1RC0A

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
b'ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rc0A00
4NV1A 4PZUA 3TQRA 2BW0A 1MEJA 4ZYXA 4TS4A 1JKXA 4YFYA 1ZLYA 4IQFA 4EW1A 3Q0IA 1FMTA 1RBMA 5J9FA 4ZYUA 4ZZ3A 3AV3A 1RBZA 3DA8A 4DS3A 4TTSA 1RBQA 4ZZ2A 4ZYWA 1S3IA 1RC0A 3W7BA 3OBIA 4YFVA 3LOUA 1GARA 5CJJA 3R8XA 5J63A 2BLNA 1MENA 3AUFA 4ZZ0A 1RC1A 2YWRA 4ZYVA 1RBYA 1C3EA 1NJSA 4R8VA 3N0VA 4QPDA 3TQQA 1YRWA 4QPCA 4S1NA 1MEOA 3P9XA 2GARA 4EW2A 1GRCA 4Q12A 4ZYYA 3O1LA 1ZLXA 4ZZ1A 4ZYTA 3GARA 2FMTA 1ZGHA 4ZYZA 2CFIA 4TT8A 1CDDA 1CDEA 3NRBA 3KCQA 3DCJA 4EW3A 1C2TA
chains in the Genus database with same CATH superfamily
2N3ZA 1DT5A 1K9VF 3I9V1 5DP1A 3UJAA 5HJ2A 4MQMA 3GD5A 4RENA 1V2HE 4GSLA 2HBRA 2Q29A 2HAEA 4M49A 5EPUA 5LMZA 1X77A 2B8EA 5M34A 1LLUA 2DU8A 4Y2TA 4YX9A 4WW0A 4P4SA 5LN1A 3QKUA 3TPCA 2A84A 5AW6A 3IMCA 3SJBA 5IJ0B 4UPVA 2QLLA 4LDQA 4MGYR 2AX3A 3R0VA 4RJ2A 1TZMA 1B8NA 1LVHA 4YQEA 1NE7A 2RHGB 4J43A 2B4TO 4YMSA 5JROA 3PZRA 3QI2A 1PX2A 3O8NA 5DN9A 5BR4A 3RE1A 1HE4A 1Z2AA 2JFOA 4ZCTA 4EITA 4IWXA 1O9BA 2NU9A 1EBFA 1M6HA 1NVDA 3UGJA 1NOKA 4J6FA 3BXGA 2XQIA 2XECA 5KYYA 3RIHA 4OHBA 1FFXA 2BONA 2Q4DA 1F14A 4MUBA 2Q6OA 1ULHA 1ZH4A 2QZ4A 3AINA 3I28A 2GNAA 2FZEA 4AG3A 4BX8A 5L7TA 1UXJA 2VJAA 1J7KA 3UWDA 1DBSA 2OAEA 2G1UA 4P2BA 4PFQA 4HTFA 2BBOA 5IANA 2IITA 3LUAA 1URPA 3M82A 3O38A 4ZCIA 4CF5A 5K6AA 1OVGA 3LW7A 4L9WA 5E3IA 1YZ3A 4O4HF 5FI3A 2LCQA 4F1KA 1TU3A 3QEJA 6ABPA 3HO1A 2Y1EA 1TM7E 4TSKA 1VKJA 1NAHA 2NXWA 1FNCA 1DNPA 5AP9A 4ENTA 1XAHA 1N8SA 3UXYA 4JUFA 4NY1A 2ZXUA 2QN6A 1SEVA 3V4OA 2IKSA 2ZIXB 1PV4A 2C95A 3I4CA 4LEIA 3EULA 2MDTA 5KKCA 3VX3A 2IODA 2PKYX 4MLZA 4YRAA 3B6JA 1SKAA 4RWZA 4CCYA 3LUGA 4H31A 4DMMA 1DKNA 2WLSA 3SIWA 2K2QB 2XLCA 4GMXA 1J49A 1GQFA 1MDFA 1K0FA 3L0ZA 4E03A 1HL3A 2IXEA 2JGMA 3CPSA 1WU8A 1IBMB 1T1GA 1VMAA 4LWPA 2FWBA 1EGVB 3EOZA 3HMQA 2E5LB 4Z4IA 1EPUA 4RJKA 5J5VA 1Y42X 3LZDA 3EDQA 3W8EA 2WJVA 2NPFA 2AG0A 4EABA 5J23A 3PUXA 1KR5A 1TW3A 1G8JA 1XSEA 4GUDA 3VI3B 3VUFA 2C4TA 3C97A 4ZCSA 1ILWA 3L6BA 5B3JC 1RFGE 1UQRA 4BQOA 2BWJA 4GZ3A 1CEEA 2F67A 2WHEA 2P9ZA 4IM7A 2LDXA 2GEJA 3PSAA 4KJXA 2DR2A 1KFBB 2ZI6A 3QUAA 3DVQX 3I76A 4PSKA 2FY8A 5JJLA 3UMFA 2WJAA 1SVIA 1PWZA 3A4VA 3KS9A 5CYPA 2B5WA 2ZSHA 5CYOA 2ANCA 4MW6A 5JAZA 4RK6A 3ZWNA 1P1HA 5M7EA 4A2WA 3W8FA 1SQFA 3CG0A 2RK6A 4ER3A 1MU0A 1T9DA 3EVCA 5G4LA 2UXBB 2Q7DA 1IOVA 3ZWKA 3FDFA 2J9ZB 2XBUA 4NKRA 2QTRA 1RI3A 1K5GA 1FRZA 2SKCA 2P5YA 4PYMA 3JQ7B 3UHOA 1ZMRA 2HL6A 3EGVA 1G5RA 2ZS7A 4WT7A 2H4JA 4H7IA 4NARA 4CI0B 4EIWA 1J39A 1IPFA 4PFSA 4UCXA 3KALA 1NN0A 4KIJA 1WEHA 3UMSA 5B1SA 8GPBA 2C9OA 1J5EB 1DQNA 3WGHA 1XCOA 2A67A 3DXZA 1CUAA 3WV5A 4U8GA 2LUOA 1WF6A 2HIAA 4TKVB 1XXHB 1ZZGA 4CKWB 3GCXA 2CGEA 3ZNPA 5I9BA 2G8LA 2CDBA 1YGPA 5BP7A 1RHJA 1HYHA 3AHIA 3K5WA 1P19A 4DEXA 4DLRA 2HF9A 1FDVA 2Q5OA 5CDYA 1H5UA 1RWPA 1XROA 1QGED 2C5HA 2BCJQ 2J5RA 2JFGA 3N5KA 4P5DA 2AGVA 3H5WA 5TT1A 5GVSA 5JFGA 4AKHA 4JROA 2VJLA 1ZK2A 4QECA 4FQ7A 5FKJA 3S7ZA 3A1EA 4IEIA 3L6CA 4ZAYA 3SJUA 2ZWPA 2REBA 1C1DA 4CE6A 1NWCA 3MOIA 4N03A 3SJZA 4MA5A 1HL7A 2GXUA 4RO0A 3ZJ5A 1AQIA 3IEUA 5LQCA 2BTOA 5K0ZA 2D2IA 2CNWA 4AKEA 1C2YA 3VAYA 3QM1A 2OYCA 1KY5A 1O4VA 1W9MA 2ZIFA 3CLHA 4GM1A 2EX0A 2FWJA 5J63A 1T91A 1RC8A 4LZNA 3E7FA 2IOFA 1FPMA 4ILKA 1S2IA 2XXAA 1MQAA 3BVPA 2C4WA 3QXJA 4QG7A 1I0IA 4DVJA 1HZZC 2IYVA 3F6CA 4QG3A 4MGKR 4TN5A 1OYOA 2CCGA 3ZHQA 3LM8A 5EMMA 2HQBA 3COVA 4CKBA 4Q1FA 2WICA 4MQEB 1RPAA 3DVLA 3MTQA 4MMXB 1KO7A 4FOOA 4I55B 4N48A 3TGLA 1NPDA 2XUHA 1H6AA 1QGYA 2GM5A 5KNDH 1M73E 1IH8A 1WXIA 1COWD 2RCNA 2XNJA 5KDLA 1YUNA 2GCEA 4QDOA 2QUZA 1QH9A 3QGMA 1J06A 2NSDA 4TL7A 2I4MA 2HCRA 3O84A 3SR0A 4IDNA 1OA0A 1TIKA 2C8VA 2W22A 4RZQA 2PV7A 4ZDIA 2WYUA 2AKAB 3THWB 1H3FA 2CHVA 2ZI3A 4B7XA 4FE4A 3I5AA 3P0EA 2OM6A 1FS6A 1B74A 1LGYA 1Y4UA 2FLKA 3KQHA 2HT1A 4WH0A 4WPGA 1WA5A 5F51A 5JBQA 1EBBA 3KLOA 1U0LA 2YOFA 4PIPA 4G26A 2QZJA 3NVMB 3FHCB 3GFSA 3VBEA 3I9V6 1E2GA 1CHDA 2OYSA 4I5IA 4BE4A 1N6OA 4RE6A 4GPAA 3PTAA 4RVSA 4X3CA 4LPSA 2JD2A 2C96A 1S8AA 1Q0ZA 3GGGA 3NGXA 1WIWA 4DHWA 4R9UC 3S2FA 3WJ2A 3NB0A 4Y6SA 3V4ZA 4QWWA 5BORA 3F5FA 3NZEA 4MEBA 4P92A 5C8ZA 1E7YA 1TUBB 4K81B 4PYRA 3G88A 4DBLE 3C43A 4FLMA 4TTIA 4UBLA 4R05A 1ECPA 1MVOA 1NVBA 2AE1A 4GPZA 3UB3A 4N5DA 3H11B 1T25A 1TJ3A 4MVYA 4OAPA 3U62A 1TKCA 2II6A 1X9GA 1QUEA 1PFUA 3UWMA 5FXMA 3V3KA 5KOHB 1RI1A 3QU5A 1XZBA 5A6SA 3PQ5A 3JQAB 3PA8A 2EFCB 1WZCA 4QD3A 4MRSA 3NRJA 1L3BA 2V0NA 3AHHA 4JVMA 4NDZA 2YXLA 2O2JA 3ZWMA 4Q00A 2NQ2C 4PN3A 1FRNA 2AFHE 2CUKA 4NMWA 1KA9H 2EWVA 1YZKA 2HCTA 2VUIB 2ZG6A 3T38A 2PGXA 3B53X 4QM7A 3TRIA 1EFAA 5G1OA 4P3NA 4DW8A 2P1DA 2BGNA 2OENG 2HDNB 4URXR 3UKJA 4DEVA 2H5IA 4EUSA 3NHAA 5H1YA 1WNTA 3PWSA 1E6WA 1ZY2A 2BN4A 4BZPA 1I2AA 4DQKA 2FJPA 5IWCA 1NVMB 5KWVA 3PHJA 3QFRA 4RW0A 5SICE 1E5TA 1RBQA 3ZE1B 3H5NA 5JJ5A 3A28A 1CY2A 1XB2A 1DEXA 3ZGYA 1QG2A 5JAHA 4YJGB 2FPMA 4W82A 2AYZA 3I4LA 1T15A 3ZKWB 4C7OB 1B93A 2ODNA 2XNHA 1OCEA 3C3EA 3EBOA 3LP6A 2GFHA 3CUYA 1FDWA 3QMWA 4POAA 1ADJA 