1RC0A

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rc0A00
2BLNA 4PZUA 3AUFA 4ZYVA 3P9XA 4EW2A 2YWRA 3DA8A 4ZYTA 5CJJA 4QPDA 3LOUA 2FMTA 1RBYA 4Q12A 1RC0A 3AV3A 1RC1A 1C2TA 3TQRA 1C3EA 4TTSA 1GARA 5J63A 4QPCA 4EW1A 4YFYA 4ZZ0A 1S3IA 1RBQA 4ZZ2A 2BW0A 1ZLXA 4DS3A 4ZYYA 1RBZA 1CDEA 1ZGHA 3O1LA 3W7BA 1MENA 1RBMA 3N0VA 4YFVA 1MEJA 3Q0IA 4TS4A 1YRWA 2CFIA 1GRCA 3DCJA 3TQQA 2GARA 3OBIA 3GARA 4ZYXA 3KCQA 1ZLYA 4ZZ3A 1JKXA 4ZYZA 4NV1A 4EW3A 3R8XA 4ZYWA 4S1NA 1NJSA 1CDDA 5J9FA 4ZZ1A 1FMTA 4IQFA 4R8VA 4ZYUA 4TT8A 1MEOA 3NRBA
chains in the Genus database with same CATH superfamily
1AD2A 3OJXA 2MINA 2V97A 3UKOA 3D7LA 1QYXA 3SJ7A 4QBHA 1HE5A 3I76A 3COWA 2H59A 4O4HF 1ST2A 1THTA 1KAEA 1PSDA 3EGVA 3FPEA 3OZBA 1QLWA 3ITDA 4H08A 5C8YA 3PNSA 1AGPA 3H5WA 4UARA 3PIDA 4MQEB 2VTDA 1XRJA 1GVNB 2EP8A 3R5FA 3VYTB 4QDUA 4PYQA 4F3NA 2ZJYA 5JSZA 2ZVJA 4M0FA 4NZYA 4IZ6A 4UMEA 4WXYB 2N3ZA 5F7ZA 5JWHA 1XMXA 2WSBA 1GNPA 2NZWA 3ZYZA 3QKRB 1R5JA 2ZIEA 2P78A 4E33A 5LXTA 2YN4A 3CEJA 1JHVA 5B58T 3HFGA 1HXHA 1II0A 1GQYA 2Q6IA 1ZM9A 2YIJA 3IVAA 3RRFA 4EX7A 3LDAA 1QIIA 3HEAA 5DN9A 3WRXA 1L8OA 2JF0A 3QYJA 5CA0F 3U61B 4U5XA 5DM60 1J23A 1NNEA 1DC7A 5B6PA 2A14A 2YH2A 5LWHA 2O8DB 5E1DA 1TJ4A 1ZUWA 5L3ZA 4IJQA 4UOEA 3AKDA 1C3LA 4CMAA 3IKTA 2LV8A 3FNQA 1N75A 1FDVA 5FOSA 2XMSA 3TLKA 4A16A 2IPXA 1NP7A 5DYIA 4NESA 3HUTA 3L3BA 3ZVLA 1NVMB 1I33A 5DXAA 3WX0A 4NL4H 4LDPA 3TAHA 2LR0A 3IELA 4XARA 5ALOA 4IIDA 2A94A 5IAGA 1T9BA 1D4FA 3CPSA 4MS1A 4RJIA 1CPYA 2CD9A 4WFJA 4CTOA 5FJIA 5HK9A 2QTHA 3O9VA 1DDGA 1JPUA 1KORA 3MXTA 3OT5A 1YV9A 4GMXA 4HDAA 5FBWB 3V4RA 3O3CA 1XZAA 3BE4A 4MR9B 4F6LA 3P2KA 4MVJM 1RJEA 2J5QA 2C83A 5ALVA 4NZ9A 3N70A 2ERXA 3L7AA 4IJWA 5DNDA 1U0FA 2G6TA 2ZRAA 2FFQA 3QENA 2ZWMA 4OTZA 5EHQA 2CHQA 4O29A 4S35A 3G1TA 1TI7A 2B34A 2GNPA 2B9VA 3EIHA 2QRUA 2FE1A 1B3BA 4JIMA 5FL7A 2A5DA 3RTGA 4BE7B 4DLKA 5KVAA 1IXKA 1I3OA 2E3JA 3WL8A 4DHWA 3ZVKA 1YCDA 5AVUA 1R15A 2A9FA 4UNRA 2P2NA 3LCVB 3LLSA 4X24A 2R751 3PFGA 5JBNA 3G0BA 3LPCA 3WTBA 4KHPB 4RZHA 1ZBDA 1OMOA 2HF8A 1AY0A 1PFYA 3OOYA 4NPHA 4DBZA 3DVAA 3PDWA 2ZI4A 2JAUA 4DVGA 1BVUA 2OENG 2QJWA 4CTNA 1TGVA 3GA5A 4A1OA 4KWHA 1HDOA 1ZIOA 3R7DA 2H4YA 2Z1DA 3BGDA 3RANA 1LLDA 4D92A 1AUXA 4W9RA 4Q3LA 3L7YA 4KWTA 4BLSA 5HQ3B 3R6DA 4GBMA 1EFVA 3VNUA 2PIDA 1HM5A 5J2TF 1S96A 1L7AA 1BS2A 3R24A 4CV2A 3PICA 4LZZA 1EFLA 1PJ2A 2XCUA 4OMCA 4NJEA 4V0SA 5E9AA 1GDTA 1L7VC 4URYR 1YS7A 3OHMA 4C2TA 4Y6RA 3CF2A 1FTGA 3ORYA 3FUWA 4KQ9A 4MGYR 1H3FA 1Z34A 3SS9X 2QTRA 3K6KA 4DHEA 1XNHA 4BMOB 2AOVA 2IITA 4G86A 5LBTA 2QLBA 3WLEA 3Q88A 1QVAA 1Y0BA 3T5MA 1RRKA 2P67A 1S2MA 2W70A 1I0ZA 3NHFA 4KDCA 5A05A 3OEHD 5CT4A 4PQGA 1LPPA 3M6AA 1JHPA 1IWOA 2HCJB 1NBEA 3M1AA 2P4SA 5AW0A 4QPDA 3WIVA 2AS0A 5CUQA 3HLKA 1QG4A 2GBLA 4AMZA 1BN7A 1JLSA 2C2ZA 2VDVE 1UDAA 2VA9A 2WF8A 3HA3A 3L0IB 4L7VA 4QGHA 4UE3S 1FDTA 2B1RA 4V38A 4YQZA 3PQ6A 1D2GA 2MYNA 1LJ8A 1XFDA 3GRPA 1VQ1A 1RMTA 3BJMA 1SHJA 3DMFA 4FDUA 3U62A 4KU4A 1BFDA 3GF4A 4UZEA 4X5OA 4XCVA 4FCTA 5JC8A 5LP6C 2PQ6A 1WEKA 1IBMB 2W4IA 5BOSA 1BQ3A 2C1ZA 2PZLA 2IKSA 3GVHA 4JJIA 1RYMA 1EM8A 2R6AA 3EYWA 5FX2A 3E8MA 5CK5A 4DRZA 5IKEA 4TZ0A 3JXEA 4IS3A 2BHLA 3GLUA 4XIIA 3AVPA 4BFZA 5KOHA 4RSMA 3W5JA 2PUFA 1V9SA 1VL6A 4L8WB 5KYWA 2XKBA 2JBAB 4LJSA 2B4YA 3TLZA 4DBLE 1YOVB 1DAMA 1SZCA 1IAVA 1OHHA 2P2GA 2FEKA 2ZKLA 4ND1A 3ZQUA 4MQUA 3OZIA 3KAQA 1F6BA 2PM8A 4EO7A 3P32A 1R0BA 3G17A 2EL7A 2R3SA 4GZ6A 2JEOA 1WOYA 4O5AA 1GGJA 5HZKA 1L2TA 3IR7A 3ZCXA 1UM9B 3C3MA 5HSGA 1XD2A 3BFPA 2IYAA 3IIEA 4FXOA 4BWFB 4QYTA 3G8DA 4WIAA 2AIRA 2WG0A 1QK3A 3WXBA 5LJLA 3UHFA 3P94A 1P0MA 2QTVA 3I6QA 4JVOA 4M7OA 1EBFA 1U5AA 2BSAA 1ZGJA 3EFHA 2EC5A 1WCWA 2FZVA 2ENUA 1D2HA 1DRVA 5SZHB 1KOLA 3MEQA 2IBMA 3N9IA 2P9EA 3DYVA 3R20A 1LTQA 1IUPA 4YJHB 5CW1A 1FJHA 1I2MA 4D9MA 4OI4A 3T7CA 1U1GA 2PL9A 5KYTA 1T5DX 3IPXA 4BLVA 1YKFA 3UMRA 2ZI6A 2ZYHA 1I14A 1JVNA 3BAFA 3DCJA 1UZAA 4ILKA 1QXSA 2PEZA 1B73A 2BFDA 1EFTA 1H8HD 4RE6A 3RSGA 4RY8A 3G8BA 3JVEA 1GPNA 4LCEA 4OJNA 4RTSA 1Q7EA 2F8LA 3KHTA 1JP7A 4B8WA 1DJMA 2ECKA 3G5UA 1U0TA 3UJHA 1W94A 4KBGA 1OI4A 3ZHUA 4RD2A 3QMPA 1T2EA 2NYRA 5BN1A 1DELA 1WU7A 1C7IA 3SQOA 4WXRA 3C5CA 3GFPA 1BWPA 2P4HX 2AZDA 3W8RA 5C35A 3FR7A 2QAGA 1MTZA 2YFKA 3EDRA 3M2TA 4J2HA 4PGHA 5B30A 3GO4A 5KTYA 1PV4A 1WXQA 1YGYA 3CISA 4UC0A 2PFSA 3BKWA 3K0KA 4ZO6A 3VR5A 1P73A 4PEVA 2FMTA 3ZJ4A 2FOXA 3VDQA 5B3LA 1MVLA 1QFJA 3KFVA 2RGWA 4HB0A 1C0PA 2EQAA 2O2JA 4D26A 2A0XA 4H7HA 4ETWA 1C1XB 1PJ8A 2A5JA 2X0EA 4JQOA 5BR8B 1RT9A 5E2IA 5REQA 4JI0B 3LH5A 2WU3A 1ZNXA 2WYUA 4TS1A 2EEPA 4FX5A 1VCIA 3BA6A 4FFDA 2BUBA 4PANA 3RTDA 3JQGA 1P19A 2QTNA 2YVKA 1U80A 1T3SA 1V5WA 2PX3A 4J3NA 2BFBA 5AVXA 3R5KA 1PDVA 4XI9A 1KC1A 4B6PA 5A9RA 4R40A 5CEJA 1A96A 1VE6A 2L69A 4JYMA 1E4EA 1ZHFA 3DLBA 2AJ8A 1QHFA 4DMCA 4XIJA 3ZZNA 1TMOA 3NWJA 3A1NA 2FZCA 5ITSA 3CNNA 5ALMA 4J4TA 1CEYA 3EUEA 1W5EA 1MHPA 2IWRA 3T38A 3DV0B 1GL6A 4RTRA 1KEEB 2G9NA 3TDNA 3V33A 3CURA 3IHLA 4LK3A 1J5XA 2CXTA 4AP6A 3BHIA 4DV1B 4ARIA 3FYUA 3DE7X 3AHEA 5DYGA 1KFJB 1CQWA 