3C6ZA

Hnl from hevea brasiliensis to atomic resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
256
structure length
256
Chain Sequence
b'AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxynitrilase
molecule tags Lyase
source organism Hevea brasiliensis
publication title Atomic resolution crystal structures and quantum chemistry meet to reveal subtleties of hydroxynitrile lyase catalysis
pubmed doi rcsb
total genus 95
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6zA00
2XMRA 5EI5A 2ZYRA 1WHSA 3WKBA 1UK9A 1RYYA 4KAAA 3TEJA 1QO7A 2BGNA 1XRNA 2PPLA 3C87A 4LHEA 1ZOIA 4U2FA 2QTBA 2XLCA 5KWJA 4W1PA 4QA9A 3R3VA 4BC1A 4FDMA 3WK6A 4H7KA 3VVLA 3C8DA 4X6XA 4CG3A 1CUEA 4M0MA 5FKJA 1E3QA 1FFEA 2HFJA 2HA4A 2XI4A 2WKWA 5AK6A 2WTNA 3H1AA 1CIJA 3C6XA 2GZSA 5K3AA 4F21A 3NGMA 3JYHA 5KWIA 1VE6A 2XQIA 3LCRA 2H7XA 3TJMA 1E5TA 3EIOA 1THTA 1CUUA 1HPLA 2OXEA 5JAPA 3WK7A 4ARAA 1VE7A 3R3UA 5CTAA 2HADA 5DYTA 1MJ5A 1P0IA 3W2TA 1QIIA 2Y2VA 5LKRA 3IUQA 5D3KA 3JW8A 3ESCA 4H77A 4MXDA 4WCVA 3LLCA 5HCUA 1GQRA 2XQJA 4Y2UA 1CUSA 1WB5A 2PM8A 3FCXA 5AHXA 2AJBA 3B12A 3DNMA 4YX9A 1LPBB 2HU7A 5AKGA 3ZLTA 5ALDA 3C45A 1BEZA 3QMMA 3K6KA 2QJRA 3IA2A 3RARA 5LZ7A 2JGKA 1B41A 2XT0A 2I3DA 4AN1A 1HQDA 4BZWA 2B4KA 4KR0A 3VISA 2XMDA 2IX9A 2H7YA 4TPKA 1WB6A 4QZVA 1E8DA 5AI4A 1JFRA 1OILA 1TQHA 4X94A 4J7AA 1QIMA 4OB8A 1R1DA 2BJHA 4H18A 4IH4A 3H04A 2RAUA 4W1QA 4Y2XA 5ESRA 2OPHA 3BE8A 4B84A 3QPDA 1EB9A 3WIBA 4INZA 1DTEA 2GBCA 2RGUA 2CZQA 1R50A 1W52X 1GPLA 4WY8A 2QUBA 5EFZA 5ALVA 4EA6A 4EHBA 1QZ3A 2PSHA 2BAGA 4U2EA 1YCDA 4OCZA 4K2AA 2V9ZA 4Q82A 4ARBA 4H35A 4Q1VA 3D3NA 3E4DA 5LZ8A 5AKZA 1F0NA 1MNQA 3OTQA 2X8BA 3YASA 4G9EA 5D6OA 4EUSA 1FFAA 4C87A 5ALUA 3PUHA 3D2CA 5CXUA 4BCCA 3KSRA 4WY5A 1M33A 3VJKA 5ALIA 4UHFA 2JGEA 3DLTA 3H1BA 4CI9A 2WFLA 3STTA 2HRQA 4J3JA 3WI7A 3O9VA 4BVKA 4QWWA 4FNGA 2RHWA 3O4IA 1H23A 3WZLA 2FJ0A 1O6GA 1VKHA 2OCGA 1MTZA 1LBTA 4Q3LA 3WQHA 2XUGA 2QKYA 1EK1A 5ALNA 5K3BA 5AP9A 2WSLA 1CQZA 4OUKX 2H9YA 4J0DA 4UHCA 3DKKA 4RPCA 1XQYA 1XLVA 4NS4A 1R9MA 2HRRA 4CCYB 2H1IA 4KRXA 1THGA 3PF9A 3T52A 1C7IA 1MNAA 1CUWA 4X6YA 2QT9A 5ALKA 1AKNA 2HU5A 1EDBA 2WIGA 3Q8WA 4DSAA 5DNUA 3PFCA 2XQKA 3A70A 1CLEA 2LIPA 3H19A 1DQZA 1ODTC 2Y2UA 5J3JA 1KEZA 1WPRA 1QIKA 3WL8A 1A7UA 1AGYA 4FOLA 3FLAA 4MJ3A 2Z3ZA 4BAUA 1QIEA 1ZI9A 4X90A 2OCLA 1A8QA 2RONA 2B61A 2NW6A 2PU5A 3SC2A 2PVSA 4UBIA 3AILA 4J0GA 3C8HA 1SCQA 3I2HA 1CUBA 5IVIA 3NUZA 1DT5A 4UBKA 4J0KA 1PV1A 3KDAA 3I2KA 2WG0A 2ZSIA 2XE4A 4PNZA 1JMYA 4C89A 4I4CA 4EY8A 4NVRA 2ES4A 4D9JA 3QM1A 5JD5A 3VJMA 1J07A 3IIIA 4WFKA 4IH9A 1R88A 4BDTA 1EK2A 4C6HA 2YH2A 2VSQA 4X3CA 4GXNA 4ZV7A 3EQ7A 1GQSA 5YASA 1C7JA 3ZLUA 3BDVA 5K5EA 3GZJA 4L3WA 4TVKA 3WKAA 1K4YA 3MGAA 3ICVA 3KOOA 3FWHA 3FLEA 1AX9A 4I3FA 5AOCA 4G4JA 3STXA 4AQDA 4FBMA 3A2NA 3DOHA 3NWOA 3OOSA 4Y2VA 1JT2A 2XUFA 1VJ5A 4FHZA 5I8PA 3QMVA 2G4LA 1EHYA 1Q0RA 5KBYA 2AJDA 3D4LA 1CUJA 4XIIA 4EY7A 2WHPA 3MVEA 3SWWA 3NOXA 4DM7A 4OYYA 5DJ5A 4ZXFA 4OU5A 1UOPA 1XZEA 3OC0A 2OAEA 3FBWA 3C5VA 2DHEA 1EVEA 4HZGA 5EIEA 2JGIA 3BWXA 1YSCA 2B9VA 2HU8A 3I6ZA 1LPNA 5JANA 1OCEA 4QE3A 1TCCA 1XZDA 3E3AA 4HTAA 2CUTA 6YASA 1XRLA 4DMCA 5E2IA 4H7IA 5DNVA 1OXMA 2EDAA 3STYA 2PBLA 4MEBA 1ACJA 1Q83A 5CT8A 5BWCA 5KREA 5AK3A 4QDUA 1P0PA 4KJXA 5AK4A 1QLWA 3N2ZB 3HEAA 4QEKA 1EINA 4H7JA 5FPPA 1A8UA 4P92A 3WL6A 5T4FA 4BVLA 4L72A 2OQVA 4PQEA 1QO9A 1MN6A 1BN7A 1IUOA 4HS9A 4PSDA 3ILSA 2QZPA 3H2GA 2VF2A 1HDEA 4G5XA 1L7AA 1XKTA 1GZ7A 5K3FA 1W75A 1W4LA 3WKDA 2Z3WA 2C5FA 1ZJ5A 5JZSA 1QIDA 5A7FA 3WL7A 4XJVA 4JYMA 4BP8A 5JZBA 4J0HA 3QBJA 3IB3A 3HLKA 4IO0A 2OGTA 5D3ZA 2GBFA 4RE5A 4WFIA 5AJHA 4DNOA 4I19A 3FNBA 3RM3A 1MAAA 4B7ZA 4ZWNA 2VAXA 4QDOA 3D2AA 2WFMA 2PKYX 2ONCA 3H18A 2HA3A 4X91A 3WL5A 1TK3A 1UOOA 2VEOA 5AI5A 2I3ZA 1DWOA 3WK5A 3G9TA 3I2FA 1GT6A 3HABA 5AKHA 4DYHA 1HKHA 2C0QA 3G02A 5CMLA 1VZ3A 3QYJA 5LKAA 1CUDA 5JALA 3AINA 1XZJA 1FJ2A 2WIKA 4UBMA 4LXGA 5AIAA 5SYNA 2O2GA 1F0PA 4L9AA 3DD5A 1UFOA 2QUAA 2VJAA 5A62A 4FNMA 4X93A 5DWDA 1YAJA 1K8QA 4FFWA 4BZZA 3R3YA 3KWFA 1Q0ZA 1LGYA 2P8SA 1N8SA 3G7NA 2VTVA 3CN9A 2WJ3A 1K6EA 2XB6A 1ORVA 3AZPA 4ETWA 3M83A 3VJLA 3WA7A 2XUIA 2V96A 2XMZA 2CJPA 4X71A 4E15A 4N8DA 4LXHA 5FDFA 2AJ8A 3IDAA 3GELA 2XUQA 1CEXA 4B81A 1KU0A 2HDWA 1EVQA 1MU0A 4FFVA 4JUIA 3G0IA 1EDEA 3C6BA 5ALEA 3BIXA 3PDCA 4N8EA 4EY6A 4UHDA 4BRZA 2J3DA 2OCIA 1K5PA 4AZ3A 3ZWQA 3I2GA 1W6RA 4KRYA 4X92A 5A7HA 3HC7A 5A6VA 5K3CA 3BDIA 2YASA 4U2DA 1BRTA 2XMQA 3VDXA 1DINA 3HACA 1I6WA 1UK6A 2QRUA 4GLBA 1XRRA 4G8BA 5LIPA 4MYDA 4BCBA 2YXPX 4MQMA 1QJ4A 5EHXA 3QPAA 2IIVA 2QJWA 1QOZA 5E4JA 3STWA 4Z49A 3I1IA 4LXIA 4Q34A 4B9AA 2RIPA 1H2ZA 1CUGA 2AJLI 1DT3A 4GWLA 4GEGA 1LPMA 3IULA 5CT4A 4M0EA 2OLEA 1K63A 5ALQA 1ODSA 1JU3A 4K6HA 5CH3A 3FSGD 1YR2A 2JGLA 2C58A 4UBNA 1AZWA 5IVKA 3G0DA 5ALYA 1BEEA 2WIJA 4DNFA 5BV7A 5JAHA 5AM3A 3EQ8A 4IH1A 4Y2QA 2ECFA 1MO2A 3I6YA 1XQXA 3I2JA 1JJIA 5E4TA 1ZD5A 2O2HA 2XUHA 3WK9A 1O6FA 2XUKA 1BU8A 3PICA 4N5HX 3DKRA 2PSEA 4JNCA 4RE6A 3WKCA 4ZREA 2G63A 4BAGA 3GA7A 2B20A 3QZUA 1CUXA 2WUGA 1CFJA 1X2BA 1SCIA 2EDCA 1SC9A 2Z8XA 