1RC0A

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rc0A00
5J9FA 4ZYWA 3P9XA 5CJJA 4EW2A 3AUFA 4NV1A 4S1NA 4ZYZA 4ZZ3A 3W7BA 1RC1A 3O1LA 1S3IA 3R8XA 1ZGHA 4Q12A 5J63A 4ZYTA 1JKXA 1RBYA 1CDEA 3DCJA 1MEJA 1ZLYA 4QPCA 1YRWA 4YFYA 1MEOA 3TQRA 2FMTA 3TQQA 4PZUA 2BW0A 1RC0A 3N0VA 4EW3A 1NJSA 3LOUA 2YWRA 4DS3A 1C3EA 4ZYYA 3NRBA 1RBQA 4R8VA 1MENA 3KCQA 4TTSA 4IQFA 3DA8A 4TT8A 4YFVA 2BLNA 3Q0IA 4ZZ0A 1RBMA 4ZYVA 2GARA 3AV3A 3GARA 4QPDA 1ZLXA 4EW1A 1C2TA 4ZYUA 4ZZ2A 4ZYXA 1RBZA 1FMTA 3OBIA 1GRCA 1GARA 4ZZ1A 4TS4A 1CDDA 2CFIA
chains in the Genus database with same CATH superfamily
5E6UA 1Q7TA 3H2ZA 1K7CA 3HLYA 3OE7A 4O08A 4RVCA 5AJTA 4TLCA 3TBKA 2FNAA 5HNKA 3ANYB 4D56A 2XZLA 2B83A 3ZXSA 3GGOA 2R5NA 2WBLC 4PZCA 1KY4A 3HCPA 3VVLA 2FU5C 4GWLA 1MG5A 3BIXA 2B2CA 3FBWA 1C9MA 1OXKB 4E5NA 3F67A 2AG1A 4MMYB 3S8EA 3FBGA 3ZJTA 3JPYA 1Z0JA 3SF8A 1XF9A 2FRDA 1KXJA 4J03A 3RC8A 5AD1A 4MQEA 1P1KA 3TN7A 3LP8A 4G41A 3AKYA 5KB3A 3C7TA 2FPIA 3DBHB 3EXIA 4TQUS 3VZBA 1G0OA 1H4TA 3OWXA 1UOQA 1IRIA 3AUYA 4RV5A 4H1UA 2F3TA 3FZQA 2HU7A 3GH3A 4CF3A 4DWOA 1PS0A 2IHZA 3NJ8A 1I80A 2RHHA 4U0JA 2PFGA 4N49A 1OGYA 4M9RA 2EF1A 2VHZA 3TGWA 4B0OA 3GVCA 1DFHA 1JVBA 1XDUA 5ER9A 5E6UB 4YQEA 2C5AA 3KR1A 2I6SA 2QMYA 3U4MA 3G2HA 4IQ0A 1N2CA 2JZCA 4G0ZA 4AL4A 2PCLA 5GIOE 2W42A 1FS5A 2Q5IA 1SIOA 3P9SA 2QQ5A 3SEQA 5JRZA 2AOVA 2NUAA 2HAEA 4DMUB 4PS1A 4ZT3A 1F8GA 3HRKA 1QM5A 3OZBA 3LW7A 4RETA 1VIVA 3GDFA 5JSFA 4ZVMA 3TZQA 3AIKA 1JFFB 4R8KA 2BFWA 1CDOA 3DE3X 3E7PA 3JAWB 1XCJA 1C8KA 4AY4A 1Z18A 3DKRA 5LJLA 1OXSC 4UU7A 2XUZA 1P1RA 1NIJA 3DBIA 5FFNA 2PKWA 2LPMA 2Z4TA 4WUTA 3WGGA 2ZBVA 4I08A 1BXGA 2CK3A 3EQZA 3FWYA 4RKFA 2QA5A 2IFTA 1Z5ZA 4D0RA 4KREA 4RL6A 2QL7A 1U9JA 2CSXA 1LUAA 1AIPA 2Z4SA 1FFXB 2ERCA 1ZICA 1KAOA 2AUNA 2IOYA 2O7NA 3AM3A 5K3CA 4AG6A 3LHKA 1PW7A 3FHJA 4HLUC 1P9NA 4TTQA 3MAAC 1O8CA 3LBFA 5TPZA 2VRNA 1KMNA 3HYSA 3P32A 2ZP1A 4DLTA 5ELLA 2AWNA 1L7MA 4IEIA 4M1OA 3ILXA 2Z2IA 2W4QA 2V3CC 4EHFA 2AJTA 1ODTC 4TMFA 3NPAA 3AOGA 3VZRA 2YWXA 2VDWB 3B5JA 1MAVA 2P2SA 4FPXA 1VSBA 3SC3A 1KI4A 3I23A 2HHHB 1Y3CE 3IUYA 4KQXA 4O33A 2Y6VA 4P8RA 4ZI5A 5FFMA 3T3GA 3V2HA 5E4FA 5FAXA 2NSLA 3GJRA 4LYEA 3TLCA 5A4MS 3DLBA 1ZJ6A 4N9QA 5DB4A 4WK0B 5ARBA 4OREX 2JLYA 1ODSA 1R64A 1TK9A 1B74A 2Q3CA 2YYAA 2ZRHA 4R3NA 4RK1A 2J45A 1F1JA 3PLAE 5KOHB 1MQSA 3IQWA 4RE5A 4B35A 4JDPA 3B6IA 1IUOA 1NOKA 3I6BA 4CIXA 4GW3A 4HMQA 4DC0A 5TJHA 3GGDA 1CUBA 3L4BC 4B47A 4Y6GB 4G0UA 621PA 4FP9A 1JVSA 2ET6A 1FW8A 2J32A 1WTCA 2Z2ZA 3EY4A 3O2SB 2V6FA 3OKAA 1R0SA 2VWPA 4FNGA 4GC9A 4M7OA 4Q12A 5ES4B 3PF8A 3EQ6A 2YBEA 4G6ZA 3VTKA 1GU0A 4PZUA 2R7MA 3V8QA 3JQ7B 3RTBA 2WMNB 3MTQA 4H15A 1RLMA 4XEUA 5SY6A 4O29A 2H5LA 4ERNA 2JKYA 5CLHA 3FH0A 5BQPA 4W5RA 4RAQA 5LP1A 1A5ZA 4XCVA 3USES 1YAHA 3TVTA 5TVKA 1KAMA 3T5MA 4BQRA 3NM4A 2PV0A 4A0QA 4OMUA 2WRZA 1CJTC 1GTVA 2XNCA 4FDMA 4TL7A 1U7TA 2I6QA 1CKEA 3UJPA 5F3WB 4MVJH 1JKFA 4TS3A 1FRQA 1QIDA 1KFJB 2DC1A 1UBNA 1AKMA 3MTJA 2OCIA 2NU7B 2OWDA 3FSGD 4PX5A 3JYNA 5FCDA 2H4YA 2EL9A 3KOXA 3PSHA 1T35A 3N2LA 4JX9A 3IP6A 1YS9A 1XZGA 4JVSB 4KQKA 4P82A 5LFAA 1Q1NA 1U2ZA 1XVVA 3ELBA 4RIFA 5YASA 1LCIA 4ZT5A 2IX9A 3PPWA 1T8WA 3AVQA 4DS3A 3O38A 4ALMA 4UVEA 1YCHA 1ISFA 1AE1A 4EFDA 5JFOA 3ZK9A 5JWOA 1DV2A 3ECCA 1Q7EA 2ZT6A 3BIWA 3NG1A 4MLZA 5AM3A 4TWBA 2BZGA 3BQ9A 4E6EA 3PNOA 1T9DA 1TAGA 2G9UA 4HY3A 4Z7NB 5EWMB 3K0HA 1NW6A 1M8JA 4N5HX 1VJ0A 4P3PA 5FUMA 3WFJA 3DC2A 3TLMA 2N47A 2HBRA 3KQVA 1K27A 1VPEA 2AT1A 4HTAA 4BNZA 3HV2A 3MOSA 3W5VA 2B9VA 4LK3A 5LZ5A 5I7HA 4ZHQF 3KQNA 1EZ4A 1WJGA 3PYLA 1OWOA 2BF4A 4I4NA 1I14A 4YV0A 4LJ8A 2VHYA 3H11B 2HJSA 1VSUA 1GRNA 5JJIA 5AVXA 3HSKA 2BSQA 3HNOA 3WI7A 2QK4A 3H1AA 5BW6B 3PUKA 5GGYA 4ZO9A 1USKA 4YPFA 4YDHB 3ANNA 2R84A 1J2RA 3GD7A 3VSEA 1Y1SA 3MJRA 4POOA 1YR8A 4BX3A 2RAPA 5CBPB 1QLHA 4YV7A 4JP3A 3EFBA 3Q8WA 5FLEX 6PFKA 2OBMA 1GNRA 1YUBA 2UYGA 4XH9B 4HO1X 4YRKA 2J87A 1RLIA 2GEBA 2KLHA 1KY3A 2VDUE 1Z7YA 4H7KA 5AI5A 1PR9A 1GDDA 2AZMA 2WSYB 2BFOA 2Q3HA 5CXXA 1PJCA 1DFIA 2YUIA 5KVQA 3A6GA 1QU3A 1XA3A 2VOEA 3MTIA 1SOUA 3OT1A 1QGAA 2QJOA 2FZ4A 4AJHA 1RBYA 4A1OA 4RD0A 5FPTA 1IOVA 3G1UA 1TNDA 4KR9A 4UE2A 3S6JA 1YWGO 2ACEA 3V4OA 3ZTTA 1W0KD 2YV3A 1JNYA 4A8JA 5JQWA 1UJ4A 3HMKA 3QPCA 2Z8YM 5D3MB 3WB2A 5GINE 3H5OA 3QHQA 4QOEA 2HQSA 1UOPA 1EK1A 4IHAA 4GOOD 4K6OA 5JS2A 4BE7B 2D00A 4E30A 1PWHA 1AT1A 1Z07A 2R1VB 1N2GA 1VRCA 4PSCA 5LDGA 1IHXA 4EHLA 1DKMA 2GJKA 1BMFD 3NUZA 3DMFA 1NDQA 3PFWO 4G85A 4PAQA 4XW2A 5I9TA 5KNCD 2Q4DA 4BO5A 3GCXA 4DNXA 1E2UA 1KMIY 5EFOA 3KTDA 5C1DA 3N7UA 1Z5NA 4XQCA 2HIHA 5IBQA 4HQ6A 3HR4A 1KDTA 2NG1A 5CITA 1ZRSA 4WCFB 1NKSA 4OJNA 4RHCA 2I22A 3B6JA 3WXBA 4EI2A 1EPUA 4BKPA 1CZKA 3K16A 2QRVB 2P3LA 4D9CA 2B8WA 1P7PA 3EC2A 2PZMA 1E32A 4UCQA 4UTNA 4B8ZA 1MPXA 1YS4A 1LBIA 3PEWA 1PF7E 3LUCA 4HI0E 2QJTA 4EUSA 1R4ZA 5TQVA 1IMJA 1JHPA 3G8CA 3MWJA 4RK4A 3MB8A 5BUQA 3K1ZA 5D51S 1X7YB 2JFPA 3ROQA 2R0QC 4V0QA 3A1NA 3FGNA 3F6CA 4DCGA 2I8LA 3UB2A 5KS2A 1J8MF 1WPRA 4RE6A 2V65A 2ZUSA 3L0SA 4KQGA 4GL2A 1J39A 1EFPA 4GZMA 1OA0A 1ZHFA 