1KS9A 1RQXA 2BEUA 1ECJA 4DT1B 2F8TA 1KSJA 5AKHA 4YT4A 2M6SA 5D87A 4D81A 4WEQA 1PR6A 3U16A 2RAFA 1U9YA 1Z4QA 1J99A 1HEIA 3U31A 4CQJA 2DBRA 2Y1KA 5E6RA 1JEOA 3ED5A 3WP0A 1EAMA 3EXEB 3THWA 2TSYB 1D7OA 4J1TC 4ZQEA 1SXQA 4Q1CA 3ER8A 3K09A 2JCVA 1I7QB 4KVAA 1NQVA 1LY1A 1JQ5A 4BGUA 1BQ4A 2OD7A 2X5OA 2QQFA 4KO1S 4RETA 2VQEB 5EXPA 1Q11A 1NR5A 4I99A 2OBBA 4DNOA 4HEJA 2QY6A 4KCGA 1T34A 1PUJA 2H1WA 3AXTA 4C0XA 4R9UC 4AXXA 1PEDA 1QPBA 3F4KA 4GXTA 2AKYA 2D74A 3QNUA 3B13B 2GZDA 1F14A 3BSSA 4N49A 2VAXA 5CA1B 2AOXA 8LDHA 2O2EA 3U7GA 1O6GA 3H8WA 2ZBEA 4LV6A 1U04A 3TXYA 3T4EA 4HNUA 5CP8A 5ENDA 1EVLA 1II8B 1CP3A 4BFVA 1HZZC 4OUDA 5JXWA 1FXWF 3KV3O 3BRWD 2W6JD 2O9JA 1LQUA 1SXJB 5BOSB 4J6FA 4JBYA 2H5LA 4Y2JA 1TOAA 5JSUA 3PE3A 3DR5A 1U2GA 4Z7JA 4EM6A 1QOZA 3SX0A 4XQ9A 5BQOA 4DPKA 1IN4A 1TK3A 4QICA 4XTCS 2J3QA 1XCLA 2BZSA 4MNTA 5ADVA 1TRKA 2WSSA 3EPLA 2IYEA 2FHPA 3PCTA 1LLUA 5HMLA 4RTOA 1K9SA 3KPUA 4PYMA 4WKNA 1YA6A 1Y3AA 3LQ2A 4C4SA 4REQB 2WINI 4G0NA 4NCXA 1C4XA 3PHHA 5FPYA 1HEYA 3SR0A 4QGAA 3QTBA 3VR5H 4ZDKA 3S6JA 5LQDA 5BQ3A 3QG1A 1FB5A 1GCUA 3FGPA 2H18A 3INGA 5BR4A 3HSKA 1LS1A 3HO6A 5CLQA 3PNVA 1FX1A 4YAOA 1XG5A 2EJVA 4ZOLF 1W47A 1PFVA 4K9KA 4HDOB 4M87A 1ZU4A 1CB7A 4MUYA 1ZN2A 1Q92A 2B99A 4L2IA 3HDTA 1HLGA 3G2JA 1SHTX 2B1IA 3BPSA 3GHYA 4O4LF 3F8SA 3B9PA 3F7NA 3LUDA 4G0UA 3F6RA 3ITEA 1GNTA 4XLLA 1FDRA 1CR0A 3ZCTA 2B94A 4NG4A 1QO7A 4F91B 3AONB 3T54A 3U7FB 3AB3A 1C2YA 4GDMA 3F5QA 5CVCA 2H5JA 1VIAA 3RODA 4EGCB 2VEOA 3GLGA 4DZZA 3IV6A 3LLUA 4IIGA 4C4TA 4JZYA 4ND8B 1ISJA 5FO1A 1O77A 1PGJA 2D0DA 2LCIA 3ZPXA 1Z2DA 4NLLA 3WQHA 2QZZA 3P96A 4N0MA 4XR4A 4FKMA 1ZW1A 5FI3A 2PLRA 5CVTA 2DG2A 5BV2P 4XGNA 4I50F 1LDMA 1R12A 5C3MA 3WRXC 3ZBQA 2ZQ5A 5EJFA 2XH8A 4E21A 1JI3A 2ESRA 2V96A 3AFMA 3PNLA 5J63A 3KUKA 3SC2B 3SN6A 1X1BA 4DF3A 3AR2A 2JHCA 1POXA 2FMFA 4JOCA 3T1OA 4IDPA 4HFJA 1KZHA 4L6CA 3BGOS 4O4HA 4ZZ0A 1AF7A 1RQ7A 1Q95A 2FNAA 1UP6A 1XV5A 4KXNA 3DT9A 3HB9A 2B35A 4TMVA 1G21A 2Z43A 5FR2A 5LQSA 2BJWA 1K86A 1BXRA 5GJBA 3OESA 3ILHA 3NUGA 2BM0A 3W1EA 3I34X 4M1WA 821PA 5IVHA 4MEJA 3MWJA 1EX1A 1WQ3A 1C30A 5ARDA 3V80A 4ZEWA 3VOTA 1ABFA 1QQ6A 2R62A 2AB0A 4BB0A 1XCPA 4K5QA 5HXAA 3TTYA 5K4GA 2VP3A 3ZW7A 4JJ7A 2B30A 2NZXA 2WIFA 2WQZA 5IWCA 4ZYLA 4RS4A 1G5RA 4PYIA 3VBCA 1PWEA 4QE3A 1M6VB 1X15A 2X22A 3WYDA 3MNFA 4XYEA 5CA0A 4ZTUB 4RAOA 4DB4A 1CUUA 3FZYA 3DLPX 4K1XA 5IF9A 4RLFA 2L0XA 3A32A 1DBWA 4QGGA 1E3TA 2JFHA 2HWXA 3F46A 4FQ7A 1IQUA 1Q1AA 4Z4GA 1Q77A 4HMPA 5TNXA 2FKNA 4MWSA 1Q22A 3N86A 3V4PB 5U4QA 3PJRA 3LTEA 3VU3A 2I6QA 3B89A 2GKGA 1FFGA 4RFSB 5KYUB 3J7AC 4II3A 4YMGA 3AGQA 3UFXA 3G68A 3UJCA 4B3HA 2YS7A 4X6UA 3V8NA 4EFDA 4W5TA 3P9PA 5LMCA 3QX9A 1Q16A 1Z39A 1KMHB 2ZUBA 4RJTA 1H4VB 1FVXA 1CT9A 1SKQA 2G1UA 3T6KA 5A4KA 1E79D 2QTAA 1NXTA 3K0CA 2ON6A 3ZWOA 4D46A 5ICGA 3HRKA 1ILEA 4WBSA 1QG0A 5EJAA 5AM2A 1Y1TA 1ZOOA 1QQ5A 2DY0A 2P9BA 2BFWA 2IYRA 4OF4A 1O08A 1PG5A 3DAPA 3T7JA 5JD6A 3OURA 4K86A 1F06A 2IH4A 3HCNA 2XW6A 3TEMA 4HGRA 4RWZA 5H16A 5EJIA 4E2FA 1NFRA 4R2WA 4ZXFA 3T9BA 5C1DA 1NI4B 1WXDA 1SCAA 5AJTA 4U2KA 1GSIA 3COYA 2OL4A 2H1VA 2XZTA 4RMNA 3DBIA 1CRLA 1OD6A 1RWQA 2DE0X 2HK7A 3AIMA 4GQAA 5IJ0B 1O0CA 1OAOC 1S02A 2ZIFA 2LUOA 1NL3A 1Z5UA 3KBBA 3MTDA 3W2HA 4DV6B 2GS9A 2FPWA 2EW2A 3VH2A 1L4LA 3PUKA 2X4GA 3P0FA 1JDTA 5A1JA 1XJWA 2XTNA 1PEAA 1JEEA 4IOMA 2RGEA 2PBZA 5JHHB 2O5VA 3PC2A 1CQJB 2ZTMA 2DUNA 3ETEA 4LFAB 2D06A 3LVQE 1N34B 1JE0A 2GBIA 1P44A 1SHLA 2GN6A 2HH9A 3H65A 3IDQA 4LWQA 1XEWX 5DCWA 1AK1A 1OILA 3UWPA 2QENA 3KQOA 1LPBB 3S8MA 1AQLA 5BSWA 1KI6A 3ILSA 4WJKB 2IP2A 3CF0A 4B0OA 1XRSB 4Q9NA 1E61A 3HGQA 1IG0A 4MPJA 4DQDA 4N5IX 4WBNF 2QMEA 5KX5B 2ZRCA 4O2AF 3NDBB 3ZI4A 1WM1A 1BXKA 1EDBA 4GVPA 1E2MA 3WKDA 3EPRA 4INAA 1JEQB 2PY6A 4HEHA 4I08A 3SWWA 3AZOA 1WKBA 1MVNA 5BSTA 4IR7A 2IS2A 5B2ZA 3L92A 4EJ0A 5IPFA 3HP7A 2C9ZA 4H18A 2D59A 1J7JA 3K1TA 2XRMA 1E94E 4PYNA 4YUVA 1SBNE 2BMJA 3C3YA 3E0QA 3TZEA 3KYDA 4YRBA 4M86A 5DEOA 3SYLA 3U2QA 5EIFA 9GPBA 2HMVA 2RB4A 3IOEA 1NWCA 4YBZA 1U02A 5PNTA 4M22A 4CLXA 4EBFA 1GM5A 1W36C 5IF3A 1N4DA 4GLOA 4Q9KA 3TM4A 2C4HA 2XQKA 3W7BA 1I10A 4MVJG 1U90A 5HUJA 1P5HA 4MKRA 3TSCA 4R2KA 2HSEA 1L5LA 1KBQA 2AI3A 1I5EA 1XMJA 3NIBA 3V34A 4RELA 3ZTTA 3RVPA 1BN6A 1SKAA 1UOQA 4WV3A 1EDZA 3RTEA 2GVDC 4A26A 4K46A 4MA5A 4Q4LA 3LT5A 4AO6A 5AK3A 5KBYA 1J6UA 2H17A 2VAPA 5D84A 3IQGX 4DNXA 1NOIA 4CTMA 2AH5A 2ODPA 3GVPA 4N18A 5LZ4A 5HZHA 3CO5A 1KHTA 2H48A 1LDEA 3DFIA 4NU6A 4P22A 2N42A 5ETJA 4B9AA 2Q3MA 1E1RD 2NPOA 1V5EA 3PYLA 4HWOA 4UASA 5C4IA 4FUQA 3LPAA 2ORVA 4NOMA 4FWTA 3GRFA 5LD2C 1GTJ1 1VJGA 2R4TA 3FZGA 2PNFA 3RREA 2QN6A 4O8ZA 4PO3X 3U37A 5KKCA 2PUEA 2OCXA 1YL5A 1BE0A 1EDEA 1TTQB 1JFFB 2JIZD 2W4QA 2WM3A 3GFGA 3SNHA 1SCKA 1UF9A 3DMHA 4JT4A 5BO5A 5JS6A 3GLGE 4JJEA 3QELB 3WO1A 2C9BA 2NVUB 3QEMA 2HYIC 2C5GA 1QAOA 1OA0A 2RHWA 1UDXA 3AHFA 4OQDA 3HHPA 5L3VA 4A27A 1RRVA 2IELA 2F90A 1DO2A 1ZJ4A 2F3TA 4QUBA 2A3RA 3WBKA 4LY9A 3WK6A 2FZ4A 3G0OA 4JGIA 3HM9A 2IV7A 1AQ6A 2CLHB 3INTA 3NGXA 3F6EX 2XJ4A 4OXNA 5FCDA 1R6TA 2CNDA 2R1VB 