3C6ZA

Hnl from hevea brasiliensis to atomic resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Hydroxynitrilase
publication title Atomic resolution crystal structures and quantum chemistry meet to reveal subtleties of hydroxynitrile lyase catalysis
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 95
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6zA00
2XMGA 1LGYA 4QNNA 4FFVA 3SX4A 3LIPA 1TCCA 2XUDA 2C58A 2WHPA 5AI6A 4HTAA 2X5XA 3ZLTA 3DOHA 2DFPA 1HDEA 1VLQA 4Y2TA 1EXWA 4INZA 4LXGA 5DYTA 2QKYA 1QIGA 2PSHA 1CV2A 4BRSA 4DYHA 2RAUA 5K3AA 1UOOA 4O08A 4QWMA 4OD0A 1YA8A 2BUBA 5CT9A 2XMSA 4G9GA 2QJRA 1XQWA 4AB1A 1JJIA 4QA9A 3H19A 2IITA 2XLBA 3ZPXA 4L0CA 4CCYA 5IH7A 1JI3A 2G5PA 1R88A 2G5TA 3ICVA 1GGVA 4FLMA 4EZIA 2HL6A 1EK1A 2Y6UA 4NS4A 4B9AA 2HFJA 2XQIA 3E3AA 3BDVA 3OOSA 1KU0A 3ILSA 1A8SA 4H7HA 4JUIA 2B9VA 2UZ0A 2XE4A 1LBSA 1VKHA 2PVSA 3WKBA 4MQLA 1CLEA 4GEGA 4OPMA 4ZV9A 3VXKA 4B84A 2V97A 4PF1A 4AN0A 5AOAA 2O2IA 4C88A 2VQ6A 4UHBA 3ICWA 4IO0A 5JASA 3DCNA 2Y1KA 4FWBA 4GLBA 2WU3A 1TCBA 2OAGA 3UUEA 3BJRA 4N8SA 1HQDA 1WB5A 5ALOA 1DX4A 3WZMA 5AK5A 1XZCA 1R4ZA 3ANTA 1MX1A 5ALDA 5HF9A 3U1TA 1CIJA 3U0VA 4CCYB 2OLEA 2QJWA 2XMCA 1QIHA 3D59A 1ORVA 2JF0A 3FLEA 4UFNA 3HACA 5E2IA 4BZWA 1HLGA 3D2BA 4UBIA 4KE6A 1JU3A 5HQ3B 2QUAA 4AX4A 2QVBA 3AIOA 1NU6A 3I6MA 4EY4A 4BVJA 3W04A 1DQZA 1MAHA 4AO7A 1XZAA 1QTRA 4IQ4A 4I19A 5I9IA 5HF8A 4G9EA 2D5LA 3O4JA 2WTNA 3NOXA 5ALHA 1XROA 4G1FA 2GBIA 3IUMA 4LIPD 1TCAA 3ZLVA 4AO8A 4X95A 1BCRA 1VZ3A 3W9UA 3GA7A 3R40A 3D0KA 4E46A 3HXKA 1ZIYA 2XQFA 2O7RA 3QPDA 3P2MA 4FBMA 4V2IA 1CUJA 1XQXA 4FTWA 3ESAA 5A62A 3WWOA 2BUAA 2QTBA 1CQWA 1ZD2P 5ALUA 1XZBA 3O4HA 5AI5A 1QIEA 1XLVA 2ZJ6A 2W6CX 1XZJA 5AKXA 5AO9A 4RNCA 4X71A 2AXEA 4UBLA 4BC1A 2VSQA 3JWEA 5KREA 1XFDA 1DINA 4C87A 5FDFA 3M81A 4ZGBA 1RP1A 3BF8A 2B20A 1QJ4A 4Q05A 2XQKA 5AOBA 4X6UA 2ZSHA 3SC2A 3W2TA 1A7UA 2OPHA 4H7EA 1BRTA 2VEOA 1EK2A 2XUPA 5ALNA 1ZIXA 3HZOA 5CXUA 4UHCA 3OTQA 5AK4A 1GPKA 4WFIA 3G0BA 3C6ZA 4GECA 3OPMA 5IVDA 2V98A 2B4KA 2NW6A 1CUDA 3VJMA 1EB9A 2HU8A 4I3FA 4KRYA 3QVMA 4MEBA 3WK7A 3WKAA 2GZSA 3I2IA 4J3JA 4TGLA 1D07A 2XUFA 1A8QA 1P0PA 4P9NA 3WI7A 3DL7A 3WIOA 1UKAA 2ZYRA 2Y6VA 5D7BA 1W1IA 4I4CA 2ES4A 2CB9A 5AKHA 1BROA 2XUQA 5E4YA 3LP5A 1YA4A 2JGEA 2WLSA 3I6YA 4U2CA 3STXA 3FAKA 3G0CA 4EY5A 4DMCA 1YCDA 3FNBA 4IH9A 2WQZA 4RPCA 2WG2A 3AIKA 1CUIA 3H1AA 1N1MA 2BKLA 5JD4A 2ACEA 3LCRA 2CJPA 1L7RA 4KE7A 2C7BA 1CEXA 1CUAA 4A16A 4H18A 3IURA 4EBBA 4GWLA 1FFEA 1QONA 4UFOA 5KWJA 2ZYSA 1B6GA 5LKAA 3CCCA 2BJHA 1C4XA 4DMKA 4HXFB 4YX9A 5AM3A 2PL5A 5HF6A 3O0DA 4LXHA 3K9BA 3QPAA 2ZVDA 3I1YA 3WQHA 2FX5A 1UFOA 1ODSA 2WHQA 4BRZA 5IKXA 2XUAA 2ZJFA 1EDBA 5T4FA 5ALFA 1BN6A 2Z8ZA 5LP1A 1EH5A 2QUBA 5EHZA 5C8ZA 3K6KA 4HAIA 1KEZA 1QTIA 3QH4A 5A71A 5AI0A 1UKBA 4ETWA 3G9XA 3I28A 4HZGA 1XKTA 4B9EA 4CCWA 1AMNA 4BCBA 2IX9A 2QXTA 3QYJA 1PFQA 1ODCA 4DSZA 4Y2JA 1SCIA 1RWQA 4X00A 4BE9A 2RIPA 2WG1A 1W75A 4RE6A 4QZVA 2WHRA 3CCBA 1MAAA 3RKSA 1DWOA 2HA7A 1VOTA 3QBJA 4IHAA 3HRHA 1JJFA 4RE5A 3H0CA 1XZMA 4EB0A 1ZD5A 2WG0A 4KR0A 2HA2A 5FKJA 5DYYA 3FWHA 3FLBA 1K8QA 3IVMA 4X7BA 5ALTA 5EIEA 5JZSA 3WMRA 2HRRA 1KU6A 2HA6A 1DT5A 2VJCA 5AH0A 3TEJA 3AUKA 4M0EA 3DQZA 3VDXA 1JMYA 2OAEA 4OYLA 5FLKA 1ZD3A 3CN9A 3QM1A 2XMQA 4WY8A 2JIDA 5CURA 1GPLA 5AKIA 4DNQA 5AM4A 3L1IA 1CUYA 3WIBA 4MWTA 1ZI8A 1WOMA 1SFRA 1ODTC 4DNPA 3G0IA 2XMRA 1FJ2A 5AJHA 4P08A 4AMZA 2OGZA 1IUPA 3H2HA 1VXOA 1JU4A 1XZGA 2O2GA 5DLPA 3WJ2A 1F6WA 2AJDA 5EHNA 2DCMA 1EB8A 1UKCA 1MJ5A 4P92A 5CH5A 3EQ8A 2XB6A 3C6XA 5LZ7A 4WDQA 3EF3A 5D3ZA 5HK8A 1W4LA 3FOBA 5KBYA 2R11A 1E8DA 1MT3A 3NUZA 3UMJA 2ORYA 4BBZA 4ZWNA 2VA9A 4DSAA 1EX9A 5K3FB 3ZI7A 1JJBA 1EHYA 4C4XA 1VA4A 2G4LA 5JYCA 1WB4A 2WKWA 2RHWA 5JZ9A 2DR0A 5AKLA 1QO7A 1UWCA 3RK4A 4X91A 3PUIA 3C45A 1FFDA 4CIBA 3V1MA 5HKAA 5ALKA 4F0JA 1LPBB 2HU7A 1Q0ZA 3ESCA 5AKYA 2GYVA 4XIIA 5AICA 5FPQA 2PSDA 5IVKA 3FVRA 3I2FA 1U2EA 2XT0A 3O9MA 5AHXA 3DNMA 2WJ3A 3LIIA 4J0DA 2JGIA 5J3JA 4OU4A 5I7UA 4B82A 3WKEA 5FXMA 2OGTA 1BEZA 3PF8A 2J3DA 3VVLA 5ALVA 5AP9A 2YXPX 3JYHA 3V1KA 4KYVA 4UHFA 2XUOA 3HI4A 3ZWQA 2HHAA 3JW8A 4MXDA 5AKGA 4MEAA 4AO6A 1S8OA 1ETHA 2XUGA 4QDOA 5CH8A 1XZFA 4C01A 1H23A 5HF5A 2VJDA 1XZIA 2BGRA 3T4UA 2BUCA 3GUUA 2EDCA 4U2DA 3MUNA 4G4IA 3HC7A 5LIPA 1TK3A 5DYWA 1BCSA 4Q3LA 4WJLA 1CUEA 5IVIA 3QPCA 1ZJ4A 4BVLA 5ALGA 2HADA 1Z68A 3GZJA 3FSGD 2RI6A 4EUSA 3IDAA 3WL5A 4W1RA 1OCEA 4EA6A 4K5QA 2WHPB 3HABA 3WA6A 2G63A 1JKMA 3A6ZA 3R41A 2Y2VA 3HJUA 2CZQA 4B0OA 5AM5A 4DMFA 5AK3A 1LNSA 3OM8A 2D0DA 3EIOA 2QMQA 5BV7A 4J0IA 3IB3A 3BXPA 3GROA 4X94A 1ISPA 3I6ZA 2IIVA 4N5IX 4MWSA 4DTCA 4CFSA 3X3HA 2QR5A 1TRHA 1LPMA 4GDMA 5K3DA 2JGKA 5JAPA 1XZKA 3PUHA 2VJBA 3F96A 4N5HX 1Y7IA 1SCKA 5HKBA 1AZWA 4KAJA 4X6YA 2R8BA 1USWA 3WA7A 4A23A 1DU4A 5LLSA 2JGLA 3CN7A 3KWFA 2XMBA 1ZICA 3PE6A 4BVKA 2GBFA 4H77A 5HFNA 2WU4A 3DYVA 2ECFA 3STWA 4H7FA 3E4DA 4EY7A 1UK7A 3V1NA 2BCEA 1MTZA 4MYDA 3WJ1A 1K4YA 2WFZA 3PF9A 1ZGBA 4AMYA 2Q0XA 5K3EA 1JFRA 4DGQA 1CUSA 1EVQA 3ESBA 4X90A 1W76A 4K2AA 1FFAA 3FYTA 5D3KA 4DM7A 1J1IA 2EDAA 3W9BA 