1RC0A

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
total genus 62
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rc0A00
1CDDA 3KCQA 5J63A 4YFYA 4ZYYA 5CJJA 4ZYUA 4ZYZA 2YWRA 4S1NA 4TT8A 4ZZ3A 2BLNA 1JKXA 3TQRA 4ZYWA 1RBZA 1NJSA 3NRBA 3O1LA 3P9XA 3Q0IA 4QPCA 4QPDA 4TS4A 3W7BA 4R8VA 4ZZ2A 3DA8A 1CDEA 3AV3A 1MENA 1GRCA 4ZYTA 1RBQA 4ZZ0A 4NV1A 1GARA 4IQFA 5J9FA 2GARA 4TTSA 1C2TA 1RBMA 4ZYXA 1ZGHA 1ZLXA 4Q12A 1MEOA 3AUFA 4DS3A 1C3EA 1FMTA 1RBYA 1RC0A 1YRWA 3GARA 1MEJA 3N0VA 4YFVA 3DCJA 4EW1A 4EW3A 1RC1A 2FMTA 2BW0A 4PZUA 1S3IA 2CFIA 3R8XA 4ZZ1A 3LOUA 4ZYVA 3TQQA 4EW2A 3OBIA 1ZLYA
chains in the Genus database with same CATH superfamily
2R751 5DF1A 2UZ1B 1JAYA 1OD6A 1E98A 2O7VA 3D8NA 5FBQB 4PHHA 2E48A 1OBFO 2PLRA 1V71A 3G5AA 4KSBA 3IT2A 4YQEA 3QX7A 4XGQA 5CFQA 3QWIA 5AVXA 2FEOA 5ENZA 1AUPA 4E46A 4M22A 3BC1A 4YCJA 3BVPA 5KYTA 1GTJ1 2XZTA 3ICWA 3W2HA 1LDNA 2GHIA 3WAGA 1KI4A 1U2DC 1W5EA 5BNZA 1YK0A 1IHDA 2NO1A 5H7XA 2AOTB 5REQB 2Q9AA 3MF4A 1LPSA 1Z73A 2AEFA 2NU7A 2CNBA 5IJ0A 2GTPA 4TYWA 2PMWB 2QMQA 4QL3A 1TVKB 2EF1A 4DZZA 4EUFA 3FVVA 4MWEA 5CT8A 4M8KA 4Q7MB 3FX2A 7REQA 4G0XA 1EQ2A 4Q16A 3E3OA 1XMIA 3A3PA 2VF7A 3P9SA 1JF8A 2Q2VA 3ZNNA 1NONA 3Q3IA 1X7DA 2ZBUA 2ECOA 4LJ7A 4MS4B 2X0KA 3RS2A 3URMA 4D9MA 1YZHA 4UQOA 1TQ6A 5JCOA 3EMBA 3N05A 4XJSA 5F23A 4N0MA 4Q3NA 1UMCA 4II2A 3WWEA 2GB4A 1VSTA 3JYNA 3L8MA 1EE9A 4ZCTA 1QF6A 3HKEA 4PLPA 2F6RA 2HA2A 3KEMA 5K0JA 3I3SR 4AY4A 1L4EA 2OAP1 1MABA 2P67A 3PD0A 4R40A 3GROA 5D3ZA 3TPFA 4EMTA 1J5EB 3QJGA 3T1OA 2HA0A 2P5TB 5LA6B 4HDNB 4HWTA 3A2NA 4HJXA 2O2SA 4PVDA 1JLHA 3BERA 3G49A 3E9QA 1JEYB 2YR0A 3F7MA 1INLA 2P91A 3HXLA 3KD3A 5D7BA 1QOZA 3FLEA 4OQDA 2XB4A 3RYTC 4C07A 3QVUA 2GTHA 2WJWA 3GLRA 1P77A 4JROA 5ECYA 4R1QA 5EQDA 3H17A 3SP1A 4KFTA 3BMCA 4D3SA 3PGJA 1BKDR 1L1FA 2FYTA 1KYVA 1C14A 3R0VA 2H1HA 4DIMA 5JG7A 4RVHA 4X44A 4ZAZA 1JR3E 2QU7A 1VKRA 1XZDA 3C7TA 4HB3A 4HEHA 2AW5A 3HXQA 1FU4A 2PH1A 1CEEA 1XJCA 5LYYA 3JWHA 3C8UA 5CW2A 4YJ2F 4LYYA 4ZGGA 4ZV4A 3L77A 2JAPA 3L8YA 5FQNA 4MUBA 2FLWA 4C3VA 2IHNA 3GPCA 3QXGA 4PXAA 3W3AH 1ZJYA 4ABYA 2CEKA 2EKZA 4NMHA 3TG8A 1ISSA 1QQ6A 2HK7A 2JJYA 2C2MA 2JKYA 4PG7A 3TNLA 4S35A 4EHAA 2ZYVX 3FNBA 2RJ3A 2AI2A 3TTSA 2DLNA 2FGJA 3I9V6 4D79A 5C37A 4FBLA 1TF7A 3L7NA 3I45A 3TPZA 3TZBA 4IUDS 3DM9B 3I2HA 4X90A 3K31A 4GVXA 5ITWA 5GGYA 2DWOA 1UBEA 5HM6A 5LOVB 3KR9A 2WB2A 4DA7A 1UFKA 1RXEA 1IM8A 1QO7A 2AE2A 4N5DA 1Y48E 3CT4A 2XT9A 1TAQA 2ANCA 1XBTA 2NO9A 4JYPA 3TLEA 4EATA 3BB3A 4FZ5A 3KJXA 3LY5A 1CX9B 5FFNA 2PRSA 1O95A 4GGOA 2O06A 4NXNB 5B58C 1MAUA 2ZP1A 3DEFA 1EP1B 4RESA 5CAEB 1P80A 2HBRA 3GG9A 5B53A 5I8WA 3TIXB 3D6VA 3KSUA 4LDPA 2OZLA 4CMJA 4GP9A 5BUQA 5AJVB 1NVEA 3E9NA 3AI1A 1HE1C 2G67A 3MCAA 3O31A 4OP1A 1W0KD 1ISIA 1NBMA 2I03A 3IVRA 3KQYA 4X1IA 2Q5FA 4V0QA 4CQMB 5IHPA 4IS2A 4RQBA 1EFVB 1H66A 4LZLA 4CM4B 5EMKA 3EPHA 2NVUB 2NQTA 3WP0A 5AJHA 2GH1A 4J75A 4H4CA 2ACWA 5F78A 1UR5A 3RHZA 5BR8B 1P61B 1YS7A 1KMNA 3RF7A 4G5HA 2VBCA 3I0ZA 4PRKA 4ITVA 1JEEA 4M0LA 2VOJA 1JEDA 2OUKA 5I47A 2ZT7A 4UZSA 5AYVA 1SD2A 4CQJA 4FKBA 2VHYA 3I9V1 3RREA 3TK1A 4D9NA 4EW1A 2OC4A 3M2TA 3S0JA 1X1AA 3M5WA 2WD7A 2B4YA 2QOEA 1MC5A 1ZUWA 2QSUA 5ALOA 3AF2A 4FVTA 4ARUA 4P8RA 4EMUA 4CLDA 3JZAA 1YQWA 3S1LA 2KMLA 1DQNA 3OF5A 4FC7A 4B2LA 3O2SB 3DZCA 1Z0ZA 3EEQA 4XIJA 4FMCF 3L92A 3E1KA 3K8QA 2MOKA 1Z28A 4J76A 2J8ZA 3WWCA 3H1EA 4WFIA 4LYEA 2H1IA 5BQPA 3RVPA 4CTMA 2VI5A 1Z4MA 2W48A 2OD9A 1Z39A 4Y6GB 4URVR 2JFXA 1RJEA 2PGXA 4I5IA 4BFTA 1H9CA 5JSUA 1GV1A 1GADO 2CL6X 2GVZC 2X0FA 4FYYA 1SHJA 2Y1LA 4NH4A 5CDSA 5JCOC 3T3PB 1QQTA 3PQCA 2C03A 1UINA 4KQMA 1XROA 5ESDA 3AYXB 1R37A 1FU7A 2D8AA 4J16A 2C5SA 3PNBA 3QFSA 4K26A 4OD0A 2QZ4A 1E3QA 3I4CA 5G41A 4D41A 4X97A 1VFNA 5FFMA 2QL7A 4BNDA 2PMCA 3AL2A 3DBRB 3EIUA 3CIFA 4QIHA 3ZYZA 2FK7A 4CMAA 2CE2X 4RTJA 5J1SB 3OSUA 4LX8A 1G8YA 3COSA 1U80A 4DM4A 1FS5A 5CFZA 1JYSA 4OQNA 3D0QA 2WWTA 1E60A 3NWPA 4Y2PA 5F3RA 4WNIA 3WL7A 1K3FA 3KHUA 4F8YA 3AVWA 2WLSA 4KRGA 2J0EA 2VCEA 1AUOA 1XTIA 2NUTB 3COYA 5AUQA 2CLCX 4K7JA 2RH8A 3ZI7A 3C6KA 1MUUA 1K2VN 2WMYA 3CIOA 4TXHA 4Q4CA 5IKXA 3FHTA 1A9TA 5KWSA 4DCJA 4H0FA 2QRZA 5TT1A 4TV8F 4Y18A 3WHPA 5EHGA 2ZRIA 2WIBA 4TX1A 3ET4A 3AH8A 3RBVA 4C20A 5IDQA 3GFFA 2R1UA 2QVCA 4YJ2A 5BQFA 2QG9A 2NOAA 4KO4S 2E9SA 4ECAA 3RFTA 4EQ6A 1QLHA 2PQMA 1D4FA 1N8SA 4UFNA 5AKHA 2XMCA 1XRRA 1U2RA 1F3OA 3F98A 3R3JA 1ZEJA 3UYLA 3RJZA 1K0FA 4TSFA 5DNCA 1F7VA 4AJIA 1NYQA 1ZZGA 3LCRA 2L42A 1E1RD 1VSUA 4LA4A 3QSYA 3ROGA 2YICA 4V0OA 1R6BX 4MR7A 1K7XB 1G20B 2QX8A 2QX7A 3QYPA 4J94A 4QPJC 4Y30A 1B0PA 3ZHRA 3T6KA 1W7AA 2CVQA 4BNWA 3EXG1 1BMFA 4L16A 4QYXA 2G4LA 4HN9A 1F6DA 4LGYA 5ELMA 4ZU1X 4AQDA 2YWGA 1IJKA 4WEOA 3ZKWB 5CEFA 1GPJA 1L4FA 2FE4A 2HNBA 4D0NA 4UAVA 3DE7X 2C5EA 3FNQA 2BFMA 2AJBA 1E2FA 3GN2A 3V5NA 2IQIA 2PCLA 3KL2A 4D0SA 3WRVA 3VRHA 4G1UC 4OXNA 1VE6A 1NBMD 3KKQA 2QN8A 3L1IA 1WOYA 5KWEA 4TTQA 5JS8A 2YFYA 4F2DA 4KREA 3AJRA 3MD9A 2Q0HA 4QTUB 3OOEA 4G9BA 1T9GS 1X7ZA 2HA7A 3G5LA 3R5TA 4GRIA 4M54A 5EE5B 3V8EA 1VQ1A 2QQ5A 4ZODA 5DISB 