1UWCA

Feruloyl esterase from aspergillus niger
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
261
structure length
261
Chain Sequence
b'ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERULOYL ESTERASE A
publication title Structure of a Feruloyl Esterase from Aspergillus Niger
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 104
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uwcA00
1GQSA 3OOSA 1MJ5A 4J0HA 4ARBA 5K3EA 1JMYA 3IUQA 1SFRA 1CV2A 4DSZA 4BTVA 3I6YA 2XLBA 5AK4A 1Y37A 5D6OA 5AI9A 4OYLA 1THTA 1QIHA 4U2GA 1ORVA 3BIWA 1HKHA 4JUIA 1CIJA 2GYWA 1GPNA 2OQIA 3ILSA 2XMCA 5AKKA 1BCRA 3H17A 3VJMA 5YASA 1QIFA 2JGFA 5BWCA 3H2HA 4OYYA 2C5GA 3TEJA 1H2YA 1OCEA 3O95A 3QM1A 1XRMA 4KE9A 3A2NA 1AKNA 1E8NA 3S8YA 4E14A 4E15A 2OCIA 3V1KA 4X6UA 1DWPA 4EY8A 4NS4A 1CUAA 1MNQA 4B9EA 4HXEB 4G4JA 2C0PA 4J0JA 2XUGA 4BB0A 1UWCA 1UKBA 5HQ3A 2E3JA 3FVTA 4OB8A 4B6GA 3C5WP 3R3VA 4CCWA 1ZOIA 2VJCA 1N8SA 1JMKC 1XLWA 5C7YA 4DNOA 3A6ZA 2XT0A 3W9UA 1CPYA 1LPAB 4OPMA 1R9MA 1W52X 1AUOA 3I6ZA 1E89A 1C7JA 3RM3A 3PE6A 1K4YA 1MTZA 3I2JA 3CCCA 1L7QA 1XQXA 3WK8A 2RAUA 3VVLA 2WHPB 2JGLA 1UFOA 3VJKA 1BCSA 3WKEA 4H35A 3D7RA 3SC2A 3NGMA 3V9AA 2CUTA 5SYNA 3STXA 1NU8A 4AO8A 2AXEA 5A71A 4YX9A 3C6XA 4U2BA 1DT3A 1XZIA 5DNUA 3R3UA 3WMRA 3ZPXA 1LPSA 2AJLI 4QDXA 4B9AA 1BU8A 3H2JA 1XRLA 5ALEA 1CUBA 4N8SA 5CXUA 2XUQA 1W6RA 2JGKA 1XZAA 4DMCA 4KAFA 1OXMA 4EZIA 4Q34A 4LXIA 3QMMA 3WK5A 4PNZA 3AFIA 1YSCA 4GWLA 5LYYA 4DTCA 5LLSA 2B20A 3FYUA 1DQZA 4Z49A 2ZSHA 1CUWA 4X3CA 3JYHA 5ALJA 3V48A 5K3DA 4BC0A 2PU7A 1EB8A 5JZ9A 2EDCA 3I6MA 4CIAA 1XZEA 4BVKA 2YASA 3CN7A 3DCNA 1N5RA 1CLEA 3DS8A 4AO6A 1D07A 2VA9A 4HTAA 1G4HA 1UXOA 1HPLA 1XKLA 3QBJA 2XUOA 3EF3A 3MGAA 4A23A 5ALYA 1NX9A 5K3FB 4JYMA 1DX6A 2XLCA 3WK6A 