1UWCA

Feruloyl esterase from aspergillus niger
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
261
structure length
261
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords FERULOYL ESTERASE A
publication title Structure of a Feruloyl Esterase from Aspergillus Niger
pubmed doi rcsb
source organism Aspergillus niger
total genus 104
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uwcA00
4HVTA 2QMQA 4XJVA 2BCEA 5DNWA 1YAJA 3IIIA 4B84A 5FKJA 1ORVA 5BOVA 3AZPA 5HF5A 4ARBA 1FFDA 1XLUA 2JIDA 5AI0A 1EDEA 2QM0A 3O4HA 2VTVA 5JZ9A 3R3XA 5JD6A 5ALJA 2XUGA 3MGAA 2XQKA 1VZ3A 4H77A 3ANTA 2PM8A 1DQYA 2OLEA 4Q3KA 5A6VA 5KREA 3G0IA 3QMMA 3X3HA 5AOBA 4H18A 4CG1A 2GYUA 3RK4A 1ODSA 4C4YA 4BATA 1R3DA 4G4JA 1GPLA 4B0OA 4LHEA 1ODCA 3D2CA 2ZYHA 3ICWA 4IO0A 2DQZA 4N8EA 4Y2SA 1W75A 5ALHA 5AK4A 4OCZA 1GQSA 2VT6A 2CEKA 1QIFA 3HLKA 3BF7A 4E14A 4B83A 1CUBA 1QIGA 2ECFA 3FVTA 1PV1A 1ACJA 3PFCA 4BTLA 1EX9A 4CFSA 1MJ5A 3A2MA 3WZLA 3IA2A 3GUUA 5HQ3A 3FYTA 2JGFA 5AOCA 3PUIA 3VKFA 1AUOA 4HRXA 2PUJA 4W1PA 4AXBA 4DMHA 2DHCA 2VA9A 3A70A 1IZ8A 3DOHA 2O2HA 3WK6A 1A7UA 5ALDA 3VDXA 1TAHA 5FV4A 2IX9A 4Y2VA 2GBFA 3FLBA 4GWLA 3WIOA 1XZMA 3WJ1A 4M0FA 4KR0A 5JANA 1AZWA 2XI4A 2D0DA 4KAJA 1EXWA 3V1KA 5JYCA 4PSDA 3K2IA 2Y1KA 4UBLA 1ZD4A 1DX6A 1CUAA 1JFRA 5AM2A 5E4JA 1CUCA 1CUUA 3YASA 4X95A 3WI7A 2DCMA 4X97A 3G9TA 5HFAA 1SFRA 4BAZA 4AB1A 4B0PA 2LIPA 4U2FA 3W2TA 4OUKX 2RHTA 4UBNA 3MUOA 2ES4A 5EHQA 1MNQA 4JEIA 3RARA 1DWPA 2AJLI 2GZSA 2QZPA 5DNUA 5CXXA 5AH0A 3JYHA 3GROA 3WYDA 3FSGA 4QWMA 4WJLA 4FMPA 1OXMA 4HXFB 4HAIA 1LPPA 1XFDA 2Z3WA 1GKLA 4A16A 5H3HA 3AZQA 1J07A 1FFAA 3OM8A 2OG1A 5CT8A 5IVKA 1MX9A 4LXGA 4KE7A 1BEZA 4HTAA 3WKEA 2IIVA 4J03A 5K3EA 4BCBA 1UWCA 3O95A 4PF1A 3BL8A 1BU8A 1GPNA 1ZD2P 3WK4A 2BUBA 4F60A 2RHWA 1XZKA 2UZ0A 3GFFA 1S8OA 3FAKA 2EDAA 3KDAA 3DLTA 5C81A 1E5TA 3FCYA 5JIBA 1EB9A 2PU7A 5AK5A 2AJDA 3AIKA 4KRYA 1LZLA 3DJYA 4B85A 3WA7A 1HQDA 3C6BA 4GECA 3ESDA 5IVHA 2OCLA 4KRXA 2XB6A 5CXUA 4DNFA 4AO6A 1UKAA 3EQ8A 4YPVA 1J2EA 1XKLA 4C89A 1RP1A 2XMBA 4Q3OA 4BCDA 3OC0A 4B9EA 3LIIA 5LYYA 4DSAA 2IITA 2QXTA 2WQZA 4H7FA 3S2ZA 2CB9A 4Y2JA 5A7FA 1U65A 1D07A 4YASA 1XZAA 5AO9A 5K3AA 2BUCA 4Y2XA 4PQEA 3DYVA 2FJ0A 4EZIA 3I6ZA 1G4HA 3HI4A 5EFZA 1EINA 3PDCA 4OU5A 1U8EA 4NVRA 3PFBA 4G8DA 3VJLA 2PSHA 4P08A 3V48A 2RIPA 5SYMA 3DDUA 1WB4A 5ALZA 2YYSA 2WUEA 2WHPA 1IZ7A 3DYIA 5ALGA 1DTEA 2J4FA 5BWCA 1ZI8A 4ARAA 2Z5GA 4IHAA 1F0NA 2B9VA 2QOEA 4X71A 1YS2X 2Y2UA 3H2GA 3EQ7A 4QDUA 1N1MA 4FFWA 3C5VA 1CUHA 2GBIA 4B82A 2QKYA 1DINA 5JASA 3I2IA 4HS9A 1JMYA 4KEAA 4MEBA 1XZFA 4EBBA 1XZJA 2BAGA 4WY5A 5HKBA 4DSZA 1N8SA 1XQVA 3QPDA 1XQWA 2B20A 3ESCA 5AKIA 2H7XA 4QZVA 1QONA 5JAPA 3U1TA 4DNOA 3WZMA 4HZGA 4LKOA 4KE9A 1DT5A 3W9UA 2OXEA 3E3AA 1U2EA 5AI6A 2JEZA 3AFIA 1NU6A 4G9GA 2WLSA 1CUVA 2X8BA 4Y2PA 5T4EA 4G4GA 2HL6A 3W04A 5ALIA 2AJ8A 2QUAA 5HK9A 4AN1A 4JNCA 4L9AA 4X6UA 2R11A 5FXMA 4YX9A 3M3DA 3QYJA 1JKMA 1ZIXA 3C87A 4MYDA 3O9VA 2WHQA 2XMSA 1W52X 3C70A 2GYWA 1JJFA 5J3JA 3VJMA 5A2GA 2EDCA 4UBOA 1W4LA 4F5ZA 4P92A 4C01A 4DIUA 2VJBA 3BXPA 1A88A 4FFVA 2GYVA 4UHBA 1L7AA 4G4IA 3KXPA 1N5RA 4J0GA 1XZBA 1QIJA 1XZIA 2XUDA 3L1HA 1QIHA 1YS1X 1AX9A 1MX5A 4FTWA 4Y9SA 4Y2QA 5JAHA 3WK8A 2C0QA 4U2EA 2AXEA 1H2WA 1Y7IA 1EDDA 3WLAA 3R3WA 1UOQA 4C88A 2VJDA 5HK8A 1NU8A 1OILA 4ZRDA 4DMKA 3WKCA 4CIAA 1QO7A 3H1AA 1VE7A 4CIBA 4Q82A 4F21A 2ACKA 2QTBA 1WHTA 2OQVA 5CT6A 2WFMA 3F67A 4KACA 2C5GA 4LYDA 2CZQA 4PNZA 3LCRA 3VVMA 5HFNA 1Y7HA 2W6CX 4BE4A 2CMFA 3ILSA 1ZI9A 3FYUB 2BGRA 2R8BA 4N8SA 3DKRA 1G5FA 2QRUA 5FPPA 5K3DA 3QZUA 1LBTA 3DKKA 1K5PA 2DHDA 3JWEA 4FDMA 1VE6A 3DL4A 1CV2A 1BN7A 3KWJA 1P0QA 2HA3A 5I9IA 2H7CA 3Q0TA 1LPSA 3QPAA 4Q1VA 2FX5A 1YB6A 1YR2A 2OGSA 2OQIA 3MUNA 4JYMA 5CTAA 4L0CA 5DJ5A 5C8VA 1PJAA 5JD4A 3H1BA 4QDZA 1LPMA 1AURA 2V96A 1OCEA 1CUZA 5CH3A 4IH4A 2PVSA 3ESBA 4FNGA 4W1QA 3TGLA 3M82A 5ALVA 3WIBA 2OGZA 3C6YA 3DD5A 1L7RA 4J0JA 2PSEA 4BRZA 2PU5A 3HEAA 4BCCA 5AKJA 1JJIA 4BVKA 1Z68A 5ALKA 2O7VA 5JZSA 1CUWA 1EDBA 5BWBA 3PUHA 2JEYA 3C5WP 2WHRA 2X5XA 2XQFA 1THGA 4QDTA 3OOSA 1GZ7A 1YSCA 2XMCA 2XLBA 3N2ZB 1R50A 3F96A 4BAUA 1ZGCA 2BFNA 1MAAA 5AKLA 4J0DA 2J3QA 1QGED 2XUPA 1H23A 1QIEA 5I8PA 1WPRA 3D2BA 4IQ4A 2K2QB 2HDWA 5ALSA 1CFJA 3G02A 3SK0A 1HL7A 2XMDA 2HA5A 3RM3A 1A8UA 1BE0A 4P93A 2X76A 3BDIA 1J06A 1ZD3A 5A62A 1W76A 2XLCA 5ALRA 1A8QA 4G9EA 5CH5A 1T4MA 3P2MA 4JH0A 4IH1A 2Y6VA 3LS2A 1TCAA 3WMRA 4G8CA 2XMRA 5LZ4A 1E8DA 5C8XA 1X70A 5ALYA 1VXOA 3QM1A 5DTIA 1U4NA 1XZHA 4J0IA 1XKTA 3PF8A 4QNNA 3S8YA 2DQYA 3DCNA 4BB0A 3FCXA 4UBKA 3AUKA 3SC2A 1DWOA 1IVYA 2QS9A 3E4DA 1GT6A 4BC1A 1FJ2A 1P0PA 2DFPA 3ZV7A 5DYTA 5DWDA 4UUQA 4K6GA 4MWTA 3ZLVA 3D5EA 3HACA 4H7JA 2ZYIA 3FBWA 4X91A 2W22A 3HSSA 4BP9A 3O4IA 4H7DA 1IUNA 4MJ3A 2C58A 1UKCA 5I7UA 4UBMA 5DYWA 3A2NA 4N5IX 4B81A 1QTIA 1XRLA 1AGYA 4HRYA 1AMNA 1UK6A 4DMFA 5LP1A 1PFQA 4W9RA 1BEEA 5AM0A 5D7BA 5AIBA 4X00A 3C45A 5ALFA 5KWJA 3WL5A 2ZSIA 4K6KA 2VF2A 3EF3A 2PBLA 3BWXA 1SOMA 1IUOA 2I3ZA 2VEOA 1XRRA 1RYYA 4I19A 5EGNA 5HQ3B 5JALA 5ALOA 5T4FA 2WUGA 4FWBA 3FNBA 3I2KA 2HU7A 