3GO4A

Crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
RIDTESAHSARIYDYIIGGKDYYPADKEAGDAMSREWPALPVHMRANRDWMNRAVAHLAKEAGIRQFLDIGTGIPTSPNLHEIAQSVAPESRVVYVDNDPIVLTLSQGLLASTPEGRTAYVEADMLDPASILDAPELRDTLDLTRPVALTVIAIVHFVLDEDDAVGIVRRLLEPLPSGSYLAMSIGTAEFAPQEVGRVAREYAARNMPMRLRTHAEAEEFFEGLELVEPGIVQVHKWHPDAATADGIRDEDIAMYGAVARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Rossmann-fold protein of unknown function (DUF574) (NP_823353.1) from Streptomyces avermitilis MA-4680 at 1.80 A resolution
rcsb
source organism Streptomyces avermitilis
molecule tags Unknown function
molecule keywords Protein of unknown function DUF574
total genus 84
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04672 Methyltransf_19 S-adenosyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3go4A00
3BGVA 3KPVA 2IIPA 1RJDA 5DRYA 1JTFA 1XDZA 5K09A 1P1CA 1RJEA 3FYDA 3IV6A 3HVKA 5DRTA 3EEOA 1QZZA 3SR4A 2XYRA 5BP7A 2JHPA 5BW5A 3GRYA 1TW2A 5CUQA 3C6MA 2AOUB 4X41A 3KQMA 2OZVA 1JQEA 2P40A 5P8WA 4C06A 1VL5A 2R6ZA 3LL7A 4P7KA 1RJFA 3BWMA 1QAQA 4RTMA 1YFJA 4RTSA 2IH2A 2Y1XA 5FA8A 1IM8A 2AN5A 3E8SA 5DXAA 2PLWA 5EQJB 4P7JA 4BY9E 3CJTA 3ORHA 2ONYA 1O9HA 4PGHA 2AOXA 2H00A 3B89A 3THSA 3AXSA 4RX1A 2NXCA 3HM2A 5T64A 4YUXA 3EVBA 2YX1A 1WZNA 1X19A 2GLUA 3HCBA 3B3GA 1UWVA 4PNEA 1IXKA 5DPMA 1BHJA 3DLIA 1YZHA 2JHAA 2XVAA 4PCAA 1JSXA 2HWKA 2PGXA 3FUWA 3KPYA 1R8YA 1JQ3A 2P3LA 2P41A 1VP9A 4YV0A 2FK7A 1EQAA 3UA3A 4KRGA 4HTFA 5FQOA 3UJ6A 3EGEA 3C0KA 4HH4A 4EKGA 2GS9A 2NXJA 2PT6A 3MQ2A 4V0RA 3DH0A 4A6EA 3LPMA 4AZTA 1O9GA 1NW3A 5U4XA 3I53A 4AUKA 1BKYA 3OE4A 3G89A 4GF5A 3UZUA 4PONA 3UJ7A 5BXYA 5GIPE 3OZRA 3KR2A 5EPEA 5E9JA 2I9KA 3HTXA 4C03A 2UYOA 1B42A 4A6DA 3FTCA 5LQUA 3DULA 2IP2A 1WG8A 3NVKI 3A7EA 3HCCA 3A26A 3KQYA 5HILA 1PJZA 1VQ1A 4FT2A 1G8SA 3EVCA 1M6EX 5KQRA 3F4KA 1NBIA 1YB2A 4H0NA 4U7PB 4EKIA 5GM1A 2H11A 3GO4A 3PX2A 5E8RA 5K8VA 3UJ9A 5KS2A 2G72A 2YXLA 4P58A 4R6WA 1MHTA 3H2BA 5HIIA 2N47A 3O4FA 5KQSA 1U2ZA 5GWXA 1WXXA 4P7GA 2PXAA 1ZGJA 3PB3A 2FK8A 1ORIA 1R6AA 3CJQA 2B3TA 1IY9A 2HV9A 3DXYA 3KPUA 3LBYA 3OCJA 3P8ZA 1XXLA 2ADMA 2IDJA 4MWZA 4CKEA 3SM3A 3P9NA 3KQVA 3EVZA 4ER7A 3BWCA 2QRVB 2F8LA 1QYRA 3VSEA 4E32A 4G56A 2XYVA 3PFGA 3KR9A 3EVGA 5LQCA 2R3SA 5LQNA 4RSRA 1YUBA 2OY0A 3TM4A 3OFKA 4QVGA 3TLJA 1OR8A 2OB2A 5LR6A 2BZGA 3UBTA 2CWWA 1M0EA 2IGTA 3MTEA 4HGZA 5EKXA 2C7QA 1H1DA 3BKWA 5T67A 5EMJA 4DA4A 4X61A 3G2PA 3HCAA 4LWPA 4RVGA 5C9ZA 4EMSA 3P2KA 4EVIA 5K0EA 1HMYA 2ESRA 3MHTA 3FUXA 4PIMA 3HA3A 3LECA 2HNKA 1FJXA 3MCTA 4GQBA 5E9WA 4BLVA 1RI5A 4RVHA 5EZSA 2O05A 1P91A 4FSDA 4R8RA 3P97A 4FGZA 5CVJA 3CGGA 3P9CA 5CCBA 1G38A 5MHTA 4PWYA 5H02A 3AXTA 1RI2A 3A4TA 3KQPA 3NMUF 2GPYA 4FP9A 1Z3CA 3G8AA 3HCDA 5FTWA 2UZ4A 2ZBPA 4QPPA 4PINA 4OBWA 1X1CA 5EHIA 2P35A 3GDHA 5FULA 3DXZA 4RTRA 3VC1A 8MHTA 3LHDA 2ZFUA 2OYRA 5GOZA 1WS6A 5FWAA 4FR0A 3BT7A 3P9KA 2YVLA 3FPGA 3G2MA 5T6BA 4DCGA 2PXCA 3HCEA 2FRXA 4OA8A 3T7SA 4RYLA 3LCCA 2OXTA 3FRIA 2IH5A 2AN3A 3FUVA 5CVVA 1NKVA 1N7IA 3M6WA 1PRYA 3I64A 1KP9A 2B78A 2PKWA 3DMGA 2ZW9A 3IYLW 3MAGA 2NXEA 4GC9A 2PBFA 4DMGA 2PWYA 2KW5A 4KWCA 2GAFA 3G8BA 3T0IA 3THRA 1EAMA 5HFJA 3G88A 3ER8A 3GRZA 5DTRA 2PSSA 3CJRA 2ZULA 3AWIA 5E1BA 1JTEA 3OU7A 3KR0A 2EJTA 4QTTB 4EK9A 3NWBA 3OZSA 3UJAA 2EFJA 5ICGA 4CXMA 3LDGA 4PYMA 4GUAA 2P7IA 2PWPA 1XCLA 2G8NA 3ID6C 3B5IA 2YQZA 1XCJA 1KPHA 2HTEA 3DMHA 3NW9A 4RTPA 2IBSA 1MJFA 2C7OA 3KPWA 1L3IA 2JJQA 5B1SA 4R6XA 4IWNA 4CKCA 1R18A 1ZG3A 4RTQA 5KVAA 2NNWB 2ERCA 2CMHA 3KU1A 2AZTA 3CCFA 3P2EA 4YUWA 2Z6AA 4QDKA 1Q0SA 3R24A 3OPNA 2PY6A 2QE6A 3KHKA 4EQZA 2P1DA 4OA5A 3SSMA 5E2BA 3UJ8A 4JXJA 3FPEA 1X1AA 4M36A 3TRKA 5K0FA 3L8DA 3EPPA 3GRRA 4HRAA 4BLUA 4KDRA 4MTLA 3O7WA 3FYCA 5EG5A 1EIZA 2YTZA 2B25A 5FHRA 5E2AA 3SSNA 5EKUA 5ICFA 4ER3A 1JR4A 7MHTA 3P2IA 3M6UA 4DQ0A 3SGLA 4RTOA 4YMGA 4QQKA 3LDUA 4X63A 5C0OE 1KHHA 3C3YA 3X0DA 1G6Q1 3NWEA 3PVCA 2VDUE 4B17A 5E1MA 1VBFA 5EIFA 5HIJA 4DF3A 1AV6A 4DZRA 5DX1A 3FPHA 2FCAA 4HSGA 4QQNA 5K01A 5EEHA 4M7RA 5HEKA 4RWZA 5DX0A 4BP1A 3EVDA 1NW6A 1ZHFA 3EVAA 3ME5A 4PIPA 4XUCA 2BM9A 3A25A 1R8XA 1Q0TA 2DULA 3LKZA 3VC2A 3DTNA 3LCVB 1JG1A 2ZIFA 5E8JA 3ANXA 3FPFA 2ORED 3IHTA 2QYOA 1JQDA 3DP7A 1DUSA 1N7JA 2AOWA 3CBGA 3UA4A 3NVMB 3QOXA 2PX5A 3D2LA 4U7TB 1L1EA 1SQGA 3EMDA 4BP3A 5F2NA 5K0BA 2HR1A 2FYTA 1RI1A 3TPZA 3CVOA 5KYGA 4GOND 3OFJA 5D1HA 2JHCA 2YXDA 1FBNA 1JSZA 3KQSA 5DM4A 4ATNA 4C4AA 3ELYA 4L7VA 3ELDA 2CL5A 3C3PA 5G02A 3K0BA 1ZQ9A 4FZVA 2AN4A 2ZWAA 3ELUA 4IV8A 4O29A 1Y8CA 5CM2Z 2PXXA 2YR0A 3DOUA 3AY0A 2GH1A 3GWZA 4M37A 4C04A 3M6XA 2AOVA 3MERA 4CTKA 5FCDA 4PGGA 1KXZA 3LCUA 3REOA 4E31A 4E2WA 3BWYA 2VZ9A 3LKDA 3GRUA 3KKZA 4QVKA 2ZZKA 5ICCA 2XBMA 2QY6A 2YUIA 5CVDA 1M6YA 2JH9A 3FRHA 5DX8A 2OPBA 4Y30A 2BH2A 3TQSA 3RW9A 2O57A 1VE3A 5LQJA 2QRVA 4GOOD 1NV8A 4XCXA 3NTVA 4PYKA 4XUDA 1QAOA 2GB4A 4GBED 2I6GA 1R00A 3P71T 3SVZA 3ER9A 1G55A 4AX8A 2AOUA 2PT9A 5JUWA 1I9GA 3A7DA 3GNLA 4PCLA 3AJDA 4E2ZA 1XDSA 3FZGA 3E23A 4UOEA 2HMYB 3FTDA 4OX9Y 4RTJA 3BWBA 1NT2A 3HNRA 4R05A 4MHTA 4E2XA 2LD4A 1KYWA 2PV0A 3T7RA 5HIKA 1BOOA 1D2GA 3CC8A 3TKYA 2ZIEA 4QDJA 5GP1A 4YV1A 3M33A 2IDKA 