3GO4A

Crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
RIDTESAHSARIYDYIIGGKDYYPADKEAGDAMSREWPALPVHMRANRDWMNRAVAHLAKEAGIRQFLDIGTGIPTSPNLHEIAQSVAPESRVVYVDNDPIVLTLSQGLLASTPEGRTAYVEADMLDPASILDAPELRDTLDLTRPVALTVIAIVHFVLDEDDAVGIVRRLLEPLPSGSYLAMSIGTAEFAPQEVGRVAREYAARNMPMRLRTHAEAEEFFEGLELVEPGIVQVHKWHPDAATADGIRDEDIAMYGAVARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein of unknown function DUF574
publication title Crystal structure of Rossmann-fold protein of unknown function (DUF574) (NP_823353.1) from Streptomyces avermitilis MA-4680 at 1.80 A resolution
rcsb
source organism Streptomyces avermitilis
total genus 84
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04672 Methyltransf_19 S-adenosyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3go4A00
3R9XB 3GGDA 4GQBA 3EVCA 3OU2A 3NDJA 3GRZA 1JG1A 1I1NA 4YUXA 3FRIA 2YXDA 3OZRA 5FWAA 3UZUA 4AZWA 3OPNA 5GIPE 4YMHA 3SMQA 2IPXA 3RIEA 2G71A 2Y1WA 2UYQA 2E5WA 3DOUA 1Z3CA 2FYTA 4C06A 3KR0A 2IH5A 4PYMA 5E1OA 1F38A 1SUSA 3SSNA 3NW9A 5EQJB 5CCBA 4RTQA 2I9KA 3GIWA 3BUSA 1KPHA 5CM2Z 3TRKA 4U7PB 2R3SA 3T7SA 3RW9A 5BW4A 5EZQA 3PX2A 2K4MA 2CL5A 2C7QA 3GU3A 3TKAA 3HCAA 1N7IA 3PVCA 2ZULA 2DULA 3ELDA 4HSGA 5LQNA 5CVDA 3M33A 4FGZA 3ELWA 1XJ5A 3EMDA 4YV2A 5DLYA 1KPGA 5FUBA 4OA8A 4XUEA 3LBFA 5K0CA 3G5TA 3HP7A 2UYOA 4C08A 3X0DA 3BWYA 4P7FA 5CIYA 4PIPA 3UA3A 3A7EA 5E1DA 5EKXA 1YFJA 3KPWA 5GIOE 4RTRA 2I62A 2YR0A 3NVMB 3P71T 3TM5A 1L9KA 5EGSA 4AUKA 1KIAA 2PWYA 3K0BA 4RYLA 5T6BA 5LQJA 4RTMA 2FK7A 4DA4A 1M6YA 4RTJA 1DCTA 2WK1A 4R6XA 3SX0A 4P7GA 2BR5A 1XCJA 1O9HA 2JHAA 3P9CA 4FT4A 4F86A 1ORHA 1JTFA 5JR3A 3NVKI 4KWCA 2PKWA 1PRYA 3IEIA 3MQ2A 1NW5A 4KIFA 3GRRA 5CVUA 5DM4A 5F2OA 5GWXA 4QQNA 5BP7A 5EEGA 3HM2A 4RWZA 3EGIA 3LSTA 1NV8A 2O0LA 2AZTA 3EVFA 9MHTA 4ER7A 3L8DA 1BC5A 4JXJA 3SR4A 3UJCA 4DF3A 1X1BA 1EJ0A 1BHJA 1H1DA 3E8SA 5GOZA 3V97A 5IKMA 4E2YA 3BWCA 4GOMD 2HR1A 2PLWA 1EJ6A 5E8JA 2ZLBA 4OBWA 2YXLA 4FSDA 2JHCA 3LKZA 4QDKA 2PV0A 4A6EA 3VC1A 3A7DA 3M6VA 1OR8A 2H00A 3CBGA 1INLA 4R6WA 4OQDA 3JWJA 3FRHA 4LWOA 2PXAA 4QDJA 1YZ3A 4WXHA 2PX8A 2P1DA 4GF5A 3P2EA 3B7PA 4PGHA 5EMLA 3LX6A 3TMAA 3GO4A 3P9NA 5FA8A 3GWZA 3UA4A 2IH2A 4C07A 1KYWA 1R6AA 1NW7A 1X1CA 4EQZA 3E7PA 2EJUA 5HZMA 5K0EA 2NYUA 3MCZA 1AF7A 1L3BA 2VDUE 2OBFA 4P58A 5C1IA 4R05A 3GDHA 3SSOA 3B3JA 7MHTA 4GEKA 3I9FA 2IDJA 1G60A 1NBHA 3THSA 3D2LA 4LWPA 4RV9A 3PFGA 4ER5A 1ZHFA 2O07A 3B3FA 2IBTA 1NE2A 4QVGA 1G6Q1 1DUSA 1WXXA 2IGTA 3ORHA 4E30A 1VQ1A 1ZGAA 3EVGA 1SQFA 2H11A 3LKDA 5EMJA 5LQKA 3DXYA 1AQIA 5IH3A 5K05A 5GM2A 2B78A 5GINE 4ISCA 1KHHA 1NV9A 3LECA 4KVZA 3MTEA 5E8RA 2YVLA 2P3LA 5EIFA 4KIGA 4RTOA 3KR1A 3P9KA 5LQCA 3PX3A 3IV6A 5FHQA 4YUVA 2P40A 3LCVB 3H2BA 2CKDA 2GPYA 2PBFA 1KXZA 1YZHA 5FWDA 3HVIA 3OFKA 4GC5A 2G70A 3JWHA 3UFBA 1B42A 1WXWA 4NECA 3TR6A 4BLVA 4BP1A 2Y1XA 1TW3A 2PSSA 3KPJA 2EG5A 3OFJA 2B3TA 2BZGA 3KQPA 3KR2A 5P8WA 4GUAA 1UIRA 1X1AA 5EKUA 3OU6A 4FS8A 1VLMA 4PWYA 2ZVJA 5GP1A 1XTPA 5FCDA 2ZBRA 3M6UA 3MHTA 3LCCA 3FUVA 3LCUA 2HTEA 4P7KA 2AVDA 3A25A 4RVFA 5DTMA 3FTEA 4PINA 3HCDA 1KPIA 3A27A 5T64A 2JJQA 2OYRA 2IBSA 2ZW9A 4HGZA 5D1HA 4OX9Y 2XVMA 4EKGA 1WY7A 2HV9A 2ZBPA 1IM8A 2AR0A 3UJBA 1M0EA 3DH0A 2B2CA 3LDGA 3UJ6A 2OO3A 3GRYA 5CCXA 4R8SA 1VP3A 3R24A 1FP2A 2P3QA 2PT9A 2VDVE 3EEYA 1QAOA 1TW2A 3O4FA 4KDRA 4GOND 5GM1A 5LQAA 2BR3A 5EMKA 3M6XA 4CTKA 2PX2A 1QANA 4KW7A 5JUWA 2V7EA 3NTVA 3KPUA 3UJ7A 1X1DA 2KW5A 2ZWVA 3CC8A 3MB5A 3HCEA 3B3GA 1D2CA 3M6WA 2ZIEA 2QYOA 3AJDA 3PTAA 4QPNA 2OB1A 4GBED 2P3OA 4M38A 2AN4A 1D2HA 3NWBA 2NP7A 2P35A 5FTWA 1KYZA 2GA9A 2ESRA 2ORED 3LGAA 2P7IA 3R3HA 1ORIA 5FADA 3TFWA 3TPZA 3UWPA 1AQJA 3GRVA 1P91A 5DX0A 5MHTA 3Q87B 3V8VA 1JG4A 3G2QA 5DSTA 5FHRA 5EEHA 4HC4A 5EZSA 1XDZA 3GXOA 4V0RA 4R8RA 5M5BA 2P41A 2H1RA 3IHTA 5KQSA 4M36A 4YV1A 2ZZKA 1D2GA 3GJYA 2GH1A 2UZ4A 3O7WA 3NJRA 4O29A 3EVBA 1RJEA 4CKCA 3T7TA 5BXYA 1RI4A 5EIWA 1L3CA 2PY6A 1YB2A 3K6RA 3GRUA 3G88A 1HMYA 3OE4A 5E9QA 4YUYA 2NP6A 5FQOA 3EGVA 3PS9A 3B89A 1L3IA 5DRYA 3OE5A 5BW5A 2ZZMA 2YUIA 2HNKA 4MTLA 1P1BA 3CJQA 3P97A 5CVJA 1JR4A 5HOQA 3DULA 3T7RA 2AOXA 1Q0SA 4HH4A 2OXTA 4PYQA 2NXCA 3EVAA 3G8AA 3FTDA 4GC9A 2FK8A 4PYOA 4YUWA 1X19A 5DRTA 5K0LA 2I6GA 2I7CA 3PT9A 3G8BA 3JWIA 3PB3A 4PCAA 4X41A 3QOWA 5KVAA 3BT7A 5CVVA 5DM2A 4PGGA 4RVGA 3FTFA 2EX4A 4E31A 3IYLW 2YTZA 3DMFA 4EMSA 3BXOA 4PYLA 4EKIA 3ER8A 1RJGA 1ZQ9A 3SXJA 5HIMA 2QRVA 4B17A 3OZSA 5E2BA 5EVJA 2ERCA 4HTFA 1BKYA 2NXNA 3KPYA 4X1OA 4IV0A 5K0FA 1I4WA 3ERCA 3A26A 2Z6AA 2BM8A 1RJDA 3TLJA 2IDKA 3DUWA 3E05A 4OA5A 3QV2A 4LECA 2AOTA 4GOLD 1QAQA 2OY0A 4BLWA 3KQSA 2NXJA 2PVCA 4C4AA 3BWBA 2Z6UA 3JWGA 5E1BA 3HTXA 1YF3A 1QYRA 3VC2A 4YV0A 2O06A 3FPFA 5EMMA 4DQ0A 2PT6A 3P2IA 5K0GA 1P39A 1Q0TA 1JG2A 5DSXA 3MTIA 2CMHA 5ERGB 3DTNA 1R8YA 3I5UA 3M4XA 2IFTA 4QVKA 2O05A 4PYKA 1VIDA 4X63A 4M7RA 3TQSA 3CCFA 3ER9A 2GLUA 2XYQA 5DPMA 5C0OE 4RTKA 2NXEA 3C3YA 3P8ZA 2CMGA 1QAMA 4HGYA 2HWKA 4XUCA 5KQRA 4C03A 1MHTA 1WZNA 3EVEA 4P7JA 1EG2A 2AOUA 2GB4A 4DZRA 4POOA 4RTSA 4BY9E 4FZVA 2PJDA 4LG1A 4ZTBA 1M6EX 4RTNA 4X60A 4Z2YA 4CWAA 3AY0A 1R8XA 5DX8A 5EG5A 3RODA 5ICGA 4RX1A 1ZKDA 