2GCOA

Crystal structure of the human rhoc-gppnhp complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
187
Chain Sequence
b'HHHSSGLVPAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-related GTP-binding protein RhoC
molecule tags Signaling protein
source organism Homo sapiens
publication title X-ray Crystal Structures Reveal Two Activated States for RhoC.
pubmed doi rcsb
total genus 65
structure length 187
sequence length 193
ec nomenclature
pdb deposition date 2006-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gcoA01
4ILEA 1H8ED 1W4AA 2IEYA 2MSDB 2R44A 5KPDA 2PX3A 4RCZA 1C9KA 2ZRPA 3KB1A 4Q4HA 3M4YA 1G4UR 2OAQ1 2Q0HA 5DI3A 5J5CA 5LPNA 1E9EA 1KY2A 1OFIA 2GBLC 2QAGA 3OEHD 1H8EA 5FOWA 3K0CA 1AGPA 1CJVC 3NDBB 1SZPA 2OFWA 3TSOA 3I73A 3Q72A 2OCAA 3KKPA 4M9QA 4OHYA 1Q12A 3IBGA 2G9NA 1ZCBA 2JDID 4IOJA 4DCUA 2RGCA 3DL0A 3NVAA 2UKDA 4KI0A 3EPJA 2D4HA 2YOFA 2GKSA 1FQJA 4JZKA 4GNKA 4C4PA 3TH5A 1E2DA 1WXQA 3MRSA 2YOHA 4M2LA 3GLHB 4OI0A 3GP8A 3ADCA 1SVOA 2WBLC 3AQ4A 1JECA 2QORA 3U7FB 2ZUDA 3GJ3A 3CLVA 1RFLA 4KFTA 4Q02A 3IDQA 1DVRA 1ZUHA 1XWIA 4GP6A 1ZC4A 4FCTA 5IHPA 1KK2A 2FSFA 2ZJBA 3FMPB 1VECA 1E99A 5BN3A 1HE1C 1MABB 1U9IC 3B7GA 5FR2A 1E79D 2JAQA 1S4QA 1SXJC 2JEOA 2NG1A 3FGNA 1CR0A 3MLEA 4GMDA 3DMDA 4G5SA 1OH7A 1I4DD 1GDDA 4ZIRB 1W4BA 4P3YA 1AM4D 2C98A 5SZKB 5LD2C 3WYFA 3TGPA 4JVMA 2KWIA 2WPDA 3BFXA 1M34E 4M8NE 1HUQA 1OJLA 4RVCA 4JLDA 4QBFA 1JALA 3HR7A 4I1VA 2CCJA 2EFHB 3EC2A 4C30A 5HKKD 1NN0A 1UF9A 2BCJQ 2GRJA 3OFND 3CX6A 1DTSA 3ZVLA 3B9PA 5F9FA 4WAUA 1X8JA 2O8FB 3UG6A 4NTZA 1DAIA 1YZGA 2HEIA 5EP1A 4RZXA 3BH6A 1HT1E 2GVDC 1X6VA 5CYPA 5LD2B 4WZ6A 1XB2A 2FFQA 4QGFA 4CYMA 5GVSA 1OFUX 2Z4SA 1B0UA 3X1ZA 3I8SA 3U3RA 1E2FA 4ON9A 1FW6A 3NH9A 5CDFE 4TMTA 2W00A 2XJ9A 5EE5B 2FMXA 1KI6B 3ECCA 5TDHA 4D4MA 3TAHA 2GBLA 4TMZA 4DC9A 1JPNA 2QT1A 3CX8A 2QP9X 1E98A 2ZRAA 4W7SA 2PT5A 2BBOA 2P5TB 1JR3D 4PPGA 4YQFA 3ADDA 4A1FA 1COWA 3TSZA 2P6UA 2RGGA 3SFZA 1W4RA 1Z8FA 3SHFA 4JYBA 3O8DA 1JR3A 2ZREA 4IDHA 5LBIA 3MG9A 4LHWA 3IEVA 5UKDA 1XD8A 2GK7A 2VTKA 3U3KA 3CF0A 4B6FA 2OILA 2HJVA 3JVUA 3JZMA 3QENA 4G0NA 4OL0A 3T1QA 3EA5A 1SXJD 5CM8B 1E9RA 1F48A 3WMFA 4B43A 2QGNA 2V55B 5AR1A 1OB2A 2QN6A 3B78A 1CR1A 3BC1A 2QEQA 3RSLA 3FVQA 1W0KD 4UJ5A 2VPPA 3Q7QA 4DHEA 2RCNA 4A0HA 4LJ5A 2ZJ2A 1F60A 1E6CA 3DHWC 2YYZA 5G3YA 1XEWY 5HPYB 4LV8B 3DZ8A 1P7CA 2HT6A 2G88A 4PC1A 2ORIA 3VHLB 3TNFA 2P0EA 5JBQA 3EIEA 3RYTC 121PA 2F1JA 2OZEA 4AG5A 3O8BA 4RY2A 5J40A 2C99A 2JIZA 3IQWA 4TLEA 2P6RA 4IVRA 1JB1A 2WKQA 4TTPA 1YZNA 4HZUA 3WHKA 4DZZA 2H1LA 4IVQA 3BAFA 3HYRA 4JBWA 4JLMA 4DCNA 3CH4B 1II8A 4KODA 4TSFA 1TEXA 1BH2A 1P2SA 4GOJA 3RS3A 1PLLA 3BBPA 2JJ8A 2ODNA 4TSFD 1DAHA 1GFIA 1XMSA 1Z0AA 2J87A 3AVQA 3LY5A 4L15A 2YKGA 3H1TA 3A6PC 1U90A 2GEDA 4KO8A 2ECKA 2OO7A 4PZYA 2C5LA 3RS0A 5HR5A 1XDBA 1F2UA 4NYIQ 2FFBA 2HV8A 3GFPA 1YRAA 3LAWA 1JR6A 1E4YA 3IO3A 2WWHA 4M1TA 4QHYA 1Q20A 3OIWA 3PIRA 4JVLA 1IN7A 5TY0A 3HP1A 4TL9A 2B7BA 2XOKA 4HATA 2CCKA 2XJ4A 1A82A 1T5IA 4R2HA 4PAOA 1GKYA 4DSNA 2Q3HA 3THWA 4A36A 3CONA 1BS1A 1VYUA 4IDOA 4ZCLA 3GLIE 1BIFA 3I92A 3KXIA 1VYTA 2QE7A 4FI3C 3SJBA 1NIJA 1KI2A 1ZNWA 1I2DA 2A5FA 2NZ8A 4AKEA 3LLUA 2O8BA 1K8RA 1Z6AA 2YV5A 4Q48A 5TB5A 3X2SA 1KI1A 1FX0A 1QHNA 2JLZA 4TWZA 4TZ6A 1R8QA 2B7CA 4D81A 1DOAA 2BOVA 3QKUA 4GP7A 1AN0A 4I99A 4TT3A 1ZCAA 1E2QA 1E9CA 2FSIA 4Q00A 4IRUB 2VP0A 3PEWA 1Z07A 3CRW1 3K09A 3QBVA 3KQUA 4II7A 3ZH9B 3K70C 1Q0UA 2G1JA 4NCJA 1G7CA 4A2QA 1VKJA 3RS7A 3DDCA 5CM9C 2CK3A 3ZS8A 2VIIA 1OH6A 4D0NA 4OI4A 3AVXA 5DO9A 3ETLA 3U61B 1Q22A 1N6HA 2ZROA 1G8HA 4A2WA 3UMRA 1R0YA 3PEVA 1ZP6A 4LGMA 1KJZA 3LXXA 1LVGA 1EGAA 1QVAA 4MKHA 2I4IA 2E1RA 4Q1BA 4Y0AA 1OXTA 4ZPXA 4DT1B 1HE8B 4M9XA 4PSAA 2QQEA 2IT1A 4KXFB 5F3WB 1R0XA 1DAKA 4I1SA 3AVOA 3ZZUA 2CCGA 1GNQA 4TMWA 1UAAA 3OIYA 1W47A 1G21E 4Q47A 1G7TA 4OYHA 3LO5A 2ZSAA 4AC9A 1VHLA 2R62A 2ATXA 1FMLA 5EE1A 5EXTA 4AYXA 5HCNA 1L7VC 5IDVA 2G6BA 4BLRA 2B21A 1KTVA 1XEXB 1NMYA 3FKQA 5L3QA 3NC0C 1SVSA 4MRVA 1NKSA 1ELOA 3TUIC 1LB1B 2OEPA 3I4LA 2P67A 2EVWX 2FEOA 2Q21A 4OHVA 4PC6A 4AI6A 2A30A 2ZE6A 4Q66C 3B8HA 4JLNA 3ZD7A 1R8SA 3AF0A 2ZI5A 2VHUA 1RRCA 2ZVQX 2HYDA 4XWAA 4TYYA 2E87A 3RRMA 4V02A 4LJ6A 1NF3A 2ORVA 3LWNA 1T3LA 1UFQA 1U8AA 2F1RA 4H1VA 4LJ9A 4PZZA 4ZDKA 1P2VA 2IHYA 1U94A 4G1UC 1G18A 2ZSFA 4PHTA 1Z0DA 4OQLA 2C9YA 5EXSA 4CGZA 1T4GA 1G291 3AUXA 3CR8A 3HU3A 4Q03A 5KDDA 4HDCA 2GNOA 3OESA 3BB1A 4Q9IA 3K70D 2VYFA 1F6BA 2H18A 1AJEA 2JJ1A 4UXHA 3TIFA 3CNNA 1E4VA 3CZPA 1LNZA 4BQSA 1CTQA 1SKYE 3OEED 4UXJA 3RRYA 1XTSA 4JIMA 1ZM4A 4B33A 1MO6A 2C8VA 3QG1A 3KFXA 5K8UA 3KKMA 1GKIA 1Z28A 3GCGA 3ZIAD 3NH6A 2C78A 3K0FA 1GG2A 1NP6A 3GQBA 1TPZA 3SN6A 4TL7A 1DO0A 3FFAA 2P65A 4MGKR 5JI3E 4R7ZA 2ZI7A 3IIKA 5FPKA 4IHQA 3SBDA 5JSZB 2FDCA 3NBFA 2LCFA 2UZ3A 4HAVA 4JL8A 4C0SA 1GNPA 1XFAA 4PC2A 1VIAA 3H86A 3PCRB 4U5XA 3F0TA 4QBGB 4WA7A 1E2IA 1VG8A 4XTRA 4EPRA 3BB4A 5L3QB 1AS3A 2J7PA 2VP4A 1KAGA 4KFRA 1OFHA 1E2KA 4IXNA 1ZAKA 4PO1A 3GMTA 4FMCB 1PVOA 3FMOB 4QM7A 1R6BX 4V0LA 4CEJB 4MQBA 2BM1A 4Z8YA 1FUKA 2HF9A 3MWJA 4US2R 2PZEA 1ZYUA 3DVLA 3PJRA 