3GO4A

Crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
262
Chain Sequence
RIDTESAHSARIYDYIIGGKDYYPADKEAGDAMSREWPALPVHMRANRDWMNRAVAHLAKEAGIRQFLDIGTGIPTSPNLHEIAQSVAPESRVVYVDNDPIVLTLSQGLLASTPEGRTAYVEADMLDPASILDAPELRDTLDLTRPVALTVIAIVHFVLDEDDAVGIVRRLLEPLPSGSYLAMSIGTAEFAPQEVGRVAREYAARNMPMRLRTHAEAEEFFEGLELVEPGIVQVHKWHPDAATADGIRDEDIAMYGAVARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein of unknown function DUF574
publication title Crystal structure of Rossmann-fold protein of unknown function (DUF574) (NP_823353.1) from Streptomyces avermitilis MA-4680 at 1.80 A resolution
rcsb
source organism Streptomyces avermitilis
molecule tags Unknown function
total genus 84
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2009-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04672 Methyltransf_19 S-adenosyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3go4A00
1KPHA 4WXHA 1VQ1A 2K4MA 2ZSUA 4HSGA 4CKEA 3KQTA 5CVUA 3HA3A 4K6MA 3OZRA 2PV0A 4F86A 8MHTA 5K0LA 3B3JA 3L8DA 3VYWA 4F85A 3FYCA 3AY0A 2QM3A 5LSAA 3TOSA 5ICGA 5K0JA 2WA2A 5ERGB 5E1DA 2VS1A 2OYRA 1JR4A 2GPYA 2PSSA 1MJFA 3P2KA 3KQYA 4FR0A 3R0QA 3HCDA 2YXLA 3HCEA 3ID6C 4PYNA 1R6AA 2UYQA 4GC5A 3E8SA 4HTFB 4YUWA 3ER8A 4DZRA 5LR6A 3TM4A 2FPOA 3LCUA 4QDJA 4RVFA 5E9QA 3T7SA 4EVIA 2UYHA 1ZG3A 2P8JA 3OPNA 5K05A 5DM4A 3C6MA 1ZGAA 1RJFA 2PXCA 1UWVA 3FPGA 4NECA 3SX0A 3MHTA 5CCXA 4POOA 2JHAA 3G8BA 2XYRA 4OBWA 4AUKA 4CTKA 3PLAE 3UJ7A 3P97A 2OB2A 3AWIA 5DT2A 1VP9A 3I64A 5GWXA 3VC2A 1XVAA 2ONYA 4L7VA 2Z6QA 2ZVJA 3DMGA 3EMDA 4DKJA 4G56A 4AZWA 1JQ3A 2GAFA 3NDJA 5CD1A 4HGYA 2P41A 3PX3A 4HC4A 4FS8A 1P39A 3HM2A 3GRZA 3G5TA 2IIPA 1NKVA 2FYTA 2P1DA 4BLWA 4QTTB 5IKMA 5EEHA 3FTFA 1QAMA 3A7DA 4DMGA 5KS2A 5EMMA 4E2WA 2BH2A 4E2XA 1AQJA 4O29A 3KQVA 3OCJA 4Y2HA 3IV6A 4A6EA 3PX2A 4PIMA 4QVGA 2ZWVA 4R8SA 3TFWA 2Q41A 2CMGA 4IV0A 5GM2A 3X0DA 4EMSA 2UZ4A 1ZGJA 4HTFA 10MHA 3G2OA 4YMGA 2PY6A 2CMHA 3GCZA 5EKUA 1T43A 2ZULA 2NP6A 1RI3A 2H11A 4E33A 2EX4A 1R8XA 3BWCA 2VDVE 3HVIA 2ESRA 3R3HA 4BP3A 5BW4A 5E2AA 1NW5A 4C4AA 4X1OA 5GINE 1IM8A 4XUDA 5B1SA 2PT6A 3KQOA 4PYIA 2EFJA 3NMUF 1KHHA 4C05A 2G72A 2H00A 3HCAA 3PB3A 2DPMA 2F8LA 5BP7A 3F4KA 1WY7A 2JHPA 2IH5A 1I9GA 3FRIA 4RTKA 3KPUA 3P2IA 3PVCA 3GDHA 3RW9A 1SQGA 1QAQA 1KPIA 3B3GA 4UOEA 1FJXA 1XXLA 4M36A 2Z6AA 2ZLBA 3PS9A 5DX8A 3UJ8A 4PYMA 3BWBA 3C3YA 4QTUB 2VDWA 1SUSA 4YMHA 2AN5A 5EIWA 1AV6A 2ZIEA 4M37A 2OBFA 5CVDA 1FPQA 1RJGA 2ERCA 3MQ2A 4B17A 3C3PA 2BR5A 1DUSA 3QV2A 4RX1A 5DPMA 5LQNA 2AVDA 4LG1A 2OKCA 3DH0A 1M6EX 3KQMA 2YUIA 3CKKA 3OE5A 5DM2A 3FZGA 4P7JA 3MTIA 5E1BA 2AVNA 1JQDA 2GB4A 5MHTA 1YUBA 1YFJA 1L3BA 5M5BA 4CTJA 4PNEA 2JH9A 4OBXA 4OQEA 2NXJA 1QYRA 5EEGA 2C7RA 3T7RA 5K0FA 2AN4A 3DLIA 1L9KA 1X19A 2CWWA 4R6WA 5E8RA 4QQNA 2WK1A 3CJTA 1JTEA 2YR0A 5D1HA 2PXXA 1UIRA 3MCZA 3PT9A 3HA5A 1WG8A 4RTPA 4IV8A 1EAMA 3AXSA 1G6Q1 2AS0A 4KDCA 1NW8A 3I53A 3K0BA 3EEOA 2I6GA 3EEYA 3VC1A 3NWBA 4KRGA 4ISCA 5U4XA 4ER6A 3NJRA 3BKWA 4PYOA 1VPTA 5CUQA 3P9CA 5DSXA 4CKCA 5LQRA 5JUWA 5HEKA 3DXXA 3FUXA 4RTMA 4KWCA 5GIPE 3TQSA 1HMYA 4RTNA 3A4TA 3FPHA 5K8VA 4WVLA 2EG5A 2C7QA 3KQPA 5DWQA 3EGIA 3HVKA 1P91A 2QY6A 3ELDA 1SKMA 3P9IA 3JWJA 2NYUA 5K0GA 3BWYA 2P3QA 1XDZA 3E7PA 3D2LA 3BGDA 7MHTA 5DLYA 3DXYA 1XCJA 3TRKA 3UJ9A 3SSOA 3V97A 5EMKA 2AOWA 2IDKA 2P7HA 4PYLA 3KU1A 1X1BA 1FBNA 3ME5A 3FPEA 3KR1A 2PBFA 1IY9A 4ATNA 1YB2A 1OR8A 2PX2A 5C1IA 4P7FA 4GOND 5FTWA 3LDUA 2P3OA 4AX8A 4JXJA 1X1CA 2JG3A 4M7RA 2ZZMA 2P35A 1WZNA 5EVJA 4PGGA 2O57A 1YF3A 1G60A 1M6YA 2E5WA 5T6BA 3EMBA 2ZIGA 3O4FA 1AQIA 4OQDA 4C08A 5LQAA 5DX0A 4YUYA 3EVZA 3KQSA 4OX9Y 3TM5A 3DXZA 3LHDA 4V0RA 2I62A 2FRXA 3GRRA 5GIOE 5FHRA 4KIFA 5DTMA 2BM8A 1ORHA 5GP1A 4HG2A 4CXMA 5DXAA 1L1EA 3GRUA 3LBFA 1G55A 2O06A 2GS9A 3KR9A 2ZCJA 3SMQA 2FK7A 5T64A 3FUWA 5ICFA 3FPJA 3KR2A 5EZQA 5LQKA 3UBTA 1BHJA 5BW5A 5HOQA 3CC8A 3IYLW 4YV1A 4CKBA 5K0CA 4PINA 2JH8A 2DULA 3KPJA 2ZZNA 2GA9A 1I1NA 2PLWA 3LX6A 3MCTA 4PYQA 4R05A 5EHGA 4RTJA 1JG3A 5FHQA 3JWIA 3DLCA 3UJBA 5DM0A 4ER0A 1YFLA 3H2BA 5EPEA 2PWPA 3IHTA 3ORHA 1BOOA 2HV9A 1R00A 1JSXA 1N7IA 2EJUA 2G8NA 3M4XA 2IGTA 3EVBA 4FZVA 4GOLD 3UJDA 3B89A 1Y8CA 3LBYA 3QOWA 5HILA 4KDRA 3FRHA 4BP1A 1KYWA 3V8VA 3A7EA 4RTLA 5C0OE 3GXOA 3SVZA 1F38A 4C07A 5CCBA 2I9KA 2Z6UA 3DR5A 3DUWA 2AR0A 2B78A 3P8ZA 5BXYA 5E2BA 3FUUA 3GJYA 1JTFA 1SUIA 3OE4A 1L3CA 4DCGA 5ICEA 2CL5A 5GOZA 3A25A 4C04A 1F3LA 4DQ0A 2XVAA 3AJDA 1DL5A 3FTDA 2ZIFA 4P7GA 3PFGA 3RIEA 1D2CA 2ONZA 4RWZA 2YXDA 3CBGA 3LCVB 4U7TB 5FQOA 5KQRA 2BZGA 3GO4A 5E1MA 5E8JA 5CIYA 3KPWA 5HFJA 2HMYB 1G8AA 1SQFA 5FA8A 1WXXA 3UFBA 5DX1A 3HNRA 1RJEA 5T67A 1AF7A 1RI4A 3WSTA 4EK9A 2R3SA 4OA8A 4ER3A 4OA5A 2UYOA 1N7JA 1R8YA 1ZKDA 2B2CA 3GRYA 2OPBA 2XVMA 3O31A 3Q7EA 4MQ4A 3GU3A 2EJTA 4MTLA 4R6XA 1JSZA 3M6UA 4RSRA 2PGXA 4RVHA 5HIKA 2IDJA 3GGDA 3NVMB 2IBTA 3PFHA 3SM3A 2GH1A 5GM1A 4Z2YA 2CKDA 3SR4A 3UJ6A 5CM2Z 3LGAA 2PJDA 3BZBA 4MHTA 2I7CA 2HTEA 3JWHA 4GOOD 3DP7A 4XCXA 1R18A 1EJ6A 1TPYA 4KW7A 2WA1A 4AZSA 4XUCA 4QVKA 2ZFUA 4QPNA 1ORIA 2B3TA 5HIJA 1KP9A 3TLJA 3BT7A 3OZSA 4M38A 5DTQA 3HTXA 2HWKA 3M33A 5EMJA 4AZTA 3NWEA 3BXOA 3T0IA 1SVUA 