2OO3A 5DSXA 4P7FA 4RV9A 2I62A 2ZIGA 3KQOA 4HC4A 3LX6A 4WXHA 4F85A 2Z6QA 4F84A 3R3HA 1JG2A 1FPQA 2FHPA 3EVEA 4GOMD 5LQRA 2NP6A 2OBFA 3KR1A 1NE2A 3MB5A 2AOTB 2ZVJA 4E30A 2B2CA 5DLYA 4IV0A 5DTMA 2EG5A 3G5TA 1JG3A 1R74A 2PX8A 3C6KA 1AQJA 2YXEA 4POOA 2EX4A 3JWJA 3SMQA 2WA2A 3JWGA 5CVUA 4QTUB 1EJ6A 3PFHA 1XTPA 2OB1A 1F3LA 2A14A 2EJUA 2ZWVA 5DWQA 5EHGA 4Z2YA 1YFLA 1TPYA 2G70A 2O07A 5EOVA 3KPJA 1TW3A 4PYOA 5C1IA 2WA1A 3M4XA 2BM8A 2V74B 1EJ0A 5LQKA 2FPOA 5DM1A 3I5UA 3DR5A 5CD1A 3EVFA 5ERGB 4RTNA 4FT4A 1INLA 3O31A 4DCMA 2IPXA 4WVLA 1L3CA 3OU2A 1KPIA 3K6RA 2WK1A 4KIFA 5K0GA 2BR5A 2ZTHA 3TFWA 4E2YA 3QV2A 3QOWA 5DM2A 5ICEA 1XJ5A 3A27A 3PS9A 4ISCA 5LSAA 2QM3A 5DXJA 4AZVA 3BXOA 2XYQA 1NBHA 3SX0A 5JR3A 2IH4A 3KQWA 3TR6A 2Y1WA 5CCXA 1RI4A 4GC5A 4HTFB 3HVJA 4AZSA 3T7TA 3EGVA 2XVMA 3LDFA 3UJBA 4RTKA 2JG3A 2ZZMA 2PJDA 1VPTA 3MGGA 4K6MA 5BW4A 1SKMA 1AF7A 2JH8A 1WXWA 3BUSA 3CKKA 4M38A 5EIWA 2O0LA 1ZGAA 5EZQA 2BR4A 4KIGA 4V0QA 5DT2A 2AR0A 1G60A 1UIRA 3I58A 3U81A 4X60A 5IKMA 5FUBA 5M5BA 2P7HA 1L9KA 1VIDA 4GEKA 3ELWA 4KW7A 2VDWA 3GGDA 2GA9A 5D1NA 4ER5A 1L3BA 5HZMA 2NP7A 2CMGA 5DSTA 5EMLA 1AQIA 2IFTA 4ZTBA 3NDJA 2AOTA 5FADA 5FA5A 5FWDA 3V97A 1UFKA 4NECA 2VP3A 2C7RA 2UYQA 3OE5A 1SQFA 5F2KA 5K0CA 5GIOE 2P8JA 3M6VA 2C7PA 1P39A 3HVHA 3S68A 2NXNA 4Y2HA 3BKXA 3OZTA 1VLMA 1X1DA 1RJGA 4CTJA 1EG2A 3ERCA 3MCZA 5EVJA 3LSTA 5F2OA 1WY7A 2O06A 5E1DA 2P3QA 2VDVE 3BGDA 3DMFA 1FP1D 3HCFA 1SG9A 3HA7A 2AS0A 4PYNA 1D2HA 4PYQA 4QPNA 1NW7A 2ZSUA 3G5LA 4OQEA 4XUEA 3TOSA 3GRVA 4BLWA 4C08A 4ER6A 3GU3A 1ZKDA 3BZBA 3PLAE 2VS1A 3NDIA 3P9IA 1JG4A 1SVUA 2G71A 3B7PA 5K05A 2H1RA 4PYLA 2V7EA 3GJYA 4YV2A 1G8AA 3RIEA 3E7PA 3TM5A 2K4MA 4KDCA 4LECA 1ORHA 3UFBA 5K0NA 4LWOA 1NW5A 5DTQA 3JWIA 3G2QA 5EGSA 3SSOA 1X1BA 4X1OA 3TKAA 4MQ4A 1BC5A 5CVEA 1I4WA 3PX3A 1KYZA 5HOQA 3MTIA 4HG2A 2P3OA 4DM3A 4AZWA 4YUYA 2DPMA 3HA5A 3BGIA 3FUTA 4GOLD 3R6TA 3V8VA 3WSTA 1KIAA 3DUWA 3R9XB 1F38A 3HEMA 1XDUA 5EMKA 4HGYA 5FQNA 3TMAA 4C05A 3PTAA 2IBTA 2NYUA 3OU6A 2OKCA 3FTFA 3HVIA 5FHQA 3GIWA 5LQAA 4DKJA 1QANA 3LGAA 3UJDA 1YZ3A 5GINE 4ER0A 2PX4A 3I9FA 5K0LA 5IH3A 1D2CA 1DL5A 1P1BA 3GCZA 1RI3A 4PYIA 3DLCA 2AVNA 3EGIA 3E05A 1VP3A 1SUSA 3KQTA 3HP7A 3M70A 3NJRA 4YUZA 2ZBRA 4OBXA 3EEYA 4E33A 2I7CA 1QAMA 3R0QA 4YMHA 2Z6UA 2PX2A 4RVFA 5GM2A 3G2OA 4R8SA 4FS8A 3EMBA 3UJCA 5HIMA 1I1NA 1XVAA 3Q7EA 5EMMA 1FP2A 2G1PA 3B3FA 4RVDA 3UWPA 1NW8A 1V39A 1HNNA 5K03A 5DM0A 3RODA 3GXOA 5E9QA 2ZZNA 4YUVA 2ONZA 4IKPA 5EEGA 9MHTA 4C07A 1YF3A 3KQQA 2UYCA 3PT9A 2B9EA 1NV9A 2AVDA 3VYWA 1DCTA 2PVCA 3DXXA 5K0JA 4OQDA 1SUIA 10MHA 4PYJA 4FSXA 3G7UA 1T43A 2ZBQA 2Q41A 2E5WA 2BR3A 4F86A 3B3JA 1N2XA 4LG1A 4RTLA 3FUUA 5CIYA 1KPGA 4E70A 2UYHA 4CKBA 5E1OA 4KVZA 3SXJA 2CKDA 1KR5A 4MIKA 3FTEA 3IEIA 3FPJA 1O54A 2ZLBA 5EC8A 3LBFA 2ZCJA 4CWAA 3JWHA 3Q87B
chains in the Genus database with same CATH superfamily
4I5EA 1F60A 1E3SA 1O96B 2QE7D 2R0QC 4PXSA 1WTCA 5GJWC 2WFLA 3URMA 4XIFA 2I66A 3GNSA 3LA6A 1XZBA 3E03A 1XJWA 3H11B 3GLVA 3UK1A 5IJZA 1G16A 2QZ4A 4MROA 1BDHA 1Y8QB 1FVOA 4PPQA 1RM4A 5ICMA 3JRXA 1E9VA 2D62A 2OZVA 4RYDA 2N0SA 4XKJA 2I55A 4X8OA 3WL6A 2JEZA 4RTSA 4YP1A 3F8WA 2Y1XA 1KOLA 3RUHA 3L77A 2QAGB 2B99A 3UUGA 1V0JA 5KVCA 4QGFA 1PJLA 1FNBA 2DPYA 3CNEA 3AM4A 2GM9A 4L4ZA 2K5UA 2NGRA 4HLQB 4PBTA 3EW7A 3D31A 3GJTA 5JCPA 3OZ7A 2FMTA 1Z5VA 2VQDA 2E49A 1SA0A 4FNMA 1UUFA 2PZAA 2JGDA 2XVAA 4II2A 1PFWA 2P9HA 3QEJA 3R0IA 2Q5IA 2C20A 4YN3A 1XLUA 1XTJA 3GEHA 2PZ8A 3GGJA 4DGSA 1HT1E 3U3KA 3VI4B 1C81A 1MG5A 2EFCB 2ZSBA 3BK2A 4FGJA 1M2EA 2PV7A 2Y4NA 4TT3A 5DJ5A 4BL5A 1YZYA 2D0PB 2Y1OA 3B85A 4GKVA 2Q3LA 3AL2A 4HTFA 3MAAC 3GJQA 4OK3A 1O9BA 2O2DA 2ZRIA 2GS9A 4NYMR 3ROXA 5EP4A 3H6GA 1VIMA 1XEAA 4AUKA 1SCJA 1WBJB 1LRJA 3EBLA 3HFSA 3QWAA 4GF5A 3ZU2A 5CG1A 5BR8B 1XK7A 4BVJA 4JEUA 5LFAA 2G9ZA 4HWOA 2HLPA 3OSUA 3AEUB 2PS1A 4US2R 3B1KA 4JVLA 2NUBA 1CY6A 1Z12A 3H17A 1Y5LA 2QTVA 1DJPA 5FNVF 3M2PA 5HILA 1R3DA 1ZIYA 3K1ZA 1FNMA 1MB9A 3QU4A 3FA2A 5IJ0A 2P2SA 5B58T 3GFPA 3VHQA 4D5EA 1AQNA 1RWKA 3GV0A 2B6NA 4JEMA 4KE9A 4F6LA 4XGKA 3CM0A 3M8KA 1JLHA 3ZZMA 4XWAA 2E4VA 5HFAA 1YDHA 5A3VA 1JU3A 5FOVA 5BSHA 3WAJA 1U7OA 3UXYA 1SC1A 3OOSA 2XZOA 1A1SA 1NSTA 3P9NA 3UWMA 1GAXA 2CXTA 2QZZA 2VJMB 4K9OA 5EE1A 5FI0B 5D7NA 4CMIB 4NC9A 2H6EA 2I6SA 5D5PA 3T7AA 2ZB4A 4LC1A 2K2WA 3R77A 4DMCA 2JAOA 3NBQA 5E0KB 4ZCLA 2JFBA 1Q1AA 3W0LB 1H05A 4H1VA 4H77A 3EFBA 2QMYA 3EIQA 1OWMA 3JQPA 4C7KA 4OOEA 2C7QA 1DBVO 1DEHA 2Z1NA 5KWJA 3RHZA 1V37A 3G2PA 5ALEA 2OBMA 3OIYA 4ZVSA 1XZGA 1GILA 1QDUA 4C0WA 4L57A 4NZZA 1JEEA 1RRVA 3BIXA 3U5ZB 3FUXA 5ALOA 3OIVA 1WHTB 2YXPX 1E7SA 1RXYA 1QH0A 4J90A 5ALPA 5IDYA 4LGCA 2KYRA 4RVHA 5A2GA 2I6UA 5CDGA 4FSDA 4M0PA 2IOFK 4FGZA 4DAEA 2R8XA 3D8HA 1Z38A 3OZCA 3NP9A 5CJPA 4J1TC 5MN6A 3LXRA 1N6OA 3W5AA 3DEKA 2HL6A 2QD2A 1IN8A 2F1OA 4JI5B 5HRAA 1EFAA 1WPRA 3L4JA 3JPWA 5A4FS 3CZCA 5H81A 5JXJA 1PNRA 4IQ0A 4UM7A 4RGQA 1ZJ4A 2PUWA 2P8SA 2R84A 2QUHA 5EHIA 4BECA 2ZXEA 3GLIB 1ZOLA 2FPPB 1KO8A 1WW3A 3QFSA 2BHLA 4I4TB 4FK8A 4PBSA 4ZO4A 2YVLA 4E1VA 3LUFA 4DXHA 2PXCA 3EGDA 3KV3O 5AVJA 3BHIA 1FJGB 2W4IA 4Q15A 5AK4A 2QL6A 4YLEA 2OXTA 2FETA 