4WVLA 4C05A 3CVOA 1XCLA 3P9IA 2ZIGA 5HIJA 3THRA 1U2ZA 1XVAA 2A14A 4FR0A 2PWPA 4KDCA 3SVZA 1P1CA 1JQDA 2EJTA 4K6MA 3KU1A 5K0NA 3FUWA 3ME5A 5CUQA 4F84A 5HILA 3ID6C 3C0KA 3LL7A 3M70A 4MQ4A 5LR6A 3TOSA 1YUBA 3KQWA 4DCGA 2QRVB 2ZIFA 3OZTA 4HG2A 4DMGA 4PNEA 3FUTA 1WS6A 4HTFB 3DLIA 1EQAA 3HA5A 4PYIA 3A4TA 2JG3A 4QTTB 1R74A 4CTJA 4RTLA 4HRAA 3UJ8A 3NMUF 2VP3A 4M37A 3G5LA 1DL5A 2OZVA 2UYCA 2Z6QA 5G02A 5DXJA 2FPOA 4QPPA 2LD4A 3OU7A 2JH9A 2BM9A 3HCFA 3KQVA 2AOTB 4DCMA 4A6DA 2G72A 4Y2HA 4CKEA 4EVIA 4BP3A 2DPMA 2FRXA 5K0JA 3G89A 3VSEA 3EMBA 3KKZA 3LBYA 5DWQA 3F4KA 3PLAE 4UOEA 3CJTA 3FTCA 1NW8A 1SVUA 3DMGA 4V0QA 2AOWA 4BLUA 4YUZA 4ER3A 3U81A 2R6ZA 3DR5A 5ICEA 3EVZA 3HA3A 2ZZNA 3MGGA 4L7VA 5DTQA 4RVDA 5DM0A 1I9GA 1VP9A 3P2KA 5C9ZA 3TM4A 1FJXA 4OBXA 1RI3A 3KQYA 3AWIA 1G8SA 4DM3A 1T43A 1O54A 2AOVA 2OPBA 1VL5A 3ELUA 3KQQA 2AOUB 2C7RA 3ANXA 2AVNA 3FUXA 2PXCA 1FPQA 5B1SA 2QY6A 1N7JA 5K8VA 1NT2A 3C3PA 3GCZA 2PGXA 1UWVA 1V39A 1FBNA 1IXKA 1PJZA 3FPEA 2IH4A 3KQMA 4XCXA 1ZGJA 5HEKA 3VYWA 3MERA 2VS1A 4QQKA 2O57A 3BGVA 3UJAA 1O9GA 2VZ9A 3FPGA 5LSAA 1IY9A 2B25A 3Q7EA 4E2WA 3SGLA 3ELYA 5KS2A 1VPTA 3I64A 1G38A 2VDWA 5EHIA 1XXLA 1VE3A 2V74B 3KPVA 4QTUB 4E33A 3LDFA 1JG3A 5CVEA 4RTPA 1SKMA 1RI2A 1RI5A 3BGDA 4X61A 4XUDA 5K0BA 3BZBA 3R6TA 3DP7A 3HVJA 1NW3A 5FULA 2ZSUA 3HEMA 4C04A 4E2XA 1XDUA 2BR4A 2WA2A 3KHKA 3KR9A 3HCCA 4FP9A 2P7HA 4PYNA 5E2AA 5EOVA 2G8NA 5E1MA 2WA1A 3G2MA 1ZG3A 2FCAA 4RSRA 1G55A 2OKCA 3G7UA 5F2KA 3DLCA 3T0IA 3TKYA 10MHA 1TPYA 4MHTA 5DXAA 5HIKA 1FP1D 3FPHA 4PIMA 4AZVA 1NKVA 8MHTA 3FUUA 2CWWA 3BKWA 4RVHA 2ZCJA 3REOA 3UBTA 3HCBA 3KQOA 4KRGA 5T67A 4MWZA 4AZSA 4H0NA 1R18A 1JSXA 2YX1A 4OQEA 3C6MA 3I53A 4E70A 2BH2A 4AX8A 1L1EA 1XDSA 5EC8A 1AV6A 2JH8A 1NW6A 5HIIA 1WG8A 4PCLA 4PONA 1VBFA 4Y30A 2PX5A 3DXXA 3LHDA 3BGIA 2YQZA 4G56A 4GOOD 2AS0A 4E2ZA 4YMGA 3FYDA 2QE6A 2ZBQA 2AN3A 3FPJA 4ER6A 5LQRA 1Y8CA 3CJRA 4PYJA 1UFKA 3HNRA 5K03A 5EHGA 2HMYB 1N2XA 3NDIA 3BWMA 5DX1A 4EK9A 2EFJA 3I58A 4U7TB 3MAGA 2ZTHA 3FYCA 2N47A 2XYVA 2ONYA 3HVKA 3WSTA 3S68A 5H02A 3SM3A 1G8AA 2B9EA 2PX4A 4IKPA 2FHPA 4ER0A 4FSXA 4E32A 2IP2A 4MIKA 2ZWAA 3KQTA 3OCJA 4F85A 5F2NA 3LDUA 3SSMA 3R0QA 5E9JA 3DXZA 2ADMA 3HA7A 3LPMA 2UYHA 3B5IA 5DTRA 1EIZA 2GS9A 5K01A 5CD1A 1QZZA 4FT2A 3E23A 3HVHA 2C7OA 2NNWB 1SQGA 3UJDA 1JTEA 3FZGA 4DKJA 1RI1A 5DM1A 1R00A 1JSZA 1BOOA 2ONZA 2F8LA 2OB2A 2Q41A 4ATNA 1HNNA 5FA5A 3C6KA 5LQUA 4IWNA 3UJ9A 2IIPA 4CXMA 1JQEA 3GNLA 5ICCA 3EEOA 2XBMA 3PFHA 5ICFA 5FQNA 3QOXA 1YFLA 2P8JA 3BKXA 2JHPA 2G1PA 3G2PA 2XVAA 2YXEA 3MCTA 4IV8A 1MJFA 1SG9A 2PXXA 5DT2A 3AXSA 4AZTA 1NBIA 4CKBA 5EPEA 5E9WA 3EGEA 2QM3A 3CKKA 1RJFA 1KP9A 1JQ3A 3O31A 2C7PA 5HFJA 2AN5A 3NWEA 2XYRA 5K09A 5KYGA 3EVDA 5U4XA 1EAMA 3CGGA 1F3LA 2ZFUA 5D1NA 3EPPA 3G2OA 3AXTA 1KR5A 3DMHA 2GAFA 1SUIA
chains in the Genus database with same CATH superfamily
4D3FA 1T35A 1W47A 4P93A 5E3IA 1RQLA 1U02A 4JR0A 1VKRA 1DFIA 5DGCA 4CKXA 2RGGA 4JBXA 1T0IA 4MI6A 2ANBA 2ET6A 3JYQA 5AP9A 2HRQA 3OVMA 3J81A 4DR2B 3ZHCA 1ZEMA 4E5YA 1IBMB 1ZWLA 2IPXA 2D7JA 2H59A 3GVPA 4OXKA 5IBQA 4O2AA 1QONA 5I01A 4OYRA 4EPYA 3RVDA 3KR0A 3ESQA 4KYTA 3DZHA 2J59A 1PS8A 1FVOA 4W5JA 3DZFA 2OXCA 2G36A 3H2JA 3MS4A 1R4MB 4I9UA 4O2RA 4WZ6A 2NUTA 2R5WA 3W04A 2HSEA 1NJ1A 4ZI3A 1AXGA 1L4EA 3HXKA 4U2BA 5BNWA 5IBCA 3EIUA 4MV5A 1VSUA 3C3KA 4LDZA 1LX6A 3QFRA 4MWGA 4YCBA 3GLFE 5LQNA 1D2NA 2PFSA 1E9BA 1U94A 4WFIA 2FFAA 5TEVA 4NHEA 4CG2A 2P9TA 1U8TA 2PL3A 3KLNA 2UKDA 3SM9A 1YDFA 4BFSA 4YV7A 4HDKA 4CKBB 1H2RS 3Q4GA 3QKSB 1P4AA 5CIYA 2R48A 1ODKA 3MJFA 5JCJD 5KOHB 5ECYA 1E9CA 4URZR 5JTUA 5GIOE 3GN1A 1JBQA 4UUPA 3NAZA 4PVDA 2QTWB 1AKUA 4E5UA 2IKQA 4ARUA 1W88B 1T36A 2X5KO 5LQJA 4CMCA 1DCTA 3W5BA 1EZ4A 4RTJA 2G8LA 2FJUA 1XEXB 2JKZA 3EMKA 3BTSA 1ISJA 3LUFA 4OGFA 3MNFA 4AVYA 4CQJA 3STXA 2VXCA 4H7EA 4M1SA 5E7JA 4MMYB 4B3MB 1YA8A 2D0PB 3BTVA 4KQ9A 2AD5A 1IZ8A 3QLVA 3B8HA 3MBKA 4E12A 4F12A 4F2WA 4OK3A 5HM8A 2X6RA 4Q1FA 5JH7A 3N6RA 2X23A 2ZUDA 4GS5A 4NYIR 1JU4A 4IS2A 2KJQA 2HF2A 4JB3A 1XP5A 1ZAYA 2R44A 3V97A 1GQ2A 4RABA 1R1DA 3ZE0B 3UPTA 2OCKA 2E4AA 2E82A 1Z38A 3IP5A 2BMWA 2YNMD 2M1ZA 4OYHA 5EY5B 2O8CA 3EULA 1NKSA 3LQ1A 4R2XA 3ZTTA 1H0SA 4GOXA 4C5BA 4EYKA 1P4SA 4WPGA 2H2AA 1A8HA 2HA7A 2LXNA 1XCPA 2FSUA 1YB7A 3L93A 1CYDA 4O4IA 4R1MA 3AFNA 4Y9UA 4XOUA 4CLDA 4GXNA 1DPGA 3AYZB 1XRRA 3FRHA 2HU7A 5LMCA 1XCOA 3I34X 4K0KB 3X43A 2MR6A 4EUSA 1KK2A 4GF5A 4INPA 4PLVA 4HQKA 3LX6A 1KFJB 3HFRA 5IUJC 1ZIYA 2VAVA 4QXRA 4JCCA 2OC4A 2GK6A 1KOJA 1OBFO 3DBRB 1PQUA 1WV1A 4ZOBA 1VHWA 2I3AA 4FFWA 4JMLA 2IPOA 4ZVQA 4WLEA 1EK1A 1G2OA 2GLXA 3QX8A 4LJKA 3SF0A 4XA8A 3E9MA 4JX8A 4MVXA 4EFMA 3GOQA 3TAHA 1RLUA 3SYLA 2IDJA 1NXQA 4AQYB 1NN0A 3DQZA 5IHPA 5IVKA 3CT6A 4QVGA 4HY3A 3CGWA 3W4JA 4AXXA 1E3TA 3KWFA 4YAOA 2NQ8A 4QBIA 2YIVX 1AQIA 1YS4A 5KNLA 2F55A 5GM2A 1RTTA 4U1RA 2B78A 5TX7A 2EGUA 2WVJA 4OPMA 3NIDB 3VNBA 3SK0A 5LBTA 1NF2A 4ZEOA 2D2FA 2QMHA 1CE8A 1UCFA 2HJSA 2OXRA 5FJIA 2XJ4A 5DYTA 1YZHA 3I2FA 3P96A 3GVXA 3NTRA 3RYHB 1Z6TA 3MCWA 3P2OA 1KI1A 4V0MA 2BTQA 5IFKA 1VE9A 1XWFA 3EF0A 3B12A 3TR6A 3ZEIA 4BLVA 1TMOA 2J5KA 2C2ZA 1Z3IX 3E70C 2UV8A 1RQRA 