2PBLA 1MPXA 3A2LA 4FHZA 4N8EA 2XQJA 4F5ZA 2WILA 2I78A 4FDMA 2WIFA 5CT8A 4B0PA 1WCYA 1G66A 1IUOA 5DWDA 1TQHA 5E4TA 5LZ9A 2DHEA 4Q82A 5A2GA 3R3ZA 2Z3WA 4K6GA 1VA5A 2WFLA 3FSGA 5ALSA 3FYUA 3LS2A 3BWXA 5ALJA 1CUVA 4RGYA 3R3YA 3KWJA 2HA0A 1ZI9A 2RGUA 1QOZA 2JEZA 4J0KA 1XRLA 2LIPA 4YASA 5AM1A 1P0QA 3MGAA 4HXGA 1XRRA 1C7IA 4Y2UA 3A2NA 3WL8A 1R50A 3W06A 2I03A 1TKRA 5ALMA 1O6FA 2FUKA 3PI6A 5K3BA 1H2ZA 3L1JA 4ARBA 3DS8A 4AQDA 1DT3A 1MX5A 2GZRA 4M0MA 3BDIA 1FFBA 4E11A 4KAFA 4C4YA 3GELA 3AZOA 2ONCA 1Q0RA 4G8BA 5KWIA 2WUFA 5DJ5A 1F8UA 4Y2VA 2I3ZA 4PNZA 4FMPA 5FP0A 5ESRA 2DHDA 1K63A 5ALWA 1LLFA 1CFJA 2WFLB 3F98A 1NX9A 3WL7A 2OCGA 3RLIA 3QMMA 1EDEA 3AIMA 1QZ3A 3RARA 2O2HA 1LPAB 4HXEB 1UT6A 2HDWA 3QITA 5C8XA 2HM7A 3D4LA 1HKHA 4J0JA 1N5RA 4WFKA 2QZPA 4W9RA 1UK6A 4UHDA 2P8SA 4B80A 2QM0A 4BCCA 3B12A 2QRUA 3PICA 4A5SA 3E0XA 1N5MA 2C0PA 4OB7A 4CG1A 3F67A 2C5GA 1GPNA 4PO3X 3F9CA 4UBJA 4PSDA 5EGNA 1IZ7A 3BIWA 2H1IA 1H22A 5CT6A 5EHXA 2PM8A 5JD5A 1LPOA 2J4CA 2I3DA 3S8YA 3AILA 1WM1A 4QE3A 1Q83A 1QFSA 2PPLA 1CUWA 3H2KA 3TJMA 1ORWA 4BZZA 4L9AA 4OCZA 4OSEA 1CUHA 2Z3ZA 5AKEA 2B61A 1U65A 3BF7A 4Y2RA 3EQ7A 5E4JA 1JMKC 2WUEA 4G8DA 1E89A 5FV4A 1DX6A 4BCDA 5HFAA 4XJVA 2AJ8A 3AJAA 3CXUA 2HFKA 4B81A 5HCUA 1VZ2A 1F0NA 1P0MA 1MX9A 5T4HA 3OC0A 2BAGA 4BAUA 2J3QA 3C8HA 4YPVA 4Y2SA 2HA3A 2RHTA 3VJKA 2C4HA 2XI4A 5AI9A 4C6HA 2PKYX 1LBTA 4H7IA 3WK6A 4ZI5A 2YYSA 5AM2A 1ACJA 4D9JA 3I2GA 1VE7A 2ZJ7A 3QMWA 5SYNA 1MO2A 3C5WP 4EHBA 1QGED 1X2BA 3D5EA 2VJAA 3C87A 4GI1A 3D2AA 1XZDA 5DTJA 1BU8A 4Z49A 1MNAA 2ROQA 5CH3A 2O7VA 7YASA 2OXEA 4PSUA 1P0IA 3H04A 3STUA 1G4HA 1XRMA 2HU5A 1AURA 3DEAA 1B41A 3F8SA 5ALZA 3M83A 5AM0A 3IUNA 4QEKA 3PDCA 3FVTA 2X8BA 1K6EA 4BDSA 2JBWA 5LZ4A 4CI9A 3VKFA 1T4MA 4FLEA 1ZI6A 3C6YA 1XQYA 3ED1A 1PV1A 5JZBA 3C6BA 3G02A 2QT9A 3AFIA 2VTVA 1XZEA 2WUDA 4EY8A 1HPLA 1PJAA 4GHWA 2BGNA 3DDUA 1MNQA 1JT2A 2W22A 5JANA 3QZUA 4LXIA 3BIXA 1DTEA 1R1DA 4NMWA 1EDDA 1ZGCA 4HRYA 2YH2A 1FFCA 2PSJA 5EFZA 4FOLA 5CW2A 3S2ZA 3TRDA 5HK9A 4Q3KA 5I8PA 4Y2XA 4HVTA 4TPKA 2JEYA 3G9UA 5CT5A 1TIBA 4FBLA 1THGA 5FRDA 4W63A 1E8NA 1YB6A 2H9YA 4KJXA 3PFBA 3UUFA 4J0HA 2OG1A 5ALPA 1CRLA 5CT4A 5T4EA 4KRXA 4WY5A 1W52X 5A6VA 4GW3A 4K6KA 1XLWA 2HA4A 5T4BA 1BE0A 1AC5A 1K5PA 1YR2A 5ALLA 5LZ8A 3O4IA 2WTMA 3DJYA 2OQVA 3WWDA 2XDWA 2H7XA 4W1SA 4BP8A 3PFCA 4G8CA 4X6XA 4Y2QA 4AN1A 2OCIA 1L7QA 5BOVA 5JADA 2EEPA 5ISMA 1E8MA 3DD5A 2DQYA 4IH1A 1BS9A 4E14A 3KD2A 1C7JA 1E66A 1R9NA 3V1LA 4W1QA 3WK4A 1AX9A 2PU5A 4Q1VA 1YASA 3FLAA 4DMHA 2WJ4A 4BAGA 1DQYA 4H35A 4AZ3A 4G5XA 3ZLUA 5FPPA 1AQLA 1WPXA 5A7GA 1QIFA 1IVYA 3T52A 1EVEA 1UZAA 3HYSA 1CUGA 3DKKA 4Q34A 4BDTA 4ROTA 4FNMA 4ZREA 3IUQA 2WFMA 3FCYA 4H0CA 1IUNA 2FJPA 3E1GA 2PUJA 1I6WA 5BWCA 1FSSA 3I2HA 4F60A 3VJLA 1ZD4A 4QDXA 1YS2X 2ZSIA 1AUOA 1YS1X 2DSNA 1M33A 4HRXA 4LHEA 4M0FA 5HQ3A 2CEKA 2OQIA 4LYDA 3NGMA 3SWWA 1U8EA 2WJ6A 4KE8A 4TVKA 1EINA 1VJ5A 4LKOA 4Y7DA 5C7YA 3DKRA 5JALA 3BJMA 4LYEA 4QDZA 2CBGA 4WDRA 1J2EA 5ALYA 2PUHA 1UOPA 4DIUA 1QIIA 4QLAA 5DTIA 1BN7A 2VF2A 1CVLA 3V48A 1SOMA 3G8YA 4UHHA 4FFWA 1YSCA 2XUKA 1IZ8A 2Z5GA 2XQGA 3R3WA 4U2EA 2CMFA 4JNCA 3Q0TA 1VE6A 1OILA 1GKLA 4CIAA 4CG3A 3D7RA 2HRQA 1E3QA 2Z8XA 5JAOA 3V9AA 1CPYA 3WLAA 1SCQA 4J0GA 3FCXA 3WWEA 4UBMA 5JD6A 4BTVA 4E15A 5DNUA 3WKCA 2K2QB 3SK0A 4X97A 1XQVA 1ZJ5A 1SC9A 1CUZA 2GBCA 4WFJA 4N8DA 4FKBA 3DL4A 3R0VA 4JYMA 3GFFA 2XMDA 1N8SA 2VT6A 3TGLA 2PU7A 1UOQA 4ARAA 3B3QA 4X93A 5EI5A 2WIKA 1J07A 4KE9A 3A2MA 4U2GA 3I1IA 4UHEA 2ZYHA 1T2NA 1VXRA 3AZPA 1DWQA 1CUUA 4DNFA 3R3UA 4UPDA 1CR6A 4MQMA 1QIKA 5ALQA 2XLCA 3EBLA 1LPNA 5EIHA 5AOCA 2V9ZA 4AZ0A 4PV7A 3IIIA 5CXXA 4C4ZA 3WK9A 2OGSA 4JEIA 3IULA 5LZ2A 1R9MA 4UFPA 1CUBA 2WIDA 3WK5A 3G0DA 1H2YA 3O4GA 1UXOA 3EQ9A 2HA5A 4KEAA 4ZRDA 4BATA 3I2JA 1YAJA 4B83A 3G9TA 4XVCA 2PSEA 5AI8A 2X76A 1QO9A 5EIAA 4B7ZA 2JGMA 4MJ3A 4OB8A 2WIGA 2XUJA 2AJLI 1QIMA 3H2JA 4BE4A 1LPPA 2XMZA 3HSSA 4YK7A 3OG9A 5CMLA 3DOIA 4AXBA 2H7CA 5ALXA 4NVRA 3C70A 1XLUA 4KACA 3C8DA 1XKLA 5F4ZA 5LKRA 1BEEA 2J4FA 4P93A 4IH4A 3D3NA 4BTLA 1HBJA 4W1PA 5A7HA 2DHCA 1Y7HA 1WPRA 4CG2A 3FYUB 2OCKA 2BFNA 1A88A 2QXUA 1G42A 5C8VA 3KXPA 3WWCA 1W6RA 2VAXA 5AKKA 1CUCA 1X70A 1H2WA 1WHTA 5AIAA 5JAHA 1CUFA 3WK8A 3MVEA 3STYA 5AI4A 2C0QA 4X3CA 3IA2A 4ITVA 4MYSA 1LZKA 4UBOA 2WUGA 1QIJA 3L1HA 3QMVA 4GXNA 3STTA 4Y2YA 3FBWA 1F0PA 1G5FA 2ZYIA 4OB6A 5SYMA 1AKNA 2WIJA 1A8UA 1YB7A 3WWPA 2ACKA 5HZGA 3R3XA 3G7NA 4PW0A 1GQRA 4OYYA 3G0GA 4OUKX 5C81A 2H7YA 4G4GA 4GBGA 4K6HA 1YAHA 2AJCA 1LZLA 2GBGA 4JYPA 5D6OA 1UK8A 4NZZA 5H3HA 4BAZA 3H1BA 3A70A 3GBSA 4H7JA 2CKMA 5JIBA 1GXSA 3D2CA 1MU0A 3M3DA 3O95A 4UUQA 5ALEA 2XUHA 3HLKA 3ESDA 4BB0A 1WHSA 4ZXFA 2YASA 5AK6A 2VAVA 3AZQA 5AKZA 4BYMA 5JARA 1OXMA 3H2GA 5LZ5A 3BL8A 2GYWA 4X92A 5ALIA 5AIBA 3KOOA 1MN6A 1H2XA 1O6GA 1X2EA 3W05A 5FOQA 1XRQA 2RONA 3VVMA 3B5EA 1LPSA 3N0TA 2WSLA 3OURA 3Q8WA 1RYYA 3H18A 3STVA 4OU5A 4DNOA 4ZV7A 2QS9A 2CUTA 4J7AA 4B85A 1NU8A 4WCVA 3WYDA 1CUXA 4L3WA 1GKKA 3YASA 4PSCA 4H7KA 3G9ZA 4L72A 4XWGA 3IBTA 4S0XA 3H2IA 5CRIA 5DNWA 1L7AA 6YASA 5BWBA 3R3VA 2VATA 4QLOA 