5KC8A

Crystal structure of the amino-terminal domain (atd) of iglur delta-2 (glud2)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
406
structure length
398
Chain Sequence
DSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQTEKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTGVRKLGCWNPVTGLNGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Glutamate receptor ionotropic, delta-2
publication title Structural basis for integration of GluD receptors within synaptic organizer complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 136
structure length 398
sequence length 406
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kc8A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kc8A01
4FE4A 1BDHA 1JF8A 3GRCA 3DGFC 3T38A 8ABPA 4KK3A 2LBPA 5T7BA 3QX8A 2HQOA 3JY6A 1D1QA 2FMIA 1JHZA 2CD7A 2FKAA 3OLXA 5JNSA 4W5OA 1JFTA 1LBIA 3OLVA 3EDCA 3ROFA 3O2QB 1C4WA 4QICA 4XFKA 4P98A 4ETIA 4MPTA 1L5ZA 4E7OA 3CHYA 4MS4B 1USIA 1XHFA 1VLZA 3C3KA 3BILA 1Z2DA 4Z9AA 4WT7A 1JBEA 1U2QA 2MYPA 2WWVD 4RY0A 1QQBA 3RVLA 4H60A 1U2PA 4RWEA 5ED4A 3KS9A 4ZYLA 5TQ2B 3QLTA 3K9CA 1KMIY 3SNKA 3UK0A 1E6LA 5JNUA 3TO5A 4LZLA 5EWJB 3QEMB 2WB4A 5BRJA 3H75A 5DCLA 4PEVA 2FQWA 4UHJA 3T8YA 3O1IC 5B3JC 1QQAA 5JS1A 3JVIA 1P2FA 3RVOA 4W5RA 2RJOA 2FSPA 2LUOA 4LE2A 4RK6A 4RSMA 1E6KA 4TMYA 5IUKC 3SQNA 3GT7A 3HM9A 3NNSA 4MYRA 4W5TA 1NXSA 5IX8A 1EFAA 4OLAA 4IF4A 4EGSA 1JWLA 2R25B 4ZPJA 4DN6A 2PUGA 3GL9A 2LP4Y 4MS4A 3N6VA 4QYMA 4YO7A 2ID9A 1ZAYA 4ZMRA 2E4XA 1DCKA 2HQBA 2FTKE 3LUAA 3Q15C 3NHZA 3B2NA 1GCGA 5BQ3A 3HVRA 3K4HA 5I4CA 1MAVA 1ZY2A 4MQFB 3H6HA 1OXBB 1P8AA 3DLBA 1EHCA 1JDPA 1FSPA 4WZZA 1K66A 1JL3A 2HJ9A 2PL1A 2JRLA 2HQRA 1DG9A 3NNDA 3GWGA 3H1EA 5TQ2A 1MB3A 3GBPA 3SM9A 3KYIB 4Q7EA 1TVMA 3GV0A 5EWJA 3QEMA 5CHYA 3RVNA 3H1FA 4MR9B 3EAFA 3H5VA 3C3MA 2Q5CA 2L19A 1VRVA 3E3MA 5BR1A 3FFXA 4RK1A 3CRNA 2FN8A 3H5LA 4ZMSA 3SG0A 5DGCA 2MYNA 3N8IA 4KQCA 1SRRA 2JVIA 4YV7A 4DQDA 3O21A 4Z9BA 4YS6A 4MS3B 4RDCA 2E4WA 2IOYA 1U04A 1FFSA 1Z15A 3LUFA 2R4QA 1GLGA 3N53A 3CG4A 2GBPA 5D2CA 4RXTA 1URPA 1K68A 3JVDA 4TN5A 1FQWA 2QVCA 2ZWMA 3RVRA 1HEYA 2GI4A 1RNLA 3H5TA 3IP5A 3OMWA 4RY9A 4KPYA 4IMJB 1YMUA 5EWMB 2WJAA 2MYUA 4EVRA 3QLVA 4PICA 2NZVG 3MM4A 4KQ9A 3RVQA 3RVJA 4KFCA 4MQFA 2WRZA 4RK4A 2PUDA 4IRXA 4UHKA 1M5TA 5IEJA 2PKXA 2A9QA 2JBAB 3H1GA 4WWHA 3OQMA 4JAVC 4RZSA 1ZHHA 4G0YA 5KC8A 1W9HA 2IPNA 3L49A 4TLLB 1ZH4A 2IPAB 4KREA 1ZVVA 4F3TA 2GX6A 4G97A 4XXHA 4JB2A 1R8JA 1DRKA 2FMHA 4RY8A 2QVGA 3CS3A 2MSWA 1RXEA 3KCNA 2M98A 3KLOA 3KSMA 3M6MD 4MR9A 7ABPA 3HXMA 2MSKA 1Z12A 4MR7B 3I42A 3CZ5A 3DLHA 2CWDA 2JVKA 2NUBA 3KYJB 3I5AA 3A10A 4EVSA 1E2BA 4Y9TA 3SAJA 4NQRA 2R47A 2IDMA 2IKSA 3LKVA 4LRQA 4EYGA 3CZCA 5TQJA 4MS3A 1ZDMA 3OO1A 4O1IA 3LUHA 1BAPA 1QNLA 3HJFA 3CFYA 4F06A 6CHYA 4G0QA 4RKRA 1E6MA 1EWVA 3EQ2A 2IYNA 1JYFA 1J56A 1ZGGA 2QW1A 2R48A 2HSGA 2ID7A 1L5YA 4G0PA 4RS3A 3NBMA 4F11A 1IIBA 2PUCA 2LPMA 3QELB 1JFSA 5EWMA 2IPLA 4LDZA 1YTUA 3GYBA 3I09A 4LE0A 1BA2A 1PHRA 4W5QA 2MYTA 1YIOA 1DRJA 5KQGA 1M2FA 4EYOA 2JBAA 2H0AA 3C6QA 1QPZA 2E4ZA 5IULC 3QLVC 1PNTA 1EAYA 4PZ0A 4MLCA 5IUNC 5EWLB 1AB5A 3Q7TA 4XARA 4RK5A 1BDIA 2PUFA 1Y1LA 4JB0A 2DRIA 1CYEA 1DP4A 1JYEA 4CBVA 1ABEA 4MR7A 5TPWB 1D4ZA 4Z4EA 1AB6A 2YHAA 3CU5A 3HO1A 4OBBA 1UDRA 2FN9A 3LUCA 1KGSA 1ISSA 5DKFA 4GPAA 2VUHB 2VYCA 3OQNA 3HV2A 5F64A 1Z25A 5HM6A 4G0MA 4KV7A 4D74A 1QO0D 2B1JA 3DGEC 2FVYA 3HUUA 3ROTA 4S04A 4Z4CA 1DBWA 1YMVA 3HCWA 4Z0NA 3MF4A 2FW0A 2MSLA 3BREA 3FFTA 2N9UA 3KKEA 1S8NA 1F51E 3CKMA 3H5OA 3KHTA 4RKQA 5KQPA 4N0QA 2CHEA 2X7XA 2HPHA 1VPWA 4MQEB 5JNTA 5HSGA 4FB4A 3HDVA 2F8TA 3A0UA 1YS7A 2NT4A 2P9HA 3IPCA 3QELA 5TPZA 1NY5A 2A9RA 3T95A 2QXYA 3LKBA 4HNRA 1SD5A 4N47A 3O75A 3RVKA 2GKGA 2WMYA 4EUKA 3IP7A 4HNSA 4MRMB 4F12A 1ABFA 1ZN2A 3Q41A 1Z18A 3KG2A 1B00A 1QP0A 5TPZD 4N41A 2PMCA 5EWLA 1JH9A 5FWXB 1XWWA 3HDGA 5FWYB 3QK7A 4N76A 1GUBA 4FE7A 1YK1A 3EQZA 2B4AA 2WY2D 5TPWA 4RK0A 5JNVA 2FEWB 1USGA 4KNYA 5FBKA 4KMRA 3JPWA 3Q7SA 2JB9A 5BRAA 3H5WA 1ZITA 5JS2A 5PNTA 3IDOA 1KRXA 3S99A 1MB0A 4O5AA 1BDJA 5HKOA 5FBHA 1P6UA 2V0NA 5DLEA 2L18A 5GOTA 2PUAA 3Q9SA 3RH0A 2RJNA 5KC9A 2PJUA 4M88A 1Z13A 2M1ZA 3ILYA 3RQIA 5IC5A 2L17A 4OATA 3CTPA 3QX9A 1PEAA 4Z4FA 3E61A 4NICA 4MQEA 1QP7A 3VNAA 3ILHA 3JS5A 1JLKA 4QPJC 3D8UA 3G85A 3JPYA 1ZESA 3NNNA 4JP1A 3SY8A 4B09A 2PE5A 1XHEA 1H9CA 2W42A 4XLTA 2CHFA 3IP6A 2WJWA 3A3KA 6ABPA 5TE9A 5JNRA 2O20A 3F6CA 2QR3A 3O2SB 5T3YA 1D5WA 4MR8B 5C5CA 3N0XA 5KQMA 4MRMA 4Z4IA 3LOPA 3MYYA 4H3HB 4YP9A 4MAAA 1QMPA 4IMIB 3UUGA 1GUDA 3URMA 3HS3A 2QV0A 1GCAA 3N0WA 2OENG 4JASB 4MS1B 5FWXA 3W9SA 3MMNA 3N0RA 2OQRA 1Z17A 1NXXA 1EWTA 4PE5B 3TMYA 3Q7RA 4MLDA 4OTZA 4Z99A 1SXHA 4EYKA 3T6KA 3EJWA 4ETNA 1U0SY 2RGYA 1SXIA 5KI6A 1I3CA 4IGAA 1PNRA 2PUEA 3RVMA 4D6XA 4EVQA 1NTRA 2FEKA 4JOQA 3DBIA 2PUBA 1D1PA 1LJLA 1CHNA 1DCMA 3QEKA 4YR7A 3KTOA 3OM0A 1VKRA 1U8TA 3RVSA 5KQLA 4KZKA 3R0JA 3I45A 4S05A 4W5NA 1KRWA 1F4VA 3M9XA 4KRFA 1NXPA 3O2JA 4LX8A 5ABPA 2L2QA 3A0RB 2GWRA 1M2EA 3KJXA 3LUKA 5GQSA 4P1ZA 1DC7A 4WXEA 3BRQA 2LIVA 4NCAA 1JDNA 4O1HA 2PAFA 2IPMA 2P4UA 1PEYA 3TX6A 2VUIB 