2BGJA 4H3SA 5KYXA 2OORA 2Y68A 2NADA 2IV2X 1GXSB 1E3WA 4ARUA 1ZX1A 3HJRA 3RRNA 4EX6A 4AUMA 5AW7A 3I6MA 1XFAA 1U3CA 5KDOA 1G7RA 3OG9A 4QATA 5ALIA 2NUBA 3WK8A 1GT6A 4IH4A 4E2XA 4N5NA 1QAMA 4B6EA 4WINA 1Q1GA 2PBLA 3FZGA 2HR1A 3E5HA 5JCOA 4LZOA 4CU2A 3OP1A 1VBNA 1TAQA 1A4RA 3BD7A 2JVKA 3D6MA 3KTOA 4P3YA 4YAOA 3JZDA 3TZEA 2GAAA 2F90A 1FXSA 1PN3A 3F6BX 2AFIB 1A96A 4JI8B 4BATA 1GRQA 2P62A 3NC4A 4WY2A 5J43A 3G0CA 3L8ZA 5CTAA 5GPBA 1C8LA 2P11A 2C98A 1O6GA 2XNDD 4QFBA 1QVWA 2JCXA 3ZGVA 2PBRA 4EKEA 1H8HD 3S2ZA 1C3XA 3C6QA 2YNMA 4Y7CA 4HX9A 5DSXA 3JQBC 2JCGA 5IJ9B 4I9FA 3K9GA 2Y8EA 4MUFA 2GD2A 1E3WB 2BFAA 2NXWA 3BAFA 3EUEA 4P38A 5HUQA 1W52X 1Y80A 4B4KA 4EB0A 2RGBA 3PPXA 3S55A 3W5IA 1H5QA 2IIPA 2G5GX 2YASA 4PBTA 5FUXA 3JVDA 1KYYA 2ZYRA 3HBLA 4Q9LA 1C9KA 1C1DB 3N2GB 3WK9A 3DOUA 4BX0A 1I1HA 2LKDA 4LIPD 4FIZA 1BD4A 3WLAA 1KDOA 1M34A 2GZRA 3GT7A 3ONFA 1SRRA 2A0XA 1OFVA 4MX8A 4TLAA 4Q1DA 3CVUA 1E63A 1PG2A 4Y9DA 5A4IS 1TRKA 4W5NA 5C8XA 2YMLA 5IJWA 1A9QA 3FZNA 4FKBA 4GZLA 4M0LA 3PGXA 4MA4A 5LOVB 2BFDB 2ZBUA 3JQAB 2Q4RA 5JHHB 3WAGA 1B14A 2QS9A 2J07A 3IAHA 2BI8A 1Q22A 2DUWA 4C2UA 2Y1WA 5I7RA 1Y3BE 2VUIB 1H8ED 1DELA 3M7IA 2BUBA 5EIXA 1EUDB 4PIVA 4EEXA 3G5MA 3GWGA 4LI3X 4QT4A 2VPYA 2E5FA 1MO4A 1D6NA 1YE8A 3ABIA 5BN5B 3WKBA 4I5DA 1Z2DA 1Z25A 4GM1A 2LV8A 5CB0A 1RJFA 1UBKS 3B1KA 1P33A 1Z15A 5I5EA 4N01A 1W0JD 2QY9A 3ML1A 3HPRA 4FSHA 5J59A 2EGGA 1E6CA 4ZREA 4O4IF 3S3TA 2PR7A 2NPOA 2YWRA 3UOGA 4OB8A 2HFJA 4PG5A 2PWPA 3LECA 2ZBRA 4FHGA 4F5WA 3MJ4A 1PCXA 4M1WA 2WJYA 1EM8A 5BQ3A 3MTEA 1GG5A 3IBYA 4RDIA 5KYUA 2HMYB 5ALDA 3AI7A 4CUJA 1JDVA 1XCMA 1CULC 1Z6GA 2YXEA 2BFDA 3AF4A 2X0IA 4J3JA 4FFSA 4YRRA 4G07A 4M89A 3SHFA 2NNLD 4B6GA 5E1BA 2WNIA 4IDAA 4MJ3A 3E5NA 1C9YA 1ZGGA 3L84A 2HDNB 3O8NA 4A0GA 2GNOA 3QEMB 5IT9A 2XCTB 4EVSA 4RKQA 5DNEA 4AKHA 2X7XA 1DP4A 1JDJA 1CF9A 3T34A 1EFRA 3VI4B 1XCOA 1DJQA 2APJA 2QUZA 3Q7SA 2VHXA 2IRWA 1V25A 1NF3A 1P8AA 1NUPA 1FP4A 1X8LA 2CFSA 2MSWA 5EGNA 3U7GA 3KPWA 5HP4A 3U4AA 1SUPA 1OU0A 5I9MA 2G4CA 3A32A 1YDMA 3NS7A 5KU1A 3KM0A 1XHLA 3I9OA 5G0WA 5KBYA 2WFLA 3KOOA 3QYAA 1KI6A 2NZ2A 3ZJYA 4JOSA 4B6RA 2DLDA 1AK9A 4IH1A 4RQAA 1YRLA 3UWSA 2J3IA 4EW1A 2Q3BA 4YK7A 3U7EB 1KE1A 1QYRA 2V7XA 3ACBA 2A8YA 1SKQA 5HZKA 2W2QA 2QTCA 1P4AA 3BD6A 1XLVA 2ORWA 3PUWA 4L7VA 4MP8A 3RIYA 5HSGA 5IXYA 1CS0B 5K4GA 3EAGA 1V7CA 3H4MA 3EARA 4RQUA 3AB3A 4K03A 4EHBA 5HR5A 4JYZA 4G0NA 3DE2X 4PWZA 2D74A 3T61A 3U80A 1SEPA 1O8BA 4EYGA 3GT4A 5T41A 3V8PA 1DCFA 5DGHA 1FUEA 2QM3A 1O9GA 3VGPA 4DW8A 1FSPA 1WZ2A 1G4AE 2WFZA 4U0KA 5LIRA 3TG8A 2J9GA 1UWCA 5JZMA 2QR5A 3TUJC 3NRCA 2VKTA 2ZIXA 2HN9A 1NVWQ 1IB6A 5AW9A 3G6WA 4AKEA 4R1NA 2GTHA 2DKNA 3TCNA 5HTOA 2NO1A 2Z43A 3N2KB 5D1NA 2HBYA 2CL7X 2GBLA 2M2IA 2MR6A 2PCJA 3KWFA 1D0VA 1EQUA 4Q9IA 4PO9A 1H3NA 2VRCD 2ZIUB 1L3IA 1PK7A 3BTVA 3NEAA 2JLQA 1RYMA 1W5EA 4G3XA 5BWBA 5H81A 4E3WA 2EYQA 2WSIA 1GP2A 1UMBB 2OAEA 4ECEA 3AUXA 4BNVA 2ODQA 5F2OA 1GV0A 1XIVA 3LXMA 4W1QA 3S5UA 2NO6A 1K7SN 3T9FA 1ONPA 1E6LA 4Z7JA 5K8TA 3LBHA 1T3TA 3MCWA 1Z8HA 4MRMB 4F8EA 3ZI4A 4BY9E 4BKRA 1PLJA 4D7AA 1QHYA 5BQOA 2AS0A 5F5XA 2R8BA 1Z35A 3EUWA 1RC1A 4RO0A 5H1YA 4UAGA 2HHCA 3N8IA 4ZI7F 1Z2OX 3ZWCA 2JFOA 2H2DA 4DLSA 4C21A 2AZXA 2IDMA 3ZVMA 1EBFA 3GPBA 2CCGA 4IF4A 4KJXA 5BO5A 3U4CA 3AM5A 5FWNA 2PD6A 3L4KA 4CLRA 2WMDA 3NGLA 3H9QA 3IKJA 1N9ZA 1LTHR 4ZMRA 1UDAA 2Q6KA 4E03A 3NHUA 5D3KA 3SS9X 4B71A 2I7CA 4BVKA 4EKGA 3K2BA 5C52B 4WH0A 3BIJA 1E6MA 5DOZA 4H16A 4G67A 4J1TA 2F8SA 5JHGB 2X8JA 2VDQB 3GG9A 1GJRA 3CIOA 5LZ4A 4GI5A 3KLNA 4C30A 2ZCVA 4XLLA 3FCAA 4NG4A 4KQ1A 2IEDA 1G42A 4FCCA 4MCIA 3D0KA 1A9TA 2RGUA 4XM1A 4FM9A 2CYAA 5IKOA 4A1FA 1HXHA 4AJ2A 4PSVA 5HKLA 4AI6A 2WYOA 2X1MA 3MQ4A 2RK3A 3M6WA 2DWPA 3N9IA 3KKPA 3V2GA 1NXVA 1W0KA 1ADBA 5JATA 1B8UA 3EFOB 3CO5A 2PT7A 3SMQA 1D5CA 4NYIQ 4MYCA 4P35A 3VDMA 2ZBFA 2XEDA 3C24A 2J5QA 1NC1A 3KQHA 4LI0A 3LFTA 2JAUA 3II6X 2D5CA 2WK1A 2GPBA 4L9RA 5BUZA 1Y4ZA 2DTDA 3ETDA 2JZOA 3IALA 1AU9A 1AHHA 1G4HA 4YUWA 1E3LA 4HWPA 4EHKA 4YI3A 3THYA 4L5CA 3H6HA 1HE2A 1SG6A 3DO5A 3KOMA 3K94A 3LHIA 3I1IA 1T26A 4MGEA 5JCJD 2FWNA 4TTTS 4CF4A 5I9SA 5LQKA 1YS1X 1W4LA 3QFHA 2JKVA 3RAEC 3W06A 3KJGA 4N65A 3WYAA 1GGHA 1Z4KA 4IJUA 3QSYA 1NVDA 3VYUB 4P5EA 1TZJA 3CO0S 3HG7A 1DSSG 3FDXA 4OQZA 3BE8A 5GZ6A 1NXTA 1P4HA 2HRZA 1WMAA 3HFSA 4BNTA 1RT9A 4N8DA 1DGQA 3AU8A 2GARA 2AN5A 2O7VA 1R00A 4W63A 5K2MA 1S96A 4HUQB 2J5BA 2Z98A 2CEAA 3DPIA 3NOXA 4LXUA 1Y7TA 3R5HA 1LPAB 1OYVA 2OO5C 1JH9A 2AHOA 5AKEA 4RAOA 3HB7A 1TZ2A 4QWWA 2DY0A 4ZOCA 4ZO6A 4M7RA 2YXDA 2ZE8A 3AL2A 4JX8A 3S28A 2R8ZA 5F23A 1W59A 2WKSA 3LT0A 3ZE0B 1XZPA 2DBYA 1NVXQ 2BN4A 1HMPA 3HZOA 3ZGYA 2NVBA 1G17A 3T5TA 2QX4A 1Y6JA 3S2GA 3FAZA 4D3DA 1P3Y1 1VLHA 2QD1A 4H3VA 4Q3LA 2P9ZA 1XZEA 2RGAA 1HYEA 3LS2A 3PFCA 3USCS 4ARVA 4FU0A 3MCUA 4B3BA 4OK5A 3P1JA 4O4JF 1IMOA 5DXJA 1MW9X 1N8NA 3LKBA 3KSMA 3A05A 4TWAA 4BVAA 1MO3A 1S1MA 4IO0A 4YFYA 2BEVB 1R6XA 3B20A 2BONA 3AOEC 3R44A 3IKMB 4H7JA 3D0QA 5BV8A 4JLMA 4IHJA 2W2LD 2PHZA 1XHEA 3D59A 3WQHA 2GVNA 1LC3A 3Q0TA 1E3IA 3RUAA 