1UWCA

Feruloyl esterase from aspergillus niger
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
261
structure length
261
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERULOYL ESTERASE A
publication title Structure of a Feruloyl Esterase from Aspergillus Niger
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 104
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uwcA00
3HEAA 2DHDA 1DT3A 1UK9A 1XLWA 4K6GA 3H17A 4UFPA 3VVMA 4FWBA 4AO7A 2GZRA 1P0MA 5EHNA 3WZLA 5ALEA 3I2FA 4B9AA 4C4YA 3NWOA 3OG9A 3R41A 1E89A 3KOOA 2O2GA 4H7DA 4QDUA 4E14A 3OURA 3AJAA 1ZD5A 2QT9A 1RP1A 2XUPA 3O0DA 2O7RA 4AO8A 5LZ2A 5AHXA 2QUAA 3DKKA 4X7BA 5T4BA 4B0PA 5JARA 3LS2A 2XQKA 5K3BA 1VZ3A 1CQWA 1WCYA 1K63A 3WIBA 1QFMA 1FFEA 5ALVA 3DOIA 2HU7A 1K4YA 1Y7IA 2V98A 2HL6A 2XQFA 4CG3A 4FKBA 5ALPA 5D3KA 2Y2UA 4FDMA 5CMLA 3WYNA 2C5GA 4JH0A 1MJ5A 2JGJA 1MX5A 1NU8A 3CN7A 4J0CA 1MNAA 1ODCA 1B6GA 2Y6VA 2QJWA 1OCEA 1CUAA 2H9YA 2Z5GA 5ALXA 2WFMA 4LKOA 4AO6A 5JZSA 2VATA 3STUA 5D3ZA 4XWGA 2VA9A 2I3ZA 4H7JA 5ALMA 5JAUA 2HA6A 4Y2XA 5AM5A 1ZJ4A 3FLAA 1ODTC 4G8BA 5IVIA 4BDTA 2XMDA 2XUQA 1VE7A 4BTVA 3VJLA 3FBWA 4QA9A 4BB0A 4DNQA 1EHYA 2OAGA 3LLCA 4J0IA 5CH8A 4CCYB 3PFCA 1Q0RA 3A2LA 4QDTA 4PO3X 1A8SA 3M83A 4OB7A 4J0GA 4B82A 4DYHA 4Q3OA 4FLMA 4Y7DA 3QVMA 3VJKA 1A8UA 5AI8A 1EX9A 4UBLA 1JMYA 1LNSA 4I3FA 1VLQA 1XKTA 2HFJA 2XQIA 5HF6A 2G4LA 4DSZA 5AM4A 1XQXA 1W76A 1WOMA 1ZIXA 3WQHA 2VJCA 1QTIA 1E8DA 3C6YA 3HACA 4GI1A 4G5XA 4UBJA 3P2MA 5JAPA 3S2ZA 3IUMA 3FSGD 2ZSIA 3WK9A 3NUZA 1EK1A 2GYUA 2JEZA 5JALA 1AC5A 2BJHA 4NVRA 1XZKA 3MUOA 4U2CA 5JASA 1KU6A 2XUOA 2XQJA 3I6MA 1ZJ5A 2JF0A 4FMPA 3O4GA 4J03A 1A88A 4J0HA 2C58A 1QIMA 1X70A 3IVMA 3FYTA 4U2DA 5ALYA 3GROA 1JT2A 4HRYA 3H0CA 4N8EA 3WL6A 2BUCA 1AUOA 2QS9A 2XMGA 4WDQA 3Q8WA 3UMJA 2RI6A 2R11A 3WA6A 3QZUA 4DMCA 5HZGA 4GECA 3C45A 1G4HA 2CZQA 1UOPA 3BJMA 3QMVA 1GXSA 3IDAA 5AKHA 5AP9A 1N5RA 3G0GA 4CIAA 1MAHA 5CW2A 2H7XA 5FXMA 2XUJA 2XUDA 3IBTA 2GBCA 3PUIA 4V2IA 4BATA 5JAOA 1LLFA 3WYDA 3RK4A 3I6YA 2C4HA 3DD5A 4QWMA 1TIBA 2QXTA 4H18A 2OGZA 5HKAA 4W1QA 4EBBA 1XLUA 4OD0A 3W04A 2C7BA 4DTCA 3T4UA 3I6ZA 2O7VA 1FFDA 4HS9A 3F67A 1SCKA 4B9EA 4I19A 2OXEA 1DX6A 4EY8A 1H22A 3ESBA 3MGAA 1EB9A 2DQYA 5ALOA 4KR0A 3DL4A 3DL7A 1HL7A 2PU7A 1Y7HA 1XZBA 2DCMA 3EBLA 5H3HA 1O6FA 1SC9A 4ZXFA 2Y1KA 3WKEA 1J07A 2C5FA 5C8ZA 3G8YA 2BUAA 5AIBA 4S0XA 5C7YA 3SK0A 4M0EA 5ALRA 1XLVA 2J3QA 5AKEA 3BF7A 3PF9A 2ZYSA 2WIJA 1SCIA 5FRDA 1BCSA 1XZAA 5D7BA 3STYA 1OILA 1GPKA 3DQZA 2WFLA 3A70A 5DNWA 1O6GA 1DX4A 2HRQA 1MNQA 4KE6A 1UKAA 1MT3A 5CT6A 5CT5A 4UBOA 3HABA 1XZMA 4LXGA 3WZMA 4C87A 1LPSA 4RE5A 3KXPA 3IUNA 3A6ZA 4KACA 4U2BA 2DR0A 3DDUA 3SX4A 1ISPA 3B5EA 1XRLA 1CUXA 4BZWA 5AI6A 1BS9A 2E3JA 4UHEA 1IMJA 4F0JA 1W4LA 1F0NA 3ANSA 1XZCA 5T4EA 3AZPA 3QPDA 1EDEA 4MQLA 5AJHA 1CUHA 2HA7A 3JWEA 3G0IA 5KBYA 1X2EA 5HF5A 1BRTA 4CIBA 2LIPA 3ZV7A 5AK5A 2VJBA 4PQEA 4LIPD 3H19A 4ZV9A 4H7FA 4RE6A 1F0PA 3WWPA 3E4DA 4MWSA 4W9RA 1WB5A 3FVTA 3LCRA 4LXIA 1LBSA 1ACJA 4H77A 3HJUA 1EK2A 5EHZA 4X85A 4RPCA 2CJPA 4LHEA 4EY6A 3AUKA 4DMKA 1BE0A 2O2HA 1QIJA 2WHPB 5AOCA 1CUBA 1YA4A 5HF9A 3WWCA 2JBWA 4Y2SA 2I03A 1L7AA 1BCRA 3HLKA 3OM8A 4UFNA 1D07A 4UHFA 3ZWQA 4AZ3A 5LLSA 3AIMA 4L3WA 3UUFA 2IIVA 2WLSA 3LIIA 1P0PA 2ZJ7A 4A23A 1OXMA 3O4JA 4UBNA 1TCBA 3M82A 1IZ8A 4Y2UA 3NOXA 3R3UA 3VVLA 4XIIA 3I2KA 2XUFA 3F97A 3E1GA 1CUYA 3BIXA 1JJBA 2B20A 1E8MA 3M81A 1ZICA 3G9ZA 1CRLA 3OC0A 6YASA 2PSHA 5BWBA 2Z3WA 4PSDA 4CFSA 3YASA 2XMQA 2XQGA 5CBKA 1L7RA 3PF8A 4HTAA 3PDCA 1EVQA 3PUHA 4QNNA 3KDAA 4X97A 3E0XA 3WWOA 1YA8A 3WJ2A 5HQ3A 1Q83A 5A6VA 1C7JA 2B9VA 4J7AA 1WB6A 1DQYA 4F5ZA 4Q05A 4K5QA 1HKHA 4GDMA 1T4MA 3SWWA 5IKXA 1QONA 3DNMA 5K3FB 5DNUA 1TCCA 1VA4A 1CUUA 2QM0A 4MEAA 3QYJA 2QR5A 1P0QA 4AB1A 4UPDA 2OQVA 3DJYA 4FBMA 4P9NA 5CT4A 1VJ5A 1XZFA 3PICA 2C0QA 2WIDA 4B6GA 4AZ0A 2IITA 2JGKA 3V48A 1DWOA 1W1IA 5ALKA 3O4IA 5EGNA 5A2GA 5ALTA 2QMQA 1LZLA 1UK7A 3DKRA 2OCGA 4QE3A 2XE4A 4BRZA 5JZ9A 2VT7A 2ZYHA 1HQDA 1ZD3A 5LIPA 3VXKA 3A2MA 1CR6A 3HI4A 4LYEA 3R3VA 3L1JA 3TJMA 3G9XA 1L7QA 4J0DA 4OPMA 1G66A 1XZDA 3FCYA 1IUPA 3KWFA 5EIEA 3H2JA 3O9MA 1I6WA 4XX1A 4BP9A 5SYNA 4C89A 1TCAA 2WHRA 4U2FA 3BDVA 5DWDA 1X2BA 4N8DA 4L72A 2CKMA 1K5PA 4EY4A 2P8SA 5K3AA 3FWHA 4BCDA 5K3CA 1ZGBA 2VTVA 2OGSA 4A16A 3H2KA 1XRRA 2H7YA 1YS2X 2QZPA 3K2IA 5AI5A 2HA4A 3I2GA 4BP8A 4G9GA 4Q3KA 1XZJA 3QMWA 2QJRA 4Y9SA 4HVTA 4U2GA 1DWQA 3DS8A 5ALDA 4AXBA 1UOOA 1LPOA 5AM1A 4ZI5A 4AMZA 1H2ZA 2JGMA 4A5SA 1VKHA 4X71A 5LZ7A 3D0KA 3L1IA 4AX4A 1XQVA 3AZOA 1QIHA 1WHTA 1QLWA 5HFAA 2VT6A 4DIUA 3GUUA 4FNMA 5ALNA 2WTMA 4BTLA 2AJDA 3BL8A 2PPLA 3V1KA 4YX9A 1CUEA 3W05A 2RAUA 3B3QA 1CUCA 3WJ1A 5AKXA 5DLPA 4Y2JA 5ALFA 4P93A 5AI9A 1PFQA 3R3WA 3TGLA 4P08A 2CBGA 3LIPA 2XT0A 5ALUA 4ZREA 2EDCA 4DMHA 2IX9A 4JYMA 1LPPA 2OCIA 3CCBA 4GWLA 4XJVA 5ALLA 4WY8A 4J0KA 2V9ZA 5LZ4A 2Z8ZA 3WK8A 3C6ZA 1USWA 5LKRA 5E4TA 1CUZA 1EVEA 1Y37A 5FPQA 3F8SA 2K2QB 1GT6A 2OCLA 5JIBA 1WHSA 5AM2A 4B81A 2VQ6A 1ZIYA 4YASA 1UK8A 4DM7A 4OB8A 1XQWA 2OG1A 1AMNA 1WPRA 4PF1A 5FKJA 4X90A 3WWEA 4QEKA 3WA7A 