5KC8A

Crystal structure of the amino-terminal domain (atd) of iglur delta-2 (glud2)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
406
structure length
398
Chain Sequence
DSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQTEKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTGVRKLGCWNPVTGLNGSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor ionotropic, delta-2
publication title Structural basis for integration of GluD receptors within synaptic organizer complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 136
structure length 398
sequence length 406
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kc8A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kc8A01
4Z4CA 4JASB 3IP5A 3IPCA 4MR9A 5JS2A 3LUJA 3JTEA 4M88A 4RK7A 4S04A 4MR7B 2PAFA 3O2QB 2WB4A 3ROFA 5IUJC 3HCWA 2FTKE 3KG2A 4H3HB 3RVSA 3JVIA 4JP1A 2FLKA 5KQGA 1C0EA 1PEAA 4P98A 1L5ZA 3FMVA 4LE1A 5KQPA 1R8JA 3Q7SA 1GUBA 3T38A 1ABFA 3C3KA 2IPAB 2XDYA 1M2FA 3JPYA 3N8IA 4YV7A 4RXUA 5IEBA 5IULC 2BGGA 4DN6A 3O2SB 1Z2DA 3B2NA 3H5OA 3ROTA 2NT3A 5EWMA 5IC5A 5T7BA 2E4YA 3QEKA 1OXBB 2PJUA 2MYPA 2PUCA 1OXKB 3LUKA 1KRWA 1ZHHA 3EDCA 5HSGA 3NHZA 4Z9BA 1F51E 4Z0NA 1RZRA 3S99A 4G0XA 1D5WA 3KKEA 4MS4B 1AB6A 4Z4IA 5FBKA 3T8YA 3BREA 2B1JA 3IP7A 1E2BA 5EWLA 1USKA 1JHZA 1BA2A 1MB3A 5FWXA 4YP9A 1D4ZA 1YVUA 3LUHA 4EY3A 1A04A 1ZH4A 4TMYA 4MR8B 1KRXA 1ISSA 4F11A 1NY5A 2QXYA 2IPMA 3ILHA 4ZPJA 3SM9A 3URMA 5JNVA 2PUDA 1DP4A 4JB0A 1Z13A 3LUFA 4F06A 4MQFA 5B3JC 5HKOA 1JYFA 1NATA 1SXGA 2JVIA 3M6MD 3TX6A 1CYEA 4KNYA 4G97A 3LTEA 2YHBA 3H5IA 4EVRA 4KREA 1WETA 3HUTA 3F7NA 1DC7A 3QX8A 4RV5A 4WZZA 4ZYLA 1DBWA 1TJYA 3H75A 1JBEA 2HQOA 3I5AA 4RKQA 4ETNA 3O2JA 5KC8A 1VRVA 2HPHA 2PLNA 5DGCA 1XHFA 1MAVA 2B4AA 3EQZA 4EYOA 5ABPA 1U8TA 1K66A 1KMIY 2JVKA 1ZESA 2TMYA 3NBMA 1GCAA 3QLTA 1JDPA 4Z4FA 3Q9SA 5TQJA 3CFYA 1P6QA 3H1EA 4N03A 2M1ZA 2JRLA 2PKXA 4MQEB 3BRQA 1VKRA 5E3JA 1YMUA 1JYEA 1T34A 5KQLA 1H9CA 1FFWA 2HQRA 5TQ0B 3H5VA 3G85A 4Z9AA 3TD9A 1U2QA 1Z18A 3OQOA 4EGSA 2A9QA 4GNRA 4QYWA 4GPAA 4JA2A 4KRFA 5FWYB 1QO0D 4W5TA 3KJXA 3EODA 4MYRA 4RK0A 2CWDA 3N75A 1P8AA 2HSGA 4Z4GA 1NXTA 1RZRD 4HNRA 1F4VA 2GKGA 5HQJA 2FQXA 2WY2D 3A10A 2X7XA 3LMKA 5EWJA 2H3HA 1YIOA 3GV0A 4LE0A 1M5TA 3OQMA 5JS1A 2R25B 4P1ZA 1PUXA 2GWRA 3FFXA 3GT7A 4LE2A 2IPNA 1B00A 4KK3A 3F73A 4W5QA 4OLAA 4CBVA 1JFTA 2O20A 3IPAA 3O1HB 3RVJA 1LBIA 4ZMSA 4O1IA 3H6HA 3M9WA 4RK4A 1U0SY 5TPZA 2P9HA 5KQMA 4WWHA 1JL3A 2E4VA 2FMKA 1DZ3A 4YCSA 3CZCA 1SXHA 2GBPA 1EWKA 1GLGA 2ID7A 3ILYA 5HM6A 1S8NA 3KLNA 1PNTA 3RVPA 3HVRA 4N0QA 3CZ5A 3JPWA 5GQSA 4E7OA 4ZMRA 4RK6A 4OLBA 3Q7RA 3UKJA 4RU1A 5IUNC 1GCGA 3DGEC 3SQNA 1NXPA 1Z2EA 5DKFA 4ZJPA 4RKRA 3KCNA 1DJMA 1DBPA 4Z4EA 4QPJC 4QYMA 1YK1A 3RH0A 3K9CA 5CHYA 4EYQA 4WXEA 1Z25A 2HJ9A 2IPLA 2ID9A 5IX8A 1TLFA 2WRZA 3OO1A 4G0YA 2JBAB 3H1GA 4O1HA 3HEBA 1YS6A 3FGZA 3GL9A 4XFKA 1GUDA 5TQ2B 3O1JC 1Z16A 4IMJB 4KZKA 5JNTA 1JFVA 3W9SA 4N41A 2JK1A 3L6UA 4KVFA 5IUKC 2MYUA 1QO0A 4XAQA 5DCLA 3H6GA 3KLOA 1NXVA 4FE7A 4MPTA 4MRMA 5JNUA 2QSJA 5ED4A 1PNRA 3GWGA 4L85A 3GYBA 3DBIA 5CNMA 1ISRA 2F8SA 5IBQA 1NXWA 3N0WA 3OMXA 2FEPA 4L4UA 3FFTA 3Q7TA 2ZAYA 1D1QA 2E4WA 2F8TA 1NXOA 3HDGA 5TPZD 1SXIA 3OO0A 3OLWA 3EJWA 3QEMB 2PUBA 2WJWA 3OMWA 3MMNA 4YRZA 3LOPA 8ABPA 1BDJA 2QV0A 2ZWMA 3KSMA 4H60A 4MR7A 3NHMA 4RS3A 3JS5A 3LUGA 4XXHA 1LJLA 1U04A 3GA5A 4IF4A 3LKBA 1YMVA 2MSLA 2E4ZA 4LDAA 2PMCA 1E6MA 1U2PA 3G1WA 3GBVA 3VNBA 1PHRA 4NV3A 1SRRA 2E4XA 2E4UA 4JAVC 5F64A 4KQCA 2WMYA 2RJNA 5TPWB 1XWWA 1NXSA 2MSKA 4RSMA 2FSPA 5BR1A 1QKKA 1ZVVA 3O21A 4KFCA 3SY8A 2FW0A 3CRNA 2Q5CA 2FLWA 3SNKA 2PUGA 2NUBA 4OATA 5PNTA 1DRJA 1LJUA 1C4WA 1EHCA 2N9UA 3N0XA 5C5CA 3LFTA 3RQIA 1A2OA 2A9RA 2A9PA 2OENG 2R48A 4EVQA 4MS4A 1ABEA 2FMFA 4WT7A 4XASA 4YO7A 4EUKA 4YR7A 2LP4Y 3QLVA 1Z17A 1Y1LA 1DBQA 1URPA 5T3YA 3SG0A 1VLZA 5FBHA 3MM4A 4PICA 1QMPA 3LUCA 1PEYA 4W5NA 4MGEA 5TE9A 4MS3B 4MR8A 3HM9A 1M5UA 3I09A 3Q41A 3DLBA 1APBA 4QICA 5DTEA 3I45A 5CNKA 2HQBA 5BRJA 2IKSA 3HJFA 2I6FA 2WWVD 3N6VA 4YLEA 3QLUC 3HS3A 4KK4A 5KC9A 2PUFA 4MR9B 2QVGA 5JNWA 1D1PA 5DLEA 2GI4A 2R47A 1NTRA 2QW1A 3IP9A 3C97A 3JVDA 4RY0A 4RY9A 4D74A 3HXMA 2CD7A 3TB6A 3CHYA 4ETMA 3CLKA 3EQ2A 3GRCA 2OQRA 4N0PA 3DLHA 1DRKA 1FSPA 1K68A 4OG2A 4B09A 4MS1A 2NZUG 3UUGA 1ZAYA 1IIBA 1ZN2A 3RVKA 1LK0A 2FXIA 3SAJA 2PUEA 1QQBA 4UHKA 5EWMB 4ML3A 5TQ0A 2FMIA 4KMRA 4DQDA 2PUAA 2L2QA 6CHYA 3RVOA 3MYYA 3H1FA 4Y9TA 6ABPA 4S05A 1MVOA 2FEKA 4TLMB 4KV7A 4RDCA 3CTPA 4E7PA 5FWYA 4PZ0A 3TO5A 3MA0A 4FE4A 1W25A 3O1IC 4XARA 3LKVA 1QQAA 3BRSA 1AB5A 1JFSA 5EWLB 2JCGA 3KS9A 4Z99A 3DZDA 2VK2A 2QR3A 1YK0A 5FWXB 4RK1A 4W5OA 3IDOA 3LUAA 1ZGGA 2YHAA 4O5AA 1TM2A 2QZJA 1TMYA 3T95A 4KPYA 1CEYA 1XHEA 4MQFB 4F12A 1JLKA 1BDHA 2RGYA 1BAPA 3HDVA 3QLVC 3I42A 1QP7A 1P6UA 2W42A 4ETIA 4WXMA 3A3KA 3N0RA 4HNSA 3O75A 4DADA 4PE5B 3QLUA 2CHFA 2VYCA 3TMYA 1KGSA 1DCKA 1LBHA 4LRQA 4EVSA 2JB9A 3BILA 4HYEA 2FMHA 3OLXA 1CHNA 3HSYA 4G0ZA 4EYGA 5C5EA 3FFWA 1I3CA 5I4CA 3CKMA 2WJAA 4MLCA 2A9OA 3FDFA 1L5YA 3QELA 3CNBA 4YWHA 3A0UA 3OM1A 3C6QA 1RXIA 2MYNA 3CU5A 3HV2A 3IP6A 1EWTA 2VUIB 3F6PA 