3VRHA 4LSGA 4BWYA 1GGKA 1JX6A 1CW2B 4D92A 1NJGA 4C3VA 4L74A 4EUFA 4RGQA 1FYWA 2ZKLA 2AD1A 3S68A 3T3HA 1NBMA 1NKTA 3NEYA 1KMCA 1B6RA 2DHQA 4I46A 4LC1A 5LP6C 1CUAA 1M8GA 2C97A 1I7LA 4G8JA 3HVRA 4MQ4A 3GRVA 3OMXA 4ENSA 2I29A 3R7LA 1PFUA 3FBTA 3ANLA 3FRJA 4BMVA 1AZWA 1Q50A 1CZLA 4OJQA 1XXLA 2YFHA 3ZWPA 4BPBA 1PFYA 4XFJA 4Z53A 3WLNA 2Q4EA 3STWA 3H4IA 3V46A 3VJMA 2WQ6A 2A84A 5L7YA 1N77A 3B7PA 1J42A 1ICIA 5CR9A 1YBMA 3NOQA 4NOJA 8MHTA 3FRHA 3OE1A 1KKLA 4AYWA 4MYHA 3HZZA 4QG3A 4UTOA 2SKEA 4TRNA 2AQIA 1U0TA 2AN9A 4NPHA 1JFFA 2IYXA 3K2EA 3FOCA 4RM2A 3T4PA 2C1EA 1Y82A 2W58A 3R4CA 4K88A 4EARA 1EUZA 3WADA 2QT9A 1KO8A 3KZNA 2GXAA 1OUMA 1W88A 3U9SA 1PK9A 3K2QA 1YVPA 3MUOA 4GVPA 5BW4A 3ROZA 1G3RA 3H5NA 4DCMA 3PIRA 3JU3A 4FGWA 1R9MA 1FPQA 4QXMA 5H9VA 1JKJA 3BSWA 3VOTA 3DLTA 1T34A 3I9MA 2A35A 4TLEA 3V1YA 5IFKA 4KBYA 1T15A 3DMGA 3U26A 1UPCA 1UJNA 1RXVA 4DQXA 3QE0A 5EJEA 1B2LA 3T06B 1ADJA 1P7WA 3OJ0A 2ENWA 5ITWA 1Q3HA 1FS4A 1Z73A 3RSFA 3B6KA 2R6FA 3BF7A 4Q3OA 2OCAA 2A5FA 4W5JA 5JZOA 3NMUF 1X7ZA 1Z7EA 4EZIA 3A37A 1RTTA 3D5QA 1DLIA 5EA2A 4BAUA 1KXZA 1QFJA 4PPGA 1VE9A 2GR9A 3P0HA 1JFLA 1DAEA 1LDEA 1RQ2A 2FP3A 1C7JA 2NLOA 2L42A 5ENVA 1HNWB 3NANA 1L5GB 1IFXA 2I7TA 2FWAA 4HQNA 1W73A 3FLAA 2XMCA 3M2PA 1LH0A 4NFLA 4MW2A 3HY4A 4FDAA 5EXTA 1LBQA 1EG2A 3GMSA 5CP8A 2BHLA 2Q50A 3L5KA 4FHCA 5B1DA 1R5BA 4ARZA 3S1SA 5I45A 4BNWA 1DQNA 5K3EA 1S2MA 4OHCA 2ABWA 1IQPA 1UEIA 3NI2A 3EHDA 3BBPA 4ZC8A 1W6UA 2WOJA 2XE8A 3IP9A 1V8FA 1KDVA 2B6NA 3E8XA 5MFZA 4NBLA 1VPVA 4OH7A 4LYYA 3HCOA 3UC5A 4X1YA 2KB0A 5JQGA 1O89A 2VQSA 4LSMA 3CWCA 5C7LO 1GA1A 2EG9A 2AVNA 2F62A 4R3UC 1M6HA 1LRLA 1QH0A 4G86A 1A8QA 4U7TB 1CS4C 2XRFA 2CBXA 4G56A 4M1EA 1CDZA 4CKBB 3DLHA 1WCWA 3VH3A 4URWR 2GK7A 3PR2B 3EQ9A 4MUAA 1R0YA 3W8DA 2B1IA 2WP8J 3GI1A 1IULA 3DXXA 2HK8A 3EN0A 2ZR9A 5AKHA 1NI3A 1TKAA 4Y2UA 2FMTA 4PO1A 1X8XA 1XD9A 1Z5OA 4N54A 1TQ4A 1L1RA 4HZGA 2I03A 3DEIA 3T3PB 1MP0A 2BF7A 4BMZA 1W36B 5HGXA 1RTKA 2X22A 2ID7A 3MTBA 1RQRA 3GLTA 2SCUA 2O2JA 2ZB2A 2W6CX 1MTOA 3D7LA 4HAOA 4WLVA 1PJTA 1NKVA 3A1WA 3H5TA 3D4IA 4NG5A 2I1VB 1QIHA 3RGGA 4WOJA 1X87A 3R77A 4B4VA 1ID1A 4HZUB 4OOFA 3NHPA 4XTCS 4X3PA 2WAAA 3V9AA 1CQIA 3BD9A 421PA 4DL9A 5CDFE 5JQGF 3GIWA 4HS9A 2XUKA 2BGTA 1ZM7A 1OASA 1ZWLA 2FSHA 5I7AA 3GP3A 1MQ9A 3GJXC 4J0FA 3GC6A 4IQ4A 4K5QA 3WWEA 1A8UA 3A3YA 2X0FA 2GCIA 1VMKA 5IYZF 4DR2B 2QLNA 3UB4A 2V45A 4IDOA 1PTJC 2FK7A 1SOMA 4TXNA 3JY6A 2XCSB 4YT4A 1AKRA 4ADSG 5CH3A 3KU4A 5DMHA 5JDIC 4MRVA 1FRNA 2YDYA 1HOTA 1NQUA 3MG9A 3QLTA 2VHUA 4XOUA 2HJRA 3KKKA 3G2KA 3LE8A 4BMOB 1FOEB 1YDGA 2D0PB 3KD2A 5LA6A 2O0LA 2PX6A 4L51A 4WFKA 3V32A 3IMCA 4TYYA 1X0VA 3L79A 1M33A 3ZS8A 4PLPA 2EVWX 1HRKA 2C8VA 5LSAA 1SHUX 2HY7A 1IZ7A 1NVVQ 1V95A 2AFHB 2YHUA 4ZVTA 4TWJA 5FUQA 3K0BA 5JZSA 1FNSA 1E1QA 2JL1A 1VYUA 4FN5A 1AHIA 4J0GA 1L1EA 3LOUA 1PQWA 4XIYA 4YQFA 4WI1A 1J0DA 4PHGA 1E98A 1ICEA 2Z9DA 1ZOPA 1SQFA 3HCBA 2VK2A 1ZD2P 3NWPA 1X7ZB 5KNBH 1TJYA 3SC6A 1JXAA 1OREA 4M8SA 3DHYA 4LN1A 4D74A 4YCAA 4DCPA 4PYIA 1BDBA 3IDZA 1PUIA 1RADA 4F93B 3TTTA 3HXLA 1L5YA 3BREA 2FFJA 1KO4A 3QKUA 2FOIA 2KW5A 3U3OA 3ZE1B 2OHGA 3P9XA 4UPEA 4FWBA 3CG0A 4ZYWA 1EXMA 1MF7A 1H5NA 3B8EA 3IVGA 4F56A 1SVNA 3TTSA 1M0WA 4D4MA 1IUNA 3REOA 1AV6A 3EG9B 2ZULA 1QNFA 3JYOA 4HJXA 1LK5A 2BV3A 4KBFA 4O4JB 3IKLA 3SZMA 4ONEA 4KQ9A 4JBLA 1TYEB 2CBZA 3D4NA 5C46F 1E1MA 3EIQA 4B33A 1NE7A 5IEBA 2SICE 3V2UA 1J22A 3G23A 3BRCA 4R9SA 2JGJA 4BB5A 3HEAA 2O07A 2EBFX 1WABA 3CEHA 5HBGA 1L7DA 5EOVA 4WXYB 1RI2A 3PNMA 5JPDA 1D0SA 1YOVA 5T8KA 2ZRQA 2FSPA 2PM8A 5HOEA 2Z8XA 1YXMA 3ZY6A 3ZBPA 2ZCUA 1MAUA 4N48A 4ZHSA 4CM4B 3AP3A 1W35A 3AHFA 2ARKA 5HE8A 4EHHA 5DNUA 5KNBA 1UDXA 4UHHA 4KN8A 1QQ6A 3L2OB 1F38A 1OFHA 2DHDA 2JIMA 5LXTA 1M5TA 2DULA 5KHAA 1P3DA 1NBEA 5JJBA 1QVRA 2SKCA 2XWSA 4EPTA 2H1FA 2Q6TA 2Q0HA 4Q3DA 4DJAA 1BSVA 5BSTA 4X0EA 3I39X 5IARA 1SKMA 2QLLA 4MKIA 3DQQA 3DQZA 3VPSA 2XGMA 2X42A 5BN3B 5JROA 3C6KA 3EC7A 3EXHA 3L18A 4ETWA 3NBKA 4CETA 5U4XA 5E4JA 1ESMA 5I8PA 2QMZA 4DIMA 3FSRA 4MW7A 4P6VF 1T5TA 3Q8MA 2VP6A 3LDFA 1XJQA 2VNAA 2Q6LA 5BSRA 4AAYA 3EIEA 2B21A 2BEJA 4WNAB 1GAJA 4NF2A 4MHSA 3I92A 5HCIA 4CW7A 3DHEA 3UMMA 4JKOA 5SICE 1DRVA 4D3SA 3ECSA 4BWFB 2CVHA 4PC2A 5CFPA 1UAYA 5G2OA 3FTDA 1SGWA 3G2MA 1PZFA 3HDQA 1DJOA 1JL3A 2FUKA 2GN0A 4XFKA 4F6LA 1JLLA 3O31A 1G1MA 3HUEA 5GZ1A 4KGVA 1RXWA 2CZGA 4NBWA 5DN6D 5JPCA 3EGXA 2IWHA 2XMPA 3WYGA 4Q19A 3ZGOA 4L22A 1XNJA 4XVCA 4YY3B 2EZ4A 3F6PA 3MN1A 4GHWA 1UMKA 3E48A 4AUEA 2PY6A 1J0EA 4KKVA 3DP7A 4OUDB 1VGQA 2AN1A 2FVXA 2CNOA 2BLNA 3WB0A 3EUAA 3SQDA 3IOCA 1G5RA 1VJRA 1QG0A 1I2AA 1B15A 2NACA 1PL7A 2O5VA 3OTQA 1JYFA 5DI3A 1N2IA 1VLQA 2OPBA 2Q1UA 5A4FS 4DBZA 1XMQB 3HL4A 4X71A 3ZQJA 1O96A 2HK6A 3F98A 3QY9A 1K9SA 3L9WA 3Q2KA 5DULA 1JDBC 3BJRA 4GKBA 4FBGA 3HDVA 2G7ZA 3DCYA 1T2CA 3QX9A 2CXNA 3PXAA 4GEGA 3VR6H 4B3TB 4FZ5A 3AGPA 1QZ3A 3BFKA 3V2IA 3ONEA 5B30A 1Z6PA 2GCGA 5ICSA 1N6KA 2VAWA 2BBSA 1CFZA 2HBQA 3VUFA 1NJ6A 1JYSA 2HSEA 4HDNA 5EL0A 4EEKA 3AX6A 2UU9B 4WERA 1E9CA 2ZW9A 3JWJA 1DTWA 1UT8A 4MYDA 