3G1WA 1YK0A 3O1HB 1TJYA 3FDFA 4MR8A 4YGXB 4E7PA 5E3JA 3LUJA 4RV5A 3FFWA 2PL9A 2FMKA 4G0XA 1DCFA 4L85A 1P6QA 1TLFA 4YRZA 4D6YA 1Z2EA 1QO0A 2TMYA 5CNMA 4OG2A 5TQ0B 3VNBA 1BVHA 4MS1A 1WETA 3EGCA 2XDYA 2PLNA 3HZHA 3MQ4A 4Z4GA 3F6PA 1ZH2A 4LE1A 4RXMA 5CNIA 1QP4A 1M5UA 4RK7A 4LDAA 1NXTA 3LFTA 4ETMA 4XASA 2RDMA 4NCBA 3CG0A 4Q6BA 2A9PA 2FLKA 2KYRA 4G86A 3KLNA 1YS6A 3EODA 2E4YA 2FQXA 1DZ3A 3FGZA 3CLKA 3TB6A 1RZRA 1RXIA 1JX6A 1Z16A 2VK2A 3FMVA 1SXGA 3NHMA 2QSJA 4PYRA 2I6FA 3F7NA 2FMFA 2YHBA 3HSYA 3O74A 3LMKA 4YCSA 1RPJA 5C5EA 2AYZA 3N75A 3RVPA 4DADA 5DTEA 1TM2A 1RZRD 3GBVA 1A04A 2NT3A 3MA0A 1T34A 1NXVA 3L6UA 3D02A 4G0OA 4MGEA 4NV3A 2E4UA 2F8SA 1QKKA 3C3WA 3OLYA 1Z26A 2JVJA 4ML3A 4RU1A 4JA2A 3BRSA 1PUXA 5TQ0A 1A0OA 4IILA 4KK4A 2H3HA 2FEPA 3HUTA 4GNRA 4EY3A 1EWKA 2A9OA 3BBLA 3LUDA 3LTEA 1NXWA 1NXOA 3DZDA 3QLUA 3IPAA 3OM1A 3EULA 1W25A 3F73A 1USKA 4QYWA 3OLZA 1MIHA 4RXUA 9ABPA 1CEYA 3HK2A 3P9YA 2AYXA 2BGGA 3TD9A 1DJMA 3JTEA 4HNQA 3OLWA 4HYEA 2QZJA 4Q6WA 3HEBA 1ISRA 5IEBA 3H6GA 2J48A 3UKJA 2FLWA 4TLMB 5IBQA 3LUGA 1NATA 4KVFA 2QU7A 2FQYA 3IP9A 4Z4HA 4H3KB 1LK0A 2E4VA 4F8JA 1TMYA 5KWSA 1ZGZA 4G0ZA 1A2OA 1JFVA 1OXKB 5FWYA 4N0PA 3GA5A 1D2AA 1APBA 1DC8A 2JCGA 2NZUG 4XAQA 4L4UA 3O1JC 1C0EA 4WXMA 3H5IA 4YWHA 3OO0A 3OMXA 2JK1A 1DBQA 5JNWA 1YVUA 5B3JA 3M9WA 4ZJPA 1MVOA 2ZAYA 4YLEA 4EYQA 3OQOA 4OLBA 3C97A 1LBHA 2FXIA 1DBPA 4N03A 5CNKA 5IUJC 3CNBA 1LJUA 4WUTA 5HQJA 1FFWA 1FFGA 5CNJA 3MIZA 3QLUC
chains in the Genus database with same CATH superfamily
1WMAA 4GU5A 1GFZA 4ZI5A 3HXKA 1MA0A 2UYYA 3D8NA 4MA4A 3NYRA 4B5KA 3H9GA 2FPSA 2ZJ8A 3ZTTA 5BYJA 4J7CA 1A9YA 1H23A 1W87A 2XW6A 4WBXC 1W75A 1OXTA 7MHTA 3R24A 3L7BA 3EIQA 2CVFA 4LZAA 4P98A 1WP4A 3QE0A 1AN0A 4G85A 4HC4A 4TTIA 1TTTA 3A26A 4ZZIA 2ONKA 3AVXA 4JLUA 1I0IA 3Q7PA 1ULHA 3TOVA 2CZCA 2JFYA 4MCIA 4WT7A 1IH8A 1FDWA 4B6GA 4OX9B 1K8ZB 2BPOA 2ZRLA 4RY0A 1P9OA 2J9RA 3FUVA 1QH8B 4OL0A 3UUEA 3RS4A 5ED4A 4L7QA 5GJVC 3U4IA 1WE2A 4BC1A 1YDHA 3HYTA 3MGKA 5H3LA 2FX2A 3LXMA 5B7NA 1YZTA 3K6KA 2PBFA 3WZ2A 1N6IA 3H4IA 5AJYA 3M33A 4MVXA 2A7QA 2FPRA 4QTYA 3BXXA 5CTJA 4FNOA 2NZXA 3BK1A 3R3ZA 4L9SA 4NFHA 3IQIX 3DZBA 4G5QA 3JALB 5BRJA 1D03A 5TLSA 2BYTA 2V97A 2BFWA 2OCAA 4B76A 1EM8B 3HZRA 4EEXA 5CD1A 1P60A 3O3NB 1QV6A 3ZWOA 2VZEA 4UHJA 3UAVA 1NT2A 1G19A 1Q7EA 3R5TA 4DEXA 4EPRA 1WHSA 3MPUA 5FUBA 3A6PC 2EV9A 2VQSA 5IVPA 4JFAA 4MHOA 3PUYA 4D4MA 2VTDA 4YIKA 4R31A 1GRNA 4NXNB 2X5OA 1BFUA 1NP7A 2PX3A 3AR7A 3CISA 1JMYA 2ZAMA 3C1AA 1M8KA 3K0FB 1CZLA 4MUNA 5DHRA 2RGXA 2C8KA 2E4AA 2LUOA 2OCBA 2YWXA 3PA8A 5IJAA 1W19A 2VAVA 3BYZA 3EZ6A 5EFZA 3T5GA 4AICA 1YL6A 4ER3A 3ZVKA 2GASA 3TRHA 4DZRA 4CEJB 5BSWA 2I6QA 1CDZA 2Q9UA 1LX7A 3DOIA 1GTG1 3GVCA 2R62A 3R20A 3G9TA 1XAGA 1Z5ZA 5CLGA 5AKHA 3UHAA 1V71A 2BLNA 2VP3A 5EA2A 2NV6A 1CVIA 3GHHA 4I19A 5F5NA 2HQBA 2Q2OA 3KOUA 1X92A 3IURA 3LUAA 2B8NA 2IYLD 3NHZA 4LHEA 4NZOA 2B5VA 5IFKA 2B4TO 1KXJA 3UANA 2QMHA 2V98A 5AI4A 3I2KA 2WHRA 1P8AA 3PC8A 1QBKC 2WF5A 3BA6A 2OBMA 3LPDA 1QH9A 2JIOA 1BOFA 1T6YA 4TL6A 1WRBA 3F6EX 4FFPA 1SMKA 4Q1CA 3LSTA 3TBHA 1HV8A 5FEUA 3L0SA 1HF3A 3DMTA 1TVMA 3FVRA 4C0HA 3L7OA 4S12A 5MGBA 1ZISA 3AYZB 4OI0A 3B8HA 1M7HA 2GBGA 2W2QA 3LECA 4NI5A 2L19A 3DG9A 1CERA 2HA6A 1QLJA 5BV0A 5BPHA 4Q3AA 4HF7A 3P20A 3CV3A 1VJRA 2WVJA 3IRUA 2QTRA 5HW0A 3VTFA 2Z56A 1WXFA 4ED9A 2Q3BA 4XVRA 5DGCA 3DDHA 4M7OA 5BSRA 3FW1A 4HLQB 1SRRA 1GUAA 4Q82A 3O21A 1WDWB 4KVGA 3L0DA 4QUIA 4RWZA 1Z2CA 3ROEA 4Q39A 1QQTA 2BJWA 2CSUA 3E0XA 2CNKA 1U04A 2PRKA 1KC1A 2P9FA 3LUFA 4NESA 1BCRA 1GY8A 2OHIA 1AZWA 3Q12A 4G0UA 2Z04A 3HCCA 3AERB 3K0EA 1NYQA 4R8SA 1PKXA 1PWXA 4DV5B 4RDXA 4BBJA 5HM8A 2O2YA 4CKBB 5J4YA 3BE4A 4G4SP 5AM3A 1FDUA 2FSIA 3OZCA 2EZ4A 5DP2A 5IDQA 1Q14A 4ZI7B 1R4NA 3BWVA 2VJKA 4DRXA 2CNLA 1XVLA 5C53B 2O1EA 3FUWA 3DOUA 1QANA 1PQUA 3RVJA 1I1HA 3OJCA 4IRXA 2Y9PB 3T9BA 1O9GA 4F7DA 5E3HA 5K6AC 3LYUA 4RZSA 4KFRA 1EBFA 3AFHA 2IX9A 4IQ4A 3RBZA 3H65A 3AGQA 3LQ4A 1ZVVA 1SG6A 5EJIA 5INTA 1P4GA 3EBOA 4DM7A 3UWMA 1VLLA 2HU2A 4WCVA 3UXHA 1JQ3A 1YDFA 4DQLA 2I2FA 2QP9X 1I33A 4BQRA 1YQGA 4JIMA 2CY0A 2PUWA 3LQQA 3FUTA 3PNSA 4P84A 1JFRA 3TLJA 5GZ3A 2A0WA 1D6NA 3V8MA 1R9JA 2BKXA 1BO6A 3JD0A 2XAAA 4NYJQ 4O2BF 1XNGA 4X3PA 2PZMA 1N3IA 2Q5OA 2LCFA 2RB5A 3FR8A 4NQRA 1YCFA 3TXAA 1GKLA 2IDMA 5DX8A 4MW2A 1LPAB 3CW8X 5TQJA 2J4CA 2VLBA 2X42A 4MS3A 4O1IA 2O7RA 3UK1A 1M1NA 4IIFA 3KQOA 5TNXA 4AJKA 5CJJA 2ADMA 2ROQA 3AUYA 3COPA 3IMKA 4ND3A 4L15A 3MCZA 2ID7A 2SICE 2CDRA 2WHPB 3K6JA 1L5YA 3OAAD 4RS3A 1T5LA 5BSTA 1YS4A 2LPMA 4MIOA 3H3JA 2AXEA 4GKKB 1FTQA 5FUMA 2XMRA 3D4IA 3I09A 1XPRA 3TI9A 3CEAA 1VMAA 2DUWA 2WWWA 3A6JA 1M66A 4FJ1A 3NIWA 1HFJA 1Z33A 2C5GA 4JEHA 1T6ZA 1XZMA 4NPHA 5AK5A 3I04M 5BV1A 1DAPA 1XTIA 3QXHA 3FPLA 3DP7A 4NDAA 3USZA 3IBYA 2Q0SA 3D4PA 2O2ZA 3B9PA 1Y1LA 4GNKA 4TLDA 2BHTA 3B12A 2ZUTA 2HHLA 2PU7A 4J49A 1L3CA 4YLGA 4DR5B 2AFHA 2VP9A 1Z0IA 2RGCA 1R88A 1KK2A 4P54A 4RNCA 3EPJA 1JJ7A 2C0PA 2CVQA 3D3NA 4BO7A 5CGQB 2X6QA 3TECE 3MD0A 4GPAA 1TI7A 5HS4A 3ZNNA 3SHOA 1IBMB 3FPKA 2OYSA 4EHBA 3DEKA 4GUDA 5HRUA 3NWOA 5GONB 2YFHA 4K86A 5I9TA 3D8TA 4B4UA 2PFKA 3GJ6A 1TADA 