3MJ4A 4AAYA 2PZKA 3G5MA 3MFQA 5KI6A 3TL2A 1R8XA 1UDBA 2Y1CA 2JKZA 2PXXA 4OHYA 5DVZA 1IUPA 3HVUA 3EEYA 2Q0QA 4IOKA 4BTVA 2BP7A 1BOFA 4J29A 2OUIA 2FSVA 3R8XA 1Y9JA 2GM3A 8ABPA 4K9NA 4X45A 5DPMA 1DXHA 3HS3A 2NZVG 5HGJA 2M6RA 1D8TA 4D9BA 2YXNA 4LSGA 3HUDA 5A0VA 1FVFA 4F5WA 2YZNA 2HJSA 2XUIA 1DC6A 4WE3A 5CIYA 1HNZB 3D7MA 4NFSA 2FCRA 1CE8B 3F7OA 5IJ9A 3MWDB 3DEFA 2VZ9A 4GZ5A 4AFNA 1C9YA 5DBGA 3O95A 4L78A 2DX7A 3B6MA 3KZNA 2PS9A 3PVSA 4L5BA 1RWKA 3C3DA 4D2IA 4D5EA 2YFHA 5FPHA 3BZBA 3ANLA 2P1RA 2WJ3A 3GNQA 4BNKA 5K3EA 1HLDA 1KMCA 5DLDA 5KNCH 1YL7A 2GMWA 1KEKA 1CPYA 4YN3A 5JS2A 1RJ9A 2NQTA 4QODA 4XQ0A 4AY5A 4PG5A 4EZIA 3PS9A 3RAGA 5K0TA 1QHHA 1A4RA 2YWBA 3K9FC 5AM4A 2GN8A 4U3JB 3S2YA 5DZSA 1KKLA 1Z7GA 3DDCA 2O54A 1W2GA 2FKNA 1J7JA 3U3MA 4MWTA 1ZHFA 4V03A 5ESXA 2Y92A 4E4RA 4F21A 1M5TA 1S2MA 4NC9A 3WFJA 4RIGA 1DWPA 3M5WA 1LW7A 1RHRA 2Q5IA 3AERA 3ER8A 3IO3A 3GEIA 3PUYA 3PFIA 3ZV3A 4BMXA 2X77A 4PZAA 5JCPA 2IE0A 1YV9A 1OPXA 1TA4A 4NU6A 4F72A 2D3TA 2FX3A 1JAZA 3HMKA 1B42A 3EVBA 1E9FA 2NXCA 5DGDA 2NPIA 1UBUS 3BAFA 4AP6A 1Y6QA 1D0IA 3VC7A 4B3SB 4LKRA 5FH9A 3UY4A 3EZNA 3U7QA 3JQEA 1X13A 3UJHA 1B15A 1HWYA 2MSEB 3UK1A 3ZR4B 4X85A 3DVRX 4KMRA 4EW3A 1XOIA 2REQB 3LAWA 2PMDA 4K9QA 4EELA 4EHHA 3W5CA 4GOOD 1AB6A 5AOBA 1RRVA 4ND6A 5BYBA 5DM70 1X8KA 2WTBA 2UVPB 4MW4A 2CZCA 5F2KA 3ESRA 4DUZB 3WHLA 5A5GA 2KBFA 1K7XB 3D6TB 5JXWA 1J24A 3VR1A 3ZWAA 2QAGA 5GONA 1FJHA 4QTYA 1N8TA 1FVXA 1RBMA 1DXQA 3GVXA 3QEMA 4D8VA 3L6OO 3HADA 5DHPA 4WBNB 3BAZA 3DDNA 5DJ5A 5K7SA 3D3QA 3OIFA 1BCRA 4IUBS 1KFKB 4J3JA 3STVA 3DVAB 3P9SA 1IZ8A 4X00A 4BMVA 3BF8A 1Z0SA 1PSZA 2QZ9A 2JRLA 4X63A 2ODQA 4J0FA 2Z9CA 4F93B 3HNPA 1YBAA 4FYVA 1FFHA 3PVCA 4QJ5A 1OU4A 5TXGA 4PZLA 3PF9A 3U13A 1JNXX 1QM5A 4C7BA 5LM3A 4DV3B 2QRKA 4HDKA 5LU9A 4PZZA 3F73A 3RVOA 4FLFA 2OD2A 1PJLA 2AYXA 2YXBA 4IPTA 1E79A 1PUIA 1OXBB 3QTTA 4MP3A 4UFNA 1OIXA 3RVDA 4E70A 3ET4A 4UHHA 5LQNA 1LV7A 4RANA 4ENUA 4OLBA 4B82A 3E9YA 5C5IA 1OIVA 4ZO9A 5CFPA 4IRXA 4KH1A 1KQFA 1M9NA 5JQGB 5IDQA 4X6LA 4FHZA 1E5VA 3IP9A 2UYQA 3D4OA 5DHUA 2AJTA 2V9PA 1AZLA 5CXQA 4LGMA 5EXXA 1CS0B 4YJKA 2H1FA 2REXB 2W83A 5LZ9A 3HXPA 2DFVA 5LB4A 5EHNA 3VYVA 1W36C 2J3KA 1UM8A 1EX1A 2J7KA 3LUDA 4H0CA 4XUEA 2QROA 3ZZ1A 2DF8A 4DLZA 3SF8B 2GEDA 4YP0A 3FOBA 2AMJA 2FG7C 1LQUA 2D74A 4R9RA 3BEDA 2C4VA 4OQYA 4NG4A 1V1RB 4WFKA 1BCSA 5E1BA 1YK0A 5JNLA 1H0KA 3HLYA 1T2UA 5AO9A 1NC1A 4I8XA 4B8ZA 4KXWA 5F1OA 1QF6A 4FR2A 2ZYHA 4FYYA 4JUDX 1CQIA 1NVEA 5MN6A 4PX5A 9LDBA 3ICCA 1OXVA 3C45A 1YRHA 4XQCA 2X5OA 2FQWA 3LE8A 4MKXA 3F8WA 3PDJA 2JCGA 2P8JA 3KSMA 1H5QA 1YR8A 2NNLD 1UUFA 3OMWA 2OSVA 8ADHA 1BFDA 4JQZA 4LHZA 1ESDA 1EFDN 4GX2A 4MR8A 2G06A 4N5MA 2GJ4A 3QTLA 4XYGA 1HDRA 1U0FA 3KYDB 3PPXA 1P1FA 1RQPA 3FNIA 3N8DA 4I0WB 3E8XA 5HMMA 5A4FS 1X1AA 1DO8A 2Z95A 4G84A 1UC4B 4YV1A 1HRKA 4FSDA 3EIOA 4F2DA 2AG1A 3EEQA 5KAMA 4BYMA 4CMIB 1XCJA 3U6BA 1OWLA 3KV3O 1TJ4A 3QH4A 4UM7A 4A6XA 4LZZA 1V16A 3FMFA 2B82A 1V3TA 3CGGA 4HSGA 5K0GA 4N65A 1NW5A 4QUJA 3V48A 4X8LA 2GZDA 3T5AA 5JCJA 4XZ3A 4QBKA 3HKDB 3DMTC 3ORQA 2HDHA 3MTGA 2OKCA 1N2EA 4II2A 3VJKA 1T36A 2YX1A 1PT5A 2VPTA 3H6GA 5JPIA 2QT9A 4E5PA 2WWHA 2W6OA 1KERA 1EFVB 1VLHA 2XNCA 2RKWA 4S1WA 2FLWA 1KDZA 2VAWA 4BVEA 1JSLA 4KYIB 4XWAA 3HBJA 5FL7A 1UJBA 3UPDA 4A8HA 4F6CA 5DSTA 1JLSA 4I55F 1EAMA 4O4LA 2W4MA 3E1GA 5DHRA 3ZQUA 3HY6A 1RBZA 1P5FA 1Z17A 3EXFB 2NACA 2WQ6A 5A4AA 3KZVA 2R8BA 2QX4A 1R7RA 1G291 2VRCD 4CYMA 4X1OA 5FQNA 2B7LA 3U4QB 5C8XA 2BHTA 1QOQB 1G3UA 2RHJA 4X1KB 4X90A 3SSNA 2OVBA 4JLKA 2ZAOA 4N5IX 4ER7A 4ZAWA 3JWHA 4Q24A 3OI7A 3DR5A 3I2HA 2XUAA 3TB6A 3IA2A 2IHUA 2BEWA 2IDKA 2RK3A 3AH8A 3E81A 1ZNWA 4M9QA 4WLOA 4OB6A 5LD2C 3AEQA 1VJTA 3AR2A 1JZQA 1W5TA 3AHDA 4OXQA 3LW8A 2XA1A 5IM4F 4U9UA 3U3ZA 4L8WB 2G4CA 3JYQA 3BCSA 3CBGA 3DYBA 3QE3A 3HWSA 2ZQ5A 2C7RA 2BFDA 1E66A 4G56A 2XY4A 4HX5A 4ME6A 4C4XA 5T4FA 2Q2OA 4Z86A 2J31A 1GFSA 1UBTS 4MO2A 2VOEA 4XWKA 3AVWA 1QX4A 4CLOA 4AKGA 1Z5OA 4FYXA 4JELA 3VZPA 3L06A 2Q41A 2ON6A 4MV5A 4XAQA 4LFBB 1UKEA 4QJIA 4AJOA 3U31A 2C9YA 5MFZA 1LK7A 3H9QA 2O4CA 4UEJA 3RR2A 1Y6ZA 2C3MA 2QT0A 3FWHA 4N9QA 1L5QA 3DZKA 5GV8A 5AR1A 3OHPA 3IDQA 3JQGB 4IGEA 3EDRA 4P83A 3WYFA 2PX4A 1HMYA 2P7HA 1Z4LA 3LWNA 4GWKA 1GZ4A 1ZRMA 2OCYC 3AR8A 3IVXA 5T7BA 1Z2DA 2ZSDA 1G8MA 3FDXA 1ZXLA 4YRZA 4UE6A 2I2DA 5AVUA 2A1UA 4D8XA 1U9YA 2POCA 4AKTA 3KDPA 2NV2B 3HI6A 1GZ3A 4XLZA 3NT4A 3U7IA 2BI4A 2JLCA 4AIIA 1V6AA 2G5GX 5BSEA 2WQZA 3JD2A 1RHKA 1UEXC 3EISA 3TQTA 1XZEA 1CUYA 3I6IA 5T57A 2X1VA 2BZGA 1M7BA 3S27A 3NHWA 3ZTWA 4IO0A 3JALB 2BFMA 2IYWA 1OH6A 1A69A 3D6HA 3P4UA 4ONEA 3RS2A 2I71A 1FP4A 4D6XA 1DJMA 4IRMA 3F0TA 2GNOA 4OD0A 3B1FA 2Q3FA 3OICA 1P7WA 4L72A 3TVDA 5FBQB 3T54A 1KYQA 2IEGA 2J59A 3NIFB 3OZRA 4K9MA 2Z8YM 3BXOA 3RS0A 5HNKA 2OP0A 1GKIA 3RROA 1HTBA 2AEJA 4CQMB 1ES9A 4MIEA 4RH0A 4FDLA 5HRAA 3MB8A 3AHJA 4CMHA 1XIVA 2I34A 4NHOA 1OXSC 1H65A 1F38A 1GGVA 2ZYVX 5ARBA 3FYTA 4C2UA 2HBYA 3QBVA 2JA2A 1L5OA 3H2IA 4BJ1A 2PUVA 3ICPA 3D4LA 2H65A 2XCQA 4LI0A 2H8GA 3QLJA 4TL6A 4TXHA 3UKDA 2BZSA 3LBHA 1M2VB 4WACA 