5C8XA 4DGQA 2HA3A 5C8VA 1R88A 4Q34A 3FOBA 3HXKA 2BFNA 4FOLA 1KEZA 4JUIA 1UXOA 4JEIA 4W1SA 1XROA 5ALHA 2JIDA 1W52X 1XQYA 2AJ8A 2BUBA 2G5PA 2ZJ6A 2Y6UA 5AK4A 1IUNA 2BCEA 3OOSA 3ESAA 2XUAA 5E4JA 2XI4A 3RARA 2HA2A 1S8OA 4C88A 3SC2A 2ONCA 1CUFA 2W22A 1CUDA 4ZGBA 4G4IA 4ARAA 2QOEA 4X3CA 4UUQA 4BBZA 3IA2A 3F96A 1W6RA 4Y2QA 5HK8A 4Y2PA 5AH0A 1C7IA 3C8HA 3D2CA 4D9JA 1ORVA 2PU5A 1WM1A 1AGYA 3WIOA 3STTA 2DHEA 5DYWA 1E3QA 2XUGA 5JD5A 2VJDA 3C5WP 2WJ4A 1CUIA 5JD4A 2B61A 2XMZA 1YB7A 1R3DA 3G0DA 4KAAA 5KWJA 5FP0A 3ESCA 4BYMA 2FJPA 5BOVA 2BAGA 2HHAA 4H7IA 2PBLA 1EINA 1YAJA 4OSEA 4UHHA 5FLKA 3HSSA 2GYWA 1J06A 1QIDA 4GW3A 3FYUA 2HIHA 1H2YA 2FUKA 1JI3A 1DWPA 3VJMA 4EHBA 4BC1A 1CUJA 1JJFA 4FFVA 1G42A 1K8QA 3H2GA 5JANA 5AKIA 2W6CX 3W2TA 1EXWA 1BN6A 3IUQA 2FX5A 3TEJA 3WWDA 1YASA 1QE3A 4PNZA 2WQZA 4WFKA 1TAHA 4MYSA 3RM3A 1ACLA 2DHCA 5AOAA 2RHTA 1AURA 1ZD2P 2QTBA 2I3DA 2PX6A 4M0MA 4O08A 3IUJA 4ROTA 1GZ7A 1G5FA 5CURA 3DCNA 2QXUA 4PV7A 5FPPA 2ES4A 2WU4A 5CH5A 2WUFA 1UFOA 4C4XA 1LPNA 4N5HX 1N1MA 2CB9A 2RIPA 3R3ZA 3WKCA 1THTA 2HU8A 4GXNA 4BAZA 5F4ZA 3BE8A 3NGMA 1LPMA 5E2IA 2WFZA 4X93A 2ZSHA 4QLOA 4F60A 2VF2A 4NMWA 4CI9A 4B85A 4WDRA 2XLBA 2DSNA 3WKAA 4M0FA 1VXOA 5A7GA 1SCQA 3K9BA 1DQZA 5HKBA 4OYLA 1QFSA 1EB8A 5JATA 4KRYA 4FBLA 2O2IA 2OCKA 3N2ZB 4Y2VA 1UKBA 5AKLA 4BE4A 2J4FA 2PSFA 4TPKA 1A7UA 1KU0A 2WTNA 1U4NA 4HAIA 4G9EA 4FTWA 2ECFA 1UOQA 1XRPA 5AOBA 2NW6A 3FYUC 3DOHA 1EDBA 1CV2A 1F6WA 4F21A 1LGYA 2WUEA 2I78A 5IVDA 4BDSA 1QIFA 1JMKC 2ZYIA 1CEXA 1QOZA 1ZGCA 4PSUA 5AKZA 2WG2A 4KAFA 2PL5A 1ZOIA 4IH9A 3H04A 4B7ZA 4XVCA 3D2BA 4INZA 5EIAA 4C6HA 2GBIA 1MX9A 3N0TA 3CN9A 3FLBA 1LBTA 1R4ZA 3EQ9A 1QTRA 4ETWA 3ED1A 3AINA 3BWXA 4UBIA 3BIWA 5HF8A 4KE9A 3WKBA 2YH2A 2WIGA 5CXUA 4YK7A 2PUHA 5JADA 1FJ2A 3F98A 3C87A 5IVHA 1UKCA 2PKYX 4UHDA 4WY5A 5ALQA 5EHQA 1AX9A 3WI7A 5A62A 1E66A 1IZ7A 5KWIA 3H2IA 3DEAA 3QMMA 3FSGA 4EY5A 5C81A 4HRXA 1MAAA 4E15A 2WG0A 5FUMA 5IVKA 1VA5A 2RHWA 3AILA 2ORYA 2EDAA 2WSLA 3WKDA 2BGNA 2JGIA 4P92A 1BN7A 3B12A 4Y2YA 1M33A 4H0CA 1MU0A 2XUIA 3E3AA 3A2NA 4C4ZA 4BZZA 4NZZA 3STXA 4J3JA 5A7HA 1QIIA 2XMRA 1T2NA 3DYVA 5CT9A 1HPLA 3AIKA 3CCCA 2Z3ZA 1CPYA 4ITVA 4HZGA 4G4JA 1XKLA 5HQ3B 5JD6A 4JNCA 1MN6A 7YASA 4U2EA 5JYCA 4Y2RA 5EFZA 2CMFA 1PJAA 3ICWA 3ILSA 4X6YA 3ZLUA 3ICVA 4H7KA 4DSAA 4ARBA 1N8SA 1CUGA 1YAHA 3QPAA 1QGED 4BCCA 4WFIA 2G63A 3WK5A 5K3EA 5BWCA 1TQHA 1LPBB 1DU4A 4MJ3A 1XRMA 4DNOA 1H2XA 5T4FA 5JAHA 5HFNA 5A71A 2JGLA 2JEYA 4ZWNA 5AKGA 1UWCA 3HC7A 2WHQA 3L1HA 3RKSA 3M3DA 5I7UA 4TGLA 2AJCA 3QITA 3OPMA 4Z49A 1BU8A 1GPLA 2HM7A 4QDZA 2XB6A 3WK4A 3R40A 3FLEA 1N5MA 4ZRDA 1CQZA 3D2AA 2GYVA 1CUSA 5AI0A 2UZ0A 5DTIA 5AO9A 5K5EA 1FFCA 3HZOA 1H2WA 4UHCA 4UFOA 2DFPA 2AJLI 1P0IA 4BE9A 5ALIA 1CVLA 4MWTA 4QWWA 2XMBA 1DT5A 1QJ4A 2OQIA 3V1MA 4EUSA 1J1IA 2CUTA 4AN0A 4J0JA 1TKRA 1AZWA 4Y2TA 4H7HA 4EA6A 1NU6A 1WB4A 2ACEA 2PSJA 2WJ3A 3BJRA 4EY7A 4BCBA 3MUNA 2GBFA 4K6KA 3GBSA 3W06A 3G0CA 3H1BA 2VJAA 1ZI9A 2X5XA 5ISMA 4DNPA 3D59A 1JU4A 2JGEA 3JW8A 1QO9A 3PI6A 2XLCA 2PUJA 5AM3A 4C01A 2H7CA 2C0PA 1ZI6A 1GKLA 4EB0A 3D5EA 2WKWA 4DNFA 5LYYA 3DYIA 5IH7A 1XFDA 3FVRA 3MVEA 3AFIA 4LYDA 4AN1A 5ALWA 4OU4A 4IH4A 4Q1VA 5DNVA 1E8NA 5ALZA 3RLIA 2YXPX 2AXEA 1BEEA 5AICA 1XZIA 3FAKA 3D3NA 1YCDA 4MEBA 2XMSA 2DQZA 4CCYA 3CXUA 4CG1A 1FSSA 4Q3LA 4TVKA 4OUKX 3U0VA 1IUOA 1EA5A 3TRDA 1LPAB 4X94A 4L9AA 5J3JA 2XUHA 3W9UA 5AI4A 1FFBA 1JFRA 2WIFA 4HXGA 2VAVA 4FNGA 3G02A 2RONA 4KRXA 2GBGA 3IIIA 4RNCA 5I9IA 4JYPA 3Q0TA 4EZIA 1HDEA 1SOMA 4HXFB 4GBGA 4DMFA 5LKAA 1THGA 2HDWA 3BF8A 2WIKA 1BROA 1GGVA 2OLEA 3O95A 3G9TA 4KE8A 1Q0ZA 3VKFA 5SYMA 2YYSA 2HFKA 4PW0A 5DJ5A 5ALSA 4ZV7A 4PSCA 2Q0XA 5DYYA 5ESRA 4FLFA 1VOTA 5FDFA 3I1IA 1QIEA 5DTJA 3G0BA 4KYVA 3EQ7A 1UT6A 5LZ9A 5I8PA 4X00A 3I1YA 3OTQA 2ZJFA 4CG2A 4BVLA 2XDWA 3W9BA 5CXXA 1VXRA 2WU3A 5ALGA 3O9VA 1XRQA 4X6XA 4QZVA 2ACKA 1CFJA 2H1IA 1GKKA 1BEZA 3I28A 3JYHA 5E4YA 4N5IX 1QIKA 4WCVA 1JKMA 3VISA 4WJLA 4IH1A 1YS1X 4X92A 2WUDA 1EI9A 4G4GA 5LZ5A 3ANTA 1YR2A 4FFWA 2Y2VA 2ROQA 3BXPA 4RGYA 4QLAA 2OPHA 4AQDA 4LXHA 1CIJA 3WL8A 1UZAA 1VE6A 2G5TA 4BVKA 1U8EA 3QPCA 4G8DA 3QBJA 1TRHA 1B41A 4BRSA 1HLGA 3AZQA 2VSQA 4QDXA 1Z68A 1ZI8A 3KSRA 4BC0A 1XZGA 4K2AA 4W1PA 4KE7A 3IURA 3R3XA 1H23A 5DYTA 5FOQA 1R9NA 3V1NA 2CEKA 1QIGA 1SFRA 4CCWA 1R9MA 4NS4A 5CRIA 3FYUB 3ZLVA 4I4CA 2QKYA 5HK9A 4IO0A 3D7RA 4L0CA 4OYYA 5YASA 3WK7A 1UK6A 4AMYA 2J4CA 3FCXA 3ZPXA 1GQSA 3G9UA 3R0VA 4WFJA 3PE6A 2HADA 2WILA 3GELA 1XRNA 3ZLTA 2XUKA 4GHWA 1A8QA 1QZ3A 3C6XA 3STWA 4UBMA 2WUGA 4QDOA 5AK6A 4H7EA 3GZJA 5AKYA 3IULA 5AIAA 1VZ2A 2HA0A 4FLEA 5AM0A 3R3YA 4MQMA 3HRHA 3S8YA 1F8UA 1K6EA 3PFBA 3VDXA 2WFLB 4HXEB 1ETHA 4MYDA 1R1DA 4GEGA 1ODSA 3EF3A 4KAJA 1EDDA 1RWQA 5T4HA 3WLAA 4MXDA 3T52A 4Q82A 2Z8XA 3X3HA 1ZD4A 2OAEA 4DLNA 4K6HA 3WL5A 4B80A 5LP1A 3EIOA 1HBJA 3DLTA 1J2EA 1Q84A 2JGFA 1XZHA 2WG1A 2VAXA 5KREA 2PVSA 2QVBA 1AQLA 1GPNA 2PM8A 3FNBA 2GZSA 4W1RA 3STVA 5D6OA 1C4XA 2HU5A 1PV1A 2ZYRA 5HCUA 2BKLA 4B0OA 3BDIA 4UBKA 3V9AA 2D5LA 3C5VA 1MO2A 4B84A 3QH4A 4BAUA 1IVYA 1XZEA 5EHXA 1FFAA 2WJ6A 1U2EA 4FHZA 