3GO4A

Crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
RIDTESAHSARIYDYIIGGKDYYPADKEAGDAMSREWPALPVHMRANRDWMNRAVAHLAKEAGIRQFLDIGTGIPTSPNLHEIAQSVAPESRVVYVDNDPIVLTLSQGLLASTPEGRTAYVEADMLDPASILDAPELRDTLDLTRPVALTVIAIVHFVLDEDDAVGIVRRLLEPLPSGSYLAMSIGTAEFAPQEVGRVAREYAARNMPMRLRTHAEAEEFFEGLELVEPGIVQVHKWHPDAATADGIRDEDIAMYGAVARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of unknown function DUF574
publication title Crystal structure of Rossmann-fold protein of unknown function (DUF574) (NP_823353.1) from Streptomyces avermitilis MA-4680 at 1.80 A resolution
rcsb
source organism Streptomyces avermitilis
molecule tags Unknown function
total genus 84
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04672 Methyltransf_19 S-adenosyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3go4A00
2PXCA 1QANA 1XTPA 3MTIA 5K05A 2E5WA 3G2PA 2G70A 4KDCA 4U7PB 5DWQA 3HVJA 3NWBA 2IP2A 1NW8A 3PX3A 4C4AA 2P7IA 3ERCA 3M6UA 3NMUF 2ZULA 4PYNA 2FPOA 3NVKI 4C05A 2P41A 3PFGA 4PIPA 4HC4A 1P1BA 2Y1XA 2OO3A 4PIMA 5P8WA 3K6RA 5LQKA 3CBGA 1NE2A 4XUCA 1JTEA 3SR4A 5FA5A 3FZGA 2HMYB 3KQPA 3BUSA 4DA4A 3PT9A 3EVAA 5H02A 3AWIA 4XUEA 3CGGA 4RSRA 3FTFA 2I7CA 3HP7A 3I9FA 1KR5A 4PONA 2UYHA 2ONZA 3FYCA 3ER9A 2IFTA 2NXNA 4LG1A 2UYOA 3E7PA 1MHTA 2YQZA 1VP3A 2F8LA 3CKKA 2OXTA 3CJQA 1AQIA 2ZLBA 1AF7A 1ZQ9A 5DM4A 4B17A 3CVOA 3FTDA 5DSXA 3HA5A 2FHPA 3AJDA 4C04A 4K6MA 3D2LA 1FJXA 1D2CA 1RI2A 4E2XA 4CWAA 2GPYA 2P40A 2JHPA 2I62A 3KHKA 1NW6A 3ID6C 3LCUA 5G02A 4OX9Y 4V0RA 3S68A 2ZZMA 2YR0A 5HZMA 3KPUA 3OZTA 3A7EA 3SMQA 3ELYA 4ER5A 3FRIA 1P1CA 1KPIA 2G71A 5EOVA 1BHJA 2JJQA 3T7RA 5GM1A 3VYWA 4YUXA 5E9QA 5K0BA 1R6AA 3L8DA 5LQRA 2NP7A 3MERA 2PX5A 1DUSA 3EVCA 3FUXA 3SX0A 8MHTA 2Q41A 3UJAA 3T7TA 5K8VA 2P3QA 3PTAA 3E05A 2R3SA 3CCFA 1YFLA 2AS0A 2AN4A 3EVBA 3B89A 2PWPA 1NBIA 3O7WA 3ME5A 3FRHA 2PJDA 3FUTA 4YUYA 5CIYA 1TW2A 4RTKA 1G38A 3HCAA 3I5UA 1ZHFA 2ONYA 3OE5A 3OZSA 3T0IA 1SUSA 4H0NA 1NV8A 1WG8A 3KPJA 5K0GA 3LBYA 3AXSA 3DP7A 3LHDA 2ZBRA 3B3FA 1SG9A 3G8BA 3LSTA 2B2CA 4OA8A 2B3TA 3THSA 2CL5A 1R00A 3A7DA 2WA1A 2YTZA 4RVFA 5E1OA 2ZCJA 1B42A 1EJ0A 1NT2A 3GRUA 1KIAA 5C0OE 4YMHA 2IH2A 1FP2A 3PX2A 4RTLA 3JWGA 5LQUA 2WA2A 5GP1A 3EGIA 3LPMA 3BWYA 3FPHA 5DSTA 4BLWA 4YUVA 4RV9A 5E1BA 5FA8A 3EEOA 3BKXA 5EHIA 1QZZA 2N47A 2AOXA 5D1NA 3G7UA 3V97A 4C03A 3OU2A 4YMGA 5MHTA 3GRRA 1I4WA 2A14A 2UZ4A 3MGGA 5DXJA 4BP1A 4QPNA 4MWZA 2AOUA 3MCZA 3TRKA 5DTQA 5ERGB 1VLMA 5IKMA 4XCXA 4HSGA 1VQ1A 1FP1D 2FYTA 2JHCA 2AVNA 3GIWA 3DLCA 5DX1A 3FUWA 4EKIA 3UBTA 4GF5A 5BP7A 3SXJA 7MHTA 5LQJA 1X1AA 1RJDA 3KR2A 5DLYA 1R8XA 3KQSA 3JWHA 1YF3A 5FWAA 4QDKA 4E2ZA 4PGHA 1JG4A 3EEYA 4QTTB 2P7HA 2BM9A 3PLAE 1X1DA 2AOTB 1ZG3A 3VC1A 2IPXA 3QV2A 4P58A 4X1OA 4DF3A 1JR4A 5DX8A 4YV2A 4FZVA 1IM8A 1JQ3A 3KQYA 2ZWVA 3MAGA 4DZRA 5E9WA 4HG2A 5CD1A 1XDZA 4KRGA 1P39A 2IBSA 4F86A 1UIRA 5DM1A 1AV6A 1BC5A 1Q0SA 3BGDA 1N7IA 3U81A 1BKYA 4AUKA 1O9HA 4UOEA 2Z6AA 1N7JA 2AN5A 3P9CA 3KR0A 2XBMA 4HH4A 3P9KA 2O57A 5HIIA 5DPMA 2GS9A 3P9IA 4KVZA 4LECA 3C6KA 4F84A 2YVLA 3GO4A 3KQWA 5EIFA 1PJZA 4RVDA 4AZWA 3G89A 2P1DA 3DLIA 3LGAA 2ZSUA 4LWPA 4X63A 4CKBA 5KVAA 5DTRA 2KW5A 1JQEA 3MTEA 5E2AA 1V39A 3DXZA 4GC9A 4E30A 1ZGAA 3G88A 4QVGA 1X19A 2V74B 3ELWA 3OE4A 3HVIA 4QPPA 1NBHA 3FUVA 5K03A 1WXWA 1Z3CA 5CVDA 1KHHA 3A27A 3LDFA 4QTUB 1TPYA 2QRVA 4HTFA 2PX8A 4EK9A 3HCCA 5EZQA 4RYLA 3R6TA 2UYCA 5FADA 4IV0A 3Q7EA 5LQAA 1L3CA 2VS1A 2H00A 2XYVA 2YXDA 3OCJA 1G60A 4DCGA 5HFJA 3M6VA 3PVCA 2VDUE 3KPVA 5CVUA 5DM0A 5EC8A 1Q0TA 5C9ZA 2PGXA 2PKWA 3OFKA 2ZZNA 3TMAA 1WZNA 3C0KA 2BZGA 1G8SA 2HNKA 2ZIFA 3TM4A 1RJFA 3IEIA 2PSSA 4ATNA 3UJ6A 3FTCA 2IGTA 4X41A 3KQQA 2ZW9A 3SGLA 1U2ZA 2NXEA 3P97A 2VDVE 1YUBA 3JWIA 1L3IA 3EGEA 5FWDA 2C7PA 2OB1A 4BY9E 3ELDA 1QAQA 2CKDA 3ELUA 5CUQA 1F3LA 1RJGA 4OQDA 5E1DA 4E33A 5GWXA 3EGVA 4IWNA 2C7QA 2G8NA 2Z6UA 1HNNA 1NW3A 1SQFA 5ICEA 3I64A 4MHTA 5EHGA 2I9KA 2AR0A 3H2BA 3HEMA 4XUDA 1VP9A 1TW3A 2G72A 1EG2A 1VBFA 2NXJA 2PV0A 4O29A 5FUBA 3B5IA 1JG2A 4KIFA 2EG5A 3OU6A 2NP6A 5C1IA 3JWJA 3G2OA 2XVAA 4X61A 2IH4A 1F38A 4M36A 2JH9A 1L9KA 3KPWA 3KQVA 1XCLA 2AZTA 4PYOA 4QDJA 4DKJA 3G2MA 1KXZA 2VP3A 2OPBA 4KW7A 5FQOA 3LCVB 4R6WA 3OU7A 4EVIA 2QYOA 3E23A 3GRYA 4DCMA 3B7PA 3NWEA 1DCTA 3PB3A 3T7SA 4E31A 2I6GA 2K4MA 4PWYA 4DQ0A 4P7GA 3O31A 3SSNA 5GIPE 2C7RA 2JHAA 3UA3A 3HVHA 4E2WA 5DRTA 2GH1A 4R8SA 3GRVA 3LDGA 4GOMD 3DMHA 1R74A 4EMSA 2QE6A 3GU3A 4AZSA 2C7OA 5M5BA 1XDUA 1ORIA 2ZVJA 1D2GA 3BKWA 3HVKA 3KKZA 3LKZA 2PBFA 4FT2A 3C3PA 3M6WA 5EMJA 1IY9A 2PX4A 4BP3A 5KQSA 4A6EA 2Z6QA 5CVVA 3EVFA 5T67A 3EVZA 4CKCA 4PYJA 3V8VA 3DH0A 2QY6A 5BW4A 4PYIA 3FUUA 3FPFA 4PINA 3A4TA 4ER0A 5FCDA 3P2IA 5EEHA 3HM2A 4JXJA 5K0NA 1QAMA 1D2HA 3QOWA 4MTLA 4Z2YA 2IDJA 4C06A 3P9NA 3ORHA 4KIGA 1KYZA 1UWVA 2CWWA 1FBNA 5FHQA 3EPPA 2ZTHA 3ANXA 5E1MA 3AXTA 3RODA 3CJTA 3GNLA 3TKAA 5LQNA 3MHTA 1VPTA 5KS2A 1SQGA 1JSZA 3KU1A 4QQKA 5EG5A 5FTWA 3NW9A 4PCAA 3OZRA 4R8RA 2HR1A 3P2EA 4RTQA 1RI3A 3DR5A 3FPJA 5ICCA 2FCAA 2NYUA 3KQTA 2ERCA 4ER7A 4RTPA 4GUAA 3HTXA 3R9XB 3M6XA 3MB5A 4GEKA 4V0QA 5D1HA 5HEKA 5GINE 3P8ZA 5LQCA 2DPMA 2PLWA 5GOZA 1DL5A 3HA7A 