2A5LA 2JEYA 4CQNA 2ZRNA 3WJ1A 3SLKA 4B75A 3CX3A 4Q12A 3N07A 2QUJA 4O6VA 4CW7A 2ARKA 3PD0A 4L0MA 1H5QA 2ID8A 3K8YA 4EUEA 1N1EA 1UWKA 4RVCA 2O59A 1HEUA 3H5AA 3QPBA 4BNNA 4B3CA 1CEYA 2P4UA 4OREX 1J00A 1XSEA 2JFNA 1SBNE 4LZPA 4MX8A 4MUAA 4QODA 3UGTA 4HTAA 2L2QA 4G89A 4QTTB 5K3BA 1XHFA 3KR0A 3AHGA 1J6UA 2C3YA 3F6PA 2IA5A 3BD7A 2Z30A 4HJXA 1QH8B 4LI0A 1K8YB 1TZKA 1XMSA 3NW9A 5IEJA 2HBYA 4LJLA 3RRFA 3TTXA 4YRSA 3AU8A 3MMZA 1M2VA 1Y7PA 2J5BA 4XWKA 1ZC4A 3ZHYA 2VTBB 5E95A 3PIIA 3HP4A 4H9GA 1ZG3A 3F3YA 1U8CB 4WA8A 5JPIA 3PE3A 4RTQA 4RTOA 4YJKA 1H69A 2C58A 4BO0A 3LWBA 2BHSA 3AW9A 5LZ4A 1E0KA 2HIHA 3A9UA 4QGAA 4WJZA 2EIXA 3C8DA 1ZNWA 3S28A 4EWLA 1M8KA 4D26A 2GD1O 3T4EA 1PWZA 1R10A 4WXPA 1U8EA 3NHMA 3DOIA 4M36A 2VSYA 1GUYA 3TRKA 4UCQA 1WCYA 4ZQFA 2AH5A 4GDMA 5AYVA 4ZCPA 3EDQA 2JBWA 3C5HA 1E32A 1UXIA 3PPXA 4GPAA 4HDSA 5HCNA 4UDNA 7MHTA 5FDFA 5ALUA 1A7AA 1O8CA 5KTOA 4ND4A 1TKRA 4X3OA 2KBEA 1JDBC 1JSRA 3LF2A 2VKQA 1Y3CE 3G8YA 3Q3GE 2NM0A 1IHXA 4FYKA 4COKA 3LNCA 4ZHSA 1I4LD 2OORC 1TMKA 1UPFA 1NRWA 2YJ6A 3EQ2A 1PZEA 1K6IA 1W4BA 2ACWA 2OZPA 2VVTA 4G09A 4DSTA 2B36A 4G0MA 3OJOA 4QFBA 4WNAB 1ZUHA 2J85A 3H3XA 4JDUA 5K0TA 1ZHFA 3EVAA 4ENSA 1VJ1A 4KXNA 1B73A 1HT0A 4DBLC 2ERXA 2WDZA 5LBIA 2FY8A 4TMZA 5FEMA 2JI6A 1NVFA 3MLAA 3LU1A 1N5RA 4OKNA 5DULA 2ADFA 4ES6A 2ZUSA 1I7LA 2H52A 3S2UA 4ZK6A 2XCIA 1NYRA 5JJKA 3UA4A 1L8XA 1N8KA 3F97A 3IALA 7YASA 1AQ6A 5JNVA 1W44A 3CVWA 2ZE8A 1A2BA 4ON9A 1MJ5A 4D0LB 1H6DA 3LUBA 2QQEA 1YB5A 3D4LA 3DG9A 4BP9A 3NHKA 4HUTA 4OXNA 3EULA 5K3AA 1HH4A 3T0GA 4AUNA 2KB0A 2SNIE 3AV3A 3HM9A 3FHJA 4RE5A 1CNEA 3JX9A 4KG7A 2I91A 1R88A 4WOBA 3FJOA 4EH1A 1ZIPA 2FSVA 3EB9A 3VTAA 1JEDA 3RFVA 4PZ0A 1NULA 2O23A 2VXBA 2XQVA 4MR9A 2W2TA 4RH0A 1Y6RA 2V98A 1TYAE 3Q40A 4QXOA 3AO0B 3EAFA 3BRCA 4XZ3A 3WB2A 4D9FA 3BULA 3CWZA 1TF2A 4JXKA 3H99A 1CRPA 5L3SB 3TCKA 4HV4A 3H0CA 3ZGXA 2A4KA 1P77A 4ECAA 1H4VB 1UZMA 4DCTA 5AW7A 4W5RA 2G9VA 4QXRA 1U2EA 3A1SA 1IPFA 2QY9A 2QENA 3RBAA 3NJ8A 4ALJA 2HDWA 4MRAA 3VZSA 4ZKEA 3W2IA 1DDIA 2RJOA 3CRNA 4ZO6A 2F1RA 2A1IA 2HRBA 1DKNA 5AO9A 4JBXA 3B2QA 4M1EA 5E6RB 1WDWB 2HXYA 3WLPA 1JPUA 5TMPA 3O5AA 4DA7A 4TKUB 2PRSA 4DKXA 2ANBA 1DXQA 4MYDA 4X7RA 5I4IA 2ECPA 5MGBA 1OH6A 2Z8XA 1M3SA 3BWBA 1G6HA 1TECE 2OXFA 5K8JB 3CX7A 4BZXA 1D2GA 2C4KA 2W11A 3P9ZA 4NCJA 3JWPA 2HXGA 2VDJA 4YC7A 1P45A 4L8LA 4P7FA 3EXG2 4R1TA 4P3PA 1DBWA 4J0JA 4M8KA 1XLWA 4RV9A 5EJIA 8AT1A 4MPTA 1DFGA 3MT7A 4ZEOA 5C51B 1XNRB 2IHUA 1RADA 2ASEA 4ME6A 4MUKA 4V24A 2NYAA 1B0PA 1E2IA 1KSHA 5CLGA 4YFVA 4D4JA 4CMCA 1P9RA 1Y7IA 2J59A 3ABIA 4YB8A 1SM4A 2FXIA 3WQSB 1X6VA 1VL8A 1HRKA 2EG5A 3WFJA 1JG3A 4DWVA 5CA1F 1SVMA 1P2TA 1PGNA 1EPUA 2DEUA 1E3EA 2JJYA 4DWOA 3CRQA 3MPUA 3JWGA 3MGBA 4QTUB 4WE3A 2YMLA 3NU1A 4HFJA 5DGCA 2R79A 2ZWPA 4IJ5A 1XRLA 4GO1A 2BWJA 2P9GA 5BN3A 3QI7A 4Y1RA 2VHVA 3FKJA 3KLMX 4P92A 5C1IA 2BMFA 8ABPA 2Q9BA 3MZ0A 1CZRA 1VIVA 3KBBA 4GKBA 1TO1E 1QK5A 1QRRA 4KYIB 4KXQA 3ZWBA 3OCVA 1YJ5A 2GHTA 3DWGA 1EFHA 4TTTS 4EA8A 2HMVA 1MEOA 2A9KA 5CT6A 3V8RA 4E5YA 5JNUA 2XOKD 1E1CA 2XZTA 4DSAA 4ALLA 5CFPA 3K72B 3L0PA 1E99A 3WRVA 1NASA 1XFDA 5AICA 4S0ZA 1ZCFA 1VPVA 4O63O 1E6KA 1QP8A 3ASUA 3NG1A 2GJKA 3IQXA 3PJFA 4JODA 4QULA 4AZVA 5JR3A 3DPIA 1T9ZA 4I4TA 1XKTA 2X1LA 3BQNB 3KQWA 1DKQA 2X2FA 3ZWMA 4R81A 1UFOA 1O6ZA 2AG5A 4GC5A 4AZSA 1QYDA 1FL9A 3CLKA 3LDFA 4X84A 4A0FA 3FMFA 4AURA 2IXGA 3I39X 3GLRA 3A1CA 1HT3A 1SELA 1T2NA 5TRTA 5EIWA 3WHIA 2CEAA 4MYSA 2JLUA 3WVNA 1ZP6A 1KY5A 1XEXB 2GEUA 2H5EA 4ZVKA 3RRMA 3U81A 4ZDIA 2IEDA 5YASA 1N2HA 4GQIA 2P7HA 2HT6A 1IEVA 1N1DA 3NHSA 1YTUA 2C2ZA 4ZZ1A 2KS6A 1Z4NA 5IDQA 3BMCA 5E2IA 3T5TA 4O3MA 4MO2A 1WMAA 3PYXA 1FDWA 2WWWA 5A6VA 3O4GA 3MMPA 2BTQB 3T5BA 4ZYXA 4D0GA 3E9EA 2C7VA 3VX3A 4IJ6A 3CEAA 1XPUA 3OLYA 3EIEA 4WKPA 4KXUA 4WAUA 1LI7A 3VUEA 2JJMA 2H51A 3PYMA 1E2JA 5F1OA 3AJRA 3BZWA 3GCXA 5CDFA 1S8FA 4DVJA 5EVJA 4MRMA 1YQGA 1N2ZA 1R6TA 5E1DA 2FWRA 2P3QA 2FFAA 2C7GA 2YRXA 4RIEA 4C76A 1T9GS 4JA2A 4TS9A 5JV5A 3DAHA 3T7CA 2P79A 2FQXA 3STHA 1NJGA 2I6FA 4MA4A 5L8VA 3QW4B 2WPDD 4D7AA 1T1SA 3GD5A 3OZXA 2VSFA 4CCAA 3WBFA 1P6XA 3K4HA 3EN0A 3QFFA 1CUWA 4YP9A 4G1FA 1LU9A 1NMXA 2YW2A 4Z3DA 7ADHA 1FVHA 2W6PA 3HCOA 1OTXA 3TIVA 3KD2A 3QJGA 3B7WA 4LY6A 4M1TA 4IWXA 5K0NA 3GLGA 2RARA 3NBFA 3ONVA 3ORFA 2H2HA 2ZTLA 5KYXB 3GRAA 3KS9A 1H1TA 1OXMA 1SQ6A 3BWEA 2AG6A 3PNKA 1K4MA 4GU5A 4I5IA 5CVEA 3OPYA 5EGNA 1T8WA 4LJ5A 4Q3KA 4CQMA 5AM3A 1LLCA 2CLKB 3H5VA 1NZJA 4D5GA 2RIRA 4OHMA 1UIMA 4CR8A 3DO8A 4X54A 2X8AA 4HPJB 4B5KA 1TO2E 2AZDA 3EX7C 1C8LA 5JBIA 3TMAA 5KQMA 4H60A 4L78A 2FMHA 4CIBA 1SIOA 2ZETA 4EAQA 1NVUQ 3WLNA 3ENQA 2HF7A 3I9FA 1NR5A 4DQKA 1J25A 4UHCA 1RI3A 3QV1A 4L5AA 4Y1FA 3E05A 4IZIA 3A10A 1GCOA 3ASVA 3TLXA 1JB1A 3ONEA 4OBXA 3VSBA 2PJRA 3SEQA 4J91A 5TSDA 3QITA 3VHXB 3R6WA 2IEIA 1EFLA 2V5VA 3CR8A 4R8SA 3TR0A 4F9TA 1CUXA 1DC6A 1IHOA 1XVAA 1J8FA 3BYZA 1H3FA 4L2IB 4F06A 2XHZA 3DBIA 4IIHA 1R4NA 4MUIA 4ZYUA 3KHUA 2C94A 3UV3A 1RBYA 4Z0HO 4LZZA 1YTLA 1ECJA 4Y6RA 2FMKA 5E9QA 1GJRA 5HR5A 1NC1A 3OT5A 4MZDA 2CYBA 2PPLA 1MG0A 3NQ41 3KQQA 4NBKA 5TS2A 1TJ3A 3SFZA 3EEFA 3HS3A 4JOQA 2XIJA 3P20A 3E2PA 1N34B 4I50B 5F21A 