5KC8A

Crystal structure of the amino-terminal domain (atd) of iglur delta-2 (glud2)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
406
structure length
398
Chain Sequence
b'DSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQTEKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTGVRKLGCWNPVTGLNGSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor ionotropic, delta-2
publication title Structural basis for integration of GluD receptors within synaptic organizer complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 136
structure length 398
sequence length 406
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kc8A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kc8A01
1DRKA 3SNKA 2QZJA 1ZHHA 4LZLA 4RK6A 3F7NA 3TO5A 2JVJA 3GA5A 3QEMB 4OBBA 1U0SY 3KYJB 1JWLA 1EAYA 4G0ZA 1RZRA 2QV0A 3OLZA 4G0PA 3UUGA 3HCWA 3H1EA 2J48A 4MR9B 4KQ9A 5DTEA 1TVMA 3G1WA 3T8YA 4EY3A 1S8NA 1ZESA 4IGAA 4OTZA 5EWMA 3IP9A 2Q5CA 1R8JA 4E7OA 4NQRA 3BBLA 3DLHA 3C3MA 3OO0A 2NZVG 3NNNA 1I3CA 3GRCA 5BRAA 2WRZA 3EODA 4Z9AA 3O2SB 3MM4A 2IPLA 4EYQA 1JYFA 3L6UA 4EVSA 5KQLA 5JS2A 1XWWA 1YMVA 2E4WA 2LP4Y 4MS4B 4DN6A 5EWLA 4LX8A 1LBIA 4KK4A 3UKJA 1BDHA 5CNJA 1VPWA 2MYTA 1DC7A 3HDGA 3NBMA 4MS3B 4RXMA 1OXBB 2GX6A 3IP5A 1W25A 3HDVA 1EWVA 2ZWMA 5IUKC 2ID9A 3LUCA 5IX8A 3GV0A 4W5RA 2QW1A 3QELA 3LUAA 4Z4EA 4RXTA 2FEKA 1QQBA 5E3JA 3R0JA 3RVKA 3CS3A 5C5EA 2PE5A 1PEYA 3O75A 2WJWA 1QO0A 4D6XA 1PEAA 2AYXA 1L5ZA 2O20A 3JVDA 3CHYA 3KCNA 5ABPA 3LOPA 3LUHA 3JPYA 3OLWA 3JVIA 2AYZA 4O1IA 3I09A 1KRXA 3CRNA 4Y9TA 5GQSA 1GLGA 2JK1A 2VYCA 3I42A 2WWVD 1QQAA 1MIHA 1JF8A 3GYBA 4PYRA 4TLLB 3CG4A 3EDCA 3RVMA 2BGGA 1M2FA 3B2NA 3IPAA 3H5OA 4YP9A 3BILA 4S04A 4W5TA 2OENG 1PUXA 2IDMA 1D5WA 2L19A 4JA2A 3RVLA 3BRQA 1U8TA 4IMJB 4OLAA 1YMUA 4ZJPA 3JPWA 2V0NA 1Z12A 2M1ZA 3Q41A 3JS5A 4B09A 4JOQA 4RS3A 5TQ0B 1QP4A 3KHTA 4KMRA 1C0EA 1TMYA 1YVUA 4GNRA 4H3KB 1Z2DA 3KKEA 3ROFA 5IEJA 2MSLA 3A10A 2NUBA 1VRVA 1NTRA 2JBAB 4LDZA 5D2CA 1TLFA 4EUKA 2OQRA 3GBPA 3QLUC 1DJMA 1KRWA 3DBIA 3GT7A 4EYGA 4N0PA 3O1IC 4G0YA 5KWSA 1C4WA 3NHMA 4NCBA 1A04A 4OG2A 3T38A 2JVIA 3K4HA 4LE0A 5KQMA 2FEWB 1ZITA 2JB9A 5IUJC 1BAPA 3OM1A 1JH9A 2WB4A 5JNRA 3KJXA 4RWEA 2FQXA 1AB5A 1UDRA 6CHYA 1DBWA 5JNUA 2ZAYA 5FWYA 4KNYA 1SD5A 5CNIA 1E6LA 5T3YA 2MSKA 4KPYA 3KLOA 4Q6BA 3KS9A 4P1ZA 3LKVA 2E4YA 5FWXA 3HJFA 1A2OA 4YO7A 5BR1A 4H60A 2CD7A 2PAFA 4MRMA 4NICA 3DZDA 2YHBA 1DG9A 2FSPA 3OM0A 2X7XA 4ETMA 1WETA 3RVJA 3LUFA 3C6QA 4FE4A 1DCKA 3TX6A 5HM6A 5TE9A 1ZGZA 3TMYA 1RNLA 3QEMA 1BVHA 2TMYA 1Z2EA 4D6YA 5JNTA 1NXOA 1NXXA 1MVOA 4FB4A 3T95A 4XARA 3N6VA 4EVRA 1HEYA 3GWGA 5KC9A 1ABEA 4MR9A 2FMHA 3FGZA 1OXKB 3QLVC 4RK5A 2LIVA 1MAVA 5KC8A 3S99A 3VNBA 3EAFA 1NY5A 2PL9A 1ZY2A 2IKSA 3H5IA 3OLVA 5KQPA 5BRJA 4RK0A 4Z0NA 4JB0A 4WXEA 4MR8B 2P9HA 4KV7A 4Q6WA 4G0OA 4RY8A 4MS4A 2WY2D 4HNQA 5CNKA 1ZGGA 2JVKA 2DRIA 5FBHA 4F06A 3LFTA 2W42A 5TQ2B 1YIOA 2FMKA 2A9RA 2WMYA 4P98A 5C5CA 1JFSA 1SXIA 3E3MA 5EWJB 1K68A 5JNSA 2A9OA 5I4CA 3D8UA 2FMIA 2R47A 3RQIA 5BQ3A 4O1HA 1USIA 4G97A 1DZ3A 2E4UA 4KK3A 3MIZA 2JRLA 3CLKA 3QX8A 3Q9SA 2IOYA 1ZVVA 3SAJA 3O1HB 4MQFA 1JDPA 4D74A 2RJNA 2GI4A 1U04A 2R48A 3Q15C 1Z25A 5EWMB 4MGEA 2GWRA 4RY9A 1ZH4A 3OMWA 3Q7TA 3HVRA 3ILYA 3JTEA 4YR7A 2FLWA 1MB3A 1QMPA 3HUTA 3HUUA 4ML3A 3OLXA 1URPA 1JHZA 4KFCA 2QVCA 2PUDA 3HSYA 5B3JA 4DADA 3KLNA 1D4ZA 1Z17A 4UHJA 2P4UA 4MLCA 3HEBA 4KZKA 2CHEA 3MMNA 3QELB 3GBVA 1D1QA 4YWHA 1SXGA 4Z4GA 2GKGA 3LMKA 4GPAA 1XHFA 4Z99A 4RSMA 5DCLA 4HNRA 1DP4A 2B4AA 2R25B 3F73A 3ILHA 2E4VA 3URMA 4Z4FA 4MS1A 1D2AA 3N75A 3GL9A 3LKBA 3RH0A 1QPZA 5DLEA 1YK1A 1ISSA 1YK0A 2RDMA 2JBAA 4HYEA 3FMVA 5CHYA 3OQNA 3SM9A 2VUHB 1KGSA 3CG0A 3EULA 5T7BA 4JASB 4TLMB 1PNRA 1JBEA 1J56A 2L18A 3O2QB 1QKKA 4WZZA 4ETIA 1FFGA 2IPMA 1P8AA 1NXSA 2HQRA 3O1JC 3T6KA 4N41A 3F6PA 1SRRA 2A9QA 4QICA 1JX6A 4RY0A 3KSMA 5KI6A 2FMFA 1EWTA 3RVSA 1GCGA 1D1PA 2FKAA 4IRXA 3LUJA 3CKMA 4JP1A 1GUDA 2B1JA 2R4QA 1DCMA 4EVQA 3DLBA 4MR7B 1YTUA 4KREA 1CYEA 1L5YA 4IMIB 5HSGA 4F8JA 3FFWA 4MYRA 1Z13A 1ISRA 2LUOA 2PUGA 3A0RB 1F4VA 1IIBA 1M2EA 4XLTA 2FLKA 5JNWA 4YGXB 4IILA 1JL3A 3CNBA 3QK7A 4TMYA 3DGFC 4XFKA 3NHZA 4LRQA 3VNAA 2PUEA 3H1FA 1QP0A 4G86A 3KTOA 1M5UA 5IBQA 3HV2A 3OMXA 4MPTA 4WT7A 4IF4A 1FFWA 4RK4A 1DBQA 1Y1LA 4LE2A 4HNSA 4RKQA 5IUNC 5F64A 1K66A 2NZUG 4KRFA 3RVPA 1JFVA 2YHAA 1ZH2A 3MA0A 5FBKA 5IC5A 2FXIA 4W5OA 2HQBA 3QLTA 4G0MA 5TPZD 4PICA 1F51E 5TPWB 4ZYLA 4RKRA 3C3WA 2FVYA 4N0QA 4YS6A 3I5AA 4MR8A 4N76A 5DKFA 4W5QA 3I45A 1TJYA 4M88A 4MQEB 4RK1A 2H0AA 4PE5B 8ABPA 3O74A 3F6CA 4OLBA 2ID7A 3IDOA 1JFTA 3L49A 4MRMB 3N0RA 5DGCA 2IYNA 2PJUA 5TQ2A 4RU1A 3HK2A 3MF4A 5JNVA 2MYNA 1USKA 3H75A 2HJ9A 3H5LA 1P6QA 3MQ4A 3RVQA 3N8IA 1GUBA 4MS3A 1APBA 4ZPJA 5CNMA 1NXVA 3QEKA 3RVNA 1E2BA 2FQYA 2IPAB 3M6MD 3M9WA 5IEBA 4Z4CA 3HM9A 1FQWA 3KYIB 2H3HA 3HS3A 3M9XA 1LBHA 2FTKE 3N53A 4MLDA 1Z26A 2GBPA 3O21A 2QVGA 2FN9A 3CZ5A 4EGSA 1XHEA 4Q7EA 2LBPA 4F11A 4YCSA 2M98A 3OQOA 1LJLA 1VKRA 6ABPA 1ABFA 2F8SA 2VK2A 2NT4A 1BA2A 1B00A 1AB6A 3CU5A 2KYRA 1QNLA 2JCGA 3A0UA 3IPCA 4WUTA 4RXUA 3N0XA 4LE1A 4WXMA 1NXWA 