3OG9A 3P9XA 3RUEA 4Z1MD 4LHYA 5H9VA 1F2VA 2CFOA 4X71A 1TZ2A 5AQ1A 5M2QA 3AJEA 2X6TA 1BRMA 4TKVB 1GAWA 3EVDA 4QXRA 3O1HB 4OHXA 3HGTA 1WF6A 2VTKA 5TQ0B 5K6RA 2D2XA 4NH0A 2J3JA 4XIYA 5E0KB 5EZSA 4F56A 4ENVA 5C5EA 4FNMA 4IV8A 4DJDC 1VTKA 3EAFA 2F1OA 4E51A 1KOFA 1GL9B 2ZI5A 4CM4B 3S29A 1OI3A 2IHJA 1X7ZB 4B76A 1ZGBA 1VMDA 3CZ5A 3ILYA 4LXYA 4CL0A 5JCOA 1PJQA 2XMGA 1FOEB 1SOWA 2R47A 1OYOA 4WDRA 4XSVA 2VSYA 1NLUA 4GLJA 3FNFA 5L4NA 1PEYA 5JD5A 2BFMA 3AX6A 1GYPA 3OJCA 1PBTA 1KIFA 1QF7A 3E1KA 3GUHA 1ZJ5A 1E1YA 2H5EA 4RH1A 4XSHA 2VTEA 3KS9A 1W8DA 2H63A 2CE7A 4GKKB 4KQEA 3VAYA 4MJ3A 3EFOA 5KNBD 3HADA 1QFXA 4FI3F 1EA7A 2O7QA 2VO1A 2BW0A 1M0TA 3BXXA 4JQSA 1YJBA 1KO8A 2GOYA 3B8HA 4MKIA 4OXQA 3A9UA 3T1NA 3C5VA 1OX6A 1YVUA 3WL6A 4DS3A 4EMTA 1G4AE 1AHNA 1SUCA 2IOQA 2POCA 1K63A 2HK8A 4WCFB 2QD5A 4G5OA 3T0IA 5CBKA 3NP7A 4ARCA 3OCXA 2BLLA 5AJUA 4JDPA 5BSFA 3OIVA 3P1JA 3WNBA 4ECEA 4TLLB 4RD0A 2Q4EA 2VYVD 2G88A 3FPHA 3WL5A 2PL3A 2XWJI 4DSTA 3U3DA 4JNKA 5JSZB 2YMQA 2XODA 1Z18A 4ZOBA 4E5VA 1HYHA 3IE1A 4BNKA 1ZVVA 1G42A 2QX8A 3OBIA 3A3YA 3H9BA 2O3TA 3HNPA 3T7SA 3LX4A 3PF8A 4DOMA 4DRXA 1U7WA 5LXTB 2KLHA 1T9AA 3RYTC 4DG5A 4ZQFA 4FVTA 3O90A 1RPZA 1UCFA 3WIOA 3SSNA 1MH1A 4E15A 2ZRHA 4ZDIA 2XNJA 4HUJA 3N6RA 5C8VA 3UF0A 1A8PA 4IVNA 2GPNA 1EVZA 4FOOA 2JPDA 3PTZA 4L75A 2YV4A 1SKYB 4MQFA 5L8VA 2QNBA 2EFYA 1P5ZB 2Y0PA 2ZANA 4HC4A 1NE7A 2NTEA 3KEOA 1XDDA 2QN9A 3LPLA 3LFHA 3A6EA 2ZR8A 4IQ0A 4HN9A 4U39A 4OO3A 3Q5DA 1XAHA 3DGFC 4OVKA 4Z9YA 4OXXA 4JLBA 3AQ4A 2E0IA 4GWGA 4MS1B 4BMPB 1LCIA 3PL5A 4QDJA 4GI3A 3CN9A 1XRMA 1N78A 3ZE7A 4BRZA 1NRIA 2FXVA 3H05A 2VNKA 1J49A 3LVFO 4MUGA 1I80A 3KLNA 1HE4A 1Z28A 2HSGA 1KI9A 1P80A 4Q21A 5AVOA 1HPLA 1EIZA 2Z9BA 5THQA 3WBFA 3NANA 3N2EA 3VHXB 2IHVA 1TU4A 2VYND 1RI5A 4K8OA 2I7VA 2I1LA 2VK8A 5J3JA 1E5DA 5IDWA 4GL2A 3VR3A 1WDLA 1TADA 3KHKA 3QKUA 5TS2A 1KEUA 1ZJ6A 2ZFUA 4UZSA 3R0XA 3HL0A 4EF5A 4CCYB 1OU0A 4MIKA 1W52X 3E4CA 3H6KA 4I4CA 4J03A 1BHSA 1V5FA 2BGLA 3KTDA 3R09A 2LVBA 5DT9A 5CH3A 3ERCA 1DT3A 2ZJ6A 3CN7A 4NEQA 1IH8A 2WWGA 3V8MA 5BYAA 3QP9A 3T34A 1EPUA 2AOUB 5JI2E 2GXAA 4R51A 4QODA 4NENA 4HDQB 2ZROA 3MINA 1B42A 3K0BA 2OSBA 4OIMA 3MWDA 3N2ZB 4RIEA 5FB3A 3JQ7A 1EUZA 1MNQA 2I3BA 2QRMA 1P9WA 4HUQB 4M0EA 3WDMA 1IOZA 2ARKA 1J0CA 4ZOLA 1JR3A 1O58A 1FUKA 3BMXA 1XZQA 2PZGA 1PJBA 4IFEA 5G0WA 3SYRA 3W5BA 3MOGA 4LF4B 2NXJA 1RJWA 2C99A 2JJ2D 4YRQA 2WM2A 5HBGA 3AETA 3OX3A 2FJPA 3L8DA 3UICA 2O23A 5AO9A 1IIBA 1DX4A 1PR5A 3HZHA 1AKTA 4TXLA 4LI0A 1FXSA 1HTTA 1RW4A 4BO5A 5J4VA 2NXNA 4QBFA 4Y98A 1G6Q1 1AXGA 3OX4A 2RGCA 3R7SA 2QK4A 3TWOA 1EQAA 2C3MA 3DW1X 2DVMA 3TDMA 2BGRA 3N8IA 1B6SA 1GADO 2P2ZA 3ZDXB 1BDIA 4UFOA 5KTRA 1A5TA 3B36A 5AI8A 3PFNA 3D0RA 2ZTVA 1NBWB 3RRBA 2EX4A 3WGIA 1AMOA 4L76A 1YZTA 2WOJA 1OAKA 4BEWA 3ADDA 1UMBA 1AB5A 3QLUC 2Z4SA 2IZ6A 4IDGA 4I50A 4ZQHA 4LGMA 2G0AA 4O6VA 4U9UA 1WULS 2GHQA 2YNMA 4Z9FA 1ZD4A 2R0QC 2JCXA 3ND8A 3QF7A 3AVYA 3FYHA 4LBYA 4UTXA 4AYTA 4LXQA 1DBPA 1ZBQA 2YJZA 2GO7A 4PZDA 3UGKA 4AP9A 1OXVA 3JSAA 4UHEA 1YE3A 1QTRA 4C06A 2Q1WA 1YJXA 3FMVA 4S2UA 2V54A 4K6GA 2F8SA 3MBOA 3N2NA 3D4NA 3DZ8A 1P5JA 4RKYA 4DIMA 2ZJ4A 1IHDA 2B7CA 3Q3CA 3VZCA 4FDTA 4D43A 4IJUA 5EE9A 4GZ3A 4ND2A 3RJ9A 3U7EB 5K3FA 1GXSA 2ZDGA 1IEQA 4JOBA 4KRXA 1W0CA 5ALNA 5ECWA 4ZI7B 5BR1A 1B00A 3O4IA 2FR8A 3N2GA 1NVXQ 3U9TA 2HAEA 3DTVB 2MMCA 2FRDA 2CLKB 4Q7MB 2B92A 2D00A 4UBMA 4DY6A 5CFOA 1C1DA 1KJJA 3K30A 4DSUA 2YWFA 3BXOA 4FYWA 2IHNA 5CT6A 1UEIA 2PYIA 4NJMA 3WY9A 2H9AA 3ORFA 3JWJA 4HN2A 2AMVA 2VNAA 3VM6A 4KIUA 4R83A 1NZDA 2HNBA 2G71A 3UYKA 5JZ9A 3UUWA 1DBVO 2EFGA 3BK2A 1N2SA 3LSTA 2H92A 3MOIA 4PZUA 3ZD7A 2OMKA 1ZDMA 3G3EA 1KETA 1JG2A 1DXOA 1R18A 3EFBA 3R44A 3I73A 2VOJA 5YASA 3NBMA 5HFNA 3CU5A 1FXUA 4BX8A 5DX1A 1YJ8A 3AEUB 3GEMA 2B25A 2QTVB 1TC1A 3WISA 2C42A 4HP8A 5C3UA 2CLIB 1VDZA 3JVUA 1RZRD 4EG5A 2RH5A 4WJZA 1Z56C 1CYDA 1OI2A 2DX7A 1QV6A 1TKCA 4MS4B 3W9YA 3EZLA 5JAIA 2VHTA 3AFNA 3KQKA 3M81A 1JRLA 5IT5A 5JZBA 1V47A 1A7KA 2M32A 1N5RA 2RGAA 4R9VA 1ADFA 1RIIA 3ETLA 3RR2A 5KTNA 2I4OA 1Y9JA 4PC1A 4KQCA 1GRNA 5LUBA 1QIDA 3TLCA 3WLFA 2QBYB 1KZ6A 3T3EA 3OM9A 2N1BA 1CZRA 3AF6A 4U3JA 1UPUA 2V4MA 3OY7A 3WK9A 3ZWMA 3FOFC 2CHEA 4IH4A 1FSSA 1K6EA 1X7WB 2WJWA 2WUWE 2XRFA 3CX6A 3D31A 3HY4A 4GOLD 3CIOA 4KFUA 4P4TA 3VQTA 2HLNA 4WVFA 1Z33A 3FDFA 3KVOA 5HE8A 4ATNA 1GTMA 4YMLA 1C9EA 2ODAA 2XYVA 3DCNA 3PCXA 2AUMA 4ICIA 3P71T 4XGKA 5IBRA 3WGKA 5LA6A 3ZE6A 4Z7OB 1LWNA 4B6FA 4B40A 9ABPA 1B16A 3B2NA 2DWPA 4IXMA 3GRKA 3LQFA 2CFTA 3F4BA 3NTVA 5KSPA 3COPA 4NYMQ 1QB8A 3WA7A 3QUSA 3FCXA 3MWLA 1JR2A 1EFUA 1JHAA 2GHRA 4LIPD 3RCBA 3L1JA 3PGMA 3EPPA 4DLBA 5CEFA 2X8LA 3CZMA 4HMQA 4D9BA 4WN3A 5A9SA 3RIGA 2G4LA 1AQUA 2I4RA 2QTBA 2X3UA 1CRZA 2RHRA 3AUAA 5REQB 1UBGA 1O0BA 3H2KA 1O9BA 2HM7A 3B5JA 3ROPA 4E7PA 1G8HA 1NQUA 2GSWA 1DUSA 1KZ1A 3FTPA 1BOOA 1NG1A 5L40A 4MV7A 5IXYA 2KMLA 4QJ4A 1TPYA 1R4ZA 5TF0A 3K71B 2A5LA 4LHVA 1TQHA 5AK4A 2OC4A 3HBJA 4BAUA 1ZL2A 3W3AA 1E7WA 5ARCA 1JVSA 1JEDA 4BXOB 4RA6A 4HZUA 3RKSA 3BIXA 3R7LA 1ML4A 4I55A 4O2AA 1TJ5A 