1YR8A 2I7TA 1BXRA 1EG7A 3CSDA 4Q1EA 4ZPXA 1KOGA 1BGVA 3RSCA 3IUMA 2LGJA 5FX2A 5ED4A 3NNNA 1FFXB 4GD3Q 1GZ7A 4XLTA 4CCYA 4ZJZA 2A0KA 4R8KA 1ZCBA 3C3DA 4KGVA 1WWKA 2WU0A 4IGEA 4TV9A 4XIGS 1ZINA 1N4DA 3DZFA 1MVLA 1O54A 4UMEA 4GMGA 4UUPA 1HR0B 3VFDA 3L0CA 2WUGA 4EQ6B 2IIPA 1JTFA 1JH9A 2AF3C 1DEOA 1G8PA 2CVQA 2X4DA 3WGLA 1XTIA 2WFAA 5AW9A 3EEQA 1JBKA 4YCLA 2A5GA 4QARA 1THMA 1QKJA 2D59A 4YWHA 3T3MB 1WP4A 2MSCB 5E6RA 4NEHB 1NWCA 1LI5A 1TW2A 5A2QA 1RAEA 2RKWA 2B4KA 2R6ZA 3QM1A 1HYBA 4QUGA 1G20E 1I4TD 2GPJA 5ADUS 1W581 4HMOA 4XR4A 3MQ4A 5B6PA 1IM8A 1DBSA 1LXCA 2IW1A 2NO6A 5DXAA 4TLMB 2WP8J 4DABA 4G5HA 1Q7BA 5JRJA 1Q0ZA 2GN0A 3ZYZA 1FU4A 3TLKA 2EERA 3AXSA 4BNHA 1H2RS 2NXCA 4P0PB 3IULA 3L7YA 3ZX5A 5BT8A 3GQBA 1G7RA 2CDAA 2CFSA 4RIFA 3R75A 4QRDA 5KJ6A 2GM4A 3I0ZA 4WPGA 5JTTA 4RK7A 2PBRA 4KDEA 1OI2A 2H31A 3MG9A 2AMYA 2VLBA 3H8VA 3BFKA 3KPYA 3NC1C 1XDDA 2VTEA 2Y67A 1GA1A 2YFYA 4YV0A 4TOIA 2JCYA 3GUZA 3RRJA 1Q19A 2Q3DA 2B0CA 3O0TA 4EKGA 4QBHA 3GHHA 3ABSB 4V0RA 1B0AA 1J1IA 1B41A 1LB1B 1Y1KE 2GPSA 3LGSA 4LYEA 4I50A 3WWOA 4X62B 1RPZA 3JD2A 1BKYA 2FPIA 4JWKA 4WDRA 5KYKA 2ZXUA 4L5YA 5I47A 2SICE 5GIPE 1TUBA 1PSDA 3OZRA 3D3JA 4I4TF 4II7A 4MVJM 4X1KB 5FH9A 3HTXA 2BKVA 5B7GA 1MP0A 1PT9A 4YYEA 2WWVD 2QOEA 1GGNA 3DULA 1GPH1 2RE8A 1BXGB 1WG8A 2NOAA 1UADA 4IO1A 5CA1B 2RHLA 4HFRA 2E4XA 1QBGA 4ZAFA 1PEAA 4MVWA 5SYNA 4FT2A 2HFJA 2ECFA 4QPCA 2Y9MB 1Q1GA 4KC0A 5LD2C 1ZZGA 3LG2A 4MV9A 4R1SA 3AR8A 1A88A 4IFTA 1J7KA 4XVRA 1LDEA 4YJGA 2Y6UA 2G77B 4KX5A 4I1IA 1XT6A 5KS2A 2V1XA 1PNVA 4XOIA 1YQTA 2N47A 3PXAA 1X94A 5KQSA 2UXCB 2NO4A 2BFAA 2LP4Y 4HNGA 5F35A 2C07A 2ECKA 4CKBB 1PG0A 4LXTA 2Z08A 3AR3A 1EVIA 1KTIA 3WNVA 4B9AA 4B3HA 3SBXA 3FN4A 5IJ9A 4V1CB 2P2GA 5BSWA 1E62A 3MJHA 2OZLB 2QTAA 1RHQA 2WF8A 3BICA 3VNRA 4M99A 3ZHRA 1KZ1A 2DHEA 3AI7A 5KOYA 4EYSA 1ZO8A 1RPJA 4DSNA 2BGJA 3RKUA 3QKSB 1E1YA 3QA3E 4DYDA 4YPOA 5B6JA 5JDIC 3OM0A 3MB8A 4C7OA 1WMSA 1JXQA 1XU4A 3QELB 3O8NA 3MTEA 4V1CA 3PCRB 4CLXA 4OX9Y 4NE2A 1CY2A 3X1DA 2P1ZA 4HVCA 1RYHA 2XNHA 2ZYIA 4AMZA 2BGUA 2X8JA 1IXYA 2CFOA 4D0NA 3N6VA 1I1OA 2GD6A 2HRCA 3FROA 3TCXB 1SG6A 5FUXA 3VR6D 3KQUA 1Y9ZA 3BRWD 2OG1A 2PD3A 3KKOA 3A0RB 4WFQA 1PX0A 3GJZA 3ZHVA 4URFA 3D02A 4GQBA 3ORYA 3SZLA 4F92B 3ROZA 2HWXA 2R4UA 4BNDA 4UXIA 3DLPX 2XTZA 4PWYA 2OQRA 1EK1A 2GPYA 4EJSB 2EWWA 3MBKA 3QVXA 4JIGA 2ZIVB 1E1RA 1JHPA 4RGVA 1QMGA 2YRFA 4Y6PA 3ESYA 1N6LA 4KQ1A 3P9RA 4RTRA 2A5FA 2H7XA 4NYJR 2QJRA 2BTEA 4J1TA 3GYGA 1YT5A 3FZNA 1COZA 3RJMA 1LW6E 3OT1A 4AMGA 4MPRA 1DAMA 1M34A 1P9WA 3SK0A 3ZNQA 1GKYA 1A8PA 1TAHA 2HA0A 1SWVA 4IDAA 5CVVA 8LDHA 4TZ6A 1NKVA 2NAPA 3AL0C 5AK0A 2OUKA 2VXOA 3DMGA 4YCDA 1VKHA 1AUXA 1NVDA 3EISA 2QMHA 3MAGA 2LRHA 1D9ZA 4JUDX 4K03A 3QOFA 4TKVB 2QL7A 2IX9A 2KW5A 4AP6A 2CXRA 1T3GA 1CFZA 1KJYA 3ZTWA 5IKXA 3WYAA 4XWWA 1XB2A 1VKZA 3KEGA 3M6LA 3NZEA 1EXNA 3CUWA 5LA6F 3O94A 2WIKA 2BKAA 2MMGA 4ZAWA 3H2IA 2WZCA 2JC3A 3ZH2A 3SM9A 3A37A 5E6SB 3WWPA 1W2WB 3DHEA 3ZDQA 2F8TA 1T3ZA 1VFNA 3C7DB 1CUFA 2QV7A 4Q3LA 5IBPA 3VPCA 2NV0A 2PANA 1W35A 4E14A 3TQCA 3LYUA 3HSYA 5ERXA 1U3CA 3B5IA 4EGSA 1KPHA 3PGKA 1OBFO 1P62B 5HTOA 2JBHA 1XGKA 1Q95A 4L16A 4MUMA 3QEBZ 4FFWA 4CKXA 4V2UA 1E0JA 1C8BA 1XEWY 1QZXA 1W25A 1DAFA 4MUXA 1H2YA 2Q27A 3OZDA 5CP8A 3FDXA 4LWZA 2H2IA 1UK6A 5DT9A 1DCMA 3DM5A 4KQHA 4DV5B 3KHSA 4FU0A 3R24A 1XF9A 3FE2A 3ZS9A 1QRAA 2HU7A 3PQCA 1E2EA 2PYDA 1W4CA 5K0FA 2QAIA 4IG4A 1QVAA 3UGQA 1A5TA 4KP7A 4WUTA 3OT1B 2PGIA 2VSQA 4PPYA 1AJEA 5FD8A 3RFCA 2DUWA 1NLYA 4MV4A 4BEVA 1NNEA 4QOFA 3AUSA 1SG0A 1VBFA 4GZMA 2B35A 3M82A 4E5VA 4OLJA 1HDEA 3FCXA 1TJ5A 4O2BB 3I0MA 3NIBA 3CZMA 4DZRA 1XKQA 3SKVA 3ZW8A 4IMIB 2QTTA 3GLHE 4LJ6A 4GXQA 2R6GA 5G1OA 1KNQA 4PIPA 1HYEA 2SKCA 4I1RA 3GLIE 5FBVB 4HEQA 4ZMRA 4LSWA 4RA6A 5JOQA 1HO3A 3O8BA 2ZIFA 4OF4A 4UNSA 4DMUB 5LQDA 2Y27A 13PKA 4M1MA 1YDEA 3NVMB 2PX5A 4Q3BA 5I01A 1U1DA 1KHTA 2X7XA 4CM7A 2C00A 1WCXA 3A9CA 2A1UA 1Y3FE 3CNLA 3KJQA 4OY3A 4NCHA 3MYRA 1FBNA 1ZMBA 3PEFA 2GPAA 3O93A 1YIDA 5AVRA 1JEQA 1N6HA 4FPXA 4QKQA 2BI4A 2FMUA 5G02A 3VR5D 1R6XA 1G0OA 1X7ZA 3I8OA 2XRYA 2ZWAA 3P2YA 4MPJA 2ATEA 4QUDA 2WTEA 4IDEA 3DB1A 3RVLA 1LC3A 5HZKA 3G0BA 2D3WA 3L79A 4TSRA 4BGEA 2ZAGA 2GVNA 4JX9A 2GVZC 2H1LA 2QG9A 4C04A 4YCCA 1Q77A 4DNOA 3F73A 3JU3A 2GXAA 3BCSA 4JU8A 1P17A 1TJPB 1ISHA 2OG2A 2P9BA 1IBKB 1JFFA 3AF5A 1UT8A 2GJAA 3BL8A 4EELA 4N4AA 4Z99A 4HDMA 1OF1A 4YXFA 3SZUA 1E2MA 4Z7OB 5HQTA 2GJSA 1HE3A 3L8GA 5IJ9B 3AVQA 1UOEA 3D0QA 3TG2A 2DC1A 2CNLA 4LYDA 5EXSA 1XWIA 1PZHA 4WACA 1JF8A 4BZZA 1QU3A 1G55A 1MBZA 2PT9A 3ZHOA 1Y63A 1LGYA 4EZBA 2V7QD 1H22A 1SK9A 2C97A 3GRFA 3N05A 4MCJA 1CQZA 4REMA 3T34A 1EMDA 2JLZA 1YQ9A 3ZVNA 1CFJA 2C29D 3O95A 3B6ZA 4MRMB 1Q84A 3LVRE 2LD4A 4LHSA 4E2XA 4J7XA 4PV7A 4UAUA 4ZEMA 1VI6A 1H65A 2IXAA 3UV7A 1JFTA 3FH0A 2EKLA 3H19A 3TTWA 4DUGD 3KQOA 4F85A 3ZE2B 3HR4A 1EVQA 2ISSD 1EX7A 4H7HA 4E7OA 2E85A 3VGJA 4DCSA 1YA6A 2FHPA 1T8PA 2G09A 1VPEA 3D3KA 3NNSA 5CDUA 3IEVA 2IBMA 4M6WA 5HFNA 1KEKA 3AC0A 3C2QA 3AU9A 3PEVA 4GLJA 1WX1A 5BVGA 4EFLA 4GGOA 3C1UA 3GA5A 1YRYE 3SMQA 1HDRA 2OHGA 1FIUA 1SIBE 4XX0B 3HR8A 3GEEA 4AJIA 2X23A 2ZWVA 3IAHA 3SOPA 4TXLA 1W49A 