4H3HB 3QLUA 3FFTA 4ZMSA 1P2FA 1H9CA 2MSWA 4O5AA 2L17A 2NT3A 4NV3A 1FFSA 5EWLB 5TPZA 1VLZA 3D02A 4N47A 2QSJA 1U2PA 3O2JA 2MYUA 1E6KA 3RVRA 1DCFA 3H6HA 4EYKA 9ABPA 1JDNA 2XDYA 2PMCA 3H5VA 3HO1A 3TD9A 3EGCA 1M5TA 5JS1A 3Q7SA 4XXHA 1Z18A 1ZN2A 4MQFB 1JYEA 2PUCA 1U2QA 2IPNA 4N03A 3IP6A 1KMIY 1RXEA 3TB6A 1PHRA 3CTPA 1BDJA 5TQ0A 1P6UA 2CWDA 1DC8A 3E61A 1EWKA 3EQZA 2N9UA 1ZDMA 1RXIA 3W9SA 4YV7A 4ZMRA 3EJWA 7ABPA 2QR3A 3LTEA 5KQGA 4NCAA 3SQNA 3Q7RA 1ZAYA 3SY8A 2HSGA 1JLKA 4L85A 4WWHA 1QP7A 3NNSA 3OLYA 4KQCA 3ROTA 3CFYA 4PZ0A 3UK0A 4L4UA 1MB0A 3LUKA 3HXMA 3C3KA 4ETNA 4CBVA 2HQOA 3QX9A 4LDAA 3H6GA 3JY6A 1SXHA 3QLVA 2I6FA 3OQMA 1BDIA 4W5NA 4MR7A 4TN5A 1NXTA 3G85A 2L2QA 4S05A 4F3TA 3C97A 1GCAA 2A9PA 1CEYA 4G0QA 1E6MA 4XAQA 1DRJA 3SG0A 1EFAA 1LK0A 3P9YA 4MS1B 4XASA 1T34A 2QU7A 4KVFA 4JB2A 3LUGA 1RZRD 4QYWA 1CHNA 3A3KA 2VUIB 3K9CA 4RDCA 1W9HA 4Z4HA 3FFXA 1USGA 2RGYA 3OO1A 5PNTA 3BRSA 2LPMA 4PEVA 3MYYA 4QYMA 2F8TA 3IP7A 2PLNA 5B3JC 3DGEC 1FSPA 2PUAA 4RZSA 1EHCA 1Z16A 3CZCA 4F12A 5HKOA 3H5WA 1NATA 2HPHA 2QXYA 2RJOA 1DBPA 3NNDA 1LJUA 3N0WA 5GOTA 5TPWA 1YS6A 1PNTA 4FE7A 4JAVC 3H5TA 3HZHA 4MAAA 3FDFA 1TM2A 2PKXA 4G0XA 2FQWA 3H1GA 4YLEA 4UHKA 1RPJA 5FWYB 5HQJA 2FW0A 5IULC 1NXPA 2E4XA 4MQEA 2WJAA 3KG2A 5ED4A 3BREA 2PUFA 2FEPA 4EYOA 4OATA 4RK7A 2FN8A 3LUDA 4E7PA 5FWXB 2PL1A 1A0OA 4Z4IA 2CHFA 4RV5A 4YRZA 2MYPA 1QO0D 4Z9BA 1YS7A 4DQDA 5TQJA 2E4ZA 2PUBA 3EQ2A 3RVOA 1Z15A 5EWJA 4QPJC
chains in the Genus database with same CATH superfamily
3QF4A 3ORHA 4L0CA 1QGDA 4RORA 3WX0A 5FIUA 1MNAA 1QOZA 2FQQA 3DP7A 3KYCB 1UBFA 1IC6A 3PKIA 4LC0A 2FOLA 1P44A 2GEDA 4Q34A 4O3FA 4L6CA 3RS7A 3TE7A 1ENZA 2FR8A 4ZO6A 3SYMA 1UFKA 4YV2A 3TF5A 1G7TA 2GPWA 2QRGA 3KUCA 4N18A 2Q2OA 3UUGA 1RACA 4A73A 1AQJA 1CY8A 1ZM2A 2J48A 4KQ9A 4YCAA 1WTCA 2WUDA 4UAUA 1K3TA 3ICOA 3C3XA 1VIAA 1A96A 3LBIA 1EFCA 3TTVA 3V5NA 3IUQA 3WHKA 1T0BA 1U1IA 1BU5A 3LXMA 3BFJA 5GV8A 1AKRA 2WRZA 3CNOA 3IKVA 4MUNA 4P53A 5AKJA 5JQGF 5DNVA 3BF8A 3KAJA 4G65A 1L7QA 4GPBA 4TWIA 1CQJB 4DJFC 1KK3A 3ADDA 3U7RA 2DTDA 4GGPA 1L5RA 2A86A 1M2GA 4FT4A 1TC2A 2XVAA 4Q47A 3BXFA 3ZVLA 3L93A 2JAPA 3G88A 4PTZA 2VR1A 1P75A 5DTJA 1WW8A 3LE8A 1X6VA 4HAZA 4JVLA 3A4MA 3ADBA 1KI8A 2JGIA 4U6QA 2E21A 1Z4IA 4PGHA 2G9VA 3DV0B 4MDYA 4XYGA 4YCBA 4UD2A 5ALOA 3RJMA 1TD1A 3RVKA 2DEUA 3WP0A 2TSYB 3O75A 4JJ8A 1X7ZB 3T4PA 2XJ4A 2P35A 1MV5A 3U6KA 1U9JA 2I1WA 4XIGS 4YK7A 3IJPA 1C8KA 2VP3A 3KCNA 3AEXA 3FOBA 3LUHA 5D3KA 5AH0A 3SXPA 2XMGA 2BSQA 1XRMA 2O0LA 1Z0AA 4PIPA 5KKCA 1QIFA 2C84A 1R8SA 1QE3A 3B3GA 4BNXA 2OBMA 3TECE 1MIHA 2ZJ3A 3F49S 3RRBA 3GGDA 2UYOA 4TLLB 2GAIA 3AK4A 2CFOA 3IR5A 5AKYA 1M7GA 1YU9A 1Z22A 1UJMA 3GAZA 5DNEA 3QTTA 2IYWA 1JLLA 1XE3A 2VFAA 4KPFC 4BMDA 4MA0A 4IDCA 5BP7A 1XPUA 2PGLA 2XUIA 2X86A 3DFFA 1X13A 4M9QA 5I9SA 1JIQA 1IHOA 1N32B 1U8TA 2FUNB 2PGIA 2PKQP 2QUAA 1VECA 2WYOA 1K3UB 3C74A 3H1PA 3O31A 3NANA 1RZ3A 3Q41A 1W1UA 1YUBA 2OKCA 3NBUA 4G0VA 4B74A 1M0EA 3H9CA 4LJ7A 4C3UA 2R8EA 2ZGVA 2ODBA 2O8DB 3UATA 4O4HA 5JS6A 4UFPA 4BXOB 4R1TA 1RRCA 3KAKA 2AIRA 4HQRA 2MSLA 1K2VN 3ICVA 4Q9NA 1GN9A 2JBAB 2PUWA 2ZJ0A 3ENZA 3KP1A 3PD7A 1KI4A 1ZH6A 4OF4A 4I3GA 2QG9A 2H7XA 4L9SA 3TDMA 3LPNA 2WZQA 4D80A 2G1JA 4ZHQA 1YSCA 2A5JA 4EMBA 2JJ1D 3PQEA 2GHTA 2ZJ2A 4N0PA 4RJIA 4FYYA 4D8UA 4B79A 4IQ8A 5CAEB 2I6GA 1RJ9A 4BOYA 1F0PA 1S0UA 2FHPA 3FDXA 5B57C 3OESA 2BI8A 3U3KA 1BROA 3DEIA 4MZDA 3D3EA 1ODSA 1P0CA 4CDRA 4D1YA 4WN9B 2A8YA 5SYAA 1ICEA 2L69A 1O87A 2OCYC 5I7EA 3GJ8A 3VI3B 2JLVA 1Y33E 2NXCA 2PMEA 3W3AA 4HQLA 2YMPA 3OQIA 3KETA 3KE9A 4WESB 1MRSA 1U28C 2Q5LA 2QN8A 3K1AA 1EB8A 3NUQA 3PXDA 1QIHA 1G8MA 4XWKA 1W581 4RADA 4E88A 2A78A 2C8KA 4R8VA 1RR6A 3H97A 2QLMA 4CKBA 1FP1D 2OHGA 4JT9A 2IBSA 1Q83A 4ZRDA 1AVTA 3W90A 4LOIA 2IV3A 1G55A 5AQ1A 2OYSA 1QQ5A 4GS5A 4IKPA 1KO4A 3C6QA 1J22A 2QPTA 2WM8A 2BKLA 1L4LA 1DCKA 3QU9A 5ELXA 1L0BA 4B7ZA 2EX1A 3KEQA 2X0JA 3SZUA 1RNLA 2PWYA 3F5DA 4CN9A 1J07A 1JFFB 5L51A 3IVMA 4IQGA 1YB2A 3L7NA 1I7PA 1K8RA 4IMRA 1NW3A 1WX1A 2YJ3A 3T95A 1AD2A 5LBUA 2G9UA 4PZZA 1Z4MA 3IE0A 5EJMA 1CUBA 2BRUC 3A26A 4Z7OB 4BNDB 2C4VA 3BHJA 1E3WA 2Y93A 1Z73A 3AEYA 3P8ZA 2IS6A 1ZNQO 1I1QB 3L77A 3IMKA 2EU8A 9ATCA 3RT1A 4QPPA 1NW9B 1Y80A 2WV7A 3G0CA 1OSNA 5LPNA 3R5SA 2PJDA 4F72A 5K20A 2ICAA 1YA8A 4WXEA 1W44A 3PBKA 4TL6A 1MC4A 1MUUA 2ZUUA 1II9A 2CXQA 1ZLYA 3SVZA 1K0UA 1J5PA 4QOSA 4XDHA 3PEYA 1F3LA 3AETA 2RGUA 4QULA 4WEQA 2CCKA 3OOHA 4AW9A 2C7PA 1H8ED 1RAFA 3OZIA 4TV8F 2R4TA 4CN8A 3VR4D 1ZRHA 5JNSA 2A9OA 4G67A 1BIFA 4KVZA 2QAGA 4C1BA 3V3KA 1BGXT 4OJYA 3M1YA 4WK6A 3LV8A 4MLZA 2I0FA 1U0JA 3A9CA 1JDPA 3L1HA 1UDWA 3OQBA 4LA4A 1UK7A 2HLDA 4DMUB 1IVNA 3ZYCA 2ZQZA 2D74A 3KNZA 3L8CA 4ZGBA 4LBYA 2F48A 4UVIA 2HHJA 2RJ3A 2ZYUX 3E5RA 4CV2A 4NMHA 1UJBA 4P5EA 3GP5A 3UCFA 1OX4A 4E30A 2PX3A 2SICE 2Y9MB 4TLEA 4YPVA 3QI7A 4EKGA 2C54A 4BNFA 4YR7A 1NURA 1SUIA 1IN4A 4ZANA 2A57A 3LCCA 3EPHA 3OUTA 4GI3A 4DQVA 3I37X 5JY6A 3HXOA 3V1NA 2R6AA 3OFSA 2H9AA 5DSXA 4AIRA 4F3RA 4PZEA 4XVCA 3KLNA 1H23A 2QHXA 3VTZA 5DZSA 3TQSA 4QNMA 4X85A 4DWWA 3GLFA 3PUJA 1E2QA 3ZIAD 2W2OA 1PL6A 1C0LA 1T4BA 1BHSA 2M2IA 1L4KA 4EUNA 4RPJA 