1RC0A

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rc0A00
4ZZ3A 1MEJA 4ZYYA 3TQQA 1YRWA 1NJSA 1CDEA 4Q12A 4ZYUA 4ZYZA 3Q0IA 3DCJA 2FMTA 1ZLXA 3P9XA 3AV3A 3R8XA 2YWRA 4ZZ0A 1RBZA 5J63A 4ZYTA 1CDDA 3W7BA 1RBYA 4YFYA 4TT8A 3AUFA 3GARA 4ZYWA 5CJJA 1ZLYA 3DA8A 4QPCA 1JKXA 3N0VA 4NV1A 4ZZ2A 4S1NA 3LOUA 4TTSA 1FMTA 4EW2A 1GARA 4IQFA 2BLNA 2CFIA 3KCQA 4ZYXA 1GRCA 4EW3A 1C2TA 4TS4A 4PZUA 1MEOA 1RC1A 1RBMA 3TQRA 1RC0A 3OBIA 1RBQA 2BW0A 3NRBA 2GARA 1MENA 4R8VA 3O1LA 1C3EA 1ZGHA 4EW1A 4ZZ1A 4YFVA 5J9FA 4DS3A 1S3IA 4QPDA 4ZYVA
chains in the Genus database with same CATH superfamily
5FPTA 1VHQA 3DLAA 3QUTA 4QWMA 2WHYA 3JD1A 2H4JA 1P3Y1 2PUWA 2NU8B 1BSVA 1EWVA 3OD5A 1R88A 3EIFA 2COKA 3OIUA 3A2NA 1T2EA 1AZTA 2I4OA 3W3AH 4DLZA 5DMXA 2VNSA 3C1UA 2H85A 1XZIA 2NXWA 1G3MA 5EIAA 5FOXA 3O1HB 1ND6A 3LDAA 4IFBA 2A92A 3W04A 1OILA 2X0DA 1E2PA 3KHUA 5EZSA 3O6VA 4UTVA 1FF9A 2PWYA 3G0IA 3KKEA 3ZZMA 4EPYA 3D7SA 2K6GA 2O2YA 3ENZA 3KWJA 4LVOA 1GTSA 4FUTA 1ZUWA 4RF4A 3P2KA 1J1UA 2QPTA 4D57A 3NMUF 1A2BA 1EGAA 1L4NA 1ZVMA 4QDKA 3K8YA 4JX9A 1Z2AA 4O08A 3ZNQA 5IYZA 4XOIA 3QOXA 2XOEA 1P17A 3SQNA 8GPBA 3TIFA 2WC1A 3T0IA 2R1TA 2I7XA 3B7GA 3IAAA 1W47A 2VDPB 2C83A 3DFIA 3PI6A 1KZ7B 1ZMBA 1LD3A 1H9BA 1SO8A 2ZB3A 4F56A 4FB5A 4RSRA 2CZCA 5KOJB 1VJ5A 4NNPA 3Q3GE 4Y9SA 5IARA 1GKYA 2ZRNA 3LQ1A 5DI3A 1KMCA 3L77A 2BBTA 2VBGA 2OGWA 2VJMB 1TD1A 3WQQA 1SUEA 5AVKA 3UT0A 3TCNA 2ZW9A 2OQIA 3T6KA 1A9XB 1T5BA 5K3SA 1TCUA 2WZQA 4YRNA 2FK8A 1KDZA 3QFFA 1GITA 4DLLA 2BEUB 2RHTA 1KDPA 2GZAA 3RRMA 1FYXA 4FLEA 4PINA 4EG1A 5CLJA 5FBQB 1OHHA 2I65A 1GKKA 5JXHA 1PT5A 2BOVA 2GO7A 1FDTA 1EH5A 2FFBA 1CRWG 1KHTA 1VIAA 1OW3B 3LOPA 4Q1AA 5GGXA 3ZCTA 4TKVB 5C4IA 2DXIA 2B83A 3VDXA 3HJAA 2RAFA 3K9FC 4Z9AA 1PFUA 3NAZA 1EFAA 3GEMA 3PNVA 1ZVJA 4BQQA 4IEIA 2OGZA 4IIDA 2M32A 2I2DA 3KB2A 4E88A 4MWGA 3RFTA 3FNFA 1Y9DA 5ILGA 3VPSA 4V1CB 1VE9A 1Y7HA 4YAOA 1GQFA 3NO4A 3RJZA 4F72A 1YDHA 2P8JA 4XVQA 3BA6A 3T12A 4J3FA 2SKCA 1A95A 3H9QA 4DLUA 2YZ7A 5IAAA 4MTCA 2PMEA 4IDCA 1ABFA 4LJ8A 2YY5A 3TB4A 4MPDA 4K9OA 4KUGA 4IYJA 1YASA 5T6BA 4HZUA 3HKCB 3LDHA 3R3UA 1E6CA 2OYRA 1OIXA 3BWBA 3EOBI 2YOFA 1M75A 5DWVA 1Y8CA 2RARA 2VR1A 4EHJA 1QP4A 3ZBQA 3SS9X 5CJPA 2E4ZA 1L4EA 2XVZA 3PQDA 1M1ZA 4B4KA 5K0CA 2IW3A 3H17A 3U3ZA 4LCJA 4AYWA 4AMUA 5EEHA 3PQFA 3Q12A 3GDOA 3DULA 4JXXA 2R4UA 1MRZA 4FZRA 1QHSA 3C3EA 1KOFA 5HZMA 1XMOB 2FN9A 2ZAGA 3GUCA 3DEAA 3BILA 4QNNA 1G7SA 4JK3A 2OYCA 2O8EB 2H5JA 1SGWA 2B1GA 1RRGA 1L5QA 1H23A 5EP3A 3IHKA 2QOEA 4FYKA 3F1KA 1CRZA 2W98A 4CMAA 4J0KA 3RT7A 4UXHA 1V6CA 5CVDA 3FOEC 3RADC 1NC3A 3QVJA 1VG8A 1RRPA 2OO5A 2QRZA 4KK3A 3GRZA 1ICEA 1S3IA 1S2MA 1WXEA 1I3KA 4J7CA 4PYNA 1E62A 3IEPA 1H94A 2BFPA 3VTKA 2BSQA 4B9AA 2Y05A 4LHVA 4UBMA 3HDGA 3IV6A 1QQ6A 2ZE5A 4A6EA 4B7UA 3I1FA 1KYQA 3RU2A 3Q7IA 1Q0HA 3O31A 4GYWA 1BVUA 1IIBA 1KY5A 2XWBF 1HDZA 3HGQA 3ZHCA 2DOKA 2FAXA 5FL3A 3BX1A 3K0BA 1SEVA 4MO2A 4QC2A 1X7WB 5JDCC 1Z5WA 1JFFA 3TDKA 1KIFA 3BF8A 2HZBA 2W00A 1VMAA 3ZY3A 2VXCA 2AFHB 3K5HA 3P9XA 3BEOA 4X90A 5JFOA 1GN8A 4Z4QA 1A7KA 4V39A 4FFBA 4ZODA 2ATEA 5P8WA 1TT7A 3L0ZA 1ZSNA 4CEJA 2Q1WA 1XNQB 2ZIFA 3DO5A 2QY9A 4AICA 1QYVA 2HSZA 4RH3A 1ZNZA 3HKBA 1XU9A 1QLJA 4DLKA 2QTFA 5AKHA 4GKAA 2DPYA 4L28A 1JR3E 1AD2A 2HJWA 2ZRMA 3GT3A 1T8UA 5K7SA 1HG1A 1YHZA 3GGGA 5JIBA 2GAJA 4X20B 2BMFA 2PH1A 4RACA 2YFYA 1CQXA 4QO7A 4URVR 5HRAA 1TF2A 2B7CA 1I4DD 2HV9A 3OTIA 3QXCA 4AQDA 3BMOA 2HA4A 5BSFA 1HNXB 3H42B 4A1FA 5JMOA 3R76A 2G72A 4YUAA 4AWXA 2CXQA 4L7VA 1XTJA 4KPUB 1UC4B 3E18A 1JW9B 2INGX 2VKQA 2Y1KA 3FPAA 4J1TA 2AFIB 2DP4E 3IAEA 3NHPA 2ZS9A 2MIIA 4IIEA 3AERB 4WY5A 5LU8A 1VDZA 2IYTA 4UBJA 3A36A 3CLUD 4UUOA 4V0LA 5JPIA 3LQFA 1OAOA 2VYFA 2QVGA 3G9TA 4RZUA 4XR9A 5G1NA 4AZVA 2ERXA 3GMTA 4WFIA 1UP4A 1J9GA 3G17A 1O54A 1STOA 5ENVA 4C5AA 2UXDB 3IALA 4OJNA 4E5SA 3DE7X 4XASA 5JBIA 3OJCA 3D6MA 4FYXA 4CBVA 1XNRB 1DQZA 1U1FA 5AH0A 2IHKA 3KQVA 2HDNB 3SF8A 5IZCA 4ND3A 1JILA 3AU8A 3FNGA 3K32A 4NABA 5ALLA 5DYTA 1BDHA 1R00A 5TQ2B 1KRHA 4KE7A 4AJ9A 2DJIA 3THSA 4IDQA 3K6JA 2WJIA 1TAQA 2XZDA 1E7QA 1HETA 3C8ZA 3D4LA 4PLFA 3OCYA 1DKMA 4TS4A 1OX4A 4DWJA 2B35A 2OD7A 3T8YA 5M04A 2Z4TA 2HYDA 3CLSD 3GIWA 4IO0A 3LNCA 4WASA 1ADGA 1C8BA 1T8WA 4UE6A 4ZVLA 2CMGA 2HZ7A 5CG2A 3RG8A 2P6RA 2V4MA 5FBVB 5EG5A 4E2FA 1FP6A 1ZUNA 1LX7A 1IBMB 1RJGA 1YRHA 1UEJA 4Z53A 3FUUA 4LY6A 1B41A 1IWBB 4Y1RB 2XB2A 4UPDA 3ZOZA 1UINA 2PLRA 4R1NA 3LG2A 4FQ8A 1OX6A 3TVYA 1JEYB 2CFTA 3D1LA 2C1EA 1TO1E 2R66A 2CLIB 4G4SO 4HWRA 2ZYSA 3TRHA 1B15A 4KOAA 4GGMX 1E3IA 4N7JA 1LV7A 1H5UA 2FPRA 2XYPA 2ANCA 3CLVA 1KI6A 1SCUA 4J1QA 3BMXA 4NBTA 2Y71A 5SY6A 2WY2D 5HTOA 3GK3A 1ZXBA 2H1VA 4CEIA 1L5HA 1QO9A 1XNJA 2IDKA 5JXIA 1ZIYA 4X63A 4KH0A 1WMDA 4CCYB 4J6FA 2QEQA 4QFDA 4YALA 5A5VA 3BIWA 4ZVTA 1TM5E 5T4HA 5I7VA 1YHYA 3UW1A 5DK6A 1E9AA 3KLMX 3IEIA 1R8YA 1GRRA 4GOOD 5CDUA 4JT4A 5JWOA 3G13A 3W9UA 1FFXA 1YKSA 2CVZA 2OXIA 1S9HA 1SURA 1WQ3A 2ZAMA 1RHRA 1NW4A 1SY7A 3QXSA 2WU4A 3KUUA 4IOMA 4B33A 1JUDA 1R4MB 1Y48E 2J3LA 4QUKA 3REGA 2JVJA 1UBJS 3MWEA 4RU1A 1Z47A 