5JMPA 4EHAA 1PZXA 4J0HA 1OJ7A 1ES9A 3AB8A 3RF7A 2JLSA 4RMGA 5JZ9A 1E89A 1EGHA 4ZVVA 3QXGA 4WFJA 1TYDE 2YIMA 1L9XA 2VF5X 2WEKA 3PUXA 4NFSA 3CY6A 4F9TA 4A8HA 3VPHA 1KZ4A 1V3UA 4MVJP 1OKKA 4G1UC 5L53A 1HLGA 2ZYIA 3HA7A 4RJ2A 2A9QA 1QONA 4HLQB 3OD1A 4KYTA 5IZCA 1E5VA 1XXHE 2ZRDA 3RH0A 3E9YA 3M81A 4HLCA 2HJ9A 2ZITA 3I5YA 4DLYA 1ESNA 4DCUA 3PGMA 1W87A 4YJHB 4DQLA 5EC8A 4U5XA 3A6KA 3B48A 4RF3A 1VYTA 4EBFA 1ISHA 3PC7A 5JV5A 1HE1C 3QFTA 2YX1A 5EXSA 1FDSA 1WUHS 4I81A 4XRGA 1P4RA 1X39A 4HL6A 9LDTA 5INTA 5ADUS 3MRXA 4V1CI 4DQUA 4LDQA 1KKMA 4F5DA 2E4WA 4IYJA 3C6MA 4UAJA 2QZSA 4CJXA 4ZP1A 1E0SA 4UXJA 3LHSA 3N0RA 3OUZA 1NXWA 3VNQA 3ZY4A 3OEED 4CR8A 4CM4A 3AO0B 4B1FA 3QBJA 1A76A 3U39A 1A1VA 3DLAA 1P62B 1ZMOA 1NRXA 2VJLA 1M6NA 3PT5A 4QPZA 3ORHA 3FTEA 3BB4A 3GGJA 1PVDA 2BM1A 5F1KA 4GQBA 3D1LA 5FUBA 1Z45A 2D1FA 4TRJA 1C30B 3D2CA 1ST3A 3TMKA 1HG0A 1ZA2A 4N6OA 1TE2A 3TM4A 4FIDA 3NWEA 2WIAA 4JUIA 1NP3A 3T7EA 1E1RD 4FFVA 3U7QB 4N0EA 3ZHUA 3ADPA 3QEMA 1ZD1A 4YJHA 2E37A 4JL5A 3NH9A 3GJ0A 3D3JA 2JFHA 1C7RA 2PL5A 4FONA 1ZL2A 4G0MA 1TYCA 1AN9A 4RNCA 2IPNA 2AF4C 4WJKB 5HQTA 4EB8A 1CXZA 1LA2A 2H4WA 2I5PO 2SNIE 4V0OA 4R2XA 1YZFA 3SJAA 4LYHA 3TQTA 3WK7A 3E5MA 5IC5A 2BDTA 5CX1A 2JJMA 5JCOC 1KO5A 5DBOA 4IUDS 4RQTA 1RKUA 1H65A 4N5LA 5L7WA 1P2GA 4Q4AB 1TYAE 4UTZA 5REQA 2EHDA 3JCZA 2GM9A 4HX5A 2ZANA 1V16A 3E1KA 3LK7A 1JAXA 1RSZA 3VNSA 4M37A 3QU7A 1D7AA 3EDRA 1IEVA 4INAA 1YGPA 1G8PA 1QH8B 1SO8A 4NESA 5SZJA 4G5GA 1R5OA 3P96A 4I1SA 3REQB 4MZDA 1IZ0A 2E18A 5TMPA 3K73O 4JQYA 2WIBA 5JSYA 5KSOA 4U00A 3VR2A 3C39A 4R71A 1Z4JA 1IBSA 3A3NA 1MB0A 2IOFA 1I7PA 1ZD4A 2LWIA 2IYYA 1DTSA 2ZETA 3DB1A 1KQFA 5ICCA 3VSAA 2OOSA 3UJ6A 5B5SA 2ZIZA 3ZVKA 1P80A 3ZVRA 3CZAA 2Y4NA 1W0CA 5IM4F 5KJ6A 3U4DA 3LQ1A 4BUCA 1EVIA 1OCEA 3U3ZA 3MS7A 2COEA 3VKUA 1NVBA 2Y1GA 3F5DA 5ICMA 2V7VA 1DVRA 2VXCA 2Y1CA 4Q1VA 4HAXA 2EGHA 3GUZA 3OOSA 2XCRB 4UXIA 3VNRA 2Q7OE 5I48A 1BE1A 1MABA 1T1IA 3BXHA 2IZOA 2HA5A 4G4SO 1XEWY 2WD8A 3AT1A 1NFQA 1T5BA 1KNQA 1PG5A 2ORED 2P2DA 4GPBA 3HXPA 3QELB 1SQ0A 5TEWA 2FA9A 2G3YA 1T6BY 2AK2A 2J4CA 4ALLA 4WHMA 2ZAOA 2WWYA 5D5PA 5GWXA 3ZCVA 2X7HA 5JG7A 3M6FA 1QF6A 1UXJA 4ER3A 1ZQ1A 2CVZA 1IK6A 4MS1A 2FVYA 1UUFA 5AKGA 2GPAA 1WSAA 1POXA 4MSUA 4UCWA 2QGNA 3TR5A 4RC9A 5ALRA 3A4IA 2DWOA 4D8XA 3ZXYA 1CY7A 4J49A 2XT9A 1BDMA 4HF7A 1THZA 4HAIA 4D02A 1KU6A 2HHLA 3OCCA 4HAUA 4Q93A 2W6OA 4M53A 4PLYA 2Q3JA 2EDCA 4TXLA 1ZSVA 4L57A 4HUTA 1Z47A 3LLSA 1QWOA 4RELA 2OD2A 3I72A 3PVSA 5E6SA 3WLFA 2AEEA 1X14A 5KC8A 2PA0A 2ISSD 3DVQX 1QKKA 2QVCA 3OZXA 4ZOBA 4CQNA 2G4LA 1KFEB 3EISA 1JBKA 3Q8KA 5IEJA 2AFHE 1PGQA 2EKQA 4NDZA 3W77A 3MUNA 1EAMA 3BWCA 3D8NA 4DJJA 2O0JA 1JWLA 3G9QA 3RUPA 4MGKR 3PXGA 3CU5A 5E3JA 5DN6A 2RHRA 3HB4X 1EX7A 2Q28A 1UL1X 3KP1A 3NX4A 4IHKA 3IX7A 4J2HA 4MO2A 2CFRA 5FLYA 4KIUA 2GCEA 3GOHA 2CDNA 4O8CA 4CTKA 3OFKA 1FYXA 1LLCA 1MT3A 2VNKA 5HF9A 1GLGA 3W9SA 2B4RO 1KGDA 1E0KA 3FNBA 4ZO7A 5FEUA 1TTTA 4MV6A 5DYWA 4TV8A 4ASUA 5BNZA 2QN3A 2X15A 2IVFA 2ZS9A 1OB2A 2QMUA 4TQGA 1YRWA 2RGEA 2BZ0A 3L40A 3ZBTA 4NBVA 1OX6A 4YJFA 1NT4A 3E05A 1DBVO 3GRAA 1AMUA 2K2WA 2R8OA 1BFUA 2WJWA 2ZIXB 3VPFA 5BYAA 1U99A 4DWWA 1Z74A 5HMLA 4ENQA 2FN3A 3CNHA 4M9QA 4QDZA 3EOAI 1YKFA 3B36A 4QLOA 4BZWA 4CLEA 5I4BA 5F98A 2ZWOA 3SYTA 5JMOA 4P0PB 1ZN7A 2HMVA 1O97D 4FBLA 2PYDA 1M2WA 4Y9TA 4Z6KA 4UZEA 1WULS 4NMXB 4JXKA 3ZVNA 2F8LA 4Q34A 3W2HA 2J9ZB 2HPVA 4D80A 1QAOA 2O3TA 1JSLA 1Q1EA 3HB5X 5A2GA 2W6JD 4HUQA 1DJNA 2WUFA 3VJRA 1D2NA 2PRJA 4IIBA 2A92A 2Y9MB 4RF2A 1BFKA 1N8SA 3SF8B 2DCMA 2IGBA 4M1QA 3GA5A 3UFXA 4OJMX 4DLPA 2LW7A 5TT0A 4RTLA 1YZVA 2IUFA 2MU1A 4OQQA 3Q5EA 2FLWA 2XV1A 3FF1A 2ZSUA 3MZ0A 5T7BA 3PGVA 1Z4LA 1QGED 2QVXX 4P22A 3QYFA 1ANKA 2ZE7A 3DWFA 4L4SA 3X0DA 4EB6B 5IDXA 4J0QA 1HLDA 1NY6A 1I3OA 2NTYC 2V0NA 2QROA 2VUUA 3NORA 1E1LA 1P74A 3MINB 4X24A 5B3KA 4Y6LA 1HPLA 4LF4B 4I1RA 4JNKA 4NMMA 3W8EA 4C0LA 1JN0A 3QFRA 2NV6A 2FGJA 3L0YA 2ZAMA 3GLGA 1XZIA 1XYGA 3HM2A 4PXAA 5CT8A 3IS3A 4X1KA 1OI2A 3KCNA 5THXA 3C1OA 2MMGA 1YCFA 2NM0A 2Z3ZA 3VHXB 3NIFB 2Z5GA 4Y2XA 2O3JA 5CEEA 1EESA 2QTLA 4LDZA 2IPXA 3UENA 4EMTA 1BQ3A 2XB2A 2PJDA 2QIPA 1PD1A 3FD8A 1OF1A 3G7UA 4NU8X 1Y0BA 4OHVA 3JQAD 3MJSA 4P3OA 3NKFA 4G8DA 4S2UA 5BPFA 1U1GA 1MDFA 3TFWA 1DWUA 1FP2A 3I2JA 2OECA 3KSRA 4DIDA 1JB9A 4ISBA 2C7BA 5BURA 1E9DA 3CX3A 4XCQA 5EHQA 4I1UA 3E1GA 4RWEA 1Y4AE 4FDTA 2UUAB 4OG2A 1REQA 2AYZA 2I6FA 5HS6A 1CR0A 1CPYA 1ZNXA 3HE3A 3DOHA 3B3GA 2HEGA 5KC9A 4JQCA 3ZWVA 1ZGCA 3SJ7A 2ZM5A 4ZVNA 1B16A 1ITZA 1G9XA 1Y98A 4QDKA 5DNCA 1C3OB 1XLTA 2GA9A 4A2WA 2HHAA 1QC5A 3QXXA 4F04A 4LCJA 5H70A 2P4SA 1LPMA 4FFNA 3PEYA 4WEQA 2OG2A 5DE3A 2PL3A 3BXZA 1B00A 3KJFA 3HHEA 5CDSA 1QMPA 2NGRA 3LP6A 3MJVA 4PCVA 3S1AB 5COAA 1V37A 2EYUA 3TD6A 1VHLA 4RPJA 4I6JA 3MELA 2ECOA 2FN4A 4GICA 4JEMA 3MBIA 4Q21A 1YZKA 2VDNB 3UV6A 2W93A 1U1IA 4F3RA 3FNFA 4Q3KA 2A7XA 3I37X 3KLBA 1C5KA 3GJ8A 2UVQA 4PU0A 2MINB 1CEYA 2YN0A 3WOVA 3H19A 4GVXA 1N8KA 3IT0A 4QSHA 2NXNA 4NCIA 1MVNA 4QU9A 1ZXLA 2BE7A 3HKDA 4FMBB 4B0PA 2JEOA 4GNRA 4HHEA 3EXHC 4ZU1X 