1DV1A 2QTTA 1G5TA 3QBVA 1FB5A 3E58A 3RI3A 5CLLA 1KI6B 4RPHA 2XBLA 4ZZ0A 2V8BA 5AP9A 4OX9Y 4YRKA 1CY1A 2GKGA 2B1QA 1M2JA 5JVDB 3ZCPA 4HWOA 1IJBA 2FW6A 2JD1A 3TM4A 2OHHA 3AJRA 5FI1B 1P2TA 2JFYA 3L8HA 1ZHFA 4QTTB 2PV0A 1ISSA 2RDMA 5AHWA 5L3ZA 1TVEA 3UJ7A 1XCOA 3ZJYA 4P81A 2OCPA 4C3OB 2H0RA 3BB4A 3L6RA 3OPXA 3W6ZA 2Z04A 3K9BA 4CTKA 3EVTA 3LQRA 3COYA 1EUCB 1OXUA 3MSCA 4OSEA 1EDZA 1Y3DE 2DBQA 5FORA 2LKCA 4PLPA 2XKBA 1D7AA 4FX2A 2EQBA 4JB8A 2WR8A 5ALSA 1ZKDA 4ZO8A 2A9QA 3HA3A 3HL4A 1CUAA 4FOLA 1J21A 2Q6LA 2P1ZA 3UXHA 4HQOA 2QKYA 3QEOA 1BVUA 1KJJA 5BMVB 1E9BA 4C7OB 2B2XA 4CKEA 1IPFA 3TSWA 3UEOA 5B3LA 3VKWA 2WKWA 2WTAA 1C2YA 4HRAA 1GDHA 1CZLA 1NQOA 5BT9A 3QMWA 4MR7B 1RAEA 3G9XA 4PYNA 3EAGA 1XRSB 1V6SA 3LWZA 5AUPB 5CXQA 2WHEA 1AUXA 2Y68A 3CJQA 2I7XA 4IHQA 4Q00A 1VKJA 1V8BA 5EXPA 2ZJZA 4WASA 2J31A 4XX0A 1F4VA 1IIBA 2OFFA 4YFYA 4I9UA 3HZRA 4YGXB 4U3JB 3ORQA 4REQA 1QWSA 1WDTA 3D2CA 4IVRA 4R3UC 1CLUA 3KZVA 2H08A 5AM0A 2WJIA 4ZAGA 4C5BA 4Q0MA 4RSGA 4XYBA 3SC4A 3OMXA 3U26A 4MPTA 4EHHA 3STUA 4BZXA 5CG2A 2HYIC 5D51S 3RTAA 5SY6A 1RWOA 3ICCA 4KYIB 4X6XA 5JAIA 3PXUA 3TJMA 2A4MA 4ZT3A 3JWGA 3LLSA 2IIVA 4GI7A 1VXRA 5KOIA 1K6JA 3PFFA 4X20B 2CJPA 2EKBA 2GF2A 3OFKA 2PRKA 3DUWA 1SHLA 4GBGA 3EN0A 5KAPA 1IMJA 2O8EB 5E7IA 2I7CA 2CJFA 1D2MA 2M9MA 1GVNB 4JJFA 5LR6A 3P45A 2D2FA 2GCGA 2VNKA 4XRRA 3IDOA 4UAJA 3S28A 5BR8B 4MJ3A 1LQ2A 2WWXA 3N0RA 1IULA 1ZW6A 4GICA 5LMCA 2PG3A 3DS8A 1X9GA 1B1CA 3VYSB 2VDWB 1ZAKA 1NMEA 1NBEA 2EIHA 2IYUA 3I0NA 2RGNA 1CD5A 3NIBA 4RWZA 4WCFA 3I9OA 1WMDA 3FY4A 3IIEA 3KXIA 2IY9A 2WWWA 2CNBA 2O7RA 4A8JA 4AJPA 2VSFA 4D5EA 3HKBA 4CLOB 1PR9A 4V3CA 2R3SA 3HS3A 3BFPA 1VL6A 4MIEA 4OJTA 3A9SA 1OPXA 5DBOA 3VNVA 4UEWA 2R66A 4Y2YA 3PXGA 4TV8A 4YCSA 1FA9A 1CJVC 2PRYA 3ENWA 1Z8FA 4RVFA 4IHKA 3HJUA 4RHXA 3V2HA 3TEFA 3CX4A 4FIDA 1Q0SA 4IWNA 1F60A 4P93A 5DN6D 1V41E 4D25A 3I9V6 1VIMA 5IRCD 3EIHA 4B0PA 2FU5C 3RS9A 2QBYB 4RIFA 4UUNA 3WGNA 4UOEA 5C9ZA 2R8XA 3P52A 1Q77A 4KUGA 1RWPA 1JDJA 5EWLB 2HLNA 4WY5A 5FBRB 5FTWA 4M1QA 2AOWA 1XQ1A 3O2JA 3DKKA 2NXEA 3V2IA 2BTOA 3HXPA 2BFOA 5DW0A 4BQPA 3A9WA 1J2YA 3CE6A 3ESQA 2O1SA 1KK2A 3FBGA 4EYKA 1G38A 3C5VA 3M7IA 3GK3A 3KCQA 3W79A 3GYGA 1COWD 3GJZA 1RQNA 2IDZA 2VRNA 1XZ8A 2OBXA 4HL6A 4RFSB 4N03A 3B6JA 3SZOA 2ZWAA 2XTNA 3E9NA 4DWOA 4JFAA 3D6UA 4D99A 4P0QB 4TYYA 3G23A 4KBYA 1CTQA 2XZOA 1I80A 1UKEA 1UXJA 3PRJA 3DFIA 1UJ4A 1Y4SA 1YRQA 2QMHA 2QTWB 1I6MA 3WOVA 2V7GA 3IEXA 4NPAA 7ABPA 1QRDA 4DV1B 2R8OA 3LZCA 2YOHA 3BJIC 3E70C 2FI1A 4N40A 2FWPA 4HYQA 2V7PA 5AK3A 4EA8A 1ESMA 3PR2B 1TT7A 5JPCA 3AUYA 3QEBZ 1YAJA 3EZYA 1XPRA 1ZAYA 5DHTA 2IYAA 3LCJA 5FJIA 4YIHA 2C7VA 2JLCA 3QPVA 1KKUA 2QM0A 2XT0A 2R9VA 3U1TA 5ITSA 1E66A 1WD5A 4UARA 3ROTA 2QRLA 3RUFA 2G09A 4IDNA 3BQ9A 3U56A 3WFIA 1A50B 4POAA 4ETNA 1I0ZA 4JIMA 5CHEA 2I7TA 2FCRA 2PH7A 1ODKA 1WDLA 5DGIA 4ZALA 1E9AA 4WQMA 1KH3A 1NXTA 3ZVRA 4F3TA 2XT9A 7REQA 4UUQA 2WWFA 3U81A 2ZJFA 3QU4A 3NYRA 1O6GA 4OQPA 4DZZA 1AGYA 3VPCA 2YC2C 2NZXA 2ID8A 3JQ8A 1E2PA 4HUQB 5HCUA 4BAZA 5EINA 3EC7A 3BMQB 1X8JA 3W2IA 3V7FA 4Z4HA 2H4WA 5IJZA 2O6LA 3VSBA 2W2NA 4CCYB 1UJ6A 2LPMA 5FO0A 3W9UA 4LNHA 5INTA 1Z63A 4ARZB 4ZOAA 4L0MA 1L7PA 3FYTA 2CNWD 3MOSA 3OCWA 2G5CA 4LHVA 5DGXA 2CKMA 2WE7A 1E0DA 1X8LA 2YWRA 1G21E 3RC7A 4F4IA 4TPKA 3DPIA 3N8GA 2BMVA 2ZDHA 5HKOA 1WS6A 3PJDA 1VZ3A 3VH1A 3FOWA 3LL4A 5EHGA 3ZWKA 3ESRA 1QONA 4BKPA 4DOMA 3A9RA 1C14A 2GEKA 3EXG1 2X8LA 3G8BA 4LDRA 4DIBA 1Z5UA 4WXRA 2QMZA 2QTMA 2W43A 3HGTA 4X71A 1WLYA 1OYVA 2FW0A 4PN7A 5CA0B 2WJAA 1PJTA 1NYTA 3BREA 4DLXA 1UDAA 1C9MA 3JWPA 5A3JA 3C4JA 1BKDR 4ZVSA 1RKXA 3G2KA 4PXAA 3RSHA 1GGEA 5IBPA 4NENB 3F6SA 3UWPA 2J5XA 1KYZA 1UBCA 2P9JA 3AR7A 3DT9A 4O2RA 5EHQA 4GVXA 3C1AA 2C8LA 1JA9A 3UAWA 4NE9A 3ZHYA 4RV5A 3TL6A 1YB7A 5I7VA 4GXQA 1E64A 3GIWA 4B33A 4F60A 1ZBDA 1N2CA 3ORRA 1JLMA 1JGTA 2ZSFA 3TR6A 3W6UA 5KTMA 1CXZA 1U0TA 2ZYGA 3GA5A 2VHCA 4HTFA 4RZXA 3RFFA 2Q6IA 4CQMD 1SC4A 4MKGA 2BTQA 1NYRA 2HBQA 2C5GA 1Z4KA 1E3JA 3HHPA 4G0PA 1H0RA 2Y4NA 4KPUB 3C8HA 1GA4A 3HFRA 4BFVA 721PA 4DLLA 5JEEA 1GTVA 3VXKA 3UOAB 1DIOB 3RABA 2YW2A 1P9OA 2HSEA 5B6PA 3DNMA 3NVMB 1CQIB 3C70A 5CT6A 1UWLA 3C3MA 1X7YA 3W5DA 2G3YA 2X7HA 3EVGA 3SFVA 3L1VA 5BRAA 4AJ1A 3IOMA 2W6ID 3O2SB 1VJ0A 4ALKA 5BQOA 3B5JA 1UM8A 2OQVA 5FLKA 4B8WA 3MWFA 1OWNA 3ML1A 1YI1A 4ZVKA 4IJ5A 5CYOA 3D2LA 2F8MA 4GL4A 2Q3CA 1ZD1A 1BTOA 1VPWA 2MYTA 2FEAA 3AHFA 4XB1A 5TF4A 3KQLA 1NBMA 2FFBA 5I47A 1FL9A 1RIIA 3T61A 3MGBA 1LPSA 3CZAA 3NFYA 3GXBA 1VJDA 2PSJA 2VXBA 5IDYA 1LXCA 3SZGA 3VSAA 5KHLB 1KEEB 5EMKA 4CYMA 2AVNA 1U2EA 1Z0UA 5BQ5A 4M1EA 1WW2A 2PX8A 2C5BA 3FB1A 4BNVA 5M2QA 4BLWA 1L7AA 4XGIA 1G4UR 4BLRA 2PE5A 1ORTA 5HQ3A 2IODA 1F2UB 1Q3TA 3HYNA 1Z6YA 3L6EA 4GHWA 1YMQA 4P4TA 3FPFA 4LIPD 4QU8A 1WU7A 1OAOC 2AYXA 3EA4A 2YHIA 3OUUA 3QFTA 1LFAA 4NAVA 1WO8A 1C41A 1D2CA 3W5UA 1E7YA 1P2UA 4P32A 3CHYA 2Y76A 2XUKA 1SOAA 5JATA 5AESA 2ZZNA 1QORA 3JPYA 4JFRA 1QR2A 3HRIA 3JVIA 3NTOA 4N5MA 3SKYA 4C14A 4CTNA 1IK6A 4ZI2A 1TLTA 2OCDA 3OZVA 3DLTA 4IIVA 4EEZA 4DR5B 2ZSIA 2C7BA 1DXOA 2VTKA 2DY0A 3EASA 1FQKA 1DC6A 1JQJC 3HR8A 2M32A 3Q8XB 4R16A 1CJBA 2Q1UA 5KOJB 