2FHPA 3BWMA 3R9XB 5EIFA 3EGVA 3ELYA 3M70A 4GC9A 3HVJA 1TW3A 3KQQA 1U2ZA 2NP7A 2IPXA 3BGIA 2NXCA 5EC8A 2C7PA 3NW9A 5FADA 1JG1A 3U81A 3MTEA 3B7PA 5CVEA 3S68A 4A6DA 4RTSA 5FWAA 5LQJA 4MIKA 3BKXA 3HCBA 4HH4A 2LD4A 3DMFA 5EG5A 2FK8A 3NTVA 5DXJA 1NE2A 4DM3A 4FGZA 4GOMD 5DRTA 3TKYA 1QAOA 2AN3A 5FULA 4E2YA 4Y30A 1KR5A 4BLVA 2V7EA 1VLMA 1RI1A 3OU6A 5EKXA 4DF3A 4GQBA 3NVKI 2H1RA 3CGGA 4AZVA 5K03A 1YZ3A 4IWNA 5K09A 1VP3A 3AXTA 3QOXA 2IP2A 3OFJA 2ZBPA 3LKDA 1O9HA 3EVAA 3P9NA 2AOUB 3VSEA 5JR3A 3TR6A 1RI2A 1QZZA 1X1AA 2PX5A 2PXAA 3MAGA 1NBHA 4P58A 5E9WA 4RVGA 3SSNA 3UA3A 1SG9A 3DTNA 4H0NA 1Q0TA 2HR1A 2BR4A 2G70A 3GWZA 5F2KA 1VE3A 3EVEA 3G7UA 3KQWA 4C06A 1DCTA 2Y1XA 1V39A 3FUTA 1KPGA 1NW7A 3DULA 5DSTA 4E32A 2JJQA 5FUBA 1D2HA 3OU2A 3ERCA 1NV9A 4DCMA 1ZQ9A 3ER9A 4E31A 1PRYA 3I5UA 4IKPA 3KPYA 3FPFA 2KW5A 1L3IA 2PX4A 2ZBRA 3KHKA 5CVJA 1G38A 3K6RA 2O07A 1JG4A 4GUAA 4GEKA 4YUXA 3MERA 3O7WA 2A14A 5HIMA 2ADMA 2P3LA 1TW2A 3CVOA 5FWDA 1NBIA 4PYKA 2UYCA 2R6ZA 3FTEA 4BLUA 4V0QA 2FCAA 2O05A 4ER7A 5K0EA 1XCLA 3TMAA 1XJ5A 3HCFA 3LDFA 3G5LA 3PTAA 4LWOA 4PYJA 4GBED 1EIZA 1RJDA 2NXNA 3DMHA 3M6WA 2AOUA 3R6TA 5EZSA 2XYVA 2IFTA 3IEIA 5C9ZA 1RI5A 1Z3CA 3CJQA 2ZZKA 2PWYA 1PJZA 1ZHFA 2OXTA 5FCDA 4X61A 3MGGA 1NV8A 5DRYA 5KVAA 2YTZA 1FP2A 2QRVA 3DOUA 2ZTHA 4FT4A 5FA5A 3SXJA 3T7TA 3ELUA 4LECA 3G88A 3EGEA 4FSDA 4PCAA 3UJCA 4FP9A 2PT9A 4RV9A 3A26A 1O9GA 5EOVA 3Q87B 5D1NA 3HA7A 2ZBQA 5CVVA 4PONA 3EVCA 3LPMA 1VL5A 1I4WA 5DTRA 4EQZA 2IBSA 3LKZA 1P1CA 5ICCA 3M6XA 4BY9E 5G02A 5E9JA 1D2GA 1EJ0A 3C0KA 3G89A 3LCCA 3UA4A 5LQCA 4RYLA 4U7PB 1FP1D 3P9KA 3P2EA 1NW6A 2P7IA 2GLUA 1NW3A 2N47A 3G2MA 3LDGA 4EKGA 4RTQA 1XDSA 3LL7A 3E05A 4E2ZA 4KVZA 1P1BA 4E70A 3HP7A 5K0NA 5LQUA 2VP3A 2OB1A 2Y1WA 3B3FA 3C6KA 4PWYA 2G1PA 2NNWB 3CCFA 2IH2A 3UWPA 3GIWA 1UFKA 1N2XA 1WXWA 2XYQA 2OZVA 2JHCA 3LECA 2AZTA 2QYOA 4QQKA 1YZHA 2YVLA 1H1DA 2AOTB 4F84A 5EHIA 1VBFA 2OY0A 3EPPA 2BR3A 2OO3A 3ANXA 3NDIA 5K01A 1EG2A 3R24A 3G2PA 2NXEA 4RVDA 4RTOA 3HCCA 3I9FA 5KYGA 2ORED 1BC5A 3UZUA 5K0BA 4RTRA 4ZTBA 1JG2A 1B42A 2YX1A 4DA4A 4X60A 3E23A 3KR0A 3SSMA 5EMLA 5F2NA 3MB5A 1MHTA 1EQAA 3FTCA 5F2OA 1XTPA 1IXKA 3KKZA 2B25A 3GNLA 4YUZA 3THRA 3KPVA 3OZTA 2O0LA 3OFKA 1NT2A 3G2QA 3HVHA 1WS6A 4R8RA 5EQJB 4YUVA 1QANA 3ELWA 5DM1A 2BM9A 3GRVA 4LWPA 4XUEA 2IH4A 2ZW9A 3THSA 2G71A 2B9EA 3EVGA 4GF5A 4HGZA 3LSTA 5FQNA 3BGVA 2P40A 3G8AA 2QE6A 2VZ9A 5H02A 1XDUA 3EVFA 4PCLA 4KIGA 2VDUE 2ZWAA 5EGSA 3RODA 3EVDA 3SGLA 3TKAA 5E1OA 2XBMA 3REOA 3M6VA 5IH3A 2PX8A 4E30A 3I58A 1M0EA 1Q0SA 2YXEA 2AOTA 4X41A 4FT2A 4CWAA 2V74B 3B5IA 3FYDA 4X63A 4QDKA 3OU7A 3TPZA 2AOXA 4PIPA 4C03A 5HIIA 1R74A 5HZMA 1KXZA 4YV0A 3BUSA 4YV2A 3FUVA 4MWZA 4FSXA 4ER5A 1O54A 2C7OA 2HNKA 1BKYA 1KIAA 5KQSA 1G8SA 4HRAA 2AOVA 4P7KA 4PGHA 2PKWA 4QPPA 2PVCA 3HEMA 3A27A 1VIDA 2YQZA 1KYZA 2QRVB 1JQEA 1INLA 3UJAA 4EKIA 3P71T 3CJRA 1HNNA 3JWGA 5P8WA 1X1DA 9MHTA
chains in the Genus database with same CATH superfamily
1K6MA 1S02A 3GT7A 3HO6A 4XR4A 3D8BA 2VRNA 2XZPA 4FXOA 3DHWC 4LPSA 5AT1A 1Z2DA 3TQIA 1Z18A 5ILOA 5BQFA 1Z35A 2GKOA 4LMAA 5CEJA 5JZ9A 1MN6A 3OZRA 2PV0A 2WFLA 1XU7A 4TLMB 2AGVA 5K0LA 3NGLA 3KHUA 3S1AB 4F85A 1TL7C 5LSAA 4OB6A 5EIHA 3RUEA 1MOSA 1OJ7A 2IXGA 4BU0A 4CEHB 2PH1A 3KLMX 1G3UA 4LYGA 4H1WA 4TKVA 5LXTA 5TRTA 3TTVA 4CCWA 3L3BA 3IAHA 1TQ6A 3KJGA 5I7VA 1X7XA 3CTMA 2P62A 1ZG3A 3K9BA 3U3XA 3EPKA 1V71A 2AC7A 2Z2KA 2CN1A 1JXMA 3C6XA 7AT1A 4HEJA 2VJMA 5GOTA 2QRQA 3QNUA 3R3XA 1NJ1A 3MUEA 4AUKA 1FYDA 3PLAE 3TZHA 3ZJ5A 5E0KB 5CB6A 1NDQA 4YCDA 3OPYB 1TCVA 3PGA1 1RRPA 1XVAA 2ONYA 4L7VA 2CF6A 3LIPA 3ZVMA 1DEHA 3DMGA 4CUZA 2VA8A 2WNIA 4TKZA 4OHZA 1NWHA 2PD6A 3NDJA 3OIFA 1CF2O 2WD7A 1KS2A 3D2BA 3WP1B 2VBIA 4O4HB 3IILA 2JD2A 3NU1A 4CU5A 2QR3A 4KRFA 3OOJA 3KXLA 1PKXA 5JC1A 2YFKA 3DEAA 1Z5NA 2EWVA 2QSYA 2LIPA 1V8ZA 3HDYA 2GHRA 3O91A 1E20A 4PFSA 1P7VA 2GEUA 2HSEA 3L6OO 4ERXA 3EVTA 2AFIA 4KXUA 3HKBA 4A6EA 3PI6A 4NG5A 4OUDB 5BV8A 4JVMA 1VIMA 3RSFA 4YP5A 3WJ2A 5IAAA 1EQ2A 3F6BX 2AJDA 2PY6A 1CS0A 3FMGA 3GPLA 2IUFA 3ZLTA 4ABYA 4E33A 2PX6A 3PC7A 4JB8A 3T8YA 3BWCA 2N42A 2EIHA 1PJ3A 5BW4A 5EJ5A 2P0EA 5GINE 2VT7A 3O8DA 4YMWA 1Z28A 2NUAB 3B78A 2VJBA 4MH0R 1JZQA 2JGDB 2J41A 2Q3DA 1DZ3A 3A4IA 2O8EA 1RHUA 2Q99A 4X1IA 1T3TA 5I7HA 1AVTA 2GNOA 4ZAZA 3GYBA 3PF9A 3A6ZA 4KO1S 4KO4S 2HB6A 1IIBA 1RZ3A 5ELMA 1P2SA 2QRNA 3CINA 3I01M 3INNA 4KWEA 5EKDA 5BSMA 4W8GA 4H6WA 4PX3A 4ZN6A 4F91B 4M37A 3QH4A 1U31A 1HWYA 2EQBA 3QE3A 1H2YA 2DBZA 2X0NA 1U5BB 4JIGA 3UK6A 3A9UA 4TYNA 1TT5A 1PR9A 2JAPA 4RX1A 2RG7A 4TSKA 2P6PA 5TSDA 1E5VA 2UYGA 1EXMA 2P6MA 2OFFA 1RM5A 3MTIA 5CH5A 1DAKA 2CEAA 3U48A 3TQOA 3TDKA 4AT1A 1FS4A 1JS1X 2D1SA 3WXMA 2Y0EA 4G1EB 5D6NA 1BQ4A 5HKLA 5K0FA 3CN7A 3K73O 1AKQA 2C8LA 4JYCA 3JSXA 5JI2E 3PPWA 1RHJA 1E9FA 2WK1A 3BHMA 4WDQA 5ARCA 5AW0A 2DH6A 1WG8A 4RTPA 1XZBA 1ZSNA 5D84A 1NAHA 5DMHA 1NW8A 1AJEA 1FS5A 3RVRA 2J9GA 3IXQA 4EVSA 4NEHB 3QIAA 1EVEA 1GQRA 3ADDA 2PKCA 3QX9A 4JI6B 3ZIUA 2QVLA 1XMXA 5CM9C 3I2FA 2B5VA 1W4CA 2C4UA 3A4TA 2ZJYA 4Q3OA 3U62A 3M3DA 1Y6QA 2LGJA 2ZKIA 2HZBA 3DM9B 3KKQA 2GMWA 1SG0A 3OX4A 5JAUA 3E5HA 1IJBA 1LJUA 1Z8DA 1CD5A 3HEAA 4J2HA 4M8SA 