3D7RA 4HXEB 3O0DA 3DYVA 1N5RA 1XRQA 4JEIA 1T2NA 2XUDA 1MX5A 5C7YA 3CCCA 1LBSA 3PUIA 3EQ9A 2BUCA 4H7DA 3DOIA 1ZIXA 3AIMA 2BCEA 2QVBA 4FWBA 1CR6A 4O08A 1CUYA 5FOQA 2QR5A 3C5WP 1EDDA 2C0PA 2DCMA 1JMKC 3MUNA 3GROA 1H2XA 1GPNA 3HI4A 4BRSA 1E66A 3FYUB 7YASA 3ZPXA 3O95A 5T4EA 1JJFA 1FSSA 4LYEA 3W05A 1CUCA 3O4JA 1GKLA 3F67A 3H17A 3WIOA 4UHBA 4E46A 2JGFA 4QDTA 4YPVA 1QONA 1XZGA 5EIHA 1GXSA 3FSGA 3UMJA 4P08A 4OU4A 4B82A 4DLNA 1QTRA 2BUAA 5A2GA 1E8MA 2WU3A 2O7RA 3QITA 4EB0A 1ZD3A 5HZGA 5JAOA 1LPOA 2OGZA 2XMGA 1TIBA 2FUKA 4OD0A 2O7VA 5DTJA 1J1IA 4G8CA 4BYMA 3STVA 3A2LA 3HXKA 4GW3A 5AKKA 4FLFA 2Q0XA 3DL7A 5CT5A 5AKXA 1CUFA 1E8NA 1G4HA 3K9BA 3H2IA 4QLAA 1ISPA 2AXEA 1MX9A 4PSCA 3F9CA 4KE9A 5AH0A 1UZAA 3CCBA 4X6UA 1ORWA 5JAUA 2JF0A 5EHNA 5AKJA 3AZQA 1TAHA 3SK0A 3IURA 1AUOA 5LLSA 1RWQA 3O4HA 2PU7A 2W6CX 1QFMA 5AIBA 1Y37A 1PJAA 3V9AA 3R41A 1XLUA 3D2BA 5T4HA 4KE6A 1HBJA 1WHTA 1WCYA 1XZCA 3G8YA 3DDUA 1BROA 2D0DA 3Q0TA 2XUJA 4DTCA 5ALZA 5IVDA 3I28A 5AKLA 3OM8A 2XUPA 2PSFA 4K5QA 1UOQA 4W1SA 5CXXA 2DSNA 4WJLA 1VLQA 3UUFA 4AXBA 3WWCA 4IQ4A 5F4ZA 2WJ4A 1XLWA 4HXGA 1CUZA 5HK8A 2QOEA 1X70A 2XUOA 4YK7A 3DYIA 1XZMA 5C81A 3FLBA 5HF9A 4J0JA 2PSDA 2WUFA 4IHAA 4B0OA 2XMBA 4JH0A 5DLPA 4H7HA 2RHTA 1CQWA 4CG2A 2FX5A 5ALTA 4RNCA 3HZOA 1CPYA 5AM0A 4MQLA 3BF8A 4BAZA 3VVMA 1ZICA 3L1JA 5JIBA 5CH8A 1WOMA 5IKXA 1LZKA 4A5SA 1H2YA 2E3JA 1NX9A 3WK4A 3STUA 4MYSA 2HHAA 1P0QA 3GBSA 2ZJFA 5AI8A 5AI6A 1DWQA 3BJMA 1EH5A 2HM7A 1JU4A 3HJUA 4J0CA 3FOBA 5H3HA 4MWTA 1YA4A 1H2WA 4UBOA 4BBZA 2J4FA 1C4XA 3HYSA 2BKLA 2VAVA 3M3DA 5JZ9A 1JKMA 2X76A 4GECA 1XROA 1XZLA 3C6YA 4EBBA 3ANTA 3LS2A 1VOTA 1FFCA 2WUDA 1N5MA 5ALWA 3IUNA 4ZRDA 5BOVA 5AI9A 2UZ0A 1X2EA 3WKEA 3ZV7A 5IH7A 4UFOA 4EY5A 1TRHA 2AJCA 4DGQA 3C70A 4DMKA 5AI0A 5DYYA 2WFLB 2XLBA 5I7UA 1HL7A 2ACEA 5ALHA 1IVYA 1ZGBA 5LZ2A 1NU8A 2Z8ZA 1AURA 3IBTA 1XFDA 1LZLA 2JEYA 4FBLA 5C8VA 3V1KA 1MX1A 3FVTA 3ZLVA 3L1HA 3ESDA 2DHCA 4GHWA 4P9NA 5ALJA 3DS8A 1YB7A 2IITA 2WG2A 1YS1X 2XMCA 5HKBA 4P93A 1TCBA 2GYVA 1UKBA 3RLIA 1WM1A 1DWPA 5ALGA 2QM0A 3WJ2A 3V1LA 1DX4A 4QDZA 1F8UA 3W9UA 4Y7DA 1UXOA 1VA4A 4TGLA 4B0PA 1ACLA 2GBIA 2WLSA 1SOMA 3IUJA 3F8SA 3WWEA 1IUNA 5CURA 4H0CA 3WYNA 2W22A 1LPPA 5CH5A 2OGSA 3E1GA 2JIDA 4A23A 1EB8A 3H2KA 4QDXA 1MT3A 1YA8A 4CCWA 3F97A 1EI9A 1QIGA 4RGYA 4KE8A 4OYLA 4U2GA 1E89A 2X5XA 2V97A 3RKSA 5CBKA 3WYDA 2Y6UA 1YB6A 1VXRA 4Q3KA 2JGMA 1A8SA 4K6KA 1CUVA 4G8DA 3T4UA 2OG1A 4UHEA 3JWEA 3W9BA 3ZI7A 3ESAA 5E4YA 5A71A 4F0JA 3R40A 3BL8A 2CEKA 1GGVA 5LZ5A 3IVMA 4A16A 4GBGA 1YS2X 2BGRA 4G1FA 4N5IX 2PUHA 3AJAA 4W9RA 2XDWA 3LP5A 4HXFB 2VA9A 3GFFA 5FV4A 1DX6A 2WILA 4BE9A 1WPXA 2DHDA 3B3QA 3I1YA 5HFNA 1EX9A 1R3DA 3S8YA 3S2ZA 1N1MA 4ZI5A 2HA0A 1LPSA 4E11A 2H7CA 3AFIA 3FYUA 2WHPB 3FAKA 5JASA 1PFQA 3TRDA 3V1MA 1ZI6A 2VJBA 1AC5A 1KU6A 1JJBA 3AZOA 3R3XA 4V2IA 4Y2RA 4PSUA 4BATA 4BCDA 2EEPA 4CIAA 1R4ZA 4OPMA 3BF7A 2WIDA 2OQIA 1HLGA 4XX1A 4YASA 3WMRA 4LYDA 1YASA 3G0GA 5EGNA 1U65A 2VT7A 2YYSA 4WDRA 5FLKA 2ZJ7A 2WM2A 3OPMA 1VZ2A 1BCRA 2BUBA 3SX4A 4ROTA 4DNPA 1IZ8A 1ZD2P 4Y2JA 3VXKA 4DNQA 4AMZA 4G9GA 4FTWA 3OG9A 4BB0A 4EY4A 2GYUA 2WQZA 2WHQA 2PL5A 2VT6A 5BWBA 2HL6A 2VJCA 4KEAA 2PUJA 1DU4A 5CT6A 4H7FA 5HF5A 4FLMA 4KAJA 2FJPA 4UBJA 1G42A 2C4HA 3ED1A 4M0FA 5AK5A 5ISMA 4QNNA 4W63A 3N0TA 3BXPA 4U2CA 1ETHA 3QVMA 1BCSA 4HRXA 2WIFA 3CN7A 5ALRA 4CCYA 2JBWA 5HQ3A 1UKCA 3RK4A 1QE3A 1XZBA 5K3FB 1U8EA 5DYWA 3KD2A 1QIHA 4MWSA 2GYWA 1CV2A 4C01A 1IUPA 5HFAA 5C8ZA 1ZIYA 4Y2SA 4BC0A 4J03A 2ACKA 1IMJA 5ALPA 4KYVA 4E14A 4OB6A 4B6GA 4X97A 4UUQA 2ZJ6A 4NZZA 4L0CA 3BIWA 3V48A 3LIIA 1MPXA 5K3DA 5JATA 4F5ZA 5AOBA 3E0XA 3H2JA 4N8SA 4ZV9A 5JD6A 1UT6A 4S0XA 5EHQA 1P0MA 1DQYA 4GI1A 5AKEA 1XZKA 5AKYA 5AM5A 1G66A 3D59A 3OURA 2QMQA 4X85A 3TGLA 1L7QA 1LLFA 4NMWA 1TKRA 3EF3A 1FFBA 4J0IA 2HIHA 2G5PA 3AIKA 4B80A 2CBGA 2QXUA 3I6MA 4MEAA 1AMNA 4PV7A 3KXPA 2D5LA 4XVCA 2RI6A 5JARA 5D7BA 5CW2A 1QTIA 2PSJA 5EIAA 4QLOA 5ALXA 1EA5A 1H22A 3R3ZA 4G4GA 3H0CA 1XZHA 3ANSA 2Y6VA 4Q05A 1SCKA 3R3WA 1U2EA 2ZSHA 1QGED 3U0VA 4Y9SA 2XQFA 4C4YA 3M81A 1RP1A 1YAHA 2HFKA 2WJ6A 4PO3X 4DIUA 1LPAB 3QH4A 4Y2YA 4LIPD 4AO6A 2DFPA 4KE7A 3V1NA 3G9ZA 4AN0A 1ZGCA 1ZJ4A 4UBLA 1Y7IA 5FRDA 5JYCA 2WTMA 1ODCA 3G0BA 2OAGA 3D0KA 5IVHA 1L7RA 2VQ6A 4B85A 5AKIA 2ZVDA 5HF8A 5JADA 5LZ4A 4JYPA 2V98A 2ZYSA 4X00A 2J4CA 5JD4A 3WA6A 4H7EA 4GDMA 3HSSA 5AM4A 5LP1A 4PF1A 5HQ3B 2R11A 2CKMA 4OSEA 1USWA 4FMPA 3U1TA 2PX6A 2G5TA 4QWMA 4F60A 4X7BA 1J06A 1BS9A 5EHZA 1W1IA 4KAFA 5T4BA 3WWOA 2WUEA 4UHHA 3FVRA 4LKOA 2WU4A 1WB4A 1BN6A 3GUUA 4G4IA 2JEZA 4ITVA 4AX4A 1U4NA 2ZYIA 3D5EA 2HA5A 1JI3A 3AIOA 4C4XA 3QMWA 3DQZA 2WG1A 4DMFA 1XZFA 3DCNA 5ALLA 1F6WA 4BTVA 1ZD4A 1GKKA 3WLAA 3AUKA 5HF6A 1VXOA 5ALSA 4C4ZA 2HA6A 3CXUA 1UK8A 4AB1A 3L1IA 1MAHA 2HA2A 4UFNA 3O9MA 3HRHA 3M82A 1S8OA 2GBGA 5HK9A 2I78A 1Y7HA 4CG1A 4BE4A 2K2QB 2XUAA 4UPDA 1XQWA 1G5FA 1Q84A 2XMSA 4AMYA 5AO9A 4Y2TA 5AICA 3MUOA 3DJYA 3K2IA 3C6ZA 3PI6A 2I03A 2J3QA 3FCYA 5HKAA 4AO8A 4FKBA 3UUEA 3WK8A 2VATA 3DL4A 2WHRA 1T4MA 1NU6A 2DQYA 3G0CA 3PE6A 3PF8A 2ZYHA 3FYUC 4DMHA 1EXWA 4FLEA 1B6GA 1VA5A 