2ILVA 1MNQA 1JLHA 4NBUA 2V4UA 3RB8A 3TLGA 4ZODA 1XZLA 4JC5A 1MENA 4P83A 3ESAA 3DTTA 3N2GB 3WGQA 3AZOA 2Y8EA 4LJAA 4DIMA 2CLCX 3LGXA 2NQTA 1K06A 3QVTA 1BHQ1 1UBTS 4X54A 3WL8A 3S8YA 1F48A 5JH7F 1BX1A 4AKIA 5G53C 3L7JA 1E1YA 3QMMA 4DBLC 1ZR2A 1RPZA 3H2SA 1S02A 2AQIA 2WP0A 1E7RA 1M0WA 4R0MA 1DQZA 4YT8A 3W2FA 4UJ3A 5TS3A 4YAIA 2C20A 2NUTB 2EZ4A 1TZJA 2JI4A 4PNEA 2WSYB 1KRWA 2E6KA 3AY6A 4FOOA 2DC1A 4J9VA 5DMHA 4EABA 1P0MA 4JB3A 3RRFA 5FL3A 1SOUA 2WM3A 1BZYA 1PFVA 2Y1WA 3U4DA 2IX9A 3BTUA 5ANRB 4YV1A 1IHXA 1ZMOA 1RPAA 2OZLB 2PS0A 1BMTA 3FYCA 3M34A 4FVTA 5TXGA 2FQXA 2GVDC 4UNPA 6CHYA 4KR3A 1PZNA 5FPHA 3PLAE 3ELBA 3KAPA 1GRRA 1D4AA 1WIWA 3ANMA 4IBOA 3ZIDA 1OWLA 3WKAA 4C6RA 2NTNA 4H15A 4YQZA 3P9SA 2DR3A 3BN3A 1H85A 1XF9A 2BSXA 3DDSA 3MINA 4ZT4A 3U31A 4KXQA 4J7CA 1ESDA 5BV8A 1QIJA 5FPQA 4DBZA 2M1XA 4H60A 4ALIA 4PSVA 2AMYA 2J5BA 4URVR 3TB4A 5E95A 4U7DA 3TOVA 4PS1A 2J6CA 1LTQA 1OYOA 2QL5A 1EDBA 4FE4A 2IUFA 2O05A 4G84A 4JH0A 3M1LA 4ZCLA 3TMAA 3TL2A 3C41J 3V46A 4B45A 2XW6A 3ECSA 4MW9A 4DLAA 3CNNA 2PJRA 2VXOA 4U7WA 4EG1A 3GEDA 2SCUA 3TCNA 2P2YA 4X63A 3ZNQA 2H31A 4YI3A 3T15A 4FMDF 4L3WA 1VRWA 1HEYA 2DWPA 2O8NA 3W4KA 2O50A 4I4NA 4BQIA 3U7IA 4H08A 4ZZ3A 1T1IA 2BZ0A 1HT2E 2VDVE 2ZIVB 4LMBA 1SD1A 1F5NA 7ADHA 1ZIXA 2PPLA 3QHAA 2UUOA 1G8PA 4FFBA 5H3LA 2XHZA 1ZY2A 2IKSA 4PR3A 4G4JA 3AJAA 5BRJA 5ENZA 5K6AC 4L5AA 5A5EA 1AX9A 1AIPA 1DAKA 1JILA 1YFKA 4FYXA 4LY6A 4Y6QA 5C37A 1QTRA 1G18A 1ZZGA 2SHKA 2VJQA 3E81A 1TAQA 2BAGA 3LBHA 1JALA 3LXRA 2F67A 2HF7A 2YYZA 4RTJA 3NYWA 2WOJA 1IN1A 1MH1A 2WUEA 2IF2A 1KK1A 1FRZA 3S70A 4HLCA 1HYBA 3Q6NA 2P5YA 2BFBA 3ZU2A 4GKVA 2W6JA 5IJ0B 1NLZA 3F71A 3GJ5A 5DBFA 3DOFA 1P1CA 3PF9A 3TIIA 1ZH0A 3A1SA 1L7EA 3DDWA 1ZZEA 3KYDA 4B2IA 2NMVA 1AKTA 2VAVA 5GGXA 1USIA 3ZQJA 1SC1A 2BM0A 4WNAA 2NU7B 4CDMA 3ZOZA 3FMIA 3TQTA 1HEIA 4HNVA 1C30A 3EVFA 4NRDA 2IL1A 2AN1A 4EY4A 4FW9A 1NE7A 1KEVA 3UJHA 4DV3B 1LTHR 1UWKA 4RKFA 3PDJA 2AX4A 1YL5A 1LCIA 1RWKA 2XMBA 2Y0BA 3JZFA 5DNYB 3ERCA 3KB2A 4D8WA 3INYA 1VYTA 5F21A 1GTZA 1ZD2P 4ZCSA 3JSXA 3GDGA 5TRTA 4ZEMA 3C24A 5KSOA 3FTPA 4RD3A 1HZJA 2BMFA 2YMMA 1GTMA 2IQ5A 2PT7A 4INAA 4MKHA 3OEEA 4JYCA 4HQKA 3GT0A 1K27A 3JASB 3VOBA 2RGCA 5BV7A 1P45A 3REQB 1PKEA 1T5SA 1YQEA 2B7CA 3OQPA 2OHIA 2X2FA 2XYRA 4UCWA 4UTOA 1CS0A 4C78A 3JCZA 5HS4A 3U3JA 1WB4A 3RASA 3WKEA 3REGA 1UKCA 4ZVUA 4YMTA 1JMVA 1XEXB 3TOZA 4B1FA 4JS0A 5HOQA 1KKLA 4Q4LA 1SXGA 4Z4GA 1YR2A 2HV9A 4GPAA 2FPIA 4Z99A 4RE5A 4RSMA 1YDHA 4INOA 4R8RA 2F62A 1VL5A 4V0QA 3FWHA 1QG0A 1D2AA 5EP2A 5F33A 1G3UA 3SSNA 2IS1A 1FLDA 1HFEL 4HAIA 1YK1A 3A2LA 4HRYA 4PG6A 2AX3A 4TXJA 2O2HA 2PS1A 1GY8A 1TF5A 3QMVA 5A5VA 3PRKE 4R9NA 2WWHA 2X0KA 5DV9A 5JTTA 3SSAA 3DDHA 3V9PA 1L8OA 3HCCA 4L8GA 3TUIC 2BWJA 2JEOA 2FP3A 2G17A 2RAPA 4BKRA 2VBCA 3PFIA 1IYZA 1YVDA 1JR2A 1U0BB 1YB6A 3DL7A 4GT1A 5LM3A 1LLFA 4WZZA 5JH7A 5CTJA 3V97A 3NEYA 4OKNA 1Z6GA 3G2NA 3ZNNA 3SP1A 3NS7A 1UZLA 3D4PA 4LXQA 4YYZA 4J0JA 1FMFA 1T9CA 5IDVA 1QFXA 4RY0A 5L4SA 5TMBA 3D6AA 4CMEC 3ER8A 3TW6A 1DKOA 1E5VA 2HNBA 1D1PA 2VHWA 3W7BA 2W2PA 3A11A 4OQMA 1MW8X 7MHTA 4EVQA 3AI3A 4Z54A 2FXVA 1Z5OA 2AR9A 1KZ9A 1P29A 4Q9JA 4KIWA 3TQQA 3RAEC 5JNTA 4CL3A 2H6EA 2QMEA 2IRWA 3MB8A 3Q8KA 3GP8A 1UC4B 4J1TC 1IXZA 1W36C 4H27A 4RKYA 3RUEA 2IELA 1U6JA 4MA4A 1JI0A 4HS4A 2WJHA 2NX2A 3QK7A 4TMYA 3DGFC 4ZC8A 4E1BA 4HNUA 5IXJA 2QF7A 1Y6QA 1ZH8A 2W93A 4ND1A 5G1PA 2Q21A 3TQOA 1I7QB 1QVAA 2HA0A 1IOLA 3CLHA 3KU1A 4G9GA 4TT3A 4ZVPA 4PFJA 3WC4A 4AO6A 2BTEA 1MRNA 1KJ9A 1DBQA 4GOOD 3GMIA 4JJEA 5LZ7A 3ZKWB 2IBTA 4TRRA 2DJ5A 4J1QA 4BO9A 1TCAA 5CDFA 3A6PC 3B1FA 3NM4A 3ECAA 4I14A 1NN3A 3PQ5A 3FWYA 4JT8A 1TAGA 5AI5A 2ZPTX 1U7DA 2C3PA 3LJKA 4RKRA 1X8XA 3NBYC 3IJ5A 3R5FA 4R1LA 3H9QA 3ZHRA 2V1XA 1QYWA 3TLXA 3G2LA 5AHRA 2RONA 4HWGA 4MR8A 3L2OB 4GYWA 4KQ6A 3ZU3A 5FLXA 1MOQA 2WC1A 4BMYA 2XQFA 1V71A 3UK6A 2JZOA 3OCVA 1N7JA 1SG0A 1W29A 2QA5A 1YGPA 5HKBA 2EGGA 2REOA 1QTNA 2PO7A 1T5BA 1I7NA 4RHTA 4OQDA 3FSRA 1V8OA 2CL0X 3B78A 2NTVA 2Q1XA 4GLFA 3RROA 3LX4A 2ZJ1A 3AF1A 3Q87B 5FUBA 1NRWA 1TZCA 2CXUA 3JYQA 4NS4A 4PIMA 4W6ZA 4MS3A 3K30A 4CM1A 2GKSA 1PYOA 2RIRA 3MJVA 1EXWA 1J0AA 2I2CA 4G09A 1IUPA 2H8GA 3DZBA 3S2ZA 1ZK2A 2H3HA 3KSUA 1O6CA 1D6SA 3ZXUB 1Z3IX 4DT1A 1VI6A 2GBLA 2VDLB 4R51A 4L9AA 3WQRA 4B3CA 1QE0A 2D62A 3E9RA 3GLHB 4OHMA 1WXHA 3NYQA 4GX0A 1R5NA 3ME5A 4FD3A 4TYPA 1GKUB 3GT3A 1MC5A 1X0VA 3NJ4A 2C8JA 4LYHA 5DYTA 3LIIA 5KCMA 1KERA 4JBXA 4MNTA 3REOA 2BISA 2WB2A 2TMDA 4OSOA 1PS0A 3VO2A 4TS1A 1CF2O 2VWGA 3U0VA 2W8BB 1KZHA 2H18A 2HU2A 4DA4A 1FNNA 3GH3A 4B87A 4Q37A 2W2VA 5GPBA 3FUUA 1N2OA 4FYPA 1CF4A 1G291 4BGDA 3BGSA 4UHHA 5IM5A 3SQLA 3JYNA 1H9CA 2C94A 2ZIWB 1ZFNA 3DKVA 4JU8A 4QXPA 4B4UA 3DJYA 4ROTA 3IH5A 2I55A 3CWZA 2QX7A 2PGNA 4X1IB 1H6BA 1NJ6A 1T9AA 2GXAA 1UMDA 3ZWOA 1F6WA 4YRCA 2IH4A 4DUGA 3IIIA 3X0DA 4BVJA 5HW0A 2MOKA 1O54A 3EDYA 3TD9A 2GFIA 5HQ3B 1OILA 1A3CA 4QEKA 5FV4A 1Q95A 1JYEA 2B1RA 4XI9A 1W85A 2JAUA 2DUMA 1S2LA 2R8ZA 5DVZA 2B2NA 3F3YA 5BV0A 1CNEA 1J23A 4HYYA 5E4YA 3SVLA 2NYAA 2IGBA 2Z2XA 4KO3S 1JXOA 2IDKA 1HYEA 2NAPA 4TSRA 2XUDA 4RPLA 3W9SA 3PDIB 5KS2A 4C4OA 4GWGA 5DM1A 1NMYA 