5DXFA 5KWEA 4QTYA 3KPJA 3EPKA 1L5WA 2CE2X 3CY6A 3SPXA 4CM3A 2J67A 2P1ZA 4JKOA 1X9GA 2PU7A 3I9KA 4O59O 4O4JF 4UBIA 5CT8A 4UCXA 5M3BA 3TN7A 3UW3A 3ZJYA 5AVVA 3R5TA 4UQPA 3GIWA 4KR9A 1IDN1 4LOJA 4N7JA 4PFKA 1NLYA 4EJSA 4CKWA 2VHXA 1XZJA 3H1TA 3PQFA 4LCBA 1EESA 3LX6A 4QBTA 2HWKA 4AU1A 2MU1A 4KUGA 3HYTA 1BEEA 4YAEA 2EL9A 1HKUA 1PKEA 5D1NA 3O3NB 1IJEA 3QXSA 1NHWA 1TW2A 3AIIA 4KACA 4KPEC 3FOAA 3GGCA 3SMVA 4DQUA 2O2DA 1RE1A 1SCBA 4X84A 2PR7A 2X2PA 2D2EA 3PJDA 3VR4D 1ZHOA 1F2TA 1NJ5A 3MTJA 4FK8A 5JH7B 1L5RA 2HGZA 3PXBA 2JG3A 1S1MA 2CDAA 4IDCA 2UVPB 2MSLA 1CVLA 8OHMA 4I5FA 4UU0A 1M8GA 1XX6A 4CKXA 1ORHA 3IVXA 4ZOAA 4CFYA 2P9FA 1H05A 4V0OA 4ZU3A 3DKRA 3V1NA 1CW2B 2MMGA 1GFSA 2JC3A 3TB6A 2E9SA 2HW8A 2VAVA 1T9CA 2DLDA 3SYTA 1HUQA 1FRVA 3WL3A 5K20A 4OI0A 4BZQA 3EODA 2G67A 1JR3E 1N2EA 3FDJA 1DCFA 2PZBA 4HAYA 4PPFA 4TUYF 4YCDA 3W6NA 3R3HA 2IK8A 3A2MA 3BIWA 1FFHA 5FXMA 3WV5A 3PPVA 4DIKA 1CBUA 4CLRA 5IKXA 3G6KA 1G0NA 4OV6B 4DLRA 1FUIA 4EARA 4LVNA 1DO0A 3L6BA 4L0MA 1NRJB 1L0BA 1P5FA 1YNOA 2YZNA 3HXPA 4JB0A 3C1OA 4P33A 4ARZB 1P18A 4FOTA 4OQMA 4QX6A 5JSHA 5HOQA 2EZ4A 1UT5A 3LWZA 4OQZA 1PX2A 3QVKA 4OA8A 5GADl 2GK4A 1QHIA 3O3OB 2OGTA 1JGTA 5A4AA 3ZDYB 2FN3A 1MX3A 2KPOA 3OZWA 4IUDS 1OYYA 3K0AB 2DUWA 2PFGA 2AFVA 3LK7A 4E5MA 1JLKA 1HMYA 5FWNA 1KRWA 1A95A 1ZRHA 1M0WA 1IM2A 4YMVA 4OYHA 8ADHA 2NPFA 1QYIA 1XJQA 2BWJA 1MNAA 3FUUA 4FHDA 2IPLA 1NYQA 2NIPA 4I9UA 4KV9A 4BNYA 1BKSB 3AY7A 3PFCA 4IM7A 4JMPA 5F2KA 5J5AA 5K0NA 4WMLA 3SQNA 4PLVA 4N76A 2Z04A 1KI4A 4FEGA 4X3PA 5CMLA 1QF6A 1UT8A 4KAAA 2XRYA 1UBEA 5JD3A 2XMPA 3H5TA 1MPTA 2PL1A 4NKRA 5IG2A 5LMZA 2BGKA 1V7QA 4PHCA 1XZLA 2Q4RA 3IV7A 3NIFB 4K3UA 3Q5EA 1H42A 4B5LA 4WVLA 3S1LA 4D74A 4ZGWA 2VJCA 1GUZA 4NYMR 4ZTZB 2ODTX 1DXHA 4P34A 3ROXA 4G1UC 1ISGA 1R6DA 5ER9A 4RZSA 1G1AA 2I4IA 2DJ5A 5E6UB 2UUBB 5TPWA 4BMZA 4GT1A 4KNWA 5LFAA 2IYUA 1WY5A 5EJEA 3F5FA 2OZPA 3A37A 2HEIA 1B8VA 4M9XA 3W3AH 5KOJA 3ESRA 2LZ0A 2IIBA 1KKLA 1ZP6A 3HKBB 3I0NA 3PSAA 2WKQA 3HVJA 1LF0A 1SUEA 4TLCA 5HS6A 3RT9A 1T8WA 3EJ6A 3MD9A 5FP0A 5JATA 1GRCA 1K8XB 4PHGA 4BC1A 1NNSA 4DWWA 3MGAA 3LMKA 4CKYA 4AF7A 2IYFA 3EK2A 3U48A 1YDGA 1LEHA 2XQGA 3BX1A 1T1SA 4ALMA 3O4FA 1HA3A 3P20A 3LKVA 5HEKA 3DAYA 4DV2B 1JLRA 2AKAB 3FHLA 4PBTA 3F9RA 1RP7A 1BS9A 5E95A 1VA4A 2ZR9A 2HCFA 1S2DA 1E2HA 1WCXA 1ZH6A 2AVNA 2CMHA 1GCGA 2EP5A 3PB3A 1QP4A 2D8MA 2Z5FA 3NBZC 3DTYA 1PCXA 3KPWA 4N47A 2HPZA 1N0IA 4EG3A 1BXRB 2AQHA 3BHMA 3KZCA 2WKPA 4XD7D 1IK6A 4UULA 3G88A 3EEBA 1W581 4ZWNA 2C2GA 4K9MA 4LQDA 4V1CA 4BY9E 1IPFA 4JA0A 3R77A 3D6FA 3A6DA 1JNXX 1H6DA 2JGLA 4NZMA 3VGPA 3DLAA 3C87A 5I01A 2O05A 4CM6A 3K8YA 3Q3IA 3GRVA 3LP6A 1ZKMA 3FOCA 1UKBA 4GO1A 2RHHA 3SF8A 2QV0A 1H93A 1Z35A 2QZ9A 4A0SA 4F7DA 4QOJA 3JQAB 3QI7A 3THYA 4EPXA 3TO5A 1L7DA 5MGBA 5CVJA 4OKNA 2O1XA 3DBOB 5DHPA 3FHTA 2QUHA 4UDNA 1PSWA 3DKPA 3FKSD 4WNAB 4HDCA 5F5XA 2B7LA 2QHXA 1NGSA 2Z1MA 3D4IA 3VPDA 5I3CA 4IF6A 2EEZA 4RORA 1NHGA 4M9CA 1IYZA 1G8KA 3IHTA 2IF2A 3NV7A 3UB2A 1MW8X 1PLJA 1T9ZA 2C98A 1ZQ1A 3MUEA 2QRGA 2UYGA 4PZPA 3FTNA 1TZBA 1EX7A 2JFZA 2IVFA 3FPBA 3OPNA 3T9FA 5KREA 1P45A 4KXQA 3NRCA 3D7NA 4ZCSA 4OATA 4D5GA 5BUZA 1EGVB 3O7WA 1ZOIA 1OROA 1TQ4A 1R7RA 4MGKR 4PLHA 4QPJC 1A8UA 1XCJA 4BWGA 3KD3A 4OOFA 2MYTA 3BTOA 4TRMA 4ZREA 5KWVA 2VDMB 3T15A 4P4GA 4BQNA 4R8RA 3CHYA 1HETA 2OV3A 4AF8A 4TGLA 4BFXA 4RPHA 5LYYA 1G6OA 3PR3A 1M2GA 5D1HA 1PQWA 1E1KA 1A04A 2AX4A 2NSLA 2AOTA 2ZUDA 3BAZA 2KQUA 3E7PA 2DR0A 4O5OA 1Z9BA 4HDMA 1G3RA 2R60A 3GN1A 4Q7EA 3TL3A 4BATA 1J90A 2J8ZA 2OXRA 3GCZA 1XQVA 3SHTA 1QJ4A 5JO0A 2AFHA 3KKPA 1DWOA 4QXQA 3V7UA 2J3IA 3V7YA 3BTSA 4JEUA 3OQBA 1WB9A 1U5BA 2CGEA 1O54A 1NVDA 2G08A 2IY7A 3EIWA 3F5MA 2ZG6A 5A5FA 3UKDA 1ZI8A 2ZVQX 3ZIUA 1RXWA 1GUFA 4BNUA 3T1QA 1EK0A 1UPFA 1N1GA 3D4BA 1GZDA 2WF7A 3LCCA 4P0QB 2JDID 1E6MA 3I0ZA 4TMXA 1V5IA 1WZUA 1H1LB 3L1KA 4A0HA 1PYOA 2E7ZA 1UBFA 2QVCA 4UNNA 1WMAA 1C3OB 3W5VA 1C9DB 1TNDA 4S0ZA 3UTDA 5ESWA 4BWVA 1ZA1A 1HK7A 2L17A 3DF7A 4FR2A 3GGOA 4LV8B 4EAAA 1C9MA 2XQFA 1F3LA 1LB1B 1P0IA 1BDHA 5F76A 3ZDQA 2IY8A 4JH0A 2JA1A 3QTTA 5J2TB 1XHEA 3D59A 2KE5A 2NU8A 3K6JA 3AFOA 1KAMA 4K6OA 3GLFA 3UBMA 1T1JA 2NUAA 2BT4A 2QP9X 5DHFA 2VP2A 3VZRA 2I6TA 4Y6LA 4EUEA 1KIMA 1USVA 2A0YA 1GVHA 2DT5A 2DULA 2FR8C 2QAIA 3FHOA 3R3XA 4JJFA 4LYHA 4RZ2A 4TWZA 2OOKA 4W6ZA 4FGSA 2J0QA 3JZMA 4OXRA 2XT9A 2WJYA 2A86A 3AMVA 3T4UA 3IR6A 2Z5LA 3D6JA 1MW9X 4BVLA 5K3OA 1R8SA 4BCCA 5CB0A 2WZQA 4HDRB 1ZNZA 1DP4A 3FNIA 4U63A 3V8RA 2BBTA 3A36A 7MHTA 2NT4A 2VT6A 1DKMA 4MQ5A 5EWLA 5AW3A 1U3CA 4FGUA 2BLNA 3HCAA 1MDFA 4IY1A 2YWBA 1L6IA 2WJ3A 3D4OA 3OOWA 1UBCA 1M34A 3DDOA 3DS8A 1EHYA 3H5IA 3KV1A 1OX5A 3GXOA 4OQ4A 3L2OB 5EZ5A 5GVRA 4B74A 4TV8F 1XCMA 5BN5B 2OCAA 2X3FA 1R3DA 2R6DA 3OCVA 3VSBA 2IF0A 4M9UA 4RABA 4FN5A 4GI7A 4HNQA 5FUMA 4BV8A 2D4AA 1G20B 1YQEA 1ZM3A 3SP1A 2W6IA 4R0MA 4DDUA 4IGAA 5A4JA 1IXSB 2RGYA 4QYIB 1T26A 2E87A 3ZK8A 2GZSA 2EFJA 4P58A 5DI9A 1Z2EA 4C7KA 2H2DA 2E5WA 1WXGA 2QU8A 3P4UA 4EI8A 1RM5A 1YRAA 2J6BA 2J4CA 3R9KA 3EOBI 3W4IA 4RDIA 1ZOSA 2G1PA 3DOIA 