5CBKA 3LLCA 4U2FA 3F97A 5A7FA 3AINA 3NWOA 4J03A 3WL6A 2JGFA 4FLFA 1QLWA 3M82A 5JATA 5IVHA 1HL7A 4UBKA 3C43A 1R3DA 1ACLA 2PX6A 1Q84A 1QIDA 3RM3A 1TAHA 3H17A 3DLTA 4QWWA 3FYUC 5ALRA 5K3FA 1GT6A 1XZLA 4XX1A 3K2IA 4J0CA 4BC0A 4JH0A 2V96A 3N2ZB 4DLNA 1E5TA 5JAUA 4U2BA 1ZOIA 4Y9SA 5K3CA 3VISA 2PSFA 3I2KA 5LYYA 2WM2A 4QDUA 1J06A 2HIHA 1U4NA 2QOEA 2VT7A 3KSRA 2C5FA 3DYIA 5EHQA 4Q3OA 2OCLA 2JGJA 4Y2PA 3O9VA 3HEAA 3MUOA 4BP9A 5DNVA 5YASA 5K5EA 3WZLA 3BE8A 4FNGA 4EY6A 2Y2UA 3KDAA 1IMJA 5FUMA 4UBNA 1WB6A 3IUJA 1DWPA 4QDTA 1EI9A 1Y37A 1GZ7A 2AJBA 1UK9A 2XUIA 4PQEA 1AGYA 1XZHA 4G4JA 4B6GA 4X85A 2DQZA 5AKJA 3WKDA 2GYUA 1THTA 2FJ0A 4C89A 5CTAA 4F21A 2E3JA 4H7DA 1XRNA 1QFMA 3C5VA 1XRPA 1EA5A 3ZV7A 1QE3A 4HS9A 3ANSA 3WYNA 1GQSA 4KAAA 1CQZA
chains in the Genus database with same CATH superfamily
2FPUA 5K0TA 2ZE7A 3NHRA 1K92A 2XEDA 3NC4A 1X1SA 3G2QA 4B2YA 1A77A 2RHMA 2ZSDA 3GFTA 5KYWA 4HWKA 1ZCAA 4B6EA 4PYQA 5DNYB 2E4YA 1GFWA 4E5NA 3B1VA 1D4FA 2Q28A 2Y1OA 4DKJA 2IYFA 3FOWA 4XSHA 3KKQA 2VZEA 3LIPA 1N25A 5PNTA 5E3HA 3D64A 4N4AA 4OLHA 5EJEA 1H6BA 5AI6A 5BSGA 5L4NA 2E4UA 3BFPA 1X1CA 1YNOA 3N0WA 4HTAA 4PX2A 4JHXA 2IIBA 3DB1A 4NYJQ 3VR4A 4FN5A 1PWEA 4ZJZA 3AVUA 1EP2B 3ZVRA 2RE8A 1RBMA 1CY0A 4QT4A 2FR1A 4KO2S 4Y2TA 4WK0B 3K6SB 3U4IA 1EXWA 3OD5A 4NYIR 5DN6A 3HA2A 5DYTA 3RC1A 1QIGA 5F73A 2GA8A 1P8AA 3UK2A 2PA3A 3FBTA 5KYTA 4R1UA 4WGFA 1TJPB 1ZP6A 4HQRA 3W77A 4JI2B 2R47A 3V4VB 1ZAYA 1F3LA 4UAVA 1I4OA 4POOA 1OOEA 5C46F 3GBPA 4WKOA 4BNWA 2I2BA 4M53A 3PD0A 5CT9A 3OEWA 4X60A 3KAQA 1IHXA 4BU1A 1HQKA 2QJRA 4B75A 1T5HX 3PDJA 1BZYA 4MITA 3KUKA 4N12A 2ECOA 2ZSJA 5EZYB 4D5GA 1OC2A 4U4AA 1O5IA 5JQGF 1H93A 2AK2A 4B76A 5ABPA 1L7XA 2E1PA 2IZ5A 4FZ3A 1LTKA 3ZPXA 4EFKA 1F2UA 4Q7JB 5J1TB 2OT3B 3TZKA 3VDRA 1W5TA 2VWHA 3KEOA 3WGQA 4LJKA 2R6ZA 5E2BA 1BHO1 4F5YA 4YYEA 1JDZA 1JQLB 1R6DA 5TJHA 5JHGB 2KBEA 3NFYA 4KVFA 1SIUA 3A6KA 4KFTA 4OIFA 2PZLA 3B9QA 4QPPA 1TJ3A 4CQLA 5A6SA 1ECGA 1N77A 3N2GB 5KSWB 4WZZA 3UG7A 2HIGA 4IW3B 4EZIA 3EGVA 1RYHA 1NAIA 4TV8F 2Y6UA 3HCRA 1H6CA 4OI1A 5GIPE 2F3SA 2EXXA 2HFJA 3E3AA 5DTQA 4RL6A 2GILA 2N42A 1WW8A 2YWXA 3BDAA 5K3OA 3W2GA 5HEKA 1KI1A 3HBNA 3Q9NA 5T41A 1TQ4A 1W47A 5CFNA 3AVPA 4F93B 5J23A 4H7HA 1NL3A 2NGRA 1KJJA 3TF5A 4JU8A 2ZRDA 1Y89A 4NPAA 3WGYA 3VC2A 2GEFA 3M6AA 4O4JB 4J9VA 3QNMA 2BI7A 2WWYA 4ZT2A 2PVSA 2W2KA 4F7DA 2BOVA 1A7AA 2QTFA 1F3OA 1O4WA 5HHTA 1ZA1A 2CXNA 3QFCA 5KCZA 4R8MA 3NPAA 2I7VA 3VXKA 4NS1A 4B84A 3DUFB 4AZWA 1MKYA 4B3HA 2XXBA 3PTAA 1I2BA 4IQ0A 3SLGA 1NXXA 3A0UA 3FFWA 1JFFA 2ISQA 3M89A 3QQPA 2X9LA 5FBVB 1ICEA 5AJVB 4P7GA 1NQVA 2C97A 5DM1A 2IXEA 2XKBA 4YC7A 5TVKA 2OD2A 1ECCA 1OIVA 3U37A 4C88A 1PTKA 5FADA 1DEKA 1E3TA 4ND1A 3L6DA 1M8KA 3TD9A 4TMFA 2E18A 3MGBA 2RDMA 3DPUA 4ZQHA 2Q5OA 1XNRB 2XAUA 4RL4A 4B6RA 2IW1A 4JFAA 2B1GA 2PGLA 3KO8A 4GYWA 3DCNA 1D4AA 1NI4B 5KQGA 4HB0A 1HLPA 1NVVQ 2F8SA 3KALA 1TCBA 2DH5A 2VF7A 1HR0B 2LXNA 2OAGA 3VKWA 3CNLA 2DBVO 3LPMA 4GKAA 3AONB 3AU8A 5DU2A 2MINB 5FI0B 3VNAA 3R4VA 1DX4A 2DCUA 1XDWA 1ZQ1A 2JFVA 3WZMA 4XD2A 5AK5A 4EUHA 1U63A 2JLBA 2WD8A 1UMBA 3O5AA 3ANTA 4U7JA 1O2DA 2R00A 3U0VA 1NLYA 4XFDA 3BBLA 3GEDA 1PNTA 1QIHA 5BVGB 2E48A 4XDYA 3NORA 4QTZA 3FLEA 4V0LA 1B7GO 4H1UA 5K0NA 3TCNA 1P19A 2BDTA 4HZIA 1T2UA 1SCDA 1BHQ1 3D2BA 5E2IA 3RIXA 5KNBA 3CT6A 1HE8B 1UPBA 3DM5A 3TW8B 1F17A 1SVWA 2SKDA 4CQMD 3V4LA 3B6IA 4Q4HB 2QVBA 2FPKA 2I6SA 2PS0A 1W94A 3AIOA 4H59A 4LQLA 5GZ1A 1ZS9A 2G36A 4J6EA 4KXLA 3I6MA 3JCZA 4PCLA 3E5MA 4TL6A 1O0BA 2XA2A 4IMIB 2CB0A 1KZ9A 4BV8A 1NYRA 5MN6A 3VYUB 2HXSA 1TT7A 5LBIA 1G4AE 3FWZA 5DFAA 4PG4A 4IQ4A 4XUCA 3TLMA 4E88A 3O03A 5HF8A 1R18A 3PDIA 5FI1B 3UB4A 3ND7A 3UVEA 3E18A 5AK0A 1FRFS 3CRZA 1FS5A 2F3RA 4IIJB 2VH1A 5JSKA 2VDLB 3OTIA 1MEJA 4MYUA 3BXZA 3Q4GA 1OXBB 1JSZA 3O4JA 1XO1A 4AJNA 4GOXA 1RAGA 2P79A 4S12A 3TXYA 2YWRA 5IT9A 1ZCZA 2GBIA 3IUMA 4LIPD 1P74A 5D3QA 4RTPA 2HCTA 4KN8A 1YC5A 1USKA 4IIDA 3SSAA 1Y81A 4IDNA 3MCZA 4OQDA 2N1MA 2D8AA 1J23A 1DVRA 3IJEB 4KMMA 3GA7A 4FX2A 4F91B 1MJHA 1R12A 3FDJA 3R40A 4DM4A 4EEXA 5A3JA 4I2NA 3GD7A 4MKXA 1NULA 1KXZA 1MP0A 2LR0A 3UFXB 3KQYA 5HIAA 3X2EA 4ZOAA 4MW0A 1R4MB 1WKVA 3CEJA 4B3MB 2A5GA 2B4AA 1Z5OA 1U6KA 4XA8A 3AQ4A 1XTSA 3AFMA 3OX3A 1L4HA 1YRBA 2XX3A 4LHYA 1WCIA 4AUNA 1LQTA 2BBTA 1M2NA 1J1UA 2Z08A 4EFMA 4R8LA 1IXYA 4AZSA 2VTBB 4ZGGA 2CMDA 4R2XA 1E1LA 2QTBA 4IBOA 5AQEA 4CKXA 4PTLA 1KO4A 4DG9A 4RVUA 1NV9A 1XZBA 2B35A 2WUWE 3O4HA 3N5KA 4D6YA 4DA0A 2AD1A 5L51A 5K0FA 4EHFA 1J2JA 2W6CX 3DLCA 4NBTA 2ZBDA 4RNCA 3LDAA 2AXEA 1N2XA 2SKEA 1UXKA 3HV2A 3KL2A 2KMLA 3KC2A 3F7NA 3PRYA 4JJ7A 7MHTA 1KJNA 4DVJA 4S1OA 4TLLB 1T4GA 1BQ4A 4UBLA 5BNFA 3TB6A 3GAMA 3X1DA 3CONA 4IJ5A 4YAKA 5BV8A 1VE5A 2G25A 4GKBA 3WBBA 1SCUB 2VSQA 4BC1A 3M3PA 3SKYA 3JWEA 1I9CA 5KREA 4Q7EA 4EMBA 1ZM2A 3BK2A 2H1WA 1DDIA 1N6NA 4C87A 1P7WA 1MIHA 3D4BA 3OICA 4FVTA 4BO0A 3N9IA 4QU5A 2UAGA 4DPMA 1RP1A 2R1TB 5ARDA 2WKPA 221PA 5KVSA 4DG8A 3TCXB 4JWKA 4ZZ2A 3HU2A 5EVJA 2BP7A 3O6VA 1XAGA 1JQJC 4Y6SA 1VRCA 2XRMA 4IHKA 4N39A 5G53C 5K8TA 5KB3A 1DEXA 3HJNA 3RVLA 4X8LA 1EWVA 3ZD6A 2VBGA 