4W1RA 4B9EA 4AO7A 5FP0A 4BP9A 3VKFA 1J2EA 3ICWA 3WZMA 4AZ0A 1XKLA 1CUIA 3I2IA 4U2BA 3W04A 4K6GA 2Z5GA 4HRYA 5SYMA 5AM1A 1XZAA 5DNWA 1UKAA 4HVTA 1AQLA 2QXTA 3IUMA 5A7GA 3P2MA 3DEAA 1W76A 1CVLA 1CUAA 5C8XA 2GZRA 4WFJA 3G9UA 4CIBA 2ORYA 2Y1KA 1QFSA 1BE0A 2R8BA 4OB7A 4PW0A 3WWDA 5FUMA 5K3EA 3C43A 3EBLA 2XQGA 5ALOA 3X3HA 1A88A 4BTLA 2C5GA 2QS9A 3A6ZA 3LIPA 4Q3OA 1XRMA 5CT9A 2O2IA 1XQVA 4ZGBA 5AM2A 5ALFA 4UFPA 2HA7A 1UWCA 4X95A 3H2HA 5FPQA 3R0VA 1SFRA 1TCAA 1CRLA 2VJDA 3QPCA 2DQZA 3WWPA 5I9IA 4EZIA 1UK7A 5CRIA 2WFZA 3O4GA 5FXMA 3KWJA 2DR0A 1CUHA 1LNSA 3BJRA 1R9NA 3FYTA 3A2MA 4Y2PA 4KACA 4BDSA 3W06A 5LZ9A 1D07A 1Z68A 1XZIA 1GPKA 1XRPA 3WJ1A 1QIFA 3PFBA 3F96A 4DSZA 3ESBA 1ZI8A 4WDQA 4HAIA 3F98A 4C88A 2ROQA 5LYYA 2BFNA 2CB9A 1IZ7A 2JGJA 3B5EA 4CFSA 1FFDA 2C7BA 5ALMA 2CMFA 4XWGA 3G9XA 5DTIA 5AOAA 4BVJA 2OCKA 4B83A 1QIJA
chains in the Genus database with same CATH superfamily
5EI5A 4LOIA 5PGMA 2G7ZA 2BGJA 2HNAA 4EHKA 2FP3A 3VR4H 5LMCA 5A03A 1HUQA 3GEPA 5CA0F 1UK9A 4IDAA 5FNVB 1M6VB 1BXRB 5J23A 1EFCA 2ZRKA 4KPUB 1QO7A 1KSJA 3WGZA 5I9BA 4P7KA 4Q24A 4A10A 1WXWA 2C95A 4JUAA 5JROA 1ZZGA 1FZTA 1O96A 2IW1A 2QTMA 4M7OA 3SZOA 1ZOIA 1RJWA 4II2A 3T7KA 2J9GA 2EAUA 4TTTS 4E6PA 2QTBA 2PWBA 5JMPA 5K3SA 4OHVA 4BC1A 3HO1A 3U4MA 2G09A 2O8BA 1DRWA 1W0CA 3VVLA 1YIAA 2GF2A 3LQYA 4X6XA 4E4YA 4MWCA 4N5DA 1W46A 3KDSE 1JZSA 5CVVA 3JYQA 1XELA 4PXYA 1J1UA 4B3MB 2QZZA 1FMTA 5FKJA 2GILA 1FFEA 1AF4A 1E3TA 2HFJA 2O3QA 3AEUA 3CR8A 3P96A 2XI4A 4Q4AA 4Z7QB 3BQMB 5DT9A 1KERA 4MW7A 3JD3A 3GU3A 2EYQA 2E7ZA 2G80A 4JEHA 5JH7B 4DG5A 1Z8HA 4EB6B 3V2HA 5B6IA 5A9SB 3DMNA 3O8DA 1B93A 5B58C 2GZSA 3GLUA 1QK5A 5EY5B 3IT1A 5K3AA 4F21A 3MINA 4OATA 3JYHA 4ZAGA 4JLWA 2DPGA 2VJMB 5FBZA 4FZJA 3H8SA 4YWJA 1E2EA 4RM3A 1BA3A 5JAIA 1E5TA 2AXQA 2BFOA 1FYWA 1VJ1A 1LXCA 2AFHE 3NJ8A 3IKMB 3RRMA 4W9NA 1ZFNA 2QX4A 3TLJA 5JAPA 1HPLA 1KFCB 1NR5A 1COWD 2REBA 1WMSA 3E9NA 4QTUB 1WTAA 3A9CA 1EAMA 3P32A 3R3UA 2HADA 5GY7A 4B4KA 1JI0A 2BSXA 3VI4B 2QTAA 3Q9SA 1P0IA 1R8JA 2Y2VA 5LKRA 2HF9A 5GONF 5D3KA 4UE6A 3DQQA 4JIGA 6Q21A 3ITKA 2B1QA 1L1EA 3FCOA 1ND6A 4HZUA 3K6SB 1J23A 4DA9A 4D56A 5B7NA 3LLCA 4L8VA 2CL7X 2OORA 4IZ6A 2CFCA 1GQRA 2JANA 3N76A 4MQEA 3VYWA 2B1JA 4KITB 4KKXB 3CW2A 2NVOA 2FR8A 3RUDA 2PM8A 3FCXA 3KOZA 5AHXA 1HNWB 1M1UA 4LZOA 4K9MA 3HHEA 3HQ4O 2OM2A 2DUWA 4L8FA 3TE6A 1IHOA 2XD4A 4RPKA 5ALDA 3WB9A 1PNRA 4CMEA 4EGFA 3BTOA 3WNBA 4C0QC 5B57C 4REQA 5EQJB 3M5CA 1FRZA 4KXFB 4TRNA 1ORDA 2ZLBA 2IS1A 2HT1A 3G6WA 4IOLA 3RARA 1HR0B 1Y8RB 5F2NA 1O8CA 4IXTA 1FTGA 2JGKA 2P9FA 2NVUB 1SJ9A 5FLEX 2JK0A 3OEED 1WP4A 5KTTA 1TKCA 4TWIA 4V0NA 1J21A 4TTAA 4BZWA 4MUBA 3UPUA 2B4KA 4LXXA 4N7BA 2XAAA 4QEDA 5A3SA 4URFA 2OHGA 1U2PA 5IM4F 1SXJC 4IVPA 4R9VA 4YGXB 4HKTA 1A9PA 1C3OB 2DB3A 2MSKA 2IX9A 4HFMA 4TPKA 1PAUA 1POXA 4LNAA 3VX3A 3WMXA 3DAFA 4FS8A 4GZ3A 1T9CA 4PC6A 1F8FA 1KZ6A 3IJ5A 2VBCA 5KKNB 4X94A 3GCXA 3K0FA 3HJFA 1MB9A 1QE0A 2EKQA 4Q4AB 1YQWA 2ZEJA 5JJ5A 1B73A 4A6EA 2XOKD 4YBZA 3E3LA 3RSLA 2ZETA 3GIWA 4MR7A 3W5SA 2O2DA 3QFSA 1EUYA 4EI2A 3V42A 3PP8A 2IGTA 2P0AA 2QX8A 3IXLA 3MINB 4OM8A 4R7GA 3H04A 4W1QA 3UCXA 2ZP1A 4DCNA 4URHA 2WMNB 3GO4A 5FL7D 3U7JA 2Y0EA 3MJSA 1QYVA 2H1FA 3TM4A 3R1IA 2OPHA 4CUJA 3WYBA 3BE8A 1DLIA 1RWVA 3MAJA 4W8HA 3QPDA 1ZNQO 3FI9A 5CNKA 1J7JA 4ZO4A 2I3AA 1NBAA 2G06A 3DO6A 2A67A 4FW9A 3FYHA 1M5UA 3RJZA 3DZ8A 2JFYA 3AHJA 3FRJA 4IAOA 4D74A 2GBCA 5CFZA 1CDDA 3CBQA 1KSFX 2CZQA 3ZTYA 1R50A 5EE0A 4WY8A 4N1AA 5ITVA 4TLLB 3G23A 5IAGA 5I6DA 3VZRA 2ZWMA 3JQRA 3EY9A 4QD3A 3SI7A 2EP5A 3T5AA 3H83A 3TJZA 1Z7EA 2NM0A 2GA8A 3TUJC 721PA 3CX7A 1HT1E 4BNXA 4P5DA 1U8FO 2BAGA 5DHSA 4M2LA 2KW5A 2CEAA 1E0KA 4G8JA 5C0OE 2KQUA 4UD2A 1HDIA 1QU2A 4K2AA 3TLZA 1VPLA 1SQFA 4Q1VA 1IK6A 4DDHA 4LY0A 1QHGA 2OV2A 2G70A 5AKZA 1RRCA 1HOTA 3ZV3A 4HSGA 3NP9A 3G7UA 3P9SA 2A59A 5JCZA 1Y3BE 4HNAA 3UWSA 3LOPA 2X0RA 3I2YX 4G9EA 4WWHA 5KJFA 2IHVA 3R0IA 4MULA 5D85A 3QYPA 4BKRA 1PX2A 1TADA 3TW0A 4URZR 1WD5A 5ALUA 3LGAA 3EGDB 5KYTA 4Y1RB 2H54A 5EL0A 4C43A 3ZTWA 1CHNA 2O2YA 2ZDQA 3KXIA 4O2AB 4P58A 3PEVA 3DA8A 1M0WA 1XA0A 3VJKA 4S24A 1O58A 4L4RA 2VAMA 4LVCA 1C4OA 3DW1X 1RI4A 2OFOA 2J0UB 2OMEA 2MSDB 3CUWA 3CWZA 3WWYA 4K1XA 2BR5A 4QT0A 4RY9A 5AR1A 4HCJA 3DHWC 4C0BA 6REQB 4X8HA 1A8IA 5A6SA 3BD6A 3MJFA 3QY9A 2OORC 3P2JA 3IR6A 1VC2A 3WI7A 3O9VA 5C35A 1RPZA 2CXOA 3ICEA 1T3ZA 2H18A 1W47A 1UBHS 1K7SN 5K6AC 3BZWA 1J22A 2ACVA 4DLVA 3TPZA 1XXLA 2P9EA 5M7EA 1DG9A 1QH0A 2X3FA 5BSGA 2OCGA 1CNMA 3RFFA 4MVJD 3O7MA 3OPYB 1KY5A 1EXMA 4ZVKA 2JFZA 4B43A 2XRZA 4GPD1 2FDCA 2ATIA 3W5VA 3BXOA 1PHRA 1EWKA 4LNUA 3BWDD 2Z57A 1GNRA 2WAAA 3BGVA 3BFJA 3N5CA 4DV0B 1PJTA 3GT7A 5K3BA 1XJWA 4LRXA 3DZGA 1K89A 2QLNA 3F3MA 1XE3A 4OUKX 3EUAA 1J5EB 4UHCA 3FNEA 1QGOA 1KH3A 2ZWVA 1PD0A 4R98A 2ZUTA 4B35A 1JAXA 4RPCA 4RTOA 3TKAA 3VDQA 3NGLA 1LK5A 5HZHA 2NG1A 4UUOA 3L4JA 1NIPA 1VPTA 3O93A 2VXBA 4XXHA 5H1YA 1PKXA 4J0FA 1KP9A 1Z4PX 3OLXA 1D2NA 3JALA 4F4HA 3IOEA 4O2AF 5FWXB 2YOHA 3UUGA 1RM5A 1B14A 2AC4A 4DN6A 5IXJA 5IEBA 1ONBA 2GNPA 3DBRB 4XVHA 1IZZA 3NONA 3NWJA 4LHVA 5J47A 5GV7A 5CEJA 4BGDA 3TMKA 