3GN2A 1TF2A 4BAGA 4FHEA 1CQIA 2WAAA 2VT7A 4QECA 1K8YB 4N03A 5AJYA 3CLHA 4FDVA 3ZGLA 3S8YA 1Z12A 2O2IA 1Y9DA 4AJHA 1I30A 1NMYA 2F3PA 2WIKA 2PKWA 5AKXA 4DEXA 1TMKA 4NNOA 2IH2A 2H7CA 1M1YB 1GZ5A 5DBIA 3QRWA 3AFIA 2EVWX 3Q9UA 1IZZA 1B14A 3H5VA 2AHOA 1KDRA 4RXTA 4US2R 1J8FA 5HKBA 4I5IA 4KAXA 3KETA 5EMHA 2HU8A 3TKLA 4J91A 3TQIA 3PTLA 2P69A 4JI7B 1Q7CA 2WM8A 3BWCA 4YCSA 1LX7A 1E3WB 1B0ZA 1ZGCA 4GXNA 4RK0A 2PH1A 2W0SA 2FVYA 2A1UA 1N8SA 4RKQA 1J2UA 1GQFA 4Q03A 4URHA 2XQIA 4AY6A 2YYZA 4E0BA 4JYAB 3RS0A 4JSRA 1BJKA 1EFAA 1PGOA 3KBOA 2OK7A 4GOXA 3ZLVA 4ZCTA 3B7GA 4CEHB 1S8AA 4R8LA 2A6PA 3PE4A 1TM7E 4HG2A 1DIGA 4NHOA 4EG8A 3NEPX 1ONPA 2H2WA 2HQOA 4INOA 3V3TA 2WZCA 3TLMA 5DHQA 4ZT6A 3OPYI 2Z9DA 4FTWA 3HU2A 4HLUC 4NV0A 4Q4HB 2XMZA 5ANRB 3SKXA 3LUGA 3UAWA 3FLEA 1E63A 1KJQA 2V7XA 3H1AA 1YHZA 5AMXA 5JNUA 4MUKA 2H85A 4RD3A 1XNJA 3FCAA 4FFOA 5AXBA 1O89A 2ZSDA 3C3CA 3RUPA 1ZUIA 4DKJA 4IW3B 1YONA 2SKEA 4QNMA 3ZU4A 2EZ8A 1Y7LA 4YMWA 5DP2A 3ZY5A 4ZOQI 2OQRA 4L4ZA 4QYXA 3G5LA 3BIOA 4MW1A 4S1VA 4HR7A 3TEJA 1G7SA 4LZNA 3WJAA 2QLJA 1OKKD 3DZBA 3KT6A 3ICEA 1SXJC 3TJZA 1YB4A 3E22A 2Y9PB 3I9LA 2R7KA 2YHBA 2E49A 2RGNA 4ETIA 2VH1A 4YJGA 4IDEA 3E3MA 1DCMA 3RQSA 4EF6A 1Y4ZA 2VBFA 2HO5A 3EH1A 3FOWA 2C95A 3GRZA 4GMFA 3Q7PA 4TMTA 4EELA 4BV3A 1XF1A 2YWEA 3T9DA 3ZHCA 5DP1A 3EDQA 3WB0A 4C5AA 4DG9A 5K0BA 1I7DA 3GWZA 3V7WA 1J2JA 4MB2A 2JCYA 3WZ2A 3IEKA 3SX4A 1AJEA 1CR4A 2VJMA 3FHJA 1WNTA 3EQ8A 5EPOA 1XXHA 2VWPA 2LKDA 3U7RA 5I7RA 2EHDA 5JFOA 1WUHS 4JI5B 4U7JA 1MBZA 4A6PA 5IABA 1VFPA 5IJ9A 1USKA 4WE3A 2DBQA 2PT7A 5A4DA 2ZRFA 3W5IA 4TLMB 4WH0A 5C34B 1Z73A 3P45A 1M66A 1J9EA 3AVUA 3OPXA 1O96B 2AR0A 3PC3A 4WOCA 3DC7A 1V3UA 2Y71A 1BDJA 1XVLA 1WX1A 1CJTC 2B1JA 2DQZA 3OE7D 1WPQA 4U9IS 1V3VA 5JOQA 2O1EA 3IALA 1GNRA 1P1RA 1QHSA 3M3PA 1Z26A 1MAWA 2COUA 2JGEA 2O1WA 2PS3A 1JDPA 2P3LA 3C8ZA 2XCRB 2WSIA 4N39A 2GLXA 1SH7A 2SBTA 3CNEA 3TSYA 5BSHA 5AT1A 3I9V1 5CB4F 5JAHA 4ZFNA 4LXGA 5CNJA 4IO1A 4LHXA 4L9SA 1SVNA 1V96A 3F97A 1XMIA 2BTQB 3IQXA 4R9RA 3VTKA 2PZKA 1Q1QA 3HRHA 3TYXA 3ZTYA 2OILA 4UEKA 4CETA 4L4YA 5DM0A 4ZI5A 1HE8B 1QONA 2AFHE 4J43A 5C1IA 4EHAA 1N1DA 2IGBA 4DRYA 4YQYA 5ALDA 3EVEA 1QRTA 2B0JA 1HTWA 1ZPDA 2Y99A 5SZJA 3WGGA 4DABA 4CM9D 5ALRA 3RABA 3QX3A 4E4YA 2XR1A 1SVSA 3O5AA 5ECGC 5KKAA 2CL0X 1F0PA 4QUIA 3T1VA 3OZUA 4RXMA 2NV2B 4LZOA 2HBYA 2QTCA 3WHPA 4N0PA 2R8PA 1FQOA 3FR8A 1XVAA 3O83A 3IBGA 1DBIA 2AR7A 2I54A 3KKKA 1ONOA 4YT2A 4J7XA 5HIAA 5SYAA 4TL6A 1YRHA 2QE6A 1J56A 1NMSA 1T35A 5EZYA 3U7JA 2Z8ZA 2HBZA 2JKZA 4XFJA 3EVAA 4YCMA 2IXTA 4B44A 4I4LA 3BRQA 1K7YA 4G9GA 1OBVA 2JIDA 3ZBUA 2GSDA 5ED4A 2FEOA 5FFNA 2NNLD 2ZCUA 5CFZA 5LQJA 3HCBA 4N9WA 3USCS 3GLFE 3H3XA 2I7CA 3WK8A 2GYWA 2DBYA 4R5MA 3F8TA 1RYNA 5KNLA 4YRJA 5F4ZA 1W25A 5DB4A 4EKNB 3UJPA 1E2NA 3HJGA 1PZMA 1W48A 5HFJA 2I87A 3SLGA 4M1ZA 4ESOA 4NOLA 1GDHA 1YCGA 1GKLA 3H7AA 3ECSA 3CPEA 4YREA 2BISA 1L5HB 5BW4A 3FTEA 1NSYA 5I7VA 2GM4A 1BVRA 2OAP1 2YZMA 2NU9A 3L01A 1IMOA 1OZGA 1IXZA 3AEQA 3BD7A 1I4TD 4NS4A 3VISA 3JWGA 4AO8A 4C4RA 4CV0A 3H97A 1N7GA 5IK2D 1Y1PA 1M34E 4TVBA 3R0QA 2G06A 3RS2A 3PXAA 1KMNA 1DCTA 1JEJA 1B1CA 3GA7A 5JVDF 3GRAA 1CY1A 1X0XA 4AP5A 2VK4A 1G8FA 4CMBA 1LBIA 4UDYX 2BGMA 1NU8A 1U2DA 2ZVDA 2NYAA 3CYFA 3OCUA 7GPBA 1B76A 2XCSB 1V35A 1VBFA 3EQ6A 5TQ2B 4QPNA 5FTNA 3GOHA 3OVMA 4KFSA 4R1QA 5I9IA 5FYDA 1Z45A 2J5KA 2P68A 5FWXA 3H9JA 3VO1A 3W8FA 4O4LB 2G5GX 3F5SA 4R69A 5L3QB 4MEBA 1WPRA 2UXBB 3QYFA 3P0IA 4L3WA 3OEHA 3TNDA 2NU6A 1IJKA 1QS0A 3CEAA 1L6RA 5IJWA 3JPYA 1SOUA 1FRZA 3ZVNA 2FP4A 4EVIA 2C94A 2FR1A 3O8QB 2ZSHA 4TS9A 1IY1A 1E5XA 3PT9A 5B6IA 3ONFA 5C1PA 5IDYA 5IKPA 2PD6A 3DR3A 3UBTA 4N8EA 2PBRA 5HJ2A 3GGPA 5IJAA 2H7YA 1JQEA 3E82A 4J1SA 4GI2A 2ZBVA 5CCBA 4GEGA 1XHFA 4WESB 5C52B 3E18A 5JC1A 2IY9A 3FN4A 1QRDA 5P21A 1NXWA 4EY7A 2FN7A 4P8RA 2OG2A 3ABZA 4D7AA 1UADA 2RARA 4G5YA 4V2IA 1BO6A 3W6ZA 4B6RA 4DLZA 3IT0A 4U4AA 3G0HA 3SYNA 3W6UA 2VJAA 2QMZA 3UPDA 4IZIA 2PR2A 3T7TA 3OTOB 2FX2A 1VXRA 2IEDA 2I4MA 1KARA 5HF5A 2CLCX 2XDQB 5BN4B 5TT1A 5MN5A 4TM7A 1CUCA 5K3FB 3QQ5A 1GUYA 1Y82A 4YO8A 4LUCA 1E8DA 5JZSA 3GLKA 3VPFA 4AUMA 2PX0A 2RBGA 3M8KA 4R7ZA 3ENZA 2E18A 3AP1A 1IN8A 4GXQA 5T3YA 3HJTA 1H0RA 5C81A 1QOPB 3BWMA 1VG8A 1U1FA 5CLJA 3WMFA 1QU2A 4C87A 1C1DB 1CUVA 4JC4A 2WEKA 1P7WA 1N9KA 4AN4A 2G04A 3WFIA 2HA5A 1GQRA 2NZYA 3IT1A 1E7RA 1ABBA 3FYSA 1KAGA 1FA9A 2NZVG 3AUUA 5AHXA 1APBA 2I33A 3KL2A 1G3QA 4ME6A 3S7ZA 1JIKA 1H0HA 1R9NA 4B3JA 2P3QA 4FFPA 1SQ6A 3U7QB 2AJLI 3MRSA 2V9CA 3MM4A 2H4FA 2VRBA 3E9QA 3MSCA 4PXYA 3O38A 2A92A 3KOWA 1H8HA 1XDZA 4PC2A 4MYUA 2KB0A 2IU0A 4YXFA 3HZOA 1U7ZA 3HVHA 2YWGA 1XXHE 2X3YA 4N7MA 4ALNA 4I7EA 3A1DA 5CHEA 3G9TA 1MH9A 1EP1B 1QH1A 2FGKA 3I9FA 3ILVA 1FRFS 3MCTA 4ZAWA 3RRNA 3CRVA 3ZGYA 4I81A 4TSFD 1K5HA 4CG2A 2E1RA 1RJFA 1DIHA 4W1SA 1W76A 3OU7A 1X77A 2FPGA 2GWHA 3DCYA 3GARA 3IJ5A 5BMVF 1MJHA 1Q14A 2JLRA 4IEFB 2A0WA 2NVOA 3QU7A 5GOTA 4F4IA 5JXJA 3IB6A 1V8PA 3KZKA 2PD3A 4M46A 4U3JB 4AMYA 1TM3E 3PR1A 2ZRPA 4XH9B 3CO0S 5DGIA 3BL8A 4KVGA 2XMQA 3NTXA 4HYTA 2YQ4A 1UDWA 