4GLBA 5EI5A 1CLEA 3H18A 4BVJA 2WHPA 2BGRA 2PSEA 3V1LA 1MTZA 1MX1A 3EQ8A 4B83A 3LP5A 3F9CA 4OU5A 1E5TA 3C70A 1AKNA 1XZLA 2RGUA 5LZ8A 1YB6A 1JU3A 1JJIA 3H2HA 2OGTA 1WPXA 1RYYA 2V96A 5CTAA 1EH5A 1DTEA 3GFFA 1R50A 3HYSA 3IB3A 2HRRA 1MPXA 1CUWA 5BV7A 2J3DA 1NX9A 2D0DA 3H1AA 4OCZA 3U1TA 2X76A 5JZBA 4G1FA 4E11A 3KD2A 4H35A 2QRUA 4BAGA 5CH3A 4X95A 1U65A 3O4HA 5AKKA 1LZKA 1TK3A 5EIHA 2V97A 3AIOA 2R8BA 3I2HA 5AK3A 3WL7A 5ALJA 4X6UA 4E46A 3D4LA 3G7NA 2FJ0A 2WM2A 1YSCA 4IHAA 2EEPA 2ZVDA 4OB6A 1W75A 3KWJA 4IQ4A 4UHBA 4W63A 2QUBA 5A7FA 2X8BA 4G8CA 4YPVA 5K3FA 5FV4A 3ZI7A 4KEAA 4X91A 3QM1A 3WK6A 4N8SA 3C8DA 2B4KA 1ORWA 1QO7A 5AKJA 3WMRA 3K6KA 3ESDA 3I2IA 4KJXA 5K3DA 1GQRA 3GA7A 3I2JA 3C43A 1DINA 3UUEA 3C6BA 2YASA 2PSDA 2VEOA 1CUVA 5CT8A 2XMCA 2HA5A 2AJBA
chains in the Genus database with same CATH superfamily
1ULSA 1VKRA 2GN2A 3PQEA 5JAZA 3L7OA 2DQSA 4GGOA 4YJGB 4XLZA 3RIXA 3Q9NA 4G8JA 4DVGA 3OA2A 4QOHA 1LA2A 1JIJA 3LV8A 4F6RA 3EGVA 3GUCA 4RLSA 3FJOA 4DV7B 2GJKA 1CJKC 5BQXA 5EIXA 4Q19A 3OCJA 5JTTA 1I1QB 1Z6TA 4FDUA 4FWBA 1YDMA 1P17A 2ZPTX 5SZJA 1RLUA 4M46A 2W2MA 2II6A 4MLPA 4X1YB 1JWAB 3CNEA 1T5OA 1MDFA 1NQUA 5G3ZA 3NWOA 4YLEA 3ZWOA 4YJ3F 4B71A 4DBLE 4DCNA 4PC3A 2UV8A 1E89A 4I4TA 2QVCA 3IHTA 5EJMA 1VL1A 2DQKA 2L2QA 1XA0A 3GMDA 1I3NA 2ZYDA 3CRNA 5SZHB 4NCKA 4JI4B 1AV7A 3LLUA 1JYEA 3OURA 4FVTA 4YXWD 2MSLA 2ZIUB 1M2GA 2J9ZB 3WVNA 4JUFA 1JG3A 4C7KA 1ZJ6A 3R1IA 4I6JA 2VDWA 3H11A 4FT4A 4MPDA 4OM8A 4CL2A 4LECA 1KFCB 2G28A 2O7RA 3AHEA 1R3UA 2EEZA 4QPJC 5LZ2A 5HILA 3ORSA 1YE8A 2NTNA 2W2LA 1XMVA 2Y76A 3H9GA 5GVRA 3DKKA 4X7BA 4B0PA 4DMGA 3AY3A 4PXAA 4RKYA 1KS2A 2X3YA 5FWYA 1L5RA 2EOAA 1E2KA 3FDZB 3ZG6A 4UDYX 5IUJC 1CQWA 4MYRA 1IH8A 4QOEA 3CBQA 1JDJA 4GOLD 2OXFA 3E3OA 4JLMA 3WNCA 1GZ3A 3PX3A 4FQ5A 3OP1A 3WIBA 3QKSB 4DDWA 1FFEA 2H5JA 4NYMR 5ALVA 2N42A 4G23A 4LJ7A 3G68A 2FR8C 1DIOB 2A35A 4C0AC 1CY4A 3LU1A 2HU7A 2YC2C 3L04A 1K4YA 3ET4A 3IMKA 2BZGA 3ROMA 3VKWA 5ITVA 2H00A 3HVKA 2HL6A 1OQAA 3HCNA 1Q44A 3BB3A 3GPIA 3OMLA 4FKBA 2C2KA 5ALPA 3TZBA 4A73A 4FDMA 5CMLA 3NEAA 3DMTC 1DBIA 1F8GA 4FFOA 4EVRA 2WSSD 4MVJM 2C5GA 3LBIA 1NY6A 4WBNB 1KYVA 1K7EB 4JH0A 2NU7A 1U0HC 1ZMOA 2JJMA 1JQLB 4OLHA 2J9RA 3V8VA 3L9WA 3OLCX 1MNAA 1ODCA 2QZ4A 4Z8YA 1B6GA 3HWX1 1CNFA 3N5CA 1BMTA 2VP0A 2Y6VA 3PT9A 4GM4A 4EW1A 4Z0PA 3GFSA 1MFPA 3RC7A 2ACVA 1ZN7A 2ONKA 1WUKS 2FPGB 1VMDA 3H7IA 4U3JA 1MAWA 2FMXA 4JIMA 2OUIA 5EWMB 5DZSA 4LZZA 2ZB8A 3R7NA 5KINB 4HTFB 3PEYA 2WJHA 3UMRA 5JZSA 4OQNA 2A59A 1U5CA 2H5LA 4WLEA 5DMXA 2IPMA 4EI9A 3AVWA 2GM3A 3KL4A 3IKJA 1E1RD 3UFXA 2JLXA 4QT0A 1JP7A 2BHSA 2YS7A 4NMHA 2G76A 1Z5PA 4Q9IA 4YAIA 1KDZA 2HA6A 2VLIA 1FRQA 4DARA 1P29A 1B00A 1L7NA 1L7PA 4MUBA 4R81A 5A9TA 721PA 1DC6A 3FLAA 4JZKA 4TWIA 1O87A 3GR6A 4NWIA 4BO0A 5L6LB 3M4NA 2O05A 2OV1A 1OGJA 1AQNA 5PNTA 1OJLA 4G8BA 3G8BA 4LY6A 2A1UA 2C2MA 3OI7A 4N0PA 1AHNA 2XMDA 1HE3A 1WXQA 4ZHSA 4V24A 1CK4A 1WDWB 3VV3A 3EVNA 2GWHA 5EMNA 1Z83A 1R64A 2DFNA 2IC5A 2WZBA 2W6ZA 1E2QA 3JWPA 4IIVA 4UOQA 3M5CA 3UAXA 4F5YA 3HKBA 3DE1X 2NP6A 4QA9A 4YJDA 4BB0A 3AM1A 1EHYA 4OI4A 2GM5A 2NZUG 4PC6A 1SUBA 2D1YA 2E87A 2OAGA 2VI5A 3IT1A 1POWA 3B1VA 3KTAB 5CH8A 1QC5A 2YFHA 3EC7A 2P9TA 2OZPA 1ZUD1 3A2LA 2IELA 2YNMA 4QDTA 4UEJA 2CK3D 4PO3X 2B8WA 3VC3A 1NVMB 2BIFA 2OVBA 1EK6A 2MR5A 4PU0A 1MB2A 4TQ9A 4LFAB 4ZC1A 3RSOA 4GF5A 1T8UA 2PAFA 3DMYA 3RAFC 3R7SA 4DXHA 3ZZNA 3RUCA 4ARIA 4HPJB 3QBEA 1HRDA 3MSCA 4J0GA 2JBAA 2CHQA 3ZCPA 4B3FX 3BXXA 3L6BA 5LLTA 2EJWA 2VJOA 3QU7A 3W5SA 5KOHA 1GQOA 1PZEA 1U9JA 1VC2A 2ZJ1A 3BD9A 1PVOA 4DCPA 5JXWA 2A4MA 3CR3C 4DV3B 1EP2B 1DKPA 2EWWA 2JDID 1X7XB 3MMNA 3T0FA 3T95A 3OIUA 3DEIA 3IRUA 5KCMA 3DOEA 1T8PA 2E9SA 3QTLA 1OLSA 2QN6A 1WIWA 1QGDA 4JJIA 1WF6A 2VNKA 3UW1A 3W5HA 4A0SA 2FDCA 5ADVA 5AM4A 4O4JB 3O82A 4BO5A 4ECEA 3KR2A 5L9AA 5DX0A 3WB2A 1UCFA 1HUQA 1QG4A 2OYCA 3TNFA 3VHQA 3CISA 3HR7A 3IOCA 1P4GA 4MUMA 3GV0A 1GM5A 1T2AA 4MR8B 4C3UA 3C6YA 2VL7A 4XLLA 3LAWA 1U8FO 1JR3A 3TZ6A 3PA8A 1VL6A 5E3HA 5B4UA 1KMHA 2VPZA 4Q1BA 3WOVA 4ACBA 4DM4A 4HPXB 1JRLA 3AL3A 3WJAA 1K3TA 3GJRA 5BO5A 4CQMD 2WD8A 3CNQS 3SJBA 4BEVA 4CMBA 5JAPA 3DZGA 1KKLA 1P5HA 1PGJA 4R0VA 3TZQA 3WLHA 1GYRA 1DTWA 2A3NA 3BMNB 2OHOA 3CZQA 2QX9A 5FHQA 1R15A 3IUMA 3FGPA 3IUBA 5FJIA 2J67A 2VUUA 4IDDA 5HDQA 2AEFA 4TXMA 3X1DA 1I1NA 2A78A 2GI4A 2ZSIA 3I30X 3LQ4A 5EIWA 2FZ4A 3H0KA 1GHTA 4MI1A 4R4JA 3QP9A 5T3UA 3ADBA 1T6XA 3T38A 3ITNA 3QFTA 1U7HA 4KV9A 221PA 3L8EA 5C1PA 1O97D 3ZWBA 1EFHA 1T0BA 4BFWA 1LW6E 3CNLA 1V2HE 4XRRA 4PWZA 5KTTA 3RYIA 1PK8A 1NIJA 2IIPA 4I9GA 3T1HB 4U2CA 5IT5A 1CY8A 2F3QA 4WN9B 3VX3A 2JD1A 2XQJA 4PE5B 4YV7A 1ZJ5A 4F3RA 4CN8A 3O4GA 1CQJB 3KFVA 1ZM9A 3LUAA 1A88A 1OXBB 1X15A 2DHQA 2KJQA 3H4VA 4IRXA 2PKXA 2F3SA 2VF7A 1KRWA 1Y5IA 2BTQA 4B34A 4C04A 3INYA 1J5EB 2SECE 3DE2X 2HLNA 3EMDA 1B8NA 3WZ2A 4DXAA 3ENNA 3IVMA 3FYTA 2HKIA 3RUDA 3KSZO 3KSDO 2ZJ2A 1KEUA 2OK8A 3PXCX 1E79A 1P33A 2KB0A 4HMQA 1QSGA 4B7AA 4DJDC 3UPDA 1F12A 2P9YA 4KBFA 5FTNA 3L8FA 1O4WA 1P3Y1 2ANBA 4R31A 4B6OA 4OQYA 3LDHA 3C0KA 2W8ZA 5DKFA 3ZDEA 1Z0FA 3UXHA 2ZVPX 4WD3A 1Z2OX 