1THGA 4AKHA 2A14A 2IUYA 3AWIA 5L3SB 4NSNA 2GVDC 2VPTA 3T52A 1ESZA 1E1KA 3ZVNA 3H8VA 2HLPA 2DFDA 3DFKA 1SPXA 2IT1A 1FDIA 2ZWIA 1ULUA 4FJ2A 4YO8A 5ALKA 4NDAA 1AKNA 3THOA 4GBJA 3W3AD 3M6UA 2ZWOA 2WIGA 3DBHB 3MHPA 3KIPA 3Q8WA 4OUDA 4R6WA 4DREA 5DNUA 1ES9A 1RLIA 2QRLA 2XQKA 4HAOA 1M66A 1OPRA 2Z4TA 4R5MA 3MYRA 3QPWA 2UKDA 3TZEA 2VJMA 1RACA 4LJ8A 2JI8A 4PRZA 1WPRA 1YFZA 3D5TA 2O20A 3ZJTA 1Q1GA 3A6GA 2X8WA 3BS4A 3IR7A 1OSNA 3VBEA 5KTOA 1V3QE 4L4ZA 5LA6A 3TRIA 4PIPA 3UTCA 5CAEA 2BD0A 1ZS9A 2ARKA 1U0NA 1J9EA 3KVVA 4NV1A 1VBMA 2CF6A 5C31A 3OPVA 4ND1A 1W93A 3Q5GA 4ZKEA 1JAHA 3OBIA 4CLEA 4O59O 4IHJB 3M1YA 4P6VF 2B61A 2EW1A 4Y0VA 1BFKA 3KV3O 1GD1O 3SC2A 8GPBA 2JKZA 1BS1A 1W5AA 1E3JA 3AILA 2HPHA 3OJWA 2ZJ5A 4FFSA 3PQ6A 4ZK2A 4JJGA 3KOXA 4IJMA 5BMVB 1N75A 5F3RA 4I55F 3I2HA 3T5BA 3OFKA 1CUBA 4MYHA 2ZANA 5E8JA 2Z1DA 3NWBA 2JVKA 3OUTA 2EV9A 1IJFA 2R4TA 2H11A 1NUTA 3I2KA 3KDAA 2NU9A 4ZZ1A 1F1JA 4MA0A 3MWDB 4RK5A 1F51E 1V4NA 4C89A 1UBFA 2EIHA 2ZKLA 1T6BY 3G2PA 1PL0A 3L8ZA 3MJHA 4A4DA 4EY8A 3D6NB 3TDNA 3C41J 3I8OA 5FBWB 3ZEIA 4XJTA 2FOLA 1CY4A 4NVRA 4HXYA 1WEKA 1R12A 3UAGA 2ES4A 2EWWA 1D1PA 1NQTA 1RYEA 2IHTA 2OBMA 2WU1A 4GLOA 4MPRA 4AMBA 2ADOA 1FC0A 2XR1A 2H1WA 3VJMA 1VYUA 3WYFA 2CYAA 1TUEA 1J07A 2VRNA 4FMCF 1G8HA 4FYIA 2PRZA 3LUBA 4C7BA 4YMUA 3T3HA 4BNLA 5KNCA 2UU9B 1AIPA 1LBEA 1TM4E 1VPEA 1R88A 221PA 3JXEA 2Q3HA 5CVCA 2OL4A 2YH2A 4MUKA 4W99A 4NNJA 4WZAA 2W6MA 3KM0A 1L5ZA 2HWWA 2QE7A 2X0KA 4KFUA 4DCGA 1C3LA 3U3JA 4KIGA 1KJZA 2GH1A 4W8GA 2EFCB 4I66A 2VDJA 3CHYA 3KS9A 3S68A 3ZOKA 3CSSA 2HW8A 3IPYA 2XWSA 3ZWYA 1C7JA 3PQ4A 4ALNA 1RABA 1HE4A 3IEMA 5I9LA 1E5QA 2ZWAA 1I9CA 1EFRA 3BDVA 3CLTC 5K5EA 3FNIA 4YY3B 1ESNA 1G64A 3EVZA 3A0RB 2QI9F 3A28A 1THMA 3BRWA 4P1ZA 1K4YA 3GOHA 2QD2A 4C78A 5GONA 1GWNA 4F93B 1Z12A 1KO4A 3TNDA 2AIRA 1Q6YA 3DNPA 3KOOA 3LI2A 3FLEA 3KEMA 2GM9A 4RC9A 3LHKA 2OBBA 2PIAA 4FD2A 4G4JA 1UDBA 3RLFA 2FFJA 1XKQA 2VRBA 1IIRA 3VOAA 5DEIA 3SJBA 1C50A 4IV8A 2N1MA 3A2NA 3MS2A 3OOSA 1C2YA 2CUKA 3QFTA 4Y2VA 1CF9A 5FBKA 1CZLA 1W4AA 4JQOA 2BCGY 1JT2A 4D9GA 1VJ5A 1A95A 4LHXA 4NBRA 5E2AA 4FHZA 2FSSA 2YXBA 4Q48A 4UCWA 4TUYB 2DUMA 2G4LA 3ZV6A 1EHYA 5DEOA 1P2GA 3D4LA 4XIIA 4H1VA 1UZNA 2REXB 2VBGA 3WIEA 1UT5A 4QYSA 1A71A 4UCQA 5K0JA 3SWWA 3DKIA 3EMVA 1NXSA 2L42A 3SP1A 4BFYA 4EJSB 1M1YE 4DM7A 3PLAE 2A5DA 1QH8A 1FYEA 5J5AA 2HXGA 4DLUA 4ZXFA 4CF5A 2D1FA 3RSQA 2ADFA 1OVMA 1TKBA 4R2XA 4OY3A 4PRKA 2OAEA 4KNVA 3MBKA 1G20B 3SSOA 1EVEA 5EIEA 3GRCA 3PNOA 3T3GA 3CJTA 1QHSA 2DHRA 3WO0A 3ZWKA 4BP3A 1YSCA 2Y76A 4TMYA 3BJEA 3DF9A 2VQEB 1ECCA 2XYQA 1ZH0A 4DT1A 1PVOA 4WK4B 4M8KA 3K6RA 5EUCA 2C5BA 4YJFA 1QAMA 4AMUA 3WJ7A 5KYKA 1GAJA 2VNAA 3F3KA 3FWKA 1S96A 4YQZA 1WDTA 1D04A 1TCCA 1TCVA 1TT5A 2IQ5A 2E21A 3SZMA 3P9RA 2FPRA 4A2QA 1YZYA 3OU7A 3DC2A 4Q1FA 1D2HA 1B23P 2GZ3A 3TZKA 3GUZA 5CFQA 1Y48E 3AUJB 1XRLA 2O5RA 1ISJA 1JKFA 3QEOA 4XR4A 4JJZA 2LBPA 5DXJA 5E2IA 4RZQA 1CJBA 1OXMA 5L4SA 5TRTA 1W0JD 3STYA 1JEEA 4AZWA 3HKDB 1IQRA 1IATA 1NG1A 3TW8B 3U39A 4D0SA 2P77A 2JLBA 3NPMA 2PBLA 4DCPA 5ER9A 2L18A 3MT7A 1BWQA 3AGQA 2HGSA 4TWRA 3IJEB 2ZS8A 3HP7A 3T7AA 3V7NA 4MVJE 1HLPA 3G5AA 5CT8A 4C2TA 3NHWA 5BWCA 1SD2A 5KREA 1Y7PA 3N5KA 4RAQA 3COZA 3R20A 5H9WA 2HH9A 1WZCA 2GA9A 1IWOA 3PNMA 3D5QA 2L19A 4KJXA 4LRUA 4MVJH 4NCXA 4AKGA 4XLZA 4ZK6A 1RLOA 3RUFA 3PDUA 4QEKA 1SUCA 3ZEAA 5EFOA 4BNDA 1D5WA 1IAQA 1GQYA 3JU3A 5LQUA 1JQEA 2IKSA 4YCCA 4D8YA 5K3OA 1A8UA 1DC6A 2YHIA 1W5BA 2YL2A 5JECA 2JLUA 4I1PA 2VH2A 3D2LA 4H0NA 3AF4A 5T4FA 4ER0A 4JKOA 2G5CA 4MYRA 4QUGA 5KHLB 4KRFA 2J3LA 2RGNC 2GLTA 1BN7A 1JHOA 4DIKA 1K5GA 1SR8A 1ORHA 3WLMA 1JHZA 2PS0A 2QZPA 4Q0MA 3TKYA 5KEIA 3SDZA 3ZN2A 3LT0A 1ZUD1 5CU7A 4PG8A 1WR8A 5FJIA 4R40A 4R1UA 3JWPA 5IVPA 2JJYA 3CWQA 1RWXA 1CB7A 4II7A 1GNSA 4LYYA 4PG5A 4G5GA 2B25A 3OMLA 1P3DA 4FD3A 1A72A 1M75A 4AJ4A 3TD9A 3QU4A 1VL2A 3THXA 3ZHOA 3PRKE 3NW9A 1W75A 4E4RA 1Z47A 2NAFA 3Q3HA 4NENB 4UEKA 3R7FA 3T7RA 3ABQB 1GVNB 4DCVA 5LMUB 3HGQA 1VFPA 4F72A 1DAIA 2R8ZA 3GJ4A 4ETMA 2C1ZA 1GFWA 3K6JA 5FB3A 5JZBA 3GLIA 4TQAA 4J0HA 3UXMA 1OASA 1Z7GA 3IUYA 4FXOA 4OQFA 4OP2A 4QM6A 1VHLA 5CK5A 2AEFA 3H5VA 521PA 4ZVUA 4D80A 4JIMA 2ECPA 2XKBA 2VDVE 1E7YA 3N2KB 3FHCB 4YRTA 4J0EA 1JXQA 3R23A 3LXMA 4PPGA 1EJBA 2H3EA 2JC3A 5KSPA 1CNEA 1FDUA 3LRTA 4NDZA 1ANKA 1HURA 4EHIA 3V34A 4YLYA 4I19A 4ZJYA 3RM3A 1XSEA 3P2EA 4KIWA 3VO2A 2JLSA 1TQ2A 2NU6B 1NZDA 1SVSA 3EYWA 4AF6A 1QK3A 3WJAA 3WR5A 3ZJVA 1M8GA 4XQCA 5A5VA 5IDQA 1GG9A 4F96A 2WTBA 3T8YA 1C9KA 1Z73A 3Q72A 2ZAOA 3MGKA 5JQGB 2WFMA 5K2OA 4FUTA 4FMBB 4GO1A 4BMOB 5JNLA 3EHEA 16PKA 2XNDA 1O87A 4JUDX 4MLPA 3VH4A 1SA0A 1N5JA 3ITNA 4TLBA 3TSAA 3UMSA 5AI5A 3CZMA 3C15C 5HKKA 1F7VA 3WK5A 3TR6A 3KQUA 3L93A 2OYSA 1L7VC 4TLEA 4WERA 1P9OA 1P33A 2IP2A 2OCXA 2XWJI 1GT6A 4KC0A 3G2HA 3A6JA 3IRUA 4DYHA 5KNBD 4LCJA 5EIBD 1G3RA 1WZUA 1KY3A 2RGEA 3PC6A 1FCJA 2A0UA 3B1VA 5JU6A 3SZRA 2AF3C 2PRKA 1CYEA 1DCMA 5JDIA 2PGJA 2ZJ2A 3DMTC 1FMFA 1C4WA 3IMGA 1DC5A 1VZ3A 3QYJA 1N2CB 1TCUA 2FGKA 3ANYB 5LKAA 1CUDA 5I7HA 3A9UA 4RTJA 1Y9AA 4HH3C 4HWGA 4O02B 1NWCA 3ZDRA 4D4HA 4CG0A 1Q7TA 3AJRA 