1JF8A 4N76A 5JNSA 2H0AA 4G0QA 4IRXA 4EYKA 2LBPA 1JX6A 3A0RB 2R4QA 4G0OA 4RK5A 3LUDA 3MIZA 4NCBA 2FQYA 2FKAA 3C3WA 1FFSA 3EAFA 4PEVA 4D6XA 1JDNA 2P4UA 3CS3A 2CHEA 3E3MA 3RVMA 1RXEA 4YGXB 3JY6A 4JOQA 4RXMA 2JVJA 3N53A 2FQWA 2JBAA 1QP4A 7ABPA 5CNJA 5TQ2A 2FEWB 1W9HA 3T6KA 1QPZA 4RXTA 3HUUA 2NT4A 4RWEA 1JH9A 1Z26A 5EWJB 1BDIA 4F3TA 3QK7A 1ZITA 3H5TA 4Z4HA 1M2EA 4MAAA 4G0MA 3D02A 1E6LA 3NNDA 4UHJA 1EFAA 3KHTA 2PL1A 1DCMA 4Q6WA 3MQ4A 2AYXA 2RJOA 3KTOA 3Q15C 1DCFA 5D2CA 3C3MA 3K4HA 2FN8A 5KI6A 4IMIB 1DG9A 2V0NA 4MLDA 3EULA 3HK2A 4IGAA 2GX6A 3M9XA 1MB0A 2LPMA 4RZSA 3DGFC 2AYZA 1QP0A 1VPWA 1E6KA 5JNRA 4W5RA 3QX9A 2IDMA 1ZH2A 3P9YA 3QEMA 2QVCA 4HNQA 3L49A 1YS7A 5CNIA 3MF4A 4MS1B 4LX8A 1USIA 4IILA 3E61A 3RVLA 3KYIB 1A0OA 1D2AA 3GBPA 4NQRA 3RVNA 4G86A 2PE5A 3RVRA 3OLVA 4TN5A 9ABPA 3HZHA 3OLYA 1ZY2A 4FB4A 3EGCA 4JB2A 2L18A 1NXXA 4N47A 1JWLA 4Q6BA 3OQNA 3OLZA 5TPWA 1FFGA 2FN9A 5KWSA 1EWVA 1YTUA 2L17A 2MYTA 4PYRA 2PL9A 4KQ9A 1MIHA 2RDMA 1RPJA 2MSWA 3O74A 1ZDMA 3R0JA 4YS6A 3BBLA 1EAYA 2L19A 4OBBA 5BQ3A 4WUTA 4MQEA 4D6YA 1FQWA 3F6CA 3CG0A 1USGA 3HO1A 1Z15A 2IOYA 2FVYA 2LUOA 2VUHB 1HEYA 3NNNA 2KYRA 1P2FA 3H5WA 5B3JA 1SD5A 1ZGZA 4MRMB 1UDRA 1Z12A 2DRIA 2IYNA 4H3KB 4TLLB 2QU7A 5GOTA 2NZVG 3CG4A 3OM0A 4MS3A 3UK0A 4G0PA 4F8JA 4NCAA 2J48A 3VNAA 3D8UA 4LDZA 5IEJA 3KYJB 1RNLA 2LIVA 3NNSA 1J56A 4NICA 3H5LA 4RY8A 4XLTA 5BRAA 2M98A 1QNLA 1TVMA 4OTZA 4Q7EA 3RVQA 3QELB 4LZLA 1BVHA 1DC8A
chains in the Genus database with same CATH superfamily
5BRJA 3TQSA 3KT0A 4JASB 5EPUA 4DM7A 2FFBA 1PJRA 1OASA 2X8JA 1Q16A 2CE7A 3K6RA 1Q0ZA 2VF5X 1NFQA 3QBTA 2J5BA 4CNBA 3ZDCA 2XUZA 4BTEA 4PYIA 3OTOB 4KRXA 4YJ3B 4Q3KA 3C45A 5J2UB 4US0R 3ZW8A 3HSKA 1P5FA 2VSQA 3ICOA 1NQVA 3VX3A 1IZ0A 4CM4A 3HVJA 3LQ2A 4LQLA 3U62A 3UFBA 4MYDA 2C5LA 1NUQA 3SQDA 2OHOA 3C1TA 3IKLA 3V7FA 3T3EA 4AJHA 1RXCA 3KZVA 2CT8A 3DZHA 1TM5E 2OYSA 4JBXA 3JVVA 3GXBA 1E9BA 3RWOA 2VATA 3QVLA 2W2XA 1X7XA 3G9ZA 1QYIA 2IEDA 3QEKA 2C59A 4GPZA 3LUKA 2HK7A 1O0BA 1IJKA 1I30A 5JDCA 4AKHA 4NEQA 1G6OA 1VSTA 3OC6A 4OKIA 3LCCA 1OXTA 5B3LA 4A91A 5AMXA 1E62A 4ZVTA 2BMWA 2XSZD 3PHBE 2P5UA 1XEXB 4J4TA 4QDOA 5G1OA 3S2IA 5JJBA 1OLXA 2VHJA 5J23A 4R1MA 3M6UA 4QHYA 5TXGA 4B76A 4YRGA 1RXWA 2RH9B 4UEOA 3IUYA 1YQDA 1ZVMA 1J2RA 4TV8B 3PUYA 1YVUA 2F00A 5TARA 1O95A 3D2BA 4BV2A 1F5SA 5IMSA 2XCRB 4C1BA 2PK3A 4E32A 4QUDA 4DCGA 5ICMA 2D6FA 1SKAA 4FFOA 4D9JA 3EXFA 3F98A 3EIOA 5HXAA 1DHTA 3UHJA 4L7QA 3FLMA 5E1BA 3CEMA 2GCIA 1K8QA 1M54A 1YZHA 3WIBA 2W9XA 3NO4A 4NBLA 3QLJA 3WAGA 1W4RA 1GA1A 3TUJC 2YHBA 1ESEA 1AKYA 1T4MA 1WTCA 3DHEA 3DXXA 3FRIA 3T54A 3HUTA 3U3OA 5FR1A 4IH1A 4MKRA 1G8SA 1JLSA 1TYDE 1XQWA 3LF2A 3PJEA 4RDHA 4XVUA 4DR5B 1NTOA 1IDN1 4ZCLA 5KC8A 1OX4B 4IOKA 1C8LA 1N7JA 2HPVA 2YW9A 3D4BA 3DFMA 5F2NA 4YRRA 1KMIY 2VPIA 3EVBA 3JRNA 3MJEA 2QG9A 2EFDB 1RU3A 1N9KA 1OYVA 3C5VA 1JDPA 4D9KA 1KEPA 3KX2A 5F5XA 1MMFB 1P3Y1 5LZ8A 1ZM2A 4BVJA 1FY2A 3A4TA 4C2TA 1LA2A 4LYEA 4MI3A 4YXWA 4M21A 2ZBPA 1YBHA 2H1IA 3Q8KA 1TUIA 4OJKA 1K75A 1IE3A 5HFJA 5E3JA 1HE5A 1DEOA 5JG7A 1Z8FA 1OI7A 4QOGA 2JLVA 2HQRA 1SOMA 2VA8A 3HFGA 1HUQA 1U6IA 1GITA 1Z18A 3N8HA 4H08A 4CKCA 4JR2A 3SC6A 1YH3A 5BWNA 4WBNA 1ESZA 1KI6A 3C87A 3EA4A 4ZARA 2I29A 1VHQA 3GGOA 4CMHA 1HG0A 2HGZA 3QUBA 4A36A 1ZD4A 2O2EA 1NX6A 4GKBA 4PNEA 4G1FA 1Z6YA 3VOBA 1V9SA 2GKGA 5K8IA 4DXHA 2WPNA 4RCZA 2P1RA 1OTXA 5EXPA 5BSHA 1UOPA 5LP1A 3O8OA 5K8TA 4LE0A 2V0CA 4O8CA 1EU1A 1OT5A 4DUZB 1RRKA 5A0FA 4M0MA 1U31A 1EE1A 2FR0A 2PVCA 3MB8A 2R25B 4OI0A 4INZA 4L07A 1FDSA 3WKBA 5LOVB 4LF9B 1O95D 3R6GA 3F73A 1E2HA 2Q1UA 3R7FA 4ZMSA 1LBIA 3LX4A 2GETA 1W5BA 3JV7A 2RAFA 1TKCA 4LY0A 2JANA 3VHRA 1W94A 5LUBA 5U4QA 1ISIA 1KGDA 3AXTA 3S8EA 1CIVA 3G02A 4NZYA 5AT1A 2B4TO 1SB8A 4QOEA 2J31A 1HTBA 2JA1A 5JYDA 1QUFA 1ZMRA 1WXHA 3RC3A 1T5HX 2J0EA 2JHPA 1U81A 1ORIA 4X7MA 4YI3A 4CCYB 3RHTA 2NPOA 1TF5A 1Z8NA 5EVCA 4B75A 4NU0A 5K6AC 3TW0A 3EWNA 3LVBA 3UKJA 4RU1A 3H2ZA 1MTZA 3PQ8A 4JJAA 3UMYA 1UM9B 1K3UB 1QGYA 2FPKA 5EJ4A 4BV8A 1MKYA 1N5LA 1RHJA 4N5NA 4QBTA 3A1EA 4QNMA 2OQVA 4YXWD 3L5KA 3IOBA 2X0KA 2EU8A 3OWOA 3RKRA 4DRXB 1NVVQ 1C3OA 1IEVA 3U6BA 3BF8A 2ESRA 2CDBA 2I2AA 2QW0X 4M54A 4RABA 2YY7A 4RVUA 3Q72A 5FOVA 4C6SA 3AIOA 1H3EA 1EM8A 4L74A 4RL4A 4PGFA 2PV0A 2TRSB 3UOWA 1NN3A 1WHTA 4MV7A 5HCUA 1DFHA 1NMSA 2VNAA 2J5QA 3GL9A 5DWQA 3NRJA 1JKJB 3DM9B 1VA5A 5L9AA 3T3DA 2AN5A 2HA0A 1GG5A 1XROA 4UPVA 2ANCA 3HDQA 5IUKC 4Q9LA 4LS3A 4QJ4A 2PRJA 4NZOA 4KLZA 5ENDA 3U4QB 1H8HD 1PJ8A 1RAHA 1ISRA 3ZDRA 4B7CA 4MB6A 4ZVUA 4M9UA 4ZOEA 3PNPA 4E1VA 3TTSA 1NVUQ 1T2CA 2AJLI 2QIPA 3UK1A 3ICCA 4PC7A 2JI7A 3RM3A 5LQDA 1H4QA 2HPZA 1EDBA 3UUEA 4BAGA 1CS4C 1U28C 1X8LA 2ZVDA 3FLAA 1SXIA 5CLIA 3TW4A 5CB4B 4B3MB 5AH0A 4O2BF 2Y1XA 3HB0A 2B4QA 1KDRA 2DTEA 2MR5A 4K9SA 4KXMA 3W06A 1QHNA 3M8KA 5BMVF 1P2BA 3JYPA 1LQTA 1Q7GA 1XDSA 2QV0A 4JELA 4RHTA 3TECE 4H9GA 1WW8A 4K6KA 5FPYA 3TSOA 3U40A 1D04A 1ZZGA 3I6BA 5FORA 1SHKA 1ZQ9A 4QPCA 4PYLA 3LGAA 1SXPA 4L3VA 2J0SA 1Y7PA 3EWIA 2QGNA 2YXEA 2R86A 3O5AA 5SICE 4XGNA 3MPUA 3ABIA 4LDAA 4NG4A 4DLLA 1JXQA 5CFZA 1C0KA 5FHRA 2HJHA 3MXTA 3MBKA 4EUSA 2WTUA 3OSUA 4WFIA 