4INJA 2I2DA 4GSKA 2PKEA 4Q4LA 1D2CA 1PR3A 1IOZA 2COEA 1U63A 3UM9A 2N9UA 2QAGA 2VZLA 3BFXA 1X8JA 2YJNA 4PYJA 5EZQA 2XMQA 4EHLA 5HNKA 2W4IA 3JAWA 5K7SA 1VPWA 2QW8A 4ILKA 2DQ4A 1YS7A 4FNAA 1WXWA 4LMRA 4M21A 4BAGA 5L95A 3KHUA 2R79A 5AYVA 3UMSA 4ALIA 5A6VA 2ZRAA 3NHRA 5JAOA 1CR4A 1WXEA 2JHFA 4DMRA 2JEOA 5DXJA 4H4DA 3DUFA 2VP6A 4FHEA 4RZ2A 1M3SA 4CM9A 3FVWA 3F6RA 4AJ9A 1SHJA 1V8DA 4INZA 2DOKA 1L7NA 2ZUDA 3ROMA 2VNSA 1VCIA 4YXFA 5L7TA 2IYAA 3ROKA 3X2EA 2IS1A 1ZOSA 1W46A 3BX1A 2PWYA 3GDHA 1KJQA 1J07A 1V5EA 1T1EA 1U98A 4RTNA 4LCJA 3P9NA 1GLNA 2C8JA 2XBUA 2B6HA 3JYHA 4LJKA 4G89A 3R5SA 1P2UA 2BGMA 4UASA 4HFRA 4CNBA 1XNJA 3MMSA 4Q3NA 4RDIA 4HGNA 1R0BA 1F8UA 2FSUA 2J4DA 2NU9B 2ZI7A 4CKYA 3TNJA 4WESA 1VDZA 2PBRA 2YHIA 4N5MA 1VBFA 5DX1A 5HKOA 1DHTA 1JWAB 2K7ZA 3TOXA 2C8LA 3FNQA 1M6VA 1CS0B 3FKSD 4OYRA 5LYJB 2J8ZA 2C2MA 1RP7A 4WZAB 3RQIA 1J23A 1JNXX 2B7LA 3S81A 4IEIA 1Y6ZA 3ESCA 2GJ4A 3PLRA 3VMFA 3ZCRA 2EX1A 4NICA 2HU7A 4IUYA 1R64A 1VFPA 2JD1A 3RDPA 3UAGA 1C2YA 1XNHA 2QBYA 3K72B 1GWNA 1P77A 5FWAA 3JPYA 4DYHA 3L8FA 2O8EB 2UYOA 1JWBB 1K7CA 1PFUA 3I01M 1JEDA 3OE4A 4OA5A 2OGTA 4H7DA 3JXEA 4R54A 4CLOB 2H52A 4DSTA 5JWRA 3BTUA 1CQZA 1JHRA 1IHYA 1TNDA 3C7DB 4UDYX 4BFWA 3ANLA 1JYSA 1ZNQO 1SOUA 4RD2A 1WDKA 4D45A 1W4RA 2KHZA 3WL3A 4PZDA 2A94A 3STVA 2OO7A 4DYDA 1IN1A 4Y0VA 3PA6A 2NPIA 3CM0A 5C5DA 2ASVA 4PLHA 3TXYA 1QIFA 1YR2A 4DPLA 3I9OA 3HA2A 1V2HE 3OTQA 4WJZA 1H0KA 1RBMA 4YWJA 3LLSA 1FX0B 1P8JA 4FT2A 3PNBA 2AFHE 3HXLA 1BE1A 1QE0A 1OFHA 4NJEA 4INOA 4TSRA 1A7UA 1PQ4A 2OHXA 1UXOA 4LSMA 2FMXA 1TJ5A 3V1KA 4NWIA 3BH0A 1ELOA 1QTRA 3ROPA 4YR7A 1RHUA 3EVNA 3KKPA 4JR2A 3T3DA 3QU9A 1HXHA 2BJHA 4HEQA 3JYLA 3DOCA 5DLQC 5JMOA 4QM6A 2DH5A 3R0JA 5CR9A 2GF0A 3QU7A 4B6EA 5CB4F 1CUYA 2YASA 3D59A 1E99A 3ELWA 1C2TA 3QVKA 4I4TB 4P1ZA 1NVVR 4O4LB 1JEYB 4MICA 3EZ7A 3M4ZA 4QQNA 2LZ0A 3AUJB 3N7UA 3F9RA 1ZN8A 5EQFA 2V6FA 3L6BA 1CUIA 1COWD 1E6CA 2ONCA 1QIMA 3AETB 3CPSA 3FYDA 3G5MA 3MS7A 3PXEA 3QUQA 1GNTA 4QGHA 3TVTA 2WA2A 1JHMA 5JEDA 5JW6A 2H1CA 1G4AE 3GB9A 3KXKA 1TJYA 3DDUA 1Z62A 4GXRA 4UARA 3SR4A 4MR8A 1YVRA 2WVGA 2CCGA 3N6XA 1HZZC 2V3CC 4A23A 5EFOA 3Q9NA 2HQ1A 2F48A 1E1LA 2FP4A 4WIAA 1QO0A 2AF4C 3WSTA 3GK3A 1SBCA 3KOOA 3OEYA 1BVHA 2VQDA 1NX6A 3HZHA 1FBNA 4LSGA 4MUJA 1E9AA 1KAHA 1UBUS 1EU1A 2R6CA 3V00A 1X15A 1DQSA 2JI4A 3H9BA 5CNIA 3E9NA 2XMDA 3NETA 1G3IA 4M8KA 2I4RA 4WCFC 3VOBA 4N49A 5B1DA 4D8TA 3Q4GA 4Y2RA 1NNLA 1MMFB 2KI5A 4WK0B 5HIMA 5TV2A 1EG7A 4XASA 5DE3A 2A35A 4YFVA 1I51A 5AK3A 2A9PA 2JIQA 4ROTA 1I6LA 3FSRA 4ZV4A 2ZYDA 3ITEA 1F48A 3O8CA 2NTYC 4F60A 2L0XA 2HZ7A 4WKGA 1K7YA 5CYPA 2HIMA 4MQBA 2DHRA 3C45A 4MVJP 3WDKA 3RYHB 1RI1A 1GR1A 1RZRA 1X19A 3G9XA 5CJ2A 3GNSA 2VPTA 3DT9A 1A95A 1PU2A 2JJYA 2OO5C 3G79A 4OFBA 4PZLA 1AUVA 5REQB 3C24A 2HADA 2CLKB 1Q1AA 2P2NA 3GCGA 4J7UA 1C1HA 2RC5A 3DE1X 4EHDA 3ED5A 5L3QA 3LPNA 1CEEA 3EJ6A 1TYAE 1SO8A 4I2VA 4N40A 1GKKA 1H5NA 4U9UA 4NLLA 4EDFA 1MAUA 4HNUA 4F86A 2VDQB 4W8OA 2NT3A 4WJLA 2F8SA 3L6UA 1DXHA 4TV9B 2NYVA 2PH3A 1NUAA 4MGEA 4TRNA 4KP7A 3ZN2A 2JVJA 3W90A 1R10A 3HCAA 3GW8A 4MI9A 1R1DA 1O9BA 4B6QA 1FU7A 3G0BA 1HYQA 3Q9UA 3QOWA 4ZI7F 3ZDAA 5LUBA 1O97D 3BVPA 2OBBA 4DMFA 1AZLA 3EVEA 1MQ9A 4G1MB 5AHWA 2HPZA 3W05A 4CQLA 2AMFA 2PXCA 4LVNA 1L4UA 1Z29A 4KGDA 3Q72A 1X7WA 1NXOA 2QRKA 2VKQA 1Z08A 1RZVA 1K8RA 3SKYA 1DIRA 3F73A 1W36B 5K8LA 1FUUA 1X9IA 1GQFA 4FOPA 1UK6A 3BF8A 4FHCA 1SHLA 4OBEA 2VK8A 4ZO6A 1WQ1R 3ESYA 4BP9A 4HX2A 4KSCA 5JS8A 5DHAA 3AJ9A 4BPBA 3NFYA 1XPUA 1MQAA 4HQNA 4KQ6A 3H6GA 4KH1A 1HG1A 3JQDA 2XCUA 2MJLA 4IKEA 1X7YA 1ICIA 2I4IA 3T5TA 3SVLA 2B37A 1WCIB 3A1EA 3RHFA 3WGTA 4ZARA 5JFGA 4KHPB 2II6A 4FCVA 5B3LA 4K81B 5IJ0A 1T8PA 1QFSA 3T7TA 3HDTA 3ICOA 1YRWA 4FK8A 3VI4B 2GN6A 2WQ7A 3MXOA 5ECDA 3ZUGA 4D57A 5KTTA 2ZYVX 1W30A 3DFKA 3R3SA 5KWSA 4MUIA 5IAKA 4HRXA 1JKMA 2ZTMA 3ASUA 1N32B 1Q77A 4NSNA 1H42A 2XI4A 1M2GA 1PEDA 5JFOA 1Y1PA 3Q5EA 1IG3A 3K5PA 4CEIB 1SHKA 1T2UA 1X7GA 2GYYA 1UZLA 5DIZA 3S2GA 2IQ5A 3TI7A 4P38A 2PTHA 1YJAA 5CLIA 1APBA 2HA3A 4RJLA 1U8AA 1N8SA 2VUSA 1FZQA 4M0FA 1DIOB 5DI9A 3NHKA 4C1BA 5H68A 1RHMA 3FYUA 1DBQA 2CXRA 4Z7JA 3ZOKA 2AZ4A 3L7MA 3E05A 2WJZB 5I7UA 3JQFC 3AV0B 3V2IA 2WG0A 2Q9AA 3WGLA 3OI7A 3UJ3X 5EGSA 3T4UA 1K0UA 1VRCA 4OF4A 1LPSA 4BBZA 1KQGA 2F4VB 4NY1A 1WPQA 1RKQA 4N9WA 7REQA 1N2IA 5G2OA 3N05A 3MIZA 4OL9A 4PSCA 4PS1A 1MB2A 4LV6A 1XRMA 3I4CA 4TWRA 5FBZA 5LDGA 3RC2A 4HWRA 4L08A 4K26A 3W5AA 1OXXK 4XFDA 5AM5A 4CKWB 5TC4A 3TLAA 4XD7D 4PGAA 3W2EA 2OAEA 3ZW9A 2GNAA 4QOIA 2ISQA 3LF1A 4W5OA 1W2WB 5JNSA 4WGGA 4QOGA 4XWYA 2IHNA 1FL9A 1G6KA 1L5LA 1C4WA 3TIIA 5IDVA 3WAKA 3K70D 4NH0A 4LI0A 1L5ZA 5BW5A 3UW3A 3I9JA 5BUSA 2R8BA 1VLZA 2AB0A 4ZYWA 1CBUA 1YJCA 3ZHUA 2QN7A 1U2QA 3DLIA 2JI6A 3NMUF 1K3FA 2AN9A 4PIMA 4JP3A 4G0VA 3CXUA 2OZLB 2X6TA 1XMIA 4YRBA 4K1XA 1A1SA 2XEDA 3PIIA 1N9GA 3N2IA 5DBHX 4D98A 2VJMB 2LW7A 2HSZA 2MT9A 1CFJA 2I03A 3K5IA 3HFGA 4HAOA 4HGOA 4ND7A 1ACJA 3MJTA 1A88A 4X8MA 5EC8A 3TMKA 2AZXA 2AOWA 1X7XA 4CN8A 3Q88A 1XZKA 3IVAA 5F12A 4OKIA 1KMIY 1KTIA 4EUSA 5DN9A 4TSFD 2J45A 1ZSVA 2BM8A 4GZ5A 3PU6A 4PO9A 2VLIA 1WUJS 4YUXA 3LL4A 4P7BA 2MSNA 