3D54D 1V9SA 4LVCA 5SYNA 4IDEA 4EG8A 3W04A 1XPOA 1JKIA 1CTQA 1KDTA 2PUTA 1UOEA 1SPBS 4E12A 1TM7E 1J8MF 2IYWA 2B99A 2CLIB 4Z9YA 3W5HA 1IY9A 3WWDA 4EQ6B 1OR8A 4CQMB 3GEGA 2QMZA 2E49A 3WV4A 2I03A 3DDHA 1SG6A 4NPHA 1IY8A 1FDSA 3AFIA 5FTWA 4DCNA 3FZYA 3ROXA 3VPAA 1VI5A 3TW8A 1IWOA 2OENG 3FDZB 1P8JA 1AQIA 1NJGA 4WEQA 5DX0A 4E5PA 1W9HA 1E2FA 5E3JA 3RIGA 3AHGA 3W1VA 1GDHA 2YVUA 4FMBB 1U6JA 5KREA 2PUDA 3WHPA 1LDMA 3O0TA 2JHGA 3IPYA 4MVJM 4RXTA 3TRDA 1SKYE 2IP4A 4YRDA 2POQX 2HBYA 5J9FA 2GZ3A 2Q4OA 1UBNA 4DLLA 3PZBA 5L3QB 3N2LA 1OXXK 1AUQA 3F5FA 1MX9A 1YC5A 2XXAA 2KPOA 5F9MA 3WX0A 3QXSA 4V38A 4YIKA 1JRLA 3A2NA 4PYQA 2YN4A 1ODIA 2GTIA 1ZINA 1ZRHA 2IBMA 2PSEA 4CN8A 1LNQA 1LSJA 2FN3A 3V8QA 5IANA 5B12A 1VJ1A 4RENA 1L8AA 2HUNA 5G1NA 3F3SA 4FQ7A 2GHIA 4N5HX 3LUDA 4ZGGA 2DUNA 2AW3A 1FMFA 2G06A 3HGQA 4X1YA 1I3NA 1Z9BA 2R4QA 1FX0B 2F3QA 1Y42X 3HGMA 5EJ8A 4UNPA 4DHWA 1EUDA 4XQ9A 5BSKA 4KMOA 4H3VA 4NFLA 2BMFA 3W5SA 4BS9A 2C8KA 4RTLA 2CV1A 1FTNA 2AXPA 2B69A 3ZI0A 1VL1A 2L42A 1T1SA 1Q3TA 4Q66C 4XSGA 3CFYA 3BTSA 3CWQA 3DWEX 4KIJA 1Q1QA 5FTNA 3FTQA 3GGCA 2FXVA 4F56A 3ED1A 3TUZC 1G19A 2ZAGA 2CC2A 2JRCA 3C3CA 1YKFA 5DI3A 2O6LA 3OEEA 4MO2A 5LDGA 1SOVA 2Y05A 3USZA 1PQ4A 2GT1A 4JUAA 4IINA 3EIFA 3LBHA 4IZIA 3UKJA 5L7WA 2D00A 1C0LA 2JLRA 3O4VA 4HXGA 1VA5A 3ENVA 4MV6A 1EXWA 1I6LA 2F43A 1OZAA 4OLBA 4YJ2A 1ZSVA 3Q2IA 3OI7A 2BJVA 3LCVB 3O5AA 5BWOA 4MJXA 5HF6A 4A27A 3EZ7A 3KZVA 2XVXA 4FMDF 3ST7A 4C3OB 1GDTA 4LXIA 4OXXA 2DHQA 2H9IA 2X13A 3T4EA 2JI8A 3UFBA 3UOWA 1S1CA 1FRQA 3B1FA 3TE7A 5C5EA 3PXGA 1AF7A 1Y81A 3WRYA 1QH1A 5E4TA 4CM4B 1CLEA 1N7JA 3L9XA 5D00A 5AQEA 2ZB7A 2GGSA 1B7GO 2A67A 3K16A 5JNRA 4H0FA 2CSUA 2E6KA 5CH8A 3JQ7B 4LZNA 4ZFNA 1XYYA 3D7MA 1X9GA 3EG9B 4Y7DA 5JSZA 2EQ5A 1YR9A 3ND9A 4FS3A 4Z7JA 1AN0A 3LGAA 1R66A 3CNNA 2NSDA 3VUEA 1SA0A 2I7CA 1EX9A 2GZSA 1T8TA 1NWCA 3P7MA 1QIKA 4FWIB 3UMCA 1J90A 3T9EA 2NZ2A 3V8MA 4DV2B 3H9QA 4Q9DA 4A82A 5FIUA 3MIIA 1Y1KE 2Y1KA 2X22A 3BT7A 3M33A 5EYPA 3P4XA 1FRZA 2ON6A 2XX3A 4ZO8A 1B1CA 3BWMA 1PN3A 3C8UA 4DUGA 1REQA 1Y7PA 5AVVA 3GLUA 1ESZA 1GA6A 3V46A 3HZRA 1B6SA 3D4OA 1PFQA 3DBOB 1H8ED 3Q5EA 1TVCA 2A5YB 5K3SA 4A92A 4BE4A 1JG1A 3WGMA 1ZL2A 2RHRA 2HLDA 4D0SA 5JW6A 3P0EA 2Y66A 3NH9A 1S2OA 3NDPA 1H2BA 1JJVA 3MMXA 5E0OA 1ISHA 3CPJB 1YI1A 1B6TA 3BWDD 2VJYA 3VV3A 1NE2A 3B2EA 4W99A 1ADYA 4E5DA 1K3TA 1E8NA 3FPKA 3T0GA 3G68A 1C9KA 2WLTA 3BDAA 4GPEA 4INPA 1OX5A 3GLQA 4L4YA 5K03A 1IQRA 4TRJA 4O2AB 4KVGA 3RROA 4LY9A 4M1MA 3MGBA 2B4TO 4EF4A 1KYYA 1NZDA 2VT2A 1PNQA 1HEYA 3COYA 2ZYHA 3P9NA 3VSEA 2GLTA 3KX2A 4Q1EA 3ZY6A 1QZZA 1R6UA 2ZYTX 3D6AA 1TZ2A 5D7BA 4CMJA 5EXPA 4FC7A 4RXUA 1QBGA 1TGVA 2BBWA 3AVQA 3WISA 4HDRB 1ZR2A 1BYIA 4D97A 2MSNA 2BE9A 2R6AA 5BVGA 2FW6A 3P27A 1UANA 3P9XA 4II2A 3VOSA 3BCHA 1GZ5A 3IO3A 4I5EA 1KJQA 2BIFA 4K9QA 4QOHA 3RFTA 4EUHA 5J23A 3JQ8B 3PSHA 4AZ3A 4DLBA 2Q1UA 1BAPA 1PUJA 3LT1A 3M4YA 2AKEA 1WXFA 4RJ2A 4DG5A 2JI7A 4H7DA 4Y9RA 1MXHA 1ZI6A 4IHQA 4IKPA 4OQXA 5AM4A 2KX7A 2WG1A 4LYJA 1GEEA 4LJAA 5J2TA 4B73A 1ZLXA 3U4QA 4GKKB 1ONOA 1L7AA 2QZSA 5IJAA 1MDFA 1EXVA 5IVIA 2XMCA 4GM4A 4KK3A 2IPAB 3R3JA 3IMFA 3O3CA 5CB4F 3RADC 4DAOA 1KZ4A 5CXUA 2I3BA 1V9CA 4X7RA 2BWJA 3NBYC 4BLUA 2YRWA 3CLRC 3NT4A 1Z6AA 4MI9A 1SXIA 4P0TA 5DCYA 4XJVA 2OFOA 3CY6A 5EJ6A 2HQSA 4E09A 5FAXA 1E89A 2WAYA 4LJRA 4JLNA 1V96A 2GD2A 1TLTA 2IC5A 3PDUA 3ANNA 2X9LA 1E2IA 3CJQA 4HRYA 4QDZA 3ULKA 4PV7A 2E4XA 5JNWA 5I4IA 3STXA 5A9TA 3GPCA 1H05A 5FA5A 3QFCA 4HDOB 1OAOA 2QYHA 2HLDD 1V47A 4JUBA 1QQ6A 2NUTB 3ZD6A 4FP9A 2GXQA 2QENA 2JGKA 2VAVA 1T6XA 1QHEA 1LRLA 1V8OA 1ZZEA 3CZAA 2VH1A 3FNIA 3OFNA 4MHOA 3EVCA 4WY5A 4B6GA 4WCVA 3L43A 3ZCVA 5IAEA 4DVJA 1G16A 2YS6A 3CR3C 4ZTZB 3LYAA 2XUHA 1MH9A 1UBJS 2ADFA 4AN4A 1BE0A 2RAUA 2JEZA 2RHOA 3JVEA 5I9SA 6ADHA 1KYIA 5EJGA 3E3OA 3U0BA 1F8UA 4GZ6A 2E89A 4I1PA 1ZJZA 3LQRA 3ZY5A 2I1LA 2PS0A 2WSMA 2HBRA 3BXGA 2G4LA 3H8SA 2N47A 1D9XA 4M9SA 3IBYA 1OT3A 1B8VA 3EEBA 5IYZB 1EFAA 4EA7A 3HP7A 1TQHA 1JFFA 1U98A 1WMEA 4D0NA 4Z1MD 1P5JA 4NVRA 3VPBA 1GZDA 3VVLA 3UJNA 2P77A 5AFSA 1JSRA 5DYIA 4H08A 3R0VA 5ERXA 2ASEA 3DM5A 2NU7A 3LECA 1NP6A 2AZTA 3CT6A 5BQXA 1QUFA 4R2XA 2ZVDA 3AUTA 1XEWX 1Y33E 3Q3VA 4UVDA 5KNDD 3K4HA 1P5ZB 1SNYA 4BO1A 1EG2A 3HKCB 2XKKA 3VVBA 3FROA 4D8XA 4CL8A 5C8DA 1LFDB 1YAHA 2VHCA 5AOAA 5BXQC 3ZJVA 4HZIA 4DJ5X 1HQKA 3KTAA 3TSYA 1F8YA 1UK7A 2VF8A 1SB9A 2DC1A 5DU2A 4YY3B 1FRFS 2JVKA 3GGJA 4YRNA 2WYVA 1OOEA 2Z9CA 2J3LA 3B38A 3KJQA 3JZIA 2HYIC 4PYKA 3W9YA 1V1MB 3F78A 4HXYA 4KITB 1U8CB 4IEEA 5LFAA 5K2OA 1RXVA 3THRA 2VP5A 1V45E 4ETIA 1JAHA 2O4CA 3G02A 4JVNA 3FCAA 1IWPB 3ELBA 3OD1A 2OG1A 3Q8XB 4LJ5A 1VECA 1WS6A 1VMEA 5TS3A 1X15A 3C1AA 3SYRA 4AMZA 3A2LA 1E6CA 1WW3A 1NJ5A 3CLSC 5C3UA 1IPHA 1JPJA 2KB0A 2WKRA 4IX1A 2HWYA 1N78A 4LXQA 2GA8A 2TECE 1NYRA 3KAPA 4HX2A 2H1SA 4L76A 2JASA 5FB3A 1KE2A 3O8QB 1S4MA 2E87A 3OQHA 2BDTA 4U8GA 4CODB 5HRAA 1UXKA 1W2GA 1RKBA 3SDSA 4DKXA 2E4AA 4F60A 2VC2B 4NMXB 1SHLA 3JQDA 2C1XA 2W48A 3KTOA 4X41A 3ZBPA 2GPNA 3R5JA 2BHSA 2A33A 3OCZA 4UOZA 3UK1A 3I5AA 3NEJA 2IHNA 3I01A 4RZUA 2J3MA 5H1YA 1UBGA 1R74A 1W85B 5HZMA 1YI0A 1KQPA 3D7KA 3UBMA 3VZSA 1C30B 1II8A 1D4FA 