4L1KA 5FNZA 4NARA 4JQZA 3W5JA 3AM3A 1BQ3A 1OYVA 4GPTA 1YR9A 4KZKA 1D2RA 1XSEA 2Z2JA 4XGRA 1TM7E 1K98A 2LBPA 2Q9UA 3KQWA 3PNBA 4R1QA 1YIAA 1A0OA 1XCLA 4LMPA 4MJXA 4QXAA 1TLTA 2QB5A 4YAWA 4BOYA 3HZOA 4PYLA 1ODIA 3PC6A 2CW5A 2WWGA 1RQRA 3IR7A 4I1RA 4QTTB 1GFZA 3OTQA 3HA3A 1GPKA 3GWGA 5IUJC 3ZGLA 2UZIR 3QU9A 2V9PA 4IMPA 2OSVA 1P72A 4O2AF 3TDNA 1Z2EA 2I3GA 2GN0A 2JFFA 2P4EA 2Q45A 4JC5A 5JAQA 1RWMA 3OPMA 1M34B 1UBSB 1G7SA 1CE8B 3QI2A 2QWXA 2LRHA 1OLOA 4QEZA 4F06A 1CUDA 4DFDA 2VDWB 1XUOA 2HU8A 4KRYA 4D0SA 1SELA 1H0RA 4IXMA 2D6FA 3RU3A 3GP5A 4PLTA 3OFNA 2YJ5A 4DJAA 2QMZA 2J3HA 1PZHA 2Z3VA 2RC6A 5I48A 2ZXEA 3T1QA 2E1RA 2NX2A 1HEUA 3I9LA 3F74A 3KJGA 2H00A 3EXG1 3F73A 1SUPA 4NCAA 3UJBA 4QT0A 1A8QA 1P0PA 4O1MA 2MT9A 1RJGA 5I9TA 1EHIA 4FT2A 1SIWA 4MRAA 3WI7A 4PWZA 1RXEA 1ILEA 3V3KA 3WLTA 3AWIA 1PGOA 2OXIA 1W1IA 4CR8A 4F4FA 1OROA 3H11A 3AOGA 3M5WA 4MW6A 4FFDA 1B2LA 1UAGA 4MJLA 1O0SA 1I30A 3GT4A 1MOQA 2CMGA 1OT5A 2I4NA 5I9LA 4HPXB 3SLRA 4A6DA 3E22B 4GNKA 5ICGA 4MUMA 2GEVA 3CLRC 5E4YA 1SUFA 1J1ZA 3PUVA 3TPFA 1MW9X 3PC8A 3ONDA 1CTQA 3PNQA 3FTEA 1T1RA 2FVXA 3MAJA 4LX0A 4I5FA 3WP0A 1L5VA 1O58A 3G0CA 2ONJA 4OBXA 1CEQA 4V02A 3PWKA 1YCDA 2X0RA 4ENTA 4P38A 3V33A 3SP1A 3F3SA 1K97A 2P2LA 2X19A 4BWVA 2AFVA 3AIKA 3DCYA 1ZISA 2CV1A 4LJAA 3JD1A 3VHQA 1QAMA 1UAYA 1V2GA 1TMKA 4J4TA 2NU9B 3JD2A 1GTRA 4XQCA 3L02A 2F1JA 3BBPA 4DV5B 4PZDA 5KQLA 1O94C 1JDNA 1KBOA 1MAWA 2Y1WA 3NAGA 3EEYA 7GPBA 2HCBA 3C3DA 4Y6QA 5LJIA 2RBEA 1NV8A 3PGJA 4DVGA 3RO7A 4EFLA 2W48A 5COAA 1C9NA 2W2QA 4WTOA 1H05A 3TOVA 5KNDA 1VIVA 2GVDC 2VHWA 4H4DA 3RYHA 1U2RA 3QLVC 4R5MA 2R2AA 4A16A 1LWNA 3IURA 4MGHA 3RSSA 5JQGB 1TTTA 1T3LA 3KYBA 5ICEA 1W9MA 3KU4A 4HTFA 4RUKA 4DA9A 1QRTA 1U04A 4BO8A 1SUIA 2HO4A 4UFOA 2D7JA 3GPCA 4D6PA 4HDKB 1V11B 4JIGA 4EJ6A 3KK0A 1NXOA 1UT5A 3CO0S 2OKGA 5J58A 5ANRB 3CCCA 2OUIA 2PZMA 1E94E 1ZH8A 2VEDA 4NECA 4CQMB 3I52A 1G8AA 4GZMA 5AM3A 5J2UF 3KKNA 3NASA 3CWQA 2WPDA 2YZ7A 4J49A 4RKEA 1HTTA 3H13A 2F3PA 2OB2A 2J30A 2WJHA 3O0DA 4RXMA 4OO3A 1ISGA 1JN0A 3MLAA 2JCYA 2VKTA 3ZY4A 4TV8B 1A8PA 5ES4B 3NW9A 2Q5CA 5AVKA 4ZYYA 1P17A 1E1QD 2CXHA 2HJGA 4YRLA 4CIVA 2QX8A 1QBKC 4AMBA 4WZAB 3SYKA 3ZX4A 1Y5RA 3K2QA 3N59A 5CHYA 1ZVMA 2OFOA 3PEFA 2O1WA 4GP6A 3WRYC 2WF7A 1OKKD 3AI2A 4MCHA 1EDBA 1L9KA 2V65A 3H9CA 1RAIA 2P62A 3CHYA 4TMKA 1P18A 3W2FA 1JB9A 1C50A 3MS4A 3WFZA 5F9HA 3T3OA 1C8KA 1XMSA 4ER7A 2HX1A 1WNTA 4M76B 1GPWB 1V48A 2FCAA 3GJ8A 4OHWA 4YQZA 5HCIA 4L51A 5CFLA 3GRYA 4P7BA 4O3MA 2YRFA 2C7PA 2ZRIA 1U5BA 4O3FA 1YIDA 1YFZA 3VSAA 3KLMX 2ZUEA 1B73A 1T6NA 1QTIA 2BONA 4OAQA 1R6VA 1QFXA 5LOVF 4L27A 4P5DA 1GU7A 1RLMA 2MU1A 3GJSA 4RW0A 2GAJA 2ZGVA 1L5GB 1PZEA 4ZD6A 4A0QA 3OAAA 1PWYE 3LFUA 1X1AA 3RUPA 4G4SP 4XR4A 3GGJA 4FYXA 4JITA 3QF4A 4CCWA 3EH2A 2IZ6A 1NMZA 4ER3A 3IB6A 5H4HA 2ATEA 4LWQA 1K5GA 2G1KA 2H3HA 3M6WA 5GJWC 4C4SA 1K9SA 2H4WA 4OJTA 3U7IA 3WLFA 2PEYA 2B94A 4P82A 3TTYA 3TQTA 3GLIE 2P9FA 4LSGA 4CR7A 1J22A 1Q50A 2H16A 2OV1A 1I2MA 1XU7A 2QTLA 4JVNA 3PT5A 2PAFA 4X8OA 3GVXA 3WGTA 2HXYA 3R7WA 2NO1A 5SZKB 5IM4F 4YRQA 2HF8A 1Z5NA 4OOFA 1W0JD 4WLNA 3TJZA 1W75A 2P2DA 5CA1A 4QZVA 3IEMA 2VQ3A 2W4MA 2QL9A 5AHOA 5EHGA 1GPJA 1DWOA 2FGKA 2N3ZA 3EYAA 3O92A 3PNPA 3RKSA 1D5CA 2RGAA 3QBJA 4OQQA 4P53A 3CZMA 4FGLA 4URYR 4B3RB 1RLOA 1JJFA 2G83A 2PCJA 3HRHA 4N1AA 1A2BA 3CF4G 3FMFA 1A4IA 1DXOA 1ZXXA 2WJIA 1XZMA 2PMEA 1VPVA 4JODA 3ZBPA 2BFBA 4BVGA 2BFDA 2HA2A 4NFLA 3K2BA 4N49A 4E2XA 2OBLA 1VSTA 2QK4A 3KIPA 3BWEA 2CUZA 3PNYA 4URFA 1HMPA 2XA1A 3F4BA 1U7HA 5JDCC 3WNVA 4X7BA 5LFAA 1YGPA 3WGZA 1RHMA 2MSNA 3U9TA 2RGGA 4HLCA 1E1YA 1XLTC 3P0JA 1Z4IA 3HY4A 1N2EA 2XRZA 3A9TA 5IC6A 4EI9A 2G04A 3Q8KA 3ADBA 4DV6B 1GA1A 4NR0A 5CB6A 2XYPA 4QQRA 2Z1MA 1AS0A 2HRRA 5FHRA 4DLSA 3H2ZA 1L8LA 5AH0A 2XGMA 1NA5A 3C2QA 3CTPA 4LDQA 4DCPA 4UTRA 4ZK2A 1ZN2A 1GGKA 1BOOA 1ITZA 3AYZB 3RS0A 2C9YA 2FQ1A 2GD2A 1SRQA 4NG4A 3AUKA 3UT6A 1T5DX 1G59A 2JEOA 4KRGA 3VDXA 2ZQ5A 4ZEXA 1JMYA 3F0TA 1JJ7A 3P5SA 1C7FA 4JZKA 4S1PA 4RHUA 1AVTA 1O7JA 2C92A 4DZRA 4TZ0A 1UZMA 5GONF 1CR1A 2JIMA 3G2MA 1HG1A 4HT3B 5LLTA 4MVJE 1Z8NA 1QGUA 2GD1O 3AF5A 1A8HA 1CJTC 1PIWA 1IZ9A 3MMXA 3KB6A 1R0ZA 2Z5LA 1WOMA 3NYQA 3EFHA 1SFRA 4KR6A 2EJCA 3QXHA 3E7XA 1ODTC 1FUYB 1UL1X 2QSZA 3JASA 4C08A 4OP2A 5KUTA 3KSMA 1SU4A 1U3VA 4B87A 4IGIA 4P3PA 1LW6E 2P6MA 2GKOA 4US1R 1N2HA 1Q2XA 4P08A 5J2TA 3UGJA 3EA0A 4IM7A 2DP4E 2VQEB 4FHFA 1B0UA 3T95A 3O90A 4UPEA 2RD2A 2GN9A 4JKIA 1VPDA 4H1WA 3CLKA 2L82A 3EWNA 4EGAA 3K1AA 1CHNA 1NKTA 2QRKA 3WJ2A 4OHBA 3G49A 2AJDA 3I9V6 3NRJA 4UNSA 5EHNA 3WYAA 4BLQA 4HDSB 3KPUA 1V16A 4ALJA 3IQZA 4U7WA 1MJ5A 5C32A 4NLLA 3U7JA 3WR5A 5J4LA 4TYPA 3A9RA 5HRUA 1IN1A 1TJYA 1JPVA 1XELA 2AQKA 3C6XA 4NL4H 3L5OA 3DB2A 3LT4A 3B9BA 5D3MB 2YXLA 3ACBA 3NJ4A 4L8WB 5D3ZA 1SBYA 5HK8A 1W4LA 2EFYA 2LPMA 3ILHA 3QU7A 1YU9A 2ZZMA 4HF7A 3P4YA 3HN7A 3K5HA 3GJZA 3KYDB 1BYUA 1VRVA 3O94A 2CZCA 4EHKA 3RDPA 4MV8A 1HV8A 2EAUA 2VBIA 1ZFNA 1G3RA 2E55A 3IP9A 3K9HA 3V7UA 4EYSA 4HQNA 3JX9A 4A0FA 4ZCIA 5THXA 1ADYA 1XVLA 5HUJA 2ZS7A 3N2YA 2DX7A 2WP0A 4M8IA 2Q3CA 4XYGA 4J16A 4GX2A 2J0SA 