4KVAA 4URVR 5G0UA 2H2AA 1RS0A 2FPWA 3OH8A 3FJ1A 1WKVA 4FSXA 4N0QA 2BFBA 1VG1A 1C0LA 4LY6A 4B09A 2RHDA 2GM5A 1RZRD 5EMHA 4IZOA 4EG3A 3D8BA 2ICAA 4TUYB 2EW2A 2MSEB 3GDHA 3P0RA 5DYYA 3RV4A 1ECFA 1R15A 5F7ZA 3Q2OA 4DTCA 3TQRA 1U7UA 1OBCA 3LZCA 4OP3A 4PNPA 3O9VA 1NUHA 1XDZA 3PFIA 4KI7A 4W5QA 3B7GA 3SD7A 2E5LB 1RI1A 4ZCQA 2RGYA 3EFEA 1R16A 4BNGA 2E4UA 3DF7A 5CD1A 3PGA1 4Y2HA 4D82A 5HDBB 2Q1WA 3CCFA 4LC0A 5E4YA 5EMJA 1L4LA 5CM8B 4YECA 1XTVA 5DO9A 3ZW7A 4C7JA 4NDAA 2XB6A 4CNQA 5ENZA 1OBHA 3EB9A 3LOPA 3GX1A 4D9MA 3D5TA 4Y2QA 3VDRA 2XUAA 3H8JA 4WACA 2P68A 3PHLA 4RMNA 1O9BA 1I10A 2CXQA 4LNAA 2X3FA 4YCNA 3LWDA 4OMDA 4P9NA 2K4MA 3ZZMA 5LNK6 1OBOA 5HJ2A 4UVHA 2ZUDA 4EY8A 3ZV7A 2OHHA 4IWYA 4PGHA 1H05A 5E7QA 3SHWA 1T8YA 3GFGA 1XZQA 2FN8A 5B2ZA 3ZZUA 2B35A 4DMHA 4F4HA 3BMNB 2EZ9A 4MRNA 3O91A 5FDFA 2VJOA 3PVCA 4DREA 1M1YA 4OQDA 5FR2A 1GKLA 2R5WA 3MSXA 4Z4FA 3G5AA 3PI6A 3REGA 1TQ6A 1UEJA 3QPAA 3EGCA 4RS4A 4J3NA 2XGOA 1DAKA 5HMMA 2WHEA 3JQ9C 1P61B 1RXCA 3QUBA 4J6EA 4NCBA 3WB9A 2FPLA 1Y8ZA 1YB1A 4HB4A 2XZOA 1SXJE 4LXGA 4OH1A 2BKEA 4PBSA 3HABA 3ROFA 1PEDA 1JR3D 1FCJA 1PDOA 1FFSA 1UWLA 4A0RA 3RGWS 1FVHA 4HDCA 4BO2A 2XUDA 2PUHA 3KE9A 1IHOA 1KE2A 4U8HA 4TMYA 1J07A 1EGVB 4XUCA 4DWVA 1XEFA 3N8KA 3SDZA 4BIMA 4CLXA 2VSYA 1CZUA 3DCNA 2ILVA 3CF6R 3MBOA 1Q84A 5JE8A 1TZCA 4HFRA 3GCZA 3W3AH 2R6GA 4J0IA 3QVLA 2VQEB 2ZSEA 5KNCH 2FMHA 2I2FA 4KO3S 1A88A 1ORRA 3L7JA 4EF4A 1IZZA 2WWHA 4XR4A 1EAYA 1IJEA 1Z6YA 1UFQA 4B6QA 2FE4A 4IGKA 4AJNA 3W04A 3V80A 4J94A 3KWLA 4TV8F 1Y1LA 5AM2A 3DV9A 3C8UA 4Z2YA 4KPUB 3ZX5A 3ROGA 3QA9A 1Q17A 4MWZA 1UQRA 3E15A 1VHQA 1T5DX 2FWMX 4MPJA 2C96A 4DUYB 2WYWA 3PXCX 4CEIB 5LA6B 3MK31 2YRXA 4Q3AA 3HCCA 3A7EA 3W78A 1TFRA 3F9CA 2XUOA 3PQFA 4NYMR 4OM8A 2G5PA 4R1SA 1L8XA 4R7GA 4BB0A 5K99A 3J7TA 5U1PA 1L8AA 1YQXA 2Q21A 4S1OA 2JBHA 1EP1B 4R7ZA 2WTXA 3P97A 1LDYA 4Q4JA 5IAAA 1NJFA 2JGDA 2ZVPX 1QFYA 4RGVA 1A9XA 5CVEA 2AJDA 4QDJA 1VCHA 1Q0QA 1CFJA 4R83A 1EUQA 3MBKA 1ZI9A 3DAGA 3F5FA 3BXOA 2H2HA 3N86A 1DQPA 4LK2A 3LWNA 4EGFA 1UH5A 1EX9A 1XTUA 3D3QA 3NNSA 2XJ4A 3LOQA 4ACBA 3L0PA 3A36A 1LQ2A 2GCOB 2C77A 4IAOA 1PJQA 2QYOA 3DPSA 4JYBA 5AJUA 2HPHA 1U5CA 4DG5A 4L08A 5DNWA 1CR6A 3EC1A 4FEGA 2CL5A 2FSVC 3SR3A 3WLJA 5KHLB 1HTTA 1MR3F 3FYUC 2XRZA 3FHOA 3IL2A 2B0JA 4JGIA 5EHNA 4JHXA 2BAGA 2H2GA 3HVHA 3SSAA 4C7BA 4QTUB 1IQRA 1PZMA 3HUTA 3D4BA 1JLRA 2JW5A 3HGQA 4AROA 1QK3A 3ESZA 4YN3A 3CWQA 2RC6A 2H48A 2H7XA 3SVTA 1D1SA 4LV8B 2ONYA 3H8SA 2I80A 3VPXA 4G24A 2ZR8A 2PN1A 4Q4LA 1ULSA 1BEZA 4B3SB 1BQEA 3QOWA 5FYDA 2QTMA 3GEIA 5FPYA 2AQ8A 4MJXA 1YONA 4G84A 4L1KA 2F43B 4BQNA 1V0JA 4CQJA 4OKIA 5LA6F 1RACA 1WW2A 1NPDA 3Q6MA 2W2LA 3TWOA 1E2LA 2OL4A 4EHJA 2AMJA 3U0VA 5A06A 3DZKA 7MDHA 3IDOA 4IIEA 4OIMA 1UP4A 2IZ1A 3ZG6A 4DSTA 4ZJYA 4FNMA 2YKGA 1P1CA 5CA0A 3A9SA 2FWIA 4MDFA 4LRUA 5FHQA 2YHIB 1AKTA 1O4WA 4BU1A 2DR3A 1T3GA 3PRHA 5GJCA 2I33A 3K9NA 2PUWA 5TR9A 3KAQA 3Q3IA 4EO7A 1KZ7B 4OFBA 5CLLA 2C5SA 1WX1A 4YQYA 1TGVA 1L1QA 3GLHE 4AWAA 3CJRA 2KBFA 4GMHA 2V54A 1E7RA 2YWJA 1MX9A 3N3AC 3B3FA 1ISMA 1KU0A 1RYBA 4BCBA 4U2BA 1MB2A 1SFRA 2I76A 1S9HA 4MQUA 3TRIA 1QHHA 2FV8A 3R0ZA 4BNLA 1YJXA 3ORFA 1L8LA 1DIOB 3FM9A 4J3FA 3GUCA 5EJ7A 3DW1X 4KAXA 3WIOA 1UBHS 1YB7A 2WZCA 1Q3KA 2ACWA 4HDQB 2R85A 3GRFA 2K6GA 4GQAA 3WLEA 3Q8XB 2HA7A 3SQOA 3TX6A 1PEYA 3ICCA 4FC7A 1Y9AA 1PT5A 4CNBA 4EH1A 3N8GA 1UWKA 4H18A 4K9LA 5DNAA 2HCRA 3H2IA 5MN4A 5F5LA 4CDRA 4RLQA 2G80A 3MMXA 4WOCA 1GL9B 3IDFA 2X4DA 3K9QO 3OJCA 4TOIA 2EFCB 4C6TA 4ITRC 3TO5A 2TMYA 1NUSA 2DOKA 1AY0A 1E2GA 1XJWA 1FUIA 1V9CA 3AI3A 3BB3A 1H0HA 2F1OA 2IJGX 5ESDA 4DYHA 2HW8A 1F2VA 1KPHA 2H18A 1GZ5A 1GZ6A 1ZN9A 1Q12A 2A7QA 4ID9A 3NHRA 5F73A 1L7OA 1Q0UA 1N5OX 3HVIA 2KLBA 4MVJA 4EPWA 4C4ZA 1G20B 1B2RA 1EA5A 4B87A 4JBYA 4E5PA 5AKXA 1BQ4A 2XKJE 2QOEA 4XIJA 3FAKA 5HCUA 5EWJA 2XNDA 2AX3A 3EPHA 1SPBS 2FPXA 4FW8A 4I3FA 2XH8A 1JBQA 3GMTA 4YEDA 4PR0A 4RS3A 3WGYA 1DAMA 2C42A 3RR2A 2DWCA 4W9MC 4I8IA 1X70A 2H7CA 4AS3A 1F8YA 1JNXX 4GWGA 4MIEA 3QI7A 3TM5A 5E1DA 2AYXA 2G9NA 5DYNA 1JLMA 1OZ0A 1OXXK 4DR4B 1HMYA 1M76A 3H16A 1LB1B 5JISA 1YOVB 2OILA 3PF9A 4YWHA 3P0FA 5LMUB 1EDOA 3M1LA 1NBWB 1IQUA 4W4TA 4ZCRA 1JIKA 3T9DA 1HYBA 1OYOA 3URKA 2VUHB 2I2DA 3DPUA 2EJCA 1HE4A 1ZM9A 4CCYA 1GU1A 1LSUA 1NJ1A 2A5JA 2CHVA 1EVQA 2YH2A 1D2GA 3AV3A 3IE2A 1GUFA 4MLPA 4Y9RA 4YPVA 1QRDA 4LFBB 3GPDG 3DO8A 4KWIA 5BT8A 5FTLA 5H8WA 1SAYA 1BN6A 2O52A 1RYHA 1SU6A 3KPUA 1W1UA 1WCIB 3L7OA 3PXDA 4N0PA 1I5OA 5BN3A 2HK7A 5IN5A 4D81A 3U7RA 3QJ5A 2P8SA 1GO2A 1MV5A 2DCUA 2H3HA 2QSJA 3EVAA 4OHKA 4P93A 4D41A 3R0JA 3SCZA 2F43A 1XZDA 1OV6A 1R9JA 2C20A 2A0UA 3HGMA 4AN0A 1Z39A 2HV9A 4C0AC 2MWMA 2WNSA 3CSDA 4C03A 3IOBA 1NVAA 1DAHA 3L8MA 4JLJA 4Z0HO 2X9NA 3ZLTA 3HYRA 5H02A 2A5DA 1VL0A 3MMPA 4JLBA 3IUNA 5CUQA 5K4AA 4N9WA 3ZUGA 1HT0A 2I3ZA 1JLKA 4Q66C 4AG3A 1C3VA 1UBSB 4LZNA 2P2NA 1IG3A 2Z5VA 3KJHA 1RAIA 1GGVA 2GWRA 5ALNA 5AM4A 5CK5A 5DM70 2DJ5A 5M3BA 2XIJA 3FZEA 1PKEA 3VSDA 2V7EA 5B6JA 1X42A 3KBBA 1TF2A 1BRMA 1RFGE 2JIOA 4PRKA 3SP1A 3VZPA 5C8ZA 2ZWAA 4BEVA 