3D0KA 3G0BA 4FKBA 4FOLA 2PKYX 5E4YA 1YB7A 1SCIA 4ZREA 4DNPA 5AICA 2VT7A 3F97A 2BJHA 1UXOA 5EIHA 3BDVA 5AJHA 5EI5A 4PO3X 4Y2YA 3C43A 2VQ6A 4G5XA 3O4JA 1TCBA 4RGYA 4DYHA 5JZBA 5IKXA 3O9MA 4Y7DA 3L1IA 2JGLA 3A6ZA 3FVRA 4FHZA 1YCDA 4BDTA 1VLQA 5SYNA 5AI5A 3F8SA 3ZWQA 3W05A 4XWGA 5LZ5A 1MU0A 4OD0A 1LZKA 1Y37A 3GZJA 1QIDA 1FFBA 3H2JA 3FLEA 2J3DA 3DQZA 2DSNA 1YAHA 2WFZA 2XT0A 3C6ZA 4BYMA 5JAOA 4AMZA 2ZVDA 3ZLTA 1K63A 2XMQA 1QIMA 2ORYA 3DEAA 4EY5A 4S0XA 1BN6A 1C7JA 3ICVA 5ALMA 5K3FA 2OPHA 4KYVA 2CJPA 4BBZA 5ALNA 5EIAA 3WWCA 5CRIA 5ALWA 1LPNA 1ZICA 4H7HA 4TVKA 2Z3ZA 1DU4A 1W1IA 1CUSA 2WIGA 4N5HX 1ZIYA 5AHXA 4RE6A 4X6XA 4DLNA 4BE9A 4J0CA 2PSJA 2I03A 2HRQA 1GPKA 4WDQA 4UHCA 1DQZA 4XX1A 2ZYSA 3KOOA 1WHSA 1MNAA 4AQDA 2YXPX 1W6RA 3W06A 1QOZA 3MVEA 1MAHA 4TPKA 4QDOA 2WIFA 5AI4A 2H1IA 1ZGBA 4Q05A 5A71A 2HM7A 4ZV9A 2B4KA 4MWSA 4LXHA 1E3QA 4H0CA 3BIXA 4WFKA 4ZV7A 1RWQA 5ALLA 1ZJ5A 1LBSA 4U2GA 4WY8A 2XMGA 5AKEA 3ZI7A 2G5PA 5FLKA 3WWPA 5JARA 4E46A 5D3KA 1H22A 2YASA 1YA8A 1VJ5A 4WFIA 4K2AA 5E2IA 2WU3A 1CEXA 3D4LA 1XQXA 2ACEA 2NW6A 2G4LA 4QDXA 4X92A 5IH7A 2JF0A 4M0EA 1EH5A 1XZLA 1QFMA 5T4BA 4X93A 1CPYA 1H2XA 4QLOA 5AK3A 5CT5A 5E4TA 2XUFA 1EA5A 4BZWA 3PI6A 5LKRA 2GBCA 3IUJA 1XZGA 4UBIA 3R3UA 1DT3A 3W9BA 4C87A 1EVEA 1AKNA 2WHPB 5AI8A 5CBKA 3G9ZA 4GDMA 3H2KA 2CKMA 2HA4A 2WSLA 3CN7A 3QH4A 4YK7A 4PSCA 3V9AA 2WG2A 4GI1A 1CQZA 5IVDA 5YASA 2VJCA 4C6HA 1F0PA 2ZSHA 1ZOIA 2XE4A 3PICA 5AM3A 2RONA 1XRNA 4Y2TA 4AN0A 1K4YA 3HYSA 4PSUA 1QJ4A 1SCKA 2WFLA 3WJ2A 1UOPA 1WCYA 2XQGA 1WB5A 1FFCA 1H2ZA 5JD5A 3STWA 1TQHA 1X2BA 1YA4A 3NWOA 2BUAA 5CURA 3V1NA 3AJAA 4UFOA 2OCGA 3BE8A 1LPOA 5LLSA 3BJRA 3DL7A 5AIAA 5HKAA 1CUGA 2RAUA 5JADA 2C5FA 5EIEA 4KAAA 5FUMA 1K6EA 2O2IA 3H19A 5ALTA 1GXSA 2OGTA 3RLIA 5DLPA 2C4HA 1IUPA 1XLWA 3IDAA 2CUTA 4KE6A 5CT9A 3V1MA 4LXIA 2RGUA 1ETHA 3D59A 3ZLUA 1FSSA 3IURA 1GGVA 3HXKA 1M33A 4H7KA 4FLFA 2XUAA 5KBYA 4L72A 4W63A 4PV7A 3AINA 3WWOA 1VOTA 3VJKA 4GBGA 3V1LA 2EEPA 5CT4A 4FLEA 5AKHA 4DM7A 1ZJ4A 2JGKA 1QTRA 2H7YA 3T4UA 3WQHA 2XUHA 3OURA 5JATA 1VKHA 2V9ZA 3BJMA 3I6YA 4MYSA 4I4CA 1QZ3A 5AM4A 1XRQA 4N8DA 5LZ9A 3PE6A 3WKAA 3H18A 3WL8A 4BDSA 3ZPXA 1BCRA 2ZJFA 2GBGA 2WFLB 4GW3A 3UMJA 4AO7A 2B61A 4A23A 4RNCA 1R1DA 2HU8A 5ESRA 1CUEA 1UZAA 4IH9A 2J4CA 1HBJA 1J1IA 3ANSA 1B6GA 1SC9A 1TRHA 4K5QA 1B41A 3I2HA 2VJAA 5ALEA 3TJMA 4XIIA 3IUNA 3G0DA 5CMLA 4P9NA 1EK2A 2HA7A 3LP5A 2XUKA 4G1FA 3WL7A 4BP8A 2DR0A 3SX4A 3GELA 1MO2A 3G0CA 5AKZA 1XRPA 3O0DA 5C8ZA 3ED1A 5ALQA 1WOMA 3CCCA 1BCSA 3WYNA 4EHBA 4QWWA 4QA9A 4CCWA 4G8BA 2WKWA 2FJPA 4Y2RA 5AKYA 1SCQA 3N0TA 2HADA 4OYYA 1O6FA 4NS4A 2O7RA 4E11A 1T2NA 4D9JA 1ODTC 1ACLA 2QT9A 2HA2A 1R88A 3PF9A 3G9UA 2VAVA 1CUJA 5T4HA 5DTJA 1XZCA 3I2GA 1UOOA 5D6OA 4DNQA 4DGQA 2XUOA 1Q0ZA 4KE8A 4EY4A 4EUSA 1XQYA 2HIHA 1CUXA 3AIOA 4U2BA 3KWFA 4FLMA 1AQLA 2JGJA 2ZYRA 4UPDA 1HLGA 2C7BA 2WG0A 5HCUA 3WWDA 4H7IA 2P8SA 1HKHA 4OYLA 4BZZA 5ALUA 3Q8WA 1VA5A 5FP0A 5FRDA 1QLWA 4C4ZA 3H2HA 4QEKA 3EQ9A 1XROA 1THTA 4RPCA 3BF8A 2WM2A 4RE5A 2XDWA 3TRDA 3OTQA 1TK3A 3QITA 3EBLA 3WKBA 4QLAA 2XQIA 1CRLA 1JMKC 3G0GA 2HFKA 3R41A 4ROTA 1LPAB 1LNSA 2HA0A 3FWHA 2YH2A 5FPQA 2E3JA 4H7EA 2Q0XA 5HF6A 3VISA 2PSDA 3QMWA 5HZGA 3CN9A 2QUBA 1JT2A 2OAGA 1LGYA 4DTCA 2WUDA 4GLBA 2Y6UA 3WK9A 4L3WA 1E89A 4X85A 4BTVA 2V98A 5CH8A 5AI9A 1TCCA 5ALXA 3FSGD 2HFJA 2QJWA 3KSRA 1Q84A 2CBGA 3UUFA 4OU4A 5AKKA 4OB8A 2AJBA 1FFEA 4NMWA 1ZD5A 1VA4A 4LIPD 1DX4A 5AK6A 3AZOA 4FBMA 4MXDA 2DHEA 1UT6A 5FOQA 1QO9A 3HJUA 4UHEA 4BRSA 2Z8XA 4E15A 1DWQA 1BROA 4X6YA 4MQLA 3M83A 2V97A 3HC7A 2JGEA 3HRHA 5LZ2A 4CG3A 1P0IA 2XUIA 1HPLA 2WG1A 3R0VA 2WIDA 3DS8A 3QMVA 1AC5A 3G9XA 1ZI6A 3B5EA 3TEJA 1CR6A 4O08A 4X94A 2VSQA 3R3VA 3QVMA 2ROQA 4B80A 5C7YA 2H9YA 2RI6A 3H04A 3IVMA 4J0HA 1E8MA 3IULA 1XZDA 4ZI5A 4ZXFA 3NUZA 4Y2UA 3HZOA 1CLEA 5LIPA 3FYUC 5BV7A 3GBSA 1EK1A 1CIJA 4ZGBA 4HXEB 4QE3A 3WL6A 4UHHA 4AMYA 1KU6A 3H17A 3G8YA 4MQMA 3STTA 3U0VA 1L7QA 3SWWA 2VAXA 4F0JA 2XUQA 4KAFA 2ONCA 3ESAA 1TKRA 2FUKA 3T52A 2C0PA 2PX6A 2HU5A 3K6KA 4OB6A 2O2GA 2WTMA 3IUMA 2OCIA 4XVCA 2QR5A 2G63A 1CUIA 3QPCA 4INZA 2Y2VA 3GA7A 2PUHA 5EHNA 1Q83A 3NGMA 3I6MA 2QXUA 4K6HA 1QFSA 1BS9A 1F8UA 1CUFA 3F98A 5A7GA 5AOAA 4EY8A 4EY6A 3WK7A 5IVIA 6YASA 1UFOA 2I3DA 1E8NA 1CQWA 1TIBA 4OB7A 1EB8A 3STXA 4TGLA 1EI9A 1K8QA 1YASA 1KEZA 4BVLA 4U2DA 4LYEA 4OPMA 3BIWA 3L1JA 3NOXA 3KD2A 5D3ZA 3C8DA 3G7NA 5K5EA 4B7ZA 1P0MA 3I2FA 3F9CA 3D3NA 4J0KA 1MN6A 4B6GA 1GQRA 1C4XA 3D2AA 4JUIA 3UUEA 2D5LA 1XZEA 2JBWA 4ZWNA 1JU3A 5K3BA 3STVA 1WB6A 1X2EA 3VXKA 3A2LA 4J3JA 1CVLA 3FOBA 2ZJ6A 3DOIA 4UHDA 1GKKA 1R4ZA 1HDEA 1MTZA 5AM1A 1MT3A 4EB0A 4FNMA 3OG9A 1JJBA 3IBTA 1NX9A 1USWA 3WK5A 4Q34A 1KU0A 4EA6A 4W1SA 2PPLA 2JGMA 4M0MA 2XMZA 1EVQA 2HHAA 5LKAA 1ORWA 5K3FB 3IB3A 3R3YA 1LPBB 1QE3A 3I2JA 4AX4A 2WJ4A 4Z49A 3D7RA 3I1IA 5HF9A 5A7HA 2QVBA 3E1GA 4UFNA 4PW0A 3C6XA 1ISPA 4W1RA 3R3ZA 4CCYA 2HA6A 7YASA 4MEAA 5AP9A 4C4XA 3B3QA 2WIKA 4CG2A 1MPXA 1UKBA 4CI9A 1A8SA 4DMCA 2BKLA 4JYPA 1F6WA 1CUDA 1JU4A 3VVLA 1N5MA 4AZ3A 3FYUA 3B12A 2WJ3A 3LLCA 1Q0RA 2VATA 3JW8A 3C8HA 1UK9A 