2HGSA 3N5KA 1LDBA 3G2LA 4HR7A 3R75A 1PEAA 4GSYA 1VSUA 2FMUA 2R7NA 3I3SR 3N87A 4O0MA 4TZ6A 4DLXA 3UK7A 2YOHA 2LZ0A 3NWOA 3NUZA 1XTIA 3TBHA 2A0UA 3AFMA 5HX7A 1BHSA 1JHMA 3DAOA 3HJTA 3U6BA 2GARA 1MXFA 4IMPA 3VHRA 2QV0A 4YJ3F 1XWFA 1L4BA 1HNNA 5ALPA 1KPHA 1UKZA 1VPDA 3N2IA 3QBTA 3JRNA 4BX0A 2EGHA 3CUYA 4IDFA 2JLCA 5AW4A 4XGKA 1D1PA 4KXFB 2JKVA 3AIOA 1KZHA 3K0FB 2GBFA 4OXIA 3UK0A 4FYYA 3UKDA 4QVIA 3GD7A 1L5SA 2F9MA 1U7PA 2VNHA 4IZ6A 1B43A 1S5PA 2AUTA 4HN9A 4AJIA 4QOIA 1DWQA 1C7IA 4HZGA 4YECA 3SR3A 4MV3A 3HV2A 5KIAA 2DBRA 4TS3A 2PFKA 1VG9B 4PC6A 4XDYA 2H9YA 1C9MA 4IXNA 3FUCA 1R6DA 4FYJA 1ZJJA 2OHFA 3M0EA 3KO8A 4DNOA 2C9CA 1HKHA 2CUZA 4WKPA 1RSZA 4NEGA 4URUR 4CTKA 1BHQ1 2FTKE 1GIAA 4GM1A 3ONWA 4PHHA 3EPLA 2LBPA 1Z0FA 4EJFA 1IVYA 1VKHA 5DT2A 2NQ8A 2ZI4A 3QTLA 4PX9A 1YRLA 4ZVSA 4E7OA 4ZV4A 5BR8B 1OTHA 5JPCA 2FZWA 4GVPA 4FILA 4G56A 4KXXA 4OJQA 3JQGB 2PYZA 1A2BA 1JHRA 4ZQGA 2R97A 3ZJUA 3GLKA 3AF1A 4RSMA 2HWXA 4RQUA 4E3ZA 1NONA 2FYTA 1CUCA 4TTQA 4KYIB 3A7DA 3AGPA 1SC4A 4D4JA 3EIHA 4ENQA 4HVCA 4HHEA 4LOLA 1E2DA 3OCJA 4BFTA 5CA1F 2ZUFA 1HQYE 3IPAA 3LHKA 3HN2A 3LI2A 3X0DA 2FFHA 4QRHA 3TFWA 1LDYA 5CFRA 4C3ZA 1E96A 4MVJP 3IL2A 4N82A 4ACAA 3FOCA 1RAGA 5IVPA 3A58B 5ALRA 3BFJA 4EG0A 1M2OA 1DLJA 2CNWA 3WMXA 3ORRA 2D1FA 3HYLA 3CX3A 2L69A 2VDVE 3A0UA 2PJRA 1VJDA 4JLDA 3UPUA 3JAWB 4QGSA 1HQDA 1THZA 4NMMA 3I92A 3WGKA 5CJ2A 5FLEX 4W5HA 2G4CA 2OAEA 1NUSA 1EWTA 1XZNA 5FNZA 2NYAA 1V8BA 1PZNA 4U2EA 3OJLA 1G20A 3GRKA 4FFMA 1PT9A 4BO8A 4U2GA 2DU8A 2WUGA 4B4DA 3N0WA 5AWFC 1MC8A 1O94C 3AF3A 1TCUA 4FOTA 3Q41A 2UVDA 3Q3HA 1A0OA 2GUGA 3CVVA 1Z4QA 2C5LA 4DDMA 3ANYB 4B3HA 2YJ4A 3V8NA 5FR1A 2D0DA 1UM8A 2VDWA 3NX4A 1NPDA 1KK1A 4H6XA 1JPUA 1I13A 3RS4A 3N58A 1RJGA 3SSAA 4BYMA 3DVSX 3OQVA 4Q0MA 5DLPA 2XAUA 1ILEA 3QV2A 1GPKA 4I6EA 5KKAA 5DPMA 4GD3Q 3DF9A 4LG1A 1MD9A 4B8ZA 2YUIA 2O3QA 3WAJA 4RD6A 4XIGS 4IFTA 2OHXA 2CE2X 4BE9A 2AVNA 3N1UA 4KV9A 3BB1A 4R5MA 1WKVA 2R47A 3GLIB 5JZBA 4OBXA 3GOQA 5C4IA 2B34A 3MRSA 3Q7TA 4BFZA 4J0EA 3ENKA 4PZAA 2CWWA 1O58A 1ENZA 4HRVA 1A9QA 1C50A 1SIBE 3FFXA 1GO2A 4FYWA 3CUWA 2J0UB 3QENA 2PXXA 3RNOA 4YFYA 3AR3A 2WTXA 3IALA 3OZBA 3RVNA 3PPYA 3AEYA 3SM9A 4RZ3A 2LRHA 3WIEA 3ZYCA 1U90A 3K0BA 3I9NA 3PICA 1KJJA 2XQGA 3CZ9A 3EC1A 4L4RA 2GAOA 3SHVA 1TA0A 3ANLA 2J3DA 3EXHB 5F78A 5H70A 4E46A 1YS7A 5JUWA 4CCSA 5TQ2A 4DEXA 4O4JF 1FFXB 2VYCA 3DKVA 3S2UA 1YQWA 1HMYA 5K3DA 2VDRB 3GN1A 1N36B 4BKPA 4WVLA 4JSRA 3OF3A 1YQEA 3NT2A 1GR1A 3ROGA 1AZTA 2QY6A 3EFOB 5KTRA 3O3NB 2AW5A 2HSGA 1GNRA 1E0DA 3R7DA 4J75A 2BFDA 1TM2A 4HNHA 5AJYA 3E7PA 4DJAA 4EYOA 5DLYA 1EJBA 1DIHA 2GAIA 3C8MA 4CDMA 5BN1A 1JKFA 2GCOA 2PG3A 2X0KA 1OFUX 5I45A 1BCRB 4M1QA 3CZMA 1WNFA 1SKBA 1YB2A 1ZWKA 1QIHA 1NW9B 2JL1A 2ZVQX 3FNFA 3KDPA 4R9VA 4RK0A 2J46A 2O3UA 4RVCA 4FYIA 5ALFA 3RV4A 1SK9A 4QU8A 2ZZMA 1NIPA 3HXQA 5CR9A 1FJ2A 4WN9A 1OLUB 4OK3A 1EFVB 3BWXA 4NBKA 3EVZA 5JNUA 4FLMA 3KRTA 4V0RA 4ZZ2A 3RU3A 1UBMS 2I8AA 4BTEA 3FWHA 1ZK3A 2FEOA 1VE1A 2Y93A 3E84A 4C7OA 5D3QA 2ZRAA 4M86A 4NZNA 4DC9A 3FR8A 2QVGA 4B4VA 3KV3O 1YB6A 5I3ZA 2PEYA 3LIIA 4RMIA 5KTKA 3U1TA 4LDZA 4QD3A 3ICVA 3QPUA 4FMCF 2E55A 1G7CA 5FWXB 5K0CA 1AA6A 2WMNB 3OCCA 4JMLA 1PEKE 1SUWA 2HUPA 3AESB 1YBHA 3PIDA 4LYAA 3FSRA 3U7HB 4M1WA 4RHFA 3PPVA 1H1LB 5B7GA 5KWEA 2QW8A 2G9QA 1SUPA 1GEGA 4FN5A 3IHTA 4JI1B 2CUKA 4OQQA 4CPDA 3NO4A 3VZRA 1LQUA 3O83A 4BWFB 4W5QA 1A7JA 5BNIA 4C5BA 1NBME 1FQOA 1OY1A 2D2XA 5IS2A 3CURA 5JHHB 2XKJE 4OKSA 4GZLA 5HILA 4ZU3A 4F6RB 2I3GA 3CZQA 1HDRA 1U2GC 4G41A 1FFSA 2IUEA 2X1LA 1PS9A 2SECE 1XKTA 3DUWA 3ROPA 2QTVA 1HF3A 2YNMC 1XCMA 2CMDA 3ABQB 2VCYA 3EODA 3V3TA 3BRWD 2BM1A 3OM9A 4DQXA 4GI5A 3R7BA 3RYTC 3MINB 1D6SA 1VMDA 1BGVA 1E64A 1Q1BA 4BGDA 4AQYB 1ESDA 2XTAA 2UZ1A 3TKLA 3EGOA 1K0FA 3IURA 3ASVA 3IESA 3FCSB 3IIMA 3QVSA 2EKQA 2P9ZA 1MC1A 4R8VA 4K9LA 1E9AA 3VV2A 5KYUB 5KYYA 4N5LA 2XYPA 3M4NA 1YRQA 4Q9LA 1VLVA 5T5QA 4MQ6A 3ET5A 2OAGA 4LBYA 4CJXA 4EJ2A 5FA8A 1ZEJA 4TLBA 3W77A 1WJGA 4KV7A 3LMKA 3HNRA 3SJ7A 4JCOA 4I46A 3REFA 5KMGA 1CETA 1GGEA 1WIWA 2MINA 1WBDA 3ANMA 3BMCA 3GEHA 1CZHA 1ND6A 1JSZA 3V8EA 5BV0A 3PFHA 1IONA 1P75A 1I8TA 1QNFA 3OJCA 4XWWA 2PAAA 3C16C 2RGCA 3PXUA 1I3CA 2I7VA 3PP8A 4K2AA 4PZDA 3NHZA 2UVPB 5CM2Z 4JKIA 4EW2A 3PX7A 3JAMA 4MS1B 5E6RA 3WL6A 1SBYA 1RRGA 4W1QA 5ALLA 1LW6E 5H3HA 1FMJA 3TN7A 4F2HA 3R0XA 4Q82A 1Q7EA 2ZI5A 4B6EA 2XSZA 4QM6A 3A04A 5KOIA 1JG6A 3EXEB 1C9JA 4HUJA 4DQKA 3VA7A 5J2UB 4EL0A 2CLCX 5JIBA 3HTXA 1U3CA 1NURA 2ZIXA 4RHTA 1S01A 4TV8A 1H5UA 3KEGA 4EHIA 4EG3A 4YYEA 3QBEA 2DWQA 3GPBA 1JPVA 3TIFA 3TZBA 1SO8A 1Y4ZA 1F7UA 2R7MA 2I29A 1CSEE 1O5TA 1G7RA 1U02A 4LQCA 3RWMB 3QTTA 2IPXA 3ZR4B 5BY2A 2JLVA 2JBAB 3QU5A 3PGLA 3O4RA 4NJEA 2IS4A 3NTLA 1PJ4A 1HK7A 1NQUA 4HWOA 5CVEA 3S68A 3WAKA 4A6DA 4JX8A 2BYTA 2FRDC 3QVUA 4HFNA 1ZUHA 1ZW6A 2IZ7A 5JDIC 4ER7A 5KTYA 3N3BC 5CHEA 3FTFA 5KJ1A 4UM7A 2DMRA 1NZFA 3ML1A 4G84A 4TX1A 5M3BA 3C6QA 1J8DA 3BYZA 3S7TA 3VSBA 4XXHA 1DTWA 1S2DA 1TZKA 2IUTA 3WO0A 5J5CA 5IFKA 3QOXA 2XGJA 1HDCA 3MMZA 1TF7A 2A30A 1ENPA 1O9HA 2EZUA 4PO8A 1U7XA 1UK6A 4AJOA 1YA8A 4IHJF 3NS7A 4MDFA 2HPVA 4EZBA 3D8NA 1N6IA 1WM1A 1N3YA 3FYUA 2EYUA 3PC8A 5DYWA 