4JI4B 1T3ZA 1UDAA 3AWIA 5AJXA 1FXSA 1OBVA 2DUJA 3K1AB 3NJ8A 2PD3A 2H31A 3QU9A 4N6NA 4ZJYA 5HUQA 2GCIA 4L0CA 4WZAE 3SWWA 3LAWA 4RS3A 1LS6A 3O4IA 1I8TA 2V7QA 2F3PA 2O8FA 1T6NA 2UAGA 4QBGB 4YNBA 3EXIA 5DT2A 3V8RA 3SEZA 2JFZA 2BFFA 1DAPA 2A9OA 2RGUA 3C3WA 3CLHA 4RACA 3VGJA 3U4MA 1LV7A 4L08A 4I4IA 1XNJA 3MQ4A 2DOKA 4NCKA 5JSZA 3KHSA 4L3VA 2QTVB 3OIGA 3N8DA 3WL6A 1AC5A 4BC0A 3VC1A 4L5JA 5BNWA 4R6WA 1E5TA 3C8ZA 3OE5A 3QTLA 4PHGA 4UQPA 3NDBB 3U3OA 4WCFC 1UK7A 3SYKA 4CZ2A 3F90A 1K7FB 2DM6A 3EIXA 5DT9A 2MTBA 3RC2A 3ZJ4A 1SVUA 3KYIB 2H0QA 2WMDA 1YZUA 1C7IA 1F14A 1JLLB 1RPAA 2J3JA 4URUR 2NSLA 1ZM3A 5IARA 4OP3A 4CCAA 1QIJA 1HDGO 1KZ6A 2EFDB 3SFVA 2J3KA 3GCXA 421PA 2CLIB 1GZVA 2JCXA 3TQHA 1Z7WA 3ASUA 2XCTB 4GL2A 4EUNA 3KZKA 5IJZA 1KGSA 2BFFB 4DQKA 4MUEA 4D4KA 2H1RA 4CN8A 5TQ0B 1A88A 2BGGA 3FZYA 3B2NA 1CFJA 1T1RA 1X80A 3FOEC 5C1OA 1G7RA 3LKBA 4OA8A 3QELA 4EUEA 3OHSX 3DTNA 3DZHA 3B38A 4UVDA 3ROFA 2R68A 1ZLXA 3OPQA 4WZZA 4DLAA 1CC1S 2XHEA 3HCOA 4FKMA 3M2PA 4KI0A 1C1YA 3P45A 4TS9A 1KFCB 3IB3A 1JBKA 2WF8A 1R5OA 1LDBA 5HVNA 5A3SA 1ONSA 4UNPA 3HO6A 1FBTA 1WY7A 3HDVA 2RIPA 3R3YA 1IPHA 4JP8A 4BWVA 5IX8A 1YA4A 2E18A 2HHCA 4BIIA 5L3SB 1BMQA 1JEQA 1RP1A 3ANLA 4LPSA 1CSEE 1F2UA 3R44A 4NH0A 5DV9A 4PQEA 1KAOA 1TO2E 4DV7B 1E2GA 1AO0A 4DDUA 1UDRA 3PVZA 4RDHA 4WA8A 1BN7A 1VHLA 3QU5A 4WIAA 3SQNA 4W6QA 2ZTMA 5CBPB 5JRJA 3U3ZA 1JE1A 3OFJA 3AY7A 3DYVA 4UCQA 1Y1LA 2Z57A 5IT0A 3HUFA 4IFTA 5T8KA 4YIHA 1D4AA 4HNSA 3IBYA 1QFMA 4ZQBA 1ZR4A 4OL0A 1JHMA 1MX9A 1FRNA 1Y1TA 2I3AA 3E7WA 3PYLA 4ZALA 4FD2A 5CNKA 1QYRA 1N2BA 1B7GO 1SHUX 1RYEA 4XOUA 3GVHA 3HXMA 1SOMA 1TMOA 2QV7A 2IDMA 4TZTA 2I71A 4WNAA 5K3BA 4FDLA 3CISA 1TM4E 2XVZA 2I99A 4YK7A 2XSZA 3GBVA 3FRHA 1IBMB 2VUTA 4ZP1A 1H0KA 2ZYGA 2EDCA 5EJEA 1E63A 1DXHA 4JJ7A 2JI4A 2B30A 4FINA 4DG5A 1B23P 1NP6A 3C98A 4AK9A 5CBKA 2WUDA 5ITVA 4IHKA 3FYHA 2IPXA 2V7PA 3FDJA 4YRFA 2ZQ5A 3O92A 3R0QA 3KTOA 4KO3S 2ORED 4PZ0A 4B83A 3D43A 4CT5A 4LMAA 1KI6A 5C7IO 5IWAB 1RLUA 1BDBA 3H6HA 1JG2A 2C9MA 3LRXA 4L4UA 4MUIA 5JD4A 2X1HA 2IXGA 4EKGA 1XLWA 4GYYA 2MINA 1WE2A 4P7KA 4Q01A 5HFNA 3THXA 4TQAA 2B4KA 1KAGA 4J1QA 1AKTA 1PV1A 3P9KA 5C4IA 3O0TA 3UN1A 3OZFA 1NFFA 3QOFA 4HB0A 4P4LA 3VTAA 5IMBA 5HF5A 5M04A 5KQRA 5SYNA 1V8BA 5K0BA 5M34A 4GF5A 3A1NA 4MYSA 4FE4A 1U7HA 4YDSA 2GN0A 3P9YA 4NJOA 3UY4A 4YRZA 3VV2A 4ZI3A 3VH1A 1KYXA 3LHDA 4J0GA 4CM9D 2N47A 1VBKA 2REBA 3LX5A 1F51E 2O5EA 1R4MB 2H6EA 3TAHA 1RYMA 3OQOA 4NHEA 2Q29A 2QM7A 5LKAA 4MCHA 4DT1A 5E3IA 1A77A 3U40A 3NBUA 5KSOA 1PGPA 4GT1A 4F04A 1DBQA 2BTQB 3C87A 2QX4A 3QY9A 5DI9A 3DAOA 4GI5A 5BURA 2JLAA 1FPMA 4CDMA 2F48A 3ZNQA 3WYEA 3FNGA 1EVIA 4P7JA 2CYBA 1NMSA 1N92A 4O63O 1IM5A 2BJHA 2BMWA 1G8MA 2R48A 5T4FA 1H9AA 2ZXFA 3VZQA 4PSDA 4GR4A 5LBUA 3NBMA 1SUSA 5LQJA 5TIIA 3NEYA 3HP4A 3I5XA 3MQ2A 5FPPA 4CM6A 5K8TA 1CQZA 1P8JA 3LQ4A 4EJSB 1YR7A 3ITEA 5EMNA 2AW3A 1CZNA 1G16A 1RKXA 4K6HA 4AMVA 2XZLA 4JEIA 4E22A 3LQ1A 3AFMA 4M88A 1FJ2A 1ODSA 4FI3F 1DBIA 3AT1A 4CCWA 3I2YX 2WU3A 4GO1A 1NN0A 4OIMA 4ID9A 1BD4A 1NF2A 2BDEA 2Q5CA 2A9QA 2GCGA 1NI4B 1CIPA 2Y1FA 4I2NA 4AY2A 3KQQA 1PNVA 5IK2A 1JZTA 5EP1A 5FOTA 3V80A 5AUNB 3ZWYA 3U31A 4JMLA 2OZPA 4P33A 1Y8AA 2PL1A 2CXQA 2UV8A 2XA1A 2HBYA 3R09A 3IEPA 1M2OA 2O4CA 3DDNA 1Q21A 2G9QA 3IJ5A 4F45A 2DFTA 4DMKA 1BN6A 2XWQA 2HXGA 3NTXA 5KQPA 1WCIB 4RQTA 5TEVA 4BFYA 5T6BA 4KNWA 4O2BA 3GGGA 3EAFA 4DMGA 1CZOA 2O3JA 1X42A 2GJ4A 1BMTA 1OLXA 2H07A 3CU5A 2PPVA 3ZU6A 4XDGA 1MB4A 4KPGA 4BX8A 3VKHA 2FZKA 1EBUA 5ES4B 1GKYA 1P81A 4M9RA 1V9CA 2P2ZA 2AVNA 2WAMA 2DG2A 1ND5A 4F6CA 2B94A 1NZDA 3LW8A 3D6UA 3KVOA 4URFA 3RSHA 4CIAA 1NI5A 4JHLA 1N0IA 1U02A 3K1JA 1XNQB 3DUWA 4PC1A 1LRLA 1PNOA 1V6SA 4IR7A 4WUTA 4MOWA 3R5KA 3V8QA 2OGZA 4LF6B 1OFHA 2DWUA 1EP2B 1BEUB 3TDMA 1JHZA 1ZMXA 4C06A 1Y7PA 1RWPA 1T4BA 4BZQA 2NVOA 3L84A 4J0QA 1L5WA 3RS8A 5KO2A 3IP6A 2XADA 5DGHA 5LDHA 3I12A 1YNOA 3F5FA 2Z3ZA 1GPWB 4DIDA 4FEGA 4KDEA 4G6ZA 2ZRGA 2H4XA 2AZDA 1KO4A 3FRJA 3K30A 4H4DA 3E23A 3MOSA 4Q48A 3V7FA 4MR9B 2NSDA 4C5AA 1X14A 3QUSA 4GSYA 3TCKA 2B7BA 4CLHA 1MOQA 1EEXB 5G0UA 3RB8A 3S27A 1MDBA 1F0YA 3COVA 4M7PA 3EISA 1HZZC 4OKSA 5ALRA 4AVYA 1X1CA 4E70A 3K4PA 3TLMA 4L9RA 4AQ7A 4M0DA 1L5KA 5LBTA 3K0BA 4I3GA 4KXLA 3DAPA 4GWKA 4ZRDA 1XMXA 2FP4A 1DB3A 2X0NA 4CKBA 4D9EA 2ODBA 2WF5A 2ZJ4A 1IBCA 2V3WA 5K8LA 3EYAA 5LQNA 2O05A 1IXSB 1Z4KA 3PC8A 4MCIA 5AUOB 1CF4A 3QU2A 1IPEA 1UXIA 3HABA 5D5PA 2H4FA 5I7FA 3MGCA 1W59A 1LUAA 2EJTA 3PUHA 4R5MA 4UE3S 4EITA 2PUEA 1L2TA 2C61A 4YQZA 2JLZA 5D2CA 5IAEA 3LC1O 5ESXA 3THRA 3GDHA 1USUA 4GLFA 4YUAA 1RJ9A 4QG7A 4DMFA 3NYWA 4MR9A 5EQFA 1UC5B 5A05A 3S99A 4O0LA 4FCVA 4NBRA 1EM8B 2ZREA 4V2UA 3ZGOA 2ATXA 5AH0A 4EGSA 3UJPA 4PLGA 2X42A 1CUIA 2JLCA 1XKQA 2QA5A 5ALIA 3F97A 5KJ1A 1OGYA 3L18A 1VP9A 3IAUA 3WB1A 1R8JA 1J97A 4G5YA 3H4MA 3KU4A 2VYND 4B4KA 4JC4A 2EZ8A 3DXZA 5LUBA 2VP2A 3BWXA 2UYCA 2L2QA 4ODIA 2Q50A 5FOUA 3NU1A 4LBZA 4OA5A 2PNFA 5KNLA 4NPHA 5CRIA 1A97A 5EZYA 2RSLA 3FFTA 3W3AA 5C52B 1L8LA 3FW1A 3VC7A 3FSEA 1AA9A 2OT3B 1HFWA 4QELA 1E1CA 2P9HA 3X1KA 5DPMA 