1X77A 5EL0A 1UIRA 1J2TA 1UOOA 2DWOA 4G5HA 3EPJA 1SOUA 1QVWA 3O4JA 3KJXA 1Z0ZA 1QBGA 1XTPA 2G17A 3H6GA 3KRTA 3MHTA 4DHWA 3F6PA 4YYZA 2ECKA 3RFUA 4HGZA 3GUZA 5CRIA 1MOZA 3SR3A 1QV9A 1XFDA 4WNYA 3IRVA 3RRMA 4HNQA 3HKCA 3WDMA 4ARZA 3M4NA 4OQNA 4C2AA 1PK8A 4BE4A 1XEFA 4YJFB 3O4RA 3RADC 2C96A 1VP3A 2V6IA 3GFOA 5ULLA 1IBKB 1ZKMA 4Y2VA 4X3OA 3GFVA 1TMYA 3CE6A 1I7SB 1J0DA 1J99A 3KC2A 4NH0A 1U1DA 3R7DA 3TLZA 4WQMA 4FFBA 3K9BA 2GESA 4DA8A 3SHWA 3WRYA 2I99A 3JWEA 1S3FA 3L8HA 3R5KA 4AECA 1QFSA 3ANYB 4N8SA 2DPYA 4OOEA 3G3EA 4GXRA 2OCAA 1XZDA 1Y37A 3PLRA 3UJ7A 3VHQA 3LQQA 5HHTA 2DCMA 5KTRA 2FA9A 2XF8A 4N7RA 4X90A 3OP1A 2XKAA 3ZLUA 4IDNA 1FTGA 1KVRA 1NPYA 1OCEA 2VDRB 2OB1A 3E5RA 4GZMA 5DGXA 3IBGA 5KKNB 1VE1A 1L7DA 3BRCA 2E5LB 3WGYA 5AOBA 2P7IA 3R3HA 2ZAGA 5B55A 3GNSA 3RFXA 4EUFA 4JYAB 5I6DA 3BA6A 2G1JA 2IK8A 1S2MA 1RLOA 4HC4A 4WFQA 5EZSA 5B6IA 1E64A 1NP7A 1V7QA 1XU7A 1TMGE 2IVFA 3VTFA 4DMKA 5BWNA 2P1RA 2C4TA 5KQSA 1XI2A 2V03A 3AH8A 3RSFA 1TQ4A 1D2GA 2GH1A 2QM8A 4JC5A 4JNCA 4DMMA 4YCCA 3VJRA 5IN5A 4INJA 3I9OA 3RYCA 4FOTA 2I2FA 3WIOA 1GQQA 4N39A 1EGHA 5SY4A 3D6TB 5FLEX 3VSAA 4BTLA 5D00A 1RNLA 1IEXA 1ODFA 2JRLA 3IULA 5BW5A 2A2ZA 5CDYA 1W5EA 3CNHA 4KO2S 4GW3A 4XD2A 4FGUA 3ICPA 5DISB 1YVPA 4DV7B 4EHDA 1HZZA 3PQ6A 4W1RA 1ML4A 5TMBA 1C2YA 2PJUA 4MVJA 4HLQB 4KRFA 1R0RE 1R9NA 4FKBA 4E09A 3K53A 5CT5A 4ZAYA 2FEMA 4FMCF 1VE5A 4PCAA 4DWJA 4CIWA 5HCIA 1NU6A 4G25A 3C6XA 3P0EA 3CUWA 3EA5A 1SCAA 4WK6A 2EKDA 4E31A 3IYLW 2NU7A 3ZZTA 2GYUA 1SBZA 1G16A 1CUZA 2WAMA 2YTZA 3QG5A 1BX3A 2V7GA 3AM4A 4J7CA 4PYLA 1RFGE 5G0WA 4AO8A 4MUJA 4EHAA 5ALOA 1XQYA 5KQPA 4Y2JA 4HYTA 1SC6A 4M9UA 2N1BA 4XDZA 1PL6A 3N2YA 5ICSA 1FVXA 2E7ZA 1BEZA 4FHZA 4CQMD 5KPJA 3JQBC 4IOJA 2AFIB 3MIZA 3ZNQA 2M9MA 5ARBA 1U3GA 1BFUA 1JJBA 2AT1A 5ALEA 1QC5B 4N0DA 5IAOA 1QAQA 2E37A 2A1UA 3A8TA 4IM7A 4HOYA 5MDHA 5JG7A 3H11B 4BC1A 3PUXA 3DE1X 4FD3A 5EZYB 4CQNA 5DJ5A 1QHSA 5FLKA 4AMYA 1KMHA 1N2IA 4TXJA 3MTIA 4JY7A 1N32B 2BEVB 1U4SA 3CA8A 3RKRA 2ZIWB 2XZDA 4KE6A 4AZ0B 4EITA 1DAHA 1F2TB 1T3GA 2VXBA 3TAUA 4F2GA 1Q0QA 4LUCA 4UXHA 1MJHA 4ESVA 1E3DA 2CL7X 4IUCS 3LPDA 4HGYA 4JIMA 1Q15A 4YRJA 5FWXA 2CVPA 4AKTA 4JLPA 4MRSA 1ZC3A 3VR4H 4C2BA 5AKLA 1EG2A 3E82A 4RHEA 1J4AA 4FYYA 4NZ9A 2Z9CA 3KZXA 3TTSA 1M76A 1RM4A 3THWB 2LCQA 1EUZA 3HXPA 1EHCA 4TYQA 3WMFA 5K8TA 1A77A 3K0KA 2BFCB 3ND8A 3P9IA 4XSGA 5EJ9A 1Z4QA 3JPYA 1XB2A 2RFLA 5ITVA 3G9TA 1B41A 2GETA 2WWHA 2Y0DA 3P7MA 4IQ4A 1SUPA 1I13A 1RABA 5CUQA 4ZVMA 3K0AA 3DZGA 2HL6A 1P61B 5LQSA 2B36A 3HWX1 1X80B 2IYXA 4KYUA 4DLAA 4GMDA 1FVHA 3PI7A 4R9SA 5CB8A 4HQFA 2QUBA 4P98A 2P9EA 3GAFA 2HXSA 4L5JA 3QW4B 1DKOA 3SF8B 3V4RA 1S1MA 5BN4A 3P0FA 4WKPA 4G01B 3G5LA 2OZVA 2VYVD 3V8MA 1KR2A 1QGZA 1YJQA 2FPOA 3B1WA 1H4VB 1KO7A 1J0EA 1N6NA 2ZI5A 3OU7A 3QEJA 1NN3A 4ZRDA 1HFKA 1BIFA 3EARA 1FS4A 2X42A 1Z5GA 4YT4A 1CUIA 3HDVA 4XD7D 2GRJA 1J06A 1VMAA 3OIUA 4OQMA 5EA2A 1OKKD 2F1JA 4P6VF 4KLCA 1VZ2A 1ZNYA 4G4SO 4QKQA 1Z7WA 5CW1A 1AZTA 1TVMA 4XTCS 2XQIA 5DSZA 5IUKC 3SEQA 3WOVA 5ICEA 5B64A 1UDAA 1ZMOA 3EVZA 4IJWA 1N6HA 3IDQA 4DUGD 4ZQCB 2C29D 5FA6A 3GP8A 4R1UA 1UXGA 4PZZA 5LUBA 4DE5A 2FH5B 1J8MF 3KDAA 2IV3A 4Y9DA 3KZMA 3WDKA 4L8VA 1ZJ6A 2ZYDA 3MUEA 2OG1A 2X4DA 3PGMA 3SDSA 1WWKA 3DDWA 1GCOA 1T3LA 1IH8A 2ZIZA 1CS0B 1REQB 3BEOA 1WF6A 1UWVA 4FE7A 3BMXA 1JP7A 1C3XA 3FPEA 2XQGA 1JZQA 1TZBA 4ON9A 4Z54A 3BK2A 4IEIA 5JNUA 4LJSA 1V9SA 1X14A 3R0ZA 1IY9A 1P5FA 3T7EA 1QGED 4IJKA 1T34A 3WG9A 1XTZA 2A7QA 4YPFA 2RONA 2ZVDA 1XVLA 8ATCA 5J4LA 1PO7A 5JXHA 4UE6A 4GXTA 1VBMA 5DIFA 4URVR 1J5XA 4PLCA 3R6WA 2BE9A 3X2EA 2ODPA 4JVOA 5BYAA 4E6PA 1Z73A 5FULA 4S2UA 5FD8A 3SIWA 4C04A 2R4TA 3NWJA 1E3QA 1E79D 1YS6A 2BR4A 1XPRA 1FYDA 2OO5A 3VPCA 3U3OA 4C1NA 3LM8A 3FDZB 4G0WA 3P27A 1MENA 3BK1A 1GU1A 5J9FA 5CDFE 1F5NA 2DPGA 2ZUSA 3DLCA 4QT0A 4V1CB 4ENQA 4NBNA 2I78A 1LSOA 3VYVA 1JLRA 4S2EA 1NKVA 4GP6A 3FUUA 1QS0A 3KQNA 1YCFA 2CE7A 4IIHA 3ABIA 1LDYA 2YJTD 3KNZA 4B3JA 4F1WA 3WLOA 2BFEB 2PYZA 1YE3A 2NV2B 2OE2A 2PRKA 2CBXA 2YRFA 1OX6A 4HWKA 3VQTA 2FGKA 1PJBA 4GR9A 2FSHA 1IXSB 2O1EA 2ENUA 1H0KA 4PXSA 1YIOA 4X6YA 5EWMB 1GA1A 2EF0A 3VU9A 1ABEA 3TIIA 5BSUA 3V6LA 3T3GA 1AGPA 1DO8A 4AX4A 4EJSB 5C32A 5LQRA 1N36B 3CJRA 2C9YA 3ZLVA 3G6WA 3HNRA 3KVOA 3QUTA 5ALQA 3S81A 1SQ5A 1EFCA 3B1JA 2Z2XA 3CUTA 1GGJA 3Q98A 8AT1A 3I58A 1Y8QB 2CLEB 2HWYA 3MAGA 2ZTHA 3OIGA 4D0NA 3FD8A 3KZ1E 2G4VA 3SP1A 3H42B 1O0SA 1Y6ZA 3RTBA 1ECJA 2FSFA 1VBNA 3BREA 1GITA 1E5XA 5TMPA 1HQDA 2NV6A 4ZO9A 3LC0A 1PU2A 1TCAA 1YOBA 1JFRA 4WRRA 5J4HA 3ZHSA 1S8OA 4B35A 4P5DA 3DP9A 4HFMA 2JBHA 2JFWA 1GPUA 3HI6A 3HWWA 4N3CA 4WE3A 1LX7A 2AMYA 4D57A 3OY7A 1O03A 4LCJA 5A5FA 3HXTA 1W85A 4MLPA 4D96A 4ZA2A 1EP2B 3N2KA 3ZJ4A 5BN3A 1S9DA 2C9DA 3V4PB 1JB9A 4R8LA 5BPHA 3OQMA 4QNMA 1EI9A 4PLGA 4Z1OA 1XQ9A 2QE7A 4MP3A 4OIFA 2F8LA 4WY8A 1CNMA 3BF8A 1D2MA 1CXZA 1QE0A 3QTBA 4LFBB 2HW8A 3ZV4A 2AEMA 4DA7A 1K88A 1GNTA 2Q8PA 5ICCA 1P9RA 5ESWA 1ZH6A 4Q19A 2XBMA 3CX7A 3O95A 3A32A 4QUHA 2G40A 3ABSB 3EUAA 1BE6A 3LK6A 4M0DA 2UZ3A 121PA 1PSDA 3I28A 3P19A 4H7FA 2NU6A 1EM6A 3DDOA 4PQEA 1IY1A 4Q18A 4LFCB 3L7YA 5TVGA 1ZJYA 2ZDGA 3A9CA 1N2CA 4PG4A 4ZAFA 