2IT1A 1KI6B 1MABB 1YGPA 4YACA 4FCCA 4K9MA 1E5XA 1HZZC 2NN3C 3G3EA 3M9LA 1Q0QA 1ESDA 2FUEA 1K2VN 2QRGA 2ZJBA 3IIEA 1OASA 4PLPA 3WKAA 4RM3A 1MJGM 3MCAA 1ZEJA 3GLTA 5CDHA 1XG5A 5CM8B 2IZ6A 2P5UA 2P62A 1CR1A 1II0A 2IPXA 3P26A 4QQFA 3L1KA 1G3IA 4RD1A 3TD6A 4AC9A 1NURA 4LYJA 3T3PB 2BR5A 2O5RA 2Z9DA 1UC4B 3QV2A 2NYRA 1QO7A 4KKVA 4E2YA 4JL8A 2BGRA 4ENQA 3A27A 3TSOA 2QM3A 3EIOA 1LPBB 1E59A 4TMKA 4LFCB 1VOTA 2DH5A 3H1PA 3V4FA 3N5CA 3GFOA 4IF4A 4CCWA 3HJFA 3I9JA 4JJGA 1Y7HA 5FT9A 4LNUB 2NV2B 4TSFA 4RTKA 4A92A 4H18A 4PLGA 1JUDA 2Z95A 4EYOA 5DYWA 3VC1A 3EXHC 5AUNB 1PNQA 2YWBA 4RK1A 3A6PC 4IQ8A 4IWYA 4RPGA 1Z2EA 2WHQA 3VTFA 1IEWA 1CP2A 3U9SA 3OC0A 4KMMA 1OD6A 1YS1X 2GA9A 4X93A 1QZ3A 1HSOA 3ILVA 3TSAA 2C2MA 3R3YA 4AJEA 2Z5LA 4Q0MA 3NDJA 3PGLA 2QR5A 4HX9A 3VDMA 3K30A 5LMCA 3HB9A 3U3JA 4QTZA 1I4EB 3VH2A 5BNZA 4H59A 3RTCA 5K4AA 2HAEA 1XVIA 3PV0A 3NXKA 5DNYB 1VCOA 3JYHA 3A1WA 4Y6QA 1YH3A 1U90A 4MW5A 4QXQA 1J42A 1RJGA 1JEYA 5F3WB 1ORTA 3H7AA 2GHQA 4MNTA 3HDYA 3AKYA 1GGMA 1SKAA 3LZDA 3MCZA 1I2CA 5CLIA 2PMEA 3SHFA 4DC1A 4E21A 1WHSA 1KRWA 3HCFA 3PKZA 1G291 3G0CA 3ENWA 4JMLA 3T9CA 5FA6A 1TU4A 3HCWA 1NF9A 1W88B 4BNZA 1GUZA 4ER6A 1S96A 3LXMA 3WI7A 2ZGVA 2IS1A 3VA7A 3M1IA 3P5BA 1YXMA 5FOTA 5CCDA 2C4MA 3MPOA 3UAOA 4E7PA 4ARCA 4L9WA 4QNRA 5EXXA 1CQIA 1GUDA 1ZQ1A 1W88A 4N7BA 3UF0A 4WN9B 4RFSB 1P9OA 5ELMA 4N41A 1ZLXA 2C8LA 3UMSA 2JFYA 4TXNA 1YUMA 4M0DA 1DIOB 3MTIA 4P08A 5GPBA 4B76A 2DLNA 2QLNA 4ZT5A 1R8QA 3R6TA 4G1VA 5H1YA 4LZNA 4E3ZA 3R9XB 5FOWA 1DWOA 3R2JA 4QDOA 1X7YB 4NBWA 4J7CA 3D8SA 1BA3A 1GTG1 4OGWA 3VNBA 2RHJA 3O9MA 2VH2A 1GAJA 2PSEA 1CUZA 4Y7DA 5FHQA 3SYNA 3UJDA 2PM8A 4CM5A 4YJ3B 5GINE 4LI3X 5JYCA 2FUG6 1XTBA 3ZE0B 4ENVA 4EY6A 4JYZA 1D2CA 5AUOB 2ZRJA 5ALTA 3EGIA 3UPUA 4L5JA 1OLOA 1VP3A 4FE7A 2PRJA 3EF1A 4KQMA 1EFDN 4YP5A 2OBNA 1PWYE 4D3YA 1H6AA 4WJLA 2Z4SA 3N8NA 3TOZA 1CRQA 1MO5A 3RWBA 4YIKA 4JLVA 2BM1A 1ADFA 4AJNA 4B5LA 3EMBA 5G1PA 4ERXA 5JJLA 1HT2E 1P18A 1N6RA 1ZMOA 2YYYA 4E51A 4F3KA 2AI2A 1ZBDA 1MH1A 3IOYA 5ARCA 1SVKA 1T5BA 3DM9B 1XHEA 2Q3BA 1UXOA 3HEAA 4MAFA 4RENA 5AWFC 1SCQA 1PL6A 1N2CA 5EZYA 4PHCA 4Z2AA 2QN8A 8ATCA 1CCWA 4PRYA 2VWGA 2VNSA 3O9ZA 4QRHA 4X1IA 2SCUA 5EZ5A 3ELBA 3W8NA 5K0JA 1GOTA 3F7TA 4FSXA 3OOYA 1NSFA 4X3PA 2WPNA 3FB4A 5FNVA 1P7YA 3DV0A 3KXKA 4LG1A 3W5CA 3MOGA 1LPMA 4K87A 3RK4A 3RSHA 1J24A 3R7FA 3ISTA 1RYNA 1PDOA 9LDBA 3MGCA 1H2XA 4J3NA 3LX5A 3PP8A 3A6LA 2AUNA 4GLLA 3UOWA 5B1EA 3C3JA 4HVTA 4G0NA 2GZRA 3I34X 4KIWA 4FKBA 1M2GA 2ZDGA 4YJ2A 1DXHA 4YONB 1LBEA 3DE3X 3H3JA 1W5EA 4RXMA 2WQ6A 4PLYA 3SR4A 4IW3B 3CPEA 4L3OA 2EC5A 1AGNA 2AFHA 4B2IA 1DC4A 5LZ2A 2VJLA 3AM5A 1B93A 1FSFA 4QOJA 2NSJA 2FSGA 5IHXA 5B7NA 1HFKA 1YR7A 2O7QA 2QXYA 3LBAA 4WH0A 4BCBA 3SD7A 3JAWA 5FA8A 3X44A 1ZK3A 5ITWA 2A7XA 1TXGA 2AOXA 1RQ7A 1U0RA 4KWEA 4W6QA 2PIAA 3QSYA 1XD2A 3ZWKA 3EVBA 2YX1A 2EW2A 2HJVA 3FRJA 3NBXX 4MHSA 5D2CA 2L19A 4D6PA 5CD9A 3HUDA 1VGRA 2VYVA 3H42B 3PL5A 1WSBA 3DLIA 3M4JA 4MVCA 3ZIUA 2QX6A 3P0HA 4QYMA 3TL6A 1E6CA 3QLVA 1GFWA 4BO6A 4HDKB 4OLBA 4NU6A 1Q3HA 4BEJA 1TQ6A 1A8IA 4YNBA 1RLJA 3ESZA 3IE0A 4G8BA 4BNTA 3AJAA 3RRNA 2XX3A 4MP3A 2IHVA 5DCYA 4DDWA 1U0GA 1HURA 1U3GA 4Q1CA 4R9NA 3TRFA 4A6EA 2FZ5A 4L6CA 2Q1SA 3KXLA 4UHEA 4WXMA 4F97A 5U4XA 4CL2A 3FLBA 1R6UA 1Z5OA 3V1NA 5LUAA 2E1PA 2IU4A 1IRXA 2X3UA 3RT9A 4MKIA 1JFLA 5REQB 4C03A 4JBHA 3FJYA 5A0FA 2IP2A 1ML4A 3QFHA 1Q0RA 4F8YA 4MUEA 4LUCA 2IELA 3LUGA 3HCCA 4GPBA 4U9HS 2WILA 4FLEA 1CULC 1VQ1A 4CLOB 4D8WA 3ZK9A 4BZPA 1GEEA 4FNAA 4MQ6A 1W30A 5JADA 4B4WA 1Z0ZA 3ZYCA 1TVKA 1FX0B 4B47A 1E96A 3F6CA 1DOAA 2QR3A 2CJFA 3GO4A 4L1KA 5CX1B 1ESMA 5HUJA 1Z4JA 3T9FA 4M1KA 2QLTA 3CG4A 3U3XA 2F1KA 3EGXB 3ZU6A 4Y9SA 2DY1A 3U4MA 1YRQA 4RIHA 3CZPA 4XB1A 2NO1A 2QJWA 3UB3A 3CXRA 4CV3A 4UQLA 3SZ3A 4AFNA 3WLOA 3ETLA 4WEOA 3P8ZA 4AWBA 3RYCA 4JYAB 3MWFA 1KS2A 2WQZA 4MWZA 3M5PA 4FCWA 2JFFA 3EFHA 4Q3EA 2Q3FA 3WNQA 5LB2A 1P6UA 2GBCA 1L4BA 5C52B 1ZKMA 1QYRA 3ZS8A 1XE3A 4OQNA 2BW0A 2WHRA 1VIYA 1EXMA 2EDAA 2QZJA 4I1SA 4PZLA 2O8VA 3KR9A 1FUYB 2QUBA 1POWA 5KEIA 4DCUA 4RSRA 4XDZA 3RNLA 1G4AE 1EZZA 1B8VA 3ZDYB 4L73A 4QVGA 2AW5A 2EU8A 2YZ2A 5LR6A 3L8MA 4J0HA 1SVIA 2CWWA 1M0EA 3EY4A 2ZATA 2WUDA 4KX3A 1H1DA 4XX1A 2P9TA 3W9UA 4DIEA 2AI1A 2G4CA 4KXVA 4NNPA 3W9SA 1OOEA 1PFGA 2UUAB 3FTQA 2Y8EA 1XZJA 1W46A 4BB0A 3NM5A 2BEWB 3H9UA 3HFJA 3OP1A 3E0QA 4S3MA 5IVKA 1AUVA 3GT4A 3HSSA 3ORSA 4ZPJA 3O3CA 2VDNB 4YBZA 4A23A 2ZSJA 3L07A 2BEVB 2VNHA 1X77A 3O8OA 4LVOA 3AHFA 2ODNA 5JDCA 4G1UC 5IJ0B 1NAHA 1ZD4A 4LV6A 3BREA 4MGYR 1UH5A 5EJAA 4YHHB 4H08A 1XZLA 1HG0A 1GTRA 4J0GA 1Q0PA 3VXKA 1MAAA 3N0WA 4UAGA 1SGWA 1F14A 4WLEA 1K63A 4AZ3A 3L6RA 1GQOA 1ZNZA 3M6AA 1JE1A 2GZ3A 4LQDA 4BNJA 5FWAA 1MVOA 1X7XB 3CR7A 4E6EA 2WHYA 2YOFA 5ES4B 1ACLA 2VYCA 2IU6A 3FPGA 3FPCA 2DX7A 3MBIA 4WKCA 3SSAA 3TRHA 4AN1A 1JHOA 3I9LA 4AJPA 2Q45A 4WBXC 2J3JA 3UB2A 3PENA 4IDHA 3R7WB 5JPDA 3JQ8A 2FZGA 2A59A 3NGMA 4D92A 3HXKA 3TBHA 4H7FA 3IYLW 2COEA 2NXEA 4AG5A 1P1RA 1X8XA 5F76A 4ZANA 1YBAA 1D0SA 1V1MB 5BR7A 1VG1A 2FKAA 2WJJA 1IZ8A 1J8MF 1TM7E 1MV8A 1OYOA 2X8LA 4JR2A 1NF3A 3VC7A 2VHCA 3F74A 3WO1A 1LPOA 3EQ9A 3TXYA 3OQ6A 1JDPA 2WR8A 