1V8ZA 3OURA 3T5CA 1KOGA 5L3SA 4WFQA 5DGIA 5D01A 4MA5A 3CURA 2CXHA 1MKYA 2GWHA 5CM2Z 4KIGA 1SC1A 2PT5A 1SULA 5A05A 3I6QA 3PFBA 2EGUA 3AL3A 4WZZA 4O0LA 4N8EA 3JQDA 4OQEA 4V39A 3RADC 1CUSA 4V02A 2QM0A 1SZDA 3T7KA 3WRWA 2CDCA 4G0XA 5CGZA 5SYNA 4HQOA 3HKEA 4R2MA 2OCDA 4OU4A 3MT9A 1E6UA 2ZDQA 1SKYB 1LVGA 4IKEA 4LKRA 4E2WA 5IG2A 3IEUA 3FY4A 5A6VA 3FIUA 1JEAA 1HEUA 4KH1A 3KSAC 2XW6A 1QH1B 2DFDA 3RT7A 2J7PA 1U3DA 1QIIA 2Q9BA 4B6PA 1OIXA 4I5IA 3UJ8A 4B76A 4M86A 4JP5A 2BFCB 2HA4A 4FKMA 1MIOA 1WLYA 4P7JA 3FKQA 3Q3GE 1IOWA 1ZN8A 3CE9A 3OZAA 3Q40A 1VCOA 2BL4A 1LSJA 3LUHA 1R4NB 4ZQEA 4PLWA 2C4UA 3T7SA 2F1IA 1YI0A 5EXDA 1WOMA 4CFSA 3ZE2B 2OHOA 5HM8A 1JPNA 3U5ZB 3NHYA 4YONB 3AMVA 1QVVA 3GP5A 3IEKA 3DBRB 4YJ3A 5CCDA 2Y0BA 3PD0A 5D2CA 3VTAA 3SDSA 1J00A 3VVMA 4G25A 4DNOA 4F86A 1LVUA 1U31A 1VE7A 2Y1KA 3D6UA 3DOFA 1MH1A 2RBEA 4CL8A 3K1JA 4KXUA 4LQDA 4WCDA 5DGXA 3AKZA 1SVMA 2H51A 2QVBA 2R7NA 4TL8A 4WOKA 1KWGA 1JTEA 3H5AA 3L4EA 3RIEA 3L9XA 5JNVA 4ENPA 3A4TA 3GRKA 4L4XA 5ALJA 5KTPA 4UNPA 3PNQA 1CNFA 4FX5A 4JEHA 2N0SA 4CGYA 3WGMA 8OHMA 5HIKA 4OP1A 2Q8PA 1GUDA 2UV8A 3WKAA 2BTOA 1S8FA 4FD2A 4IIDA 3I64A 4Y0AA 3KHTA 2Y2VA 4MQEB 1XMXA 5IJ0A 1WMDA 1TC2A 2AH5A 2BVNA 2G8LA 3B3JA 4UEKA 5DFAA 5JAQA 3TB6A 4BO6A 1T2EA 3GFRA 1K9VF 1ONBA 1HTWA 4BNFA 1F2TA 2ATXA 4YRIA 3LCJA 4M1MA 3B3QA 4A92A 1NW7A 3AIOA 1ZK0A 2GMWA 1X3SA 4YUZA 5HKKD 4YIKA 2CNLA 3V1UA 4CE6A 1RHMA 4BV8A 2OEPA 2JI7A 2W6ZA 3T4XA 4AW9A 2IX3A 5EESA 1UBGA 1DC3A 1ZH4A 3HVUA 1K7XB 3IKVA 3OLCX 5LZ7A 8ABPA 2AE1A 3K3PA 4FR0A 3JQ8A 2AFIE 5I51A 2IYLD 1O54A 4KXVA 3WKCA 5K20A 4X91A 1S6YA 2PDAA 3VU9B 2WM9B 4JB2A 3SJCA 3AHJA 3BFVA 4FMDB 2YY7A 5G40A 3R7FA 1SU8A 5DGDA 4UOQA 2C3MA 4L16A 4ZAGA 2ASVA 1FJ2A 1XNHA 1XA0A 2GF9A 2ZG6A 1H2YA 1FFHA 3TR0A 3IV6A 3KLOA 4QM7A 4HAVA 3QG5A 1V7PC 1LSSA 1FJGB 4BVEA 4PS0A 1ZIXA 2VFAA 1W7AA 3K1TA 2ZPTX 1EFHA 1U1CA 2E6UX 5SZKB 3F6YA 3A6PC 2V7TA 2XTMA 1XZHA 2R7AA 2YZGA 1Z38A 1Y8RB 1SVIA 4PICA 4XCXA 1J1IA 1F2TB 1WDKA 3TOCA 4QJIA 3CH5A 4MGIR 1MJNA 2Z0MA 3BCRA 5FTKA 3KUKA 5GJBA 2WUEA 1U4NA 3F1KA 4H77A 5HIJA 3AHHA 3Q15C 4EJSB 2DXIA 4QGAA 4PVDA 1SR8A 3V8BA 1HYGA 3C74A 3F8TA 3R3HA 4LWOA 3EGOA 3T7AA 2QUIA 4KFTA 1BRTA 3U4GA 5MN5A 2EF0A 1SU7A 1SQSA 2ZJYA 4QT0A 3QE9Y 1QH8A 2G76A 2R7KA 1G5PA 4GRAA 2GPTA 2QYHA 2Z58A 3PJEA 2RARA 4RVUA 4OQXA 3SC4A 2VPQA 1U0GA 1XTPA 4F9FA 5B4UA 1I32A 3GQVA 1P5RA 1WXGA 3ABQB 4RSHA 1U3GA 4MVJE 3VM6A 1FLNA 3I4LA 2D5IA 3OQ1A 4GBED 4UM9D 5A3JA 1U4OA 5LUBA 2C2ZA 3CT4A 3GOQA 5K0EA 1RC0A 2WE8A 3CVJA 5JWHA 2W71A 1L4FA 2XA1A 5JD3A 1JJ7A 1Y8RA 4YMHA 4HB2A 4LE1A 1ZMXA 3HYNA 3N5KA 3V8RA 3RUDA 1OB5A 1T9KA 1GG2A 3E82A 1LPPA 5K01A 1N5KA 1IL0A 1WG8A 1SHZA 3DFIA 4NPCA 3WK4A 2HSDA 5KQRA 4QBKA 4LMAA 4FDVA 2VWQA 4EQZA 3CLTC 1DEKA 3PNBA 4CIYA 1XZ8A 2JBAB 1JAHA 3T3EA 2OSBA 4N18A 1U2RA 2O8NA 1JFVA 4QOGA 3PQEA 2DR2A 1VKZA 3TYXA 2XA9A 1FSGA 2P9JA 3O1LA 4I9NA 4QVKA 2XUFA 4X7BA 4RUKA 4UXHA 3V3TA 1LY1A 3OWHA 2EJWA 4R8SA 4AWBA 1IPEA 1ZJYA 3R2JA 1QNLA 2OAGA 1VPDA 2FJ0A 3ETHA 3G2OA 4QPNA 4F46A 3H87A 1VJTA 2VAXA 5ILGA 4MQ5A 2R6ZA 1M1NA 1T5HX 3JQGA 1X19A 1TVKB 2IYEA 6LDHA 4UBOA 3DTNA 2CSUA 3W2EA 2NTJA 2PIDA 1B1AA 3TCKA 1OLUA 1ZIOA 3HO1A 3PVZA 3WS7A 1BCSB 3CRQA 2Q0SA 3HKBB 4IVPA 5DM2A 1JPVA 2Z57A 4QVIA 3F9RA 4RTSA 1U5BB 3GLSA 1Y37A 3DD1A 2KPOA 3FSJX 4IWXA 4M60A 3PZRA 4BRSA 4G5QA 5DHQA 3L7BA 5IJ0B 4N39A 2AOTB 2BR4A 4FZ3A 4E32A 3I8XA 4Q00A 2ZSIA 4HTFA 2IHKA 2XGJA 3PQ2A 4BUJA 3HU1A 4D26A 1JEDA 1TIKA 4JLPA 2V7GA 1Z6QA 2X0DA 2VAPA 3COVA 1B0ZA 1T9AA 1IU9A 3KR2A 2H52A 4MV3A 2Q1XA 3V5NA 4MAFA 3CZ9A 1GG9A 1FTQA 4KSCA 3VU8A 3DMRA 3ZNPA 2BZ1A 1V2HE 3IODA 3NDRA 4DXHA 1SVWA 3VU9A 3FUCA 1V39A 4PGFA 1FXUA 3A9CA 4HFNA 4HYQA 2OYSA 3O2JA 4K05A 4XRRA 4P58A 4G1VA 3B2NA 1V9LA 2A1IA 5DISB 3QWIA 1R5NA 5FWYA 1V4NA 5CU7A 2HLPA 3T41A 1QKIA 3UK1A 2PH5A 2GO1A 3K20A 3FNQA 4NCAA 2FQWA 1T10A 3HEBA 2COKA 3ZHZA 2PRSA 4S05A 1IVSA 4IJQA 2OGUA 2AR7A 4QGSA 3K6SA 1DPGA 3E61A 4LS3A 2CL6X 1KJ8A 2VPPA 4A23A 2V6JA 4HEJA 5FBLB 1U2EA 2GDJA 1FX0B 2ZTHA 3QHAA 2DQYA 1T29A 2ZYHA 1QHXA 3QXHA 3WO1A 4RPKA 3M5WA 1K6EA 3HJGA 3ZNOA 1G0NA 1CP3A 3I32A 4RLHA 5C4MA 1H2WA 4GR9A 4GGMX 2GBGA 1Z08A 3AFMA 1YU6A 4BMNA 4DV0B 1L4HA 1YHYA 2GVZC 4H7HA 2QI9F 3OT4A 1CE8B 1JMVA 4RSMA 3ZHVA 3DLCA 2GBCA 2I71A 4B81A 4G65A 1LJ8A 4KPFC 2WHRA 4UEOA 2QAGA 2WSSD 3FNGA 2J3DA 2VKQA 2VXBA 4GBGA 3RFUA 3KQOA 3OT1B 1NW9B 3SQXA 1RJ9A 4QUHA 2O2YA 2P2LA 4G23A 4CDMA 4XYBA 4QOJA 3DKIA 4S24A 4CTNA 1V8BA 1VBFA 4P2GA 1SZPA 4JQZA 4RA9A 4O8ZA 1QQBA 4IKPA 1XWFA 1GDTA 2FR1A 1P5ZB 4TUYA 1LGYA 1JMYA 1U0SY 2EJTA 3C3PA 2QX9A 4OI4A 2WYUA 5B1SA 4P4UA 4TKMA 3UQZA 5I7UA 4BAZA 4JOBA 1O57A 2GOYA 3AYXB 2P4EA 2R1VA 4G5SA 4OATA 4LMRA 1FUKA 1G3IA 2LRHA 3A1VA 3LWBA 3AKEA 3WL8A 2BKXA 1MXHA 2ZTUA 3CRZA 3D8TA 2A57A 4JJ6A 5P21A 1KK3A 2Y27A 3ZWXA 4CQLA 3OE5A 2J8ZA 2BKVA 3HO8A 1D2EA 2P6MA 1C1XB 3DDSA 4TKUA 2FQXA 1JQEA 1QO7A 2WAXA 1S4MA 4LVCA 1MD9A 1IOZA 3VTZA 3AK4A 1T8PA 4G0YA 4GLFA 3ZKWA 2PPLA 2QSZA 3AFHA 3HP7A 3NIWA 4QTTB 4WV3A 5BWNA 1ZIYA 1VMDA 1HZJA 3RREA 2BM9A 