5EVJA 4HGZA 2BM8A 1G6Q1 1H1DA 2ZBQA 2CMGA 3EMBA 4RVGA 3OPNA 5FULA 3RW9A 3X0DA 3EVEA 2AN3A 2XVMA 5DM2A 1X1CA 2UYQA 1G55A 2NXCA 4GQBA 2PVCA 2ESRA 1L3BA 1RI4A 2PT6A 3EVGA 5LSAA 10MHA 4RTMA 3A25A 1BOOA 1X1BA 3TKYA 4CTJA 4KDRA 1SUIA 2OYRA 3UJ8A 4CTKA 5EQJB 3REOA 1WY7A 1UFKA 2R6ZA 3P2KA 4C08A 3DTNA 4M7RA 5DX0A 3GDHA 3THRA 1YB2A 5EKXA 3UJ9A 2ZIEA 4AZTA 1R18A 3CC8A 4GOLD 1XJ5A 3MCTA 4PYKA 4PCLA 3IV6A 4MQ4A 5EMLA 1MJFA 2YUIA 5K0JA 1Y8CA 4GC5A 3DOUA 1KPHA 4DMGA 5HIJA 3IHTA 3LKDA 4RX1A 1SKMA 3MQ2A 3M4XA 5CVJA 5HILA 2GB4A 2ADMA 3KQOA 4GBED 2B25A 2P3OA 3LL7A 1JG3A 5K0CA 4Y30A 3IYLW 2AOTA 2BR3A 5E9JA 2AOVA 3UJDA 2EJTA 2PXXA 2EFJA 2ZZKA 3SSMA 3UJBA 2PX2A 3DULA 3KR1A 3WSTA 4F85A 1OR8A 3BWCA 3UJCA 1JSXA 1G8AA 1RI5A 1WXXA 4KWCA 4RTOA 3DXYA 4FP9A 5BXYA 2B9EA 3FYDA 1EQAA 3AY0A 4GOND 4A6DA 4POOA 3NDIA 3BT7A 1YZ3A 1ORHA 4QQNA 4RVHA 3VSEA 5T64A 4RTSA 1VIDA 5DRYA 1JQDA 1NKVA 2H1RA 2PXAA 5EMMA 4WVLA 3K0BA 4YV1A 3HCBA 5F2NA 5K0EA 3NVMB 1NW5A 1KPGA 3EMDA 5KYGA 3BGVA 2EX4A 4OBXA 3TM5A 3NTVA 4BLVA 5F2OA 1INLA 3M33A 3HCEA 2VZ9A 3O4FA 4YV0A 3C3YA 1FPQA 4FS8A 2AOWA 3LBFA 4RTNA 3GCZA 3GRZA 4HRAA 4ER6A 1RI1A 3TOSA 2AOUB 3OFJA 3CJRA 4HGYA 2PY6A 1P91A 3HA3A 3R0QA 3TQSA 5F2KA 3PS9A 2EJUA 2LD4A 3BZBA 1QYRA 3I53A 4PYMA 4R6XA 4M37A 5DT2A 4OA5A 2HWKA 3A26A 1SVUA 4FR0A 4CKEA 3I58A 4G56A 1IXKA 5B1SA 4EQZA 2JH8A 3BXOA 2IBTA 3C6MA 2YXEA 3LCCA 1ZKDA 2Y1WA 2ORED 5E2BA 3G8AA 4ZTBA 4YUWA 3R3HA 2ZBPA 2O0LA 4PYLA 5ICFA 4P7JA 3TFWA 3UFBA 3P71T 3G5LA 2BR4A 4P7KA 4CXMA 4U7TB 4E2YA 3LDUA 2IDKA 3LX6A 5HOQA 1XDSA 3RIEA 3DXXA 3E8SA 4IKPA 3TPZA 3UJ7A 1WS6A 1XVAA 2OY0A 2V7EA 3HNRA 5LR6A 1NV9A 3HCFA 2FK7A 3UA4A 2ZIGA 4MIKA 1HMYA 4LWOA 3ER8A 1EIZA 1VE3A 2HTEA 2PT9A 5E8JA 3BWMA 5GM2A 1N2XA 3EVDA 3GJYA 1O54A 4RWZA 1I9GA 1QAOA 2OKCA 2B78A 3SM3A 2O05A 2YX1A 4NECA 5DXAA 5FQNA 3VC2A 4BLUA 3PFHA 5GIOE 3GWZA 3SSOA 2H11A 3QOXA 5EIWA 4IV8A 3F4KA 4PGGA 1YZHA 2CMHA 3TLJA 2O06A 2IH5A 1EAMA 1NW7A 4GOOD 5CVEA 1JTFA 2P8JA 4M38A 4Y2HA 1PRYA 2AVDA 4PYQA 5JUWA 1JG1A 3KQMA 3R24A 1M6EX 2DULA 1RJEA 5KQRA 4OQEA 4C07A 2GAFA 1T43A 2HV9A 2P35A 1R8YA 2ZWAA 3BWBA 2P3LA 2NNWB 3GGDA 3NDJA 4FSDA 4ISCA 5EGSA 4AX8A 2IIPA 3Q87B 4FT4A 5HIKA 5JR3A 2QM3A 3TR6A 4HTFB 2QRVB 3LECA 2JG3A 1L1EA 4R05A 3FPGA 5CCBA 4OBWA 1XXLA 1O9GA 3DMGA 5EZSA 5CCXA 1M6YA 4E70A 5EPEA 2ZFUA 4FSXA 4P7FA 2XYRA 5K0LA 3G2QA 2G1PA 1XCJA 4YUZA 5HIMA 4X60A 1I1NA 1KYWA 5U4XA 2FRXA 3FPEA 5K01A 5DTMA 5E8RA 4PNEA 3B3GA 3DMFA 3GXOA 3FTEA 2BR5A 3HCDA 5CM2Z 5FHRA 1ZGJA 4AZVA 4L7VA 2GA9A 2GLUA 5IH3A 2FK8A 4E32A 4RTJA 3KR9A 1M0EA 2OBFA 1KP9A 1VL5A 5BW5A 3DUWA 2VDWA 3M70A 3UWPA 2OB2A 3KPYA 4QVKA 5K09A 3G5TA 3NJRA 3UZUA 9MHTA 2PWYA 5EEGA 5K0FA 3BGIA 5EMKA 1EJ6A 2YXLA 2O07A 4WXHA 1AQJA 5EKUA 5T6BA 4DM3A 5ICGA 1YFJA 3SVZA 2OZVA 4ER3A 2XYQA 3B3JA 4FGZA 2WK1A 4RTRA 2BH2A 4EKGA
chains in the Genus database with same CATH superfamily
2PXCA 1UFOA 3PFCA 4DLXA 3RIGA 2FOLA 4WA7A 5IAGA 3W5HA 1PR4A 4OHYA 3ZDYB 3SEZA 2JFPA 3D3QA 3PEWA 4QRIA 1RLUA 1HEIA 1XMXA 3EZLA 3TGPA 2VAVA 2C96A 3UGQA 1L7AA 1EE1A 2PUVA 3E2PA 3K6RA 1ESCA 3VMMA 2QN9A 1EHCA 3CBGA 3GAMA 2ZRIA 1KZYC 2W11A 2W7TA 1W5AA 3CCBA 3ETJA 5DM60 4UQLA 1LRKA 1UFVA 4H1TA 1PFKA 2JJ2D 3EVAA 4QNNA 1GGHA 3Q1LA 4PLFA 1AO3A 4ND7A 3CZ9A 5I47A 2D1TA 5FYDA 1E1CA 2IFTA 4Q1BA 3CX4A 3LXRA 2DVMA 2G9RA 3ICCA 1OI2A 2OAGA 3ASVA 3OX2A 4H17A 5GJWC 2DQYA 4RH1A 1ZITA 1NN5A 1TKCA 1X7DA 4FNOA 4EHAA 3TEMA 2WPDD 4UM8B 2C2MA 3DS8A 5H83A 5I7UA 3HL0A 1GRNA 5D3MA 5JS2A 4IZOA 1YC2A 4M9CA 3LO8A 2I91A 2QP9X 2O3TA 1KBOA 1ZM4A 3I2GA 4KO3S 1LPOA 4CM6A 3GZNA 3A7EA 4W5NA 3G1WA 1NQAO 3IV7A 4MEAA 4D97A 4NU0A 4ZI3A 1V48A 2RHGB 1BHJA 3TTWA 3U7HB 3EXFB 1T5SA 4X5OA 5AESA 3SX0A 3EVCA 1PKEA 1E9RA 4X62B 5DLDA 4GGPA 2E89A 3I04A 3HDQA 3EHEA 2H2DA 4Q4HB 2LCFA 4EQ6A 2VPWA 3H1TA 2C2KA 2WIAA 3NBKA 4HWKA 4DG8A 3CLUD 3FVVA 4JHXA 4B3CA 4F7WA 3MJHA 5FV7A 4AJKA 3QELB 1L5WA 1DHRA 4J4BA 4KLNA 5JVDB 1ZHFA 3K30A 3MA0A 4BMXA 4RV4A 5JO0A 3HVRA 5A05A 4W9MC 5KO2A 1SCKA 3HWWA 1JQLB 5LDDC 4GE3A 4AJ1A 1CULC 2AQHA 3Q5GA 4YFYA 2PANA 2QRHA 5IUKC 5DGDA 1Y48E 3AL2A 3I6IA 1XK7A 1Z0AA 5CVTA 4Z4FA 1O94A 2QGNA 3QGMA 5LP6C 1RQ7A 1LVHA 2W5UA 4H7FA 1OHHA 4D3DA 4LXHA 3W3ZB 4TXNA 4X54A 3TNFA 1X8JA 3O8OB 1XPOA 4MCAA 3NIDB 1PR6A 1J25A 3AR6A 1F2DA 3ICEA 4BRWA 3A05A 3PHGA 1DC3A 1P1IA 4JL5A 4OB6A 4TRMA 5BPHA 1TK9A 1UBHS 4H3SA 4PVCA 5ER6A 4C7MA 5MHTA 4DCNA 5AM4A 2A14A 3ZNPA 4GMGA 4LYEA 1T5TA 1W5TA 3T35A 2BUAA 4NXMB 1J20A 1RVDA 1WMBA 2VYVD 2QM0A 4X20B 2UVDA 4C1NA 1ZI9A 1VQ1A 4Q7JB 4NNPA 4Y2XA 1JIJA 1YDGA 5H80A 2VBIA 3NETA 1DIOB 1MX5A 4EKIA 1C3OA 3SBDA 1YK0A 3EZ6A 2I6FA 5BSGA 1QH8B 1YF3A 1NG1A 1U65A 5B1DA 4ESHA 3F67A 1DHTA 3ABSB 4QTTB 2FSFA 1BYUA 4RSGA 2QUAA 4FFPA 3HFRA 1N2BA 4KGXA 2GYUA 3L0CA 2RGAA 3QUCA 4BNVA 3TBFA 4CU2A 4CUZA 1F2TA 4L08A 4S1OA 5IZ4A 1U4OA 3DHYA 3AR3A 1XKLA 4X8MA 3RBZA 2PO5A 3HB9A 1BC5A 4I5DA 4C5AA 4BNXA 2V97A 4Y1EA 3LJKA 3AV3A 3W6UA 4II3A 3NS7A 5JE8A 4GZ3A 1W4ZA 3KUCA 1I0ZA 2HPZA 4Q7QA 5TT0A 3T3DA 4CHGA 5JNLA 2JASA 1ZMOA 1FVHA 3VAZA 2EFGA 3MRXA 4L5CA 4ND2A 2RHTA 5DPMA 3UT6A 3ZGXA 3CLSC 4AJLA 3HKBA 2W83A 4MXDA 4BQFA 1IQUA 1J24A 4DAOA 