4TZKA 3VYUB 2XMGA 4QXOA 1GZ4A 2C5BA 1KQGA 3Q8WA 4OJQA 5AVJA 2OEPA 1WTCA 2WJPA 2VKQA 3RH0A 3OPYA 1YK1A 4XGQA 1DXOA 3KB8A 3R7WB 3R8CA 5F78A 5B4TA 3FBGA 3ACDA 2YNMC 1PV2A 2HMYB 4HBGA 5ER6A 1Y8CA 4XFKA 4LQCA 3S2EA 1FDVA 2IODA 1Z2AA 4J76A 4NNPA 4RGQA 1Z7YA 2CZQA 1EXNA 1F14A 2R5WA 3P9CA 4O2AB 2Q3LA 3NORA 4TSKA 2AC2A 5C35A 2JANA 4WJZA 4YP6A 1A8PA 3M5WA 4QQ8A 2FSVA 2Q3FA 1T4CB 1VJ0A 2XT6A 3EVBA 4TTRA 2FMTA 3QBTA 5AKHA 3TBKA 4EJSA 1AHHA 1MOQA 3CIOA 4RHEA 5EJ7A 2XVMA 3A27A 1GUBA 1XTPA 1Q7BA 4BFUA 3IEUA 4AC9A 1L5WA 1HLDA 2EVWX 1SC3A 1Z74A 4TZTA 1OREA 3U4DA 1N6NA 3OIFA 4F5EA 5JBIA 4YC7A 1EX7A 4DR5B 3FWZA 2DFDA 4GMHA 4WOCA 1GTRA 3QYPA 4C7JA 3KYCB 3U39A 1SCBA 2EYQA 5JAOA 5T67A 5AW1A 3SQWA 2POQX 3WYDA 1VL2A 3OIYA 1ZM4A 1T3GA 5KDOA 1DIRA 3FVWA 5JFGA 4FUQA 2QRVA 3C2QA 4I2VA 1DDOA 3V8EA 1WY5A 2OGZA 4LWOA 3W8NA 4KO2S 2CWDA 1PU2A 4C5BA 4QQFA 3HKCB 4ODIA 3W04A 3OP4A 3T7AA 3GX1A 2UUAB 1SUAA 1FMJA 3GH1A 3T4UA 1EBBA 2QG4A 4JOSA 1O8BA 3DDOA 3DFFA 5JW6A 2XSZD 5JMPA 3MT9A 1W73A 3G2OA 3OLQA 4MA0A 1ECFA 3LLMA 3LVRE 3VC1A 1Z8DA 4AKTA 1SCKA 3M33A 4MHOA 1V6SA 4Q6WA 5CLGA 1E1MA 1YL7A 1I2MA 3AY6A 4PINA 1DC8A 2PX2A 4YEDA 1FTGA 1R0WA 1E9BA 4MYCA 2P4UA 5LQMA 4ZCMA 3QVGA 4DDUA 1XRJA 3N75A 1L4HA 3ZXXA 2DKNA 3ESBA 3KXIA 3MGAA 3PIIA 5TQ2B 2A9FA 3SIXA 2OCDA 2HSWA 4M89A 2P9QA 3HQ4O 3ODGA 4IIUA 4TTQA 4QICA 1K5HA 3RO7A 1HL7A 1HY3A 2DY0A 2PU7A 3E15A 2DCMA 3ND5A 4MR7B 5GV7A 3EBLA 3SEQA 1E2LA 1O6FA 1PUIA 1L7BA 1SC9A 4NY1A 5EYPA 2VAPA 2Y1KA 3OZEA 3SQDA 1MAVA 3TLGA 1C9YA 1S7GA 2B5VA 2IVFA 1T9KA 3KE9A 1JHZA 1B76A 5LA6F 4HT3B 5UKDA 2D4HA 1NVEA 2O57A 3D3QA 2HBQA 5CA1B 1HNXB 3DKIA 1Y42X 2QRPA 1U0LA 3AH8A 4TSFA 3C8ZA 2C59A 2CXQA 2QAGB 1YDHA 4IDAA 1BKYA 1X1DA 4MW4A 4S0XA 5ARCA 5IU6A 2W0MA 3LM8A 5G0WA 4P7BA 2F8MA 1Y3IA 2OQ2A 4M0EA 5KYXA 4AJ4A 1X80B 3TJRA 4BGDA 3F6BX 4Z9YA 1CS0B 5HS4A 5FCDA 3ROZA 3PF9A 2R8YA 4ILKA 3DO5A 1UKZA 4ND8B 1GZ5A 3ZBTA 2HLHA 5FRDA 4HSEA 4TN5A 1LJ8A 2XOKD 3U2QA 3GLHE 2ZWIA 1CRQA 4F8JA 3CUUA 1V8ZA 4ASUA 2HV8A 1NASA 4MV6A 1WXDA 4I1VA 1Z22A 3RSSA 5HS6A 3DQZA 2WFLA 5DHTA 3A70A 4X1KA 1PE0A 2IUTA 3D5TA 2EP8A 3OEYA 4PLGA 3O8DA 4PXSA 5IK2A 5T5QA 3QUQA 1DX4A 1YDWA 1G291 3DVSX 2R6AA 2WZQA 3EGXA 1M2NA 1NVDA 2OZLA 1XALA 2FSVC 4R2LA 1UKAA 3ZLBA 3HCDA 3IQXA 3MAAC 5IMSA 5B2FA 1Z7EA 3QLTA 5CT6A 3JARA 5KI6A 4MW7A 4BJ1A 1ECCA 3M1IA 4HZIA 1VE1A 1QFZA 3I09A 1XZMA 2JLRA 4OOEA 3DE6X 1WPQA 4IRMA 1V5WA 4IJQA 1KZ9A 3H1EA 2VK4A 4IIXA 4CKBB 2V7QD 4OMCA 3RS8A 1KBQA 1MXHA 3WZMA 1P7VA 1NF2A 1AS0A 3KXPA 2O50A 4MS3B 4RE5A 1H4SA 2AOUB 1B14A 3I4FA 3IUNA 3OE7D 4Z4GA 2ZBEA 3E61A 3A6ZA 1N2ZA 4KACA 3MB5A 4A8JA 2VRNA 3NG1A 2Q1XA 3NNSA 1SOAA 2V6GA 1LTHR 3DDUA 4I5GA 2NGRA 4TKVB 3SX4A 4DA8A 1ISPA 3ZZ1A 2CEAA 3AF1A 1QLHA 1U0RA 2QX7A 3OLYA 1ZRSA 4HY3A 2O0JA 3B5EA 3KJZA 1TCUA 2CBXA 1S5PA 3F5QA 1CUXA 3U3ZA 1KOFA 1E7WA 3NXSA 1GPWB 1J0XO 1VHDA 5TX7A 4DIDA 4DIBA 4IO1A 4MQFB 2NVUB 3RKUA 1U6JA 4B44A 2HRBA 5IBRA 1P6XA 2J09A 4F0JA 4BUCA 2N47A 3SKYA 3AZPA 1QVRA 3RLFA 5LVAA 3G2QA 1C3OA 4BL5A 1QH8A 5JC8A 5KNBD 2ZI9A 4WESB 1U4OA 2XKKA 5J9FA 5BWNA 4QXRA 2G08A 3D7LA 4NJEA 4MINA 3JWEA 2HCTA 2EYUA 1F8XA 1X2EA 1XLTC 1BRTA 4EKDA 3HNPA 3ZV7A 3U5TA 5AK5A 5DK4A 3H5OA 1PYGA 2W6JA 2B2CA 6PFKA 4FZJA 5DH9A 4YIHA 5HSGA 1P9RA 5A0VA 3H19A 1V4BA 4ZV9A 1Q21A 4M49A 3O21A 5JZOA 4RM3A 3CWZA 1C3JA 3E4DA 4EHLA 4G1BA 4ZGGA 4JJEA 5EERA 4PNPA 2F4VB 1RLOA 1GNTA 2XNCA 3FFWA 5C53B 1UIRA 4ZEOA 2KHZA 1N8NA 4JGIA 3BAFA 3DNFA 3B1WA 5F2EA 3DQPA 4MP6A 2ZCUA 4R54A 4RTJA 3O2NA 1NBEA 2PS1A 3H9BA 1ACJA 4B8ZA 2WHEA 4H77A 4EECA 3FHLA 4OXNA 3IESA 1P2TA 3AFOA 1FYXA 2XVXA 3KU4A 4X85A 2IYTA 2PTHA 5K4GA 5M29A 3A6FA 1B26A 2CJPA 4O2RA 3OKPA 2ZZNA 5BQOA 1E99A 1Z56C 2JVJA 1Y8RB 3MD0A 2OO5A 3WE7A 3E0QA 4II7A 2ZJ5A 4IJUA 4BKRA 4DMKA 1FYDA 3WAGA 3D8UA 1JGTA 2ZIXA 5DLYA 2WHPB 3MXOA 1M6NA 2WJYA 4E2XA 3T5PA 1ZMXA 2X4DA 1BMQA 3Q7SA 1AO3A 1DG3A 3KTDA 4K8RB 1DRJA 4Z9XA 4XGKA 2QY6A 1E98A 4Y2SA 3U7GA 1FS4A 1EVJA 1R10A 1U9IA 4A6DA 1MC4A 4PIPA 2E6UX 1PWHA 1JQAA 4YAOA 1ZCJA 4B4DA 5E7MA 1SUIA 3TXAA 3ZWQA 4R8RA 4AZ3A 1EFRD 5CLJA 5IF3A 1GGNA 2DKFA 4KQGA 1DE0A 3AIMA 2HQSA 1N6RA 2HMAA 1XHFA 4B3CA 1FSFA 1E3EA 4D46A 2VN8A 1DC3A 5L3QB 4H16A 2ONYA 3X1KA 3H9EO 4MCIA 3QXSA 5EAIA 1D5WA 1RRFA 3A31A 3I45A 4IICA 3O26A 2BGKA 3R3UA 3T3NA 2YHUA 4B43A 3OJWA 3UK0A 1UL1X 3NOOA 4XIIA 1VMKA 5CX4A 1N2CE 3TIGA 3W5JA 4YV2A 4YHHB 5LQNA 1CUYA 1ZYUA 1OSNA 4JEMA 1JJBA 4X84A 3PG5A 5HE9A 3UANA 1E8MA 2H63A 2V9PA 3M81A 1ZICA 5E7IA 3KG2A 3TGPA 3DZ8A 5IM4F 3CS3A 2X0KA 1Z7WA 4NK4A 1N0UA 3CZ5A 1CRLA 4N18A 2AW5A 4FSXA 3PQ4A 4OL9A 1BKDR 5TQVA 4A8JC 4ZYXA 1YO6A 4OJNA 1K88A 1C8KA 3AERA 2UUBB 4UNSA 2QD5A 1XDWA 2XMQA 3T1VA 1L7RA 5SY9A 1ADBA 1KMQA 4POAA 4YJFB 2CV2A 3RADC 3HB0A 1BXGB 3F6EX 2FPSA 4XVQA 1W9MA 1F8YA 5KO2A 1EVQA 1NJ2A 2G9UA 3KDAA 3PUHA 3KALA 3OAAD 3G13A 3G82C 4X97A 2OB1A 3TI7A 3UH0A 4EVQA 1U1CA 4N3CA 4P32A 1FDIA 1NDUA 2OESA 3DEFA 4DEXA 5DNDA 4EO7A 1Z45A 1Y98A 1HLPA 2PXCA 2QSJA 3OFVA 4X8OA 1NG9A 5DOZA 2G8LA 1XYYA 4GRIA 3E3NA 3EE6A 3SGLA 1HYHA 1OAKA 2REQB 5B1IA 1K7SN 2MOKA 3GXOA 1IXYA 1N5DA 2IDJA 