3AHEA 5AVZA 5LXTB 3F49S 2VZ0A 3R9WA 5BP7A 4PG5A 2R8XA 2WJIA 5KX5F 3Q2OA 2A5DA 1ZVVA 1U9YA 3DKIA 4GI5A 5FI1B 2AFHA 3SY8A 3LQ4A 4ID3A 3OJ0A 4UBMA 3OP1A 2HTEA 2UVPB 3SZUA 3SNKA 3UGQA 5BQPA 4LFAB 4RESA 1Z06A 1T0HB 3OURA 3IV9A 4QBFA 5IXSA 5C5CA 4ZCQA 4XWKA 2A9RA 1HNZB 4CL0A 4I36A 7AT1A 2UAGA 3PUHA 3R5SA 2BCJQ 4LXUA 4U5XA 4CMGA 1TK3A 5TT1A 4R2KA 1D7OA 2ZWIA 3UG6A 4DR3B 1LPAB 2KBEA 2GZMA 5H4HA 3Q6NA 4EA7A 3TQHA 5CEJA 1HDIA 2W7TA 3FZQA 1IEWA 4FBGA 3UBMA 4CM7A 3ONWA 5JDIA 2VPPA 1KI8A 5B57C 5LQKA 2GA9A 3D6JA 4KE9A 5DI3B 5TNXA 3FKSD 3OKFA 4R54A 2C3OA 3K1AB 2G7ZA 5CNKA 5LQCA 1E99A 3G1TA 1P2SA 1H6DA 2ERXA 3B3JA 3KAQA 3MWYW 3IR7A 4KW7A 4F6RA 2ZS8A 7REQB 4GZ3A 1QHIA 2XHEA 2C5GA 1UC9A 1W2HA 4GYJA 2XCQA 3NWJA 1JNYA 1K1EA 1Q19A 1J0CA 3M4XA 2V6BA 2IFTA 3DOCA 1SBCA 2AOUA 4KX5A 5LMUB 3RIYA 3JWEA 1RC1A 4N8SA 3B13B 1NTRA 1NA5A 3FOBA 3I58A 3L8HA 1FP4B 5T8KA 5B4VA 1T13A 3NANA 3FDZB 2DP4E 3R9XA 2O52A 1MR3F 4GIBA 4D9CA 4L8WB 4N6OA 3TNYA 4DAEA 3EH2A 3EFHA 5TLSA 2OB2A 5FNVB 1K68A 2WWYA 1JEAA 3GNTA 4QJ3A 1FVFA 1XRJA 2YOFA 1IIBA 2W71A 3I04M 1L5KA 2W6CX 4XPIA 3M1IA 4MHSA 3T3IA 3RNOA 2XR1A 2OZLA 4NYIQ 3VDMA 5KYUB 2F1OA 4EHFA 4K9QA 4EPRA 2RGAA 5K0NA 4NK4A 4URVR 2J6IA 2B6NA 3I2HA 1KI4A 3H1FA 1KKUA 4TL7A 4O4LF 5H7XA 2WU8A 1SXQA 2CK3A 4OF4A 1ZEJA 4I4IA 5KDOA 1AGPA 2NQ2C 3MT0A 4K7JA 3TO5A 3UFXB 1ODLA 3NEAA 4OJQA 4ZHQB 3PX2A 3QOFA 3FUUA 1KIFA 1YASA 3H7IA 4CZ2A 2EJWA 1WNTA 4AK9A 4EZBA 1Y6ZA 3AFMA 3EZLA 3ESBA 3EIHA 4RK1A 3WYCA 2ONKA 2ZRIA 4FUQA 1XTIA 2F43A 1TIKA 2CL6X 5FUVA 5F2OA 1DJQA 1W52X 4CIAA 1CUXA 2VZ8A 1E0AA 3VNQA 3ZJ5A 1M1ZA 2YN0A 4H7IA 4CCAA 2FMTA 1BDHA 1TFRA 2GYVA 4J0FA 5FR2A 1KNXA 3LT1A 1X7DA 3T1OA 1JPVA 1QBKC 5JISA 1YBMA 2O5CA 4KE6A 4UVEA 4ZEOA 4DADA 3IBYA 2IOQA 3QW4B 3R5HA 5FOXA 1VLVA 3SJ7A 1JBQA 3GPLA 4AY6A 2Z58A 5HRUA 3JVEA 1NKTA 4EVSA 1U80A 2GM3A 1Q14A 2FUNB 5EE5B 2J5RA 4CFSA 3ZXSA 1NWHA 2Q3FA 4Y9RA 4DR2B 4KPUB 1V8PA 5JJIA 2JGKA 1OROA 4QWWA 2WJAA 3SR0A 2O3RA 4A03A 1E9AA 3D3KA 2DHQA 1YS4A 3F2VA 4TVKA 1JWBB 2YWHA 4XYBA 2PT7A 2AQKA 1PNQA 2WD9A 4H1TA 1T1RA 1ADYA 2MSNA 2YXLA 4GGMX 1WUHS 3DT8A 3K9HA 5L51A 5LR6A 5KPDA 4U2CA 4XYGA 3KKKA 3COPA 2NVUB 1V2HE 3WYAA 2C99A 2R4QA 4UOQA 1OBOA 4Q4JB 3FZYA 5CFNA 1IUOA 1RR6A 4DANA 4NCBA 5DNVA 1L4NA 3EAFA 4BQQA 1BA3A 3DZBA 2EKBA 4KQXA 5G53C 1AS2A 2QYSA 1CRZA 4L9RA 1KDZA 5JRDS 5AI8A 1JALA 1FDWA 4NFLA 5JCJA 3BXEA 1EVYA 4FFNA 1RMYA 1CR4A 1X7GA 2CK3D 2FW8A 2HO5A 2QLJA 5LDGA 5HZGA 4BO2A 5KVSA 4DA8A 3EG9B 2X4DA 3IOYA 4FI3F 1R88A 2JIDA 2SKDA 1OXMA 4XQ0A 5H3HA 2VTEA 4R1SA 4PLVA 5EI5A 1IIRA 2P8SA 2B99A 1DQRA 2H4WA 2ZSAA 2PIAA 2QENA 3EDYA 3OZBA 4REQB 5GOZA 4KSCA 3SYNA 4DTCA 1ZKDA 2QX4A 3E1SA 1FRNA 1NI4A 2AC2A 1DEKA 3MJSA 2P9YA 3WAJA 1XEFA 3B1FA 4L15A 2VC2B 3KHTA 3JQ9A 4BNLA 4H3SA 4CMEA 3HUEA 2X14A 4IXDA 3MRXA 2A5FA 1DOAA 5H0IA 1IG3A 2OTCA 3AKCA 3FPEA 3SHTA 3W1WA 1O9HA 1XEXA 5KI6A 2VWHA 2W4QA 5IZCC 2R1UA 3THWB 2GX6A 4ARSA 1RM5A 2YWJA 4EARA 2YIDA 1JKMA 4YRIA 2PAAA 4JQZA 3ZNNA 2ZCVA 3S2UA 5JYEA 2OK8A 3LA6A 3VVMA 2WP0A 5EP1A 1ID1A 1Z4LA 1XKTA 1Z6ZA 2A84A 2CL7X 4R05A 1TU0A 3USZA 3KYIB 4C14A 5HBGA 1QVAA 5AVOA 4ZDIA 3G9XA 5K3AA 1L4YA 2YXBA 2ZW9A 3A37A 1DQSA 3GPDG 3WV4A 5LYJF 2O3UA 3ANLA 3FN4A 1SUSA 3EFOA 2OFFA 4ZMBA 1OFUA 5KMGB 1NXXA 4TMFA 2CBGA 1V0JA 1NF9A 1II9A 1AS0A 4CT5A 4IX1A 3LQ1A 4KIUA 4LY9A 2CEKA 4X60A 4BO3A 2WAXA 3AR2A 3AJDA 2CHGA 1EJ0A 1FF9A 2NXEA 1ICIA 4A6EA 4EJMA 4YPOA 5IBCA 4GMXA 4PYRA 3E8XA 3LRXA 4M9RA 1CUVA 3M5DA 3AGQA 4UU7A 3HU5A 4WADA 2G9ZA 3OWXA 4HLQB 4LCJA 5CW1A 4OI1A 2JLBA 5EJ5A 2QNBA 2QG6A 3MAGA 4N8DA 3IAFA 3H19A 1RLUA 2X0NA 4X8OA 2XUJA 4S24A 2ZCUA 3W6NA 5C8YB 1ZJZA 3II6X 3W90A 1HE3A 3H99A 1W0KA 3E7DA 1EUZA 2VUHB 2OV3A 2UZ1A 3EGIA 4YAJA 4CMBA 3CJQA 2JHAA 3B6KA 2KYRA 3H5WA 1V39A 2OHGA 1LPMA 5DGIA 4GWGA 3WI7A 1BJTA 2G5PA 2WA1A 4FYJA 4IIJA 2XW6A 4HTAA 3AR4A 4QXOA 3X0DA 5L3VA 5KREA 4YONB 4FOTA 3CX3A 4KIFA 1D3AA 1Z0ZA 1CJSA 5ALGA 1IPEA 1GUYA 3R3XA 4MS3A 4X3CA 2IV2X 5BSFA 4FD3A 5ELXA 2Z6UA 4NCAA 2GNPA 4LDZA 1ZL2A 3PXEA 3QEJA 5ESRA 1PT6A 3DEJA 2JCVA 1N2HA 4NEHB 1EK2A 1SHZA 1M1XB 4IIVA 5EINA 3TQRA 1TVMA 1XZCA 3V4VB 4YCCA 5CG2A 2II6A 3LPAA 4MW2A 5I9MA 1ORWA 3T61A 3BH7A 1M0TA 5T3YA 3WS7A 5JADA 1O7JA 2QUJA 2JGDA 2Q41A 8ATCA 4U9IS 3O03A 1GZSA 4NPCA 3ROFA 5IUJC 5FULA 5FBLB 1VRWA 5JO0A 4GOMD 4H3HB 3JVIA 3KOZA 4P31A 2GVDC 1JS1X 3HWWA 5AXCA 3TD2A 3SS7X 1ULSA 3AOGA 4HEJA 2NAPA 4D1YA 1HA3A 4BMZA 5SZJA 4EW3A 1FXWF 1UJ6A 1N8KA 3AHCA 2GCEA 3MT8A 2PGIA 4K46A 1RM0A 3NEYA 3CYFA 4WLOA 4R1QA 1QTIA 5LNK1 5BOSB 1YJAA 1XEWX 3A1DA 5JRZA 1CUFA 2YZMA 1BXKA 1QCDA 4EAAA 4EG8A 3BGWA 1FTQA 1U7DA 2I33A 5JXGA 4FN4A 4FXPA 5AVQA 1EK6A 3MJ4A 4B9AA 1ZVKA 2C5EA 3DTYA 3M49A 3BIOA 4R6XA 1EJBA 1GD1O 1OBVA 2I9PA 3P45A 1R6BX 4AZ0A 2DR2A 1DIAA 1WV1A 2G1AA 3LLMA 4TMWA 2GEDA 2RHLA 3OSZA 3S2FA 3WBBA 4CV2A 3FUXA 5DOZA 1OVMA 2Q29A 3ULKA 1IATA 4KMSA 4GS5A 3SYTA 2ZUCA 3CZMA 1K5GA 4P92A 4RM3A 3IIIA 3FNQA 2B1JA 5H02A 3S2ZA 1BA2A 4TKLA 1T2EA 5EERA 1Z2NX 3PA6A 3NIDB 1SUCA 4TMYA 1E6EA 2A7QA 2PKYX 4HVLA 4O2AA 3ZE7A 1JKJA 1Y0BA 4JI7B 2FSSA 3DFIA 5EKXA 3ESRA 3PWTA 4PX3A 4JUIA 3HKEB 5C1IA 1H6AA 4JXKA 