3AQIA 1PWEA 1ZXLA 2ACVA 4DLYA 3RUEA 3M3PA 3Q7QA 2ACEA 2EL7A 4M55A 3QNMA 4F0JA 2Z4SA 3K8ZA 3G7SA 4WADA 3C1OA 3I5AA 1VGQA 3LY8A 4OV6B 4DT1B 5LOVA 3EZNA 2CUZA 1EESA 5ALPA 3D8HA 4HX5A 2R62A 3C16C 4JEIA 3HACA 3IAM6 4TMVA 1PL7A 2HBRA 3ZPXA 2FP4B 1FFSA 1NUTA 2DPLA 4C6HA 1TIPA 3TLKA 5G4KB 1BIFA 2HH9A 1T5LA 3A0UA 1F12A 2F48A 4FGSA 1AH2A 4CIDA 2C9ZA 2I29A 4RYLA 4YDSA 4DUPA 4H6WA 3K7EA 5IK2D 5IJ9B 4Z51A 3MB8A 4DCGA 4MRPA 3R7SA 1ODSA 3TIXB 4Y9SA 5CXQA 2GETA 2FB9A 1Q0TA 3D6FA 3KDAA 5FEUA 5M29A 1QO7A 4MZXA 4AS1A 1ACJA 1RW4A 1IFXA 3TMAA 4NP6A 4EY5A 2EKLA 1HQYE 3TVTA 4L5IA 4JLKA 3UAOA 2Y1KA 2WDZA 3QLEA 5B1HA 3VBEA 5MFPA 1COZA 4PYRA 1U1EA 2ES4A 3BHNA 1KAHA 4J76A 4AS3A 4YP7A 3BBPA 1IJEA 1FYVA 1KSFX 3GJ5A 2PSEA 3JQPA 4LQLA 3TOVA 3W79A 5KQPA 1G5FA 1QIDA 3G0DA 2PZLA 3IILA 4UHKA 3T8YA 1P0QA 3AU9A 1C1XA 1FJHA 1X86B 3LX4A 4GPIB 1JHVA 4PSCA 4X1KA 3ZZ1A 1XVTA 5AKGA 1AURA 2BBWA 1E2JA 1JXAA 5IDXA 2ZAMA 1BX3A 3L8HA 1W48A 2H29A 2C4VA 4M1QA 1JAXA 4MHTA 4BVHA 1DV1A 4QDOA 2M9MA 4QOIA 5FLKA 1EG2A 4AZ0B 1FFXA 2HD4A 1KDPA 3KT6A 2AGVA 1BEZA 3PNBA 3LQ2A 4GWGA 3E0QA 3EEFA 4M36A 2F9LA 4P4UA 2FUCA 2ORWA 3QF4B 5CX1B 4PZCA 4BIIA 3FKSD 3QU4A 3ORFA 3T3GA 2AW3A 3DP9A 2W22A 3E03A 1NFRA 3PUKA 4A23A 2BT4A 2R7LA 5CDFE 2X5XA 1NNUA 3JR3A 3QG5A 2NGRA 2P90A 3QSGA 5EFOA 1POXA 1V5IA 3PCTA 4HSEA 2QMUA 2IF0A 3NXSA 4JX8A 5FPHA 3SFVA 4Z1MA 4CM8A 2C20A 2CLSA 2ZS8A 3UWSA 2J87A 3MRVA 4KV9A 2NV6A 4Q93A 3LYHA 3M1IA 2DRIA 2ZAOA 3Q3HA 3NHPA 2HO4A 2OHGA 4KQ2A 4OFWA 5CR9A 1J0AA 5B58C 3WAJA 4DR7B 2PT7A 4GNKA 4HBZA 3R3JA 5LDGA 1CRLA 3E61A 2XA1A 4KCGA 3UT5A 1W36B 1UXGA 3BKWA 5A03A 3E3AA 4JJKA 4BVEA 2JGIA 2FZ5A 1ZR4A 5I9TA 1L5QA 5EXPA 1W8DA 3KQHA 1OZGA 3D3KA 5IBRA 2IEAA 1XVUA 2WWRA 3QFTA 5T67A 4CKCA 4FWIB 2VTKA 1L5GB 4GKJB 1N2IA 4AROA 5F77A 3A4TA 3P0JA 1YOVA 5H8WA 1AG9A 1QORA 2QVCA 3SKYA 1MZPA 1OXSC 3PGXA 4V03A 2J31A 5LN1A 3OM0A 1W49A 2ZWIA 2M6KA 1DJQA 4GR5A 2BMEA 1EAYA 3KLMX 5AJXA 4L0CA 5KKNB 2XJ9A 5FHQA 3OQOA 2NTYC 3PF9A 1CRQA 4WLNA 2QZPA 1V3TA 3N7AA 4NENA 3RVSA 8ATCA 3KHSA 4CEJA 3EA4A 2IXFA 1H2EA 2YMMA 3PA8A 2V0CA 4IQ4A 4OSOA 4Q12A 3TZQA 3LWZA 3B5EA 3KNZA 4HDSB 4TZ0A 3QPAA 4KFTA 1MJNA 4EBFA 4JA0A 4WERA 1JI0A 4F6RA 1V6CA 2YIDA 1I6LA 3G9XA 1M1YB 3N39C 3STUA 4PZEA 2Y6VA 5BWNA 1MG5A 1V1MA 2IPMA 3O2SB 4F5WA 1K88A 4TTVA 2BMAA 2DSNA 2JIZD 1Q3TA 1LTQA 3SNHA 5JNUA 1N25A 3IDFA 1ZFNA 3OBBA 3UEOA 1F2UA 1YRQA 2C2BA 3JASA 3T7IA 3W8DA 4EUSA 5CBPA 1KQPA 2GM4A 4GLOA 1X1CA 2UYQA 3P0RA 1O77A 3S55A 4KQEA 3S7TA 3VR0A 3WKCA 4M87A 4CRWB 4Z1OA 1E61A 2FMHA 5CCDA 1CQXA 2D2VA 2JI4A 1EBUA 4P53A 4YLEA 3HJUA 4ZOAA 4V1CB 3W2FA 3MWLA 4QD3A 3SE7A 1GZ6A 5B4TA 2PGNA 3PQ7A 3DTNA 4M7RA 1CV2A 3BXFA 3CPHA 4P9NA 4Y6QA 3WXMA 4BDTA 4DUGA 4QODA 3VPXA 2WINI 2QPAA 1Y0BA 3RSCA 3CC8A 3Q0IA 5KSZA 1NBMD 2GGSA 4MDFA 3PNKA 3IAXA 1KY5A 4S0ZA 1NF8A 2P6OA 1GV0A 1G3IA 2VEDA 2WFMA 2YUIA 2DWCA 3HB0A 4QTZA 4UBOA 4YXWA 4EUKA 3LPNA 2G77B 3M4XA 5K8CA 3ND6A 1YE3A 1CFJA 4TRNA 4CV2A 3L0SA 4R2MA 1VPLA 4JIGA 5AJUA 1WDTA 3Q8LA 1HYHA 4ME6A 3GRPA 3UJDA 4EHHA 1FNSA 1ATZA 2PXXA 3GD7A 5KTMA 2PBZA 2F3QA 4DEYA 3GL9A 2RIRA 4YQYA 1PJ3A 5IABA 1ECBA 5FBRB 3ZCQA 3FMPB 5K8JB 3WDMA 5FR2A 2CL7X 3CZPA 5BYJA 4HAZA 1VBNA 5C80A 2IIBA 4N6NA 4U00A 1XNQB 4JI6B 1D8AA 3B36A 4L78A 3AM4A 4U4AA 1RRKA 3BE5A 2CLFB 2WUWE 2ECFA 2Z56A 4I81A 1IBSA 1ZWKA 3GLHA 2O2YA 2PGJA 1N92A 4FXPA 1NXWA 3IXLA 4P32A 4WVLA 3WHLA 2ERYA 3WNVA 5AVQA 1JFTA 1EXDA 2W6QA 2JI7A 5BWBA 5K51A 2FR8A 2Z5VA 4DBVO 1KFBB 4RUKA 3H9UA 3NALA 4PEVA 5EWMB 1S3FA 3K70D 3WMXA 2HWYA 2R7KA 4TKVA 3C3YA 1EWKA 2E4WA 5I7VA 2AOWA 2NU9A 1NOJA 1Y8QB 3AV0B 3ED5A 3FW1A 3DEZA 4LN1A 4TQUS 4DV3B 1JAHA 4G9BA 4EUFA 1CUCA 5A5DA 3L6BA 3PSAA 4IMIB 4XOUA 5HVNA 3R5KA 1UT8A 4A0QA 5F1YA 1EGHA 3SR0A 3WGNA 3H4TA 4Y6LA 5BN4B 4G56A 721PA 1E79A 1L7OA 2H2FA 3BXOA 2Y1LA 2PUGA 2HHCA 2FEPA 1IXSB 4UASA 5J1SB 2QW0X 5BT8A 2QLJA 4HVCA 3DFMA 2BR4A 1SQ6A 2VPIA 2H54A 3Q7SA 4JCCA 4U7TB 2Z1NA 2DQKA 2IX9A 4NV0A 2VRCD 3LX6A 2DJIA 5JHHB 3SJAA 7MDHA 1WS6A 3W2HA 2I3AA 2IKSA 1EWYA 4HVLA 1HLGA 4DHEA 1U7WA 2CK3A 4H27A 4M2LA 5UKDA 4AZ3A 4QDZA 5FF9A 1UJ5A 1R27A 5DNEA 1I9GA 1I6MA 3OZAA 4DBZA 2WZQA 5LUBA 1QS0A 1RAFA 2GKSA 3NHLA 6GPBA 3AP3A 5HJ7A 2QD1A 5EIWA 4EJ6A 5LBIA 5EPOA 2V54A 2QNRA 2YS7A 3DO5A 3JAMA 1G7TA 2AXPA 2AX4A 2VSFA 4XUGB 4WOKA 1WZCA 3ZJUA 4HB4A 3OEHD 1A4UA 1JTFA 2YV5A 4Z9BA 3UMCA 3VPAA 1BVHA 1O89A 5T5QA 1CLUA 5EMNA 4MKGA 2C9YA 3I5YA 4NXNB 1SHJA 3KUUA 4N8DA 4V3CA 1U0BB 3GIDA 1Z7BA 4E4RA 3M0EA 2WVGA 3HFSA 4LXUA 5IEBA 4RV5A 2Q3LA 1LQUA 1W34A 5JAPA 1R8YA 3MOSA 1OLUB 4KFSA 4Q00A 1H6CA 3PUVA 2ONCA 5JT1A 1L5MA 2ATVA 2P2LA 2Q1SA 1RXCA 3OJLA 4UTXA 2QRVB 4YAWA 3TR6A 3CS3A 1OAOC 4C4RA 4OAQA 1SVMA 1Z5GA 2VWHA 3UMFA 1LEHA 2WWIA 1C9DB 4E70A 3OPMA 3REQA 1R0BA 2OEPA 4ZZ2A 5I3CA 1Z6TA 2I8AA 4JXKA 4H6PA 3UB3A 1E2MA 1JBQA 5I9BA 5B6JA 1CF9A 3QWFA 2WFLB 3RS9A 4NOJA 1AE1A 2OWEA 1F48A 1XROA 1GRRA 4JJ8A 2I7XA 1Y5LA 4RA9A 3SPXA 3ZDFA 4D42A 1P6QA 2CVFA 2GLUA 4GDMA 4CG2A 4XWWA 3UW1A 4NFYA 2YY6A 3HI6A 2AIRA 3W9SA 5CLQA 5LMNB 1HZJA 4OAOA 1UK7A 4D46A 5AUOB 3MIZA 1KGSA 1ND6A 2NAFA 4MPDA 3L4KA 3C3DA 3R74A 3BRQA 2PTHA 2Q3FA 2Y66A 4NE9A 5C81A 