4GKKB 4QM6A 1A1SA 1PQUA 2CZCA 1PG0A 1PJ3A 2YJ6A 3ACCA 1T8TA 2VUUA 1GYPA 2FE1A 3HKCB 1N2ZA 3HYSA 3EVZA 4QFBA 2QMOA 3LGAA 1KC1A 4R69A 2B8TA 2H4HA 4W5RA 2PSFA 4FSDA 5TPWA 4DA9A 2G5TA 3LH5A 1U8UA 3EGXA 4RJJA 2SICE 3VM6A 2WILA 2ZKLA 3WB0A 1K92A 1YQ9A 3TL6A 2CBZA 1B14A 2H11A 1M10A 1JHXA 2Z98A 2ZSAA 4RAOA 2B5WA 1Y3DE 3KYBA 5KNCA 1AURA 2AF3C 2C0CA 2VJDA 5F1OA 1WP9A 1XVTA 4MGZR 4UUPA 2ID8A 3M5CA 2YTZA 2JK1A 3AFNA 1P44A 3KRTA 3WQSB 3B3AA 1IXKA 4HZGA 4Q18A 5MGBA 1FSZA 2ODQA 2XWBF 3F7OA 3IFSA 5I9BA 1QGUA 4K88A 4UC0A 1QH1A 1T2NA 2R65A 5JMOA 4E30A 1B2RA 1Q3TA 2C9ZA 2F4NA 3LWDA 3NDRA 2D59A 4PZDA 3TS1A 4DNQA 5BY2A 2W6ZA 4L22A 4AUEA 2JD0A 3PB3A 4ZI7F 5HQ3A 1E2DA 1OLOA 4QUJA 1OT3A 2WB4A 4NCXA 3CBGA 5EEHA 4DJJA 1IWPB 2RG7A 3B36A 3TVYA 5E3HA 1U6IA 5DGDA 3QI7A 2ERCA 3B6EA 3IVCA 2Q6OA 1C8BA 4JITA 5PNTA 1NQOA 3W6UA 5B3AA 4XQ0A 4EQZA 2QRUA 1JLLA 4TV9F 4CKCA 3IXQA 2VDQB 2ZRCA 3OPYI 1MX5A 5KIAA 4M6WA 4Z1OA 3OJLA 1CRQA 1VL8A 2IEDA 4GKVA 2V7WA 1A9XA 3LY7A 3I2KA 1EFKA 3O8OB 4PRYA 4HFMA 1UK9A 3DQZA 1M1XB 3RW9A 1YBVA 2EW1A 4LZJA 5C31A 5THKA 3GFQA 2F1IA 3ZWKA 1X9GA 4LJAA 2VDLB 1H42A 5DLYA 3IOMA 4EKDA 2OXFA 1XEWY 5IT5A 3UUEA 2HCFA 3DBLB 4PGAA 1ANKA 4FHGA 1UAGA 2QN3A 1RCTE 3IQFA 4IIBA 3U1VA 5K8CA 1ACJA 2QTRA 4XWAA 3EFBA 3S8YA 1QC5A 4FZJA 1YF3A 2E21A 1QPZA 2XE6A 1ZIYA 3IVXA 3EXIB 2HU2A 5J2TF 3KQNA 3NVKI 3KKEA 4BO6A 3ZV6A 1P19A 4TQ9A 3UTDA 3UKDA 4DSUA 3CG4A 2IPMA 4O4HA 1TD9A 3C5WP 1WDMA 3RD5A 4C5CA 1NLFA 4X8OA 4EG3A 3TEFA 1TJPB 3TSYA 5H0IA 1JNYA 3F6YA 4XQEA 4P38A 3U3XA 5IEJA 4GMHA 3JZDA 2H1SA 3EX7C 3OZTA 3PK0A 1VI6A 1J00A 3AJDA 3GLGE 1E96A 3CINA 4S12A 4AXBA 3OIWA 4F3NA 4Q00A 2EJVA 1FQJA 3F8SA 5AW8A 5IUNC 3G2PA 3TRIA 2NO0A 4L73A 3UQYS 4J0HA 3CCCA 3TKLA 4RGBA 1UCFA 5INTA 2YRFA 2VDJA 4MVJP 4XE5A 5C8VA 4P0TA 2DH5A 4TWAA 4ND3A 4O1IA 3QOWA 2GF2A 3H16A 4TTSA 3QXJA 3EVNA 4JUIA 3TXXA 1TYBE 5JI2E 3GZJA 1H1LA 1QNFA 4DBLE 5J5AA 2WHXA 1L7OA 1N3LA 2W2QA 1EWKA 3OO1A 4KFSA 5ABPA 3NC0C 1P7WA 4PGFA 1SC9A 4ALLA 3MJEA 4QVGA 4MAAA 5ALXA 2MINB 1B76A 3C3EA 4BNZA 3VZBA 2OVBA 4C3OB 3VR5A 3OQ1A 4DFDA 1XU9A 3K0FB 3QKRA 1JA9A 2YFQA 2GM4A 1WDKA 2NTEA 2AYXA 1GNTA 2V7VA 3FCCA 3QZUA 1IH8A 3IEMA 1QV6A 4KSYA 1YKSA 3CNHA 5L4NA 5IDYA 4P08A 4B3CA 2DBVO 1DJOA 2CUNA 2XQJA 3CE6A 2FDRA 3IAM6 4YV0A 2BGLA 4OYHA 2AJCA 2FPPA 4NYJQ 1YV9A 1D6JA 3LTEA 2WKPA 2MCFA 2M1ZA 3BFXA 3SM3A 2Z5VA 1PGJA 3DV9A 3PFGA 4KDRA 4XUCA 5BNIA 3BXZA 4CM7A 3FPEA 1GPMA 1EGMB 3G7SA 3T9CA 3QX9A 3RYFB 2XRFA 5FPKA 1RZRD 3MNFA 2Y3IA 3IB6A 1W8IA 1RWNA 1SZCA 1L8QA 2I1LA 1WULS 1ORDA 3IQIX 1G291 3JCZA 3P94A 2JCVA 3HKDB 4CMHA 3AIOA 3DEIA 5H1YA 1RLOA 3IP1A 2IHKA 1JMVA 2W6JA 2CN1A 4J0KA 5DW3A 4KXMA 5D1NA 2JKZA 3OF2A 1H4VB 2VATA 1P9LA 2JGRA 4EG5A 5I3CA 3R7FA 5AVZA 4WN9B 3U4QA 5EXEA 1C1DA 3CGWA 5E4YA 1EFLA 5I7EA 2Z2ZA 4EL0A 1RYNA 3D81A 1CQWA 5IM5A 2Z8YA 1GQSA 2FQ1A 3GUCA 3JD2A 3N3BC 1J33A 2VHUA 4K9NA 4LI0A 5F77A 4BVKA 5D5QA 1N34B 4GZ6A 1NM5C 4TRMA 4J4TA 5KOJB 3LVQE 5TVGA 1RHKA 4JWKA 1DCTA 1L5SA 1T13A 2RGNA 3NP9A 3OQPA 4V0KA 3UF0A 1NVFA 2IFTA 4E32A 2GK4A 5B1DA 3TR6A 2H2DA 2Z5FA 4MWCA 1TYZA 1AGPA 3Q0IA 2QAGC 3F74A 4PQRA 5JBIA 2X2OA 3F4KA 5DHPA 4D3FA 5CDYA 3CVVA 4HOYA 3D59A 1T1SA 1KNXA 4BBPA 3F6BX 3C41J 3PIDA 4U9HS 3CLSC 2YCBA 1XEXB 4Q4JB 1ELOA 3UHPA 5A4DA 2A0WA 2JFOA 2G72A 2QQ0A 4YAOA 3QMVA 1GAEO 2O8BA 2X86A 2XD4A 1OF1A 3QBEA 4N47A 2IS2A 4CKXA 2FEAA 4MPPA 4I50B 2IOYA 1CKEA 2QR2A 2QR5A 5K0ZA 1M7GA 5CVTA 4ZGWA 2VSQA 4OHPA 3E1SA 5A03A 3SYNA 3WLFA 3QE4A 3PQ2A 3OA0A 4JGBA 1XMSA 1OFVA 4L9SA 4LJ8A 4X1OA 2OYRA 3MHPA 4I1YA 3ZJYA 1UJBA 2CXXA 4BDTA 1CERA 1EFRD 1JJBA 1EWTA 2B2NA 3CF0A 3QXHA 1XD2B 3CW9A 1Q0RA 5A02A 4UU0A 2RHJA 1AUQA 5DCLA 2R47A 1NR1A 3N2NA 4YAUA 2Q3HA 4Q9IA 4S05A 2BE9A 2POCA 2HEGA 3DF7A 2C4VA 2LR0A 4N3AA 4R2LA 4XCVA 2Z2YA 4LJLA 3I37X 3VR3D 1GDHA 3IAM1 3M81A 4C7VA 2JIPA 5EG5A 4EVRA 2JHCA 3JU3A 3NBFA 1U28C 1XTQA 4M8NE 4CNQA 2ZBGA 4N3CA 5F35A 5ICGA 1Y7HA 3AIMA 4QE3A 1UEXC 5IH3A 1H8EA 3HBNA 1ORTA 2Z2JA 1Z6QA 3PGVA 2J48A 3CH4B 3NB0A 3K0CA 1RNLA 4UE2A 2G8LA 2X0JA 3QU4A 5PGMA 4Z7NB 1E5DA 4CETA 2BP7A 1EFUA 1REQB 4P83A 3RC1A 4QDTA 3TZLA 4I1SA 1UBRS 1MVLA 3CTPA 4UUNA 3ZWNA 3CKYA 2CJXA 4F91B 5HS4A 2O2CA 4RHFA 2DQYA 4CKBB 1ESNA 5JCZA 3EZ2A 4H17A 2P9CA 4IIGA 2P5UA 4HAOA 1FX0A 1H22A 4L72A 3PDIB 4OVKA 4DCMA 4X24A 4UOEA 5EHIA 1PL6A 2WFLB 2XIQA 4V1CI 3JQ8A 1SBZA 5KSZA 4TQUS 1G5FA 2IT1A 1DKRA 1Y5MA 1HA3A 3LNCA 4G81A 1T3LA 2D0PB 4GOND 4YC7A 3VYSB 4B8WA 3M33A 1FSGA 4Q4AA 3LLCA 3CTMA 3L6UA 3MUNA 1YR2A 2Q1WA 1NRWA 1SD1A 3Q87B 4EBFA 5DGCA 1ITZA 2D00A 2RAUA 2CUZA 2P6OA 2D5LA 1E9SA 3AILA 1NLZA 4IH4A 3W05A 1FYDA 1KEZA 5KAMA 4NQZA 1REQA 3ZI4A 3DVAA 1UBOS 2KB0A 3G2LA 3MCZA 4TRNA 4JI8B 1NIPA 4LDNA 2W43A 3L6BA 3LT0A 1WQ1R 3B70A 3ETLA 3NHMA 4BASA 1M1YE 4GUDA 2WUGA 2GCEA 4DADA 5GV8A 2QVYX 5I01A 3OFSA 5EUMA 3JVEA 3N5CA 2AR0A 2G6TA 5BOSA 3FCOA 2JVKA 2GD2A 3OX4A 5ED0A 5SICE 4U5XA 2M98A 1I2CA 2X9VA 1UQTA 2Q3LA 1FL9A 2ID9A 1BCRB 4HLDA 1KS9A 4GPZA 1QQ5A 3AFHA 3DHEA 3OC0A 4MQFB 4P4NA 3TTVA 1CJMA 4NNOA 1DBRA 1LGYA 5CA1B 4J29A 5F33A 1A8PA 