1O6GA 2WTNA 2HRRA 4H35A 2I78A 3RKSA 2PL5A 4V2IA 2Z8ZA 4J7AA 3R40A 3HABA 4NZZA 5HF8A 3STUA 2WJ6A 2AJCA 4KJXA 4BC0A 4BAGA 2OAEA 1QIIA 3QBJA 1VZ2A 4UBJA 3IUQA 1R9MA 4I3FA 1MX1A 3CCBA 1XLVA 2WILA 2G5TA 3CXUA 2WIJA 2PSFA 3H2IA 4EY7A 4GHWA 1R9NA 3E0XA 1G66A 3H0CA 5LZ8A 4UFPA 5LZ7A 4CCYB 1C7IA 4WDRA 3I28A 1E66A 1WM1A 3DNMA 1VXRA 4ITVA 1EHYA 1WPXA 3I1YA 4HXGA 3WA6A 1H2YA 1G42A 2XUJA 4FBLA 1CUYA 2BGNA 4X3CA 1IMJA 3WKDA 3LIPA 4GXNA 3O4GA 1BRTA 2ZJ7A 4A5SA 3FLAA 3EIOA 5FDFA 5DYYA 5AKXA 4UHFA 3AILA 4AO8A 3WWEA 4U2CA 4X7BA 5CW2A 5EHXA 2QJRA 4ETWA 3AIMA 5K3CA 4AZ0A 1I6WA 2WU4A 1QIKA 5KWIA 4BVJA 5EHZA 4B9AA 5JAUA 3STYA 1JI3A 5DNVA 4OSEA 5AM5A 2WUFA 1XRMA 5AKGA 2XQJA 5ALPA 4GEGA 2JGIA 5F4ZA 4WFJA 2OCKA 2GZRA 3M81A 1UK7A 5ISMA 1UK8A 4Q3LA 4WCVA 1LLFA 3OPMA 3K9BA 4X90A
chains in the Genus database with same CATH superfamily
4DSOA 1W2HA 4F86A 4MWGA 4QGFA 4XJVA 1T5DX 4RGVA 4AJKA 1QF6A 2IYQA 5E7QA 5B6PA 4P3OA 3MNFA 3WIDA 1YAJA 4QSMA 1IQPA 1E1RA 3LPNA 1TLLA 4BGUA 4WA8A 4LV8B 1LDMA 4HUTA 3MRXA 2D1YA 1PFYA 3EXEA 2E5LB 9MHTA 1FPQA 2ONYA 3AI7A 5DM70 3A1EA 2DKFA 1WOYA 3FRIA 5IANA 5BOVA 5D87A 4PTZA 5IAKA 4CYMA 1CHDA 3AOEA 4LJ4A 3OE7A 1U0EA 4BQEA 3F90A 3KSBC 4Z8YA 4QYMA 3W7AA 3P9NA 3OO1A 4KX3A 5U4XA 3W34A 1FFDA 3H7IA 5KIAA 4HNAA 4LQ4A 3S2SA 1EDEA 2OZLA 2VTVA 3B6MA 5TJHA 3BGOS 3DO8A 3R3XA 4R8MA 1S2DA 521PA 1VRWA 1RI4A 3ZXSA 1U7OA 1X3SA 3ZH9B 1M0TA 4IDCA 2X1HA 4QSHA 1TM2A 5KKCA 1A0OA 5DRYA 2NUTA 2IYWA 3PXBA 1JHVA 2HHLA 2XQKA 1PR2A 2ZG6A 4EG1A 5IT0A 4DV5B 1VZ3A 1IHOA 2CW5A 4RJLA 3EXFB 5EZ6B 3T5GA 1MO6A 3N53A 4E3ZA 1SIUA 4M9XA 4Q3KA 4E21A 1G17A 1ZK3A 5KREA 1COWA 3QMMA 2CMKA 4DA6A 1RXUA 1PHRA 3CEJA 1B00A 3B85A 3NH6A 3QA3E 1JZQA 1YE8A 3RVQA 3ZYCA 4CG1A 1NOJA 3SSNA 5BR1A 3GNSA 3M3PA 3RK4A 3SDBA 1JR3A 3NDPA 4US0R 3ND5A 4RLHA 4BATA 1PIWA 5AVVA 3EGIA 1JHPA 1U7TA 2YIJA 4XYBA 4ZEXA 4MV8A 4YRDA 5FUVA 3V2HA 1YIDA 2EX0A 4WKGA 3EZ9A 2NV2B 4XWOA 3E35A 3F5DA 3OLZA 1A77A 3W78A 1DCFA 3B1JA 4YCLA 3RU9A 4RQAA 4LQDA 2UVPB 3AERA 1O9BA 2DTXA 2FDRA 2AG5A 2WMYA 1SUPA 1FZQA 4YQFA 4IX9A 3W79A 3C7AA 1Y89A 1XU9A 3DKPA 3OU2A 3MWDA 3PWKA 5JT1A 3KOWA 2OHFA 3ICWA 4L5CA 2FUEA 1U0BB 3I0ZA 1J5XA 1RHRA 1WCIB 2DQZA 3DE4X 3PSHA 1MB2A 4BJ5A 5AXDA 1W75A 2CBXA 1JILA 2DMRA 4CUJA 1GRRA 5A05A 4DAEA 2CCJA 3PK0A 1E92A 1TMGE 1E6UA 2C8KA 2W5UA 4OCZA 1GQSA 1ITZA 4MX8A 4E13A 4E09A 1A7AA 2ZAOA 3Q15C 4GE3A 1HR0B 1IQ0A 2CEKA 2QN3A 3QE4A 5CB4F 1OZFA 1K5DA 4R84A 1D2HA 1SD5A 2FPRA 3F2IA 2QD4A 3SYMA 4XUEA 1F4VA 1WZIA 3LP8A 9ABPA 4TLDA 3V8MA 1EYZA 5AFSA 1M6VB 2G40A 2O2XA 1GNTA 1Z7BA 3PIIA 4TMYA 4D56A 3PFCA 1FTWA 2Q1WA 3KPWA 1RTTA 5JYBA 3B13B 3ZDCA 4FN4A 1MJ5A 4AYWA 3IA2A 2EIHA 2QNBA 3KT3A 3Q8LA 2IKQA 1FSZA 1LCIA 3NYIA 4OJQA 2C7OA 1T2AA 1BNCA 2BMJA 1IL0A 3FGOA 3OIYA 4KN9S 4RXUA 4LXUA 4Q4JB 2KSQA 5EL0A 1TJNA 1FL9A 2PZEA 1QQAA 1N5KA 4HRXA 3NV9A 4ZT7A 1BKYA 4A10A 4BQFA 1KEUA 4OH7A 1YDEA 2QQ5A 4QUIA 3H83A 2P5YA 1X7ZB 2V4MA 5A9TA 4C03A 5FWNA 4TSFD 4BO5A 3I30X 2DHCA 4YJGA 2VA9A 2OYRA 3DZCA 3DOHA 4PSVA 5THXA 4R3WA 5TGDA 3ZN2A 1PJ8A 5ALDA 5KNLA 5COQA 1TAHA 4GYKA 4HDKB 3U4MA 4I5DA 2VF7A 1SVIA 1QGYA 1ZU4A 3DVAB 5ITSA 1NMQA 1GD1O 1Q1ZA 1TAQA 2X4LA 1U8XX 4M1SA 3WLIA 3ZUPA 1G4AE 2I71A 1A98A 1U1IA 4HF7A 5FPTA 4F3TA 2MOKA 1XAJA 1RPTA 1MO3A 4E5YA 4RVFA 1FQOA 2PO5A 4C2UA 2GDJA 2Z58A 3TZHA 3WJ1A 2WA2A 4QOJA 3COWA 4M0FA 2A5LA 3UY4A 3MJTA 4AMGA 8ABPA 1RHKA 4X20A 2A9OA 5EUQB 4MVWA 1AZWA 2FQQA 5IJZA 2P4QA 4P7GA 3QY0A 4PO1A 2XI4A 2D0DA 3MOIA 4N3GA 4G0PA 2C0CA 1M2OB 4UMFA 1EXWA 4H1TA 1Z6PA 1RHMA 3OLCX 1XBTA 5AVJA 2O9JA 1JBKA 1M8FA 2ZSBA 1DBIA 1GY8A 3LX5A 4LTMA 4Q1FA 5AM2A 3S7TA 1OI4A 1JHZA 4Q7MB 1A4UA 1GCIA 2J33A 1FTQA 1MEEA 1GA1A 1RABA 1CUCA 1PK9A 1PW7A 2D5AA 2QG9A 3GUZA 2XZLA 3CNEA 3WI7A 2Q5LA 3F47A 1MX3A 2J5KA 4XIGS 3G9TA 3KR0A 1YFZA 2X5OA 1U0SY 4MRSA 2NSLA 1JEYA 1Y4ZA 1SFRA 1VCHA 5KHOC 4IILA 1GWNA 1MFPA 2YUIA 1DRJA 4JHXA 4AB1A 1P2GA 1X94A 1WUIS 1B0ZA 3L41A 1T5HX 4E33A 3K2EA 4JVMA 1LH0A 4Z1MA 2GA8A 1JQBA 3I01A 4OUKX 4D3XA 2QSJA 4ACAA 2JLWA 3FHCB 2WNIA 3VSEA 1K7EB 5JVDB 4DUPA 2GJKA 2O3RA 2JANA 3VC7A 1RYHA 5GOZA 4IFTA 4JXJA 4E1BA 1GGHA 1Y63A 4CEIB 4EECA 3SZLA 3I01M 4MA5A 2DF8A 1PK8A 2PMBA 1QJCA 2Z6UA 4JEIA 4MYRA 3FDZA 2R60A 2P2CA 3L8HA 3MRVA 4IZ6A 2GZSA 5EUCA 5K3SA 1MHPA 2RHDA 4U5QA 1NNSA 4PVDA 4EHDA 2JFVA 2YWDA 4XFJA 2J0QA 1R0YA 5IUKC 1O87A 3TNYA 3HJAA 2BKXA 3TQRA 1Y98A 3DDOA 4LJKA 3CLSC 1AQJA 1L4GA 3DSRA 5CXXA 5G2OA 1G3QA 4DMLA 2YVQA 5JDCA 2XNDA 2QD2A 4R2LA 4X7MA 4NYJQ 4CEJA 1E94E 5FI1B 1FTGA 1O94A 2RH9B 4DLAA 4PZUA 1F48A 2XTMA 3MTAA 2C94A 4RVSA 2G1KA 3NIFB 4JT9A 1YDFA 2VZLA 2G76A 4UEQA 4MR9B 3W6ZA 1J97A 3OH8A 5G1NA 2J6IA 2A30A 4IMRA 3F9IA 3ELBA 1RYZA 1GKLA 2LR0A 2VEDA 1GM5A 3IOYA 4A16A 4FFLA 3F7OA 1J07A 5L6LB 4JBXA 1BVUA 1MH1A 1T5SA 4EMUA 4GI2A 4FB5A 2ZE5A 1RFLA 2YC4C 1Z12A 2FPWA 2FMIA 2V7VA 3N86A 2C03A 2J9FA 3K0CC 4HTAA 4M37A 3TUIC 3WBKA 3IMCA 4J4TA 4RCVA 3C97A 1FW6A 2J59A 3UKDA 5DNYB 3ZK7A 4L3OA 1FP2A 3SMVA 3UFXB 4ARZB 3RHZA 3WLLA 3E03A 3WLMA 2JHPA 2K7ZA 5JLAA 1WL8A 2O05A 3BL8A 4ZFNA 1HE3A 1ZD2P 4UXHA 3OCZA 1PUIA 5KQLA 