4LDNA 4OQPA 8LDHA 2WIBA 4Z8XA 5C34B 3DMGA 4OJTA 5D1NA 4LI0A 3DAGA 1VE5A 3L8DA 1WHSB 1UKZA 2D8AA 2WWRA 4IEEA 4ZAZA 4FFMA 5KOHB 5CB4B 2EZUA 5KTPA 2D6FA 4JGGA 1UFOA 1U0LA 5JZOA 1I6LA 4L73A 3TMYA 1GZ4A 3WB0A 1DFHA 4FHGA 3CVWA 1S2NA 4FKZA 4GXRA 4X64B 5A62A 4RTSA 1ZW6A 2BMAA 3UT0A 5L51A 1QNLA 1BX0A 1A04A 1OROA 3FIJA 1SQGA 1Z3IX 1JSZA 4QUBA 5GV8A 3CZRA 1JQDA 5L9AA 4Z4FA 4US1R 3ND9A 1ZN9A 3OT1A 5DTQA 2VHUA 4Q4LA 4AN4A 4YP6A 1GCUA 3G7NA 3NTXA 4WL0A 1Z2OX 4ZT4A 2HF2A 3EPRA 3EXHB 3CN9A 3H1PA 4L0MA 2KI5A 3FTNA 4EHFA 4HX2A 3HMKA 1K6EA 3KOMA 1NPTO 2JHAA 2XB6A 4RXTA 2KBFA 4HDMB 1ORVA 5L3SA 3KZNA 2LDXA 1T1RA 3U61B 3VJLA 3ODPA 2QK4A 3Q10A 3HA3A 2FOXA 2XUIA 1Y34E 2XMZA 4IIEA 4B34A 4BNGA 1PNTA 3KB6A 2ZIGA 3EXIB 2VJYA 4E15A 3E9MA 3CH7A 5LVAA 3UJCA 2XWBF 1M2HA 3KZVA 1CDOA 1RBQA 4KQ1A 5L45A 1FTYA 4ZEXA 1FUEA 3D3KA 3GJ7A 1KO1A 4P33A 4CM3A 2OENG 2TECE 3K35A 4D9KA 2AJ8A 3IDAA 1C81A 5KYNA 1ISIA 2X23A 5HJ2A 3KJZA 3GELA 1MC4A 1R16A 3IOYA 1XTUA 3ELDA 2XCLA 2C9YA 2NTJA 2R7NA 2V59A 3ZGYA 4BU1A 3VZDA 1H1LA 1MU0A 2W2MA 2BEVB 4PZPA 5I9SA 4RY8A 1XC7A 3OE7D 3UBTA 2B94A 3QVKA 1W35A 3EXFB 1W0KA 5ALEA 2DFTA 2JFNA 3K09C 4HI0E 5F5NA 1U3VA 2KYRA 3OM9A 3QX8A 5FA8A 3RUIA 4N8EA 2YWFA 4TMZA 2O6LA 4G56A 4ENRA 5ERGB 1DJLA 3VV3A 2ZYDA 2YCBA 4NBSA 4PPFA 1SZPA 1P2DA 1EFVB 1JQAA 3I2GA 3FVVA 4KRYA 1Y42X 3URKA 3OQIA 2QB5A 2JFXA 3MM4A 3EJ6A 5A7HA 4LF6B 4PG7A 2M1XA 3PHBE 1ECBA 4U2DA 1M6HA 3SIRA 1X94A 2GEDA 4ERNA 3VR0A 3O94A 4L2IA 4NK5A 1PW7A 3SBEA 1ISGA 1E7SA 1B6SA 1KAHA 3PDJA 3KOWA 3HVIA 3JQQA 4GLBA 5KSYA 3JALB 1RXYA 2VF4X 4CLRA 5J43A 1LA2A 2JJ1D 3DOEA 4W82A 1DOZA 1XV5A 3TJRA 2EEZA 3U26A 1S4MA 3QWAA 5CB4A 3GLIE 3IQFA 4BCBA 1TW2A 4TQGA 3ZGNA 3II6X 2OV1A 3PC4A 3P2KA 2IIVA 2FU5C 4E7OA 5IFKA 5E4JA 3STWA 1TFUA 4LQ4A 4C2UA 1K27A 3WNZA 1BOOA 3B2QA 1NAHA 1QBGA 2I6QA 1PT9A 2VTBA 1GN9A 1UT8A 2RIPA 4OK6A 1CUGA 4XJXA 4ZDWA 1OGJA 3VR4A 3E5MA 3MT9A 3PQ8A 5JR3A 5BXQC 1P8JA 4AJOA 3IULA 5KVVA 4ZHQB 1JVSA 2YIJA 4LE0A 1T8WA 1YQUA 3V7WA 5EZ5A 1KI2A 3VNAA 1P29A 4P82A 1NM5A 2A0YA 3OZUA 3F5MA 1VHJA 4YV1A 1XI2A 1XVAA 1EWRA 3DWGA 4WNCA 2SCUB 3N70A 5KTRA 2BN4A 2C3UA 4LUCA 3CKLA 5CYGA 2C96A 5JNVA 2LCFA 3HDGA 3WLPA 1IOWA 1JQ3A 4KXVA 1OA0A 1Q14A 1FMJA 1PI3A 3AUSA 3AF0A 4UBNA 3DP9A 1AZWA 3NB0A 4YXWD 3U4QB 1SURA 1YUBA 3GARA 2ON6A 3JQ8B 3M34A 1BEEA 4BN4A 2BYTA 4F7DA 3CX8A 1DHTA 3JATB 2EW8A 5CDUA 1GTZA 1N2OA 1KEEB 2JZCA 3NHBA 1JNYA 2QQEA 4FKMA 4Z2AA 2R2AA 3ELWA 1Y1TA 1GZ6A 5KI6A 1FUIA 1NRJB 1H6DA 1Y4DE 3UM9A 1DO2A 4CMGA 2WD8A 1KJQA 2BKEA 4NBLA 3LD9A 2NZWA 3RVNA 2IDJA 4D45A 1VMEA 4F6CA 1K75A 1JJIA 4CIYA 1ZD5A 4LY3A 1NT4A 2O2HA 2PCLA 2XUHA 1J0BA 1E4EA 1SIBE 3AR6A 1FS5A 3HGTA 2XUKA 1BU8A 3PICA 2YXEA 3PXBA 1MH1A 4M8NE 3DDSA 4Z86A 1V8DA 3ZCXA 1ZK3A 4N5HX 2GD1O 5J4VA 3FJYA 1U3CA 3CF2A 3OZWA 4NOLA 5GGXA 3R7DA 1NV9A 2W2QA 1GTL1 1EHIA 2XVYA 2HRDA 3IBSA 4DKJA 4O3MA 2AQ8A 1ZK4A 4EHLA 3H5WA 3LVQE 4Q01A 1N0IA 4RE6A 1IVSA 1GPWB 4K2HA 2CZGA 3WNVA 1F5SA 3L18A 2WUGA 4D5EA 1E6LA 1SCIA 3G2LA 4YMTA 2QGZA 2EDCA 3GJYA 4QVKA 2BMEA 2MHCA 4LYFA 1L7BA 4B2IA 1ENPA 1V5GA 2GHQA 3NHMA 1BYIA 3ZWNA 1NX6A 4FFDA 4RZIA 4B4UA 1ISMA 5E0KB 1UQTA 4MWBA 1KRXA 3A3NA 4NU8X 3PX7A 4I7EA 1NKSA 3D7RA 4U0KA 2ZI6A 2A5JA 3BWYA 2IS6A 1I3MA 1ZUNA 2NSHA 2Q1WA 2QA5A 3IHTA 3VKWA 1DRUA 3DYVA 1TJYA 1N5RA 2H3HA 5E6UA 1PR4A 2CXSA 4JI1B 3ZVLA 4BX8A 1E2UA 3DVSX 2P8JA 3FHJA 1J25A 3QTLA 1T2NA 1UR5A 1Z7YA 5K0FA 1KP2A 4BKUA 5H59A 4S2EA 4Y1FA 4XWTA 3P71T 1UZLA 4G5OA 1LBSA 2HLHA 1KYXA 2I34A 4F5DA 2BUCA 4YCBA 3DOIA 3KQQA 3N7UA 1U8TA 2OLKA 3RABA 3W8RA 3A04A 3VO9A 5JQWA 3IMFA 4Q9JA 2QVBA 2H5IA 4I4TF 1ULZA 1W5SA 1WF3A 4FWBA 1KBZA 1AQJA 4GXTA 4X9XA 1NNI1 1CUYA 1YRQA 3NEPX 4ZVQA 1SOUA 2H2FA 2L69A 3DR3A 3DM9B 3K8YA 1EYZA 3N53A 1OYWA 4J49A 4LBWA 3RE1A 2K2WA 3DFIA 2DCMA 2ORIA 3GROA 1QF6A 2FNAA 1ETUA 1C3EA 1EKXA 1QFXA 1KMIY 4YUXA 1E9VA 1WXFA 1OWMA 4Z99A 3Q5EA 3HI4A 3V5NA 2PUWA 4BLVA 1STOA 1ESDA 1E66A 1DOHA 2JIQA 3O8RA 5DX0A 2QTFA 4PVCA 2ZI5A 2Q0HA 4DLZA 3CPSA 3GC6A 4QO8A 2I4RA 3SE7A 3QENA 4LMBA 1JJFA 1FSSA 4I4LA 2C9ZA 3N28A 3ZZTA 1XB2A 4D43A 4IQGA 4YV2A 3E53A 4FCVA 1R4MB 1L8OA 1NR1A 1RRGA 3F67A 4MUYA 2DEUA 4X20B 1QDUA 3EW7A 2CV1A 1PBNA 2GM5A 3ORRA 3OZIA 2OY0A 1Y9ZA 3EGCA 4TLAA 5TVKA 5KWSA 5DM1A 3FPJA 4PE5B 3CR7A 4MB6A 1SUSA 2QLFA 1V4BA 3NDRA 3NHPA 4RLFA 3VPCA 1D4ZA 1L8QA 2OXRA 2YYZA 3LBYA 3HDHA 3R7BA 3BREA 2XKAA 3K2BA 3L6DA 4M7RA 3Q3GE 4NU5A 4U39A 4TXMA 3H9JA 3UMJA 4HNTA 3EPJA 2UUCB 4B82A 2PFKA 1RKXA 1QTRA 2FFHA 2VZ0A 5TSDA 4N0QA 4A1OA 2NVBA 2Z58A 2J8ZA 5E9WA 3DV0A 1JDVA 1KOFA 1XZQA 2O7RA 2OFXA 3F4BA 5ITWA 4OHUA 2DBYA 2RH4A 3SY8A 1Y8QB 2OGZA 2AFIE 3BQNB 1XDUA 1K8XB 2HIMA 1JTEA 3QNWA 4LS3A 4OD0A 4F12A 3PUJA 1SUFA 1UIMA 2L17A 3F9RA 1GL7A 2A78A 3G3EA 2I4OA 4EUFA 3GP3A 1Y33E 5CIQA 3T0FA 3STVA 3A2LA 5REQA 2HTEA 1U8XX 3FOZA 5AKKA 1I2DA 2AJTA 1L7MA 2QSUA 2A9FA 3LC1O 1CS4C 5AW3A 4JWKA 3V4OA 2Q07A 2ABWA 4C7OB 3M4NA 5C7IO 1EUZA 2ZRGA 2Q0XA 4B7CA 2V7VA 3DFMA 1GLNA 1XA4A 3NBFA 2CBZA 4LNHA 3W6OA 2PX2A 1XTSA 4QHSA 4L6CA 3MILA 2C4MA 2OECA 4PLHA 3QXSA 4N5LA 1G55A 3KJEA 1RRVA 2ZRDA 3L7OA 4M1TA 4XQGA 