2WF7A 2CNKA 2ZLBA 1DI0A 5C8VA 2O3SA 4YCMA 4FNAA 3WAJA 3F9IA 2C3MA 2XLBA 5L3QB 3SYKA 1W25A 4YHHB 3M4NA 4V03A 3TZKA 4CIVA 3V5NA 3HLTA 1QH1A 1ZN7A 4DL9A 4WBNB 1KAQA 1Z6QA 4LZAA 1QWSA 4NE2A 3ORYA 4YRPA 1QP7A 4Y2YA 2PUFA 1QPGA 1JE0A 5IMBA 3V8BA 3DTVA 2NTEA 3RC8A 2C9OA 1HYEA 2G09A 2H11A 3EWIA 3C5VA 3AUJB 3E82A 1GKIA 3EFOB 3PU6A 4HX2A 5CMLA 5SZIA 4ESEA 2KLHA 1D1QA 3Q8KA 4F8EA 5THKA 3RVSA 1JLLB 4DW8A 2FK7A 3M33A 3NORA 1UXIA 2LCIA 4Y67A 1UFVA 2BUAA 1AK9A 3D4OA 4MI9A 2V58A 4JBXA 3KFLA 3G0HA 3LT2A 1ONOA 4OV6B 4E2WA 4MVJD 5M34A 4I0WB 1OXXK 2R87A 3H05A 1O6CA 4KLCA 2J0QA 3UUEA 2EFYA 4CFSA 3HJGA 4JLNA 5JTUA 2Q7XA 4LE1A 2NWQA 1JWLA 1DJOA 4YT4A 4U7WA 4YP1A 1TPZA 1PX0A 3WWOA 3T7JA 5FOTA 1BCSB 1RRMA 4MS1A 2ACVA 5CGQB 3FHOA 2ZUEA 2PXXA 4U0JA 1G20B 1GLVA 1UOPA 2REBA 1YB7A 5BN4B 1AUVA 3MAGA 4CQLA 4C4XA 1B76A 4RZ3A 5FWNA 1BIFA 3TQIA 3LUGA 1E1KA 1M6WA 3S2YA 2F7SA 4OFXA 4HBGA 4QRHA 4JLMA 2HFKA 3E61A 3DT6A 3Q9LA 2WWTA 3H8VA 3RIMA 1THMA 3QOFA 2BF4A 1I80A 4Z3OA 3JATA 4REQB 4EX6A 2P78A 3QLEA 3AQ4A 3IKLA 4NBRA 2WQ6A 2G5TA 3JRWA 1RC1A 2W8BA 3P9NA 4DLYA 3EYWA 4G0OA 4E5YA 3WC4A 3WNDA 1JQJC 5AVTA 4PLZA 4E21A 1RM4A 1DAMA 4C2BA 3I9KA 5IM4F 3EAGA 4QOIA 4LKOA 1T0BA 2YINC 1E8DA 2ZT6A 3JV7A 1H3NA 2MMGA 5G4LA 2H2GA 3GEBA 3MBIA 3HGMA 1ZQ9A 4FMPA 4Q34A 4XGQA 4LDZA 4BDTA 4ESVA 3NCTA 1TO6A 3VMFA 1ZAKA 1RVV1 4WZAB 4DWVA 2XMSA 3VVMA 2V5AA 5HXAA 1GAWA 2CLEB 2C8KA 2NZJA 1GLNA 2NTJA 1AJEA 4X00A 5EWJA 1WVGA 3ZWYA 4FR0A 5I7HA 4OP2A 3C7CB 3QKSB 3BHMA 1KS2A 5H8WA 1SK9A 2WJPA 1CUGA 4JLWA 3SEFA 3WFJA 5HVNA 5EUMA 3DFUA 1ORIA 1P1CA 1NJSA 2XKAA 4HDNA 4AL4A 1U0TA 2P5TB 5A5EA 5C5IA 2BFWA 4ITUA 3DM5A 3FM9A 1P75A 3RVMA 3U4CA 3WMFA 3PDJA 3RS7A 3OFVA 3IMGA 1YRLA 2WUFA 3DV0B 3QX8A 1PDOA 3QELB 4IBOA 3R5JA 4JP5A 3VPDA 4TV9B 4HOYA 4MZXA 5BXQC 2CD7A 3CA8A 2Z83A 3UPDA 2CYCA 1N6RA 1OIVA 2W6PA 3H2JA 4O29A 4Q4HA 4F5YA 4H60A 3HXQA 1ZD9A 2ETVA 1UPAA 2VT2A 1MTOA 2DF8A 3VR4D 2PO7A 3QPWA 2O8DB 2R6FA 3G02A 5AI6A 2G7ZA 2O5RA 1RPJA 5BQ3A 4ZEVA 2CXOA 2W93A 2EZ4A 4PIMA 4G4SP 5EMKA 2AA3A 1L4KA 4KEAA 1XZMA 2N1BA 4PFJA 4ZCIA 1M34B 5ICMA 2CKMA 3K94A 1HQKA 2I78A 3TMYA 1EFPA 3TNLA 4DLRA 4YA6A 2O2JA 2PL5A 3KHKA 1LWOA 1W0KD 2QA5A 3HACA 5LN1A 3D6AA 3G1UA 4G1UC 4JMLA 4X3PA 3TX6A 2DQKA 4RF5A 3MPOA 1ZMTA 3MMZA 4Q6BA 5KMGB 1P72A 4J1NA 3KHTA 5KVCA 4IDGA 2V9CA 2XB8A 3PEEA 1A9YA 3MLBA 5I6DA 2CCJA 4FINA 4URUR 2NYAA 4UVDA 2ZJ2A 3C41J 2G06A 4BX8A 4NV1A 4N7BA 2CEKA 2DLDA 4I4CA 1J9EA 1VYVA 1COWD 1WW8A 2Y4OA 3NOQA 4FFLA 4N82A 2Z8ZA 1E1MA 4U7GA 5D00A 5T4EA 5A71A 2LWIA 5E7QA 3U3XA 1YJAA 5J4LA 1ULAA 1JEOA 4U2DA 4GKBA 2OILA 4IDPA 1EEHA 3RSLA 1YJQA 1Y3CE 5EE5B 2NSJA 3ZGVA 1W9MA 4GOKA 3SYRA 2WFLB 3HKEB 3NBYC 4MKRA 1NA5A 1OB5A 3L02A 5B2ZA 2OAQ1 3H3JA 4R3UC 3SX2A 4EG7A 1K92A 1G17A 3KU1A 2CNWA 1WLYA 4G5YA 3U7QA 1TJ5A 3W79A 1OLXA 1KIMA 2W4MA 3T7CA 2WYVA 4YB8A 1MX3A 1LA2A 1P80A 2V1XA 1MDBA 1T3ZA 2GA9A 3I5AA 1BYIA 4Y7DA 2PUVA 5DBEX 5JARA 1X9HA 4L4YA 1G1AA 4M4SA 4INZA 5AIBA 1JWAB 1QQAA 4YYZA 4EFDA 4HNQA 5HF8A 3JVEA 2WM2A 4DBZA 4PLYA 1DCFA 1Q1EA 3OBIA 2MSKA 4IJVA 4M0EA 3V6MA 2BKXA 1FYVA 1DKRA 5CP8A 3NQ41 5AO9A 5EJGA 1IM8A 1E1DA 4K3VA 4MDYA 2EATA 4X6UA 5FQOA 3ZDRA 1ADJA 1Z22A 4LVUA 4J9VA 1GUFA 1VHTA 2FWIA 4NLLA 2RGRA 1SWWA 2GPAA 1FCJA 2OLEA 3L6DA 5KX5A 5AXBA 3KXPA 2O8FB 2J4DA 2XUQA 3DVSX 4DZZA 3ZDZB 4RE6A 3C4QA 4DM3A 3TW0A 4KO1S 2EKQA 4PZZA 3VGJA 4UULA 1QYRA 2H2HA 4DCUA 4R83A 3S8MA 2R00C 3CZMA 3ZWCA 4YP5A 5CB6A 2WJ4A 3GBSA 3UMMA 1Q0QA 3NBUA 3T52A 3ZU2A 4GBJA 2ZJ3A 4UFNA 4BIIA 3CX6A 3L79A 2CXHA 3A6EA 5DYWA 4JLKA 2CHQA 2EW1A 2WKSA 4FDAA 3O8OB 5JHGB 5AJXA 1OXSC 3QLUC 4MEJA 1PUJA 1OU4A 4GKKB 4I6GA 3L18A 1T4GA 1ODCA 2UYHA 3KB6A 2ZJ6A 1XMQB 2ZUTA 3A3NA 2YS6A 3SLGA 1T5TA 1TYAE 1XP8A 4RL4A 5DHQA 3UK2A 5CIQA 5BN3B 3AVTA 1CF4A 1PQPA 4JP8A 4EO4A 5I9SA 4DLSA 2H0AA 1SHZA 1YI0A 2VNIA 4U5XA 4W5JA 3TTSA 3ZWMA 3ZWXA 5B1EA 3EEQA 3NAQA 2PWBA 3U13A 4EPVA 4QBGB 2HNAA 4B3HA 4N8EA 1V5GA 3CNBA 3L4EA 1GG5A 4ZWNA 2WWHA 3DBVO 2QROA 3DL2A 3CIFA 3A1DA 3G9ZA 3IPAA 4FUQA 5D85A 4CV1A 1DLIA 2KX7A 4D8TA 1A2KC 1U0LA 3HV0A 3JYHA 4D0LB 4JIGA 1PHPA 3F3MA 4TYMA 3GLGB 3EISA 3IT2A 4JZYA 4AXXA 3AH8A 5CCBA 3UMFA 3LC7O 2ZRKA 3A0UA 4CG1A 1ISFA 2QTBA 4BKQA 2C0QA 1ZGGA 2P2GA 4FIDA 1W75A 3FHLA 3P5BA 3GZTB 4HB4A 2CK3D 1K9VF 3CS3A 4XYLA 3QA9A 5EIXA 3R5SA 4IQ4A 3TZEA 2VHTA 1ZZGA 2QNRA 3A4NA 3F8SA 4ASUA 4EIWA 3BIJA 2DUWA 4QVGA 1BMTA 2BPOA 1J2RA 2HCBA 3LBAA 5CT8A 4YT5A 4BVBA 2PUHA 5IUKC 3E7FA 1QKIA 2QN1A 5THQA 4ZU3A 1H6BA 2Q5LA 2ZBVA 3DEFA 3U37A 2ZIUB 4TVOA 1BXRB 1K08A 4RK0A 4HMPA 1SBNE 1XA3A 4FHGA 1JHYA 2GI4A 5G0SA 5GGYA 1E2DA 2WD7B 4CLEA 1T9BA 2FMIA 3GN1A 3KJZA 2HPAA 3GJ3A 2VK4A 4OYRA 2QMHA 5F1PA 4UQPA 4B2IA 2F1IA 1CEXA 4OGWA 2GFHA 2XKJE 4U39A 2EBHX 1J56A 5K3FA 5LQKA 3WYAA 1TQ8A 4A16A 5FPYA 2JGLA 2AYZA 4BPBA 2VPQA 2VPXA 1GL7A 3CNOA 4V0RA 4UAGA 2V65A 4AZWA 4H3VA 4RTLA 1JRLA 3FNIA 4GLLA 3AG5A 3T3DA 1RAFA 1BH6A 1XE3A 1ZM7A 3UHFA 4C3VA 4XIIA 3G5AA 4IDDA 2FN3A 3WGQA 4UHBA 3ZW9A 1UBFA 4YCJA 2C7BA 2R47A 1C7RA 2G9QA 2F9FA 2GQ0A 3EG9A 1KK3A 4Q66C 