3QXJA 4FZRA 4RY9A 5I3CA 2WWYA 3DBLB 1DIOB 2HJGA 1L3CA 2JJ8A 4QFMA 4ENPA 3GJ5A 2WFAA 2PFKA 1MTOA 3NVAA 4IJVA 1CZUA 3BC1A 4NQZA 5HGJA 3MCVA 4LSWA 3WYBA 2WW8A 4XSGA 2ZVQX 4U7WA 3KTAB 4Y1RA 1V37A 1JIKA 3NB0A 2VWHA 4IVNA 4E5UA 1IZYA 1CR0A 5K7SA 2PU7A 2AMFA 1JGTA 2HMAA 1YQGA 3ZCTA 2V1UA 4XVRA 1I4WA 1S4MA 4RD2A 4ZGWA 4KRYA 1NXSA 1NULA 2A88A 3O92A 3DJYA 3IOMA 3OHPA 1TAUA 4B85A 1ZA2A 2Z95A 3LQFA 3N7UA 3GFVA 4R4JA 1BQEA 2R6JA 4HH0A 3FHTA 1XVUA 4N3NA 5IVHA 4OHKA 1DGQA 1GRCA 3DMGA 1TIPA 2CLSA 4YT8A 5KJ6A 3Q5GA 1BHQ1 2YWEA 5BSEA 1FLNA 3A05A 1NJSA 2J0UA 4XARA 2HREA 4PFJA 3S1AA 1VKNA 1BFUA 1N6IA 3LY8A 3EQ8A 2FP4A 3TL2A 5KQRA 1DO0A 2QR3A 1U2PA 1QVZA 3PZRA 3R6TA 3H6HA 4EJMA 4BCDA 3KSAC 2IPXA 3RRFA 4QXRA 1ONBA 2WINI 3D6FA 2ORVA 3TSAA 4B9EA 2FYTA 4F72A 3ETDA 3FYDA 1R00A 3BRCA 5KTYA 2OPBA 5LCXA 2FPGA 3A3KA 2IITA 2QXTA 4H7FA 4ZCPA 3S2ZA 2CB9A 2IW1A 2IQIA 1AF4A 2VHXA 4O0MA 1P91A 1JKXA 4V0RA 4YASA 3TGWA 3OJFA 2GAIA 2QTAA 1QUEA 1C3EA 2J7PD 2Y0CA 4IIGA 2WZBA 4FZJA 1IE3A 4BFVA 4PQEA 2X3UA 3AEQB 3V3KA 3VPFA 4RMNA 2BEWA 1QO0A 3PE3A 5HE9A 5BR7A 2QV0A 4EZIA 2EF0A 3VI3B 2X86A 3HI4A 2OM6A 4FYVA 3BD8A 1XE3A 3PDCA 1D3AA 4RTJA 1RFGE 4GC5A 2O5RA 5E1MA 2XCOA 5EWMA 5FUQA 3SVZA 1I2AA 1U8EA 4KWTA 3SLGA 4C7VA 3AUXA 1OBVA 3OZIA 1VGVA 4DCNA 2F8SA 4EJ2A 5IWAB 3IPCA 2IIBA 2A86A 3PFBA 3TVDA 2JD2A 2BEVA 2FETA 1UQUA 1S4QA 3VHXB 1NQAO 4A2QA 1YMUA 2PGIA 3HMKA 3SR0A 4ZAWA 5ALZA 3NAMA 2YYSA 4PVCA 3V8BA 1VJCA 1L7NA 5HJ5A 2A59A 5FUBA 1AA6A 1TO2E 4RK0A 1OA0A 2WHPA 4KTTE 5JISA 2CSXA 2EJBA 3OWXA 1IZ7A 3B1XA 3LHDA 3PGA1 3DYIA 3TEFA 1KZ4A 3LP6A 4EGSA 1ZI8A 3KDPA 4ARAA 3BXXA 3SZ3A 4P86A 3T1NA 4OQMA 3ZWAA 3TW8B 5HKLA 4JC4A 1QHYA 4RIFA 3OC6A 4TV9A 1DQSA 2ZIVB 4I1SA 4ACBA 1DFGA 5KYUB 3FZEA 3EQ7A 3GNLA 4M1OA 4R9SA 2AFHE 3UV7A 2G3YA 3PCRB 4WLFA 1JTFA 1N1MA 2E85A 3EVBA 3C5VA 4LECA 2FPMA 2BSAA 4KL8S 1QGZA 2X8JA 1CUHA 2FG7C 4KIUA 1OC4A 2PRYA 2Y1LA 3UHFA 1SQ6A 4RD4A 1CJSA 3GLRA 4WJZA 1WP9A 3Q9LA 1C0IA 1XI2A 1UBGA 2B1QA 2HF8A 2M9MA 3LRPA 2ZR8A 3HCEA 4MEBA 4MQUA 4XASA 3X1DA 1C5KA 1GL7A 4CQNA 4AIIA 4EBBA 3VHRA 1XZJA 2C2GA 3DXXA 3LO5A 4H17A 3QX7A 2XOKA 4KZPA 4L5YA 3MCUA 3ADPA 2WB4A 4BX0A 2CUKA 3FWZA 3OJLA 1JWLA 5E3HA 4E2XA 5HX7A 2DAPA 1H2EA 3HG7A 3A6LA 5J43A 5LOVF 4ZTUB 1NF3A 1HZJA 4HNQA 4N4AA 4YRBA 3B51X 1Z82A 5JAIA 1YIAA 2D3TA 3K30A 3OHMA 4O3FA 3ABSB 4U7GA 2DPLA 4DNOA 4L8GA 3PQCA 5ICSA 3QBTA 1T8YA 1L8XA 3ICPA 3PG5A 4WASA 2C9MA 1IXRC 4BXOB 4DXHA 2CLOB 2C95A 3HY6A 1DAEA 4JJAA 1QKIA 2D06A 2QM8A 2HNAA 3QOWA 1ZM3A 4YR7A 3GCZA 2XJ4A 3KLPX 1GVHA 4YRSA 2J5QA 1NNI1 3FR8A 2HOQA 2L69A 2ZJAA 3EA0A 3DOUA 5AJTA 4D46A 1SZPA 2WSIA 2W8ZA 4GMHA 1CJMA 3DVLA 5BQ3A 3S1SA 3HVUA 2QLJA 2VP5A 4YRCA 5LQSA 2P7HA 3AFIA 2BZ0A 1NF2A 3HN2A 4FGKA 1AT1A 1LI4A 2O2DA 1QR2A 3ABZA 2VNSA 3LLUA 4TMVA 1IM8A 1UR5A 1CUVA 3HS3A 2ESRA 1RAFA 3E48A 4Y1EA 4FS3A 2DKOA 4G4GA 4KLAA 3ZCVA 2FW8A 4B3FX 4IVRA 1I6LA 10MHA 4YAUA 3U3KA 3BAFA 1MZVA 3PUYA 3LZDA 2IBSA 1XJ5A 2LPMA 1QU3A 1Y6ZA 3NHKA 1V2GA 5K01A 1FFXB 4HWKA 1P29A 2X0KA 3R6LA 5ILQA 5GINE 1KRXA 5I9BA 5CLIA 5FXMA 1KJIA 1WXGA 3DYBA 3PHIA 1A04A 2G36A 1PZXA 4YX9A 1M76A 2CDAA 3FNFA 3C87A 3K0CA 4S1VA 4O02B 4KMRA 4HGYA 1DHTA 3A32A 3IVXA 3JQAB 2WHQA 3NNNA 4OSOA 4LCJA 1DV1A 1KI7A 1C41A 3C70A 5COBA 5KTOA 1EMDA 2XZTA 3PT5A 4RADA 3KB6A 3PV0A 2XTZA 2I22A 1QE5A 5J3JA 3WL3A 5FOSA 3U0BA 3JATB 1FJHA 4Y0AA 1NUAA 4AJHA 3THOA 4DS3A 3IUPA 3QYFA 2CE7A 2Z2XA 1W4LA 4DJTA 1JI0A 2FX2A 3S2IA 4LY0A 3N6XA 3MK31 4YRKA 1ADJA 3PUKA 4F5ZA 2OEPA 3TX6A 3A1NA 4DB2A 1P17A 1KQOA 1WMSA 2A1UA 1HSZA 3VYVA 1QHEA 3C48A 4XYMA 5TQ2A 3VDNB 3W3ZB 1ZKDA 4ZKEA 3TBKA 3CT6A 3NVMB 1KFCB 2P78A 2CXXA 4C01A 9LDBA 2PR7A 2O0JA 2YVLA 1KMQA 1OVMA 1TDJA 2G1AA 5C37A 5JZMA 1HWYA 5FEUA 2VJBA 3EJ6A 1XMVA 3JPYA 2PL1A 4ZQGA 4DQXA 1MT0A 3DHWC 4OL0A 4UOEA 3AJ9A 1XQ9A 1HOTA 3ZY5A 4BEVA 1RBZA 3IL2A 4J0GA 4ZQFA 3WDMA 3KSMA 4FR0A 1SBNE 2EQBA 3JQBC 1R4MA 4QPCA 4YIHA 2ZJZA 3ZHYA 1HDXA 4MS4A 3L1HA 3UA3A 1M1UA 3LPCA 1D6SA 3INGA 1AX9A 1SURA 1Z0IA 1BMFD 3WDSA 1HT2E 1P5RA 2LP4Y 5DO9A 2PLWA 3E9RA 3OJOA 3OLWA 2ISSD 1YQWA 3WK8A 2IUTA 3TYXA 2JBHA 3HKDA 2O8EA 1OZAA 3ZY4A 1EDDA 1W25A 4FHCA 4YP9A 1ZGJA 3HM2A 2GFQA 1V47A 1W94A 4IY1A 4C0AC 4BP1A 2WWRA 2UXCB 1DZ3A 7GPBA 5CYPA 1T0UA 2AA3A 3LUFA 3N5KA 3PYXA 1IATA 3KYDB 3ZE8A 4KHPB 4A0RA 1NU8A 5D7NA 1XLTC 3G7UA 4DMKA 1M1YA 1MRNA 4ZODA 1AE1A 2H9AA 3OZEA 4LC0A 2MR5A 1T9HA 2GERA 1QO7A 1Z8DA 3L7LA 3LW8A 3M6FA 4WNYA 2JJ1A 4ZU6X 4D4MA 3UGTA 4DKXA 4LOHA 1YI0A 3T3PB 2CVPA 3B9BA 3K7EA 1BRMA 1W0JD 4LJLA 4Q82A 3R7BA 1SB8A 3V4PB 4EEZA 4F21A 3AP2A 3PEUA 5GV7A 3VUEA 4NR0A 4KO1S 1NJGA 3ZE1B 4KACA 1N5IA 1SG9A 3FCOA 5EKDA 4LYDA 3U5ZB 4DV3B 2XY4A 3SDSA 2CZQA 3D2LA 2EBHX 1CY0A 2OB2A 3LL4A 1Y6GA 1XMQB 3WP0A 4N12A 2A0UA 4N48A 1WMBA 4RV4A 3ZDYB 3MQ4A 4DABA 1X77A 3FRJA 4YO8A 4BE4A 4YCSA 1O6CA 1PEDA 3ILSA 4AZ3B 1ZI9A 1DQRA 2Q4BA 2YWFA 2DY0A 1TJ3A 1EUCA 3FYUB 3CRNA 4NP6A 4PLWA 1RVV1 3BA6A 4KJZA 3UJAA 4E03A 4F12A 1AKWA 5CFPA 3FIUA 4F96A 1VECA 2BEKA 2WYWA 2ZTUA 4F04A 2BGTA 2EU8A 1WDTA 2ST1A 5K3DA 3QZUA 3DKKA 4UMDA 2CLFB 3T7TA 3M5DA 4CU2A 