1I01A 2V45A 4YJGB 4V1CI 4XH9B 2XRZA 3DHNA 4Y0VA 3CMMA 3COYA 1V7ZA 2IPMA 3BK7A 1QJCA 3MAJA 2CUZA 4NMMA 3Q6IA 2XUPA 3FSEA 2GPNA 4ZC8A 3H9CA 4RETA 2J3DA 3OBIA 3DZGA 1EUYA 1COWA 2EW8A 6GPBA 2C7OA 1WCIB 3DQZA 2CNBA 2P67A 1XQWA 4G8DA 2ATXA 3P5SA 4GI3A 4EO4A 3NCTA 2X19A 2YXBA 4QA9A 2GNOA 5FL3A 3O38A 2A30A 2NNWB 3VO1A 2M6KA 3QUAA 1KO7A 5K8CA 3R0VA 3VH3A 2JJ1A 2B20A 2DRIA 1F2UB 1PHRA 1KDZA 1UKCA 4JGIA 3AF3A 4S1VA 4GZLA 3PA6A 3O91A 5DBOA 3TDMA 4KNYA 5G3ZA 4PC6A 2BOVA 1V6AA 2C5SA 2VJOA 4B44A 1UKYA 2C83A 2RB4A 1FMTA 2WJ3A 1EGMB 4CQLA 1ZVMA 5D8DA 2VPQA 3B8HA 2CLEB 1X13A 2I3GA 4ITRC 1K3UB 3GEBA 1FPMA 4ZQBA 3ZR4B 3ZU3A 2HA6A 1NN0A 2GN9A 1DELA 1N6KA 3MTAA 4ZAYA 3CRW1 2H16A 4X91A 5BV1A 3ADCA 4L8YA 1RSZA 2AYYA 2J07A 1ILWA 1B1AA 4N6OA 4Y2VA 2CCKA 3OQNA 4P32A 3VKGA 3X0DA 2I78A 2ZU0C 1YMVA 2VDUE 2Q0HA 1Z5NA 4HNAA 3UICA 1IPHA 5E1MA 3AJEA 5FAXA 4UFPA 3UKDA 3D3EA 1EP2B 1WZUA 4I4IA 1KJ8A 2ZITA 2XCSB 2GCNA 5AOCA 1DINA 4BKQA 1U5BB 2RH8A 4PO8A 3UH1A 1REQB 4C3VA 2QAGA 3A25A 4DSOA 4MVXA 3S8YA 1VYHA 3DTNA 4MV1A 2LCQA 3VR1A 3EYWA 4W82A 3F7NA 3NAGA 3U80A 3L1HA 1C1YA 1TM5E 3PYLA 5KHAA 1UODA 3L4EA 4D4LA 2BMEA 3QUTA 2PUTA 2FJUA 4DYHA 1Z68A 2Q8PA 3MUEA 2CJYA 2O14A 5D1HA 3NJ4A 2V96A 4KMRA 1HFJA 1S9HA 4IS3A 2HU2A 1ZXXA 3FZEA 4OHCA 4UXHA 3R74A 1W5TA 4C4AA 2FF5A 4NSNA 3NONA 5L95A 2GXSA 5KYWB 2N42A 5DKFA 4U9UA 2I2CA 2X9GA 2HXSA 1POXA 1ID1A 3AYXB 3T7DA 2NADA 1WRBA 3BCUA 2P6OA 5AVVA 3AY0A 4OPMA 3DV0B 2CXUA 5AUPB 1IOLA 3WL4A 4DMKA 2WHEA 3MERA 5JRDS 1KSJA 2O2YA 2PSHA 1UC8A 1SURA 3W77A 5FPQA 1RZRA 1WE2A 1TAUA 1XL1A 1Z2OX 2IKQA 4J4TA 4N12A 4WDQA 1OWNA 3CZAA 3PZRA 4MQUA 1D9XA 4KJZA 2PL9A 2XZDA 1DTWB 3H9JA 4G41A 3NH6A 5CH3A 1QONA 4OQPA 3R9IA 5AM4A 3VR3D 1W0JA 2R6CA 4H7EA 4GKJB 1G17A 2NO5A 3WK6A 2ZQYA 2W7TA 5JXWA 2TYSB 4W8GA 2D7DA 4UEQA 2AX4A 3RYIA 3CVVA 3A7DA 3NLLA 1NG9A 1K1EA 5ERYA 4DADA 3HP1A 2JI8A 1DT5A 1X1SA 3R6GA 4IIXA 3E23A 1QUFA 3QWIA 1GRNA 3GMSA 4BO8A 3N2ZB 2YZKA 3ESAA 4HF7A 5BT9A 3ZWXA 1DADA 1DAKA 1RKBA 1CJMA 2XI4A 3CB4A 4IF6A 4Z3KA 4XFKA 4CMEA 1QH8A 3VVMA 1DZ3A 2F59A 4B2LA 4JJEA 5AM5A 5HDQA 1YJXA 2RB5A 4ZOLF 2IZZA 5TXGA 2E4UA 2V7GA 4CKZA 3PXXA 5AVXA 3FPKA 5ITZA 3PX7A 2BTOA 4O3FA 1SBCA 2FDCA 1FSGA 3I9MA 2BGNA 2WWGA 1K7SN 3NKFA 4YRZA 2P5TB 1FPQA 3PXEA 5JS6A 2OBFA 3JYNA 1F1JA 3MB5A 3AP2A 1PL0A 4MI9A 4S35A 3RUIA 5BMVB 1W4LA 2WTBA 3BMQA 2WT4A 3II6X 4IHKA 1KP3A 2HF2A 2PAAA 3C6KA 2J3HA 4BQSA 4NLLA 1FSZA 2XMQA 2NU9B 2QRNA 3TXXA 2I7VA 5CIQA 5A4KA 1WOMA 1YOVB 3M3PA 1C7FA 3PUIA 3M4ZA 1RYZA 2XKAA 3IUPA 1X7WB 2OV1A 1AGYA 2HJ9A 2EYQA 4OHKA 2A9QA 4IIJB 4YI3A 1L7OA 5BSMA 1LK0A 2PH7A 4OVKA 4ASUD 1U8UA 1OLXB 3KYDA 4I55B 3W7VA 1B6TA 1E92A 1Y5IA 3KO8A 5JT1A 2R62A 4LOAA 4G0WA 5JLAA 4NK5A 3THSA 2VP6A 4G07A 4W1SA 5JWRA 1J8DA 4RMHA 1YCDA 2Q7XA 3PD7A 3NKVA 5HJ5A 3GMDA 3QOWA 1U3DA 2R48A 2VTKA 3CH6A 5MN4A 4KSYA 1LFDB 1YI8A 1NMSA 3O3MB 2IH4A 1Z0JA 1NI4A 1PJ3A 3OIUA 3L4BC 4I55F 5AXDA 3GRCA 4NBUA 5C1OA 1MJNA 4HYYA 5ETJA 2MYPA 3A2KA 3SF0A 3OUTA 4RMNA 4B6QA 2VBFA 3TJZA 1KAOA 3JYPA 4DE5A 2E89A 4M8NE 3GJ8A 4NICA 2H4YA 2VT6A 1EI9A 3CKKA 4C0LA 3CUKA 1G59A 1Z4KA 1C50A 2O0LA 2XVYA 3RB8A 2F9FA 1DAEA 2FJPA 2VG8A 2HSEA 3CY6A 3WGKA 3HU5A 4IGFA 4WNIA 4BVFA 3HWRA 4POAA 4YRDA 1EGVB 4KW7A 2YIJA 1FX1A 2IEZA 1KU0A 2EOAA 3ELWA 3FXAA 4G8CA 4GEKA 4JBIA 4TV8F 3SE0A 4AMYA 1KDOA 4PRZA 1MEJA 4IIBA 4M9CA 5BNWA 2ONCA 3A6JA 3LAWA 1N7GA 2JLXA 1YC5A 3L6CA 5CPBA 4UTNA 1PVOA 4JCCA 4MUNA 1PYDA 5LZ7A 4LK2A 3OIDA 4CKCB 5SYMA 1TKAA 1IXSB 4HXYA 4R2LA 4QJ5A 1P39A 4B3RB 2QQFA 4XQ9A 2VHQA 5K3DA 1KDTA 4FHCA 4PU0A 5KKNB 3QK7A 3R0ZA 3ENVA 3TF5A 3JQAB 1CY8A 2F1IA 1D5CA 4H7IA 5D3QA 2O6LA 1QX4A 5IUNC 4RCZA 3B20A 4PYNA 1D2HA 3JVIA 4RTNA 2ZSUA 3HL0A 3HY4A 2NTEA 1OROA 1XTKA 4S1OA 5FIUA 5C32A 4JXXA 2A9OA 2NNLD 1LY1A 1TNDA 2XF2A 3W90A 3BTSA 4KN6A 1CJVC 2G82A 2QX7A 4U0JA 2IWHA 3GEDA 2J3QA 1NXSA 2OAP1 4AP9A 2H2FA 1ENOA 1I3KA 3FWNA 3CGWA 3KTAA 3VO2A 1TM2A 4OQMA 4DA8A 3E5HA 3F9CA 4WZ6A 1NVTA 2EJBA 5HOQA 3MMXA 3WL7A 3DT6A 3C4JA 3U62A 1U0FA 2RJ3A 1CYDA 2TRSB 4PN3A 4U7DA 1PT6A 1KIAA 1XYVA 3H9GA 1BHSA 1P19A 4GNRA 1RRPA 2VJDA 3EC1A 3FM9A 3BF7A 4HGYA 4W7SA 1C4KA 1G9XA 3B6IA 3OU6A 4QNNA 3ECCA 3UAGA 6AT1A 4R3UC 2HJWA 1I4DD 1YB4A 2B8WA 1NR7A 1PFYA 3A4LA 4ER0A 1HSZA 1NPYA 2YH2A 2P0EA 2P9ZA 3BMCB 2Q9UA 4G26A 3ZNPA 4HPWA 2QTWB 4OQZA 5B30A 5CB0A 2EBFX 2ZRLA 3M70A 4KN9S 1XMXA 1TVMA 4IS2A 1RAGA 5KKCA 1HLDA 1GGVA 4Q9NA 2ZU6A 1CUJA 2PX2A 1E4EB 4RVFA 4HS4A 4NZMA 5I5EA 3FHCB 3NEAA 5JH7F 3KTOA 1SUPA 2OO7A 2D0DA 1U7ZA 2II6A 2M6RA 3KJXA 2QA5A 3R7SA 3RS0A 1EZ4A 4RSMA 2EP8A 5DNDA 4WFJA 2QRLA 1LTKA 2R00A 3RAJA 2JGRA 1NUQA 3K9CA 4R1LA 3WJ2A 1N0VC 2C2OA 4MWOA 3O0DA 3BFJA 3BH0A 1I2BA 5B5SA 5JVDA 1EZ1A 1T0HB 2GN1A 3KU4A 1DWQA 3GGSA 4N0MA 5J63A 2AVDA 4BO1A 2RI1A 3GLSA 2ISQA 4IH1A 1UXGA 4ETIA 3NIWA 5AW0A 4OQDA 1SCDA 5ALZA 3ZKWB 1DG9A 4DLVA 2CZQA 5KNCH 2NQ8A 1WSWA 2O3QA 1EVZA 2V4ZA 3KXDA 1IATA 4RANA 4BYGA 1OI3A 1MOSA 3ZXXA 1KPGA 1TO6A 2BT4A 5CIYA 5L6MB 1ODFA 5AK5A 1UDXA 3DHYA 1WMFA 4XYBA 3HR7A 3NUQA 3OHPA 3EZXA 2Q0SA 3JD3A 5IM4A 4HXGA 1A50B 1PV2A 2EFGA 3CTMA 4AJHA 5JFTA 3TUIC 4EF6A 2H8KA 4D3ZA 1RJDA 2VP4A 3MWGA 