3C6ZA

Hnl from hevea brasiliensis to atomic resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution crystal structures and quantum chemistry meet to reveal subtleties of hydroxynitrile lyase catalysis
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords Hydroxynitrilase
total genus 95
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6zA00
2OCIA 3QH4A 3O0DA 4EY6A 1VE7A 3WK4A 4DSAA 4WFJA 4G5XA 1LPAB 4QDXA 4G9EA 5AM4A 2WJ6A 4BVKA 2O7RA 4QA9A 3G9TA 4AX4A 5EHZA 2GBCA 1WB6A 4UBKA 4N8EA 4QDTA 1XZLA 4BDSA 2G5TA 1Q0RA 5ALVA 2ZVDA 1W6RA 2HU8A 5ALWA 4X97A 2PSHA 1LLFA 5DYWA 1CUJA 4AO7A 5LKRA 1T2NA 4XVCA 3VXKA 5BOVA 4H18A 3Q0TA 1ZD4A 1R4ZA 5LZ7A 4WCVA 1QONA 3HYSA 1AMNA 4C4XA 3H2KA 1VXRA 2BFNA 3GA7A 3JWEA 4BC1A 4QDZA 4KAJA 2XLCA 1SCIA 3F8SA 1JMKC 2HIHA 4KJXA 3IBTA 3ANSA 1YAJA 4W63A 2HA7A 4P9NA 3AUKA 4U2EA 4OB6A 2JGKA 1QJ4A 3K9BA 4DGQA 3G9XA 4M0FA 5JARA 4GWLA 1QIKA 3L1JA 1IVYA 1YS1X 5CW2A 2XMDA 1R1DA 5ALIA 5CXUA 2HRQA 5JIBA 4Q05A 2QM0A 4ZXFA 3DS8A 1N8SA 2D5LA 3UMJA 1RP1A 3C6XA 5CT6A 4PNZA 1CUYA 2CBGA 4WDQA 4LIPD 1CPYA 1WCYA 4W1PA 4G8DA 4KE7A 3WL7A 4PO3X 4BAUA 4D9JA 5ALSA 2DQYA 5BWCA 5EHXA 1BRTA 4W1QA 3R3ZA 1OILA 4J0IA 3STYA 2JF0A 3QITA 3WI7A 3WIBA 2XMQA 1CUIA 5CMLA 3R0VA 4B9AA 1SCQA 2VJCA 2OQVA 5FDFA 2QTBA 2W6CX 1TCCA 1IUPA 1C4XA 1XZIA 1IUNA 4KEAA 3H04A 4BE9A 4AB1A 2G4LA 3W06A 2XT0A 1VZ2A 1YB7A 5E4JA 5HCUA 3I6YA 1DQZA 3EIOA 1EXWA 1FJ2A 4U2GA 2H7YA 5AKYA 5ALJA 4OSEA 4A16A 4LHEA 4UFOA 4UBMA 4CCYB 1CV2A 4MYSA 4X93A 2PVSA 5CT9A 5AM2A 3M3DA 5K3DA 1XRRA 3WKBA 4LYDA 5D7BA 2K2QB 1YA4A 5CURA 3FBWA 1GQSA 2ZYRA 2WHPB 5CTAA 3W05A 3I1YA 5JAHA 3C5WP 4LXGA 4QZVA 2X8BA 2PPLA 3OOSA 4BCCA 1QE3A 3VJMA 1LBSA 2PSFA 2QZPA 3O9MA 3ICVA 1UXOA 2Y6VA 3F98A 2WILA 1R3DA 2PBLA 2ZSIA 1TAHA 1JI3A 2WG1A 4LXHA 3LLCA 5AICA 2XQGA 4KACA 5AH0A 5HZGA 3O4GA 2XUAA 3TJMA 4DM7A 1VE6A 3DQZA 4Q1VA 3M83A 2PKYX 2CJPA 4RNCA 3WK9A 1EK1A 1CLEA 3NUZA 2QJRA 2OG1A 1UT6A 3QVMA 3I2GA 4C89A 3BF7A 1N5RA 2DR0A 2Y2VA 1EX9A 3H2JA 2H1IA 3NOXA 1ZICA 3D7RA 3G9UA 4UBIA 1HQDA 5CT5A 3D0KA 1A8SA 5AKKA 2XDWA 4PV7A 1F0NA 3IB3A 4H7EA 1XRPA 1CFJA 2DSNA 4QWWA 1W52X 3R40A 4QEKA 1NU8A 3LCRA 2HADA 3W9UA 1XKTA 1ISPA 2OXEA 4E14A 4EY8A 1WPRA 3VJKA 3LIPA 2EEPA 3QZUA 5AO9A 3ESAA 4X00A 1QZ3A 3FVTA 1IMJA 5AOAA 4CI9A 1ZIXA 3AIMA 3DOHA 2EDCA 4XX1A 4FFWA 5A7GA 3GBSA 1IUOA 4YPVA 3WK7A 2QKYA 1QFMA 2AJBA 4H7HA 1XQWA 4AO6A 5ALUA 4EY7A 5LZ9A 2GBIA 4NS4A 1QIGA 2QR5A 3DCNA 1N1MA 4IHAA 5FV4A 1BROA 3IUMA 3FSGA 3DNMA 2ECFA 2XUOA 2XUQA 2WG2A 5DYYA 1QIDA 1JMYA 2RIPA 3WYDA 1GKLA 4GI1A 4RE6A 3R3YA 4N8SA 2J4CA 4HVTA 3V9AA 3FYTA 2QT9A 4U2DA 1H2YA 1EVQA 3D2CA 4FBMA 4C87A 4EY4A 1E5TA 3G0DA 4BTVA 4OPMA 4GLBA 1YB6A 4OU5A 1W75A 1L7AA 4LYEA 5AKLA 1YA8A 5A2GA 3O4IA 3M81A 2XMSA 4Y2SA 4B84A 1H22A 5JYCA 1AQLA 4X91A 2DHCA 1USWA 5JADA 4X90A 1H2WA 1GXSA 2WJ3A 4JEIA 1CUBA 1JU4A 5ALGA 2W22A 4FOLA 4RGYA 1X70A 5I9IA 2BCEA 1J2EA 1FFBA 3B5EA 1VA5A 1F6WA 3HRHA 1FFEA 5IVKA 1ODTC 5EIEA 2R11A 5D6OA 3PFCA 1G4HA 4Z49A 5KWIA 3SC2A 4K6KA 3FYUB 3T4UA 4H7KA 5SYNA 4G8BA 4HXGA 5K3FB 4HTAA 1WPXA 1ZI6A 2HU7A 4OCZA 3HXKA 3AFIA 1D07A 4K6HA 3AILA 4NMWA 2ZJ7A 5IVHA 4G1FA 5JAOA 1QO9A 3I2JA 1XZCA 1YCDA 5ISMA 5ALFA 4FNGA 3DLTA 4Y2VA 5AKGA 1HPLA 3KWFA 5ALRA 5ALQA 3YASA 3QBJA 3KDAA 4XWGA 3V1MA 4IH4A 4DMKA 1GGVA 4FTWA 4N5HX 3HI4A 2VJAA 4PW0A 1MT3A 1DU4A 2QS9A 2BUCA 1SC9A 2XMCA 3U1TA 4G8CA 2HRRA 3C87A 5HK8A 1E8DA 5FLKA 5EGNA 1XZHA 3AJAA 4FWBA 5JD6A 5K3FA 5ALTA 3PF8A 4Y2RA 4BZWA 2XUDA 5FKJA 4Y9SA 1THGA 2CZQA 1WHTA 3AINA 1Z68A 4BRSA 3O95A 3GFFA 2GZRA 1A8QA 3WL5A 3K6KA 4J0GA 1LPOA 4BTLA 1U4NA 2XUHA 3H2GA 1K5PA 4CCYA 5AHXA 3NGMA 3U0VA 5A7FA 5JZ9A 4Q34A 3ESDA 2WKWA 1L7RA 1ACLA 4H7IA 3C70A 3WQHA 3B3QA 1R88A 4BAZA 3WL6A 3D5EA 1XRQA 1LBTA 1VA4A 1UKAA 2B9VA 3MVEA 4FLEA 1BU8A 3PUHA 2RAUA 5K3CA 1XLVA 5SYMA 4A23A 2AXEA 4J7AA 5DYTA 4K6GA 5C8XA 3OC0A 4H7DA 4M0EA 5K5EA 5CT4A 2XQIA 3DKKA 4OB8A 2ZYSA 4EZIA 2B20A 3JW8A 4BATA 4I3FA 2OLEA 3CCCA 1XFDA 2WIGA 1QIIA 1MNQA 1BCSA 3A70A 3WKCA 3A2NA 2RHWA 3ANTA 3STXA 2CB9A 5DNVA 5LP1A 5DNWA 4H0CA 1C7JA 2UZ0A 5JALA 4GBGA 4WY8A 2QRUA 2HFJA 5E4TA 4J0DA 4KRXA 4BVLA 5KREA 2CMFA 2OCGA 4UHCA 4Y2YA 3D59A 4AZ0A 3WWPA 3C43A 3EQ8A 3FNBA 2WU4A 3CCBA 2O7VA 3WYNA 1CEXA 6YASA 3G7NA 1UOQA 5C8ZA 3IVMA 1W76A 4J0HA 5F4ZA 1RWQA 1XZDA 3QPDA 2PUJA 1DX6A 4WY5A 2Y1KA 4MWTA 4U2CA 2DQZA 3AZQA 3BJRA 4NVRA 2RGUA 4FNMA 3G0GA 5JD4A 4F5ZA 5AKIA 1CUCA 1AUOA 1PFQA 3BWXA 2O2HA 2XUGA 5LZ8A 1DT3A 1JJBA 1Q83A 1E89A 1DQYA 3O4HA 2WTNA 3A6ZA 1TCAA 1H23A 4AMZA 1TIBA 5CH8A 1PV1A 3QPAA 4I19A 1I6WA 3IURA 5LZ5A 1P0QA 1ZGCA 4QNNA 4OB7A 4HRXA 3ZLVA 1EDDA 1PJAA 4UPDA 3W2TA 1WB4A 3BXPA 1XQVA 1G5FA 3B12A 3G0IA 4OU4A 1QGED 2BGRA 1ODSA 2XE4A 1GT6A 3DJYA 2IITA 1NX9A 5AKEA 4U2BA 3V1NA 2VSQA 2WIDA 3RK4A 3I2FA 3MUNA 2QJWA 3UUEA 3FYUA 2VATA 5FXMA 4P08A 2DHDA 5JATA 2QXTA 5EHNA 1XRNA 3AZOA 2WU3A 3ILSA 3OURA 1QIHA 3E4DA 1UK9A 2PL5A 1KEZA 3WKDA 1CUZA 4G9GA 4ZREA 2QOEA 1CVLA 2GBGA 3GELA 4ITVA 5AM1A 2VEOA 2Z3ZA 2WHPA 1ZJ4A 2R8BA 3FOBA 4W9RA 5DTJA 3I6ZA 4DNFA 3IIIA 5HFNA 2XUFA 1QFSA 2VT7A 