3A4LA 2DFKB 3EPHA 4CW7A 2A9KA 1UDXA 4US0R 1N6KA 2JGNA 4DSTA 1E9DA 2J3EA 2ZRCA 2QMUA 1J8YF 3NHBA 5L3VA 1UEIA 2J0UA 4JSYA 3PFIA 2W2XA 4TLBA 2VSOA 4X8LA 5E3HA 2VF8A 5SZIA 4L9WA 1P2UA 5DLQC 2PZFA 4PQRA 1GL6A 3GJXC 3R20A 4L16A 2HF8A 1R4AA 3TK1A 1VPLA 4RFVA 2W2VA 1U0HC 1VTKA 1XTQA 4ZI3A 3ZVNA 5AJXA 2RGEA 3CH5A 3RWMB 1CR4A 4D4JA 2CK3D 1ZUIA 3RC8A 1ETUA 1W49A 4Z1MD 5FUYA 4HZIA 4GZLA 4BE7B 3SEAA 5KDOA 3RRZA 4Q4AB 5EE0A 1CULC 3AF3A 1VIYA 3P32A 1BMFD 1LFDB 1G3UA 1SVKA 4NCIA 2X2EA 4RFSB 1K5GA 1JAHA 3SDZA 5CIQA 4WW0A 2YC2C 2QZ4A 3NTUA 3KQNA 4F4CA 1G8YA 4QXAA 4XD7A 1WMSA 2E9SA 1P75A 3LRPA 4LBZA 1U0JA 2ODBA 2ZRDA 2V6IA 1OFTA 3ZJYA 3QJYA 4EPWA 2F9MA 1QF9A 3RLFA 1IXZA 5G3ZA 1ESMA 3IPXA 4AD8A 2PT7A 4JT2A 1NVVQ 2A3RA 3RS5A 3BGWA 3GJ4A 4Q9KA 1N2CE 3ZYCA 2GXQA 3CBQA 3WY9A 3IBYA 5TV2A 1EFCA 2MSEB 2YWHA 3CUEF 4NL4H 1KDRA 3EIQA 3KUCA 4LJ8A 3PR1A 2RMKA 2ZJOA 2HLDD 2F43B 6Q21A 4KFUA 4BEBA 2MMCA 3TR5A 2BIFA 4I4LA 2V7QA 3AKCA 3REFA 3LD9A 1GWNA 2WJGA 2FU5C 3WNBA 1YR7A 4K8OA 2Q9BA 4Q9LA 2KI5A 2CL7X 3MJRA 4A8JA 3VX4A 3EIHA 3QKRA 1D6JA 4HLCA 4MKGA 1DS6A 4B34A 2HUPA 3LLMA 2OFOA 1ZD9A 3QOFA 4BLOA 2V1XA 1N6OA 1IHUA 2AXNA 4B2LA 3WYAA 1E1QA 5CYOA 3FTQA 2BMFA 4G5OA 4MKFA 4GI7A 2V54A 1CJKC 1FTNA 1UKZA 4B76A 1EFHA 521PA 4BECA 4DIEA 1P3JA 1TU3A 2ANBA 4KAXA 1R0ZA 4E07A 1DPFA 4JKYA 4LJAA 5D3MB 4QJ3A 2YWGA 2QPAA 3NXSA 4YMUA 4EJSA 1X8KA 2V6JA 1EX6A 4PXAA 2W6JD 4BFYA 4B2PA 4QL3A 1N6PA 1G9XA 4HDOB 4PO8A 3ICEA 4RKEA 4HAYA 4TZ0A 4DSUA 4MGIR 5FTLA 1TUEA 2NIPA 1TU4A 3MSXA 2CDNA 2YOGA 4V0ME 4E5UA 4QRHA 4XH9B 3NEJA 1RW4A 1QZXA 3K0FB 3B13B 3OIVA 1GM5A 2BMJA 3QG5A 2C77A 1T6NA 4C0QC 3B82A 3SYLA 2AWOA 1X1SA 4G5GA 2F55A 1MR3F 1Z83A 2FOLA 2ZE7A 2B6HA 4ZKEA 2O8CA 4PQYA 1CRPA 4JLAA 3VU9A 1HY3A 1X1RA 5FUWA 1ZM3A 2GDJA 4P4SA 1VG1A 3THXA 3SYNA 5E4FA 1XCMA 2FFHA 1R7RA 1E9AA 1NN1A 4MA4A 2ZU6A 3H2YA 4W9MC 2HXSA 5KNBA 1W1WA 5J4LA 3TVDA 3FHCB 1Y3AA 1RJ9A 3GLHA 3GJ6A 4D0LB 2XXAA 1M2OB 2WZQA 1UADA 2ZJZA 2ZYTX 3C5HA 3GLFB 2O8CB 4QNMA 1X8LA 3BIFA 2BCGY 1QDEA 3R8FA 1V5WA 4W5WA 2GWHA 4M1OA 1T3SA 1L2TA 2VHTA 1N6LA 2GZAA 3NWJA 3BJIC 4RD4A 2QI9C 2X2FA 4B3GA 3WNCA 4QNRA 3L0SA 5GJWC 4XSGA 2QY9A 1G8GA 2EFEB 2ZAMA 4GFDA 4UNQA 4C3ZA 1FTSA 5J4HA 1IAQA 1XTJA 2O52A 3EZ7A 1RE0A 3TMKA 4EUNA 5CITA 1OW3B 2FPMA 5JRZA 4C0KA 2NMVA 1D2EA 4L8GA 1G6HA 4G01B 5E7IA 3CRRA 1NVXQ 1SKYB 2EW1A 4ASUA 1KGDA 4Q01A 3QEOA 1KDTA 3A4NA 3FPAA 4HI0E 5KO2A 3CPEA 4WBSA 2F6RA 5FTJA 1SHKA 3GEHA 3X1WA 2L0XA 3BWDD 2ZE5A 4ZKDA 2R9VA 3CRVA 5J4VA 2IYUA 2LKCA 2QAGC 3IHLA 2HJGA 1CP2A 1WA5A 5LB4A 5JWRA 2QBYB 4ZCMA 1UJ2A 1DAGA 4LRWA 2GHIA 4CDGA 2XZOA 1NNEA 1S3GA 3W6OA 1S0UA 5FUVA 1QHIA 3A4MA 1OPXA 3VR3A 4CEIB 2XTZA 1OXUA 3AV0B 1G5TA 4QHTA 1KK3A 2VSXA 1NG1A 1XBTA 2O5VA 3R7WB 1RKBA 1GSIA 3W3AA 1Z0IA 1DAMA 2BM0A 2QMHA 1S8FA 3TJZA 4A6XA 3WP0A 1OHHA 1YZUA 3F8TA 1GOTA 4PHFA 5B64A 2G3YA 5IF9A 4IW3B 2FPLA 2XTMA 2JLUA 2JLQA 2ZRHA 3KZ1E 4Q5IA 1DE0A 3ASYA 1OIWA 3DPUA 1CLUA 4YONB 3EPLA 5C1BA 1HTWA 2DFLA 3AVWA 3OE7D 1JEEA 1MABA 4DLSA 2PLRA 3K53A 1KMHB 2GCPA 3DOEA 5IK2D 2R65A 2WSSD 4LYHA 1OF1A 4G5RA 1G1MA 4LWZA 2GCOA 3RC3A 3WBKA 1FFHA 3SE0A 2OCPA 4RKFA 2XEXA 4JJKA 3VR4A 1XCGB 4PQFA 4JLPA 2WSSA 3TLXA 3LBHA 3ZQJA 2QAGB 4HLUA 2V3CC 2HCBA 5F98A 1DBSA 1GP2A 1E2JA 4MUBA 1R5NA 2KBFA 3TBKA 4AKIA 1AK2A 5EUMA 1W2GA 5FOTA 2XTNA 3BERA 3A1UA 3DEFA 4GOKA 1EK0A 2Q6TA 1E94E 4WXRA 4Q7KA 2G77B 2IWHA 2ZI4A 1OXSC 3SC3A 1KMHA 2ASEA 1W5TA 3K9NA 3EX7C 3QKSA 1AA9A 4JLVA 2JATA 1NLFA 1GTVA 2FFAA 3I72A 2O8FA 1SVLA 1FP7A 3AKDA 4A2PA 3T06B 1A2BA 3L0OA 2LWIA 3Q85A 4KCGA 3QF4A 1XJCA 4Q9HA 4PSVA 3SFVA 4B3CA 3OAAD 4TLDA 2WWYA 3QY0A 2JLXA 1RRGA 4Q1DA 3TSWA 1VCMA 5KDLA 1R5OA 4H9GA 4LBWA 1S1CA 3S1AB 4QBHA 2ZTSA 3AP1A 2GAOA 2VLIA 4LC0A 4X8MA 1Z5ZA 2ZUBA 4EFMA 4C7OA 5JEDA 4NCHA 1Q1BA 2BMDA 3EC1A 1E2LA 5LDDC 2FJUA 4NDZA 4M0LA 1EESA 3BRWD 1XD2A 3K09C 3QVUA 3OF5A 2RHMA 2NGRA 1ZINA 5JECA 3BE4A 2EFDB 4QJ5A 4M1KA 4IOLA 2ONJA 1CXZA 1OXXK 1T3HA 2QM7A 2QENA 1P5ZB 3EW9A 3X1XA 1SXJE 2WWIA 1Q1QA 4BUJA 3PITA 1KDOA 5JFGA 4XD7D 5DN6A 2V9PA 1NJFA 2IC5A 2DY1A 4X8OA 5BN5A 1E3MA 3CNLA 2XNDD 3D31A 5JHHB 3P26A 4M1SA 2ZXUA 2CHGA 2RKOA 2XB4A 1G4AE 3KTAB 3AGQA 1ZIPA 3EASA 4DEXA 5FBVB 1NN5A 1WF3A 4GBMA 4IOKA 3U3OA 1NY5A 1N0VC 3PUYA 1V43A 2DR3A 3W8RA 2ZUCA 3KQHA 4KSCA 3K9HA 4TQ9A 2AXPA 5AJWA 1KJWA 1ZM9A 2OM2A 5GJVC 4CT4B 3BK7A 4KBGA 4QFMA 4YXWD 2Z5FA 1J2JA 2JJ2A 4O0MA 5SZHB 1G16A 1ZMXA 5JJIA 1MO5A 3N2IA 5CLLA 1E9FA 3R8CA 1TAGA 1SVIA 1U98A 2B8WA 1YU9A 1IN5A 5FTMA 4BFWA 4B35A 2SHKA 1FUUA 5H68A 3W34A 2WOOA 3RNLA 3HPRA 1E2NA 1P4SA 1SVWA 4P4UA 4JKIA 4S2EA 1H65A 3RHFA 3MWKA 3QIAA 2ZRFA 4C2UA 2WJJA 3VTKA 2QMEA 2JLRA 4AURA 2I3BA 4EKDA 2FA9A 2AK3A 3A1WA 3K9LA 1GRNA 4IJMA 2IXGA 2PCLA 3QKTA 5KUTA 1WCV1 5KTYA 2JLYA 1XF9A 3HU2A 4FN5A 1F2TB 1LF5A 4D4LA 1NBMD 4MYUA 5K8TA 2DB3A 2G83A 621PA 3WP1B 1CIPA 2B8TA 5F2EA 1P72A 1E2EA 3LBNA 3UPUA 4OI1A 4D0GA 3G82C 3KKOA 4LY6A 4GOXA 4IFBA 2NPFA 3ZLJA 2ZEJA 4W5JA 2IF0A 1EX7A 5IK2A 1LY1A 3TUJC 4D80A 2NOAA 2QP3A 2I1VB 2J45A 5A5GA 1IONA 2C03A 1E1RD 1KK0A 5JRJA 4F93B 2GK6A 1OYYA 3SZRA 1OV4A 2WWFA 3NDPA 4C0JA 