4WPGA 4AWBA 2OE2A 2JAQA 2WG2A 5LZ5A 3R0IA 4DWOA 5AUOB 4JI8B 3KDAA 4Q19A 4D79A 1H8EA 1HO3A 1EI9A 3P0EA 3LM8A 3KLPX 4KFRA 3IHKA 5CDHA 1IZ8A 3DAHA 1ZC3A 4WK0B 3SOZA 1CDZA 1MX9A 4PO1A 4YPOA 3A2KA 1HFEL 4FQ8A 1W1IA 2R8BA 4A0FA 3MS4A 4FS3A 3NHRA 4IRXA 4P86A 4W8OA 1R4MB 2IXFA 5DMHA 2RHBA 1V45E 5ESXA 5AUPB 2VTBA 1D1SA 5IAJA 1ZH2A 3IP6A 3NRBA 4TYMA 4YIKA 1GZ7A 2IHUA 1C4OA 1EINA 1UQUA 3UANA 3WIBA 1PJSA 4TL7A 1FUYB 2E4XA 1UWLA 5FNVF 2VZLA 3V4SA 3WIEA 2J9YB 1UAAA 1EAYA 2FWAA 3P9YA 3JWIA 3VNAA 1ZMRA 3MGCA 4E5NA 1LSOA 2D7CA 4WFQA 1XDSA 1N5LA 4L51A 1EUCB 1HDEA 2DTDA 4FHZA 1ZM2A 4B6JA 4U0KA 5T5QA 4FB5A 2PE5A 4QBGB 3PXCX 5GMOA 4C5BA 3ZWPA 1LLFA 1RS0A 1GKKA 2EJWA 3DBRA 1MB0A 3NDJA 1Q3TA 3U4QB 1F2UA 3LOUA 4JHLA 4QXAA 5JXIA 1MXHA 4GLLA 4WBNB 3PBKA 1UJ4A 4EABA 1OVGA 5BURA 4O2AB 1X7HA 3RSOA 4LRUA 1FFYA 3ZCSA 4F3YA 5HNKA 3LUCA 2KBEA 2PK3A 4TTJA 4CZ2A 1SUPA 4KSCA 3HUUA 3W2TA 4ZIRA 2QM3A 5K1ZA 5L51A 1OTXA 3MJDA 3IILA 3ZXXA 1XKLA 3QPWA 5EMJA 4FMPA 2B4KA 1XK6A 2O4UX 3PVZA 1Z5VA 2YYSA 2AUTA 3E2MA 3NTLA 2Q6VA 3ICPA 1LU9A 4CF4A 3ORRA 3OM1A 4JKYA 4OB7A 2GYYA 3IOCA 1KY2A 3ME5A 4TV8A 3PF9A 4FBMA 2ZRBA 3ESXA 1V11A 2QLLA 4DC1A 2PQMA 1MUUA 2C8VA 3N05A 3KJNA 4QARA 5I9BA 4WZAA 5K9ZA 2Y68A 3NHBA 3C48A 1F2TB 3SVTA 3DMTC 3HBAA 3HZRA 3PVCA 4F1JA 3EXFA 5JQWA 3FTFA 3EGDA 3C6QA 4X20A 1E32A 3GPCA 1FFEA 4UCFA 5BXYA 1X8LA 1HL3A 1EVYA 3NC4A 4TTVA 2QP3A 3DYBA 3GUYA 5SV2A 4O2BB 4WCFC 5DYWA 2Q5FA 3TXXA 1ECFA 2P1DA 3FJYA 4EVRA 3OI7A 4FKBA 2PH5A 4MRMA 1WSBA 1J0XO 3BRWA 2W6JA 5GOZA 1YRBA 1VG9B 4M1SA 2PNJA 5BWCA 2ACEA 1KDOA 1J07A 1M67A 1VOTA 3PXEA 2C4KA 3Q87B 5LB2A 2OZVA 2F48A 1CUWA 3DEJA 3VVBA 5B3JC 3EDYA 1CVIA 3NXKA 2V8BA 4MW7A 2ZPTX 3DM5A 4HO1X 3LY9A 3J81A 1I0IA 2PO7A 3H19A 4K7JA 4LJ5A 1OQAA 1E69A 3ZU2A 3DGEC 2OCIA 3N0WA 1O94C 2WMOB 5EHZA 1BWSA 3FF4A 3TQHA 5JNWA 1Y5NA 3EZGA 1Z0UA 2QZPA 1ZLYA 2F8MA 2MTBA 2WJGA 4EY4A 3B3QA 3ZHTA 1U8AA 5LP1A 5IVPA 3ND7A 2Q3HA 4N6OA 4PRYA 4D9JA 2R9VA 3DB1A 2AV6A 2BFOA 2I4NA 3PXDA 3BD6A 2VXCA 3UMGA 5E3JA 2ZWOA 4UW9A 3ZY4A 1OIWA 1TIPA 1L5MA 2P0EA 1W4CA 4AMGA 3SC6A 1XCOA 4LFCB 2OHIA 3IKLA 3WRVA 2J3EA 1R8QA 5FTWA 3LDUA 4LNAA 1EK6A 1P3JA 1QV9A 1I2DA 2RK4A 1KJWA 1SU8A 5TEVA 3AP3A 3EE6A 4RVOA 3K9GA 4O2LA 2NTJA 4QVGA 4Y67A 1USIA 3QNWA 3GJ3A 4PG5A 5AVWA 1FFXA 1KHHA 2GBFA 4QGBA 5F12A 4UHBA 1NM5C 3AIKA 4RIIA 1WUIS 3L0ZA 2D62A 2V7QD 4CMCA 3S2FA 1Z88A 4DQ0A 3RROA 3VOBA 5KO2A 1A4IA 1FUUA 2ZS8A 4MSUA 1PR2A 4NEHB 4YYEA 2FSGA 3RPEA 4M83A 3NKVA 2Q7DA 4ETNA 1QB7A 1Q5PA 2QDKA 2ZSBA 2ZJOA 3RJMA 5KOJB 2JEYA 2DFKB 4KEAA 1RHQA 2XADA 4M99A 1B7GO 2HIGA 1Q7BA 3AOEA 5T3UA 3VZPA 4ECAA 3A6PC 3I6BA 1Q44A 1W4BA 4HXGA 1M8KA 1JDZA 2YYYA 4KXFB 4TTRA 3LQYA 2L42A 2YFHA 5TQJA 2VA8A 1JPNA 4PWZA 3COZA 4Q9JA 1E96A 1IEWA 5COQA 2BMDA 3EQ7A 3U44B 3UMMA 1FNNA 3HPRA 1V6SA 1NDQA 3KSDO 3QU9A 3VVCA 1MO2A 2QZJA 2VJQA 3HR4A 1N77A 4W7IA 2M6LA 4JWTA 5AI4A 5B1YA 2J7KA 4YUYA 1PS8A 3OCYA 2FMUA 3C3AA 2NO6A 3AERA 3L0SA 1SPXA 3K72B 1SK8A 3WRYA 4A6DA 3ZWBA 4L4RA 4QQNA 2XHEA 1ZIPA 4I8DA 2ID9A 2AC2A 4DANA 5CLHA 1I7PA 2FQ1A 3K1YA 4QREA 4WKBA 3BD9A 5A3RA 5LOVF 1WE2A 1J0EA 3MJFA 4KDFA 1TM4E 1ZD2P 4DAEA 1O5OA 1HFJA 1JYFA 3RVLA 4JU8A 3KNZA 4IXDA 2DHEA 2GT1A 1MF7A 2DBZA 2IZ1A 4JCOA 3WTCA 1ZLXA 4AJ2A 2Z8YM 3UHOA 1CIJA 3RAPR 4F0JA 1U11A 1PN3A 4KFCA 2H07A 2W0MA 1NI3A 2GPWA 3JW8A 1Z0IA 3IIJA 5B53A 1X3SA 1XA3A 2OORC 1U7UA 5TEWA 1NQXA 1GY8A 1IDOA 5DTMA 3SF8B 3LHIA 1G5FA 3N3BC 4RJJA 4X6YA 4IPTA 3M49A 4RZQA 3THYB 1N5MA 4AVYA 3GCXA 4N01A 4FMDF 1IB0A 2R79A 3GGDA 1ZJYA 3DJYA 4RVGA 3MCVA 4HD8A 5F1OA 2JLCA 3F71A 1Q21A 2AYZA 3HG7A 3Q0IA 1PKXA 1ULTA 1WCYA 1FQJA 3CZAA 1MEEA 3DE0X 3EARA 4XGRA 1GTRA 5D5HA 2GARA 3SQDA 3BSFA 4NDNE 4U00A 1LA2A 2C8LA 1QG6A 2WV9A 3QUCA 2IS1A 1WHSA 3W4JA 2ORED 1AZLA 1HKHA 2AW3A 2Q2OA 4KN6A 3MUNA 3QBJA 1PJ4A 5DI3A 4JITA 3CWCA 2F17A 3I2HA 1E2EA 4X6XA 4PLCA 3ZDBA 3DG9A 1E0AA 3IIMA 3O8OA 4Y2QA 1U2DC 1RCFA 1P2SA 4GM1A 1A72A 4KNVA 5K5EA 4I6EA 4UBLA 3V3KA 1NG9A 3DZJA 1P1KA 1R0XA 2ZJBA 3FROA 1TJYA 1R0ZA 1E5TA 1T91A 3KIPA 5K3BA 2ECOA 4JY7A 2PUJA 5K4AA 3ZXUB 4GHWA 4IJVA 5IYZB 3RBXA 3OMXA 3SOPA 1IY0A 4RO0A 4WNYA 3BREA 1VJTA 1ZO8A 2H5IA 1BG6A 3R2JA 4DQKA 2BBSA 5KPDA 2ZRJA 3OTHA 4G0ZA 2ADOA 2BONA 5CYPA 4QL3A 4FEYA 4X93A 1PV1A 4K6KA 5CDGA 2QWXA 1AKEA 1QYWA 1JAHA 2NUBA 4QLBA 2B82A 5LDHA 3LUFA 3WWPA 1YQTA 4C9BA 1SVMA 1T43A 1FTQA 1GPBA 2A8YA 2DUJA 2R8EA 3GELA 2FJ0A 4TS3A 3EGXA 1JHRA 2DWQA 4H31A 2X58A 2W9XA 4L95C 2FPIA 3BWVA 4BKPA 5JVDA 5EWLB 1JTEA 1WA5A 5ITZB 1OXTA 3H4MA 3LBIA 5KHLB 4DN6A 4WZAE 3Q8KA 4D0NA 2N47A 3UT5B 4HWSA 3HA5A 2YHUA 2H4XA 1OLSB 1R6AA 3CS3A 1TJNA 4GPIB 5BSUA 1T4MA 2JFYA 4ZVSA 3OT1A 4PLYA 2EGGA 4HRYA 1X86B 1T0HB 3W3ZB 3B1WA 3UATA 2NU8B 4NCJA 2RHTA 5EKUA 4QPZA 1W9HA 3UJ9A 2VRWA 2NUAB 5T8KA 2NZ2A 2YRFA 3NT5A 1EKXA 1W5SA 3FG9A 4P31A 3VV3A 2Y0DA 2C5HA 2Z4RA 1QX4A 3AK4A 2ZB4A 1QFZA 2PUTA 3DNMA 5IASA 4KVFA 3PQ4A 2RAUA 3ZH2A 2ZYUX 5HG0A 3T0GA 5DWVA 4AY5A 2G4VA 4NFHA 2GYVA 2JH3A 1N7JA 3GFTA 2BRUA 2CNOA 5IAAA 1SA0A 2ZRKA 5CFQA 3I01A 5D51S 3W9BA 5AHWA 3M2PA 