3X1JA 1Z0SA 2EBHX 1KH2A 4F5EA 4D96A 1ZUNB 3IE0A 3NP9A 4KQMA 3IILA 3AUUA 4NS1A 5JAZA 5MDHA 4WLEA 4LJ6A 2FY8A 1BO6A 2GM3A 3ABSB 1YC5A 2WLSA 5IH3A 4UFPA 1UT5A 3MGBA 4ZYUA 2P9TA 1TLFA 1LRJA 2CF6A 3ETLA 3SVZA 2YR0A 4GMFA 3VH2A 3TECE 5AW8A 4GM4A 5KSPA 2J85A 2G04A 4IQ8A 4CIVA 3RWMB 4R16A 1UPFA 4A2PA 4L4YA 1XUOA 2PGNA 3LY8A 4YREA 2E89A 2EQAA 3ZWYA 3TTUA 3JATB 4C7VA 1ZI6A 1HX7A 1JU9A 3ENKA 4JBGA 2EATA 2FF5A 3OFNA 4WCFC 2A0YA 4ILKA 1ND6A 2VBGA 2XKBA 4E14A 1EHIA 1WVGA 4Q03A 4Z0NA 1II8A 3ZJUA 3ZEAA 2A9PA 4EJMA 1DXOA 2WIFA 4Y18A 4RULA 4LXYA 5TXGA 4YJGB 3TEJA 1SY7A 4X95A 3STUA 1XZAA 3AR3A 3MD0A 4XARA 3CMCO 4GPTA 5TMDA 5THQA 3SC2B 4LZWA 1X7GA 2R00A 4A73A 2HNKA 1PO7A 2XOXA 5FL7D 4B7AA 1UT6A 1KRHA 4MI9A 4XUDA 2P3QA 3Q12A 1HEIA 1L4NA 3AVPA 4L3WA 4J8PA 3LRTA 1I2MA 2P9QA 1DBRA 1W93A 2G77B 1VE5A 3GJZA 3LFHA 1VM6A 3CBGA 4QBGB 1XDSA 1KK0A 2GX6A 2JLWA 3SIPA 5KX5B 1NDUA 5EHZA 4G5HA 1RKXA 4KPYA 1ZK1A 3OO0A 4KQCA 1ZK3A 3O7MA 4P4SA 5KTSA 2AC4A 4LF9B 2XF8A 1FVFA 1NVKA 1RLTA 3E8MA 4QFDA 1M34E 1T1RA 1A95A 1VHJA 1VZ3A 2Q8QA 1IAQA 5JNWA 5J23A 4IS2A 1VDMA 3E7DA 1O6FA 3G8BA 4LGYA 5FUWA 1RKVA 5FWXA 5I47A 4NHOA 3UXMA 3OUTA 5HRAA 1S0UA 1BXZA 2JVIA 3BEDA 3GVHA 1YDEA 1VYHA 2XQVA 3MOIA 3P4YA 1A8SA 3QKTA 3CTPA 1W34A 4DM3A 3A25A 3D9QX 4LXQA 5BV0A 2CN1A 5CB4A 1KQOA 3SC2A 5F21A 3R7DA 3U61B 3JWPA 4MI6A 1YUNA 5AIAA 1N3IA 3GV0A 1CRWG 4WLUA 1TTPB 1C7QA 3ZJVA 2FEOA 2JHCA 3UAGA 1CUZA 3FJOA 3GPLA 4JC4A 4KE8A 2OAP1 2JCYA 2X76A 3K9HA 4M9XA 5L3QA 4J9VA 4LNUA 4HWOA 1LTQA 4OXIA 1D2HA 1MRSA 2NZWA 4KQFA 4NOKA 4RA9B 4ID3A 4RORA 1XD8A 2ZRCA 3SQWA 1X15A 2ZUWA 1Q21A 1MH9A 3VR4D 3VV2A 3BKXA 1NRWA 3ZGZA 4NBUA 4ODIA 4XIIA 3ZJ4A 4ENUA 4F2HA 1Q19A 3B12A 3WIUA 5H0IA 2VP5A 3H2JA 4I36A 4TMWA 1GQRA 3NNDA 1PR6A 3NV7A 5IN4A 1XJCA 4RENA 3C6ZA 5KYNA 2EP8A 4A9AA 1L7NA 1FJXA 2G1PA 3VR2D 1Z16A 2V98A 2AOWA 3RKUA 3UEOA 5JAPA 2XKAA 3QOXA 4UPDA 2HRRA 2XGGA 2OK7A 3FPSA 1Z88A 2D2EA 3NO4A 4BLPA 5LB2A 1P9OA 2Z8YA 1MAWA 3ZY3A 2FZLA 2KBEA 3OLXA 4ZICA 3ZHYA 1RPZA 3WNBA 3IAAA 3FKSD 4Y2JA 3FJYA 1GKKA 4X6LA 1C4WA 1SK9A 3UT0A 2Q4BA 1QTIA 1F3LA 3HI4A 4D8UA 4C04A 4DE5A 4JQSA 2GYUA 3NASA 5B37A 4C7OB 2XUHA 4YP6A 2QD2A 2P4UA 1RHQA 1KFKB 3ZU6A 5J2UA 5CHEA 4CMJA 1J0BA 2X8AA 3SJBA 3HLKA 2XYPA 3L8CA 2DHCA 1WL8A 2JJ1D 4MLDA 4BEJA 5J4KA 3ZY5A 1IYZA 3K96A 2FQ1A 3FVVA 3MD9A 2PGIA 4DQKA 3HXTA 3IULA 4LYJA 3IV9A 4MMXB 2KYRA 1WTAA 4N5IX 2FH5B 2R9VA 3HY6A 4DLXA 2YHIA 5EHIA 4AMBA 4AZ0B 2YOFA 1Z6ZA 4H08A 4NRDA 2C3UA 2O05A 2RBKA 5TARA 3OZ7A 3UXHA 4G0QA 4HH3C 3OEYA 5EJIA 3FMPB 4QYWA 3MEQA 4Z9BA 2OHXA 3OQHA 1YNOA 3TUIC 3A0RB 5K4HA 2PU7A 2JHAA 3O4VA 1KI6B 5ULLA 3QVOA 2VP2A 2YZKA 1YF3A 2VT2A 3KJIA 4LF8B 2QG9A 3H3FA 3K5WA 4E3ZA 2FP4A 5CD9A 2P3OA 1YJ5A 3UWDA 1F7VA 3C3BA 3TAXA 3KKLA 4W1RA 5EIEA 4IS3A 1YQQA 4NU5A 1UBTS 2WF5A 4OK6A 1U2QA 3H84A 1U2DC 1JSCA 3IQFA 4DCTA 3KJQA 3AB7A 4GOJA 2GLTA 3MWGA 2WM8A 5AWFC 3ROKA 3IUPA 3R5JA 5E7MA 5LUAA 4QYXA 5TS3A 3WMFA 4DA9A 3LVRE 3T0GA 2AXQA 2C07A 3DFZA 4Q9KA 4HN4B 4EYEA 1N1DA 1SXJD 5AW0A 5IJZA 4N4AA 3PDIA 4QHSA 5B58T 1BDHA 4I55B 2VT7A 1PDWA 3HP4A 3JZFA 2O2GA 4MOWA 1ZNZA 1WRBA 1SBQA 3HB9A 1GKYA 3EEFA 1VOTA 4C6TB 4RESA 1GPYA 2C3OA 3KEGA 4ALIA 1SWVA 1KERA 1DDIA 3CIFA 3GZNA 4ECAA 2R44A 5GAJA 3L6RA 4DJDC 4J7AA 1OOEA 2VP9A 4CODB 4KRYA 4F4FA 3WGUA 4GX2A 4WLOA 5ALHA 2IVZA 4V38A 3UW3A 4AU1A 4B74A 3UUFA 4U7FA 2BH9A 5FOSA 2DECA 2HRBA 3VDXA 1BX0A 3SEZA 4M3NA 2FPUA 5CNIA 3WA6A 1KI7A 2JK1A 3L6DA 4A0FA 5T3YA 4V3CA 2HQBA 1HE8B 3G85A 1HDEA 5IXSA 5JD4A 2FSIA 13PKA 4GP6A 4E1VA 1KY5A 3IT3A 2OGTA 2CFCA 3DF9A 5FI0B 4FYHA 5FULA 2XBUA 3DTVD 3SM9A 2TMKA 4IYRA 1PVVA 2R8PA 1XRMA 2OWEA 4XVUA 4RF5A 3QF4A 4YRBA 3GROA 3ZHTA 1OI3A 1YB5A 1PNTA 2YOGA 1GD1O 2W2PA 3E27A 4HPWA 4QEZA 4ZZIA 5KVSA 1QCCA 2G17A 1VBMA 4MGYR 4CT4B 2RJNA 5JVDA 2G1JA 1P0PA 3C5CA 1E2KA 4EY6A 1Q95A 4FQ5A 2V58A 5C5IA 2BJVA 1C3JA 3GR6A 2ZE6A 3OLYA 4HZIA 2NXJA 4GXTA 2Q3DA 1NAHA 1H94A 1PFGA 5DGTA 1AHNA 1BEEA 3TL6A 1D7OA 2WU8A 4PLFA 3KAPA 1ETHA 3GDOA 1O7JA 4FJ1A 3U7QA 1L4KA 2OENG 3BEOA 1KI3A 4HNRA 1T4MA 2IZZA 3VR4A 1NONA 1BJKA 2IIVA 1ECLA 3CB4A 3MTDA 2I9PA 4GKVA 1V3VA 3L6EA 4D0GA 2VTKA 1J2JA 5K8IA 2QIOA 2AKEA 2DHRA 1M6WA 3HO6A 3UB3A 5JTTA 3ITEA 3B38A 3HZHA 2DE0X 2GJ8A 5FOUA 4QYMA 3WWYA 5MN6A 2XVXA 1GXSA 2WC1A 2C2MA 4BVJA 4P7BA 2NU6A 2O5RA 2YW2A 4GRDA 2PU5A 1V11B 4AF7A 3ZDBA 3H1FA 4R51A 4NNJA 4IFEA 3C8ZA 2D2VA 1TUEA 4EYSA 4XSVA 4DOMA 2NV0A 1EXWA 3UXEA 3WNVA 2AMVA 5H9WA 4MVJI 1SZCA 4LRYA 2WWRA 3KELA 5LP6F 2JGMA 1CP2A 2X4GA 4WKBA 2FSGA 3SPXA 2AFIA 3ILHA 1AF4A 5AXCA 2FZEA 1KJJA 3P0IA 1I3LA 3QITA 5CIYA 4C4XA 4UBNA 1Y7LA 4B84A 5ILOA 3KJNA 1M5RA 1F0YA 4Q9HA 1TFUA 1B41A 1PNVA 4CWAA 5CB6A 3FPBA 2QX8A 3QE4A 4RYLA 3CSSA 1THTA 1ZCFA 3MYYA 1IXKA 1T2VA 5SY4A 3C45A 4X92A 2P4HX 3WGTA 1KSFX 1F4LA 3TNYA 3UNXA 3ZD8A 1J06A 1S89A 4HK4A 1R0XA 2CZCA 2QB5A 4ASUD 1NVFA 3DDZX 2H0AA 2QW8A 4OK3A 3P7MA 2QBYB 3U31A 1LLUA 4YJ2B 4IDQA 2NZVG 3C87A 3V9PA 3BOSA 3QZUA 1WB4A 2Z5FA 1XALA 1GPH1 5JI2E 1GZ4A 4BLOA 2BFCA 1B6TA 1PQYA 5DW0A 4KG7A 4L7QA 2UYCA 2GD1O 3WGVA 