1CC1S 1L7EA 3D8NA 4NESA 1MP0A 1EFTA 3JVDA 4F1KA 1L8XA 2LWIA 4JK3A 3PX7A 4N6OA 1OHHA 5CYGA 2DHDA 4Q1VA 2KLBA 1ICEA 2YYYA 1KBZA 1JQ3A 3GOHA 2HYDA 3R7SA 3T4PA 5KOJB 1W93A 3WK7A 5A5DA 3NWEA 1N0WA 1Y6QA 2XYRA 2GEBA 1I30A 1RT9A 3TL2A 2XDQB 4ROTA 1R9GA 1DJLA 1Z2CA 4IIGA 4B43A 3IPAA 1P0IA 3HPRA 3MWKA 1USWA 3N74A 1U2DC 2PK3A 3K9LA 3ZIAD 1GVHA 2YOGA 4BQSA 2X4GA 4GLBA 1CIVA 3PGVA 5KVSA 2CV1A 4GVPA 2GYWA 3NDJA 1ODJA 4DCUA 1WVMA 2AFVA 3R74A 1B6RA 2QZZA 1OXSC 3K92A 3DAGA 1A5AB 3AOEC 5HA5A 3E2PA 3C7DB 3EC7A 3EXG2 1FSGA 3H17A 4P4UA 2BI4A 1IOLA 2MSDB 4GZLA 3INGA 4UCXA 3WYNA 4R3WA 2ZIAA 1NMXA 1O96B 2FOXA 2QM7A 3V2GA 1P17A 4IGAA 5B30A 1X42A 1MX1A 1DGQA 2VVTA 4INAA 1F8FA 1KFEB 1ZD8A 3OKFA 2VYND 3H6KA 3HKBB 1FNCA 3IC5A 4V02A 2FY8A 4YCDA 3BK7A 3TJMA 5KIAA 2XE8A 3PNKA 5IX8A 3UGQA 4KLZA 1N6KA 1YE5A 3NBQA 4JASB 4XB1A 2JJ1D 2IYVA 5CVDA 1RAEA 2CNDA 5B3KA 2XMGA 3ELWA 2BKAA 3A2KA 2D8AA 2CDNA 1HDGO 1OWLA 2QZ9A 2AG5A 4TTVA 1ECCA 5K3BA 2A58A 2QI9F 1D09A 4EHBA 2C9BA 5JNRA 7REQA 1FTQA 3A3KA 2ILTA 4R41A 4AU1A 4X66B 2FU5C 3KG2A 1RWMA 2NTVA 4JL8A 4KQCA 1LW6E 3OCYA 5EKXA 4MI9A 5AKEA 3VYUB 1TTTA 3MCAA 3OFVA 1UZMA 2C5LA 4UEWA 5BQ5A 1GJRA 3NTQA 3RHSA 1VMIA 3D0KA 3SIXA 3UPUA 3LDHA 3FNIA 2CLCX 2LR0A 3A6PC 3JQQA 3URMA 3DE4X 4PQFA 5FOQA 4GRIA 3NM6B 1GM5A 4X8MA 3G79A 2OUIA 2IYEA 1W5FA 5GMOA 2J48A 2ZUUA 3KYDB 4C1BA 1H2XA 4MHSA 3A1WA 5CH8A 1X86B 2C5GA 4KGVA 4MWCA 1NV8A 1K92A 1MOPA 2F43B 2A0KA 2FN4A 1GAJA 1ECGA 4U2DA 1G21E 2ZB2A 3VVMA 3O8QB 4H60A 2CLOB 2C2XA 5AHWA 2JGNA 3E61A 3EEIA 4B3FX 1GL9B 4JVSB 5F7ZA 3ACCA 2XVYA 3DD1A 4JENA 3AFOA 3RCBA 4DZZA 5CAEB 1BXRB 3QVOA 1HORA 1L7XA 4JT8A 3F47A 4X8LA 5BSHA 1RWVA 5JSUA 1X7YB 2B9VA 2IHUA 3NB0A 5J43A 1KDRA 2NWQA 2HH9A 3JSAA 5LZ5A 3HYLA 1NIPA 3AF6A 1QKIA 3R0VA 4RY8A 3HU2A 4TV9F 1DIGA 4YR7A 2W2PA 2G7MC 3N9IA 3CR7A 1RXVA 3P4UA 4RZQA 4U2KA 3NQ41 1X7DA 4AUEA 3MMNA 4A6PA 1NW7A 3AIIA 3PJFA 3SHQA 4Q9IA 3QUAA 1KJNA 3DCJA 1EGAA 1SUDA 2Q0SA 3QJYA 1TKCA 1GCIA 1T5OA 2V59A 3HL0A 2ENWA 3IOEA 3A4NA 1V5WA 1H9BA 2YWHA 4X7PA 2BBSA 4HAVA 3RB8A 4CM3A 5AW0A 5EJMA 1TUBA 2C7VA 3PFGA 4CN8A 3JZFA 1BN6A 2DLNA 3N5KA 1SQ6A 3F98A 3IQXA 4A8JC 1K6MA 3MGKA 2H11A 2BMFA 1NW9B 2Q3JA 4IGKA 1AHPA 4HLUC 4C0AC 5CHYA 5LA6B 1HDYA 3DKIA 2HT6A 1V2HE 1KHHA 3LECA 3WGJA 4DNPA 3FPAA 3MTEA 3MILA 3ZY2A 1AJEA 5GY7A 1NZFA 2HMUA 5FBLB 2QTFA 2DZDA 2O8BB 1RW4A 2BBTA 3CT4A 5DE3A 1QYDA 4RVCA 4X3CA 2NZWA 3PR3A 1RC1A 3IT3A 3TD6A 4DCSA 1RCFA 1TA9A 5CURA 3GLFA 3O03A 4HSEA 2CL0X 3COJA 1JR2A 3KDSE 3ZHXA 5TB5A 2XTJA 1BDHA 1TJNA 3U56A 4FYJA 4R3NA 2Q07A 1P7PA 3RQSA 4DDHA 2XRZA 5FCDA 4JT9A 2GHRA 2EBWA 2IHYA 2VDQB 3P9RA 4FNMA 1RRPA 4DR1B 1K7CA 4MVJH 3HCDA 1CY7A 2CVOA 1UMBB 2OKGA 2JH3A 3U9SA 4HWGA 3OURA 5GJBA 3NJ8A 1VG1A 4NZPA 2DH6A 3FVWA 4CMBA 4ZDJA 1KJ8A 4PFJA 3G9XA 1AHNA 4NHOA 3FMPB 2RAPA 2WG2A 4L9SA 4G8DA 4PM4A 1B8UA 2RHDA 5K9ZA 4IV5A 1ODSA 4NMXB 3EY9A 4FFLA 1OX4B 4TKLA 3H1FA 4KDRA 2DQZA 1Y8RA 2XEXA 2QIOA 1H4QA 2KQUA 4BB6A 3IVCA 4QICA 4J16A 1SGWA 4MXDA 4NPCA 3V1TC 1H2BA 1U81A 2GHTA 3LFHA 3TPCA 3R5FA 1CVLA 4MRMB 2ZJBA 1MGOA 5HZKA 1B3RA 1OLOA 4YB8A 1V1JA 1QYXA 1NJFA 3KPUA 1CJMA 5AD1A 1B14A 2A9QA 2YVUA 1GXSB 4OXNA 3K9NA 3CC8A 3O94A 2J67A 5JH7F 2BMJA 1K86A 1OZAA 3G6KA 3WI7A 1AKWA 1O8CA 3CKMA 1NY6A 1XQWA 2QLTA 3A9SA 4GX0A 2R60A 4KYVA 5JC1A 2X2OA 2I29A 4MDEA 1HNWB 5DGDA 1KKLA 4N6GA 3U7HB 4X91A 3I5YA 4GR5A 2A35A 3QVSA 4BLSA 2CJWA 4UHDA 3W2EA 5MHTA 5EHQA 1KO8A 1W0JA 4EECA 1WCIA 4JC0A 4PZEA 3K94A 3TTYA 4NPAA 3CX4A 4OMFG 5A3VA 3OQNA 3RU2A 4EKDA 1YVRA 4HDSA 3ESBA 4DQDA 3GRAA 3KX2A 1V3VA 1GYRA 2LZ0A 2NU8B 4BO9A 2NMVA 1OA0A 1PV2A 3CN9A 2VNIA 4W7HA 5EIHA 4XR4A 4GZ5A 4PG8A 5IM4A 2AG0A 3MSXA 3ZS9A 4GSYA 1Z35A 2CZCA 3V42A 1SCJA 3SKXA 5BXYA 4TXHA 4KR7A 1F7VA 1KVQA 1YVEI 3OEED 1DQRA 3G88A 3ND9A 4QPDA 4ZT7A 5JO0A 4ALIA 1OLXB 1IB6A 4MQEB 5C51B 2AG8A 2GAJA 4NICA 1CQJA 5H80A 4GPIB 1Q1AA 5FNZA 1BEEA 4UCQA 3DMPA 5DBFA 3P26A 1NC3A 3GLHB 4KQWA 4GKKB 1N6LA 1Q0SA 2OHGA 4MJ3A 3L77A 4CF7A 1PVOA 5FRDA 3WLFA 5HTOA 1W4CA 4L75A 4EJ6A 3G8AA 4MA5A 4NIMA 4UHJA 1YAJA 3KOXA 4WTOA 5JFOA 1CUWA 4D4LA 3NTOA 3RVLA 1C9JA 4TWAA 1UBUS 4L8FA 3M3DA 3PB3A 3SI7A 1TYBE 3ZLTA 1ZD5A 4MV9A 2BISA 3JQAA 4PGGA 5EIOA 3FTFA 4ZIRB 2OM6A 2VO1A 2VPPA 2R11A 2HDNB 3T5DA 2XRYA 4RHFA 2FZKA 1FDOA 1H4TA 2ILVA 4EKIA 2X1HA 2SCUB 3KALA 4GP7A 4NDAA 3BZWA 4W1PA 4NU0A 4UEKA 5E2BA 1SXJD 1PFGA 1TEXA 1SIOA 1ZUD1 2FPGB 3BJMA 3F97A 3QFFA 4IDOA 4KV7A 4RPJA 4Y2GA 2QAJA 4ZO6A 4JP8A 3HBMA 4G5GA 4RQAA 2FB9A 3L1JA 3PEEA 1XU9A 2R87A 2VSXA 4QPCA 1BAPA 5ALNA 1ZNXA 3SFVA 1SCUA 4BLWA 3RVKA 3V4SA 3OT1A 5G0UA 1SCDA 3KZCA 3EAQA 2PT6A 2J3IA 2IIBA 1A9OA 2BOVA 1QVVA 3EDOA 1ZK4A 4FI3C 4OXYA 3CPHA 1BWQA 4OX9B 5JHHB 1H8HA 3G1TA 3U62A 1GQRA 1K63A 2XYQA 5C0OE 4J3FA 4QHTA 4MWDA 2NXEA 5H9WA 1RYEA 1FXWA 3THXB 3NDPA 4B81A 1UJMA 4HZUA 3MK31 4BB5A 2KX7A 3BIJA 721PA 1X9IA 3MBIA 2W6CX 3R0JA 3PNLA 3JQBA 4F5ZA 1NJ8A 2REOA 2BIFA 5TQVA 5L3SB 4B2PA 1XRSB 1XZCA 1XYVA 4LI3X 2QVCA 1XCLA 5TQ0A 2JJ2A 1USVA 3U80A 1EFUA 3THRA 1FDTA 1EDEA 1G8GA 4G36A 4IKOA 4AY4A 2N75A 1Q6YA 2J0SA 4IJ6A 3T7KA 1B6SA 1EX6A 1N5RA 4GXQA 3L8FA 2VLBA 4CTNA 3QY0A 4GL4A 2IUEA 4UNQA 