1GRQA 4UKDA 3U7EB 2Z83A 3QQ5A 4DLZA 4EFLA 1MKYA 4V0NA 3CW2A 3HJNA 3EARA 5FOVA 2BV3A 2WWWA 2AL7A 1KI4A 3PENA 2REOA 4I81A 4PC7A 5CIWA 3ZVMA 1QVRA 4Q7MB 1DAFA 2BC9A 3A1SA 2AKYA 4QOSA 5EP2A 2YHSA 1W0JD 1KO5A 4A4DA 2HCJB 4TTQA 1S96A 3QXHA 3ONWA 4CEHB 4IEIA 1EXMA 1Q1EA 1XZQA 4YDSA 3FWYA 2CE2X 1G20E 3TAUA 1XRJA 1KIMA 1W4CA 2Z6VA 4LPSA 3WRYC 1ZU5A 1G17A 1G5RA 3HPQA 2VQSA 3BH0A 3K70B 2O0JA 3LV8A 2VEDA 5C4GB 1UKEA 3PVSA 3AB3A 1WE2A 2WIBA 4DLUA 4ARZA 1KI9A 3MAAC 4XSHA 2PJZA 2QSZA 1KO4A 1ZW6A 1KK1A 1N5IA 3OAAA 3EZ2A 5C46F 5J4YA 3CO5A 3W90A 5CLQA 4D26A 1ZM7A 1G3QA 3X1YA 1U2RA 3VKWA 4DT1A 3KX2A 1LS6A 1LW7A 4NCKA 1IY1A 1GL9B 1OLOA 2R6CA 3SYKA 3VMFA 1NBME 1FQKA 3MFYA 5DSZA 1MT0A 1XPUA 3B1XA 4M21A 1GITA 4PAMA 1SKQA 1KO1A 1KKMA 2OV2A 1T91A 1XNJA 4DLRA 221PA 1XXHB 1UM8A 2QU8A 3QPWA 1Z6XA 3LXRA 1XP8A 2D7CA 3I61A 3DMNA 3KTAA 2XAUA 4RCYA 3ICQB 2W58A 1U99A 1XX6A 2ZJ5A 4HDQB 3CX7A 4DEYA 4BPBA 3B1VA 2LKDA 1D8TA 4RJLA 5BQ5A 2FWRA 2VSFA 3MD0A 2ZSEA 5E7JA 3PV0A 5K8IA 3AH8A 1PLJA 3D3QA 4POAA 1G7RA 2ODEA 1L4YA 1N5KA 5KYKA 3AVVA 1Y63A 4M9ZA 1G3IA 1AZSC 1NN3A 2GEVA 1BO6A 4O25A 4RZ3A 4G5QA 2I1QA 1F2UB 2GJAA 3QBTA 4MRSA 2VO1A 1OHHD 4L5BA 2OFXA 3SS8A 1FNMA 1F5NA 3IEUA 4OI2A 1YR8A 3TQFA 4J0QA 1T8TA 2YJTD 4BFXA 4E22A 4B3DA 4CEJA 3FHTA 4QM6A 3T5GA 3HDTA 3THWB 1QG2A 1D2MA 2PMKA 2A5YB 3UATA 1QBKC 2XSZD 3LQRA 1YZQA 1L8QA 3OE7A 2IYQA 1EG7A 2FPKA 3D6TB 4KBFA 2DWPA 4M9SA 4UXIA 2AFIE 2JLWA 2EYUA 2HLDA 2PMDA 3RABA 3QKSB 4WZBE 2N46A 1MOZA 1XCPA 2FG5A 4B3FX 2VP5A 4GMXA 3O8RA 4LPKA 2WPDD 2ZIAA 3SJCA 4A0RA 3BXZA 4JT4A 1E79A 4Q21A 3U3JA 3WYGA 1CRQA 5GJBA 3OFNA 1N25A 4A8JC 2AWNA 4ZDWA 4OK6A 4DB2A 1GAJA 2GCOB 4LUCA 2QGZA 2ZYVX 3O47A 2XGJA 4BZQA 4AWXA 4EIWA 1QHYA 3EXAA 1I4TD 3QPVA 2ATVA 4UNNA 3B9QA 3HR8A 4TLAA 2J9RA 4FWTA 2Z0MA 4O2RA 3JVVA 1NMZA 3K1JA 4NKRA 4HAWA 4DKXA 4V0MA 4Z8XA 2GJSA 3IIMA 2AHOA 3AF4A 4P32A 1AQUA 5JS7A 2YINC 5A0FA 2FNAA 5L3RA 4DLVA 1D9ZA 2HXYA 4C0BA 2IWRA 3IILA 3LW7A 5FOXA 5KU1A 2BKEA 3D8BA 4TYQA 5FPYA 4NBSA 3L0PA 4I1OA 2EWWA 3FKSD 4HSEA 2C9CA 1QHSA 4AYTA 3RAPR 5BYKA 4BFVA 5JEEA 5B57C 2IXEA 4M22A 2Y8EA 2ERXA 3EWSA 1FP6A 4FINA 4KYIB 5FBLB 2C9OA 1XZPA 5FBRB 2J0UB 4JLKA 4NMMA 5TMPA 4XTCS 4DXAA 2OCBA 2F7SA 2BKUA 3KFVA 3AP3A 4D6PA 4OHXA 1YKSA 4DVGA 721PA 3I5YA 3GFTA 5KSOA 1GILA 2ORWA 4MYCA 1YZTA 3NKVA 3L43A 1TEVA 3EZ6A 3PEYA 4TL6A 3MUFA 5HTKA 1SXJA 2YVUA 2OSBA 4AKHA 4ZDJA 3C5CA 3U2QA 1M74A 3T34A 1COWD 2AKAB 5EP4A 1IN4A 1Q21A 4BFSA 3NC1C 3EWAA 2X77A 3C8UA 4EPXA 2NO7A 2WJIA 3ND9A 2RGBA 4NYMQ 2K5UA 1LV7A 1NIPA 3UMFA 1M1YE 4BRWA 3Q8XB 4QKQA 1WQ1R 4BLTA 2EFGA 1LS1A 2VH5R 2WSMA 1P9WA 2A5JA 2NO0A 2ZR9A 5LB2A 2W0MA 3GJ7A 2P3SA 1W36B 1ANKA 1DEKA 1SXJB 3CM0A 5CB6A 4BRUA 3FDIA 3VNVA 4DCTA 1KYIA 2WKRA 4U02A 1TQDA 3LVRE 3CKLA 4IFEA 1KI8A 5FH9A 2R6AA 1AQYA 3RDPA 4ABYA 1NL3A 4X8HA 2OXRA 4FWIB 4GT1A 2PL3A 3TKLA 2WWGA 1ZNZA 2GESA 1KAOA 4I1UA 2ZJ8A 3VKGA 3PUVA 3KKQA 3QI2A 1PZNA 3C15C 1E9BA 3TUZC 4C2TA 1C1YA 2UVQA 3DM5A 3I5XA 2W83A 4C0LA 1ZU4A 4NYIR 4RZUA 1X3SA 5JSZA 4DLYA 4MGYR 3SI7A 2JIZD 1N6IA 5D3QA 5J4KA 1ZD1A 5TXGA 4OQNA 2VHCA 1OH8A 2CL6X 3CF2A 3AP2A 1ESNA 2XB2A 1GUAA 1TMKA 3I3SR 3VKHA 3FMFA 4UNPA 5JWOA 4B32A 1XEFA 2IYLD 5EE3A 3KKNA 5BXQC 4EAQA 2N1BA 1JXMA 3U6KA 2ANCA 2R2AA 1NSFA 4GZMA 5AJZA 2C2HA 1TQ4A 2FZLA 2QAJA 4PHGA 1N3BA 4O3MA 5FBWB 1K6MA 3W9YA 4N0EA 1MH1A 4JL6A 5BN4A 3WNDA 2D2FA 2QM8A 3MMPA 2J7PD 4DCVA 4HUTA 4ITRC 4Z54A 4OBEA 3K8YA 4GDFA 1QHXA 4IDQA 5GADl 1SQ5A 2ZPTX 4ZO4A 5JCPA 4LCBA 2ZRIA 3OIUA 4QBIA 3QXJA 5FI1B 3NBZC 2FV8A 2F1HA 4DIDA 2ZRLA 1HA3A 1NLYA 1H8HA 2J0VA 4QG7A 2J1LA 2IYWA 2WVJA 2NO6A 5FTNA 4Q19A 1NJGA 2G1KA 3T12A 4CRWB 1I4LD 4XWKA 2IBMA 1YQTA 3RVBA 1HEIA 2WV9A 2FGKA 1Z0FA 4ACBA 5AUNB 1H8HD 2CXXA 5E95A 3P4XA 2WJYA 421PA 3CRMA 3EG5A 1A5TA 1KOFA 2C96A 4MYHA 4JVNA 1TTTA 2B92A 3CF6R 5AUPB 3Q5DA 1XPOA 2RGAA 4DJTA 4Q1FA 3UANA 4OHWA 4LYAA 1JQLB 3GLIB 2XITA 1XPRA 1LTQA 2PBRA 1Z06A 4PPQA 1UBCA 4UNSA 4A0GA 3I32A 2BEJA 2VBCA 5JWHA 1NVVR 3ND8A 1Z0JA 4R9UC 1ZVQA 4MRRA 2F9LA 3BH7A 1EFUA 1W2HA 1XJ0A 1AKEA 3CB4A 3WMEA 3FKSA 4NYJR 1XMIA 2WAYA 3HU1A 3AM1A 2Q9AA 4LV6A 3THOA 1X86B 4DB4A 2IS2A 1ZIOA 5HE8A 2X8AA 3PXGA 4XVUA 2RAPA 3J81k 5KSZA 3KJIA 2GILA 2WICA 3T61A 1XTKA 3VR1A 1TQ6A 4OQXA 3K9GA 3QKRB 2N42A 1ZRHA 1NG9A 5FPTA 1MO3A 1FX0B 5L8VA 5IRCD 5JI2E 1E32A 3A37A 4RFSA 5P21A 3ADKA 4DDVA 3S1AA 1IJEA 4TLCA 5K8LA 3PUWA 1NLZA 3RSOA 1FPMA 1W36C 1E0KA 1KHTA 2O8BB 2IEZA 4CZ2A 3R7WA 1J7KA 4ESHA 2DFTA 3TVTA 2ZS8A 2GAAA 2EFCB 2P2LA 1SHZA 2REXB 3VR6A 3LH5A 4LHYA 2KBEA 4IXMA 4Q4HB 3UG7A 4RSGA 3B85A 3V9PA 4URWR 4AG6A 1VYVA 2BBTA 1B23P 1OSNA 2QPOA 4MDFA 2DYKA 5DISB 4F7WA 1VG0B 1E9SA 1VMAA 1Q44A 2IUUA 4B73A 4TMKA 4M1MA 2AR7A 2W6IA 1P73A 2XOKD 1Q57A 4AIIA 2QSYA 4P4SB 4PANA 1G8PA 4LJ7A 2J0QA 2PH1A 1P60A 4NPHA 2XZLA 4LYJA 3FHOA 1E0JA 3ZS9A 2IXFA 1EFTA 4IOMA 2IL1A 3EA0A 4YDHB 1CJTC 2ZVPX 4YXWA 5TVKA 2VP6A 3THYB 5CK5A 2XZPA 2OBLA 4NYJQ 5HE9A 5B2ZA 3MJHA 4NCNA 5EUQB 1ZNXA 2ZR7A 4LZZA 4WIAA 2O8DB 1DAEA 3C14C 3V4FA 5F9HA 2IX3A 2AX4A 3ZIAA 1D2NA 4PO9A 2IS6A 3IGFA 3UK6A 2ZS9A 4D25A 2CJWB 3DM9B 3PEUA 4WZAE 1G7SA 