4H6PA 1DVRA 5B1SA 3HGTA 3KBBA 4BMYA 3NDPA 2EFCB 3PUHA 4PAGA 2NTJA 5BT9A 1ISGA 3EVTA 3B51X 1WCYA 3R8XA 3U61B 1IZ8A 2R6AA 2YWJA 1N3BA 1E9BA 1CY8A 2P30A 3HJCA 3JARA 3MWKA 4BX9A 2HNBA 3MAAC 1KH1A 3OJ0A 2IYFA 1I36A 3DE0X 3QUSA 4U7GA 4C89A 4EGSA 1JWLA 2I66A 3NGXA 1LW7A 4GGMX 1DSSG 1MORA 2ID9A 4NECA 5DW3A 3NEPX 2Q5JA 3D1JA 1RHJA 1WKVA 4D9IA 3G2LA 5KOHA 1T4CB 1R0ZA 1E1MA 4XUDA 4RKFA 4CT4B 3HBFA 4WY2A 3RVDA 3H6HA 3QY9A 3FSEA 1GCOA 1PNOA 3GNLA 4QDTA 4RE6A 1V45E 3ZE8A 1O94D 4PG4A 5TQ2A 5CFMA 4CCAA 1IN5A 2P9CA 2D3WA 5C37A 2H57A 4IMRA 5AH0A 3F8SA 3HMKA 2Q4TA 4O4JF 3SMVA 1E3EA 4DABA 4GG1A 3NTOA 5G4LA 1UR5A 1CJSA 1VRVA 3NPAA 1R0CA 1AQLA 1ARZA 3H83A 1KJ9A 4A1OA 5DBIA 1L4BA 4UEKA 5FBWB 4J0EA 4KMMA 3OEED 4Q4JB 2ODAA 4Q9IA 2E1PA 3ZW8A 4DCGA 1ZS9A 3IR5A 3JAKB 4CNQA 4GOKA 3STUA 5DTIA 4YV7A 1L4EA 4K05A 2WWHA 4LOLA 5DO9A 3PRHA 2P9TA 5M04A 2SBTA 4EA9A 4W1PA 1H2ZA 1D2MA 3QOYA 4DL9A 4MEBA 5E1BA 1LLCA 1PJLA 2ZJZA 4BX3A 1U2GA 2Q5QA 2O1SA 1XA4A 2BKEA 3UMFA 2ODPA 2R1VA 4OB7A 1B6TA 1DOZA 1SA0A 2IEGA 3FKQA 3OIDA 4V3CA 5ILQA 3T9EA 3DWEX 3W78A 2CBGA 3WWCA 3FWNA 4O4LF 5EP4A 4BVGA 1PGNA 1KH3A 1JDVA 1W96A 2E2WA 2GKOA 2RARA 3L46A 3PENA 4PBTA 1YCDA 4ZEWA 4HQ6A 3RRNA 3T5CA 1K5HA 1PW7A 2OHVA 3BHJA 3OZTA 2DJ5A 4JAVC 4GQBA 1TMKA 5F7OA 1PWZA 2W0SA 3RWMB 1Q0PA 2FPKA 3C4VA 4K6HA 3VJMA 5BORA 3O8BA 2IIBA 3GYGA 1ZCBA 2GX6A 4GYWA 3B9RA 2M32A 5A9TA 1XCPA 2XZOA 3KCNA 1JPNA 2G67A 4GLBA 2XTZA 4MR9A 5K4AA 4KW7A 2Y66A 3STYA 3UUFA 1ZU4A 4Q1DA 3V48A 3DKVA 2UVQA 2BGUA 3FOCA 4Q93A 3DFUA 2X4DA 2YIJA 3K73O 2XE7A 4MGKR 1KIMA 4NOJA 2VTBA 4F5WA 1YBMA 1D1TA 4LF7B 3JYPA 2M1XA 3HJBA 4KXMA 3UFBA 1AA6A 4D25A 1Q6ZA 4Q9NA 5EZYF 2CLIB 2Z43A 3QU4A 4FCTA 4GSLA 3RHSA 4ZICA 3EXHA 1H3FA 2RGBA 2NUPB 1I0ZA 2JA2A 4WVFA 3MJCA 3OETA 5D3KA 3REQA 1P5HA 5DYGA 5ES3A 3DV0A 4RA9A 5FO1A 1JZQA 4ND4A 3VQTA 5GP1A 8ADHA 3CZQA 1VL6A 2M9MA 3B7GA 1SELA 1WPXA 3DZFA 4K9QA 4BLWA 2O8CA 3WLLA 5JDIC 2C5BA 1KI6B 4LNHA 1Y4DE 1DIAA 3GJQA 2VF4X 2ZI3A 2Q21A 3O73A 4JL5A 4W1SA 4GRDA 1N6HA 1M10A 3NBMA 3BFJA 4MCJA 1L7EA 2Z5GA 3GEGA 4ZVKA 3X1WA 4CR6A 3IJPA 4JLWA 5EYPB 1RYBA 2WV7A 3HBNA 5ICFA 1X0XA 6NULA 3QIAA 3M6LA 4IDDA 3FYCA 3GG9A 5HILA 4DUGA 4EO7A 3FOZA 2NQ8A 5F1PA 1U0JA 3E58A 4KQMA 3TG8A 1QIKA 2ZYUX 3C6QA 3L0OA 4TT3D 4X24A 1WM1A 2WIBA 1UADA 1G2PA 1HNWB 4ME6A 5JHGB 2GBIA 3S2SA 4UDXX 4CF3A 1ZN7A 4TV9F 5BSKA 2G1JA 3A06A 1QAMA 4Q3EA 3VKGA 2CLHB 4LY0A 4DIFA 1KZHA 2P2YA 3DVAA 3NHSA 3PL5A 1G3RA 3SDBA 5JVDA 1DQRA 3W6ZA 5FLYA 4U2DA 1LRLA 3VGPA 1QLWA 3KLBA 5IK2A 5I5EA 3ZIAA 1ZA2A 2VYCA 2WKSA 4MRNA 1HDGO 1YS1X 5F64A 1SQ5A 5HR5A 5LKRA 1AH2A 4P35A 2B1JA 4ND6A 4Y7DA 3ZW7A 2FPIB 1CRQA 3ME5A 4A26A 2WG1A 1HDEA 1B0UA 4X97A 4GXTA 3QEAZ 1MX3A 3T99A 1IXKA 4Q7KA 5D1HA 4GLLA 1E4OA 1I2CA 4KOEC 2KBEA 3N3BC 4N3CA 1TU0A 3T1VA 1DMRA 4Q15A 3RTEA 4FB4A 3OCZA 5JC1A 3QELA 1ZJ5A 1BW9A 2FRXA 1Z6PA 2XA1A 4KTVE 1UJ5A 4ZHQA 2ZBFA 2JLXA 4MOWA 4MB0A 5LP6B 3CLUD 3R6DA 1NUPA 3O0DA 1R2QA 2EVWX 1AKQA 1C30A 4HAXA 1A2QA 2H48A 3K2QA 1OI3A 4II7A 1VI6A 1WMSA 3L1VA 3QTLA 1Y3DE 1RPTA 3I9KA 2JH9A 3N7AA 1EBUA 3WK6A 3WDSA 4RESA 2DG2A 3CKKA 1FU4A 2XVZA 4FUQA 2CL0X 1P2DA 3EIWA 3FNFA 4I66A 4J76A 4J0HA 4Q7MB 1VBKA 3QLEA 5SYMA 2FSHA 2DR2A 3X43A 1YS2X 4I7EA 4MSUA 2WD7B 4WNYA 1CUVA 4B3BA 4EHKA 4H9GA 2BZGA 3WFZA 2FUEA 2JB9A 4EMTA 4GOXA 1IRIA 1TQ4A 2ZRFA 3DV2A 2O8VA 4MP6A 5IKEA 1UXGA 3EVBA 1ZRMA 1Q0RA 1ZKMA 1CZKA 1BX1A 1LK5A 1RHKA 4IHJB 2E55A 3ORHA 1K2VN 4MWOA 1L3IA 4PU0A 4M2LA 3EEBA 1XZDA 4BDTA 3ZGYA 1AZSC 4I5EA 4EI2A 2DP4E 4FYVA 1JG6A 2QLTA 2QMQA 2W8BA 2R00A 4K40A 4M88A 3SYMA 1K75A 1Q6YA 2NQ2C 4ANFA 4FJ2A 4W8GA 4DG8A 4M7PA 1SCBA 4HXGA 1FPMA 1SAYA 4IQ8A 1TZ2A 1N1GA 1DEXA 2WWGA 2XWPA 4ISCA 3PF8A 4Q9KA 3ETLA 2QD2A 1Z35A 1UBOS 1YBFA 1YL7A 4MW0A 3AVOA 4MCAA 1K6MA 2PE5A 4ALLA 2WQZA 5CX1A 3BCSA 3T9FA 3FMGA 4TXMA 1Q7CA 4JK3A 2XD4A 1PK9A 1E9DA 2GJAA 3UPUA 1T0IA 1YDEA 1ZC4A 3PXDA 4UHDA 3RBAA 3ZHVA 4Z54A 4MAAA 1FP6A 3UJ8A 2XA9A 3URMA 3PDUA 4MJXA 4A6XA 3QTBA 1F60A 1P44A 5IBCA 3M3HA 1OI7A 5A1JA 2V7UA 4MLDA 4OTZA 3U7QA 3OQIA 4FZ3A 3U4AA 4NENB 3O5AA 4JCCA 3DDZX 5DVZA 2GEUA 3PDIA 3P0JA 1U0SY 2QSZA 4DT1B 4W99A 1PNRA 4P22A 5TS3A 4RJ2A 3RVMA 3ZQ4A 2NXCA 3CNHA 3OLQA 4LYYA 1RRVA 1GADO 1S3IA 2I2CA 3SDSA 4PLVA 1SPBS 5KQLA 3AERA 1DKMA 1YUNA 4C4PA 4ASUD 1H2BA 2B92A 2YVKA 4TV8B 5HYVA 2VYVD 3A0RB 3TW0A 3DVLA 5GV8A 4F5YA 1KDVA 1KFKB 5CH8A 1K5DA 2JFBA 1UBRS 1HQKA 5HDBB 5AD1A 1ADCA 1EVJA 1O54A 2R60A 3E3LA 1GGFA 2BR3A 2ATCA 2IPMA 2EATA 2VUIB 3G1WA 4LHSA 3UOAB 2AG8A 3EUFA 1AZTA 1SXJD 1RFGE 1V8ZA 2PZEA 4YP6A 3SNHA 1T0PA 1VM6A 3MCAA 2Z2XA 1E1KA 5EP2A 4BMNA 1RKBA 3MAJA 4A36A 1PX2A 3OX2A 4TMZA 2K4MA 1FW6A 2V1XA 4XJVA 3K09A 3I9NA 1G4UR 1DIHA 3WL6A 4EY6A 3ZK8A 4ZT5A 3LCCA 2H63A 2PLNA 3I72A 3BERA 3RAPR 4PG6A 3GLHA 4U0KA 3OZGA 2F1KA 4UNPA 3SQXA 4OHYA 1MJGM 3SZGA 3G23A 1IY9A 1U99A 2G0AA 2QTNA 5CP8A 3LFTA 3QVJA 4JC4A 4LBVA 2PQMA 3RNOA 1GSAA 3GT3A 4Z51A 3GUHA 1WL8A 1VSBA 3BPSA 1QIEA 2AQKA 2OL4A 2Q8QA 2QTGA 2Y1CA 1YU6A 3KLNA 2FUCA 5FWNA 4QT4A 2JLAA 1N7IA 4HX9A 2FPWA 4RVSA 3TDKA 4CG2A 1ONNA 2HLDD 5BW8A 4G2TA 1QHYA 2OXEA 2QTMA 4CG0A 1QHXA 3A37A 3R5HA 3U4QB 2P8SA 