1CUVA 2WU3A 1XFDA 2ZSIA 5AOAA 1AURA 1QIMA 3OC0A 1ZJ4A 5JAUA 4JEIA 4F60A 2GYUA 4CFSA 2YXPX 4LYEA 4L72A 3W04A 3R0VA 3STUA 5FDFA 2J3QA 4H7EA 4I19A 2VAXA 1H22A 1TCAA 4FLFA 5EHQA 1X70A 4WFIA 4W1SA 2IX9A 1BEEA 1MT3A 5HFNA 4Y2SA 5CT6A 3W06A 4UBNA 3IVMA 5AP9A 3PI6A 2GZRA 2X76A 2CEKA 5LZ5A 2DQZA 1WB4A 3WL8A 1EI9A 1JJBA 1ODCA 3WWOA 1P0IA 5KWJA 4W1RA 2O2GA 4IH1A 1XZCA 1IUPA 3LCRA 3R41A 5CTAA 4FLMA 2XMZA 1A8SA 4UPDA 2XQGA 3DJYA 1MAHA 1ETHA 4AO7A 4B82A 5HK9A 5CW2A 1B41A 4KEAA 3KWFA 3EBLA 1R9NA 4X85A 4Y2TA 5HF5A 2WKWA 2HDWA 4XX1A 1IMJA 1VA4A 4I4CA 4W63A 5DNWA 5EHXA 2V9ZA 3DOIA 4FWBA 1ZJ5A 1W1IA 4Y9SA 2OAEA 1UT6A 2RGUA 3FYUC 4GXNA 1YA8A 3GZJA 5C8XA 2PUJA 1IZ8A 1TCBA 5E4TA 5JASA 1R4ZA 5AK6A 1GGVA 4J0GA 3D5EA 3E1GA 5CH5A 2XQJA 3EIOA 2OGTA 2QUAA 2Q0XA 7YASA 2BGRA 5HQ3B 4S0XA 3VISA 5LZ8A 1MO2A 1WM1A 3HACA 2WJ3A 1LPNA 5ALKA 3LLCA 3AUKA 2I3DA 4FBMA 1IZ7A 5JIBA 3NWOA 2WIJA 2RIPA 3G0IA 3I1IA 4N8DA 4BAZA 2HA5A 5A2GA 3R3ZA 1M33A 2X8BA 5IH7A 4WFJA 2RI6A 4HZGA 3ZWQA 2DQYA 1LPPA 2WUGA 1O6GA 5ALXA 5IVKA 1HBJA 2QOEA 5JZBA 2QUBA 2HFJA 1LPBB 4G5XA 4BZWA 2WTMA 4U2EA 5EIHA 2WUEA 2PUHA 4L0CA 2HHAA 4QWWA 3G9TA 3G9ZA 3OG9A 5AIAA 2DFPA 2CBGA 5DYWA 1ZI8A 5EI5A 3C70A 1ZD2P 1XZFA 4H7KA 4B81A 4EHBA 2VJBA 4X93A 4RPCA 1JKMA 1DT5A 5KBYA 4CG3A 3HRHA 1ODSA 5JAOA 5ALWA 3IULA 1VOTA 1JU4A 1PFQA 3FYUB 1CUZA 4FTWA 3WLAA 2OCLA 2YYSA 1THGA 1VLQA 3IBTA 4N8EA 1EK1A 4WFKA 2XMBA 2OXEA 2PU5A 3IUJA 4BZZA 4IH9A 3STVA 3GROA 1UOQA 4FKBA 3C87A 1BN6A 1XZLA 4Q3OA 1C7IA 4GLBA 3C5VA 1YAJA 1QFMA 4MWTA 1DTEA 3R40A 2QT9A 5FP0A 4HS9A 1CRLA 1R88A 2WG0A 3QPCA 1A88A 2VJAA 4H0CA 5BOVA 1QGED 1J07A 4FBLA 1LLFA 5FRDA 3WWEA 4A5SA 2DHEA 1QIJA 5ALGA 2WIKA 5EHZA 2WFLB 4CG2A 3M83A 3ESBA 3WL6A 5D7BA 2RHWA 3SK0A 1UOPA 4Q82A 5EHNA 3BIXA 4A16A 2DHCA 