2QPLA 3EX7C 3PC6A 1G5PA 1M67A 3DOCA 2H7VA 4OP1A 1EDDA 2FN7A 4MQBA 5CEJA 1GGMA 4RLFA 3Q85A 1H9AA 4FWIB 4Z3OA 2WT9A 4OO3A 3KHSA 1QHSA 4LHZA 5E2BA 3K0EA 4Z49A 2EKDA 3HJTA 4QXRA 3NNSA 2PX5A 4COKA 2J3QA 3T9CA 4GX5A 4PZ0A 1Y8QB 1YQTA 5EKSA 5CITA 1TOAA 1U8CB 1N78A 1G2QA 3TBHA 3C3KA 3TNFA 4QGSA 1TZBA 4LDAA 5LIPA 2EFDB 3ZJ4A 1NL3A 4AJ4A 3R6GA 4H1UA 4MV5A 4DCUA 2EJWA 5K3EA 2OYRA 5IHXA 3U7EB 5FTLA 2IYRA 3RBAA 1WXXA 2EZUA 1MC1A 3PQ8A 2HRQA 4M6WA 2X22A 4NVRA 5AVQA 1AGNA 2PLFA 4FMBB 2QX6A 3WK6A 2ZIXB 4P4GA 1CUSA 1ULZA 2GJSA 3DPSA 2RGYA 4G5YA 3NASA 4XIIA 4EY5A 3W5HA 5KVSA 1U0LA 5B2ZA 5AJUA 3OFNA 4M7PA 4KXLA 3V32A 4ECAA 1ESEA 3UHOA 1V5GA 5CYFA 3IIJA 3WB9A 2QLNA 3SQWA 4QYSA 3OQVA 3CZCA 3O9VA 2X1VA 3E82A 1KNQA 3E22A 3QJGA 4OJQA 2IT1A 1JFRA 4M8SA 3UAZA 1RWQA 2GN1A 4CZ2A 1WPGA 2EKLA 3BYZA 4XYMA 3H5TA 2HA2A 2XUFA 2X3FA 3C3CA 2PKXA 2WKPA 5LU8A 2RHOA 3W5CA 5E7QA 2DFVA 1RKBA 2Y1XA 2DERA 1HL3A 1HDEA 3SE7A 2XQGA 1G3IA 2C8VA 2FK7A 4L75A 1LLUA 3GJYA 5LP6C 2W2LD 1HQYE 1V3QE 2ZE7A 2AEMA 1XA0A 5TY0A 1KY4A 5KZMB 3D1LA 4GD3Q 5HQTA 1UMCA 4DLTA 3DVRX 3GFSA 2CBGA 1AURA 4RAOA 1EE9A 4RCZA 1XTZA 1GGHA 3U4AA 3DDNA 4DQDA 1YCHA 1ZXLA 5EZYB 2DH5A 2ZE8A 2PWBA 2WFAA 3F6PA 4MB6A 1XRNA 2VA8A 4P4NA 4F84A 1CUUA 2IYEA 2P67A 2QZJA 1OTYA 3DCIA 4G1EB 4N8EA 3ZHVA 4PQRA 2NXJA 4M0EA 4QPZA 4XEHA 5KDOA 1R15A 3QG1A 3V80A 5JDIA 2JZNA 3VR1A 3IRUA 4H4CA 3N2EA 1B0PA 2EKQA 4NBVA 1IBSA 3AESB 3LVBA 4G0ZA 4YALA 2QMUA 2FZCA 5GM1A 4KYUA 4WMLA 1CUCA 4J3JA 4Z7NB 4KIJA 3IULA 5ALWA 5IDXA 4C0XA 3LY5A 1MABB 1E94E 2GH1A 1G0OA 2GYUA 5EIEA 2Z8XA 1NX9A 1R5OA 2IEBA 2P9FA 3JQAB 3BBLA 3S1LA 3ZN2A 3CVOA 3DHVA 3OO0A 2NZVG 2IZ1A 3H04A 4KSYA 4EJ6A 4Q9KA 7MDHA 3DLAA 2QL9A 1MT0A 2VJKA 4H7HA 2A14A 1XWWA 3NT2A 4HNAB 1LK7A 4OK6A 3FPCA 3IPRA 2ZIEA 3D8NA 3MIIA 4BO7A 4UM9D 1SWWA 1NC3A 5SYMA 2Z95A 3GA7A 5HZHA 1B8UA 1Z3CA 1UXHA 4D82A 10MHA 4KGZA 1LPOA 1NNSA 3K0AA 1N7IA 5K2MA 4LY9A 2PS9A 1DTSA 2ZI7A 1L3BA 2V7WA 2NVWA 1OLSB 4I50F 1MP0A 2PA3A 2P3LA 4KH0A 5ICCA 5JC8A 3D0RA 3AP3A 1EFHA 2FEKA 1J99A 2O6HA 5HRUA 4BHTA 3LVRE 1Y3IA 5JJLA 3HB9A 2P3SA 3AO0B 3PUWA 1EQAA 3R0ZA 4QELA 2QTCA 4U5QA 1OX6A 4B5KA 4O4JB 2EW2A 3ZHOA 2ODEA 2LWIA 1O4VA 2WTMA 3NU1A 1VFNA 5BURA 4TROA 3LOPA 3UJPA 4JIGA 1CV2A 1PR1A 2AYYA 3TFOA 3T5CA 5HUHA 1Y1KE 3L4JA 3FKSA 1RZUA 2ERCA 4E5PA 2RHHA 2OXCA 4DLZA 4WHMA 1I13A 1DC3A 1YDWA 3TG8A 1I01A 1GLGA 3MWLA 4ETWA 1O57A 5FFNA 3IOBA 4N3AA 2WNHA 5BVHA 4ZHSA 1I9CA 1C7ZA 3SFTA 3TKYA 3IPAA 4MOWA 3ZDQA 4IZOA 1RQRA 2YN0A 3HE3A 1GLVA 3IHKA 4PAOA 2PGOA 4HAOA 3ZTWA 4BQFA 2P6NA 2IDMA 4UTNA 2J6HA 4BFYA 1B1AA 2P4SA 3DEJA 1V16A 2OOSA 3TUZC 1JIKA 3ZWXA 3ZVKA 1C81A 2PXCA 5LZ4A 3G13A 2Y99A 2G28A 3NDRA 3JS5A 5CT8A 4JOQA 3U48A 1WQ3A 2GN2A 4ZV7A 2ZANA 4GMXA 4X66B 1XRQA 3EHEA 3KEGA 3GH1A 2ISSD 4F0JA 1HFJA 4PBRA 4LVOA 3BJEA 3K0BA 3VHQA 2ENWA 3ROFA 2YDXA 1KYIA 5D2CA 4JWKA 2XEDA 2E55A 3OTHA 3B1KA 2HNAA 4EUKA 1JJIA 2OQRA 4XKJA 4EA9A 2H1RA 2XIQA 4NARA 4QJ5A 3VDXA 5I3ZA 1XMOB 1HORA 1Q19A 2YV4A 1CP3A 4L27A 2CFCA 2TMGA 3QXCA 4K40A 4GUAA 1PD0A 2FSGA 3NHMA 5IVHA 5FL7A 1D2HA 3LIPA 3OSZA 2XR1A 2CLDX 4HI0E 4DIDA 3RREA 1I7LA 3NHYA 3CEAA 1PL7A 2GDZA 2C0PA 4A15A 4YQFA 1F1JA 1B8NA 2DQKA 2CXOA 2Z1NA 2QRKA 3HJAA 4JEIA 4NL4H 5EJIA 4I5GA 2D5CA 3CLVA 2IHKA 1REQA 3KQNA 5FOVA 3GLHE 3N59A 1I5OA 1LDNA 3KS9A 4F6RB 3LY9A 2PX2A 3WLAA 1KP9A 1ML4A 1X38A 3IYLW 4LJYA 4EI9A 5MN6A 1K7FB 2Q0HA 3PFBA 4NICA 4K6OA 2BSAA 3PQCA 4Y30A 1CUEA 1JG3A 4ZEWA 1X1DA 4OH7A 5JWHA 4F9TA 4Y2JA 1BKYA 3HZOA 2X13A 2OD2A 2DH6A 2I76A 3AOGA 1CIVA 3JARB 3KFVA 5F2OA 3SEFA 1W6UA 1HUQA 3PT5A 4J03A 3RR2A 2WAXA 4ARBA 2EBWA 2TMYA 4HJXA 1KVUA 4PSUA 5KNCD 1Z34A 1VKNA 5JNLA 3Q88A 1FYWA 1T13A 2QW0X 2LVBA 4XARA 3RK4A 4I1SA 3BE6A 2X8JB 5MGNA 3BWEA 1LRKA 4G5FA 1U2SA 4RVSA 3VO1A 2ORYA 2Q3LA 4OQEA 4Q21A 3NFRA 3DEZA 3ZDZB 3M81A 1K75A 4IHAA 2JGAA 3L02A 5F1YA 4DKXA 2HRCA 3O7MA 4FC7A 3OLVA 5JR3A 4Q4AA 4RQAA 4YMVA 3X1JA 3AL2A 1G1MA 4PYMA 3JQFA 1ZVQA 5JS8A 3UOGA 1NZDA 4QO7A 3LW7A 4HP8A 1J5EB 1XYGA 4BBPA 1P3JA 1T0PA 4HNQA 5AW6A 1ZUWA 1U7UA 3SIXA 4EDHA 1AXGA 1E8MA 1XU7A 4BLTA 1K97A 2IYPA 3FZEA 3HLTA 4D3ZA 3JAMA 5LD2C 2HHHB 5FP0A 2WAMA 2B94A 1OFTA 3FUCA 3UVEA 5KQSA 1BQ4A 2AD5A 4NBLA 3DO8A 1QFJA 1T10A 1XO1A 2BEWB 5AIBA 5K1ZA 1XDWA 5I4KA 1ADYA 3KJZA 2XPCA 4KPGA 5ER6A 3DQQA 5DX1A 1KI9A 4A6DA 2CT8A 3G02A 1XMXA 1Y4UA 2WIKA 3ONVA 4E08A 4TWBA 3BCHA 2Q6OA 3CT4A 4X0EA 4EZIA 2AG1A 1TJ3A 4CMKA 5BSWA 4QM6A 3JYHA 3F67A 3LHKA 3TTUA 1ODFA 4JCCA 3WQBA 5IWAB 3L8GA 2X4IA 3WMFA 4BMVA 2DKNA 1QTQA 1BWPA 3BKXA 3KEOA 2NZ8A 1XZMA 1VP3A 2HK9A 4WN3A 1YZHA 5BW5A 2GPTA 3FNEA 3GUZA 4ISCA 2Q5IA 1TGVA 1JKJB 4PYJA 1W9MA 1Y3HA 1QMPA 3HUTA 4I50A 1C0IA 1JSRA 1U6KA 3DVSX 4RDXA 1ULTA 3LCRA 3GUVA 5FD8A 1BH2A 5K3BA 3RLIA 1YS4A 4KQMA 1NONA 2Q3EA 5CBPB 2HEGA 1TL7C 2GCOB 3WAJA 3U1BA 2FZ5A 2XD9A 1IEWA 3LPDA 1DKNA 2R751 3BUSA 2QP3A 1KBQA 4TM8A 3TIGA 5BSUA 1MZVA 4Y3UA 3MMPA 3TIVA 5B55A 1PN3A 4NAHA 4CT5A 2ONKA 4IGIA 2AFRA 2V98A 4HNRA 3C87A 1I94B 2CJYA 5K8CA 3COWA 3A70A 3A1UA 1PV1A 5EGSA 4B32A 2Z8YM 1ZOOA 4OAOA 5K2OA 4W1SA 5FAXA 8MHTA 4XLLA 2NACA 3DXYA 2GZ2A 2AFIB 3HZZA 3ZHCA 4LYFA 1VSBA 