4LY3A 3LP8A 4RCYA 3PDIA 1E9CA 1WSDA 4ZMSA 3X2SA 4QZVA 4RMGA 1CQWA 5DEOA 1NPDA 2AN5A 3NDJA 3RNLA 4D0NA 1N7GA 2VDRB 4H6XA 3ZH2A 3FNBA 4MUYA 1E4EA 3FUTA 4PLTA 5IHXA 5JFGA 1NOKA 4FDUA 4KR9A 5EUQB 4KFTA 3GLHE 4EYGA 4DMRA 5KPJA 1P77A 3Q40A 2LPMA 3KQHA 3E9YA 1G9SA 4OHFA 4GR5A 3DAOA 5IAGA 4CEHB 4WZ6A 1QGOA 1LPMA 1XHEA 3R0JA 1SVWA 4MYRA 1OSNA 4BN0A 4QJ3A 2HNBA 3FMPB 2GK4A 1Z06A 1XAHA 1FDSA 1LJUA 1Q7EA 2RGAA 2GPYA 3HG7A 3OFNA 4JQCA 4MB0A 4DCMA 3CINA 3M6WA 4ER5A 3H7AA 1OV4A 3HLYA 3CNNA 3ONEA 1IEVA 1ECFA 1GEEA 5TVGA 3DPUA 2G71A 2QENA 4GI3A 4J43A 3TW6A 1OBOA 3NWPA 2WQ7A 4TQ9A 2D5CA 2FN8A 3NVKI 6NULA 1P2FA 2LP4Y 2OUIA 2L17A 3IRVA 4LUCA 2WVGA 4Z4FA 1LNSA 3RYFB 5BY2A 4D3DA 1WUHS 2H48A 3ANXA 2ZDGA 4G81A 5EIEA 3I9JA 5A0FA 4I9NA 4MULA 2E2WA 4R1TA 1BO6A 2FMUA 5KYXB 1BMFD 2EKLA 2WIDA 5D2CA 1EFRD 4OXRA 4BVAA 2A5LA 4IOLA 4CMGA 4F0JA 1Z6XA 5JVDF 3D64A 3DJFA 3Q85A 4PTYA 3RVPA 2DC1A 1R0LA 1Z4LA 3L4BC 1EFDN 3OZCA 1BOFA 3EGXB 4KI0A 4NARA 5CXSA 4Z99A 4L5CA 3GVPA 5TPWA 4CTKA 1U3TA 1VL6A 2F59A 5CJ2A 1C9KA 1JAXA 1OBVA 3QKTA 4UBNA 1AHHA 2VXOA 4B17A 1HSOA 2ZT8A 4IDAA 5JAOA 2CV1A 4NDZA 3RVOA 3ADBA 4UMDA 3EE6A 4MQ5A 1ZD3A 1MN6A 4O59O 2G5CA 3KB1A 3X1KA 1IB6A 2H52A 1FJ2A 4QX6A 1XTKA 4L6AA 5AKKA 2ZSHA 1BGXT 1HDRA 4LNUA 3R5FA 4O2AF 3PR3A 3GJZA 4QEZA 3AYZB 3O84A 2DHQA 3AKDA 5HILA 4AWBA 3WSWA 2JZOA 2VC2B 4HI0E 2M98A 4JUDX 3UQZA 2Q4TA 2B99A 4RIIA 5B1YA 3EH2A 1V8BA 4D6YA 1EBUA 2KW5A 4P81A 4TYPA 3IR7A 5BN5A 5IZ4A 1CRPA 4EW2A 1GYQA 2QZZA 4OCZA 3QX7A 4MDFA 2YHUA 3TSOA 1WO8A 1O97D 2PZMA 3DUFA 1MHPA 3JY6A 4MVJG 1LTKA 2G6BA 2HL6A 2WTNA 2Z57A 2Z2KA 2F17A 2J31A 3IQHX 3K2IA 1PZHA 5EPEA 5FUMA 3ENQA 5EPUA 1PV4A 3EIQA 1BG6A 1HDEA 3OLWA 1FSSA 2HOQA 3FCAA 4V0KA 4WBXC 3TK1A 1PAUA 3FCXA 3DLTA 2QPLA 2JEZA 2RAUA 2IF0A 3LZCA 3P4UA 1I5OA 3C3KA 4KV7A 4UNPA 1T10A 2B30A 3HWX1 4ZOLB 1GNQA 2ID8A 2ZULA 2QL9A 1F6BA 2CDRA 3O7WA 4H6PA 3IQEA 2LZ0A 5LQAA 3EXFB 3NGMA 4OJKA 4B82A 2CCKA 3AHHA 1VL0A 3KAQA 4URZR 2ZVDA 2GJKA 4WINA 1RYFA 2X0RA 3ZLTA 2PBRA 4X44A 3FLBA 3T7AA 2WAMA 2OZVA 4OLJA 1JA1A 4BO3A 1HOXA 5DULA 2I9KA 1XZNA 1ZNYA 2AEEA 3B12A 2C2GA 4AF6A 1N75A 4HQLA 2YWEA 1DOHA 2FX2A 1C80A 5BYBA 4YV2A 1WXQA 4RTNA 2NU6A 3QXXA 1XYGA 2QTMA 5CRIA 2NU8A 2ZG6A 1MO4A 2JD0A 4RFLA 4B6GA 3B1KA 3ZW7A 3JZDA 1FFWA 1T1JA 2JI4A 1XWFA 3OX3A 3D6HA 3IV9A 2D0DA 5CX4A 4AURA 1RWKA 1Z17A 1YRWA 1M66A 2E1PA 2FQ1A 3B5JA 3KHSA 4K6GA 4QHSA 4MVCA 3BXZA 2O8BB 1TK9A 1ZRMA 5KUTA 2G77B 3HADA 2HK9A 2W7TA 3DKPA 4OIMA 3TVTA 4NCIA 4DLAA 1JLHA 4IL5A 5KINB 1BNCA 2X8JB 4K2HA 2OM2A 3U16A 4JI8B 4A15A 3VJLA 3CSSA 5CFZA 4YUWA 2ZKLA 4E7PA 4URWR 4IRUB 1B26A 1G8KA 2P0EA 3WLFA 4BCCA 2FPIB 2DBRA 4M53A 3AY6A 3EVDA 3WISA 4DR7B 3VZBA 4EFKA 3WO1A 3IXMA 2RH5A 3ELWA 3LF2A 2ZIAA 1J2YA 2C4UA 3PNBA 5KOJA 1QTQA 5LA6A 3USES 2V7QA 3DMTA 3L2OB 1RAEA 4QEKA 2XUHA 2JFXA 4W1RA 3TLGB 3TRJA 4CMJA 3QKWA 3LSTA 1MVLA 4Y6PA 1IOWA 1WUKS 1RWVA 4XKJA 3DL7A 3HFRA 3IP8A 3DT9A 4FFPA 2HBZA 4FFMA 1A9XA 2JBHA 2XNHA 2JPDA 3KTAA 3OOYA 1YA8A 3NHJA 3OIDA 2BEUA 3DPIA 1AS0A 2XTMA 1IIRA 1FK8A 1JHAA 1QIFA 2ZYWX 3C6ZA 4WE3A 4RIHA 1NULA 1LPAB 2I2AA 5CYGA 4NWIA 1P18A 5M29A 2YIVX 1CCWA 3RAFC 3D2AA 4HGOA 5MN4A 4TKVA 4B4UA 1JQLB 1KOGA 3OQBA 1D04A 1DUVG 1AXGA 2QJOA 2UZ3A 2W6CX 4TQUS 3SYMA 1FSFA 3H5TA 4BECA 1FW6A 2FEWB 2YIMA 3GLTA 4UTXA 4LRUA 4UDOA 4YDRA 1SIBE 5ALZA 3DDHA 2GTIA 4YGXB 2CHFA 2HMAA 5EWMB 1OYWA 4MIOA 1U3WA 3ETEA 4YJ2F 2HN9A 4F8YA 1OFUA 4IIYA 4AW9A 1NVEA 2DSTA 5EZ6B 2QL7A 1BZYA 1RC8A 4B7XA 3BXEA 3NC4A 1SAYA 3FG9A 4RHUA 5AP9A 3ABZA 4D5GA 1E2FA 1ZI8A 4IZ6A 2D00A 5EP4A 4YR9A 3S2GA 4D8VA 1YZFA 1UMKA 1GPWB 1CUAA 1FU7A 1SVSA 2L69A 2W48A 4C29A 3MD9A 1F7UA 3DKKA 2NUPB 3NRJA 1AE1A 5KTRA 1J1IA 3G9QA 3KQQA 3ITDA 3QW4B 3T3EA 1SOUA 5J2UB 1GUBA 4TLEA 1X42A 4G37A 3U5TA 2JAHA 1Q1GA 2WG0A 4NJMA 4LQCA 4Q3OA 4TS3A 2YYYA 4JA2A 2FSPA 1L4UA 5DCYA 1D2MA 3MMNA 3RUDA 1P33A 2IYEA 1BEUB 1J90A 1LDGA 2HT6A 3OH8A 4V2IA 5DCWA 4BMPB 5BN1A 2O8EA 4RGQA 4M8SA 4ATNA 1YTLA 1SZCA 1VZ3A 2HDOA 3KEGA 1KJJA 2H18A 4XQ9A 3MQ4A 3SC3A 4BXOA 3AKCA 5G0UA 1RWBA 3SHTA 5LUBA 2HHHB 1F14A 1RYHA 3EZ9A 3K0CC 3RVJA 2PCLA 4AU1A 5L4SA 2NT3A 1VCOA 5AVQA 3GLFB 3EZ2A 3RHFA 4KDRA 4DUGA 1U31A 2OCGA 3SIPA 3ON5A 5J5CA 3WICA 2VSFA 4PYJA 1MOSA 2H7YA 1JXQA 2PHZA 3PK0A 1ZRNA 1WTCA 3VFDA 1IY9A 1JDBB 4HWTA 1USVA 2MT9A 3DZBA 3CEMA 5DHUA 4OK6A 3R6LA 3AP1A 4MW1A 5BQ5A 2ORIA 4P0QB 3H9BA 4ARZA 2GUWA 4A0QA 4TTQA 3C3YA 2XADA 3ZHBA 1GUAA 3AOGA 1J09A 3M3PA 3P9SA 4OP3A 1F1BA 2Z4SA 5HEKA 5JRDS 1NDHA 3LQKA 1FDIA 4IGEA 4DXAA 1XT6A 4S1PA 1JSLA 1ZY2A 2WMNB 4MW5A 3ASVA 1ZXXA 2ZVJA 1RKXA 2ZS7A 1SKUA 2OQVA 2P4EA 4GOND 3DGEC 1ESEA 4QRDA 2YV5A 4U0KA 2IP2A 1GGJA 4RHFA 4W5HA 4AKHA 3OZIA 3F7MA 4JHLA 4E1AA 1PJAA 4MRPA 4F46A 1FVOA 2H4FA 3N2NA 4NS1A 1FFYA 1FA9A 1G4HA 3I6ZA 1T6XA 4G5GA 4P7FA 1CUHA 1WDMA 3VH2A 4EY8A 2FW9A 3E3LA 1EJBA 1F8YA 1WB4A 1EX7A 2JHFA 5M3BA 4MR9A 4E7OA 3EMBA 2Z3WA 3EF1A 1C9YA 1G2PA 1F2VA 1YJ8A 3NJ4A 5MDHA 4ZZIA 3HJUA 3RR2A 4NNOA 2VLIA 4WD3A 2IGBA 3RVBA 1W5SA 1VKZA 2JDIA 4KPUA 2CUKA 2ZEJA 4NFHA 3UMRA 4WV3A 