4ARBA 1S8OA 1WHSA 3BDVA 4N5IX 5AIAA 4AXBA 2GBFA 2QXUA 1ZD3A 4GDMA 3HSSA 3S2ZA 4E46A 5E2IA 3CN9A 1X2BA 1N5MA 3D2BA 3KWJA 3IUQA 2J3DA 1UK7A 5IVIA 5AM0A 2DHEA 1YR2A 2CKMA 1MX1A 5CH5A 4K5QA 1KU0A 1LPMA 1GPKA 4MWSA 1J07A 1VXOA 1XLUA 3A2MA 1LZKA 4UBOA 4RPCA 5AKJA 2FUKA 4BB0A 5AM5A 1QTIA 2OCLA 5JZSA 4BP8A 3IULA 3H1BA 3DD5A 1MN6A 1EDEA 2HA5A 3FLEA 5ESRA 2EDAA 4CG2A 4UFPA 4L3WA 1DWOA 4JUIA 3CXUA 5YASA 4KYVA 3OPMA 2I03A 3KXPA 1M33A 4J03A 4DMHA 3V48A 3E3AA 1ZI8A 5E4YA 4CG3A 4UFNA 1JKMA 4Q3OA 3D2AA 3LIIA 1LPPA 1UK8A 5HFAA 1FFCA 3I1IA 3ZWQA 4PSUA 1Y7HA 4RE5A 5J3JA 2WQZA 3STVA 3X3HA 2I78A 4QWMA 4MJ3A 4Y2XA 4G4IA 1A7UA 1BEZA 1CUXA 2QVBA 3IA2A 7YASA 2ES4A 2BJHA 2XLBA 3R3WA 3EBLA 5JZBA 1EK2A 4X92A 4ETWA 1O6GA 4HAIA 4EA6A 4MEAA 3WK6A 3VISA 2HA2A 4H7FA 1BN7A 3WA7A 1CUWA 2B4KA 2WIJA 5HKAA 1XZGA 4X71A 5AKHA 3I2KA 5JASA 1XZJA 5LKAA 4MXDA 3HC7A 4KE9A 1UFOA 2VA9A 2Z8XA 2YASA 3PFBA 5T4EA 1TCBA 1HLGA 1MAHA 3L1IA 3TRDA 5KBYA 4G4GA 4UBNA 4Q82A 2WFMA 2WUEA 1YSCA 4QE3A 1VKHA 4DIUA 5AI5A 3OM8A 3WWCA 3R3UA 3UUFA 1LPBB 4GW3A 3C8DA 3WWDA 2PU7A 5CRIA 1EB9A 1CUUA 1CQZA 4HXFB 5HKBA 2FJPA 4BBZA 1UOPA 3OG9A 1CIJA 3STUA 2XMGA 2HHAA 4B7ZA 2YXPX 2ROQA 5BWBA 2OGSA 4OYLA 4F60A 2ZJ6A 1XKLA 1U2EA 1GQRA 1GKKA 3FLAA 1F0PA 4MEBA 1TRHA 3Q8WA 5D3ZA 1EH5A 2XUJA 5AP9A 3ESBA 3N0TA 3ZI7A 3M82A 1W1IA 1VOTA 5ALPA 3F9CA 3IUJA 3VJLA 4F21A 2QUBA 1TQHA 3DYIA 5JAUA 1ODCA 2JGMA 1G42A 3TEJA 2ORYA 4GXNA 5HF9A 5ALXA 2HDWA 1UKBA 4KR0A 5AI6A 2AJCA 3ICWA 3C6YA 2BUBA 3W9BA 3FCYA 3G9ZA 4W1SA 2H7CA 1T4MA 5HQ3B 2ZSHA 2V96A 3OTQA 3A2LA 3BL8A 2OAGA 4GECA 3HACA 5ALYA 1J1IA 5K3EA 4BRZA 2GYWA 2C0QA 3F97A 5ALKA 3E1GA 2J3QA 5I7UA 5EFZA 4HS9A 5AJHA 5C8VA 4GEGA 3C5VA 1K6EA 2C5FA 2WM2A 5CXXA 5FOQA 2JGEA 5AKXA 1QTRA 3PICA 3H19A 1XQXA 1XROA 4MQMA 2VQ6A 4Y7DA 3RARA 2CEKA 3WIOA 4B0OA 1SFRA 1LPSA 4H77A 1MTZA 2XMZA 2VAVA 4PSCA 3WKEA 2WUFA 3I2HA 2H7XA 4H7JA 1QIFA 2WUGA 3ED1A 4OD0A 2ONCA 3WJ1A 5HF5A 1CUEA 4AMYA 2D0DA 4BVJA 3FAKA 4WDRA 5ALEA 1Y37A 4DMCA 5FP0A 4FLMA 4JNCA 5AK4A 4C4ZA 3FYUC 3EQ7A 1ORVA 3V1KA 4MQLA 4C88A 5FUMA 4QLOA 4TPKA 3FWHA 4DNQA 5BV7A 2HFKA 2JGLA 1Q84A 1BCRA 4C4YA 4BP9A 3JYHA 2RHTA 1JT2A 1QO7A 3FCXA 3R41A 1XRLA 1ZOIA 3H0CA 2ACKA 5ALMA 3WK5A 2PSEA 1CRLA 4OUKX 4DNPA 2B61A 2WHQA 5LZ4A 2XUPA 4ZV9A 2AJ8A 3HABA 4X6UA 3H2HA 2XMRA 1NU6A 1CR6A 2XQKA 4YK7A 3VKFA 5AI9A 2AJLI 3PE6A 5IH7A 3BDIA 3HJUA 1YAHA 4LXIA 2HU5A 1U8EA 4BZZA 1HBJA 1DT5A 4BC0A 4OYYA 3WWEA 5AK6A 4YASA 2XUKA 2VT6A 2WFLB 3GROA 3RLIA 2HM7A 2JGFA 3SK0A 2Y6UA 4A5SA 2JGIA 3BIXA 1AKNA 2RONA 4AZ3A 4FMPA 4Y2UA 4EHBA 4YX9A 2XUIA 4TGLA 4M0MA 5FPQA 1HKHA 3F67A 1MNAA 4ZV7A 2Y2UA 2WUDA 3WLAA 3WZMA 1E3QA 1MO2A 4H35A 1GZ7A 1VZ3A 4ZWNA 3C8HA 1TK3A 2FJ0A 3SX4A 3I2IA 5I8PA 2JEZA 4KAFA 1AZWA 1JU3A 3STWA 2G63A 4UHHA 1L7QA 1WOMA 5AK3A 1R9NA 2C4HA 1AX9A 1G66A 1R9MA 4BDTA 1X2EA 4CFSA 4B83A 4INZA 4N8DA 4DMFA 3WZLA 1XZEA 2VJBA 5HF8A 2C5GA 5A7HA 1EI9A 5EI5A 5C7YA 2BGNA 5IKXA 4E11A 3EQ9A 3WK8A 2WLSA 5JD5A 4B81A 1FFDA 1HDEA 2VAXA 3N2ZB 1U65A 5EIHA 2OCKA 2HA3A 4EUSA 4UHBA 5LYYA 2XB6A 5JAPA 1P0PA 1SCKA 3S8YA 2OGZA 3G02A 5T4BA 1F8UA 4JYMA 5HK9A 2ZYIA 3KSRA 2JGJA 4L0CA 4JH0A 3ZLTA 1ORWA 4J3JA 1JJFA 2XQJA 4WJLA 3R3XA 5HF6A 2WG0A 1P0IA 1Q0ZA 2GZSA 4NZZA 2C58A 5LLSA 4V2IA 3HZOA 4X6YA 3D4LA 3L1HA 4W1RA 4AQDA 4S0XA 1AC5A 5EHQA 1B41A 3I28A 2V97A 3G0BA 1FFAA 4FLFA 4MYDA 2WIFA 2IIVA 5HQ3A 1XLWA 5ALLA 4UHDA 5DJ5A 4J0KA 2PM8A 3IUNA 2YH2A 5H3HA 3KD2A 3SWWA 1MX5A 5DLPA 4UBLA 2Z5GA 1ETHA 4EB0A 1XZKA 2ZJFA 4GHWA 3FVRA 4QDOA 5EIAA 1THTA 1CUFA 5A6VA 4Q3KA 4P92A 4BYMA 2OPHA 1A8UA 4FDMA 5FPPA 5A62A 4CIBA 4DTCA 3ESCA 4I4CA 3K2IA 4PSDA 4B0PA 1YASA 1OCEA 2GYVA 5LIPA 4ZGBA 4Y2QA 4UBJA 3AZPA 5T4FA 1HL7A 4PF1A 4X7BA 2WSLA 1CUGA 4Q3LA 5AKZA 5A71A 1EVEA 2ACEA 1EDBA 1CUVA 2BKLA 5AI4A 2Z8ZA 1UZAA 4IH9A 3AIKA 3O4JA 1TKRA 5LZ2A 1LPNA 2O2IA 1QIMA 2BAGA 3CN7A 3WWOA 3ZLUA 3O9VA 4FFVA 3WJ2A 4QDUA 2WHRA 4F0JA 1DWPA 1QIEA 3LS2A 2X76A 4O08A 1MPXA 4ZI5A 4UHFA 1CQWA 2GYUA 2V9ZA 4X94A 1UK6A 5AIBA 2AJDA 2HL6A 2VTVA 2XI4A 1LNSA 4U2FA 1K4YA 3H18A 4ZRDA 3V1LA 5ALOA 4IQ4A 2Z3WA 5ALDA 2G5PA 1MU0A 3C6BA 5AK5A 1R50A 4P93A 3C45A 1JJIA 1UOOA 1Y7IA 4G4JA 3RM3A 4X85A 3WMRA 5C81A 5DTIA 1ZI9A 2H9YA 2JBWA 2PX6A 1FSSA 5DNUA 5AI8A 4CG1A 4B82A 3QYJA 1AGYA 5ALNA 5D3KA 4KE8A 5K3AA 1B6GA 4QLAA 3VVLA 3KOOA 4FKBA 3H17A 2BUAA 1GPNA 1E8MA 4KE6A 3PF9A 2X5XA 1H2XA 1A88A 3BJMA 3MUOA 4Y2JA 3W04A 1QIJA 1ZD5A 3HEAA 3E0XA 4AN1A 5CH3A 2WFLA 3MGAA 5ALHA 4XJVA 1SOMA 1RYYA 3DKRA 1MAAA 3H2IA 3QMVA 3G8YA 5K3BA 3PDCA 4E15A 4C6HA 2PSJA 4DLNA 2Q0XA 1JFRA 5FRDA 4BCBA 1EA5A 4K2AA 4B85A 2VF2A 2YYSA 1WM1A 2C7BA 3NWOA 1ZD2P 3C6ZA 4IO0A 3R3VA 5AOBA 2E3JA 4Y2TA 4DYHA 1EHYA 2NW6A 1VLQA 2QUAA 1XQYA 2RI6A 1QLWA 1DX4A 1XZFA 5AM3A 4ARAA 3F96A 4L72A 4DNOA 4HZGA 4WFIA 1O6FA 3GUUA 1GPLA 5AOCA 4Y2PA 2P8SA 1CUDA 1BEEA 1OXMA 3DDUA 4BCDA 3BF8A 3LP5A 4HRYA 1LZLA 3WL8A 3STTA 4XIIA 3WKAA 1DTEA 1WB5A 5ALZA 2HA6A 1EB8A 1CUHA 1E66A 1J06A 1IZ7A 4EBBA 4UHEA 1CUAA 3DL7A 4KRYA 1P0MA 3BIWA 4L9AA 4CIAA 1YS2X 2O2GA 3ZPXA 5IVDA 1BS9A 3ZV7A 4J0CA 3DOIA 2WJ4A 4TVKA 