3N6RA 3L3BA 3RFTA 1T2AA 2XF8A 5F1KA 3MT8A 4IJKA 3WO1A 1U7PA 3OU2A 2I2BA 1KL7A 1JE0A 4H1TA 3A6HA 4DV0B 1GNTA 3A1EA 3A7DA 4L3OA 3KSZO 2ZTVA 4DVJA 4DAOA 5BNIA 4D41A 4EY6A 3MERA 2Z0MA 2VL7A 5SV2A 4ZCIA 5U9CA 2LXNA 3HHEA 2Y0CA 1X1EA 3USZA 3VDQA 3F7OA 3U4HA 4C88A 5JO0A 1MQ8B 1TQ6A 2COEA 2QRNA 3EXG2 3Q0TA 3MRXA 4JJAA 3UENA 1I10A 1ETUA 1ESZA 1G20B 1NW7A 3D8BA 2PVCA 3EZXA 4IIJB 1EWTA 4R8KA 4ZQEA 5CMLA 1QGAA 1OLXA 2I22A 2P9TA 3I83A 4X6YA 4F6LA 4HSEA 2PU7A 1WDMA 3BWDD 4YUVA 3ND8A 1U0EA 1YC2A 1RM5A 5J9FA 1KPHA 1V47A 3R7SA 2QW8A 1WUYA 1TVKA 3BSSA 1K5DA 1UJ5A 3PC8A 4FTWA 1YCGA 4RJLA 3MUOA 1B14A 2PUGA 4R68A 4W8GA 5HS6A 4ALNA 1YAHA 4LMRA 4DMCA 4OHYA 3B1YA 3SX2A 3CNBA 3HU1A 3MJHA 3NHZA 2AF3C 4L2IA 1NWHA 4YDQA 2GN6A 2AC4A 4AG5A 3DP9A 4KITB 1VG0B 1NR5A 1M8FA 2N42A 4FI3F 4RF4A 2F43A 4JR2A 1ZK1A 2WMNB 4LE2A 4PRZA 4J16A 3SC6A 4TZ0A 5D3ZA 4NH0A 1Z0DA 1A4RA 1BMDA 2UXBB 3QLTA 2PQ6A 1PDOA 2OORA 1AOXA 5AW8A 2IF0A 1C3XA 2IEGA 3C3WA 5ALEA 1ZGJA 4Z8XA 1CVRA 4FLFA 3VDNB 1AUPA 3QPBA 4QHTA 2E5LB 2PSFA 5A02A 2P8JA 5T4FA 1CRZA 5C1OA 1AXRA 2BVNA 1FZQA 1ONSA 4PFSA 1TJYA 3A28A 3O91A 3PJEA 4Q4JB 4D0GA 1CUHA 1Y42X 2OO5C 3OIFA 5KU7A 1RKQA 3AY0A 4L8FA 4CI9A 1CQXA 3DB2A 1YRAA 1Q6ZA 2OC9A 4ZJUA 4G6ZA 3T35A 4UM5A 3PCTA 5ALHA 4ZGGA 1LVGA 5KNDH 2H06A 3IMCA 1TA4A 2Q49A 3N8NA 2IYQA 4G4SP 4R1MA 4WKPA 3BJMA 3U17A 4BKOA 1HO3A 3KQHA 1W49A 3FF4A 4S1WA 1Q74A 4YONB 3N8KA 4IPTA 3QEKA 1E77A 2LCFA 3B9BA 5IEBA 3SI7A 4BB9A 4URXR 1P4GA 3K71B 1TMOA 1E5LA 3KLMX 4LGVA 1MOSA 2HXSA 3K3PA 3FAKA 4H6VA 2XH8A 3EQ6A 3IV6A 4GDMA 1B6TA 1E4EA 1ABBA 1JSXA 5A5GA 1KFKB 2FN9A 2V7VA 1KJIA 2YWFA 2XT6A 3CZ5A 1ONNA 1W0KA 3PXXA 3F96A 1M6NA 2AL7A 2DQSA 4PLWA 1O9GA 3LTNC 1QVVA 4Q3KA 5JLAA 1RXVA 2VK2A 2XB4A 2YFKA 2H4JA 3E15A 1B00A 5AI6A 1OH6A 4FXPA 4HZUB 4RULA 1FDOA 3IPCA 1RLJA 3KWJA 4Q1EA 3TRDA 4PX5A 4RGVA 2Q3JA 3VPAA 4DYVA 1YOVB 2PIDA 3KEFA 3JQ7A 2OE2A 3NP7A 4I4TB 4RH1A 3UT6A 1XNRB 1IDOA 2GM4A 3HUFA 5AVVA 3NIWA 2HU7A 1DAMA 1C7FA 1MDFA 1YZKA 1DKUA 3I62A 1U2PA 4ZT2A 1T2EA 4L02A 4IXWA 4W1RA 3RIEA 3AM1A 1XZGA 2L42A 1LF0A 4HFJA 3ZXIA 1QH0A 4K88A 3VNSA 4EGQA 1AQ6A 2I6TA 3X1XA 3ZGLA 2B61A 2IXEA 2FJUA 4P35A 1CFZA 1X9HA 3U7QA 3R44A 2CNDA 3VHXB 1T9HA 2H57A 3QENA 3PPXA 2J4DA 3KQTA 3PSHA 4ZDJA 3HKCB 3ENQA 1WNTA 2XMSA 2ZRBA 1QMGA 2ZVJA 4FNMA 4NIMA 1PL0A 1VIVA 5A6SB 3Q5DA 1TEZA 4K6HA 2JDID 3T3MB 1ZDMA 1U65A 4I5DA 1QC5B 1KO5A 1NLMA 1QO9A 2QM3A 4P7FA 3SF0A 2OUIA 5DMXA 3TZQA 5KQGA 1FW8A 2GNPA 5L6LB 5HFAA 1HT1E 1A82A 4IIYA 1WZEA 3A6KA 4ZI3A 3NLLA 2AC7A 1R9MA 1RYFA 1JLKA 2C07A 2CLLB 4JSTA 4O25A 4WWHA 1NJ8A 3OLYA 5L95A 2VG8A 1YOBA 3MJEA 5FOTA 3ZW7A 1COZA 5IBCA 4ZEOA 3KALA 1VLJA 5I7FA 2DHQA 5H4GA 1YRBA 2GR9A 1MCZA 2HMYB 3JY6A 1Z33A 1J8MF 3QLVA 1T3LA 1K6XA 1LS1A 2D0IA 5DHSA 4GYJA 3UO8B 3G85A 1SK9A 4J4TA 1ID8A 3NKVA 1I33A 3HKDB 2PGDA 4G0QA 4E4RA 3L4BA 2VHUA 2I3GA 3D6NB 4PN3A 1SCAA 2JHFA 1RP7A 4YWJA 5C18A 1IBMB 1LA2A 3VPFA 3RTBA 4F97A 1RZRD 3AHCA 3U4IA 3DUFB 4F4UA 4YMLA 3KXDA 1IU9A 4FOPA 3K9CA 3COVA 4K03A 4PSDA 3EZFA 3F97A 4B47A 3W8EA 1SO8A 1YI8A 3QV2A 2NVUB 4JI8B 1CRQA 4UNRA 1M54A 2DLNA 3IP7A 4J0CA 4EJMA 5JFTA 1P7WA 5DNDA 2VRCD 2Z5LA 4F12A 5H4HA 5CX4A 2GPSA 3MS7A 3EA5A 3UUWA 3R7LA 3ITKA 3X1DA 5KYUB 2QTZA 3BE5A 1A8PA 4YO8A 2P8SA 3R74A 4AQDA 4ASUA 3OC0A 1ORWA 3EGDB 3HZHA 4I6GA 1L4UA 1KQPA 1N3LA 3ZBTA 2EHJA 4MRPA 2R87A 4R6WA 4LTMA 2ZYDA 2FQWA 4NJOA 1R5JA 4M55A 5FWYB 1Z4LA 1U1DA 3AJ9A 4FSXA 4JSYA 3RWOA 1E7MA 2Q4EA 3L7AA 5EYPB 3RYFB 5DYWA 2DFKB 1R12A 3O3CA 3AC0A 3OZBA 2GAFA 4OA8A 3OOWA 5HRCA 1AUQA 5DTRA 2GJ8A 2JA2A 5H82A 1WHTA 3R8CA 3J81A 1PV4A 2NLOA 3GFRA 3E1SA 4WD3A 3QUQA 3CX3A 1A0OA 3E03A 3C6BA 3ADOA 3BXOA 3GPDG 1GZ4A 2ST1A 4LKRA 4YRZA 3WYEA 1ARZA 1L6RA 1N3IA 1QAOA 1BGWA 1ADFA 1PQ4A 3EIUA 1WCWA 2BBSA 4FZ5A 2PUBA 1GG5A 3A9VA 1MFPA 4UZEA 2VS1A 2BFWA 4DEVA 2ECKA 4X41A 5JTUA 4X8OA 3VC2A 1Y3CE 3CX7A 1VDMA 1ZBQA 2IXTA 2XSZD 5LB4A 3ORYA 4CEJA 5JC1A 4F4CA 1R8YA 4OBBA 3COJA 2GA8A 2BHTA 2YW9A 3AHEA 3ITEA 2RARA 5DF1A 3RF7A 1HNXB 1JTEA 2ZRAA 4EMTA 3GDOA 4BVHA 2EHDA 3HVHA 4RQUA 1H2HA 2IS4A 1A5SB 3G1WA 1CR6A 1JPUA 1XG5A 3NTXA 1KDYA 3UJDA 1GZSA 1YUMA 1QVWA 1PWEA 4ZWNA 4Y6GB 1C29B 5D01A 4F1JA 3QPCA 3V7WA 3NBQA 4H7FA 1N3YA 4KXNA 3P9PA 1NOJA 2LE0A 3MM4A 2IPLA 1H8HD 3OQ1A 2GPNA 2ZWIA 1ENYA 1NFFA 1RRMA 2YVAA 3QITA 1AF7A 2XMCA 1M8JA 3PXBA 4G3XA 2DFTA 2VQDA 1XAIA 1WA5A 1GFIA 3UJAA 3ZS8A 4HH4A 5IHPA 3FYUC 2WLTA 1FP4A 2WVGA 5E7JA 2GO1A 2H63A 4OM8A 4URYR 1G66A 1W6RA 4RETA 5H83A 5TSDA 1DWQA 1NT2A 2GX6A 2HUPA 4NDAA 4ENSA 4GAEA 3UJNA 5BWMA 2OK8A 2F1KA 1CLEA 3JWJA 5JARA 4B46A 2ZU6A 4ENPA 4UE6A 5G0VA 3V8EA 5JSUA 2ZQYA 1D7OA 2VDUE 3RUCA 4GQBA 1G20E 5J63A 4OJKA 1P7ZA 2BM8A 3UXMA 4AMBA 4EELA 1QQBA 3KXPA 4MWSA 4Q19A 4ER5A 2FE4A 2UKDA 1JEJA 2H2AA 3B51X 3ONEA 3UJ3X 4P3PA 4ZOLA 4KXVA 3B1VA 1GA1A 4DLPA 2WHPA 4QOGA 1IATA 1WD7A 2O7VA 4LXGA 4FT2A 1VKZA 2FPGA 5BWCA 2BHLA 1EUQA 3OLWA 5JD6A 2EX4A 2VYVA 3FYSA 3ZGOA 1PJAA 3LX5A 3CX6A 2X9GA 1SQ0A 4E46A 3KPWA 1VKOA 3BGWA 3P2KA 1J2UA 3BXHA 2NYRA 3B3FA 3IFSA 3M6VA 2ZRHA 2GPYA 1R74A 4F71A 3U5ZB 4JGBA 3OAAA 3PUHA 1U2TA 2PLAA 2ZBRA 5DYIA 4B82A 3G8DA 4HC4A 