1QONA 1PUIA 1P1KA 3L07A 1OASA 3QFCA 1J97A 2V3CC 1T0JB 3MTIA 5BOSA 4CMIB 4OMDA 5EJMA 3HYCA 3RDPA 3NWBA 1NW8A 3RH0A 2PZJA 2RGNC 2FFHA 1QFSA 1B6RA 2SHKA 4N9WA 1F6WA 1M5UA 1ZVKA 1X80B 2PL3A 3E4CA 4GVXA 1PIWA 1O5OA 1K4KA 1SXJD 1UMCB 4D1YA 1QCCA 2FGJA 3LUDA 2CLKB 3K0CA 3RU7A 5AJWA 2D6FA 3TRJA 1KAQA 4J1TA 4I4NA 4ZXPA 2WP8J 1UIMA 4MR7B 3B1KA 3LDAA 4FEEA 4KZPA 3W04A 2JI8A 1EJBA 3TX6A 4D44A 4F11A 4IILA 5I9LA 1VIYA 4ZMRA 3UHJA 1TUBA 2YY7A 3FDFA 3OLQA 4O1HA 5TNXA 2VCYA 2VZ8A 2W2LD 1GCOA 3F97A 3H8SA 4EYQA 1QB8A 1QK3A 2PH5A 4EZEA 4S1VA 4MVJF 1AF7A 1Z2NX 4ENTA 1DRUA 3UYKA 4J9UE 1F7UA 1F5NA 4FILA 4E5UA 4EELA 2H2AA 3CONA 1NJ5A 2QMQA 1YDEA 2P40A 3HB4X 3BFJA 4YHHB 4OX9Y 4M0KA 1GOTA 1T0HB 4PW0A 2RKWA 3TYXA 2J3DA 2C0PA 3G79A 4BJ5A 4FM9A 3M4JA 5HZKA 2H57A 2J4DA 1KJYA 4X0EA 3T7RA 16PKA 1E6KA 3LUFA 3VYWA 2GBIA 4ALLA 3RTAA 1Q0ZA 1NYQA 1R6AA 1VI2A 2ZIWB 4PLZA 3U2QA 2RHOA 3DAYA 4CPDA 3C70A 3AYXB 1T6NA 4LA4A 4WRRA 3RS0A 4ALJA 4EEKA 3GI1A 4Q9JA 1YT5A 4JI5B 5CD9A 3VYUB 3QXJA 1U2DC 3ZOKA 3KKKA 2XKKA 5FLXA 3FRHA 3U0VA 1Z5OA 1O0CA 1Y6RA 3IOEA 4CIVA 5BSVA 4G0QA 3LXUX 2OCBA 4JEMA 1G4UR 2CDCA 4TMWA 4DCOA 1C0LA 1RYEA 2PWAA 1SKYE 2PRYA 2C9CA 4K6HA 3SF8B 3LUAA 2WAAA 3ZIAA 5KSWB 3KWMA 5K4GA 4LI0A 4LS3A 4MH0R 1DC7A 4M22A 1KQNA 3JWGA 4UFPA 4J4TA 4QOSA 3WSWA 2YWDA 4CMAA 1WNFA 2AL7A 2H1FA 1Z39A 2YIVX 3CG0A 2XB8A 3EGIA 3FI0A 3HCRA 5DSTA 3SP1A 4V02A 2HK6A 2MR6A 3VH4A 1LNQA 5AXAA 3KSAC 5EHIA 3QWHA 5DTEA 3N2ZB 4W5HA 3BM5A 1IC6A 3CEPB 3WRVA 2QLFA 1I4WA 5ALJA 2ZANA 1F0PA 1VYHA 2OHXA 2PMBA 3V5NA 1JDUA 3DSRA 1EMDA 4LF4B 2ECKA 5FOWA 2AI2A 5GVSA 2QG9A 4XYMA 4UD2A 5DX1A 1MEEA 2WYUA 3W2EA 4N5HX 3W4IA 1S2LA 3AI2A 1R8XA 1NVTA 2XXJA 3Q11A 3S2EA 1DE0A 3ZJ5A 5J2UA 2YKGA 3WDLA 5EIHA 4P0QB 1H8HA 3JQ8B 3D8RA 2Q3CA 4PPNA 3CZAA 4YV2A 4P5DA 3CF2A 4IIFA 4WV3A 4EO4A 1TECE 1ZD8A 2JAPA 3BRWD 4IHQA 4URWR 4YJHB 4NYJR 3H8JA 2YCBA 2ASVA 2HL6A 1VFNA 5CXXA 1AXRA 2AMYA 1Q0UA 1AA6A 2ZDQA 2Q5QA 1U3WA 4GZ6A 3S5JA 4GMKA 5HF5A 1E2PA 1UPUA 1YQWA 3BGDA 1QKIA 4XA8A 5FWYB 2GD2A 4D8YA 3ZIUA 3RSHA 2DTDA 3RTEA 2RH9B 4ZVPA 2ZIAA 1YIAA 4J0FA 3HWX1 3SQNA 4DMCA 1AKVA 5HR5A 5MF6A 2V8BA 1WB5A 4WA8A 1PU2A 1W85B 1ZK1A 3NBXX 4YRQA 2GFQA 2HA6A 3V00A 3KQLA 2WSSA 1ZK2A 4ALNA 4CL0A 1C7JA 1KORA 1H65A 2MOKA 3IUEA 1PNQA 3GZTB 3KV1A 1S9HA 2XE4A 1RM3A 3LP6A 4U7JA 3UB4A 3NIWA 4X63A 3N86A 3B9QA 3EODA 4IXWA 2FUG1 1JQEA 2QOEA 1K9VF 2QXUA 3A4YA 2MSKA 4D56A 4N0DA 1RYMA 3FCUB 1XF9A 2JFHA 4Z9AA 1GPDG 4G84A 4ZAVA 1GCGA 1BXGA 1JLMA 1NBHA 3FUCA 2R25B 3H86A 2G83A 3L84A 3R5FA 4KTTE 4R2HA 2IS6A 1JKIA 1LZKA 1XAHA 2R4TA 1S6YA 3N0XA 3TZCA 3WWDA 5CEFA 4DWOA 1CERA 1JKJA 4FEGA 2Y77A 3H0CA 4Q3EA 5JV5A 2XNHA 2ADOA 1DUVG 3FX2A 3WNCA 4YJ3A 4GW3A 5HF8A 3ZHSA 1FUIA 2H1WA 1LRJA 2BUCA 5E6RB 2DKNA 1TM2A 2CE2X 3OWHA 2W2MA 4QBKA 4RCZA 1ZIYA 3I30X 4M60A 1NQTA 1ZY2A 5ELLA 1K5HA 2C9DA 3LYAA 4L74A 3ANSA 1K66A 5T4FA 1GTSA 1FMCA 5SYNA 2G08A 3A6GA 4TSRA 3UPTA 3L8ZA 1GSHA 4QYIB 1R4MA 4ZO8A 1I33A 2GN1A 5FWDA 2D5AA 1VPWA 2XXAA 2Y0DA 3COSA 1Z5NA 4OMFG 3TRHA 3UPUA 1F1JA 4Q1VA 1QAQA 3L0OA 1UJ2A 1Q2XA 2E37A 3ZU2A 2BM0A 1CJSA 3QPUA 1CEEA 2VYQA 2LP4Y 4OO3A 3IMEA 4NESA 4CF7A 1MX3A 3O3OB 3QWIA 3NATA 1BH2A 4CCWA 3O8CA 4FJ0A 5CW2A 1MR3F 1QE3A 2A6PA 1H4TA 4IHKA 1YZFA 521PA 2YHUA 1UWKA 1WW2A 1G5PA 1OLXB 3K15A 3K94A 2DWQA 5H3HA 4US0R 4XQ9A 4F72A 1M0TA 5D5PA 1PI3A 2Y1CA 4NJOA 4P1ZA 4QWMA 1ZP6A 4IO1A 3DVSX 4NBLA 5CM9C 1QNLA 2XVAA 4KYIB 4LXXA 2JH9A 1L9KA 2DY0A 3IPCA 4J2TA 1P0MA 5CB4B 1G8GA 3BS4A 3IPRA 3NC4A 2X4IA 3ZD9A 1KEWA 1RWXA 1DX4A 1X7YA 2WP0A 2ZUUA 2RJNA 5EZYF 5SYAA 1ZRHA 2QU7A 2C5BA 3HJAA 4HPWA 4FLFA 2ZJAA 3QU7A 2W90A 4GYYA 2AF4C 2HLHA 4HWRA 2VQSA 1A3CA 1EGMB 2FOIA 3ZHYA 4JU9A 4B31A 2CBGA 1L5RA 4L8FA 4OJMX 1Q92A 2YFYA 3HGMA 4GSYA 4EI8A 1RQXA 5EJ7A 3E35A 3VFDA 4P4GA 4C4TA 2IZ7A 3B38A 2EWVA 2GH1A 1UAAA 1V5WA 1IG3A 1Z56C 2O4CA 5DLPA 1R10A 3MGKA 4WI1A 4YCLA 2YOFA 4HGQA 5KQSA 1MRNA 5EMJA 2UVPB 3C45A 1MB3A 4Y1GA 5BSKA 2YXPX 3F6CA 5IKOA 4IOLA 3RTDA 3VAYA 4BLPA 2CZQA 3G8YA 3FPFA 3H5TA 3L7DA 2C61A 3PENA 1G2QA 1YV9A 3PKIA 4AYWA 3F4BA 5G3YA 4EPWA 3UFXB 3UUEA 1JT9A 3N2NA 1HMPA 5E1MA 3BJIC 2WKSA 4XW2A 5KS2A 2L69A 1SQ5A 1OW3B 2PQ6A 1U7XA 1PQYA 2QE7D 2QLLA 1N1DA 2C3PA 3EIEA 1DWQA 3C6BA 3NM4A 4JELA 4KQ6A 1KZHA 4HLUC 3QBVA 4CODB 2CB9A 3BJEA 2NYUA 5KTKA 1ZM7A 1JR3D 2HFJA 2IP1A 3PWKA 2AA3A 4WIAA 1Z74A 3ANNA 4CEIB 5BYAA 1ID8A 1P4RA 1BE6A 2WSIA 2YJ5A 4KC0A 4RIIA 1XLTC 1C8KA 1MA0A 1U8AA 2O48X 4HNHA 4V0QA 4KPFC 2E85A 2WYIA 1AUVA 1SVNA 4JSTA 3CRW1 2NU8B 4FQ8A 2Q7OE 3STVA 4YYEA 2G82A 1ZS9A 1KH1A 3BH7A 2FW6A 2EKZA 4OF4A 5EVJA 4ZVQA 3OPNA 3NPMA 4TMXA 2IDZA 1A82A 4WD3A 3F8TA 3R5SA 1GEEA 2VA8A 1ZIPA 3QMMA 2CVPA 4GM4A 3PR3A 4HNQA 2Q2OA 3AHHA 2RD2A 3UWMA 3K1AB 2Q0SA 3TJZA 1SUIA 3IIKA 2D0DA 2OQRA 5FI5A 1NG9A 1TPZA 1SOMA 1FDIA 2IKQA 2CKMA 1KO5A 3GDHA 1QRRA 1GNTA 3AEUA 3A1VA 3C41J 3MGBA 5D3KA 5EJIA 3AUYA 4N3BA 1VRWA 4OHKA 2CJWB 2HM7A 4R41A 1I2BA 1ECFA 2HCTA 5FWNA 1EVJA 3FOEC 3LGXA 2J7PA 4GC5A 3AIKA 1CWUA 2C7VA 1SU7A 4K05A 1GNLA 3LKDA 3B1VA 4L4UA 1GV1A 4IFBA 3MQ2A 4C0BA 5I7EA 2JJMA 3F9CA 1COWA 1SPBS 2PU5A 4JI1B 3IEUA 4I3FA 2EU8A 4UEKA 4B76A 2J85A 1FRQA 