3DTVD 4L50A 3WQBA 5HQ3B 3AFHA 1FMTA 2HRQA 1L1FA 1Y6FA 1FTNA 3DXYA 3PYLA 2AOVA 4YJ3A 1H1LA 2AN4A 5KBYA 5DNVA 4F8EA 1P4JA 3NIBA 1K3FA 2JJ2D 3WLSA 2PKCA 2G80A 2H11A 2C2GA 2VWGA 4RNCA 1RKUA 4W5HA 5J1TB 5BR1A 2FH5B 1RPZA 4UM8B 4GMDA 3ONVA 1I3MA 4NSNA 4V0LA 5BOVA 2KM1A 1U11A 4I1UA 3BT7A 1KMNA 1YU9A 2QNRA 4Q3CA 3ISVA 4BCBA 1U2PA 3QE0A 3PEWA 1EZ4A 3QLVC 4ZV7A 2CJXA 1KEPA 2ZE8A 3QYAA 3O8BA 3JRNA 2R00C 4RZXA 4XR4A 3IELA 3ZOKA 2AN5A 2AN1A 4IJ5A 2HFJA 4D8TA 2QUKA 1I36A 2Y2UA 2PL3A 1LPPA 3CW8X 2YWCA 3LOUA 4IZIA 1KSFX 4JDPA 5K0SA 2QBYB 3ZY5A 4OQPA 4RJJA 2PQ0A 2KSQA 3F3MA 3K8YA 1NNI1 4PRZA 4Q3EA 4QUHA 2PANA 2ZROA 2GXSA 2G70A 4EB0A 4TQUS 3PR3A 3UV7A 1NVFA 3G8YA 3A6ZA 1J2TA 3CUKA 3DV0A 2JH3A 2VSXA 1UR5A 1KQNA 1NUQA 3QRWA 1Q0UA 3BXXA 4RFSB 4CDNA 4XVCA 5D51S 1ISFA 2R5NA 3WICA 2GEBA 4U5QA 4UOEA 2YHAA 3EQ6A 2O3JA 1MTOA 3FNFA 3VSAA 4HF7A 4N7RA 5AUOB 1DJLA 2GBLA 1WULS 3DYVA 3EWAA 1YI0A 1JF8A 4BFLA 1Y1TA 5JBNA 2GJSA 2HI0A 1CCWA 3M6MD 1Y1PA 4HX9A 5JNSA 5BQPA 2HXGA 4L9RA 1EXMA 1AN9A 1ZNZA 1DUSA 1FYEA 2C3YA 4PFKA 4N5LA 2QVCA 4JK3A 1LJ8A 1VSQA 1TZBA 2EJWA 3MGGA 4GI7A 4QO7A 4JR1A 4WBNF 3A25A 1KVRA 5D87A 4IDEA 2B37A 1H2HA 1LC0A 2Q0HA 3NJ4A 5T3UA 4YT4A 2D00A 3O8QA 1TUIA 5H5JA 2PKWA 1KJNA 2GYUA 3E18A 3NBQA 3MWGA 1J99A 2H18A 1E0KA 1JHXA 2WWRA 2YWEA 4EZBA 1XBTA 4FKZA 5B4VA 5LFAA 3IB3A 3E58A 3WGOA 3WP1B 4JI2B 4KR0A 1DAPA 4RESA 2Y1DA 2RAFA 2W11A 2GR9A 3IO5A 3HUEA 4O2RA 2ZI9A 2ZITA 4BFUA 1IIBA 2X7XA 1JKIA 2QDKA 1CDOA 3C5HA 1XNRB 4P2GA 1BWPA 5HA5A 3MA0A 5AW3A 1TMYA 1WB4A 3D7KA 4M22A 3DB1A 2ERCA 3E3AA 4P4GA 1NY6A 3WYNA 3ZWOA 1JQDA 2OK8A 2OGZA 4HUQA 4YGXB 4TQ9A 4FDUA 2HSGA 5JQGF 3AP3A 3DAPA 3DEHA 2IU4A 3UAOA 1X8JA 1X7WB 3BDIA 3LXMA 1EUCB 4QL3A 2I9KA 1ESZA 3DFIA 4HQ0A 2UYCA 4TS4A 3T9FA 3F96A 5KYKA 1PG2A 4CHGA 3OZIA 1FK8A 4MWBA 1ITZA 4P3YA 5EMLA 1GRRA 4CBVA 3RS3A 1MJ5A 4GMKA 2VUTA 4NIMA 4UNPA 4ASUD 3A1WA 2VZEA 3G9ZA 1E8NA 1I6WA 2H9AA 3INGA 4DADA 4FSXA 3T7AA 2HSDA 2WP0A 2OPHA 3TLZA 4F92B 3STTA 1DC8A 1ZD9A 1SAYA 2E9SA 3NH9A 1L4BA 3L7BA 3TLCA 2IHBA 5CG1A 4D4HA 4LDZA 3V00A 3QOXA 1W34A 4OHOA 4M8IA 4QJBA 2FQYA 1GZHB 1UT5A 1BROA 1XEXB 2V7XA 2GWRA 4P7BA 5REQB 3KE8A 5DX0A 2WQ7A 4B4KA 1E20A 4F9EA 5I7WA 3FF4A 3BYZA 3KQKA 3SLGA 3SSMA 4D6PA 1K08A 3B78A 1EVLA 3VA7A 2I1QA 5E38A 4LJAA 2JLBA 4M1EA 1T8TA 3OAAD 5EHQA 3PDWA 4BP1A 1H69A 4BNTA 4IIYA 1NFQA 1TGYA 1O08A 2HH9A 2RDMA 3T1NA 3WP0A 3L4JA 3CLUC 3ZDDA 4TV9B 1YKGA 3KZMA 4RDXA 3QP9A 1PI3A 3TDMA 3P26A 5CH8A 4Q3KA 3ZUGA 4D1YA 4KE6A 2R11A 3W2GA 4HQOA 2OFOA 1NF8A 1Y3DE 3AESA 1QK3A 3EGOA 5BWLA 3HVIA 1P18A 2HMWA 3D6MA 3ZZUA 1UM9A 4PSCA 5DM60 3NAZA 3KM0A 5EJ7A 2Y2VA 4RETA 2A0YA 2W2LD 4KSYA 2CMKA 2X0FA 1EFPA 3D3WA 3TJRA 1A5TA 3QPCA 1GITA 4HVLA 1DAMA 2C5AA 4GP9A 3CJQA 1AKUA 4NS4A 5GADl 3VR4D 1G5TA 1E3IA 1XI2A 1YRAA 3TBFA 2DKNA 4WASA 2BFBA 4EUNA 1VSBA 1R00A 1IWPB 1DQZA 3GUZA 3N2GA 3DBLA 5BN3B 1K6EA 2GFQA 1Y80A 2QMQA 2WVGA 2ZTSA 5HDQA 2D0PB 3JVIA 1AZWA 4DM3A 5FPKA 1SWVA 4OJQA 1QAOA 2A9QA 3O9VA 2CNBA 1RXWA 1SC4A 4N0MA 4LIPD 5JD5A 4HG2A 1PW7A 1KVSA 2FPRA 2C9DA 4B9AA 4UFPA 5D85A 3GVHA 3OIDA 4X20A 1Q7EA 4IW3B 4EL5A 2JGDB 1UP4A 3D4IA 3H04A 1LTQA 5F9HA 3SF0A 4HK4A 5CFLA 3MCTA 4L76A 2K7ZA 2XMZA 3GLRA 2QIOA 5G3ZA 5H80A 1U0JA 1TB4A 3GIDA 3RHSA 1F06A 4ZGGA 3DTTA 4HEHA 4J0GA 4QEKA 4XXHA 5CX1A 5C7YA 3RYCB 1CS4C 1ZUHA 1I14A 5CVJA 1MB9A 3KTAB 3V6LA 3EBPA 3LPCA 3JQRA 3P9NA 1KWGA 3W8NA 3HI4A 2VCEA 3Q40A 1SKMA 3O3NB 3OZAA 4NBTA 1J90A 4N01A 4G1UC 4OJNA 4WOKA 4XDHA 2GN6A 3EIWA 3JS5A 2PFGA 1UL1X 1EAYA 2G67A 1CJKC 5IXSA 4XPZA 2FPGB 2ZIEA 1KAQA 5EQFA 1KZ6A 1NVAA 1RCFA 5B53A 5I5EA 4Y7DA 3WRXC 3EPKA 2BIFA 1EESA 5LBIA 2EFHB 2JFYA 2NUTB 2D7CA 2BL4A 2P2LA 4PV7A 1ODJA 3JSAA 2FEKA 4OH1A 4IL5A 4BQRA 1VMEA 1VPEA 3TYXA 4DLNA 2XTMA 4UXIA 2QU8A 3SC3A 1GYRA 1XEFA 1YDWA 2W0SA 2XOXA 1U0RA 3NWPA 3O4RA 4A92A 2PGDA 4RTSA 3TXAA 4ZICA 3CZ5A 4OV6B 4LMBA 1OAOC 4NMMA 4F85A 5JNWA 4EW1A 1J0XO 1T24A 1NQVA 3CTPA 2O2CA 4NNPA 1U7OA 2O8FA 3N2NA 1E2EA 4X7RA 4R98A 1MUUA 2FTKE 2X42A 5FUXA 1LQTA 3IV6A 4ZI3A 4BKPA 4DMGA 3W5VA 2SCUB 4FCVA 3MMPA 4JBWA 2Y1GA 2QN8A 3I5YA 7REQB 4R8MA 4JLOA 5EJAA 1U5AA 1YI8A 3IHKA 4D9CA 1U04A 4UMVA 4ATNA 3DEYX 4FXPA 2DP4E 4A8JB 1PFKA 1NOIA 1TVKB 1OVMA 2QOEA 3WLAA 1M66A 3A10A 3CF2A 1IN1A 1FBTA 1MVNA 5C7OO 1KU6A 3IUEA 4P9NA 3ZHZA 1PD0A 4FCTA 5C5EA 5F3DA 1O1YA 2XMCA 3KEGA 3ZDZB 1KP3A 3EPRA 2X6TA 2BTQB 1NX6A 1AXRA 1JQ3A 1IJKA 3HU3A 1NZFA 3QBDA 1RCTE 2ZTLA 2RHRA 4A5SA 3KXIA 2PCJA 1T5OA 3INTA 2JHGA 2FDRA 2HOQA 2QQ0A 3CXRA 1WXQA 4GL4A 3UJBA 3IEPA 3I52A 4L0MA 5ALLA 3S5UA 3DV2A 1JEYB 1F51E 3EDMA 3CRMA 4PQEA 1FU4A 4HR7A 4Q1CA 2HA4A 3ROQA 4AJNA 5I3CA 4PQFA 3B3QA 3H42B 1ODFA 3L43A 4ND2A 4FHGA 4M1MA 2PSDA 1RU3A 4QTUB 1DBRA 4R2XA 3AHEA 3MMXA 3BH0A 3ODPA 2YVQA 3F97A 4AECA 4AKIA 4N5NA 1KI8A 2VTDA 3KPVA 4FYHA 1KWKA 4CFZA 1JHMA 4RTNA 3JWJA 1E0JA 4JCCA 1Z25A 3VH4A 1PDOA 2DWUA 2ID4A 2IXBA 1DHTA 5ESDA 4XFDA 4JLMA 4O4IA 5EY5B 2N9UA 4FIDA 4JB2A 3D3NA 3CXUA 4QGHA 4D4MA 4DPLA 3D0KA 3LBNA 4QDUA 1DAGA 4X1IA 1EWRA 3Q6MA 1PJ4A 3WMWA 4JXZA 2JJ1A 3CNNA 