1AB5A 2R97A 4B3XA 3C1UA 3I5AA 4JSRA 1GZ4A 3B60A 3A4LA 3I8OA 3C3CA 4HQ6A 2CN1A 3OQBA 4MKHA 1ZK3A 4DSAA 4TS3A 4JA2A 5KVQA 1OBOA 4F71A 2Q2VA 2I7CA 1CVRA 3C85A 3MJTA 4JVSB 4AJOA 1P80A 2G82A 4BFWA 4PBTA 4PLHA 4X9XA 1Z9BA 1WB4A 5IXYA 1EYZA 1CR0A 1R0SA 5EZSA 2O0MA 2JIBA 3VX3A 1UANA 4FR2A 1I36A 3GDGA 5AKLA 3WMWA 1RTKA 3L4BA 1FSGA 2VDMB 3SFZA 3OCUA 4PZZA 5COQA 4AYXA 3CRVA 3I2YX 4XWOA 5HWSA 4Y0VA 3E58A 2DR3A 5I7SA 4YACA 5DVZA 4O2AB 4EWLA 3CR3C 1Z5GA 4LDZA 5BR4A 2A7QA 2IK8A 5A5DA 5FO0A 2N47A 2ZKLA 5ALKA 4YCMA 3C0KA 2G06A 1LPBB 3H16A 3BZBA 4RY9A 3RJTA 3SE7A 2VL7A 5FTWA 4W82A 5BWLA 2IEAA 5HKKA 1SKQA 3TIXB 3O3MB 2O1EA 1LJ8A 3BYZA 1GGMA 1N2OA 4XIIA 3WLEA 4E5SA 1EU1A 3Q1KA 4I50F 4ENVA 3ZBQA 2HQOA 4MQFB 4Q19A 5GGYA 1RWXA 1KP2A 1J49A 3I2FA 4M7RA 1UDBA 2VRCD 1U2EA 4MCJA 3O9MA 1EJ0A 2CYAA 3I0NA 2JW5A 3M4XA 2FNAA 3FVWA 3LIIA 1B26A 4LV8B 1Y8RB 1F14A 2JGIA 1DB3A 3F6SA 3NGXA 1WXGA 1OWNA 1Z8DA 3PL1A 4MRSA 3KD3A 1PHPA 1CCWA 2A9OA 1OWPA 1Y5LA 3VR5A 3TNYA 5KJ1A 1HDOA 2MMCA 4J75A 3EJ6A 1BJRE 3C6KA 2V7UA 1GZDA 3M6UA 3AHHA 3QVWA 4ENWA 2ZCJA 3HU5A 3RVPA 3SE0A 1T5TA 4R69A 4NHEA 2BW0A 5C18A 4TKUA 3LOUA 2WSYB 5KCMA 4NPCA 5DKFA 3RVQA 1WP4A 2JLUA 1JFVA 3OLZA 5ALVA 2B4TO 4MMYB 1E4YA 5KVAA 2NLOA 5AP9A 5IEBA 3TS1A 4RF5A 2HCJB 1Q1EA 3KLBA 5IM4A 3TQCA 2XUOA 2D7DA 2NU6B 1HF3A 3HI4A 4HSGA 2P7IA 5TSDA 1VHWA 5AVUA 1RD4A 4PAOA 4QDKA 4YP7A 3UV3A 1N0UA 2XUGA 1OLSB 2Q3JA 3CE9A 2IZ7A 3I42A 3O38A 4HSEA 2QAGC 3H3FA 3Q40A 3UNXA 3EVAA 1PF7E 2Q3LA 4RFSB 3V8RA 3K70B 1FQWA 3NKLA 1HM5A 2AFIA 3UHPA 4A1FA 2KLBA 5HF5A 2ONYA 2QRHA 3AEQA 3MTEA 3OLWA 4ZCLA 5JVDA 1XP5A 2BGRA 2NO6A 2OV4A 4QOFA 1JKXA 3UV7A 4I4IA 3SQOA 2EDCA 2EL7A 2FPSA 1GNVA 4LHZA 4L4RA 5SZHB 1A9PA 2F64A 3NPMA 4I4NA 4E51A 2O8CB 3A6EA 3HBJA 3MUNA 4OHVA 4OBBA 1TPYA 1YE5A 1Z5PA 3BJEA 2C94A 3JWPA 1NJ1A 5DYWA 3HMKA 3BVPA 3H4IA 3NP9A 3U26A 1BCSA 5HRCA 4O0LA 4F56A 4V0ME 4WJLA 2Q5HA 4XDZA 5HM6A 4FEAA 5IVIA 2W4QA 4YLGA 5EIFA 3Q10A 2ZVJA 4YMUA 2QZJA 4CKZA 2C2OA 5ALGA 3FSGD 2QYHA 1Y8CA 3B6KA 3L6EA 3NLLA 5HUQA 2Y05A 4L28A 3LAWA 1Z83A 4D9NA 1R27A 3LVQE 4E1AA 4UOQA 3EPJA 4YRRA 4EUSA 5J2UB 5KYKA 5B2ZA 4RS3A 3GOHA 5BRAA 4RCVA 3T3HA 5K8CA 4XOIA 4OYHA 1WE2A 2V7WA 2VFAA 3BWMA 3EXEB 4WOCA 1P7ZA 4AC9A 4W9NA 3HABA 4QU0A 4EPYA 4JJAA 2GUGA 3DMTC 3VR6A 4OHXA 1IEWA 1Y3HA 3SPXA 2YVLA 3UMFA 3SBOA 3NHBA 3NG1A 4D44A 1Z0FA 1CHDA 2FZWA 2YHSA 3BRQA 3K73O 4HQLA 2Y9MB 2Z2IA 2CZQA 4RHXA 4B0OA 3V34A 4DIMA 2HEGA 4DMFA 3ML1A 3K16A 3OUZA 4YGXB 5AK3A 3OM8A 2D0DA 4QHTA 4BMDA 4Z6KA 4W5QA 3ZJTA 2YNMA 2MYNA 3IDQA 2DWPA 2QP9X 4MA0A 2QNIA 5FULA 1X15A 3GNTA 3RS3A 1Q16A 2ODEA 3BXPA 3GUZA 4HX5A 3Q15C 4NENB 3UAVA 1ISPA 3PNVA 3MXTA 3N05A 3VSCA 1GCOA 1IPHA 5INTA 2V1UA 3LY9A 1SU6A 3KZVA 4EFDA 1LX6A 1ORRA 1VSVA 3C7DB 1IWPB 2DTXA 5BUZA 1YI1A 4N5IX 4PQFA 4LOIA 5IN4A 4L5BA 1TAQA 1E96A 3ADPA 4RD6A 2HTFA 4HRVA 1CJCA 3AKCA 3X3HA 1WV0A 3QUCA 1NUHA 5FAXA 1LPMA 2WJYA 3LG2A 3EZYA 3LKDA 5LOVB 3OOHA 4FMCF 2BKEA 3AYXB 5JXJA 5ITZA 1XZKA 4QJIA 3ZLJA 3L6UA 3HN6A 5KYXB 3PUHA 4RGVA 3GZ4A 1UEIA 2VJBA 2PWPA 2X5KO 5HGJA 3HO6A 1C3VA 5EMKA 3ZU4A 1SCKA 4C7JA 3LTEA 1AZWA 3CRNA 4LF9B 4FHGA 3ZCSA 4XE5A 3KBOA 1L7DA 2GXAA 4AWAA 4BP1A 1TEXA 2YV4A 4GZ3A 3OH8A 4EYOA 1E5VA 5I7WA 3EDRA 1JQEA 2GHTA 5ERGB 1USWA 1PFKA 4YH1A 4DV4B 1VB3A 1GVNB 3ZWDA 3WA7A 5BSVA 4JQOA 1DU4A 3HLTA 3IFSA 5LLSA 1E6LA 2E9SA 4EVIA 1H4QA 3KWFA 4ADSG 3B7WA 1QZTA 2W93A 2ORIA 1YRYE 3HKCB 3O8LA 3EVZA 3WLQA 1XE3A 1SWVA 2GBFA 2VC2B 5HFNA 2ECFA 5B1YA 4H4EA 3IVCA 2YY6A 3E4DA 4EY7A 3SVLA 3CZ5A 1UK7A 2FPGA 2NUPB 3D8BA 3RPEA 3V1NA 2IHZA 3QNWA 4K0RA 4BNDA 2XHEA 2BCEA 2X0NA 3W3AA 1RRPA 4OBWA 4RWEA 4YCDA 4ZVSA 3MELA 2IT1A 3X2FA 1TIPA 3LUJA 4RGQA 4BNTA 1J0AA 3Q6MA 3QRWA 4EAAA 4PZUA 2AUNA 3B1WA 4ICIA 2Z9CA 4FGWA 1R8JA 3PQEA 1JFRA 1KP3A 3VPAA 4DGQA 3GGDA 2YWCA 3ZY5A 5C1OA 4MARA 4Q4AB 2Q6VA 1NC1A 1KP9A 2IXDA 5GJBA 1FFAA 2FDXA 4B2LA 4AUEA 4I6EA 1QS0B 3U3OA 1TAUA 2LIVA 3O1HB 3C6QA 2PBLA 3DMGA 1V41E 2H1LA 3BICA 4R51A 2V8BA 4UE3S 4UQPA 3OJFA 1FMLA 1X8JA 2ZYWX 1BWSA 2A7XA 1RXUA 1WRBA 4QGAA 3HHEA 4IAOA 1Y6GA 3AESB 1CD5A 3BWCA 4B4OA 1IUOA 3GF4A 1FZTA 1Z8FA 3I01M 3PE4A 1TQHA 3T3GA 4O25A 2XSZD 5GONB 2B3DA 2ZJ0A 5ETJA 1PJ4A 2DHEA 3E5NA 3I0MA 3EWSA 1UBFA 5H0IA 3Q5DA 1IPFA 1WSWA 2DWCA 4F1KA 3EF0A 2I4IA 3RTEA 2UUCB 1BRMA 1LJUA 3HHPA 3PGVA 1C0LA 2CLLB 3OM0A 4L15A 2ZM6B 1VA5A 1TEZA 1N2BA 3T1OA 2WFLA 1TA0A 4HEHA 4LZOA 4C3OB 3DXXA 1GNLA 2P77A 3DQQA 1FMTA 3O84A 2DWUA 2NV2B 2V7XA 4I0WB 2D1SA 2JGDA 4P36A 2PVPA 4TTIA 2XYQA 3VR4H 4B5KA 4XDGA 1YO6A 4F1WA 1T3TA 2W6OA 4QUIA 3T99A 1Z0KA 4HGPA 1CUVA 4JR1A 3D6AA 3PQ3A 1JZSA 3I9NA 2LDXA 1DBRA 3R3YA 1L5OA 2EFJA 2JHPA 1DBVO 1U0NA 2R79A 3KWJA 3TRFA 2R1ZA 3CLVA 3DDHA 1VCHA 3MIIA 4Q48A 3RRYA 4KB5A 1N57A 4DT1B 4ETIA 2I6XA 5MGNA 5F77A 5FUXA 2JEZA 3S55A 1JS1X 2Y1CA 1RYMA 3RTCA 4KQCA 3SKVA 4J0KA 2CD7A 3FMPB 2FMKA 1BXGA 2OFFA 2J32A 3TRJA 1PN3A 2V55B 1KZYC 1P0QA 1RWKA 2BFWA 3VTFA 1H2RS 1CF2O 3KVNA 4D0RA 2AXPA 1FS4A 5KINB 4NBLA 1KS2A 2P0AA 4IIUA 2BEUB 1Z6QA 1XEFA 4CTJA 1TQDA 3UT5A 4YMSA 3L7LA 3HXQA 2QLJA 1GT91 1WKBA 3FZYA 2VLIA 