2ZYHA 1H2ZA 4JYPA 1XRMA 5DWDA 2PSDA 2OGTA 4KAAA 3PI6A 2JEYA 3I6MA 3GZJA 2QMQA 2CUTA 3IDAA 3D3NA 1VJ5A 1EINA 3DL4A 2I3DA 1K8QA 4C01A 2HA4A 3QPCA 3DYVA 1ZGBA 3FLBA 1AURA 2I3ZA 1MJ5A 2VJDA 4HXEB 4B6GA 5CBKA 3BE8A 3EF3A 1DINA 2OAEA 2J4FA 4X3CA 1QOZA 2WIKA 1CUSA 3QM1A 5KWJA 3PUIA 4PQEA 1IZ8A 3VVMA 2DFPA 1ZJ5A 2HA0A 4B80A 2FX5A 2IX9A 1KU6A 4LKOA 1E8NA 3QMWA 4BAGA 2WTMA 3VDXA 3DEAA 4CCWA 4BE4A 3RKSA 2DCMA 3P2MA 4B9EA 1BE0A 4ROTA 4EY5A 1LGYA 3T52A 4AN0A 1C7IA 2PUHA 5JANA 1ACJA 3H1AA 4IH1A 5AI0A 2JIDA 1K63A 1XZMA 2XMBA 1W4LA 4X95A 5CT8A 2PU5A 2OQIA 4UUQA 4WFKA 2C0PA 2LIPA 2XQFA 3WA6A 2WFZA 4FBLA 4DSZA 3HLKA 3G0CA 3QMMA 1UWCA 3TGLA 4AO8A 4FHZA 1ZIYA 3FSGD 1MX9A 1XZBA 1UKCA 5T4HA 1DWQA 1XZAA 3AIOA 4J0JA 2V98A 1BN6A 4X6XA
chains in the Genus database with same CATH superfamily
2CZCA 4OI1A 3V80A 3DOUA 2J5KA 2ILVA 2SNIE 4BKOA 3T35A 3NIFB 2FN7A 4XSVA 4OK6A 3FDZB 4EY6A 3RTGA 5TVGA 5KX5A 1N2HA 3HA3A 3MGGA 4LWOA 3KR2A 4KDEA 4ZVPA 1I33A 2Z5FA 3GGOA 4KQXA 1YRQA 3DFIA 1KS9A 3P4YA 5F51A 1C14A 4QDXA 1Z7EA 3GFTA 3HL4A 4G9EA 4JL6A 5HBRA 2W6NA 3CM0A 3IAEA 4QJ3A 5B4UA 1SBZA 2O7RA 2RHJA 1JPVA 1X94A 4PR3A 2AX4A 5LQNA 4MKZA 5JNVA 5TIIA 1XZLA 5KKNB 4FX2A 4MS1A 1N4DA 3ZVKA 2O3TA 3IS3A 3Q0IA 3FFAA 1CK4A 3ONWA 4OJQA 4RENA 4DA8A 3TVTA 2DKNA 1PV2A 1HTWA 1NFFA 3KJNA 1W6RA 4IZHA 4LS3A 4ILKA 5ALWA 1C7EA 3CWCA 4X97A 1ZK4A 4RK0A 2GJSA 1T0PA 4BNWA 4R8VA 1I7NA 3S1AB 1FMJA 2H1SA 1VPLA 1YACA 2PSHA 2YRFA 3NTUA 4YRGA 1LLFA 1E6WA 2A4KA 3S81A 3LQ2A 4TKZA 2VQEB 1GGNA 2Q2VA 5LKRA 3JD2A 1EP2B 4YROA 1GFSA 4MA0A 3VHXB 2ZJ1A 3R44A 4GZ6A 1U04A 2XTZA 2G40A 5LZ7A 5SYAA 5FLXA 1IOWA 4BMYA 3BHNA 2WJWA 1MRNA 4EVQA 3TQOA 1OFUA 4BFVA 4DSOA 1WY7A 4V0MA 3GP3A 3UJHA 3VKVA 1JQKA 1OGYA 1MA0A 1SXJA 5I6DA 3HQ4O 1FCJA 4C4XA 1GDTA 4M9ZA 4ZEVA 3HP4A 3PHGA 1TM5E 3SF0A 1OZHA 4XQ9A 1KA9H 1VXRA 1C3JA 4O1MA 2BFNA 1DEOA 2G4VA 3JWEA 4IUDS 4TLBA 3V55A 1A96A 4BC1A 4QDZA 2IGBA 4KAJA 1QQ6A 1SXJD 4EYGA 5IZCA 2PUAA 1GG2A 1MG5A 3JQAB 2HIHA 4KJXA 5JI2E 1UXGA 3ANSA 1KDZA 1YAJA 1Z75A 1NQVA 1J23A 2WAAA 3DLBA 4P9NA 1RHRA 2R5FA 4LDPA 4P86A 5GQSA 4JQOA 5IAJA 7REQA 3L5KA 3A4NA 2JDIA 3PNMA 3AUKA 1LW6E 2JAOA 2XHEA 3LT1A 5CB4A 1DKUA 1ZG3A 3U61B 1DAKA 2WP0A 1ORRA 2COEA 1JVSA 2I6QA 3WE7A 4IQ0A 2I7TA 4URHA 1ODIA 3C3AA 1K86A 4HBGA 4ZEMA 5L51A 2FFBA 4Q00A 5JARA 1WABA 1XVVA 1ZVQA 4GWLA 1HDZA 4PN3A 1GL3A 1WF6A 3QSGA 2FNAA 4K6FA 4K9LA 1OJ7A 1QRDA 2R3SA 3F3YA 4IDHA 3UAVA 1Q91A 1YZ3A 3J7TA 4TWJA 1RAFA 5ALIA 1P3DA 5JCXA 3EVCA 5CVUA 3ORQA 3GH3A 3U39A 2HRQA 1KP9A 2INGX 3PUVA 1WD7A 1N2XA 1GLGA 2H00A 2QM0A 3G89A 4Q05A 4Q4HA 5IFLA 3E2PA 2B3DA 3WNBA 1KGSA 2OAQ1 4GKKB 4PGFA 5C7IO 4OP1A 1NIPA 1LVUA 1QQ7A 2C2ZA 3UMJA 3M4XA 4Q9IA 5TQVA 1W0KD 4IXWA 1DAHA 1K75A 3QLTA 2XWQA 3TR6A 2C88A 3AWIA 4N82A 1CUYA 3AFHA 3TFOA 4R0NA 3OQMA 3LPAA 4LIPD 3BWMA 2PS0A 3ZDXB 1H2FA 3NR2A 5JSQA 5FUQA 1JMVA 3AIIA 4FGKA 1FFSA 1WCYA 3BBLA 1EE1A 1F4PA 2XNHA 4QXAA 2IY7A 4BFUA 3AI7A 3NM4A 2C78A 5EJFA 1DUIA 3G7UA 1K4KA 4IS3A 4PO3X 4ZVRA 1IJEA 1Q3HA 3K32A 4RAOA 3NAMA 4HNHA 2VFAA 1E2QA 3STHA 4V0RA 1WX1A 3T3EA 4U63A 3E7DA 4HDOB 4KFUA 2WB2A 4XWTA 4W1QA 2FPLA 2RGXA 1HURA 1SOAA 1R8XA 4Z1MA 5CFMA 4FOPA 3TIVA 4HY3A 5K8VA 3L41A 2PYZA 4P3NA 4MW4A 1U0NA 4NU5A 3WI7A 3GDHA 2DEUA 2XMQA 5H16A 1RFGE 3L7LA 5ERXA 3JVVA 2BGIA 5HA5A 4QDJA 5DNEA 1U1EA 3P94A 3A11A 3RSHA 3IUEA 2J7PA 2ID8A 3LPMA 4F45A 4ZU6X 2XW6A 5GPBA 4ZA2A 1J09A 4JENA 1WW8A 3DMGA 3MWGA 1DBVO 3TS1A 1K5DA 4O63O 4WVLA 3L4SO 4C0BA 5FPSA 1G38A 2W6CX 1IUPA 1SBNE 2CXSA 1E60A 2O7NA 4CL0A 4R8SA 4BQQA 2BMDA 4RFLA 3O7MA 3SKXA 4BLSA 3T5AA 2BSAA 1VZ2A 2QE7A 1M76A 2QQGA 4D8WA 3FCEA 5HYVA 4LCEA 1YB7A 1D5WA 2HJ9A 2PQ0A 2ZBFA 3I6YA 3M1AA 3Q72A 4HLUC 3DM9B 2DZDA 1S6YA 1FJ2A 1P9OA 3CEJA 1C3EA 2P1DA 3AJEA 3PSHA 4Q19A 2HY7A 4DCJA 2H7YA 4BYGA 3BXZA 4H6PA 1NW6A 4RIHA 3CISA 3TAUA 4QTYA 1Z26A 2F3QA 4FEGA 4PLYA 1RWOA 1D2AA 3HEBA 4KFRA 4G5YA 4LHEA 4CTJA 1KJQA 4UBMA 3MOIA 1CV2A 3LO8A 2R8EA 4EO7A 3H9GA 3OCVA 1U8UA 3B3FA 3SYMA 3R7WA 2X4GA 4BJHB 2EFEB 4D98A 2ZXUA 1I4WA 3VYWA 2OEPA 1G6KA 1KJYA 2IUTA 3M3DA 4D2IA 4EI7A 4F56A 2WPDA 3IP1A 2Q1UA 3ONNA 4HF7A 4TS3A 4DBVO 1EEXB 4BNXA 3GUCA 9LDTA 1IDN1 3WKBA 4LYDA 4BFWA 5A4AA 4UU1A 4PS0A 2DERA 2RDMA 3F3MA 4HPWA 1KFBB 4X9XA 1J8QA 1KFEB 2VRCA 2K2QB 3QTLA 4HDSB 5EJAA 2F17A 3RCBA 1YA4A 4DE5A 1P7YA 2QA5A 2Q5OA 4JP3A 2ZYRA 5EMKA 3VO8A 4DLXA 5JQGA 4UUMA 2VQDA 3E58A 5FOTA 1G6OA 2PANA 1QFXA 4JJ8A 4KZKA 3ROPA 3B6MA 2VRCD 1L7DA 1HDGO 2EZ4A 2PE5A 5TE9A 4HAOA 1A71A 5EJ4A 3DHNA 1L5WA 1EGVB 1UBKS 2LNDA 3DMFA 1XMIA 4LF8B 3B9BA 3OOSA 4D4GA 2I1QA 1I2BA 3WS7A 4BCCA 3OKAA 3W5VA 2E1PA 3KB2A 3OZCA 2WWIA 1VIAA 3C6QA 3GGDA 2VDQB 3VDRA 4GUAA 3O9MA 5LQDA 1V11A 4K88A 4DIBA 1F5NA 1J49A 3SSMA 4LOLA 3KV3O 2G9VA 4V0SA 1FYVA 1JXMA 3K4QA 1OJLA 4MB0A 3RC2A 3WSTA 1Y4DE 2B0JA 1ZD8A 3I8XA 2PFKA 4RVOA 4A10A 1RLMA 3F98A 2QUHA 4IV0A 3CUUA 3V4ZA 3ZI0A 1S4QA 2C97A 4JT8A 3WMFA 2RGCA 1Y3HA 5FWDA 1ZLYA 1UEXC 1SUPA 1JI3A 4YEDA 3WLJA 3M6AA 3VBEA 4MW5A 2Y66A 1Z63A 1G6Q1 1QU3A 1F0KA 2R6R1 4ZOLB 4KACA 4PX9A 3WHLA 3MT9A 2Z8YA 2IS6A 4IVRA 3DEZA 1TX4B 