3L8FA 1WY5A 3KL4A 1QHGA 4OYRA 1PO7A 4J0EA 4QUIA 4KHPB 4E22A 2V4UA 4IDDA 5BVGA 4X60A 1ONSA 4DSUA 2QN3A 1X7YB 2WD7B 3DPSA 1CNFA 3L7NA 4Q0MA 1Z8FA 5A1JA 3ZGLA 4M38A 4CLRB 3KT0A 4HEA6 1W4AA 4BMOB 2DWPA 4L7VA 2DY1A 4DC9A 1IAVA 4RBNA 3WIDA 1GNRA 2H92A 4Y0AA 1ONOA 4CPDA 4MW9A 1JVSA 3GUHA 4V2UA 1AF7A 1IE3A 2CK3D 1OH7A 1PRYA 1ZO8A 3CR3C 3UXHA 1FNBA 1AMUA 2G76A 3DEAA 5BNFA 3U49A 5CDFA 3ZU6A 4C1NA 3AUUA 3O21A 1SD2A 3G59A 1XNGA 2CWWA 1D5CA 3M6UA 5EWMB 5JC1A 2EQAA 4OU5A 5KYUB 3A1CA 3RKSA 1EM8B 4JVNA 4F1WA 1C1XA 3UAZA 3E9DA 4B4OA 2IP1A 2RGYA 3C8MA 1F60A 4QAJA 3NTRA 5TX7A 2YWDA 4MWDA 3RVQA 1IZYA 1M7GA 2JASA 3V2HA 2BFEB 4KITB 5D5PA 5IC6A 4HWPA 5L45A 2J67A 4JI4B 1AK2A 1JDZA 2BUAA 3NP7A 4IIHA 4I4IA 2YJ4A 3AHFA 4RVGA 2VP0A 3WGNA 3S2EA 2BH9A 2NU9B 3O47A 1EUQA 1RS0A 2Q4EA 1SZPA 3M9LA 5H0IA 3TJZA 3UICA 5KYYB 1YA6A 5DW0A 1SPBS 1U3UA 3W4IA 1K6MA 1AKYA 2HD4A 3P9YA 3X2EA 4EF6A 3LZ6A 5F5LA 5L51A 4KNYA 2PD3A 3QWFA 5JQWA 1I30A 1AZTA 5JCXA 4MR7A 3D7NA 3W79A 4DLLA 3HCEA 4EKEA 3B6IA 3F4BA 5AI9A 1TQ4A 2A9RA 5B1HA 4ZHQA 2ZRMA 5D6NA 3B5JA 3LXUX 4ZYLA 1P2TA 2CL6X 2G08A 3LCJA 4FPXA 5CVDA 3I5XA 4YR9A 3IE2A 1CJMA 1Z2CA 4BPBA 4Q3BA 4PZEA 5I4KA 3H1FA 3LC1O 3TNJA 2PZAA 1Z6YA 3V1UA 2JLXA 2WHQA 4FTWA 5CK5A 4LS3A 2P68A 3FGNA 1ETUA 3WZ2A 4BBZA 4EKGA 1J0DA 4Y2JA 2AIRA 4WK2B 4LCBA 3X2FA 1P31A 3D6FA 3RS5A 2W2PA 4ZP1A 2QX7A 2AYYA 3NM5A 4C89A 2J3MA 4D9MA 3ZLUA 3RPEA 4ROTA 3MCZA 4BHTA 1N78A 5JSZA 5I45A 4MYDA 1NQTA 1AK1A 1XD2A 2JJ8A 2ZBFA 4PNHA 3WB2A 5ADUS 1S02A 3UVEA 1EVZA 5J5CA 1EGQA 1SZDA 1C3EA 1KI4A 2PH5A 4MUGA 5GQSA 4CWAA 4BTEA 4DMFA 3GDHA 3QTBA 2DBQA 4H08A 4DV6B 2ES4A 1IZZA 4E3ZA 2A9PA 2DULA 1XU9A 3TAXA 4YO8A 3OM1A 2TECE 3L9XA 4Q66C 2AXQA 1Z47A 3S1SA 1QIMA 4UQLA 2V7EA 1Q1GA 2P4EA 3HRIA 4OA5A 5HE9A 3QU7A 3BN3A 3ANYB 4ABTA 1P39A 2IYYA 2OBNA 3DO5A 3PC8C 3EC2A 1CY4A 4HD8A 1IN4A 5GJWC 4P8RA 5EXTA 2ZM6B 1GM5A 5CURA 4XOUA 4CTJA 2H8KA 4F56A 2YCBA 1F2DA 1ZBDA 4ACAA 3UGKA 1UDCA 3T5PA 3AK4A 3JAKB 3NHUA 2DTXA 3OH8A 2PRJA 1Q57A 2WWIA 1QH0A 3A27A 4BVAA 4NFHA 1O5TA 1OT3A 4PCVA 2I6SA 1ADFA 3QSYA 2NUAA 3E70C 1IK4A 5T67A 4G0VA 4EVQA 1PSDA 3GFBA 3RU7A 1B7GO 1N33B 2O3SA 5L4LA 5K3SA 1H05A 2PD6A 4RTKA 1Y5NA 3BKXA 2VTEA 4CN8A 5HZMA 4XEUA 1Q92A 5FLEX 3RTBA 1FXUA 4TV9F 1MC1A 1UMCB 2GKOA 4OHMA 3BJMA 1YS2X 4NNOA 5A5FA 1I1QB 4DQXA 2VH2A 4QHTA 4A2CA 3PG5A 1HY3A 3F2VA 4MV6A 1EX6A 4P7FA 5F4BA 2RI6A 1FZQA 3RVMA 4C0QC 3D3KA 3WHKA 3I32A 4QPPA 2VQEB 1M2KA 1R6DA 4LBYA 5TE9A 5BR8B 1EVIA 3VDQA 4W5QA 1IY8A 2B6HA 2YZMA 3HSYA 1L5SA 2AMFA 1IYZA 4KFCA 1L1QA 3SLRA 3BRQA 2PUEA 1JYEA 4CUJA 2R62A 3DHEA 4DA0A 8AT1A 1KY3A 3Q3EA 1ZGAA 4JZYA 1I7DA 3H4VA 1F6BA 1C5KA 2OXEA 1GPBA 3A31A 3OZ7A 3PBKA 4BMPB 2ID7A 4L6AA 4O5OA 5EKXA 4EQZA 3KVNA 3PWKA 4RJLA 4V0MA 2JIOA 4MA4A 1GSIA 2FSGA 4G01B 5ALKA 4HV4A 5C8YB 4N8DA 3ZDXB 2Q49A 1WW2A 1I0ZA 1JG1A 4JUIA 3KVVA 4LXYA 1KOGA 1TYBE 4KPUB 2N47A 4HQ6A 4JWTA 2IS6A 4HATA 3S99A 1MAWA 1FU7A 4Q7JB 3E03A 4KIGA 4ZODA 2PK3A 2IX3A 4ND3A 1EWQA 2QY9A 2W42A 1QR2A 3Q7TA 1F17A 4RL6A 2M1ZA 1NJGA 3K1JA 1E6KA 2WDZA 4EGAA 3V1NA 4EUFA 1II9A 2YBEA 1S7GA 1X0VA 4NDAA 3UAWA 2YIMA 2FRDA 4DA9A 3BOSA 4RDIA 1Z8NA 4CDRA 4F46A 2ZJ7A 1ILEA 1NUPA 1WKBA 4JBNA 5TQ0B 2GS9A 2ID9A 3HFGA 2X9NA 4MVJF 3EX7C 1EGHA 1BVHA 1HE5A 3IMGA 5IVKA 3MS2A 2J07A 3HPRA 1E9RA 2JFQA 3DFMA 4J8PA 4KO2S 4UJ3A 4CR7A 4CKBB 1QTRA 5JATA 2GKGA 3PR2B 5EP4A 4ZD6A 3CZRA 2EQBA 4CM4A 4D8WA 4EL0A 1GXSB 1TL7C 3ANNA 2V7WA 2VDWA 5LYJA 1ODLA 5DCLA 5CA1B 4QXOA 2XQFA 2DCMA 2VPWA 1PJ3A 4ZYVA 2AE2A 2OORC 4KR7A 3FFBA 3VR6D 4ZEOA 4AUMA 1PQYA 4K1XA 3QFCA 4NENA 2BHLA 1Y0BA 4QU8A 2WFZA 5CP8A 4JJAA 1LLQA 3BSFA 4PLWA 2Z5GA 4QPDA 4N54A 1Y8ZA 1JIKA 1F4LA 4FHCA 1GZDA 3SMQA 3FY4A 3D3EA 2VHVA 3UOWA 3BE8A 2JCXA 1P6QA 1KDPA 3IIKA 2EGHA 5J59A 1MABB 1WPRA 2ZRFA 3ZHSA 1SBIA 1S2LA 3HZHA 1OIWA 1TJNA 1DMRA 1EHYA 1XLWA 2Q1XA 4FCCA 2B8TA 4G1VA 1S1MA 2P41A 4LJ7A 5KMGA 2ZAIA 3MGCA 3RVLA 5CBKA 1QQAA 1X1EA 1PTJA 5D3KA 2WPDD 4ICIA 1I5OA 2DQSA 4AN4A 1H2XA 4R71A 1MD9A 2FPOA 1MG5A 4N49A 4UNNA 1GTG1 4NE9A 2CDCA 4LF7B 1L7OA 3K73O 3O93A 1O58A 2VUHB 5EIXA 1HOXA 3BTOA 2A9OA 3HWRA 5TPZA 2GBIA 2HA3A 3TWOA 1G19A 4BKUA 1CD5A 2J9RA 2JVKA 3L7DA 5FIUA 3I9FA 3PT5A 4KYTA 5LQDA 3MJHA 3JD1A 4UTXA 4R1UA 4EPVA 2P9JA 4F38A 4FB4A 1YF3A 4URZR 1B8OA 3DDUA 2P40A 2CDNA 2Z8YA 1YHZA 4ZTBA 3AJEA 3FTNA 2XAAA 1AHHA 4P4LA 3TOCA 3GT4A 1CJCA 1PJZA 2C8JA 1XU4A 3CCFA 4HGPA 4F3NA 4HNTA 5K4HA 1W36D 4FDMA 3FYUC 1NY5A 1O3YA 1TAUA 3RUCA 4MLPA 5TGDA 4EI8A 2ZR0A 2H00A 3BA6A 4BJ3A 5LQJA 4RNDB 1GZUA 2JATA 3ZVRA 1QGAA 1MORA 3IAS1 1M2OA 4XI9A 1AY0A 4Y2YA 2XB8A 3G8BA 4YHBA 3W3AD 4JOBA 4LSMA 4QOFA 4HWTA 2ZT8A 2EKQA 4MV3A 4DYVA 5DXAA 3BGOS 3H86A 4Q6BA 3NNNA 3BQMB 4H4EA 1PR6A 3UMRA 3JTEA 5HKKD 3QXXA 2PZBA 1DC7A 4EY6A 2ZS9A 3C3JA 4DWVA 2CYAA 4QUBA 2WG1A 2BR5A 4MQBA 4YJ2A 1D6MA 1L7DA 1SMKA 2FG5A 4EPXA 5HIIA 5DIZA 1Z8HA 2Y3IA 3KKZA 3AG6A 5B37A 5K1ZA 4D92A 1FVOA 1I6KA 1VCIA 3HXLA 1PJ2A 2ZIUB 2GQ0A 3LBFA 5HRUA 1IATA 1VG1A 2XF8A 4L95C 1D7AA 1II8B 1VKOA 2GSDA 2RC6A 4BU0A 4DILA 4ZU1X 5FRDA 3AKYA 4N5HX 