3WK5A 2B5OA 1CUVA 3S8YA 7GPBA 2XE8A 4FX5A 3X3HA 1QH0A 1T24A 4EDHA 2BELA 4A91A 4ENUA 1Z07A 3JQFC 4DJ5X 3AHJA 3FTFA 4DMUB 4ZQIA 1ORRA 2Q3DA 3QVXA 4EABA 1OKKA 2DVMA 4JN6B 3IIIA 2P0AA 1Y3FE 1RLUA 2WHEA 1GZ5A 1NX9A 3FOCA 3GU3A 4WOBA 3AEKB 3AF2A 5K4AA 3A4YA 4XGKA 4GR9A 4P33A 1TYBE 2HQ1A 4RV4A 3HFSA 4Y2UA 1FU8A 4RABA 2DQ4A 3BXOA 1XALA 5JQGB 1RM0A 4AP6A 3D31A 1S2IA 4JXJA 1OV6A 1X19A 4W6ZA 2X58A 1Z26A 4AROA 4Q9LA 2P2DA 5BV0A 2W6QA 2ZR8A 3ENVA 4GZ5A 4BB6A 3DEHA 1XAIA 4BX9A 3OFSA 4AUMA 3LPCA 4YQFA 1Q12A 2QTRA 3ONFA 2MOKA 3BF7A 4MR7B 1V3VA 3AFGA 3SFVA 4QM7A 4N48A 5JNSA 3A6ZA 2O48X 2KBEA 4D3SA 3LPNA 4GI1A 3OEHA 1WPRA 4XSVA 1HDCA 3GCWA 3N59A 2ZI7A 3N8NA 3GL9A 4B3FX 6ABPA 4ED9A 1MA0A 3F7NA 4DDTA 3MHPA 4YRJA 2O5CA 3TLAA 2I66A 1ESZA 2EWWA 2VZ8A 3T5CA 3MF4A 3F5SA 3ICQB 4JUFA 4FDLA 2DFDA 4B87A 1H1TA 4Z9YA 1OWMA 1QANA 1MABA 4S2UA 3AFIA 2RJNA 1HOTA 3ODPA 4MW6A 4O1HA 3LAWA 1VG1A 2CL6X 1UK6A 2QV7A 1DC7A 4NULA 4Q02A 3OY2A 1FRZA 2ZPTX 3DF9A 3T9DA 1GA1A 1FYFA 1LPSA 1VHDA 3G88A 3E7XA 4RY9A 3C3MA 1F8XA 4L08A 4A36A 1QU3A 3UICA 2C94A 3OTHA 4G1CA 1EFVB 2FR8C 3CX7A 2PX2A 4KQFA 4M1SA 2PRZA 3ZY2A 4R0NA 1IAVA 2OBFA 3DBRB 2EJCA 3CZ9A 1W94A 1MVOA 3E23A 1PHRA 3H4VA 3NI2A 1C1YA 1RZVA 4S12A 1AQUA 1U7TA 4EG6A 3GRCA 1KC1A 3OQ1A 4C89A 1W5AA 2OMEA 2X22A 3JZFA 3WB1A 1DX4A 1WXXA 2BFBB 4UU0A 4OHKA 5AR1A 1E96A 1TD9A 1ZNQO 3TR0A 1KJYA 2ONKA 3GF4A 3QFCA 5IC6A 3I92A 2A35A 1O95D 4TM7A 4ZAFA 4AMYA 5FYQA 1W49A 4FQ5A 2UAGA 1XA4A 4U3JB 2CHGA 5CFRA 3GGJA 4KN5A 2XXBA 4EYKA 2N75A 3EZ7A 3VH1A 1O8CA 4DC9A 1NBWB 4EHHA 5E6SB 3WDMA 1SIWA 2XGGA 3AGPA 5DBIA 3F6CA 3W05A 1QOQB 1QONA 1SIUA 4IDBA 4KO4S 5D3KA 1V41E 5EP1A 1FVXA 5C35A 5C5CA 4TMVA 5L3QA 1SULA 4HK4A 2O0MA 5CNIA 4OGLA 2D62A 2IYSA 3KOXA 5IS2A 2O59A 3E8SA 4ZU1X 3ZGYA 4DANA 5DPMA 4A6PA 5KQSA 1Q20A 2IYFA 1WP4A 1TYZA 2LDBA 3AU9A 3ZQJA 2IS1A 1KGSA 4UBIA 2HXGA 2QQFA 1VYTA 2F43B 4MI3A 2VXBA 5FTLA 2GXSA 4EK9A 3QYAA 2A1UB 3AR2A 1W7AA 2IHBA 5SY4A 4PVCA 1T29A 1EG7A 3A27A 2ABWA 2VAVA 3LHKA 4FCCA 4UM5A 4WUVA 4ZVUA 4BLOA 1N6HA 4NFSA 4XD2A 3ZIDA 4EI8A 6REQA 3ABQB 4A8JC 3I2IA 3MWDA 4GMKA 4XUEA 4QREA 4PCVA 4RJIA 1ZN9A 4OY3A 3BB4A 3C48A 2IEYA 2QSZA 3CF0A 5FPPA 2APJA 3GNSA 3TOVA 3ZU6A 2JJ2A 1H2XA 3EVEA 3UWSA 5HS4A 3SC2A 4MO9A 5E3HA 4BVEA 1R3UA 1GRQA 4IIJF 1GGMA 2GM3A 4I55F 3H8WA 3QMPA 1CS0B 2J8ZA 1KJIA 2XNSA 1G7CA 5BN4A 3LYLA 1M3SA 4K0RA 3WGMA 1SXQA 4RKFA 5L95A 5GONA 4B8ZA 3JVUA 3PJRA 4PZEA 3BIOA 2OA0A 2RGGA 3SXUA 3OT4A 1QHGA 2O23A 1AKVA 2P9BA 4G67A 2V4ZA 3KCQA 2JLRA 2ZWOA 5FI1B 5PNTA 3WGYA 4REQA 4W7HA 3WWDA 3KPUA 3OU6A 4MEBA 1QDUA 4WACA 2HTEA 1DV2A 3ZE2B 5B12A 5GINE 1PE0A 2MYTA 3KV3O 2O0HA 4N3GA 3O8RA 2JLWA 5KNDD 3SX4A 4K9KA 1S8AA 1SBHA 1TW3A 3EJ6A 1RQLA 3KJXA 4UBOA 3RTEA 1E0SA 4HFRA 4ER7A 2IBTA 4RELA 3ZQ6A 4BMXA 3MJTA 3B89A 3Q8MA 1Q1NA 5EJIA 3ACCA 1CR6A 3QZUA 2AMJA 4CNQA 1RLIA 2Q5IA 4BFUA 1YE8A 4F7WA 2XWQA 4LIPD 1QTNA 1CW2B 4TUYB 3EPRA 3CH5A 4UUBA 3TVDA 2RHHA 4CL0A 1JI3A 2JGRA 1JIXA 5ENZA 5GVSA 4OEHA 2Z56A 4FDMA 1C7QA 3WHLA 3EXAA 2HIMA 5CDYA 3QU9A 4PSUA 3UN1A 3QKSA 3P9CA 3VKVA 2P3OA 1R0CA 3I0MA 2CMHA 2CLLB 1CUFA 1R6AA 5DGCA 1YUMA 2HWXA 3ESYA 1VJCA 3GLIA 3T4EA 2XX3A 4RL6A 5J9FA 2C4TA 2ZZKA 5IBQA 1NZFA 1AXRA 4M8LA 4MWOA 1SM4A 4K6KA 5AKGA 2RGEA 3PF9A 5IKOA 1W36D 2NTNA 1GKUB 2QGFA 3GHHA 3HUTA 2Z30A 5F5XA 5AI0A 3QELA 3U48A 1SCKA 2A57A 1JGTA 2D0IA 1E1NA 1S6YA 2JS7A 2SHKA 3G0BA 2GSWA 2X6QA 3P96A 4JOBA 1G5PA 2GR9A 3JAWB 3AJRA 1H1DA 3CG0A 2G88A 4KNWA 2NQ8A 4OLFA 3TEFA 2WBLC 3BCRA 4EB6B 2O8DA 5KAMA 1ZD2P 3I9V6 2H0QA 5CFQA 3RIEA 4OQXA 2NW6A 4JYCA 5CNMA 2J3MA 5K3OA 4JI0B 2GS9A 5COQA 4RHTA 3EGDB 5CDFA 2J6HA 4Y9RA 4YQZA 1OJ7A 1XK7A 1QRRA 3CKMA 1QOPB 4KQCA 4BFSA 4IDNA 3DHWC 2TSYB 2WE8A 3LQ4A 1P61B 1RNLA 2QLJA 4FHCA 4MLPA 1M34A 5TB5A 3PGA1 4GE0A 1HDXA 1Y5LA 1IFXA 3DWFA 4JP1A 1P4AA 2PS9A 3JS5A 1K27A 5CK5A 4AO6A 1VGQA 2BN4A 2JW5A 3IUJA 5F2KA 5IWAB 2NPFA 5KZMB 2I2WA 1I4WA 3U7GA 1RQRA 1HEYA 2R7MA 3IODA 4JC0A 3AR7A 3QVGA 1G9TA 1G2OA 3PNKA 3PUVA 1HFJA 1SQGA 2AG1A 4H3SA 1L7DA 4D9GA 4DLNA 3OF5A 1E0JA 3ZV4A 4ID9A 4RPCA 3AWDA 2J41A 3FTPA 1AXEA 1Z18A 2P9QA 1JG6A 1XYVA 3Q9NA 5EMNA 3TKYA 4XDGA 4P5DA 3LWZA 5JATA 4R69A 5KSPA 3STYA 3GCGA 3TDNA 3FDXA 3NHZA 5AI9A 2IYOA 2ODWA 3L6UA 1AA9A 1IATA 1HDOA 3JD3A 1DSSG 3M6IA 4DIOA 5JBNA 1JIUA 3E7WA 3N0VA 4I9HA 5DLPA 3F2IA 1HKHA 2H1RA 4GBED 1DMSA 1U8TA 2ZWVA 2JATA 3A1TA 4N8SA 4YI5A 2WFLA 4BEBA 5IVHA 5DM2A 2QRUA 4Z4IA 3JYPA 4QBIA 4R0MA 1C4WA 2OAEA 1A5BB 2A1TR 3DFKA 4RGYA 4HS9A 3QMVA 1ENYA 1PTJA 1AF4A 1RWXA 4GD3Q 4BUCA 2BLNA 3S28A 1IN1A 2YX1A 3K6KA 2I71A 4V0ME 1Z4PX 2PIDA 3IOBA 4QT4A 3L7NA 2O07A 1FXWA 2WOJA 4GFDA 4TKMA 4UU1A 5C7YA 1XRJA 5F23A 3DQPA 2J0UA 2HMWA 3TSYA 2QQ0A 1ZR4A 1X7XA 2CNBA 5CFNA 1P3JA 2C9ZA 2WP0A 3I53A 4FR5A 3ZI4A 3OUZA 4ZAYA 1ZO8A 2WSMA 4LXTA 3SKYA 3LKDA 5HZKA 4HADA 1H4SA 4GYKA 1VC2A 2P9JA 2R65A 3NBFA 4KO3S 1I8TA 1NL3A 3V1LA 3S2ZA 4HT3B 3G5TA 3HZZA 2GRAA 3AVYA 2NUAA 3BH6A 1O87A 3PCXA 4JLOA 5JH7B 4TSFD 1E7MA 2ISSD 5IULC 1QIEA 4WZBA 3LKZA 1M2HA 2XOXA 4FJ0A 2A67A 3CCBA 1GZUA 