5JFGA 4QOHA 3E15A 2J3KA 3AXSA 5AK0A 2VDJA 1JG6A 3MWFA 4KQ6A 4LHSA 2R5WA 3T7IA 4COKA 4EX7A 3U4QA 2QUBA 2HF2A 3WGJA 5K0FA 1AK2A 4ZYLA 5D85A 1XF9A 3NAMA 1SHJA 1IJEA 1RWXA 5ABPA 5NULA 2FPSA 2R85A 2O50A 5BWOA 1J0AA 4FHCA 1E1MA 4CM1A 3FMIA 5DOVA 1B8UA 3A31A 4HXFB 5C7LO 3H1EA 3TMKA 3D7RA 5DTIA 2JRLA 4MQEB 2G5TA 1W0JA 2A5YB 3IIJA 3K70C 2NUPA 2IE8A 3I8SA 3HR8A 3N59A 1FX0B 2P5YA 4MYTA 3G0OA 3JWGA 4X1IA 5TGDA 2V58A 4DMFA 2O23A 4CEIA 4Z9AA 3K72B 3OWHA 4EBFA 3DXFA 1DIGA 1CE8A 4N5HX 4Y1GA 1ZD2P 1M8FA 3D0RA 4GPAA 4C4SA 1WMFA 2BT4A 1JQ3A 3UATA 1F2TA 1JSZA 4TSRA 3VR2D 5EJFA 3NIFB 5CYFA 5E4YA 1NXTA 1IB0A 4D9EA 4D9GA 4H7HA 3UZUA 5HOQA 1F4VA 4IDCA 1AUQA 4DDTA 4QBHA 2X7XA 2C5HA 1JAZA 1HMPA 3N0VA 5CIWA 2G9NA 5I8WA 1TM7E 4F2GA 2JIZD 1T9GR 2O1XA 4P6VF 4R1NA 3AVXA 1P2DA 1E2UA 4M1EA 4C4ZA 1XAHA 4NS4A 3PUIA 5K0EA 2QL6A 4ND3A 1N9GB 4TV9B 2XB8A 1Y7LA 2Y1EA 1KJ9A 2WC1A 3FNGA 2D0OB 3H3JA 3LKDA 4IHJB 2W8BB 4RGVA 5EIBD 4BQEA 2BR4A 3GQBB 5KYNA 3MYRA 1SK8A 4NCIA 2GPYA 3OT1B 3ZHOA 2OMEA 3RBXA 2VEOA 3HQ4O 2W37A 2IUYA 3OTIA 2QTFA 2ZE7A 4MDFA 3M0EA 1E9FA 3AETA 4NARA 3ER9A 4UAJA 1DO0A 1E5DA 3RBVA 2ZLBA 5J43A 4I8XA 4UNNA 3DBLB 1WKVA 2KLBA 2VNJA 3HR7A 1PNTA 4M9ZA 3TDNA 3TOVA 4F4HA 4K05A 4CKBA 2FX5A 4WK0B 5LQMA 4PW0A 2A88A 2YJ3A 4DHEA 7REQA 4RK6A 3UM9A 2R97A 1XC7A 2AA3A 4WBXC 1LVUA 3NGXA 3FYUA 4MW9A 2ZYRA 2WE8A 2PA0A 1FU8A 3E1KA 3UAZA 2IYRA 2BEVA 3WYDA 4UDOA 3KZMA 3X2SA 3K71B 4E0BA 2GF2A 1CZRA 4DMRA 1VL0A 2XXAB 1R5NA 1L1QA 5JH7A 3DULA 3JQBC 3R0VA 4KRGA 1B0PA 3PDJA 3RH0A 4DIUA 1MUUA 1E9CA 4HYYA 4NXMB 1I7QB 3E9DA 5FNVA 3ETCA 3OZRA 5DYIA 2TMDA 5DV9A 1DC5A 3GCDA 5DTJA 1Z38A 1A95A 1Z16A 1LQUA 4NYMQ 1D2CA 1YRLA 4HRXA 3FB4A 4N41A 3HV0A 1I4LD 2LCQA 4ZA2A 2VSOA 3QQPA 1NR5A 1K4YA 3HKDA 2FWAA 4KAJA 5F1YA 2WNSA 2IHNA 1SBZA 4FE7A 2Y68A 4P54A 3HBNA 2SKEA 1UZNA 1F6WA 1YQXA 1R6XA 5ED4A 4D41A 4MVJI 1R8XA 3PTZA 1GP2A 2IU6A 2BSXA 2GQ0A 5FOWA 2XKKA 1KAGA 4ZHQA 1BXZA 2R6R1 1YAHA 3A06A 3A9VA 3W8FA 1UOQA 3EPPA 3NHUA 4WLUA 5T4FA 4D0GA 4NZNA 2H0RA 5G2OA 1NXOA 1JDBC 1JR3E 2HGSA 4CDRA 2XPCA 4EPTA 1UDAA 3COSA 1SHTX 1EQAA 3EMKA 3MRTA 3WWDA 4AZTA 3QEMB 4CUKA 3GB9A 4YRZA 3K0CC 3VNUA 1BJRE 1BDJA 1YU9A 4LZOA 4PNPA 2CFCA 1D2HA 3T52A 2R8OA 4O4IF 4BKRA 3ADKA 5ICSA 4M2LA 1OZFA 2V9CA 3T5DA 3V4RA 3QVMA 2SNIE 5ALQA 2GJAA 4B3IA 1ZMTA 4EMSA 1VBFA 2C94A 2PRKA 3OEYA 1CUCA 1J20A 4HNUA 1WWKA 2C96A 4NV3A 2QWXA 2E4UA 2EGUA 1P5ZB 1XCBA 5TPWB 3QVOA 1BDMA 2VDNB 4WKCA 2NSLA 2FAXA 1CS0A 1VIVA 4J0GA 1TGYA 4Q1DA 1CUYA 3GFSA 1ZO8A 1AH2A 1U0JA 1XRNA 2D8MA 3QXSA 4JUCA 4PHGA 1E2EA 4HZUA 5DWDA 4QM7A 3LDUA 2YV5A 2WJ6A 1G2PA 4NIMA 4RHCA 4BVLA 4XCVA 4AI6A 2B4YA 3VVLA 5T4EA 4ZGBA 1Q0UA 1F60A 1B76A 3A6KA 2FRDC 2VQ3A 3RFTA 4DJJA 3THRA 2Q5LA 3C3BA 4DCVA 5BSKA 1JA9A 2VPYA 2WAOA 2D5AA 2JFUA 1CRQA 3LPCA 4EGJA 4UTVA 4QX6A 4PPFA 2BM0A 1Y1LA 3L93A 4B48A 4F6LA 2Z2JA 2VH1A 4AP5A 5AW1A 3EYWA 2ODNA 1QMPA 1EXDA 1PEYA 2CW5A 2PX5A 3GJ3A 2BFPA 4GLFA 1U0GA 4HAVA 1FTGA 1OZHA 2HHJA 4J0QA 2WFLB 4MI1A 4RGYA 4RBNA 4R3WA 2I55A 2M1XA 3LBNA 2AH5A 4U7TB 4U00A 3I2GA 5KZMB 2R8BA 2OGUA 4OGFA 2XA9A 4DQKA 1RWVA 2OOKA 4REMA 4X6XA 4TRRA 4A92A 1HGXA 5JXJA 3BWDD 4B2YA 1QWOA 5EKSA 4ZYUA 1IRXA 2Q1YA 4EKNB 4MVJM 2D0IA 3SVZA 1V7PC 3ZXUB 2JGJA 1QYXA 3OD1A 4EPXA 2P8JA 2PGJA 3D4LA 3C6XA 3PXBA 4PO1A 5FAXA 1OB2A 4EY5A 4OHYA 1J25A 3A1VA 2LIPA 3R9KA 1Q1ZA 2HJWA 2HWYA 2XMBA 5F9MA 4PM4A 4DDKA 2CGEA 3EQ2A 1VJRA 1CEXA 3CF4G 3GRCA 5EYPB 3U48A 3WIVA 2RK6A 1FEZA 2FOIA 4LBWA 1L4EA 3DLHA 2AJ8A 4DMLA 2IIVA 3ZIAD 4AZ3B 2IXGA 3HY6A 6REQA 2Q8PA 3K1JA 4FKBA 4C9BA 4BWYA 3K16A 3NYQA 3RVKA 1Z39A 2FXIA 2EL9A 4BNUA 3Q4GA 5E9AA 4D9MA 1JJ7A 4FCTA 1XNHA 4OXKA 1OI2A 3ZWQA 4KMRA 2H4ZA 1S0UA 3EOZA 3EF0A 1NNEA 2PV7A 2C98A 2ZRCA 1ENOA 2YASA 4XM0A 5FTKA 1ORVA 5J1TB 4TLMB 1MX1A 3WLOA 3NXKA 4N0EA 1GILA 1AHPA 3IAS6 5HIJA 3CX7A 4ZT3A 2HLPA 4JK3A 2IP4A 1G8KA 2OLJA 4ZTUB 3FOAA 4PLWA 2ZR7A 3FDIA 1J33A 1R4MA 2ZYTX 3G7SA 4Y8VA 4I50F 1KFEB 2YDYA 1IY0A 1K8XB 1XQ6A 1TJPB 2Q1TA 2VBGA 3ZWVA 2MTBA 4AJLA 2O8BB 3B1WA 2J1LA 4REOA 3W4KA 5KYYB 1E9SA 3WLJA 4B2PA 3BG5A 3EWSA 1I3KA 1UWKA 3P2IA 3WGOA 3QOWA 2VUTA 4HN4B 4JR1A 2VF4X 5KOJB 2JAWA 2IGBA 3V2GA 1ULHA 4AX4A 4ZO9A 2M6LA 5JCZA 3GLGB 1PJQA 4N3NA 2E3JA 2O2HA 5FTJA 3HJAA 4BKUA 1YFJA 2HV8A 1SZJG 4M36A 1ZS9A 3SM3A 4RWZA 1NRWA 1VMIA 2A30A 4OP1A 1Y6RA 3QLUA 5HDQA 1JU3A 2PS9A 4ENTA 5GJWC 3WWCA 1Z0IA 4C0HA 1GPLA 2JIRA 5EHQA 2GN4A 3PFKA 2JB9A 1Y3IA 3HSYA 3HABA 1ULAA 2WPDA 1Z47A 2H52A 2IL1A 4G0ZA 4JQOA 1ZI9A 2NN3C 4WLFA 3UV3A 1F0KA 1VSQA 3B8HA 4PIMA 3VJLA 2HF9A 1DOHA 1QSGA 3BMNB 3L7DA 3OM1A 3EEFA 4KQFA 1OILA 4B6JA 2RC6A 1UFOA 3WKDA 2E7ZA 3KO8A 3OOJA 1M3SA 3L82B 3F6PA 4J7CA 2VLIA 3UIEA 2FX2A 1IVYA 2H4YA 3GT3A 3M4YA 2AI1A 1KOLA 3OEHD 1P9OA 3G2KA 1G63A 3AEYA 3WOHA 4QQFA 5J4VA 2HRCA 2JLSA 1GU1A 1QX4A 1BCRA 3G2LA 4F45A 4UMDA 5I7FA 3R0ZA 5L6MB 1H1DA 1PR4A 3FGNA 2C5AA 3IVCA 3IQFA 3TLCA 5KDLA 2ZULA 1WPQA 5B1YA 3N53A 1KJIA 5DT2A 4NEGA 1OFVA 2JBAA 3OCZA 4G5SA 4P80A 3NHFA 1Z2PX 4YUWA 1JIQA 1Z22A 1GL6A 2JCSA 3OPYI 3V5NA 2WUFA 3OBBA 1L5MA 3CPSA 3M6LA 2BUBA 1BDIA 4KLNA 1RQXA 4Z4HA 3WGIA 2XCIA 1M2EA 1RKVA 3ZE0B 3NTOA 