2VEOA 2C2HA 2QI9F 1WRBA 1X7DA 2BP7B 3DGEC 3NHKA 3D8RA 3HN2A 4RIEA 1L2TA 1YKFA 3OC6A 3A8TA 4TZ0A 1CZKA 2XLBA 3DKPA 1DFGA 5C2JB 3MMSA 2HWWA 2VTBA 2JAWA 1FUYB 4ARIA 4D46A 4JJZA 2C7BA 1X80A 4J6EA 4WFJA 1VGQA 1I33A 1DX4A 1T3SA 3OKFA 4OL0A 3VDMA 1XVLA 1Z6GA 3W5HA 2VHQA 1IM5A 3PDUA 2C2YA 1JW9B 3B13B 3PHLA 1WD5A 3MD9A 2NZWA 2RGDA 5IKOA 1RQ7A 2W2VA 3O3CA 5MHTA 5I4IA 1VBMA 4GR9A 3N2IA 1A9YA 2ZW9A 3GGCA 1BG6A 1XMIA 2IK8A 4D41A 4TVSA 2D8MA 1JUDA 4UBIA 4K26A 3V1MA 1XNQB 1EI9A 2I2FA 3TS1A 1K2VN 3PVZA 2M32A 1DDGA 4JMPA 4UU7A 1W5EA 2H4YA 2XTZA 3QVWA 1KR2A 1CUGA 1N0UA 2VRBA 4TL8A 2GPSA 2LD4A 1VRWA 1TEVA 2DPYA 3CF6R 4BMCA 2AQHA 4CT4B 4CMBA 1KOFA 3OLWA 2PKQP 3G9UA 3LVBA 4YV0A 4LY3A 2JLAA 3FLBA 2PL1A 1IY0A 2YOGA 4UNRA 3T99A 2ZUDA 1N0WA 1T0IA 2PR2A 2W93A 4KXVA 1B43A 3UGTA 2JIPA 2WSBA 5TDHA 3NM6B 4OXIA 4GC9A 4LBZA 3R3SA 3BJRA 4INPA 5AVJA 4JYMA 4IUYA 4KFTA 5KZMB 2SKDA 5HKBA 4DRXB 3HBNA 1GG2A 1ZLXA 3A7DA 3W9UA 2C2MA 4I3FA 3EGXB 5EP1A 2IBTA 3LWZA 2DWOA 1RRMA 4U7FA 4HDSA 4B2PA 1SHTX 3UB4A 4EHFA 4HHEA 4NQRA 1GR1A 4A0HA 4DHEA 5IHXA 5E95A 1PBNA 3LWBA 3RUIA 3RVSA 1JQAA 4HAWA 4JOSA 3RSQA 4YPVA 5CEEA 2BMEA 2BM1A 1KI7A 3E7DA 1T9GS 1BXGB 3FYDA 4S12A 4Z1MD 5A3RA 1BWSA 3WQRA 3GLUA 1K75A 7ABPA 1VTKA 2ZKLA 1S2OA 2A33A 3G1TA 2P9FA 2FFJA 4HRAA 5BN1A 1DRJA 1TVEA 1L1EA 4GX0A 3DMRA 1BVYF 3GJ6A 4NZYA 5FPTA 3KD2A 4NK4A 1HDIA 3OVMA 3TUIC 4H1HA 3SYLA 4EQ6A 1UKCA 3F9RA 5CBPB 4XR9A 3NDJA 4A0FA 4HDQB 3R4CA 1JL3A 2FWAA 2E82A 2OFFA 5GOTA 1PR1A 4LJSA 5ENVA 2VAVA 1PR5A 2GN9A 1BCRB 2IELA 3FAZA 1N0VC 3EXG2 2HNKA 7MHTA 4W9MC 2VC2B 4BLWA 4ER6A 2QQFA 2V5AA 2MU1A 3SVZA 2X2FA 3AOEA 1COWA 3HCPA 4I9FA 5HBRA 2DBYA 1KH1A 2ZU0C 2DWCA 2PRYA 3H2KA 5ALDA 4N40A 1IQ0A 4LBWA 1JR4A 2XITA 3WIUA 1M75A 1V1MA 1IJEA 2R6HA 4O08A 5IN4A 4JBIA 3ONEA 1ZD4A 1ORVA 1VMKA 2CFSA 3FZEA 4BZQA 2X9VA 2IH2A 4TLLB 3ZH2A 3EFOA 3V7NA 3GPIA 3QNMA 2XNKA 4ZDWA 3WA6A 3BWBA 3IV7A 2QORA 3Q3VA 5K3FB 4OI1A 2GXAA 1EZZA 4BS9A 2VQFB 1C8LA 5HF9A 1RC0A 1UIMA 4LJ8A 3SX2A 4B4DA 3WAJA 1XN4A 3L5OA 2JGAA 3QVSA 2WZQA 5K0LA 4QUKA 3BD6A 3ITKA 3ZI7A 3H18A 1ZUNA 3WWOA 1M3SA 4IJ6A 4N6NA 2JGIA 3JQAD 4NCXA 4BKRA 3P8ZA 2O06A 3KKEA 4XE5A 3GT0A 1VJGA 4OHCA 5K45A 3CRNA 1RPNA 4PZYA 4WKNA 4M8SA 3WMFA 2FSPA 1R18A 4UD2A 5ADHA 1TA0A 2AK3A 1T8PA 3TG8A 1YIOA 4G8BA 4XM0A 3NV7A 4C5CA 1ULSA 2Q9CA 2VNKA 2IOQA 3DMHA 3ZVLA 2ZUBA 2BGKA 2GERA 1GPMA 4NMLA 3V1YA 5I4CA 5IXYA 3PNLA 4QRIA 2D1YA 4A91A 1BCSB 1EDOA 1NR7A 1NXXA 1TX4B 3GCDA 3JZIA 2DHCA 5TPWB 2QTTA 1YJCA 1EX7A 5DGXA 2WSSD 3TW0A 1OX5A 4U7PB 1FMCA 4G37A 1O6CA 4HY3A 1CQIB 1V4NA 5BV2P 1RM5A 3FPFA 1Z0ZA 1JILA 2R2GA 1CLUA 1MKYA 2IYQA 3AP1A 2GN4A 3MCAA 3DR3A 4IFEA 3I09A 5M29A 3GRFA 4KXFB 3UUGA 1KJIA 3NHSA 3R5SA 1R4MB 3PGJA 4BEBA 4D7AA 5EUBA 3MHTA 2NG1A 5U4QA 1LPBB 1N5JA 2OGWA 3QVUA 3QFHA 2X0EA 3CC8A 2A4KA 4I50B 4B79A 5JC8A 4Q12A 1WE2A 2PKQO 5C8YF 4BFTA 3A4IA 5KQMA 3FDZA 4X71A 5I7AA 1I1OA 4OPMA 4KYUA 4Z8YA 4Z99A 4EWLA 2HWYA 2X8LA 1D03A 2Q6LA 2YZ7A 1H2WA 1U63A 4B4WA 1V16B 1SIWA 3L46A 4OOEA 5JMPA 1HLFA 2QRGA 3C70A 1MCZA 4MKRA 4N7MA 5DWDA 1AKTA 2D2XA 4WNYA 5BUZA 5L7WA 3MM4A 4W9NC 4HL6A 3U4CA 5DLPA 1ZOLA 5FA5A 4N3AA 3B6EA 4UU0A 1W44A 5TR9A 3ZYZA 4X8OA 1H2ZA 2NV0A 2VAMA 3IVGA 1T36B 5ECDA 2BR3A 2Y27A 3LT5A 3W8RA 1UPTA 2OKGA 1FLNA 1WPQA 1PD1A 2UYOA 4CU2A 4DLXA 4IDHA 3JYLA 3NW9A 3OOEA 2JFVA 5TMDA 1TPYA 3EMDA 2Q3DA 3GG9A 3UMMA 5DOZA 3SHFA 3KC2A 2XYVA 1F2TA 2Q7OE 1CZRA 1PS8A 1HKUA 1WXHA 2ZYDA 3DE5X 3IQZA 1YB4A 3CUSA 2ZRAA 1GYQA 4O4LB 4PRKA 4GLBA 1I6MA 2W71A 5AM2A 3G2MA 3IDZA 5EC8A 4YMHA 5CA1F 1D2CA 5CVVA 5JSKA 4GGOA 2O7SA 1LV8A 4FT2A 4ER0A 2DFDA 2I3BA 3BXFA 3D3JA 3NLLA 5EJ2A 3PQ6A 1RHUA 3LECA 3CLTD 1HNNA 3I58A 4G9EA 3FB4A 2L82A 1OREA 1L7AA 1J6UA 2QA5A 4RPJA 3U4HA 1XP8A 4IIJB 3FNEA 1XTBA 1D7OA 3Q1LA 5H70A 2VHJA 3PEVA 4A0SA 3V3TA 4ND5A 2C9ZA 3PWTA 1WXEA 3AYZB 1IBSA 1U28A 1SBCA 5KTOA 2Z6QA 1N9ZA 2IZ0A 2WJPA 2W6CX 1WXDA 5IDXA 4Z4GA 2YIVX 1RXUA 1OC4A 5IPFA 2IBMA 4W5OA 2HJWA 5CDTA 3ZDFA 1NR5A 3R6DA 5GZ6A 2XOKD 1U8UA 3ZDEA 1DIRA 3SQDA 1H4SA 1GPDG 1O94D 3IRUA 4P3XA 3I8OA 3K9NA 4TQGA 3WK8A 4DKJA 1YTUA 1XRPA 1UK6A 2B4AA 4GT1A 1RJGA 1T2VA 4PC7A 4O2BB 3VSEA 4RGYA 3IAM1 5IN5A 5FTLA 5JCZA 1YR9A 5EJ5A 1ZVQA 1JHOA 1KOJA 1MOQA 5JCOC 2EG9A 1QIGA 2XCLA 2XA2A 1SBTA 4LOAA 4DMKA 5JZVA 3VR5H 2PR7A 3K2IA 3NVDA 2GVDC 4QOHA 5JPDA 2GI4A 3MK31 1GPYA 1QANA 2NU7B 2A1UB 2QAIA 4IH4A 4WWHA 2Q3HA 2Y1WA 3GR6A 4Q4HB 1C4KA 3UJ8A 1QDEA 2H1IA 5K4AA 4JKIA 5INTA 1LJLA 4GH5A 3WMGA 3ZE0B 5KYXB 4RTLA 1QHSA 4JZKA 4D56A 3BBPA 5LDGA 1X7XA 3ETNA 9ATCA 1G5HA 2JRCA 1P1KA 1W29A 5EL0A 3HJAA 4FJ1A 4IKPA 1SD1A 1P7ZA 2PLAA 3IP7A 3ICQB 4C5BA 2D4AA 2D5CA 3I2GA 4OUKX 3SZ3A 4EI9A 1XU7A 1YJBA 5EWLA 1FP4B 3C7DB 4FGJA 2I6GA 3B20A 4YAOA 4M0MA 1E1DA 4NATA 5K6TA 1N3IA 3MF4A 5DBHX 4HLNA 3RK4A 4B8WA 1JG4A 3BXHA 2M9MA 4QYIA 1ZI9A 3KBBA 4JX9A 4ARSA 3H16A 1QE0A 1E2DA 3L1UA 4DSNA 3QX9A 4CQLA 5TMBA 4WCFB 1P62B 1SXJB 1C7FA 1ZEJA 221PA 2Z4SA 3GEPA 1LFAA 3T5MA 4N3CA 4OHUA 4MI3A 2FLVA 2H4FA 3EIEA 4C3ZA 3QEAZ 4D81A 3F4KA 1R74A 2JB9A 3WR5A 3ZCXA 2H3HA 2GK3A 