3K31A 4Y30A 3DV0A 3TNYA 2IH4A 5AW1A 5E9JA 4W99A 5JNTA 1XZBA 3JW8A 4H6VA 3EDQA 5CDFA 9ATCA 4MRSA 2VYFA 2X9QA 2Z04A 3FCSB 1HFWA 2NAPA 4S1WA 2BRUA 2EWWA 3T3HA 4C9BA 1E9SA 1VRVA 1WXXA 3OM8A 3OY2A 4X44A 1P77A 5K6RA 1R12A 4G65A 2C2WA 2F1JA 1GGKA 3B2EA 1KYVA 3ZWPA 5ED4A 2IA5A 1JLSA 1TCAA 3QLUC 1XZ8A 4IIJB 3HHPA 4BVJA 2IQIA 4EO9A 2AKYA 1TC2A 2ZB2A 2B61A 4I3GA 5CBKA 3EFEA 1VSTA 3MUEA 4K9DA 4EL5A 3JQAD 4U1RA 4AY3A 3T5CA 4AVYA 2GX6A 3ONNA 3QE0A 5IAAA 1NJGA 1WABA 3SG0A 5CDTA 1N2SA 1NI3A 1XL1A 4JVSB 2Q7XA 3DHEA 3BIFA 3SEFA 1RDFA 3ZY3A 1H4VB 2XAUA 1IK6A 1AUXA 3IT1A 2ST1A 1Y3FE 2VZ9A 3F3YA 1DU4A 3HP1A 4UU1A 3RUCA 2UUCB 2GZRA 2AZ4A 1FTYA 4RTNA 2XRZA 4DE5A 2AOUB 4HLDA 1ID1A 2J3JA 1C4KA 3O8DA 1EUDA 2UXBB 2HWXA 1YB1A 4MOWA 4F2PA 1FU8A 3RKRA 4EJSA 4YCSA 1JU4A 3RHZA 4BC1A 7YASA 2HF8A 3K70B 4UVDA 3RO7A 4YHBA 3IT0A 5HK8A 4XTRA 4XB6B 4QM6A 1GGNA 1L4HA 5DIZA 4ZTBA 3UG6A 3LU1A 2J4CA 2JAHA 2O0LA 4E3ZA 2YBEA 3HWRA 3G5LA 3P71T 3O1HB 2VHJA 4JGBA 3SE0A 4OXKA 4KX5A 3CZCA 4PBSA 3EMKA 5HOQA 4HGOA 2QP4A 3DXXA 5CDSA 1AU9A 2R97A 4IKPA 1KQFA 2H1OA 3CLSD 1GZUA 4K81B 4Q15A 5CGZA 3CW9A 3PG5A 2C95A 4AP9A 5G1NA 4U2CA 2NUTB 2HDWA 3UGTA 5DHPA 1OWNA 3EVDA 1Z63A 5AM0A 1E5VA 3VRHA 4DSUA 4PS1A 3V80A 5CT5A 3RT7A 3TQFA 1D4OA 4NCKA 1XQWA 3EUWA 4J2HA 4EB6A 4R2XA 5MFZA 4EYKA 2ZBGA 4F2GA 1LDYA 3BE4A 1TO6A 5DM70 2C1ZA 5B4VA 1YQTA 1G8HA 2PS9A 4JBNA 3GFRA 4QU9A 3I8OA 4YCAA 5B3KA 4NPHA 1UL1X 3SYNA 4D02A 2XGGA 4B7AA 2G09A 3GLKA 3VYRB 1HEUA 3BWVA 1DC5A 1JQKA 1SHTX 3M5PA 2OCIA 1ZIOA 3RCBA 1YR7A 5JUWA 2FPRA 4JBIA 2VK8A 3KQMA 2HQSA 3L7JA 3GAAA 1US8B 4L75A 5C1OA 4O59O 2P35A 4C89A 1JHZA 4RL4A 1B0PA 5KC8A 1PDOA 4OGWA 4AX8A 4G5SA 2TMKA 3JQBC 3KKOA 5CYFA 3PYLA 2OMEA 3MJSA 2HU5A 3DWIA 2OFFA 4XKJA 3M5CA 5LA6F 3RRXA 2XDYA 3QU2A 4IIXA 4QLBA 1P1JA 4P83A 4NZMA 4EMTA 4RFLA 3WSVA 2X0KA 3FBTA 5KBYA 3NV7A 1CK4A 4JYBA 4EEZA 1K7FB 1PWXA 2A9OA 4FMCF 3GCXA 1N9KA 5HIMA 2B8EA 1V1RA 2JGAA 3KWFA 3MAJA 3OOSA 4OHMA 2FNAA 3ZK9A 3RAEC 1P7ZA 1SZDA 4EG4A 3PUJA 3N8KA 3PDCA 3EC7A 1RAAA 3PWTA 1GGJA 3OKFA 4MI3A 4PX2A 3OUZA 2IPOA 2RHBA 4MGIR 1NPTO 3I6MA 1K7EB 3RYCA 4WACA 4WY8A 3U0BA 3VDQA 2I76A 2J6HA 2N42A 3KAQA 2Y2UA 4U6QA 1CIJA 2YXLA 4ZAZA 3SHQA 4HT3B 5JECA 5JQGF 4B6GA 1Y1SA 1PO7A 2XITA 4ZODA 4JI2B 2JLXA 3ZDDA 2VJOA 4INJA 2RE8A 2W58A 2EF1A 4GRAA 3WHIA 1RZUA 4PAGA 3WK4A 2JANA 2CFIA 2JCGA 3A2MA 4M7OA 4MGZR 2PSFA 5FKJA 5K05A 4P82A 1KS2A 1TQ4A 2BONA 2MR5A 2P9CA 1M1ZA 4P0TA 4RSHA 5FTJA 1CUUA 1T9GR 5A71A 4TLDA 4YRJA 2GAAA 5KNBH 5KNLA 3IIIA 3W1VA 5ALGA 4JYCA 5CNIA 4HY3A 1HORA 1VLHA 3L6UA 2P6UA 4EB3A 4FE3A 2NSJA 5CHYA 2ZRCA 3LMKA 1FYDA 1PQPA 1XP8A 3K09C 2Y4OA 2VJAA 2IZ1A 2EIHA 1Z5ZA 5AHOA 4ZU3A 4O4HF 1OIVA 1N78A 1ABFA 3LPAA 4LDAA 5DBHX 3D2BA 1L7VC 1IHPA 2ZPTX 5FFFA 4RSRA 2C2ZA 1P6XA 5BUCA 1JYFA 1L4FA 1YCHA 2DFPA 3PU6A 3SHTA 5IM4F 1Y8ZA 4C20A 1HYQA 2NXNA 3QFFA 1ZA1A 1SK8A 2ZXUA 4JFAA 1H5QA 1SXJB 3DCIA 2ZYRA 4EA9A 4JBGA 4FDTA 4NATA 4DREA 4J7CA 4OL0A 4PSKA 4ALMA 5JQWA 4QUBA 3N0TA 4IUCS 5BSFA 5HW0A 1A5SB 1UJNA 3CT4A 5K8TA 3GDGA 1CVIA 1NAIA 4OH1A 3D2LA 4DMRA 5ITZA 1XPJA 1KWKA 1N75A 1CY1A 4LSGA 4BJ6A 1E5DA 2J0EA 1NI5A 2DJ5A 1KVUA 3L8EA 4UU7A 5F33A 3STTA 5FUXA 1GXSB 3IVXA 2YR0A 5HG0A 1ISJA 1CNMA 1YZNA 2ATCA 2I67A 2O23A 5DGHA 1T2NA 2GPTA 4M7WA 4M8SA 4MGEA 4ER5A 1JIKA 1IM2A 1G20B 4FTWA 1E4YA 3BL5A 4C6RA 1FTNA 1N33B 5I7SA 4KX3A 4ZDKA 1DUSA 2XYGA 3PRHA 4M3NA 3SDSA 1GQ2A 1EUYA 1Q3KA 3MD9A 5GPBA 2XUJA 3UJAA 2JLYA 3QYPA 3I5XA 1QHHB 2ZRNA 1FLVA 3ZHOA 1RZRA 2OAP1 1AZSC 4TLLB 5DYNA 5FBQB 3PLRA 4ZGWA 2JIRA 5T8KA 1A1VA 2ZYAA 4TTJA 1T1GA 2C54A 4TTIA 1TW2A 1X74A 4JROA 4BGUA 4CF4A 4EVSA 3X2EA 2YMQA 4XQGA 5TS2A 3LQYA 4P31A 2FPLA 3TTTA 5F3WB 5ALMA 4Q66C 4A3SA 5K0GA 5FPKA 3GN1A 1PJCA 3VNUA 5J23A 3RVNA 4ZARA 5B12A 3MTQA 2B2CA 1JPNA 4ND8A 4OXNA 5JJLA 1NT4A 1UMKA 2A4MA 4IGIA 4PLGA 4MHSA 4IIVA 1E2FA 4BMYA 3WLLA 2VQ3A 1KIAA 4YP5A 2DR2A 5J2TA 1FP2A 3PL5A 4ZCMA 5CA1B 4F8EA 4OOEA 2W2XA 3R3XA 4H08A 5BN5A 3KBOA 2RGCA 5K3SA 4AL4A 5HOEA 1XD2A 3DMTA 4BLWA 1A1SA 1AQNA 1Z5PA 2ONJA 4B4DA 1M8FA 2NO7A 3LQQA 2HY7A 3TSCA 1K3UB 1VZ2A 4WAUA 2M6LA 4R16A 2EGHA 5BV7A 1RAHA 3DDWA 3TBKA 3VC3A 4A0SA 1WSBA 3DOCA 3WO0A 4ZJPA 5AFSA 1QGUB 2ZTLA 4BE7B 1KEEB 2OUIA 2UV8A 4UUMA 1ULSA 2AFVA 3UBTA 1H3FA 2PD4A 2R7NA 1U81A 3KYIB 4HQ6A 2M1ZA 2CXHA 3ZWMA 3GFGA 1D09A 4S0XA 5L53A 1POWA 3KTAA 4PX5A 4EVRA 3VHLB 2WWVD 3B85A 1H1LB 2C9BA 1Q84A 3PLAE 1VJRA 1X1DA 2PUTA 1ZG3A 2GD1O 4G8BA 4Q7MB 3SBXA 4PG8A 2GN6A 3TD9A 5JMWA 1IM8A 4M8NE 3PPXA 1CHDA 5KOHB 1Q0RA 1ZONA 2PX6A 2ZJFA 1T6ZA 1XELA 1XHEA 5E9WA 2OL4A 3PD0A 1G7RA 1P39A 3KXLA 1M5RA 1Y9DA 3FOAA 5EN4A 4KGZA 3V4FA 2ZSIA 5IYZA 5DN6A 4BRUA 1ZISA 1ZXBA 1P19A 2X8AA 1M6WA 3GPCA 3M7IA 1K7YA 1YAHA 5LXTB 4Q3OA 4JAVC 1E1KA 1UK9A 2GFHA 4H6XA 5KJEA 5HQTA 3ONDA 4JNKA 2IOYA 3NYRA 4BVLA 1Z25A 2ICAA 4EY6A 4WZAB 2AK2A 3C6KA 3WS7A 5EKTA 2IS4A 1QO9A 1E8MA 5F7OA 4NV1A 1F9AA 3LUBA 3F96A 3EQ9A 4MR9B 1LPSA 4CM4B 1GITA 1P2VA 1KU0A 1SZJG 2GUWA 2VL7A 3OJFA 4IGAA 1JFFB 3ANMA 1R4NB 3PHJA 1VIAA 2GF0A 2P1ZA 1E2EA 1P4GA 3SHFA 1M1XB 5DMXA 1R6BX 2UZIR 3G9QA 4KXNA 2WJPA 4BGDA 1XBTA 3HVIA 3E22B 2JAWA 4KR9A 5BR1A 2VPYA 4UU0A 