1E7WA 3BSSA 3D7NA 3ZI0A 1I7SB 3MWDB 2AVDA 2BGNA 3QTBA 1RI5A 1PV2A 3H17A 2CV0A 4EZBA 2ORVA 3EAQA 4CCYB 5AKZA 1HT3A 4ZYYA 4A10A 1M8FA 3NYQA 4BV2A 3DL4A 2P5SA 2Q4TA 3U0BA 4BPRA 1XNQB 1JLHA 4Y2VA 2BDEA 1YRAA 3PC8A 1NLUA 1QMGA 1XEXA 3UHJA 4C2BA 3VDQA 1BH6A 5JD6A 1SXJA 1XTKA 4OJTA 4EI9A 4YI5A 5DHSA 4MW0A 2C5BA 4O4HA 3QPUA 3CRVA 3F3YA 3KYBA 1W2HA 1CVLA 2JAOA 4ZZ1A 2X9GA 3ESDA 3VR5D 5ALXA 4I3HA 1BH2A 2ILTA 4P0QB 2JI6A 4MVJD 3I76A 1G16A 3RARA 2G71A 1CRZA 2C4TA 1VL1A 3DNFA 1XG5A 4TS1A 4MGHA 1AKNA 3OMWA 4AJ1A 3OF3A 5CFRA 2CNWD 2HBZA 2OCPA 2WF6A 2C8JA 1Y5IA 1J21A 1HFEL 2OQ2A 2B98A 2YIVX 5ALVA 4F1KA 2AZDA 4ARCA 3R74A 5KQMA 4OBXA 2PRKA 1IZ8A 1MA0A 2BGGA 3RU7A 5A0FA 5UKDA 3KIPA 4JT8A 5D5QA 3SEFA 3HLTA 4TT3D 3C43A 1U65A 1DJPA 3D6TB 2OZLB 1C41A 3HYTA 3SYKA 1COWD 1T0HB 2P2GA 3W5JA 4TLBA 5ESXA 1CF4A 2IHTA 3WJ2A 4DMGA 1NNEA 1DJMA 1UZNA 5ETJA 5T4HA 3LCUA 3F78A 4YJFB 1GQSA 1NVVR 3QXCA 3EXEA 1WNFA 2Q7DA 5JVDF 1E1DA 5KPJA 3WICA 5BNIA 4HPXB 2UZ1B 1V4BA 2AA3A 2EX0A 3OX3A 4PHFA 3SBOA 3GLKA 2JEZA 4YYZA 3GFTA 4PVCA 1OX4B 3LAWA 3RVBA 2GK6A 5DM0A 2GZ3A 1XDDA 1XJ0A 5E3HA 1KBOA 2E4ZA 4RXTA 3W8RA 2ERXA 3F47A 4F71A 2IYUA 5EN4A 1PKXA 3T99A 1U3FA 4DEYA 4CMIB 5J4VA 4HMOA 1YZLA 3NJ4A 3ZHQA 1Q1AA 2CJPA 1GYQA 4BC1A 4YPOA 3Q1LA 4IOKA 5TEVA 1IXRC 4L07A 3KSDO 3FGPA 4AO8A 1XCGB 1O0SA 1KDPA 3FRIA 3IJEB 2QRJA 3CPJB 3UT6A 1NMQA 2VPWA 3A0UA 2PZAA 5DHTA 1F5NA 3F96A 3P5BA 3LY5A 4XYEA 4A82A 5AXAA 2RI1A 2OAQ1 5C5CA 2RSLA 3K0SA 1ISSA 1PX0A 1NHGA 1UXGA 5CTJA 3PC8C 5FR1A 5AOVA 3RK4A 2X2EA 4AC9A 4EB3A 5BSGA 5M34A 5EKTA 2G5CA 5B55A 4D6PA 1SQ5A 1GAWA 2HU8A 5IVDA 2JFGA 1JDSA 1FMJA 2NYAA 4TLLB 1VP9A 3NHSA 4WE3A 1M2GA 2VXYA 1QU2A 2WAYA 1G41A 4GS5A 4KYVA 3BYZA 4TS4A 5DBHX 2QBYA 4CN8A 4QXRA 4RZ3A 4FLFA 5HCNA 4QX6A 2CLEB 4BBAA 4MNTA 2CJWA 3OY7A 3AJDA 1V5IA 1Z8DA 3FDZB 3Q11A 4EJ0A 1B73A 2VYVA 5FWXB 3JWIA 2GILA 1LX6A 2Z1DA 3U48A 4BVFA 4D43A 4RTRA 5CLIA 3TRHA 4DVGA 3DYVA 4HNGA 3UMRA 4D6XA 4BVLA 3HDTA 4JWTA 5A3QA 4DAEA 2GBFA 3DDNA 3DMDA 2X1HA 3X44A 2IW1A 1XYVA 1H3EA 5EJAA 4E08A 1MX5A 1OH6A 4D3YA 1W4AA 4B2YA 2A3RA 2PK3A 5FOVA 3FPGA 3K1AB 4QQKA 4RZQA 1FBTA 1QO9A 2X13A 3C8DA 4AZSA 1H4QA 1VSQA 5LMNB 1JU3A 3UUEA 2QRKA 4FYKA 4TGLA 1ZM3A 1OZFA 2PX5A 2EHJA 1GTJ1 2A6PA 4BLVA 1BA2A 3IVXA 1R4AA 3OF2A 3D2BA 3STYA 1QYXA 2B7BA 3W7AA 3TNFA 4V0RA 5B4VA 1MVLA 1GTL1 1NI4A 3B1FA 1KC1A 1DAGA 1Y6RA 3RHZA 2QAGC 4DA6A 2R62A 3EZ9A 4XJSA 5L3VA 2IEIA 1E2BA 2PL1A 4KGXA 3KE8A 4LYAA 3CPEA 4G0OA 2E87A 4LHWA 5JSHA 2OUKA 3FCUB 4Z4CA 2O3RA 1T8SA 1LXCA 2I6GA 1HG1A 4UPVA 1WA5A 1XWWA 2J5XA 3UGKA 1HETA 1E7MA 5TPZD 3LW8A 3U81A 3VU1A 3ZE7A 4DR7B 5A4DA 5AKIA 3R7WB 2X8JB 1EXNA 3I52A 4V0SA 4TKZA 5ECDA 4B32A 2ZJOA 3K1YA 3QW4B 3FMGA 2R7LA 2B61A 4XLTA 1V5FA 2C4HA 4J7UA 1F4VA 2QM8A 4FZRA 2D1RA 3AXSA 3MWYW 4L4ZA 3NKLA 3QX3A 2PQ0A 4BGEA 1JJBA 1C1HA 4JENA 4YS6A 3AR2A 1SURA 3I6YA 3BWXA 3O8OA 1X38A 3N6RA 4JJ4A 1D03A 4HH4A 3W6UA 1W36C 4LQLA 2M6LA 1EFUA 2ZYSA 4OFWA 3A1EA 3ZW8A 2IS6A 5AI4A 3G2LA 4O1MA 3PITA 3R0IA 1E6KA 4MTLA 4O2AA 9ATCA 4MWSA 3O1IC 5AKKA 1R50A 3BXFA 2B1JA 2I8AA 5K03A 4G4JA 1C2YA 2G9RA 3Q9UA 3ZK8A 4E15A 4HQLA 1KMHB 1QF7A 2FKAA 4HD8A 3WGLA 3KRTA 3LJKA 1U7WA 3F5MA 3MJFA 4D46A 4QRIA 5BR8B 2GLUA 3I53A 1OWPA 3ZD7A 1RVDA 1CR1A 2F3SA 1YJBA 2UVDA 4PRZA 3V34A 2WG1A 2KHZA 4N03A 2UXCB 1J2EA 3GU3A 5I6DA 2DWUA 2A86A 3A6FA 3TI9A 3EYWA 4CIDA 5JLJA 2CFOA 1VIYA 1Q0ZA 3QKRA 3E23A 3ZWWA 2IGTA 4C3ZA 4DJFC 5J40A 4YMGA 3C4JA 4CMAA 1U3VA 5D8DA 3TR6A 1HGXA 4AX4A 2FEPA 2ZS7A 3LIPA 2IU0A 1RQXA 2QAJA 1B8PA 4QA9A 4BFYA 2V8BA 3O82A 1GZSA 3QTTA 3IP5A 3DE7X 1ORWA 4BC0A 4G0PA 2CD9A 4GSYA 4KCGA 1MVOA 4F3CA 4NENA 1Q20A 2FXIA 3RK1A 3E53A 3HBJA 1H2ZA 1O9HA 2PWZA 1A27A 3WLTA 2YJ3A 3IR5A 2YC2C 8LDHA 5DHRA 2G0NA 3E1SA 3VMFA 8ADHA 1BCSA 1SCDA 1YRQA 3H0KA 1QORA 4R98A 3DM9B 3JQPA 5CDYA 1KI9A 1C0PA 1X1DA 3SHOA 3ABRB 4PC7A 1P75A 3K32A 4I4TF 3IDAA 3SBEA 4QOFA 4ENTA 2UVPB 2F1KA 4TZTA 1RQPA 4IXDA 5GVSA 4FUTA 1M5UA 1SKAA 3EAFA 3RCBA 4PTZA 2PVSA 5ALPA 2QXTA 3UF0A 4EA9A 4MV7A 1GCUA 3DW3X 5AVSA 2GRJA 5D5HA 1JHZA 1N2SA 1CR4A 3DWGA 4Q7JB 3O83A 5JNTA 1D4ZA 1T9GS 2P77A 1DT3A 3MJDA 4L3VA 3VC7A 5D7NA 4YAJA 4IXNA 1GL3A 1P4GA 1ZUNA 2C4KA 2Q9UA 4P3NA 4ZXPA 3SKYA 4D79A 2JLXA 1PSDA 4NENB 4OJYA 2ZRJA 3LLUA 5DEOA 4DBVO 5K0TA 3BSYA 4JP8A 3SLGA 4EG6A 5LLDA 1E4EA 2ZFUA 4TWIA 4GM0A 4YR9A 2ZTLA 2XE6A 5TQ2A 3WE7A 4RZSA 3EEQA 4AMVA 2JFNA 2A2ZA 2AN3A 3NBYC 1NSFA 2JLBA 2XGSA 3LGAA 2RBGA 1AQ6A 1RPNA 2R96A 3FTPA 1V9SA 1YC2A 4CLHA 5J47A 2WQ7A 1N2BA 1E6WA 2VZ0A 4YMSA 5J9FA 3EJ6A 3P2IA 4H6XA 4YCLA 1L5QA 4MUXA 5IJ9A 4V2IA 1EKXA 2DBZA 1ZD3A 3DEZA 1XQ6A 3W34A 1XV5A 2DZDA 2WZBA 4EDFA 1PJ8A 5JEDA 5CA1F 4WKGA 1UK8A 2XYGA 4TV9A 3DVSX 1AH2A 5ISMA 1KAEA 3NBUA 1II8B 3GAFA 5AK3A 2W8ZA 5IWAB 2RHMA 3EHEA 4DIOA 5ITSA 1J25A 2WKRA 1EM6A 2BCJQ 4PF1A 2VEOA 3F2VA 2BMEA 4LTDA 1WY7A 2LKCA 4J0DA 1L4UA 4LOIA 4DLVA 4EATA 4F0JA 1V6CA 5J4YA 5K3FB 1FYFA 1QV7A 2Y99A 3OZVA 2WKQA 4YP7A 4A26A 2TYSB 2GAFA 3SS7X 1W47A 4ESHA 3OJXA 1B1CA 3A4NA 3LHDA 1BVHA 2PVPA 1RPTA 5HW0A 1I0ZA 4G97A