1QIEA 1ORWA 1KEZA 2VT7A 5IKXA 2Y6UA 3AILA 1QIGA 5ESRA 2O7VA 1VKHA 5K3AA 1C4XA 4Y2YA 3F67A 2ZYSA 4PSUA 1AZWA 3HXKA 4X00A 5A6VA 1TK3A 4J3JA 1CFJA 4X71A 4UFPA 3QMWA 3F96A 4B0PA 1UZAA 3UUFA 1LNSA 4J0KA 4K2AA 2XE4A 1CEXA 4H18A 4UUQA 2PX6A 2AJ8A 3RKSA 2ZJ6A 3C6YA 1AGYA 2OCGA 4OU4A 3WKBA 1H2WA 1AX9A 3X3HA 1UOOA 2HA6A 3HJUA 3O0DA 1RWQA 2OG1A 3H1AA 4K6KA 3WWPA 1Z68A 3PF8A 5JANA 5H3HA 2WILA 3T52A 3FLEA 4PF1A 4X97A 4BP9A 4FMPA 2XMDA 4ZGBA 4AZ0A 3ICVA 4H7JA 4Y2UA 1BS9A 4BAGA 3VXKA 1QZ3A 2DCMA 3EQ7A 2OGSA 2ROQA 1HQDA 3G7NA 3R3XA 3GA7A 3AIOA 2H1IA 3D3NA 5AM0A 3QYJA 5JADA 3F9CA 3ESDA 2H7YA 3PDCA 2XMQA 3ANTA 1XZJA 3IB3A 4GEGA 2AJDA 3I2IA 2OGZA 5HF9A 5LP1A 2GBGA 4UHDA 4LKOA 3CCBA 3KDAA 5IVIA 1EK2A 3RARA 2C0QA 3CXUA 3FYTA 1YAHA 3QPDA 5AKGA 3H18A 4BRZA 1J06A 4W1PA 5HF6A 4BVLA 1EVQA 4OU5A 4NZZA 1ZD4A 4PQEA 4BDSA 1CUYA 5ALIA 4Y2RA 5FKJA 4X91A 4P93A 3U1TA 4EB0A 1DX4A 2PSEA 4UFOA 5BV7A 1QJ4A 3G9XA 1L7RA 2QVBA 1MPXA 2ECFA 4Y2XA 1L7AA 3WI7A 1QTRA 5ALRA 3BDIA 4LHEA 2XQIA 2WIFA 2Z5GA 4JH0A 3V1NA 3DKKA 1X2BA 5ALTA 4KRXA 4Q3LA 4KACA 3VDXA 2UZ0A 2VT6A 3A2LA 5EGNA 4B0OA 5C81A 5FV4A 1EHYA 2QR5A 4W1QA 5JALA 1CUGA 2R8BA 2EDAA 4NMWA 5I9IA 2WUFA 4B84A 4ZV7A 2JEYA 1LZKA 3AZQA 1P0MA 4HXGA 1CUSA 1WOMA 1K6EA 2C7BA 4BE9A 1YR2A 4KE7A 5BWBA 5DLPA 4UBMA 4UHHA 4HRYA 5AI4A 1R3DA 1PJAA 3UMJA 3H19A 1DWOA 1EX9A 2QXUA 2V98A 5AI6A 3WL7A 3HSSA 1UKCA 1AC5A 3H04A 4UHBA 3ZLUA 4DGQA 2PSFA 2ACEA 3F8SA 4H77A 4MJ3A 1KU0A 4UBKA 3O4IA 3BF7A 5CXXA 4FLEA 1LBTA 1F6WA 4OUKX 4P92A 4PSCA 5ALSA 2WSLA 2QXTA 3HI4A 1K5PA 3KXPA 4H7DA 3C8DA 3T4UA 1DINA 1K8QA 2I3ZA 1UK9A 2J4CA 1W75A 1USWA 1VZ2A 4UFNA 3HABA 4BVJA 3IIIA 3I2KA 1UK6A 4IH4A 3K6KA 2VAVA 4DSAA 4Q05A 4BAUA 1BEZA 5J3JA 1TKRA 1IUOA 3AIKA 3IDAA 1IVYA 1J2EA 1FFEA 2B4KA 3GELA 2HA0A 