5LIPA 3OKAA 1QG2A 3KQWA 2PZEA 2W9XA 1HDXA 4HG2A 4FE4A 3D0OA 4LSZA 3HZHA 2HK8A 1JHZA 1HYEA 4NAUA 1IWPB 5J2TA 4EKEA 4RHCA 4TVOA 3RG8A 3P52A 1UMCA 5H3CA 2DEUA 4D6PA 4U9IS 2LKCA 2N0SA 4QUAA 3DUFA 3LCRA 3NT4A 4TZTA 4UZFA 1TC1A 2QUKA 4WOPA 1F2VA 1D4OA 2IU0A 4D45A 1YCHA 4EVIA 2BJVA 5FO0A 4ZN6A 2DPMA 4AYTA 4YO7A 2QF7A 1KI6B 1CZLA 2A4KA 3PLAE 3AHIA 1C9YA 1FLDA 4I4TA 4I55B 1JQAA 4OJKA 2JPDA 1MC5A 4MVYA 1DBWA 4OMDA 4R7ZA 3K72B 2E85A 3M0EA 4D56A 1E8MA 2FFRA 3CKLA 1QGYA 4E7PA 2HFKA 5JAIA 4RVDA 5EJEA 4U2CA 2AYZA 4FYVA 2CMFA 4X1IB 2XADA 4IAOA 1U5BB 4UHEA 1PFYA 3SR0A 5FORA 1WULS 1LBTA 1VL1A 3B9QA 4FGSA 3WK5A 2G08A 3U17A 3NETA 2HCFA 4MYSA 4MS1A 5JZBA 2ZM5A 5DNUA 2HRDA 4GDFA 2PGXA 1JHXA 1V5FA 1TU4A 1IXKA 2HLHA 2XMRA 4IDFA 4MW1A 4WAUA 4ZRNA 1XYYA 5TC4A 4EPXA 2IV2X 4LOKA 2FQYA 4MV6A 1ORDA 2XYHA 4PTZA 5CTAA 5CA0F 2G1AA 2WWXA 2BBOA 3B52X 1BROA 2HSDA 5E7QA 3RS8A 1N77A 3FPGA 4MIEA 2C0PA 4YN3A 1BD3A 1EK6A 3ED1A 1U9ZA 2C8LA 2VDWA 1MAUA 1T5DX 2EFHB 4JHXA 4Q3KA 3U3KA 3LNCA 4GVLA 3D3WB 3WMWA 2C88A 1TA0A 2Z5LA 3O8OB 2CLKB 2DQ4A 4I14A 3UB3A 1MAVA 1KVTA 1ZW1A 1W4BA 5A1TA 3CWZA 2F3RA 3NIFB 2OSVA 4ZV9A 1OFUX 4ZVVA 1GRRA 4JLKA 2W22A 2RJOA 3A1DA 1GOTA 4DR5B 1U0SY 2ISSD 2R1TA 4M21A 3UC9A 3V33A 2GSWA 3SJAA 3C3MA 3G7UA 4E0BA 1QJCA 2XUOA 3CO0S 2NSLA 3DG9A 3FMOB 3QBTA 1U2GC 3NC4A 3NZEA 4D81A 2H2GA 8MHTA 2G04A 5BNZA 5KO2A 3I2GA 5JE8A 2Q3BA 2OCGA 3PIIA 4P08A 5LLDA 1IY8A 2IEGA 1A8UA 4WZBE 2VXYA 4ZVLA 2QQ0A 4YAEA 2ONCA 5EHNA 1T2AA 1W1WA 3BXGA 3HABA 2A88A 2I1VB 3KJFA 3L6RA 3RANA 1G4HA 1VBFA 1AKQA 1SHKA 4I81A 3CW9A 4Q39A 3B2QA 3BGIA 4WGFA 3GJTA 4LCBA 4DCCA 1IM2A 4MKFA 4ER6A 1RWKA 1S2OA 2IP1A 1KC1A 2CUKA 3M1IA 3NC0C 3TQTA 4FEYA 1EK5A 3JQEA 4EOGA 1PJTA 4JQZA 4I1PA 2EKPA 2XRMA 2JI4A 1PBTA 3CW8X 3H2KA 4MUMA 5EESA 5LIRA 1P81A 1X1TA 4G37A 2A9VA 2OPHA 4FHFA 5BUSA 4A5SA 1XDBA 4CUKA 3OIWA 1XMPA 3IIMA 1OGYA 4DV2B 2O3TA 5TQJA 3FWYA 4JOSA 2EW8A 2QQEA 5HJ2A 1S6YA 1X70A 4IRXA 5JCOC 1HTBA 3WJ2A 1OUMA 5EI5A 1YGPA 3R0QA 4FZRA 1TA4A 4L9WA 3ZZ0A 4GI7A 4B1FA 3FOFC 5KWJA 4B3TB 5HKLA 5DNDA 4EQ6B 4JHLA 1EIZA 4L15A 5K3EA 2RKBA 2BMAA 2QRZA 4YWHA 5IAEA 1LRLA 5NLLA 1PI3A 2PM8A 4F4HA 3A04A 4YJ3A 4RLHA 3UJDA 1RKXA 1AQUA 1CBUA 1RAAA 4HAIA 1R00A 1SD2A 2QXYA 1THMA 2O0JA 2IITA 3ZEAA 1KAMA 5D6OA 1IEWA 5U9CA 2ZQZA 2J3LA 2H6EA 2GFQA 2VTKA 3U3DA 1ISGA 4EY7A 1NQAO 3JY6A 1ZVKA 3PFHA 2ZSBA 2YXBA 3I01M 3VYRB 5A3SA 2H5EA 1YFLA 5JYBA 1NR7A 3WMGA 1ZA2A 3RE1A 1T4MA 4G67A 4A8HA 3MCTA 1SVLA 2R8OA 3T34A 2ZRMA 2Z5VA 4K88A 5AWFC 1U2SA 4OOFA 5GJWC 5ADVA 3RS3A 4GH5A 4ZJUA 1SOWA 4V0LA 2WYHA 4DV3B 2MINA 4YREA 4B82A 4OJNA 5IPFA 1W4AA 1MA0A 2A0UA 2NZXA 4FGJA 3QNWA 5JATA 4AG6A 1USKA 3TZLA 2JGMA 4U5XA 4UEJA 1ESZA 4DY4A 3O2JA 4OHXA 5C37A 2JIMA 2GN2A 3MT8A 4TKUB 4QATA 4NU8X 3RU7A 5IJ9A 4TKZA 5ETJA 1PVVA 3WGKA 3T1HB 2EWMA 1SVMA 1LPOA 2WRZA 2XUFA 2RB4A 3GXBA 4G97A 4O2BB 3VM6A 2X6QA 5JRZA 4NENB 4E07A 3HPQA 3R8CA 4F3YA 1SEPA 4CN9A 5K0GA 5HZGA 3RRBA 3IOCA 2NN3C 2YMLA 3GGDA 4I46A 2FW1A 4A0RA 3GRZA 2JGLA 1JJAA 3OICA 2B5WA 4S1VA 1WQ1R 3GRCA 3OM1A 2XHZA 3OPNA 5CDFA 2XWSA 1T4DA 1VHDA 1ZFNA 2IZ0A 4UCWA 1C9MA 3AWDA 1P9NA 4Z9AA 3OEHA 3TAXA 1X7ZA 1Y7PA 3I5AA 2VJNA 3FW1A 4MVJD 3CLUC 3IXMA 2V1XA 1UKBA 2UYQA 1D04A 2GPWA 3ZCPA 1GNVA 5E1OA 3JD4A 3SSNA 3O3OB 4LC0A 1W2GA 2G28A 4XCVA 3TQRA 2EF1A 2ZRLA 3GIWA 5H8WA 1YI0A 2VYCA 1OH6A 4G26A 1TEZA 2H29A 2E21A 4OHCA 2ZSAA 4LRXA 3KHTA 1ZESA 2DJ5A 3U26A 3U09A 4LTMA 4ZOQI 5D2CA 2ZULA 3U44A 1YNSA 4O5OA 1U2DA 1GNRA 4LBVA 3VR5A 1CG6A 4LYDA 3NRCA 3JZIA 1BXGA 1KSFX 4JDPA 5AXBA 4YQFA 2WVAA 4KPUA 3AI1A 4PHHA 4LXXA 4FD2A 3WHKA 1BDIA 1E58A 4CVNA 3LJKA 4JQYA 1UM9B 3WIEA 1QB8A 2XWJI 4E5NA 4C08A 4EO9A 4OB7A 3TDKA 3AOEA 4ZQGA 3G8DA 6REQA 2LP4Y 2ICAA 4KREA 5KI6A 3ZHYA 1AKNA 5HE9A 5EXPA 4ZVOA 4FXPA 3IQEA 4DLTA 2XUGA 3P71T 1WPXA 1LQUA 5FUVA 1YRQA 3FI9A 1ZY2A 1ZM3A 2DT8A 2FK7A 3D7KA 4LVUA 3T3PB 3CX3A 2HMSA 2XW6A 3M5PA 3PITA 2JJMA 3AUXA 5KNBA 3P9CA 4FT4A 1LPAB 1Z4OA 4NJMA 1C30B 4B8YA 3PUWA 1PFKA 2AZDA 3EGOA 4KWCA 4LCEA 4AQ7A 2CFIA 5ALPA 1XZAA 2XNDA 1QNFA 3QU7A 2IDZA 1ZS9A 3H2ZA 3HM2A 3MS7A 5JV5A 4XM0A 1XAHA 2FG5A 4NBRA 1XRQA 3ADDA 3RV4A 1J24A 2MSCB 3B3AA 4RO0A 4CM6A 4FKMA 3K6SB 2W8BB 4BU1A 1GVNB 5GTDA 4Z9YA 1EJ0A 1BHJA 1NATA 2A78A 2IKSA 3BIXA 3NKVA 4LRUA 3RGWS 3EIEA 4G4JA 4CV3A 5A3JA 1L1QA 1IK4A 2H00A 4OU5A 3JAKA 1Q0UA 4H15A 4I6JA 3PUYA 4IIXA 3BPSA 5K2MA 3TSAA 3SYRA 5JS1A 4HGOA 1D03A 4FM9A 5A4FS 3RKSA 4P4TA 3ZG6A 5J47A 4HAWA 1DOZA 4YECA 3WXBA 1W36B 1G5PA 3RJ9A 2LDBA 3KUUA 1FMCA 1V3UA 1PLLA 3K9CA 2BAGA 3CF2A 1UKAA 3IO5A 4P54A 2Q8QA 2ZSEA 1U9IC 5E6SB 4Y1RA 3TDNA 3VHXA 4BVHA 4B3RB 2JFNA 3GLIE 4HDNB 4MS3B 1OIVA 1UBRS 3AF0A 3KUKA 1R8QA 5LZ4A 2GTIA 2XQJA 3VH2A 3IBYA 4HNUA 5GAJA 1G5RA 3R23A 4FEEA 3KIPA 3I9FA 1R15A 3PRHA 3V4VB 1RXYA 1NJ6A 1K6XA 5IVPA 1SKBA 4HWTA 4JMPA 3UQYS 1QH1B 2ZR7A 3L7IA 4B33A 4MKZA 1QF6A 1VQ1A 1AK1A 2D0DA 4RTMA 3UAXA 2GZHA 3D54D 3C98A 3QQ5A 1RXUA 4OGWA 3NALA 5TGTA 3E3NA 3DBHA 3S55A 4RE5A 2DQKA 4RTOA 1A8IA 3MTGA 4DR6B 4RAOA 5HTKA 3AX6A 1NASA 4FEAA 4KLRA 1RHJA 1U8FO 1QHEA 5KSOA 3UFBA 3I1JA 1JAYA 4D4MA 4L07A 3HJTA 3RNLA 2OV6A 5KNDA 3M5CA 4NKRA 1YXMA 