4TZ6A 3MRSA 3ZXXA 3HWWA 4BLOA 2AD5A 1XDGA 1ZJYA 2VPXA 3QELA 3HU5A 4WSOA 4Q15A 4ATNA 3U3DA 5JE8A 3U6KA 1S2LA 3U17A 1K5HA 1TFRA 3PLRA 2X41A 4XVRA 4CNBA 3CCBA 3JS5A 1DL5A 3O4FA 4K6OA 4NOMA 4X6UA 4DV5B 1NDHA 1RCTE 1KKUA 2C5SA 3DD1A 1TJNA 3HFGA 4NRDA 1PWEA 3TIXB 1VPVA 3WMWA 4W5JA 2C3OA 1A5BB 1S1CA 3JQ7B 4IDNA 1SVOA 1A76A 8AT1A 1R4NB 3GMDA 5C1OA 4FEGA 4I2NA 3L4BC 1RWQA 4EMSA 2O2EA 3NVAA 4BECA 3AETB 3SLKA 1M0EA 2V58A 2IL1A 5F2OA 4RORA 5DN6A 3PRHA 3VSCA 4D5GA 1Y37A 3KZXA 1U3WA 2CFIA 3UOAB 3V9AA 1ZXXA 4PS1A 4EHDA 4ZCLA 5FUQA 2IY7A 4KE6A 5T4HA 5C1DA 4TV9F 5GJCA 4PLCA 4H2DA 3HFSA 4Q7JB 4FHFA 3EODA 4NJMB 3RBXA 3WOHA 2Q6IA 5TT1A 3NT4A 1F4VA 2R8OA 4CLXA 2GN9A 2VF8A 3G8YA 5JQGF 1WUHS 3DDUA 3LXRA 1SD5A 2BEWA 4OV6B 4QOIA 4F2DA 4HX9A 4JVOA 1YF3A 2X4IA 3AONB 3KFLA 2R86A 3EIWA 1B8PA 4R8SA 1DJQA 5A04A 4KX5A 4JVMA 3LYHA 4WZAB 2BH9A 4ZXPA 1UBMS 5DF1A 2DETA 2Y92A 4B73A 1QGUB 3B52X 1E79A 2A88A 2V0CA 3EZ9A 3NBYC 5FTLA 1BVHA 4DTCA 4RTLA 5GVSA 2DG2A 5IVDA 3I28A 3KR0A 1S3SA 5AKLA 2X0DA 1P72A 4WY2A 3S2SA 1W36C 2XTJA 1OQAA 4MVCA 3IP8A 4JLPA 2GESA 3JVIA 4IJVA 2OB2A 5IT5A 5LLDA 2FG6C 1UDRA 4UU0A 2ZIVB 4X66B 4PFSA 1EJ0A 5HJ5A 2OO5A 1T4GA 4C0SA 5BXYA 3CZCA 1UOQA 4W1SA 5CXXA 2DSNA 3CTMA 3L6UA 1MFZA 4GX5A 5KNDA 3PFKA 2HK7A 1Z5WA 3KVNA 3LP6A 2CLIB 2X1HA 2DT5A 1CQPA 2NQ2C 4S12A 1HFWA 4I0WB 3UUFA 4PYOA 4OEHA 4R81A 1GYQA 3QU7A 1H85A 3WYAA 2G67A 2Q27A 4OMCA 4JI2B 2R5NA 4QECA 4UDNA 2BGIA 2VSXA 3TIGA 5CM2Z 1V8ZA 4NY1A 2VRCD 3CYFA 4L4XA 4J7XA 4CQNA 2QOEA 2B4RO 5ER6A 1QQ6A 4BZPA 4IGEA 4R1NA 3O2QB 3G59A 4R05A 2E0IA 2PEZA 1TMKA 4KG7A 1XU9A 1UZMA 5KTMA 3FLBA 2P1ZA 3PG5A 1RPNA 4J0JA 2ZZKA 2PGDA 4Q3AA 5HF9A 1DIOB 1TW3A 3BERA 3K0KA 3ONDA 3PNSA 4IG9A 3RU9A 5KTKA 2UYOA 5BW4A 1T26A 2XMBA 3O1HB 4JH0A 3O1JC 2AVNA 2P2CA 1CQWA 4RD6A 4REOA 4TT8A 4H16A 1U9IC 4XR9A 5ENDA 2EQ5A 4PONA 1ZICA 2O1EA 3A3OA 3L1JA 3OX2A 5EPEA 5JC1A 1Y6JA 2A9OA 3UB4A 2HBZA 3E5RA 4B6PA 1U02A 1WOMA 5EMLA 4IY1A 4YP1A 1E3WB 3HWSA 1C9DB 4M89A 3AVTA 2FE4A 2NO0A 2EJCA 5LP6C 4CUKA 2DTDA 4NBWA 5EIFA 2WJHA 3GOQA 1UBJS 3OJLA 4Q6BA 4MYSA 3IE1A 4YDRA 3GGSA 1YOVB 1LF5A 2ZJFA 3QUBA 3R24A 4TUYF 4ALMA 3H99A 1KJ8A 1M2JA 4RXUA 4H60A 2IDZA 4JLMA 1RVDA 3NHJA 1IEVA 5AI6A 4J0QA 2JRCA 1NVGA 3OJ0A 4Z4HA 2BHNA 2FMHA 2IXEA 4P3NA 3SIPA 3R7WB 2NNWB 4WKPA 1JU4A 2FFRA 3HJUA 4Z3KA 4KR3A 5BN3A 3OLCX 2EGGA 3FOBA 4EPYA 1JIUA 5HSGA 1K8YB 3D0OA 5BMVA 3RFVA 5LBTA 3B51X 4Q37A 3MWEB 3UB3A 3JVEA 1P77A 1YA4A 4KVGA 3TTWA 2FW8A 1UQRA 2OZVA 3EA5A 3AUAA 3RJ5A 4MS1A 4B31A 4GPZA 1FYFA 3GY0A 2B99A 4BBZA 2OCBA 4BO5A 3K5HA 1H8ED 3L8HA 1E3WA 4Q6WA 2XGGA 1QOPB 1G21E 4UASA 1VL5A 2SBTA 3HYSA 1TU3A 3P4XA 3L77A 1WNTA 5BQ5A 5IU6A 4YRLA 4TXJA 5K0NA 3OTWA 1TLLA 4FT4A 1RJEA 1ULBA 4QOGA 5IJ0B 5FL7A 2Y4OA 1FVXA 2H6EA 2SNIE 1R0ZA 3T1TA 4YCNA 4RK4A 1SWVA 4GECA 5TDHA 2YJNA 4MHOA 5K0BA 3RYIA 1HE1C 1Y3FE 3H16A 4BMNA 2P4UA 4D96A 1NT2A 1ZDMA 4MO9A 3LS2A 1VOTA 4BJ3A 2IHYA 2ZIWB 3G2NA 1DUSA 3KU1A 4M6WA 2YHUA 1RXEA 3AESA 4WGFA 3PCRB 1UXIA 3UQYS 5BOVA 4C3VA 1XTZA 2FAXA 3FYCA 3EVEA 2RG7A 2QL6A 4LDQA 2WZCA 2YBDA 4OHPA 2A4MA 4X1IB 2WBLC 2NU7B 2X9QA 1RZUA 4RBNA 3ZV7A 2FSVA 2WT8A 1Z18A 5J59A 4DFDA 4JAVC 2O0MA 1B7GO 3CONA 4YLGA 3EDOA 2X8JB 2VC2B 2IY8A 4PSAA 4HLNA 4DLSA 1QHHA 3N59A 4I1YA 1XTVA 2PPVA 3VR5A 3OCWA 1TRHA 3NIWA 5BN1A 1O4VA 1NNLA 1N5KA 1ULHA 3EVGA 4DSTA 1FNDA 4CTMA 2ODEA 8ATCA 3U56A 5CDGA 1ELOA 3GZNB 4RH0A 2XF2A 2Q2VA 2FQWA 2VHXA 2WFLB 2XLBA 3S2GA 5I7UA 3SAJA 1V2GA 4A8JA 2C2WA 3ZHSA 2IXFA 3N1UA 4HATA 5BSFA 3OF5A 1BJTA 2JFBA 2WJZB 2XCOA 4M9UA 3SM3A 4C0XA 3L6RA 1DJMA 2Z8ZA 1O9GA 2XNSA 1AURA 3U4AA 3ZDAA 3PFFA 4ZANA 1NW4A 3HKCB 4V24A 1XFDA 2IPNA 3BZUA 1KDOA 2JEYA 4D98A 1H65A 1PZGA 3EGDA 5EWMA 4OKIA 2FSIA 2JRLA 1A3CA 2ZIEA 4H3HB 1K9VF 3LA6A 1EJ2A 2WWYA 3ZLVA 2OYCA 7MHTA 3PKZA 3ESDA 2DHCA 4BIIA 2H1RA 2QE7D 1SVIA 2JJ8A 4G0UA 3T9AA 1YUNA 2QL9A 3WGJA 1V7CA 4QOJA 2INGX 1H93A 2BFDB 1T5HX 3MXOA 2QUHA 5EMHA 1AKVA 5DN6D 1NKTA 2ST1A 3K8QA 4KH0A 1V45E 2RB4A 1U31A 4P93A 4CTOA 2AZXA 1RAEA 1FDRA 4PG4A 1M6NA 4CM8A 5BY2A 3B38A 2VHVA 4MVJA 5H3LA 1O97C 2WAXA 1OF1A 4WGGA 2ALJA 2BIFA 2PANA 3EEFA 4FYPA 4M1OA 1GGFA 4QDZA 4BMXA 3OEHD 3CUYA 4O25A 2PZAA 3W9UA 5FPKA 5ELXA 1TLFA 4PHFA 3QFHA 1UXOA 5FL3A 4K0KB 2CNNA 1RQ2A 1ACLA 1SHUX 2GBIA 2LCIA 3B70A 5TQ2B 3RAPR 2YMMA 2C07A 2QTVB 2WLSA 4RWEA 1YXMA 5DBHX 4TVOA 1TUGA 2OZLA 4MUXA 1GNPA 3VTAA 3REFA 3BMOB 2O2SA 1FL9A 4RVNA 2NAPA 1DXOA 1LS1A 1N7JA 2V6BA 3EQ6A 4UAUA 5G0UA 1I2ZA 1JXMA 2FWNA 2N75A 5THQA 1VCOA 4TTIA 1R9GA 1T13A 2V6MA 5A5DA 3BX1A 2WPDA 1RYFA 3GA0A 1CK4A 2VPZA 2W22A 1XDDA 3VYRB 1XJ0A 1JIQA 4QOEA 1I4OA 4QBTA 1P91A 4X63A 4U3JB 1L4MA 4YNBA 4Z8YA 3RYFB 1Q3HA 2CXQA 3H2KA 4ND8A 2R79A 3N6RA 3I9KA 2GRAA 4L08A 1K92A 1MT3A 1NJSA 3A1EA 4CCWA 5DYGA 2G7MC 4BVFA 3O38A 4DZRA 1PSDA 4JI5B 3F97A 1EI9A 4R71A 2Q5IA 2GX6A 13PKA 2W8BB 2PAFA 3HDYA 4IVNA 5JNWA 3J80A 2J5XA 3UAXA 1F3LA 5COQA 3ZHBA 2P11A 2V97A 3L05A 2XT9A 4OG2A 4WXHA 4LK2A 5J2TF 3UH1A 5EJEA 3D7NA 4JI7B 1QVWA 2IE8A 3E22A 1PYOA 4BMYA 3A4LA 1J2RA 4L57A 4LZJA 5DLDA 2Y6UA 3KSUA 1MO5A 1VXRA 2WV7A 3UGKA 4A5OA 4PN3A 5BSHA 