1JEOA 4CR6A 1I4EB 5DT2A 1DQYA 2JZOA 5IS2A 1LDEA 4CM4A 1QYCA 1Z0JA 4GDMA 8ATCA 1WXIA 2LD4A 3N39C 2IW3A 2VHUA 3SYTA 1KDYA 3VU0A 5IKXA 3PDHA 1BEUB 1LWNA 1YI8A 3MTDA 4QQRA 3N8DA 5EXSA 2Q0QA 3EXFA 4KIWA 2M6LA 2GJ8A 2UU9B 4M9ZA 1PAUA 3I39X 4JT8A 1C8VB 2Q5OA 3D3KA 1K08A 5DXFA 1IN7A 5EEGA 3RGGA 5H4HA 4U0JA 1AKTA 3JYLA 1M8FA 1NN1A 5DCUA 1R0ZA 5GPBA 2OQVA 1ZOPA 4L74A 4HGNA 1KI9A 4DVJA 3DJYA 3VPBA 4FBMA 3W6UA 2IYUA 3BA6A 4B09A 2VDUE 1NMYA 3I8OA 1HLFA 4UM5A 1PZMA 4KIJA 3WV4A 2YY5A 3SQMA 2JB9A 3L0CA 2OO5C 2C0QA 5KYUA 4R6WA 2P77A 4E03A 4B6GA 1UC9A 3V48A 2C98A 1W1IA 3PQ8A 4IFIA 5DX1A 5HKKA 3VKHA 3EG9A 4W5QA 1ADGA 1B4DA 4MVJD 5COQA 4JL8A 4TUYA 2J0VA 1U9IC 4QSMA 4C08A 4HUTA 5KVQA 2VDJA 3CSSA 4G26A 4JI1B 4FOPA 2LDXA 1JEQA 1I3KA 1ST3A 4BRZA 5JS1A 1L8LA 3JTEA 2OKCA 2XDQB 3Q7IA 5THQA 3R4VA 1SVKA 4R5HA 5BQPA 1ZD3A 2OBNA 3VXKA 4C05A 1E94E 4DQUA 5IUNC 5LIPA 1G2QA 5BMVB 2JC3A 1U8CB 3J81k 4QHYA 2QN3A 1JHDA 3EXEA 3FDXA 5HOQA 3FFTA 2PE5A 1Y9EA 2XJ9A 2E21A 3R3VA 5EVCA 3C15C 1JH8A 3CH6A 1KWKA 5L95A 3FFAA 1ONPA 4IXTA 5GGXA 1L7QA 5EJ9A 1JN0A 1XZDA 3VZPA 4PHHA 1JEAA 1CJTC 2BR3A 3SS9X 3SR3A 4BNFA 1L5QA 4F6RB 5DNAA 1LQTA 4KNVA 2AS0A 2NVBA 3NBZC 1YS7A 1PZGA 2FSIA 1H3EA 1WP9A 3AUJB 1YU9A 1T24A 2G1UA 2VNJA 3QX9A 1YBVA 4IXMA 3TEFA 2I2DA 1ZH2A 1VPLA 3L8CA 1AN0A 5JJKA 3PLNA 4LVNA 1P5JA 4MKHA 3DBHA 1TCAA 4V03A 5A1TA 1TF5A 2PQ0A 2NN3C 4Q21A 1AKVA 1D2HA 2QB5A 3FYCA 1NY5A 2V9CA 4I4TB 5DWDA 4ERNA 4RMGA 4L72A 1O4VA 1YQ9A 4PBRA 1FNSA 3JQRA 4CLOA 2JLAA 4EKGA 1Z7BA 4AWBA 3K92A 2DLNA 2ZVQX 4RTPA 3ZQKA 2VDWB 3H11B 3QLUC 3RVMA 4LXUA 4P35A 3VOSA 4BCDA 4XQEA 1S2LA 3K9HA 4X7PA 3EHDA 3O4VA 5EHIA 4DT1B 1KP9A 3HZRA 3BUSA 3I5AA 4G5SA 3JTMA 5DVZA 2H7YA 3OFJA 4YRQA 5FWYB 3U4CA 3V6MA 3Q7TA 5CFLA 2C9DA 4FX2A 4XARA 3IA7A 4IG4A 5AI5A 4TQUS 1L1RA 3D8RA 4MW9A 4KXNA 2C8KA 1WMSA 3RIHA 3RC8A 1RKVA 4K6OA 4A27A 4D97A 2E4WA 5EA2A 3PPVA 5EQDA 3TQOA 3UJ3X 1UXGA 4UM8B 3RVBA 4P5DA 4ZVQA 5KTKA 4FJ2A 3HWRA 1LDGA 2IZOA 2BKXA 2Y3IA 2QJRA 5CNJA 1UP6A 4Y9SA 2VP3A 5BYJA 2GDZA 4DHWA 4L0DA 1Y7LA 5K8IA 1IOLA 2G70A 1NP6A 1TD9A 3OOHA 3DS8A 4Q12A 4CM1A 3BDAA 1RWWA 5EEHA 1TGYA 4MV4A 4EELA 1NYTA 1V25A 3FSRA 4JBGA 1LPOA 1YRAA 2PS9A 4AMZA 3M3HA 1U5BB 2AVNA 4W9NA 3PL5A 4XJTA 4ZPXA 2FPIA 5LQRA 3BHMA 2ODEA 2NU7B 2XEDA 2JGMA 3H9QA 3DCJA 2BDTA 2BI4A 4X71A 1G0NA 2ACWA 4JB0A 3O7WA 1J2JA 5ILGA 3ZU3A 4L7VA 3D6HA 2WT9A 3KJEA 1CETA 3BMXA 1YGYA 4U7FA 1Y1QA 2GPSA 1J2RA 1A27A 1EBFA 1JZTA 2AX3A 1E59A 4GPBA 3ZDZB 1U9YA 4U3JB 2QU8A 1O6CA 4AF6A 2PY6A 2D1FA 3A6HA 3QV2A 3ZE2B 4HGZA 1JA0A 3IDSA 5E3JA 2HGZA 3O93A 1ZJZA 3K1ZA 4FNMA 4ANFA 1SEPA 1IQ0A 5LJIA 3NASA 2LE0A 3UFXB 1XMSA 2JFXA 3HY6A 5IZ4A 1PR2A 2BV3A 1Z08A 1CVRA 4IWXA 4REQA 5F2NA 3CLRD 5T57A 3LQYA 2AN3A 3OHPA 5BYKA 2FKAA 1R8QA 2PPLA 3M4ZA 2VCHA 3SDSA 1NDQA 1CUEA 2ESRA 4HDNA 4QUBA 2KBFA 4OQPA 4WERA 3W05A 1R0BA 4DDVA 4MW6A 4HADA 3D0OA 3WJ1A 3EZ2A 3KKZA 1ZSYA 1TIPA 3D02A 3WHPA 4KBGA 2A1UB 5AI9A 3FB4A 2HHHB 3BT7A 1WABA 1VCMA 3M6VA 1PT5A 4YXFA 4N12A 3UJNA 1KAQA 1VSVA 4RU1A 2ZJYA 5F98A 5K0NA 1ISFA 5ALUA 2EDCA 1MQSA 2R7AA 4LMPA 4YAGA 4AM8A 3WMFA 5EE1A 1DEXA 1B8PA 4BO3A 4GIBA 1W5SA 2PL9A 4C6RA 1Y6FA 3CCBA 1Z35A 2D1RA 2H2FA 2FWIA 5C8YF 3GDHA 4FPXA 3SZUA 4WLFA 5TMDA 2O2EA 4XJVA 4AY5A 1QC5B 1UP7A 5KYVA 4CLRB 4J0KA 4RS3A 5JSQA 1YZUA 2XHZA 1W9HA 4LTDA 3IQHX 2V9ZA 3TLMA 5LZ4A 4J6FA 4XD7A 5DM70 4M0CA 2OG2A 1USWA 5K3SA 3B48A 1V8FA 2AJTA 2JBAB 3MFYA 3RWMB 1TC1A 4Q37A 2NU9A 3JRWA 1OLOA 1U3UA 1GT6A 2OCLA 5L7WA 1USVA 3ZE1B 2CXPA 4P82A 2FLKA 3ZU2A 4R98A 1R5JA 4OQDA 5MGNA 4JB3A 1HT3A 1NSYA 3D6VA 3DV0A 3KCQA 1G2PA 3KQVA 2R97A 3ZVLA 4BVGA 5C5CA 2P9EA 4X7RA 1TYAE 1P73A 4RVFA 3GLUA 4ZCSA 3BRWD 3RG8A 4MV1A 4EAQA 1SURA 4XA8A 3SE0A 1OLSB 4IF4A 3OT4A 3GJ7A 1NF9A 3SDZA 1SELA 1M83A 1PLKA 3AUUA 5DTQA 3C3JA 1DKNA 3G79A 4IVNA 5H82A 4OXIA 2IE0A 1WX1A 5HIMA 5TNXA 3TSAA 4M60A 4Z0TA 4C3ZA 4OXQA 3EPPA 3PC7A 2IDMA 2B1GA 3G2JA 3DDHA 2PHZA 3KVRA 5BWOA 2PUEA 1U0OC 4KB5A 4PTLA 4Q34A 1IRXA 3FOBA 4AJLA 3HXKA 4JROA 1ZC4A 3B3JA 1L5MA 3Q88A 4R16A 2FDXA 1RWXA 1M75A 1W2GA 1UWVA 1KMHB 1TKBA 2HYDA 4FOLA 1KDTA 4IVRA 4O0LA 5JPDA 5E0KB 3R0QA 2J87A 4F2DA 4W9NC 5LBIA 4JEIA 1T1JA 2COUA 4DPMA 4UREA 1GA4A 2AFIB 1K5DA 1XROA 1DTWB 4GUAA 2BMFA 3QWIA 3P9NA 3U1VA 2PMDA 4ZAXA 4BQRA 5LP6F 1Y6GA 1E9DA 1VECA 5LR6A 1W52X 3P32A 1XQYA 3STHA 5DFAA 4RAQA 1GCUA 1C80A 1G3MA 2OT3B 1RLMA 1TU0A 1YQEA 3NNDA 4PGHA 3FCCA 1LQUA 3ZGOA 4A36A 4PHGA 1IDN1 1PEYA 5I7EA 1F2DA 1T5BA 5D5PA 4OHBA 4I46A 3RYIB 2UYQA 3PXXA 2H2IA 2HC9A 4E31A 5K8UA 3QIVA 3W2EA 4QJBA 4OLJA 3N0VA 2GO1A 4OK6A 2HO5A 3I9OA 4NBVA 5LQJA 5G02A 2JLUA 1EE1A 3DLCA 4I1RA 2QTNA 3LT1A 1IDOA 2XI4A 1ZGZA 4CMJA 1Z62A 2HA2A 1WO8A 3C74A 3R9WA 3LQ1A 1NI3A 3OEED 1WDTA 3I92A 4LDAA 1S8OA 4HDKA 4JJ6A 3ZE8A 4C88A 4J9VA 2PRYA 2H07A 2CHEA 2BTQB 1E6CA 3I3SR 2BR4A 3EFBA 4YCLA 1WNTA 3KHSA 4HQ6A 1YQDA 2VWPA 4JQSA 2W8BA 1KJNA 2XTNA 1G20B 4F11A 1RQNA 4F3CA 4MR9B 2OZVA 4CE6A 2JJ1A 3FUTA 2BZSA 3ZH9B 4JZYA 4FR5A 4G4IA 2ZKIA 1AK1A 2J6HA 2MJLA 4X3CA 4B3XA 1SXPA 1XTQA 2E4UA 5B6PA 4LGCA 1JG7A 4XPZA 3IA2A 5KNCD 4QYXA 