3UJHA 3I45A 3R0XA 2SKDA 1VHTA 3OFJA 1GT91 5IXSA 3OOYA 3EPLA 3FKSA 1ECFA 3AVXA 2AC2A 2QPOA 2XCSB 2OVBA 4JLUA 1AKMA 4YMUA 5GP1A 2V97A 3WLNA 3LCUA 1RQGA 3FUVA 4A8JA 1FY2A 2EFDB 1QG4A 1JRLA 2IBSA 1M66A 3LUBA 4IXWA 4L51A 1R0BA 1V8ZA 4HLUA 3DE3X 2DBVO 4UNSA 4KXVA 3VU0A 3IEVA 4H17A 4CV1A 1SMKA 2IJGX 4LNHA 4MR7B 1VG0B 4E46A 1I4LD 4K81B 2RJNA 1GEGA 4ZHQB 4R8SA 3K96A 1FP2A 1Y1QA 5FX2A 5I9NA 3CXRA 4CF6A 4DPMA 4XQ0A 2M6LA 2C31A 3S4YA 2WWIA 3VC3A 4WGGA 4B73A 3D7SA 2PG3A 3PG5A 4CTKA 1EDOA 1M7HA 3OM8A 2QTGA 4KBGA 4TM8A 1OYWA 5JUWA 3N39C 4FNAA 4IXTA 1ZJZA 5BNFA 2I4MA 5IDVA 2K7FA 1G21A 3TOXA 1UAYA 1VGQA 4FFMA 1T29A 3ZVRA 3T1QA 3CUSA 1M2FA 3LA6A 4QPZA 5E3HA 1EGMB 2NNLD 4FDMA 1NPDA 4Q3NA 3RAEC 4RC9A 3NWBA 2H7YA 1BVUA 4ME6A 2A9OA 4N0PA 2ZRAA 3TR5A 1WW8A 5A9SB 3MJ4A 4YRAA 4K9MA 3ETJA 2NM0A 4QYIB 2VXOA 2Z2JA 2GDZA 3AGQA 2E4WA 3E9ZA 3VAZA 4DDMA 3VH4A 4RZ2A 1LW7A 2IY7A 2GN0A 1GSIA 4FR5A 4QO7A 4IWYA 4TRMA 2YMQA 4M1QA 3OIDA 1Y81A 2B8WA 1A4UA 5JWHA 2NPFA 5F3DA 1NZJA 1OGJA 2BDTA 1Q1EA 5BQ3A 2JCSA 1DAMA 1NU8A 3M83A 3O7WA 4G0XA 4RPCA 4BO0A 4OKIA 3C7AA 3EVBA 3KZNA 3V4OA 2GT1A 4RETA 3T7TA 3EGXB 5IUNC 1UFVA 3LWNA 2I55A 1LDNA 2AH5A 2X2PA 4LA4A 3WXMA 2NPOA 3UK2A 1XTJA 3PS9A 3U4IA 4PC3A 3ZWYA 4TYYA 1RS0A 3SQOA 3O73A 4HGPA 3URKA 4H4DA 4C4PA 3E9QA 1JQLB 1H2YA 2PQ0A 3H5VA 2IYRA 4RFSB 3N75A 1JL3A 2ZRDA 4JA0A 4KAAA 3T7RA 1DV2A 2BFNA 1RWWA 3LO5A 3T9EA 4MR8B 1HG1A 2BGGA 1LBEA 3TE7A 2QV7A 1II8A 2K5UA 2XD4A 4KO8A 1ZCAA 3C7KA 2O4CA 4OQXA 5C34B 1DRJA 3L7NA 4M1TA 1JXMA 1SKQA 4ZU3A 4AS3A 2CLLB 3SZUA 2H2HA 3EPKA 1S5PA 3VMMA 3LVFO 2GERA 3PD7A 5HJ5A 1F6DA 3HBAA 3CF4G 1T5HX 2EX4A 3A4LA 3S1LA 4CV2A 3KKEA 4F3CA 4Z8XA 4QAJA 2H92A 2DWUA 1ZQ9A 3NORA 1VFNA 3A06A 3D3QA 1ZSNA 4BBZA 1HETA 1Z5UA 2ZRQA 3IUSA 1N3IA 3TZ6A 4QOEA 5AYVA 4IW3B 2PZGA 4S1NA 3TE6A 2G5CA 4PPGA 4YRBA 2AI1A 2WMDA 4RV4A 3WQSB 2DTXA 3GQBA 2ZT8A 4NV3A 5MFZA 2EX0A 2J45A 4TLEA 2H4YA 3HTXA 1YRAA 2FX3A 1ZD2P 1PSZA 3CTPA 3FPFA 3MLBA 4HAOA 2AMVA 2V3WA 2X0NA 2YBDA 4B6PA 5ALHA 1JPUA 4W8GA 3I2KA 4J9VA 4WUTA 4U7DA 1J23A 2PD4A 3SJ7A 2G09A 2O2DA 1WB6A 1XLTC 1M67A 3PWZA 4P3OA 1VL0A 1ND6A 3VKVA 4HH1A 1Z4IA 4DLUA 4ZKDA 2VZLA 3EVNA 2C03A 4W7SA 4ZQIA 2G83A 1WXGA 3Q3HA 1ZLYA 2RD2A 1EIWA 4I5DA 3TDMA 3ENQA 4FFPA 4AJ2A 2R5FA 4K3VA 4BY9E 4L7QA 2C2KA 1GQOA 1M6EX 1YKSA 2FKAA 1QH0A 3EF1A 3VNRA 3A1EA 4AP9A 3IUEA 1IHYA 2IYNA 3EK2A 4JOCA 5EG5A 2YY5A 3RODA 4R2WA 1ULSA 1ZH8A 2X1VA 1VSVA 4NNJA 4TWZA 5COBA 3QKRB 1P2SA 5FBHA 3NDBB 2X0KA 2AUNA 4DLRA 3ADBA 2F9FA 2XDWA 3FUWA 1K2VN 2XI4A 2CXTA 3WLLA 4GL2A 2VNHA 3SC3A 1O95D 4TMFA 2W6QA 4Q93A 4S1PA 2DB3A 1WNTA 5I7WA 1NUHA 2OTCA 3ZLBA 3AKEA 1NUAA 3CZRA 1Q7GA 1CIJA 1EGVB 4U02A 5LP6C 2NVOA 2XXAA 1QGOA 4R1TA 3RS4A 3OD5A 5H68A 5HKOA 2A59A 3EIOA 4IXMA 4MQUA 3HVRA 2W2KB 1C81A 4TSFD 2BKLA 2JH9A 3KQVA 5KX5A 1DZIA 3QW2A 2NSHA 2Q5LA 3FLMA 1VJ1A 3OQ6A 4DCMA 4LJ9A 1A5ZA 2FW6A 5LXTA 4B0OA 2H0AA 5DNEA 3WFIA 1JEQB 2IUYA 5F1PA 4WBNB 2CNWD 5DM70 1CQIA 1HDOA 4RF5A 1GKLA 1K7EB 2H3EA 2XZPA 3QEMB 3U4QB 1GKKA 2ZZNA 1S2DA 3IP9A 4WXYB 2Z43A 5A4AA 1PKXA 2PBZA 3L6OO 3ZK7A 4LFAB 4ZAXA 3FR8A 4JSTA 4MKXA 1QK4A 5TS2A 1G1AA 2O14A 3WGVA 2YS7A 3AWIA 1K68A 3QWIA 3TLGB 4XVRA 3EOAI 1ORRA 2FR8C 4UBIA 1DDIA 2PXCA 2VH5R 4ASUA 5K8VA 1Z6AA 3L05A 4IKEA 4TKVA 2HRBA 3ZYZA 1Z36A 2Q7OE 3ST7A 1PUJA 1NQVA 4LY9A 1AGNA 4WADA 4IHJB 1I8TA 2DQSA 4ZYTA 2VS1A 1ENYA 5LYYA 5KVCA 4E94A 1G8PA 5KHLB 1NDUA 4JBLA 1NLYA 1FU4A 1XIVA 1M7BA 1VLLA 3AJ9A 3K30A 3OJLA 4ENUA 1WXIA 5FPPA 3VYTB 4I2VA 5AOVA 1OJLA 1TT5B 3K0FA 4TLBA 2OHJA 2JI7A 5JZOA 4DB2A 2WWVD 2VTBA 5DBGA 3HVJA 4YCLA 3HQ4O 2P91A 3GJ0A 4E2XA 2AI3A 3ISTA 4AY6A 1ZGGA 1T1IA 3C48A 3AB8A 3OWOA 2JAUA 1OC2A 1U1EA 5E1MA 2XQVA 2ZT6A 5U1PA 1X6VA 2XUAA 3HKEA 4WXPA 2JCXA 2PIDA 1XQ6A 1L5MA 2IZ7A 1AU9A 3AI7A 1E96A 3F7OA 3FWZA 4KOAA 2ORIA 3HI4A 2ZTMA 4MMZB 1E0KA 5H3HA 2G9QA 2GYYA 3NYRA 4PIMA 4DR4B 3FOBA 3G2HA 2CWWA 1A2OA 4CMAA 2NVUB 2AK2A 3A70A 1D9ZA 1RHRA 3AUAA 2A8YA 1XEWX 3OLWA 3UH1A 4G5QA 2FQWA 4NZYA 5B3JC 3I53A 4NF2A 2QG6A 2F1OA 4BPBA 5HKKA 2RH5A 2F62A 1RTKA 4I6EA 1RZRA 1WD7A 3M6FA 3OQ1A 2B6NA 2ZJ2A 3HKDB 3PC7A 4E88A 3H4VA 5EJIA 4MPRA 3BMCB 3PC4A 1HKHA 4PLPA 4A8TA 3ETCA 4RKQA 1XBTA 4G23A 2JC3A 5D5QA 3BH6A 4NEGA 5ABPA 1BQ4A 1AS0A 5IK2A 5LKRA 1G0OA 1TK9A 2IPNA 2W2QA 5E38A 2HTFA 4AY5A 1XZHA 1PN3A 4DGSA 5I4IA 4QIHA 3WAGA 2EQ5A 3INTA 1SKUA 3UANA 2OHHA 3E7WA 1U2GA 1Q17A 2EXXA 2W00A 2FHPA 2ZUWA 1M2VB 2WHPA 5IU6A 3UHAA 1CY8A 2I34A 1RWXA 4PC1A 3B85A 4G0MA 4ITRC 4X8HA 2CT8A 1W7AA 2R8RA 4TSRA 2CBGA 4J2HA 4CMIA 1XZ8A 4MINA 2BHSA 2E49A 4K9KA 5HDBB 4KPYA 2CSXA 2B5OA 4H35A 5DTRA 1NURA 2CXUA 2X0JA 4KQKA 1DJPA 2ZAYA 3GLUA 4RD6A 3ZXSA 5CD1A 1QZZA 2YQ5A 1QZXA 1EVYA 1YDGA 4KFCA 1PT6A 4ZP1A 4KPEC 3U4MA 4G9EA 4AM8A 4IP0A 2I8CA 3AB7A 5J4VA 1JKMA 1Q7EA 1VMDA 1FNDA 3AGPA 3UYLA 1OLSB 1Z82A 3JQ8A 2Q41A 4MAMA 4KGXA 2CNBA 2ANCA 1K5PA 3IB3A 4D4GA 1PK9A 3WHLA 5A2GA 4ZEVA 3R77A 3D5TA 3GRFA 4B0PA 1Q7TA 1XZLA 4TS1A 1NW4A 4PAOA 4PR3A 2WHRA 3REQB 5ES3A 5IMBA 5CFOA 2AK3A 2Q8NA 1PWYE 1MW9X 5I4BA 5IS2A 2R66A 2BFDA 4AO7A 3IBSA 1KEVA 4QECA 3PKJA 1G7TA 3U7GA 5JCOA 1SG9A 5D3MB 3QFHA 5AVTA 5L40A 2VPWA 