5CH8A 4B7ZA 1PV1A 4DLNA 4AX4A 2XMRA 3QVMA 4C88A 1WHTA 2G4LA 4FFWA 1GPLA 3WJ1A 4C4XA 2GBFA 3D4LA 3FAKA 4CCYA 2CJPA 1GT6A 4HAIA 4U2DA 2FX5A 1QO7A 3DD5A 1Q0RA 2XMGA 3BWXA 1XZBA 2WHQA 5EIEA 2ZVDA 4AN0A 4DNQA 5C8ZA 3WK7A 5AH0A 3VVMA 5JD4A 1CUHA 3ESCA 1MN6A 3I2GA 4WJLA 2G5TA 5AKXA 2V97A 4C6HA 5AM3A 2VF2A 1XZKA 3L1HA 5IVDA 4F5ZA 1T4MA 5AM1A 3BDVA 5JAPA 4B80A 2HU7A 1R50A 2BFNA 3GUUA 1CVLA 1XRRA 4ZXFA 3H2GA 1MNAA 2OQVA 4PSDA 1ZI9A 4X6XA 2YH2A 1GQRA 2ZYHA 3DLTA 4YK7A 1CUEA 1YASA 4GW3A 2WLSA 2XQKA 2BCEA 3FOBA 4J0DA 3WYNA 2JBWA 1ACLA 4CG1A 2PKYX 3FNBA 5HKBA 3OM8A 4GI1A 2R11A 3BXPA 1YCDA 4HXFB 3L1IA 5IVHA 3FLAA 5JD6A 2OLEA 5AO9A 4C89A 2C5FA 1LGYA 4N5HX 3WKCA 2Y2UA 3FVRA 4QDZA 4C87A 4MWSA 3DYIA 2D0DA 1SCQA 3O9VA 2HM7A 1H2XA 1JFRA 4C4ZA 2QS9A 3O4JA 2HA4A 5E4YA 4AMYA 3G9UA 3Q8WA 3M81A 4UHCA 5A7GA 4G9EA 1B6GA 3R3YA 1DWQA 2I03A 3PFBA 4BP8A 3BJRA 5K3BA 5CT5A 3I2FA 5JAHA 3ICWA 5T4BA 4MEAA 2J4FA 1UK8A 5ALQA 2HADA 4QWMA 2JGJA 4Y2QA 3WZLA 4I3FA 1EA5A 3AIMA 2JEZA 2XUJA 2WUDA 5ALFA 4EY4A 3C8HA 2WHPA 4U2FA 4C01A 4EUSA 3P2MA 4CIBA 2BGNA 3AINA 5DYTA 5C8VA 2ES4A 2XUFA 1CUUA 5KREA 1JJIA 4AZ3A 3WJ2A 1ODTC 1JT2A 3D2AA 2XI4A 4GDMA 2XUDA 2XMSA 3G0BA 1QIDA 5LZ9A 3KOOA 4DMKA 3S2ZA 1QE3A 2QJRA 1A8UA 4P9NA 3FLBA 2BJHA 1HL7A 3WK4A 3C43A 4IHAA 2JGMA 3GBSA 2O7RA 4TVKA 4DMHA 1ZI6A 1HLGA 1EXWA 1DQYA 4FFVA 1FFCA 1WCYA 1FFAA 4DIUA 4ZREA 1XZDA 4AMZA 3ZV7A 3KSRA 2WG2A 4WY5A 2K2QB 2XUPA 1Q0ZA 1TQHA 4FNMA 1XZGA 2HA3A 4QDUA 5JZSA 5FLKA 3C45A 4FNGA 3W9BA 5AKHA 5FPPA 1MU0A 1N5MA 4Q1VA 3AJAA 2WM2A 5JATA 4X95A 5K3CA 1U65A 4G8DA 3MUOA 3Q0TA 1LPMA 4G4GA 4HVTA 2ZYIA 1CUXA 3B12A 1FJ2A 3SWWA 3BE8A 5ALZA 1E66A 2ZJ7A 1OILA 2BAGA 4KE6A 2CKMA 4ZI5A 3FWHA 1I6WA 5JYCA 3W05A 1WB5A 3F98A 1SC9A 3HLKA 4X94A 3DL7A 3FCYA 5DTJA 5K3FA 2H7CA 