2JIZA 3L06A 1D0IA 4LS3A 2FZWA 3WIOA 4A92A 1CZRA 1PWYE 3C39A 1H3NA 4BAUA 4DA0A 3C14C 5F35A 2C5EA 4JGIA 1OB5A 4IMJB 1NSFA 3HGQA 5M34A 3KOMA 5SY4A 4ZEXA 2YOGA 2ODWA 4AWAA 3NGXA 1TDJA 5CX1A 3U44A 4ACAA 1ZJ5A 4OOEA 4L8YA 4DCSA 3AVYA 2Z2KA 4BMNA 3VSDA 1TMYA 4GWKA 4ZZIA 2EC5A 5M29A 4LF4B 3EH2A 3QVSA 4KWEA 1RAAA 4PVCA 4D46A 2J0UA 4AUMA 3T9AA 2JLAA 3A10A 4AN4A 1QZZA 1SD2A 1OWOA 3SCZA 5HZMA 1VI5A 3I6BA 5AI0A 2C0QA 3NX4A 1K4MA 3LNTA 2X14A 4DLRA 3EISA 5F2EA 1D8TA 1UINA 3UQZA 1T91A 4ND3A 4MP3A 3GZNB 4KJXA 5LB2A 4EG8A 1WABA 1GP2A 1P61B 4BV8A 5P8WA 3V6MA 2GSWA 2IV7A 4BFLA 1Z7YA 3DMGA 1QB7A 2XNHA 2IIPA 2QORA 3OA0A 3OOEA 4PG4A 3P4UA 4BNJA 2WSLA 5CXUA 3KJXA 5BYKA 5FPYA 3HWWA 3WMEA 3E8SA 4EKNB 4ZJZA 4I36A 1O08A 4CLHA 2HJHA 2JATA 5I8ZA 5BSMA 1ZICA 4ARAA 4DV4B 9LDTA 4KPYA 3IVCA 4Y0NA 3KSDO 1A9PA 5CVVA 5HILA 2HQ1A 1GPJA 2IUUA 4EF4A 1E0JA 4FZRA 2YIVX 1VE9A 2C4UA 3DAPA 3ZWPA 2FSPA 1NAIA 2BFEA 2GB4A 3C3BA 5D5QA 1GWNA 2GETA 3GLTA 3R0XA 1AG9A 1NBAA 4LOKA 4ARIA 5M3BA 3WGOA 5KJFA 3USES 2CVOA 2JH8A 2QRQA 3KYCA 3A2NA 3TW8B 2O14A 1T2NA 3GJQA 5AK5A 3UMMA 1E2KA 4P08A 1TT5B 1CQWA 1M6VB 1ABEA 2YV2A 2RBGA 3DC7A 3R24A 2ZUBA 4FONA 5IW8A 3ROQA 3STHA 4NNJA 4QTYA 4JMLA 4A36A 1W8DA 2LIVA 5FA8A 1N5OX 4E09A 1ECPA 4OL9A 3UAVA 4A2CA 1N6LA 3KL2A 1V25A 4UFOA 3EFEA 3Q3IA 4GEGA 4I4LA 1SBZA 4F6CA 3NR2A 4U7HA 1CETA 1I24A 1MXFA 3O26A 3QY0A 1TCBA 1UANA 2VOEA 1FDSA 3KHUA 1KYTA 2GFHA 5M5BA 4ZIRB 1CQJA 1GRNA 4MWZA 4L6IA 1F2DA 1JSCA 4KR6A 2Z08A 2FMKA 4KUEA 1C8LA 4KCGA 3RF6A 3TKAA 4BX9A 3HYSA 3I9V1 2V6FA 5CDYA 1JQLB 3FPEA 3QF4B 4QBGB 1OGJA 3O8NA 1MJ5A 1TVCA 3E1KA 2QVZX 3T7CA 2ERXA 4O1HA 3WDKA 4DJEC 3OBBA 1AV6A 1E2UA 5EMHA 1DZ3A 2GWHA 4DPLA 3DV0A 3HB5X 3OURA 2C29D 4FHEA 1P1FA 3V4RA 3OKAA 1OKKA 1HMYA 1PUJA 1QGED 3ZWDA 1WMEA 1ZUNB 3IVAA 1AZWA 2Q0SA 3LWDA 4I7EA 2P3QA 1DQYA 1X7ZA 1C9YA 1TEVA 3MGKA 4OP3A 1XQVA 3AKDA 1Y6FA 4K3VA 4C4RA 1OE0A 1FS6A 3TNDA 2R6DA 3V4FA 3WAGA 1U8UA 3BJZA 4UULA 5EJAA 4ZK2A 1G41A 1XTQA 2IS2A 2OXTA 4WACA 1E1KA 4DDVA 1QYXA 1KP3A 1YIAA 3H1TA 3BORA 4FNGA 1UPTA 3GRYA 4KQJA 3CKYA 2W83A 3GFVA 2DHEA 4D2IA 2VJMB 3R8XA 4C1NA 1PP4A 1AS3A 2WWIA 3HUUA 1GHTA 2OILA 4ML3A 1URPA 4U5XA 1RIFA 3H42B 3NUZA 5EMNA 1FLNA 3T7TA 2GXSA 3LBFA 3PPVA 2JAWA 1I0IA 2YVKA 3OCCA 3L5KA 4M21A 5H02A 1ZM4A 2C2HA 3DSRA 4BATA 5IKMA 4H0FA 4NZYA 3TOSA 3JALB 3ZE8A 2ZZKA 1E18A 2FR8C 3GOHA 5C32A 3JAKA 1UK6A 1RTKA 4MV4A 2AI2A 2WQZA 1IY0A 3I3OA 1PYDA 1NP6A 2DUJA 3UB3A 2FWJA 2AWNA 3NZEA 4Z9XA 5EKDA 1FP6A 1U2RA 3OF3A 2P2CA 3FA2A 2O8DA 2MR5A 3B8EA 2Q2QA 3LH5A 3N75A 5C7LO 1WG8A 1QPZA 1UXIA 4BXOA 4RD6A 5FTNA 4JBYA 1UFRA 2JBAA 4J6FA 4DMRA 4RIHA 5CHYA 3ROEA 4X92A 5B7PA 2ATXA 5TF0A 4I8DA 3RYHB 3VUFA 3WBBA 1B42A 1DXHA 1L6IA 2P1RA 1PNRA 1WW3A 4CM3A 2QG4A 3SKXA 4DMFA 5CAEA 4OHZA 4EUSA 3TNLA 2L18A 3NHSA 1QTIA 3GZ4A 1JHYA 2MMCA 3O1JC 3BDAA 2I4MA 3E27A 3DV9A 4XB2A 4RJ2A 4IVPA 4GM0A 4N41A 1AO3A 3C3AA 1JLLB 5A4MS 1UBEA 3SQOA 3BZUA 3V1UA 1JR6A 1GYQA 1JR3E 1U7HA 2BT4A 2RH9B 2CFSA 3R20A 4LF8B 3QKWA 1J2JA 1GCGA 5JCZA 5DK6A 4BIIA 5DWDA 4WBNF 1EUDB 1NJSA 1VSTA 2I33A 4WESA 3HN7A 4OXIA 1FTWA 1GUDA 1E2DA 1DCMA 2CZGA 1NUPA 4PY2A 2JLYA 1TPZA 4GP7A 1FDWA 3PC2A 3MHPA 1Z2OX 4PYLA 4X94A 1UJCA 1GSAA 3I8XA 3MTAA 3CR7A 5GIPE 2OCLA 1J1UA 4Q3AA 1S1CA 1ZLXA 2C61A 2GD0A 2ZVPX 4II3A 4I3HA 3VPGA 2XY4A 2GT1A 5DWVA 2HMWA 5BN1A 4K7JA 4FFVA 4ZHQB 4KAJA 1FE8A 1OBCA 1YL6A 3MWEA 3QFCA 5AUQA 2W70A 3VNAA 5EJ5A 2K7FA 3VOAA 3ZWQA 2XI4A 1JFFA 2HZ7A 5IBQA 3TQFA 1NQTA 1VZ2A 2J5KA 1VDZA 2J9XB 3CMMA 4IOKA 4EHDA 4MPRA 4LC1A 3P94A 2ZRJA 5JAHA 4BNDA 1CY6A 2FR0A 1QOQB 2NZUG 4OFXA 4RHEA 1EFRD 2AQ8A 3KUXA 1DEXA 4NZOA 4AJLA 4CCWA 4EW3A 1V7PC 1U3TA 3OT1B 4S0XA 3A31A 2Q2VA 3OQIB 4K9PA 4M49A 2AXEA 5AOCA 4OYLA 4GVPA 3I5AA 3RU2A 8ADHA 3K15A 3OECA 5D3MB 1AKYA 1B93A 4X5OA 4L9RA 1DEKA 2EFGA 2YXEA 3HB7A 4MYSA 2FWBA 3QUTA 1JKXA 3NWOA 4CKBB 1FDIA 3Q2OA 4AY4A 2BN4A 1JHAA 5L7WA 3UA3A 4CM4B 1G21A 2CZQA 4NWIA 4JZKA 3U7FB 1OIVA 1U9IA 4YAJA 4ZTUB 3BZWA 1XDBA 4ND5A 3PLRA 4WCDA 3AF6A 3A1DA 1WB9A 1AF4A 4K9NA 1NU6A 5HDBB 2Y1EA 4Q3CA 3TCXB 1E2BA 1LI5A 2IPAB 3MT0A 3O3MB 1P60A 2GJAA 4NZZA 4FHFA 3STYA 4QJIA 1Y5IA 2J7PD 1JQ3A 2NO9A 4GC9A 3Q7EA 3H8SA 3K31A 4NEHB 3RSCA 4XVQA 1E3WB 4E4TA 4FMCB 1XYVA 1EP3B 2KSQA 4FYJA 3FWPA 5AJWA 3ZUGA 3LGSA 1ZD9A 5C8XA 2FFHA 3RS5A 3OQOA 1NRJB 3PFGA 3PVSA 1MJNA 5KUTA 4H18A 3GCZA 1Q3HA 1I7SB 1FRNA 1L4MA 2ZI5A 3HR7A 4R8MA 3G0HA 3CU5A 1AB6A 1RVDA 3AHDA 3JQ9A 1SVIA 1XQ6A 2O52A 3ICPA 4J1SA 3V1KA 3F6EX 1T4DA 2D8AA 2UZIR 5ALKA 4LZOA 3KKNA 4DRXB 3QLUA 1GPUA 1E7SA 1SHTX 1XAGA 3FFTA 2NT3A 4KNVA 1DNPA 4LXXA 4NV3A 3DAOA 4Z8YA 5EXTA 3U1VA 4TRMA 2MU1A 3OUZA 4H1HA 3EBLA 5C34B 3RFUA 4MJXA 1KI6A 2QTBA 3EDQA 3GMSA 3R40A 3RVRA 1MHPA 4A23A 1LBSA 4WERA 2B82A 2V7UA 5J5VA 5JQGB 4Y2GA 5JVDA 3WGGA 1JIJA 1WVGA 4HG2A 4MYCA 2CLEB 2FW7A 3AF2A 1ZN2A 3NTRA 2PUCA 2CUKA 1UJ2A 5BSFA 1TYDE 1U99A 1C50A 5J4HA 4G89A 4D4JA 4WZAE 1Y3AA 1PTKA 2P2SA 3P0EA 3L04A 3X1WA 3MLAA 3SYLA 3TZLA 5ENVA 1SHZA 2WJ6A 3IOYA 1BX3A 4RNCA 1OX4B 5HIJA 4C22A 4CRWB 1OTHA 4HQNA 4LDJA 4IICA 1V4NA 1Z4PX 4RGBA 3K9QO 3GN1A 2RHCA 1S96A 2KW5A 5DLDA 3L0DA 4Z6KA 