2ZE8A 1O6FA 2FUKA 3F6PA 3IO3A 5BT9A 4H0NA 3CURA 4DY4A 3DBHB 3MCVA 4ARBA 2PD3A 2AF4C 2ZRNA 2HPVA 1DQSA 1PT5A 4M21A 4ZYWA 2AE2A 5LWQA 3VM6A 3EXFA 3ACDA 3EZNA 3CX4A 4CM4A 2XIJA 1AO3A 3CA8A 4DUYB 5DBHX 4DYVA 4E11A 4RMIA 3JAMA 13PKA 5F4BA 1P2SA 3AZOA 1P2VA 4JUDX 1Q0RA 3G59A 3REQA 1U28A 4G8BA 1TO6A 4ZMBA 4MICA 3OZTA 4LYHA 4XEHA 3RWBA 4FK8A 3DTYA 3OPYI 3UHOA 3N8NA 2Q21A 4Y2VA 3C4VA 2QY9A 2WJGA 5HNKA 3GVPA 2UUOA 4PNZA 5JCOC 3H4VA 1KF0A 1SUDA 3RYFB 3TEMA 2FMHA 3W8RA 4DA7A 1AUQA 1Z0ZA 3QEJA 3EGIA 5BUQA 4BFLA 1H2FA 1Z29A 3R20A 2ZRPA 3W1VA 3EPHA 3EODA 4IYRA 4C1BA 5AESA 4DSNA 2DHDA 4DDWA 3MWEA 2AF3C 3GK3A 4IF4A 4U8GA 1LLFA 4FR5A 1PG0A 4X5OA 3BOSA 1YDEA 3C3XA 5G41A 2ZANA 3OO1A 1PR5A 2H1SA 3VRHA 4E5KA 4E09A 2Z95A 3LQQA 3UKOA 3MJVA 1ZSVA 3VUEA 1NI3A 4I50B 2FWJA 3U7RA 3KQQA 2GKSA 3AIMA 3K1ZA 4NU6A 1Z6GA 3GJRA 1KOLA 3RARA 2O2HA 1IWOA 1UQTA 2YN2A 5BMVF 4MMZB 4L8YA 4UUOA 2FFBA 1PT7A 3C3WA 4PYJA 4V0QA 3ROEA 3NTVA 5BQFA 4HXEB 2WYUA 1UT6A 5D7NA 5BYKA 4RJJA 5C8XA 1KY4A 4OHPA 3IQHX 4BO6A 3QE9Y 5L3ZA 5CITA 3N0XA 1YIOA 2RAPA 4EIWA 2E5WA 2A94A 2IYTA 1GP2A 4DR5B 4PCVA 3TLEA 2QZPA 2WYIA 2X3UA 3CNQS 3HZZA 3LXRA 3PUKA 1F6DA 2QENA 2P8SA 4NJMA 3HFJA 4A8TA 2Q4BA 4BCCA 1CYDA 2DUUA 1W85B 1ZMXA 5TMBA 4F6CA 2C9OA 5ECGC 4EGJA 4JI6B 1YL7A 2JDID 1TZCA 2HREA 4G6ZA 3KZ1E 3PICA 4A5SA 4DWJA 2TSYB 5KDDA 2G0TA 1N5MA 4OXKA 4N01A 3MINA 4PPNA 3CUKA 5EUBA 4NCHA 1QV7A 3Q88A 3DAHA 4P35A 1GNQA 4P22A 4V1CB 1M74A 2ZRKA 2O3JA 3FZEA 3JALA 3LUPA 1FYFA 1WMDA 1COWA 4LVOA 4D9IA 3HVRA 2HHHB 4YV2A 1EVIA 1Y5IA 3CSDA 1ECLA 1C1YA 3F67A 4KDEA 1WCV1 1G8KA 2VLBA 5E3JA 3BFKA 1JQBA 2GHRA 3BCRA 5DCUA 3M2PA 5KNBH 4RTRA 3MQFA 3DBOB 4MI1A 3JVEA 4PSDA 3VC7A 1B15A 1SUCA 3SF8B 2DPYA 4EX7A 3OQHA 3HUEA 5EGNA 3EY9A 4JA0A 5NLLA 1U98A 2P0YA 2PTHA 4FEGA 1PSDA 5FQNA 5FF9A 1IZ7A 2C07A 4OG2A 3VNSA 1DAIA 3KT8A 4H3SA 4EI7A 1FLNA 4ZXPA 5EHXA 1HX7A 1Z4JA 2IUEA 4BGIA 5A4DA 1ULHA 1KWKA 3RK0A 4MS3A 1YZFA 2MR5A 4YJ3A 4JI7B 2J4CA 2YJ3A 2I3DA 1Y1LA 2M98A 3FWKA 2EGUA 1N9ZA 2YWBA 1CBUA 4QVKA 2O0KA 4QE3A 3VZBA 2D5BA 5JMOA 1LEHA 4UUAA 2JBAA 2PPLA 1QHHA 2JAXA 3W5VA 4C6RA 1RI1A 4HUQB 4W5OA 1ORWA 1XU9A 4YQFA 4BZZA 2GAIA 2NO0A 1ABFA 3OIDA 3KAPA 4KN5A 1YB4A 4Q3AA 4UATA 4W8OA 2GS9A 1IH8A 4D4HA 1JR4A 2Z2ZA 1JLLA 5K4AA 3RVMA 1TK9A 1Y6JA 3HH8A 3PUZA 1GG9A 1BXRB 1FMJA 1MC4A 1KJ9A 2W6NA 3DNPA 1PQWA 4TZ6A 1Y1PA 4W7SA 4BX0A 4BX9A 1XL1A 2XYVA 2ZYTX 3OJLA 4G81A 1GRVA 1JMKC 1V45E 1H3FA 1CFZA 2PGDA 2R6HA 3EAGA 3F7TA 2EATA 3JQBC 4GD3Q 3VPCA 3H65A 4L08A 1PZFA 1DX6A 4BCDA 2AX3A 3ETHA 4XJVA 4DBLE 1GPDG 1P45A 1IRXA 4R41A 3CXUA 3S4YA 2JCGA 2V5AA 4B81A 4MIOA 3FCEA 5HCUA 2DG2A 1VZ2A 4D8XA 3PSHA 1UFQA 4TKZA 4C4OA 3PK0A 2V6MA 1XCBA 4E1VA 2B9EA 4DMMA 2B2NA 3QBVA 4G9BA 5FTLA 2VJQA 3I04A 4JLNA 3QPUA 4PRYA 3KQVA 1I7DA 3NU1A 2VH5R 3BSFA 2C00A 1BFDA 1JNXX 1H66A 4FDTA 3ROXA 4G0VA 1HYBA 3AEUB 4YRBA 1V7PC 5EQDA 2P3LA 3EXAA 4J1QA 1SULA 3C8HA 2OOSA 2WK1A 5JXIA 1D0SA 4TRJA 2IYSA 5F5XA 2V0CA 1F2TA 2FE1A 3EJWA 3PNLA 1K06A 5DXFA 3K6RA 2UVPA 5A3SA 4R84A 5BNWA 4M0CA 1J0DA 2RHTA 2D3WA 2C31A 3EIHA 3IVXA 3IHTA 3QVVA 5CTJA 3RSFA 4CM8B 1JAIA 1P1IA 2C4HA 3MJEA 4FMCB 4C6HA 3HYRA 3PEVA 4BGDA 3EPLA 1U1IA 4NF2A 3KM0A 5EWMB 1LBTA 3HZRA 2EIXA 2RKWA 5B7NA 1T5BA 4ZALA 1JE1A 3NHZA 4ZI5A 3OIWA 4IFIA 1XTZA 3P9RA 2JFGA 2WUVA 5ELXA 1E3SA 3PTLA 4FCCA 5HMMA 1P1KA 2WD9A 1UCFA 2DUNA 1VE7A 2XNHA 4ZQEA 3TKYA 2C7RA 3IMGA 2OD9A 3C5WP 3I5UA 5CM8B 3S8EA 2H5LA 5K99A 2VJAA 1KA9H 1ZD1A 4HY3A 5EJ8A 2H65A 1ZNWA 3NBKA 4OHOA 1NW7A 5EIBC 4MHSA 3NB0A 3VNRA 3K9LA 3WG9A 2NPIA 2VA8A 5DTJA 3B5JA 3SXJA 2PXHA 5LQCA 1WB9A 3VPXA 1FVHA 5DRYA 1G21B 4ZT6A 2ROQA 2Y1DA 2ZZKA 1A9SA 1MUUA 4C7MA 2DERA 3IELA 2Z0MA 5CDFA 1L5NA 3SHWA 5DWQA 2OXEA 2CVFA 1GGJA 1KO7A 3D6FA 3P4UA 4P8RA 4ZKDA 4AULA 1RSZA 5TPZA 1G4HA 1R2QA 2HU5A 1KDOA 2R8XA 3VKHA 4BN5A 2GPBA 3NUQA 4Y3UA 4CKBA 1ZM4A 3BD9A 2RG1A 4R1SA 3DH0A 5SYAA 1FLVA 1QJCA 3FOAA 4CV1A 4LXTA 3A3NA 1NLZA 3M83A 1AG9A 1J33A 2VSXA 3KFVA 3KZKA 4UD6A 5D1HA 1G5PA 2CXOA 1GD1O 4MPRA 1H5QA 1RKUA 1WW3A 3FMGA 4UU1A 3PDCA 1V3TA 1X9IA 3NDRA 3FVTA 2AZ4A 2D3TA 1U7WA 1K6EA 4EB6B 1ISRA 4GUDA 1SGWA 2BR5A 2GXSA 3Q3CA 4I8DA 4DV1B 4MR7A 4N7JA 2BFCB 3OPVA 4BDSA 1IBLB 3WL4A 1WLYA 2ZE5A 3ZXXA 4AJ4A 4DR4B 3VKFA 3B48A 3MAAC 4JLMA 1HT0A 1FFXB 3RFCA 3PFFA 4FN4A 1V8PA 5C1BA 1VLMA 5ITSA 4NBNA 1JKJA 1NYLA 4ZHSA 3AUXA 3LP6A 3I05A 4M9UA 4LOJA 4KQ1A 4QOIA 1DHTA 3AFIA 3DE5X 4DCOA 4BX8A 1XZEA 4C4AA 4ZAXA 1PJAA 3SI7A 1OXKB 3G7UA 3MSCA 1T0PA 3DDUA 4D8YA 2JZCA 2GD0A 1PJ8A 4A0HA 3B7PA 1A9XA 2FZCA 1FU8A 5JNLA 1JT2A 4J43A 2PGIA 4KTVE 3QVKA 1DS6A 1OLUA 1GU1A 3CUVA 1AMUA 2JZNA 4N3GA 2O2YA 3PDHA 5JANA 2FY8A 1QR6A 4ER0A 1VBKA 2ZJOA 1R1DA 4NMWA 2H0AA 4YXWA 2YTZA 1EDDA 3UJ9A 4I5IA 1CQJB 4CM7A 1DKMA 2PSJA 1W1WA 1ZUIA 4RM3A 2IV3A 1GPH1 4TTTS 2WOOA 4MB6A 3S2ZA 3TE6A 1WQ3A 4JP5A 2H63A 3FCCA 4WBSA 5HK9A 4Q3KA 2R4TA 5KKCA 5LM3A 4XUGB 2VP4A 2QMEA 5DT9A 4BJ6A 1RI3A 4YRMA 2JEYA 3Q41A 1AY0A 1Z26A 4FMBB 2YV1A 1MTOA 4EUEA 1RZRD 5FRDA 1NX6A 2JVIA 1E8NA 1CZUA 3ZCRA 4D3YA 4J7XA 4LHXA 1WW2A 4JOQA 1KSFX 1A9TA 3THWB 4EVRA 4RV9A 4Q3BA 