2RGNC 4LSGA 2A5DA 2QE7D 1UPTA 3CWQA 2W0SA 2DPXA 2ZYWX 1DADA 3MWYW 3UWKA 2QTHA 5HKKA 2O0HA 2ZU0C 1S1MA 4ZIRA 4TYPA 2ZJAA 4Z51A 5H8WA 1IN8A 4MKIA 3A58B 4XIGS 2WOJA 2GCNA 1R0WA 2GF9A 1Z6GA 2ZS7A 4JL5A 2O8EA 3GJ8A 4D2IA 1KMQA 4DCSA 2A78A 2QT0A 1TF5A 4OJKA 3HYTA 3THXB 1W46A 4Y0VA 4FCWA 5L3SA 2R6FA 4BGDA 2IS4A 5EE9A 1NY6A 3NEYA 1MV5A 4JBYA 1NBMA 4YMSA 2WMOB 4A8JB 4G3XA 1W36D 4RZ2A 4OQMA 4BASA 3MWLA 4ZI2A 2BJVA 2AFHE 3P4YA 1UBGA 2ZRKA 1ZM2A 2CLCX 1Z08A 3TW8B 3V4RA 3LX8A 1I2MA 1Q1ZA 5FOUA 1JPJA 2OCYC 4XVQA 1IOZA 4A9AA 1JI0A 3C4JA 2P5SA 1HURA 4QGAA 1XD9A 1FNNA 2FX3A 4MH0R 3U44A 5G41A 1NI3A 2PCJA 2GEUA 2GA8A 2NO9A 2MSCB 3QXXA 4Q9JA 2QL6A 3M6AA 3SU8A 2EQBA 2XX3A 1KSHA 2OBMA 1E96A 2Z43A 4M4SA 4IDNA 4BLQA 3U4QA 3EAQA 3AVTA 3Q9LA 4LK2A 1W0JA 2WM9B 2WMNB 3E5HA 4IVPA 3GLFA 1HQCA 3C41J 1IM2A 1RPZA 1A2KC 4NP6A 3JZAA 2GJKA 5AUOB 4NU0A 1FZQA 4FCVA 4BZXA 2CMKA 2ZRGA 4B2IA 2GXUA 4HB4A 2H17A 4TMXA 5BWMA 2NTYC 4YMVA 4PFSA 4Q4JA 3IPYA 3FFBA 1NSTA 2KJQA 5B58C 1R5BA 4MRPA 1UDWA 3MCAA 4V0KA 4M53A 3AVPA 3VU9B 4LHVA 1TL7C 1KNXA 4IDPA 4Q4LA 2H16A 1NKTA 2IA5A 3L2OB 1TQ2A 1D9XA 3AEZA 1N0UA 1II9A 1Z3IX 3IKJA 1OH5A 2EWVA 5ELXA 4C9BA 1VCNA 2DCUA 5FOSA 3SJAA 3AF1A 4TYNA 3R9XA 3W8NA 4IEEA 2DHRA 3QXSA 4FIDA 4ZDIA 3AVUA 5HZKA 2NZJA 4XOIA 4N3NA 1YR6A 5M04A 3CR7A 4N0DA 1AKYA 3AUYA 3P1JA 4JLOA 3ZQ6A 2H57A 2F1IA 3FMIA 4GRAA 1M7GA 4PAQA 5KNDA 3BFVA 1T0JB 2CLSA 3GEEA 4JMPA 4C7OB 1T9HA 3F5FA 4TYWA 1BOFA 4URYR 2BHRA 2V1UA 4H1UA 1CS4C 2GXSA 2V7QD 3EZFA 5EP3A 3GLFE 2D2EA 4PZLA 2IUTA 4MYTA 3FYHA 2ZM5A 1Z0KA 2XNSA 4B3BA 1U81A 2ZSBA 2R6GA 3THYA 3IIJA 4OHZA 3RANA 4ESVA 5E7MA 2VP2A 2TMKA 1Z2AA 3N70A 4HLUC 4HUQA 3WMGA 2O8DA 3R9WA 4QJ4A 1KY3A 4AK9A 1S9DA 2Q3MA 1W44A 1NVUQ 2VHJA 4TQAA 2OT3B 1G3RA 3LQQA 1XXHA 3BS4A 2Q3FA 3IHWA 1K5DA 1XEWX 4F4JA 3AKEA 1II0A 1L4UA 4AY2A 3QVVA 1T5LA 2G0TA 1AZTA 3L82B 3REGA 3BFKA 1IN6A 2J46A 3SQXA 2W6JA 2WWXA 3A36A 3K0EA 2VHQA 4WXPA 3QF4B 3T35A 2D7DA 3BOSA 1ZD8A 5FL3A 3UKDA 1E1QD 2ZRNA 3NHAA 4KVAA 5AJYA 1E2MA 4LDJA 4A0FA 1OXVA 1RRPA 4F92B 1RYFA 1U8YA 2O0KA 4S35A 1N6RA 1CJUC 3QUSA 3ZZTA 1VCOA 4HEJA 4N1AA 1A1VA 2IYYA 1YRBA 4UJ3A 2VRWA 4XJXA 1Z2CA 4MRNA 1YZLA 4F38A 4YMTA 1RC8A 3H84A 3G0HA 2H92A 2R6DA 5CB8A 1Z6YA 2P6NA 2J7KA 4FXPA 1KZ7B 1O87A 5GJCA 4BZPA 2IHBA 1W5SA 2JA1A 1KKLA 2CNWA 1UEJA 4B44A 1RZ3A 1RYHA 1OKKD 3SNHA 1JXOA 1VHTA 4DLWA 3LBIA 3WXMA 5DE3A 1Z22A 1XU4A 2ZETA 1D5CA 1XJQA 4LOAA 4BLPA 2NQ2C 2OG2A 1OKKA 4PPNA 4BFUA 1KSGA 1KO8A 1TF7A 4O2LA 2FZ4A 3NIBA 2IYRA 4JYCA 4KHZA 1YVDA 2ZAOA 5EXPA 2GZDA 3L0IB 1GNRA 3P27A 2ZRBA 4Q18A 3AKYA 2CEAA 4YMWA 1IQPA 1EFRA 1OE0A 1PLKA 3W3ZB 1O3YA 2J41A 5CJ2A 1ONBA 4V0OA 1KI3A 3RS4A 1KI7A 4LHXA 1G64A 1EFRD 5JZVA 1M8PA 2J5XA 3QPUA 1OIXA 2C95A 3UWOA 3GLIA 4EFNA 3M1IA 1DO2A 1UBEA 3PG5A 4LX0A 3BD9A 2IYTA 1UKYA 4A6PA 3W6PA 3QE0A 3CPJB 1E2GA 3E70C 3R9IA 2RGDA 3TW4A 4V03A 3B2EA 1BYIA 3C7KA 2OBNA 2QPTA 4JSTA 2ZQ5A 2ONKA 5ANRB 3OZXA 1AS0A 4L9SA 2BJWA 3C16C 3QEJA 2J59A 3WRXC 1AGRA 2OLJA 2HT1A 4KLZA 5JS8A 3I8XA 1AIPA 3LFUA 2YZ2A 1QHHA 5DYGA 3SHWA 1IJFA 5G53C 4LHZA 3EZ9A 1SVMA 1WP9A 3PUZA 3U4QB 2GJ9A 4EJSC 1T0HB 4EPVA 3GLGB 1XMJA 5GVRA 4M1YA 2QROA 2QRZA 1IXRC 4Q1EA 3TR0A 3VNUA 2FSGA 2ZANA 3I62A 1WBDA 1YE8A 2KE5A 3RWOA 4YC7A 3IQXA 4LV5B 2RH5A 5BYJA 2AN9A 1BKDR 1KSJA 1U9IA 4TQUS 2JLVA 2O8EB 2UZIR 4B6EA 2QRNA 3VR5A 1ZC3A 4HAXA 4RD0A 2YC4C 4URXR 1HT2E 3NBXX 4K81B 2F3RA 5D3MA 1MRNA 3DOFA 4DDUA 1XEXA 4LJYA 3SR0A 4B71A 4DBLC 3GLGA 2OE2A 5DI9A 4DDWA 3OEEA 4PC3A 2OAP1 3KQLA 1CEEA 2D06A 4CIDA 3Q7PA 2CJWA 2GJ8A 3P20A 4HLQB 4FMBB 5DI3B 3D7MA 3SOPA 5JHGB 5DHFA 1U8ZA 4RD3A 2W2TA 4LBYA 5SZJA 2PJRA 3VFDA 1SGWA 3KXLA 4DSOA 2H5EA 3LVQE 3Q5EA 3LDAA 1HV8A 1LF0A 2D62A 4QHSA 5DH9A 4F4IA 1E2PA 3F3YA 4CT5A 4DRZA 4EQ6B 1U0LA 1JAIA 2BVNA 3DO6A 5KSPA 1ZNYA 3UXMA 3U7GA 2DWQA 4ERNA 2A5GA 3IO5A 1HQYE 4HYYA 1US8B 3EPKA 2VL7A 4E03A 2REBA 1PUJA 3M0EA 2D74A 3GD7A 3KJHA 3TRFA 3BB3A 3GJ5A 2ZYUX 4B75A 3W5JA 1KNQA 1G8FA 3GJ0A 3SBEA 4A92A 4DLXA 5KPJA 1RJ9B 2PZGA 4Q4JB 2BWJA 8OHMA 2VP9A 2KSQA 3ASZA 3UIEA 4RD6A 3W5IA 2FN4A 4LJ4A 4R2IA 2EYQA 2IYXA 4DUGD 2QA5A 2ZI6A 4HZUB 1RVDA 4MGZR 4L4UA 2ZI9A 1GZSA 4QC2A 3OHMA 1Z63A 4DUGA 2CNWD 1N5JA 3FOZA 1UBFA 1TX4B 4Z1MA 2OXCA 2HDNB 1UKVY 5HCIA 1XMVA 1VG9B 2JLSA 3E2IA 4M1WA 4PHHA 4RD1A 5A4JA 2GF0A 2ZRMA 4B48A 4E09A 3B5JA 4GPTA 3VAAA 2RB4A 1J90A 1Q3HA 4OJQA 2C04A 2QQ0A 5EZ5A 2QG6A 4TL8A 5CDFA 5DN6D 3U44B 1P9NA 1A7JA 2CHVA 1CKEA 3QF7A 3U7HB 4MDEA 1HH4A 4JS0A 4DDTA 4AYWA 3OEHA 3QNUA 1DARA 4WOPA 5DHAA 4XVRA 4CEHA 5EXXA 5KOYA 1FOEB 3ZVRA 1W48A 821PA 1F3OA 1WRBA 4KYUA 1FMJA 3V00A 3KB2A 1M7HA 1BMFA 4PX9A 2GVZC 2JDIA 4ARZB 1ZUNB 3N2EA 2RHDA 4URVR 5CJPA 3G5UA 5H70A 5AUQA 1KJYA 2FGJA 2IYZA 2AD1A 2OLKA 4LBVA 5L3SB 4TMVA 2XNDA 4KJZA 2IS1A 1GIAA 3GFOA 1BYUA 2WAXA 4TTRA 2NO1A 3K0CC 3UMSA 4UNRA 2FF7A 3ZDQA 3MGCA 4OKSA 3AVYA 4JLBA 4HAZA 3ZD6A 3LX5A 1PUIA 2XSZA 4PR0A 4KFSA 3WHLA 4NHOA 4UQOA 5H1YA 1DG1G 1RIFA 3T1OA 1W7AA 1YJ5A 5G40A 2W6ID 1WB9A 3GLHE 2BBSA 1JQJC 5KSYA 4KSBA 2JJ2D 4OK3A 1JBKA 2AK2A 5EJEA 3FB4A 1KSFX 2X1VA 4FD2A 2YWEA 4BWYA 3U60B 2DFNA 4KLNA 