4G0MA 3D02A 4UHJA 1WVGA 3R20A 1YZNA 3G17A 1XB2A 2POQX 3OT5A 3HLTA 1DCMA 4GE0A 4IQGA 1NUAA 3BDIA 2R6GA 4MQ6A 3VUEA 1JH8A 3DD1A 1E3QA 2Y1FA 2PBRA 3N8KA 2FW7A 1PVDA 1W5AA 3FPAA 2IBTA 3PEYA 3WWOA 4ND5A 1RIIA 3MG9A 4YECA 4V1CB 3COYA 1DLJA 1OZAA 3IO5A 3NHRA 4KBFA 4JEIA 1E6KA 2Q5OA 2QYHA 2HSJA 4HNQA 4EITA 1V1MB 4N54A 4BFLA 4GPBA 2PU5A 3WE7A 3N8NA 4RLHA 1O94D 2P0YA 4DREA 1SIUA 3RVLA 2J67A 2VTBA 2ZJ7A 3RV4A 2OV6A 2R6JA 2JFNA 4HAUA 4MUNA 4RMNA 5EXSA 3WSWA 3DEAA 3TI9A 3LVRE 3WL6A 2WQZA 3EGCA 2BDEA 1V8DA 3H87A 1ONNA 2IGTA 3KVOA 3LBAA 4O25A 4PSAA 4ZVMA 4HGYA 4XIIA 4R7ZA 2P2ZA 2O59A 1K6XA 3TLAA 3DQQA 1GFSA 1JU4A 5FBQB 1LRLA 3VOAA 3IKVA 4XQCA 5LUAA 5EHXA 3LXXA 3MCUA 2AOTA 3QUSA 4LRUA 3HJGA 1G21B 4BJ1A 2YMPA 4KQ9A 2ZRKA 3KJFA 3E9ZA 2GXSA 2BYTA 1RPJA 1ZDMA 1QLWA 2C9MA 3CZRA 3CJRA 4Y2QA 2X8WA 1K0UA 3QFSA 3AR5A 1G9TA 2BONA 2G28A 3NYWA 4MQEA 4Y6LA 3E3AA 2D54A 2Y0CA 1C0IA 4Y2RA 4R1PA 2OECA 5THXA 1ND6A 4EI7A 5I7VA 4DV5B 1FX0A 3D8TA 3LWDA 1P0CA 1Q0SA 3NNNA 5IAGA 1Q6YA 1PUJA 2JL1A 4TPKA 3S5JA 2ODQA 4R7GA 4AROA 2B3TA 3VTKA 5K8VA 3HXTA 2AXEA 1INLA 2BGNA 4FJ2A 4LUCA 3ZKWB 1MEOA 4G8DA 4JT8A 4D2IA 2Q6LA 1MFZA 4D81A 2YR0A 1CC1S 1BXGB 1WD5A 5ALVA 1H69A 3GDHA 5CEEA 2NZVG 3OM0A 4NMXB 1G59A 3LZ6A 4XSHA 1AQUA 3R7NA 2IHTA 1KQFA 3SYLA 1CRLA 1NZFA 3I37X 4B1FA 1A4RA 1S3SA 1U5BB 5B5SA 1OC4A 1I2AA 1UXHA 2XWSA 2YQ4A 1QNLA 3EIXA 3IAEA 4GR4A 4LSZA 2ONJA 5GY7A 3NHJA 3RVQA 3M1YA 4Z4QA 3IB6A 2ZBDA 1SUAA 4AT1A 3F4KA 1N9GA 1UJ5A 2FUCA 2R3SA 5JS2A 3PVSA 2HLDA 2W2VA 1VE6A 4LMBA 4G0NA 1PJ3A 1Y8AA 2W8BA 1WDLA 4KRYA 4TMKA 5LDDC 3FWKA 3HG7A 3H9BA 4XJVA 5FKJA 4N7RA 1UZAA 3RS2A 1GNPA 2PT5A 2VQ6A 3IR5A 5BQXA 2O8FB 4L2IB 3CMCO 2ZUSA 1PEAA 1DIBA 2YZ2A 2PJZA 3OQ6A 5IM4A 5K5EA 1I2BA 2EAUA 5CG1A 3I2FA 1NF8A 1W85A 3HDTA 3HFRA 3V4FA 1RWKA 2NYVA 3ROXA 2BSAA 4J6EA 1QRAA 4I2NA 1E1DA 3N8IA 2G40A 1U7HA 1OPXA 2OGSA 4TXHA 4XGRA 4YV7A 1NLMA 4AD8A 1EZ4A 2RHOA 4WKPA 2DSNA 3B2NA 4FNOA 2BDUA 1L6IA 1FC0A 4NDNE 4IAOA 4PG8A 3TMAA 4KUGA 2NV0A 5D3QA 1OXKB 1XJ0A 2JCXA 3E0XA 2HREA 1SUFA 2TSYB 2VAVA 4IDQA 2ZTUA 3KOOA 4RHFA 3E3LA 4ZVKA 5THKA 4BHTA 1QG6A 2Q1WA 1KZ9A 1WEHA 1ENPA 1ULBA 1G2QA 4XYEA 1Z2AA 6Q21A 1HT1E 1HQDA 1UJ2A 5L7TA 3C6MA 1LF0A 1UMDB 3T8YA 3H05A 1H1LB 4XH9B 4ZO7A 3GVXA 4OYRA 1IN8A 4B2LA 4R51A 4MEBA 5DHTA 3U4AA 3UF0A 3QE9Y 3O8BA 3ESDA 4ZPJA 4BLRA 3WQSB 2Z95A 4KO8A 1N8TA 2DYKA 4YASA 1PFUA 3LUFA 1WXWA 4A8JB 4D79A 3TWOA 1QC5B 3B7WA 1NATA 4YAEA 5ALTA 4ND2A 4MHTA 2B8EA 3G9UA 4ZEWA 2G5GX 2GEKA 4PVDA 3EPKA 1CYEA 4CI9A 2QN7A 2P1DA 2C2WA 4QLBA 1N25A 3IAAA 5LMZA 4EI9A 3B1ZA 5ADVA 2VTKA 1FMFA 2LDXA 4RV5A 1P8JA 3ZVMA 3G82C 1N0HA 1DBWA 3MJRA 1JBEA 1IWOA 3GGGA 1AA9A 2YH2A 1E3DA 2HPHA 2CVFA 1XHFA 1XMSA 1MGPA 2JGAA 2X58A 1FYWA 3RK1A 4ZFNA 1CJKC 1GSOA 1V35A 2FSIA 2J4DA 3BN3A 3LLCA 2CC2A 2TMYA 3A4YA 2BFMA 4ZO4A 2CJXA 5E0OA 1CY0A 1XTJA 2J09A 3DZFA 4OV6B 4PLYA 1DU4A 2R1VB 4L02A 3CLTC 5FTWA 3ZJYA 1C3EA 4CF7A 2VJBA 4NX2A 3KALA 1U7TA 3IYLW 2ISCA 3R3YA 2VP4A 1YMUA 3SFZA 1N0WA 2ZIXA 3CNEA 1CQWA 3ET5A 3FPCA 5ESDA 3MNFA 4Q34A 3G85A 1SM4A 5M5BA 2OHHA 3LW7A 1SULA 3MK31 3KPVA 3TIVA 3WJ1A 4F5DA 2RKBA 1Z5NA 3MWEB 1DKUA 3TGLA 4EI2A 1VDMA 4M0FA 4JI1B 2BHRA 3KQMA 4Z4GA 3RI3A 1P17A 3JYHA 3QEAZ 3I0NA 1W4BA 3SBDA 1VBKA 1Y1TA 3MBOA 3BWVA 4Q3EA 1L7XA 3A26A 4XDZA 3E23A 2B1QA 4Y6PA 1VPDA 2WJ3A 4Q9NA 3B2QA 2VP2A 3TL3A 1RCFA 3HCCA 2Z2IA 1PUXA 2ZT5A 4UARA 4K8OA 3REQA 4R0MA 4W5QA 4D9NA 4CBVA 1EXVA 3FGOA 3SF8B 1NMQA 3NVDA 3GFPA 4WTOA 2QY9A 4RGBA 3W3AH 3DKVA 1PZHA 4XYLA 1NQXA 4XIYA 1NV8A 2R65A 3LIPA 3QUCA 1ACJA 2FGKA 3F3KA 5LA6B 1GNSA 1NDQA 5JALA 4A9AA 3D6UA 2XYRA 2Q4EA 3FAZA 3I9FA 4IQ4A 5I3ZA 1P1KA 4JJ7A 1GT6A 3ILYA 4LCEA 4X1YA 1VJTA 3W7AA 1Q74A 1V11A 2DF8A 3FWPA 5KJCA 1P1JA 4MGZR 3U4IA 1VL6A 2J30A 3DMGA 4AFNA 4CQNA 1BHSA 1MXHA 4X1KA 2LKDA 2VRCA 5FFNA 2NTVA 4XQGA 1YXMA 2R8ZA 2HSWA 3GOHA 3H04A 2DAPA 4OOEA 3AHDA 4FHDA 3ZQ6A 5CFQA 4BWVA 1IM8A 2DBRA 4FJ1A 2XQFA 3QU9A 4X6LA 1GG2A 2HU7A 5JASA 1B8NA 4BIMA 2VH2A 5AUQA 5HK9A 3N58A 2JJ8A 2QLTA 2DH6A 2A8YA 4WAUA 1PS9A 1XTSA 3NDJA 1FRQA 4WBNF 1NYQA 3DYVA 3HA2A 4HQ6A 4J0EA 3TPFA 1YK1A 5EYPA 4Q3OA 4W9MC 2DCUA 1VCHA 4AY4A 1ZM4A 1VL8A 3B2EA 3QBJA 1V16A 4B83A 2WBLC 3WLQA 4C0JA 4DKJA 2VDKB 4Q1VA 1F0YA 4IW3B 1CUZA 1LC0A 2BKEA 4OPMA 3VA7A 1IXRC 1G20E 4UKDA 4EKDA 1EX9A 3IUNA 5B55A 1KK1A 1SG9A 3T7JA 4F2WA 2CXSA 3O1JC 2ZXFA 1VMEA 4E03A 4J0CA 5A3VA 4HY3A 2QRLA 3F7MA 2JK1A 1QG0A 4LZPA 4JJEA 1WG8A 5IM5A 1VKZA 1CNMA 2ZE5A 3HKBA 1MFPA 3TNDA 4ZV9A 1JEYA 1MLDA 4ZRMA 4PZZA 5FV7A 1ZJWA 1Z6QA 3NCHA 3CKKA 4HL6A 1YKSA 2EFJA 4OXQA 1QRSA 2ZWAA 2HA7A 4KXVA 1NVBA 2YXDA 1F6DA 1KY4A 1JMVA 1VPWA 1QYVA 1NT4A 2DFTA 3A4NA 4HQRA 1TUBA 1T4GA 2Z3ZA 3ESXA 4M99A 3T99A 2DPMA 5HP4A 2ES4A 2JAXA 1NDUA 4PLCA 2VZEA 1QFSA 2FSUA 2WD7B 1XD2A 2RGNC 3WRVA 5K3FB 3KJHA 1QX3A 4AVYA 3KU1A 4DR6B 4R2MA 2YRFA 2NV6A 2X8AA 3GA5A 2H48A 2Q9AA 1CY2A 1E58A 3MCWA 3LM8A 3OZFA 3LKBA 1NQ5A 1HQYE 2RKOA 2ZRBA 3AVPA 1KJNA 1T0UA 2X42A 4FYYA 4JR0A 4OSEA 3W4JA 4PONA 3EZGA 1Y5RA 3D5QA 5JC1A 2HH9A 5A3QA 2A5LA 4BVBA 2BE7A 2WSBA 3DO6A 3KJGA 4JAVC 3AMVA 5IAJA 3RUDA 5CXQA 4O59O 3PEFA 3LW8A 1ZBDA 3HXPA 