1W6RA 4MJ7A 2ZR0A 4Y2QA 3DBVO 3W79A 2H85A 3G5MA 4AJ2A 4CIVA 1ORVA 3E3LA 2WE8A 4YWJA 1T3HA 5F2OA 3P9SA 2VO1A 3OPYB 4P38A 1AGYA 2ZSAA 2FG5A 2NTVA 3C3WA 1ZMBA 4JT2A 1DKRA 2DHEA 2I4LA 3P71T 3TAXA 4IGIA 1Z17A 1OXSC 2AK3A 3OT1A 2XKAA 3VDMA 3FPLA 5CDFA 4P81A 3PXEA 1DWUA 1H6CA 3CVJA 2QTCA 1NUAA 3H8JA 4B3DA 4ZHQB 4RABA 1P2GA 2GBLA 5IM5A 3LDUA 521PA 1GZSA 4FEGA 1TGVA 2CHFA 3IV9A 4N5LA 4HNAA 3X1WA 4C5AA 2PTGA 1PGPA 1QDUA 2VZ0A 4WECA 3THYA 1JQBA 4ZAVA 3HA3A 4U7WA 2VXCA 1YB7A 5BWMA 1PFKA 2CXSA 1PS0A 1HKUA 4G9BA 4WZZA 1C3EA 3BBPA 2P3SA 5JDCA 2XGOA 3OZFA 4P4UA 3ESCA 5HIJA 2F1KA 3TZHA 1SRQA 3TKLA 3SQOA 4B74A 3HFGA 5KJ6A 3H7AA 1KYTA 4DAEA 2PBLA 2VTDA 1H2AS 2QRVB 2RGDA 3LA6A 4OMUA 4RHCA 5TY0A 3CX6A 2PBFA 2Y99A 3AEQA 3MD9A 3QFFA 3ZGNA 4W82A 1I3OA 1WKVA 1J06A 2GYWA 4XJSA 4GW3A 3ICEA 2EKBA 4RKRA 3S70A 3MMPA 2O3TA 1J2TA 4V0MA 5F5NA 1M8GA 2YHSA 1JQ3A 4FZ3A 4GEKA 4PNHA 1ZAYA 4O5AA 1Y5NA 3ADKA 5E6RB 1JI3A 4FYIA 1OX5A 4EHJA 4K6FA 2YR0A 4EHBA 1YT5A 4OHXA 2C3YA 2XYGA 4LZLA 1H2RS 1P7PA 2VJNA 2WSMA 1GGKA 4BC1A 4MCJA 4QUHA 4FFVA 4WZBA 5A4JA 3TG8A 1G42A 3ONVA 3QVGB 1YKFA 2W6CX 3W2TA 1ZEJA 3R9XA 3FFXA 4H59A 1BN6A 4L4YA 3K0HA 1L1QA 3E53A 2EJVA 2BZ1A 1DAMA 1A9TA 2B7BA 4EGAA 4ERXA 1KEKA 4XR4A 2FX5A 1FW8A 3E6AA 1N9KA 3HBFA 5DLQC 4NZMA 3F3SA 3COYA 5EYPB 2B2NA 4IV8A 4EA7A 1AS2A 3QVUA 3EIQA 3EDYA 5DU2A 3TLGB 2QF7A 3O8OA 4MYSA 4JVLA 4PZLA 2DHCA 2IF0A 1ISSA 1QF9A 4IJMA 2RHTA 3GCXA 3MJCA 4JVMA 3RFXA 4CF7A 3AO0B 1AMOA 1XZPA 2VPTA 4QU9A 5AHRA 3K2EA 2R48A 3GMSA 2QNIA 5DW0A 3WLNA 4PG4A 2FMKA 2IW1A 5AW5A 1E3MA 2Z43A 2CLOB 2H65A 1TFRA 1XKQA 4FWTA 1Z0ZA 2JFFA 3GLSA 4J1TA 1EM6A 1MJHA 1C3LA 1HTWA 3PQ3A 1G5FA 4J29A 4F38A 2FG7C 3MPUA 1ZUNA 2CN1A 5LYJB 5BR8B 3B2QA 2FZCA 2W2LD 3RUHA 2ES4A 1FJGB 1YQQA 1EFVA 5CH5A 2WUFA 2F67A 3LHFA 4G0OA 4R9RA 4RETA 3SXUA 5KQLA 4EYOA 1ZCBA 3AB3A 1Q1ZA 1J09A 2QD2A 3OFNA 4L27A 1CS4C 3RIMA 3ZVNA 1HE5A 1N1MA 2RIPA 3AB8A 2HU8A 3AF4A 4W5JA 4GXNA 3RC3A 2PFSA 4LY0A 5DM2A 1XCMA 4HVAA 4DANA 2QMZA 4LXXA 4X1KB 1G9SA 4JV5B 5B12A 1YTLA 3BFVA 3DHNA 3GYGA 4UUAA 5B7GA 5CDFE 2WRZA 2FZVA 4IHJF 2V7VA 2ZSHA 4L8GA 3EGXB 5E6UA 1QVAA 4E5DA 2YVKA 4ZVRA 1CJBA 1MHPA 3UTCA 1W4CA 2C29D 2GBLC 4QTTB 2Z6UA 4OHOA 2R751 1IXRC 1R0SA 1RADA 4RBNA 3OQMA 2XIQA 4NBRA 1RAIA 3C5CA 3HWSA 3KSUA 1SCQA 5A4DA 2IUYA 1OT3A 4EW3A 5LU9A 2PR7A 1S9DA 3L43A 4TXNA 4U6NA 3UG6A 2FEXA 4C7BA 4MHTA 2FZWA 3OCCA 1HZZA 3H5VA 1QNFA 1RVDA 1W5EA 2ZSJA 5JDCC 4A8JB 2BCJQ 1W5TA 1CIPA 1EK5A 2ZLBA 3KB6A 3ORRA 1U8AA 5AKLA 1QJCA 1C7FA 3JQDA 4LDQA 2PSFA 3KTOA 1W49A 2XWSA 1KEEA 3N76A 3IMEA 2P1ZA 2H11A 3OECA 4HDSA 3U3OA 1OFVA 1OUMA 1T1SA 2D5BA 1PWEA 2GXSA 1HT2E 2PKRA 2WTNA 3G5AA 4GE0A 4NHOA 1H2FA 5JH7A 3OH8A 3I1JA 4BLOA 2ECFA 4FGSA 5C4IA 2P9HA 3DT6A 3N7AA 2Q9CA 3NHWA 1GQ2A 1QX4A 2X1MA 3KQNA 1C3OB 1EDBA 1Q1BA 1QH8B 2Q0SA 1ECLA 2QJTA 2XMPA 4I9FA 2J3JA 3JXEA 1DQPA 2BHTA 3CEHA 2RI1A 3FDFA 3RHSA 3I4LA 3FNHA 4WNAA 1T0JB 4UCWA 2F3PA 1RD4A 3T6KA 1I1OA 3AHGA 3ZZMA 4RTNA 5FWDA 2VDOB 3EZNA 3PQDA 3ZTTA 4L6CA 2RGAA 1QIFA 3LKVA 3BB1A 3K8QA 3VR6H 4BV9A 1NTRA 1P45A 1UC8A 4PSUA 2ZT5A 1NR7A 4NXNB 3ABSB 1YQTA 4QFMA 3K9NA 4A26A 2WG2A 4W5TA 3LWBA 2FEOA 3G2MA 4KAFA 5CFRA 4RMIA 2C5EA 3M9LA 4IIJF 1D09A 2QTMA 2R68A 2YNMD 2YIVX 3B51X 1YQWA 4B7ZA 3DWIA 3G8DA 4FGJA 4HWGA 1JECA 4XAQA 1DPFA 1ESDA 1RP7A 1IVSA 1GN9A 2BFPA 2EBHX 1MX9A 3E8MA 3RC9A 3TXXA 3A6LA 1XYGA 2GPNA 1L2TA 3FLBA 2AFHB 1LBTA 3LH5A 3RHZA 4EUNA 1E3SA 4G1VA 3EVZA 2R8ZA 3NZEA 4OFZA 1KJ8A 2B4AA 1G38A 3PD0A 3ED1A 3VR6A 4R3WA 3AINA 3KQLA 5K7SA 3AF5A 3JR7A 5J2TA 2ZIXB 1JIIA 3BIWA 4KE9A 3U19A 1BW9A 1N75A 4EIWA 2CVZA 1QVZA 2Q50A 3ZGLA 2ZM5A 1W1WA 3GXBA 1FDTA 2X9LA 4RIFA 4ZT4A 4E5PA 1PZFA 2YMMA 3BAZA 1FNCA 1U1EA 4R05A 5IVHA 1RWKA 1XT6A 3B1KA 1GITA 2VT2A 1ZIOA 1PD1A 1XHEA 2ZB3A 2PH7A 3GVCA 4ZANA 2MCFA 2PGXA 3WI7A 3W5AA 4RWEA 1IZ7A 1ZL2A 3GOHA 4AZ3B 4YQFA 3H2IA 3KVYA 3IUSA 1YFZA 4S1TA 5DCWA 4E5NA 5EJEA 3QMMA 1PJZA 3PLAE 4E07A 1ML3A 2PD6A 4L5BA 3U4AA 4HX9A 3JASA 2NLOA 3FG9A 4RCYA 1X1QA 4DLVA 4ZVUA 4E15A 1R4MA 2LTAA 4GR4A 2B30A 2ATEA 5IVKA 1P91A 1XTBA 1YBHA 3PKJA 3DC7A 3UY4A 3Q3IA 2C88A 3GVIA 3AVTA 2QPTA 4Q15A 3NHFA 3VKVA 2ORIA 2FU5C 4M6WA 5FNVF 2WSLA 5I4IA 3ZDQA 4GXRA 3WKDA 4BMYA 1OA1A 1KY2A 4D4MA 1FLVA 1IN4A 1HZZC 2DUNA 2YOFA 3B9PA 3S4YA 3ZHTA 2GPJA 3HV2A 3BMQA 1NF3A 1ESZA 1P7CA 1QVVA 3K30A 3MJHA 1X1BA 4BVFA 5GZ1A 3CRZA 1M33A 4I5IA 3HEBA 4GKAA 3I3OA 4UM9B 4KHZA 2BF4A 2EQ5A 3AERB 4WV3A 5FO1A 3PT5A 2XA9A 4QUAA 2YRXA 4FOOA 1U3TA 4CGYA 4XYEA 1M2HA 2H0RA 1G21A 2VHZA 2XADA 2FPLA 2R47A 1EWRA 5DRTA 5JJCA 4FONA 3NYQA 4EPRA 4JK3A 1ID8A 4HNTA 2W0SA 2FG6C 4BMXA 3TOVA 4EZBA 5FYQA 1QIIA 2VYFA 4MWGA 3M1AA 4LBWA 1VP9A 4Z1MA 2F8LA 1GDHA 3FTNA 5I45A 2IS6A 1Z15A 4EWLA 4AVYA 2HCRA 1L7XA 2Z3ZA 1JEYA 4ITVA 3BGSA 5CHYA 2NOAA 2YY7A 3CRVA 1AKQA 1XKLA 3Q10A 5TE9A 1E79D 1RRVA 1S2MA 3CF4A 3FHOA 3V8BA 4Z8XA 2X9NA 4D25A 4U2EA 4CEJA 5AVSA 1EG2A 4CM4B 3QX7A 4AG3A 4RKEA 4IQ0A 2AD5A 2R6GA 3FOAA 3PNLA 2HHJA 1PJAA 2G1AA 4LNAA 3OU6A 2O54A 5A9SA 1GUDA 3IKLA 4RDIA 4TVOA 3AHJA 3WGMA 3EXFB 4FMBB 4H7KA 4KSCA 4RJJA 4EF5A 4DSAA 