4ZV4A 5JJKA 1E0AA 4TT3D 1SULA 1OB5A 3T1TA 1PJRA 1OIVA 4YLGA 3PUXA 1DELA 2Z4RA 3H0KA 2WKPA 1G3MA 1XXHE 1EWQA 4B74A 1P61B 2ERYA 1F2TA 4K46A 1YR9A 4HB0A 2A2ZA 1VCIA 2EU8A 3QXCA 2FH5B 3NBYC 4GL2A 1II8B 4P0TA 1XTIA 1N6NA 1R2QA 5AJVB 1GRRA 3A8TA 4B3XA 5JCZA 4NZYA 4BFTA 2GTPA 1ZBDA 1GKUB 2PEYA 4FMDB 4BEJA 4F91B 1N0WA 5FL7D 3B1ZA 3CRQA 4HB2A 5FI0B 5C2JB 1DG3A 2QTVB 4Q7LA 1US8A 2A7QA 2FSHA 5FTKA 1AS2A 1A4RA 4D4KA 4KITB 1M7BA 3QSYA 4A15A 2J0SA 4R98A 4Q7JB 2ODWA 5BW8A 2PX0A 3B1WA 4MUAA 3VHXA 5FPSA 2PEZA 1RRFA 1P2TA 1P62B 1G41A 1GL7A 2QP4A 3E1SA 4KV9A 4MITA 4EPYA 1JR3E 1OT3A 2ZITA 3SJZA 1FL9A 2ZSDA 4NONA 4Q4AA 2QTFA 4US1R 3GPLA 1G19A 3B60A 1Z6TA 1Z29A 2CHQA 4JJZA 2D3WA 1CJMA 3LW8A 4FMCF 4FW9A 2VF7A 4C0AC 5C4MA 4OQFA 4IKEA 1JEDA 1JNYA 1IXSB 2WTUA 5IT5A 3GEIA 4PSKA 2IYSA 1KZGB 2QNRA 5CK4A 4B47A 4BLSA 1CF4A 2BEKA 4U00A 5JJLA 1G5PA 2RGNA 2WHXA 2FEMA 5FUXA 3T5DA 2WJHA 3NG1A 5AWFC 4NH0A 2KB0A 3W6NA 4D82A 3U6BA 2GXAA 2FE4A 1KO7A 4ZCIA 3VR2A 4NYMR 1E2HA 3TE6A 2CE7A 2V8OA 3H4MA 4EQ6A 5HZHA 3SQWA 1P9RA 1VDZA 2BMEA 1NMXA 2H7VA 1QG4A 1S3SA 5FFMA 3ZGXA 2RGXA 4CVNA 1ODFA 1Q3TA 3LA6A 1OYWA 2DWOA 2JCSA 2JJ1D 2IW3A 3KXKA 4LC1A 4ASUD 2OHFA 2F43A 4NE2A 3KJGA 2OUKA 2G0NA 3L8ZA 3K0AB 4FMDF 1EWRA 4C0HA 1JJ7A 2HYIC 2IUSA 2GETA 3CPHA 3O8CA 3VX3A 3TQCA 1J70A 2CL0X 1XTRA 3KUDA 2WJVA 4LI0A 2CVFA 3DZDA 5FPHA 2GZHA 1MO4A 2NPIA 5FBQB 1R10A 4DWJA 1P6XA 1N5LA 2F3TA 3BORA 5EZ6B 4EDHA 4P33A 3A1VA 2VA8A 2YWFA 2ZE8A 4TN1A 3CWZA 4QGGA 3HWSA 5JMTA 2XXAB 1TNDA 4XWOA 1J8MF 4DLTA 4HB3A 4PPFA 2BDTA 2QMOA 4ACAA 5KHOC 2H8KA 2IYVA 5DIFA 1GVNB 4EJSB 1IY0A 3T15A 3U3MA 3AGPA 3KJEA 5DNYB 2AD5A 1TF2A 3DKPA 1NVWQ 4RD2A 4WVFA 4KVGA 1JJVA 3VQTA 3KQKA 3CNOA 4OK5A 2ZI3A 1E1RA 3N5CA 1M6NA 1QHHB 3I1FA 1KI6A 1ZJ6A 2WIAA 2DBYA 4JLJA 3CIOA 4Q1CA 3GLGE 1S2MA 3PQCA 3T1VA 2JASA 1MRSA 2V4ZA 3RRNA 4LYFA 3ZZ0A 2BBWA 5KNCA 5FR1A 4HLDA 4P4TA 2IF2A 3LNCA 1Z47A 1QHGA 1CU1A 4GSYA 5EQTA 1E69A 3U5ZB 4U7DA 4PTLA 4CEIA 1T8UA 4AKGA 1WDTA 2ZJYA 4HAUA 5AK0A 3AF2A 5DYIA 3B1YA 1J99A 1TADA 4EPTA 4JVSB 1G6OA 2OESA 3CZQA 5TARA 2QBYA 1QRAA 2CBZA 3Q3JB 1NRJB 3WBJA 3FE2A 1PV4A 3IUYA 2CVHA 1HYQA 1IBRA 4BFZA 3KDSE 4URZR 4Q1AA 1CBUA 2PLFA 2YNMA 4R71A 1TUIA 4QGHA 4A82A 1CR2A 2Q9CA 1S9HA 4W5HA 5B30A 5J47A 2R8RA 2QUZA 2ZR0A 2CLDX 1XD2B 1YZKA 3A1TA 3K0AA 3L8YA 3RS2A 1WBBA 4HUQB 5DGXA 4CF7A 1W0KA 3B6EA 2MMGA 3KL4A 1YHNA 3ADBA 2ZRJA 4KU4A 1E0SA 5FL7A 4URUR 1KDPA 3DKVA 4P31A 3X1DA 4JBXA 5C18A 1C4OA 3K0SA 2IK8A 2X19A 1IY2A 5JLJA
chains in the Genus database with same CATH superfamily
2PX2A 3K94A 2FDRA 1WB4A 3DLIA 2MSDB 1ACLA 5KPDA 1A8QA 1KQ3A 5FP0A 2ZRPA 1GPNA 5LMNB 2I87A 1ZXLA 2Q0HA 4BIIA 2N47A 2VZLA 2CF5A 5LU9A 2GBLC 2QAGA 3IUPA 5CVVA 1JFLA 3E9RA 5FOWA 3TQRA 5A5EA 3K0CA 1YS1X 3UOGA 4RIFA 4DA4A 4RL4A 3Q3CA 4ZQHA 3F6BX 1NNSA 3JS5A 4NCAA 5B7GA 1QGZA 1N7HA 2JGAA 2OCAA 3DUWA 4JHLA 3KVOA 4JZYA 4OHYA 4FFWA 3FNFA 2QVCA 3EWNA 3LT0A 5LOVB 4UU1A 4YI5A 4DCUA 1J5EB 2OXEA 2UKDA 3N53A 3KPVA 1U2SA 4D6XA 3N59A 1P0MA 2QRQA 4JZKA 4FDMA 4C22A 3AB8A 4LOHA 1WXQA 4Y9DA 3TJMA 1NJ2A 1NUSA 3B6IA 4M1EA 1SVOA 3HUTA 4H7HA 4W63A 3BSFA 1YT5A 3CLVA 3GJ3A 4KFTA 3UA4A 4R3WA 4DMRA 4YAWA 3F97A 4Q02A 1TJ5A 1W30A 3M81A 3PRHA 4MW2A 1T25A 3OQHA 1FUIA 1T4CA 3PHIA 3A25A 1Y1RA 3TXXA 2FSFA 3FUVA 4F8EA 3GBPA 2DAPA 4F3RA 1EUDB 1HE1C 5B1IA 1R27A 3B48A 2O0LA 3DJFA 5DT9A 4J29A 3G0OA 1NW8A 1SXJC 3FGNA 3PFHA 4UNIA 2LV8A 4G5SA 2D5BA 1I7NA 4YV1A 1JLRA 2YCBA 1MVOA 2WI8A 3V4VB 1LRKA 1AM4D 4TS3A 3GVPA 3WAKA 2O14A 3HL0A 4JVMA 3BD8A 4AN1A 5L9AA 3DAGA 2KWIA 5CW1A 3UHFA 1ORHA 2WPDA 3UN1A 1VGRA 4LI3X 4N5HX 3ESRA 4XASA 1HUQA 1WDWB 4H7DA 4JLDA 3QVMA 4YVFA 3Q6NA 2CCJA 5KTKA 3U19A 3EXIB 1NN0A 1ONSA 1UF9A 2BCJQ 2VF5X 2EKZA 1BW9A 4N6NA 2ZCUA 4JOSA 3QM1A 4BPRA 5MN4A 2Y71A 1MPXA 1NMEA 1X8JA 3MFQA 2ZJFA 3UG6A 1LPAB 5JXHA 4H17A 1DAIA 5JRDS 1ABBA 2QLMA 4RZXA 5DM1A 1K06A 2EX4A 2LR0A 4U0KA 4AZWA 3EUAA 4L95C 1T1JA 1X6VA 2BFEB 2WE7A 5K0NA 4F5EA 2BT4A 3ZE8A 1YONA 4S1VA 2CFTA 4W82A 3EYAA 4KXXA 1K8XB 3QHAA 1B0UA 2JH9A 3X1ZA 1ID1A 2NVBA 2PAFA 2BEVB 3I2JA 3OOHA 3J81A 1RI5A 1E2FA 3OJEA 3QE2A 3V3TA 1Q83A 4JN6B 1FW6A 3NH9A 2NU6A 4G5HA 5J1TB 1EBUA 4JC5A 2PR2A 2JIBA 2DGDA 1KI6B 2FMXA 3TEJA 5TDHA 4D4MA 3OZVA 1RXWA 1WXHA 1RLTA 4Q3BA 2G7MC 4CMCA 1N1EA 5REQA 2Q1WA 1JPNA 3CSUA 4EJMA 2HNBA 2HTFA 3CMMA 5EI5A 4P36A 3DV0A 3HUEA 4IYRA 1NNI1 5KYYB 5C31A 1SVNA 3B89A 4KQGA 4ZQCB 2I9KA 1JR3D 2W98A 3H83A 4RA6B 4MUYA 4MZXA 1Q0HA 2QVXX 2GGSA 3MAGA 2RGGA 4FYJA 1DKUA 1GA4A 3F49S 3T38A 4DQUA 4JYBA 1NI5A 2ZREA 3GAMA 4I4TB 4J1TC 1XA4A 2C7GA 1JN0A 4PZEA 4V3BA 1QQ7A 3LUHA 2GBCA 3KHUA 4OMFG 4NSNA 1XD8A 2Q0QA 3W5UA 3WMRA 2VTKA 2DP4E 3T5MA 4D4GA 3D3JA 1T8SA 1Z4LA 4OL0A 4WEOA 4IH9A 2C5GA 2V7WA 3DNMA 1YBHA 2Q4EA 1KKUA 3EA5A 1SXJD 5AOBA 4JYMA 1OB2A 3H17A 1PF7E 2ABWA 2QN6A 3BC1A 4UM9D 4CM1A 5JCXA 1YB4A 2WABA 1UBKS 1U2TA 1VE3A 2HWKA 4DNQA 4U2BA 3U3XA 5L7TA 1W0KD 4YJFB 3WZLA 1FLVA 4O0LA 2FWJA 3Q7QA 4DHEA 1Q7BA 2K6GA 2V7XA 2IHTA 1DB3A 4E70A 1SELA 2ZJ2A 1F60A 4LMPA 2PQMA 5G3YA 5F3RA 1SUSA 2XQVA 1KTIA 3DZ8A 3FSGD 4NABA 2XHZA 3L84A 1NVAA 3VOSA 4LZPA 3VHLB 