1QIIA 2QR5A 1LSJA 2A94A 4OQFA 2HBRA 4KYIB 4ZZ1A 4DRYA 1RCTE 4LXIA 2WT8A 3O4HA 1EZZA 1Z26A 2DKNA 3WRVA 2F9LA 2YMMA 3HK2A 4ALJA 1YULA 3BMQA 4NABA 1SC1A 1MB4A 4YAJA 1TF2A 1QIDA 2ORYA 4IILA 4S35A 4OUDB 3F9IA 4EF5A 4N76A 3EWNA 1YR9A 2IZ6A 5U4XA 5AKGA 5HJ7A 4MI3A 5FLYA 3ESZA 2KMLA 1TO2E 4GOKA 4QOSA 3SC4A 1W46A 4BC0A 1NHWA 4YP1A 1VCIA 1BCRA 4I6GA 3OAAD 3ND5A 1I3CA 1YKFA 2VJOA 3QK7A 5GIPE 4B2LA 3KU4A 2CCJA 3FTPA 3NVAA 3HB5X 3VBCA 1FU8A 3AU9A 2C04A 5ALYA 1MOQA 5DLPA 1E4EA 1NM5C 1GRVA 3ZW7A 3DEYX 2ZE5A 3E48A 3RYFA 1TI7A 2J8ZA 2PNFA 3KKMA 4I1RA 4WZBA 5HMLA 4DFDA 1Z4NA 5L7TA 4CM8A 2GN9A 4DN6A 1NAIA 1F38A 1SUSA 4RGQA 1UDXA 3OPXA 5CCBA 4LRTB 3JQAD 3T1YB 3G5AA 4TX1A 3SNKA 2Q6IA 3JTMA 3ITNA 3JALA 3T7SA 3LX4A 4W9NC 2V7WA 4DJJA 1IBLB 2J6IA 3NM5A 2FSGA 1SCQA 1FSSA 3OPYA 4HUQB 4MPPA 5JLAA 3DV9A 1M6WA 2PUTA 2VDOB 1EUCA 1WCV1 1AX9A 4BLQA 3DHVA 5CDUA 5C8VA 4FW9A 1IU9A 3GEGA 1Z16A 2R68A 4NCNA 1Z12A 4WV3A 3VNQA 3IT0A 5C8YB 2WTBA 4DSZA 2DOKA 3SQDA 1EXVA 3KB6A 1ZI6A 4ND7A 3RASA 1NT4A 3PGA1 3RJZA 4EYEA 3AY3A 6CHYA 4AY3A 2HF8A 2I62A 3EBLA 4M76B 3NVMB 4DSTA 3AV0B 2NO5A 5EWLB 1TFRA 3R44A 1GTJ1 4GT1A 1A5SB 2OP1A 5DI3A 1GG8A 2RGCA 5T6BA 5AVYA 3LUJA 3QX7A 1EP1B 4RDXA 5LYJB 4TMXA 5DOVA 5KNDH 3HXMA 3UGJA 4ZARA 5MN4A 3MT7A 1RE1A 4PXAA 3VZPA 2ZJ1A 3UMJA 1KJIA 3OFSA 1WSWA 4WNCA 5DHPA 4W5OA 1GN8A 4I50B 3TTVA 4FMBB 4OV6B 1OU4A 3LSTA 4NK4A 1JIJA 4BGUA 4DC9A 1LK5A 2HSZA 4UXJA 1Q2UA 5EINA 3QLJA 1OLUB 4RY0A 3CB2A 2QSJA 3DV2A 4FR2A 4JEHA 4QPJC 2JJ2D 1P2VA 1FW6A 3V8RA 3MWYW 3UXEA 1C0IA 4R0MA 4PC7A 1QUFA 1CP2A 2VJMA 4K2HA 4M1EA 4MV8A 3WLTA 2BSQA 3K1AB 1KOLA 1Z0DA 2O4UX 4ZRMA 5KC9A 2WTUA 2PT5A 2V55B 1CU1A 1SA0B 4NTZA 4WCFC 4G5FA 1E5LA 4LYYA 1AF4A 4LZJA 4OG2A 5AHOA 4W9RA 4KN6A 3ZVLA 5JJCA 1A5BB 3TCXB 4G1CA 3QVUA 1I2ZA 4RUKA 1X1CA 4P3XA 1KY2A 4BTVA 4XRRA 3F9RA 3Q7QA 4I9GA 4J1NA 3RYIB 4WOCA 5K3SA 3TQIA 4HI0E 1KARA 5KAPA 4BNNA 4EZIA 3HLKA 4WFJA 4TV8A 5DHUA 1EM8A 4N5DA 4DWVA 4YMWA 3JU3A 4IGFA 1RXIA 3EUEA 1PW5A 3HDQA 1P31A 2OV1A 3SVTA 3PRYA 4NCIA 4C6TA 1U31A 4E30A 2JBAB 1RZVA 2GEFA 3KVYA 2LRHA 3FYUC 2PL5A 3HDTA 1FVFA 2JFOA 1E7WA 2EEPA 1KC3A 2F3UA 2OBBA 2QD1A 1Y7LA 2RHOA 2YINC 4Q3CA 4UTZA 2PS0A 2IU4A 3PXDA 4OGGA 1E9RA 1J8YF 5DHRA 1SD5A 1OXMA 4ECEA 3CE9A 2NUAA 5AVSA 4HZGA 1T8WA 4P5PA 1E5DA 5ADHA 1P0MA 2W4IA 4J4HA 5K3AA 4OHFA 1EFPB 2I9PA 2IYYA 3AINA 4B3SB 2VEOA 3VPBA 4G9GA 1JTVA 1IJKA 1U9IA 4LMBA 1AQYA 3UW1A 4GGPA 3QEAZ 1W6RA 1WXWA 3BL5A 2Q6OA 3FJYA 1C4OA 3LUAA 2OZKA 1J0CA 2XECA 2JFXA 1MJ5A 1W19A 1ZGBA 4YJDA 2YHIA 4H6VA 2QVGA 1X1AA 5EKUA 5P21A 1W6UA 2YN2A 5SZJA 5G1OA 1PGOA 4K9OA 5F1OA 4LZWA 5BUZA 1VC2A 3FTEA 4A2PA 2J41A 1UR5A 4AS2A 3T5PA 2DC1A 2W93A 1AUOA 3UT5A 1WDKA 4YAKA 1LJ8A 1SURA 1AUPA 1P7VA 9LDBA 1XZNA 2IYAA 2PGAA 2B8EA 3DH0A 2JRCA 1RM0A 3Q1LA 521PA 3TTTA 4BUZA 1CJVC 5BURA 5CCXA 1HSZA 3ZDXB 3UY4A 1A95A 1CB7A 1MIOA 2KM1A 2QUHA 3EEYA 1H05A 1MTZA 4U7FA 3HFSA 1F8GA 5GM1A 1HE3A 1U3TA 3H75A 4ZI7A 3GEHA 4CMEC 1RPTA 3DDZX 1IN1A 4P83A 4DQLA 2ZRHA 4FGLA 3ECCA 3MTJA 1KS2A 1DELA 3D3KA 5KHOC 3DF7A 4V0SA 1S89A 5T3UA 5KYTA 2WYVA 4ARIA 2V7VA 2WQ7A 1G8HA 5FAXA 1EE1A 4E4TA 2GZ3A 2WINI 4JUCA 4CEHA 1DC8A 1N3BA 2D3WA 5BR7A 4UUNA 3GDGA 1PUXA 2ZGVA 3D2BA 2FLKA 1RBQA 4ENPA 2DSTA 3L01A 3R8XA 3LQ2A 3IVAA 1OBVA 3L7JA 2C1XA 1JUDA 3MG9A 5FADA 1JBKA 3IVRA 5KVQA 3DTVA 4FCCA 4Q00A 2BGMA 4FOSA 2A4MA 4CQMB 1Q0HA 3P9QA 1EVLA 1GCAA 1IIRA 4HXYA 4Z0HO 2Q4RA 5I7RA 4XWWA 1LWOA 4J0JA 4MVJM 3F71A 4R83A 3G5MA 3GBVA 4NVRA 1YONA 1R3UA 3GLIA 2GVDC 1HZJA 2QTRA 1LK0A 2VSOA 2QX8A 3LSYA 3K8QA 3LXUX 4TT3A 4CKCA 4IDHA 2CUTA 5EIWA 4PS0A 2MDTA 1DIRA 4ZQHA 2HA0A 1L6IA 2G80A 2NZUG 2Y6UA 5DRYA 4F97A 2YUIA 2HNKA 1VPWA 1Z56C 7AT1A 5FWYB 4Q7QA 3JZDA 1HX7A 3GZNB 1R0CA 3C3EA 3KFVA 5CIWA 3DULA 4YAWA 1KYTA 3VTAA 1ZHHA 2AOXA 3VMFA 3WK6A 2HA3A 3F1LA 4MW0A 3DE6X 4ZQFA 2WQZA 4ZZ2A 1QIHA 3ZQ4A 3SICE 3N6XA 4MV7A 1R4NB 4ZKEA 5TMDA 1PFQA 2QTLA 4BO5A 3BSWA 3VC7A 4LJ7A 1WMDA 3QPVA 2Y1GA 4ID9A 1CQWA 3HDYA 3IOBA 4AN0A 2IXTA 2AQHA 3O2NA 3C16C 1CETA 4FMDB 2OG2A 4HVTA 2VP5A 4S1TA 5DDIP 5FPTA 1IQRA 2BI8A 3LIIA 3WICA 2V4ZA 2ZYSA 3U61B 1OB2A 3SXJA 4H3SA 3JVVA 3RIXA 1JKJA 3U48A 2ERCA 3C3WA 1SN7A 1BKYA 1AB6A 1E2PA 1TJ4A 1ESNA 2XB6A 4Z1MA 4CLOA 1NUPA 1GCUA 2FE4A 5K0FA 1CRZA 1HRDA 2JIPA 1JDSA 1KF0A 4NFYA 5ILGA 4ZCSA 5CVTA 2EAUA 2Z6AA 1L5SA 1J8QA 5C4GB 3PFIA 3SCZA 4GOLD 4AP6A 3ZS8A 2NXJA 2Q2NA 4NMLA 1IOZA 1CY2A 1J70A 1ISHA 1O89A 1ZOLA 5EKTA 3SZLA 4JI5B 1JDNA 2AFHE 2PAAA 3GVIA 3M3PA 5BVHB 2R7MA 5BW8A 5ECDA 2ASVA 3PSHA 3AR5A 4H7IA 1DKMA 1JG2A 3RUHA 2HLPA 3ZHBA 4ZVRA 2BP7B 4UARA 5J2UF 5EE1A 2XIJA 2IHTA 1M8FA 2QVBA 4MCHA 4R98A 5E4YA 3L6BA 3OEHD 1R88A 4O1HA 3W5HA 4CCYB 4S05A 2BEUA 3CPSA 3TLBA 1JLHA 1MHTA 4PO3X 3ZBUA 5KTSA 5CNJA 3D8SA 1DG9A 4FZ5A 2E18A 1WTCA 3ZNNA 3KSUA 2AOUA 3SFTA 4O4LF 4XH9B 1T3TA 5M3BA 1JFSA 1PEKE 1Q84A 4LG1A 2RGNA 4H7HA 4D9IA 4EDHA 1QHHA 3SBEA 4EX6A 1RC8A 1CZHA 4CWAA 1PE0A 1A2QA 4MHOA 5DX8A 3ORQA 4FBLA 2BKEA 5KINB 1FFHA 2C9ZA 3FSEA 4RJLA 5HUJA 2FR0A 4TTPA 2ST1A 4MS4A 1BGXT 2Q45A 2PWPA 1LNSA 1OB5A 3SVZA 1A2BA 1GEEA 2WM2A 4QOIA 4FIZA 4X20B 3RVRA 2WE8A 2JLQA 4HMOA 3VR5D 4QM7A 3ROMA 4B3GA 