1A8QA 2EEPA 4WCVA 1TRHA 1YS2X 5D3KA 3G8YA 6YASA 2QRUA 2Z8ZA 3G0DA 2P8SA 4W9RA 3PF9A 2Y1KA 3I2HA 2ZYRA 4WDRA 3O9MA 2H9YA 2RONA 1BE0A 2JF0A 2IIVA 5AKLA 3U0VA 5A7HA 1XQWA 5ALHA 3M82A 5AKEA 4Y2PA 1FFDA 5K5EA 4OD0A 3IURA 1E3QA 3MVEA 3OPMA 3BJMA 5ALOA 5AK3A 1DU4A 5AJHA 4UBOA 4M0MA 5DWDA 3KWJA 1Q84A 4V2IA 3ZI7A 4QA9A 1ISPA 3CN9A 2FUKA 3BL8A 5SYMA 2PSDA 4DNPA 2VQ6A 3D0KA 4L9AA 4LXHA 1NU6A 2WHRA 4QE3A 1Y7IA 3WKAA 4UBLA 2QJWA 5LZ4A 1W4LA 1JU3A 1QIIA 4DM7A 1WB6A 5A7FA 3B5EA 1RYYA 3QMVA 1Q83A 3R3WA 1BROA 5EFZA 2HA2A 4BBZA 1ZGCA 4DMFA 2AJBA 5LZ7A 2IITA 3HZOA 2VTVA 3O4HA 5HK8A 4QDOA 5LZ2A 3PFCA 3D2CA 1H23A 3WWDA 4K5QA 1FFBA 1LBSA 3IUMA 5CT8A 2PL5A 1TIBA 3H2KA 3GFFA 4QEKA 3STWA 3V1MA 4X92A 2C58A 2WFZA 1HDEA 1QONA 4ETWA 2G63A 3FSGA 1XQVA 1SOMA 1ACJA 2WJ4A 2LIPA 3HYSA 4RGYA 1F8UA 4WDQA 2WTNA 3N2ZB 2DHDA 2HU8A 3F97A 1N1MA 4BTLA 3WIOA 1CUCA 2QZPA 3H0CA 4NVRA 3W2TA 3AZPA 2XUKA 3WZMA 3WYDA 4AB1A 2XUIA 2JIDA 5AOCA 2B9VA 3WL5A 4F21A 2WU4A 4EY5A 4PO3X 3G0GA 1QO9A 4KAJA 3WA7A 1YB6A 1H2ZA 3A2MA 3ZLVA 2GBCA 1MX9A 1ZICA 4G4IA 5AICA 4QZVA 1VE7A 3LS2A 5CURA 3ZLTA 4DYHA 4LIPD 1BN7A 2Y2VA 2OPHA 5CH3A 1R1DA 2FJPA 2HFKA 5ALMA 3AZOA 5AKZA 2BUBA 3E3AA 3FBWA 3DKRA 4KE8A 5AM5A 3RK4A 1S8OA 4MXDA 2O2HA 2AJCA 4RE6A 2I78A 2NW6A 1XZHA 5AHXA 4EBBA 2B61A 3DQZA 1GZ7A 3PICA 4GHWA 5HZGA 1E8MA 5HFAA 1QTIA 4ITVA 2VEOA 3D59A 3LP5A 2QKYA 3MUNA 4YPVA 2VATA 1AMNA 4FDMA 5AOBA 1GKLA 2DSNA 3K9BA 4HRXA 2CMFA 1GPKA 1P0QA 3BF8A 3I28A 5AI5A 5DJ5A 2JGIA 4MQLA 4FOLA 2JGEA 4E11A 4PW0A 5ALNA 4JYPA 4EY6A 5AKJA 5ALDA 3QPAA 5KWIA 2BKLA 3B3QA 4O08A 1CR6A 4C4YA 1CQZA 4K6HA 3VKFA 4Y7DA 1GXSA 2BUAA 3YASA 2PM8A 4U2CA 3LIPA 2WFLA 1XRQA 4BCBA 1YA4A 1VXRA 3A70A 2PPLA 5ISMA 1WHSA 3EQ9A 5LIPA 4X90A 4QLOA 3HC7A 4N5IX 2XB6A 1W76A 1VZ3A 2XUHA 