1SXHA 5IT4A 3E9ZA 3HGTA 3DDOA 1L4KA 1MD9A 3UKJA 2PR2A 4DBZA 2DFTA 2P30A 1OV6A 4WGGA 5E95A 1DC3A 3QFFA 5ITWA 1BX0A 2OECA 5A03A 2CLIB 2I9PA 3NBZC 4LOHA 5KNDH 4G2TA 3LTNC 4UKDA 1J00A 4M1TA 3T4PA 5AUNB 2AC4A 1MHPA 3HPQA 5DW3A 5G0UA 1SK8A 3BHMA 2ZUUA 5LP6F 1KTVA 2VUTA 4CE6A 1BX3A 5A04A 1W52X 5P21A 1I1OA 1NT4A 1IULA 3G1TA 4K6KA 4EF6A 2QM8A 4LBYA 2IUFA 3TZCA 3CBGA 4JHLA 1CC1S 2C88A 2PLAA 3FNGA 4II7A 4S1TA 4A6PA 1BE0A 4LVNA 2ZSAA 3JAKB 4LWPA 3LLUA 1K5PA 1YR2A 3N74A 2HXGA 4U02A 5ALLA 4DQLA 2QUKA 1LFDB 4CTKA 4E08A 5KQPA 1OV4A 4KYTA 1N5IA 1ZITA 4P83A 2BGWA 1SH7A 3SJZA 5IJ9B 1WQ4A 3GCZA 1Z0DA 3OUUA 1O8CA 2XDWA 5HJEA 4OKSA 1GV1A 5DHSA 1UP4A 3PG5A 5DM4A 4RH0A 5FOTA 4ME6A 1DMSA 4QOHA 1UEJA 3HVJA 3KWLA 2V6GA 4Y2QA 2D2XA 5KNCA 1PVOA 4I3GA 3DVQX 3N2GA 1VCMA 5IJZA 2CDBA 3ZDZB 4Q9NA 5JADA 2YVQA 3A6PC 3K6JA 2H06A 4ZCRA 3WAKA 2EEPA 3H3XA 1NP7A 3SYLA 1FXWA 2D1RA 3BTOA 1AS2A 1F06A 5F3RA 4D02A 4E6EA 3HJHA 3OFKA 1T36B 2XJ9A 3QOXA 3WADA 4B44A 5JMWA 2QGFA 3C3JA 3UY4A 3BD7A 1Q2UA 5EQJB 1T13A 4K9DA 2GZAA 4MUAA 4QL3A 4CF6A 3U6KA 3BUSA 1ISJA 4CVNA 1N2CB 1ZVQA 4DMHA 1L4MA 1X39A 2ASEA 1FNNA 1XJQA 3FKJA 4JL5A 5BMVB 1QXSA 3GJ5A 4UTXA 4PLGA 1TQ6A 4JXXA 1ZMTA 1QK4A 2XNDA 3TTVA 1O8BA 3FI9A 4LRSB 1AQLA 4KSBA 1BQEA 4II3A 2J7KA 4R1MA 1CRWG 4WMLA 2HWXA 2O50A 3U39A 2JD0A 4FSXA 3ESZA 3AR7A 3PXAA 4LDNA 2UZ1B 4OXNA 3NT5A 2FB9A 4JYBA 1JVNA 5C1DA 3V8BA 4DLKA 3OIFA 4MGEA 2R7KA 1HUQA 1KBZA 4RJLA 2AZMA 1DRJA 1XAIA 4Y6RA 3VZPA 4XYLA 2W90A 3FN4A 4XVUA 1T5IA 4NHOA 4UQOA 1GAEO 4NU8X 1QG0A 2NPFA 3T9CA 5JO9A 3IKMB 1NI4A 1KRHA 4BS9A 4PTYA 2QMYA 4HYQA 4BNGA 1U0HC 4FNMA 5K8VA 1T6ZA 5DTMA 1O77A 1WBBA 5B58C 3EXHA 4HNGA 4PBRA 5BUSA 1PT8A 3LC2O 4H0CA 4FZVA 5D6NA 1VGVA 2YVAA 2MINA 2BE9A 3P0RA 2FEAA 2DT5A 4EAQA 1A5BB 1ICIA 1ZLXA 4P4GA 3VNVA 1U9IA 1U2ZA 4PS0A 2BGGA 3EAQA 3EEFA 2PUJA 1YBHA 4I1YA 5H9WA 2XDYA 1OBVA 2A2ZA 3QENA 1DRUA 3TNDA 1PTJC 5B30A 4QDXA 3E35A 4KUHA 5BVGA 5K9ZA 3NOQA 3ER9A 1YS2X 1PUXA 2P11A 2QYSA 2W6ID 4KPYA 2P78A 4LBZA 2ZRFA 2DSNA 4IZIA 1MG0A 2G6TA 4MROA 4D45A 3WDKA 1E0AA 4HRXA 3TW8A 1Q7TA 3MRXA 4M8LA 2CEKA 3SF0A 3U1VA 2W42A 2P68A 1G4UR 3EFOA 1HQCA 1O94A 5AWFC 4I5DA 1NIPA 2EZ4A 4TVKA 3FPJA 4MAMA 3BFVA 4KO8A 4YAGA 1WXFA 3GJ3A 5CDSA 1EUDB 2JI7A 5KOHB 2QRLA 5ENZA 5C7YA 1E2BA 3BJMA 3IEVA 4QDZA 4HEA1 5EKXA 1R37A 4WW0A 4ZGWA 1STOA 3ZY2A 3QLVA 4LVCA 3BMCA 4WDRA 5F7JA 1OF1A 4CKCB 4IIJA 2PT5A 5D51S 1BFUA 3ESQA 4BQIA 5I3CA 3RFXA 1J99A 2CNLA 1O9HA 1RYDA 1QIIA 4EKEA 3B53X 1XMXA 2YXEA 1X94A 3FHCB 3W4KA 3KSAC 4NYJR 1DXQA 2ZRCA 4TLBA 1T91A 2QIOA 2M6LA 4KQXA 3SXUB 3ZHVA 2BHTA 3IT0A 1EQUA 1U1GA 2JLXA 3N87A 2P9CA 1WMFA 1NDQA 3MJDA 3DFZA 4I99A 3V4SA 3OQOA 4UM8B 3P2YA 4BLUA 2PANA 1IZ8A 3X2SA 2EQBA 2CVZA 3R3WA 3GCWA 5GMOA 3ZNPA 3BSSA 4GEKA 3GCGA 1Q7GA 4JLKA 1XX6A 3RIYA 2V3VA 4FCVA 1E9DA 1OJLA 3L7CA 1VCNA 1ZU4A 3KQMA 1Q91A 5DB4A 3F4KA 1RDFA 3M8KA 4NEGA 3UFXA 2UUBB 4WRRA 1R4MA 3F6RA 4BV2A 4YHBA 2DHRA 3FG9A 1F1BA 1DELA 4EG6A 2VDNB 4GRDA 3EW7A 2C42A 2Z8XA 4JUCA 4BQPA 2MSCB 2ZWIA 3M2TA 5DASA 2FMTA 1CPYA 2FFRA 5A2QA 3H5IA 1K7CA 1YJCA 2IYXA 4BIMA 1M73E 5DGCA 3B78A 4PS1A 5AJUA 5KYUB 4K6FA 2VTBA 3WLLA 3KELA 5G3ZA 4LMBA 2ZR8A 1OZHA 1SWWA 1V96A 2I4MA 1A9ZA 3SIXA 4MW1A 3X44A 1JLKA 1GL9B 3JRXA 4IWYA 2TMDA 2ZDQA 4Z86A 1E64A 3ND8A 5IUKC 1WSBA 3SFTA 4E15A 1GSOA 4HYYA 1C7RA 4IINA 4X97A 4OKNA 1BS2A 2H2DA 2ODBA 4CMCA 5LYJF 1SC9A 1Y9AA 1P31A 4WA7A 3THXB 2ZSKA 4UU7A 4N40A 4C0LA 1GSIA 1YJ8A 2BVNA 2QA5A 1TB4A 3OLCX 4AIIA 1AA6A 4M8SA 2HMAA 2UYOA 3ET5A 3JWHA 4GX5A 4JJ8A 1PR2A 4ZANA 4JYMA 4WCFA 3GFFA 3IVGA 3QEMB 2X9QA 3QOWA 4XUDA 2AEJA 2PKEA 1SCUA 1GZSA 1L4EA 4PCAA 4YEDA 1F38A 3B3QA 3EUAA 1GEGA 4U7GA 3A9UA 2WIKA 5EI5A 4EHLA 5BQ3A 5EIOA 3G2LA 4L22A 3FW1A 3O8NA 1OX5A 3HBFA 4KE9A 4IVPA 4ZAGA 5F1OA 5CNKA 2R1TA 1S2MA 2IOFA 4M6WA 3A2MA 4R3WA 3I1IA 1D04A 2OCXA 1KEPA 2WNHA 3Q7QA 1QOQB 4FEYA 4WACA 5IDVA 3ET4A 4YHHB 1T2NA 2YHUA 4PX3A 1KFEB 1Z7GA 2IEBA 1RRVA 1CETA 1DWQA 5BSTA 1KI8A 3UPUA 4Z9FA 1CUUA 1NN5A 1QAOA 4YRDA 3VKVA 1R0CA 4QIHA 3IAHA 2EW2A 2B98A 4DNFA 1QHGA 2VPTA 3LY7A 5DE3A 4RKWA 2TMGA 3DONA 1IHUA 4L02A 1VCOA 5B4VA 3I8XA 5ALQA 3MCUA 2XLCA 4R6WA 1EWYA 5FWNA 3AF6A 5JG7A 1LPNA 2AFHB 2BCJQ 1HURA 3FFBA 3HUTA 1N34B 4Q3EA 2V9ZA 4YCCA 4KH1A 2NAFA 1HDYA 1VG8A 4FEEA 1N8TA 2FUCA 3O2NA 2H2HA 5DDIP 1L5MA 1A4RA 3WK9A 4C04A 1N7GA 3HJAA 4PRKA 4C2TA 3DFMA 1NVVR 1ZUHA 3UH0A 1WS6A 4ZOLF 3VZDA 3WIDA 1M34A 3CUSA 4WEQA 2X3YA 5AW8A 1CE8A 4DLWA 2O2ZA 1XLTA 3QWFA 2GZHA 1YDWA 3N7TA 4LJ9A 1QPZA 1GILA 3ASVA 4P0QB 4JEIA 1K88A 3TQOA 4CZ2A 1J90A 1G6KA 4JVMA 1N7JA 3CW8X 3MJFA 1UC4B 1X38A 3I0ZA 3VR5H 4C22A 1HFKA 1R9MA 2IDJA 4COKA 2ET6A 3PCTA 3ZHTA 3L6BA 1WWKA 2OBFA 3LQ4A 5ELMA 1TU4A 1K8YB 3LLSA 3PFGA 3MYYA 5B6PA 4P81A 2FW6A 3L8ZA 3HKEB 2PG3A 5DOZA 1U2GA 3DP9A 3WK5A 3SQWA 4QRDA 3KQUA 4CQNA 3R0JA 2QR3A 2XADA 3L82B 3BIOA 4AM8A 3EQ9A 4CLRB 4C3VA 3L8FA 4BATA 3I2JA 3LWZA 6ADHA 1M2FA 2EZ8A 3TEFA 3VR0A 4QULA 4B83A 4R8KA 2XCUA 5DGTA 2X76A 2VTEA 2HV8A 3TD2A 4B3DA 2ZR0A 5EIAA 2ZR9A 1NZDA 1QH8B 4GQBA 4B7ZA 2JGMA 5TXGA 2ONKA 4QYXA 1BSVA 2F6RA 3VPHA 