2R8BA 2WMOB 3NBUA 1EE1A 3ZQUA 1E3JA 4YDQA 3RK1A 4ZVNA 3E9EA 4B46A 3DJFA 5DASA 2WU8A 5P21A 1SXJA 4IDOA 4LF7B 1NJ8A 3D7LA 1K3UB 2Q8QA 5FUBA 3FHJA 4LBWA 3ZY3A 1KO1A 2PS9A 1NV9A 2AMYA 2HU8A 2OAP1 4QBKA 2DUMA 4QODA 4RGQA 1U9IA 4LWQA 4X85A 4A6XA 4BV2A 3ER9A 3KTFA 2OLKA 3K31A 4AULA 2JW5A 5EE1A 1NL3A 3C5EA 1MO3A 2A9FA 2RJNA 3EXG1 5F7ZA 1RLOA 3AZOA 1W4RA 2CVQA 5G4KA 2OMKA 4RY9A 3H2JA 5HQ3A 1IHDA 2IHUA 2UYYA 2B8NA 5K3OA 2PGJA 2XEXA 4OM7A 4XIIA 1EXDA 4MICA 3RBVA 1I3KA 4LWOA 3GGGA 3PGXA 2MR6A 2PMDA 1WPQA 3FIJA 3HLYA 1IHYA 1Q12A 3PUXA 3IQHX 4KN9S 4PGMA 1MO6A 1NSFA 3RFUA 5GZ3A 2LKCA 4IHKA 3PDJA 5A06A 1E4YA 5ESDA 1E2HA 3SJCA 1PJZA 2OXTA 4WJLA 3K35A 4DE5A 3VC3A 2I2WA 1NY6A 5K6AC 2ZB4A 3GEDA 5FL3A 1SURA 1XZ8A 2EDCA 1E1NA 2GJSA 3O4JA 3WGZA 4BDSA 1YOBA 1NULA 4AN1A 3BIXA 3U3RA 4NBVA 1DXHA 2QN3A 3ITNA 4G25A 4PO1A 4YAFA 1FYFA 1M0WA 1IH8A 1L4HA 1MAUA 5JCOA 1VDMA 1NYLA 3EDCA 3EE6A 4M0FA 5BNWA 3SF8B 3UHJA 2PKRA 2V7WA 3SKYA 2GPJA 3RF6A 1RRFA 4KWHA 3F5QA 4O2BB 1IEQA 1D2GA 3C0KA 1KMCA 3S1AA 4MX8A 1NPYA 2XTJA 2ZSKA 3SYMA 3DYIA 5JJBA 2FN9A 5ENDA 4PPQA 4OXYA 2BHTA 4CEHA 2WKPA 4IHAA 4P5PA 2I8CA 3RDPA 3T34A 1P1BA 2B92A 4IF6A 1SY7A 3DZJA 4BXOB 4ZZ3A 2OB1A 4N41A 8ADHA 4L6AA 3DKKA 3WLPA 5FKJA 1JKJA 4TQGA 3G2JA 1W1IA 1BMTA 3DEHA 3L4EA 3VSAA 3GIWA 2ID4A 2FW8A 2XYQA 3P4YA 1DAFA 1XTRA 3UHPA 1CVLA 2AOTB 4LX0A 4HLUA 1GM5A 2HK7A 2FH5B 4UAVA 3OPYA 5FYDA 2NXEA 1XWWA 2WV7A 3DCYA 3W5VA 1SOAA 2GWHA 3WIBA 3GLFB 3WJ7A 4D82A 3RARA 2WWGA 1QE3A 1WSDA 3TW6A 5K0BA 2XDWA 4UMEA 1XDGA 5FOVA 4ZVUA 4DZZA 3FWYA 2OO5C 3W8EA 5B4TA 2H7CA 1NRJB 1HZJA 3L6DA 3VBCA 1XTPA 2RJOA 3GVHA 3K0KA 4AJ2A 5HRCA 1T25A 4PLZA 1EESA 2ZIZA 2ZYRA 1M0TA 3JPWA 5AOCA 2NYRA 5JAMA 3MRXA 3MC1A 1IUKA 3R40A 3ZX5A 4DQVA 1EM8B 3D8HA 4URHA 5AHOA 3T94A 4ZI2A 2DR2A 4DCPA 2ZUWA 4I66A 3C85A 3UCXA 4DLYA 4KLCA 5H9WA 5LZ2A 3D3KA 4KFCA 1FVHA 2DPHA 3A10A 3V4SA 3MLEA 4OUDA 4RSGA 3MAJA 4NBNA 4D98A 5FQNA 5H02A 1QU2A 1PSZA 2P2DA 2D4HA 3INTA 4PCLA 1OLXB 1YIOA 1YCGA 4L4UA 2JFYA 2B94A 5HCIA 1R6XA 4ZQFA 4E2FA 4OKIA 4D43A 5A4KA 1ISIA 1SOMA 3I09A 2WOJA 2PRYA 1WVIA 1X77A 5HF8A 4D4HA 4GYYA 4EUEA 5ENZA 4BBJA 3AI1A 3B5IA 3R9IA 3Q8MA 1PZXA 2XV1A 5K4AA 1PJAA 4EA8A 5HIIA 2C2HA 4HQLA 1PLKA 2GF2A 4B7XA 3GFQA 3DEKA 2D6FA 1IN5A 4Z8YA 2DUUA 3EZGA 1KXZA 1N25A 2ROQA 3FFAA 4IJ5A 4DRZA 1PZMA 4I4IA 3NWPA 3BUSA 5EIBC 3NOOA 3RQSA 1OLOA 3FUVA 3LD9A 2ACWA 4YV2A 3KQUA 1O6ZA 1QONA 1YS1X 3PQ4A 4NAUA 3GLGE 4O1HA 4KQJA 4RLSA 1JLLB 4DDVA 3HR8A 4NE2A 3KOYA 4H4DA 2MWMA 2QZPA 4WFQA 3S5JA 4MK4A 3CB2A 4CLDA 4EG6A 1Q19A 2Z1NA 2VT6A 1C3LA 5FV4A 5B4UA 3SP1A 2G9ZA 1DKMA 2ID9A 2X6QA 4EYQA 2W6JD 2GO1A 4L9RA 4D1YA 1NJ2A 1KZGB 4MB0A 2WF9A 2R6GA 3AOGA 1M54A 3H1AA 4FOPA 5FRDA 5FTMA 1ZM3A 2IXDA 3I5MA 3LLVA 4OLFA 1CQJB 4TOIA 4UUAA 4ASUA 4D4LA 4NYIR 4F86A 5J1SB 3N53A 4FINA 1RZVA 1QE0A 1PX2A 2L2QA 4KQFA 3DFZA 4HJXA 2FEKA 4MCIA 2O50A 3H9GA 3O90A 3RWBA 2O2DA 2OYRA 1JR4A 3UV6A 1E7RA 2VP4A 2HC9A 1YJQA 5L51A 5ARBA 1ABBA 3GJTA 1JQBA 2GZ2A 3MT8A 3CIOA 3LCUA 1UZUA 3AQ4A 4HYYA 1H8HD 3D31A 1HRKA 4L5IA 4DM4A 2QXUA 4Z1OA 5ITZB 2EFYA 4TV9F 1ZN8A 4LMPA 4RPJA 3PGKA 3TLKA 4Q3EA 3K8ZA 2KSQA 3SN6A 2OL4A 1I7DA 1Y4DE 1CUGA 4ZCMA 3GT0A 3VC2A 4J0FA 4UQPA 4YRFA 2O14A 1OV6A 1P2DA 4L3WA 1GLNA 2XMBA 1OBHA 1CRZA 3Q5DA 2JC3A 2QAGC 3EBPA 5CFPA 5JXJA 1KF0A 4CL0A 3HXPA 4ENSA 1RWOA 4L8YA 1QO0A 1RU3A 3C14C 1PX0A 4LJ9A 2RFLA 4YS6A 3D9QX 3DE7X 1FDTA 3W4IA 3MMPA 1OI4A 1G21A 3W7VA 1JDBC 1JUDA 5A3JA 5IKMA 3OPMA 4JJGA 1XROA 5KU1A 5CFOA 3BJEA 4E2XA 3FRJA 3OCXA 4LJ6A 1A7UA 1IQPA 2R85A 2IWHA 3L92A 1A4RA 1Y7IA 4Y2HA 3FDZA 1U3GA 2VVTA 2ZETA 2GZDA 3D7NA 1XGKA 1RQGA 3ISJA 3L7IA 4RM3A 3UWSA 2J09A 5M2QA 2UZ4A 3G5UA 5KI6A 1GG2A 3ZGXA 1OCEA 3PK0A 5F76A 3ZBQA 1FSPA 4F11A 2O7SA 4CFSA 1LVHA 4M46A 2GCIA 5F5XA 3O2JA 1OXMA 3HYCA 5B2FA 3EN0A 2WTUA 3AH8A 2KBEA 2N75A 4I9GA 5A0VA 2QG9A 4A7PA 4AF8A 4QBGB 4OHOA 3WRVA 3LOPA 3QLJA 2PL1A 1LQTA 2QQ0A 3Q1KA 4O4IA 1BMDA 1J6UA 1O97C 1Q7GA 1QX3A 2RHMA 4OJMX 4B35A 4RKRA 5A3SA 5J47A 3GBVA 4P32A 1FPMA 3IDSA 4C4YA 4Q3AA 4WNCA 1E79A 1KO8A 2FEXA 3SJZA 1A3CA 5ALNA 2XZOA 4QOSA 3R7LA 3I9MA 1LLUA 2VOEA 2F3SA 4LY6A 3WLHA 2BZ0A 2PGNA 3K6JA 2RGXA 4W5WA 3R74A 4UOEA 4HB2A 5EQFA 2NU8A 1VJRA 1QPBA 4DZTA 2VNAA 3CX7A 4PYMA 5B7PA 3LTEA 2LCQA 5BUQA 4MRPA 4CLOA 1W87A 1WY5A 2GBLA 1FX0A 3A1EA 3SEZA 2IX9A 3QITA 5CVDA 3N2KB 1S8AA 1T3ZA 1IOWA 2BR5A 2CDBA 1GOTA 4H1TA 2FI1A 2YDYA 3HLTA 1X7GA 3N70A 3QKSA 4OB7A 4YQYA 5FEUA 3WWYA 3K0AB 4EEKA 4MWOA 4LTDA 5KQGA 3KZOA 2ZS9A 1HYGA 4CTJA 5ARDA 2CJWB 3O8LA 4NHOA 4RD1A 1YS6A 2P9QA 1M2EA 3HB1A 1UEXC 2YR0A 3H5IA 1KMHA 1TT7A 4PPFA 1VPWA 1QZTA 2VSOA 2JVIA 3AXSA 1QO0D 2Q5IA 3GAMA 3H6GA 2CLHB 1EVIA 1R9JA 3P9RA 3RR2A 4KR2A 4RK1A 1JAIA 5A2GA 2H52A 4CQMD 1TLLA 3HU2A 5ALKA 1RHMA 2VSQA 4Q39A 5IJWA 1I1HA 3CCBA 5A9RA 1VHQA 5IVKA 3ORSA 2YS7A 3ACDA 1L5NA 3VYVA 4CM4A 2HF9A 1QF6A 2J85A 4PHTA 1SB8A 1NVWQ 4Q9IA 1U3TA 2PA0A 3H2IA 4RHEA 4YMSA 5DHFA 2P11A 2EF0A 4RE6A 3OMLA 4JB0A 4IDQA 3AU8A 4RE5A 4OX9B 1YHYA 3DL7A 1OYWA 3SSOA 3K0CA 2VIIA 1RBQA 4FHZA 3TVYA 5HRUA 2HSJA 3KSRA 1G1MA 1MRNA 3GQVA 3ZZ0A 3ME5A 3R5KA 3LCMA 3R3WA 1DHTA 2XD4A 3CF0A 4F4DA 3GHYA 4KH0A 2I5PO 