2BP7A 3R6TA 5FPKA 2V8OA 3DCYA 3RPEA 6CHYA 5U9CA 2OO7A 3D54D 5AHRA 1H2RS 2AG6A 4XI9A 3VHXA 1YZQA 1ZL0A 1PNTA 1RXUA 3NUZA 4LZPA 2CVHA 2VYND 2QJRA 4LDJA 3TECE 4KWCA 3C6KA 3QVMA 4KXNA 4NV1A 2G5CA 1RQRA 8ADHA 2HWYA 3AUFA 3BRCA 5ESWA 1R4MA 1RJDA 3CX4A 3BAZA 4ZVUA 3WYFA 3PEWA 1PW5A 3NOXA 2HB6A 4ZOCA 2CE2X 4GL4A 5B6PA 3TYXA 3SD7A 3L77A 4MICA 2RAVA 2C2MA 1EG2A 3R0QA 5AUOB 1EPUA 3H7AA 4ZYLA 3HR8A 1MB0A 5AKKA 1FC0A 2XDWA 3BMQA 5CVDA 4H7EA 3IB3A 4XM2A 3TM4A 1JR2A 4MKIA 2DSNA 4R8KA 2YRWA 1J7KA 4QWWA 4OP3A 3JQPA 2ZI4A 1NJGA 3FHTA 2QTLA 1RAEA 1KZGB 1HE8B 3PQEA 3W1WA 1J0AA 1V4BA 1O54A 4HDNA 3I4LA 1B0AA 4BRWA 3HUEA 4YRMA 3T1QA 3B9RA 4EENA 4KPYA 2O8EA 2D7CA 3DDZX 3AVTA 3GAFA 3BEDA 4EY8A 1C9KA 2IEBA 3TIIA 3L8YA 4FQ5A 1I6MA 1N2IA 4HEHA 1YZUA 1HSZA 3HDQA 2EEPA 3OEEA 4M8NE 1Z4OA 2HIAA 2CLEB 5IC5A 4EZEA 4O2BA 1ISSA 2Q5LA 1JN0A 2PD6A 4N9QA 1P5HA 4ASUA 1NQXA 3AHDA 2VPYA 1HYBA 3GJ6A 3OFNA 3DBHB 3FVTA 4N9WA 3REQB 3SDZA 1HG1A 1RI3A 1ZQ9A 5J47A 4DKJA 1TI7A 2YHUA 3NTRA 3H4TA 1U0GA 1ND6A 2WYVA 1Q0UA 1E4VA 1NXWA 2VG8A 1IG3A 1XPRA 3TRJA 4JIMA 5AW3A 1NMQA 4KITB 1EWTA 3DEYX 5AVXA 1IUOA 1AHNA 3R7DA 2VHQA 1MEJA 1X7XB 3FNGA 3WK7A 3DB2A 4J4BA 1NP3A 3LX4A 4URUR 2ZLBA 3LRPA 1MFZA 2GA8A 2GVZC 1T5HX 3PWZA 4DCPA 2A5YB 3FIJA 3BERA 1GLNA 3H5VA 2WPNA 1JEQA 5AHOA 1GZ4A 1KNXA 2GBIA 4Z1OA 5LZ9A 3DLCA 4G0YA 1RWVA 5AQEA 3MB8A 1R15A 4X20B 4S0ZA 2R96A 3EUEA 2CV1A 3G1TA 5SY4A 4O8ZA 4F3CA 1HDYA 4FYWA 5I5EA 2HRBA 2QG4A 1NMEA 3AH8A 4ZOBA 1BROA 1JEEA 1QE0A 1FW6A 3ET4A 5L3QA 4B3CA 1U7OA 2Y3IA 3OZEA 4XWOA 4V0NA 5DHTA 5HG0A 4HNVA 5BSHA 5JNWA 3D0RA 3EFEA 2G76A 2I2CA 9LDBA 2X9GA 3ZE0B 1XDUA 3KVYA 3CZMA 4KQHA 1YS4A 4NDZA 3TGWA 4I9FA 1QIDA 4Q93A 1P2BA 1JMYA 1J25A 1UZNA 3UPDA 1M34A 1TLFA 1C2YA 3WYDA 1ADBA 2VHUA 2PVCA 2X1MA 1EFCA 1WXGA 1TJYA 1U2PA 1DO8A 2CKDA 2OV3A 3DHWC 3HXLA 4XW2A 2JCVA 4YT2A 4RE6A 5DISB 2PJZA 4RUKA 3PQ4A 1OY1A 1R5BA 2VDRB 1GLVA 2ZTLA 4I4NA 3UAWA 3FYTA 4NC9A 1NW8A 4YCLA 1XLTC 3RU7A 3TE6A 5D84A 2QT9A 4U2DA 4EPVA 3LPLA 4RMJA 2NXWA 2P27A 4DXHA 1H2YA 3V8QA 4FBMA 1LS1A 1EVYA 1NF9A 3C5HA 2A9PA 4CEIB 4B2PA 3PVZA 2YCBA 3IDFA 4BTVA 3DZBA 4PS1A 4LHXA 5KWVA 4RPJA 5IMBA 4TRJA 3GV0A 4ZDIA 1YHZA 1OI7A 4G1EB 4ENVA 1JWBB 1PUIA 3R74A 1L7AA 4YJ2A 5AKLA 1UBCA 4JVSB 8ABPA 1UMBA 1FX0B 2PUTA 4J4TA 1KQFA 4BUZA 2GASA 4R2KA 4LTMA 4EG4A 4URYR 3O4IA 4A0QA 5A2GA 1QHGA 2NN3C 2XBMA 2RHGB 2VDKB 4Y2SA 4B84A 1H22A 4R41A 3IQHX 3PNKA 1AQLA 1EJ6A 3NANA 4BN5A 1KF0A 1W85A 1USWA 4AZTA 3ZW7A 3H84A 1XXHA 2B4AA 1VRCA 4IIYA 2ZB2A 4RDCA 4JEIA 3ZBUA 2PUEA 1KOGA 2YJ4A 3VR6D 1C3XA 1Y7PA 3GVCA 3CRVA 3DV2A 1CQIA 3IXQA 4KYTA 4C08A 3MCWA 5CCXA 5F9FA 2W22A 4B6QA 1AUQA 3A4VA 1W87A 3D3EA 2A7XA 1FFBA 2DFNA 5ARDA 3RUEA 3A1NA 4LYHA 4PO1A 3W9YA 1EGMB 1TKCA 1HYGA 2XIJA 1MW8X 1O08A 3B5EA 1XJ5A 1H1TA 2VP6A 2AKEA 2NWQA 2QTMA 5EIEA 5FQOA 1MXFA 5J4VA 2XTMA 3QFFA 4I4TA 2LE0A 2NUAA 4GOOD 4GVPA 3EC2A 3KUXA 4PAQA 4UOQA 4QQRA 3V1UA 2O3RA 4NARA 4E5DA 5KYXB 1KJWA 3KJZA 1N36B 4DQDA 3AR5A 5MFZA 2V6BA 1Z0KA 3D3WB 2XEDA 3GRFA 1WUHS 2OVFA 3NFYA 3VUFA 2IPNA 2ZYWX 4JLOA 3RVDA 3WIDA 3DDSA 1QRTA 4H7KA 4R9VA 4RKQA 1SQFA 3LBHA 2EJTA 1EFPA 1PEYA 1AHHA 3GU3A 3QFHA 5K3FB 1KFCB 2IYTA 4BO8A 3BKWA 1G3MA 3AERA 1VHJA 3THSA 2JAQA 1TO1E 4JJ7A 4XCQA 4OCZA 4YRNA 1E3MA 2O5VA 3O2QB 2LPMA 3TW4A 1AN0A 1KEPA 1MTOA 1YZTA 3L8FA 5M29A 3ORFA 1YR7A 3JZIA 2X1VA 1D8TA 3EEFA 1O57A 3ETDA 4KXFB 4W4TA 2NUPB 3R5FA 4D0GA 4K6HA 1Q7TA 1NY5A 3AILA 4XLZA 3RFFA 5T7BA 2DXIA 1ONOA 5LB4A 4G1FA 1HZZA 4ML3A 5JAOA 1GGJA 5KJFA 4RLHA 1O94C 1S96A 3I2JA 4IIVA 1E3WA 2XZPA 1B4DA 1FTWA 4GMKA 4KMSA 4HLDA 1WDMA 3IAM1 5ALFA 3UXMA 3W7VA 4E2FA 3HUUA 4FNGA 4Q03A 3ULKA 3WDMA 2Y93A 2P0EA 2V45A 5AKGA 1Z45A 1HPLA 4TM8A 3IAS1 3UHFA 2R9VA 1PDWA 5CVCA 5AXCA 5I7WA 1GRRA 1RXIA 2GAOA 3KWFA 5ALRA 4BNIA 3N28A 1Q50A 4XFJA 2X15A 2QX8A 4QUJA 4WA8A 4ZTBA 1OOEA 4NATA 3LUFA 3KDAA 1ZXXA 4DCOA 2WZCA 3TKAA 1PTJC 1ULZA 4FYXA 2W7TA 3DWEX 2QP3A 4O33A 3RHTA 3RNLA 2CCKA 1SKAA 2SCUB 4MYUA 2JA1A 2ZS8A 4FTWA 5FWXB 1QGAA 2RB5A 1T3TA 5CK5A 3VNQA 4WVFA 4Y6SA 1N5DA 1QYWA 2L17A 2YFKA 4EPXA 2BH2A 3FMFA 1L7VC 1E1RA 5JJKA 1MT3A 2QS9A 1I51A 4JJEA 2CFCA 1Y7TA 4AK9A 1TAQA 2Z08A 3DFFA 5EKUA 2YN0A 3N2KB 2A57A 2XMCA 4DQKA 1QHXA 3GLKA 3ABIA 3PX2A 1N2CE 4JYBA 2GO7A 2HRRA 5FUXA 1QCCA 3PDIA 1J90A 4XCVA 4ZCSA 5HK8A 1GTSA 1E8DA 5KNCD 1Z22A 1IN1A 4M60A 2Q9CA 4G26A 4YRCA 1XZHA 1U7TA 1J24A 2VJNA 5EUQB 2AOVA 2UUPA 4MGHA 4YRJA 4Z7JA 3EGIA 4IIUA 1UIMA 1NXQA 1WPGA 1ZPDA 4C20A 5ALTA 2ZI3A 3GIDA 3PF8A 1T8PA 2EBFX 4KN6A 4L4SA 3B52X 4I9GA 5FKJA 3G8BA 1THGA 5F1KA 1AH2A 1PZMA 2CZQA 1LJUA 2QWXA 4FFPA 4Y6GB 3P52A 5D86A 2JZNA 2CYAA 2AG0A 2OBLA 2WDZA 3O95A 3I34X 4KG7A 3KKOA 1JFTA 4OLJA 3DONA 3WMWA 3L05A 1GGEA 5LXTF 4LGMA 3NVAA 3W8RA 1BWQA 3H16A 1EVKA 3C39A 3NEYA 3K6KA 3BE5A 4RQUA 1U4NA 5FL7D 3L0PA 3NH9A 4EL0A 1JGTA 2GEDA 2KYRA 2XUHA 4OHCA 5IK2A 4CCYA 1NVAA 1NWCA 3U13A 3VU8A 1T9DA 1WQ3A 1M2HA 1C4OA 3KKNA 3NHMA 4LSZA 1L4NA 3U0VA 1W6UA 5FNVB 4KGDA 3JRXA 4Q34A 2R86A 2RFLA 3TLGB 5JZ9A 1YTLA 3L46A 1FRZA 4HWPA 1OXUA 4ABTA 5DBFA 3WQHA 2VP0A 3G0HA 1QR6A 2Y0PA 