2H5JA 1GIAA 3EF0A 3OQHA 3EWSA 1UADA 4BX9A 3FTEA 2W6NA 1TX4B 5F73A 3BSSA 4EW6A 3C3XA 1DWPA 2GJSA 3ZE0B 4X60A 3WLLA 4ROTA 4MLZA 1JXOA 521PA 1U2QA 4KCGA 4DUPA 3BQMB 3CZ5A 3Q6NA 1BWQA 3CR3C 2CT8A 2DGDA 1TIKA 2AT1A 2FSPA 1YIAA 4JQZA 3E2PA 4PCVA 1F6BA 1N4DA 2ZRAA 5AHOA 1BYIA 3BE8A 5JSFA 2UZ3A 3DQPA 3T4XA 4NAVA 2PZKA 3Q3VA 4BFWA 1KJYA 5I9SA 5BUCA 3H2HA 3OEYA 5AW4A 3HO1A 1A69A 4ARIA 1JG1A 4B46A 1NVGA 3DOOA 4PPGA 1VBMA 3GJXC 4B8YA 4QBHA 4G97A 4IHJF 3GCGA 3ZXUB 3GFSA 1EBFA 1RRGA 3AGPA 2VYFA 3ACDA 1Z13A 4O4IB 3ZK8A 1V5EA 1JG7A 3FKSA 4O1MA 1PJ4A 2A3RA 3RT9A 1QDEA 2Q2OA 3D2CA 3IQDB 3SLGA 2BMFA 4WNAB 4YP6A 5TQ2B 1LKZA 1JWBB 4MZXA 1R12A 3JTEA 5D85A 2QRGA 2GWHA 3IVMA 1SCKA 3MWFA 3B7PA 2VUHB 1Z5PA 3NCHA 4DC1A 4NABA 1EVJA 2HB6A 4WKBA 4DAEA 4MKHA 5ALTA 4WECA 2VBGA 3V4LA 4Q9NA 5JY1A 1U8ZA 1VRCA 2AOTA 4ACAA 3HU1A 4OQQA 4WKCA 5J4VA 4O0MA 2QMEA 3B6MA 4IWYA 4WK6A 4DWOA 1GUYA 1RACA 2Q27A 2ZDQA 5IJAA 5K0GA 3EFEA 3QXCA 4QO7A 1TYDE 3RHSA 3F6PA 4R2IA 2QT0A 1W1UA 1AS3A 1MJFA 2VAMA 4P2BA 5HA5A 2QPAA 2NVUA 3BB1A 1XR3A 3AVUA 2I3GA 1EXWA 2CJFA 2JLYA 1G8SA 2QUAA 4LE0A 1U98A 4AFNA 4G24A 2BFDA 3ZE6A 2YFKA 3Q98A 1Z2AA 3CCFA 1WBJB 3CZ9A 4ZEVA 4CIWA 2J0UA 1SIBE 2ZGVA 3RIHA 3ZOZA 3Q12A 3F2IA 5HX7A 3WFJA 3FOWA 4N7JA 4LRYA 4OQPA 3VDQA 4O2LA 3NPAA 3ZCPA 4PRLA 1V5IA 2ATIA 4Q3AA 5CLGA 1FDIA 3P19A 2FHPA 1MH9A 4R31A 3W5VA 4RKFA 4DBLC 1PT9A 3R24A 5I6DA 2A5LA 3GJ3A 5JIBA 3K9FC 3BRQA 3F4BA 7ABPA 1G8KA 4YRNA 3VHXA 1RRVA 3W2TA 4C6HA 2XMPA 3CVOA 2QTMA 4N12A 5EIAA 3RRFA 1PWXA 4QTTB 4PX5A 1YJ5A 1Z2CA 3UG6A 1RI4A 4EAAA 4CLEA 4MGHA 1ZGBA 3S2ZA 3WC4A 1R0CA 1Q1BA 3EFHA 3F9IA 3WGGA 2I9PA 2O8VA 5KYUB 3KZOA 1Y9ZA 3K0FA 2V5UA 3AF6A 2PMEA 3HNPA 1VJ0A 3ANNA 2ZAMA 5DBHX 2EDAA 2YUIA 2CJPA 3R0ZA 2PK3A 4OOFA 3VKFA 1F8FA 5EMLA 1V1MA 1SQ6A 3X1XA 2ZUSA 3RTDA 3ZJTA 4EYSA 4BJ3A 4QOFA 2HD4A 5KYVA 1ZRNA 1ZJJA 2GBCA 3Q3HA 4MGEA 4XVHA 2OFFA 3K0AB 4YROA 1MTZA 1QORA 2TMDA 2N3ZA 2O0KA 3AXTA 4XA8A 4DWWA 1N2CB 2YY6A 3KKLA 2CXOA 4MI1A 5F2NA 2VZ9A 5IUJC 5EP2A 1NPDA 4L57A 2DR0A 1I94B 4IEIA 3G89A 4IPTA 1VMIA 1U7UA 4LHSA 3JVUA 3MGGA 2R8BA 1JR2A 2Q99A 1DZ3A 2HN9A 4E08A 3WK6A 1YA6A 2EQ5A 4FGKA 1ABFA 1PDOA 5KYUA 3KDAA 4IX1A 1UEIA 1Z82A 3UCFA 1NNEA 4XRGA 3D7NA 4R8VA 3WHKA 1LBIA 1X1DA 2QF7A 3AXSA 3LMKA 4IO1A 1UBNA 3UAGA 1IXZA 3GJZA 4H0CA 1F1BA 2VA8A 4Z4HA 1BG6A 1Z9BA 5KZMB 1JLKA 3E7DA 1VLMA 1ESEA 3ICCA 4IVRA 1K98A 4ZT2A 4A0FA 2RC5A 3H19A 3BZWA 3PGLA 1JVSA 2VP5A 3HWWA 2NU8A 1LCIA 4MR7B 2DPXA 1G3MA 1KVTA 5KWIA 2IXFA 1ZM7A 2GQ0A 1CZRA 4N5HX 3STHA 3EQ2A 1ILEA 4MHOA 1MC4A 4R2JA 3WX0A 2V58A 4EHIA 2WT4A 2ERXA 4AN1A 3AETB 2BV3A 1PDWA 5TQVA 2PT7A 2H8GA 4KWIA 4ZGBA 3B6JA 3BD9A 5A3RA 4EENA 3PC4A 5DEIA 2CXRA 4QNRA 1B8OA 4PZAA 5BYAA 1N5LA 3OECA 4L75A 2PQ2A 2G80A 4NV0A 2Y67A 4S1TA 5TB5A 4PS1A 3SZGA 3ENQA 1UKEA 2YY7A 5KEIA 2I2WA 2ASEA 3IIEA 4U39A 1IVYA 1D7OA 1MDFA 3R0XA 4GXQA 1MNQA 4TRRA 1YUNA 4KB5A 4KR7A 1JL3A 3PJDA 3FTFA 1A5TA 1SBIA 4MH0R 5C2JB 3KXDA 3HL4A 1WCWA 1E2PA 1YDEA 5IAKA 2IPOA 3FI9A 1FC0A 3R5JA 5HZHA 3RK1A 3J7AC 1S2LA 4KP7A 5JJCA 5EC8A 3BXHA 1XP5A 2P2YA 2OILA 3NWJA 1VP3A 3OAAD 1XXHB 3A4LA 5FPSA 4ZYTA 1I2BA 3R6TA 5IYZA 1JXAA 3LPNA 4HL6A 4IG9A 1QOPB 1VB5A 3DMTC 1EP9A 2RKWA 3IT0A 4J0JA 3Q41A 1RHQA 2IHUA 4TN1A 4XZ3A 3KUCA 4NESA 4I6JA 5IVKA 2D7DA 1NKVA 1ZU4A 3SQLA 1LQTA 2VVTA 3V8VA 1O1YA 4ZOLB 4B2IA 3NKVA 2XXBA 5FB3A 2QBYA 5HGXA 2NX2A 3GEEA 4HS4A 1I7PA 3S68A 2D2IA 4WBNB 1D4OA 2FRDA 2WWWA 5AKYA 4FR0A 1L7DA 1ZC4A 2C88A 3BK1A 3LG2A 4X91A 5ERGB 5MN4A 2R66A 2HA3A 1KGDA 1YBMA 4Y2RA 2W8BA 3DPIA 1L1QA 2FN4A 3X1JA 3FF4A 1G21E 1WSDA 4N9QA 1DQZA 4W5HA 4XYMA 1CE8A 5B1HA 1DAHA 4BYGA 5IULC 1T34A 3GARA 3KLBA 4IDPA 1Z2OX 5HIIA 2L69A 1N8KA 4EB6B 1UIMA 1W0CA 1ZJZA 3LQYA 2GVNA 3M4JA 4YPFA 2BR4A 2P3LA 3CNQS 2H3HA 2H0RA 4HQRA 4LE1A 4DGSA 2XYVA 1KEVA 3N1UA 4RM3A 1NUAA 2MWMA 4RKRA 4WW0A 5EKXA 4JLOA 4QOGA 1B0ZA 3OZGA 4BY9E 4G8CA 1KAQA 4G1CA 4MVJH 3DBLA 3UMSA 2XUGA 4FOTA 4ZOLA 4E51A 3K32A 3AMVA 3IAXA 1R6DA 4XD7D 2CL5A 2HCJB 5CLHA 1ZKMA 2J0QA 3PIIA 2FFAA 1WW8A 2OPBA 1RRMA 1U2EA 5FYQA 4AKEA 4RABA 5FUMA 1NXSA 1HMPA 2PX2A 3FUWA 5DNDA 3SR3A 2XA9A 2DRIA 4DE5A 5AM3A 2M32A 1KMCA 4KXUA 1CRWG 4NCHA 2CVHA 3JY6A 1QFXA 1DO2A 1FRFS 2Z5LA 1ZXLA 4D8YA 4ZIRB 1L7BA 1Z8DA 1SVMA 2R25B 1GGFA 1VRWA 4Q5IA 4ZTBA 1DJNA 3UPDA 5B3KA 2BZ1A 2B7LA 1JHUA 8ABPA 1I1QB 4NDZA 3U4AA 4ZYYA 4PFQA 1VJRA 1Y8CA 2ZT8A 2CV2A 4HQ0A 1WTAA 2Q5IA 2YWCA 4E1AA 1FX0B 3ZE9A 3ET5A 3P9NA 2B82A 4NZYA 2WU0A 1YI1A 3I72A 2JD1A 2II6A 1BQ4A 1L7MA 3AIKA 3QF7A 5I8ZA 4IJVA 1T4MA 1SR8A 4GQAA 1R16A 2V6GA 3U7QB 1IULA 2Y68A 4UDOA 4ZVPA 4DCPA 5FOVA 3FPCA 3SJUA 5CLJA 4XSHA 1FFXA 1CQJA 3CLSD 2XWJI 4HDAA 4LUCA 4NOJA 4QJIA 4DY4A 1J0CA 2CDRA 3QMWA 1Y80A 2PGDA 2BMJA 2Z6VA 1HT2E 3FUCA 1CR2A 5EJ2A 3ZDFA 1PZGA 4MPJA 1GPUA 3NMUF 4HZUB 4NPAA 4DDVA 1HX7A 2W2VA 4A15A 2FOIA 4RVFA 1Z6PA 4GOLD 2X13A 5F98A 5LQDA 3AR9A 4WLNA 4G1FA 1QTRA 2CXSA 4YJ3F 1T91A 3KR1A 3IUBA 4JKOA 4PTYA 5L3RA 2CD9A 4EFKA 5K6TA 1RXVA 4HQLA 2ZJZA 3KKPA 3OKPA 5HKKD 3ZIAD 1EB9A 1K6JA 1E9EA 1UOEA 5HIKA 4M99A 1CTQA 