4EIWA 2FUCA 4I14A 3DDHA 3T5MA 3GEGA 3ICEA 1FW6A 1U0LA 4GI1A 4KIUA 2HHLA 1GNTA 4MW7A 1J33A 1ZXBA 1A95A 1YD7A 4FYPA 4EB3A 2BE7A 1RWMA 1VHDA 2PLNA 2IVZA 5BY2A 1V35A 1KAHA 2AN9A 3C5EA 2P6MA 4G37A 1RJFA 2BDUA 1AT1A 3BWXA 1CJBA 1U8AA 3RYHB 1A69A 5EXTA 4KPGA 2AN5A 1HG1A 1EK2A 1VGQA 1M73E 5HK8A 2RBKA 3OJFA 2IZ0A 3B48A 2GN8A 2H00A 4PGHA 4LYHA 2R97A 1JI0A 1T2CA 5GY7A 3ZZTA 1TU0A 4BVGA 2O6HA 4R5HA 3JW8A 4R1PA 5FBZA 1Y34E 2QRQA 3TH5A 1Q1ZA 4BTEA 3E5MA 3WMEA 4FC7A 3KE8A 3NYIA 1IXKA 4JYPA 1CU1A 1GZ4A 1CEQA 1T15A 1I4OA 3DBHB 1BMFA 3FFTA 3OKAA 2XIQA 1T13A 1R8YA 4HMPA 1J5PA 1BE1A 4XCQA 4BFTA 4TLCA 2AR7A 1VP9A 2WU4A 3H1TA 3TO5A 1RM5A 2XDYA 1P4GA 2XF8A 3CISA 3WZ2A 5BMVF 4LNUA 3VHLB 2HADA 1KMQA 2XQFA 4PLHA 5A0TA 1XVUA 3NTLA 1S01A 3TTTA 1Z25A 2OMKA 3OEWA 4DS3A 5IT0A 1DQSA 1T2FA 2ODPA 1GUFA 1C3XA 4MS3B 4GI2A 2Z4TA 4HI0E 2HWUA 5H68A 5AW8A 1ADCA 1QVRA 2UAGA 2FE1A 1V16A 2OV3A 4AZ0B 3DDNA 1SU4A 2NG1A 2BEUA 2PKQO 3BXZA 3IURA 3DBRB 3IO3A 4U39A 5C8DA 5AVKA 1GNPA 4MWSA 2OLKA 1ECBA 2QF7A 5IAJA 2ASVA 4ZFNA 3K5HA 4HDRB 1IWBB 5MGNA 1VSTA 4PSUA 4ENUA 2WIJA 4HAIA 2QV0A 5F7JA 3QMWA 3T95A 4GHWA 3OWHA 3E81A 5CYOA 1ABBA 5FBRB 3W2FA 2YCBA 2G5TA 3K70C 2V3CC 2G72A 1EEXB 3T61A 3PI7A 4P58A 4X66B 3W5JA 1THTA 5IU6A 3RCBA 1SQ5A 5J2TF 4DIBA 1E7MA 4RJKA 4ENTA 2RKOA 1R0LA 1WABA 3I6BA 4M3NA 2AXNA 1CY4A 3P2OA 3Q8KA 4QC2A 2CXPA 1TPZA 4IM7A 5BSTA 4X7PA 1IY9A 2HV9A 3NDRA 4FI3C 4DWWA 1XXLA 3A1FA 5JTUA 1DARA 3KZMA 4LRYA 1N78A 3D43A 3IUBA 3IR7A 4YRRA 2PIDA 3KQVA 3SZRA 2VHTA 1OA0A 3T7JA 4D4MA 3NC0C 3UWDA 2XYVA 5THXA 1A9YA 2FSHA 1S7CA 1Y1SA 1F2TB 2ZUUA 1HK7A 1WUJS 1KBQA 2PYIA 3E53A 4Y1GA 4BNYA 1SUAA 3OPQA 4HN4B 4D4KA 1R1DA 5HHTA 4KFCA 1DPGA 3OQIB 4K2HA 4DM7A 3K32A 1OZHA 5JANA 1ZK0A 4E09A 2ZJZA 2MOKA 3I09A 1W36B 4A73A 2C2XA 2AG1A 2DPXA 3S0JA 5HUHA 1LVGA 2ZROA 1P4RA 3K94A 4RACA 3RSFA 4PXYA 5HZHA 1X14A 2Q21A 2HNKA 3CVJA 3HXTA 1KKUA 4BWVA 3JZDA 4XYLA 1OVGA 1L5HB 4A26A 1RAIA 2IOQA 5EZSA 3ZD8A 3EUWA 4XPIB 1O5TA 1ZHHA 4V0SA 1A2OA 1C7ZA 2J9FB 4J0QA 5CU7A 4DBVO 3N2GA 4DHWA 6NULA 1KP2A 1RI2A 2REOA 3WRXC 1Q2XA 1KYVA 4FP9A 1AKEA 4M9QA 3H84A 1YJBA 5CHYA 5AHOA 3T38A 4BO7A 2ZJ8A 1UJMA 1DLJA 3F1KA 4GLFA 3K6SA 2EGGA 2P35A 1VYVA 3DZCA 4HX5A 2HFKA 1C8VB 3OCYA 3ULKA 2VP2A 4FCVA 4FR0A 4RK5A 4V0LA 3RSLA 2Z4RA 4ZYYA 5I3ZA 3RYFA 4R01A 1Y4DE 5T6BA 2MINB 5KNDA 1JEQB 2XD9A 3HO8A 4LX8A 4L51A 2YHAA 2VDMB 4JJ7A 3G2NA 1DIGA 1FB5A 1KP9A 1ODKA 2PKWA 5HJ2A 5A3SA 1EUQA 5AOVA 2CHFA 4LKOA 4UU0A 1ID8A 3WLLA 4MTCA 3IAM1 4NHOA 5KAPA 4DMGA 1N3BA 1CKEA 2JAWA 4MS4A 2IDZA 2GAFA 3I1IA 4IJWA 4KBYA 1F5SA 4BKOA 1J8VA 3PRHA 3GL9A 4PZAA 3HZOA 1HKUA 4IG9A 3RAFC 2OBBA 4UJ5A 4B74A 3SWWA 1EESA 1MIOB 4ZICA 1GZ5A 2EJTA 4Y7CA 5K4HA 3HY3A 2ZBVA 4KXYA 5C46F 5H3LA 2E7ZA 2XXJA 3FYUC 3UN1A 1XA0A 3PUVA 1OT3A 4EO7A 1O94D 2YZMA 3EOBI 1YR2A 4CIVA 1GD1O 1ST3A 2YWGA 3RC3A 4F8JA 4KREA 1IY1A 4IWNA 2VC2B 4O0MA 1AZSC 4LSMA 4RNCA 2WF9A 4UHDA 1V71A 4ETMA 2QWXA 4UNNA 3LQ1A 3E3MA 4RXUA 2J1LA 1HYGA 2WG2A 3OH8A 4BGUA 1F8UA 1E1MA 3CV3A 4FKMA 2FN3A 3LK7A 4HB2A 4OB6A 5J40A 4ILEA 2R1VA 5C8ZA 2QIPA 3M49A 2CBZA 2XE7A 1W0JD 3F5DA 4H31A 1ILEA 3G9XA 1D1QA 2X8BA 4L72A 2JLYA 4QPDA 3ZD6A 5SY9A 2LUOA 4HRAA 1Y48E 2GSDA 2PT5A 2RCYA 2Z83A 4FOOA 1F0NA 1FJHA 4JITA 4KDRA 4EECA 5LWHA 5EKUA 4GM4A 5CA0F 3P2IA 1Q16A 2QRJA 3SGLA 5JH7B 1MT3A 3LDUA 4B6GA 5GQSA 1SRQA 4ENPA 3TW6A 2QPTA 1P75A 3FPAA 3QLEA 3VAAA 1KH3A 4YRMA 2XXBA 4DIOA 3CH5A 1GZ3A 2FWMX 1G5RA 2OD9A 4KLRA 2ZVPX 5AJYA 5I7AA 3TL2A 3DTVB 4HL6A 4HSGA 4LTDA 5CXUA 1RPNA 1DX9A 2ZYDA 3IQFA 4RWZA 3VM6A 2C4VA 2H1HA 2C42A 2QN7A 3BGOS 3K9QO 3N2KA 1TLTA 2ISCA 1V7QA 5IJXA 4LJAA 3E61A 3SC3A 2OAEA 4D43A 2PUEA 4E2FA 1T9CA 2DG2A 1CHNA 2WZBA 3SFTA 3T3IA 2R5NA 2VLIA 1TTQB 1Z5PA 2COUA 3A6ZA 2CJWA 3R09A 3BIFA 4RM2A 5HCUA 5JSKA 3RQIA 3V1TC 2P9CA 2PZGA 2ATCA 2YS7A 2A0WA 3UJHA 4BP3A 1B23P 4EKYA 3VNVA 1JR3E 4BV3A 1UQRA 4EFKA 1E4YA 3LQ2A 3H16A 4ZIRB 1XRNA 1QR6A 2WKSA 3U16A 2AJBA 1ZGCA 2ZK7A 3KT0A 4YECA 4YMIA 4FN5A 3QU7A 1G3QA 3EDMA 4B43A 3IUJA 1G1MA 5A5GA 1C3OB 2M6LA 3TGWA 4C14A 1J9GA 1Y8AA 1EUCA 4O4JB 1I5RA 1AQYA 1Y8CA 2D2IA 4TTQA 4EITA 4IXWA 4KFUA 4U7GA 1KZHA 5C37A 3DZJA 2WW8A 2V7WA 2NZ2A 2H1WA 2EXXA 4Q4HB 3VTKA 4BE4A 5HPYB 1B0ZA 2XUQA 3UFXA 2DBVO 3Q2IA 3VHRA 3FSRA 3GFBA 3FPSA 1XN4A 1K66A 1BZYA 2G06A 2ZSEA 2EL9A 2OPBA 2D5AA 1IUKA 3TQSA 1V6CA 2E18A 4U7JA 4BJ1A 1I24A 2O57A 4ZN6A 1VE3A 3QENA 5K5EA 1VZ2A 1TLFA 2C9ZA 4FMCF 3NGLA 5JH7A 4XCXA 1X8LA 1JR2A 2WINI 3DEJA 4RJTA 3BK1A 3D4NA 4OATA 5K7SA 4OM7A 4XJXA 1VJTA 4E88A 1SPBS 1X38A 2WWFA 3T9EA 3E22B 4MR7B 4RFLA 4RZSA 4YRJA 1KR2A 3AVVA 4MB2A 4X24A 2XODA 4AXXA 2ZTUA 2GWRA 2VT7A 4LRTB 1W8DA 2HKIA 1FFCA 3F3SA 3IJ5A 1LVUA 4FFRA 1QMPA 4FSHA 4Q47A 4R05A 3UK7A 1AN0A 2FWPA 3UT5A 1PSWA 1KEZA 1UOPA 1HYHA 1YKSA 5BSVA 1YJCA 1OY1A 4KOAA 4I8IA 4KK4A 3FDIA 5HM6A 2GEDA 1WDTA 3HGTA 2C5HA 1XU9A 3DFMA 1YAJA 3B1WA 4WINA 2VTBA 4L3VA 4UUNA 3DDUA 4DDMA 3OAAD 1OAOA 2BH9A 1JXAA 2FPMA 4LBWA 3I32A 1W2HA 3KR1A 4UMDA 3TQRA 2AOTB 1KIMA 2VPTA 3IVAA 1D0VA 3COPA 1J23A 4P36A 3G5TA 3U2QA 4CLDA 1U0TA 1PD1A 3PGMA 4F2GA 4GKAA 4DLRA 4JY7A 1IBCA 1M1YA 1YKFA 3D54D 4IEIA 3DO6A 5C3MA 1F6BA 