3KIPA 5GJWC 4X8HA 4P2BA 3KQWA 4F9GA 2AQHA 1A9RA 3MWGA 2QAGC 2P40A 4HB3A 1PD1A 4G07A 4KQKA 3VYRB 1T8YA 5BMVA 3P0HA 1H1LB 2YBDA 4LCEA 3RYTC 4DDUA 5JZOA 4O4LF 1K9SA 3IT3A 2R1UA 1OW3B 2I6FA 3KQUA 1IE3A 2W4IA 4MR7A 1KF0A 4AO7A 2GM3A 4EX6A 2VQ3A 5LXTB 1NPDA 1PBTA 1PR6A 2P90A 3KU4A 5JHHB 1DRJA 1EFAA 4U2DA 2PD6A 2QVXX 3LLCA 3STXA 3LS2A 2OZVA 1CEXA 1LX6A 4LY3A 2RAUA 2B37A 3ZCUA 4ZAVA 2HSDA 2WG1A 1XUOA 1IOVA 1J9EA 1NKVA 5CJPA 4U39A 1RCTE 5C4GB 5CA0F 1BXGB 5FULA 3DWIA 1WUIS 1N7HA 1G2PA 3WK8A 2JLBA 1JVSA 4GP6A 4ZO4A 3H1BA 1V11B 4GI2A 2I80A 5CM2Z 1EGVB 4U6NA 1ZVJA 4BNNA 1LPPA 1BS9A 2VF7A 1SKQA 4CT4B 1LJUA 4JLSA 1BHO1 8LDHA 3IURA 5YASA 3C45A 1JHRA 1LD3A 3QSYA 1ZEJA 3DA8A 4CKEB 4JT2A 4DMKA 4R31A 3U39A 2H1SA 4OVKA 4Q4CA 1RI3A 2ZJAA 3DTYA 1NOIA 4WSOA 5ED4A 2JBHA 1M75A 5JWRA 3IAHA 3OQNA 3AL0C 3S5JA 4EB8A 4OATA 2NZYA 2FN8A 3IRVA 4PG7A 2PX6A 4EAQA 1WXGA 3KKPA 1QH1A 2O2EA 3HBLA 1RFGE 1KO1A 2PL1A 1ADGA 3DOHA 1H22A 4HDAA 1TUIA 3CNLA 4BUCA 3R5KA 5DPMA 1SU6A 4IF6A 3T5BA 1AE1A 2DWQA 3MT9A 3O8DA 1G4AE 1UBKS 1TF7A 1Y6ZA 2FUG1 1ZHHA 3CONA 3VVCA 4CLOA 2YS6A 4XD7A 4OQXA 4YCDA 1HTBA 2G5GX 3KYJB 1DADA 3RIHA 5IU6A 4BFTA 9LDBA 4JI6B 1DCTA 2G0NA 2Q7OE 3S2GA 4CF7A 1JQDA 4GNKA 3B8HA 1LH0A 1PCXA 1IM2A 1EVKA 2XQJA 4P22A 4YP0A 3ETCA 3R7AA 1NVMB 2CLKB 4BO8A 4PHFA 1Y1TA 4IGAA 3OC6A 4BWGA 2EV9A 4R3NA 4XQ9A 1RM0A 2YJNA 3AI2A 2KB0A 1EJBA 1UP4A 1ZKMA 2CK3D 2ZK7A 3GJXC 3O4VA 5FR1A 3WLHA 1MEEA 3GD5A 4WADA 4YQYA 5EJ2A 4KOAA 3Q3JB 5BSTA 1G6KA 3BJRA 3KOXA 1UKAA 3K8ZA 1E62A 5BWNA 5EWLA 1LBIA 1TU4A 1PEDA 4RY2A 3QOXA 3VU1A 1P17A 1WVMA 1TTQB 1GGNA 2H2GA 4OB6A 2I34A 4Q7MB 1ZR4A 2R62A 3HRHA 1ECLA 3HXLA 1W25A 2FX2A 4A8JB 5G0WA 3SR0A 3HKBB 1GDTA 1WULS 4P86A 3GFGA 4RFSA 4WX2B 3JW8A 5DX0A 2QW1A 3E1GA 3SY8A 5A3QA 5KNBA 4BJ5A 4R69A 3CB4A 4DBVO 1O0CA 6REQA 2XIJA 1LX7A 1G5QA 2JFWA 2OOKA 2WJWA 4D6XA 1MGOA 5AM3A 2VYND 3U7HB 3J80A 4IEFB 1W2GA 5ED0A 4KHPB 5H1YA 2J07A 5JFGA 1N8TA 3KOYA 2W58A 4X62B 1DKLA 4URUR 4X7MA 1SK8A 2B8TA 3GLSA 4XQGA 3ZZ0A 5KNDD 1EIZA 3II6X 3QU2A 1V3TA 4NP6A 3I42A 1Q7TA 1X77A 2ECOA 4WCFC 2RGNC 4LWZA 1USWA 3COPA 4KWHA 3ZG6A 4L4XA 2BFCB 4PLZA 3UMCA 3H8WA 4WLVA 4K9QA 4ILKA 1KZ4A 4KMSA 2Y2UA 1XTTA 1UL1X 2KM1A 4OV6B 3TIFA 3VV2A 4JBGA 1W4ZA 4A7PA 7AT1A 3HDQA 5DTIA 1RHRA 4FLEA 4YRDA 3LNCA 1AN0A 1IQRA 1Z45A 2OPHA 1LZLA 4XSHA 3G68A 4M87A 1KS2A 2I03A 4PLHA 5CH8A 1S8OA 1T0JB 1U31A 3GEBA 5AUNB 3LLMA 1SPBS 1KORA 2FPSA 4GOND 4EJ2A 4HUQA 2HDNB 3AM3A 3EIXA 3AU8A 3BMQA 2C4KA 3FCOA 4J2OA 4KI0A 1YVUA 5KDDA 1JEDA 3BGDA 1D3AA 3REFA 2KI5A 4CCYA 3NHJA 1SCJA 3KUUA 3ZBPA 5JLJA 2YJ5A 3GWZA 3L7CA 4JQCA 1J06A 2J3LA 2VKTA 3IBFA 4TQ9A 4K0RA 4IHJF 4M86A 4MK4A 1VIYA 1G7SA 4A82A 4C4ZA 4DLYA 1FBTA 4AIIA 3O03A 4OKIA 1HM5A 3C5CA 3DMDA 4CKXA 3AV3A 4NOLA 4G0YA 4Q9LA 4XSGA 4XRGA 2WG2A 1HURA 2VHQA 3GJ4A 1WY5A 1WXQA 1GFSA 4S2UA 3W04A 4LG1A 2FEWB 4UCFA 3F98A 3VKFA 1BAPA 1A71A 1H2FA 3B70A 2Q4BA 2WB4A 3VU0A 1RYEA 1I4WA 1KC3A 2JAXA 2P79A 4QYIB 5ALDA 2XADA 5A5DA 2Z2JA 4GI1A 4Y0AA 5CA0A 1DAOA 4XWWA 3PX2A 3RK0A 2JFVA 1T4MA 2Q5JA 5T4BA 3C8UA 3KJEA 1Q1ZA 4NENA 3O9ZA 2BKEA 4DIKA 4RL6A 1ATIA 1SCUA 4YPOA 5CB4F 3LPMA 1AQNA 1Y3BE 5TGDA 4YO7A 3ZV7A 3I2YX 1Z5NA 3C6MA 3RWMB 1CUWA 1TTPB 1DG9A 4NBWA 5F3WB 3ASYA 1ISGA 3H0EA 3JD4A 1OR8A 3R7WB 3V00A 1CEEA 1J9ZA 2H8KA 1L5VA 1OHHD 4Q15A 3BWYA 3DQPA 2VH2A 4DBLE 1F12A 1O89A 3OE5A 2NP7A 2F9MA 4Z86A 1YZLA 1KJWA 3ENNA 2E9SA 4H7DA 4QLOA 1JHOA 3D6JA 1OT3A 4HN4B 4RTQA 1NM5A 4ZU6X 3ZVMA 4LF7B 2GF0A 5JXGA 1S3SA 2XOKD 3ZD6A 2D13A 4UCQA 3FGZA 4RTLA 5TEVA 1QUFA 3NB0A 4R2HA 3D7RA 1BOFA 3IDSA 1K7YA 2WAAA 4PQGA 4C87A 4ER0A 1CQIA 1D2NA 1TM5E 1HE5A 5KQPA 1DV2A 5HHTA 4RK0A 1QIGA 2QXTA 3IEPA 5EE5B 1SNYA 4QNNA 1K6MA 1XDSA 3PK0A 5EE0A 5JECA 5I7UA 4TWZA 4CFYA 4GZMA 5ERXA 1D6MA 1OXSC 2O7QA 5CFQA 2FUEA 2JVKA 4PX2A 3UKOA 2P65A 2W42A 4QRIA 2IH2A 4YRBA 1RXUA 2DP4E 3LAWA 3E3MA 4GSKA 5G0TA 4BFUA 4C2AA 3SC2B 2G9NA 2JGDB 2GAAA 3L7LA 4JLWA 2JFOA 4FHCA 3RQIA 3EG5A 3WL3A 5DCWA 1KEEA 4RLHA 5TJHA 1XJCA 2BTQB 2IGTA 4Q9DA 4ZO7A 3K70C 4FDTA 3SBXA 1KZ1A 2JFNA 3OPQA 4HEHA 3NP9A 1IOZA 1P31A 1I1OA 2E87A 4MB2A 4GPZA 3P9ZA 1NRXA 3ZQKA 5A05A 4B4OA 4B81A 4EARA 4IKOA 4CM7A 1FUUA 3BA6A 3GLIE 2E82A 4E07A 3N39C 3K6JA 1J25A 3VZCA 2YIDA 2OP0A 4A0SA 2P3OA 1GGVA 3PRYA 3ZXXA 4ZQCB 1DO2A 4BEVA 1BEUB 1I4TD 1NASA 1XJQA 2V6BA 2PR2A 3EXHB 3PKZA 4KKVA 3RKUA 3FCYA 3TZKA 5B4VA 3BL6A 2GHIA 2WOOA 1U0RA 5DE3A 4LXTA 4DADA 1PR2A 1U4OA 5EE9A 2XLCA 1HQCA 3MCZA 1MORA 4K87A 4Q7JB 4B31A 4KYTA 4XM1A 5KWIA 3C85A 2P4UA 3V4VB 3UIEA 1YBAA 4GF5A 4ONEA 3WGIA 3HEBA 2EKZA 1JEEA 4HO1X 3T5PA 4TYWA 5K09A 1K89A 4OGGA 4C0BA 5ESXA 2J45A 3USCS 3F78A 2WF5A 1OYYA 2IE8A 4UUAA 1TYBE 3RRXA 3FKQA 1E1LA 3VC3A 1KBZA 1DWPA 3B89A 1M73E 4NATA 4OJNA 3UMGA 1VCMA 1HTWA 2ZYWX 1N34B 3T5TA 3AIKA 1GQFA 5C0OE 1BG6A 2HFKA 3RH0A 1O97C 5DU2A 5AKXA 2JFFA 1Z2AA 4ZOEA 1KSHA 5FI0B 2NUTA 4EJFA 2UZ4A 2Q28A 3EF1A 2CNNA 1S2MA 1HPLA 2ZUTA 2CLFB 1CY2A 1LKZA 3A3OA 1T0IA 2JARA 3RAPR 4LXUA 2V59A 2LZ0A 4L78A 1MX9A 3P27A 4M53A 2ZJ4A 3WLLA 4A16A 1D03A 5AW2A 5HYVA 3F8WA 4I1RA 4C0HA 3MGGA 3KJNA 1IMOA 1DXQA 2HFJA 2IPMA 1J00A 4RCYA 4TWJA