA 4N5DA 2QTZA 2ZJ2A 3T9EA 3R4VA 5EHIA 3P8ZA 4AI6A 3I9KA 2JDIA 1R7RA 2XKJE 3M4YA 2A5JA 5AICA 2HMUA 1AMUA 1XTVA 1GV0A 4C4AA 4BLRA 3O83A 1IFXA 2HM7A 3WZMA 3OCCA 3AEUA 4JI6B 1T5HX 2I2FA 1NZJA 2QUBA 3EXHB 3NKVA 3OLQA 4UC0A 2WVGA 1TEXA 1NXVA 3P52A 5JG7A 1KSGA 2QP9X 1UOQA 1BHQ1 1X7WB 4BX2A 5JNLA 4D8TA 3OQNA 2XB2A 2FF7A 2O8DB 3WB0A 2EKLA 3LFTA 1E6CA 3FNFA 1WU7A 2PL9A 5JXHA 4TLAA 3BEOA 3QVOA 5B3AA 1HX7A 2II6A 5E1DA 5CX4A 4FGZA 1KDPA 2PCLA 3K9HA 1WP4A 1BMFA 4ALJA 2GPAA 2XYPA 3IT1A 2CHQA 3SJBA 1PD1A 4C4OA 1TCAA 1KH2A 1W0JD 5BMVA 4J0DA 1KDRA 1GL6A 1WNFA 2AI3A 3NHWA 2CVOA 4TWAA 3D7LA 4GXNA 4F6RA 3Q3EA 2WKRA 2AC2A 3PD0A 4KB5A 1UZNA 4KU4A 1RWVA 1WHTB 4QT4A 5H16A 5AM3A 1NWHA 1PDWA 3WMGA 4HX9A 3KT6A 4G25A 1CR1A 5LLSA 5LOVB 2WF9A 2PPVA 1NOKA 5JROA 4AG6A 4CUZA 4OKNA 1MB4A 5HF6A 3EXEA 4EF4A 4ROSA 1YS9A 1OZFA 1MJGA 4XYEA 2HQBA 1M8FA 2CLHB 4BKQA 2DCMA 2GF0A 3EQZA 1JHXA 1HT1E 1UMDB 2FPPB 1GKIA 1HFJA 3WLFA 6REQB 1X7WA 3EGVA 5JMOA 2CWWA 1W4BA 3CUWA 3VOBA 1AD2A 3WL5A 3C3CA 4BB0A 4S1WA 1G7SA 4JVNA 5HBGA 2PNFA 2W2KB 1GA6A 1HM5A 4GPZA 4RELA 4AKTA 2OCIA 4BVFA 4DLXA 1BD4A 3SBXA 2B61A 2Q8QA 5EPUA 2Q2QA 1F0KA 5K03A 4Q9AA 1U8YA 4TZ6A 2Z57A 1BXZA 2A9PA 3UT5A 4NBWA 4M1TA 1CJUC 2Q62A 2XVZA 1WA5A 1U90A 3H5LA 1O87A 2HGSA 3FWHA 2FDCA 5TT0A 1UQRA 1GZ6A 1V6SA 2QY6A 2CFIA 4ZT4A 1LRLA 2FPKA 1XMSA 2HWYA 3PNPA 5HOQA 3ND9A 4ZHSA 1D2CA 5IUNC 1LSJA 5LQJA 2V1UA 1E2KA 1WHTA 4TZKA 1PQUA 5AUOB 3KLMX 2IYFA 5GJCA 2WWHA 1SVMA 2NVBA 4AN1A 4FMCB 2QTTA 5KINB 4Z8YA 4MGYR 1CE8B 1BXKA 2H3HA 4NZPA 1NYLA 1XRQA 3GT4A 4WT7A 3AVYA 4XJVA 2HHLA 1E3IA 1II8A 5AMXA 2W9XA 3RG8A 3WGTA 4ER0A 2FPPA 1UMDA 3Q3VA 4TV9F 