5JBQA 5A4DA 3PHJA 4I46A 4OY3A 3MPOA 5CT9A 3ST7A 2JF0A 3VKFA 2C99A 3T7EA 3IQWA 1G8AA 2WKQA 1LVHA 3FF1A 3WHKA 5A71A 5M04A 3C1TA 3IALA 2HNAA 5AKIA 5B37A 5JW6A 2PJDA 4JBWA 4P84A 1H2ZA 4MTCA 3SWWA 1PNRA 5E7QA 3CH4B 1P5FA 2DHQA 3DYVA 4DNPA 1OGJA 1PJ3A 1YBAA 3FHLA 1P2SA 1ZH2A 3HY3A 1WY5A 2VWGA 4EB8A 2C9ZA 5ER6A 4PHCA 2XXBA 5TS3A 2HDOA 3P0HA 1JA9A 4TSFD 1D8AA 4M76B 3UPDA 1ZXBA 1GFIA 1XMSA 1Z0AA 3DP9A 3BK1A 4ZT6A 5EFZA 4L15A 2GPBA 2IXTA 2ZJ3A 4GQBA 3ZCUA 2YKGA 1U90A 3UJ6A 3RS0A 3V4LA 1H4QA 1XG5A 3CN9A 3JAMA 3L0BA 2HV8A 3RUIA 1YRAA 2GB4A 3EF1A 3EIWA 3DDUA 4FDTA 4FUTA 4J9UE 3DQZA 4NLLA 5TC4A 2NUPB 5HM8A 3IO3A 3EZNA 1KARA 4JVLA 3HP1A 1WSDA 3Q10A 2FN9A 1Z13A 3G5LA 4N5LA 3PFGA 2XOKA 4KLAA 4QREA 4E21A 3UZUA 1A82A 1HE3A 1T5IA 3KCNA 2ETXA 2XD4A 3LU1A 1RM3A 1ISSA 1ZSYA 2ASVA 2HWWA 2I2WA 5DNVA 4DSNA 5LL6P 3CONA 1VYUA 2UXDB 2JIOA 3DT8A 1C7EA 3FGOA 1BSVA 3HN2A 1N8TA 3N6VA 3NORA 4H16A 5HA5A 4HAIA 3I92A 3HDGA 3B9RA 1K6IA 4FI3C 1TYCA 4CLRA 5CFZA 2E21A 4AKEA 2NZ8A 4DCCA 2QD1A 1Z6AA 4I5GA 3QOXA 4QATA 1KI1A 3WKAA 3X2SA 4RMIA 2DUWA 3CUYA 4CIVA 1FX0A 2JHFA 5I45A 2JLZA 1TM3E 2MSWA 1SRQA 2ZT7A 4D81A 2QQGA 5LFAA 3P5SA 3QKUA 3AF5A 5CVCA 3ECAA 3JU3A 4UW9A 2EX0A 1FYFA 1VRVA 4CQLB 1E9CA 1GHTA 2I7VA 2FSIA 3M4JA 4Q00A 4X20A 1WW2A 1RYYA 1Z07A 3K09A 1H2HA 4O2AA 5EHQA 4II7A 4KQIA 5BSFA 2QUJA 1Q0UA 4QASA 2V7EA 2G1JA 3O1IC 3SXJA 2VNIA 4ZMSA 2I3ZA 4NCJA 1CY0A 1P5JA 2G17A 3CUKA 4MCAA 1P4RA 1MEOA 1BWQA 2RBEA 4D7AA 7GPBA 2CK3A 4H7IA 4ESEA 4OI4A 1NZJA 3AVXA 5DO9A 2JBHA 3VDNB 1C30B 1CY2A 1GUBA 4U8GA 4MIYA 4ZYXA 4KNYA 4WXMA 2ZROA 4QTUB 1G8HA 2WPNA 3K8OE 3QTBA 5AW9A 3UMRA 3QY9A 1E1CB 2VRBA 1E3WB 2YBEA 4P3PA 1A72A 1VE9A 1LVGA 1EGAA 1OX4B 2EW2A 3FWZA 2Q3DA 3LXXA 4HBZA 1PQYA 1Y5NA 4MW4A 4FC6A 1GO2A 1ECJA 2EERA 1S2IA 2QQEA 2XGSA 3W0LB 5EQJB 2GWRA 4CUJA 1E2BA 1L4FA 1R0XA 4Q34A 2B5WA 1JDSA 4RC9A 2CCGA 4Y1RB 2O3SA 1GNQA 3CKYA 4FFOA 3LXMA 5KNBD 1W47A 1D1PA 1L7RA 2N9UA 4OYHA 5PNTA 2ZSAA 4AC9A 5KYXB 5D3ZA 3OZUA 2ATXA 1FMLA 2C2MA 4AYXA 4CODB 3HLKA 4DQVA 5CEJA 2PX8A 4RTOA 2CHFA 2G6BA 2GRAA 4K5QA 3EFOB 4BLRA 2JFZA 1Y6JA 4UBLA 1KTVA 3FZNA 3FKQA 2G28A 5U1PA 4Q15A 2IY7A 1SVSA 1NKSA 3LGXA 1ELOA 4OJNA 4ZQEA 3WO0A 1LB1B 1DX6A 2OEPA 2W6PA 3QRWA 4CL8A 1XROA 3KZMA 1MRZA 3BTSA 2Q21A 5FLYA 4OHVA 3X3HA 5IMSA 1PQWA 1X92A 3TOVA 1R8SA 3ZD7A 4OREX 2B8JA 2IYNA 2XVXA 3DC2A 4PG5A 4H1TA 4TYYA 1UFRA 3KPUA 3O3MB 3ICPA 1KE1A 5DBGA 1H66A 1QB7A 2B61A 1CF2O 1L4NA 4C01A 5EIOA 4ZDKA 4BRSA 4Y6SA 1S6YA 2IHYA 2P41A 2ARKA 4Z1OA 2WJAA 3FSRA 4TKUA 1YJAA 1YL5A 2OZVA 4A8TA 3EEIA 4PHTA 1SMKA 1O94C 3ONNA 5EXSA 2C9YA 3C7AA 4GX2A 1ATZA 4Q03A 1HMYA 1NZDA 16PKA 1T1EA 2HJRA 1D7OA 3Q88A 2JJ1A 3TIFA 3SF8B 1E4VA 3CZPA 1LNZA 5FJIA 4MW1A 1SKYE 1RAEA 2FMKA 1QJCA 3BGDA 4UXJA 3RRYA 5BQXA 1Z5VA 3VJMA 4B33A 1LGYA 5F2NA 2C8VA 3M5CA 1TA4A 1DRJA 3EXG1 1K6XA 2CFOA 1Z28A 2VUHB 3HCDA 2I1LA 2RJ3A 3DZBA 1GG2A 4TOIA 3PHBE 3G6KA 5FCDA 4TVSA 4UFOA 1VP3A 4DR1B 4JI4B 5IVDA 4KP7A 1TC1A 2W2QA 3T9CA 3JQ7B 2ZFUA 1U0EA 2A9QA 1Z2NX 1DBVO 2G9VA 3OTQA 4G1VA 3IAS1 5ALRA 5ULLA 5JSZB 4IHQA 5JCOA 5A3SA 3NBFA 4UHJA 4HAVA 3B2QA 2EZ8A 2FQQA 5J59A 5A4IS 1VIAA 1LPNA 2CZCA 3PCRB 4FZ5A 3F0TA 4PYKA 5DULA 5IANA 1EFVA 3WIVA 5EIFA 1EHCA 1DIAA 2DHEA 1K1EA 1QC5A 2IP4A 2ZBUA 5HCUA 3UTDA 4EPRA 4UCQA 5L3QB 1AS3A 4CLHA 2VP4A 3QX3A 1OFHA 4RF4A 4U6SA 3E03A 1P45A 1NWHA 1EDDA 3BFJA 2FPOA 3CNQS 2Y27A 4KBYA 4U1RA 4X7RA 2XKKA 3FMOB 2Y76A 4MQBA 4LZAA 1JHZA 1RJFA 4DMFA 4BY9E 2D59A 4KQEA 4MJXA 4KAAA 1GPBA 2W9XA 1C3LA 2BE7A 1Y6RA 5BSTA 2WNSA 3UYLA 4RETA 2ZRCA 5A6SB 3G7NA 4BIMA 1AOXA 1V8DA 3VU8A 1GGNA 3M1YA 1OFGA 5TSDA 5DASA 3UAWA 2ADMA 1PTJC 4MQFB 4X8LA 2RI6A 2VF8A 3DFUA 2D6FA 5DLQC 3AUSA 2AG8A 2PZFA 2QYTA 4HDRA 2Q50A 3GJXC 1VRCA 5CT5A 2QW0X 5IAGA 1XQ9A 2VEOA 1ZIYA 3F5SA 3TM5A 2ZPAA 2W2VA 4UASA 5DX1A 3EHDA 5AM5A 1TKAA 3COVA 2FWBA 1LDBA 3KYDA 4RMGA 1UM9A 3CH5A 3A3YA 1CFZA 3LSYA 5H4HA 2C2OA 3JYLA 5H16A 1Z82A 5AP9A 4RTPA 1UP6A 4HNTA 3DZIA 1W34A 3HYNA 2C5SA 1BE0A 2FKNA 3Q9SA 1W49A 1ZG3A 1QDUA 2YN2A 3HCOA 3IR6A 4IGIA 1WULS 4YV2A 2HN9A 5FUYA 4ZARA 4GZLA 5K3AA 1TMGE 5KDOA 3RRZA 4ZI7F 5DWVA 2VJQA 3KOZA 1LFDB 1TCBA 4WN9B 1X0VA 4EY7A 3Q11A 2IU0A 4NCIA 3PTLA 2X2EA 1JAHA 5JPIA 4BKOA 1W8DA 1JYSA 4RPIA 4ZXPA 3NTUA 4S1OA 1T2EA 4F4CA 4QE3A 3WHPA 3EQZA 4XGNA 1GTG1 3HADA 2V6IA 1EVEA 2ZBGA 4WT7A 4AJ9A 4Q3LA 2PFKA 3D3NA 1SOAA 3TSYA 5ABPA 2VSQA 1YE5A 1ESMA 2PMWB 1QB8A 3AHDA 3CBGA 4RM2A 2CUTA 4JT2A 1NVVQ 4R31A 1EGMB 2J07A 3DNPA 5DW3A 5JJCA 2H1SA 2UYQA 1N2CE 3WKEA 3NOVA 1P81A 5JAHA 4K88A 5FWDA 2O7NA 4H77A 4WJLA 2XCIA 3GRVA 3DDSA 5J43A 3EIQA 3RSZA 4LJ8A 4ZO6A 4DM4A 2JVKA 1G5QA 1XWFA 1ODCA 5ALIA 2Z95A 4XI9A 5M2QA 3FYCA 4PAGA 1V11A 1OR8A 3P9ZA 1FF9A 4AUNA 1IOWA 5EPOA 3JQ8A 3QKIA 3T41A 3CCBA 4IZOA 2IZ0A 1DAOA 5L95A 2V7QA 4FFMA 3AKCA 4MMXB 3REFA 1L7QA 4FFRA 4NQZA 2AJLI 1H6CA 1FLAA 2CLOB 2W2LD 3EZLA 3Q87B 3V8QA 3VZRA 1TK2A 4CKYA 1N2BA 5TMDA 3VX4A 4ENUA 2OSVA 3MHPA 3VYRB 3ZN2A 1CG6A 2IU4A 1ORRA 1J00A 1DS6A 4LF9B 4B34A 3WJAA 2XLCA 2HUPA 1MB2A 1M6YA 2NUTB 3IYLW 1QWOA 3L7CA 4K9MA 1U8FO 2Z5GA 3LNTA 4KVFA 1QXSA 3MRTA 2W43A 2YJ3A 