1I3MA 5HF9A 5D3MA 2XNJA 2HD4A 1Z16A 3QF7A 4I6JA 3F71A 3SR0A 3TQTA 2CHUA 4KR9A 1EEHA 2HM7A 1EI9A 2I6FA 1G20A 1HY3A 2AFIB 2JANA 5F73A 3U0BA 1UKZA 3CWZA 3V7YA 1GDDA 2EW8A 1GGMA 3EW9A 1DFIA 2Q3DA 3DOEA 2HLHA 4JI3B 2XQIA 4OK5A 1M67A 2QROA 5FI3A 2WPDD 1EMDA 1JJIA 4HAVA 4RPHA 4UZFA 2JD2A 1LSUA 1O08A 4G0OA 1KR2A 4IUCS 3E9CA 4QAQA 3K35A 5EZ5A 3SF8A 1Z6GA 4JEMA 3WKCA 4CM3A 2Q6IA 3WGNA 4BO5A 1A0OA 4R01A 2J3HA 2H3HA 1ZUIA 3DWFA 3MFQA 3W06A 1TF5A 1CQJB 1GFSA 2YMLA 3I83A 3UCXA 4C7BA 5AVYA 4R2MA 2H7CA 3OM9A 3IDZA 2VYQA 3MWDA 5BO5A 2O7QA 2RI0A 3FYHA 4O2AB 5ARCA 4U0JA 5JADA 3L7AA 1RJ9B 3GWZA 2XIQA 4LXUA 3FDJA 5FRDA 3GEPA 3KQLA 4I1RA 1XZCA 1USWA 1MIHA 4EHFA 1Y1SA 2RHHA 4U39A 3ZY2A 3IHKA 3DMGA 1Y33E 3AP1A 3TL3A 1QFMA 2CMDA 2C31A 4RJTA 5BWMA 3THXA 5JRJA 3OX1A 4DLXA 1ISRA 2QI9F 1CRLA 2D5AA 3BWBA 5EXEA 2FR8A 1OLUB 3JTMA 4H15A 3W2IA 4ECEA 1M6WA 3IDFA 3B6IA 1T3TA 2Q6OA 2B1RA 3RFCA 3ECCA 4AG6A 4IS3A 4N0MA 2CFRA 4CIDA 2OLEA 3TLKA 4ZT6A 4BZQA 3ITNA 3FZQA 4X1KA 3L4BC 4FGZA 3GRUA 1BX3A 4G0ZA 1TMGE 3B1JA 3F2VA 3IP8A 1PGOA 4E46A 4BWVA 2DCUA 2GN0A 3ZI4A 2Z3VA 1KQFA 2HDOA 5JSHA 3NVAA 3ETNA 3HCDA 5FO0A 1S7GA 5EPOA 2CC2A 4GKBA 3GFTA 4L07A 2ZJ7A 3E48A 1HDYA 4U2EA 1Q1ZA 3OMXA 4ER0A 3L43A 2GKSA 2XGSA 1NZDA 3GLHE 2AR0A 3LYHA 4OI1A 5EI5A 2CXUA 4CIBA 2C96A 4ZDWA 4BJ1A 1P0CA 1JSXA 4N18A 1LBHA 3LWZA 4E30A 4XEHA 4Q18A 2V7WA 1DBPA 2D1FA 4JJKA 4U3JB 5LYJA 3LGAA 5JJIA 4WLUA 1HQCA 2OCDA 1PV2A 1G63A 3CMCO 2EDCA 4LPSA 2GN8A 4BGDA 1UOOA 4A7PA 3ZWKA 4S1PA 2QTBA 3AO0B 3DGFC 4ZOLB 1YHZA 2LBPA 2UZ0A 3RE1A 2FFHA 5SYNA 4QREA 1J6UA 3Q11A 4KIJA 1R8SA 4O0MA 5LD2C 4KXUA 5JPIA 3JD4A 1V4BA 2FKAA 3OIVA 4KXWA 4BO2A 4B3IA 1E8DA 1DQZA 2BGJA 4B7CA 3PIRA 4GWKA 2W0MA 4RH0A 3ROFA 3U9SA 1N34B 1G20E 1JG1A 1NJFA 3B1ZA 4LAFA 5F78A 3T1QA 3TD6A 4BPRA 4ZC8A 3DBRB 1KA9H 2HF9A 1XHFA 3PQDA 1IOVA 1JQLB 4MS4B 4KAXA 4WFJA 1E2EA 3ZGNA 2IS4A 1XCBA 3JQ8A 3CNNA 3LQFA 5CFQA 3LZCA 4AJPA 3T3IA 3K6SB 1DPGA 3KM0A 4K03A 2BEWA 3FRJA 1D6MA 1ZICA 2C1ZA 1SBTA 2C84A 3P45A 1QGDA 3NS7A 4IGKA 5LP6F 3CH7A 3HYCA 3CA8A 1E1QD 5BSVA 2P4QA 1GQ2A 3CJRA 1MVNA 2GN1A 1LQTA 5KSOA 3K9CA 2QTCA 4UBOA 1QHHB 2VAXA 3PI7A 4HVLA 3ZLJA 1QK3A 5E7MA 4PXAA 4KG7A 1SUEA 1BXRB 2R2AA 4FHZA 5ELXA 4M0UA 2OV3A 2VWGA 1S8OA 3EZLA 3IT0A 1CCWA 2QRZA 4O5OA 1T9KA 3FZEA 4WFKA 3UH0A 1NU8A 3MBKA 3ENWA 4MP8A 3U1VA 3UVEA 1C29B 5CYFA 1U8EA 3VU9B 1QQAA 1DT3A 2WUFA 3LSYA 1P2FA 4EYSA 5B4UA 2IZZA 3GZNB 5HGXA 3EIOA 4F9EA 1W0KD 1PFVA 2DFTA 2VUTA 3BULA 1TUBA 2FNAA 4TMYA 5I47A 2DBYA 2IVFA 2AH5A 2BFBA 4RHXA 3V33A 5HZGA 5F9FA 3GLIB 1VIYA 5ICCA 3ZHRA 2POCA 1BWPA 2NU6B 3GJ4A 4PG7A 1OV4A 2LP4Y 4CGZA 4OJMX 4FINA 3L41A 2H18A 2HUNA 2UZ3A 4RV4A 3FPAA 2GCEA 3Q15C 5E38A 4R3NA 5ELLA 1QG6A 4DC9A 5IJZA 4A5SA 3MUFA 3NT5A 2PBLA 4B3MB 1YA8A 4QU5A 1RS0A 2YVUA 1TQ6A 4WOKA 1QX3A 1CZNA 3T4PA 4HDNB 5JAQA 5FAKA 1JL3A 3UKOA 2EJVA 3NKVA 4TKMA 3H1EA 3TTXA 1T8YA 3DKPA 2XDQA 5LJIA 2Z30A 4DRZA 1BKDR 2IOQA 3QEMA 3ANSA 2Q45A 5FXMA 1KDZA 1TF2A 2Q3HA 2YV2A 4DJ5X 4PLCA 1FS5A 5JJKA 5LLSA 4BUCA 1ABBA 2PD6A 3E3MA 2Z57A 4GD3Q 4NZZA 5EE0A 4B0OA 1QFJA 3IBTA 5F35A 1P1FA 5FV4A 1I2DA 1O58A 3I0MA 5J3JA 2EEZA 6AT1A 1SVNA 4ND1A 2HJHA 3L6DA 3T61A 4UHFA 4WY8A 2Y4OA 2H17A 1U11A 3VDXA 3HO8A 3BGDA 3RS8A 4JOCA 3THRA 3WNDA 3RS0A 2P1ZA 3I0ZA 4YAUA 5JOQA 4NYIR 1E8NA 4LVCA 4X44A 4FQ5A 2D1RA 3MJ4A 1R4MB 1SUBA 3CMMA 3MZ0A 1E2DA 5LB4A 3DDWA 3VJLA 5BN5B 4E1AA 3AEXA 1ACLA 1JT9A 4GQAA 3GRAA 3IKVA 3SYTA 3CF2A 3TRIA 1YMUA 1CY2A 2XD9A 3E5NA 5CBPA 4B6FA 3QVVA 5CFPA 4ZCMA 3LFUA 3RSSA 4MDFA 3RVQA 4TOIA 3K30A 1AV7A 1P0MA 2SKDA 3EGDB 4UHKA 4EF4A 4XOIA 5FADA 5J58A 1KF0A 5D87A 3NG1A 2BUAA 5GZ6A 1K1EA 3UEOA 1YI0A 4Q48A 4K5QA 3FOWA 4DBLE 3PC8C 1N2ZA 1V7QA 4FFNA 4AJNA 1GEGA 2NU8A 1H2WA 2YOGA 7ABPA 2EQBA 3AV3A 3ABQB 3KLOA 5KVCA 1I7SB 1I4LD 4G1UC 2CZQA 4LA4A 2BFOA 1GT91 1Q20A 2TRSB 1A8QA 2CWDA 3DMTC 4NCHA 1J2JA 4R2WA 2BHRA 3KB8A 2IYOA 1MRNA 4F4CA 2ZIZA 3BFPA 4QC2A 2BEVA 1TIPA 1IBKB 3FWZA 2ZIVB 2PEZA 2ZUSA 2AW3A 1ENPA 4CU2A 1DAKA 2QX4A 2BC9A 3CZCA 3WYAA 3ZU6A 5KWJA 2HRRA 4EY4A 4C22A 5LOVB 2VPZA 5IG2A 3FOEC 2A5GA 3HJFA 1RKUA 6CHYA 1Q91A 3GEBA 3FSGA 4GIBA 1SULA 4KLZA 5BW4A 1JKJA 1ESNA 1ZGGA 3PVCA 4X1IB 3RIHA 3W7AA 4BLOA 4U00A 2WIJA 3RWOA 3FMFA 4M99A 4X54A 5DMHA 1AUXA 3INNA 1BS1A 1Q22A 3ADKA 4UZSA 1V41E 1YTUA 4C0KA 4CFSA 2PUCA 4C2UA 4N9QA 3FI0A 1ADYA 2EW2A 2OWEA 3Q3GE 2C4HA 2RH8A 2VJNA 3HNPA 3M6UA 4F5ZA 1HNXB 1XZNA 1YR9A 3G2KA 1EAYA 4N6GA 1DAHA 1U9JA 2J31A 3G2OA 4OQEA 4P3PA 4RMJA 5EJ6A 2ECPA 3C5VA 5HQTA 3L8ZA 3U39A 1IC6A 4B83A 3EUWA 4LUCA 1TOAA 2ZJ0A 5BYBA 5BNTA 1C50A 4BVFA 4ZCRA 3CF4A 3BXPA 4ZXPA 3BGIA 2YHAA 3JWEA 3E7FA 1ODCA 1UK8A 4BFLA 2ZSHA 3GARA 2FN9A 1T29A 1G7TA 4O2AF 1DG1G 4MKZA 2BZ0A 2BONA 3O8OA 1YR3A 4KKXB 2H92A 3BD9A 4UULA 1NJ2A 2FXVA 5BSGA 2NV0A 2QMYA 4CMJA 1VCNA 1YMVA 3AVWA 3U7HB 5K05A 5KO2A 1ADBA 5GAJA 4IIVA 4GFDA 4KHZA 5CPFA 4ZQEA 3B38A 2PZKA 4GM0A 4QU9A 5G0UA 4QLOA 1NKTA 3GQBB 1IQUA 2OE2A 4GPD1 4GPTA 1DU4A 4KO2S 3ZV4A 4QAJA 5T4FA 4E4RA 3GOQA 2I4MA 1Y3BE 3MCVA 3G89A 3B3AA 3JWPA 3M5PA 4CKEA 2QRHA 4DCPA 4YCMA 2NT4A 2PMDA 1T10A 1L6RA 1NY5A 2IEIA 3IQDB 3MWYW 1CD5A 