5EIFA 2D74A 3RUCA 3LO5A 4IX1A 4JL8A 4F2GA 3ZGVA 1YQ9A 3ZVRA 1GZ5A 4A1FA 2VRNA 5D86A 1IHYA 1I4LD 5TQ0A 4O3FA 1H9BA 4IIYA 3FZGA 4H4EA 16PKA 2AN1A 1Y7IA 4XM0A 1A8IA 4AUMA 1MQ9A 3R0ZA 3PXGA 2F8TA 2RGEA 3E9MA 4MDFA 1V2HE 3L4BC 3TEMA 1JE0A 1SCAA 2XADA 2QSUA 3BKXA 3FBWA 4LGVA 5JBNA 3DFZA 1KDTA 3QEMA 1SBCA 1WE2A 2F62A 2GJSA 3OZFA 4A2WA 1IB0A 2NZXA 4EHIA 4RAOA 4RFSB 3WK8A 3MSCA 2XGOA 2J9ZB 3OEEA 3GLIB 5EXPA 4XUEA 3H42B 1O54A 4LRWA 4R9NA 4Z86A 4OXRA 3Q3IA 5G4KB 1VFPA 1L5VA 5DF1A 3VZRA 3MEQA 2OV8A 4NE7A 4OHKA 5IKEA 2FPUA 1XP8A 3ET5A 3RKRA 1TYZA 1SJ9A 4Z0PA 3U7EB 4B33A 3G9XA 3VO1A 5IX8A 1WSDA 1WMSA 4G5YA 4YCNA 2QX9A 4GF5A 4HDKA 3O3OB 1ZI9A 3HCBA 2JAHA 1YJQA 3J7TA 3UWPA 4AKHA 1C7JA 4MPDA 1K66A 1YRAA 3TLCA 5HYVA 5DKFA 1RYEA 2IZ6A 3ZOKA 3A26A 1PSZA 2HEGA 1RHMA 3NI2A 4ZU3A 5AYVA 5GWXA 2ESRA 5CDHA 1VL6A 2VHEA 5FO0A 2W2XA 2F4VB 3DTVA 2C31A 4L8LA 2FW9A 3KU4A 4XI9A 3WQQA 3QMWA 2JHPA 3VKUA 3AUJB 4CDRA 1R6XA 3FVWA 1EE1A 1PX0A 2BCJQ 4ENWA 3ETEA 3AOEC 3IPXA 1PR2A 1WCIB 2NO1A 2WG2A 4Q3AA 3IEXA 2OCGA 1YDFA 3GFTA 4MUXA 3RVSA 2GNPA 2B5OA 2PDAA 4B47A 3JAWB 3VU1A 4RTKA 4OMCA 4Q4CA 2DBZA 5H59A 4PPFA 1PNVA 3LS2A 1LKZA 3P5SA 3SXJA 4EGQA 1E62A 1K7SN 5EXTA 1VKJA 4ZRNA 2R6R1 4A16A 4BGEA 5K8UA 5DULA 3W3AH 1UFRA 1L4FA 1E32A 2TRSB 3RLIA 3SHOA 4JLMA 4B7CA 3D6UA 4TWJA 1TCBA 2BHLA 1XTPA 4YN3A 2NTNA 4V02A 3TLGA 1JL3A 1LPMA 4QVKA 3GJ8A 3NHRA 5CP8A 4O08A 3B85A 3GHYA 2O0MA 2GZRA 1GU1A 2VT6A 2EX0A 2XD9A 2AJ8A 2RBKA 2OFWA 1NVWQ 2P3QA 1P1RA 4FCTA 2K6GA 3DEHA 4QUAA 2OKGA 4W63A 3TW6A 1U8UA 4F91B 5K3BA 2QQ0A 3WLLA 5EZYF 4BV2A 4EABA 2QV7A 4HDNA 4CKBA 3PIRA 5CBPA 1U63A 1C7EA 3ITKA 3CR3C 3PXBA 