2B0CA 4B7CA 2UZ1B 5G53C 1HDIA 2H6EA 1XRNA 4Q3EA 5FXMA 3TTWA 3FVTA 4C1BA 5KU1A 1D4ZA 3GFGA 2IX9A 3OCUA 4A10A 5C53B 3KDAA 1C3JA 3PE3A 1Q7CA 4MUGA 4PLHA 5EERA 3FGZA 1UADA 3FW1A 3QP9A 2JVKA 2BMJA 5C8DA 1KAEA 2OORA 5EVCA 1Z4QA 1T8YA 4JOQA 4MLDA 1T4MA 3UWKA 4HXYA 2JK1A 1IBCA 1PJZA 3A1VA 4N6GA 3E8XA 4OBXA 5BN3A 2NAFA 3IGFA 2B8JA 4IUDS 3NFYA 2ORYA 3R3HA 4Q15A 5E1MA 1E3LA 5CU7A 4HDRA 4UPVA 2QLTA 4BO0A 5A1TA 5J23A 1Z8HA 4HDSB 4P36A 4QJ4A 4R2HA 1S3FA 4HXEB 4MVJM 4XEUA 1IBKB 3CLTD 4HEHA 4X62B 4AUEA 1QHYA 1YCFA 2SCUB 2J3KA 1QXSA 2W6JD 3D2CA 4JLUA 3WWEA 5FH9A 2CLSA 2XYQA 5TQ0B 4MARA 4IJKA 3RGGA 5A7HA 3SJCA 1Z68A 1FP2A 2VNKA 2XEXA 2CW5A 1UIMA 2P27A 2QX4A 2WOOA 3H1GA 1E2KA 3KOUA 1X8KA 1GZ7A 4NCNA 4X60A 4XR4A 4YVFA 1U3CA 2I80A 5DHPA 4CODB 2A8YA 3A04A 2JD2A 1G5RA 4O3FA 1KDOA 4XVHA 3RYIB 5FOSA 4AZ0A 3WIOA 3R9XB 2E3JA 2G0AA 4KX3A 4JIMA 3IQDB 5FTNA 2OV6A 2BAGA 2NADA 4OQQA 4PE5B 1Z12A 1CVLA 4XUCA 1FNBA 5TE9A 4PYIA 3AUYA 5J3JA 1J6UA 1P29A 1Y5RA 2Z8XA 3E53A 1Q1QA 4CIXA 2Z1MA 4DZRA 1ZLYA 2HDHA 2ZYUX 4KFRA 4RMIA 3WSVA 4BAUA 2B3TA 3L4KA 1I33A 4HB2A 3MXTA 13PKA 3TFWA 4RTJA 1BROA 4EGSA 3M1AA 1YR7A 5BSHA 2VSQA 4MVXA 5KWEA 3QX3A 1II9A 1N33B 3O21A 3QE2A 1Y1KE 4EUNA 3QJYA 2AW3A 1OHHD 2A4KA 4N6OA 2YRXA 1JYFA 4BY9E 3OLZA 3L6RA 1B8OA 4JV5B 3JARB 2G08A 1F17A 2XUIA 2BFDB 3PXAA 4R2WA 1BDMA 4IWYA 4FVTA 4C0HA 5CM8B 2X13A 1AN9A 2R2GA 1EFLA 1UPFA 2ZJ4A 1DEKA 1OA0A 1GQSA 3HB5X 2NO4A 2DWCA 2PZAA 3QU7A 1NFRA 4GMDA 4XJXA 1ST2A 4FJ2A 4EITA 4EL0A 4U00A 1S3SA 4OUDA 3U44A 3O3MB 1V7ZA 4L2IB 1OBHA 1RQGA 3CURA 1NVMB 1VRCA 1WU8A 5CVCA 2A1TS 3RM3A 4CMEA 4CMKA 2C5GA 5CHYA 3CR7A 5CLLA 2JFQA 1GNVA 1U65A 1E9RA 4LXHA 3KJFA 4BJ6A 3EGOA 2XBUA 3VYVA 5KSOA 1T3SA 1PSDA 4ZDIA 6LDHA 2A9VA 2I34A 3G59A 1PJ3A 1XZGA 1WHSA 2HSDA 4M86A 1UKZA 4H7KA 3Q3IA 5B55A 2DWOA 3RU9A 1AQ6A 4Z49A 2WZDA 3HVHA 4P2GA 2FN4A 1Z38A 3AP2A 4BYMA 5EIFA 2UV8A 2HHAA 3U9SA 1IG0A 4CLRA 3TE6A 1KFBB 2I2FA 2VP0A 3PTZA 2P9YA 2WAXA 5DNWA 1E77A 1O96B 1NQAO 1QGAA 4O4IB 4QPNA 3IEUA 5EZYB 4BB0A 4CM5A 1WKVA 4UM7A 1RP1A 1OI4A 3OJOA 3WRXA 1LH0A 2OBMA 1XD2A 1D6JA 1BDBA 2H9YA 4RY2A 1MRNA 5HSGA 1SA0B 1WB6A 1GVHA 1XQ1A 1ZJ4A 2BWJA 3QVUA 1JZSA 4HH1A 3RYFA 3P4XA 3VR5H 5KYUA 2D8AA 4OBWA 4RQAA 4Q3AA 1XKLA 5C31A 2RAVA 2YMQA 4CTOA 4EJSC 1CJVC 5A9RA 3INTA 3T1NA 4P4NA 3NV9A 1QNLA 1O77A 3RKSA 4AYTA 2OCYC 3JAKA 4OB6A 4BV8A 1A8IA 2WIFA 4MV9A 3DZKA 1QVZA 1DTWB 4GXRA 3ZHUA 1U9CA 4BZXA 1ZGCA 3HI4A 4J29A 2LCQA 1PZEA 5IJ0B 2VSNA 2WTAA 1PJ4A 3FCCA 4NE7A 2E82A 2GNOA 1E6KA 2PR2A 2WWRA 3LL7A 3VU1A 2PT6A 4BNKA 3BSWA 4NZPA 1JFVA 4UEQA 5A5FA 3PCTA 4FS8A 3U5ZB 2FPUA 2A7QA 4Z8XA 3V97A 2O3RA 4GUAA 1VLZA 3JQPA 5FO1A 3Q3VA 4HFJA 2WILA 3VR3A 4DIBA 3EW9A 4E07A 3KYDB 4CIYA 2X6TA 4ZA2A 3OQIA 4M1OA 1E6MA 2I3GA 2DHRA 3LD9A 2IBSA 4UCWA 1NBEA 4CKWB 4G0ZA 3WHIA 1BWRA 4DJTA 4MLZA 3IE2A 3UPUA 2NGRA 2LKDA 1WOYA 3PFCA 2RGCA 5SYMA 1XYYA 2B6HA 4PRLA 5I45A 1SUDA 1JNXX 2D0OB 4JBLA 4G1EB 3VJMA 5CBPA 3NOOA 4G25A 3T1VA 1YQ9A 2DM6A 2HWYA 4O0LA 1OZFA 3UKDA 3PR2B 2AJDA 4QSHA 3M6FA 3VPBA 3KTOA 3P0JA 2EF0A 4HQ0A 4F06A 2EZTA 1EBFA 1E9VA 4GPAA 1YBFA 4O2LA 3LLSA 4BQPA 3VNVA 1RXVA 1JB9A 1Z15A 3NYRA 2GCGA 2IC5A 4EBBA 4V1CI 3R4VA 4N47A 4EKDA 2XNDD 5DZSA 3F5MA 1J5PA 4TTSA 4QVKA 1XCGB 1SXGA 4ZT3A 5H3LA 5ALUA 1WY7A 4N18A 1HM5A 2P79A 1V4NA 3TCXB 2ZCUA 4B44A 4OYHA 1I9CA 2PA0A 2IPNA 2YJ5A 3O83A 4QA9A 1JIJA 3ZE9A 1ZITA 2PKYX 4LRYA 1NWCA 2J5KA 3OC6A 2A1IA 3LUPA 3SNHA 2R6JA 3AF3A 3GQBB 3Q1KA 3AP3A 4ZOLA 5MGBA 4XVUA 4X7BA 3RWBA 5B1HA 3AI7A 3NCHA 1DRUA 1AURA 2HI0A 3EXFA 4G56A 3O90A 2WVAA 4PQEA 1FP7A 1GPH1 1JQ3A 2ZYRA 4RCVA 3SZUA 4CMEC 4G0VA 2C1XA 2ZR9A 3TD9A 1KO1A 3CMCO 5F3WB 4KBFA 3N6RA 1M1NB 4FGWA 4NCJA 4CUZA 4Z0TA 1ZVQA 1JLSA 2CZGA 3ILYA 1B16A 4PWZA 4BTVA 1L5ZA 2HKIA 3WKDA 2ADMA 2IIBA 4RMHA 4CW7A 2NV6A 3V7NA 2OBBA 4ZC8A 2HCFA 1G66A 5A6SB 3WMGA 2DTXA 1TM2A 1RPZA 1WOMA 4NRDA 4Z9XA 2FOXA 3L9XA 5LP6B 1L1EA 1QB8A 4XDHA 4HQNA 2VHUA 4OHMA 1SXIA 1W5EA 3E03A 1EA5A 5C81A 4XUDA 2FZGA 1FNCA 2JG3A 1T2DA 1E2MA 3E5NA 4OUKX 3HXTA 2YUTA 2ZWIA 1MO6A 3PD7A 3TNYA 2I29A 5JYBA 3TMKA 3KZOA 2IP1A 1CQPA 1X1EA 1MEJA 1AKUA 3NTVA 3WRXC 2X8JA 5BR4A 1OB2A 4I6EA 4OAOA 4QU5A 8AT1A 1T1SA 3M0EA 1BA2A 3RARA 3BVPA 1B0AA 4GGOA 1YBVA 2PXCA 2PH3A 1FFBA 1RR6A 4FT2A 4XLLA 3B3JA 4TVSA 1E7RA 1J7KA 5B5SA 3LTEA 1FTQA 3VKHA 4F3KA 5BUQA 1KRXA 3DO8A 5B6JA 1XN1A 4WBNF 3ECCA 4P80A 2PKQO 2AH5A 3L3BA 4KDFA 2YRFA 2AK3A 3L05A 4JVMA 4E6EA 3CNHA 3D4IA 3NWJA 1L5KA 1WX1A 5TGZA 5HKBA 2C9YA 3I0ZA 5L8VA 2R6GA 1XRMA 1NY6A 1ZS9A 4YCNA 3HHEA 1MH9A 3Q7PA 3ZVKA 1JEQB 3KWFA 3WMXA 3UHPA 1IYZA 1GXSB 1NUPA 2EX4A 5HWSA 2ZRBA 5TPZA 3DNPA 3NTOA 3R7LA 2JA2A 5FO0A 4RZQA 5JG7A 5I7WA 1TAHA 1A4UA 3V4PB 3BIFA 1WSAA 3QLVA 2JCYA 5B4VA 2GKGA 4YJ3B 3Q5DA 1V1MA 2FW1A 2HLHA 3IEVA 4P86A 1WZCA 2K7FA 2GAOA 1KEEB 4UUNA 5JJCA 3WZMA 3ZDDA 1OY1A 4XB2A 3DCYA 4F6RB 3ND7A 5AVSA 5JAPA 2Y2UA 4G8DA 5K0TA 2BFCB 4UD2A 1WNFA 3FOWA 5EJFA 3A2KA 3B1WA 3O4RA 5DW3A 3AM3A 1N2CE 1YVUA 2XMRA 2ZATA 3I72A 2H9AA 2VDKB 3OWOA 2CJFA 4F96A 3WKAA 1NV8A 3MAJA 1M2GA 