3K1AB 3PR2B 3QV2A 4AZ0B 4C7VA 4FLEA 4IJWA 5BNFA 3T5MA 4JVSB 4C3UA 3M70A 2XUGA 3O75A 2FSVA 2WMYA 3IEPA 4V1CA 3DT6A 3R4CA 2I62A 4HNSA 1KI9A 2J6BA 1RAEA 5FFMA 3GJRA 1WCWA 1XHLA 4N5LA 4Q01A 1S3SA 1PV1A 2C58A 3LC7O 5T6MA 3DDNA 4L22A 1FYEA 2ECKA 2BM1A 3WLPA 5KOJB 2DY1A 3F74A 1TZJA 4UTVA 1ENOA 5FI0B 2IZ7A 4DR2B 2WY2D 5JPCA 2JGKA 1DKUA 1KPIA 1OTXA 2ET6A 4NTZA 2JGJA 4DV1B 4QFBA 1P7PA 4KPGA 3T3EA 3KJEA 2CLCX 2CK3A 2VJAA 4HDCA 5HRAA 3ZBQA 4YUYA 2WAAA 2Z2YA 3A9CA 2I6GA 3UT5B 2V0NA 2D5LA 1G66A 2EJWA 2DE0X 1PFQA 1IY8A 2L18A 2NUTA 3RFUA 3V5NA 4F46A 1NBMD 2DR3A 3UY4A 3WIDA 4DMHA 4TXJA 2M1ZA 4DNFA 3HA3A 1J1IA 3QVUA 5IC5A 4ENPA 3T1YB 4BMOB 2JLUA 3ZU5A 1J00A 2G1UA 2WU1A 3QX9A 4WERA 1PEAA 5FX2A 1ZGHA 4LJAA 1Y48E 3L9WA 3PS9A 4MW7A 1Y8CA 3NBQA 3E7WA 4K3UA 1ZUNA 3PJGA 4QPJC 1IEWA 1CHDA 3RJ9A 1FQJA 4JP1A 1E64A 2EWWA 2GCPA 2FK8A 4GOND 4I9HA 3VH2A 3ZWDA 1W73A 1CRWG 2WM9B 1YZFA 1PVVA 3DLPX 3IP6A 2W42A 1ONSA 1N9KA 4JXJA 2BW0A 4C08A 2EP8A 4WHMA 2QVXX 4MW6A 2X2OA 3GCDA 3WQSB 2AC7A 4CKXA 4DCCA 3KZXA 2QOEA 3GA0A 1R0WA 3LTNC 4PNZA 1QMPA 1FNMA 2A5FA 4FHDA 3C3XA 4KLNA 3RWBA 2HDWA 2GSWA 2I80A 4EKIA 3CJQA 1GCAA 1Z5UA 5FWXA 3ILVA 3UTCA 3T7CA 2YW2A 4FC6A 5LQUA 2FE1A 3BZUA 3WGYA 1EWTA 4HB0A 3NGMA 4UATA 3RM3A 4LFAB 4G1FA 4Q4JA 2JAUA 2XVMA 5IKOA 3EXEA 13PKA 4OP3A 1VL5A 1HDZA 3LD9A 2R8EA 4JI2B 1EUYA 3FR7A 5ESRA 2V7PA 3EQ9A 4LMPA 3QEOA 4IGEA 4R8VA 3DBIA 5HCNA 1V11A 2PA0A 5IT4A 2JJ2D 4B2IA 3BGOS 2VHJA 2HRBA 3FPBA 2P11A 1RC0A 5KOYA 4AMUA 2IYSA 4A92A 5AM4A 1D5CA 2V9PA 3LA8A 5DBGA 1FUIA 2WE7A 3ICVA 3PXGA 1CG6A 2YVQA 4WXEA 3SEFA 3EA4A 4HADA 1X80B 4X60A 1RLTA 1UMCA 2PT6A 4MQ4A 1WNTA 4X9XA 3DMNA 3ZOZA 3OOYA 3A1WA 1PL0A 2EIHA 4HTFB 4YDHB 2J87A 4PPGA 5M34A 3FTEA 3STHA 4C06A 1EDBA 1AXGA 1IPHA 3C87A 3OZSA 4J91A 4TVBA 4EMSA 1JW9B 2HF8A 2RAUA 1D8AA 2VS1A 4ZOQI 3VR3D 2WMNB 4BWYA 4BCCA 7MDHA 5K45A 5FH9A 2DYKA 3BXOA 1TA9A 2O2HA 2WWRA 3TWOA 3I2JA 1E59A 4LYDA 3JAMA 2JLWA 2XDYA 2MTBA 3E9QA 3MQ4A 3WFJA 1U8UA 5L4NA 1SUWA 3RF6A 1ZH2A 4AY2A 3PDHA 4P3OA 4RTMA 1BFKA 3F5QA 4BB6A 4FGSA 1HE1C 1QF6A 2O5VA 3KR0A 5L3VA 5LM3A 2BHNA 4I50B 1DKLA 2PMWB 3MFYA 3PQ2A 4KQEA 5DULA 4B80A 2EKQA 1T0JB 2NUPA 4BECA 2G28A 1VKJA 2ZREA 1LSJA 3OE1A 1GVHA 4GAEA 2I87A 1SB8A 4YRDA 3ZC3A 3ZGOA 1E9CA 2Z0MA 4KACA 5EZSA 4KX3A 1NVVQ 2AFRA 3HCBA 1XZQA 1OFTA 1YDGA 4MMZB 4JENA 3RNLA 3G7SA 4C1NA 3TF5A 4QLAA 1D07A 3BMCB 4Y7CA 5DNAA 2K2WA 4MLPA 4HN4B 3T7KA 1NW3A 1SIWA 4XTCS 1Q2UA 3A9SA 2VNJA 3HWRA 4J7XA 4JKOA 5EINA 3OCYA 5EUQB 2JCVA 1JB1A 3VDNB 5JSZA 3O3CA 5KYYA 1JXAA 2VNAA 4FYPA 1PS9A 3OJLA 3MRXA 1EE1A 3ZS8A 3N75A 1OLOA 3QHPA 4JJZA 1C80A 1C9MA 1U5BA 5F21A 3WQQA 4DADA 1ANKA 1PYOA 3ROGA 3QFCA 4ZMSA 1GPNA 5JHHB 3D02A 1VZ3A 1GITA 4YRQA 3TR5A 2WHXA 2N0SA 2OILA 5CA0B 5ADWA 1Q1QA 4MIYA 3TFWA 5TQ0A 1Y9AA 4KK4A 1UFOA 1ODKA 5BVGB 1BEZA 4HY3A 2OAP1 3FBGA 2DTEA 2ZCJA 5BNZA 2A9OA 3EY4A 4YK7A 1LC3A 4QDKA 3VJKA 1U7HA 1RM5A 3CO0S 2W6QA 1RWVA 3CEMA 3KUKA 2FG7C 1UK7A 4FBMA 1GQOA 5ENZA 1H69A 3O90A 1MG0A 1PR1A 1GKIA 3NYIA 3BFVA 3PFFA 1E79D 4D8YA 3HKDB 1PQYA 3SKVA 4RLQA 1RLIA 5AI6A 4HYEA 3R7NA 2WKRA 1X1SA 5AICA 5DTRA 4TVSA 1IPFA 3ZDDA 3W4JA 1QFZA 2QM8A 4JCOA 1Z0AA 2Z8XA 1W88B 1YZHA 1GP2A 3QGMA 3L1IA 4YR9A 4LY3A 4BCDA 4B7XA 3UW1A 4B3RB 1E7MA 2BDTA 4N12A 5ALDA 5ERGB 4GZMA 5MFZA 1M34B 3P9RA 3CWQA 1IHXA 2OSVA 4X0EA 3IE1A 2IYVA 2EJUA 3OBBA 3LLCA 4F72A 1YF3A 5AP9A 4CF7A 2QLBA 1D0SA 2P6PA 1O6CA 3G2NA 3I39X 4GOLD 5PGMA 4YRIA 2GTHA 3ND9A 1S0UA 3IXLA 4LIPD 4R40A 2ST1A 4YJ2A 1NV8A 2IODA 1T5TA 2XJ9A 1BGVA 3A9WA 4HWSA 4DNPA 3O31A 4X63A 4FMBB 4ZOEA 2HR1A 2RHGB 5DEOA 4ZVPA 1W581 3TMAA 2QENA 3KFXA 4R05A 3TYXA 1JTVA 4IDPA 1QS0A 4KWTA 1TVKB 4G5GA 2NO5A 3WGKA 1M2JA 3AFNA 4YJ3B 3KETA 2JLSA 2D2XA 3C4QA 2DXIA 2PX8A 4LXQA 2BMEA 3DMRA 3LX4A 3CF6R 1TTPB 4KMSA 3VR5D 2UXCB 1LJUA 4D9BA 5E7IA 3EVAA 1EPUA 2C0CA 1C9YA 4IM7A 2XOXA 4PAQA 4EM6A 2PDAA 1N0IA 4II2A 3GJYA 4WY5A 3QX8A 2Q4EA 2PGLA 2Y4NA 3EPRA 1KEKA 5T7BA 4FYMA 4C4ZA 3B53X 3PL1A 4L8LA 1R0SA 4OLBA 1PLLA 4D9EA 5CDUA 3B6MA 3O2QB 3DAFA 2BEKA 4B3SB 4MVJA 2EG9A 1HDOA 1M0EA 1P9WA 1FQOA 2PBZA 4L0DA 1HLGA 1L8AA 1MNAA 1NJ5A 1T2AA 1QLHA 3NAQA 1O96B 4JDPA 3BJZA 1R7RA 5DMXA 3TLXA 2UYCA 5JU6A 4DCTA 1M6YA 1OZAA 4EJFA 5IHPA 3WRXA 4XIIA 2VQEB 2MCFA 2VN8A 1EXWA 5KNDD 4EB3A 4JIGA 5JR3A 4MAMA 4UVDA 1CXZA 2CJPA 5EKTA 4NENA 4ARSA 4DA7A 1R8QA 1Z74A 4LG1A 4JUDX 1EP9A 2C2ZA 3UK0A 2Y0BA 1B0PA 3N87A 2WB4A 4AN0A 2CDCA 4BYMA 3FIJA 2ZQZA 1KAMA 1U1IA 2JBWA 1DFHA 2CXOA 3PNOA 4EB0A 1DEOA 3E82A 1ODTC 1UWCA 3F2IA 3A4LA 4I0WB 1ZJZA 3C85A 3RGGA 3RI3A 4TV8A 1XD9A 2XCIA 4MPRA 4FDLA 3OCVA 3QPWA 4LCEA 4QBGB 4D96A 3WDLA 1DB3A 3AJ8A 4I9GA 2WZBA 4A0HA 2RHLA 2ZIWB 1GTJ1 1K2WA 4RVDA 4TL9A 5E0KB 3SVZA 3G0HA 2TECE 1E6KA 3WWYA 1KRXA 2PUJA 3NVMB 1Z5GA 3V4PB 4W5TA 1J8YF 4OLAA 4IF4A 1CVRA 4IO0A 3ACCA 4NCXA 4RD1A 4NQZA 7GPBA 4MPPA 4HNTA 4HATA 2NTVA 10MHA 4TRJA 3G88A 4RD3A 2P1DA 1NBEA 5K3CA 5K3EA 3HWWA 3O3OB 4TX1A 3E8SA 4DNQA 1RLOA 5HHTA 4BQNA 3UG6A 3OCWA 4C2AA 2O0LA 1RXCA 4ZJZA 2CGEA 3M89A 4TRRA 5FQNA 1EHCA 3UV3A 4BO8A 1LNQA 4CLHA 1D0IA 2I5PO 2WMDA 3HACA 2H11A 1EUDB 1RMQA 5ALXA 4K9KA 1WVMA 2YWCA 