1TEZA 2W2PA 2C7RA 4R68A 1RD4A 3LLSA 4DLSA 5AK0A 1LUAA 3AILA 3HBFA 4UMFA 2RGYA 3LUGA 3NXSA 4PC7A 4A8PA 1GPLA 3KQYA 5ALYA 3RJMA 1I33A 3PQ2A 1H6AA 2QTBA 3K15A 1WCIA 4OA8A 4R3WA 4TTSA 4F5EA 1L5FA 2ZULA 4HTFB 2XJ9A 4JJ4A 3SYNA 3URMA 5A6SA 3KOMA 3ZDFA 2EGUA 4LJ8A 2CUTA 4N48A 1C0LA 1G3QA 1TU3A 3WDSA 3ZE6A 3WGIA 5HQ3A 1M2VB 2ORYA 4J0FA 5KYYA 6NULA 3L5KA 2D7DA 4JR0A 5MF6A 3Q7EA 5CXXA 2FI1A 1IQPA 1RZVA 2KX7A 4M1SA 4WNCA 3WYGA 4DCSA 5LP1A 3AJRA 2ERXA 3D7MA 4QKQA 8ABPA 5BT8A 3QENA 3LD9A 3HKCA 3VR2A 2RJ3A 5JDCA 1TZKA 5K4GA 2JASA 3K6RA 3DBLB 4OB6A 4MI6A 3TDMA 1CYEA 1B6TA 4N49A 1W2WB 2V4ZA 4QFDA 5EP2A 3D4IA 1EM6A 4IJ6A 1U9YA 2R9VA 3DVLA 4RXUA 4MWSA 3PJEA 3EXIA 3IUQA 5FOWA 1M6YA 3JRNA 1DWUA 2RAVA 3RARA 2VT2A 4CCYA 2I7CA 5HIKA 1QAOA 1M8GA 3IBSA 4AUEA 5MHTA 5PGMA 2X6QA 3DBIA 3FPFA 4HXEB 3WNQA 5I7VA 3OTHA 3SCZA 4NLLA 3V2HA 3M89A 2Y1EA 2P9TA 1UDAA 3TOVA 1E8NA 4GMGA 4I81A 4BJ6A 1KNXA 2C0CA 5ESWA 2F1JA 4I9GA 4YRPA 4G09A 4OQYA 4FOSA 4QHSA 5EHNA 1X74A 3T5CA 1Q57A 2G1JA 4RO0A 5IH3A 5B3LA 5DEOA 1SHLA 4RD2A 3B13B 1XSEA 3BGVA 4YASA 3V4VB 5DHRA 3DUFA 4NENA 2HRQA 2YYAA 4BVEA 4UCWA 1M2VA 4F7WA 2WUGA 3HS3A 1CUBA 3QI7A 4P3NA 2J0VA 4ETWA 5LQMA 1YQTA 2OGSA 3DVSX 1LJUA 2A6PA 1O9BA 3PWKA 3L8CA 4MQUA 2WZQA 1SUWA 3DZIA 1W4LA 3EODA 4WOCA 1DKOA 5FT9A 3UXHA 3V4PB 4EW3A 1HDGO 1Y80A 1SKYB 1SR8A 3GP5A 5HRUA 3IEKA 5ALKA 2X0JA 1JSXA 3FVTA 3O1IC 4BB6A 5KSYA 3DBLA 1F2TB 3EDQA 4MQEB 1ONOA 2AJBA 3ECSA 4F86A 3GP8A 1JHDA 3ZDQA 1AKUA 1ADBA 2IYYA 4RK1A 3PT5A 1YA6A 2GN0A 1K6EA 1P3JA 3EGDA 4AJ4A 5L3QA 1UR5A 1XZIA 4DIFA 1MX5A 3RC8A 2JLBA 1U9JA 3QVVA 5CVCA 3WSTA 2VF4X 1KGDA 2IDKA 2FWPA 2F1OA 4KJXA 3WKEA 