1BRTA 3WK9A 2XQFA 1O6FA 5CT9A 1E5TA 4GECA 3STTA 3QITA 1G5FA 2WFMA 5HKAA 5ALVA 3EQ8A 4J03A 4F0JA 1SCIA 3IA2A 4BYMA 1ZGBA 4J0CA 3QZUA 4YASA 3WIBA 5AKIA 1CUJA 4BATA 2PSHA 4X6YA 1VA5A 3C6BA 4XJVA 4DNFA 2ONCA 1MX1A 2HU5A 4Q3KA 5DTIA 3WA6A 4RE5A 1MX5A 5T4HA 3SX4A 3FSGD 4AN1A 3H2IA 5EIAA 4ROTA 4MYDA 2WIGA 4INZA 5HCUA 4KJXA 2XDWA 4H7FA 1U2EA 2GYVA 4AXBA 4ZV9A 1KU6A 3UUEA 3NUZA 1UK7A 2VJDA 2VSQA 4KAAA 3DYVA 4M0EA 1UKAA 1XROA 3QH4A 2H7XA 2CZQA 1EB9A 2J3DA 5JARA 5ALUA 3PUHA 1YS1X 4BCDA 4QDTA 1EDDA 1VE6A 3C6ZA 2WQZA 3LIIA 1QLWA 3O4GA 3VJLA 5AIBA 3ANSA 4MEBA 4H7IA 1P0PA 4P08A 1QOZA 2W6CX 2V96A 4XWGA 3DNMA 5CMLA 3ESAA 4MQMA 2Z3WA 2HL6A 4KYVA 1U8EA 4BDTA 1TCCA 5AKYA 5AI0A 1EDEA 1XKTA 3E4DA 5FPQA 1EVEA 1U4NA 3L1JA 4BCCA 2ORYA 2O2IA 4G9GA 4K6GA 2Z8XA 4MYSA 3D2BA 2HA7A 2Z3ZA 1LZLA 1XRPA 1WPRA 3K2IA 2Y6VA 3WWCA 5F4ZA 2QMQA 5DNVA 1ZD5A 2HRQA 5AI8A 4OB6A 1CUFA 1AQLA 4RNCA 5HF8A 4PV7A 1ZIYA 5CT4A 4LYDA 1YB7A 2W22A 3NOXA 4UHFA 3PUIA 1Y7HA 2FJ0A 5FOQA 5T4EA 4OCZA 4BRSA 1EH5A 1F0NA 1ZIXA 3N0TA 4J0IA 5D3ZA 3H1BA 2ZJFA 3ED1A 2D5LA 4G8BA 3DDUA 3KD2A 5JD5A 4LXGA 1K63A 4Y2VA 2HRRA 3JW8A 1VJ5A 3STYA 4G1FA 1QIKA 5CBKA 2X5XA 3E0XA 4KRYA 3DL4A 2RHTA 2WIDA 4IQ4A 2GBIA 2GZSA 3TRDA 2QM0A 2WG1A 4FHZA 5DYYA 2PVSA 3WQHA 4B83A 1XLVA 1VXOA 4JNCA 4M0FA 5T4FA 2XUAA 3V1LA 2HIHA 2PSJA 1IUNA 4EA6A 1EDBA 1G66A 4XIIA 4ZWNA 3WKDA 5I8PA 1LPOA 2PBLA 5E2IA 4E46A 2C4HA 2G5PA 2OAGA 1CUDA 2CB9A 4BC1A 5FXMA 1XRNA 1GKKA 5ALLA 1MAAA 1QFSA 4GBGA 4UHEA 5LKRA 4UBIA 3RLIA 4QLAA 1FSSA 1XZMA 4H7HA 3HEAA 5FUMA 1CUIA 4X7BA 1F0PA 4OB7A 3TJMA 3G02A 1J1IA 1TAHA 4KR0A 2QTBA 4WY8A 1X2EA 1A7UA 1JI3A 3G0CA 5AM4A 3TGLA 1CQWA 4Y2JA 5CRIA 3JWEA 4OSEA 4IO0A 3OURA 5I7UA 5LKAA 4B85A 3FCXA 4EY7A 1SCKA 3DEAA 4D9JA 4TPKA 4J7AA 1WPXA 5AM2A 1E8DA 2DR0A 4L3WA 4G8CA 1EINA 4BE4A 3M3DA 1XQYA 4AQDA 2ACKA 3DOHA 4CCYB 4XVCA 5A62A 1XLUA 2OCKA 1ZD3A 4ZRDA 1G42A 5AK5A 4ARAA 5E4JA 2BUCA 3I1YA 3OTQA 1T2NA 1JJFA 1RP1A 5ALPA 4TGLA 4QNNA 4UBJA 2WJ6A 4CI9A 3IUNA