2MSKA 3O9ZA 2QRMA 1CWUA 3QU5A 1KAQA 1IJBA 3EPJA 1RBYA 2HM7A 4KFCA 5FQOA 2O8DB 2FW0A 3NVKI 1PS0A 1FP2A 1NMYA 3LUPA 4IXWA 1JDUA 1Q6ZA 2HA4A 2D7JA 2H2FA 2WF5A 3EZ7A 3I1YA 4H4CA 4WZAB 5JMOA 4LFBB 2PQ2A 4OATA 4GX0A 4KBGA 1UPAA 1AT1A 1EHCA 3WMRA 1OHHD 4U2BA 4GO1A 3VHQA 1A2OA 4LXQA 2A9PA 4LVCA 5KHLB 1GADO 1KQ3A 1UAGA 2C0CA 3CA8A 4XASA 5EQJB 5A9TA 3S6JA 3GPIA 4GOLD 4C7MA 3ZY2A 3RS9A 1JHYA 3OTQA 2PBFA 3ACCA 4FI3C 4K2AA 5AVTA 4E2WA 4PICA 1UBNA 2NO0A 1E20A 5EJMA 4F1WA 2QNIA 4MGEA 1VYTA 4LTMA 1FX1A 1RLIA 3BD6A 3LZDA 1W96A 1CY8A 4WESB 4FGLA 2ZUFA 3AOEC 1UIRA 4E94A 2WSSA 1VECA 4WZBB 3F9RA 1J7KA 2ADOA 3C1AA 3OKCA 4K9KA 4NSNA 4OHKA 3ZBUA 2PY6A 4EKGA 2WYHA 5PGMA 3CLUC 4KJZA 2XNKA 1MXFA 1ZGBA 4TYMA 3UA4A 3P0JA 3RF7A 2OPHA 1MU0A 3SZOA 3HYCA 1YRQA 1XMVA 2IYEA 5KIAA 3CRW1 5KCMA 3WLPA 5LQNA 1YDFA 4YJ2B 2AN9A 3TSYA 4LXYA 2IZZA 1FXUA 2PD4A 1QIIA 2QW1A 4FGKA 4PLPA 3THSA 4PYOA 5FA8A 4Z86A 2C4HA 2ZDGA 1PR5A 4JOCA 4H18A 4ZOAA 4RFLA 4EA9A 2CLHB 3SX2A 4ALMA 1V1MA 4D4MA 1BYUA 3HCPA 5FWAA 3UOGA 4B09A 4D9HA 1FSPA 1K7FB 1G4HA 5FBWB 4GPTA 1T4BA 4ZODA 5BQFA 4J1TA 1LK0A 3VYRB 4DOMA 2UUCB 4P84A 2BHLA 1DEAA 2WNHA 3HU1A 4W8HA 3K4QA 3C39A 2QSZA 4UVHA 4EHBA 2GZ3A 1JLLA 5FPKA 3TQCA 4DVGA 1Z5GA 1WB5A 3PKIA 2YWRA 4DA9A 3WGQA 1MIOB 3FNHA 3U3DA 3QMPA 3UJ9A 1FFAA 5FQNA 4D46A 2QAGC 3O9VA 4ND7A 4TUYB 3SF0A 1T2DA 2QN2A 2DPXA 4MO9A 1F0NA 1UWCA 1G8MA 1VLQA 1P29A 1QQAA 3V1KA 4R1OA 5JZBA 3HJNA 3V4SA 2QR2A 4IOMA 4NBVA 4RMIA 4H59A 3HGQA 2XWBF 3BJRA 4ZI5A 3SIXA 4QC2A 2ZYIA 4Q3DA 2I9KA 4WX2B 1ZGHA 2O3SA 2GFHA 2GUWA 4M1YA 2VPZA 4ZPXA 1E32A 1KH1A 2EQ5A 2QTAA 2XMZA 3V1NA 3I0MA 1NVGA 2X6QA 1EFVA 4WK2B 3RUIA 1W2GA 2BSQA 4LTNA 2PH5A 2X7HA 4FFBA 3DKKA 4JX9A 2QROA 4JCCA 1Z0SA 2VUUA 1DKLA 5HF9A 3JVUA 2QTTA 5T3UA 4RZIA 5C7YA 1CFZA 5LU8A 4LGVA 1B0AA 1QV9A 4KO3S 2H08A 1POWA 5FNZA 1E1LA 1KI9A 4AC9A 1AV6A 3BL5A 1QQ6A 4RD0A 3UG7A 4OUDA 2GBFA 2BFWA 2JARA 4HWKA 1DO8A 1Y8CA 4GICA 3L7NA 5KYWB 2OCXA 4MWZA 4NYJQ 3U13A 4EG5A 3PEVA 2Z1NA 3AERB 2H1VA 1AU9A 2MT9A 4RTNA 3AW9A 1SBQA 4KGDA 3K9BA 3CH5A 2LXNA 4M7OA 2O8FA 4L2IA 4CQLA 2WKQA 3QPVA 1EVKA 1NWCA 2FG5A 4JQCA 1CJTC 4LKOA 2BFEB 3P0IA 4OP2A 5H1YA 5UKDA 4HDRB 4MGKR 4TSFD 1QIJA 2XVAA 1PDOA 3BFXA 1IOLA 4MYHA 4XWGA 1H4VB 3AB8A 2FQWA 1S7GA 3KSDO 3OAAA 1JA1A 2AZTA 2Q8QA 3CNHA 1TQ6A 3CWQA 3E1GA 5ECWA 2PX8A 4KR9A 4C5AA 2QRVB 1GM5A 2PH7A 1OYWA 4JSRA 1KYXA 4BQPA 2PYIA 2Z9CA 1GVHA 5B2ZA 2NGRA 5AESA 4QARA 1BS1A 3ODGA 2IT1A 1DKRA 1PQPA 3PNBA 4DIKA 2OK7A 2ZM6B 3U81A 1CSEE 1EDOA 1G0NA 2JAHA 4MVJH 2V7XA 3NG1A 1LVHA 5HGXA 5E3HA 1ZGAA 2Q46A 2PYZA 3DL0A 1O96A 2FN8A 2QRQA 3I6QA 4HSEA 2VAMA 5DPMA 4CF3A 4FOLA 1VJ0A 2CJWA 1P44A 2G17A 1RQLA 3DR3A 4XUEA 5JECA 4LJ4A 2VPTA 4LOHA 3IR6A 3MCVA 4RIFA 3RSSA 2FK7A 3WIEA 1N0UA 1U98A 3QX9A 2WOJA 1T3SA 1TAHA 4QLAA 2OLEA 2XT0A 4XFJA 4QVIA 4I9UA 3DVAA 4ZVOA 2EBHX 3S1AB 1LSOA 2L82A 5D3MA 1I5OA 1USIA 5KTYA 4V0NA 3GIDA 1FB5A 4JGGA 3FVQA 4KKVA 5LKAA 2VWPA 1LDGA 1XQYA 3GBPA 2ZIZA 4OHBA 2RGBA 5J2TB 1PFWA 3EXHA 4WGGA 1SCJA 3F74A 2PN1A 3H2JA 4OHZA 3V33A 1GFZA 5CBPB 2A9JA 3R7BA 4FZ5A 1FBNA 2QN3A 1HK7A 3AVQA 1DE0A 3EUFA 4BZQA 5A03A 5KS2A 5C0OE 5A04A 3J7AC 2XB9A 2XB4A 2J6CA 4JJ4A 2PGXA 1PTJC 3PU6A 5BN3B 2HTFA 3ECAA 3RJZA 2Q50A 7YASA 3L6OO 5KWSA 3C4QA 3MJTA 1LB1B 3DEFA 4C4RA 2MYTA 1F4PA 3MUOA 1MIHA 4IEEA 2GO7A 3B3AA 1I32A 2CMDA 5BQ3A 1V37A 3IT0A 2R68A 2WICA 1YZTA 1C30A 4UMFA 4P9NA 1C80A 4WCFB 3DE2X 4IJ5A 5H3LA 5JZVA 2J4CA 1T3GA 1M8GA 2YUIA 2XADA 2LUOA 4BNGA 3DL7A 4NQZA 3UMMA 1LWOA 3EGXA 4F46A 2FPXA 1J1IA 2LRHA 2VPQA 3OQIB 5AW0A 1MQAA 3GH3A 1U8FO 3NP9A 4DV6B 1EA5A 4HDMA 1J9GA 4YK7A 2WIGA 2O8VA 2WWGA 2X3UA 5GM2A 5B3KA 1DUIA 3MD0A 4TLLB 4OM8A 3E5HA 4NZZA 1UXGA 2PWPA 4OREX 1DXYA 3LHDA 4BZZA 1ORDA 2Z56A 4QRIA 4HMOA 4M1ZA 4RJTA 1DB3A 4RJ2A 1WABA 3ZZMA 4FYMA 5K4AA 4HAZA 1PWZA 3KAPA 3T1NA 3H2HA 2VTVA 5AK6A 4JXXA 1UT8A 1Z6PA 2GEUA 4QGFA 1ADJA 4RNCA 4DVJA 2B6HA 3PNSA 3H0CA 4OYLA 3SZLA 3PEEA 3SF8A 2GAAA 1VHWA 3L07A 2XUHA 2FTKE 4W7HA 5D1HA 3KG2A 4AG3A 3A6JA 3BXXA 5LYYA 3M5PA 1JFRA 4JP1A 2YS6A 2VT6A 4CF5A 2PJRA 3IKJA 2FPPA 1SNYA 1Y8RA 4TTVA 1NG1A 1U2GC 3ZE9A 5IANA 4EB6B 1R8JA 1JR3A 3CF2A 4EFMA 1NVDA 5JSZB 4RTMA 2FN4A 2ZTHA 5CB0A 4DA0A 2AEJA 2Q3EA 1L7DA 3ZDXB 3QX3A 1ZC4A 5CTJA 4Q9HA 2QPOA 1KI7A 4WL0A 5SZIA 4G0UA 5F3RA 2OO5A 2RGUA 4BE9A 3R23A 3D1VA 3PDIA 5K0BA 4M60A 2UZ3A 4PGGA 3EPHA 4LSWA 4RY2A 2J7PA 2Y2VA 4BNXA 2V4ZA 5AWFC 3C7KA 4LYHA 3BSYA 2OESA 5BT9A 1RXUA 2FKNA 2G1UA 2JAOA 1M34E 2YQ5A 3T94A 4FW8A 5HSGA 3UJPA 1G2IA 1QUEA 2GKOA 4YIKA 1WKCA 4IIJF 1GGVA 1R00A 4FOOA 1IY2A 3MN1A 3B85A 4AJ4A 1I0ZA 1X0XA 2VHQA 4DLPA 4FBLA 5LQRA 4QO7A 4Z4IA 1TKRA 5EMNA 4B35A 3IQIX 2LGJA 2MWMA 3KLPX 1USKA 3P5BA 4HB3A 4JX8A 4KXLA 5CH3A 3W1VA 4C0BA 1Z73A 4HB4A 4DJAA 3GRZA 2IV7A 4E21A 2FPLA 4DNFA 3GLIB 4HGOA 2W70A 2H1CA 7ADHA 1V43A 3URMA 1QG2A 1I4DD 3EXEB 1YB2A 4LC0A 5TB5A 5C4MA 2ARKA 1R3UA 4FNMA 2R6ZA 5I9BA 2PXHA 1UXKA 1DAHA 2HYDA 5IKOA 2WJ4A 5ALEA 4EFDA 4HRYA 1O87A 1NRIA 1EUQA 3WB1A 3KPUA 4RFSB 3LHKA 1LU9A 2ZZNA 1XTZA 4QFMA 2Z43A 5K9ZA 4EJ2A 4K9DA 4D3ZA 5F35A 2HQOA 1OF1A 3CM0A 2RGWA 5JEEA 3C3JA 1QKIA 3S2EA 5B1HA 