1A9OA 2BFOA 4KGZA 4TM7A 5LXTA 1UMCB 3TGWA 1CUGA 2RH5A 1ZN2A 4K2HA 4M9RA 1WBDA 1QGED 3ZIUA 4CHTA 4A6EA 4BBAA 2X19A 1YU6A 4AS2A 4F4DA 3OLWA 1YR8A 2GHIA 2GVDC 4WFIA 1W0JA 4AS1A 3S2YA 1FNNA 2EL9A 3MK31 2A6PA 2P7HA 4YMWA 3RUEA 5KS2A 3CVYA 3PC4A 2GAIA 1G16A 4MJ3A 3KR9A 4EG6A 2FE4A 2WBLC 4GICA 1QH1B 4LJYA 5U4QA 1Z4MA 4NZNA 2YWFA 5IKEA 5JTUA 1UBTS 1QRTA 1I5RA 2HJGA 3BPSA 4UAVA 5EMMA 4N5DA 2ZSEA 1I3LA 5KYUB 5B1EA 1UWCA 4UUNA 1WW2A 4EHAA 3PEWA 3BK7A 1NRXA 1DADA 3COSA 3GRVA 1YDGA 4YHBA 1ZK2A 5JRZA 4EL0A 3N05A 2DFKB 3L1HA 4TLAA 1U0EA 5JSUA 1Y8AA 5LNK1 3L1VA 1QAQA 3PGVA 2FF7A 3EG9B 5CCDA 3H5LA 1SXQA 2GPYA 1HFWA 5LC1A 3BKWA 2I65A 2JJYA 4TUYB 2PLAA 3V8QA 2B4YA 1A0OA 1W2HA 2QUZA 3NKFA 3IALA 3QUTA 4KAXA 2AJCA 1QE5A 2IXAA 1E3JA 2GB4A 2ZB2A 2ON6A 3OE4A 1RBMA 3IPCA 3RYTC 3OPMA 4WKPA 5JNWA 2QT0A 3JD0A 1XVLA 3BEOA 2PUFA 1GG9A 5AVXA 1WDMA 4JLOA 2H4YA 3EXEB 3UIEA 4CKWA 4QU0A 2ASVA 3OU2A 4ZYWA 2B83A 1Z0DA 2P35A 3Q15C 3I5MA 3EYAA 1YZYA 3R40A 4GVXA 1RWMA 2JFGA 3FLEA 4RV4A 4ZRDA 2GYVA 1EA7A 3E7DA 4YAUA 4E32A 2H2AA 2OBBA 5BNZA 2UZ0A 1DAIA 3U9SA 3JAKA 4A82A 3OCWA 4LJSA 4A0GA 4BO1A 3G0HA 5IRCD 3ZQJA 4HNQA 1GLNA 4C0LA 3HZOA 4K3VA 4KXMA 4YYEA 4PNEA 1KTIA 1RWBA 3WNBA 4UHCA 1WPGA 2ZJAA 1E7QA 2DFPA 1N0HA 2AJLI 1BA2A 4Q9HA 1XTRA 1SKYB 1CVLA 3I37X 3VHXA 2PJZA 1SMKA 2WM3A 1G21E 3FRJA 2XMBA 1TM2A 3OKFA 3L92A 2PIAA 4RD3A 1QJ4A 1WSDA 5ABPA 2NVOA 4EUSA 1J1IA 4H1VA 2O1SA 4CT4B 4A92A 2YMQA 3EARA 3P2YA 3SPXA 2DH6A 4AN0A 4LBVA 4WAUA 3T5DA 3QOWA 2D5CA 3QI7A 1OF1A 4ALMA 1KSGA 4CLOB 4FD3A 1E1NA 1O1YA 4MUXA 5DBGA 4XKJA 1IIRA 5FLYA 5HKLA 2F1RA 2OY0A 3E2MA 3PWTA 3LPCA 4RCVA 3W90A 3LGSA 4HFJA 4PZ0A 3S44A 4ENVA 1Y34E 2ATXA 3MWKA 3R0IA 4JKIA 3U6KA 2VIIA 3EF0A 1NU6A 4YCAA 5B53A 4CV0A 3BJRA 4L5IA 4EY7A 1APBA 1H5UA 3WRWA 4BCBA 1NFFA 4F04A 3VQTA 1JLMA 3MWDA 4P84A 4RQBA 3L6EA 3PFIA 3DV2A 4BLWA 2FMHA 4ISBA 4OREX 4JP3A 3W06A 4KMRA 4G81A 4H0FA 4IZIA 4DLYA 4US2R 5K9ZA 1U1IA 4RZ2A 3OQJA 1ZUHA 1EFCA 1T91A 3KQQA 3M1LA 5GJWC 3H1BA 1NBOA 4YP7A 5AUOB 4QG3A 3FTCA 4MRRA 1BJRE 1U7OA 3PCRB 4GM1A 4Q93A 4ASUD 4C03A 2ZIVB 2JBHA 1W44A 2X5XA 3A1FA 4FJ1A 1XVVA 2O0LA 4DR2B 3C3PA 3I9FA 3JVEA 1B23P 1UBNA 4ZCLA 4MKRA 5H8WA 3QKTA 1KH3A 1X77A 2NIPA 1ML4A 3O3MB 3V4PB 3V7WA 4AJNA 1KI3A 3F9IA 1HO3A 3LTNC 5J63A 1G2IA 4LMAA 4AIIA 3KKOA 1VHTA 2BR5A 1NVVQ 1WDLA 4KVZA 4NIMA 4O63O 1ZJJA 3IOEA 4CIXA 3KP1A 1JAXA 3P2KA 1K6JA 1M10A 1NPYA 1Y82A 2FPIB 3TSCA 5FNZA 1A8IA 1JFVA 1PQYA 2R85A 3Q8XB 1XA3A 5IN5A 1HFKA 2QROA 1Q17A 3KQSA 1KP3A 4YRLA 2X14A 1UADA 3H9JA 3P96A 4RPJA 3PXDA 3P0HA 1FXWF 2PGJA 3HYLA 2R44A 1H05A 1D2CA 2CC2A 2LCFA 2F1OA 3D5EA 4K9QA 2ARKA 4EP1A 4GO1A 3ZXIA 3FWNA 1T26A 1KMCA 2IH5A 3NH6A 4TWRA 3FM9A 1US8A 2MYTA 2QLLA 1XFDA 3KYDA 1GGFA 4GS5A 3AT1A 2OBFA 5U1PA 4E51A 2GCOA 4BO8A 2YY6A 3OHSX 4IH4A 2IX3A 5IFLA 3NRBA 1RPJA 1QYWA 4D4HA 1OI3A 4EQZA 5C7IO 5JFOA 4REQB 3GQBB 1KZ7B 2DUJA 2VAWA 4OQLA 3QQ5A 2EARA 4QASA 4DWOA 1BQ3A 1K98A 1WVMA 1IEWA 2PG3A 3L4BA 3NYRA 4LKRA 4YUZA 3QKUA 4HDNB 3ZVKA 2JFOA 2WWYA 3GNLA 1BDJA 4E2FA 2Z09A 1KO5A 3ROKA 2A9VA 2WMYA 4KP7A 5HZHA 2C4KA 2G6BA 3TD9A 3CONA 3A6DA 1BEEA 5AICA 4PRKA 4C43A 1XZIA 4I6EA 4J43A 5FA8A 2Q7XA 4NZ9A 3RUPA 1ICIA 4RA9A 1H65A 2G06A 4MEBA 1FNBA 4FI3C 3U16A 2FW1A 2Q3CA 1FSSA 3AKCA 2NSYA 4OUKX 1TPYA 3ISJA 2G07A 3C6MA 4R2IA 5SY4A 5FR2A 1UJMA 3FTFA 3OZGA 1XUOA 4JNKA 1E6UA 2QMYA 3E5RA 3W9UA 4BOYA 1Z29A 5CYFA 5AI4A 3BRCA 4EYEA 2C94A 1LDMA 4YRDA 4URXR 1ETUA 3T5GA 4AJHA 3S68A 4Z7NB 5JMOA 2J3IA 1JFRA 5DYNA 3HP4A 2IYNA 5D2CA 1VG0B 2VAVA 1IWBB 2Z4RA 3AONB 4UKDA 1IVNA 3G02A 3DFZA 3SS7X 1ZHOA 4D0RA 4KI7A 2RONA 1JVSA 4R1UA 2GBGA 4K9MA 5HQJA 3SBDA 2HSJA 1W2WB 1HGXA 2WV7A 5HNKA 4K0KB 3RSQA 5FL7A 3HKEA 4KO3S 1L5GB 1A5ZA 4CDMA 3Q0TA 2CDCA 3M6XA 4EZIA 4PZAA 1ULZA 1JXQA 3FH0A 3MMZA 4OGLA 1RWPA 2F17A 4QTXA 4BU1A 1K5GA 1O9BA 1MJGA 2XH8A 4FEEA 2NU9B 4P4SB 3ENKA 3O8CA 4DMFA 2QLNA 2Z58A 2ZJ0A 3DEZA 1JDNA 2LZ0A 2QUHA 2VSOA 3BF8A 3DHEA 4U6QA 5JISA 4IS3A 1A4IA 5AT1A 4WNCA 1Z6GA 1UAYA 2E1PA 3DV0B 4JLPA 4BFVA 1JYSA 2J48A 3KKKA 1P18A 5IXJA 3WLEA 4DDTA 2ZXFA 1TNDA 2LDBA 2G7MC 3IBCA 5FBVB 2FUG6 4XI9A 4DA4A 4ZTZB 2ZVJA 4DILA 2IYOA 3PVCA 4ZAGA 1JLKA 2EWVA 3C3CA 4ZV7A 2GVNA 3A0UA 1YDEA 4YPOA 3ZX4A 2R66A 4ZU1X 3QU9A 3WNDA 3NX4A 1WNFA 1D2RA 2HF2A 2J3KA 3B82A 3Q87B 2GZMA 1M8JA 1T10A 4QYWA 5CGZA 5AJUA 1QKKA 1ZZGA 1EFPA 3TLYA 5CAEA 1E7MA 4MVJP 1Y9JA 1X13A 3FNFA 3RVJA 4CKEA 3RHFA 3HE3A 3Q2OA 2XV1A 1XCLA 3EQ7A 1L5LA 1T35A 3OPYI 1KXZA 4BN4A 1NWCA 3PU6A 2FGJA 4L73A 1AQYA 3W6OA 1GCOA 2WWHA 2ZI6A 3A1DA 3DOJA 1LWOA 1VCOA 4FN5A 3ND8A 4FEYA 1QFJA 4X00A 3X2FA 1EP3B 3NTXA 3OTQA 1POXA 2QTWB 3QNWA 1VYTA 4JJZA 3ENQA 4Z4CA 3ILYA 3AR4A 2JI9A 4KWEA 3P19A 2IU4A 3DXZA 2XDWA 2ZWOA 4BVLA 1KDOA 1ZA1A 2JLSA 3HDGA 5DSTA 2JIZD 2ZE7A 3WLRA 5CA0F 3OJFA 2RAPA 1FXUA 2ZB7A 1RW4A 3TNYA 3VGJA 4E4TA 2QDKA 1QGOA 1NBHA 4B6FA 4Z1OA 1EFTA 2WEKA 1FQWA 4NPHA 3BKXA 4ZALA 3SZGA 4IV0A 1QUFA 4HDKB 3L4BC 2EFEB 2C3OA 2QVGA 2VHWA 1MC8A 1LDYA 1X7WA 5FPYA 2H1IA 4IXWA 1EBUA 4X45A 3IAHA 5B3AA 4P0TA 1BEZA 3I28A 4WLOA 3RVLA 3VR3A 4XSVA 2BEWA 2W8BB 