2ZT6A 3NNSA 2GNAA 1TKCA 2LCQA 3WGLA 1KYYA 2AB0A 4DIDA 3A1TA 1UBLS 1FUEA 1TJYA 1SVKA 2R2AA 1OROA 5L7YA 2P6RA 3INYA 4H6PA 2FZVA 2V7XA 2YJNA 2RAFA 4ENSA 1KJQA 2P11A 3MSXA 2IPOA 4CQMB 3RAEC 3NTXA 4X8HA 5M34A 3JAKB 1GPH1 3NALA 4B3TB 1OFGA 1P0QA 2R4UA 4O3MA 3GBPA 2XYGA 3EMDA 2H7CA 5BW6B 2HXSA 3IP8A 4EG8A 2NUBA 1HYEA 2AWOA 3A31A 4ZICA 4D6YA 4MHSA 5JPIA 5FTLA 2H1FA 2W6JA 1EXMA 1G4UR 2QAGC 1OYYA 2PQ6A 3QNMA 2IGTA 3ZK9A 2IYPA 5L95A 2GEJA 1NHWA 4O4LB 2UUCB 3FRHA 4JYMA 3SCZA 2IDKA 4IMIB 5CB4A 4P3PA 2ON6A 1LB1B 3TQIA 4BUJA 4J7UA 2P3QA 5K0NA 2B4AA 2G04A 4J90A 4H3KB 3KKLA 1SCAA 1PJAA 4FSHA 4DIFA 4EG0A 2D1QA 1Y1TA 3NOQA 4M0UA 4AJNA 2GARA 3IJ5A 1NYQA 4S1OA 4MUAA 1ZH8A 2OBNA 3RKRA 5EJ5A 4TZ0A 3SSMA 1NG9A 4I1YA 2A7QA 5IMSA 1PWZA 1XMSA 3OQVA 4I08A 4DG8A 3TPZA 5CA0F 3LQQA 4R1SA 3WIBA 3ZDZB 5A9RA 1M0SA 4F6RA 1L7RA 2W90A 3V7FA 2JIPA 3IBFA 4I81A 4P5PA 1T8WA 2PUCA 4MW7A 3C39A 2ZSEA 3IPRA 3CT4A 1ODFA 4QDKA 3T94A 4ZEOA 4RJTA 2I1WA 3SYLA 3MEQA 1KARA 1GNPA 4CE6A 3VH2A 5I9SA 4CM7A 2JFUA 3ZE9A 1SC1A 2N0SA 1RHQA 5JRZA 1VPVA 1OWPA 2O7VA 4CJXA 1TUIA 5BWBA 4NBSA 2JEYA 2GPBA 4F4IA 4M54A 2ZJ4A 5K8VA 4DQVA 4JK3A 4ZCTA 1WS6A 2X5XA 1BDIA 1M7GA 2AL7A 2H06A 4IJKA 1QRSA 1O6ZA 1THGA 3COPA 3FPBA 3L18A 3PNVA 2C3YA 1EFCA 1OI7A 2XMCA 5DLEA 2M6LA 4QTYA 4IGKA 3AL3A 1SC4A 3AR6A 4YLGA 1KJWA 1NDQA 3AHHA 3MMPA 1RP7A 3PJGA 3DE0X 1NSFA 1MAAA 1DEHA 1N0WA 1ZCJA 2JH3A 3ORHA 2RGDA 4JYBA 5M3BA 2HLDA 2ZJOA 4MW6A 1QGED 2XUPA 3OBIA 1BMQA 2R7MA 3FZGA 1BKDR 4OBEA 4ZRNA 3D02A 3GFBA 4JSTA 4NEHB 4DDTA 1XNHA 4IQ4A 3KXDA 2HDWA 1Z08A 3KQSA 1CFJA 4M9QA 4K2HA 3W1VA 1CE8B 3FPHA 3GRUA 5JC1A 3MZ0A 5CD9A 4S04A 5C1PA 1ZM7A 3OPQA 4RAQA 4TQGA 4XM2A 3S3TA 3SK0A 4UQPA 5LYJB 5AW9A 1J7JA 1NZJA 4WL0A 2XMDA 4AWAA 2CHQA 1TIKA 2XDQB 4L7VA 1K6IA 1PR5A 4AZ0B 5U9CA 4RKFA 3WS7A 4MMZB 4YAEA 4YRRA 4ER5A 2R6CA 1VMIA 3FMPB 3D1JA 1TUBB 2X76A 3BDIA 1JB9A 1J06A 2FPKA 4UUBA 3GGGA 1J4AA 3WJ7A 3LUJA 3DPUA 3ZHCA 2VDUE 1TJ5A 1W76A 2XLCA 5L53A 1PR4A 2H8GA 3SI7A 5EE0A 4G9EA 2JCGA 1VE9A 5HXAA 1XV5A 2RGEA 4E94A 1XEWY 3CM0A 2L0XA 3U4HA 1V4NA 1GO2A 3LS2A 3PUJA 4NCHA 1DAHA 2HMSA 3TSOA 2XMRA 3WMRA 4EHNA 4RLSA 5F1YA 1E5QA 3W5IA 1Y8RA 5LZ4A 4ZK2A 2B4TO 1R5BA 1Z34A 3FJYA 3I5MA 2IF2A 3JQBA 4L4SA 2AOUB 5ALYA 4O2BB 1L4FA 1T5BA 3HP7A 1X1QA 4WEOA 3QM1A 5KSPA 1U4NA 1RQXA 3L7MA 4OO3A 1E64A 4JI1B 3CLRC 3HVKA 1HE4A 3GBVA 1F2TB 3TNJA 4QM6A 5AQ1A 5B7NA 2HJRA 1LFAA 2BFAA 3IVAA 4BB0A 3GGCA 4XOIA 2V3CC 4DR4B 4JHLA 3FCXA 4TYQA 3NAQA 5L3SA 3OTIA 4E6PA 1QFXA 2XE8A 3RDPA 3I6BA 2J41A 4NBKA 5C0OE 4NARA 1O5OA 4I4NA 1XLTA 4TKZA 5KWVA 1RZRD 1DBQA 1UMKA 1U6JA 1Y4SA 4RD0A 3DZDA 2M1ZA 3BZWA 3JWJA 1KQNA 4ZPXA 1P0PA 4DLVA 3HVHA 2HJVA 2MTBA 3ZV7A 5BORA 2I1QA 2JJMA 3JD3A 2D7DA 4LYAA 2GD1O 4U9UA 1D2CA 2DFNA 2RH4A 3DM9B 5CFMA 3H1PA 4D3SA 5DN6D 5CLFA 4XCXA 3HACA 3OJXA 3WJAA 4RO0A 4EJFA 5TS3A 2ODTX 3H8WA 3GG9A 4M87A 4YJHB 5F4BA 3GMIA 4AX8A 1NUHA 3JWHA 4ZT2A 2W22A 2E2WA 2ERCA 4BP9A 2NOAA 3C3XA 5H80A 3T8YA 1ZG3A 1IUNA 1V6SA 3W8EA 1NV8A 2GWRA 4CMIA 3U44A 3LLSA 4DMGA 3EASA 3M3HA 4RVNA 2FK7A 2QZZA 1I3NA 1BX3A 4DJAA 4EHFA 3EB9A 4XIFA 4PCVA 2G9RA 4PGFA 2XHEA 4YJKA 4AROA 4KR3A 4B81A 1H6BA 4M9ZA 2X4GA 1XRLA 1CRPA 3ROEA 4NCJA 2HSZA 2YVUA 1QAOA 4O2AB 4FI3F 4W9NC 4ECAA 1QH0A 2QX6A 3BK1A 2DH6A 1V7PC 4PGHA 4Q9DA 4B3BA 4HX9A 4CIVA 2TMKA 5KTPA 2KMLA 4W9MC 1AMNA 1Z5OA 3K96A 2F8MA 3BH0A 4TLCA 5C2JB 3AYXB 5LP1A 3PNBA 2X5JO 4W5RA 4QBTA 3S2YA 4XLZA 1GUDA 1VSTA 3I92A 4X64B 2PZLA 2W8BB 3GG2A 3BGIA 4IIUA 1N1GA 3FTQA 5JNSA 5BUQA 1JG2A 4ISCA 4PXAA 3GR6A 1UM9A 4Q0MA 4Y3UA 3GF4A 1JFLA 4UCFA 1SKBA 1Y9EA 4ND3A 5KWJA 3ILVA 1L0BA 3JQGA 4MQEB 4PG7A 1CYDA 4YTEA 1VIYA 3PNQA 4Q7KA 4YUVA 4B47A 4CR6A 2Q9BA 1N2IA 2FR1A 2A3RA 3AM5A 1Z22A 3HJBA 4JLNA 3AEZA 4TKLA 4B8YA 4KXVA 4KP7A 4OATA 2P27A 2VF2A 2Y92A 3H8JA 5LLDA 1T1RA 1PGNA 4O63O 1FDSA 2P2YA 2MCFA 4BMYA 2Y1GA 3OEWA 3OX1A 2QAGA 1R5NA 1TZBA 1H2RS 3C41J 3BWXA 1R16A 4JQSA 2MR6A 3RRJA 4UM8B 3ADCA 3CSDA 3WBFA 1GQ2A 4EO7A 4ZYZA 1DXOA 5FBZA 1Q7RA 2I3ZA 3C8ZA 5AVUA 3E22A 4RDXA 4OSPA 1RYYA 2CXTA 4PHGA 4D96A 5LA6F 1UANA 5JALA 3MYRA 3PSAA 4ND4A 2JBAA 1KEWA 1PSWA 1JIVA 4FWBA 4RTNA 4DFDA 2BGWA 1YTUA 3H0EA 2O8DA 1DXYA 1N0HA 1RYNA 1GL9B 1S2OA 1VTKA 2MYUA 2ZYTX 5E2BA 1LTQA 4Q9KA 3V4VB 4CLRA 2XMPA 2Z43A 3BB1A 3B52X 3GRFA 1Z17A 1CF4A 3G0BA 1PZFA 3L4BC 2WHEA 3C5CA 3EBPA 1Q6ZA 2WWIA 5LFAA 4QUGA 4RPHA 5IASA 4X3OA 3U1VA 4RVHA 1LJLA 4OK5A 1D03A 4U7TB 3H86A 3G5TA 4OA8A 4ZREA 4DNPA 5IHXA 3EMBA 3CB4A 3R2JA 1KGSA 3F97A 4Z7NB 4KI7A 4NNJA 1O58A 2BTEA 2O0LA 3GEGA 1BS1A 4P7FA 2YHAA 2WBLC 3BDVA 1J25A 3BFVA 2IVZA 5IJAA 5AJHA 3WLQA 1ZMTA 4BECA 4UREA 4F3KA 5LDGA 4PO3X 3E70C 3WV4A 1U3FA 2BWJA 1MRSA 3E9DA 4XWKA 1XN1A 3T3MB 2OGUA 3OPYA 1K3UB 5ED4A 2B6HA 2W2MA 4FXOA 4TTIA 4R7GA 1TCBA 4JNKA 1P9LA 2J0VA 4UNIA 4WT7A 2GD6A 1TXGA 2Y68A 1H42A 2ZSKA 2B5VA 2AKYA 2HHCA 2JGLA 3CC8A 3P9RA 4K03A 4GPTA 4LVNA 5DBOA 1MBZA 5ITZB 5IX8A 1U0NA 5KQPA 1EUYA 1B76A 2X9QA 1BA3A 1O9GA 1S3SA 3KPUA 1Z0AA 1N5OX 1YACA 1ZONA 3ZGXA 2ZYUX 3ZWQA 2FEOA 3T35A 3CVUA 3U4QA 4OHWA 3OZRA 4XWGA 3WQBA 4AYTA 1Z18A 5LZ5A 2JHFA 