2ESRA 4B6QA 2Y05A 3HJBA 4HFJA 8MHTA 3F6SA 4DPLA 2ZUTA 1QWOA 5LMNB 3H97A 4W6ZA 4JUDX 3D8HA 2D5AA 4DSZA 2QHXA 2EBFX 4UCWA 3R2JA 4UNNA 3OD1A 4JXXA 2I91A 1GG8A 1Q77A 1XQXA 3W1VA 3AERA 4CKWB 5CT5A 1IUOA 3GNLA 3QWBA 2CNOA 3T5PA 2R8ZA 1H8HA 1TVEA 4U0KA 3GJQA 5JQGB 1THMA 2ZB2A 4CTJA 4AWBA 1T1JA 3NHSA 1GQYA 3CZAA 3T12A 4O5OA 1GAXA 1H2FA 3BRCA 4BCCA 2C5LA 2R6HA 3NPMA 3LT4A 3EVFA 2O3TA 4ETNA 4PYQA 3IE1A 1ULHA 4AZ3A 2GBLA 2CV1A 2OCXA 3TRJA 2B92A 4CL8A 2GEJA 4Q15A 2V45A 3N2KA 4KKXB 4ZYVA 1HNXB 1Q16A 1QZXA 3L46A 4BNVA 1ZVKA 1GQFA 4TS3A 1RM5A 4M9ZA 5JNLA 2ZB7A 5IC5A 4DB4A 2I1VB 2JFWA 1Z0KA 4GNRA 4D1YA 2PL3A 4UVIA 1BQEA 3P96A 5JCXA 2WR8A 4A2PA 3EPLA 2C59A 2G76A 2JBAB 1PT6A 2VS1A 3HMKA 4RE5A 5JZOA 3PUXA 3RWMB 2YVUA 3W0LB 3RVLA 4RHEA 3EFOA 1KNQA 1GPLA 1RVV1 2XZPA 4EL5A 4DLTA 1CFZA 1R3UA 4GLLA 4NZNA 5KJEA 1QHSA 3ER9A 3JWJA 2ISSD 3VU1A 3P1JA 3ZE2B 3FZEA 3NASA 4AZ3B 4EKYA 3GRYA 2CHFA 2XR1A 4OI2A 3UH1A 2ZT6A 1H0HA 2NXNA 3LP5A 5AKXA 1UJ6A 1XJ5A 1OYYA 2Y1XA 4S3MA 1WB4A 2BISA 4MB0A 5H02A 4PBTA 3OTHA 4YB8A 4XPIB 5LZ8A 1XELA 5JY6A 3COWA 3JATB 3REQB 3S2FA 2CNLA 1T9HA 2HFKA 2FP3A 5AHKA 3UWMA 3T0GA 1ZM4A 2AXNA 2ADMA 3B3JA 3B7GA 3NAZA 1XPOA 2FUKA 1Q95A 2YXDA 2C31A 2HHJA 3DHVA 4KXXA 5DBEX 4IP0A 4B3DA 5L7YA 3FB4A 1I4DD 2Q5HA 3DE1X 4FCWA 1E3EA 1P60A 4YJ3A 5DNAA 5JD5A 1UMBA 3C1UA 5ALMA 3T61A 5IXYA 1EP3B 4BLPA 1DC7A 4UHJA 1DX6A 1VDZA 3A70A 2D54A 4PCUA 5CIQA 4QBIA 3DKPA 4LRSB 5JAQA 3RK0A 3QVLA 3TEJA 1SEVA 1NVAA 4XH9B 2QZJA 3VSEA 3AM1A 4OHRA 3R7WB 2PX3A 3JARA 5A1JA 1G64A 3OZVA 2P75A 4D9KA 5HWSA 4KIFA 3K9BA 3CCBA 2DTXA 3CY6A 1VLQA 3FYDA 4P22A 2ZUBA 4GPD1 4FW8A 4N5NA 3NDIA 3OOSA 2QL5A 3QY0A 3SJCA 3A11A 3CJRA 3P9IA 2Z6UA 2HIHA 4FFRA 2C9DA 5H59A 3EGDA 3EODA 2PUBA 4PQGA 2OG1A 5IBRA 1ODKA 3L6OO 1DIRA 1DT3A 1N7GA 4WCFA 3R7BA 3RRJA 1JILA 4ALKA 4CKEB 2PT9A 2KW5A 1EUQA 2JAUA 4PQYA 3T5BA 5BSGA 4CV0A 1GZSA 1SKUA 1YB6A 3PNMA 1DKPA 3A6GA 3DXFA 3LQRA 5DSXA 2R8XA 3W7BA 5D6NA 4PBRA 3OZSA 1G2QA 1PW7A 1WXDA 2VHQA 1SKYE 1QRSA 5BXYA 4FB5A 1FDSA 1XA3A 3QEOA 5D84A 4NFHA 3CM0A 1V9LA 1SXJB 3NIDB 3ZWCA 3GAZA 5CFRA 1SKQA 5LUAA 1I7DA 4DUGD 2LVBA 1E2QA 1YRLA 3H2BA 1E8NA 1O2DA 2WT9A 4RA6B 5CXUA 1R15A 5CDFE 1PFYA 4GDFA 1FW6A 3DV0A 1U6JA 4MV5A 3RIEA 1ADFA 2W6OA 4M1KA 4PYJA 4MQ4A 3ZX5A 4LG1A 4PEVA 1ZOLA 2JA1A 3OT4A 2G9ZA 4YIKA 4L78A 2OXIA 4BP9A 3W9YA 2HBZA 2PRZA 4S24A 2P3QA 1Y0BA 4C7MA 3TE7A 1H5QA 1F3LA 4BX3A 4LF5B 5GADl 2NUBA 4G0WA 3ESDA 2KQUA 3QHQA 2RH5A 1ZRMA 4RMNA 1ZK1A 1H8HD 1I3KA 3P0IA 4FOLA 3CLKA 3MWDB 4US0R 1J0AA 4NSNA 3ZS8A 5TC4A 3O4FA 4XGRA 5EKSA 1ZNWA 1VFPA 4JD5A 1JR6A 3GDFA 3TSAA 1KIFA 3F0TA 3O1LA 3OQJA 2C9OA 4D8VA 1IQPA 2Z30A 2VPTA 2X5OA 1CHDA 3VU8A 5KNBD 3AEXA 4J2HA 3GGPA 4B0PA 5FLXA 3VDRA 3SPXA 4XR9A 5LLTA 2VT7A 4CEHA 3HXKA 1TADA 2OOSA 4BLOA 4V3CA 3VNVA 4H31A 4EO9A 2BGWA 3EIOA 1N3IA 4IVNA 1ONPA 1BX0A 1P2FA 3T9FA 3V1YA 1E2MA 3VVBA 3NQ41 3JAWB 1B43A 1O96A 3U1BA 1LQ2A 3H8SA 4PC6A 4BNNA 1Q74A 3OUUA 5D3QA 4ZC8A 2Q0SA 1IJFA 3HJCA 5T4BA 2WJYA 3N2YA 2LDXA 4Q3CA 5AM1A 5ITZB 3DZFA 1WL8A 2P79A 3C85A 2RJNA 3NHBA 3NRJA 4JR0A 4AJNA 5TPWB 3ROTA 1YOVA 3HJTA 1MAAA 4BRWA 5JAOA 1JIUA 2QORA 4RH3A 2JD2A 3QVWA 3TKAA 2CWDA 3II6X 4F11A 1NHWA 1UJNA 2YYYA 3CLUC 4EY6A 1Q6ZA 3GCWA 1ZOIA 2IHTA 1ECLA 2EJUA 4XB2A 3OJ0A 1UMKA 2ZJ0A 3LBNA 4D8TA 3HCEA 1NM5A 3O21A 1MN6A 5TR9A 4LXYA 2PSHA 2X8BA 3JAKB 4M1EA 1D6SA 1IAQA 1ZK4A 3L9WA 4O4JA 2WC1A 3HJUA 4EJSC 4MUAA 1KEKA 2IXEA 3PCTA 1J8FA 1MRNA 1WXWA 2PX0A 3NHRA 3E9RA 1AGYA 1YRBA 3A6JA 4WVLA 4ER3A 2OAEA 4D4GA 3SXJA 2JEZA 2JK0A 3EK2A 2JI9A 5A0FA 1GZ5A 1YCGA 5AOAA 4L4YA 1J7KA 2D3WA 2GCOA 4MVJM 3VC3A 5I51A 3R8CA 3GUYA 4AZ0B 3OTOB 3PHBE 4ZN6A 1DCMA 2VP4A 3ZZ1A 2PXHA 1UBHS 1E2EA 3BAZA 3EBLA 1X87A 4WJKB 4BGVA 3WWPA 2GEVA 3DVRX 1EXMA 1EGHA 3ICOA 2WVJA 3M1LA 4R8KA 4AMGA 4DG8A 3MT9A 3OC6A 4GXNA 2R9VA 4RZIA 3U60B 2GHRA 3AB7A 2GAJA 3L6DA 4IX9A 2AOWA 4V0RA 5CNIA 5ILQA 3HCDA 4QXRA 1HEUA 2JFVA 4C7XA 4GBMA 4A8JA 5DN6D 1JDSA 1AF4A 3ONDA 4TTTS 5FPTA 3Q1LA 4EEXA 2ZJBA 3H5TA 3Q7RA 3HJNA 3LVFO 2X40A 2QMZA 2WWHA 4ND4A 3SEAA 3JAMA 2MT9A 3E7PA 1KA9H 3DCNA 1U1GA 3EPPA 3PR1A 4JUFA 3UOWA 2PRIA 3WRYA 2KM1A 4X65B 4XCQA 4RTSA 1T5DX 2AMYA 3SD7A 2C5GA 5HMLA 1X70A 1YFLA 4L5YA 1AQUA 3PUZA 4WBSA 1PFVA 1CV2A 1RCUA 1LXCA 3FPKA 3OEHA 2QKYA 2UVQA 2IQ5A 3IT1A 4XAQA 5A9RA 2GPBA 1GVNB 4RLSA 2ZAYA 3SKYA 3S29A 3NFYA 2QUJA 3AL3A 4ZQGA 4YT8A 4BNXA 5L3QB 2ZBFA 3VO9A 2NMVA 3COJA 2CNKA 3GC6A 1M2VB 4JLBA 5ECDA 1SAYA 3LYHA 5LLSA 4KLNA 1I6LA 1D2AA 3K2IA 3GRZA 4LRXA 3E9EA 4BFVA 2FW6A 3FLBA 2OXCA 9GPBA 2EX4A 3PHLA 4E03A 4S1PA 2JGLA 4IJKA 3H6KA 4MW0A 1QRTA 3H9JA 4X7PA 1SWWA 2BE7A 3CUYA 3OURA 4G4JA 4MWBA 3L9XA 4EHNA 1ZMRA 4C2UA 1CQIA 2A84A 4MUJA 3LDHA 1N5MA 3UBMA 3VSBA 5IJWA 2DFVA 4F92B 1RWXA 3GIDA 1T2FA 4V0SA 4UM8B 3PXXA 4Q9DA 1V4NA 2TECE 5U4QA 5AVVA 2OV6A 4KZKA 1WMAA 1KQGA 2GOYA 3M3HA 5EWLB 4BLVA 1PYDA 1NVVQ 4CL3A 1DARA 4Z0TA 2DE0X 5AM4A 1TMGE 1NV9A 3PI7A 4BVBA 1XWIA 1JSCA 2DFDA 2AYZA 1ZR2A 3U7GA 3OIUA 2J4FA 3AG5A 4HRYA 2D1SA 4E6EA 5M7EA 1KRXA 5LMCA 1LPBB 3T54A 1JU9A 1DX4A 2XBLA 