2P67A 2IHUA 3SBDA 5EQDA 1IQPA 1L5HA 3ZIDA 5C1BA 1NMEA 2Y1DA 5F3DA 5YASA 4MRVA 1DQNA 4ZZ3A 4BRUA 1AKWA 3RVNA 4AUNA 1CC1S 1W48A 4C6TA 2DGDA 3CZAA 3K9QO 1U5CA 2GM3A 4OOFA 1JR6A 4IZOA 1WZ2A 2CXQA 5JVDF 3R3UA 3EC2A 3F7OA 5DNYB 2XODA 3CO5A 3EDYA 3LNTA 3BWXA 5BR4A 2O2CA 1E4YA 4DQXA 3GFQA 1M2WA 5B57C 5ALSA 4E03A 4HMOA 4EW6A 4JNKA 1QCYA 4EWLA 3WISA 2JVIA 2QPOA 4CQMB 3BS4A 1G8FA 4CGYA 3AUUA 3VPHA 5AVZA 1YKSA 5FCDA 2AEFA 2QKYA 1R4AA 2F59A 3L1KA 1KDTA 4XJTA 1C0IA 3U9TA 4BNIA 3OEHD 3R23A 4KGVA 3RIYA 3FUUA 2GBPA 1YA6A 4JUAA 2SKCA 4GECA 1A9OA 4KBFA 4MVJE 3DDSA 4WGFA 2NUAB 5F2OA 2D06A 4L5YA 4MWTA 2B98A 5BMVA 2GN9A 4EMBA 3G5TA 4I5IA 1SWVA 3V9AA 1Y6GA 1QOQB 4RY9A 3SMQA 1W76A 2DFLA 2PIAA 3AVTA 4BNDB 4WLVA 1G21B 3SD7A 1CQJA 1EVLA 3PQFA 3EG5A 3K1TA 1C3VA 2ZPAA 3KELA 1SXQA 1LCIA 1WCV1 1KHHA 2D1YA 2PU5A 3IVMA 2FX3A 1C4KA 1F8GA 4G0YA 4XDYA 5H9WA 5LQJA 4TLLB 1XZLA 3I5XA 2VRCA 3NTQA 1N5LA 2ZPTX 3QJ5A 2DPHA 4W4TA 3THYB 1JH8A 1JQDA 3M4JA 4RY8A 3EH2A 3RLIA 1IWPB 5JSQA 5IABA 3FAKA 3OPQA 4V0LA 1ORTA 2ZYWX 3THWB 4HLCA 3CX6A 1L7VC 2CDNA 3MB5A 1K3TA 2P35A 5T41A 3C4JA 3I1IA 4PFSA 3WYGA 4LZOA 5DDIP 2I7CA 5EMMA 3D7MA 1U80A 4KQKA 4XQCA 2Z4SA 1YQXA 2ZZNA 4I50F 3NB0A 4JOSA 2CZGA 2VHVA 4GICA 4MUKA 2X2EA 5GTDA 1BVRA 1CQIB 1UWKA 3BJRA 3P9ZA 4GVXA 5F4BA 1X2EA 2WMOB 2WJ4A 2COKA 3ETEA 3ONDA 1T4MA 4MRAA 3LUHA 4QOSA 5EKSA 3KEFA 4ZAYA 3LA6A 4D82A 1JB9A 4EUFA 4WXPA 4IV0A 3W2HA 1M74A 1HFKA 3BBPA 2IYNA 4XI9A 3FWHA 1E89A 3LCMA 1ICEA 2ZIXA 3Q7IA 1P31A 2H4ZA 2K6GA 2BGLA 2PKQO 3AJEA 4ESEA 4UVHA 1VCOA 4UCXA 1RRFA 1U2GC 3O4IA 3AIIA 2FA9A 3BTOA 4J6EA 4ZT4A 4LVOA 2ZTSA 4V24A 3GIDA 2BFFA 2I7DA 2FU5C 4D5GA 4FFMA 1BA2A 4W5QA 2RC6A 1YB5A 2D2FA 2MYTA 4BIIA 1X77A 3L3BA 3REOA 3ZYZA 1ECPA 3D3QA 4LJRA 3ZQKA 1W94A 1KBQA 4ZN6A 1TQ2A 5A4IS 1TCBA 1E4EA 5C51B 1GUFA 2JF0A 1VCMA 2HWYA 1NPDA 4U3JA 4XIJA 1I8TA 4WA7A 5CA0F 4Z7QB 2BFDB 5E7JA 2JDID 3N3AC 5IASA 4HX5A 1VHTA 4MR7A 4UMFA 3NM5A 4DR6B 3C6XA 3ZWNA 3GEMA 4LHYA 3EEIA 4H1HA 1QVZA 3H05A 4DIUA 1U0FA 3VR6H 3ITKA 2QXUA 4NBNA 1BD3A 4O3MA 1UINA 2ERYA 2X7JA 2QG4A 3AOGA 1UJMA 5E8JA 4GOMD 3W5BA 2J7PA 2ZGVA 3I2HA 1XTVA 2XB8A 1DBWA 4PF1A 4OHZA 4HRYA 3IIMA 1D1SA 2O2EA 3DBRA 3Q5GA 4J4HA 3L2OB 3LRTA 1S8NA 3LYAA 2YKGA 2J3MA 2X0KA 2Z5FA 1G6HA 3EXHC 3K15A 3KHTA 4X71A 2RSLA 2NACA 4MYHA 5CXSA 3ESBA 1S96A 2BKUA 5HSGA 3K6SA 2YMMA 3TJRA 1BXGB 1C81A 1TFRA 1XE3A 2GO7A 2A9RA 4OQ4A 4XRRA 3WLQA 4BO0A 4DG9A 1IB0A 2IHYA 1XTSA 5BNWA 1MEEA 1RYMA 2DKOA 4YQFA 2D0IA 2CFSA 1Y4AE 1KYWA 3ETCA 2WF7A 4H4EA 4HLUC 2OAQ1 1MEJA 3TW4A 3VR2A 4N3NA 3ORFA 4A03A 1TUGA 5B58T 2HIAA 1NULA 1YKFA 3AWDA 4H7JA 2AOXA 2JIZA 1NLUA 3FOAA 4H3VA 3VC7A 2A86A 3H11B 2ZUFA 4GPZA 1RWKA 3WLJA 4I4NA 4MGHA 4RTPA 4UEQA 4BU0A 3DWGA 1IN4A 1GPUA 1A76A 1HA3A 1GUBA 3FBWA 5CM2Z 2PRJA 2EBHX 3GJXC 3L79A 3F3MA 3HI4A 3M83A 2O7NA 3ZI7A 2HCJB 5CVJA 4AKIA 1DJPA 2UUPA 4UU1A 5HQ3B 1U3UA 3MTEA 3P9KA 2FW9A 1IY0A 1KZ7B 1U65A 4I9NA 4M0EA 4A8JB 2HW8A 3BOSA 2C3YA 3TIFA 2Y68A 1BDJA 1RPAA 1VYTA 4MHTA 3HY3A 3GEHA 2R3SA 3VKVA 1KZ4A 3ZY5A 1M2VB 3OQVA 1Z0SA 2J7KA 2QPLA 2VCHA 1QUEA 2XMBA 1O5IA 1EHIA 1UKCA 3QPCA 4Q05A 1XOIA 3ZJTA 3U3RA 2YUTA 2WNSA 4GRIA 2JLVA 2Y3IA 4DCUA 4HO1X 2CNDA 3TGLA 3QE9Y 3AY0A 2HN9A 4PQYA 4FSHA 4RS4A 2YFQA 2FJ0A 2VPPA 3R0ZA 4LZZA 2BCEA 1OYVA 2H06A 2YC2C 2Z6UA 1GJRA 3TBFA 3S1LA 4DREA 5D51S 4Y2HA 5TRTA 4FYJA 5I9NA 3DQQA 3U2QA 2RCNA 4KPEC 4MEAA 4OM8A 1G2OA 1XLTA 2DBZA 4TVKA 1R6BX 4YALA 5DTQA 3BJIC 3H4TA 2BBTA 4I81A 4PIVA 3AHHA 4WMLA 1ORIA 3TQCA 2XBMA 3IUBA 3N0WA 1RWPA 4OMFG 3MLAA 3EWAA 1IDOA 2XZTA 1WZCA 3PSHA 4GX1A 4F4UA 4D8UA 2OQRA 1AGXA 2OGWA 3NV7A 2Y0DA 4DA0A 1WBDA 5AWFC 3ADDA 2DPYA 1T2CA 1WDMA 4HAUA 2Q28A 4ETNA 2PCLA 1C3OB 3S5JA 2QHXA 3UA3A 2FZLA 3ZXSA 1YJBA 3IEUA 1NTRA 2XQKA 3C2QA 4WEQA 4R98A 4DSZA 2CBXA 2P3OA 1P1CA 4ZVVA 2KS6A 3H2HA 1YB6A 3VR4H 1BXZA 1WXIA 2IYYA 1Q44A 5ESWA 4XM1A 3IV7A 1IK6A 4J0JA 5A2QA 3KRTA 4AX8A 4UTNA 4QDJA 3CR7A 4Y67A 3GHYA 3PRJA 4N48A 1J90A 4E51A 2LIVA 1ZH6A 3CX8A 1W36D 1SUAA 4ZQGA 4HLDA 4QEDA 5IAJA 1BHJA 3FKJA 1E2NA 1AK1A 2O2IA 1E58A 1H2FA 2QZPA 3O4GA 1W6RA 2X6RA 3EHDA 5FTNA 5AXAA 2CSXA 3A2NA 1N8NA 3P4UA 1EJBA 1O0BA 2YZ2A 4MA5A 1EEXB 3EA0A 4CLRB 2A1UA 2V65A 1U3WA 3WE7A 1VL2A 2PWPA 4BO3A 4BO9A 4XGIA 1R6DA 3VSCA 1O4WA 3T1OA 1F8FA 2AG6A 2J1LA 3AR6A 3E22B 3QV1A 5LQRA 3OHMA 4RGQA 5H83A 1Q7RA 4URYR 1H6DA 3EZFA 1Y8QB 3K1ZA 1XMPA 1GNLA 1T5OA 1NA5A 3M2TA 1WF3A 3QENA 1ZOIA 4F21A 2JARA 2EIXA 1WD5A 3FDZA 2LR0A 4PSAA 4KUHA 4CUKA 2OORA 2QUHA 3C5EA 1FRFS 1NW8A 1SCUA 2N1BA 1CUDA 1L7QA 1FNCA 1YIDA 2NXNA 3FCEA 3TRJA 2R8XA 3PGMA 4JBNA 3PXXA 2HDNB 2QL9A 5LOVA 1CUXA 2J9YB 3FWYA 3GRRA 3IOMA 3KEGA 4L8FA 5BWNA 2ODBA 5JUWA 4EK9A 3OHPA 1WBBA 1X7ZA 1PR5A 3RFVA 5KYXA 3CW9A 3K0HA 4ZYYA 2G7MC 1QNFA 1I4OA 4IJUA 3LH5A 5C81A 4D41A 4NZPA 1CIJA 3OFNA 4HDAA 1KMNA 1W52X 2FMFA 2WT4A 4FDMA 4X91A 1Y81A 3TJMA 1H2AS 1CEXA 3TTWA 1J7KA 3TEFA 4C4RA 4OHPA 1FFXA 3KR9A 5DZSA 4YHBA 5FUYA 2Q3JA 5J5CA 4ESVA 1TFUA 4UBJA 3HR7A 5DTJA 4NV3A 1BVUA 1MTOA 2YZNA 4HAWA 4L2IB 3U09A 1VYHA 4OHXA 2WJPA 2WINI 2P7HA 4ENTA 1FFYA 1LH0A 3LPMA 4FFOA 2AEJA 2D62A 2RH4A 4QYTA 2OGSA 1SIOA 3R09A 