2WB2A 1M2GA 1M6WA 5L40A 3PWZA 5JWHA 2BFCA 2Q3MA 5E9AA 2Z98A 2FGJA 2Z2JA 4Y9UA 5HHTA 4K6KA 1PJQA 5LOVB 2W2VA 4RCYA 2C2GA 5FWXA 1CUVA 4HAWA 2ZG6A 4JCOA 3T4UA 5FEMA 3K1ZA 5K8VA 3EEOA 1V96A 3M5DA 4LFBB 4EABA 2ODBA 3WBJA 5IBCA 1KR5A 4R4JA 4U6QA 3TPFA 4AG3A 2CXPA 4D6YA 2J0QA 5DM2A 1OTYA 5CB0A 1PG0A 1F6BA 3ZXYA 1I9GA 2DAPA 4WBXC 1RYZA 2EFHB 2JFGA 3LUJA 5FI5A 1KQ3A 1MD9A 1JAYA 1QKJA 1W581 3CS3A 3M9WA 3O26A 4K9OA 4QJBA 4RD0A 2DTXA 2KBEA 2A5FA 3LY5A 4EG8A 4U8HA 2CVQA 3H9CA 2TRSB 3QSYA 4DDVA 2ZSEA 1D03A 3C3JA 3OCXA 4BV2A 3FMOB 4X1KA 4YJ3A 3DAOA 1U94A 2QP9X 2QXYA 3ZG6A 3ZC3A 3NHYA 4CL3A 1XQ1A 2HMVA 2VPPA 3GAFA 3IE0A 1LRJA 4COKA 3GUYA 4F6LA 3O8NA 3SYMA 1MXFA 2R8EA 2X7XA 5DI3A 2MR6A 4QPJC 4BNZA 2BGRA 4S05A 2FWBA 1XMPA 3FFWA 2BFCB 4IZIA 1DTWB 5B7GA 3TOZA 2KJQA 1KE1A 2RI0A 2VP2A 3LP5A 4AP6A 3G2KA 3CLVA 1P7YA 3ER6A 3WE7A 5I8ZA 4ZGGA 4QTYA 2LGJA 4HXFB 3KAQA 2EKZA 4J94A 4B09A 2ONJA 3GJXC 3S55A 3TNYA 1TYZA 3NTRA 2WILA 3ZY4A 3AWDA 3IMEA 5ILOA 4BE9A 1QHEA 1HG1A 2BRUC 3VR3D 3B1YA 1WPXA 4L2IB 1AQYA 1SG6A 1IXKA 2DHDA 1L5OA 2Q9CA 3B3QA 2HJWA 2P79A 2HPAA 4ZICA 1JW9B 1F9AA 1EX9A 3O84A 1R8YA 4MV9A 2YV5A 3N8NA 4FC7A 1PRYA 3K9GA 2X5NA 3KYCA 4JR0A 1YVRA 2E9SA 3PBKA 1ZVJA 3D4OA 3SGLA 4AMVA 1LPSA 5EE9A 3V4FA 3FYUA 1GPMA 2WHPB 3FAKA 4EAQA 1NN5A 1JYFA 4WVFA 4S35A 3TRDA 1M7GA 4BVAA 3T7JA 3JPYA 3QBVA 4HG2A 1BXZA 4LV8B 4XDHA 4V2IA 3CH6A 4Y2RA 1P6XA 2EEPA 3ZS8A 1DXHA 2D4HA 3UAWA 2CE7A 4OPMA 3UPTA 2XV1A 4GM4A 3C6KA 2WIDA 1XDWA 2P7IA 5AVYA 4Y6QA 1HLGA 4XX1A 4YASA 4EUEA 1HDRA 3SKYA 2UVDA 3WMRA 5K0ZA 4DY4A 3NCTA 4LGYA 4FU0A 2X2PA 2GN2A 5DNYB 4IXDA 5IG2A 3M6MD 4RA9A 2ZJAA 1SZCA 4XYMA 2I7DA 4LMRA 4O2LA 1HEIA 4QUAA 4YH1A 3J81k 4Q21A 4WDRA 3PRJA 4FMDF 1MB3A 1S0UA 3EARA 2ZJ7A 3ET5A 4JXJA 1JEQA 1EX1A 2IC5A 4CMCA 2C5EA 3NWEA 1K6XA 1SU6A 4MB2A 3U62A 2Q2NA 1GY8A 1W5EA 2W6JD 3D8RA 1Q5PA 5J63A 2OO7A 1PFYA 4CWAA 2C4TA 6LDHA 4QUJA 3T7CA 3QEKA 2Y1LA 3EZYA 5JRJA 2HXYA 1D2EA 4H6PA 3SQXA 2WAOA 3CVVA 1Z56C 4Y2JA 4KQCA 4ZOQI 2H2IA 3S2FA 1U6IA 2FA9A 1W49A 2ZQ5A 4FTWA 4WNAB 1Z5ZA 3OG9A 3RYIB 4EPVA 3D8SA 3BILA 3GLSA 2VT6A 5BRAA 2NMVA 5DNEA 3WIDA 5LUBA 3ODGA 1O96B 2JFWA 2ZRAA 2PBZA 2QRQA 4I99A 5IUJC 3X1JA 1FUKA 4I1RA 2PUJA 3K05A 4UXHA 4ZT2A 2H7VA 4FGZA 4JQCA 2JAOA 4KAJA 2CHEA 1JFTA 2BEUA 3S3TA 4K9RA 1G42A 1UJBA 2JLRA 2C83A 3ED1A 2GCPA 3JRXA 3JTMA 5AK5A 1JAIA 5JXIA 4ZQFA 4LZAA 2HCTA 2IV7A 2GN0A 4ZMRA 3ZU4A 4KQGA 4QNNA 4W63A 3CLHA 1X7WB 3ZZ0A 4U2CA 1EG7A 1UDWA 3BH6A 4US2R 4OLHA 1JX6A 3IV6A 5G1NA 1SPBS 4BVGA 1WZ2A 3OZSA 1SUWA 1DIAA 3EXFA 1LVHA 5K8CA 4EA7A 5GWXA 3BIFA 4OA8A 3UJNA 1TOAA 5ALRA 4QYMA 3KT3A 4O2BF 2XA2A 3P0EA 4Z0TA 1NLZA 3FROA 3I5MA 4R2HA 2F9LA 2QR3A 4FHCA 3C3YA 3GG9A 4HFRA 2FSVC 1E1RA 1HQYE 5DBGA 4A26A 3OOJA 4DDTA 4ZZ2A 3TECE 2W4IA 3RAJA 5A4MS 3GRUA 4DUPA 1DGQA 5ARBA 1P44A 1U8EA 2G82A 4JT2A 3AY7A 1YQGA 5JJBA 1CF2O 3KYDA 4WXMA 3RIGA 3SKVA 4MRAA 1Z2CA 1KEPA 3RTCA 3GGDA 2X1LA 5TV2A 1RYDA 2VTKA 2CT8A 2GYWA 4HB3A 1CV2A 2LUOA 3VH3A 5EJGA 4HZUB 3K6SA 2F00A 1M1ZA 1YQEA 3NXKA 3OFJA 4LOKA 4AJ2A 3WDMA 4CEHA 2VHTA 1DDIA 1EBUA 2XDYA 2NZXA 4U7GA 3R6GA 2XT6A 4DG9A 3SM9A 3IQZA 1W94A 3DUWA 1JP7A 3GT0A 3N7AA 3Q11A 3RS9A 4XARA 5ALPA 1W2WB 2NSJA 3A4YA 5KNDH 3NMUF 2PAAA 2QYHA 5K2MA 5IX8A 4P35A 3SBOA 4J07A 4E14A 2B8NA 4ND8B 1KK1A 4MKFA 4B6GA 2F4NA 3FPSA 5ES4B 2H48A 2FR1A 1SEPA 4X97A 4TVBA 2BWJA 5A4IS 5KQMA 4M1YA 1ADBA 3ZDYB 4PLWA 3EE6A 4BEVA 4TKUA 3X2FA 1OTHA 1CR1A 3QW4B 1NZFA 1E59A 1J90A 4NXNB 5K3DA 1SKUA 1GRVA 1Q3TA 2IDMA 3BMOA 3QKSB 3E0XA 1CHDA 4NR0A 3LLUA 4JC0A 1O94A 1SCAA 3R76A 4W6ZA 2QM3A 4N8SA 1U2RA 3IVAA 3F0TA 3KZMA 1YNOA 5JD6A 3AF1A 4CI0B 5FYDA 4AJPA 4UNRA 3IOBA 5EHQA 3RVQA 5MGNA 1M7HA 2O4CA 2PZ8A 2ZBGA 3CIFA 4ZO8A 1T9GR 5FWDA 2VDWA 5TC4A 2IYFA 4CHTA 5AKYA 3F8WA 1COZA 2FZCA 3GJ5A 5I4BA 3NKVA 5F73A 3TTTA 1ZMXA 2PA0A 1ODFA 4CM5A 1UBSB 4XPIB 5BV0A 1F0KA 1NJ5A 2RIRA 3DE1X 1AN9A 2D13A 4J6EA 4ND7A 5EUMA 5T3YA 3X2SA 3RIEA 5CXQA 2CMHA 3EF3A 2G36A 3T7EA 1DTSA 3E48A 4J0IA 2HIHA 1B4DA 1FNMA 1PR5A 2DECA 2V5VA 3NAQA 1JQLB 2H1VA 3TL2A 2V6IA 2GJKA 4TL7A 3E03A 4B80A 3OIUA 2CVHA 4LZZA 5EA2A 3SR0A 5KX5B 5LD2C 1R15A 3L7YA 4PR0A 4ENQA 3DVLA 2H8KA 4CW7A 1UC9A 3MXTA 4AUNA 5CLHA 3ESRA 5EG5A 5LWHA 5IULC 3PPYA 3EVFA 2G07A 5TEVA 3PZRA 5ES3A 2NZUG 1PJCA 2J3IA 1BJKA 4PHTA 5LCXA 2VDUE 3WGKA 4B4DA 1QH1B 1REQA 4D81A 4DBVO 3HB5X 3AEYA 4KBYA 1ISRA 2B69A 5DZSA 1GCAA 4BLQA 1HFEL 1DADA 2WHYA 2Q29A 3N0VA 1LWNA 3PL1A 4KQWA 5CX1A 5GZ3A 5CW2A 1QTIA 3MWFA 3NFRA 2JNWA 3JRWA 1V47A 2YJGA 4P22A 5DNAA 2ERYA 1T91A 1IJKA 1NFFA 1HL3A 3BKWA 4P34A 1LQ2A 1R0WA 4QUEA 5D6NA 2BFEA 1XZHA 1AV7A 3CLUD 4B2PA 3I9JA 5FWAA 3OQJA 4Q05A 3MBIA 1Z6GA 3WRXA 2QQGA 2NSDA 3GNSA 4KLZA 3QXXA 2GEKA 4FSDA 1XO1A 1FPMA 2OHVA 3R3WA 4M36A 4QXAA 3AEXA 2J5BA 1FLNA 4HMPA 1P8AA 3TW4A 3C8UA 4D8VA 3OLZA 1CZKA 2XXAB 1QGED 2I80A 3I0MA 3KYBA 3MERA 2JLAA 1BIFA 2QDXA 2FPWA 4HNGA 4F4JA 2M6SA 2Q62A 1M7BA 4J4TA 3OAAA 1NF3A 2X7HA 4U4AA 1KJIA 1YDGA 3SFTA 2HFKA 2JATA 2V54A 2WINI 4Y6OA 1GUFA 4ZAFA 3CM0A 1U11A 3W8DA 2PUCA 2CNLA 1LPAB 2HPZA 2Y9PB 3AW8A 1KI7A 4J4HA 4KAXA 4JYZA 2BM9A 3V8EA 