3EYWA 4TL6A 4NMXB 4N8DA 4UREA 3W8RA 2XB2A 4FXPA 1T6ZA 2FFBA 2BPOA 5FUBA 3GUHA 3QBTA 2WIDA 3BMOA 1GSAA 4HWRA 2V5VA 1RXIA 2H00A 2IKSA 4QEDA 2OBMA 2PUDA 3QXSA 3BH6A 4X0EA 1MO6A 3RC3A 5EWJA 4WH0A 2IYZA 1M73E 2I4RA 3SYLA 4AKGA 2REOA 5C46F 4IKEA 2WYWA 3VNAA 3RUFA 3EXHC 2FWPA 2XDYA 2I78A 3QP9A 4FJ0A 4QULA 4PX2A 2ZE6A 1XYGA 5JOQA 4RIEA 4G67A 2O2EA 5GPBA 3NYIA 3EG9A 4XWWA 4ER5A 4PIPA 1JJAA 2X4LA 4URZR 13PKA 1XF1A 2B99A 2IF2A 3L43A 2JVJA 2VBIA 4K5QA 4DL9A 2GA9A 3R7NA 1YRAA 1J0XO 5BSUA 1MQ9A 2YYAA 4U1RA 2QPOA 2WINI 3TGWA 4CEIB 1O6ZA 1XQ1A 1R5NA 4DARA 1DC6A 1NI4A 2GRAA 2JJ2D 1OPRA 1XHEA 2NVWA 1P4HA 2I4TA 3I6YA 3JQ9C 1JIIA 5AJWA 1XKXA 1XZKA 2WIFA 1I5EA 4KPFC 2DY0A 2GBGA 2PVPA 4REQB 5IC6A 3QHPA 4W5OA 2QLNA 1RADA 2XCOA 4FKZA 5HF8A 1N2HA 3NNDA 5G02A 1E9DA 4N4AA 3V1TC 3DGFC 3I2IA 1NMZA 2GAOA 4PIMA 4R81A 5DXFA 3K6SB 5ELXA 4NBVA 3PXEA 2DWCA 2XMZA 4ZVRA 621PA 2IEGA 1F2TB 4RJTA 3URKA 1QJ4A 3D4NA 5KOJA 3ZTWA 3EIHA 1D2CA 5CB8A 3DOFA 4LHXA 3R76A 1W52X 3UAWA 4K9QA 5B1IA 2A2ZA 1G21A 1TD1A 4XX0A 1GA4A 1P0PA 3TD9A 4D9FA 3DHNA 3HM9A 2Z56A 2BY4A 4O2AA 5FQOA 5A5GA 5IASA 3NYQA 2R4QA 3WAJA 3VSDA 2CBGA 3ZD6A 1Y42X 2WJPA 1A76A 2ZK7A 2ZPAA 3K1YA 5H82A 1HO3A 1UZMA 4PHCA 3Q7PA 4PAQA 2FSIA 2I8CA 1E0DA 1MO2A 2Q21A 2SECE 3B53X 3PXAA 4WZBE 5ENDA 5J5VA 2P2NA 4ZCRA 3MT8A 4KYVA 4X92A 2AMJA 3GP3A 4JC8A 2H7CA 1K4KA 3O8BA 3SC4A 3TL3A 5TMDA 4YRSA 3V33A 3BX1A 3FD8A 5BN5A 1DAMA 2G7ZA 3ZZNA 4BUZA 2C7QA 2GETA 4TMFA 4MWGA 2GFIA 1LTKA 2VRCD 2Z3WA 2WY2D 3TM4A 1IRXA 1UEJA 4P3YA 5LL6P 1DAGA 3OUZA 3ZS9A 1N1MA 2DJ5A 2AC2A 1V7ZA 4IVPA 1N57A 3LDFA 1DC8A 4FYMA 4IQFA 4JEMA 1WZIA 1GKUB 1ZN7A 1BU5A 4YJGB 2LIVA 3EZ7A 1HMYA 3ZPXA 1VHWA 3UK1A 2BD0A 3C5CA 1T2DA 2EHDA 3NWEA 1HDXA 1HZJA 3P2IA 4RSHA 4Y2SA 2IC5A 4AJLA 3EUWA 3LWBA 4YDRA 1GUFA 1PD1A 2H9AA 4N01A 2JI6A 4R1UA 3KELA 1JAZA 4DZTA 3K9QO 1U5BA 5J23A 1VPWA 4YCNA 4MB6A 5JDCC 3ASVA 1JKFA 1P45A 2HT6A 4M37A 3W5IA 4RHCA 1CJBA 3A6EA 1GCGA 1HQYE 2CNWD 1JDVA 2CLOB 2HXSA 3FWYA 3N8HA 5CM8B 3C1OA 4JI7B 4AJ2A 5KDDA 2JCBA 1WD7A 1KZGB 3M5DA 2BGTA 4Y2JA 4HTFA 1KJJA 4P7BA 4QLBA 2AFIE 2NXEA 4TUYA 3CVUA 4LZOA 3LOPA 4AKSA 1TQ8A 4F9TA 2X4GA 2VK8A 3NH6A 3UA3A 4OEHA 1WHTB 1VYHA 2NV0A 4JVOA 5AWFC 1E92A 1I6KA 1KXZA 2RHGB 4Y0AA 5KWVA 1IZ8A 1G66A 4NAUA 1NFRA 2DBYA 1OX6A 4QUAA 4M46A 2JCSA 4QVKA 5C53B 1A0OA 2E7ZA 3T7CA 1RQRA 1UODA 5KYYB 4QO8A 4MQ6A 4FE3A 3OM8A 3PX2A 1D0SA 5IK2D 3RIXA 1KH1A 4PZLA 4C89A 3BRWA 4JJ8A 2V03A 1S5PA 4G89A 4PO1A 4RK6A 4TT3D 3A31A 3P0HA 5BV0A 2JAXA 1SGWA 3Q85A 1HE4A 5JFTA 2H4JA 3WIUA 3RSSA 5BSWA 3KFVA 5T3YA 2H3EA 3PQ4A 4PAWA 4G5XA 2PHZA 3QLTA 4Z7OB 3DMPA 1CY6A 3MWDA 4OHYA 1RI2A 1XZMA 1FVHA 2C4NA 3ZHZA 1L7QA 3EIEA 1BGXT 1GZ4A 2IEYA 3N2LA 3ZGNA 3AKZA 2G82A 2VK1A 3E9MA 2B1JA 3LVRE 4V0ME 4ARZA 3U44B 1FUIA 2IYAA 3NRCA 3LT1A 4MR8B 4BLWA 1EVYA 4HWOA 3ZHCA 5JJLA 2F3TA 1SOVA 3IKVA 4CMIB 1M8FA 1WUYA 3X2FA 4GBED 5JMWA 2AJ8A 3WADA 2NYUA 3KSZO 3GLHE 2Y92A 1RJDA 5AQ1A 1DRWA 5CITA 4TL9A 2XVXA 4YCCA 1I2DA 3SC6A 3EVTA 4DLSA 2DBZA 1XT6A 1Z8HA 3LX8A 4XRRA 3RV4A 1KI1A 3V8NA 3HH8A 1EDDA 3LPLA 1RLTA 3PHCA 4LCBA 4KPYA 1R00A 4MDFA 2I7VA 1E4EB 3HHEA 3LHSA 4YMUA 3QG5A 4NEHB 4A5SA 1RTKA 1VHQA 1JQJC 1WAMA 2RAPA 2XUZA 2CLDX 2OY0A 1T2CA 2OCDA 3HB7A 3EE6A 3L1JA 5JAMA 2I1QA 1DRJA 3DD5A 1K7YA 2R86A 2HMSA 5KOHA 1H4TA 1PK8A 2CYAA 3QMPA 3G2IA 4W1SA 4FFOA 1BTOA 4R7ZA 2KHZA 1J24A 3DBHA 4LXUA 4ME6A 2CXHA 4N03A 2YNMC 3B48A 5AKLA 4E5NA 5JU6A 4HDMA 3RVNA 2XCUA 2RK4A 3L8FA 1JDJA 4LMPA 4MIEA 2PS3A 4GMFA 2C2OA 3VC2A 2WUEA 3UAVA 2XXAB 1KP2A 3N6XA 1MEJA 3MMSA 3AETA 4LJ6A 4EGAA 2X6QA 2I4NA 4MUMA 1JKIA 3ELDA 3EQ7A 5AHXA 3B12A 3IA2A 3VNUA 4YP9A 1MOSA 2AN9A 1V9SA 4IDEA 1FUKA 1K6XA 2A0YA 1NJ5A 2VTKA 4I46A 3EZXA 3E27A 2P3SA 2IS1A 3H5WA 1BAPA 1P0FA 3A6KA 1EXVA 4P36A 3GLSA 3NM6B 5EINA 1KAHA 4HAZA 3DMTA 3TRDA 2D1QA 2DECA 1QCZA 2PS0A 1Z2PX 4QPCA 5KB3A 4RTKA 2DF8A 1TPZA 2E4VA 3BRSA 1MO3A 3M5PA 3ZEAA 4G26A 3PFBA 3GO4A 1B41A 2PM8A 3U3JA 3WLMA 221PA 4RE6A 2ZDHA 3BFJA 4HUQA 3OLZA 4PFKA 2XSZD 2VWHA 1TCUA 3UJBA 1SXHA 1TPYA 1W30A 3GXOA 1GHTA 1X15A 1LZLA 1S96A 2UVPB 3DOJA 3GOQA 3OOHA 3BEOA 4A8JB 4E7PA 1HLFA 1DJLA 3Q88A 4QDUA 1CF9A 1MHPA 1SZDA 3FYUB 4HLUC 4R98A 4WN3A 2AXQA 1T5OA 3KBBA 5KJCA 2H1WA 3BE4A 4H3KB 2HHLA 2PKXA 1KIMA 5B3JA 2J6HA 2ZU0C 4JSYA 2ZTVA 4WA7A 3G9XA 3HI4A 1Z5ZA 4XB1A 4E5YA 3OCJA 4MULA 3T4PA 3LBAA 3MWLA 1N75A 1QLJA 1VTKA 2WE7A 3D5TA 3JATA 3TIVA 4BE9A 4E5KA 5I48A 3TLAA 5IMSA 1JU3A 5DM70 1A82A 2I7TA 3E3AA 1DUIA 4JBNA 3HTXA 1NULA 1ECFA 4BO5A 1TUIA 5FV7A 4HGPA 4MLPA 3SOZA 4KLAA 2VRNA 1R0BA 3WG9A 2QYOA 1A9XB 4PE5B 3WL8A 3PEVA 3WJ7A 4IJMA 4UARA 2BGMA 1LLQA 2XYPA 2C7RA 2Q3DA 4YMLA 1FY2A 2HPZA 1YS4A 1VL1A 3DWGA 1TYEB 4QDKA 1ODLA 3ES9A 1DLJA 4KLRA 1J56A 2B8NA 3QKRB 4JXKA 4RJKA 4Z9YA 2GBPA 1SCQA 1A8UA 1DS6A 5CCEA 2J0VA 1LV8A 4RV9A 2VQEB 4GEKA 4MROA 1Y1KE 1FMCA 4UDYX 5CK4A 4LRWA 2X9NA 1SXJD 1M0TA 2P9ZA 4RZQA 5D00A 1JU4A 3PX3A 3SXUB 4DSNA 5EIXA 1SOAA 5A9TA 2YZ2A 2CCKA 3ZDYB 3P52A 4DRXA 1ZGHA 2JJQA 3NOXA 3MLEA 4G1EB 4KGVA 4R0VA 2GLTA 4N48A 4PG4A 3H8WA 1WU8A 5G40A 