1Y5NA 2NV0A 1KEEB 4GOND 3X44A 4C22A 4N3BA 1L5HB 1J4AA 1WZNA 1QHIA 3ZCSA 1E79D 3EAGA 4G5YA 4KQHA 5GAJA 3QYFA 2LR0A 1GHTA 1P7YA 3KQSA 3DAYA 5FWNA 4ZD6A 5HXAA 5EUMA 4EY7A 4PCVA 5DF1A 4DLNA 2YWJA 1R4NB 2CXPA 3UAGA 3WRWA 4IH1A 1CJKC 2VZEA 3ODGA 4MPPA 1F7VA 3WGYA 1DTSA 2CLFB 4BNHA 1UWCA 5EIEA 4ADSG 3DKRA 1CY2A 1TMOA 1CNFA 2IELA 2RBEA 3MGAA 3RPEA 4YLYA 5DNCA 4CETA 4QUHA 1ZVQA 1MAVA 3GCDA 5I01A 5KSOA 4DR4B 1HPLA 4CKBA 4FYMA 4IXWA 4L4SA 4PINA 3HQ4O 2DULA 1H69A 1NU8A 1OXUA 2GA9A 1QORA 1L7VC 1XEFA 2HT6A 2EHJA 1S6YA 2OCKA 3LX6A 2CVPA 4RA6B 3ZN2A 5FHQA 4C0AC 1TU0A 4O2AA 1Z83A 4MI3A 1SQ5A 2V4UA 3GELA 4UTOA 4BN0A 1PBTA 3NB0A 4EHJA 1XX6A 1QQ7A 3MTJA 1ADCA 1XSEA 3DVAB 4PQFA 1D4AA 3U4DA 4BO0A 3ORHA 2Q1WA 3B9BA 3JD3A 3IVGA 4CM8B 5HMLA 4UHBA 1J0AA 2QJOA 3LBYA 4K9RA 1J99A 4HDRA 1KK2A 3KJIA 5TMBA 3YASA 4YR7A 4YRMA 1XD2A 2GPSA 4OQ4A 1AXEA 3OQMA 1Q16A 1XCGB 3U5TA 3A7EA 4IIEA 3TOXA 3OC0A 4JQYA 1P2VA 3WKDA 4BQSA 4LOJA 2DFDA 2OWDA 1YK1A 2O3RA 4Y9SA 5HF9A 1DAHA 4C07A 2OBXA 4X8OA 1QFJA 5DTJA 4MRNA 3IOEA 2B78A 2IF2A 2OM2A 1LA2A 3FH0A 2G9NA 4UHHA 3UFXA 4J49A 3LT4A 1JTFA 4NDZA 4EJSB 2N0SA 3MCAA 5ECWA 4W1RA 1NSTA 2J7PA 4K9SA 4MQLA 1ETHA 1KIMA 1BIFA 1PCXA 3HYSA 3NNDA 3ZDXB 1R88A 3RIEA 3RSLA 1PW7A 2OC4A 5EJ7A 2PL3A 4N8DA 1P1KA 3AT1A 1XF1A 4ESVA 2YXDA 4BOYA 2VPPA 5FQOA 4F5ZA 1NOJA 4RV5A 3R7SA 3RAPR 3FY4A 5CIYA 1HG0A 4PG4A 1NJ6A 4G85A 4ZOCA 1VXOA 1WTCA 2ECQA 5A7GA 3EGCA 5NLLA 2QRHA 1U3UA 1L5GB 3KLPX 4Y0VA 5C18A 2R7AA 3MWFA 3VSDA 4DBLE 4ER3A 3WGUA 1XVLA 2WV9A 1D8AA 2BDEA 4MTCA 3SYKA 5EJAA 3HFRA 2C1EA 5TGZA 3EASA 5F5LA 2AFIE 2UZ3A 5HIKA 5D51S 2M98A 3GGDA 3LHSA 3NVMB 4HNRA 2EYQA 3IERA 3T4PA 1THTA 3JCZA 3KJHA 4YJGA 3UJ6A 2FPIA 4IGEA 1UOQA 3U2QA 4WTOA 5CCDA 4W5JA 3V55A 5C35A 2F64A 2NUTA 4CIDA 5IG2A 2IXAA 3IEXA 3JU3A 2ZUBA 4IJVA 1VIVA 3OFSA 5JMTA 3M34A 4OMUA 3SIWA 2GNAA 5HIJA 2AKYA 3JD0A 3PL1A 4KSYA 4BNUA 3QG1A 1GWNA 3LKVA 4CQJA 5BOSA 5LA6F 1V7CA 2DWPA 3CF4G 1E1RD 3LA6A 4TQ9A 4CW7A 1K8QA 3CF2A 5FNVA 2FMIA 3VNAA 1B26A 1Z47A 2O8NA 4UZEA 1SQSA 1UFVA 1O95A 3D0OA 1Z4NA 3HJUA 1T0BA 2J9XB 2Q3BA 4Q3CA 1WBJB 1EZZA 5EE0A 4BO9A 5IYZA 1Z22A 3K8OE 3RYHA 2YWHA 3WR5A 1GPLA 1IY0A 1XQWA 2VUUA 3ZYZA 2DJIA 4JASB 3WZMA 4CIWA 5J4HA 4Z4QA 2HADA 4RTSA 1X1TA 1PHRA 4MQ5A 3REQB 2BFNA 4F1WA 2FP4A 5DJ5A 1S3IA 2PDAA 5EG5A 2VPTA 1I36A 1QO7A 4ARUA 1PR3A 2HJSA 1MTZA 4NSNA 1ATZA 4HATA 2BP7A 3T38A 5EKXA 3E03A 3G0IA 3M5CA 2D06A 3G17A 4HQ0A 4IJQA 4OXRA 2ZAIA 3AFOA 3P2OA 4Y2VA 1T24A 1WULS 4AUEA 1N33B 5ESRA 2IYZA 3DFMA 3KB8A 5BN4B 3ZKWB 4AI6A 1MX5A 2PZFA 2J7PD 4M87A 2N46A 5KTOA 2P4UA 1UJNA 2P0YA 2ATXA 3TZCA 1L1QA 3U39A 2HMVA 5CXXA 3KETA 5IJ9A 1X1AA 5IJZA 5UKDA 3WL8A 3JQAA 4XQGA 2F1RA 3ON5A 5JD6A 1SG9A 1YKSA 3WB9A 2FB9A 1KI4A 1MENA 2BR4A 3SNHA 3VYTB 2BBTA 4EUFA 5F2KA 2H1VA 2EJVA 3UJ3X 3SQMA 5IWCA 3U09A 2IOFK 3LXXA 5KNLA 1ZRNA 5TE9A 3KCNA 1PD0A 2PZJA 4UAGA 5LMZA 1HNXB 2JJQA 1D2HA 1Z3IX 2DH5A 4NEQA 4B6FA 1CXZA 4QU0A 3DCNA 1J8VA 1BX0A 3OTQA 3S44A 3RSQA 1XEXB 3EEIA 2RC5A 4OFXA 1OKKA 1XB2A 1JQJC 3BTOA 3QPVA 4DR5B 3KE9A 3VPXA 3HXMA 4GUAA 1Y4SA 5HIMA 1NNEA 2CFIA 3O9MA 2P3LA 1E2GA 4IWXA 4RHUA 3MGKA 1KBOA 3U49A 4QBTA 3DEZA 4MV8A 3VYSB 4Y6LA 4PSVA 3A37A 2F67A 1PFUA 3BL6A 2HPZA 3TEMA 3TJRA 3H5OA 2NXNA 2EKBA 5ILQA 2WPNA 4Y2PA 1CR2A 1W88A 4KK4A 4HMOA 1UJMA 5I9MA 2JFPA 2M6LA 1N9KA 3DBRA 1O95D 3WLFA 3HJFA 1RIIA 4BVKA 4CLRB 2NXWA 3I5YA 1FA9A 1XK6A 2KWIA 1MIOB 1QS0A 2NU6B 3KFVA 4NH0A 5FCDA 5GMOA 5K3CA 5TC4A 4DCTA 2PA3A 4MWGA 4YJFB 1JECA 5AOBA 3KWJA 3KUUA 4FSDA 1JFTA 3B6ZA 3UV7A 4RV9A 2W42A 2WP0A 5KHLB 1MVNA 4DIDA 2ODWA 2RGAA 3IV7A 1N3LA 1W59A 1YVUA 1YR8A 1TYAE 2YIJA 4IIFA 4EYSA 1XTKA 1N1DA 2EXXA 1CY4A 3LOUA 4EKDA 4YAIA 1PTKA 3LUKA 3L0ZA 3ABZA 3CEPB 1G6HA 2HJ9A 5DP1A 2FZ5A 5IUKC 3MS4A 3RF7A 1VHLA 2YINC 3TS1A 4MUFA 2QLBA 4Z3KA 1U6KA 4LISA 2J59A 2FR8C 2H0RA 5E6UA 4ZMRA 2XZDA 10MHA 2MSEB 2CZCA 4I4TA 4PX5A 3NHPA 4OOFA 4FFWA 4N18A 5JYBA 4OP1A 2V1XA 4YEDA 3H83A 4JP5A 4QNMA 2G1PA 3U9LA 4D96A 2D2FA 2YV2A 3UWPA 1I4DD 2VJKA 1E1QA 3CNOA 3LXMA 1XTTA 1YZLA 2YN2A 2OZVA 3D0RA 3ETJA 3NV7A 4P81A 3I61A 3U4IA 2VK8A 5CDFA 1RKUA 2PGOA 2GZ1A 1UDBA 2BEJA 5CW2A 4EB8A 3TPCA 2YN0A 2ZYAA 1EYZA 2JFVA 2OCIA 2G6BA 4WESA 3HCCA 3VAZA 5KJCA 1ORTA 1DZIA 1VBNA 4HB4A 1B2RA 3TIVA 1KVUA 1W0JD 5CM8B 2ZUCA 5B55A 4HDNA 4UOQA 1XZGA 2C9OA 1NC3A 2IYYA 1A8QA 4MRMA 3VDRA 2JJMA 1KMNA 3Q6IA 5K99A 5KTSA 1RCTE 3PUJA 2IODA 1LFAA 1G6OA 1QIMA 2PL9A 4BJHB 1DWOA 1JAXA 3T7JA 3H2HA 1E69A 3G2QA 1KORA 2GN0A 1OH7A 1H6BA 1L7QA 1PEYA 1Z5WA 3JQFA 3MPUA 4WLVA 3LCRA 3FVQA 1GZVA 3BD8A 3LWNA 4YDHB 4IIVA 4URFA 3OO0A 1TAHA 3EVGA 2JZNA 1Z4MA 3L6CA 1RPZA 3LUFA 2XMRA 3GJ8A 3L6RA 1KC1A 2B6HA 2X8BA 3EVFA 4LZJA 4DSOA 2IY8A 3U7FB 1TEHA 4GLLA 1V8FA 3X3HA 3EH2A 2O5VA 1PGPA 3GFSA 3M6VA 1WD5A 3OKAA 4XZ3A 4CIYA 2YXEA 1JU3A 4K88A 4R2MA 2J3QA 1ST3A 4MKRA 4NBTA 2CGEA 4YRCA 2WAXA 4FDMA 3ISTA 1UXGA 4LHWA 2M32A 4WGGA 2AOXA 2NN3C 3PUWA 2RH5A 1ZCJA 4ZMSA 3O3OB 1M6HA 4Y2XA 4B47A 4URWR 4K6KA 3B36A 3I6ZA 3ZJTA 1JG7A 3GEMA 1P74A 4D9CA 2XNJA 3DT8A 3OO1A 1M8GA 3AHFA 5JASA 2Q8NA 3T7AA 2BELA 3M4JA 4IRUB 2AK3A 1QHSA 2KQUA 2P9TA 4P83A 3WI7A 2ATEA 3DFFA 4PSAA 1JHUA 