4OFWA 2V9CA 3K09C 1Z5VA 4N3AA 3T15A 2O50A 2CL5A 4M38A 2D8MA 1A5AB 1NXWA 3R9WA 1S9HA 1QGAA 3T9CA 3Q3VA 4KI7A 3SZOA 4M4SA 4GOJA 1PVDA 4O4HA 4KQFA 2A0UA 4ZQCB 1RCFA 3BDAA 3N28A 5B36A 3Q8LA 4Q03A 4G8DA 2CNWA 1S7CA 4FFSA 2KMLA 3KJHA 3MD9A 3GQBA 1QGED 4D3DA 4Z9FA 4D6PA 5JALA 1KS2A 1M6EX 3HYSA 4HNAB 5TY0A 3WZLA 5C18A 5IS2A 4Y2UA 3RQSA 1YV9A 3FFBA 4DW8A 3AY6A 3REGA 1GKUB 2EKBA 1AG9A 1N9ZA 1UMBA 2FQYA 2OXRA 3PFCA 4X92A 4C3ZA 3KJNA 3BHMA 4KL8S 2E4VA 1H1LB 1GRQA 1L7XA 3CYFA 1TRKA 5D6NA 3W1VA 2FX5A 1P7ZA 2JHPA 2PVSA 3RF7A 2IP4A 3OZDA 1YE8A 2FW8A 3CQ9A 3HPRA 3DWIA 4NBLA 5JASA 5BV2P 3GGSA 3QU5A 4EQ6A 4N0PA 1KAEA 5CPBA 1BH2A 4DCJA 3QYFA 4CI0B 3K2BA 2X5NA 4JJ4A 3N70A 3I8XA 5FA5A 3I28A 4Z7OB 2XSZA 4G1CA 3LLUA 1T4DA 3ZJVA 3FHJA 1Y82A 5C7IO 1E2MA 2PUVA 3RVBA 4AS3A 4JX9A 1N0UA 4M76B 3EY9A 2QLJA 3UOWA 3ZHZA 2OYRA 2J5QA 3CX3A 4QUJA 5A3JA 5E6RA 4BKRA 4BO1A 3EISA 4N03A 5KCZA 5L40A 1ISHA 1YR1A 2ODEA 2QT0A 1Y3HA 3RS2A 1FFGA 3MJRA 4NEQA 3R7WA 3OURA 1JF8A 4LDRA 3C3DA 3RU3A 2R8OA 2YWBA 3FF1A 3N6RA 4ZIRB 5FOSA 1E9VA 1MH9A 5ALZA 2C98A 2VTVA 1Z07A 3BF7A 3HY6A 1RLMA 1QONA 4H6XA 4J3FA 1G60A 4FQ7A 2GD0A 1BKSB 2XR1A 3CUVA 5HUHA 1KARA 4N82A 3MWEB 5G41A 4JXXA 1TQDA 5K09A 2ORIA 5EKUA 4OP2A 1A8PA 3WG9A 4TQGA 4DXDA 4RENA 3EGVA 4F6RB 3WHLA 1SU7A 3NW9A 1DBRA 1GO2A 2CJYA 2MYPA 1CV2A 3PT9A 4B17A 3DDCA 3EXG1 2WWVD 2P9YA 4HXEB 3X2SA 3L4EA 1FNSA 4HDMB 3ZK9A 3ZWWA 4PFQA 3HXOA 2GPYA 3KKKA 3I5UA 4TLBA 1UBEA 5J47A 1WKCA 3NH9A 3OZUA 3PGJA 3RKRA 3U60B 4AF6A 4UKDA 4KDEA 1YONA 3VYRB 3DE4X 4DZZA 1UMKA 4HGRA 4GOOD 5JXJA 1E7WA 4HDRA 1VJTA 2VHWA 1U9IA 4C0AC 1A50B 4P4SB 2G9RA 1ZU5A 2FQWA 3HKEB 3S7TA 3T8YA 4BNTA 1NLFA 1XK7A 3U4CA 3SZRA 3HB4X 4C7XA 5DBFA 4FDVA 4K6OA 1MDFA 5DYIA 3RVOA 3SFVA 3T12A 2NP6A 2DHQA 3R9IA 2BKAA 4U2FA 2RJOA 5IYZB 3WADA 3HL4A 3JYNA 1JFFA 4AN4A 1PF7E 2PT5A 3NAZA 1VE3A 1Y9EA 3MUOA 4TM7A 5IUKC 3ZXYA 3HM9A 4QUAA 4LGVA 1MAWA 3DF9A 3MK31 4U7DA 3E3NA 1NASA 2PL5A 1MQ8B 2C99A 1FJ2A 2VBGA 3NIBA 2CLFB 3G2QA 1N1DA 5B7QA 3AQ4A 3SJBA 1NF2A 1M75A 4MKRA 5I7AA 1KEEA 3PLAE 3VV3A 3EQ6A 4AWBA 3VHQA 3B2NA 2IPXA 4B73A 1T25A 3C3PA 3K4HA 4CTOA 6ADHA 2I7XA 4IFIA 2CWWA 5DCWA 5JAIA 3SZUA 2M2IA 5EMLA 5B55A 4Q4HA 3ANTA 4IINA 5AOBA 3NEJA 2QN1A 1NF8A 3HH8A 5LDHA 3FPEA 3TW8A 3LJKA 1L9XA 1MLDA 2JRLA 1UAAA 1HE3A 4L5AA 1XEXB 5C8YA 2D5IA 1CWUA 4DLBA 4Q7EA 1UT6A 4U9HS 5KWEA 2ZFUA 5LIRA 3GV0A 5AKJA 1CY4A 2YJ3A 2ZW9A 2WG2A 4F6CA 2VBFA 1JU9A 1P4RA 2ZRHA 3M2PA 4M98A 4QVKA 2JCXA 4ZAVA 1ZUD1 3AUTA 2DBRA 2FN8A 1O03A 2QORA 3ACDA 3DS8A 3S68A 1Q83A 3L5OA 1ZXBA 1FSFA 1J8QA 5ALHA 4KQCA 4DV2B 3TNYA 1ZLYA 2D74A 3ELUA 5HFNA 5BRNA 4R1PA 2Z2JA 5CVVA 4IHQA 5C0OE 1KZGB 4C4YA 2PNFA 2OAGA 1QC5B 5KWVA 4L95C 3ZS9A 2ZB4A 2AFVA 4JP5A 1KI7A 2GD2A 1FTSA 2RMKA 2FZ5A 3IIJA 1G9SA 3JQGA 2MIIA 3T7SA 1ZXXA 1Z3CA 4ER6A 1OASA 1JILA 1GFWA 5H3HA 4KPYA 2Q46A 2ZCVA 5M2QA 1ECBA 4UOZA 4CXMA 1A96A 2R8RA 1AC5A 3IV6A 3Q6MA 1AHHA 4JQZA 2XCRB 2A58A 1IEQA 3EZNA 4EY7A 2CE2X 2WJVA 2BEJA 4FPXA 4OQXA 1XF9A 1XTUA 1QAOA 2YY6A 4YI5A 1IATA 1TEZA 5U1PA 2B9VA 1XPOA 3ET4A 1ESDA 4JB2A 4G0WA 1R8JA 2BMVA 2FMHA 3KQYA 2AL7A 2MSWA 2O4CA 3M6IA 5JAZA 1NJSA 4A0SA 4QBTA 4BLVA 3OX4A 4EHNA 3UOGA 5I01A 3CCFA 4GW3A 4LWZA 3EMKA 1P1BA 1XTPA 4UTXA 3ZV5A 4HB3A 3QXXA 3NDBB 4G5FA 4J1SA 3EXFB 3OKCA 4KR0A 4E6EA 3Q40A 1XTKA 2NXWA 4YCDA 5LN1A 4E13A 3C41J 3WHPA 3LKVA 3OY7A 5CIYA 4EKGA 1BRTA 1ZHFA 4RZXA 4QM7A 4YHHB 2C3OA 1NI5A 2ODWA 2ENWA 1BAPA 2JLBA 3PQ4A 3E1GA 3Q3IA 1ESZA 3AESA 4QOEA 2ISSD 3C16C 4ZFNA 1QUFA 4QVGA 5JY6A 4CFZA 3BE8A 1IIBA 1ZJJA 2IOFK 4QKQA 1Y34E 1NG1A 4I8IA 1WWKA 1YS9A 2GCOB 2W93A 2YN4A 4I3FA 4LDZA 4NFSA 4Q4AA 2GUWA 3VHXB 4CV1A 5JYCA 4B85A 1X6VA 1BQ3A 1OIWA 5FT9A 3LDHA 3PEVA 1A72A 4RIHA 2H51A 4H0CA 1N5JA 1RWMA 2JBAA 4FFLA 4N6NA 4HB2A 1PZGA 4OSEA 3V8PA 2E4ZA 3NV9A 2ZRPA 4CF4A 3PP8A 1E9FA 2A1TR 2R1TA 2VXYA 1LDMA 4QULA 3WGHA 2QD4A 2XECA 2PRIA 3KBOA 1KTVA 2AMJA 4LJ7A 4AC9A 1NKSA 4ZREA 3FA2A 1MX9A 1MQSA 2QN8A 1BDIA 5F1OA 2FG5A 1CYEA 3BEDA 4J0QA 2C2YA 2JFWA 3O7WA 1KYTA 4IS2A 4YFYA 1FTYA 5DLYA 2WYIA 4JMLA 1UDRA 1W2HA 4KIUA 4QO8A 1F38A 4L57A 4U1RA 1CUHA 3JSXA 4LDJA 3S5UA 3UK7A 2Q9CA 2V7QD 3KYDA 1T43A 3P9QA 3JQAA 4MGYR 5ENDA 3H17A 5T3UA 4A9AA 3K71B 3ZGLA 4XQ9A 4F2WA 1LBSA 4PZZA 3HUUA 4S04A 3GLGB 4ZT7A 3KKZA 2VUUA 1II8A 1GYQA 2AOVA 4PCUA 4QQRA 4ZVRA 1I9GA 2BGNA 2J6CA 3A4MA 3GPDG 1O96A 3NTUA 4K0RA 4OGKA 1FEZA 1RRCA 2QJWA 2B4KA 3HN6A 5GOZA 3WLSA 4AM8A 4AQDA 5KYUB 1N7JA 3EFBA 2AI3A 4JX8A 3MILA 5J4HA 2GM9A 3WAGA 2GEJA 2OSBA 2V55B 3W8DA 3BQ9A 1KQOA 2XXAB 2ZBGA 2B20A 3LKBA 3Q2IA 3VU8A 1EGMB 1E5LA 1ETUA 4OB6A 4NCIA 3TRKA 1YRHA 4MJ7A 2GZAA 4YJDA 2J0UB 3IHLA 4JGBA 1W1WA 1G6OA 5EHNA 1T9CA 2J5BA 4F12A 3BC1A 1Z47A 3C1TA 3TUJC 1GN8A 4FNMA 4HAZA 3H5AA 4INPA 4MQUA 4JT2A 1KL7A 2MHCA 3L8HA 4Y0AA 1ZQ9A 1E1CA 2OECA 2F9LA 4GR4A 4L4ZA 4N7JA 1AXEA 1HMPA 3QK7A 4IJMA 5KBYA 4FE7A 4NH4A 1UKYA 2QE6A 2B9EA 1CJKC 4G9EA 4Q12A 5EIEA 2BH2A 2HDHA 1KO5A 2QVYX 3FWKA 1FXUA 3Q7SA 2L42A 3T35A 4DCNA 1VE5A 4PZAA 4CCYB 3L0BA 4EB6B 4YMUA 3MCWA 1PWYE 1ZD3A 5HRCA 2Q0XA 4C6RA 1V5GA 2IZ6A 4QHYA 4XX0B 4C7OA 3AIKA 4QNMA 3S99A 2WWFA 2YYSA 1Z6TA