2R00C 1K89A 1E6WA 5GJWC 5HBGA 1GYPA 5DOVA 4IXWA 1Y37A 9GPBA 3TG2A 4FPXA 5JC8A 1Z36A 3HFGA 5EFOA 4R1UA 1FFBA 4NBTA 3FLEA 5CCDA 3SHVA 4ZU3A 2ZKLA 3LXMA 3UJNA 1T35A 4MB2A 3WYAA 4RU1A 3GRYA 1OREA 1CNMA 3KT0A 3LGXA 3QLUC 2D0IA 4BYMA 4EPWA 3RYFB 3IT1A 3QBDA 1TMKA 4B4KA 1MJNA 2BHTA 1G8HA 1DBVO 3C15C 3KVNA 3SLKA 2Q3BA 4MHOA 1ZAYA 3I5YA 1M2GA 1QIMA 1UBOS 5K20A 2OBMA 4L4YA 2JGNA 3TX2A 3LK6A 2XBUA 2QLNA 3TH5A 2ZXEA 5CBPA 2PH3A 3PNPA 2GPTA 3F5MA 3KVRA 4EKGA 4BB6A 3I9JA 2FEPA 4JAVC 4KQJA 4ZOLF 5C8YB 2NTVA 3GQBA 3L05A 4UVHA 5FL3A 4YAKA 2ERYA 5BWOA 1SOUA 4Y6QA 2OV2A 2GEVA 1MEJA 3O7MA 3A1FA 2Q27A 2JZOA 2F4NA 3AJEA 2PMCA 3L01A 4HX5A 1ZISA 4NZPA 1M2VB 4BNWA 5CEJA 2ONKA 4P5DA 2XYRA 4BBZA 1NQ5A 3BKXA 3D5TA 2DM6A 4NZNA 5DE3A 4L57A 5ALNA 1XGKA 4NULA 5A6SB 3DDHA 3ZWCA 1R6UA 1CT9A 1DO8A 4YLYA 4AY2A 2H57A 4X7PA 4C3OB 1FYWA 4LTDA 1N6NA 1YL6A 2XCLA 5M7EA 3WLNA 1OY1A 2NIPA 2WU1A 4B87A 3LCJA 4N0MA 1CUSA 3HI6A 3VTZA 3MCWA 4JMLA 4OKNA 3VHQA 2I1VB 3IO3A 3NFYA 4P32A 4KOEC 3NHRA 1RKBA 1JVBA 3TIVA 4PLYA 1J00A 3K5PA 4YIKA 4IFIA 4GT1A 4G2TA 2QTHA 2WAMA 4DEVA 3QYPA 1NW3A 2ZIFA 3FETA 5E3JA 3MAJA 4UHCA 1DQZA 1A9QA 2PLFA 1FNDA 4XX1A 3WFIA 1QKKA 3CLHA 2ZYSA 4G25A 3M7IA 2W48A 5KNDA 5ESDA 2PX3A 1BTOA 3SQXA 3LAWA 5FQNA 4ZOEA 1C8KA 4MUYA 1N7IA 4P4UA 2WDZA 5KX5F 4HYQA 5DBEX 2AMVA 3W06A 2PKCA 3AUFA 3R9KA 3SHFA 3TINA 4LAFA 3GAFA 5B7QA 2HU2A 1Y34E 2F62A 1ORHA 2RCYA 2H29A 3ELYA 3F46A 4QDOA 5GVRA 3W2IA 2C7RA 1V39A 2YFYA 1IZ9A 2XVMA 4S35A 2Y05A 2WUVA 3IQHX 5HUJA 2ZYWX 4HT3B 5DULA 3DFUA 1DIBA 3LYHA 4RESA 5KHAA 1ZUD1 2GEUA 4W9NA 3ENKA 2DE0X 4FMBB 1E7MA 3U40A 2JRCA 2KWIA 1LNQA 1TO6A 1PT7A 1CWUA 1Y4AE 2AYYA 2MSLA 1FFGA 4HCJA 1Z33A 5HE8A 1E3QA 3FX2A 3EEFA 3S2FA 1SUSA 4R83A 1I3MA 1K7SN 2BONA 2J9RA 2VL7A 4J0EA 5AW3A 6Q21A 1NRWA 3K70B 4R40A 3C3EA 1N7JA 4F1KA 3FM9A 2CL7X 1RWQA 2PRKA 1ND6A 5ALLA 4C7BA 4MZDA 4X7RA 1N5JA 5TSDA 4D9NA 2X2FA 1OXXK 1XTKA 1YRHA 2PGAA 4IQ8A 4WY8A 1NP3A 3EXG1 4ZZ1A 3K6SA 1GYQA 2FCAA 2JFYA 4R2IA 4E46A 4KH0A 4G4SP 4RF2A 4GQIA 3O8NA 3KKOA 1VJ0A 2AS0A 4GBMA 1Z37A 4M22A 5I01A 5JW6A 4B4VA 3SM3A 3CEAA 4AKEA 2X23A 4ZEMA 2FF7A 1VJ5A 1KK1A 221PA 2MINA 1OHHD 3OCXA 2CXRA 3RO7A 1PKEA 3JQ8B 1H3FA 5H70A 3FSRA 2JFPA 2O8BA 1H5NA 4DQUA 4DR6B 2VP4A 3HB4X 3U16A 3NC1C 1CBUA 2XYQA 2JATA 4RFVA 2XODA 4XGRA 3C4JA 1EH5A 1XZLA 3LYUA 3H7AA 4C2AA 2WB2A 6PFKA 1NVBA 4CKZA 3UA4A 4G5HA 3A6GA 3I8OA 4X93A 5EC8A 3ZTTA 3BHMA 4ADSG 3KXLA 2KBFA 3O38A 1O4VA 3CS3A 5AK3A 5CCEA 5FPSA 5E4TA 4AJEA 2P9ZA 1GTL1 5JBQA 3PI6A 1Y3AA 3L4BA 4P80A 3KL2A 3VTFA 5J2UB 4PYJA 2GBCA 3IUJA 4Z5XA 5IWCA 3PNOA 5E6RB 2E48A 2O2JA 4UBIA 6ABPA 1Y1PA 1XMXA 5JCJA 3R3UA 1YGPA 1DT3A 1VL2A 4AP6A 1P7PA 4LV5B 1XN4A 3D7LA 1KZ6A 2H5IA 4EI8A 5CG1A 1Z62A 3N0WA 4MUMA 2IH2A 2Y1XA 5LD2C 3VMFA 3E6AA 2PMWB 1AKNA 1DP4A 4XM1A 2QUZA 5TMEA 4CM9A 2AXNA 1O97C 3G23A 4ID9A 5AI8A 3G9ZA 1NDHA 1YZNA 2D13A 2ID7A 2IZ5A 2NT4A 1POXA 4JB2A 1KZ7B 1BO6A 1IEVA 3H2KA 4FI3C 4MCIA 1N8KA 2PJDA 3F2VA 1LVGA 2HA4A 1Q3HA 3QEAZ 4ILKA 2GSDA 2E1PA 5LWQA 1Z2PX 5C5IA 1G8YA 1KGDA 4GI1A 2XGMA 4RGBA 5YASA 4ZVPA 3JYNA 2UXDB 3M9WA 1HLFA 3ZTYA 4CHGA 3GFTA 4HNVA 4B8ZA 1ZH6A 1QP7A 1AHHA 3OT1B 1I2BA 2G88A 3ETCA 1M72A 4RHXA 3UJBA 2J48A 3KC2A 4AP5A 5AM3A 3B5IA 5L4SA 3VGPA 4WOBA 4YFVA 1N78A 4YREA 3JRWA 4EM6A 1JDTA 3FUVA 4TS1A 4AY5A 2J67A 3UMBA 1K4YA 1XX6A 2R00A 1DVRA 3VO8A 1T8PA 3BMNA 1X86B 3V33A 1G41A 1QJ4A 3E4CA 1IDOA 1UOPA 5HIIA 3UQZA 2GQ0A 2P75A 4KMSA 4ZAGA 4X63A 2VHEA 2FXVA 2JLQA 5CFOA 1H4SA 3R7WB 4EHAA 4V3CA 3DBVO 3EXHC 1H2ZA 1JE1A 1V8ZA 4BO3A 3M6LA 1TQHA 2ODAA 3STWA 1CR4A 5F7ZA 3K35A 2EL7A 5H02A 1TT7A 4H31A 4Z7OB 3P0FA 3QLUA 4PX3A 3VNAA 1QXSA 3A6HA 3BJRA 1JBQA 4PRZA 3L6OO 3X1KA 2AYZA 2FAXA 1E1QA 1SU4A 1ZHHA 2YBDA 3Q40A 2RAUA 5KO2A 4EP1A 1KIAA 5EWLA 4BNNA 1IJBA 2O0KA 5KS2A 6ADHA 1O89A 3C98A 2C5FA 2NO5A 3K31A 2VJKA 4FC6A 4IF6A 4KAAA 2A2ZA 1GAJA 1R4NB 1K6EA 1N92A 4MUIA 1AGRA 2D4AA 2O2IA 5ICMA 3H19A 1EFAA 4L73A 5CA0A 4C43A 1KDOA 3CX6A 4MQ4A 5B5SA 1Z6YA 4U00A 1WD7A 2DWPA 2GZ1A 3NBXX 5DLPA 5FR1A 1AD2A 3DP7A 4IJ6A 2C4HA 4G1BA 1WUYA 4KXXA 4JD5A 1M1NB 1KMHA 1EVLA 3IDAA 4IS3A 4ML3A 3GRZA 4KE6A 1KBOA 3AKDA 5CT9A 4I66A 5K0LA 4LXIA 4RHUA 1ESDA 1I13A 3ZLUA 5DH9A 2G4CA 1J23A 4N7BA 4GPD1 1N2SA 1UPUA 3N87A 4N5LA 2EKDA 4GRAA 3VDRA 4X65B 5CDFE 1GSIA 1X1RA 3QHQA 1V5FA 2CDRA 2SKDA 4FDLA 7REQA 2VK4A 4XKJA 4H7KA 4AY3A 1HK7A 2PXHA 5EXPA 2FN9A 5KYXB 3KK0A 3W5UA 3IJPA 4UDOA 1UBRS 3R0XA 4HC4A 4WSOA 5EKUA 2JVKA 4OGLA 3CVWA 2RBGA 3HBJA 4HB3A 4L72A 4MV1A 4YMTA 1HT3A 1X8XA 1JQLB 3GPIA 3O31A 4MKGA 5DKFA 2AX3A 1N4AA 4EYQA 4W63A 3O1JC 1JECA 1TMYA 1EX1A 1ZN2A 3A0RB 1KYIA 2ZJ2A 3IJRA 2DG2A 4P83A 5FEMA 4J1SA 5AJZA 4PV7A 3BN3A 5LP6F 2AUTA 1XTBA 2IYXA 4H0FA 3VJKA 3AX6A 4GBGA 4G5GA 1N9KA 1RXEA 3REGA 1ZVVA 3OVMA 1CRWG 1VIAA 2EEPA 3TBHA 3UAWA 4DM7A 2IOFA 3L0IB 3GLFB 2C61A 3IHLA 1VYVA 1WE2A 1OUMA 2O4UX 2H7YA 4AJ4A 3EZXA 1FIUA 4URYR 1ZY2A 1XEXA 3USES 1HNXB 3R7NA 1FW8A 1U6KA 2QUJA 3JZFA 4RTOA 1E1RD 3I6YA 1UBKS 2HGZA 3NKLA 1E3TA 3NRJA 1NVTA 4RVUA 3TE7A 2JKZA 3O8BA 1MB4A 3C74A 4WEQA 1ZU5A 3UJHA 3QBVA 4MJ7A 2P6OA 