1HH4A 2VHEA 2VQDA 3CGWA 3QGMA 1M83A 4FW9A 5ALSA 1MB0A 2BZ1A 1P19A 1WLYA 4FDAA 4GX0A 4KSCA 2V1UA 2OTCA 5K1ZA 1R5NA 4MW7A 1WOYA 3QW2A 4GYWA 1ZGHA 4ZOEA 2NO6A 3UJAA 4P0QB 4M0LA 3FJOA 4MLZA 3FJ1A 3K0HA 2YV3A 3SC4A 1GNVA 1T34A 3BZWA 2VKQA 1UBKS 5DE3A 3STVA 3OQIB 2QJTA 4BLTA 2K4MA 4HSGA 2E37A 2LPMA 1WXDA 2H9AA 3WNDA 3K4QA 1HDOA 1YACA 4YT4A 4KGVA 5TJHA 2B1RA 1RXIA 2QRLA 2J0UA 4JX9A 4LHYA 5L7TA 3I62A 5TF4A 1JEQB 1NBOA 3TOSA 2TSYB 4GUDA 3KJNA 3SQLA 4KODA 3L7AA 4B80A 4CCAA 4FR0A 4PYNA 1UPXA 4TMFA 1GA4A 4A1FA 4FNGA 1S3GA 5JNSA 1A71A 2QJWA 2VN8A 4LOAA 2AZXA 2XWPA 3AHEA 4NJMA 1VTKA 3UMJA 4ED9A 3DG9A 3EXHA 1W36C 2WTAA 3II6X 2NSHA 5BW6B 1EP1B 3JPYA 1FFXA 1T8SA 4J4TA 1SOWA 3H4IA 5JO0A 3V4RA 5AKXA 1U5AA 3R5TA 5TF0A 1EHCA 5LYJF 1NTRA 4WAUA 1YBVA 3MCUA 1WDMA 2B98A 3LE8A 1OWLA 2ECOA 3U4HA 2XQJA 1XOIA 2J9FB 1T29A 5JAIA 2JJ8A 2RKOA 4GHWA 5BQOA 4ZZ1A 5JY1A 3QWAA 1HFWA 3WDLA 1X7DA 4HC4A 3WGGA 2EW8A 2ILTA 4DOMA 3H1EA 4PVDA 4LHXA 5KINB 3RU9A 1WMAA 1FYEA 1SWWA 2VYVD 3M7IA 4MVJH 3JQQA 1R10A 5EEHA 4CIVA 3SK0A 4BFUA 5ALVA 1JXAA 5LIRA 5FH9A 1PWYE 4GPD1 4Z7NB 3A9SA 1J2UA 1VI6A 2H4HA 2H4JA 3TOVA 1GSHA 1IK6A 1RTKA 3LF1A 3PU6A 4Q4LA 1K6IA 2Q62A 2MMCA 3MWYW 3QUAA 1EFVA 5ES3A 2QN9A 2CMKA 1J24A 4F92B 2WLSA 1CQIB 1M74A 4KLAA 5K8UA 1NI4B 4LDPA 1P0FA 4EITA 3OIUA 1V7QA 2RG1A 1NMXA 2H11A 3ZDDA 4O4LF 4E4YA 1D5CA 2I67A 1HLPA 1F0YA 4DXHA 5KC9A 5G0TA 5GONB 1DC8A 4U7FA 2I91A 1IY1A 3D4NA 1VKJA 5I9LA 4C4AA 1Z7YA 2GEBA 3OCYA 1RABA 3PVSA 2AZDA 5FBHA 2FWAA 1B8OA 3OP4A 8LDHA 3I2JA 5FWXA 1T2CA 4AROA 1ABEA 4KCGA 5C4GB 4R1TA 5E4JA 5FO1A 2VJDA 3JD2A 2R1ZA 3R0JA 5FLKA 3DNMA 2YQ5A 4ID9A 3VKVA 5FUMA 5DYGA 1G5PA 1BE1A 2ZT5A 4G09A 1ZH0A 5KPDA 4JP3A 1CIVA 1CUSA 1RXCA 4B1FA 2RI6A 3U3DA 3NTXA 4NICA 1CVIA 3PGMA 3ZI4A 1P77A 4L5AA 2H08A 4JI0B 3M81A 4URVR 2AN5A 1AT1A 1Q3HA 4JOSA 5HJ5A 1DPGA 1MV8A 1SN7A 4TYQA 1JLMA 2G6TA 2I78A 5BOVA 3B3QA 2X9GA 3F5DA 5GZ6A 2H07A 1SKAA 2NZYA 3FF4A 3O0DA 1L4NA 4LXYA 2I2XB 1XMPA 1Y3IA 2MSCB 2PR7A 3DS8A 1J9ZA 3M49A 5B58T 4B8WA 5KJ6A 3KQNA 3U80A 3HCNA 3MWDA 5H4GA 1ORWA 3PJRA 4MWDA 4HLCA 4ILKA 3MINA 2ODEA 3NV9A 3RAEC 1RBMA 1W29A 4F4CA 3QEOA 1HFKA 3U3KA 3C1UA 2ONKA 2XADA 2Y1OA 3FI9A 4RJKA 4B45A 4AF7A 1KJ9A 2CK3A 2EAUA 1QPZA 5KYUA 3OEWA 3T3NA 1AUOA 3WWOA 4ER6A 2JARA 5BYKA 3NFRA 2Q6VA 2VPIA 4HFMA 4MMXB 4PYOA 5CU7A 5EWMB 3UATA 3Q7SA 3X1ZA 2A94A 1E9VA 1LC0A 2QUJA 1Z7EA 4X9XA 3TQSA 3LC0A 1VE9A 1GU1A 2QQEA 2VYQA 3UQZA 4JSTA 2BONA 5B3KA 2C7QA 3ASYA 2J0SA 1N5JA 2ZR0A 3NVDA 3Q88A 2BEKA 1YMVA 2AYYA 1IY2A 4UE2A 4E1AA 3ESZA 1ZD2P 2QM7A 3HWX1 4IYRA 3A6LA 2PLRA 1OI2A 1Z56C 3BGDA 2PQ6A 1U2EA 5DK4A 2NACA 1X92A 3B1ZA 5A5EA 4ETNA 3RUIA 4XWYA 4AKHA 2C77A 1P2TA 4LCEA 4ICIA 2VPYA 2PBFA 3ANTA 3OCWA 3AHDA 3EXEA 4I4CA 3CH5A 4IX9A 2R6JA 5T4EA 1G4UR 1J5XA 5EY5B 3GDGA 2QHXA 4L8GA 2DKNA 3PEFA 5F12A 4CMEC 2YJ6A 4JY7A 2O59A 1OVGA 3GVPA 5A03A 1ZJWA 3F96A 4FK8A 4AMUA 1XLTA 3RBXA 5JSFA 3ZHOA 1WDTA 2ZG6A 2X41A 3DMYA 1J97A 4JEIA 1PNRA 1WTAA 1UBRS 1V4NA 3RFFA 2PU5A 1RPJA 3BWEA 3HR4A 3JZDA 4GWKA 5HUQA 5KX5B 2V45A 4GE3A 1VXRA 5KSPA 4AY6A 2ZCJA 2NPIA 2YVKA 3ORYA 3SD7A 4AX4A 3FTNA 2ZRBA 3GROA 4MUMA 3HJNA 1E7SA 1HETA 1UMBA 5H68A 3IYLW 1U3DA 5K3EA 3EZXA 3SJAA 4A1OA 1MMFB 1SPXA 2EHDA 3OX2A 2PLWA 2VTBA 1J23A 2O7VA 1MB4A 2JFHA 4M1KA 3UJBA 2W6OA 2JEYA 2O52A 3RT1A 1WR8A 2C07A 3OX3A 1RJ9A 1TUIA 1T3GA 3UUFA 1TX4B 5AYVA 4Q3BA 4MPJA 1XTQA 5JECA 1R00A 1FYVA 4MS4B 2IGTA 4GOLD 5KYNA 3M89A 2AFHB 2BKEA 1UBTS 5CLQA 4V0ME 4NQZA 3V8BA 1P6UA 4G8JA 3K4PA 1RWMA 3FMPB 4U1RA 1K7CA 2B8JA 1JE0A 4G8BA 4YCBA 5AJXA 3STYA 5AUOB 1UBSB 4WK6A 2WZCA 5CCBA 4BCBA 1SR8A 2QTTA 2AHOA 3VZBA 4E88A 2AQIA 1QIEA 3E3NA 4M22A 1OPXA 2C94A 2I9PA 4OJTA 4C0WA 3NHKA 5T8KA 3VNRA 1JH9A 1JSLA 5DLDA 2ZIFA 1R27A 3PFGA 3LNTA 4EFDA 4X8HA 1AKTA 4NYMQ 3KJXA 1FP6A 2ONZA 3GMTA 1FXSA 1GGVA 1MVOA 1OZFA 4BEWA 3ZVLA 5B1EA 4JQCA 4TMYA 5JI3E 2G1UA 2CHEA 4QX6A 2AT1A 2PKQP 2ZE7A 1G8AA 1SQFA 3L02A 5CTAA 3RRJA 3U40A 1C2TA 1W73A 3MB8A 1FEZA 2VXBA 4BL5A 4BEBA 2Y68A 5B36A 5CA0B 2IZ0A 3OZIA 3RIHA 3MOGA 3ZLJA 4FFDA 1GITA 2QN2A 1JE1A 1J00A 4HX9A 1UL1X 2B2CA 2ENUA 4JLAA 4DBVO 3O31A 1FFAA 3P9YA 4RVHA 1C0EA 3OA0A 4R6XA 5GJVC 3A6GA 1DJLA 2W2NA 3UT6A 5D87A 2GN9A 3LXUX 2CKDA 3TBKA 1T2DA 4WZBB 1E1LA 4I3FA 4MIEA 4ND5A 4YJHB 4RLFA 4MHTA 1QG6A 1JH8A 2F59A 2VK1A 3ZY2A 3DL2A 4CTOA 5JG7A 3ONFA 1WUJS 2WA1A 4NENA 2B8EA 3ZEAA 4X45A 1PV1A 3SF8A 8ATCA 4J3NA 2FDCA 1OUMA 2HT1A 3D6NB 2O2EA 2XR1A 1O87A 5M29A 2OAQ1 1ZD3A 4J0IA 3ZNQA 1MW8X 3F4LA 3IBGA 3T0IA 4S0XA 3MTDA 3O2QB 1Y7HA 4K7JA 1G20E 1JYSA 3GJ7A 4QSMA 1B76A 1E3IA 4TXMA 3Q3GE 3PXCX 4RCYA 2G9VA 2OBBA 4BFXA 3HMQA 2NXCA 1UP4A 3KVYA 3K5WA 4WZAB 5DO9A 4ZOLF 1GVHA 3LHIA 3IV9A 5CT6A 3DOJA 1LCIA 1HZZC 4FI3F 5KO2A 5JSHA 3IPLA 2QTMA 3BKXA 1QE5A 3DZCA 3HCBA 3DMFA 1KOFA 3NTVA 4MKZA 1B15A 1PGQA 2AN3A 2I6TA 3E7DA 3NKVA 1KR5A 2QUAA 4KQMA 4WXMA 2FPGA 5ALWA 4RLHA 3DAHA 3AJ9A 3KT6A 1DDOA 2BE7A 2YWXA 3P94A 4KEAA 5B3JC 2ENWA 3PTLA 4EHFA 5KQPA 3GLFA 5ECGC 1AURA 4OK5A 4XWTA 5KKCA 2XLBA 1H2XA 1E92A 1GQSA 2UV8A 1ZCAA 2PANA 5DVZA 2BPOA 2IITA 3W1WA 1C0IA 1HGXA 2HWWA 3KQHA 5JJ5A 2NTJA 5DYNA 2QN6A 1HKUA 2YXBA 3A9RA 5CITA 3T7IA 