2DPLA 3WL4A 4HBGA 1EDDA 5ADHA 3HY4A 4QBHA 4JC8A 4X20A 3I6BA 3B3FA 4I5DA 4E5DA 1L4YA 1T9HA 3JWJA 4RDXA 3OOWA 1MO3A 3I4FA 1Z7WA 2VO1A 4FMPA 4FHDA 4MR8B 4KE8A 4V24A 3IAS6 2QVZX 2R1TA 1U1FA 4I46A 2YJ5A 3U4IA 3NDIA 3N7AA 3GLGB 2CFTA 1DU4A 1QO0A 3UA4A 4PZEA 1NQXA 4UNQA 4YT2A 2ZCUA 1ZWKA 4UU1A 1QXSA 4ARCA 5FCDA 2OLJA 4C6TA 4FB4A 5DHFA 1N7GA 2A9JA 2FN4A 4OJQA 3AIOA 3N58A 5H0IA 5EG5A 4CR6A 1DQRA 5K01A 2AZ4A 5I7UA 5K2OA 4EEXA 2VTVA 2FCAA 5KO2A 2RDMA 1PZMA 3BRWA 4MQEA 2HYDA 3UMFA 1A69A 4NJEB 1EWVA 1X3SA 3FOAA 1BDJA 1SUIA 2YX1A 1FSGA 3K8YA 2I6TA 2DUWA 3VPCA 3H5WA 4YAGA 3E0XA 4BJ1A 4IAOA 1FCJA 2JIQA 3T3DA 4D80A 2X3FA 4MUFA 2I87A 1EFVA 1H2BA 5B3KA 3M81A 4RY8A 4HNSA 1JWAB 1XLWA 4IDDA 1AQYA 1M5RA 1CP2A 1NKVA 2CKMA 1TM5E 4ANFA 3N2GB 5FJIA 2HFJA 4PBSA 5L95A 4QASA 1ADCA 3OPQA 2R3SA 1UWLA 3HSYA 1EFLA 2HBZA 2JGRA 1RCUA 1T13A 3K2BA 3R40A 4FDAA 3RG2A 1I0IA 4JDUA 4DLWA 5ICMA 3SJAA 1T9GS 3V1TC 4BCCA 4JJ7A 1IAVA 1MO5A 2A7QA 2FRDA 4YRLA 2OAEA 5CX1B 1PGQA 1B42A 4AKGA 3H9QA 5LP6B 5H81A 4G86A 4A73A 3GLGA 4AIIA 1YS4A 4XWAA 2LWIA 3E3NA 2A67A 2G77B 3HU2A 4OKSA 1XJ5A 4UFOA 1TC2A 5KOYA 3IAUA 2PZAA 4COOA 1CV2A 4N7BA 3E05A 3IIIA 3BGOS 3IKVA 3SZUA 3ANTA 2QRJA 4UFNA 3L43A 3SSMA 3TSAA 1T5SA 2IA5A 4FWTA 4XD7D 4I4IA 3NVDA 4W9MC 4G85A 2FVYA 3KG2A 4ZQBA 2VYCA 1KO7A 2REXB 2BTEA 1QE3A 2VNAA 5I5EA 4EFLA 3CWCA 3GUYA 1Y33E 2X2PA 4NJEA 1F8GA 4AQDA 3INTA 3PDWA 3E22A 1PYDA 2GBIA 5DP2A 4B6OA 4EWLA 4UAUA 1A76A 1JA9A 1N2CB 1Y6JA 1ONBA 1QPGA 3CO0S 1Z26A 3MUNA 4OLHA 1U8FO 2VS1A 2G5GX 2FX3A 4IDCA 4IJMA 2ZPUA 1IRXA 2P79A 3OLCX 4D81A 1AXGA 3A37A 2HIAA 2CMKA 2RHRA 3R5KA 3KKEA 5AQ1A 5BR1A 1QK3A 1N6PA 