1QP4A 3HDHA 3EY4A 5CD1A 1O4VA 4G85A 2XQVA 4TV8A 1E6CA 1PX0A 1Z6YA 3IV7A 2ODNA 3C5VA 5SY4A 4BCDA 4F4DA 3PEWA 4I14A 1SVSA 4Z8XA 3V00A 3WDLA 1U0LA 2JA2A 3LFUA 1QSGA 4CM4A 2W42A 2Q3JA 4EA8A 3ZU4A 1U0HC 4LX0A 3WGJA 2HYIC 2UYYA 2BKUA 3N6VA 3UKOA 1ZVVA 1AXGA 3RVRA 2PUGA 3B51X 4ITUA 5CW1A 4WJLA 4PLFA 3C3AA 2AN4A 4AS1A 2G4CA 1J1IA 1IBRA 2XV1A 1E7RA 2OV3A 3EVAA 3MWJA 4G8JA 3UAOA 5B5SA 5K2OA 3BQ9A 1OA0A 3B13B 4LVOA 2QVXX 1U3FA 4P2GA 1B8UA 3GMTA 1TK3A 5KC9A 4NZMA 4MV9A 1DHTA 2PRKA 4K2AA 4ZZ1A 5M2QA 4EY8A 2HSJA 4OAOA 4R16A 5BR4A 1JFFA 4EUHA 5HEKA 2FHSA 4JI5B 4D92A 1S01A 3LP8A 2ZEJA 2ZIGA 3Q7EA 1CD5A 4R1TA 1BOOA 3P9RA 4TLLB 4TXJA 4UM5A 4UHKA 2OQRA 2XCRB 4NCAA 1GYQA 1U9YA 3ZKWA 4ZMRA 1NF3A 2P11A 1MTOA 2F9MA 2GX6A 2BIFA 3A9SA 1RFGE 3L4SO 3QE0A 1QIIA 2BJWA 5HE8A 4EHHA 1PR6A 4C43A 4NV1A 1JPUA 2AA3A 4HQ6A 4YRIA 4ALIA 4GVLA 5FI5A 3N0WA 1HKHA 3BMQB 3DDWA 3WHIA 5DASA 2B4TO 4MUKA 3CZQA 2XNCA 2JHPA 2M6LA 5KNCD 4A1OA 4MITA 3Q8LA 1Y6QA 3G1TA 2YIVX 1RQGA 5JEDA 4B32A 2IU0A 4CMGA 3AHHA 4QBFA 1BE0A 1E79D 3FZQA 4G07A 3OEWA 4ZYZA 4C22A 2UUBB 3JASB 1A2QA 1Z0IA 1M1NA 2DMRA 2IIBA 2Z6QA 3T4UA 4HNQA 3NC4A 4RSGA 4LIPD 4X8HA 5CA1F 4N41A 4QUEA 5JSYA 1RFLA 1ZDMA 2W6PA 4Z0HO 4KNVA 1JDZA 3BMXA 2O3RA 4HAUA 4N0DA 2C5BA 1I0IA 2BFNA 4JR1A 1EVQA 2GYWA 5LB2A 5FTKA 3HO8A 3C48A 2ZIVB 4YP7A 3TMAA 3ZZMA 1L3IA 2EWVA 1Y4ZA 2RHLA 3N28A 2HEIA 3BE5A 2W71A 3OMXA 3P9PA 4NBTA 2FG5A 4HN4B 4XYGA 1WIWA 2N75A 5DBFA 4Z3KA 4XUGB 3MTQA 5LJLA 1RS0A 1AIPA 1OE0A 3AB8A 3AV0B 3K9HA 1SIUA 3VJMA 4C4ZA 1VBFA 3E5RA 5FULA 3SEFA 2OLEA 2AJDA 2I8LA 4DUGA 4ARCA 3PI6A 4X6UA 5H3LA 4KX3A 1Z37A 2F1RA 4JB8A 3CZMA 1IMJA 4UM9B 1NP7A 5GTDA 4F7DA 4XYBA 2WHQA 1MC8A 4G0MA 1Z5NA 4OJNA 1ULAA 3NAQA 1X1BA 4QATA 3VO8A 4B76A 4DLXA 4JYAB 1VI5A 4C88A 3E35A 1CZHA 1A9ZA 2EBHX 2OESA 2EBUA 2N1MA 3MWEA 3O4HA 1A7KA 2QJFA 5HZGA 1XRJA 2GK6A 3GD5A 2J59A 3PA8A 2CHGA 4RPJA 3I9JA 1G3QA 1HRKA 1KETA 2PGIA 3SQOA 1JLMA 1LPNA 3VZRA 3WNZA 1JIJA 4EG8A 5KPJA 3U5TA 5BSTA 4NYIR 2BONA 1ZONA 4D3XA 1Y9AA 2NG1A 4NC9A 4BFZA 3TWOA 1EFDN 3BL8A 3CX3A 1E9RA 4QVIA 4FBGA 2JI8A 2QAIA 1E2NA 4A10A 3JQ8B 1OSNA 1JI0A 3QPCA 1YZYA 4XPZA 4RKWA 5DTIA 4TROA 5LN1A 4Y6OA 5E7IA 1N77A 1OZ0A 1NJ2A 1VYVA 4HCJA 1XB2A 3KR0A 3GFPA 1XXHA 4MVJG 1OC2A 3V8MA 5C7OO 5E6RB 2A78A 3IERA 1EK0A 2Q5JA 4I8DA 1SJ9A 4R1MA 4FILA 4FFVA 1Y33E 3WYNA 3A7DA 4GM4A 3EAQA 3WE7A 5DOVA 3SC3A 5JYDA 1V7PC 3D6FA 4C0XA 2TSYB 3KTAB 3THOA 1FOEB 1WWKA 1TZBA 2GYYA 5IKEA 3A28A 3KT6A 1PEYA 4G2NA 1DRVA 4C4AA 4PINA 2PV0A 1TL7C 3IJEB 3IP9A 3TZHA 3A4NA 1BVHA 2ZJ8A 5DU2A 2Q0QA 1ORVA 2K4MA 4MW9A 5D51S 4A0SA 1G7SA 4HD8A 2ZUWA 2IHBA 1Z3CA 3ZR4B 5E7QA 4BC1A 3L6RA 1RKUA 1KFEB 1XWFA 5AUPB 1J0EA 3BF7A 4GZMA 4EPXA 3DKVA 1N36B 1C81A 1JUDA 2FP4B 3P4XA 3AZOA 4LDZA 1MA0A 3VNBA 5J2UF 5JADA 1BJTA 2ECQA 2QRMA 3EG5A 1W25A 3IVGA 3OG9A 2JW5A 4PBSA 2YZ7A 5E6RA 3CG0A 2ZROA 1IOZA 1P4JA 1SC3A 5K8JB 3QVKA 3N6RA 3OKFA 1W581 3A32A 3F9CA 3QV2A 2Y4OA 4KODA 4ZC1A 5AXBA 3A4YA 1RXCA 4ZDIA 1N32B 3ITKA 1TLFA 3AEKA 4PLCA 5FWAA 4GEGA 3A37A 1PHPA 2OK8A 2FW0A 3EDQA 3LI2A 4FCTA 1SKAA 2VG8A 1YL7A 3QPVA 3V7UA 1T2VA 1L4NA 1E2IA 1XA4A 3QEKA 1D2MA 2JLXA 4GM0A 3C4QA 2QK4A 2F64A 2IHJA 5EE3A 1P5RA 1UXHA 2P6UA 3DO8A 3KFXA 5K3CA 3F78A 5ILOA 2XAAA 5A9SB 4NNPA 1E1QD 2DPGA 2LGJA 2QJTA 3OKAA 2OLKA 3DEHA 2V1XA 1PWYE 4I2VA 3EXAA 4UDXX 4ZAGA 5H80A 3ONNA 1EFVA 4BVAA 1EUDB 1AKNA 3JQFC 3EAGA 3YASA 4Z0NA 3T7SA 3H5NA 1M75A 1E5QA 3BXFA 3WRXC 2J6IA 3ER8A 3FZGA 3HHPA 4RGVA 3U62A 3WGZA 3EOBI 1E4EA 4FYVA 3B6KA 1V41E 4X54A 3U56A 2YWXA 5GM2A 1G38A 3ZCSA 4JJZA 1MW8X 4ZQFA 1T0HB 4CHGA 1EZZA 1YOVB 3HI6A 1QP7A 2PUFA 1VE1A 4ZJZA 3AHEA 3IR6A 4UUQA 5EVCA 4XVCA 1UBMS 4LYAA 1FFDA 4K3VA 3WNCA 5LIPA 1S9DA 1SXJE 2B69A 3A9TA 4H7PA 2QVGA 1UXOA 4EX6A 2XDQA 2BUCA 3I4FA 5KBYA 3OE4A 1NSFA 4BWYA 4JI2B 4EHJA 2AR7A 1IYZA 2OWEA 5DP1A 3CA8A 5JFOA 2HT1A 4E1VA 2IS6A 5CT9A 3HL0A 3LUHA 3K0SA 4A23A 3WIVA 1WQ3A 4TYNA 3VYRB 1VG0B 1YOBA 1CRZA 2ZS7A 3FOBA 4K1XA 1FNCA 1PTJC 5T41A 3V4PB 3VMMA 2EWMA 4KVAA 4BNKA 4G4SP 1M66A 4C7BA 3M4YA 5TXGA 2BWJA 4L8GA 4WCDA 4D8WA 2ETXA 3I2GA 4CCSA 2WE8A 3L02A 3WI7A 4DV6B 2AOUA 2HADA 3O2NA 5K99A 1CULC 4Q3LA 4EJSA 5K6AA 2OM6A 3SQWA 5EHZA 3BMCB 2FPOA 4JB2A 3NJRA 4R05A 4WKPA 3T3DA 3HLYA 1T8PA 3Q9SA 4M7OA 2Y2UA 1KI6B 4CGZA 4LW8A 3KSDO 4L3OA 1DFIA 3GBPA 2G07A 1PF7E 4J4HA 2CSUA 3BHMA 3VR6H 2N42A 2PKEA 4MVJA 4GKJB 3NLLA 3PQ7A 3L6CA 2W2NA 3B5EA 3GUZA 4YXWD 2Z9DA 1G1AA 1P0MA 1KJZA 3ZDCA 1UXKA 2OGUA 2OCIA 2IZ7A 1EWYA 3O4GA 1GGKA 3GVXA 1AV6A 4UW9A 1A50B 2P0YA 5ILGA 2NSYA 4JODA 3SXUA 1T9AA 3K5IA 4CPDA 2GN1A 2YXPX 4Y6QA 4FSHA 2ONJA 2ENWA 2ORWA 4B74A 3TX6A 3WNVA 4BU0A 2A9VA 3WLAA 4ACBA 6AT1A 3JS5A 5FUWA 1GPH1 3HXTA 1QU2A 2FOLA 2VNIA 2B35A 2B20A 1K66A 3O84A 4B7UA 5K03A 3H9CA 1MZPA 3ROPA 5IDWA 5IS2A 4P7FA 3SHFA 1QS0A 2H08A 2D1FA 1VA4A 3D8TA 4KG7A 1W4ZA 4ER0A 1PGNA 1PL0A 1XVVA 4ONEA 4AY3A 4XFDA 1W75A 1EVKA 4Z7JA 2ID7A 4IIUA 5C1IA 3RVSA 3TNFA 4X94A 1IXYA 1YONA 3N2GA 3NT5A 3TJRA 4E11A 4CN9A 2ETVA 4MI6A 1QG4A 4ZK2A 4DRXB 3EGVA 1S7GA 2O3QA 1HFJA 1VB3A 