2ZXFA 4NNPA 4JOQA 5SZKB 2F3SA 5JSZB 3RS9A 2EYQA 1T2AA 5IJ0A 2J59A 1E2KA 5LJLA 3CURA 1DAEA 2F1RA 4C0WA 3VZDA 4CCAA 3B3JA 3SR3A 1UKAA 3A37A 2B9VA 4D99A 3B1KA 2BP7B 1TUBB 1BU8A 2C9MA 2AL7A 4HLUA 2HLNA 4WZBE 4XM0A 2RAUA 4EUEA 1U2GC 1QXSA 3QVUA 1M2EA 4M9CA 1YMUA 2MYNA 1NTOA 1NR1A 3A05A 3GLRA 4PY2A 1LV8A 1IVSA 4M89A 4NV3A 4P3OA 4J7AA 4FHGA 4MSUA 2IYEA 5DYTA 1XDBA 4K6GA 4ZJUA 4L5BA 4Y1GA 1JIKA 3OC0A 5KUTA 4CV3A 4IVNA 4M0EA 1Z0DA 3NHZA 5JFOA 4O8CA 5IAKA 5CT4A 2XQIA 1MC1A 3FE2A 1N2BA 3A6LA 2PD3A 7ABPA 5LYJB 3TG8A 1MJGM 4P4GA 2PIDA 3D7LA 3EDMA 3KOWA 1OLOA 2VEDA 2B20A 3GNSA 3HB0A 1P5ZB 1ISMA 1E5LA 2ID7A 5I7SA 3IPCA 3RUPA 2QTGA 1H6CA 1PR5A 3CCCA 2WT9A 2Y1XA 1YK0A 4CYMA 1XFDA 2OZLA 4QOFA 2E4VA 3DMRA 5GY7A 4J0QA 2RHCA 1UMBB 2BN4A 1F6DA 1JDUA 2QI9C 2FCAA 4EPYA 2W4QA 4GR9A 3T9BA 4K7JA 2FZLA 5HIIA 1NFRA 1WWKA 2DJ5A 4W9NC 5TB5A 3WKCA 1JH8A 1H8EA 3KSAC 2FWAA 1KOFA 2C83A 2NX2A 4DREA 2EKPA 2ZZNA 4Y7CA 5DNVA 3FPGA 3NHBA 5BSWA 3ZLBA 3KYCB 4J3FA 3MT8A 1ZU5A 2IYAA 4RVFA 1H8HA 3NNSA 1QGUA 4GBGA 4XR4A 5CX1B 5JALA 1RAGA 3VR5A 5IHPA 2BV3A 1MVOA 5CLJA 2JHFA 4YFYA 5FA8A 1SY7A 2OXCA 4EITA 4L73A 4YECA 5EMLA 3F6BX 4L9RA 4F97A 5KI6A 3KPUA 2G7ZA 4GRDA 2Z9BA 3HVIA 1P18A 2OCGA 3KLNA 1P3Y1 2ADOA 2Y0EA 4DXAA 3H65A 1F1JA 3G2JA 3HVRA 3O82A 3ZYZA 4BO3A 1RFLA 1E2MA 3WWPA 3CWQA 3QEKA 3MMSA 1X7YB 4JBHA 3T1NA 1HL3A 1DRKA 1TUBA 4DRXA 4NI5A 2J0QA 3D1LA 3FNBA 2WU4A 4C6RA 1KY4A 2Z04A 2OMKA 2IKSA 2CD7A 3I5AA 2J6HA 3GRKA 4PPGA 1JAIA 1L1EA 4KU4A 5ICGA 3IVMA 3LQ1A 3F74A 2I1LA 4BFSA 1G6HA 1OLSA 1R0RE 2IUYA 4NBVA 5F76A 1RQXA 3SZGA 4N41A 3QPDA 4BN4A 1LQUA 2MSNA 4D4LA 1FJXA 3DMNA 3KSUA 4N12A 4IFIA 4JR1A 4WY5A 4C5CA 2AMYA 2XKBA 4WZZA 3DBLA 5EKXA 4AMBA 4DRYA 3X1JA 3QNUA 4FSXA 4QPCA 3N70A 1NATA 3NYIA 4FHCA 4QQFA 4U2CA 4E4YA 3GNLA 2HEIA 4RMNA 3DDOA 2JATA 2DQZA 2RGWA 4LVCA 3BJRA 4AVYA 4G1MB 1PIWA 1GPJA 2H9IA 2QZ4A 2RGUA 3OEWA 3QQ5A 3TQRA 4OP2A 3UENA 2N46A 2D7DA 2IVFA 4KPEC 4BU1A 5J9FA 1CUCA 3VZRA 3PNPA 3UMYA 2QTNA 2P40A 5JSFA 2GXUA 2HJVA 4R2WA 5IC4A 5C3UA 1CZUA 1A1SA 2C5LA 2J3HA 3P71T 2HOQA 1FVFA 2AEEA 1GFZA 4YV0A 4F11A 3ZXYA 4M38A 1IQ0A 3WLKX 2D2IA 4BBJA 4LDAA 1UPTA 2IBTA 1CSEE 1DT3A 4HB0A 3UMRA 4N03A 1YRAA 3HG7A 3GOHA 3C97A 4MJLA 5CIWA 1PDOA 4BX3A 3VKGA 2E89A 4IQFA 2O1WA 1E89A 1AXRA 1DQYA 3Q7TA 2JJMA 1OV4A 3FPBA 3L7YA 3P2KA 3PKJA 3KHKA 4ZO7A 1R9JA 2O23A 4X20A 1AF7A 5ADUS 2R8OA 2G80A 1JG7A 1NLFA 2HXSA 3GQBB 1CNEA 4AMZA 4MW7A 1XAHA 3ENNA 3U6BA 3IEPA 5AVKA 1KBQA 3EH2A 2BGGA 5KYKA 3DVAB 3EZGA 1KP3A 3HB4X 2LTAA 2QVLA 2EF1A 1P0QA 2XTNA 3G2HA 3ZOZA 1ZGCA 4QNNA 4ARVA 3UYLA 5GV8A 4LDZA 2ZZMA 4CKEA 3QYPA 721PA 4IVQA 1KAEA 1TUIA 4HRXA 4ZVOA 3SJBA 3ZLVA 1KY2A 3QKIA 3E9NA 1XTPA 5KIAA 3AXSA 4NONA 1H5QA 4MUHA 4AYXA 1EDDA 2CDAA 4UPDA 2QTWB 2ZVPX 3T7IA 1UJ5A 4CF3A 3HXQA 2OXTA 1EGAA 1LNZA 3JU3A 1JIVA 1XK7A 2QORA 1RXEA 2AQHA 2HMAA 2G77B 3A9VA 2XNDA 3EDQA 1KRXA 1X3SA 4MQUA 1DJQA 3PEYA 3R5KA 4RSHA 3VUEA 3I42A 3FUTA 1B16A 2FZWA 4DJDC 5KPDA 2XA2A 2BGRA 3ECSA 1SXJC 3FMPB 4PX2A 1VG0B 1VL6A 3MOGA 4GF5A 1Z2CA 1RCFA 2AB0A 1CKEA 2D1QA 4WK4B 5DTEA 2V6JA 1BHSA 2JIZD 3A2KA 3UC9A 1NIJA 1T25A 4FZ3A 3DTYA 5AKEA 1W34A 2DSTA 2VR1A 1XK6A 3IQFA 4PHHA 2I7CA 4MNTA 4L76A 5WRFA 1E0KA 1FFHA 2RK3A 3PX3A 1WXQA 4R2JA 1T2UA 5KTPA 2BGJA 2REXB 2WIDA 2ZIEA 5E0OA 4D56A 4DV7B 3A6PC 4C78A 4IQ8A 3I2FA 5C8YA 3E18A 1MLDA 1E3SA 1TL7C 4YH1A 1Z5NA 2BZ0A 4LQCA 4EJFA 5K6TA 2YOGA 1K66A 2A1TR 4L6AA 3MWDA 1JYEA 4RVDA 4PC2A 3VR0A 2N42A 3H83A 6LDHA 3EG5A 2M9MA 3AJ8A 4NYJQ 3F1KA 5CDYA 3RQSA 2UKDA 1B00A 3AKEA 1NYLA 4CJXA 4HLQB 5KTKA 2FY8A 4BEJA 3OUUA 3AZOA 4HGOA 1JLKA 3UJ7A 2CXHA 3IOBA 3ILSA 2IJGX 1EZZA 5BV8A 1SIOA 2BBTA 4P8RA 4ROSA 4F3NA 4TKUA 4D3DA 5J4LA 1WAMA 3AB7A 3BE4A 2V7WA 2J0EA 1E3EA 3GQBA 3P1JA 2IZZA 3K8QA 4GX5A 1HOTA 3GZ4A 3IVGA 3WKDA 1JFFA 1XDGA 1VKZA 5MGBA 1O0CA 1L7PA 5E0KB 3AONB 1BC5A 1CVLA 3W6PA 4YP9A 4ZEXA 4AJPA 1F9EA 3K96A 4ITVA 4K9DA 4PZEA 4J6FA 5I4CA 4L5CA 5IRCD 2AW3A 4JBNA 1J5PA 5LOVA 1GP2A 2Z3ZA 1E20A 2ZE5A 2O59A 1CR0A 1Z5ZA 2R8BA 2RH5A 3UGKA 4W9RA 1RU3A 5IHXA 2J45A 3Q9LA 1QYCA 1T5SA 2VHCA 1K6MA 2DLDA 4GRIA 4RTRA 2JJ1D 5TSDA 1BX0A 2WE7A 4LGVA 1I8TA 4M49A 4LBYA 1JBEA 3NRJA 2WMYA 4RFSB 2P4EA 1KH2A 1WHSA 1KO1A 3BDVA 3JQ9A 1JWAB 5JFTA 4E13A 5KSZA 5NULA 1WXEA 1W5FA 1NRWA 1YZFA 1TADA 2AJTA 1PL7A 4GICA 2R5NA 2FYTA 2QSZA 2KPOA 4W7IA 1X2BA 4A8JA 3BWDD 2A2ZA 2PA0A 1NOIA 2KX7A 3UQZA 4KHPB 1T2CA 1Z13A 3MT0A 1FNCA 3E8MA 4US0R 3WO1A 3IUQA 4MUBA 4PZUA 2ZUDA 1I3CA 1EUDB 2XDQB 3GG2A 4P38A 1M8FA 2CKMA 2F9MA 1YBAA 2FHPA 3PRHA 5AXDA 1RHMA 3N2GA 3V9PA 3W6UA 6REQB 4P34A 3JZFA 5BR4A 4TSKA 4KSYA 1KEWA 5CH5A 5D00A 2NZ8A 1QAQA 5B12A 3IV7A 1KU0A 1LPMA 4X66B 3IQGX 1ZNWA 2XXAA 3EZ6A 1J07A 1DOAA 4ZHSA 4JT4A 1WSBA 3B38A 3AHIA 2H5IA 3GRZA 4H3HB 4KK3A 5BOSA 3GN2A 3Q3CA 3A2MA 2N1BA 2Q8NA 2GPYA 5AKJA 3RHFA 1XEWY 2GILA 4WECA 1CRPA 4N7JA 4REQB 2IW3A 3HVJA 3OF3A 3V4RA 2IDZA 3KQWA 3D6VA 3W3ZB 1A04A 2PXCA 4JDUA 4XYEA 1P44A 2I76A 1C9DB 4BP8A 1CXZA 5JSUA 4EYKA 3WLOA 3DD5A 2HT1A 1MN6A 4UMDA 4UDNA 3D7MA 5ESRA 2E48A 3C3YA 2EDAA 5IM5A 3GJSA 3N0RA 4CG2A 4PNEA 