4H1VA 2C3OA 1ENOA 1AZSC 1OR8A 1U4SA 4P7GA 1PZNA 2TMGA 4J2OA 3UAWA 3N2GA 4XKJA 1UKCA 2DR0A 2GH1A 3BE6A 3JAMA 2E4WA 4BFZA 3WYEA 4ZQCB 3SQDA 2JCVA 1YL5A 2BKAA 2VJYA 4Q19A 2DTDA 2XBLA 5DHAA 3W05A 2V7EA 3P20A 4FEEA 1XBTA 4OAQA 3DXZA 5AP9A 4R54A 2EX1A 3HCFA 3OHSX 1EBUA 3N1UA 1EX7A 4Q37A 4BP9A 2IS6A 1H2XA 2CVPA 2ZYGA 4BX9A 1TJ3A 3L6RA 3DGEC 4J0KA 3VC3A 5LR6A 1UJ2A 3U6BA 4YACA 2BFBA 1ABFA 4PM4A 4REMA 3O8LA 4BLSA 3LFHA 4RF5A 3TIGA 4FT2A 1S1MA 4DMGA 1AA6A 3ZVNA 1CVLA 3M6WA 3WDLA 1SOAA 1TT5B 2RARA 4TLEA 3BCSA 5CCEA 3DOOA 4A36A 2L2QA 1NVDA 1JPUA 1Q20A 1XZCA 3LYUA 1K7EB 3KEQA 3U0VA 3B3AA 2GVNA 3P7MA 4B4KA 4CMGA 1SEVA 3GQBB 3IALA 1VI5A 3EZLA 3KB2A 3PFKA 2DKOA 4NONA 3TDNA 3C8MA 2OESA 1CLEA 3GCGA 3PG5A 4N01A 2Z1MA 4N65A 5EPOA 5HEKA 4YMLA 1PV1A 2Q5IA 2DECA 2IYWA 4FFDA 4L8YA 1BKYA 4RH3A 5C51B 4I1PA 1SC1A 3CXRA 3HYRA 3QLEA 2B30A 1ZXXA 4MJLA 1S3GA 3BD6A 4G84A 4WK2B 1QOQB 4LZJA 2QLLA 2PBFA 2JIZD 1F17A 2OORA 1EM8A 1YASA 4RK4A 3U17A 2JAPA 3OD5A 3NTXA 3PKZA 1I14A 4TQUS 4UXIA 1OWMA 2XBMA 4NJOA 3IOYA 4XB2A 1XNJA 2AZDA 4RNDB 3QUSA 2C7VA 2ZR8A 3EWSA 2JI7A 4QICA 4KN8A 5CM8B 3CX8A 2X15A 2GYYA 4D0GA 1GSAA 3G1UA 3PYMA 4P3YA 1YQXA 3WSVA 3BMOB 4URXR 4O4LF 2IL1A 1M6EX 1Z7GA 3L3BA 4ENRA 2H8GA 2ZWOA 4HNGA 2PZ8A 1KFBB 3VR3D 2DB3A 1T6BY 3AYZB 1C3OB 4FYKA 1SPXA 4TWIA 1JHAA 3GEEA 1OFTA 3H9UA 3OIDA 1X13A 4LMPA 1Z2EA 4RADA 4E1VA 2ATEA 4G5RA 3MERA 3B6MA 3LOUA 4URZR 4K0RA 1ML4A 3H2SA 3U2QA 1JIQA 4RE5A 3ZGXA 2YHSA 1AUXA 2KBFA 1L7MA 3D3WA 4GBMA 4C3UA 3P2IA 2FTKE 1JLKA 3DOJA 1LI7A 4BFYA 1T5DX 4EHBA 2HQRA 2YOHA 4QDKA 3U7HB 1QDUA 2Q1TA 2IYSA 1NVKA 1TVKA 4H0NA 1DL5A 3LCJA 4OHUA 1IDN1 1RRMA 