2NTEA 4JUIA 2WMDA 3STUA 1Q11A 2BFCB 3FTQA 2BMFA 4MKFA 5FI3A 2P91A 3WA6A 3DBRA 5HIJA 2A8YA 1ZL0A 2NAPA 1P33A 2FPPB 1LUAA 1TU3A 3G8AA 1M72A 1R0ZA 5C3UA 2QRHA 3MWDB 3WNVA 4ITUA 1A77A 4WXHA 2NZXA 1V47A 3G2QA 2QPAA 4IO0A 4OXXA 5D3MB 4QJ3A 1Z18A 5I5EA 3IFSA 4HFMA 3FG9A 3REQA 4PG4A 1I8TA 4REMA 5TS2A 2Q6KA 2QG9A 4QUEA 4I8DA 2Z2KA 4QL3A 1CRLA 3IUNA 1EFDN 1MA0A 2I7XA 3JR3A 4B2PA 5I3CA 3LBYA 1NUUA 2IQIA 4RIGA 2YFKA 4YRJA 3RIYA 3T3OA 4IY1A 1PT8A 3C3WA 2R87A 3CZAA 3NLLA 4G9BA 4E2WA 1P2GA 1TU4A 2NIPA 2RGUA 3M6IA 3RC9A 3CCFA 4F8JA 1B4DA 4QRHA 3QU7A 1P8AA 3NEJA 2Q5QA 2H4HA 2OMEA 2RHLA 3B13B 2Y9PB 3K0FB 4G0MA 3MJEA 1OZAA 5BSUA 3U9LA 1XMXA 3ZV7A 1GM5A 1T6NA 3D7SA 2BR4A 4DA0A 1KRHA 1PR2A 2OECA 3IUJA 4LISA 3HKCB 2UXCB 3D6AA 2DETA 2XH8A 1JEYB 1BX1A 5MGBA 1DKPA 4J1QA 2FOLA 3FR7A 1NXXA 4QU8A 3TTWA 2B6HA 3EVTA 4LYDA 5IXSA 4AICA 4JLAA 1J0EA 4HY3A 3U0VA 4FT2A 1X1RA 4Q24A 5IJWA 4XKJA 4GWLA 5AOCA 1I5OA 1T4BA 2PPVA 2IE0A 1W76A 4NDZA 3ZXXA 1TD9A 1KQFA 2OCIA 4L51A 3G1TA 1FBTA 2AJ8A 3FRIA 5TEWA 1E9AA 2P6PA 2B4KA 3H2YA 5ENVA 4W9MC 1NTRA 2C3UA 2HXSA 1EE2A 4YROA 5J4LA 1Y3IA 3FHCB 3CLUC 3RHTA 3AILA 3FETA 3NAQA 2O1XA 5FQOA 5BV2P 2XCOA 2ZYTX 3WE7A 3C5HA 4EB3A 3RFCA 1GLGA 1KPGA 2CVOA 2O7SA 2O8CB 4G0WA 1M5RA 1LQ2A 4IPTA 1VOTA 4G2TA 2GWHA 3RLIA 1UPBA 4W1PA 3H5IA 2SKEA 3WICA 3NWJA 3BJIC 3CFYA 4B3GA 3EVCA 5LP1A 1DKNA 1JJIA 1XZIA 3GELA 1ZGCA 3KR1A 1G8GA 2ZAMA 2F17A 1FTSA 2B2XA 3PX7A 3BDAA 1RE0A 3EGCA 3LY9A 5CITA 3ETEA 1IVNA 1GZVA 2I3DA 1C50A 3GZNA 1KFEB 2VPZA 3IKLA 3V1KA 5EJ6A 1GYPA 1G6HA 5AM3A 5IARA 4G01B 2LD4A 4L2IB 3HA3A 3H11B 3D1JA 3C5WP 3S29A 4TS1A 3H8JA 5H80A 1SKYB 4LOIA 2I76A 1T4MA 4MQUA 5JDIC 3SS9X 2G67A 3QEOA 5KO2A 1DKQA 4EL0A 1P9OA 2WU0A 2EIXA 4WBSA 2F6RA 1SHKA 2TECE 2AN3A 4UUBA 5AM4A 3UHAA 1SC3A 4OFBA 4WBNF 4ZKDA 2R9VA 3UGQA 1WX1A 3MJDA 5J4VA 1O89A 2HJGA 2I78A 3MGAA 5LB4A 2SKDA 2QBYB 1ISJA 1GTMA 3F6YA 4FTWA 1ULAA 4L75A 3DV9A 2GKGA 1EM8A 2I1WA 3ZLTA 3DLBA 2D1YA 1LK0A 2XZOA 1T2NA 3TFWA 4D8TA 5JSQA 2X2OA 3M2PA 4BV9A 2XTZA 1DT5A 1WXGA 3AV0B 1G5TA 3SG0A 1KK3A 1PE0A 1NG1A 4G9GA 2O5VA 1H0HA 1RKBA 4RPGA 1UFOA 2CXSA 1E9VA 2P9QA 4OL9A 5ESDA 1HDGO 1Y7TA 2QSUA 1KS9A 4IUDS 3TJZA 1H2BA 5BP7A 1GNSA 4YRNA 2SNIE 4IWNA 4LMAA 4IW3B 2D0PB 3KZ1E 5JSUA 4HLNA 2ZIWB 4AMUA 1J0BA 3N6RA 4PBSA 1OIWA 3FPLA 2PDAA 1IB0A 3U4IA 1Y9AA 1V26A 1FFEA 3USCS 5C1BA 2QTVA 4KX5A 5LXTB 3AVWA 4RJ2A 1L5LA 1MABA 2JHGA 3SD7A 3WMXA 4AM8A 4DLSA 1C3OB 1MAWA 3FB1A 2GCPA 3K53A 1G5HA 4N0QA 1THMA 5D87A 4MDYA 4P54A 4FGKA 1OC4A 1X8XA 1OF1A 3O4VA 3QWBA 3CGGA 1GR1A 4LVOA 1PQPA 1M6HA 1PL8A 4NJOA 3T4UA 5KVSA 1FFHA 3V97A 2OCPA 1O1YA 2VYVD 4L0MA 3N05A 3NI2A 1JHMA 1FXUA 2WSSA 1HRKA 3LBHA 1SUDA 2QKYA 4UEOA 2QAGB 2ZIFA 3R9KA 1DBSA 3H16A 1GP2A 3KT0A 3FTNA 2KBFA 4K6GA 4MUBA 3WGLA 3PQ6A 1AK2A 1T10A 1W2GA 2XTNA 2PSEA 3BERA 3E9NA 1EDEA 4C4TA 4Z49A 1JGTA 3DEFA 4GOKA 2P75A 1KDZA 4EUEA 2Q0SA 1S4MA 5KTNA 2FEAA 4D3FA 3ZI0A 2VA9A 4DNFA 2ASEA 1U4SA 2W11A 3K9NA 1ISIA 2YH2A 1SCUA 3K15A 3MPUA 5E4JA 4JI7B 5DBEX 3BTOA 4RK1A 1P5HA 3T06B 4ZPJA 5KX5B 1U1CA 3WG9A 2W4IA 1G8JA 1NGSA 3ELUA 3KQMA 3QF4A 3R24A 4R4JA 2IHNA 3ERCA 3SFVA 5HZGA 1BDIA 4ARIA 1G2IA 4U2DA 4J3FA 4EG6A 5I7FA 1J0CA 4G2NA 2WWYA 3MK31 4YRPA 3HA2A 2JLXA 2OV6A 3BT7A 2Z3ZA 1RRGA 1VCMA 3GVCA 1NVDA 5TPWA 1S1CA 1IPFA 1RKUA 1UDBA 1KEPA 5DV9A 5E6RA 1OFVA 1OMOA 3VAYA 3QJ5A 3OZFA 2FK7A 4FS3A 1NFFA 4NCHA 5JEDA 2Y66A 3LUJA 4QVKA 3ZCXA 3PNBA 3EC1A 2HL6A 3FGZA 2G4VA 3CKMA 4A73A 5LDDC 3UV7A 3L1UA 2ACKA 2H31A 1MXHA 2QMQA 2Y0EA 1WKBA 4N4AA 3K09C 1LLDA 5JO9A 2WDZA 3A6LA 3IP1A 2PZBA 2RHMA 2NGRA 4HDSB 1ZJZA 3OU2A 1Y8AA 3CNHA 4HEA6 3VR4H 3DCNA 1IBMB 2C3MA 3EVNA 2P30A 4FLEA 2F9FA 1BFDA 1UMCB 1ZICA 2O48X 4DMKA 2IKSA 3LFHA 3WK8A 1YZ3A 3M70A 4NXNB 3BRQA 4Q3DA 3CF4G 4EY3A 4I3HA 4IQGA 4O5AA 2QENA 3ZU5A 2WWIA 1Q1QA 3DONA 3TBHA 5LJLA 2DFPA 2PG3A 4MB2A 3O3OB 1KDOA 3KSRA 2HADA 3ES9A 3DDHA 4HYQA 3UQYS 4B85A 5DN6A 4PGFA 1SURA 2E18A 4MQFA 5ALHA 1ODTC 2I03A 1NNUA 2J5QA 1XUOA 2DY1A 3CG0A 5HG0A 5KNDH 5JHHB 4IVNA 5AXBA 4M1SA 1M2FA 2I5PO 4L85A 5GIOE 2CHGA 2R8OA 2RKOA 1U0FA 2XWPA 1DKOA 2ISQA 3RUCA 4WWHA 5CNMA 2QGFA 3AGQA 3BPSA 3QA3E 4M0PA 5IVIA 1WF3A 1VL6A 4GBMA 2Z3WA 4W8HA 4W1SA 5DEIA 2WQ7A 1T6YA 3PUYA 1MJGA 2IITA 1V43A 1ZI8A 3FRJA 4NJMA 3MUNA 2VPTA 4KSCA 5TLSA 4TQ9A 3VO1A 3OP4A 3RSGA 4R68A 2DPHA 1R18A 4YXWD 2GDZA 4KBGA 2P9TA 2Y1KA 1SZCA 4FGSA 1I3KA 5SZHB 3I3OA 5HZMA 4UFNA 1JLHA 3DL7A 4GH5A 4HSGA 4V39A 2QRPA 3R8CA 1RJDA 1E9FA 1N2IA 3S0JA 3G7UA 5K0BA 4MUFA 1J2TA 1YB2A 5AI8A 5MHTA 1U98A 2B8WA 4C7XA 1IN5A 1T9KA 1VL5A 2XIJA 3IMKA 4OLBA 1VMIA 1X7YA 5BSVA 2H85A 1FUUA 3A2KA 1MPTA 2DM6A 4FFDA 1FSFA 2NU6B 2FZ5A 3C97A 1OXMA 1I1HA 1RYMA 3CUSA 1E2NA 1NF2A 1H6BA 2CNOA 4P4UA 3RHFA 3WYBA 3THSA 2P9FA 3O4FA 4C2UA 1PBNA 1XRQA 3RI3A 4KQCA 4AURA 4F2PA 2CYBA 2I3BA 2RE8A 1MJGM 4EKDA 3FX2A 4JROA 1J21A 4HRVA 1EPUA 1PWXA 1I1QB 4JWTA 4DMLA 2GN6A 2PCLA 4CIAA 2GYWA 1L7BA 1UBUS 1U3FA 5F77A 1JQKA 4DREA 2NT3A 1F2TB 4D4LA 3OX1A 3M6WA 5K8TA 2EZTA 5IC5A 1EDOA 2G83A 1X38A 2J4DA 3WP1B 1ZCJA 1H2FA 1RR6A 2CYCA 2SCUA 2ZKLA 4X92A 4P53A 5DJ5A 5JBIA 3PQ4A 1JIXA 3UPUA 