4PCLA 2WVHA 3CXUA 2QRVB 2E2WA 2F3PA 4L3WA 4RTOA 1L4FA 2NSLA 1MRZA 4OQMA 3SYLA 3NAZA 4IS2A 3MRXA 1NQTA 4IDAA 4L78A 5E8JA 2EEZA 1T8TA 3E5NA 4ZVNA 4AC9A 3U1VA 5DGXA 2G09A 3B2EA 3JAMA 4MGIR 4QATA 1AY0A 4WLUA 3HWWA 5IDWA 3B1JA 5JHHB 3V48A 3QEOA 4NYMR 1W2GA 5FFMA 1ECCA 2ZIUB 5LSAA 5KX5F 2RJOA 3I8SA 3L1UA 2IY8A 4LYAA 5CX4A 1NSYA 1YBVA 4ZT5A 4CG3A 1QP0A 3WV4A 4B3IA 3KUDA 3QV1A 4K3VA 5CJPA 4QVGA 4B3TB 1P4HA 4NULA 4F9GA 2WF8A 2RBGA 2C54A 4TTAA 1UK8A 4BLQA 2IP1A 2C2YA 3H42B 3DTTA 4RHCA 4Q1DA 1RKVA 3I1IA 3PYXA 3R6WA 4PG7A 3HN7A 4EOGA 1YVPA 3ME5A 4V38A 1UXIA 1JT9A 3CNLA 4OBBA 2IC5A 4RSRA 5F98A 4LJ4A 4Q0MA 2ZSEA 4QBGB 2NSHA 4DADA 4WASA 4WBSA 3INGA 4LK2A 4RMGA 1O95A 1ZS9A 3VR4H 2IS1A 3W3AH 3U5TA 4KFCA 4TMZA 3NU1A 1TZKA 1OTHA 1QG0A 3HCOA 1ZEMA 4A8HA 4YYZA 1XWFA 1W9MA 2X4IA 2YIVX 2NIPA 3CPHA 4BN0A 1FTGA 2IDKA 2OT3B 1Q12A 2NZXA 4G4IA 4UKDA 5BO5A 4MDEA 2QSYA 3I04M 2HD4A 3DC2A 4L0DA 3SZOA 1NF3A 3KQOA 4CR8A 4EMSA 2Q9AA 2QVBA 1RJ9B 3EVZA 4C2UA 3B1VA 1YQDA 2QD4A 4D82A 5MN5A 1GTG1 1JR3A 2M2IA 2DFVA 2XLBA 4UXIA 1H6DA 4YJ3F 2BEKA 1G291 2W8BA 2HPHA 1EP1B 1T6ZA 4WZAB 5JZBA 1EK2A 1SIBE 2XA9A 2XRYA 3AVPA 1ST3A 3TTTA 1RDFA 1SA0B 4KIFA 5COAA 2V7GA 1WZ2A 3C24A 4KVZA 1VP3A 3HA5A 1RD4A 2P2DA 2VDMB 1ENPA 2AFHB 1UM9B 3EMVA 3NBMA 4HX5A 4YMWA 4RESA 2VUTA 1UXJA 5DGIA 3E27A 2PWBA 1IWOA 1M0TA 3AMVA 4O5AA 3RG8A 1T4BA 3Q85A 2HSGA 4MV3A 5A06A 1ZN8A 1X7YA 2ZT5A 3BD8A 2HW8A 4B09A 4OUDB 2WQ6A 2NUTB 3I2KA 1BJTA 1JEOA 4IZ6A 5JASA 1KORA 1DAPA 2QQEA 2CNLA 1Q22A 2XOKA 1E0AA 1XZJA 1G8KA 3LF1A 3OJXA 4FDUA 4PZ9A 5C5CA 4FYIA 4PM4A 2ZUVA 3HC7A 4KE9A 4O0LA 3MELA 3PWTA 3RUIA 4Y6PA 1J99A 5DHFA 5C35A 2VA9A 1I4OA 4JLMA 4YJFB 1E77A 4FFBB 2BR5A 1DKPA 2IV2X 3VO1A 2LKDA 2HF8A 2JEOA 3PUWA 2EBUA 4GP6A 2H4JA 3RWMB 3R9XB 2JFBA 1X1DA 3KFXA 3PC8C 8OHMA 1B3BA 2JZCA 1P2VA 4KVAA 3ZCXA 2ZT7A 1PSZA 2NU8B 3FB4A 3TL3A 4DDHA 3BD7A 1G64A 5KNBD 1MAHA 1N1GA 1P60A 2W58A 3KYJB 3L1IA 3TRDA 3U4GA 3ETJA 4G4GA 4WZ6A 4FQ8A 5FEMA 3ROGA 4BTEA 2QZZA 1N92A 1U2RA 2O0MA 2PX3A 3O93A 4AUNA 4REMA 4A3SA 4ZI7B 2BVNA 1UJ6A 4GPTA 2IUUA 4C0QC 1TCUA 1BKYA 2RHLA 5IC6A 3VAZA 1YNSA 4OQXA 4XCXA 1CIPA 2TS1A 2P9BA 2ZBUA 2B30A 2BKUA 5FUWA 5HFJA 5TXGA 4RJJA 3DGFC 3VKHA 4M21A 2C3UA 3AM3A 3SHVA 3WZ2A 1FXWF 3LOPA 2IV3A 4QE3A 1SD1A 2ERCA 3L0SA 5HW0A 5IJWA 5AI5A 1UMCB 1HI9A 3O4FA 1RMQA 1ANKA 4HC4A 5EIBC 4TV9A 3U3MA 4RLQA 1VGRA 3D5TA 2PU7A 4JLUA 4CLDA 1CBUA 2DY1A 1VCHA 4E08A 2PLAA 4GFDA 4RZ2A 1Q1BA 5AIBA 1Q7CA 2NO0A 5F52A 3DLHA 5LVAA 4F3KA 5BNWA 5SZJA 1WZEA 4KLCA 2H5EA 4N5NA 2O07A 2G6TA 5DWQA 4BMOB 1NNLA 4BFLA 4DBLC 2G1PA 1KHHA 1PJBA 4Z54A 3AR3A 5KNCH 1R16A 4HNRA 2WU8A 3GDGA 3AUXA 5EKTA 3WHKA 4G0MA 4F6CA 1JPJA 3KQLA 1Y34E 2B8JA 2H9AA 3W5DA 1Q0LA 1NUTA 2R25B 4BBZA 4Q4AA 1ZNYA 1VLZA 5DK6A 4JWKA 3M7IA 1U0RA 1CIJA 4NV0A 1KKLA 2HHAA 3WL4A 1ZCFA 4A8JB 2ROQA 1H3EA 3UGQA 3H9EO 1VCNA 1S7CA 1JQLB 3UTDA 2RI1A 3VR3A 1GQRA 1NW4A 1GKKA 1W0CA 2NU7A 1SUBA 4CM9D 1OAOA 1QK3A 2E55A 1QQBA 4S1NA 1IBRA 3P0FA 4TVBA 4YJKA 2Z09A 4CIYA 1HQYE 3ICQB 3I2YX 5AP9A 3RWBA 3SN6A 4NNJA 1XD2B 2JD1A 1VPTA 1OH7A 2I65A 1DCFA 3ESBA 3N0TA 4ME6A 1PFUA 5FPTA 3Q12A 5GONB 2NYAA 3SZMA 1FYFA 4Z5XA 1Q5PA 1W1IA 2O0LA 3SNKA 1VOTA 3LT4A 3T06B 1QPZA 1LW7A 1T9AA 2EC5A 5BQ5A 1BA3A 4B8ZA 5JAUA 1K92A 3S2UA 2JGMA 2WT8A 3VSEA 4PYKA 4S12A 1G42A 3ZDRA 4FFOA 4Q16A 4WA7A 2HDOA 3IO5A 3NM5A 4GXNA 3MWEB 4B6SA 2ZG6A 4OLFA 4E33A 3FOFC 5ALXA 2HDWA 1QH0A 1U3TA 4RK5A 3RO7A 3QVTA 5AI6A 4P3PA 4PYMA 3QPBA 2HXYA 2QN9A 2ATIA 1G16A 3EK2A 3L7OA 4HPJB 3C6YA 4JL8A 4LGYA 4YBRA 1HDRA 1R5JA 4IYRA 3W9BA 1XB2A 1PT6A 2OHGA 3E0QA 2FSSA 4G97A 1YI8A 2DUUA 4JKIA 4W1SA 2YWHA 1M1NA 2R8PA 2YXDA 1DRUA 2JAWA 4RPGA 1PS0A 2CDNA 3MLAA 4O2AB 1QK4A 1U5CA 5FULA 3ZHVA 2ZRNA 3TDNA 1Q6YA 1R8SA 5HQ3B 3NC1C 4Q3DA 3O3MB 2HRZA 3OTQA 3A2LA 2OAGA 2IZ5A 1FDRA 1GZHB 1J1IA 2CXPA 1E9FA 1XUOA 3MA0A 1ZIDA 2GYWA 2H63A 3C3MA 2AZDA 4BRZA 1XTZA 4H2DA 4F85A 5JPDA 4FFLA 2ODWA 2FETA 3PEUA 4X1IB 2ISCA 1HC7A 2R47A 5EFZA 3LO5A 3DHVA 1RR6A 5AJHA 4M8LA 4I9HA 1EVJA 4MLZA 5FWAA 2F7SA 2W70A 4EG3A 4JI4B 2G9RA 3H5RA 3C5VA 5EXDA 2IYOA 3W90A 3E15A 2C5FA 2WM2A 3O1LA 3WR5A 1IL0A 3OC6A 4JA0A 1RHJA 2IOYA 2PRYA 1L3BA 3KEOA 3PDIB 4RTSA 2BWJA 3SE0A 2X7JA 4G0XA 2V6MA 4LZOA 3IOEA 2WDPA 3EG9A 3EGCA 3IELA 1Z6PA 4YIHA 1QC5A 2FEPA 2IU4A 3LWNA 3WYBA 3SQOA 3RARA 4MGZR 3ZCRA 1XRJA 3WIOA 4DV6B 1SFRA 5IM4F 5JDIA 3EPRA 4DJEC 2GMWA 3CT4A 1E3JA 3NLLA 1T2VA 4F3TA 4I1SA 3NVMB 5ENVA 1E5DA 5ED0A 1OFIA 2FDXA 1NBMA 3L8HA 4OKIA 3FY4A 5EE0A 2WJIA 2O54A 1T5IA 3QVVA 4PSCA 1JU9A 1XDZA 1G18A 2DBZA 3ISVA 1N1EA 3W8EA 5GV7A 2UXCB 5AVSA 5LD2C 4PRYA 3WKEA 1QMPA 2YWXA 3W7AA 4U5QA 1XN1A 3NVKI 2WUFA 3Q7IA 2B1JA 4DDTA 3QHPA 4AM8A 5ITSA 2H7XA 2OA0A 4H7JA 1Q6ZA 1QIFA 4KKVA 1KEVA 1TO2E 4IIGA 3SYNA 2PMFA 4OD0A 2DWUA 4DJAA 3QWIA 4OATA 4HEJA 3RK0A 3ZXSA 1ID1A 3Q15C 4PN7A 1DKQA 2B1GA 4BKMA 2OCAA 4PC7A 1P62B 2FLWA 1XA0A 4JVNA 1USKA 1UZLA 4AMYA 3BFXA 1NUAA 2VH1A 4RJ2A 1XNQB 3MBKA 3C3CA 4ZYZA 2H16A 4OH7A 2RH8A 1KQNA 2WWYA 2Z2IA 1JQDA 5JAQA 2VRNA 1H3NA 4RWZA 4ZU1X 3K3PA 1YK1A 1GTRA 1WP9A 3KV1A 5FP0A 3WFIA 