1W0KD 3D43A 2POCA 3P9ZA 3GJSA 5AM1A 2O7RA 3EQ6A 3UK1A 3DEJA 3HCCA 1C3LA 1CUYA 1FBTA 4OBEA 3R6TA 4LAFA 4R0VA 4RZUA 2C83A 3NKLA 4B8ZA 4IG9A 4V1CI 1CG6A 1SAYA 2VXYA 1BFDA 2ZBVA 3AG5A 3HU3A 4QASA 1JP7A 4BWYA 3K6SA 4NEHB 4UNSA 1M3SA 3KKLA 4B6FA 5A4KA 1Z7EA 4D9FA 1U7ZA 2PJRA 2R1VA 2GESA 4RCVA 5D7NA 4HBGA 5KWIA 4ATNA 3GNSA 4NMMA 4X41A 3EQZA 4GPZA 2WY2D 1Y1LA 5LBUA 1YUBA 4MQMA 3EGEA 3IAAA 1WQ3A 4ZIRA 4ODIA 1VKJA 3C8DA 4KKVA 3N8DA 2V0GA 3ZWBA 5GGYA 3LLSA 2YNMD 4DA6A 3CXUA 1BTOA 4JNCA 1GLVA 2P4SA 2RHLA 4OQQA 2X6QA 1QLWA 2Y2VA 1TB4A 1WXFA 3C8HA 3E3LA 1MXHA 3AM3A 4FJ2A 1ZH2A 2UZ1B 4JWKA 1FF9A 4LHVA 4TS4A 1KRHA 4WN3A 5KSOA 1NHGA 2FSGA 1W0JA 4UZEA 1K8QA 2XNJA 3JSXA 1P9NA 5DLQC 3RS3A 1FVXA 1V41E 5BNIA 4DDVA 3ICPA 1EM8A 4JJZA 5L95A 3UAWA 3OUUA 1A8QA 2ADFA 3NGXA 4P4LA 4BAZA 2CT8A 2AWOA 1XRLA 2DE0X 4F4UA 3KPWA 1MJGM 3STWA 3S2SA 2JIBA 3U3ZA 1A7KA 3LFTA 2D2EA 2PUEA 1I5OA 4TV8A 2ZI7A 1SXQA 3R6GA 4WLEA 3CX7A 2BGLA 4QGBA 1SIBE 3H11B 2VNAA 2EARA 1RACA 2PR2A 3ET5A 4HB0A 4OLHA 5FQOA 5G40A 3LLCA 3AVXA 2MYTA 1M2KA 2HT1A 4MVYA 5J5CA 2OAQ1 4NCIA 5JWHA 2BFDA 5TT1A 3RG8A 3RS8A 4GXRA 5LP6A 4TXLA 5H4GA 2B8JA 1Z38A 2QQGA 1OXUA 4R8SA 2ZIXB 3UC5A 2Q9BA 2QE6A 3KX2A 3NTQA 5JYBA 3LKZA 4BP3A 1KFKB 2JEYA 1DKRA 2IHVA 1UC9A 4RXTA 1LBTA 2CSXA 3H7AA 3DMRA 3B6EA 1TLTA 2VC2B 2VUIB 3GFOA 3SC4A 1QV7A 2JARA 3P0IA 3RASA 1X13A 3ZWYA 4ER0A 5EEHA 4LHZA 5FPPA 3V8NA 1QIFA 3BWDD 3LNTA 1T1JA 4WK0B 3MVEA 1UDAA 4X00A 1CJBA 3FNGA 1NF9A 3KB1A 3OH8A 2A5GA 1RS0A 2XMSA 1FBNA 3M6AA 4LNUB 3SDBA 5BV2P 1H5NA 4KSYA 3QEMA 1MAAA 1YO6A 3JQRA 3QRWA 1NW9B 3AUAA 3L7NA 3QFRA 3H87A 4X1YB 2VCHA 3KFVA 4L9SA 1TGYA 1QVRA 3EVTA 2PGIA 3PC2A 5C18A 2HR1A 4UHJA 2G9ZA 2FCAA 2JFVA 3KQTA 3KDSE 4KOEC 1L5HA 3D6MA 4MPPA 3PIDA 4OGGA 3SJ7A 3DOEA 3GG9A 4M1OA 3VPGA 4BECA 1MVNA 4JUAA 1MTOA 4BO5A 3CKLA 2Y0PA 3N8HA 5GINE 5DIFA 3GFTA 1TU4A 4B0PA 4E5KA 4JLJA 2LXNA 4ZYYA 1EA5A 3GMTA 3ZLJA 2BM8A 1KI6B 2XUKA 3P9RA 2CUTA 4M4SA 5FULA 4P81A 4RVGA 3RNOA 4HQKA 3X0DA 4NZ9A 1DBWA 2DSTA 1M6VB 3N8GA 1NLYA 1EG7A 4AWAA 3E5NA 3K4QA 2HA5A 2BN4A 3MCAA 1E79D 3P0HA 2WAMA 4RZQA 4R31A 2IS1A 1YS2X 1WXQA 1E5TA 3DZKA 2Q3MA 3UJ8A 4F06A 4Q6BA 2PUDA 1G5TA 4XM0A 3THRA 1XZCA 1I3NA 3MMPA 4JR1A 1RLTA 3PHCA 3Q8KA 4GOLD 4ZOLB 3WLPA 1ZCZA 4DWVA 3QX7A 2IY9A 4LV8B 4L6AA 1IHOA 2OXRA 5KYTA 3FCAA 1NYTA 4ZGGA 3AHJA 1KZ1A 4E5MA 5K2OA 1WCIB 1GCUA 1CDOA 5DFAA 4RX1A 3FGZA 1BJKA 1T24A 3LCJA 4XIFA 3H65A 4ARBA 2VQFB 2VDPB 2XGOA 4YRIA 3PXBA 2IU4A 2GI4A 2D59A 2FQYA 3Q9SA 1HYBA 1MN6A 1W96A 1Z5VA 2OO7A 2X3UA 4IRMA 3KKQA 4JY7A 1E7SA 3WK8A 4CTOA 3LL4A 1W2GA 2HUPA 5G1PA 2QZSA 1DAKA 1Z37A 4EI7A 1MGPA 1W4BA 4CUJA 4RTOA 1GG8A 2B0JA 3JRXA 1Y4AE 2PZAA 4CV0A 4PLWA 1R5OA 3K9NA 1DV2A 5BV0A 1DAPA 1W47A 1FLAA 1XZDA 2L17A 1P2UA 1JHMA 1NBWB 4K40A 5TMBA 3QVLA 5E6UA 3TUZC 1RYHA 1DUIA 1SBZA 1VIDA 1L7XA 2H1RA 2X6TA 4E6EA 5JQGA 4DPKA 3R0JA 4D9MA 4KODA 5JAZA 3UAGA 3WBJA 4L27A 2Q29A 3BEOA 2HX1A 4G67A 4G97A 5LC1A 4NH0A 3VKUA 3JVIA 3V48A 3FCYA 5CRIA 4FYKA 2Z5FA 2GPJA 3JRNA 4HNRA 3TZLA 2NYRA 3LIIA 4E4YA 3JQAB 4NNOA 4TVBA 3V6LA 2QW8A 1DWOA 1EXNA 1LWOA 1TT5A 3QBJA 1U90A 3QP9A 2B7LA 4W6ZA 4NWIA 3TQSA 2Q1XA 1J0BA 1DTEA 2LD4A 1ZNXA 4MW7A 5BVHB 2VAPA 1U1FA 2J41A 3I53A 4KMOA 3S0JA 3UANA 4BASA 3ZDAA 3OUTA 3UXMA 1ORDA 1TF7A 3GFPA 5AQ1A 1JYEA 2Z58A 1GNSA 2D5IA 1FYFA 2R2GA 3P2OA 1K8YB 4ITVA 5I7RA 3WXBA 2VNHA 5ICFA 4F1WA 5CEEA 5LYYA 1IDOA 3H1AA 4KQGA 1X9IA 4OB8A 2V6FA 3PQ5A 4MRVA 2HIHA 3ZS8A 1AGRA 1SNYA 1GPJA 2XKBA 2QL5A 1H94A 4C7BA 4WE3A 1F3OA 2UXCB 3S44A 2TMGA 3D6JA 3BTUA 1I3KA 1HKUA 4D99A 1GPKA 1MFPA 4JKOA 4PX9A 4N82A 3AP1A 5GMOA 5GM2A 3VOSA 4OX9B 1CJKC 4K26A 1OFHA 1GRCA 2HBZA 3DJYA 3QVVA 4I55B 1JV2B 2A9RA 1M8KA 1S2NA 2YX1A 4YLYA 1MO2A 1ZC3A 2WJWA 3GBSA 5H16A 5CB8A 4EZIA 4QYXA 4C2UA 2H11A 1N0IA 1T8WA 3QSYA 3UN1A 4ZA2A 5A4MS 1XZKA 1YZHA 5TGDA 2HJWA 4BNFA 3FHCB 3VPSA 4GI3A 4CVNA 3TJMA 2G25A 2NYVA 2QD2A 2H85A 4LHYA 1KFJB 2R1ZA 5LB4A 4PLHA 2BKEA 5D3QA 1X38A 1UKBA 2WZBA 3FMIA 1V4BA 4PPFA 3AI1A 5DNAA 1EWQA 1GZ3A 1JFRA 1N8TA 3AEKA 2VPTA 3DUFB 3ITKA 3M6LA 5B2EA 1W19A 1JU3A 2WWTA 4N3CA 3QIAA 4MWGA 4F4DA 4F9TA 1NJ2A 1SCIA 1X9GA 3HCOA 4DQUA 1I4OA 1ECLA 2B21A 3AJ8A 2HA2A 2Q4TA 1C50A 1FK8A 4HTFB 1T3ZA 4UM5A 5FL7D 3SOPA 2V3WA 2HRDA 2H2WA 4DVJA 1OVGA 1RZVA 2R8RA 5KJCA 1YE5A 3TIGA 2J08A 4B2IA 3NU1A 2EJBA 1KDRA 2ZFUA 3N8IA 4ZAXA 1RM0A 1DAGA 1JHRA 3K3PA 2R00A 1QCDA 4LIPD 4CMBA 4LJ6A 4CCAA 3AVWA 2QVYX 4FOTA 4MMXB 1XVIA 4B3HA 3FTEA 1UT6A 4TS1A 3HCDA 1BMDA 1JZSA 3WK9A 3WFZA 4OPMA 3C1TA 3K71B 2OLEA 3MCWA 3BFPA 3ASUA 1ONBA 3P4XA 5CTAA 2WQZA 5I9MA 3SCZA 5KSYA 1EIWA 3RVKA 3H04A 5C3UA 2X5NA 4NU6A 5HPYB 2CF6A 3HEBA 1O8BA 1IY1A 2WMYA 3DF9A 3IS3A 2HXYA 5FNVB 3OPQA 3UV3A 1JKXA 1DFIA 1QK5A 2O20A 1G17A 1CVRA 2P6MA 2C94A 3G0GA 1SU6A 2O52A 3BCHA 3O2NA 2PMDA 3AUTA 4LOAA 4OJYA 5EKUA 1H85A 3LC0A 4AJOA 5IKPA 1PLJA 1YFJA 2D13A 4KK3A 4RTRA 1SUCA 2J9FB 4DYDA 3EBPA 3FMGA 1QANA 4LZOA 2XUZA 1NP6A 2PH7A 1GCIA 2JATA 5AKZA 4INZA 2C2YA 2IP2A 1M10A 4P92A 2HBQA 2QN1A 2CHVA 2XTNA 1YRHA 3RK0A 2FPOA 4P6VF 13PKA 4QUJA 5ENZA 4M1TA 1EJ2A 3RK1A 5EJ5A 1B0UA 2IOHA 2JJYA 3L1HA 2VT7A 3PUIA 5IJWA 4UHCA 3THXB 