4LHZA 4MP3A 2HA6A 4NZOA 1PT5A 3IDZA 1AXRA 4JBXA 1WF6A 3QNUA 3CLVA 1KSJA 3OQMA 4WKGA 3SN6A 4RK7A 4KJZA 4MW7A 2WM9B 1EMDA 1UBFA 2AFVA 1K8YB 3BJMA 4WVFA 4EY4A 1MMFB 1YUBA 1X7HA 1DLIA 3B5JA 2P69A 2PD6A 2NIPA 1KVRA 3E18A 3EEBA 5LSAA 1QGOA 4AXXA 2MMGA 2R62A 4UU7A 1EA5A 1P33A 2EWWA 2HGSA 2WJIA 4MMXB 2CY0A 3MWKA 4LXQA 4TYPA 4DJDC 2PKRA 4EVQA 1R64A 3CMCO 4XASA 2GJ8A 3PPXA 4NYMR 1H4QA 4NCBA 4IOMA 3SSOA 1Z74A 4YALA 2ZIWB 1RIFA 1PR4A 1WXIA 4M36A 2X0IA 1GWNA 1MG5A 2GFHA 2NYVA 2C9CA 3NH9A 2O20A 1FTQA 1D5WA 3R6GA 3IDSA 4P82A 2EXXA 4PPNA 1IN8A 3MGKA 4TSRA 2H5LA 3OP4A 1DDGA 5THXA 1KEWA 3GVPA 2JRCA 2B4RO 4LXTA 1BWPA 1HT0A 3E3MA 3LUBA 4EFDA 3KXKA 3M6VA 4ZVMA 4OKIA 4U6NA 5FX2A 2Q2QA 3VOBA 1V1RA 3IPLA 4IH9A 3C6BA 3D7SA 3O83A 4KGXA 3UO8B 2G70A 4ETWA 2LXNA 1UZUA 5HM8A 1IU9A 3J80A 4KACA 1WHSA 2O2JA 3B60A 5T7BA 1NW3A 4J6EA 2B8EA 4U4AA 3GLKA 4PANA 1P2UA 3HSKA 4IHJB 1OWOA 2VHEA 1E1NA 3FBTA 1U5BB 3MAJA 1C0KA 1W96A 3O73A 3OPVA 4Y6LA 1O08A 1ZVMA 1X77A 1MVNA 5EXDA 5EZYB 5TS3A 3W34A 5FA5A 3ZBUA 4F96A 3K8YA 4RAQA 1O03A 2IOQA 3ISTA 1YAJA 5SZJA 2BTOA 5CIWA 4I9UA 2EFYA 2FUNB 1Z4QA 1YFJA 4IDFA 1TYCA 4DA0A 1QIMA 5C32A 3ZD7A 3VJRA 4IIHA 1FNMA 2ZSUA 3HRHA 5IG2A 3IHWA 3BILA 1I7SB 4G36A 3W5BA 1FTWA 3B6ZA 1ZK3A 2C4KA 2JFBA 3JR3A 1SVKA 3GFBA 2DULA 1QKIA 2XUPA 4RCVA 2HJRA 3SI7A 2CK3A 2RAFA 4LWOA 4F3YA 5C8YF 2X8JB 2E6UX 5L4SA 5CUQA 3A1FA 4O33A 3NTOA 2IZ6A 4C4OA 4DUYB 2YZGA 3JD0A 5E9AA 3PSAA 1X8XA 4B73A 1QE3A 2X14A 5T57A 1FS6A 4ZYUA 2RE8A 1GNPA 2I2BA 2LNDA 5IDVA 2XVMA 3WL5A 5CLLA 3EBOA 4XJXA 4R51A 4XLTA 5K2MA 1ONBA 2QUKA 3B1ZA 3H2KA 4PNHA 3ZE8A 5GY7A 1XEFA 3C6QA 3RABA 3ZH9B 1QTNA 1HOTA 3Q8MA 3SS8A 4R8RA 4V02A 2OFPA 1QH8B 1XWWA 4I6GA 2FPWA 3I30X 4ESOA 3KKZA 3QE9Y 5TJHA 1LBQA 1P1IA 1P4SA 3G8DA 1G6OA 2WBLC 3VDNB 3ZXIA 3ABIA 4EA7A 1KP9A 4YTEA 2WV7A 3DFIA 3MWEB 4JLPA 3PL1A 3TUIC 1GZ7A 1E0AA 1T3SA 2YRWA 3MOGA 1JLSA 2HQRA 2E4ZA 3GRRA 3KB2A 4OSPA 1OB5A 1TQHA 3G8BA 3UJDA 1GRNA 3G3EA 4BMYA 5B64A 4LQDA 5F1KA 3QXXA 1DAIA 3B2EA 3C6YA 2ZULA 2A4KA 3EA0A 3MWGA 3GEHA 5EJ8A 7YASA 4KJXA 1BS9A 4GICA 2VDVE 2PSSA 3FYSA 3HKBB 1DRUA 4HI0E 4OJTA 3JWEA 3ZXSA 1XZLA 2GXSA 1J39A 3MRXA 3L0PA 4ILKA 1FP6A 1SIOA 4ZO4A 1CB0A 1ENZA 2P78A 2DHRA 3A6LA 4PSUA 2EP7A 3ANYB 5I7RA 1HDIA 2DAPA 4IG4A 2IOHA 2VJCA 3TE6A 3DVAB 4HTAA 1RZUA 4RPIA 5TF0A 1PJ8A 3ULKA 2ZRHA 4CF7A 3L4BC 2I2CA 2I22A 2PVSA 1RAGA 1VC2A 1R0KA 4IF6A 4OYYA 4U2DA 4AT1A 5LQKA 2HU5A 2OHIA 1PJAA 1QG0A 4ZVQA 1IN7A 2G5PA 4D4JA 1P72A 2V7EA 3ESAA 1FRVA 4KQHA 3KZXA 2OQ2A 4P31A 1L5ZA 4HSGA 4KH1A 4BLTA 4U2KA 4GBJA 3E6AA 1OCEA 3KZMA 1R9NA 3DMRA 5IJ0B 3BJRA 1C9KA 1Q2XA 2ODWA 4IXDA 1F12A 2IE0A 3VYVA 1IIBA 3EXFA 4TS1A 3WAKA 3P2EA 4Q9JA 4C7KA 1NC3A 5IVHA 5D1HA 2ZYWX 3ANXA 2YXEA 1QYVA 1E8MA 2VXOA 3NOQA 1C7JA 2WJ6A 2YZMA 4E2YA 5L4LA 1BEZA 3W3ZB 5EXXA 4BNJA 1SMKA 4R9SA 2WQZA 5I4BA 4TKUA 1A04A 5CH5A 4M1QA 3RYIB 5AXCA 4EI9A 1T43A 2FB9A 4BVLA 4EB8A 2LCIA 3ENKA 3QLEA 1P7VA 5A06A 5DFAA 5LNK6 5FI1B 1UKVY 3UGJA 1L7AA 2A0KA 2HIGA 4A6PA 4LKOA 3W5AA 3UB2A 3TGLA 5EYPB 4OUDA 1XMQB 2CFSA 1ICIA 3JALA 2D62A 3UV7A 3TQOA 4KMOA 1DZIA 3EVBA 4KHZA 5DYGA 5BR1A 1TTPB 1P6UA 3AEUB 1I5RA 4MCJA 1JFTA 3FDZA 2LCFA 1Q0TA 3KEFA 4DGQA 2W11A 2NVBA 3LBIA 2B5VA 2C42A 1IAVA 3G8CA 1SD5A 4K6MA 4EMBA 1UAAA 1TUGA 4F3CA 2D2XA 1RTTA 2B2CA 1AF7A 3EDOA 2W58A 3MXTA 3H9UA 4KXYA 3EGCA 1FW8A 1CNMA 3TD6A 2WZQA 2EQBA 1K4YA 1TQ2A 5KREA 3NVDA 4X62B 1CY0A 1Z06A 4XB6B 5BPHA 1FA9A 2REXB 3HLTA 4YXWA 5A3JA 2FAXA 2EG9A 2I76A 3FFXA 4L0DA 1UOQA 1TAGA 4HRVA 4EY7A 1ZY2A 2CFRA 5JBNA 4G4GA 3LT2A 3OWOA 1BMFD 6GPBA 3GW8A 4LV8B 1NMQA 3CHYA 1RHRA 1DFGA 2WU8A 2AUTA 1D7AA 3PXDA 1NTOA 3A6HA 3HP1A 4G23A 4L50A 5FUXA 4DNPA 1F0PA 4IHAA 4AJ4A 1W46A 4QT0A 2OECA 1UPAA 3IAEA 4GDMA 5K3SA 4O4JF 1U0FA 2EYQA 2QRVB 5IF3A 1VIAA 1F2VA 1M2HA 3A0RB 3GA0A 2Y4NA 3T3GA 1P1RA 2YDXA 4CQMD 2QD1A 4TWIA 3UBTA 3U5ZB 2NT4A 1M0WA 1X74A 3HYNA 4MA0A 3P4UA 1FFWA 5BW6B 3FKQA 1ESMA 3LQFA 1E58A 4AUMA 3Q6IA 2BM9A 3S55A 1J5PA 2HMWA 2ZRPA 1TMKA 1LEHA 4F4CA 4FNGA 4BFXA 5JQWA 3WGIA 3F73A 1IUPA 1PUJA 1QIEA 2B8WA 3ILSA 3ZLJA 4TV8B 4ED9A 2IZOA 5I7VA 1C2TA 4DCNA 2Y1GA 1NXOA 2IY8A 2QRQA 4RMJA 3AR2A 3QFTA 4N65A 4YFVA 5KX5A 1LLDA 3KOUA 3WLIA 1G8AA 2VH1A 3CXRA 3HB4X 4DMMA 4U3JB 4K8OA 3RRYA 2RJOA 4W7HA 3QEAZ 5DIZA 4QYIB 3R7LA 3DMGA 1UT8A 5DBOA 4G84A 5DWVA 4AMUA 1EEHA 3PENA 4PNEA 4H1WA 3K0CC 4G0UA 3GRPA 5J63A 2FV8A 4PX9A 5CA0F 1RPZA 5FDFA 3UB4A 2H0AA 4FXOA 4D9GA 3FG9A 5JZMA 1K68A 2NSHA 2YVKA 4PYMA 1XCMA 3TUZC 3G5MA 3RHFA 3WGYA 4CF4A 2CFTA 2IUTA 3BWYA 3WIBA 2JJ1D 5CNMA 5DM2A 3IOBA 2XDQB 1RLJA 4M89A 1E7QA 4JUAA 4YMSA 4FUQA 1J0BA 1GRRA 3RM3A 3ZHOA 2Y1CA 3WS7A 5FUYA 1X2EA 2HKIA 3QU7A 1L1EA 3AB3A 2O8EB 3UMJA 5CDUA 1CY8A 4INZA 4N9WA 2PRYA 4OP2A 4XTCS 3UHAA 4CU5A 2VYVA 1OXMA 3KAPA 2GSWA 5AICA 2XE7A 4ZCMA 2I66A 4E09A 4EG7A 2YWEA 1AHPA 2F3QA 1ZAKA 3SDBA 4EHFA 1HRDA 2G3YA 2VNKA 2SCUB 2HLDD 1JQ3A 5JO0A 2X1MA 2YV4A 4JLMA 1H2WA 3BIXA 3T3OA 4IRMA 2VKQA 3LLUA 1P2GA 3FB1A 3D0OA 2NACA 3FYUA 5DE3A 2NUAB 5JXJA 4EKEA 2DP4E 3WLOA 2YC2C 4I8XA 1KDZA 5A0TA 4DDKA