3WKEA 3HJBA 4GYWA 4RHTA 3AESA 5A3JA 3G9ZA 4CKCA 4CIYA 3SIXA 2AF4C 2FZLA 4CMHA 2DHCA 5B55A 1QCDA 2FSFA 5EP3A 1X87A 2JCGA 3F96A 4LGCA 1XRLA 2AMLA 4W4TA 5ISMA 3B3FA 2O8EB 1RHJA 1BMFD 2BGIA 3UQZA 2RSLA 4B5KA 5KQMA 2O8NA 1JYSA 3NMUF 2G5TA 2HN9A 3KXLA 4YAFA 1SZPA 1XTTA 221PA 3U0VA 3WGHA 5HJ7A 3N2KA 1L7PA 5KTTA 1IATA 4FCWA 4DWJA 3F90A 4WWHA 3H1BA 4MCAA 4ESEA 3GCWA 4P53A 4Q16A 1E1RA 4WUVA 5CR9A 4P83A 2ODBA 1ATIA 2OD2A 1DCKA 5J1TB 2MCFA 3ESCA 3DHWC 4QFCA 1JDSA 4ZP1A 1NF2A 4FFSA 3OX2A 4P98A 1TT5A 2JZNA 1CQIB 3IJEB 3E7FA 2XAUA 1P0QA 4OQYA 2JIZA 2PO5A 5EE0A 4MVJI 5IJXA 2PKXA 5B4VA 3GLIA 2R1ZA 2I3GA 2V65A 2OV4A 2YIMA 3WA6A 4IL5A 4YDRA 1AURA 1UMCB 2H52A 4N3BA 1XCBA 1JA1A 3H2YA 2R7MA 2DYKA 3MMNA 3DT8A 1NVUQ 3IVMA 2O52A 2B21A 1R4NA 1ORIA 2C4MA 1Y6ZA 2YHAA 1DJNA 2Q3EA 3L1HA 4TYPA 1QP8A 5DE3A 5EZ6B 2EQ5A 1PVDA 2FW9A 1N57A 1X70A 4HNSA 2AN4A 3DPSA 1T10A 2CLSA 2WIDA 4M0MA 3U4DA 3ASVA 4Z1MA 1BW9B 2EKBA 2YX1A 4MYCA 4Q3BA 2H1OA 2WJPA 5JCPA 5KJ6A 4UUQA 1S8NA 1SKMA 3QLTA 9LDTA 2B69A 2OVFA 2DT8A 3CKMA 4CT4B 1NN1A 5K03A 1RJ9A 1JT2A 2XWSA 3UK2A 1G3IA 5TMPA 2DKFA 3OF5A 1S8OA 4J0CA 4Q3CA 3P26A 1QYVA 3C43A 3QKSA 3LVRE 4HQLA 5A3VA 1JHYA 1KEVA 4RZUA 2H1LA 1M1ZA 4EFLA 4R1LA 3EMDA 5BMVA 2YZ2A 2FXIA 3L1VA 5DGCA 3P2EA 3DEYX 1GLGA 4WOJA 3WKCA 1WWKA 2XT0A 4TYYA 1GLNA 4P81A 4AWAA 4MV8A 3H99A 2EWMA 2ZXEA 1M1NB 2PTHA 3ACDA 1TKAA 4JVMA 2PSHA 1P77A 4QNRA 5EUMA 3K8QA 3H2IA 3IDSA 3ZE0B 2RDMA 3OCJA 1A50B 1QF9A 4R98A 2YZKA 4BQRA 4JBXA 4KQXA 1DKOA 2PBLA 2CJWA 4TVOA 5ENZA 3EDCA 2WYIA 3U7HB 1IVNA 1NTOA 1O5IA 2ZAYA 2Y1XA 3DE4X 3GJRA 1JS1X 1ZN7A 2Z57A 3AF0A 3E22B 4RGQA 1WDKA 4X54A 2VHQA 4R1NA 2AEJA 4E4RA 3RJTA 4EVSA 1A76A 4XB6B 1IQ0A 1GZ3A 1XLTA 5EQTA 4MP3A 4CR6A 3GK3A 1B4DA 2A0KA 1AK9A 5JAOA 5J2UB 1WXIA 3AM3A 2BM1A 3I2FA 5HPYB 3A25A 5KNBA 2X42A 1QZZA 4GKAA 5JAMA 3W2IA 1XN4A 1H85A 5FNVA 3SJCA 4B3IA 2H1SA 2PKYX 1RCUA 2VJMB 3BIJA 3EASA 5DO9A 3RASA 4L08A 4DV0B 2XZLA 2QTZA 5IT9A 5B1IA 3PNKA 4CM8A 4FYXA 1XP5A 3STYA 2RHGB 1RYDA 3C7CB 1BD4A 4E03A 4EPWA 4EJ6A 4JXKA 4JSYA 3PRYA 2JFXA 5FL7D 3RSHA 2H1FA 2PWBA 2ZYWX 2GDJA 2OZLA 1SN7A 2VYVA 2B3TA 2ID7A 3AZPA 4E11A 3F78A 3I28A 2NX2A 4O8CA 1NW4A 1B6TA 3M3HA 2AEEA 4G23A 3I4CA 5DTJA 5TJ9A 4W1QA 1X2BA 3A06A 3QLVA 1EVKA 4BGDA 3FCCA 3JATA 1DOHA 2SICE 4O4JB 4CDGA 3ZCQA 4YR9A 3D9QX 4TMKA 3LBAA 2Z6UA 1C8BA 1TE2A 5G4KA 2QRPA 3WHKA 4WN9B 1I3CA 2L18A 4LSWA 5IC6A 5FL3A 3C1AA 3EVZA 5GV7A 4L4UA 4G5QA 2F43B 4YR7A 4PGAA 3MF4A 5IM4F 3VPSA 3NTOA 1N4AA 2HKIA 1A4RA 1JH8A 1CUZA 3ZZMA 4MGIR 4CEIA 1X1DA 4E5PA 2EBHX 4Y2YA 3IMCA 4PSDA 2Z2KA 4IGIA 4QLAA 4F5ZA 1YS1X 2FUNB 3UJAA 3ZWNA 4D9IA 4NBSA 2DERA 1CS0A 1Q19A 5CVDA 5DHAA 2QYSA 3RVSA 2WF9A 4ZA2A 4RHEA 2DFLA 5CXQA 2WU0A 3BN3A 1HT2E 2YJ4A 1SBYA 3OJFA 4ZV4A 1U3GA 5LZ8A 5BVGA 3L0OA 1RRFA 2TRSB 5K8TA 1XBTA 2Y2UA 1YZ3A 2Q28A 5TDHA 5ES4B 4F06A 2ZRQA 4IDNA 4XAQA 2WUDA 3U3RA 1L7XA 4YP7A 2GFQA 1ZFNA 5IBPA 3SM3A 3WR5A 3EHEA 4KKXB 2ZSIA 4MUNA 5JDIA 4TUYB 4RMIA 5FBRB 1X80A 5FLEX 1ZSNA 1DZIA 5D7NA 3KALA 4XD2A 1EJBA 4R2MA 3CNOA 4RV9A 2I6UA 4Y2VA 5I9SA 4ZVVA 3UG6A 2HPAA 1WXHA 4YCBA 5FBVB 1V3TA 4JI3B 3HR8A 5HRCA 3ZXSA 3DYIA 1F4VA 3VNSA 1V6AA 2ZB8A 3IVGA 3MWYW 2WUEA 1TUBA 2D1YA 2NUPB 2QPOA 1BEUB 3FIUA 4HSGA 5DHTA 4F21A 3TPFA 3M34A 1DX6A 1DC6A 3ZK7A 3CW8X 2HA3A 3RW9A 1FJ2A 1GZ6A 2XXJA 3CZ4A 3E61A 2PD4A 2ECPA 3VFDA 2HRQA 5FEMA 3M6LA 3AOEC 1BCRA 4KLZA 5LDGA 3N0XA 4FOSA 1L5GB 3RUCA 3WLIA 1YFJA 3A2NA 3RSCA 3FZEA 2ZCJA 2NU9B 5DRYA 2A9JA 4EZIA 3D7KA 1G4HA 5A3SA 3RK0A 1Z4NA 4G81A 2FQQA 1JHMA 1ZMOA 2CMFA 2PV0A 3FGZA 2WOOA 3PK0A 4RJLA 3ZU6A 1C3EA 1UFOA 3U5TA 1XD9A 4JB3A 4AAYA 5ADUS 1TO2E 5KNBH 4G63A 5JSKA 4XRGA 4P93A 2VF5X 3W78A 3LK6A 2YXLA 1VA5A 4AO7A 2ZJ0A 1QHHA 3QOWA 1H5NA 1NURA 4LY6A 3ZU5A 2G7ZA 2CDCA 3PHGA 4FDLA 1PZFA 3NKLA 2CNKA 2OB2A 3DKVA 3SZGA 3MELA 1W36D 2QL9A 4LFBB 1P1HA 3BBLA 1IE3A 3NM4A 1GV1A 3FFTA 5JASA 1K7SN 3FI9A 1REQA 3ZVRA 2GCOB 2Y0CA 3C6KA 1CUYA 3N53A 5HJEA 4FFBB 1OASA 1ONNA 1Q0TA 4X1YA 4B3BA 1G7RA 1T5BA 4DCVA 4TKZA 1TVCA 4HEA6 4KR7A 3GLIE 1N2HA 3FSRA 2BGNA 2WD7A 3PGKA 4UVHA 3WGNA 3FPAA 2VHCA 3NM5A 4QUEA 4Y9RA 1USWA 5COAA 3VR0A 1EBUA 2PMBA 1TLLA 1XKQA 2ZE7A 3FUXA 1FFAA 4KOEC 1OLUA 4ZCRA 3TKYA 4BV2A 3IP8A 2RG1A 2E4YA 3NT2A 5DHSA 1MC4A 3KB1A 3TW8A 2AWNA 4LJ4A 3WS7A 3FD8A 4EKEA 1QAMA 1MN6A 1JPVA 3TTWA 2BEKA 1FMLA 2EJUA 3LHDA 1LNSA 2Q50A 3WYGA 4WDQA 1G9XA 1U2TA 3U0BA 1HURA 2QN3A 3NOXA 4DJAA 2PLAA 1U8YA 4NY1A 1O57A 1R5OA 3BDAA 3S1AB 1U7DA 1WR8A 5LOVA 5I4CA 4WA8A 2WIJA 3NIGB 5I8ZA 1XOIA 8ABPA 3C39A 3OQIB 1ESDA 1JTVA 2IDZA 4FN4A 5TF4A 1TVKA 1U8CB 3IUMA 5GWXA 2NGRA 4PS0A 2I29A 1DFGA 3RE1A 1LVUA 1A9OA 4YB8A 2V1UA 5BSKA 4Z54A 1YB5A 1AH2A 2ERYA 1FMTA 2QTGA 4ESVA 3I45A 3O93A 3VU9B 1YZNA 2V58A 5H1YA 1Z68A 1T13A 5IHPA 2Y3IA 3NLLA 4ZAZA 1CE8B 3RIHA 2Q2QA 4HWGA 5L45A 4EA6A 2QW0X 3BM5A 4C6TB 3OJWA 1Z3IX 5HHTA 1GRQA 1LPSA 4FPXA 2ZWAA 1AMUA 5JV5A 1RZRA 1CJSA 1O87A 2AXQA 2CD7A 4KDRA 2FW7A 2YXBA 5ENVA 1Q74A 5DASA 1ZNYA 2ZSJA 4IHKA 3RVJA 3ML1A 4OQXA 5EI5A 1NMXA 1Z82A 3PVSA 1P62B 3DTNA 2CW5A 