1JECA 3TVDA 3IEKA 4JNCA 4U7GA 5AK4A 5LOVB 4JGGA 5JCJD 1E18A 4P54A 2XYHA 4R1OA 2ZBVA 1BKDR 4W5OA 1Q14A 1TVEA 3H05A 3IHWA 3B6KA 4UU8A 4XPIB 3ZY2A 4BKPA 2XB9A 3S99A 2ZTUA 2HLPA 4DNQA 5BV7A 2HMUA 5J23A 3NOVA 3R9KA 4WL0A 3L18A 1EFPB 2HFKA 3NT4A 2FOXA 3P0RA 4ON9A 4A8JC 2EU8A 3SBEA 1KJZA 2FZGA 4JB0A 4MPTA 1UBEA 1WBBA 1TK9A 4BU0A 2YJNA 3S4YA 2X42A 5I8ZA 4ZARA 1XU4A 3I61A 4JI5B 1DO2A 3JYHA 2CL5A 3KQTA 4NAVA 2RHTA 1UF9A 3F2VA 3OFVA 4YC7A 5JE8A 3FCXA 1XRLA 1ZOIA 4C6SA 4AG5A 2JFYA 2F43B 4RY9A 2GXAA 1FP2A 3IESA 3K1YA 3OT5A 3QPVA 5ALMA 4KODA 4CEHA 1U0BB 1M5TA 1P6QA 1Z07A 1Z6ZA 4QAJA 5EG5A 5JNUA 1ECBA 1QP4A 2BTEA 2NU8A 1LJLA 5BYJA 1B8UA 3CNBA 3U49A 2J3EA 1YMVA 4OGGA 3DEHA 1S02A 1Z2DA 4LDQA 4PINA 3V6MA 1NMXA 2B61A 2OESA 1F2TB 1I2DA 2XUPA 4YFVA 3REQA 4IZIA 1KOJA 1VSQA 3D7KA 2AJ8A 3O94A 3VYUB 4BWYA 2P4UA 5BW5A 1KEEB 3QLUC 2QZJA 3HABA 2XHZA 3I4FA 2C3MA 3OESA 2VUSA 3HFSA 3H2HA 1UBJS 3DE0X 2C7VA 1U80A 1W4ZA 2GX6A 1SBTA 1NU6A 2F8SA 3ZDBA 2ZWPA 4M53A 1VRWA 2NYRA 1L9XA 1CR6A 3HKBB 4KO3S 5F21A 4DBZA 1URPA 3UIEA 3LP6A 3VYTB 4YAIA 4HNQA 5FPYA 2XQKA 4YK7A 1SUSA 2C20A 1BS2A 2HU2A 5AYVA 3PFKA 4ID3A 3ROTA 4H27A 2NU9A 3IVXA 3VHRA 4IL5A 2J41A 4JX8A 3BDAA 1WY5A 4I1UA 2IYWA 2P9QA 2QEQA 3CQ9A 2HU5A 4EB6B 2X22A 2E5LB 2VWQA 2OO5C 2EKQA 1NV8A 1OA1A 3WGJA 1XRSB 1GG9A 1RPTA 3G8AA 3VGPA 4BZZA 3C7DB 4Q4JA 2O4UX 3PLNA 3FMIA 4QOHA 5E95A 1DT5A 4Q7JB 4DOMA 4OYYA 3H87A 1UDCA 1F06A 2R84A 3JVIA 5D1NA 5BV2P 2AR9A 2UAGA 3RABA 4Z9BA 3PL1A 5EIWA 2MYTA 4AG6A 4AWAA 2HCJB 4C06A 5I8PA 1G4UR 4LJAA 5AJVB 4E3WA 2WFLB 5KQGA 1JIJA 5EEGA 3MN1A 3T5CA 4OFXA 3PC8A 3IAXA 3C7TA 2YJ3A 1U11A 2N47A 1ZRSA 3AKYA 4UCXA 3SK0A 4CWAA 2EJWA 3LHKA 3OT1B 1C5KA 1MV8A 4EYSA 3PCTA 3BB1A 1CB7A 1KOLA 5CB4B 4MCHA 3UJNA 1K3TA 3RUDA 1CF4A 1L4BA 4UEJA 3UK6A 2RONA 5JFGA 1V39A 4AZ3A 1KAGA 3GDOA 2D0OB 2WTAA 3PGMA 4FMPA 5DNAA 4CQLA 4EHBA 1ZN9A 4F1WA 4G1BA 1U7HA 1C8KA 3QY9A 3CLSC 2XUIA 3MNFA 4NAHA 4YQEA 5B36A 3RC9A 4XH9B 3L4BC 4FWTA 4KNYA 1ZOOA 2OAP1 3FBTA 5EQJB 3W0LB 3L7DA 2X3YA 3BRSA 3NTLA 5KNDD 2NZVG 2GM4A 4LW8A 1LC0A 3EYAA 4TMXA 4B6RA 2W98A 4CEIA 2Y2UA 2P6OA 4XIFA 3GI1A 3M4NA 4PLCA 2J48A 1KO7A 2ZBRA 4YRIA 1JE0A 4QASA 3WGYA 2YWRA 4HRVA 3MJTA 4V03A 5F2EA 5A3SA 1E3QA 1RI2A 3VDNB 3OQ6A 4LBVA 4X3OA 2ZTHA 2B5VA 2ZSBA 5HR5A 2GEBA 3K9FC 2B7CA 2CVQA 1W36D 2ON6A 3C8HA 3OX3A 4HDRB 4QECA 3KQPA 4PG4A 3SX4A 4E1AA 1JHUA 1R4MB 1A27A 5G53C 3HS3A 5HIMA 2JEZA 4KAFA 4D42A 1N0VC 121PA 1KDTA 1TAUA 1JU3A 1K2WA 2P9TA 4TRNA 1EXVA 3KRTA 5K1ZA 1NOJA 1BGXT 4FNOA 2DMRA 4YYEA 2P4SA 2GFIA 5AK3A 5FTJA 4PC3A 1S4MA 3I92A 3D3JA 3NGXA 1F60A 2R6HA 5K6RA 3SVZA 2IZ6A 2IFTA 2A9VA 5DH9A 2GCNA 1AX9A 1G66A 1DKNA 4DDUA 4BDTA 4EPTA 221PA 3NHWA 1L3CA 5ERYA 1IZ0A 3QLJA 4HLCA 4MKHA 4UDYX 1NVTA 2TYSB 3DKVA 2OP0A 2Q6TA 3K6JA 3N75A 4TM7A 5IAGA 3P0EA 1TLTA 1P1JA 3WZLA 4F4IA 4HNAB 1YJQA 1HA3A 3VBCA 3EULA 3F47A 2O1EA 2JK1A 1ZINA 1YC5A 4TL6A 3SPXA 1NYQA 5EI5A 4DL9A 5C7YA 4Z4IA 1CYEA 2BGNA 1GZ6A 1NKTA 5IN5A 3ZJYA 5EJ7A 3U4QA 1DPFA 1VBFA 1W88A 3O5AA 1WTAA 3JAWA 4CQLB 2QAGC 3NORA 1FFDA 4M1TA 2NPIA 3U7GA 2WSBA 2ZATA 1Y89A 4G56A 2VAXA 1DC7A 4UM5A 1M5RA 1IY1A 1SHZA 2HO5A 2VAMA 3RV4A 4ZK2A 3TB6A 3DAHA 5C34B 2ZIFA 4TTSA 5EIHA 1NBEA 2M1ZA 1HY3A 4JSRA 4KP7A 5LFAA 1SKUA 4REOA 2HA3A 4ESVA 3UWSA 2C4WA 2OLKA 2B25A 2XB6A 3ZCVA 4YGYA 1A69A 1Z08A 3Q88A 3V4VB 1RBQA 3ONVA 3PG5A 1ZNXA 3S8YA 1OH8A 3VOSA 1ZN2A 1VYTA 3ONDA 3F4LA 4HKTA 4UUOA 4XB2A 2D5AA 1G41A 3I12A 3R3JA 2FGJA 4OLHA 1NC1A 3FTFA 1JR6A 4LXXA 1Q2XA 2TMDA 2NYVA 3K2EA 4BX2A 4DC1A 5HK9A 4NBRA 4IHJB 4W9MC 4JR0A 1FVXA 2NOAA 2PWYA 4KW7A 3EOZA 3CUEF 4KXMA 4LRSB 3Q8KA 1W5SA 2J6CA 3EEQA 5CR9A 2ZSAA 1B7GO 2O1SA 3ZLTA 4YLYA 4KQEA 4J3JA 2B4YA 1KC1A 3DMDA 4C7OA 2C8KA 1UKYA 2WZBA 4G24A 5HF6A 2G28A 2OFOA 2Y0CA 1HGXA 1P0IA 4MVJE 4RZQA 4YMHA 2I29A 5HE8A 3T3OA 1AKEA 3T0IA 3I39X 2VZ9A 1E99A 4NZZA 5LLSA 5FUVA 3RBVA 3SKYA 3D4LA 3L1HA 2ANBA 5IX8A 3KAKA 1D2GA 3QMPA 1G20A 1O6CA 5TJ9A 2C84A 1JFFB 2VQ3A 3D6NB 1OUMA 3FZQA 3JQ6A 5FF9A 1VBNA 5LCXA 5HOEA 4HP8A 3T7KA 4MR7B 2HUNA 1IN6A 2NZ2A 2PT7A 3FR8A 3KZVA 4JI3B 3T5GA 3UFXB 1ZM4A 7MDHA 1XZQA 1AGNA 2IXDA 3FGPA 3I9OA 4C22A 4ENUA 1QLJA 2P9EA 4ARUA 1HLFA 4MW9A 1NVEA 4HAYA 3T15A 1XPUA 3AKCA 2P2CA 3G0BA 3OICA 1UFQA 1WBJB 4LUCA 4QBTA 3HU1A 1GCOA 3T7TA 4D41A 4FLFA 2XGMA 2TMYA 4IICA 1XJQA 5H9WA 3VPGA 3G13A 2C8JA 4R2MA 2OOKA 2O2DA 1RJEA 2RGNC 3T5TA 5LXTA 1P4JA 4RTPA 3H5AA 1V41E 3N59A 3PFWO 4CL2A 3OPYA 4PQRA 3DT9A 3HU3A 2I0FA 3CLKA 2FVYA 4FOOA 3UG6A 2ZI9A 1DJLA 1E6MA 1Z4NA 3EODA 4J16C 1OYOA 1UAYA 4X5OA 4EB0A 1ETHA 1NMSA 3A14A 3QENA 2E21A 2Q5FA 2R1TB 4G5SA 1RADA 4Z8XA 5KHAA 3RW9A 2G1JA 5AVUA 1Q57A 1Z73A 3H2BA 2AKAB 3ASVA 3FVRA 1S3IA 2B34A 2FLVA 3I9MA 4B6EA 1TJPB 4FGJA 4HWKA 4KFSA 3D8TA 3GCGA 3AG6A 3F71A 3KVOA 5EIAA 5IYZB 1THTA 1CUFA 5FR2A 2REQB 3MJCA 4Q3KA 3AB8A 4Q4JB 3ZDQA 1W8DA 1ZZGA 3PFNA 3Q5EA 4JVMA 1OAAA 4EJMA 1MRSA 3U56A 4KV7A 3FVWA 5DX1A 3FD8A 4DTCA 1AJEA 4ZQHA 2I3AA 4I4CA 1SAYA 2EP8A 3EC1A 4C7XA 4BO9A 1K5HA 2ZP1A 1KPHA 2XQVA 3RU3A 4GI7A 4H16A 1OCEA 4N3BA 2R7LA 4CKEB 1YUBA 1WTCA 3QPUA 4A0FA 2B8EA 