3BS4A 3CZ4A 4MUXA 4PXSA 3R7BA 4MIYA 4BQNA 4D4MA 1ISHA 1IJFA 3EQ6A 1OA1A 4W8OA 4ENVA 5EJ5A 4KE9A 2GMWA 1EP2B 2NUPA 2VDQB 4MUBA 5FEUA 1NI3A 1HH4A 3JQAA 1A0OA 2B3DA 3QEMB 4WWHA 3CUKA 1KSFX 1JVBA 1NDQA 2F6RA 2G70A 3I0NA 4MQ6A 4HKTA 4IV8A 3P2YA 4C7VA 3DMYA 2RI0A 1U11A 2E4AA 1HYGA 2XNCA 1KYTA 3N2IA 4OL0A 2PXHA 4UTZA 4ZT4A 2YC2C 3PCRB 4PLGA 3NATA 4S1TA 1FFDA 2O8NA 3BMCA 4WA7A 4Y2GA 5FWDA 1ULBA 3WQSB 4C7XA 5LSAA 2X5NA 2QVZX 3AEYA 4J07A 3GYGA 2IYPA 2Y9PB 3UZUA 1PI3A 4XFJA 2NACA 2Y67A 2IZ1A 2REXB 4EH1A 5IJZA 3O4VA 4HSGA 1H42A 1EK6A 3VNSA 4BNUA 3M1IA 3OM9A 2YRWA 3A9SA 4PGAA 2H1CA 1IVNA 2XKKA 3NIFB 1GSOA 1VPTA 1WF3A 2XQGA 2I1LA 3BMNA 4ID3A 4E11A 4DARA 3DHNA 3L6OO 3R3SA 3T3NA 2JFNA 1D1TA 3GXBA 4YRAA 3O1LA 5K2OA 3U7FB 1W4LA 3MUOA 4R98A 3VHXB 1S7GA 4Q9JA 3J81k 2WPDA 4ZANA 5MN5A 4TV9F 1NT4A 2G0TA 2VP6A 3C97A 3EXG1 4RM3A 5H68A 2II6A 3I39X 3OX2A 2VTEA 3KD2A 4NE9A 1YRBA 4LAFA 3ZKWB 4JKOA 4FBLA 1CEQA 2IH5A 2IEBA 1A4IA 2XVMA 1DCMA 1GT6A 1TGYA 2ZCVA 3LK6A 4IXWA 3RSCA 1T9GR 3NYWA 5IEBA 1Z5PA 2B1QA 2VI5A 3IKJA 4B84A 2F3TA 2RHJA 2O3QA 1IRXA 1G98A 1CHDA 2BZ1A 2FSIA 3A37A 3CHYA 3CPSA 4UEKA 3RTBA 1TM1E 4ZDJA 3ZKAA 4P38A 3ZK9A 4OJMX 1IONA 2WIAA 2I6QA 4IXTA 4IX9A 3WDLA 4CCAA 4G97A 4ML3A 2I62A 4XVRA 2F1OA 1KVQA 3WLAA 1FX1A 3FPLA 3PVZA 4Q0MA 4PPGA 4R7ZA 3V42A 3ZQUA 4ZJPA 2R8BA 3OZFA 3VA7A 4ZQBA 2H5EA 3W3ZB 4U2BA 4EG3A 5JNVA 1A04A 3GCZA 1E2QA 4X61A 3OEYA 5JANA 1E4YA 2GKOA 2OY0A 4OM8A 2GCOA 2LIVA 1YQGA 2YZGA 4Z0NA 1WBJB 1H2FA 1DT5A 1KZ4A 3M9LA 1ECGA 1LNZA 3QBTA 5ALWA 3PQEA 1UL1X 1E66A 1U7HA 1V3UA 1B2RA 1UDRA 2H92A 3GUUA 4IICA 1L6RA 1KTVA 3BHNA 3TZLA 4XH9B 3FJOA 1KTIA 1PP4A 2BDTA 2PIAA 1CQZA 1L2TA 3E58A 4WFJA 4EY5A 1U28A 4XYBA 5T7BA 3AEKA 1ZM3A 3WLJA 1WULS 3L1UA 4BNLA 1JE1A 2XF8A 3MJ4A 3UKJA 5LJIA 1NQVA 3GLRA 7ADHA 1W44A 1YNSA 2Q29A 2PKQP 1JEJA 5EHNA 3WK8A 4EKNB 1I94B 1H9AA 3GMIA 1C3LA 3ZBPA 1FTNA 4EG5A 1KPHA 3QHQA 4Z1OA 721PA 1ZC4A 2Z0MA 2OV3A 2O9JA 3H5NA 4ND6A 1Z29A 4E70A 5ERGB 3GLKA 3WADA 5A2GA 1FXWF 1FFSA 1WXGA 4F3NA 2AJTA 2UUPA 1WXHA 2I8AA 2N47A 2Y9MB 2CE2X 3QUQA 2YJ3A 2IXAA 4RFSB 4L0DA 3WOVA 1DELA 2B7BA 4C03A 3GJQA 5GQSA 1U2SA 3DOIA 1RSZA 2O19A 2HREA 3DDWA 3UUWA 1ZCBA 3IUNA 4TL8A 4AY6A 4M0FA 1UQUA 1FUIA 1D5WA 2O1EA 1D2CA 3LNTA 3OESA 1XDGA 2C4KA 2IU4A 3ED1A 4YDHB 1N4AA 5KTMA 5LZ4A 4O33A 4P8RA 3RPEA 1JHQA 1O5TA 5EQFA 4BL5A 1SOAA 1MO5A 2BISA 1BFDA 2Q3HA 5G3ZA 4L8VA 3O5AA 4KXWA 1U2EA 5AOAA 2ZTMA 5C7OO 5LFAA 5FFFA 1EFVA 4O5OA 5WRFA 1NSFA 821PA 5ALMA 1NRXA 2QLLA 3KYCA 5KNCH 3PXUA 2N3ZA 4UOZA 1EXMA 3DBRA 3I5UA 1JDBC 1RADA 4DCCA 4F93B 4FDVA 4E33A 3ZYCA 1HLFA 2VF2A 4F4DA 3FCYA 2W0SA 4KW7A 1NX6A 3IE1A 1XGKA 2ZRGA 3FAKA 4IF6A 4IRMA 4MGYR 2PS0A 4RHCA 4UXJA 2XEDA 4JP2A 5KDLA 1HE5A 1U0FA 4ZZ3A 1BHSA 4ZYYA 5J1SB 3RLIA 4FC6A 1ENZA 1DRKA 4QATA 2BEVA 1VIDA 3R2JA 3ROFA 4EZEA 3GBVA 4NHEA 1AZWA 5JAZA 3HB4X 1ULUA 5FADA 4AN0A 1PL6A 2WTEA 3DAPA 3JYQA 4B8WA 4F38A 3BGOS 3LHIA 1RLOA 3Q7EA 4E4TA 4LCBA 4AJKA 3KQNA 2GK7A 1A97A 4RVNA 2BLLA 5KC8A 3E9ZA 2A9KA 4OMUA 4EY7A 5BWOA 2ZXEA 2R0QC 2XY4A 4UZSA 4JC5A 1P19A 1RBZA 1ZA2A 1R4NB 2X40A 5EXPA 1AQLA 2ZVQX 5FL7D 3I8SA 2F43A 3JQ6A 3PUWA 3GGDA 2YJNA 3DBHB 4O02B 1NVTA 1T9GS 1C0IA 2GM9A 3H83A 1HV8A 1PJTA 1UH5A 1PLJA 2XMCA 3CVJA 5JPDA 3O4HA 5JRZA 2J5XA 1ZA1A 2XQFA 1NT2A 2RI6A 1XOIA 2QRVB 2CJXA 5FEMA 4BQFA 3LO5A 2IKSA 4WNYA 1FX0A 4ECEA 1BWSA 3D9QX 4S1VA 1N0HA 1XEXB 4LMBA 4I66A 2XI4A 1RPTA 3BE6A 4ECAA 5FA8A 1BRMA 1JAHA 1OTXA 3QTBA 2FETA 3JTMA 1CS0A 4A5OA 3EVBA 3X1DA 3DAGA 1Y1QA 1ACMA 1GD1O 2UVPB 2ZIVB 2NZWA 1JH8A 3GRAA 3BSSA 4C87A 2W2NA 3PNMA 1QAOA 4I1RA 3Q3JB 3VSDA 4JYAB 2QRGA 2YCLA 4XXHA 4B2PA 2EWMA 1PV2A 1P7YA 1SXJD 3F67A 3IP9A 2XZLA 4LCEA 4Y6SA 5SYNA 3ZIAA 3QXJA 2Q0SA 2A0YA 1N3IA 1RI5A 3DL4A 3PJGA 1HEIA 3QFTA 3CT4A 3SVZA 1DOAA 1SHJA 3SFTA 2PGDA 3R3VA 1AGPA 4KMOA 3STVA 4QYWA 3TE7A 3ZCSA 2ZIXA 2D3WA 2X4IA 5IH7A 1MV5A 4JJAA 4GSLA 4YMVA 3E1GA 1QO0A 2VHQA 4D81A 1Z6PA 5TS2A 1Y9AA 4Q7QA 1Z6AA 1C0EA 3CH7A 3AHFA 3C70A 5DEIA 5C46F 1K5DA 1I7QB 5D7BA 5HGJA 3RS8A 3N2KA 1UIRA 1ODFA 1WEHA 2GYUA 4TUYA 1C3OA 1NMQA 3KQMA 1JA0A 3ZI7A 1TZKA 1NQUA 4MUFA 3ILSA 2WYIA 3OJFA 4ZTZB 5GV8A 3LLUA 4IFIA 3ITNA 5K05A 1LKZA 2AZMA 2YNMD 4I19A 2W2KB 4CF4A 2EIHA 5K6RA 4H1UA 4IR7A 3MIZA 2HIAA 2TRSB 4KV9A 2X41A 2HXYA 4N9WA 1HE4A 1V8OA 1SU4A 3NIDB 4NENB 5G1PA 4O4LB 2Q6OA 3INRA 1LW7A 2PGOA 4OATA 4FYVA 4UCXA 5F98A 3A1CA 5EQTA 3WLSA 2G9VA 2VS1A 4TVKA 2AEFA 2YWBA 3QOYA 1P9RA 3D43A 3EIHA 3FPCA 3N0XA 3JRNA 2QD2A 2NPOA 2Z3ZA 3JAWA 4AAYA 2X5JO 2UYYA 2BR3A 1ORTA 3H2ZA 1A4XA 4BNTA 1NJGA 1GJRA 4TZTA 1Y6JA 3K5IA 4K8OA 1Y3IA 5L3ZA 5LQUA 1OH6A 1P44A 2C7GA 4P92A 2AN3A 3TI7A 3H75A 5K4HA 3GRVA 3IH5A 1YNOA 3BK7A 1PJBA 1DZIA 2BEWB 1I6MA 2WJVA 4I3HA 3VR0A 2H7VA 3ICCA 1PNTA 4K6OA 2FHSA 3FWKA 1O0SA 1SFRA 3ZHXA 1Z5ZA 2EZUA 4BE7B 2XXAB 3BZBA 2ZSEA 4RD2A 5DNDA 4IS3A 3C0KA 3L1VA 4MKHA 2CXXA 3D7LA 4P3XA 4KKXB 4UEOA 4MS4A 1GPAA 2A3RA 2CJWB 4J0CA 1VP9A 3MB8A 3WBFA 3WYCA 3ME5A 4EHLA 1MO3A 1E69A 2ZIWB 3CMMA 4GM4A 2IS4A 3EA0A 4MV3A 2MINA 4NYMQ 1PD1A 2LRHA 