3NWJA 2O3UA 3ZU6A 1IBSA 2QQEA 4N8DA 1ECBA 2GZMA 3NPMA 1WR8A 2NSYA 3OE7D 4G1EB 4BO8A 3OKFA 3FJOA 3CKMA 2EBUA 4ZIRA 5GONB 5K8IA 2NU9A 3ZPXA 3AR3A 1BCRA 4CT5A 4BNGA 3DULA 2ZJFA 2FG5A 2QJFA 3IR6A 4HDMA 3HJNA 3OFKA 5LB4A 4LZJA 2ZRBA 2A4MA 2WFLB 5G41A 2ZRCA 5EMJA 1BIFA 5FWYA 2LUOA 3L6EA 1G5TA 2B61A 2R5FA 3W4IA 4A23A 4FOOA 4LGCA 3GJ4A 2YIDA 2M1XA 2Q5OA 1VL0A 2VSYA 3B6ZA 3GWZA 4YJFB 5KTTA 2WT9A 3ZJVA 4RHFA 2WOOA 4KC0A 2PAFA 3BFJA 3S5UA 4BKQA 4UHJA 3AR9A 3E1KA 4DHWA 4EAQA 2H6EA 3D3WA 5KOHA 5LIRA 1RADA 2OA0A 2Q4OA 3QOXA 1T43A 2B3TA 4F8JA 1C7EA 1GYRA 1SNYA 2J4CA 2P1RA 3TLGA 1IBKB 4B43A 5K09A 4RF3A 4GOND 4INPA 2PZMA 1VMDA 1JR3D 3CF4G 4FC7A 4P35A 1PR0A 3L7DA 1YK0A 1GXSB 3O21A 4D9KA 1IY0A 3W6UA 3HUUA 1P72A 2H1SA 3DQQA 3MS7A 2C4UA 3VU3A 5BO5A 2D2IA 3R20A 5FHRA 4KRFA 4ZVMA 2HWWA 3BSSA 4GGOA 2XUKA 4G1FA 3CF0A 5JR3A 2EGUA 3SX4A 1C1YA 1FMCA 3G0CA 1EM6A 2CNWA 3IKMB 4G86A 3FOFC 2CDBA 4KQ9A 1V5EA 2WRZA 1UOEA 3OT5A 4BQIA 1FXSA 1R18A 1XRPA 2XH8A 3O0DA 4K3UA 3X44A 5ALQA 4B4UA 4BV2A 5KSYA 2R1TB 3MGKA 2PZ8A 3A9SA 1YBHA 1DB3A 2VYNA 3EVAA 3KB2A 4A92A 2G8LA 1P8AA 4EHBA 3HMQA 1PHPA 1N1DA 4WGFA 3I83A 2PD3A 4FXPA 1MUUA 1NUPA 4CCWA 5BW5A 4LFBB 3OF5A 2H4HA 1GQYA 4L8VA 1GDTA 2JCVA 4GYJA 3DTTA 1BYIA 2QMOA 4R2HA 3A10A 2VPWA 3WB9A 4C7MA 4UVIA 1I24A 2HRZA 3OZCA 4KXFB 4QHSA 1G55A 3UB4A 5ENDA 3MJVA 3V3TA 3AI2A 2HADA 4BP3A 3DTVB 1O6FA 4FZVA 3OP1A 4JJ7A 4B46A 3TF5A 2O2EA 4NS4A 5CVEA 3WO1A 1UZMA 2YIMA 1I5EA 1EUDA 1T2NA 4B3GA 4D97A 3R7DA 4AQ7A 3ZVMA 1IQRA 5F2KA 3SEZA 1GILA 3KPJA 4JT4A 2HA2A 4PZPA 1BDHA 2AI2A 2QA5A 1E4OA 2Q1XA 3QPVA 4Y1FA 1L6IA 3GARA 5T4HA 3ORSA 4HH3C 5DTJA 5C31A 1QLJA 1QQTA 1G8KA 2Q4TA 3LQKA 4EYKA 3ESYA 1PZEA 3QU4A 1E0JA 1L4UA 2FPPB 1W1WA 3ZJ4A 2NU8A 2FW0A 3CYFA 4D82A 4EUSA 1XQYA 3RVOA 1ULUA 4EYGA 1U11A 4P3XA 2FRVA 4HFRA 1NONA 2Y4NA 3IP9A 4CM5A 4DB4A 2H2HA 3AB3A 1JHOA 3OF2A 1ULZA 3LL7A 1J33A 1TT5B 2PGLA 3KWFA 3AIIA 1W87A 3RVLA 1EGVB 2ZYRA 3OSZA 1YV9A 2OO7A 3COYA 1PEYA 1P0CA 1YWGO 1QVVA 4EY3A 1SAYA 3WDKA 4GKVA 4Z51A 2R84A 5MDHA 4M1YA 4IIEA 2B92A 3EXHA 4K26A 4OYLA 5HIJA 1WG8A 4BZZA 5MHTA 2PFGA 1J1UA 1TPZA 2IHUA 3BRQA 3E5HA 2QVGA 4IDOA 3Q8WA 4REQB 4RZHA 3P9IA 2YWRA 4P31A 5FP0A 3BK2A 4WA7A 1JKJA 2GR9A 1DJNA 1JDPA 1KHTA 1KJ8A 2QMEA 3L8CA 3RJTA 2Y4OA 5U4QA 1RAEA 4ITRC 4OXRA 5LA6A 1J1ZA 1PVVA 5TC4A 3A6PC 3LX8A 4JEUA 1HEYA 1Z6GA 2ZI6A 1YVDA 3P2OA 1UBFA 1U99A 3FFWA 1AU9A 3DE1X 3FUUA 3KWMA 4I6EA 4NEGA 4Q4AB 2XB9A 1TAGA 4G1UC 1EXVA 1EZZA 4HPJB 3W5HA 2XCTB 3FMIA 3M34A 1QQ7A 2DPXA 2A0XA 1OBCA 2VNIA 2WM2A 3LFTA 1QHHB 1GGNA 4RSMA 2E4XA 3V34A 3TRDA 3S2GA 3WGVA 1N2CE 1DEKA 3QVGB 3U5TA 2UUPA 3QITA 2P35A 4MQFA 1C9NA 4QLAA 5AHWA 3O90A 2VDWB 2IPLA 1G291 4RPLA 3UHAA 4Z1MD 3GFRA 4PC1A 1XF9A 2J0SA 4I8IA 4UDYX 3G0GA 1AZLA 4ROTA 1N32B 1LPAB 3GGSA 3NBKA 1E3IA 3RFUA 4WAUA 4K9KA 1KXJA 2C57A 2Q0XA 1GUZA 1V9SA 1GITA 3AF2A 1QHIA 2PSDA 5J5VA 1II8A 2R85A 1I3OA 4FOSA 2XW6A 2KLHA 2FEKA 3O8OB 1WQ1R 4NK5A 1AUQA 1G2PA 5L8VA 3LUHA 2JEOA 4UVGA 2RGWA 4KUGA 3TOZA 3S40A 5JYEA 1JLKA 3WGYA 4ER7A 1I3LA 3OAAA 1M34E 3JXEA 2FOXA 2JFZA 3A4VA 3DONA 3NWBA 4X85A 3GVXA 1YB4A 1A5BB 2P67A 3EA4A 1KERA 3F6EX 4KK3A 1FZTA 5JXWA 1IN8A 2BGUA 3OJCA 3TG8A 1RQPA 2XNDD 2NU6B 3F74A 4JGIA 1ZXXA 4LNUA 4H15A 4ZVKA 1O94D 2CLIB 4R9VA 4II3A 2HFJA 4AZVA 2O3SA 2QJWA 1PJ4A 2GPWA 1XWWA 2BFBB 3PP8A 1Q84A 1TYDE 1R0CA 3BQNB 3UUFA 3G5MA 2FFHA 1GDHA 2VA8A 5IVPA 4YY3B 1M6YA 3PBKA 4AJOA 1OPRA 1KH1A 4BKMA 1P9OA 5DI9A 4GVPA 4NCNA 2GO1A 1L5GB 1K75A 1IMOA 1FNCA 3KSZO 2GZAA 3VRHA 3X1ZA 1I1HA 5IDWA 3HP1A 2DBVO 2B25A 2B0JA 4WERA 2IGBA 1CEEA 5CGZA 2VHTA 3A9CA 1XYGA 1DX4A 3MF4A 2VJPA 1ACMA 3PDIA 1OXSC 4XWTA 4ZVOA 5C34B 3ZBQA 4AZWA 1F7UA 2HJSA 3G0OA 4FW8A 4EWLA 3B53X 1KI4A 3ZZTA 4FBMA 4MXDA 4AT1A 2F2TA 3VNVA 3WBBA 2I4RA 2ZUUA 4G63A 4B2PA 1Q2XA 2HX1A 4LF8B 3OBBA 1DAPA 4WGGA 4OF4A 4N1AA 1J0DA 2RIRA 5DSZA 3HJUA 2Q3LA 3BICA 2GN6A 4N40A 4UHEA 4ZOLA 5DGHA 2ILTA 4PYLA 4DYVA 1DWQA 2A3NA 3BL5A 4X6YA 2PEYA 2QL9A 4MQLA 1KKUA 3SYNA 2Q1TA 2ZR7A 1QH1A 2FLKA 3M83A 5CM2Z 2MSNA 2V97A 3EXG2 4FYWA 1AXRA 2AHOA 4ZYUA 5GGYA 2JGEA 5FD8A 3HRHA 5BPFA 1FYVA 1J90A 1C30A 3ETNA 2EOAA 1D7OA 1GCGA 1SG6A 2ASEA 3MJ4A 3UKJA 2Y0EA 3FOEC 1MDBA 1XTJA 3BJIC 2C82A 421PA 4BVGA 2JD1A 3T3GA 2ZIGA 3RAJA 4Y18A 3L7BA 1BE8A 2C59A 1NL3A 1P0IA 1QC5A 1XEWX 2XUIA 1GUYA 2C98A 2GRUA 4NU6A 4B2IA 5TIIA 4HWTA 1A9RA 3EG9B 4NDAA 4JKIA 3QMVA 4LI0A 1AC5A 1VG9B 3SE7A 1QVRA 2IZZA 2P2LA 3GUHA 3WL4A 1ZI6A 1YUMA 3TEJA 3CH5A 2DERA 1CR6A 3FPJA 1OH8A 2OFWA 1P3JA 4O08A 5JUWA 3N74A 1PV2A 4OEHA 3NTRA 3QEOA 4I5FA 2GJAA 3W3AA 1ST2A 2VSQA 2JCYA 3FNHA 5LP6C 2C7PA 3RUEA 3R3VA 3QVMA 4TLMB 1Q57A 3DR3A 1QORA 3NEAA 4ZVLA 4LDAA 3WYDA 1E2BA 1N4DA 3I3OA 3GPCA 2K7FA 1UJ4A 1E8MA 1J9GA 3DGFC 4XB6B 4D2IA 2QTNA 1UBTS 1XZDA 1A9ZA 2GEDA 3CUSA 3EULA 2Q0SA 4Y2UA 1PYOA 3I73A 4AECA 3T7CA 3T95A 3S1LA 4UATA 5B53A 3ZW7A 3RKUA 5BV7A 3GBSA 5KX5A 1EK1A 4HWOA 5EHIA 3VKWA 1G5IA 3EQZA 3Q3JB 1P9WA 4UNNA 4J4BA 1DWUA 4BUCA 2C4MA 3ZQ4A 4DIMA 4HXEB 4L4UA 3WL6A 1K06A 3LVFO 4YXWA 4F85A 1BH6A 1RMYA 2VAPA 1QAMA 2BIFA 4G8JA 2FEAA 4JKOA 4UHHA 