5B1EA 2VDUE 3TINA 2HMWA 4WDRA 3T7TA 1VI2A 4GOXA 2NPFA 1ZN2A 4CM8A 4W5JA 2LBPA 2CY0A 2IF0A 3CG4A 3NIWA 3LMKA 5IK2A 2B30A 1LY1A 3DEZA 4D80A 5F23A 2I1VB 2O5EA 2J45A 4HO1X 1NSYA 1RQ2A 3ADOA 2W8ZA 2FQ1A 5I01A 2FPXA 4F93B 2QTRA 3AG6A 2GK6A 3EFOA 1OYYA 1OV4A 1VIVA 2WWFA 2H11A 2V6BA 4H6XA 4EZIA 5AW1A 3U7EB 3EZYA 4DLZA 2Z83A 3MELA 4X1IA 4YCJA 5F7OA 4JCOA 4N40A 4V0NA 3CW2A 2FPSA 3CEJA 3HJNA 4UHBA 1VI5A 4M49A 2OHXA 1G8KA 2AN1A 4K9KA 3VVCA 3GUCA 4Q7MB 2LGJA 2BC9A 1FCJA 4UHCA 4B3IA 1Y81A 1QCZA 1CIJA 1ZD2P 4RH1A 5FO1A 4PEVA 3WQQA 2IKQA 4CEHB 2YIMA 4JKOA 4YDSA 1UR5A 1XZQA 1KGSA 3FWYA 2CE2X 4UAJA 3TAUA 5L4SA 2CKMA 2HK7A 3OCUA 2FW1A 2Y4NA 3IKMB 3SSOA 5CDSA 3BH0A 1NR7A 1PG2A 1UKEA 3LRXA 3AB3A 4OQYA 4DLUA 5BMVF 1K92A 1NVFA 2PJZA 1KO4A 2ZIZA 2AG1A 4ZEOA 1NP3A 5FNVF 3RTEA 4KN8A 4LS3A 3CYFA 5AXAA 5J4YA 5KOJA 2BMVA 2JGLA 1SHUX 2GBIA 2OO5A 3BGOS 4GX0A 1F1JA 3OMLA 4ZVPA 3TTVA 3ZOKA 1CYDA 5SYAA 3X1YA 4Z7JA 1U2RA 2AH5A 4HL6A 3WGKA 1ZVVA 1WUJS 4O8ZA 1C1DA 3DHNA 1FFAA 1LU9A 3KX2A 1NJ5A 1H0RA 2Z1NA 1IY1A 2VN8A 3JZDA 2IZ1A 2I7DA 4FYIA 3OQVA 5JAUA 5LQKA 1DKLA 1ECFA 2FRDA 2JRLA 4FE7A 1GSAA 3ZLUA 4E2XA 1FTGA 4AECA 1WY7A 1QCYA 4OYRA 1YA6A 3RAFC 4I55F 1LNQA 3E61A 3B1XA 2QK4A 4M21A 4QA9A 1PNTA 4MVJH 1GITA 2ZIGA 3LC7O 5IAJA 2W8BA 1KKMA 4PQGA 1LJLA 3GR6A 1UP7A 1XXHB 1UM8A 2QU8A 3QPWA 3AEQB 3M33A 3VZDA 2X23A 2XBLA 4RE6A 5K4GA 3DMNA 1K0UA 1ZJ5A 3PC2A 1HFJA 1E7RA 4QFCA 4RCYA 3F6RA 1U99A 2JFUA 2X0JA 3EIUA 5CFRA 3EMVA 4BPBA 4DEYA 2YXDA 4B6SA 4HR7A 1TMOA 4LE2A 5JADA 2V03A 4LDAA 4KGVA 1EI9A 1AKMA 4CGYA 4Z0TA 5HFAA 2ZSEA 4JFRA 3CLRD 2Q3BA 4ER3A 3D3QA 2QZZA 4M98A 3ZBTA 5MDHA 1N5KA 3K05A 3H5LA 5D3KA 1U7OA 4ZTZB 3EGDA 1IPEA 2B0CA 2RH4A 1RPJA 1TUGA 2R8ZA 1TJPB 4NU8X 1DKRA 2BHSA 4G1EB 4O4IA 4EB0A 1J4AA 3QBTA 4H6WA 1TK3A 3K1TA 3RGGA 1JBEA 2ZRQA 3EGXA 5L45A 4AQDA 1QO9A 4BBZA 3N6XA 1DCFA 4OI2A 1IHXA 1ZKDA 3C3BA 3G2PA 4E22A 5IJAA 4B3DA 2JW5A 4F0JA 3T5GA 4DBLE 3AHEA 3DLTA 3A6JA 2IOHA 2O2SA 2VQ3A 4MW6A 3SQOA 5I7VA 1TJNA 2YWCA 1SRRA 1W5AA 2E3JA 5C37A 2PBFA 1O0BA 2HQBA 3A26A 1QC5B 3B7WA 4GMHA 3RWBA 4BVGA 4EM6A 3G89A 5EWJA 5FADA 1ULTA 4IZIA 4ZC8A 4H0FA 2HLDA 3RABA 3T1NA 4F4DA 1PJLA 3UK2A 2G5CA 4M8IA 4IF6A 4XW2A 3FNEA 1HSZA 3OFKA 4ZCRA 2JGDA 4KUGA 4GMXA 3O8RA 3WC4A 1TAUA 3EMBA 2V7VA 2GEBA 4LPKA 4P3OA 3AG5A 4U6NA 4BYGA 1H2AS 1K4KA 3JQ9A 3SIXA 3SJCA 1DHRA 4A03A 3R4CA 1O5OA 2MYPA 1K9SA 1AGYA 3Q3VA 3NTLA 3KV3O 4P82A 3G49A 3R5TA 4G24A 1S2LA 1IZ9A 3OFNA 4RF3A 4ALJA 4A8JC 4PLFA 2DJ5A 3GVIA 1YZFA 2MINB 4NG5A 4DB2A 1GAJA 2GCOB 4IJKA 4LUCA 3O47A 4JI5B 4BZQA 5K3FA 3EXAA 1L5HB 1M76A 1XQ1A 5A7FA 3E81A 3KPJA 1PW5A 2QUBA 3F78A 5E6UA 4O2RA 3W5HA 4NKRA 3VJKA 1N3LA 4V0MA 1YFLA 1TAHA 5ECGC 3A14A 1WVMA 3BIXA 4P32A 1V4VA 1LLUA 2YINC 1BHSA 5KYVA 3IAHA 5TQVA 1V6SA 2JAWA 4Q7QA 5HSGA 4J3JA 5CR9A 1U2GC 1L7PA 3JARA 1YVEI 3QX7A 5JJ5A 1V25A 4HWRA 1KEVA 2YNMD 3LYAA 4I1OA 2GT1A 4P35A 1QHSA 1W52X 5BVGB 1MOPA 5FWNA 2C5AA 5LZ8A 4D8WA 2G82A 1RLJA 2XAAA 1I6KA 3FCSB 4EYQA 2RAUA 5B57C 1UKAA 2QTAA 3VO8A 1K86A 2A9RA 5JZMA 4MZDA 3L01A 5AHXA 4BYMA 2ERXA 1Q0PA 2X9QA 5DHTA 5FBLB 2GEFA 4RHFA 1H05A 3IA7A 2WVGA 4FJ1A 4JLKA 4NMMA 4PINA 1HE2A 1Y1QA 3WL6A 5AVVA 2AQ8A 4D99A 2RHCA 2ZWOA 3C85A 3NXKA 3SXPA 3HBMA 2FZCA 3AETA 4X95A 3VJLA 5K51A 4I14A 3MLBA 1L4GA 1YJXA 1CB7A 2KPOA 3HUDA 4MS1A 1SXQA 4EGFA 3GFTA 3NUGA 5KSOA 1IQUA 1GILA 4Y9SA 4ZAFA 1YZTA 4UM9B 4BVHA 3L43A 1Y1PA 1GEGA 5I4CA 1TEVA 3M9WA 3DBOB 2B0JA 3OA0A 3F5DA 1MTOA 2X0IA 3BHIA 5HTKA 5IJXA 1XQXA 2QLTA 3KEQA 3LUCA 4FNGA 2AHRA 5FA8A 3U2QA 3IDFA 4B0PA 4RW0A 2KX7A 3ZWQA 5BWBA 4YJHB 1Z2DA 4XLTA 2ZJ1A 2CJXA 4BFSA 3HY6A 4YX9A 4LE1A 1A9PA 2VT7A 4RHXA 1JLLA 3COYA 4EHAA 3EWAA 3FSJX 3ORSA 4UTVA 4EPXA 2CKDA 2IPXA 1NOJA 4KXNA 4QYSA 2HQ1A 5EMHA 3W3AH 4C7JA 3BWVA 2E6UX 3IV7A 3UMFA 4Y1EA 4WUTA 3AJ9A 4LXQA 4QKQA 1WQ1R 3LQYA 4HQ6A 3G0DA 2NO0A 2ZR9A 3SFTA 4FC7A 3EEQA 3LY7A 2H3HA 1T2UA 4E7OA 3FMVA 4N6OA 1ANKA 1DEKA 2GPAA 1JHAA 3GRUA 4ZANA 3CM0A 1ZR4A 1BS2A 3FDIA 1YQQA 1HDXA 3B8EA 3STTA 2ZPUA 3R74A 4U02A 2DLCX 5FHRA 4KQ1A 5KQSA 1USIA 2X0RA 4IFEA 5FLEX 3T3IA 3LCMA 4EP1A 1CZHA 4E46A 4LXXA 3W4KA 3DPSA 3ZHXA 4ZAYA 3RDPA 3ULKA 4B3TB 4DR7B 1NL3A 3NEPX 5B7QA 2OXRA 3H1EA 1PQ4A 3JWJA 1Q0SA 1T5HX 3P9PA 1ZNZA 2PT6A 3E2MA 4GYKA 2GESA 1KAOA 4F5WA 2ZVDA 3QMMA 4MQEA 4YRTA 2ZJ8A 1EQUA 3PUVA 4FHZA 3RVMA 3SS7X 1SUPA 4AJ1A 4F86A 2IYPA 1LPPA 3CSDA 4N8SA 4ZO7A 3I58A 4O4JA 3DM5A 5EMJA 3TRJA 4BNMA 2W83A 4RJIA 1ZU4A 4RZUA 3H2HA 5AKGA 4IQ0A 1DUIA 1N6IA 4WK6A 5D3QA 5J4KA 3HZZA 3ILHA 1VJ1A 1TB4A 5DRYA 3D6VA 4I8XA 3TZBA 5D84A 1I51A 3C45A 5FWXB 1X7HA 1ZGJA 3FVWA 1ESNA 1I2ZA 1GUAA 2YICA 2XB2A 5GQSA 3S55A 4UNPA 4IO1A 3TR6A 4ZOLA 2VNHA 2IYLD 3CZ9A 3R3SA 1AO3A 2PZAA 3BULA 3B7PA 4XR9A 1V1JA 3E0QA 2HPAA 3C8HA 3HXMA 5AJZA 1CUXA 2XMRA 3EDRA 2C2HA 4ALNA 2A3NA 3HB0A 3K7EA 4X93A 1D4FA 1OU4A 2QAJA 1W73A 1ZCZA 4WACA 1K6MA 4O3MA 3BMCB 3W9YA 4LY9A 3O5AA 3R0XA 4JL6A 4YP7A 5BN4A 4MV7A 1PFVA 3I9LA 4P7BA 4UBIA 2X1MA 2D2FA 4A6DA 5BV8A 4X66B 2J7PD 5FPPA 4HUTA 5HKAA 5FNVA 4OBEA 4GDFA 2OORC 4B1FA 5GADl 5KC9A 2ZPTX 2D1TA 2VTVA 5KNCD 4GLFA 4KIFA 4Y2HA 4GXTA