1L4GA 3ICPA 4N5IX 1BQ4A 1P4AA 2HMWA 1JKMA 2BHLA 2N0SA 3DTNA 5L4NA 1QMPA 2BEUA 3KZCA 5D01A 2HMUA 2WZCA 4WJLA 5BYAA 3RGWS 2PKWA 2MYPA 1MA3A 1H6DA 4H3HB 5IJ0A 4A5OA 3R9IA 4XTRA 1OXXK 1U31A 5TPWB 4B6EA 3CA8A 4QREA 1Z6PA 1GGMA 2ENWA 2RHDA 4BQOA 3ANTA 4YI5A 1RJ9A 4MA4A 5FBWB 3ZY6A 4GOOD 2Y2VA 3UQZA 2Z2ZA 4RGYA 5EUCA 5KNDH 3I8XA 4C0WA 3HN2A 2QRGA 2P5SA 2F3RA 4NBLA 3LL7A 1X8XA 3K71B 2W2PA 2XR1A 3RCBA 4I5DA 4LXHA 2H1SA 2C9MA 2HBYA 4LHYA 4P83A 1SQSA 1PL7A 3FKJA 3UWKA 2YCBA 2R8RA 4XDYA 1IN8A 1K97A 2A5GA 3VU3A 2P8JA 4OQ4A 1KDRA 4BVKA 1TF2A 4D7AA 1OR8A 1TK2A 4CM8A 3SHWA 2Y71A 2A5YB 3QBJA 1PGNA 3IP3A 2ZI5A 4BRSA 5HGXA 2W2QA 3AZQA 2VJKA 1M6EX 2VSQA 3DL2A 1J8DA 1YR6A 1E5VA 1L6RA 4NV1A 4KLZA 3THYB 3TECE 1QYDA 1ZI8A 1GTSA 3DFKA 3KSRA 3KXLA 3K1TA 4JBHA 1PKEA 2W58A 2VRBA 1RJFA 4G3XA 2D06A 4G65A 4XVHA 5CLQA 1AIPA 1XZGA 2BM1A 2LWIA 3F74A 3FWPA 1E6LA 4W1PA 1WXFA 2Q6VA 4HL6A 1FFXA 2WICA 5HKKD 5KNDA 2WY2D 1N25A 4FSDA 4AI6A 4X41A 2XF8A 1T8WA 4DV4B 1LS6A 1MQ9A 4EYGA 5DASA 5F76A 3V1NA 3GFBA 1Q0UA 3Q6NA 2Z6AA 3SSAA 3AEQB 3A4TA 3I76A 4EEXA 1UR5A 3HYTA 2LNDA 3ZU5A 1ZVJA 3VPFA 3B7GA 4WZAE 4ZN6A 1P9WA 1LEHA 1R9MA 4ZVOA 3TSWA 4EW2A 1RSZA 1ZC3A 3PDJA 1NVTA 2WV9A 1SZPA 4OTZA 4KNYA 3QLEA 5KOIA 5JCOA 3F6RA 1XEXB 4AKEA 1SKBA 4PFKA 4IO0A 2DBYA 4QD3A 4L0CA 3LDGA 5K45A 2GTIA 3E2IA 4OYYA 5D5HA 1H69A 2IBMA 1SXHA 3VR5D 1H6AA 3L2OB 4WZBB 1XN4A 1ZLXA 4PZPA 5MN4A 3CH4B 3FCXA 4P98A 1DKLA 1XRSB 4WXMA 4ZT5A 3JAWA 1GQSA 1X6VA 1P44A 1PHRA 1SCDA 2CJWA 1VPDA 2EGUA 3EA4A 3GNSA 3AR5A 3IEXA 1TAGA 3L8DA 3R0VA 4OYHA 4WFJA 5ERXA 1U0SY 3K16A 3PE6A 3SG0A 3ZE9A 4BFXA 4CQJA 3BMCB 2WILA 3UMSA 1SHJA 2I29A 4F96A 5I4BA 2XUKA 3JQAD 3DPIA 4QNRA 1QZ3A 4BX0A 4HQLA 3O8OB 4I55F 4UBMA 5M7EA 3E70C 5C46F 3UHAA 4TYNA 5FPSA 1Q3KA 5DCLA 1A9SA 1ES9A 3GZJA 2C5AA 1II8A 1T8SA 2WNIA 5AIAA 3W9SA 4IIHA 1KIAA 2J85A 2BMEA 5I48A 2C9YA 1ZL0A 1OGYA 3DVRX 4AZTA 4CZ2A 1FRVA 2PWYA 4M99A 4MQMA 1DBSA 3MT8A 1WKBA 5EC8A 2JLVA 3S8YA 1F8UA 3Q98A 1K6EA 5EP4A 1ZUNB 3T15A 2XW6A 3PCXA 3B36A 1KVSA 1EFVB 2ATIA 4HXEB 3FMPB 3GVXA 4M88A 1ETHA 2Y1GA 4M3NA 4ZVTA 1KAOA 5TSDA 3OWOA 3RIEA 1UBHS 1TO6A 3ETNA 2FZKA 5CIWA 4EX6A 3EC1A 3WQSB 4M7WA 1ODSA 2J5RA 3BXEA 3ZH2A 4B32A 3EF3A 4KAJA 1RWQA 2K5UA 2P9CA 4H3SA 3SXJA 3W3AA 1U8TA 4OA5A 2RH8A 4NJOA 2H0QA 3HB9A 5GJCA 3T52A 5FADA 2Q2QA 2Z8XA 4RLHA 3X3HA 1TUGA 1ZA2A 2JGNA 3FHJA 4PG5A 3NRJA 4MV9A 3C7TA 4DLNA 3JV7A 5B58C 1X7GA 2UXCB 2XGGA 4F5DA 3VMFA 1PV4A 4K6HA 3UCFA 3V1YA 3WL5A 3ZQ4A 5B1YA 3NTOA 2A5LA 4JDUA 1EQAA 1HWYA 3QVJA 4K28A 4S24A 4YQYA 5I9NA 1SIBE 3L7DA 3NJ4A 5LP1A 1HG1A 1RYFA 3EY9A 3WJ7A 3CUVA 2OOKA 5B7QA 3NHUA 3GDGA 2ZUDA 3PQ7A 1AKUA 1VE5A 2SHKA 4LQ4A 4LUCA 2X7XA 1ENZA 1M5TA 1J2EA 2LCQA 2ODPA 4UASA 2AQKA 1V5EA 4H1WA 5FFFA 3QKRA 1XZHA 2ZYAA 1NRIA 2Y1CA 3TQIA 2DJIA 4F71A 3H6GA 4UOZA 1Y8QA 2C2HA 3PL1A 1HNZB 4IOJA 4QOSA 3P9RA 5EIFA 3KZXA 4MWEA 3L6RA 5JQGA 4HDSB 2YFYA 2P40A 3DSRA 4ZZ2A 1IZYA 1GPYA 3FNBA 3G5UA 4GPAA 2OXTA 3AETA 4GOKA 4HNHA 4YR7A 5JH7B 2M2IA 3EMVA 4Q00A 4QTUB 4BMVA 1U90A 3STVA 4YCCA 4MVJG 5HCUA 3Q72A 3QXGA 2P1DA 5JCOC 3L5KA 2WKPA 4L8FA 3CJQA 2GM4A 2PD4A 2G83A 4B0OA 1K8YB 4DUPA 2NAFA 3QX3A 1Q3HA 3D0QA 2XGSA 4N65A 1PR1A 1WMFA 4J7CA 1ZH0A 4M9SA 4WNAB 3RU2A 4EHHA 4XRGA 4F91B 2R65A 4XXHA 3SQXA 2I6QA 1BX1A 1GR1A 2NZXA 1BDIA 1P2BA 3CQ9A 3D31A 4KLRA 2R84A 1I0IA 4H27A 4DCGA 4XWKA 3IEVA 4M9CA 1BWRA 1ZY2A 4DGSA 1DEHA 3OLXA 1W4ZA 2CLCX 1IVYA 1IB6A 3LQRA 2MMGA 4CF3A 2BFDA 4JR0A 5TDHA 5EHXA 1GNLA 4GQAA 4KQ6A 3BWBA 5A9RA 1RZRA 1O7JA 3O4RA 4UHKA 5J2UB 4N0DA 4WK0B 4K86A 3I9V6 1H2HA 4BIIA 3PR3A 4YN3A 5CB4A 3LY5A 3GT4A 4XD7D 5L45A 5FBLB 4B45A 5FOTA 1H5NA 1ZVQA 3P5BA 4LK3A 5MN6A 1ORIA 1EFDN 2BGRA 1I1HA 2PSEA 4MVJF 1ONNA 4GYJA 3HJAA 1CJUC 1ZR2A 4JY7A 3TX6A 4AJOA 1GSOA 3LP5A 1QGYA 3OWHA 2ZGVA 2D0OB 1D0SA 2XB2A 4MUFA 1E5TA 1E7SA 2QP3A 2X42A 3ECAA 1MVNA 3PUVA 1SHUX 5DO9A 3AVXA 1P7WA 1AKNA 1S3IA 4QFBA 4GWKA 2Y0DA 1IY0A 3MJRA 5J2TB 1JJIA 3TZLA 3V80A 4RTSA 2NNWB 1THZA 1BW9B 4I8DA 3KE8A 4EARA 1LB1B 3NVDA 4O4IA 4PQYA 1JIVA 4ND3A 1KE1A 1FYWA 3NRCA 4CR8A 1ZW6A 2EFJA 2VPYA 3VTAA 3C5HA 4DLPA 1N32B 4Q4DA 1DTEA 4QHTA 3BL6A 3FKSD 3HVHA 3V55A 3UV6A 4BX3A 3IB3A 1GFZA 2I71A 3VO9A 5KYWB 3VO8A 4S1WA 3BWYA 2J3DA 2FZGA 3DULA 1U04A 2R25B 2X8LA 4MRMA 4OCZA 4PVDA 5FULA 2X76A 3EGIA 4RIIA 3BWMA 4N9WA 3JASB 4LWPA 4KKVA 4E3ZA 1FYFA 2JZCA 4XB1A 1R4MB 2GZ1A 5C0OE 2GJ4A 3U4GA 2ZYVX 4HDAA 4HYYA 1EUYA 2FETA 1RI5A 1XU7A 3IIJA 1KC1A 4RH0A 3MEQA 1Y1SA 5CH3A 3U09A 3ITEA 1QR2A 2IRWA 3AF2A 3DTVA 4KH0A 4WHMA 1ZONA 2YL2A 5IAEA 3E9DA 4M38A 1NA5A 3GLKA 3KTFA 1EZ4A 5AKKA 1C0LA 4DA7A 5EIHA 3UXEA 5CA1F 1HRKA 4AWAA 3BMQB 4XUDA 1SVIA 1UEXC 2DPGA 2ZAMA 3HU5A 4LVUA 5DRYA 3WGHA 3UMCA 2AE2A 1PEDA 2HCFA 3ENWA 5ALJA 1XL0A 3MB8A 1PUXA 2PZBA 3PE4A 3LQKA 2CYAA 3FN4A 5CYOA 4ARVA 4BNNA 4DSTA 3G7NA 2Q4RA 2JLCA 1F1JA 2HCJB 1PQUA 4D9FA 3IT3A 3D5QA 1ATZA 3LLSA 2NACA 2DULA 1NUPA 1VPTA 2GERA 2EEPA 2ID7A 1RT9A 3O0TA 4PBSA 4DE5A 4BJ3A 4CMIA 3U13A 1W6UA 4W63A 3D4NA 3B70A 1TMKA 3FOCA 1AUXA 3TIXB 3ABOB 2G0AA 1NW9B 1M6WA 1JEYB 2WW8A 1V16B 4HDOB 3B7WA 1A69A