2QVBA 3QLEA 1MH9A 4F6RB 4YRFA 5G1NA 3NTLA 1A9XA 2CFIA 1G7SA 3DLAA 2I03A 2H51A 2QD4A 1SOAA 3QUQA 5ELMA 1TZCA 3FOCA 3NWBA 3PRHA 4C14A 1SCBA 4G85A 4ZA2A 1ECCA 4LJLA 1XRQA 3L02A 2JGKA 2QTBA 2YJNA 1YL6A 3CINA 3X1ZA 2EWWA 2C2OA 3DL0A 3V42A 1MOPA 4DREA 1H1LB 1P44A 2FXIA 2OV4A 1E58A 4YRQA 4F4HA 2ZJ0A 4BPRA 4B09A 1BDHA 2O2GA 4KB5A 3FSJX 4OGKA 3UWPA 3A9WA 1VG9B 4IXWA 1P4HA 2CBZA 2C5BA 5LZ8A 1QFYA 3P27A 1T6YA 1WHSB 4HUTA 2VRNA 3TNFA 5HXAA 3U80A 2ZR7A 3RG8A 3JQBA 4U7JA 3RLFA 1YC2A 2FP4A 4QHSA 1Q0RA 1PQWA 3MT9A 4PZ9A 1RXEA 4CM9D 2OHIA 2PX5A 4R0NA 4TRRA 2LPMA 4I9GA 4J1TC 4MVJE 5ULLA 3A1NA 5WRFA 1LQ2A 3OJXA 4JQCA 3LKVA 4N6GA 3OE1A 4NU8X 1KMHB 1GL7A 4NNJA 2B0JA 3NYIA 1QZTA 3SZOA 1ZOIA 1ID8A 2Z1NA 1DCTA 5EVCA 1TT5B 1WAMA 1TTPB 2O1EA 3V80A 3CNLA 6Q21A 1SBHA 1HZJA 1ZI6A 3UWKA 5CLIA 1ZS9A 1LI4A 2FSUA 2VA8A 4LGYA 3KYCB 5ALVA 2MINB 3R5FA 2PNJA 1PG5A 1V43A 4IG9A 3SXUA 3R1IA 2RH4A 1K63A 4J03A 3ODGA 1YQWA 4CKZA 1YFKA 2YJGA 1U3FA 1VHTA 3A9SA 4G1MB 3T8YA 1JKFA 2PLFA 3AGQA 2O4UX 4OQQA 3TRHA 1AXGA 3SLKA 5HX7A 2P78A 4O2AF 1YC5A 3VC2A 4AP5A 3VSCA 3HV2A 3EA0A 4R9SA 2A1TR 3GLIB 4RK0A 2Q27A 3WGIA 2O19A 3SBOA 5CVTA 2DMRA 1MH1A 3T7EA 1AX9A 2F17A 4ARZA 3ZY4A 1EXVA 2PBZA 1ETHA 3TDKA 5IRCD 2V4MA 2WSIA 4Q9KA 4BC0A 1SVSA 3EEOA 4LQ4A 5AKLA 1TYEB 2RJOA 1V7CA 3GDWA 3EZXA 3KU4A 1D2HA 2NO1A 2AF3C 3D5QA 3W6ZA 1AA9A 1US8A 2LVBA 1R4NA 1LTHR 4R16A 1BNCA 2NXJA 2ZATA 1EINA 5AK0A 5BOSB 1M1NB 4E12A 1YFLA 2XCOA 4MUEA 5BUCA 5K2OA 2VRCA 2QTHA 3J7TA 2AW5A 1BC5A 3M1LA 3TGWA 1DTWA 2OOSA 2XKBA 4CEHB 1ORRA 4U6QA 5K8CA 1EUYA 3DLHA 2XQJA 1DJOA 3LYUA 1C7QA 1UC8A 4IICA 4NYMQ 1FP1D 3CSUA 3GJXC 3NYQA 2OXTA 1U9CA 1VZ3A 3AY7A 5CM9C 3ZZNA 1X7ZA 4GRAA 3GPLA 4OXKA 3LHFA 4KQJA 2IHZA 4HOYA 3KEQA 4OHPA 5JZOA 5ALUA 1NMYA 2X19A 3QFTA 2YNMD 1YS7A 3E1KA 5AM1A 4AZ0B 4HUQB 1ZX1A 5JWHA 3OECA 1SHUX 2I6UA 2HZBA 2FN3A 1G3IA 1LVGA 4R68A 3N8NA 1X7GA 3Q7QA 4O5AA 2SECE 2PRIA 1JQJC 1ORTA 1O6BA 2VHXA 4GOND 1SQ5A 1UDXA 3LY7A 4W5NA 5AW0A 4BAUA 2HLDD 2C98A 3COZA 4GI1A 3CVVA 1J21A 2NYUA 1W19A 4HSEA 3NYRA 2O48X 3O0DA 3X0DA 4BMZA 5BVHB 1JDJA 1QH1B 4JI3B 2LCIA 5EKSA 3U48A 3P2EA 1A9QA 5F76A 3RC7A 3LPLA 2ZU6A 4X6UA 3LI2A 5I6DA 1E1CB 2QRNA 1HGXA 1WUIS 2H1WA 1YB6A 3GMTA 3IAUA 1GKUB 1O8BA 1NM5A 2ZJ2A 3EXIA 1UKAA 2JAHA 3LRPA 4GPIB 5AHRA 3TFWA 4UFOA 2X7HA 4JKOA 4UM9B 4JBHA 3D31A 5JLAA 2J09A 4WY5A 3ISJA 4QAQA 4QJ4A 5HUJA 2WUDA 3WLQA 1TYZA 3JPYA 2R65A 2W6MA 3PU6A 1AQJA 3RQIA 5KYTA 1L5GB 1U7XA 2B36A 1JG3A 1J07A 2ZRCA 2ZGVA 1FA9A 3BFPA 3CURA 4ND4A 4PG4A 3WDKA 2C8KA 2B4RO 5I7FA 4I1YA 4K6HA 3ICEA 1GNSA 2C4KA 2AMYA 3OQPA 4I50F 4KXMA 4NULA 1P60A 1VPTA 4MGEA 4YGYA 3AKEA 2G07A 4JIMA 2BY4A 3CISA 3VV3A 2PSFA 4HAIA 4M0EA 4OP1A 3UQZA 3VV2A 2FZVA 5KTNA 4ENVA 4IJQA 3NAGA 1GARA 3ZWWA 3MWFA 2O2SA 5F1KA 3KB2A 3S2IA 1UPUA 2WTNA 3ENVA 2CUZA 4E5UA 2AKYA 5DCUA 3D3WB 4HPJB 5DNUA 1V8ZA 1QPBA 1UJ4A 3F5SA 1TRHA 1K5PA 4OQFA 5DDIP 1R5JA 1KQOA 1U3TA 3SZMA 5AWFC 1AS2A 2B7BA 3F6SA 1T3HA 3E9RA 3CX7A 1JIXA 1RJEA 4OAOA 3VU1A 4EUKA 5HUHA 2WV7A 5CFZA 4P7KA 4N12A 4GQIA 2EWMA 3ADKA 3TDNA 3N2GB 2RH9B 2V3VA 3DOUA 5C3MA 3FSEA 2IWRA 5HS4A 2RGXA 1WQ1R 4RGBA 1OB5A 1ML3A 3IT2A 2AFHA 1PS9A 4LVUA 2IPNA 3DTVA 4TYPA 1V7ZA 1Y5IA 1J2EA 2HRDA 2PS1A 2QMZA 2WVAA 2YV1A 2I66A 3CNOA 3ONFA 1QYCA 1WCXA 4LYAA 2OESA 3WB9A 4PBRA 4WKPA 4UUQA 1K88A 1OWNA 2I8LA 3ANSA 3E22A 1A4XA 3TI7A 2CE7A 4E1BA 3VJLA 1NNUA 2ZRJA 3GRCA 5TRTA 5KSOA 1A95A 1BEZA 2JJ2A 3LNTA 3PYMA 3WFIA 4B0OA 3IEMA 1FX0B 1H94A 2A3RA 2JFFA 2H48A 4JBXA 5CX1B 4D96A 1QOZA 1MT3A 3KG2A 3B7PA 4UDNA 1HEUA 3CZAA 3KSUA 4RCZA 3OQNA 2ZSFA 3M6FA 4H7JA 4YROA 2J9GA 4BE9A 2I55A 1ODKA 1SUIA 2Y9PB 4IIJF 1PGQA 3ID6C 4I4CA 5AICA 5AKHA 1LF0A 4HN9A 4NH4A 2FW1A 5A3SA 1P9LA 1ECLA 3CNHA 4M83A 4AZWA 1F5SA 1Z2PX 3CH6A 3VAAA 1EDEA 4PZDA 3CUEF 1GIAA 4GOKA 1K9SA 1U4SA 1EDDA 3FFAA 3LIIA 4C0BA 3LGSA 2EFJA 3B1WA 4ND8B 5KVAA 2PPLA 5BRAA 5K2MA 2G28A 4ID3A 3RS7A 5IF9A 3JQ8A 3K2EA 4Y6QA 2ZTMA 5C18A 3K0EA 1ATIA 4DV7B 3MXOA 1GNQA 5E6UA 3JZMA 2VO1A 4FGKA 4P4NA 3AFMA 1OFVA 5C81A 4I08A 3ZE2B 3WKCA 3AV0B 4M88A 1RP7A 2NZUG 2I29A 4RHTA 2PSEA 2JLQA 4KOEC 1Q22A 2FRVA 3TQRA 5AUPB 4O2BF 4RABA 5H3HA 5TGTA 4YS6A 2XCRB 1GL3A 3IIJA 2D1SA 4ZTZB 1DWQA 3G8DA 5H16A 2XCUA 3D1VA 1A9RA 3M4JA 4EDHA 1E4EA 3RRZA 2FN7A 3L7OA 3P2OA 4WUVA 5AHWA 4ZREA 2O6LA 5BN5A 4PLCA 3ND5A 2XB2A 3VO8A 1TO1E 5CM2Z 5FI5A 1J5PA 1L9XA 1UMBB 3K2QA 1MX3A 3LIPA 4QELA 2Y67A 4EKIA 2GZHA 1XNJA 5CB4B 2V98A 4WN3A 2A86A 4XM2A 2HYDA 3K4QA 1YUMA 2YXDA 1KO1A 3OA2A 2XB4A 4I1RA 4OXNA 5JXHA 5K3DA 3VZBA 5IUNC 1E2BA 2C84A 1HI9A 3GLHB 3WL6A 4ZVOA 2ALJA 4G5YA 1FDOA 1USUA 5CFOA 4PWYA 3H8JA 5EMKA 2BRUA 3EQ7A 1HG0A 5CHYA 4CNQA 3K6SA 3EXAA 1CVLA 1NATA 1VCMA 1JFVA 1QO0D 2XZTA 3DL2A 4OK6A 1JRLA 2JZOA 4C7MA 1X1QA 2ZRDA 2EV9A 3ZN2A 2O6HA 4BNXA 1A3CA 4XFJA 1P1IA 2P5SA 2P9TA 4JQOA 4F04A 4DDTA 4LOLA 4KSBA 4KG7A 4ESVA 3T34A 4K8OA 4TMVA 2EFYA 3ZD8A 4FUTA 3QBJA 4ZQEA 4E31A 1RM4A 3PXBA 2QRVA 4GKBA 3WMXA 5H3LA 4UM5A 1E5DA 4RH1A 2PDAA 3D6AA 3OJOA 3OX3A 4O4IB 3RBAA 1SEPA 1V11A 2EARA 2C5SA 1T1EA 4TTJA 