1ZRNA 4OVKA 3UT5B 5I6DA 1QO0D 4YDRA 2P6UA 1UF9A 1QG4A 2GSWA 1W4ZA 3Q8XB 1G20B 5CK4A 5DIFA 5DU2A 1EFPB 4E5KA 1TB4A 1LVHA 3T1OA 2AZTA 4PTYA 1P61B 3GJ7A 4IIHA 4F0JA 2XUQA 5TS2A 1UKZA 2C4KA 2FMHA 5FB3A 3T99A 1VMAA 1K8XB 4RL6A 3BCHA 2F1RA 3FLMA 1VCNA 2UKDA 3BWYA 1T6BY 3BGVA 3EOBI 1UT8A 5ARBA 3WGQA 1DPGA 3ENQA 1V3VA 2ZYVX 3TGPA 5K8TA 1ZBDA 3A14A 3RJMA 2P9GA 2WTMA 1TEZA 5F3WB 4FGLA 3NT2A 2XWPA 1UEXC 2P1DA 3AR5A 1JYSA 4DY4A 5LJLA 2G63A 2PQ2A 3RYCA 3Q2KA 1UDXA 1RI2A 2XRMA 3CB2A 4NCIA 3OIDA 2Y2VA 5REQB 5IULC 3ROZA 1BDMA 1X7XB 2G71A 7MDHA 2C5HA 3IOBA 4MW1A 1Z47A 3ZKWB 3VZCA 2IF0A 3NGMA 3I6MA 1E4EB 1R3UA 4H08A 4RACA 1O0BA 2J5BA 1LEHA 1K3TA 5BR8B 1BS9A 1F8UA 2FUNB 1CUFA 3TAXA 5LR6A 2ZVPX 2WF7A 2X7HA 2JA1A 2XVAA 2JI6A 5FQOA 4V0OA 5F12A 3IBGA 3RFVA 1CG6A 2AG6A 4Q9NA 3HDGA 3NEJA 4QEDA 3M0EA 1PX0A 1D9ZA 3PJFA 3QW2A 1QGUA 1WP4A 3IT0A 4IV0A 1SBCA 5EPUA 3VR4A 2DHRA 3NDRA 1QKJA 5DB4A 4UCWA 2GVZC 4FKMA 4ZQIA 3UWMA 4F1JA 2EFDB 2W2OA 4N6NA 1E1LA 1KAOA 1SVUA 2JK0A 4TL8A 3SF0A 3NIDB 4ERNA 1FMFA 5F2OA 1H85A 1I5RA 2NNWB 3D8RA 3LSTA 2XOKD 3R5HA 1KWGA 5K2OA 4Z4GA 4IRUB 2G9UA 1XXHB 2FI1A 3PWSA 1JA0A 1NW4A 4HXYA 1CW2B 4LYEA 4XGKA 2WKRA 3EARA 1GTMA 1OKKA 1PR9A 2ZYGA 3NOXA 3OZAA 1JWAB 2JI8A 4LJSA 3CLTC 4RDCA 4CKBB 3E58A 4B6FA 5LMZA 1A9TA 2PG3A 5BQFA 4FYPA 1LDNA 1MIOB 3NYQA 1E6LA 1L1FA 4CMGA 5IJWA 3T3NA 1ZUNB 4MIOA 3GD7A 1LTKA 3DE2X 3L8MA 4L75A 4Y8VA 5PNTA 4IPTA 2AN1A 2AZDA 1IRXA 3B78A 4Q1AA 1YJAA 1P0MA 1EFVA 4ESOA 3I2FA 4R0MA 1JKIA 1W35A 2BFEB 4P98A 3HXOA 1UJNA 2X9NA 4ZEWA 3SQOA 2O8FB 5DWQA 3LK7A 1V5WA 4YRQA 1XTVA 2FWNA 2J9GA 4CODB 1T5OA 5BSMA 1YVEI 4JP8A 3EDRA 1UZLA 1TQ8A 4YQYA 2V0CA 4CPDA 4CDGA 1XZEA 3CLSD 5EUBA 3ZU4A 1AVTA 3PNSA 1RSZA 3E18A 1DMSA 1ORIA 2GXUA 3L0YA 1X7DA 2QMUA 4LHYA 4NBWA 3VPSA 1OI3A 3L9WA 5CXSA 2J6HA 5L4NA 2NXJA 2P9EA 3CUWA 5E6SB 5K3BA 1SXJB 4TRNA 3WHLA 1U98A 1JHQA 3LUPA 5ER9A 4FB4A 4WLOA 3A2LA 4XRGA 1XB2A 5HCIA 4ZVRA 2O2CA 1M5RA 1QHXA 3PXAA 3OE1A 4FGSA 3DOIA 4I50F 5HNKA 4O4HF 4BFZA 1HT0A 1RZUA 1HE8B 3IQWA 5AM1A 2OLJA 5DHAA 4R71A 4LYGA 4EB0A 1I7NA 3OF3A 1JN0A 3NI2A 4FNMA 1J6UA 3UH1A 2QG4A 1GZHB 3WISA 3W5VA 4B7CA 4Z4CA 5BV2P 3IBTA 5J4YA 3LSYA 1YZTA 5HDBB 2MMCA 3KJHA 2Q4DA 5EE5B 1A4RA 1QLHA 3RYHB 3FH0A 4Q34A 2WJJA 1KU0A 1A9PA 5BNTA 1XRJA 1OA1A 2Q2QA 3C7DB 4W1SA 3LPLA 1O0CA 4EX6A 3B9RA 4AXXA 1U0LA 1CRZA 2ALJA 2GM3A 2XMZA 4M0MA 4ZI2A 3U61B 4Y9RA 2VYVA 4QEZA 1BDJA 1T5IA 2HMWA 3VO1A 3KUDA 3OCCA 4TWIA 4MAFA 2WI8A 2FFJA 1T4CB 1TYAE 2RGCA 5EYPA 1F06A 1H1TA 4DWJA 4Y1GA 1V5IA 5B7GA 3JSAA 1GR1A 1IXKA 5IM5A 3SS8A 3I2JA 1ZR2A 3IB6A 4LYYA 3G13A 4E2WA 4N65A 4NHEA 5EJMA 4NV3A 4K86A 3NC0C 3GLHB 4V0LA 1W5TA 2ZIXA 5DWVA 4FZ3A 1EGAA 1PNQA 3FSEA 4N9WA 3D7RA 3N2YA 4W6ZA 1JA9A 1G16A 3E1GA 3G2KA 1TU0A 4P53A 1LK0A 1GV1A 3PC7A 3VPXA 5IBCA 1NHGA 4D79A 4KREA 1WZEA 2DECA 2PUEA 5EZ5A 4FYKA 3T3OA 3W1WA 3WX0A 4GP6A 4C4AA 5F2NA 1V3QE 1FY2A 3PX2A 1NW7A 2UZAA 2JK1A 4ZAYA 1JEJA 2PLRA 5TE9A 3U13A 2HUNA 2P2ZA 4MV7A 3PXCX 3HCWA 1WUHS 1KRHA 4Z9AA 4DA9A 3ELDA 2AWNA 5JYDA 1AHPA 2XR1A 4JOSA 2DR3A 3FCEA 4JL6A 2FNAA 5CX1A 5T8KA 3VZPA 2IU4A 5LP6A 4EQ6A 4HADA 3BFXA 4CG2A 3B5JA 5JTUA 2MU1A 5FLXA 2A8YA 3ZQKA 4RJKA 3OD1A 3D8HA 5FADA 2HHHB 2DLCX 2VTDA 3UTDA 1V0JA 2C2YA 4AMYA 4DR3B 1Q77A 4DMCA 2BKLA 2YYYA 3KBOA 3ZI4A 1CUDA 3GMTA 1N5MA 1USGA 3HDHA 2NZJA 4LZWA 2X0JA 4FEAA 5JAMA 1H9BA 4GM1A 2XB2A 2YJGA 4FWIB 4FUTA 2W70A 2OYCA 4EI7A 2JJ1D 2H2FA 1SOVA 3S28A 4N47A 1S7GA 1YB5A 1TI7A 3C8HA 1UK9A 4BFUA 1AXGA 3AUUA 1REQB 3ONVA 4UTXA 4F38A 4H35A 4A7PA 1ONPA 1U8UA 3MERA 4H3VA 2KX7A 3A3NA 4V2IA 5FO0A 3QVWA 4IIXA 1GP2A 2IFTA 3KOYA 2YJ6A 4DV1B 3HYLA 2IC5A 2CVFA 4LS3A 3R40A 4CUKA 4UTNA 1DC5A 3NHUA 3HABA 2QP3A 1RC0A 1CY1A 3I37X 2RHOA 4XB1A 2E6UX 3ZE2B 2AJCA 2CXNA 2BGJA 4E4TA 3ZDDA 3IAFA 2VP3A 3AVTA 1IEWA 1RI3A 4K9MA 3NNDA 1SCUB 1QIIA 1ZNYA 2RC5A 4G67A 2N47A 4E5MA 3QBJA 2ATEA 4DLPA 3IUQA 5J58A 1G5QA 1GAWA 4L6AA 3RAGA 4ZTZB 4I4LA 5K4AA 1Y9AA 1NY5A 1XLVA 2V58A 4W8GA 1Y8QB 1FP4B 1R6VA 1Z06A 2BFPA 2VH1A 1EA7A 3KXIA 1WBDA 4G89A 2W9XA 2BR4A 4LI3X 4AULA 1HTWA 2C99A 1J20A 4DVGA 2UVDA 3T7RA 4LSZA 2XWJI 4YACA 3GNQA 4MKHA 4TUYB 1J0CA 1WV1A 3FUWA 4M86A 3VV2A 2PH5A 1X7YB 3F5FA 3VV3A 2XCUA 4P4LA 3FE2A 3OZVA 2NGRA 4L51A 1FS4A 2W2KB 2PRSA 4Q6BA 5FPKA 1K0UA 4O5AA 4JBWA 5DHTA 1T8UA 4EY7A 3UXEA 2G9QA 2IJGX 5FULA 2W6JD 3ROQA 3E0XA 4B6JA 1PV4A 2EBFX 1KO8A 2I4TA 1G66A 1GNLA 5LZ8A 1VYTA 2NO9A 5K8LA 2G82A 4FMDF 1NVVQ 2GD0A 2F3UA 3U7EB 1A72A 1HNNA 2CN1A 5FOVA 3TXYA 4EABA 3A06A 4CCYB 4JC5A 4YCMA 4LRTB 2YXBA 2ZUCA 4WDRA 3ABQB 3SIXA 4RCYA 5ESWA 2OL4A 2NO6A 4F4HA 3UPTA 3H6KA 3FCSB 4BGEA 4NI5A 4YGXB 3KELA 4RZUA 3JQPA 3WFJA 3TTYA 5GIPE 2OUIA 4NE2A 5EMKA 2C9CA 1T0HB 4HXGA 1CVRA 2QE7A 4I99A 5J5CA 3WA6A 3ITKA 2EKZA 4NFHA 1G42A 1W44A 4R1PA 3UMFA 4CNBA 3HM9A 2WA1A 3NAGA 1HE1C 2DFDA 2I91A 2OVFA 1LI7A 2C8LA 2P77A 1U7XA 1LC0A 4HVAA 2ZWAA 4OQPA 1RBQA 5JHGB 1Q1BA 1P2TA 1SWWA 1YJ5A 2Q21A 2BM1A 4C5CA 5KU7A 2ZT8A 3KVVA 4CU5A 1KR2A 3O4GA 4A2PA 4DXAA 3A4NA 3R5JA 1X38A 3UCFA 3FLAA 4CIXA 4P0PB 2J45A 2YTZA 3UTCA 4OQYA 3GLGE 5I7EA 1H66A 1Z8NA