3LCUA 4OSOA 4FNGA 2AUMA 4QFBA 5EE3A 4DJDC 2ZU0C 1FTGA 1K2WA 2Q2NA 3CKKA 1R0KA 3F49S 3O4FA 2O8CB 2QVYX 2FFHA 2YZNA 4H4DA 4ZI5A 5ESRA 2JEOA 3CTMA 1OLOA 1NBMD 3PICA 4Q21A 4R0VA 2PZKA 1PDVA 1CRQA 1QJ4A 1VHLA 4JJ7A 1Q50A 3EN0A 3HR7A 1KMIY 1O5OA 4G5OA 1JU9A 1K6EA 2BZSA 3B52X 4JJ6A 1PK7A 2HJVA 4G86A 4B74A 2J33A 2C2KA 2QX8A 3HJTA 4MKZA 4NZNA 3QWBA 5GPBA 3QVVA 4OSPA 1SCAA 1CC1S 4BO8A 1CVRA 3O9MA 4R4JA 4PICA 1T2UA 1KDTA 1QFZA 3FKSD 2VUSA 5L7YA 2PNJA 5C9ZA 1NF3A 4R8RA 3EUEA 3W5BA 4BLVA 1Y3BE 2OCLA 4BNYA 2YVAA 3K0HA 3V7FA 1UFQA 1RYEA 2GEFA 1S89A 4KMSA 4YEDA 1DOZA 4ZOLF 4Z3KA 2A59A 1G16A 3ITEA 1CX9B 1D6SA 1EKXA 1YJCA 2P5YA 4P3OA 1A77A 3ZY4A 1CFJA 1CUDA 2ZT7A 4GWKA 3SJAA 3O3OB 4KYVA 1YVPA 3OHSX 4MP8A 2BUBA 1T0PA 3MGBA 3ZDYB 2IPAB 1DB3A 5JJLA 2DH6A 2ZSIA 3ZY6A 3PDUA 3TKAA 2QM8A 2ODPA 5FRDA 5E6UA 3WGHA 4YX9A 1FFAA 4INAA 5SZKB 1A9QA 5ALPA 4DBLC 2CF6A 1NN1A 1NW7A 2SECE 4H15A 2C2WA 3PQ6A 4HDAA 2GJ9A 1RZRD 5D51S 4GKVA 4KDEA 4WFQA 3BRQA 1KS9A 4P0TA 2UZ1A 1PGJA 2I7DA 1FVHA 1A71A 2OBYA 4UJ5A 1VE7A 1Q1AA 3PA8A 5E2IA 2VRCA 3TXAA 2AX4A 2FP4A 3PKZA 4PX3A 3LCVB 3AL0C 3JVDA 3KFVA 1KBOA 4YUXA 4BTEA 5A3JA 1JDNA 4GBGA 2VF8A 2OXCA 2DBZA 2QTGA 4MROA 3SM9A 4AJIA 2ZSBA 2OP1A 2AMFA 4ZV9A 3ICVA 3RAEC 1EHIA 2EL7A 1CNMA 1MXFA 1TIBA 1V6AA 3GJ6A 3CN7A 3WGKA 3FGPA 4P4UA 2HD4A 1IAQA 1N5RA 2CLDX 2HH9A 3B78A 3CU5A 3R0VA 4HDSA 1WMFA 3EHDA 4JNCA 3VM6A 4DQUA 4B4DA 2BFFA 1IEXA 2ADOA 1U6KA 2C57A 2D2VA 2QVCA 3AIMA 4F12A 4CM3A 3JYNA 3WNCA 5ADHA 5E4TA 1OF1A 1TI7A 2EKPA 3LUKA 5G41A 1RMQA 3LKBA 4OHXA 4OI4A 4OU5A 3ULKA 1TNDA 4LSMA 4MQMA 3TTYA 4OMFG 1H66A 4DR5B 2WG1A 3IQFA 2PLWA 3PC6A 2QQEA 4FLMA 4GZLA 1UOQA 1YV9A 3WI7A 5FDFA 1UZLA 3VPGA 3AETA 2CMDA 1J0BA 4LGCA 5EC8A 4EGQA 5I7FA 5J43A 2BDEA 3QUAA 4G85A 3NTRA 4ZVQA 4D8YA 1AMNA 1OXUA 1PO7A 1BGVA 1KKUA 3FKQA 3SY8A 4LY9A 1OXKB 1QLWA 4HPJB 1E4OA 5ER9A 9LDTA 3K9HA 1WZNA 1L7MA 3HYCA 4JEUA 1N2GA 2I1QA 4KQJA 2C03A 4IJQA 1F12A 3SYNA 5F1KA 1VGVA 4CI0B 4EJMA 5LVAA 1BEZA 3OQHA 4HO1X 4U7DA 4JI3B 3AUXA 1CYDA 2FZKA 1UXOA 4JLVA 4Z4HA 3IT1A 1ZGJA 2JFHA 1NW5A 2OESA 3QX9A 1ZIPA 3R20A 4LJ5A 4TMFA 4UE2A 5IEJA 2VVTA 2SKEA 5IVDA 4HH0A 3S40A 5KVSA 2EFEB 2VDNB 1F8UA 1ZXLA 4LHZA 3LQ2A 5CX1A 4BC1A 1XZQA 3WBKA 2QM3A 3LT5A 4EQZA 2BFDA 2PO5A 2HDWA 3IS3A 4PCUA 4F8JA 2I3DA 1KZ6A 1ODIA 2BL4A 2NXJA 1YR9A 3EASA 2XMGA 1CUBA 2EEPA 3U09A 1VECA 5KO2A 2KSQA 1KFEB 5J2UF 4I5FA 1P2UA 4MVWA 1YVRA 3I76A 2WSLA 4P6VF 2JNWA 3DWGA 3RRNA 2PLNA 4M37A 1ISMA 5EWLB 3EVZA 1USWA 2NSHA 1TCAA 3KETA 2FPGA 4L2IA 5HQJA 4DLPA 3MA0A 1NNEA 4QG7A 1A9TA 3KPWA 5BSGA 1TKBA 2X2EA 1PGOA 3C45A 4PSKA 4A2WA 1G5QA 2CFSA 2AF4C 2R9VA 2QS9A 1MP0A 2VYND 1J22A 1JMVA 3CE9A 3DKRA 1WUJS 5DM60 4COOA 1NVWQ 4RA9B 1XL1A 4WECA 3CISA 2FQQA 1TFUA 3IAM1 5C8YB 2GM5A 2O06A 3EEOA 3QVSA 3SLRA 4XSGA 1Z36A 2BZGA 5E4FA 4OQZA 3VUEA 2J46A 4X84A 4RLSA 1AH2A 3DDCA 3NKLA 2CBXA 2ZTSA 3SIWA 2FSGA 2R96A 2MSCB 4JASB 4E5NA 2PGAA 3TQRA 4ZJZA 1SBCA 2YOGA 3NBKA 4S1WA 3QSGA 4MWDA 2QRKA 4J3JA 4M0KA 4AJ1A 1CZLA 1U04A 2WK1A 5DM4A 3U7IA 5BMVB 4C0WA 1QIJA 3THWB 3PIIA 5C8XA 4YPFA 1E5TA 2E4YA 2DKOA 4LNHA 3DHYA 2GFQA 2QD3A 4LJRA 1L8AA 4BHTA 1E9EA 3FBGA 3HP1A 1Y1SA 4ZMBA 3V48A 2P65A 3N05A 5G0TA 2A78A 5JQWA 1OC2A 1U0RA 3NT5A 3SU8A 2OE2A 3AEQB 4DUGD 3R24A 1PZXA 4R05A 4EBFA 1P4SA 2Z9BA 1LNQA 2D54A 5EE0A 1ODLA 5JZBA 5FTKA 2LE0A 3VBEA 1WEKA 1X9GA 1ZHFA 2FZ5A 3C8UA 5C52B 1GZ6A 1PG5A 2C82A 2SBTA 1I4OA 4YRFA 5HHTA 3ECAA 2JGFA 3HCEA 4X3OA 3C8MA 1M2VA 1DTWA 5D5HA 5FPSA 4NYJQ 2VUUA 2BM9A 2RKBA 5I5GA 4E5DA 3DG9A 1S8FA 5JAQA 1L8QA 1R0BA 5CNKA 3WRVA 4AZSA 4WTOA 1K66A 5AW5A 5L45A 5FBLB 5KQMA 1EXVA 2P9HA 2UU9B 2I9PA 3WYEA 5EAIA 4OQNA 2YWRA 4XD7D 3Q7TA 1YQXA 1KY2A 2YICA 2R7KA 3FZNA 3UB2A 5KWIA 2HRDA 3KYDA 2Z2ZA 1L3BA 3V2IA 2Y3IA 5JD5A 5LD2B 1C50A 3HWRA 1SCBA 3DMHA 1KNQA 3GT7A 2X9NA 2BCJQ 1KAOA 2BFEB 2M1ZA 2DTDA 3DE3X 3ND5A 3JQRA 3RW9A 1IQRA 4CV0A 3ETJA 3FUWA 3A14A 5BVHA 4XPIA 3LSYA 4DRXB 2ONZA 1DWUA 4LN1A 1SH7A 5G0VA 2VQ6A 3T7KA 4G4IA 5DGXA 1AHNA 1EINA 1VL5A 1WXFA 2MR5A 2XW6A 3R3XA 3UJHA 3I5YA 3FYTA 1LLCA 1Y4DE 4LWZA 5JQGF 4OKIA 4IV5A 5KWVA 1YMVA 2JDID 3I45A 3ADDA 4KWTA 5K8TA 1V26A 5SY9A 4LF7B 1Z56C 4MDHA 4N03A 4YN3A 2EVWX 1ZCZA 3IVRA 4U2GA 4Z1MA 4C3ZA 4DQVA 2ZSKA 1E92A 1KBQA 2NV0A 1P8JA 4RIGA 1WS6A 2AR0A 2C5EA 3RT9A 5G1OA 4UHJA 3W3AD 2AT1A 3NHMA 2REQA 3ABIA 2YW9A 4G0PA 3FSEA 1UT6A 4RNCA 1BWQA 1ZMOA 3S2EA 3DYVA 1U4OA 4KYUA 3D3KA 3EFBA 4WCFA 5KSWB 3F9RA 2XHZA 1SCNE 2Q3EA 1GZ3A 3TWOA 1GU1A 1YFJA 2YTZA 1WXIA 2CFIA 2FRDA 3ZWWA 2IZ6A 5KSYA 5LMZA 3KVNA 2XCTB 3RSZA 1E1CB 4HDKB 3J7AC 2I6UA 2B69A 2VRWA 1H2EA 4IAOA 5AKLA 4C0JA 4E3WA 5I3ZA 2EFCB 4G0QA 3N1UA 5KCZA 3I83A 2OGUA 1BH2A 1J8MF 1GG9A 2CWWA 3EUFA 1X94A 4C6HA 4FWTA 4Q47A 3K70C 5ICGA 5BYJA 1LV8A 2X7JA 4U7JA 1SZJG 4MPTA 4I9GA 2WHXA 4OXYA 3SKXA 4AZ3B 4K9MA 2IH4A 4QU0A 3OPMA 3QJ5A 3C8HA 2I87A 3B51X 4BATA 2FW7A 4M0LA 4TTTS 1ID1A 1X2EA 2B36A 3E1SA 4Y2TA 1RC0A 2MYUA 3ZGNA 3REFA 5LP6A 3ZJUA 3LC2O 3EPHA 1P0CA 4GPD1 2RMKA 1DWOA 4ZCSA 3TW8B 3ADCA 1NW9B 3SQMA 1BXZA 1XZFA 1ODTC 