4L3VA 5AJHA 1AKWA 4CFSA 3A6KA 2L19A 4OREX 3AWIA 5EZYA 1RW4A 1M7HA 1Z15A 4ASUA 1JPJA 4MINA 4R2KA 4D42A 5JDIA 1N9GB 2XNSA 3QPBA 4ZVQA 4XVUA 5A3QA 2RI1A 1EVYA 1D3AA 1JQEA 1N5OX 1E32A 2FFBA 2IEDA 1IZ9A 1X2BA 4QRDA 1CF4A 5L3QB 4B32A 3STWA 3HKBB 3LUKA 4ZIRB 2W2MA 5EE3A 1R9NA 4AMGA 2HYIC 1QX3A 1NU8A 3BSSA 3LP8A 1UJNA 3OPYB 3ZI4A 4E21A 4C2AA 3OAAA 1TO2E 1F4VA 1XLTC 4DCMA 1HDOA 2PGJA 2VQ3A 3B8EA 5FUYA 5AKGA 3T3IA 1SM4A 3DMDA 3K15A 4NX2A 3BILA 3U60B 4DGSA 1U4OA 3W6OA 1VJCA 4ZZ1A 4KO3S 4F96A 5KNLA 2VDVE 1ZWKA 4NOMA 4K9KA 3C6KA 2P9CA 2YW2A 2CCJA 2QJFA 5BRNA 2YJZA 2F1JA 3WIBA 4BO0A 2J4CA 4DNPA 5C4MA 5JNTA 1LK0A 3F8TA 4E13A 3PF8A 4L57A 3SY8A 3VXKA 2DPMA 1EVJA 1B00A 1ZD2P 5KC8A 3DE3X 3B38A 3Q4GA 5ESWA 5AW5A 1LW6E 2JFBA 2BGIA 2QIPA 2W2LA 3DTNA 5KAPA 1H2AS 3ZV4A 4QGSA 2SICE 2BM8A 4EECA 1V3UA 4LJRA 4WL0A 3W6UA 1CIVA 3VR4A 1EMDA 5E6SB 1AKQA 1PR9A 3WNVA 4BOYA 2EKLA 3U5TA 3GJYA 3I2KA 1QZUA 1MO3A 3NHFA 1KZ9A 2GZ2A 3HY4A 3V9AA 2J8ZA 1B3BA 3X1MA 2P9EA 1ULAA 1SUEA 3JQCA 2RHWA 3LNCA 1E89A 4KQKA 3R3ZA 1AE1A 2ROQA 2LV8A 2IOFK 1ZBQA 3JARA 2J6HA 1TCVA 2ZJOA 3IPCA 4MVJD 4ZHQB 4OUDA 1HDZA 4QO8A 4LHXA 3WGMA 3LYAA 2V1XA 3FJOA 2VUUA 3IIIA 3ORYA 1MLDA 3P0RA 3G9TA 5FUQA 2VDPB 4M9RA 4PN7A 3JSXA 4RTQA 1RPTA 2Y1OA 1FFDA 1Y7TA 1ZP6A 2O7VA 3EY4A 3IUMA 5FI0B 3HM9A 1MR3F 3AF3A 2XVZA 3Q98A 1P75A 5U1PA 3SC2A 4F5EA 1Z75A 1EP2B 2H5JA 1YVUA 3DP9A 2JF0A 1B8VA 1UAAA 3A6DA 8OHMA 3CLSD 1UDWA 5GZ1A 3TZBA 1RVV1 3W4KA 4JP8A 1RAGA 4JLNA 4GE3A 3WK7A 3BHMA 4R8RA 1D0VA 4LHYA 4PYKA 4L02A 1HKHA 1TAQA 3KLMX 1E7WA 2RGNC 3EDYA 3OLVA 5HF5A 2F43B 2E49A 5AUQA 2PIAA 1G8KA 1JJBA 1WS6A 1OLSA 2OC4A 2OXCA 2Q1UA 3D8BA 2YHUA 2JAPA 3KCNA 1KE1A 3R7AA 5A4JA 3GP8A 1XXLA 1RE1A 2H06A 1Y1LA 2WZDA 4G4JA 5AQEA 3TINA 2P3SA 4MYUA 3FPCA 3OT1B 4DLAA 1IY1A 1MAHA 3B51X 4HDMA 2C7QA 4DDWA 1AXEA 2NYVA 3I9JA 4CM8A 3CG4A 2QW1A 4UEWA 3GVCA 1P5ZB 3RUEA 4D5GA 2NXEA 4TWBA 3UK6A 4XLLA 1GA1A 2XMGA 1LU9A 2ECQA 3MW8A 1MTZA 5KYNA 4JLUA 1HLPA 2QVYX 5EKUA 1OXKB 2HSEA 2BHRA 2VK2A 1ISGA 5FLKA 2XNDD 3ND6A 3EH2A 2P2SA 1VYHA 1XZHA 3L4BA 1R9JA 4O4HA 1PWYE 2WDPA 1O03A 1RYFA 3W5UA 4UUBA 4EO7A 4UXHA 2C0QA 1TMKA 2ECPA 1T6BY 4BIIA 1HORA 4BQQA 4MRNA 2RGWA 4UTPA 4K46A 4KKXB 9GPBA 3GWZA 2BEUB 4W5TA 1TLLA 4BBAA 2H7CA 5HGXA 3FOZA 3TLGB 2QTVA 1HR0B 1G8HA 1Y9ZA 4PTLA 4JU8A 4EPTA 2P3OA 4DY6A 3PC7A 4TLMB 4GUAA 4QYWA 3VOSA 4X66B 1XVTA 2GA8A 3FBWA 4QXQA 1ZGBA 4L8FA 1BN6A 4N7JA 4YPOA 4YRSA 3OKAA 4Q4AA 2BR4A 1MBZA 5DYYA 3QQPA 2NZXA 5C1OA 5BSVA 1U6KA 5KYGA 4WZBB 4BDSA 2ZT6A 3Q12A 3KIPA 4KE9A 4WECA 2P9YA 1Z6PA 1FS5A 4HZIA 3ZE8A 2RIPA 3H83A 2P7IA 4DUGD 2QGFA 3EZ9A 5B55A 1L5ZA 1RAFA 4FFVA 4I2NA 4RDHA 1WCWA 4RX1A 2G9VA 2IHTA 1NFRA 2YUIA 1EBUA 4RQUA 4E5KA 3OY7A 5FTWA 4JT2A 2Q8NA 1WY7A 1O0SA 1XHFA 2AEEA 2P4SA 4QWMA 5LBTA 3DFUA 1LRJA 1HSZA 5DNDA 3SR4A 2J0UA 3DDSA 4EAQA 4GICA 3H9GA 1AGRA 3NVAA 2AN9A 3OSUA 3IOCA 3QENA 4AW9A 1L5FA 2HQRA 3GFVA 4HNUA 4Z4QA 1ZVKA 1QF7A 1SUPA 3ME5A 4IDGA 4N3GA 5JS1A 4U2CA 4UVDA 1W1IA 1B26A 2GUGA 3ANXA 2OGUA 2VHZA 1XALA 1JFFA 1FUKA 1VCHA 2W90A 2RFLA 3GRKA 3QG5A 4MTLA 4QGGA 4WOJA 4ZV9A 3SDZA 2IUFA 3UXEA 4KXNA 2GPTA 2VNIA 4IKEA 3E4CA 4RVUA 1MRSA 3IUYA 4RVHA 1WKCA 1IEXA 2NUPA 4IFTA 4K28A 5B58T 2YHIA 4AWAA 2JGLA 2W2OA 1SB9A 2VQDA 1GFZA 2FPIA 5ESRA 5T8KA 4FOTA 1DU4A 3IAXA 3K1AA 3MNFA 3OM8A 5JYDA 4PW0A 3UFXB 4CGZA 4ZCRA 4EY4A 4PBTA 4QULA 3V1TC 3FOAA 1DO2A 1EX9A 3DYIA 1YBFA 3O83A 1FYDA 3PR1A 4CLEA 2P75A 2PN1A 1LX6A 5PNTA 4TMKA 5JWOA 3MWKA 5BSHA 1U1CA 2VNJA 4BRWA 1J2RA 5IDVA 1SCIA 4K9OA 3SSOA 1WPGA 4ZJPA 1VL1A 1U3DA 4HDCA 4KIUA 5DK4A 1CKEA 3ZHYA 1XTKA 4NCHA 3WL8A 1QIKA 4M0KA 2I2BA 5I9NA 2P6NA 1F12A 5AVSA 2R79A 3A1DA 3D2AA 4MR9B 3HVJA 1NJ2A 3VOTA 5FYQA 4DQUA 4FW9A 3K20A 2E3JA 5AI4A 2E6UX 2GRUA 2NVWA 2GB4A 2ZB8A 4UQOA 5EE1A 4Z7OB 5ENZA 3G0OA 5JS6A 4UNIA 3RAEC 1GZ7A 2LIPA 4BE7B 2QTFA 3T7IA 1XZJA 3TF5A 4EKDA 4CDGA 3CHYA 1XYVA 3F7NA 1NZJA 1KJWA 2EJCA 2GARA 2QP9X 2GPAA 2WG2A 3K92A 4FDAA 3SZRA 1YQTA 4BIMA 4US2R 5EWJA 3HO6A 4O4JB 1NJ5A 4YXFA 5IVIA 3LDUA 2W8ZA 2OD9A 1K92A 2ODWA 5CB4F 1N3BA 3A6PC 3RIYA 1L7NA 3FETA 4U9HS 3I1FA 4BNUA 1QONA 3P9CA 3OQHA 3X1WA 2WUFA 1JU4A 1NLFA 1ZD8A 3ZIAD 1GY8A 2HO4A 3LMKA 4RGVA 2BMDA 1Q50A 5DGIA 4C04A 4JEUA 4P4TA 5EIBC 1Y7IA 1QYXA 5FR2A 3JXEA 2H4HA 1A2QA 4BZZA 1SUBA 3LKBA 3WLOA 4BGUA 4Y18A 2R6FA 1J56A 2PKRA 3DDOA 1EK1A 4JJKA 1E64A 1KI3A 1YE3A 2DQYA 4OFWA 1NG9A 5HOEA 4YO7A 3C41J 1G6HA 1NUSA 4RHCA 5SY4A 3VU0A 1J42A 2C42A 1L7XA 2XHEA 1HQDA 4OHFA 5IYZB 4YALA 1UFOA 3BJIC 2YRFA 5TIIA 1LWOA 3IV9A 2E55A 3ENKA 5EXDA 2G09A 4P82A 3WYEA 4PGMA 1G4UR 3LK7A 4M1TA 3RC9A 1BMQA 2W4IA 3LD9A 5K0BA 5M3BA 2CVFA 2ZSEA 4G0XA 4LBVA 1DX6A 1CT9A 1RACA 2DE0X 4JUCA 3Q7SA 4GE0A 4ZYUA 1G2PA 4FWBA 1S1CA 1U8AA 2J08A 4EMUA 3NALA 4UEOA 1KY2A 3NCHA 2FOLA 4RKEA 3ECSA 5C9ZA 4V0RA 3DZGA 3WL7A 1KJYA 1GSHA 3N8KA 4N6OA 3T0IA 4BX0A 3OJCA 4GKAA 4H3VA 3U9SA 3RIGA 1MP0A 3EVGA 4RKYA 1K06A 2FPUA 1PU2A 1PL6A 5TSDA 2NP7A 2AMVA 4YIKA 3Q3IA 4XRGA 1MNAA 3W7BA 1M1ZA 2GVZC 2LE0A 1N8KA 4C6HA 1EEXB 4MUYA 1LPOA 1VSUA 4O2LA 4U7WA 