4X7RA 2O4CA 1GN8A 2VYND 3IAXA 3T3PB 3TGWA 5KTPA 1Z35A 2R5FA 3PE3A 2A3RA 4OP3A 2HJSA 1WDTA 4D8TA 1ZEMA 3CW9A 3GUZA 5TQJA 3MC1A 2AWNA 2I3GA 2C2XA 4YUXA 3T1YB 4X91A 1A9RA 1QGUA 2OSBA 2OBMA 5F2KA 2A94A 5C5DA 3RFUA 3IC5A 3TQIA 5BYAA 1W88B 3T1QA 2NW6A 1H9CA 3CCFA 3ETDA 2OZVA 3QFCA 3BQMB 3ZVRA 5ECDA 1ORHA 4FGUA 4FHEA 2V59A 4EF4A 3PI6A 5J58A 1BS9A 4RL6A 4JA2A 1LTHR 1XQ9A 2F3PA 2ILTA 5A06A 5FWYB 1E5VA 1N1EA 2IHVA 4TLDA 3WO0A 4A8PA 2XWJI 2W48A 3ASUA 3HXLA 4MV6A 5JFTA 4N01A 3PX7A 2P4QA 3T7CA 2CE2X 5JJ5A 4P38A 3OUUA 2FWMX 2YTZA 1N6LA 4LRYA 2YMQA 3VSCA 4RULA 3PFGA 4O2AF 5FCDA 3RYHB 2GOYA 1YA8A 4NC9A 4FFWA 4MZXA 3HUFA 1EUDB 3PGA1 1PBTA 1A98A 1TPYA 3FFXA 3H17A 1CTQA 4KH0A 1TVEA 4DLWA 1ML4A 1BC5A 2EHDA 4NAVA 4PANA 3UB2A 4HTFA 3WOVA 5BPFA 1PNRA 5F4BA 1UJNA 1H2FA 2ZRLA 1G3UA 4OHPA 1J70A 1LKZA 5E1OA 5F51A 3WQQA 2Q4RA 3D64A 3ORQA 3K31A 3PXUA 1GPAA 1UPCA 3W2EA 1I7SB 2O7VA 1XLTC 2NM0A 2W2PA 4KN8A 2FMKA 3JZFA 1DZ3A 1EHYA 1XDDA 1OSNA 1YRWA 2GH1A 5H70A 2X0RA 5I7EA 1KJQA 2V4MA 2DM6A 4UATA 1NV9A 1VI2A 3KUXA 3OTHA 2FP4B 4D3YA 1UZLA 1ODSA 3WHLA 4DUPA 4XKJA 3BORA 1HTTA 3PC8C 4NAHA 3K0AB 4ZMRA 1TKBA 4OK3A 1XMQB 1WD7A 3E9CA 5CB6A 3B7PA 3FSEA 3QXGA 5T57A 1NQOA 2Q3MA 3CEPB 3LXMA 4W9RA 4KOEC 5AUOB 3REGA 4YJ2A 2DVMA 4DGQA 1UPUA 2O8CA 1FDUA 5D51S 2C07A 4E09A 2F9MA 3BAZA 3OPVA 4JLVA 1BVRA 1XL0A 2G08A 2MINB 4UC0A 1CDOA 2O5VA 4B4UA 2WVJA 1R0BA 4UTNA 1CW2B 2NWQA 3LQQA 4FWTA 1NM5A 4A23A 5A4FS 4AUEA 1EDDA 3ODPA 1L7EA 1Q77A 1ECGA 2AR7A 4G67A 4M8LA 4XWTA 2Y77A 4N9QA 2FDCA 3KVNA 2QE7D 2P35A 1W44A 3B1JA 3OF2A 4PYMA 2WWTA 2I4TA 1HFEL 1PT5A 1U65A 4YPFA 1G3IA 4C3ZA 4OU4A 3ZK8A 4PXYA 2IY9A 3WMGA 4DSOA 4H0CA 2BUCA 3TTXA 1ZD1A 1PLJA 3V8RA 4OU5A 3PFHA 2A3NA 3AUJB 3EZNA 4IEFB 4BB9A 3C7CB 4QT4A 3X1XA 4MWBA 2RAPA 4BKOA 1DRUA 3Q88A 5WRFA 2YJ4A 1ONOA 3O83A 1MEJA 1KRHA 4Z54A 4LQDA 1EVIA 4OFXA 5FOUA 2KQUA 2F8TA 4QU5A 4RHUA 5J63A 3VH1A 5CTAA 3ZN2A 1GPYA 1D4AA 1E1QD 3OO0A 4BLWA 4QODA 1KDYA 3KVYA 3ADDA 4BJ3A 1XHLA 3R8CA 2WHEA 1TM4E 3DFFA 3EQ6A 4F9FA 5I8PA 2PANA 1DV1A 2DPYA 1QVZA 1U7PA 2LZ0A 2XQIA 5IF9A 1LJLA 3GUCA 1HE4A 1JQJC 2GYWA 1UKEA 3TOCA 4BP9A 1LD3A 1WCXA 3BFJA 2ZIWB 4KH1A 4OJYA 4Q16A 1HV8A 5TMDA 2WMOB 4N3GA 5CYPA 3SHOA 1KARA 1YMVA 1PV4A 4MUGA 1P72A 1PO7A 2Y3IA 3KQYA 3TI7A 1C9EA 3TR0A 2XUFA 4HAIA 2UZIR 1P7ZA 2EBWA 4OHXA 5JH7F 4FLFA 3ZGLA 2ANBA 3Q8MA 3AP3A 3F3MA 4WRRA 4ZZ3A 4DJ5X 3E0QA 1U6JA 1YT5A 2EOAA 3X2EA 1BX3A 2JHCA 4Y1RB 5EZSA 5FP0A 3PKJA 3F97A 4PNHA 2J0VA 1YA6A 4UUQA 2MSCB 3HU2A 5KYWA 5TC4A 3EJ6A 4E51A 2PSFA 1PSZA 2O57A 1ZXBA 2AUMA 5F73A 5HR5A 3H2GA 4IBOA 3LY8A 2GJ9A 4NOKA 4A82A 1C4WA 4HZGA 3DDUA 1UT5A 4PHFA 5EG5A 3NB0A 1OGYA 4DB4A 1ZOIA 4LJLA 2WJHA 1TMGE 3G5LA 1K6EA 3L1UA 2WYWA 3OOHA 1ODJA 3BEDA 3SG0A 3MD9A 4Q9JA 3ZWAA 5IYZB 2K4MA 4L9SA 4XE5A 1JKIA 3LT5A 5KYVA 4W5NA 4OQDA 1RLMA 4PZ9A 5CVUA 2E85A 2PO7A 5JWRA 3DAHA 2F48A 3K0FA 3E58A 3Q41A 4OH1A 1HZJA 3WNDA 3EQ9A 4DJFC 5DHAA 1APBA 3N39C 3ZK7A 3K4PA 4LY3A 4PTZA 4BX0A 1Y8QA 3LYUA 3MMPA 2H85A 2ZJZA 3BSWA 2GEFA 1P4SA 3OZTA 4ER7A 3AY7A 4Y1FA 2IQ5A 3SS9X 4M76B 4L27A 5LLSA 1NW6A 3B9PA 3DLIA 4CTNA 2ENUA 1MX3A 5H3CA 3JAMA 3T0FA 3IQHX 1SKUA 3I4FA 5HFAA 4DJDC 1NBHA 2CKDA 1PD1A 2NUTA 5EXDA 4MQLA 2G06A 3B53X 2YYZA 2FVXA 1DKPA 3TB6A 2D3TA 3UQYS 2UYHA 3DFKA 1DWOA 2A67A 2I4LA 1D2MA 4GSKA 4DMCA 1T2VA 1UR5A 1XZ8A 2M9MA 3CNLA 1DT3A 1XWIA 3JYOA 4I4TB 2I7XA 5E95A 4BFYA 1C7RA 1KDOA 2I1VB 4J2TA 4MIKA 3DTVA 1Z4MA 2BBTA 3A1FA 5KYKA 1G6HA 3PYMA 3ADOA 3Q6MA 4RPLA 5JLAA 4F84A 4G8CA 4FYVA 5EWMB 3STYA 1NBME 5AM5A 4DQDA 2L2QA 5ICGA 1G7SA 2ERCA 3AEKA 1RKXA 1H2AS 2HXYA 3K2BA 2XYVA 3L0DA 1XP8A 4NULA 2ZUTA 1VE3A 4S05A 1GGMA 4ZEXA 1MVOA 4INJA 4YMIA 4RDCA 4E7PA 3P4UA 3D8RA 4MA4A 2XBMA 3BAFA 1XVVA 3TKAA 3E4DA 5A2GA 1FNBA 2EHJA 4JQSA 2JFFA 4TL9A 4A0RA 1X8KA 3N74A 3KKZA 4RVCA 2JCGA 3U4CA 4JP5A 3U4DA 3GX1A 3MT9A 4G5YA 1PZXA 2QEQA 4W5OA 1NSYA 3MLBA 5CGQB 1R16A 3ELYA 2YHAA 3F6SA 1UC5B 3GC6A 4QBIA 3UK2A 5HQ3B 1JJIA 1H66A 1IN5A 1X9HA 3T95A 4ZGWA 1FLVA 1JLKA 4P4UA 1B1AA 1MCZA 1VJ1A 3FIJA 5AUPB 1Z6AA 1ZCFA 2OUKA 3SBEA 3LDFA 1BFKA 4ETIA 1ZAKA 2D0DA 5LP6F 4I14A 1FUKA 2BTEA 2V3VA 2VYCA 4I1SA 3JQ7B 2HBRA 4JKYA 5I3CA 4GEKA 1U0HC 3SC2B 3X1YA 4B4KA 3MHTA 1MJ5A 3CXUA 5HKKA 3WYFA 2JLZA 4QREA 1XEWY 3W2GA 2QRZA 1YJQA 2F3SA 1MORA 2FPGA 5B1SA 3FFWA 4R9UC 3VKWA 2C29D 4FLEA 2HSEA 4U39A 3S2GA 1YIAA 3UXHA 3ZZ1A 4RTKA 2HK9A 4FFRA 4A0SA 1P60A 1K88A 2OV1A 5KOIA 1EWTA 3KOYA 3GFFA 4N76A 4PO9A 1OOEA 1I1NA 2GK4A 4HDNB 2FN7A 4EYKA 4JMLA 3SOZA 4CIDA 3QMMA 2H92A 3HL0A 4GOJA 4Q0MA 5GPBA 3MGAA 5GVSA 3C3WA 1RYBA 4PPYA 4MAFA 3B6IA 3RYTC 4L4RA 3WIUA 3TQOA 4EB6A 1QU2A 4GPD1 2QMUA 5KNBA 2XEXA 1KMHB 1NN0A 1TZJA 2QORA 1LDNA 3INRA 3MWJA 3N2ZB 1NLFA 4WNAB 5EKDA 4ZDWA 3ZE2B 2SECE 4AKSA 3Q40A 4MJLA 5TQ2A 1LI5A 4B3RB 5AQ1A 4KWCA 4JJKA 3UPTA 1CEEA 2XTNA 5LSAA 4F3TA 3GFVA 4LWQA 4BYGA 4DRZA 3NDBB 3VNRA 2NVWA 1Z45A 1Z9BA 4R9RA 3TL2A 3W8EA 2AG8A 1N6PA 1YOVB 4LRWA 5FO1A 3RUAA 1LRJA 5BV2P 5CXSA 1L4GA 4IQ8A 1M7HA 4MH0R 2BJHA 3JASB 5F2EA 3OZEA 5I4KA 2QX7A 4DR4B 1HYBA 4MARA 2QGFA 3LQKA 2V7BA 2Q0QA 3O4VA 4UCXA 3H8WA 3OEED 4L5IA 3U60B 3DO5A 1MB0A 