1HMPA 1QP7A 4Q7EA 5KYUA 4D44A 1DWPA 2J3HA 4K46A 2PRZA 3GJQA 2HQSA 2C98A 3M70A 1ZW6A 4O4HF 1XLTA 3EWIA 1WS6A 1OMOA 2JHGA 2H9IA 4RY9A 1EXWA 1FDIA 3IV7A 4HCJA 3INNA 1YRBA 3RS7A 1NXPA 2DP4E 1WZEA 3OCUA 3N07A 5H59A 4KFUA 5TF0A 2I0FA 3HCFA 4HRVA 2IUUA 2X2FA 2HV8A 2J3JA 1H6DA 4A6DA 1L8AA 1RQXA 2YY6A 3PQ4A 4NMWA 5KNBD 4ID3A 3VDMA 3P5BA 2IODA 1F0KA 3F4KA 5JWOA 1FF9A 1CZOA 2PHZA 4TYMA 4R68A 1C29B 4BWFB 3KSMA 1J1ZA 2R6ZA 1GTG1 4FMCB 1ZH2A 2GUGA 1P0PA 3HA3A 4XIIA 4HUJA 3COSA 1QQAA 1F7UA 1CUCA 3CZCA 2DUNA 4US2R 5L3RA 5K99A 2R6GA 1HURA 1CEEA 4RVOA 4OU4A 2FX2A 4RA6B 4MR9B 4TQAA 3B78A 2YZNA 4PIVA 4R4JA 3W8FA 1T43A 2UU9B 4JLAA 3DKPA 3QY9A 4A4DA 5B36A 5LP6A 1VOTA 3UMMA 4P4GA 1M2GA 1XRPA 2BZ0A 2JJYA 5DP1A 2YYSA 1P4JA 4DCVA 4XAQA 3UKJA 4MDYA 3PE3A 5BNTA 5KQLA 1PYOA 2IH4A 1CUGA 1XAIA 2IEBA 3HV0A 1O58A 3U7EB 4UAVA 1HR0B 4KFRA 1KI2A 3LRXA 3GQVA 4D80A 5LD2C 5KUTA 3O1JC 3NHJA 5BWBA 1G1MA 4RMNA 1HYHA 2DR3A 4LIPD 2R8YA 1GFSA 1LZKA 1SVNA 1XL1A 2WJWA 3AW8A 4DT1B 4F4JA 2YJGA 3U3RA 4BLPA 5AUQA 3KVRA 1L5KA 2K87A 2IHKA 2MSWA 5IZCC 1UAAA 4KSCA 1T5SA 3OWXA 2VCHA 3BGDA 5HCNA 4KMMA 4XUDA 1Q20A 3AKZA 1X0VA 4TZ6A 4M2LA 1L5FA 4LPSA 3OQJA 1KKMA 4QRIA 2XTNA 2YWFA 3WR5A 4F92B 4YP7A 3R3SA 5DYGA 1ZM7A 2FR8A 2G8NA 3B5EA 3P9XA 1CDOA 5FBQB 2OBYA 3H2GA 3STYA 3T0GA 3WBBA 4PX3A 1I51A 1PZEA 3NHYA 1WPQA 4IYJA 4X54A 3FROA 3VAYA 4ALLA 2OILA 3QSGA 1DC5A 3CEJA 3L7MA 5AKXA 3NP7A 4HS9A 3RRYA 3AF3A 1KJQA 1PNVA 4RM3A 4HVAA 1DQZA 4DARA 1U9CA 5KMGA 1YZTA 4OB6A 5MN5A 3EW9A 1NW6A 2R7KA 1AZWA 2XMCA 4DG5A 4DZTA 5ED4A 1T8PA 4PONA 4ML3A 5KWEA 2PX5A 4TMTA 3KXKA 1M1YB 1E1RA 1WDLA 4G56A 4KE8A 4LDJA 4OXIA 3IMKA 4XLLA 2JLUA 1TYEB 1O5IA 4YMGA 1SUFA 1O6CA 5IKXA 4Q4AB 1HNXB 3QU5A 1GTRA 1AHIA 3FKSD 1QGUA 3H1EA 3DYIA 4TL7A 1ZM2A 3VU3A 4WUVA 3LBAA 5AVVA 4O4JB 3LBIA 1XTTA 1QUEA 3FYCA 3CIOA 2ONYA 4G0NA 3TRHA 1TOAA 1U2TA 2JL1A 1EPUA 1L5QA 1Y5RA 2DX7A 1H6AA 2ZXFA 3V2UA 1KSJA 2X58A 3SQNA 2EG9A 2PX4A 1B43A 1GO2A 1Z0FA 2XWQA 2WYUA 1DG3A 4O0LA 4UU0A 2ISCA 4LYFA 1E5TA 4XWTA 4ZCQA 5ALXA 5DBHX 5B3JA 4DS3A 4I9HA 4QQ8A 5JXWA 1KO1A 4MA0A 5EERA 3ISVA 1C3OA 3O6VA 3KS9A 1UK8A 4DLLA 1J00A 3E8XA 2AJ8A 3QI2A 4YJHA 1G8MA 4G4SP 1MO6A 3FNBA 3K2EA 3PL1A 4NH4A 5IT9A 3D4LA 1CYEA 3EEBA 4DKJA 2G5GX 4JVLA 3R7WA 1ZUIA 3ZQUA 1EG7A 1KKUA 4BV9A 1KP2A 1I1HA 3FNFA 4KN8A 2OK7A 2Q2VA 4YCJA 4AKSA 3E0QA 5FA5A 4US0R 4KR6A 3ROGA 4HP8A 5JEEA 1YB1A 2GF9A 3BQ9A 1JQEA 3LV8A 4OLAA 1KOFA 4BFXA 4LVCA 1DC4A 1TVKB 3CS3A 3TLMA 4DIMA 4DMRA 4F4CA 1T9ZA 3H8SA 1N2GA 1YQ9A 3BD9A 4EF4A 5LPNA 4BVAA 1ULZA 3ZW8A 3BDIA 1NWCA 3PXXA 2IYOA 3WB2A 3AXSA 4ZYXA 4H77A 3JR3A 3KV3O 2DUMA 2XZOA 4FQ8A 3DZIA 1P2TA 2WM3A 1EQ2A 4TZ0A 1KP9A 2HJ9A 3O3CA 3YASA 4B6GA 1XR3A 1ZAKA 4OLBA 2PBLA 2FRVA 1P5ZB 5CGQB 1AUQA 5GZ3A 3A9UA 2ZS9A 4WCDA 4BMNA 2HMAA 1CDEA 1G4UR 2BEWA 3HUFA 3MWEA 1JFFA 1AKRA 3EPPA 3WWZA 5K4GA 1M8KA 3ZDDA 5FR1A 1JEYB 1KR5A 4I5FA 2TECE 3CSSA 1JKXA 4JQOA 4TLAA 2ONJA 3VVLA 4L57A 3R1IA 3BRSA 2QN3A 3NHFA 5JOQA 4HF7A 4ERXA 2YXDA 2FFJA 4OH7A 3IJRA 4P31A 4P4LA 3R3VA 5DU2A 1TM7E 1TLTA 2TMGA 3RIEA 1SPXA 5L3VA 5E4FA 2G71A 1NN1A 3AHDA 3TNDA 1FNBA 3L84A 1JHVA 3A1NA 4QQRA 5LC1A 3RFCA 5LQMA 3WAJA 2IH5A 3IGFA 4AJ1A 4K1LA 3F6SA 3ZH2A 1CUXA 3CMMA 2B82A 2G0TA 4ZMSA 1J5PA 4AB1A 5BSKA 1T8RA 1E66A 2XEDA 3HCAA 3DB1A 3HEBA 1PL8A 2XUZA 1SVSA 3N3AC 4BDTA 5CXQA 2P27A 1JPVA 4RVUA 4CV0A 5A9SA 1DKQA 4NZNA 1E1QA 3X1MA 1JU3A 2CB0A 2ZR8A 3EGDB 1QH8B 5FPSA 1PGJA 2AJBA 5KYXB 1DEHA 3CNQS 2GWRA 2ECOA 1WA5A 5I7SA 3WVNA 2WU1A 3ZGZA 3BWYA 1P80A 3IALA 1ZM4A 2PV7A 4PIPA 4DBZA 4DWWA 3VV2A 4G5RA 1HF3A 3AUYA 1DAOA 3GARA 4BNIA 1G2QA 3VOAA 2CDRA 3H9CA 5IYZF 1TQ8A 2GWHA 1E3SA 3N59A 4JJ8A 5FYQA 2WYWA 5TPWA 2Q1YA 3WRWA 5B58C 3M4JA 1M6HA 3VO2A 4IDBA 5IJWA 2PS1A 4W9NA 1O9HA 2P0YA 1ORHA 1E6MA 2Q4EA 2PKWA 2O1WA 3MQ2A 4KIFA 5ITZA 4JI2B 3MINA 3ZHZA 3MWDA 1Z4MA 1KBOA 3EGIA 4EPWA 3I2YX 4IH9A 2KBEA 3NKLA 4P3KA 4N3AA 5I47A 3U7FB 4KR0A 4PSAA 3OM0A 1FFAA 4DF3A 2Z0MA 5CT6A 4HQNA 3UJCA 1H1LA 1WMAA 4PSCA 5T3YA 4ETWA 5IJZA 3MT0A 1BVHA 3COVA 3B6JA 5E8JA 4EIWA 1M5UA 2ZLBA 4LF9B 1KK3A 4LXYA 4DJ5X 3JPWA 4QDKA 4OQPA 2YWGA 4MAAA 5FJJA 3LBHA 1U0NA 2H1WA 3H7AA 1U1CA 3PXEA 3DCNA 4IF6A 3H9JA 5F5LA 5JXIA 2C8JA 2HU5A 2P6UA 3RRJA 4FFRA 5ESXA 3W78A 1SWWA 3WIVA 3EPRA 5E7MA 1L4HA 5KDDA 4GBJA 3TMAA 2P5YA 3JVIA 2QD5A 3GG2A 4UU1A 3F3MA 1EDZA 3GJRA 1P8AA 1YFKA 1ZO8A 4RLQA 4R05A 4MWTA 2E48A 3E03A 3EG5A 1ML3A 2QZJA 4PZ0A 3QFSA 2IE0A 3QVGA 1E8NA 1KP3A 3FMVA 4QHSA 4RV9A 1EFVB 3ETDA 3K4QA 1E2BA 3O1HB 3EDRA 2RJ3A 3GG9A 3SZMA 3H5OA 3F7NA 5IANA 3I1IA 4EYOA 1W4LA 2QTVB 5AFSA 1CT9A 1PQWA 3ZK9A 1BCSA 1G8JA 1H23A 1DC3A 1ZONA 1UBCA 2VPTA 1P2BA 3B2NA 1UUFA 4HWOA 3ZDEA 5IWAB 3ZJTA 3AM1A 3UFXA 1F12A 2Z5FA 5DYYA 4GMGA 2I67A 3GHHA 2OA0A 1SIBE 4J94A 4WCFA 4DY6A 2Z30A 1PUIA 4ASUD 4TXNA 5FBKA 1SUEA 2GPYA 2PBFA 4KX5A 4YBRA 4UD2A 1Q1QA 5YASA 1PT8A 5CK4A 1NMQA 5BMVA 4TRJA 1CTQA 2GZRA 1FFCA 2Y1XA 1JIKA 3NYWA 3VKGA 2B3TA 4TUYF 4CCWA 3WGIA 2Y3IA 1XLWA 5B5SA 2EP5A 5EMHA 4E1VA 1M8JA 1G2PA 1Z9BA 1J9ZA 1VLMA 1BWRA 3H3FA 2FMFA 1HFJA 1I3OA 2OBLA 3OLZA 2ZBRA 3SC2B 5JQGF 3MGBA 1IK6A 3AOGA 3RAJA 1ILEA 5HNKA 4PC6A 3K70D