2Y92A 1EM8A 1QUEA 1VE3A 1YCDA 2QD1A 2MT9A 4F9GA 1A5BB 3FUTA 1D7AA 1WA5A 2ZPTX 2Q0HA 3ZTTA 3NIBA 5D5HA 1MQ8B 1QG2A 5FJIA 4WIAA 4ZAWA 3F6PA 2ACVA 1ZUIA 4I1SA 4FBGA 4DUZB 1C9EA 1ZC3A 1OLXA 1UDAA 4AXXA 2OV3A 4IOLA 5I4BA 1UMDA 4WA7A 1PZGA 3UAZA 1FFBA 3Q6MA 4KE8A 4GI2A 4TTRA 2OUIA 5JNLA 3RU7A 4NARA 2QN1A 2FZVA 3QELA 4KNWA 1VSQA 4OU4A 1GLGA 3RS0A 2R6ZA 1M67A 2QZZA 2W00A 5IT5A 1LPMA 1DSSG 4XRRA 3T7KA 2XLCA 1XZHA 1DADA 4L6IA 3K05A 5EERA 1XCBA 4H3KB 4P7BA 4W5TA 1UKVY 3C7KA 1SHZA 2YC4C 2C0QA 3EF0A 3SKXA 4PBTA 4CE6A 4GBED 4R0MA 5BNTA 2R87A 3FLBA 3UICA 2R79A 3TFQA 4L28A 3ONNA 1W19A 2VDNB 4NCIA 4FNMA 3V7FA 3WKBA 4S12A 3ZE1B 4DDHA 3O1LA 4WXYB 3TSOA 4JLJA 3T3IA 4E07A 3EMVA 1X9IA 3PEVA 4L4ZA 3AG6A 3L01A 5ESXA 1A2OA 1IUNA 1V3VA 2DUWA 2Z04A 3G88A 4K9MA 5HTKA 3CEMA 4A2PA 1G7TA 4RGVA 1RLJA 2ZBQA 3ZE2B 5ANRB 4CNQA 1UBHS 2P2CA 3LS2A 1J8FA 3ZWPA 4IIJF 3RFCA 2FUKA 3IRVA 2DG2A 1CQJA 1XL0A 4D8YA 4B3BA 3KSAC 2JAHA 3HFJA 4RKEA 3KE8A 4TT3D 4HYEA 2WJZB 1N1EA 1R4AA 2VJPA 1F14A 2IHVA 4Y9DA 5LCXA 1JQAA 2QZ4A 4RM2A 5T3YA 4OJYA 4MUYA 1AK9A 3QVVA 2PUGA 1FP1D 2B1JA 1FE8A 3V9AA 1SBHA 3BA1A 5MN6A 1KEKA 4RH0A 3G2MA 5K3AA 3KUXA 1OZGA 1XDSA 1Q1AA 4MHSA 2AD5A 3BGWA 4DMLA 2O8DB 3B3FA 4EJ6A 4H77A 4EY3A 4OP2A 4BN5A 1Z0AA 5KNCH 1BH6A 2Z3ZA 5ITZA 1TMYA 3BDIA 4PU0A 4JXKA 3G8DA 3A3KA 4QOGA 3VH2A 3ZNPA 2BSQA 1MB2A 3DAPA 3DTVB 1CQPA 3PCTA 1K68A 1Q1GA 2YVLA 5EHIA 5TQJA 3AJ8A 3IEMA 5C53B 3HJRA 1PU2A 1A1SA 5JSKA 4JJ7A 4BJ1A 4RTOA 2FMTA 2QG6A 1KDVA 1XLUA 3F0TA 4ZPJA 1FRVA 4UBOA 5DGDA 1FP4B 1FVXA 4DJEC 4IDNA 1FNMA 4BJ5A 1ZK0A 2XQIA 1QH9A 4P8RA 1F8FA 1IDN1 4N7BA 2MMGA 1BQEA 2AG1A 2YUTA 4Q9KA 4EY8A 2H59A 4LNUB 5IC6A 1ID1A 3Q40A 4MGZR 5IDVA 4EKYA 1N8NA 2WE8A 1IQ0A 4LOKA 1JHOA 3A1DA 2HDHA 5H81A 2EJCA 1DC3A 2H1FA 1TYDE 4IR7A 5FUQA 5DM1A 4QYXA 3J7TA 2BM9A 1V4BA 4OL0A 4NV0A 2GYWA 1WL8A 3FN4A 1WU7A 5ALZA 3FVRA 5ALHA 4UPEA 3JY6A 2P40A 3TW0A 4URZR 4NFHA 1PAUA 2H6EA 4ZDIA 2H65A 1RVDA 3V00A 1UEIA 3BE4A 5T4FA 2RHHA 3ENWA 4G4SO 3T41A 3VJLA 1UM9B 3DQZA 4OV6B 1M0EA 1JR2A 2QTNA 3LPLA 4WCDA 5INTA 2X86A 2O7NA 5IRCD 1WBBA 4IO0A 1E58A 1SCKA 3LRXA 4R31A 1HL3A 3GJ5A 3FSEA 4MINA 4ZVLA 3UHFA 3LZCA 4QM7A 1DV1A 1IUOA 3H1BA 1X6VA 4MAMA 2R8RA 3KSUA 2PNJA 1IZYA 4C03A 4C7KA 3KSMA 1QIJA 2R6R1 2P8SA 3D3JA 3E9NA 2VYND 4EVRA 4BN4A 2RJ3A 5BSEA 2AN9A 1RWWA 1BW9B 1E0KA 2O2SA 1M1NA 4J9VA 2V7TA 1F8XA 4R2WA 1T36A 3DV0B 1C7EA 3ZJ4A 2OZLB 3WYGA 3C43A 6YASA 2C58A 3HE3A 4WBNF 1POXA 5B64A 3KXKA 3HDGA 3AI3A 5BT9A 2AH5A 4L95C 1RXYA 2W6PA 3B1WA 3N2KA 3FLEA 3BSYA 2Z1DA 2DTEA 3OWHA 3P71T 4INZA 4ARCA 1DIGA 5D8DA 1G5IA 1BS9A 2IPNA 1RTTA 2XBLA 2NLOA 2YYAA 4KGDA 2PPLA 2W2MA 2ZQYA 3L8MA 1VQ1A 2VH5R 2CJWA 2H7VA 4GGOA 1KH1A 3QPDA 1M1YE 4TYMA 3W2TA 2K2WA 3VYWA 1SEVA 4X6LA 3QJ5A 4J07A 5JZOA 5K0JA 1RP7A 4WFIA 2QL6A 4TZKA 2XGGA 3SCZA 2F1HA 3R41A 4YXWA 4HQKA 2YY7A 3A28A 1MBZA 1YXMA 3IUYA 2QEQA 4ZK6A 3QX3A 3ER8A 4NIMA 4DZRA 4P35A 2BFWA 2O5EA 2O19A 3DYBA 1ZRSA 5K05A 3PCXA 4LOHA 1R16A 5TARA 1GPBA 1YKGA 2MJLA 2NGRA 2XAAA 3JX9A 3L5KA 1ZKMA 4IIUA 4NECA 5LQMA 1U7TA 1B2LA 5EWLB 3G8BA 5FI0B 1QYIA 2YHAA 1MEOA 1X2EA 2YZGA 3AWIA 4JP1A 2C0PA 2XCSB 1P80A 2ZQZA 1CUIA 3OPYI 1HV8A 1P7ZA 4BNZA 5IT9A 4UUPA 1TC1A 4F1JA 4L02A 3N28A 4E5YA 3R3UA 4EB6B 5LM3A 3SC2A 4NPAA 3QNWA 4WLUA 4US2R 2H1OA 1CW2B 3GRZA 5FBKA 4B7UA 2M9MA 2ZUEA 4B2LA 2Z1MA 1QF7A 2ZJ0A 3GJXC 4RCZA 4C5CA 4YHBA 1ES9A 2CXTA 3X1KA 4Z7QB 2I54A 2CD9A 1PSDA 1KEEA 3K1TA 7REQB 5J3JA 1V6CA 1L5HA 4H15A 5LL6P 1UDRA 1NFFA 3NYWA 2OA0A 2WJYA 3VVCA 1KY5A 3Q8LA 2AEJA 4YT5A 1W1WA 4PIMA 5JSYA 8GPBA 2IEIA 4QNNA 2Q2QA 5EZYA 1FTQA 1Z13A 2VJAA 3GCZA 5EKUA 1R4NA 4JBNA 1TM1E 3H4TA 2QSJA 3HPQA 1ZWLA 1XJCA 2GLXA 4EECA 4ZI5A 4Q1VA 3HVIA 4FBLA 4MROA 3GFBA 2ZB2A 1GNTA 2FU5C 3ZWNA 5LLDA 2D2IA 3AFGA 3N0TA 4G0UA 4EI8A 3WKEA 3TAUA 1O6CA 1XZIA 2YYZA 3O8NA 4R2KA 5CXQA 5KJFA 1A2QA 4GOJA 3CKMA 1DJMA 4JB2A 1ZESA 2HD4A 3M6LA 4TS4A 1E5LA 1S4QA 3VZQA 1I4TD 3WFZA 1EEXB 3CW2A 4D41A 1KVSA 5FOWA 4RGBA 4UJ5A 4RA6A 4QGGA 1GRQA 2AMFA 2ZEJA 3OZCA 5DP2A 2IYOA 1E7MA 3TIGA 4RUKA 3OAAA 1G8YA 3V8RA 1QQTA 1FNCA 1SUAA 5TT1A 3DVAA 4QTYA 4ZV7A 3B3GA 3DE1X 3DO8A 3OKPA 1FDOA 1UBLS 3DE4X 4PZEA 4V0SA 3QEBZ 1TU3A 3IPCA 4YXWD 4LV5B 3ZH2A 3BWBA 4YDRA 1N2BA 2JCYA 3CH7A 3C6BA 1QGUB 1O57A 2I7XA 3HFSA 4Q05A 1NP7A 3C3PA 4YMVA 3A6EA 4KMMA 4K0KB 4XTRA 3C5WP 1KE1A 3WK6A 3ZWCA 2RHDA 2GYVA 3O75A 3EZYA 5LP6F 3LK6A 1RAFA 1KDZA 5MHTA 1SBIA 4LRUA 4F71A 1JX6A 5M5BA 4PNEA 5IARA 2CHFA 5CCEA 3UG6A 5F9FA 1HURA 4AUNA 3EIEA 3IP9A 1QVZA 2EFCB 1UXJA 5JCXA 4YH1A 1PDOA 1UIRA 4W1PA 2HJGA 2NTVA 3HUTA 3PT9A 2JAQA 2QF7A 4NF2A 4YHHB 1EAMA 1A7AA 3NHUA 4UVIA 4YRQA 1F48A 1G6Q1 1UK8A 4QYIB 5FOTA 4N7MA 4M9RA 3I53A 2QQGA 2IW3A 2ID8A 2NADA 2R751 4JJ8A 4HD8A 2Y0CA 1QTRA 4LI3X 4TM8A 1OWOA 1NKTA 2B2NA 5A0TA 1RYZA 3A4MA 3NM4A 4N3NA 3DXXA 5CK4A 1W5SA 4O5AA 4L75A 4B7ZA 3ZW8A 3AEUA 1KO7A 3MILA 4RIGA 4CFZA 5IBRA 4Z51A 4ZEVA 3RTCA 3U3JA 5DNWA 1IOVA 4H3HB 1AS0A 4H1UA 5CNIA 3ZU4A 4QLBA 3FLAA 3KEQA 3BE5A 2XUOA 3ELDA 4OHFA 3P9IA 3R5SA 4POAA 2OFWA 4B6JA 4DSAA 4YJ2B 1U81A 1E3EA 4HDCA 2FWPA 2BGWA 2ZR7A 3IXLA 1EZ1A 4RS3A 3PJDA 3L5OA 1LX7A 5F77A 3V4OA 4DABA 1I1QB 4TUYB