3VNQA 3DHVA 1JTEA 4FFOA 1TQ2A 1AJEA 1N7HA 5LYJB 4ASUD 5D00A 3C5EA 3KQPA 2IITA 2BKAA 4G01B 2FQQA 3DBRA 4Q21A 1I0IA 4DB4A 3I9FA 1U02A 5CDUA 3K53A 1UF9A 1CHNA 2IHBA 2ONZA 2X13A 1HOTA 3KK0A 5JVDF 1H4QA 1E9EA 4HXYA 4XRRA 5F52A 1TM7E 1KWGA 1JIUA 2I71A 2JJ1D 3TLZA 5K6TA 3OLWA 3AHFA 1YS1X 2FWIA 3IXQA 3KLBA 2VPPA 2QVBA 4DR1B 2DU8A 5KX5B 1CP2A 3I2YX 3NRCA 1MJ5A 1RLOA 2DP4E 1CNEA 1MX9A 2XUDA 6Q21A 4JEHA 3KSDO 1CS0B 1NI4A 1V43A 3NH9A 1PNRA 2EEPA 2JHPA 3LCUA 1ZMBA 5G02A 1J39A 2ZZMA 1IUOA 4KXUA 3FE2A 2YVKA 5HZMA 2ISSD 1UKEA 5AUNB 2ZRKA 1P5HA 4BGVA 1KAGA 4YPFA 2G8LA 1JMVA 3N28A 2XCTB 4PSVA 1YR3A 2JFZA 5K5EA 3WGIA 1GUDA 1VI5A 1M2GA 2IJGX 3EZ2A 2PX5A 4BFWA 1Y3HA 2A0UA 1M76A 1QHXA 4PG6A 4DFDA 1U0HC 2FRVA 4NIMA 4TYPA 2FZVA 3E05A 1B2LA 1N6IA 2PA0A 2VI5A 2H0AA 5JEEA 4RK1A 4L57A 1M2VA 1SUBA 3BXZA 3PFKA 2V6MA 2ENWA 1GL7A 1SN7A 4L8WB 3RU9A 1EFVB 3GP3A 4HQFA 1JU9A 5A62A 1JHYA 3NUGA 3LT5A 1YCGA 3OF2A 2GD0A 4M99A 3WBFA 1BW9B 4BVBA 5DBEX 1DAHA 3DQQA 3MPOA 4JOSA 5AK5A 4XWKA 1OVMA 2SNIE 1LX6A 3GVCA 3B3FA 4FW8A 4YEDA 4A0GA 3LSTA 4YRNA 3N75A 5ABPA 1E1MA 1B42A 1EJ0A 4EJ0A 5JJIA 1F14A 1ODCA 2JIDA 5JD4A 5CFOA 4HFRA 5KQMA 1CUEA 3Q3JB 2QG6A 3KJHA 3LPMA 3LT0A 5CVCA 3S1AA 2GCGA 5JYEA 5JXHA 4B9AA 1EE2A 1L5VA 4L6IA 2ZT8A 4RMNA 1VFPA 3ESQA 1E9BA 4YMGA 1Z45A 2OECA 1QZ3A 2VA9A 3OU2A 3WWZA 5JZ9A 4KN5A 5DXFA 4YRGA 4G1MB 4W9RA 1ISFA 4TWBA 5CITA 5I8PA 3E7WA 3QVWA 4LWZA 5CYPA 2UUBB 1FDTA 2IYLD 5CP8A 3WLSA 4JI7B 4AS2A 3IE1A 1DKMA 2R96A 3SXJA 1TD9A 2W6PA 3ZCUA 2DY1A 4BFLA 1OAOA 2IC5A 1ZC4A 1AZWA 1E7QA 3DR3A 1ZJWA 4YRBA 3M3HA 2CXNA 1V16B 1WJGA 3KEFA 4CZ2A 1N6LA 2QP3A 3LQ1A 3DZBA 2FWJA 3ZVLA 3AC0A 2BKXA 1D1TA 3AM1A 1FDOA 4U2KA 1L7RA 2QU8A 1P1HA 2TRSB 1M74A 1KJIA 1Z2CA 3VKVA 3G8CA 3RLIA 3Q12A 4TSKA 4TZTA 4EHKA 5DM1A 1OKKD 1GTVA 1Q0SA 1HYEA 1IH8A 1W46A 5LNK6 4HNGA 1EH5A 2P0YA 4A6XA 5IAEA 1O96B 3T95A 1NZJA 1OXXK 2F3UA 3I4FA 3VC7A 2JD2A 3KALA 4KE9A 1T6BY 1ZBDA 2E55A 4MV7A 3OOHA 4WNAA 5F9HA 2XBMA 1WZIA 4X1KB 4ZRDA 4US1R 5ELMA 3BMQB 2GPSA 2GS9A 2Y99A 4LMRA 1E9FA 5INTA 3JQ9A 1CRZA 3KZNA 1X14A 1V1JA 1P62B 1X94A 1YC5A 1CIVA 1U9IA 1T5IA 4OHPA 5KNBA 2GAJA 3HBNA 3KS9A 1YA6A 4DLBA 4MB2A 4XAQA 3EIUA 5C8VA 3RSOA 2VR1A 1XEWX 2H4XA 4OHRA 1NMEA 3STYA 2HQBA 4D9CA 3NNNA 1A9XB 1U3GA 2DBRA 4DIUA 5JI3E 1VPEA 2WIKA 2Z3VA 3T38A 3UHFA 221PA 4F5DA 1GP2A 3MTAA 2R9VA 4JT4A 1GPNA 4RMJA 4UE3S 4WNCA 6AT1A 2GOYA 1C3VA 1L7EA 1P29A 1ZLYA 3OY7A 3PNLA 5A3VA 1FEZA 1QH9A 4WCFB 2G9QA 1TPYA 2C31A 5JS1A 2C8JA 1H6DA 4X84A 1LY1A 4YRDA 1G8KA 2IE8A 2Q6TA 2ZYDA 2XQFA 4MDYA 4F4HA 2ZRBA 3L7KA 3J81k 1WW3A 4Q4CA 1L3CA 1W94A 3DEIA 1G60A 2GEFA 1QIIA 2B0CA 2RBGA 2VJDA 1SBYA 2RJOA 4OIFA 5L7YA 3T7JA 1UWCA 2CNOA 2R66A 4XASA 1MPXA 3HGTA 3PTZA 4I1VA 4PANA 5L3SB 1SBNE 4CLDA 2YHAA 3V3TA 4KR0A 2JCYA 1U5BB 3L0ZA 3P5BA 2X2EA 4QFBA 3KJQA 3D7KA 4TTRA 3IDAA 1VXRA 3MWEA 4RH3A 2NXEA 1QIKA 3FCOA 3FYUB 3V2GA 4A1OA 2BFPA 2I6UA 3AETB 2OB1A 3CN7A 2VXOA 3H19A 4HDMA 4U8GA 4NU8X 1D07A 3A0RB 3N07A 3TLGA 4BBAA 4YJGB 2FPPA 1YVDA 5ALWA 4FD3A 5TXGA 3ZUPA 4QFMA 4NZNA 4BQIA 5BURA 2IZOA 2AEFA 3OIDA 3IFSA 1HLFA 4ITUA 1PGJA 4OQMA 2QTVB 3ORSA 1HNNA 5ALZA 3SSAA 4IL5A 1C30A 3QX8A 2VWPA 4L0QA 5AXCA 3K9FC 4CEJB 1FX1A 4XUDA 2ZQYA 5CA0F 2OBBA 2XUIA 2YS6A 1TDJA 3EF0A 4KIFA 1JG2A 1PJSA 2AXEA 3IVGA 3SXUB 1QRTA 5C1IA 4LF8B 1XTRA 1U2DA 2W4QA 3TJRA 1U0SY 1F38A 2QRMA 3QFHA 4NZZA 3KQUA 2ZRJA 4F6RB 4PYOA 2WYHA 3W4JA 2HPAA 4DKJA 3WGGA 5MGBA 2XQGA 2QT9A 2Y68A 5DHUA 3PR1A 4MEBA 4CI9A 1QHGA 4HDRA 2V9ZA 1N5DA 1S8FA 1Z08A 3HUEA 3KKMA 1VGRA 4LDZA 3R9IA 4AKTA 3B7PA 5BSRA 4NHOA 3WDSA 1R4AA 1E3QA 4BO0A 1TAQA 7GPBA 2I1VB 2V98A 3NOOA 4MJ3A 2XX3A 4RZSA 3CWCA 3FNEA 1LPAB 3VDRA 5TJHA 5CAEB 1H8EA 5B30A 4Q37A 4NZPA 4Q48A 6PFKA 5IVDA 3UMSA 3E7XA 3KKZA 3HVKA 5E0OA 4P34A 4PHGA 4YB8A 3PX7A 3G17A 1QYDA 1RWBA 3DL7A 4HQOA 4FGWA 3CPJB 3ESAA 1GZHB 4HXFB 4JYMA 4QPJC 2B2XA 1C7IA 2BWJA 2RGYA 3CF4A 3FUUA 3JD3A 4QNMA 4R68A 3W5DA 2BTEA 4AI6A 4IDEA 1P0PA 1JG7A 1EXMA 4TTPA 3V2IA 4Z2AA 4BNLA 1XYVA 2I4LA 3H99A 1JJBA 1UBMS 4JLPA 1XL0A 1OYVA 4ERNA 2WIBA 1N4DA 3EPPA 3GH1A 3ANXA 5F64A 5LQNA 1OV6A 3ZDZB 4IMRA 5H9WA 3O4VA 5KCMA 2Q6VA 3FTQA 3PPVA 1BA2A 4QQKA 5FTWA 3VO2A 4YI5A 5BRNA 4QELA 3EC1A 5IAJA 3ENWA 4ZMSA 4ZVKA 1UR5A 3DC7A 1RAIA 5F7XA 2CGEA 3FJYA 3IE0A 4XM2A 4ER7A 3EFOB 2HLDD 2VAMA 3S8EA 5F98A 1S1CA 2XKJE 1E7MA 1KKMA 4XSGA 3M6XA 4CL8A 1MB9A 4PG7A 4J0IA 3IJPA 4GR4A 1VG0B 1ZMTA 3WKAA 4E2FA 1EEXB 4LY6A 2PLWA 3VKWA 3M5WA 4U9IS 3NJ8A 4LF6B 3ICQB 3TB4A 4L16A 6LDHA 4Y6RA 1E63A 2G0NA 5JRZA 2O8FB 5DHQA 1ZBQA 2AFHE 1MB4A 1LVUA 2X7JA 3R3UA 4UMDA 3V4ZA 4CG0A 3ZJVA 2YQ5A 3TNJA 8ADHA 3RYFA 2ATXA 5LSAA 1KP3A 2GA8A 2O1EA 3AJAA 4OI0A 1FP4B 5SY6A 5IWCA 4D3SA 4WZBE 2HXSA 4LGMA 5D85A 3A6PC 2EFEB 5CXSA 3TEFA 3P2KA 4GBGA 4GI1A 4EL0A 4KMMA 1ZK3A 3AZQA 5AK4A 3SQDA 1ZL2A 3NV9A 1PJBA 4K2AA 2ID9A 1TVEA 4PCLA 1VL1A 1PR9A 2VUUA 2VRWA 1MJFA 5J58A 3JARA 1PZFA 1IBLB 1HQCA 1YR1A 1KR2A 3AGQA 3VGPA 5LJLA 1KEVA 1KMNA 2A86A 4CM9A 1N34B 5K0CA 1A9OA 1MKYA 2Q9UA 4P2GA 4LV6A 5FWXB 4P86A 5L3QA 4BXOA 3TLYA 2LIVA 4KU4A 4MUXA 1Z17A 4EM6A 3ZE2B 5ER9A 1TKAA 3QPDA 2J5RA 1N6OA 2G63A 1SA0B 3KR1A 5A5VA 