2ZJAA 4HY3A 4WY8A 1R3DA 3HA5A 3UJPA 3WJ1A 3PHLA 4L7QA 2YCBA 1C1XB 1E3JA 3RUIA 1KEZA 3VHQA 3WP1B 3WLNA 4B0PA 4EMUA 2PBFA 1WLSA 2QYHA 4CQMD 5HKKD 2IKQA 4FKBA 2Q5EA 4X8LA 5KTPA 4IVQA 3ONNA 4MWBA 3COJA 1M8KA 3IDAA 4MP6A 3ZDQA 4EVRA 4YRIA 1D0IA 3GBPA 3FNEA 1QIIA 2X1HA 2IZOA 3T15A 4U8HA 3S99A 4FP9A 3CM0A 3A58B 3NEYA 5B3JA 1B6RA 3IJEB 4MJXA 3SBDA 2G63A 1S02A 2JH9A 3P0FA 3HU2A 1X3LA 5E2BA 4E31A 4WKGA 5JZVA 2UKDA 1PVDA 4CR6A 3A9WA 3T7EA 3R40A 3VZDA 4K6HA 3CW9A 3WGOA 5DU2A 1OH7A 4LGMA 4ZQEA 2PX6A 4K28A 3SQXA 1LC3A 2W2OA 1EGVB 1PEYA 2PBLA 4MGZR 1V43A 2MHCA 5DNEA 3FWHA 3RIGA 3VC2A 2A9JA 2H7XA 2ZROA 3GROA 3HEAA 1OXMA 3HWSA 5DTEA 4C0SA 4YUYA 4YJ3A 3MXOA 1JV2B 3HCRA 1O4VA 5JY1A 3BTUA 3OX1A 1JG3A 4O4JA 1LUAA 2GD2A 4BNHA 1K5PA 3SD7A 3C85A 3W1WA 5IG2A 4F6RA 4BMNA 1I3MA 4C4PA 2EP7A 3SDBA 2BFCA 5TJ9A 2YFKA 3ACBA 3FFXA 3MPUA 4WUTA 1BFKA 1RQ7A 3TCKA 3VH3A 4PFSA 3VPAA 4N76A 3ZBTA 3QKIA 3FJYA 3ZGZA 3HUUA 1ACJA 3SHFA 3TOZA 1BKSB 1XP5A 3E84A 3HCFA 4AY5A 1QQBA 3PFKA 2XECA 4XCVA 1R6BX 5JE8A 4Z3DA 1KMHB 3B3FA 3EXIB 5M7EA 5FLXA 5K0NA 4YK7A 2FUKA 1CZNA 3PRHA 1WDLA 1M1UA 2W2PA 1JFLA 2JJ2D 3K8ZA 4N49A 3EZGA 2IUUA 5LNK6 1JAIA 4NBUA 4PBSA 5BOSB 4PEVA 1GNRA 4AY2A 2JHAA 2GTHA 4DWWA 2XYVA 4JJEA 1T26A 1I0IA 4RZSA 4CIBA 3IT3A 4J0GA 2QD4A 4GZMA 2DX7A 3FTQA 5E1BA 3DE6X 5EHGA 1T1IA 1L5YA 2BY4A 3NTXA 4R7TA 3R9IA 5TQJA 4ZIRA 2GJSA 3EJWA 3EBPA 3X1XA 3R09A 3E9MA 5IJ9B 1AKMA 3V46A 4MCAA 1Z16A 1P0FA 1HE8B 4DCSA 5EQJB 5LP1A 1UKVY 2G5GX 2JEYA 4LFBB 4ER3A 3VSEA 1O94D 1XK6A 4OSEA 3V8MA 2JIDA 3A28A 3MILA 2WIKA 1OD6A 4OF4A 5LZ7A 3IDZA 1R74A 1LLFA 5IFLA 3QFSA 3R3WA 3M34A 3MGKA 5AK4A 3X1YA 3WL7A 1E5VA 3EVGA 4MW0A 4C6RA 4ZVVA 3LM8A 3H1BA 4A6XA 4ER0A 3R41A 1F5NA 4JXKA 1P45A 3THRA 4PG5A 5LP6C 1M6VB 5AVRA 5K20A 3M3DA 4K05A 5AW8A 1WM1A 2R97A 3A1FA 4X1IB 1ZK3A 7REQB 2QIPA 3VHXA 3X1MA 3ZDAA 1MBZA 4A0SA 1JSCA 4UOEA 2P77A 1UDWA 3FSRA 2KM1A 2HA6A 4FGLA 4KACA 3NPMA 2IELA 4M6WB 4QD3A 4MSUA 4BNGA 4B85A 5F21A 2OR3A 2WLTA 5CT9A 4IO1A 5L51A 4DUYB 1QRDA 1U1DA 2QTAA 3PR1A 4OGGA 4QBHA 3SICE 3VC7A 2ISQA 5FULA 1LK5A 1W30A 3OCVA 4YLGA 2EW8A 2C3PA 3ZVMA 2IL1A 1RW4A 2WZCA 1YS2X 2IOYA 2PSHA 4V3CA 5T3YA 2ATVA 1N36B 2JLUA 2WLSA 4CL3A 2XBMA 1PQ4A 3K30A 4Q12A 1ZD4A 3E3NA 3DOOA 1U8UA 4BKPA 3OA0A 5I5EA 3NC1C 1ZVVA 4EHNA 3FLEA 1DJPA 3NOVA 4GPIB 3HWWA 1QVVA 4MVJA 3VPHA 4JQOA 2XWSA 4HAIA 1ISSA 2V6GA 2FLVA 5JV5A 3AZQA 3QXGA 4ZDKA 2O50A 3CLUC 1J24A 2PUGA 1L7BA 4Q3DA 3MW8A 2AL7A 2RHOA 2VAWA 4GWLA 1E1RD 2YXDA 3AUKA 1RRCA 4CF6A 3X1ZA 4DYHA 4MUJA 3S5UA 3KS9A 2ZIGA 2VH5R 5C51B 3OKCA 3RTGA 4YMIA 2J9FB 5AUQA 4DV3B 2GEBA 3AY7A 4R5HA 4QGFA 4UUMA 4PHCA 1R0YA 3VR2D 1T13A 4HLDA 5DYGA 2R1UA 1P5HA 4UOQA 4CF5A 3GELA 1G60A 4D9CA 1E5QA 1L4MA 4OOFA 4B4WA 4B6RA 1IN6A 5CVEA 3ZD6A 1VFPA 1KJNA 3GEIA 3FDFA 1LBQA 3GYBA 1TA9A 2I03A 4GC5A 4CLOA 2H5IA 3IUMA 1G5IA 5DLDA 5FF9A 2Q6KA 3NIGB 4B71A 2JGEA 2X5OA 4W5QA 1JFSA 5ALGA 1QZTA 1YIAA 3CLSC 4ZI7B 1THGA 2OTCA 4BTLA 1KAGA 1KKLA 1DAKA 2G1PA 2LW7A 2CYAA 2EAUA 2X6RA 1Z35A 2QE7D 4DJAA 3KD3A 3OZDA 1W4ZA 1YZHA 4L72A 1TO2E 1Y4UA 3K20A 4B73A 5FAKA 2OCBA 3H86A 2Z58A 1J8YF 1IHXA 2NO7A 3A31A 4C5CA 5JCXA 1M6YA 4IJUA 4QLBA 10MHA 3ISJA 3M4ZA 4QFMA 4RFSA 2H2WA 1E63A 2JIBA 1MG0A 2NZ8A 1MXHA 4LV8B 1MJHA 1PR9A 3K35A 3IBCA 3HVUA 4UUQA 5DSTA 1ORWA 4TM8A 3RJTA 1DEHA 1OI3A 4RANA 3KPJA 1QHFA 4NBLA 3T0FA 2C7RA 3MRSA 1XRQA 2C1ZA 1YR2A 4IIFA 3ZWPA 4CV2A 2FG7C 2F55A 2IHZA 2ID9A 5DLYA 4OA5A 1DFIA 5JH7F 1A2QA 3H1TA 4IIHA 2VUIB 2YZ2A 1W36B 1G55A 2PZLA 3EOAI 1J07A 1JQKA 3P2OA 4DJJA 4RK4A 4X65B 2W4QA 2AZ4A 1T43A 3RSHA 3WNQA 5JDIC 8MHTA 3TH5A 1MFPA 2XUFA 2JKVA 4NV0A 2IWRA 3RWMB 1BQEA 2JJ1D 4UVHA 4TYQA 3DBIA 5H5JA 4I3FA 3FUXA 4XLZA 1ISIA 2FFQA 4HVTA 4ITRC 1PQUA 1RHMA 3IMKA 4YQYA 3VR4A 4FW8A 2A5FA 4WNAA 2VQEB 3AEUB 4KLRA 1DQNA 3NEPX 2RHRA 5INTA 5CLFA 4OLBA 3I62A 3R1IA 5CVVA 5U1PA 3UH1A 2VDMB 1RXCA 3G1TA 5E38A 1HMPA 3I5XA 1CE8B 1BEEA 1NJFA 3MT8A 1I14A 1PKXA 3U17A 1KJ9A 2YW2A 2BIFA 1YB6A 1JIIA 4GLOA 3CUWA 1TB4A 1TEXA 3L8FA 4A3SA 1W0KA 2OFOA 5AKJA 2OD2A 3QQ5A 4PLPA 1GZSA 5HIIA 4M9ZA 2PRKA 2QZ9A 3VC3A 3GR6A 2NSLA 3ZHYA 4ALJA 2HJGA 3W9BA 1L8XA 1NHGA 3GJ8A 5HQ3A 4ND4A 1XZJA 2OPBA 1N9GB 1TM3E 1ZZEA 3MS7A 2NO6A 3DEZA 1UJNA 4KO2S 2DY1A 3ADPA 1LFDB 1F06A 5BW8A 1MO2A 1X13A 2H57A 3DMGA 3DBHA 1WB9A 1COWA 4D96A 4ZYTA 5EZ5A 1KYIA 2AB0A 4U7HA 1PL0A 1ZUD1 1SKAA 3FMGA 3O2JA 1OMOA 3K9GA 3D4NA 4R01A 5REQB 2X0NA 1EFCA 3MRXA 3UFXA 3GFBA 2GEDA 3CVXA 3TS1A 1KVSA 3DQQA 3FMOB 4BNJA 4E1VA 5ITWA 1TVMA 2QNIA 1YAJA 4CV3A 3FPBA 1PVVA 3BORA 5FFNA 4IGKA 1XEXA 1GHTA 4C7OB 3ES9A 4RD1A 1BCRA 5AW9A 1Z2DA 1SVKA 3U40A 4A5SA 3B13B 3TSCA 2GPBA 4M8IA 1RAHA 2YS7A 3GMDA 5L3SB 1QM5A 3K96A 2B1IA 2V6MA 2NO9A 3DAFA 5DX1A 2UVPA 4B31A 4KR3A 3PNSA 1K86A 4JKIA 4KXNA 2RSLA 2GNPA 5HX7A 1DG9A 3EGVA 3HSKA 2J85A 4LRWA 1N5LA 1RRVA 4K1LA 2L82A 2J9RA 1U1IA 1MHTA 1EUZA 2B1RA 1B8UA 1AUQA 1RMTA 1IY8A 2EJUA 2NVOA 3QFHA 3FVWA 4Y1EA 3IO5A 3ZR4B 1FFCA 1EESA 1SQFA 4LW8A 2FWJA 4XX0B 2Q3FA 2VAXA 3SHOA 5ALNA 5LQNA 3OZBA 4HGZA 2EFJA 3UTDA 3GT0A </