4NP6A 5CM2Z 3OIGA 3OKFA 5I7WA 1F3OA 2JI9A 2XCOA 3VC1A 3UICA 4X60A 4YR7A 2ZYDA 3MTAA 9ATCA 1T3GA 2H4YA 4I4CA 1TI7A 3HPQA 5K6AA 1NY6A 1XVAA 3IP9A 2WJWA 2FETA 4U2KA 5DGHA 1W0JA 1XUOA 2Q1WA 5IT5A 1SBZA 4ENQA 1FS4A 3D6MA 3IRUA 2GAOA 5FAXA 5L7YA 4YYZA 4ZCMA 5AUNB 1U0BB 2RMKA 3GN1A 1VE6A 1FU8A 1VJDA 2ROQA 4P4SB 2WV9A 4PO3X 5E0KB 4BXOB 3QITA 2BGTA 3H86A 3W34A 5K3SA 3QG5A 3L1JA 5B4UA 1FJHA 1H5QA 2D5BA 1P9LA 2VZ8A 5HDBB 3TM5A 2J46A 3QX7A 1Z4MA 3C8DA 1ZUWA 1IBMB 1WUHS 4AZWA 4L4ZA 4E1BA 1CZKA 1Q11A 3K1TA 1WG8A 2SKDA 4OJKA 1C3OA 1CS0B 2EFEB 4LE1A 1W4AA 1PHPA 4RHEA 5LQSA 2YMQA 3OE7A 3LWBA 4W82A 1JLRA 2G9UA 2I4LA 1P39A 3Q72A 1M54A 3A1TA 4U7WA 4ZMRA 5A7FA 1S2GA 2NNLD 4PZZA 2HX1A 2RGNC 4L15A 1G7CA 1XCPA 4HVTA 3CPSA 2FWJA 3T5AA 2ZXFA 2I29A 621PA 1AZWA 4XX0B 3ZHXA 4EJ0A 1CIPA 1HMPA 1MC4A 4NYMQ 2CNDA 2X76A 1MPXA 2IXFA 2AVDA 2ZDHA 1DIBA 3A1FA 3DDUA 2ASVA 3T5TA 4FZJA 1K3UB 3GYGA 1IDOA 2J3HA 3PSHA 4E2XA 4DEYA 4PNPA 1EAYA 1I01A 1Y5IA 4QELA 1Q92A 3L82B 2DLCX 4P5PA 4ENTA 2WIGA 3KDPA 1SA0B 1RQPA 3ZD7A 3GLKA 3F5FA 3RI3A 5CCBA 2C94A 1GTZA 3X1DA 5BV2P 4KTVE 4F2PA 4Z4CA 2J6HA 2XB4A 3TI9A 2H9AA 2BBSA 3NCHA 1RT9A 1JJ7A 2Z6VA 1T0PA 5KUTA 2HMTA 2VQDA 3JW8A 3QFHA 4J0JA 5JNWA 2GCNA 3W3AD 3ZZUA 3VPBA 3CG0A 5EJ2A 4AU1A 5BWLA 1MX3A 4LOAA 2RHTA 1NVGA 3GDHA 2GPJA 4TGLA 3U39A 2HMYB 3NHFA 1NSYA 2GCEA 4KV7A 1J09A 1LLDA 2JHCA 1DQPA 1DX9A 2Q9AA 4JP8A 3VSBA 4PS1A 3QU7A 1JUDA 3K0HA 2P5YA 1WPRA 2EBWA 1IZYA 2LXNA 3D6NB 5LJLA 1KQFA 4DV3B 2FPMA 2FV8A 1REQA 1EQAA 3GRVA 4AB1A 3FDFA 2PT5A 2QR3A 3ABSB 3INRA 4LTNA 3L8YA 3MSXA 3IX7A 2FWNA 4JLWA 5J4LA 5EERA 1LC0A 3AM5A 2AZXA 1IJKA 1Z13A 3MWDB 5BYKA 4GO1A