2LPMA 4WUVA 4XX1A 3ABOB 5FPQA 3V7NA 4P7FA 1JHUA 1VYHA 4YFVA 3HEAA 5EEGA 2I7DA 4J0KA 3U3KA 3X1JA 2EG5A 3KXIA 4ZCIA 1LFAA 3QVKA 2DETA 3F5SA 4NFSA 5KTSA 4LX8A 3RJMA 1L4LA 2WB2A 3PGLA 4KTTE 1CUEA 1Z74A 1KFKB 2X3FA 2VZ9A 4TQAA 2ZREA 3G7UA 3DKRA 1DRWA 4Z7QB 2HLHA 2Z9BA 1AXEA 3W3AD 3CVUA 2HDHA 3HMKA 1KO7A 4TTSA 1VI5A 3JZIA 3LK6A 3V00A 1YO6A 2QLBA 4M0UA 2V8BA 5CA1A 1DMRA 5ALYA 4N47A 3DLPX 1BRTA 1XDZA 2BZSA 2X76A 2XMCA 4I4CA 4PYNA 1TC2A 5AJWA 1A8QA 5IT5A 3TUZC 3LECA 3OP4A 1UAYA 3I9JA 4EAQA 3C4VA 1P1RA 3F0TA 4UNRA 1J8VA 1XA3A 3IT1A 3D8SA 4WN3A 3A7DA 3CRRA 1SVOA 1JR4A 3CEJA 4KNVA 4Z53A 3X44A 3AL3A 4J1QA 5FXMA 3DAPA 1A1VA 5CR9A 1G8FA 4ENVA 2R8PA 2VTDA 1J5XA 3EDOA 3QKSB 4C0QC 2HHAA 2QZ9A 2I34A 3WNVA 1G0OA 3U7FB 1ZR4A 3PLNA 1KYTA 5TEVA 5DHSA 2X6RA 3IRVA 2GN6A 1W46A 3S8MA 4ZKEA 3OOEA 4O4HA 3AR7A 4Y6QA 2ORWA 3FUVA 4JEMA 1UJBA 1F7VA 3O1LA 5L3SB 5IPFA 1ZGZA 1ZH0A 2IWRA 4A2CA 1ZUIA 2ADFA 1TO1E 4MW1A 3PPWA 5K8CA 5GZ3A 2AHRA 3OX3A 2QM8A 4IXMA 1G20A 4NCHA 5DGTA 1D6JA 3AF1A 5DX0A 3KNZA 3ZHVA 4RTQA 1GUFA 2FF7A 3D8UA 3WGKA 3WX0A 4F8YA 1TAUA 1B8PA 4JL5A 4NICA 4TXLA 1Z63A 1S9DA 5AOAA 1R7RA 3RYHA 2WTMA 3NBXX 1J1ZA 1JB1A 4LYDA 2YHUA 5L4SA 1TA0A 2OOSA 2PH1A 3ICVA 2BRUA 3QTBA 5JAHA 3ND9A 1T35A 1PZNA 3DKPA 3QMWA 4K6GA 3RSLA 4TWAA 3NBYC 4R0VA 4F3CA 2XOEA 3R0IA 4MR9A 4AN1A 3AVVA 2WB4A 1UZMA 3CUYA 2WYUA 2WR8A 4IDFA 1XNGA 3DV0B 4HVAA 1D1SA 2YY5A 3HZZA 4YA6A 3WB2A 1FZTA 3THXB 4PCUA 1K08A 1R12A 2DFPA 3OKPA 4KUHA 4UMVA 4WECA 2EXXA 1M0EA 2D5BA 4A2PA 1TW3A 3CINA 3F7TA 3BERA 4DZZA 4FS3A 4Y30A 3AG6A 4FFSA 3T38A 2RGEA 3ZEAA 4DG8A 1SHLA 2XDAA 3KVRA 3VR3A 4ZICA 4ZN6A 5ALXA 1XN4A 1OREA 4FXOA 5AHWA 1HL7A 2ISSD 2YQZA 3PWSA 4MV1A 2A86A 3G6WA 4BY9E 1Z2DA 3GEPA 2B92A 3K0AA 1I6MA 2CJYA 2NT3A 3ON5A 3PE4A 4Q1BA 3Q3IA 3ZJVA 2BBWA 4D3XA 1T9AA 3IP3A 1P3DA 4TLBA 3D3QA 4KQKA 1PR2A 3KSRA 1VGQA 1R9JA 4WXHA 5GVRA 1MT0A 1P2VA 4YJFB 1TEZA 1KRWA 1RPAA 1E3MA 5J1SB 4KO2S 4WERA 2C57A 4DPMA 3DYIA 4NFHA 5JEDA 8GPBA 3PPYA 3UT0A 5AOBA 2MINA 1C7QA 2YWDA 3D4OA 3IQDB 4KR0A 2VP5A 4P53A 2Z8XA 2ZU6A 5CX1B 1WXXA 3D6MA 3VH4A 1AHIA 4EEKA 2GB4A 2H2AA 1A04A 1OIWA 1T8TA 4NOLA 3ZCVA 1Q2UA 2VJMB 2RKWA 4KLRA 1NY5A 2KSQA 2Z09A 5REQB 4DRYA 5BYBA 4YT2A 2YV3A 5BORA 1KEEA 2IYZA 4MRRA 4MQFA 3UNXA 5GADl 3KJQA 5HKOA 1BVYF 4UBOA 3COVA 5FFMA 5J40A 3TX6A 5AHOA 4AP9A 4DSAA 2XT9A 1YA4A 1EE9A 3W8DA 3H5NA 4G97A 2WWXA 4K88A 1KDTA 2Y1DA 3WKCA 4FMDB 4EVRA 2R96A 2RARA 4MRNA 5FEMA 3QPAA 3T5TA 1R6AA 3F7NA 2XNJA 2BHSA 5HMMA 1G5PA 3RC1A 1CR2A 4DABA 4J2OA 1CF4A 3F67A 2GPAA 4ETNA 2EVWX 3PXAA 1SVIA 1TMKA 3DZ8A 4KI0A 3FUCA 4OUKX 2XUPA 2X1HA 3K70D 1JVBA 1GA6A 1F2UA 3BKWA 3R3JA 1K66A 1Y6GA 1YR8A 4XX0B 3DDZX 4RENA 4ZVPA 3GAMA 3CFYA 1QZUA 1VKHA 3ETNA 4ENRA 1Z7BA 3D2LA 1R74A 1RE1A 1ZK3A 2OILA 4CEJB 3KETA 2JFOA 2IQIA 1FFWA 5HYVA 1R64A 3CEHA 3JSXA 4RPCA 3BUSA 4CG1A 3E05A 2XKBA 3IIMA 3TD9A 3QFRA 4M53A 1C3LA 2OFPA 4Y6SA 2JH3A 1BHJA 5CP8A 5BN5A 1QJCA 4MWGA 4QDJA 1W4AA 5HA5A 2HB6A 1N78A 3DPIA 3NXSA 3W5SA 2VVTA 2IHKA 2IF2A 2JFZA 4PQRA 2N0SA 4TKVB 5DM70 3PCTA 4II2A 2GHIA 3UPDA 3PZRA 4NY1A 3L7YA 5HRCA 5KCZA 3THOA 1IN6A 3NM5A 3AFGA 4I5GA 1XCLA 3LU1A 4KFSA 4OSPA 4RIIA 3R0QA 4TN1A 1I4WA 4RAQA 4M1TA 4AZSA 1LDEA 1LK7A 1BKYA 2P2NA 3SYKA 2X15A 3BWMA 4G36A 3ROZA 3FDXA 1I2MA 1SOVA 3TB4A 2RHRA 2V7WA 4CL3A 3PRJA 4ZOQI 2QVYX 3GT7A 4MA5A 2H31A 4AURA 4BMSA 3L7OA 5BNIA 3IEKA 1JEDA 5J4KA 2BUAA 3LQYA 3RVJA 1NHWA 3P9IA 3ZQJA 2E5FA 1CNFA 2GN1A 1B93A 4ND8A 5DT9A 4UBJA 4BC1A 3QJYA 4ENUA 3I61A 3GA0A 4H15A 3FXAA 5H5JA 1TF2A 1ZMBA 3QE3A 3AEUA 3I2KA 1EWKA 2I22A 2XVZA 4ZQIA 3HCOA 5DFAA 4UQLA 3D6AA 1NW5A 3W0LB 4WH0A 3SIWA 2DH5A 1II8B 1NW8A 3FTFA 4LCBA 3DNFA 4DV4B 4MDEA 4N0QA 1P1FA 2FHSA 3OA2A 3NBQA 3NMUF 2ZS7A 3Q7RA 4J1SA 4QYIA 3GJ0A 4OEHA 2FQQA 3CT4A 3S0JA 1BEEA 1IRIA 2Q7XA 3D9QX 3FGPA 1HE2A 3KM0A 4WGFA 2AEMA 4ZT2A 5ISMA 2CYAA 3RC9A 3AX6A 3WWZA 3KV1A 3ZTTA 1AVTA 5BNWA 4ODIA 2EJVA 1JG7A 3DE1X 3TGPA 2OM6A 4GDMA 4K9RA 4XJSA 2WT4A 1LUAA 4OMDA 1Y9JA 3EGOA 2YIMA 3I2YX 4IYJA 1BE0A 4UZFA 2N42A 3I1JA 3MTDA 3I92A 10MHA 4X41A 1GGEA 1JXOA 1I5RA 1YULA 4PXAA 3OO1A 1PZFA 5BXYA 1M2WA 4R71A 2AW3A 1VMAA 1YS6A 2XMSA 1IU9A 4KXUA 2W6ID 4QBKA 5JSHA 3GVIA 1SZDA 1XA0A 3BCUA 2HSDA 4KXFB 1PG5A 2XZPA 1PD0A 1D5CA 5B30A 1GO2A 4RVOA 5JJCA 2W11A 5HKBA 3PQ7A 1NR7A 1EP2B 4BO5A 3H6GA 1TQ4A 3CRZA 1NDHA 2G4VA 2G9QA 2QTLA 3GLIE 4UTRA 3C48A 5JDIC 4FC7A 1XLUA 1DHRA 2IZ0A 1QIGA 2NTYC 1MOQA 4H6XA 1J06A 3RFVA 3WGGA 2J07A 1D0SA 3Q7TA 2J3LA 4E14A 3EEOA 4N3CA 3HZOA 3H0KA 2COEA 5B4TA 3DBVO 1J22A 4DCPA 1ZXXA 2WP8J 3UWOA 4CTKA 1YUNA 3HEMA 3A27A 2Q4BA 2YWXA 4G85A 2V6GA 5AJYA 4ZOCA 3C6KA 1Z07A 1E2KA 4IX9A 4N3BA 3H9CA 3K1TA 3LAWA 4MVJD 4XUGB 2C77A 3T0GA 1AQJA 3NHMA 4U0JA 5T8KC 2AG6A 2O0LA 3RF6A 3ZVLA 1C4KA 4GX2A 5DTMA 4DA4A 1D0IA 2E49A 3EZ2A 2FCRA 1UIMA 3P0FA 4RMJA 4DW8A 3WSTA 4AMYA 3EPLA 1ZK2A 1T4DA 3MWDA 1QONA 2C8JA 3SHFA 1KE2A 3V4PB 1TTTA 1AQ6A 3U44B 1JV2B 4CIWA 1PVVA 1L3CA 1IL0A 1IG0A 1P9NA 1FSGA 3DEIA 5CM9C 1X15A 1ZD8A 4ZAGA 1IK6A 3BXGA 4NE2A 3EFBA 4P82A 5K20A 3ZWPA 1JQKA 4BNFA 2X1VA 4ARZB 1A9TA 3EZXA 4FPXA 1NOJA 4RKEA 3IAM1 3B20A 5C1BA 4JODA