3SBXA 4AO6A 1SA0B 3V9PA 3NAZA 3GB9A 2IOYA 1V5EA 5DULA 2PUTA 2QR2A 3I04M 4R01A 5B3JC 3FNRA 3U3RA 1A77A 2C3MA 3CRQA 3I64A 3ISTA 5C53B 3ZDDA 1SUBA 4P80A 3ITEA 3G9ZA 3GUHA 4BQSA 4L7QA 2WF9A 3IOMA 5IM5A 5B7PA 3M70A 4L8GA 4K81B 1Q1AA 4M6WB 3ROPA 3WRYA 4CF4A 1X7YA 1M2VB 2P30A 1ZKDA 2F9FA 1IRXA 5HOQA 1ZGCA 2PGOA 2XODA 1YZNA 2IHJA 4MCAA 3RVJA 1RKVA 2JIMA 5FRDA 1FFSA 3G0BA 3D0KA 2A9QA 3USES 5J1SB 2LIVA 4QJ3A 4M1KA 3ZJUA 4DRYA 4UZFA 2VQ6A 3L1VA 3UJBA 1PVVA 3A1UA 5LQMA 2J0SA 1NXXA 3PPIA 4YJHB 5AKIA 1TYCA 3VSAA 1M34B 3D31A 3LLMA 1WBDA 2ZVDA 1DKQA 2C5LA 5JADA 1Z74A 2P1RA 2Q3DA 1GVHA 1W5TA 1WMEA 1C1XB 1U7WA 1MVNA 3ELBA 4RCZA 2IU0A 2FRDC 2ZYSA 3LGSA 1GZUA 1ZITA 5AHWA 4GMDA 3FN4A 4LCEA 1U7ZA 1Y8ZA 2E48A 1OKKA 2C88A 4Z53A 3V2GA 2Q3BA 1MEOA 1F17A 3O82A 4ZAVA 1QV9A 5B4VA 2MJLA 2XYGA 4QICA 1NC1A 3TLCA 5JHGB 3IDQA 4H7EA 2QTWB 4DR4B 1LLCA 3HSSA 5ERYA 4EF5A 2RHMA 2F3SA 2J87A 2UVPA 1U3TA 2V5AA 3DVRX 4H4DA 4RACA 5E7MA 3V1YA 3HP1A 3VZSA 2C8LA 4LPKA 4F06A 4CKEA 4DLYA 4TKVA 5HQ3B 2R11A 1E2FA 2WJWA 4YRRA 5DGIA 1U1EA 3VH1A 2XAUA 3NQ41 3EIFA 3HPRA 2NO6A 4EYKA 1E1CA 4PYRA 2N47A 3QU2A 3FNHA 1H2FA 3L8CA 1KAMA 4M49A 1I4EB 3UYKA 4YVFA 3WGGA 1RWMA 3WNDA 2AGVA 1L5RA 4ALKA 1GG2A 4HDQB 1XL0A 2DTEA 2HV9A 5H7XA 5HS6A 2C03A 3FFXA 1TDJA 2C3PA 3HCOA 1PWHA 3NXSA 1L1RA 1YIOA 1RFLA 4ZYLA 3USCS 2Q6OA 2WU4A 2WM9B 3MFYA 2BW0A 1GR0A 4LTNA 4RQAA 5DK4A 5KB3A 3WLSA 1L5LA 2J6CA 3QX7A 1D2RA 4GYJA 2C7QA 3IPRA 4OUDB 1PZMA 4CKWB 4PICA 1UEIA 1X7ZB 1IEWA 2BE9A 1BX1A 2ZYIA 1V7PC 1USGA 1Z75A 3NOVA 4KN6A 3T5CA 4DXHA 2ZJ3A 1JB1A 4MZDA 2CV0A 4BPBA 3A6LA 2HA5A 3FE2A 1SKBA 2CHGA 4HUQA 4QDKA 4Y2GA 3CISA 1WB9A 1RHJA 3CRVA 2QSYA 1Z22A 1YI1A 2HWYA 4BBPA 5JWOA 1REQB 2ZXFA 3KQOA 5G53C 2GEUA 3VC7A 3DQZA 2WG1A 4DMFA 1J0XO 4JBYA 2F1JA 3FJ1A 1UC5B 1BEUB 3TAUA 4G1UC 2NV6A 3AY0A 3H1GA 3Q7RA 4OO3A 3W2FA 4F3RA 5CLGA 1RKQA 3IJPA 3MT8A 4R2MA 1TT5B 4UDOA 1ZD4A 2Z43A 3QE3A 4XX0A 4BTVA 4DWVA 4ENTA 1T5BA 3RC9A 4EELA 3N8GA 1T5TA 5BYAA 4DR2B 1VXOA 3PGXA 3L46A 1IDN1 1RXIA 3CXUA 3L7JA 4AB1A 5BN5A 4KWHA 2REOA 5IH3A 4MH0R 1MAHA 1GSOA 3O9MA 4N40A 3ZJYA 1T36A 3Q7TA 4PIMA 3FF4A 3IQIX 3T34A 3W4IA 1LW7A 4RFLA 3P5SA 5D5HA 4MVYA 4V0QA 4BJ5A 4CKCB 3RBZA 4CRWB 2N9UA 1Y7HA 5FAKA 4XI9A 4CVNA 1Z38A 4O1HA 5KDLA 2K2QB 2G77B 3D8TA 3GPIA 4FONA 3SBDA 3T6KA 1T6NA 1YNSA 3DDOA 3MCWA 2IEIA 4PRYA 5BYKA 4XCVA 5BR1A 2P9HA 5E7JA 3EG5A 1J39A 5MFZA 1A1VA 3TEFA 4EHJA 1JQBA 4ZOLA 1KC3A 4AMYA 4MP8A 5AO9A 3AUXA 4M7PA 2PZGA 3MUOA 3EWIA 4QBGB 2Z3VA 3DHYA 3O8OA 5EXSA 5JNUA 5GP1A 4I9NA 4NJMA 1NLYA 1BXKA 3K2IA 2X4GA 3AKDA 1G2OA 1O9HA 2P68A 1U2DA 4Y0NA 1B8NA 4QO7A 3LLVA 4YA6A 5EXEA 2FZ5A 4HGYA 1ZH6A 5HKAA 4PZZA 3S40A 2RGYA 5LP6B 4MHSA 4UKDA 2O2CA 3UUEA 1AKMA 3THSA 1HFKA 4DM4A 2FE1A 5FWYA 2FKNA 2FSGA 3D4BA 1TA9A 3DL4A 4A27A 1U0JA 1TT7A 1X1SA 4JC4A 3ITDA 4UNSA 5KX5F 5EPOA 4KN8A 3Q1LA 1SCDA 2GVZC 4QU9A 3ES9A 3G85A 5DM4A 4BLTA 3JQGA 4TM7A 1P45A 3BGWA 5FOSA 3HJAA 1GPBA 2FN3A 4P5EA 3KZCA 4C0LA 4DLWA 1XCLA 2W4QA 4XTCS 4AMGA 4YUZA 4NHEA 2RC6A 4TLDA 2DQYA 3G0CA 2DWQA 4DIFA 3M1AA 5ANRB 4X7PA 3H4TA 5TS2A 5EJ7A 1MVLA 4GZ5A 2BSAA 3F6BX 3MLAA 2EHJA 5AWFC 4MEJA 2P67A 2WICA 3QOYA 4C3UA 1CR2A 4D3YA 4B9EA 2O8EB 1UMDB 3B7GA 2J31A 4BP9A 1Z6AA 4Z4EA 1SQ6A 2EF1A 3OKAA 4Q16A 3RS2A 1FF9A 4DWOA 3RODA 5J2UF 3H42B 5G41A 3B5IA 3KQSA 1PK8A 3NC0C 3SG0A 3V8NA 2OXIA 1PWZA 3MF4A 3SZLA 4AZ0A 5IHPA 4E6EA 1IN8A 1AUQA 2HQSA 3LQ2A 3PXDA 3WV4A 1QZUA 2RBGA 2QNIA 4IJQA 3W04A 4QSMA 3L0PA 3JAKA 3KEGA 3LX8A 4K6GA 4O4IF 4TROA 3JQFC 1TE2A 1Z2AA 5EJ4A 4R41A 5JDIC 1HNZB 1ZN7A 2J59A 5SYMA 2VHJA 3ZQJA 2PMWB 2TMDA 5EJFA 3WMGA 3CEAA 5KQPA 2O8DB 5CFMA 4UZSA 1ABFA 4PWYA 4E2YA 1G6KA 3OIGA 4K6MA 2ERCA 3MJCA 4HVTA 1JLRA 1AQLA 2D2VA 3I30X 4L85A 1X1TA 1QTNA 1KDVA 3U40A 3U7QB 3KHUA 1JKIA 4OREX 2PMDA 5H5JA 3G8AA 3AR3A 1CY6A 3WICA 2ORYA 2Y1KA 5SY4A 4C20A 1SOWA 5C5EA 2D74A 1GFIA 2LXNA 4WNIA 2XGOA 2QUKA 1M1YB 2ZPAA 4O2BB 4PBRA 3CE6A 4QARA 4KV9A 3IERA 3MOGA 4O4JA 1I94B 2ODNA 3W8NA 2YFHA 3LUAA 2P9TA 2ZWPA 1GLVA 1OYVA 2ZSAA 4NZOA 4U9UA 3HU3A 2Y1DA 2JIZA 2D1YA 3E9DA 3PEEA 4NCIA 4UDXX 4F04A 3GF4A 4TTVA 1RQGA 3MB8A 5EJIA 2EJUA 4HWTA 1G20E 5DW3A 3FX2A 3SVZA 4EL0A 3A3PA 2PL9A 4TZ0A 2I8LA 4OGGA 2C99A 2C5GA 5CDTA 3A6ZA 4RDCA 5FCDA 2ID7A 2IBSA 2OQRA 3L9XA 2YYYA 4IIYA 4ZVMA 3KQMA 4MW5A 3T3IA 5TX7A 2QD4A 3SEZA 4F9FA 5KNBA 3IVRA 1XQVA 2XXJA 3SYRA 2J7PA 4ZGBA 1U0RA 5DN9A 1ZHOA 2HA7A 3EULA 3H7IA 1ZKMA 3E70C 1MB0A 1S01A 3D6MA 3L7CA 2JJMA 5FPQA 1U1DA 2YWGA 2IEAA 2BV3A 4ARZB 4C5CA 4DOMA 4XJSA 1TCAA 1CRLA 2BR3A 1MB4A 2RK3A 5H82A 3TQHA 3BXZA 4BNJA 1RQXA 1Z4NA 5CRIA 1QOQB 3I58A 4NECA 3AUFA 1NXVA 1WW3A 1RHMA 3DB1A 3INTA 3QOFA 1Z5UA 1XNRB 1WPGA 1XGKA 1CNFA 3ND8A 3IIKA 4WK6A 3BJRA 3FYTA 5LMZA 4BX9A 3GFOA 4Y2PA 3BM5A 2Y0BA 2CHQA 4ID3A 3UN1A 3WIVA 5BW5A 4L6AA 1HDZA 1JSCA 2OQ2A 4REQB 5JRDS 4AIRA 4FR2A 1Z68A 3OA0A 3TLBA 1GPKA 2O3SA 1LFAA 2HN9A 2OZLB 3EIEA 4DVGA 2P2YA 1NQVA 2K5UA 4G37A 4RH3A 4N7RA 4XAQA 4PLFA 5COAA 2MSEB 4TV8F 4KQ2A 5F2EA 4B7UA 4NC9A 5HIKA 1TEVA 4IIGA 1JU9A 2VA8A 4F7WA 4DSZA 3ESBA 3P1JA 4Q4DA 1ZONA 1UODA 4BASA 3EZ6A 1RPAA 4MGYR