2VN8A 3DOJA 4UM7A 3BE8A 3HVKA 4K9QA 2PCJA 2XXAA 4MLDA 5DBOA 3BGIA 3NAMA 4WOKA 2BAGA 2HO4A 2Q21A 2TMGA 2PZFA 4DLWA 1G2IA 3ISVA 2AHRA 4P08A 2G09A 3I53A 3JVDA 2NWQA 3C1TA 4L6IA 4PQYA 3L93A 1VGRA 3L7JA 1IAQA 1RMYA 4PGFA 3MLAA 3L7MA 1CJUC 2E2WA 2PX6A 3TINA 3GZ4A 4MKHA 5KKNB 3WWCA 1NT2A 1QU3A 2OPBA 5GJVC 5CCDA 4WAUA 4KPYA 2CNWD 4KO4S 2CSXA 2OFFA 3WAKA 4BO1A 5C1OA 3LLCA 2CC2A 1MV8A 1C4WA 4AN0A 1RE0A 1ZH0A 4UUNA 5J47A 2NQTA 4GBJA 2DGDA 4XVCA 3FWYA 3DULA 1JBEA 3IPCA 3PUYA 4KQWA 1Z8NA 3FUVA 4RBNA 4ENWA 3LDGA 4ZI2A 2XD9A 2EG9A 1AX9A 2YMLA 1BIFA 2ZUWA 4M6WB 3AP2A 3T8YA 3EMVA 2BRUC 2AW5A 3UEOA 3GYBA 3R3SA 5BQPA 2V6MA 4MDFA 4DXHA 3QVGB 5F3DA 2EZTA 4QM6A 1BFKA 2VF2A 1B0AA 4H59A 2UZ0A 4I8IA 4AZVA 1JKJB 5CIWA 3B6MA 4D3SA 4QDXA 1ICEA 3H6HA 1Z6QA 1UK7A 1WL8A 3H7IA 3M4XA 4W9NC 1VJDA 1Y80A 1FFDA 1QH8A 2F9LA 3OPMA 3PX3A 5T4EA 3WB1A 1G5IA 3WIDA 3N7UA 4NMLA 3V4FA 5L3SB 3C8HA 2XTZA 3D7MA 3JVVA 3KAPA 4XUGB 3ZCVA 2O3UA 1Z5OA 2WTMA 2PUHA 4B4WA 4PSVA 1D8TA 3JQFC 4U6QA 1Z6GA 2QQ5A 4MZXA 5HIKA 4U5QA 4CMGA 3H1FA 3B38A 3DXYA 1QHYA 3TW0A 3SZUA 4QYWA 1G5HA 2WSSD 3DBRB 1KY4A 3MPOA 4L4SA 4RCZA 4XUEA 1AQYA 2HMUA 2NPIA 3R3VA 1V8DA 2FFJA 3ZN2A 1Z6AA 1DAIA 1W4RA 2A9KA 2HF9A 1LJLA 1PL8A 3NUZA 1IXYA 3QA9A 1Z8HA 2FB9A 1AGXA 3AOGA 4Y1RB 5JANA 1NW3A 2B1GA 3S2IA 3K9WA 4MMZB 3VO2A 4DLPA 4EA7A 2IPOA 1N5DA 2WKWA 4GLFA 4XPIB 4ARBA 4TZKA 4EEZA 1P29A 1FFWA 2NAFA 1CUBA 4JUAA 4X90A 4YX9A 1OB5A 3G0IA 1EP3B 3CINA 4QOIA 2VDPB 2HSDA 1GLVA 4I4TA 3B12A 3MILA 4DIEA 3D3NA 1NX6A 3MXOA 3LC0A 1COZA 4HN4B 3U3XA 5CPFA 3BJEA 2C5FA 3EZ7A 4RMJA 3RVQA 5A0TA 1NFFA 5DHUA 5FADA 1U2PA 3GBVA 2GPTA 4AMBA 2CLOB 1X92A 3LCMA 4H3KB 3CZPA 3HDYA 3PLNA 3HKCA 1E9AA 1ZSVA 2KW5A 3GX1A 1M6EX 3KPYA 3D2BA 2EWWA 3RK4A 3LY5A 4LCJA 4D80A 4Z4CA 3V32A 4IMIB 7REQB 1KEKA 4MUMA 2XD4A 5F4BA 2HHLA 2NSYA 3N07A 5KOYA 3LUBA 4IIBA 3SYKA 3LIIA 4WHMA 1DKRA 4C0KA 1LBEA 1RXUA 1DWQA 7AT1A 5CFPA 1N9GA 3SJZA 5DNCA 1FMJA 4RESA 4GH5A 1GA4A 4JBNA 4NH4A 1BGXT 1M2VA 3HV0A 3I04A 3W77A 4PX2A 3H5RA 3UJDA 4OXYA 1L1FA 4D45A 1KQPA 3GUVA 3H0EA 3ECCA 1WW3A 3PD0A 3KKNA 3MMPA 1GPJA 1JLMA 1ZUNB 4FFRA 1WOMA 4Q37A 4QQRA 5GZ6A 3ZWVA 4C4OA 2CYAA 3HE3A 3H87A 3J7TA 1TMYA 1LBQA 3ZWKA 1VGVA 1V16A 2BD0A 2IS4A 2GRUA 2V7VA 2JCBA 2W6ZA 3SEFA 5BQ5A 5L4SA 4LISA 3HFSA 3NNDA 3QOFA 4RKWA 5A04A 2F00A 3G1WA 3TIIA 4HAUA 3DQZA 4XUCA 3ZJ5A 1JQAA 4XYMA 3VDRA 4DMLA 4GDFA 4S1WA 1K89A 4ABYA 4WL0A 5KDDA 1GZHB 2NO0A 3UGTA 1T2AA 3HBNA 1EVEA 2E48A 2PS1A 1NUQA 1LFAA 2ID8A 2ZRMA 4YO7A 5FA8A 3E03A 1PJCA 4CKBB 1IHYA 1W2GA 2IYQA 1SJ9A 2EP7A 4IF4A 4OMUA 5K2MA 2V0CA 2ZJZA 5KYVA 1K8ZB 1DFHA 3HN6A 2GPBA 3NBXX 2QKYA 1E9VA 4K9LA 1S3IA 3TPZA 4YRMA 1BXGA 1YFKA 3HJHA 4I14A 4UTOA 2L82A 1A4XA 4R0NA 4Z4HA 4W5NA 5JNSA 1QP0A 4RD4A 3LXRA 4KBFA 1JQBA 3W4KA 1WZIA 2CSUA 4M60A 3ZE1B 1TXGA 2ZRDA 1BCSB 1JN0A 1LWOA 3MJRA 1IUNA 4OPMA 5GONB 5L3RA 4A1FA 2XXAB 3B52X 4F6RA 2DSTA 3I32A 3BWXA 3UB4A 1JE1A 4H1VA 5KQSA 2VJLA 3LYLA 1YIAA 2HPHA 1HDYA 2QX4A 1E5LA 1K4YA 1GZVA 4GX5A 1ZCZA 1AIPA 1X7XA 3DEAA 4QAQA 3ACCA 5DMXA 5IW8A 3KQLA 2NADA 2PGNA 4XTRA 2RGRA 1ZONA 2EX1A 3G59A 4FYPA 3DZCA 4ZDWA 3SNKA 1EUDA 1M6HA 4FR0A 3LHKA 4E5KA 3ORSA 1KQFA 2NUTA 3GAAA 2ZBPA 5FQOA 3T35A 2TMDA 2WD8A 4MYRA 4Q18A 4ZAXA 2XUIA 2XKJE 3FZQA 4K2HA 1P4RA 4HEQA 2IEZA 4KODA 5JMTA 4CBVA 1SIBE 2C7RA 4XASA 2FOIA 2BDTA 1VMIA 1KU0A 3A05A 5AVYA 1XDUA 3GV0A 1QDEA 2FCAA 1MHTA 3OCZA 3I1IA 2O0HA 1XHLA 3NEYA 1IUKA 3DTTA 3LRTA 2XOKD 1DAEA 2AVDA 2JAHA 2VSQA 3PUWA 4MA0A 2CLEB 3D02A 3PU6A 4YHBA 3RVMA 4JV5B 1X6VA 3X43A 2P6NA 3TNLA 2PG3A 1RHKA 1ITZA 4XD7A 2GK7A 4JFRA 3MK31 4WCVA 5E3IA 2ZGVA 1TD9A 4XYLA 2J08A 1MIOB 4DTCA 3CLRC 1T4CB 1K6XA 1UAYA 2P35A 3Q98A 3D3WA 3GZTB 3NYIA 1FCJA 2XWPA 3LT1A 4DSNA 1XA0A 1R88A 1RTTA 1Z36A 1C9YA 3QEJA 4BJ3A 2BGTA 1P1CA 3F98A 2BR4A 4MV9A 4YV7A 5FUWA 3L1IA 2W4MA 3SZOA 1WXEA 2OO7A 4PLWA 1Q7RA 3MTEA 4TKLA 1JQLB 1W5TA 1WEHA 1UK8A 3L0BA 4P2GA 4TTIA 4L5JA 1ZRSA 1GPDG 2JHAA 3DKKA 4POOA 2F1IA 4OCZA 4CQMD 5CB4B 4J0EA 4DM7A 5JFGA 1ZWLA 4HL6A 3FKSA 1AN0A 3GZNA 5IM4A 3OZXA 3LDFA 2FG7C 4D8VA 2MSCB 4G4GA 2G1AA 1ZWKA 4QUDA 4HYQA 3FB4A 3SS8A 3T06B 4FMBB 3THRA 1YQQA 4N4AA 4Q9IA 4ZU1X 1SCUB 1BH2A 1Y5LA 4LOIA 4YP0A 1KBZA 4HT3B 2QY9A 3TBHA 2FQWA 2PMDA 5H7XA 3FMOB 1ZH8A 1ML3A 4F86A 5LQKA 3A9SA 4YT8A 3IEIA 3M6XA 4OJMX 1U81A 4ADSG 2J07A 3C8UA 3NNSA 4JJAA 4E22A 3W8NA 2O8BA 5EG5A 3I64A 4QC2A 5JISA 3LC1O 2PSSA 4UQOA 1PI3A 3HYCA 2BGWA 5B4UA 4Q3EA 5EXTA 1RC0A 3OFKA 1RLOA 4P4SB 4QEZA 4E1VA 2BF7A 3PHLA 1Y3IA 1QCYA 3F47A 1ZICA 4A8JA 4UHDA 4XX0A 3NGMA 4G8DA 2ZAGA 5JCZA 4JP3A 1XTRA 1GITA 3A9VA 1ADYA 3SF0A 5HBRA 4QPCA 2X14A 4NECA 1Z0ZA 3TI9A 3SLRA 2PGDA 1ST3A 4KBYA 5A1TA 3GDGA 4V0MA 4YI5A 4EB0A 4K9OA 2VP9A 3H2JA 3MRVA 1UQRA 3CBQA 1BD3A 3GMTA 1J4AA 1JIJA 2OOSA 2GDZA 3SHVA 2HFKA 2JDIA 2VOEA 1BGVA 2M98A 4BZPA 4CLOA 4Y2RA 5U4XA 3TRIA 4BFUA 2R8OA 1H4TA 1YFLA 1DARA 3S8EA 1H94A 2QF7A 4K81B 4MR8A 3TQCA 5JJCA 2H2AA 2HA2A 4J0DA 2CN1A 2NP7A 3PC4A 4EMBA 3SS7X 4B46A 1WW2A 2PV7A 3H0CA 3SXJA 2GFIA 1USUA 3CE9A 3DZIA 3TOZA 4IOLA</