1E63A 2VPYA 4WOKA 5JZOA 1Z7BA 3DL4A 4BIIA 3EXIB 2MWMA 1JU4A 2MINA 2CHQA 1PGOA 1OFVA 2HIGA 3EBPA 3HU2A 3KPJA 3DWFA 3NTUA 3P1JA 2L0XA 1EJ0A 1X7GA 5ER9A 1PR1A 5DM1A 2W8ZA 2HSZA 4ALMA 3F2VA 1T2EA 3V9AA 1CJUC 1DQYA 2IW3A 3BE8A 4IUCS 3WYCA 3WMXA 2GBGA 2O3JA 4JBYA 5JSUA 2IEGA 3DOJA 3O8OB 1M5RA 3UUFA 1D04A 4BO4A 3DVQX 1EB8A 2M1XA 4J1SA 4L0QA 3NHYA 4EGJA 4A8JC 2GR9A 2V8BA 3AQ4A 1PR4A 5B3JC 2XYGA 1ZX1A 3L6DA 3OA0A 4NCXA 3B2EA 1U11A 2BIFA 2G3YA 4MLDA 4AZ3B 4C3ZA 4G8JA 1QDEA 5FTKA 2X0KA 1I80A 5IAAA 3OE7A 4WESB 1ZK2A 1ECCA 5TC4A 2ZZMA 1YE5A 2NU6A 1Q7RA 1QG4A 3N3AC 3OTHA 1ULBA 4EF5A 2I3AA 4PAMA 1WBDA 2IZ5A 2VBIA 3P4XA 4RDCA 1WXWA 4CV0A 5FFNA 3D0RA 2RI6A 4KPUB 5LL6P 2OORA 3GT0A 1EAYA 1M0TA 1KH1A 4KAXA 4L28A 1NMQA 2YXNA 4X60A 1TZ2A 5DNAA 3UBMA 2CYAA 1VSUA 2YV5A 3SR0A 4I46A 5E3HA 3EHDA 1OAAA 2O8CB 2ORWA 2AG0A 4FYJA 1BTOA 1Z5GA 2R6FA 3IVCA 1YDGA 2PXHA 1QFMA 2XY4A 4HN2A 3L0OA 4YO8A 3ZQ6A 3OO0A 3G49A 4YP7A 1ZK4A 1W48A 4JB3A 3H2KA 4WASA 5CBPA 3PC7A 3RWOA 4HUJA 2ZCUA 2C7PA 3PDWA 3TB6A 1QTRA 1YHZA 4ABTA 1A9ZA 3V2HA 1VLMA 3STWA 2ECOA 3CW2A 2WJIA 3LSTA 4J2HA 4FI3F 3I30X 4JSRA 4CIWA 2PGDA 2VH5R 1SG9A 5C8YB 3FBWA 2ZRBA 1K6MA 2CFCA 1CDOA 3SF8B 1RXWA 2VYVD 1G8HA 1VHJA 5BN1A 3IV7A 1RWVA 3T9DA 2F3TA 2DQKA 1VLHA 3GUCA 3M81A 1F5NA 1MORA 1P31A 1V11A 3ZWQA 4D8TA 5IN4A 5J2TA 1Y9JA 1IY0A 1VHWA 2NYVA 2Z9CA 2WTMA 4BMYA 3Q7SA 1FQWA 1NY6A 5JQGB 3UFBA 1TQHA 1EA5A 1TEVA 1J0BA 4CETA 1CQJB 3CU5A 3I73A 1CK4A 4MQ4A 5JU6A 2FMXA 5A1TA 2NU9A 1CF9A 3KQHA 3WNDA 4INJA 2FPSA 1UR5A 1PEYA 2HPAA 2IHKA 3FOAA 3TJMA 2B4RO 3KE9A 1YB1A 3PFWO 3F67A 5AM0A 1R5BA 3PQEA 4PHGA 2PKRA 2E5FA 1J2YA 3CPSA 4X6YA 3T5DA 3WSTA 3BL6A 1XXHE 3GYBA 3I01A 4N47A 4F5WA 2XCRB 3HEMA 3HRKA 4NONA 1OLXA 3KYDB 4IUYA 2GHIA 3R5XA 3W6PA 5DOZA 5JC1A 4DKJA 1I2MA 4FHGA 4FN4A 4AJLA 1SKUA 4RPCA 4R8MA 1NGSA 1TAGA 1BWQA 4R2IA 3QOYA 2O8CA 2DVMA 4ZVLA 1JKFA 1RP7A 2QUAA 1X1RA 1Y7TA 4N3GA 2ODQA 3S4YA 5LNK1 3ZJUA 3HJNA 3ZDAA 4ND5A 2N1BA 2JDIA 4YCAA 4GAEA 4EMBA 3C1TA 5I45A 5L3SA 3OURA 3RREA 3UFXB 2F8SA 1GWNA 3BMOB 3UJCA 5ARBA 2I99A 3AHJA 4LNHA 2PJZA 2EW1A 1OUMA 2H9YA 2VAMA 5C2JB 3HUTA 3PWKA 1XPRA 3AIIA 4HK4A 4MVJG 1Q7EA 3MYYA 2HCBA 4JJZA 4RIIA 1C3OA 1ZMRA 3GJ4A 3DCIA 4L0DA 5TR9A 2FWAA 3D7SA 5D3KA 4CG3A 3PT9A 3EARA 4F11A 2UYCA 2VF8A 2VOEA 5CDYA 5KC9A 1X80A 2ADOA 4KPFC 5BV7A 2AC2A 3FCSB 1H3NA 3LHIA 4DREA 3JSAA 4CG1A 2Z56A 5NULA 5THKA 1XZIA 1AK2A 4BNIA 1NOIA 3WGYA 1ZMTA 2CL6X 1A4RA 1YULA 1V95A 1E6UA 3DMYA 3K5PA 4M49A 3O2JA 1YR6A 1U9IC 4MUFA 5EKTA 5B53A 3SX4A 5L40A 3L49A 1NVXQ 3MUFA 3INYA 3P0RA 4BNLA 3EIXA 1NRIA 3P2MA 5IC6A 4DM4A 3B78A 5IJAA 3SHQA 3VU8A 1JAXA 2VNAA 3GZNB 5IAEA 4YRFA 2IU3A 5PGMA 1GNRA 4JI1B 2JLBA 3MEQA 2G4LA 2O5CA 3EEOA 3HPRA 2AMFA 4XLLA 5I9BA 3T35A 1CTQA 3GRYA 3B6MA 2O0KA 2VPXA 3KDAA 2C5LA 2IKSA 1W59A 2V5AA 3IXQA 4MKGA 4X41A 4ZQGA 2GTPA 2B4TO 3ZCXA 2GQ0A 3A04A 4C06A 5L3QB 4JKYA 2G6TA 3KKEA 1UP6A 1PK9A 4WGGA 1KY3A 4F2DA 1R9MA 2DWOA 3FWPA 3AUFA 1T10A 4PVCA 4CLHA 4ZCSA 3ETHA 4G84A 3RWMB 3R7BA 2JD1A 2PEZA 5KDLA 2W83A 2WMDA 1VZ3A 3SYLA 3V4RA 3S2SA 1AHPA 4RD4A 3AETB 1WZCA 3RTDA 1T3TA 2R8BA 4UPDA 3HKEB 4A8TA 2J9FA 3BG5A 3DDWA 1WNTA 2J87A 3L93A 4G5SA 4FINA 5JSFA 5NLLA 3HV0A 4CHGA 1M74A 5JMWA 1GXSB 2QNRA 3JVEA 4L8WB 5CT9A 3WG9A 3DQPA 2JKZA 4F8EA 2PRZA 1J0EA 2R96A 2W2QA 2OYCA 2WU3A 2MHCA 3OQHA 5L45A 3U56A 3O2SB 2VT2A 3DBHA 3UA3A 1IN7A 2YOHA 4M9UA 5EJGA 1QVZA 3Q8MA 2ZBDA 2NXJA 4BX9A 2CXXA 1ZM7A 4DOMA 3WA6A 3THYB 4F93B 4UFNA 2VUTA 4GX1A 1OYWA 3A2NA 1U94A 4I6JA 3STYA 1NVEA 2C0CA 2R00C 4ZTUB 5JG7A 4KRFA 4Q7LA 4ZU1X 2WJVA 4JUCA 1GCAA 1ICEA 3K05A 4B8WA 3ZLTA 4MI3A 3KJFA 2VF2A 5JCJA 3QU5A 5CT5A 5CXQA 1V4NA 1Z5ZA 3WK9A 2XZPA 1KK0A 1M2VB 1A9PA 3DEYX 1XZKA 1YVDA 2IP4A 1YVEI 1VDZA 3C5WP 1G8SA 4CTOA 5I7HA 2QJFA 3DVRX 3EVCA 3I2FA 4ARVA 1UT5A 4ZCMA 4H0NA 1S1MA 3LJKA 2IYLD 1F9AA 3LW8A 3U39A 3VYUB 3WMWA 4BFCA 4EDFA 1OXSC 1P9LA 2PCLA 4DZTA 2FHSA 4G4SO 4CT0A 1MQAA 1VFPA 4JI8B 1A71A 4I81A 3RF7A 1KZ4A 1Q83A 1TVKB 4Q37A 4P7GA 2PXAA 4QLBA 1PQUA 1HUQA 2AQIA 4J1NA 4MRNA 4NTZA 5HG0A 5IARA 7REQB 3EMVA 1KZ9A 4M1ZA 4TGLA 2DB3A 1SVSA 2VSNA 3AVWA 4RZXA 4FJ1A 2D3TA 1M2OA 2X2PA 4FQ5A 1U7HA 5C80A 2F3RA 3HZZA 1Z7GA 3K9BA 4PZPA 2X4GA 1HLPA 1T0IA 4WVFA 5C7OO 4J07A 1ISJA 3WL3A 5BWLA 2GZHA 1YMQA 1F1BA 4YHBA 1U04A 2VEOA 3CUYA 1NDHA 3P0FA 4WIAA 5CLLA 1R0RE 4NY1A 4EM6A 1DJNA 1RC8A 4BYMA 2QD1A 3N0TA 1R15A 3GAFA 3GUHA 5CURA 5C9ZA 1GNLA 3JR3A 3MA0A 3UQYS 3H86A 5JALA 1WVIA 2ZUCA 3P2KA 1NW4A 2ZB8A 3BD9A 3Q0IA 2QDKA 4IIJF 2BZ0A 4JFRA 3SC6A 3WYDA 3NEJA 4ZARA 4PIMA 2OCIA 4HWRA 4XM0A 1NUAA 2Y1LA 1WXGA 4GZ6A 4B4DA 4ESHA 4BNKA 1T8UA 3P45A 5A4IS 3GP8A 1TYDE 3P97A 3Q2KA 3DEAA 1N9GB 5H02A 3SHTA 1B76A 3A4TA 3IUSA 2HGZA 4X5OA 1P0CA 3O6VA 3HCDA 1H4SA 2UZ4A 4NL4H 3K8OE 4MWGA 1KYTA 5I4BA 4Z8YA 2BUAA 3JQ9C 4C0QC 1RC1A 1ZITA 2B6HA 2Y1FA 3GZ4A 4RZ2A 2CWDA 3WP0A 1R12A 4YCNA 4CEHA 3BXGA 2J6IA 4KXLA 3WTBA 1T5LA 1KDVA 5EWJB 1FTGA 4Y2GA 3BHJA 1Y37A 3DE5X 4GOXA 3U7RA 1QSGA 3LCCA 1JLSA 4ND8B 1MX3A 3HDHA 2JCGA 1L5SA 2IZOA 2NPFA 3KOUA 1LTQA 4ZZ2A 1RXIA 3PRKE 4OOFA 4AT1A 4OMFG 1MC8A 1JIUA 2YY6A 4LJ7A 4BNXA 4C20A 1Z75A 3CW9A 4O4JF 1CW2B