3ZE1B 2GBPA 1Z8NA 1E2GA 2EP5A 1Z7WA 2IZOA 3HB9A 3LDAA 3LPDA 3QWHA 4M1SA 3T7DA 3SZ3A 1GVHA 3WC4A 3KQNA 1EUZA 3D2LA 4X7BA 1QH8B 3OKCA 2WSLA 3T3DA 3F7OA 1GG5A 2CC2A 4DLWA 1EVEA 2VHYA 4AYWA 4XGQA 2LRHA 1Y8RA 1N9GA 4H31A 3W5UA 3ZTYA 1TMYA 1FXSA 2BKXA 1O8CA 3AF2A 3WFJA 1CUVA 2BKLA 2X0DA 4BX8A 1PP4A 2Z8ZA 2OTCA 2YVAA 3TDMA 5FWYA 3WRWA 1I13A 1PJCA 3C3WA 1Y98A 1W2WB 1M54A 4TMFA 3BOSA 3HKCB 1TKRA 4LJ5A 3ZDFA 1KZ6A 1XCBA 1XOIA 4HUJA 1SQ6A 4JCOA 3MJVA 3ICOA 4BFYA 3RG2A 4EM6A 3B9PA 1VI2A 3K9HA 1QIMA 3IMFA 3TSOA 2E37A 1RPNA 5ER9A 1MDFA 1SHKA 5D7NA 5G1OA 2O8NA 3QVKA 5GJVC 4ZVMA 3UYKA 1DRJA 3AR9A 4FFVA 4GXTA 4RVNA 5F7JA 5IU6A 2WHRA 4XWWA 2I8LA 3MEQA 2IH4A 3O1IC 1FY2A 1DDIA 4X8MA 3O21A 1P72A 4O2BF 4B5KA 2W93A 2O52A 1GZSA 1FUKA 1E3TA 3KYBA 5JAMA 4MAAA 2IHVA 3HP7A 4M9UA 1U63A 2YCLA 3AKDA 1NRXA 5HQTA 1NAIA 4KH1A 1ZVJA 2VBGA 1KJ9A 4U2FA 3IXLA 2LVBA 3RTBA 3RANA 5HGJA 2KLBA 4AIIA 4DW8A 5ES3A 3FCCA 4IQ4A 4X1YA 5L6LB 4MPDA 5CD9A 5KOHB 3LLMA 1NI4A 3G2NA 3PP8A 4GPIB 4QYWA 3WB9A 3U3ZA 3C6BA 5DM70 2GKOA 3T0GA 3W8FA 2YMPA 4BNTA 1N6HA 4H1HA 1SVSA 3HZRA 3COJA 1EHIA 2QLFA 2FE4A 2V5VA 3SVLA 4ZI2A 1XZNA 4G4JA 1YD7A 3OTGA 1GARA 3BUSA 1D03A 3WMRA 2RGYA 1FS6A 2VP2A 2C9CA 1HEIA 4JGIA 3LX6A 4G67A 4MQEA 3QGMA 5F78A 1PEAA 4FDLA 4G0UA 4OQ4A 2CFIA 1E7SA 4G89A 1C3OA 4CG1A 4YCDA 4QBFA 1OPRA 1EFLA 2FPPB 3FLMA 4NFLA 3SLKA 4M9SA 1EVLA 4HAUA 3H9UA 4FEAA 4RFSA 1E2LA 3JV7A 2H0RA 3HBFA 4NAUA 4NMMA 4Q21A 3RS2A 3E3NA 3AX6A 1ZKDA 4FR5A 3TTUA 1ZP6A 1QRSA 2AYYA 3CB4A 4OYRA 5KYNA 1RWKA 4HUQA 4A82A 1UDWA 2GJ8A 3VVLA 2A9KA 1QFJA 2NAPA 5BPHA 1JTFA 4FKBA 4DCGA 2I4OA 3WLMA 1COWD 1NY6A 3CUVA 3MSCA 1TZBA 5BN5A 1GZ3A 1P2DA 1GPNA 1TM2A 1E8MA 3JXEA 4U9IS 3NDIA 1TZMA 2GRAA 3GGCA 4FDVA 1PWZA 2N75A 5FL3A 4PG8A 1TW2A 3MINB 2WZQA 5CA0B 5E4FA 4TS1A 1JUDA 4OUDA 4DC0A 2VJPA 3OM1A 2I2AA 1S2DA 4UAJA 4DV3B 3W04A 4RPIA 3NXKA 1QIJA 1NPTO 2VDPB 2VTKA 2V74B 4YJ2B 4OM8A 5FIUA 2WKSA 2K7ZA 2CLDX 3AF1A 3KJXA 4IIBA 1DKRA 4LYFA 4LWZA 2W4MA 3G6KA 4BWVA 4ITUA 5L3ZA 3E9RA 5DWVA 2WAOA 5LA6A 1ZIOA 3DE2X 3MGAA 5ALHA 3U4MA 1RRFA 1G5QA 1WZNA 2XMPA 3PXAA 5BXQC 5D8DA 4AAYA 3ZHXA 3DKRA 5CM9C 4C0XA 3AEKB 1P7VA 1QNLA 5K3BA 4BGVA 3WRVA 3K92A 2IKQA 1C0PA 2NTEA 4U7TB 3SIPA 3T34A 3B70A 4C6HA 1SBQA 2A3NA 2GBLC 1SR8A 2AQKA 2PH5A 2ERXA 4X1YB 4Z8YA 2XODA 4AYTA 4BCBA 6Q21A 1YR6A 4CKZA 2VUIB 4LG1A 4WNIA 1X80B 3ED5A 4ER3A 2VF2A 3WRYC 2ENWA 1OX6A 1NL3A 1TM4E 3N53A 3Q10A 2EWVA 4UJ5A 2FKNA 4CBVA 1JHDA 1Z83A 1IULA 4H3SA 3PUKA 1EHYA 4YXWA 3L6RA 2CNNA 2M1XA 3UO8B 3S1SA 1L5FA 4N18A 1SG0A 5HDBB 4RJKA 1PHRA 5IH3A 5AJWA 2JS7A 3DAOA 1HDCA 2DGDA 4C3UA 4R71A 4E03A 5E8RA 1DJNA 2XDQA 1MO4A 3JQDA 2ZS9A 3DZHA 4XPZA 2Y0DA 4HZGA 4L2IA 1WCIB 1O6FA 3VTAA 4X61A 3IAFA 3PFGA 5KCMA 3QVSA 4D79A 3EUWA 4ALIA 4EVSA 5BT8A 3T5PA 1PUJA 2RC6A 5KS2A 1GPLA 2PHZA 4ATNA 5CFZA 3MCUA 1XF1A 4WLEA 4Y2PA 5EZSA 2OY0A 1PWEA 5L4SA 1GO2A 3O3NB 4JP2A 3G88A 4P98A 4YMIA 3ZKAA 1XCOA 3QELB 4RELA 3D5QA 1QQTA 2GDZA 3R76A 4E51A 4F6RA 2Q2NA 3LP5A 5FX2A 1ABFA 3DZKA 3DEIA 3N9IA 4KMMA 1U4SA 3BWCA 4HNAA 4WBNB 5KNLA 1WB5A 3RVOA 5FBLB 4V2UA 1D6SA 2C03A 3CEHA 5B6JA 1EB8A 4WNAA 4RBNA 1E66A 5DSXA 3W5IA 4BMNA 5JJ5A 4EBBA 2HRDA 1ONPA 2P2ZA 3MWKA 4M76B 4UHEA 4I8XA 3UF0A 5E1BA 4EATA 1P0MA 1ZUNA 1OLXA 2WJHA 2CYCA 2PX0A 3I09A 4CIAA 1ULSA 1L3IA 3MQ4A 5IVDA 1BS9A 3RYTC 1ZR4A 5L3QB 4TVKA 3EXHA 3R0XA 4O25A 3PTAA 3RAFC 3AI2A 1TD9A 4JYPA 3IMEA 1KMQA 2EJUA 4B6OA 1QKKA 3ELUA 3GLHA 3ZU6A 5IS2A 2F8MA 3E7XA 1ZKMA 1BAPA 1GILA 2GKGA 2W83A 5K8JB 1RJ9A 2NYUA 1S3SA 2P0AA 2P67A 2Q5CA 5A5GA 3ZWXA 4L5AA 2JEYA 4AP9A 1XMXA 1CEYA 3GZJA 5JZOA 4UD6A 3OCYA 4KR9A 3KJHA 3JATA 1XKQA 4GQIA 1I6KA 2GNAA 4LF5B 5BP7A 1LLCA 3IDAA 3VGJA 4KQWA 2VF5X 1SVOA 3Q9SA 1LEHA 1A8PA 4D43A 2YQ4A 2GZAA 2JLAA 3NDPA 3OQBA 1EINA 4HTFA 3EVTA 3OE5A 4B4UA 4DZTA 4BO1A 3DL4A 3ZBPA 3ZY4A 3PD7A 1ORIA 2PX5A 1YJBA 2M6KA 4TZ0A 2XEXA 3BSYA 2HA4A 1UWKA 2BMFA 2LD4A 2Q2OA 3QPCA 4HSGA 4OL9A 4ZVQA 5JCOA 1IJBA 1RQPA 1Q0QA 2EZTA 2H57A 2QHXA 1AURA 1SULA 4MK4A 4P22A 4B4OA 5CDSA 5CVTA 1DTWB 4BX9A 1OI4A 2J9YB 4KLAA 4EARA 1OREA 2HH9A 4J2HA 3UHAA 4BNKA 4RDHA 5T6BA 1LDYA 4I2VA 1NNSA 3PTLA 4CU2A 3IIMA 3EF3A 4HX2A 1DINA 5D1HA 4BLRA 1P5JA 5JRJA 3OE4A 1PFVA 2R00A 4O4LA 3GT4A 4KDCA 2F8TA 3GCXA 5TDHA 3ZHZA 2ZULA 1OU0A 5HJ5A 2A78A 2Q50A 2G7MC 1BVHA 2XF2A 2QRQA 4L1KA 5ELLA 5LP6C 2HIGA 3UV6A 4CGZA 1WHSB 4CZ2A 1T3SA 1M2NA 2IHJA 2QP9X 1PTKA 3MJSA 4FOSA 4KO8A 4L5YA 1SWWA 4XX0B 1WQ4A 3A32A 4DTIA 5AVWA 1I94B 1Q1EA 4G36A 2OD2A 1VQ1A 2HA0A 3A4IA 4QG7A 4B17A 1BDHA 2QD1A 1MKYA 3K5HA 4WOPA 5FEUA 2RC5A 4LECA 1O03A 4C9BA 2PZJA 1KYIA 2ODEA 3EG9B 2OHFA 3F3SA 2PA3A 5I9SA 2YVLA 1VE3A 5ELXA 5D87A 4U5XA 3L7IA 2D1SA 3K09A 3QMWA 1EFHA 4B7AA 1FE8A 1KPIA 3CWZA 5I9IA 4N54A 2KLHA 4XDZA 1M2OB 2JIRA 3JQGA 1K98A 3MMNA 4ZGWA 2WVGA 2RBKA 2YUTA 4URWR 2PQ2A 4IDOA 2DECA 3PZRA 3AHJA 1U0SY 4KXVA 1SA0A 1MZVA 3LOUA 1NPYA 5IAOA 2XADA 4LHZA 4BE4A 4C0AC 3HJFA 1CJKC 4PSKA 3GFGA 3CLVA 4B45A 1NJ1A 4ZCRA 2NP6A 3OEYA 1OXTA 3ESXA 5DGCA 1VE5A 1JEDA 3GFQA 1GTZA 4Q9LA 2BKAA 3I9KA 4JS0A 3MLBA 1YZGA 4LJ7A 2A67A 2HUPA