1QE0A 1XDZA 3RC7A 3EA4A 4CM1A 4EW2A 2XCRB 1E3WA 1Q7EA 5L3QB 1YVDA 3K5IA 1OX4B 4L3OA 3QG5A 4ENSA 3H2JA 1HYHA 3EGCA 3ZV5A 3IAS6 3RKRA 3HSSA 3PKZA 3RADC 3EVGA 3QHPA 3OG9A 5CMLA 4OLAA 3DOIA 2CE7A 2FOLA 1M2VB 2C82A 4J8PA 3BXXA 3QXGA 4MVJM 1H5UA 2R8RA 3NHFA 4OQXA 3MQ2A 3AL3A 1M5UA 4KACA 3C8DA 3RREA 1L5RA 3IEXA 1Q92A 2YX1A 5LP6B 1L5QA 4FI3F 4GPEA 1AA9A 1L4FA 5F4ZA 2ID9A 5FFNA 1W87A 5LKRA 1BKDR 4X20B 4D97A 2ISSD 4UNQA 3QSGA 3WMEA 1EEXB 4P93A 4CI0B 3EWIA 4UMEA 4FDVA 2O59A 3FPEA 1TGYA 2VF4X 3LZ6A 1HBJA 1K8RA 3FCUB 1QCZA 3JZMA 3WIEA 5JQGA 4F5WA 1CY2A 4JDPA 1JPJA 4Q9DA 5FA8A 3IE0A 3LRPA 1WZNA 2DHCA 1H8HD 2IYVA 2WMNB 1Y7HA 1NOJA 1YRAA 4HDKA 3VR6H 4ZAFA 4INAA 1V7QA 5GAJA 3UCFA 1BVUA 1L5YA 2J6IA 2UV8A 3FB4A 3AW9A 3HGQA 4CUJA 4DV0B 3GRUA 5TEVA 2PTGA 3F2VA 2V59A 2FRDA 3G2JA 2Y9PB 1KO5A 5DNAA 2HWWA 5B6JA 1A88A 4LGCA 2FR0A 3KHTA 1FMCA 3HXPA 3UHAA 1W6RA 4H3HB 4YP6A 4KGXA 3VGPA 4TLCA 3WIVA 3D3WB 4K7JA 4TV8A 4CCSA 1UADA 1CUCA 2DLDA 4PG8A 4ZN6A 2R8OA 1FZQA 5BSMA 4XPZA 3FPKA 4MVJF 2IXGA 4J91A 3Q7SA 2MTBA 3UUGA 4UARA 1ENYA 5AIAA 4AJKA 1CUFA 4KX3A 2I99A 4GSYA 5BV0A 1NAHA 1ZMRA 2A0KA 2AOVA 2WVHA 1GRQA 3IGFA 4FB4A 4FD2A 3UBMA 1PWZA 1U9JA 1M9NA 4X62B 1PDWA 4Q93A 4LJRA 1XK6A 4NQRA 4RDCA 3UK0A 5H81A 5KS2A 3CEAA 3NMUF 3FPAA 3TMYA 2ZB2A 4MYSA 1Z4NA 2IA5A 4UDNA 2C9ZA 2O3TA 1G2IA 4DWVA 4YJKA 2WUGA 3QOFA 5EZ5A 4M46A 5ESWA 5IJAA 5IYZF 2EZ9A 1U7XA 1VYUA 1XD2A 3KNZA 4FYKA 2NNWB 2UUPA 2V74B 2BMVA 3STTA 1R8YA 5KJEA 3WP1B 1OXVA 1WAMA 2ACWA 4EGQA 2DB3A 4RIFA 1RWOA 2OC9A 2Z9BA 4NK5A 4BEJA 1I10A 1U0JA 3HDGA 3UTDA 2PWAA 1MJNA 1Y0BA 2P2SA 1PNQA 4MW4A 5FUBA 3SFVA 4GMKA 1VHTA 1YB7A 4NICA 3C3PA 5B7PA 3IPCA 3QVTA 3TQFA 3ZDBA 2XV1A 3A1WA 4NATA 3R3XA 1UZNA 1UBGA 2P2NA 1PGJA 4Q16A 5CLGA 1D0IA 3RNLA 1MRZA 1PQYA 3BE5A 5I9MA 1GSAA 2AR9A 4N3NA 2P1RA 1OYYA 4US0R 5C81A 5CFRA 2H7YA 4G4GA 3K72B 2H4JA 2J3IA 3OE1A 3WYGA 3LUFA 1SPBS 2O2EA 3A4TA 1U02A 4DCJA 1ZOLA 2AJCA 2GBGA 3VU0A 2XPCA 2IYLD 3P19A 5F33A 3NM6B 5A02A 1UXGA 2ECKA 2BGIA 3FI0A 3BKWA 3W3AH 1U9CA 3ZLBA 1MVLA 2ANCA 4EKNB 2AYXA 1RCUA 3A0RB 1OW3B 2FMXA 1RVV1 2V5UA 1U3GA 3DAOA 3QJGA 2WT8A 3MEQA 2QUHA 2PA0A 1GXSA 1W581 4RDHA 4PYKA 3PGA1 1JEJA 1TTPB 1HRDA 2M6RA 3GH3A 4V3BA 2J7PD 3P96A 4JVLA 2ZAYA 1MIOA 3LP8A 4Q1CA 4TV9A 3WGJA 2OGUA 2R6FA 1FDWA 3ZBUA 3BORA 4DIDA 2R6GA 1Y7LA 1V3VA 3D6VA 3HLKA 4PHHA 1NUQA 2PWYA 4QXRA 4BB0A 4UZSA 1QMPA 1ZA2A 3PC2A 2YASA 3ZC3A 4M83A 5IX8A 2VAVA 4Q5IA 4NZOA 5LU8A 5AKZA 3QIVA 1I32A 3GRKA 3HJRA 3DOFA 1WD5A 2AQHA 3VOTA 3FFTA 3GJ6A 3H2GA 4RIEA 5CDYA 2HYIC 1QYRA 1Z0IA 2C03A 3DG9A 3L0SA 2GYWA 2QTVA 4NJEB 2RH8A 1T29A 1T1SA 4XAQA 3CWZA 4HGQA 3C7KA 4MYCA 3C7CB 3KHSA 4F38A 5KJCA 1B3RA 2ZB8A 3BGDA 2ORED 1QLJA 2Q6LA 1IHYA 1CDEA 3HUDA 3K92A 4KLCA 3UMRA 3AEKB 1N0HA 3W05A 1K2WA 1TCUA 3AJEA 2RGXA 5CVEA 3DJFA 1LCIA 1NVWQ 3NTXA 2H85A 5HE8A 5IXJA 5K6AC 2EX0A 2WE8A 1YHZA 1XRQA 3DTVD 1FU7A 4I08A 3BFJA 1KJIA 1GL6A 3BD8A 3PA6A 1S2GA 4ZVQA 3B5EA 4TZKA 3C3YA 1LPSA 4RY2A 4IDAA 1QC5B 1TVMA 1GO2A 3AY0A 5EFOA 4ZCMA 2BE7A 1CZRA 2FGJA 3Q8WA 4WESB 4KWTA 1OFTA 3VBEA 3FPBA 1DIHA 4DNOA 1ZMOA 3L40A 1R0LA 2CUTA 4B85A 4ZQIA 4FB5A 1VIYA 4LPSA 4WCVA 4ETMA 4L3WA 3IV9A 3AHDA 3EEIA 3ZDAA 1TIKA 4OBEA 2J0VA 3IBTA 3LX5A 3H6HA 4HYEA 4S0XA 4X1YB 1BMTA 1XCPA 3ROKA 5DNWA 3H9BA 1CSEE 4B3GA 1EFKA 1KI9A 4FOOA 5GOTA 5C0OE 2H5EA 1LC3A 1U7TA 5KQMA 5LYJB 3SQLA 1OLXB 4BLPA 2X8JB 2B7BA 4QGBA 4PPGA 5B4UA 1S0UA 5JRJA 1YFLA 1UXJA 4HDSA 2UZ3A 1FX1A 5A7FA 1EX1A 4DEXA 5LP6C 3NWOA 1U3TA 1K3UB 1UMDB 3ETCA 4URZR 3WL6A 2HIAA 1PX0A 2DECA 5EJGA 3SEFA 3I5YA 1KGDA 2IX3A 1EXMA 4Y8VA 4GL4A 3VV3A 4ZOEA 2Y1XA 2ZFUA 1B8OA 3KYDA 3SSNA 4UBKA 4PINA 4JLVA 1CQXA 1R3DA 2AWOA 2LCIA 3C43A 1RMTA 5H9VA 1GYPA 3L0IB 3LZCA 4G0UA 5EWLB 2Z4TA 3ETLA 1ACLA 1E3DA 2GDZA 4GOOD 1G3MA 1I5RA 1E9FA 1ODJA 1PU2A 2H6EA 3GLGE 1TYAE 1OA1A 1J70A 2ZBQA 1PS8A 1ZG3A 2PYDA 3E9CA 3H17A 2FLKA 3NIDB 2R5FA 3DLTA 3FYCA 3OX2A 4WJZA 3TZEA 3IPRA 5HIKA 1CLUA 1C1DA 4MB2A 4XGNA 3ST7A 1O89A 4GSKA 4M9RA 3GLFE 4ZTUB 1G291 1QWSA 1BD3A 3P71T 4F2HA 3PQCA 4GR9A 1JEYA 1XXHA 1XZLA 4XX1A 3GPIA 1Q0QA 4KFRA 4XQGA 1PHRA 2HRDA 2Q8NA 3IPAA 1FOEB 4DLVA 5F3DA 1UBLS 1M66A 4A0RA 4CEHB 3MCWA 3BXHA 4BC0A 4YCJA 4ZCQA 1LQ2A 3NALA 1ENPA 2P9ZA 1E2QA 3LC0A 4XFKA 4WBXC 3OZRA 1KZHA 3REGA 5JAUA 4OL0A 1JEQB 2H1VA 1M7GA 4JP2A 5EYPA 3ZD9A 4URVR 2G1UA 3KT6A 3SR3A 4IFEA 1ZOIA 4A26A 4Y9SA 2I4RA 2RHGB 5K3CA 4MLDA 4O2AA 4IGKA 3VISA 3ZE9A 4N03A 4LF8B 1R8SA 2PSFA 3HB0A 4ZOLB 2ZKIA 5LYYA 2AVDA 2PX8A 1SXJE 4UTPA 2FPLA 4EJMA 2DAPA 2C3OA 2HU2A 3O1JC 1U4NA 4UUMA 5HZKA 2QOEA 4BO9A 3HV0A 3T35A 2P9HA 4G5HA 4MH0R 4BUJA 4I1PA 2QX4A 5FBKA 2QMHA 1CT9A 2GESA 3NBFA 5J9FA 1AQNA 1XMQB 4E03A 4Z9AA 4J7UA 5DN6D 1V2HE 2YW2A 1LBEA 5GGXA 4C0KA 1E1MA 1O95A 2KX7A 1E79A 2OCLA 3KU1A 1J21A 2JGJA 2X22A 2DXIA 3WRWA 3R7SA 5JZMA 3QWBA 1U90A 1BE6A 1B0AA 2O19A 4JK3A 4D3XA 1C1XB 2G28A 3HEAA 1G63A 2YCLA 3HXTA 3PFNA 4UDYX 4TS1A 4B7UA 4BP9A 3ORHA 5YASA 4YDRA 4B71A 5AJWA 3ENVA 1QTQA 4XSGA 5KZMB 5G1PA 2GFIA 3FPGA 4WK2B 1P4HA 1T8RA 4JFRA 1GGFA 2C9BA 4F3RA 4Z53A 1C14A 4MV5A 1X80B 3DVLA 4UXHA