1T9HA 5FBKA 1D4ZA 1BEUB 3T61A 1YJ8A 2PMWB 3QJGA 5I9MA 4B73A 5GWXA 3WGJA 3KSDO 1UH5A 2KI5A 5HDBB 2PBFA 4HH1A 4JT8A 4MUJA 2WYWA 5A4IS 2GJ9A 1UKYA 3DAYA 4M7OA 4P4UA 5JTTA 3GJSA 3H19A 2HHHB 4JC5A 3H3FA 4EJMA 2SNIE 3TX6A 3N05A 3GLTA 4AJHA 4GEKA 4YYEA 1AUXA 5DNWA 5F7OA 1NKVA 1C9KA 1KKUA 2AOTB 1GNVA 3FOWA 4P31A 3SDBA 2H5LA 5BMOA 2B78A 4FMBB 3SVTA 4FGZA 4PS1A 3KHKA 4LGCA 5FTMA 1J1ZA 2R6GA 5TVKA 2QJOA 1OFHA 1VPVA 3P9PA 2ONJA 4UZSA 1I1HA 1ND6A 2N75A 1O5OA 2BMWA 1X15A 2Q8QA 1NU6A 4URWR 2UYYA 4JEHA 2ZAMA 4QZVA 2CL7X 1E7RA 1AK9A 1NDQA 1THGA 3P2KA 1IDOA 2GGSA 3QX7A 4PYLA 3NO4A 5U9CA 1I7SB 4UUMA 3F78A 4KQ6A 4R2LA 2XMSA 2MCFA 1ENYA 3WRVA 4ANFA 1N25A 4AYWA 4NBNA 2ZJ4A 3VQTA 5EIWA 2NU8A 4XSGA 3RWOA 1T1SA 1AQNA 1SBQA 2O20A 2XWQA 4KQIA 2HSWA 1I5RA 4LTDA 3AFIA 4G25A 1WCIB 4BMYA 2IW3A 1COZA 2ZKIA 1B0PA 1Y7PA 3QELB 3ESAA 4YUYA 4KR3A 3I05A 3TL3A 3MPUA 1JDUA 2UKDA 1PK8A 1U8EA 5C8DA 5ALRA 2PJDA 3I72A 2XZLA 1E8DA 1PQUA 2RKOA 3NUZA 3SYMA 1QJCA 2PAFA 3B60A 3Q3GE 3N0TA 5EHGA 1TIPA 1BDBA 2WU8A 3BWEA 3CIFA 5FPQA 3THXB 1TJPB 1QR6A 4LWOA 3F67A 4IIBA 4EX7A 3ROGA 4N0PA 3QE9Y 5IJ0A 2IIVA 4OIMA 3CNEA 3NBYC 4UJ5A 3RT9A 3R7FA 4B3JA 4ALIA 4DPMA 1I7NA 2GZAA 1IJBA 2IZZA 3HSSA 4OGLA 3BREA 4W7IA 4XIFA 5EZSA 2D0IA 3PDCA 2NZ8A 5ALJA 5FQOA 3STHA 3BF7A 4X93A 3U3KA 3VR6A 4DV5B 2VDQB 4G0NA 4OX9B 2CLCX 1E60A 2Y1XA 3AILA 4U00A 1VYUA 1K7EB 4GI2A 2A4MA 3EOBI 5KTMA 1IXSB 1P2BA 2QP3A 2QY6A 4CLDA 1KRXA 4BVLA 1P7PA 3EHEA 4D9IA 1Z5WA 4KACA 3OZEA 2AV6A 3QNWA 1CUFA 4AJIA 4COOA 3NHLA 1PUJA 4WBXC 1Q3KA 4OXRA 1J70A 4Y2UA 5EQTA 1OFTA 2OFXA 1SXJE 4B3HA 3H9JA 2WPDA 1ZUNB 5FOXA 2QRPA 2OWDA 3I64A 1JNYA 2ZPTX 1WM1A 5KX5B 3IDOA 3BXPA 1R4AA 2J3EA 2WAAA 3C39A 1MB3A 4FMCB 1A71A 1USVA 1C4OA 2C58A 2DHQA 3DAOA 3SOPA 1SA0A 4GPD1 4M0UA 5ABPA 1HE1C 1PGPA 3HY3A 3N6RA 4DCGA 2FZ4A 1YL5A 3LVRE 5IKPA 4NE2A 4L5JA 4EKYA 2ZIXA 4LISA 1BXRB 5LQAA 5FUMA 4NE7A 2ASVA 3C7AA 4Q5IA 3SKYA 2J33A 2GHTA 2OM2A 2QJWA 2PZJA 2ZIGA 4GVPA 1W581 1G21B 2RSLA 3T0FA 1Y82A 1CYDA 1XYYA 5TY0A 3ML1A 2ORVA 3ETHA 1SXQA 1U02A 2ERXA 4BV8A 2HHJA 1C8KA 4ZFNA 3QG1A 4PQYA 1RWOA 3KZOA 3Q7IA 1A9TA 1U8YA 3DZFA 4D4KA 2D2VA 1QHXA 3W3AA 1IZ7A 1B0UA 2I6FA 1YZLA 2QD2A 3PC3A 4TVOA 3T1TA 4ETWA 4J4BA 1EWYA 1ZXBA 4HRVA 3ENWA 4CVNA 3FA2A 3ER9A 4NCBA 1H2RS 2CFTA 4YP7A 4PXYA 5HKKA 1IG0A 3K09A 4FBLA 4QEZA 3UMVA 2JK1A 4EW6A 3HKCB 1C80A 3KELA 4IILA 1DXYA 4NWIA 1FDIA 4FYJA 1RAAA 1ZJ4A 3FH0A 2R6CA 4LXIA 4AZTA 3LUPA 2A0UA 4QQKA 2VDMB 3WNCA 4KBFA 4NZ9A 2QW8A 1D0SA 4M53A 2GESA 4GLLA 1GCAA 5LC1A 5TMEA 3NT2A 2ZBVA 1XZCA 4L8YA 5C35A 4ITUA 3PTZA 4RXMA 2V5UA 3SU8A 4G5QA 4X8HA 3E0QA 1R3UA 3RVBA 3L77A 2PTGA 4R1NA 1EK0A 2OY0A 3PUKA 3GFFA 3FMVA 3DLBA 2ADMA 1JHZA 4FGLA 4XIIA 3ZY6A 3JQ7A 4A0QA 4YUAA 1PEDA 3K2BA 2GLTA 3FX2A 3VO1A 1RVDA 5KKAA 1Z5VA 1JEAA 1L8XA 1NVXQ 3VNVA 2C7PA 4MJ3A 1EJ0A 4CMGA 1PN3A 2YS7A 3HJNA 1IG3A 1QQTA 4KVFA 1FMFA 1JE0A 2W2KB 4N9WA 1GQ2A 2WKQA 1KDOA 3PC4A 4UTNA 4FQ5A 4QYSA 4LRSB 4Q4JB 3KUDA 3WRWA 3R0IA 4TKVA 1DZIA 1JWBB 1OF1A 1HDYA 1X1SA 1P8JA 1HE8B 2IIPA 4CKWA 3U09A 1J97A 1TM4E 5DBEX 1E6EA 3P2MA 1RYYA 1WZEA 2GXQA 3T7DA 2CLMB 4I7EA 5I9LA 1Y48E 4IOJA 1DC5A 4JVSB 1RXCA 1UBKS 2CXOA 2GBCA 4B2YA 4D82A 5LP1A 2OO5C 1OSNA 3DLCA 1M0WA 1V7QA 5DSXA 5JVDB 3E15A 3SX4A 2OB2A 5CFQA 4YTEA 2X8BA 3K0BA 4MSUA 3VVBA 4BXOB 3N0RA 5F73A 5DM2A 3L01A 1SBZA 2LGJA 3EF3A 1RLJA 1YZVA 2B98A 3HV0A 3KTFA 4QSHA 3CX6A 3E27A 5J4YA 1P1JA 3ZWDA 4I46A 5CLJA 4PQGA 1TGVA 2XVAA 3R7WB 1NTRA 2DHDA 4K9SA 5JO9A 4ZQGA 5L4SA 4OFXA 1LUAA 4XJSA 5AM0A 3P20A 1GTL1 1FW6A 2YJ6A 1N5LA 3MOSA 3G1UA 3L6DA 3SOZA 2V96A 4EY8A 2OA0A 2FGJA 5TQJA 3RYIB 2NT4A 3DCIA 4MKFA 4O4JF 1W4LA 2GBPA 1G5IA 3U44B 3R3JA 4BL5A 3A1TA 2W6PA 2WKRA 3HZOA 3HJHA 4YJHA 5DHAA 2ACWA 5EERA 3C87A 1OH8A 5I8WA 3QE4A 1T43A 1PVVA 1W48A 2N1MA 3ABIA 3N87A 1IHDA 2CLSA 3KOYA 3NHJA 4TKLA 4ZI5A 3CY6A 1WMBA 1U65A 4F4DA 2PL9A 3K5PA 5C3UA 3D4PA 4WJKB 2HXYA 4Z1MA 2CYBA 1AHNA 2BGMA 1NXSA 2D5IA 3O4VA 2QT1A 2F3QA 3M1IA 4I55A 2Z3ZA 3LCUA 4RC9A 1UZMA 2BF7A 5K6RA 5C51B 1KOLA 2JI7A 3IC5A 1A77A 3JQ9C 4NZPA 2I65A 4PY2A 3H5IA 2FWMX 3FKQA 2CLKB 2EBHX 2HSJA 4D45A 3FCAA 3RTEA 2F2TA 3W2TA 4E7PA 1LBSA 3AEZA 2WF7A 3IR5A 1SVUA 5TC4A 1A8HA 1R12A 1IVYA 1Z4KA 3CZ4A 4LY6A 4B6QA 5AFSA 4WJLA 1HYQA 2I62A 3THWA 4ZAXA 4F7DA 1V41E 3N2EA 4PTYA 4Y1EA 5DX1A 4JP5A 1M1YB 5IYZF 2BV3A 5ARCA 1U7HA 4A27A 3LC0A 2IUTA 3GRYA 3KVOA 1DOZA 4KAJA 4KDEA 1W4CA 2PRKA 2FFAA 4F12A 4DCTA 2DGDA 3QHPA 3IKVA 4OK5A 1JFRA 4JDUA 4L27A 4AX4A 4UREA 4BEVA 3KD3A 2MMCA 3V8MA 3GJZA 3H5RA 1N6NA 2RHTA 3NNDA 1I4TD 4M9CA 4PLYA 3VKUA 1Y3CE 1CY8A 2JW5A 1TUBA 2NAFA 3GFRA 1EWKA 4Y2HA 3UENA 1YZNA 1S3SA 4CQNA 4CQLB 5BMVF 3Q8WA 1A2OA 1NXOA 4RTOA 4URVR 2DBRA 3LY9A 2Z2XA 3EE6A 4RHXA 4RPKA 3EXG1 3H11A 3CNBA 1ZRNA 1M72A 1YVRA 2WIGA 4KFRA 4LHWA 4QDKA 1Q0QA 3GYBA 3QI7A 1E7QA 6REQB 1A9XB 4BB9A 2HIHA 4YCMA 5KOHA 3JQAA 2BYTA 3FPLA 1UPAA 4EJSC 2WWWA 5JH7B 1YDEA 4G41A 3GA7A 3KKLA 4ZQCB 5J2TF 3ZI0A 1XMVA 1IAQA 1O6GA 2O0KA 4ZVPA 3C0KA 4DCOA 1W7AA 3IIEA 1CJTC 3IEKA 1JHUA 1JDBB 1NURA 1R1DA 5KDDA 2C7