4TUYF 4UMVA 3IUNA 1PV1A 3W6NA 1VHLA 4HUTA 1ZCJA 1LTHR 1AKYA 3LYUA 3PFNA 4QAJA 4BO6A 2HSEA 1YMQA 2BSXA 2Q8NA 2X0FA 4YAIA 2FEKA 3HJGA 2D1YA 3AKEA 3QE3A 1TJYA 4MUEA 2O8CA 3HBMA 5KCZA 1N2JA 3WWPA 1AUPA 4U3JB 1ZESA 1QG0A 2R1UA 4Z9FA 2BFEA 2ZT7A 1MNAA 4C0AC 2K6GA 2F8TA 3IAHA 3UHPA 5EE9A 2I87A 2I3ZA 4REQA 2J9XB 4C2BA 3PRJA 4E5PA 5CG2A 1MA3A 4HRYA 1RC8A 5EYPB 3M89A 2PO7A 4V0MA 3HCEA 3RU2A 2FG5A 4I08A 3WL6A 2QUZA 4HPJB 3GRZA 1UBUS 3VR5D 4XJTA 2WKWA 2X0DA 4BQPA 2FPUA 3GFBA 3LQKA 4KJXA 1Y3IA 5E3HA 1XLWA 2PZKA 2ZKLA 4P36A 3O84A 2Y76A 3VVBA 1P9WA 3U44A 2IHKA 3BZBA 1A4IA 1P8AA 2QORA 1L5LA 1WAMA 4L76A 3FHTA 5AHWA 2H8GA 1YR8A 1K89A 4LJKA 5BQFA 5K0ZA 2X9VA 4BNGA 1HTBA 4MVJD 3EDYA 5H3LA 1YVUA 3OJXA 4EY7A 5HGXA 5KPDA 1WBBA 5HF6A 2MYUA 4G0VA 4AF8A 1ZA2A 2C5SA 4DY4A 1O9BA 4HXEB 3GLGB 2RCNA 1Q19A 2I1QA 5GOTA 5E7JA 1SULA 1PJ2A 2XZPA 3LW8A 1XVAA 4JUFA 3BXEA 3P5SA 5C3MA 1NV9A 1UC8A 3PUHA 5I45A 2F1KA 2QTTA 1SD5A 2RAFA 1XHLA 2YBDA 3DVRX 3H18A 3NEYA 1XDWA 1GY8A 2Y6UA 4FYYA 1MT3A 1SEPA 1PL8A 2HTEA 5DNVA 5I8ZA 1L4EA 3QXCA 5AI6A 3TW8B 2D0OB 4DEXA 1DARA 1O54A 3OLZA 1I2AA 4CQLA 2DHEA 2FMXA 3ZK8A 4RELA 3VKHA 4N18A 1HDGO 4UNPA 1U3TA 2CVZA 1K92A 3QOXA 4KXMA 4ZDWA 5AW8A 2PX0A 5C2JB 4ZVNA 1QP0A 1TE2A 2F43B 3KOWA 5C4GB 4J1SA 4KHZA 5T3YA 1PD1A 4CR8A 5JSFA 1ZCFA 5LU8A 4I1PA 4DDHA 3UWDA 2P8JA 4KITB 4LKOA 1WHTB 1YJAA 2R6DA 2OO5C 3ZE0B 3TLCA 4EOGA 4HQRA 2JFFA 3GVIA 1V3UA 3EEIA 5JW6A 1TYZA 2BSAA 4ON9A 5AR1A 4C4PA 4OQEA 2GAFA 4J1NA 2DFVA 2NNWB 3IAEA 4G0PA 4ISCA 4E7PA 3D0KA 2O1XA 1PEDA 3H2SA 1SUAA 3U1BA 1SVLA 3NI2A 2BC9A 2FSVC 1FDUA 2XNDA 1XLTA 4FWBA 1PLKA 2ZYHA 4MCHA 2BE7A 2BEWA 1KSHA 2F00A 1QO0D 2O7QA 4REMA 3ZWDA 4OTZA 5KYYB 3KJNA 3I0ZA 2WVHA 1JSCA 3AHCA 3EGXB 5A3JA 3T7AA 4BYGA 4XCVA 1BXKA 2IOFK 5C4MA 5EKSA 1ES9A 3WL8A 4L73A 5C31A 1SUFA 1TOAA 4AJHA 2QX9A 4QHYA 4QDXA 2N0SA 3N2KB 4RTJA 4P7BA 1UQTA 1VL5A 1J8YF 3HXOA 2VZLA 1QE5A 4WN9A 3E15A 5K09A 3MT7A 4XSVA 2D0IA 4GGOA 5KVQA 4TTQA 4AP6A 3EPRA 2VYNA 3F2IA 2WD7A 3WLMA 4HNVA 3M49A 1OBCA 3CN9A 1RXVA 1VLVA 5JTUA 3I2JA 2RHDA 2QBYA 3IUPA 3PC4A 4OP2A 3C6XA 1FDWA 2XYQA 3AESB 5JCJD 4ID3A 5TIIA 4YMIA 4B7CA 3NM6B 3E6AA 2FQ1A 4XYBA 1KKLA 5DW3A 3TZKA 2G70A 2WYOA 2X2PA 4OM8A 4C4AA 3U7IA 3L0PA 5AVWA 2G88A 2P7IA 2WM9B 1KY4A 1NKSA 3A9VA 3RHFA 3ZLUA 4P4NA 5ALIA 4PIPA 5JSZB 5P21A 2D7JA 2WU0A 4PIMA 1PE0A 4UXHA 1GNQA 2ZIVB 4IF4A 2VJQA 3URMA 3CLRD 3O6VA 1TJPB 1N3IA 1UBJS 2VQDA 3VSBA 3SKVA 5TMPA 2DQSA 2YFKA 2YQ4A 1B1AA 2NSYA 2ZIZA 4OMUA 4DIEA 1KYIA 1OXMA 2IXAA 4URZR 5DI9A 5J9FA 2V5AA 3TQOA 1WKBA 3ZJTA 1R0SA 4JLDA 5TJ9A 5JISA 2XCIA 1ISRA 1KI3A 1VXOA 2OXTA 4GU5A 1TMKA 1PV2A 1LTKA 2DB3A 5ALQA 4MMYB 2SCUB 3OCXA 4FONA 4FOLA 1Z7WA 3I28A 4LDNA 4R1QA 1SCJA 2WWYA 1AD2A 1YJ5A 1TVMA 2KBFA 5M34A 1D2CA 5C35A 2IYZA 2H4HA 4RHEA 1NW6A 1NQVA 4Z7QB 4DA9A 4V0RA 1N6KA 4LYFA 1V8ZA 1P1RA 4A16A 2DYKA 3C74A 3IMFA 2FOXA 3VH2A 1OYYA 2FJPA 4E5NA 4XGNA 2GTHA 1QWSA 1KI8A 1WDKA 2C3YA 2QUIA 4R7TA 4B33A 3S99A 4ZZ0A 5I7HA 5IJ0B 1SKBA 3ZG6A 3L8DA 4KTVE 3L92A 2EZ9A 2GRJA 2HRQA 2WMNB 1GZVA 1ZD9A 3D8SA 4NY1A 2WWGA 3D1LA 4A2WA 5K8VA 4HYYA 3SAJA 5EWJA 4G25A 4TTSA 5AVYA 3D6TB 3D5EA 3TOCA 1NVVR 1EVZA 3UNXA 1CQPA 1R6UA 3DTYA 4JGGA 4LHXA 1SO8A 3B89A 3VYSB 1LZLA 4MUJA 3HXQA 2BH9A 2ZJ5A 4MINA 5AM3A 2RFLA 3FBGA 3WLFA 2BDTA 3ESZA 4I9GA 3V8BA 1X7HA 2CFTA 1PL0A 1WD7A 1GPBA 3OZSA 2VOEA 3NOQA 4RFVA 4K0KB 1L8XA 2C9OA 2C5EA 3UGKA 1IZ7A 3W3AD 4JASB 3Q3VA 2EWMA 3QMVA 8ABPA 3U40A 2C8VA 3ML1A 1DG3A 1KIFA 2ZB7A 3OIGA 4ZRNA 5IANA 1ZCBA 2E2WA 2ZTVA 2IHJA 2Y05A 4EVQA 1W1IA 1U9ZA 3H05A 4I5EA 2HPHA 4YJ2F 1ZKMA 1NT2A 1ZUNB 2J0QA 1NWHA 1QMPA 2I6SA 4AN4A 1VMDA 2RC5A 4FX2A 4U7FA 4C3OB 2IV7A 1C8LA 3VSCA 1Y34E 1I1OA 1XA3A 2I2XB 2R85A 4E08A 1JUDA 1LLDA 4KXFB 3DT9A 2O2EA 3D3WA 1SGWA 1TIKA 2QYSA 3BTSA 3U26A 4PC7A 4BB9A 3THWA 2FPXA 3NHBA 3GRRA 4DA8A 1DPFA 1N2ZA 4INOA 4MWZA 1U8EA 4ARSA 4C21A 2EZTA 3KUXA 1XN1A 2E1PA 1ZUHA 2UVQA 4ZCPA 1PBNA 3BILA 2JHCA 2YW9A 3IBSA 4QWWA 3B60A 4G81A 1PVDA 4N49A 3F9IA 4NBVA 3CX6A 3FHOA 4GYKA 1CUZA 3A6LA 1CUJA 3GK3A 3O03A 1AS0A 4FC7A 5DLYA 3JWHA 4GLLA 4NEQA 5JAUA 1A4RA 4PGHA 1BDJA 3VPFA 3LRTA 2P7HA 2DWOA 3NIBA 1YK1A 3E84A 3EE6A 4N6OA 1KMMA 2XOKA 5ANRB 5C8DA 2H51A 2BGJA 5K2MA 2O8EB 4YH1A 2H1IA 3KG2A 1UXHA 1XXHE 3CUTA 1U98A 1XDZA 2EX0A 1GA1A 2EIXA 1RQLA 2X4LA 3K0AB 1U9JA 1AKTA 4IV5A 2J9ZB 1V37A 4HTAA 4KFRA 1KDYA 3SEQA 1Q6YA 3F8WA 2DETA 2R4QA 3TNDA 4AUKA 1O7JA 1R8JA 1UEIA 5DNDA 2PK3A 4BNNA 4Q1DA 4PU0A 4X71A 4ZYWA 3A1DA 3FKJA 2W6JA 4TWAA 3WA6A 4AO7A 2P11A 1IQRA 1QE0A 3P4YA 3CRNA 3TVYA 2WOOA 4LECA 2QX4A 4KVZA 4LY0A 3AFNA 2F17A 2CNLA 3VZBA 1EVKA 3UICA 4US2R 2ARKA 3QMPA 3NVDA 4MZDA 2FI1A 3II6X 1HR0B 1LJLA 3HEAA 1V7CA 4YECA 1ODJA 3JU3A 1E2UA 4OGKA 3KLNA 4UTVA 2IQ5A 3ZCSA 1J6UA 1R0ZA 2ACKA 2JHGA 1RFGE 2LKCA 4ZT3A 2Z5GA 1U8CB 3C3MA 4N0PA 4YJKA 3RIYA 2PPVA 3PQ8A 2IYQA 2JIOA 2Q5LA 4E30A 3A4LA 1CZLA 4ISBA 1ZGAA 1ZZGA 4L3WA 5IBQA 4Z0TA 1CJCA 1Z47A 4J6FA 1TZ2A 5H3CA 2KM1A 1X7YB 3UXYA 4QTUB 3K09A 2QPTA 1VRCA 4TV9A 5BQPA 4EK9A 2JLZA 4UD6A 4DLTA 4TZKA 1PNVA 2VZEA 4OVKA 5LQAA 2AR9A 3LBHA 1PR3A 4RYDA 4DV6B 1D7OA 1QZTA 3PVCA 1ZYUA 2YVAA 2FSPA 4H4CA