chains in the Genus database with same CATH superfamily
4K9QA 1MOSA 2QZ4A 4ZCPA 3D81A 2PGDA 1GRVA 1OBOA 2CDNA 4R2WA 1T6ZA 1QMGA 5HFJA 4J0HA 4YRQA 4KWTA 2P4QA 1NA5A 4GM0A 3U44A 1NJ8A 2QD3A 2X42A 1T2CA 1DXQA 5K3EA 3KUXA 5EA2A 2D3TA 3GA0A 5JCOC 1PLLA 3BAZA 2OZKA 2XH8A 4CF7A 3ERCA 4DSZA 1WCXA 2AG5A 2QDKA 3QYPA 5BPHA 4BTVA 5IJWA 3C74A 3I6YA 4GXQA 3ROMA 5F9HA 1G5RA 4Q12A 4M0LA 1KNXA 1TAQA 5TV2A 5B7QA 2VJQA 1ZM9A 2FPMA 3KDPA 1G8SA 4KUGA 3Q9UA 5E1OA 5EJ9A 5KPJA 3CONA 2D62A 2PR2A 4XQ0A 1XEXA 3KPYA 2AI2A 2JCBA 4J4TA 4FGWA 1SB9A 4OYLA 1OXKB 1X1BA 3H86A 5BOSB 1TX4B 1S02A 5F7XA 4O8CA 4I8IA 4V2UA 1CYEA 3WP0A 2G4VA 3M4XA 3PWTA 5EKSA 2BFDA 4RW0A 5FPYA 4C2UA 2Z98A 2ATXA 4E30A 1VMAA 1GGEA 4OHPA 3T1HB 5IJ0A 2ZOSA 4F85A 2IH2A 4MYRA 1HKUA 3GRAA 4U0JA 4LBYA 5FOSA 3THWB 1CIJA 3R6LA 5FUWA 3B1KA 4FFOA 1M2NA 2FWAA 3RVSA 5KHLB 3VJMA 3C5HA 1Q16A 3HKBB 1QIFA 4GMFA 4QQFA 4RZHA 1WP4A 5YASA 4GH5A 2E4AA 1SQ5A 2YN0A 5BWCA 3URMA 1SKAA 3L49A 4MWBA 4OVKA 2BISA 1GFWA 1U80A 2JJ1D 2R5FA 5DN6A 4BB6A 4W5QA 3RADC 3O95A 4KE9A 3I62A 2OK7A 3A1VA 2LBPA 5H0IA 5AHRA 4JWTA 4CN9A 1DC4A 4TV8F 4E15A 2OCIA 1FSFA 1SXJA 4Z1MA 4BNDB 5LN1A 1WCIB 2JVKA 3AQ4A 3D02A 3DFMA 3A9TA 4GLJA 1J8FA 2Y0BA 3WSTA 3UOGA 5HE9A 1M6WA 2JA1A 2OO5C 3ENQA 1NQWA 3PZBA 3QEMB 1I94B 1KORA 1SQFA 2E1PA 1DXHA 4JLNA 1MIHA 2XCSB 2ZTSA 1N2OA 3JWHA 4Q4HB 1BE6A 4B9EA 4L76A 3RS7A 2C2KA 4HXEB 4XE5A 1QAQA 3HFSA 1SCNE 2DFKB 2I7DA 3LKDA 4HAYA 4JL6A 1P1HA 4LWZA 4PQGA 5TSDA 1YDGA 1TC1A 4A0RA 1OZAA 4B5LA 4B3RB 3BJIC 1ZVQA 1DZ3A 1PK8A 3B78A 3H16A 9LDBA 1BVRA 4PY2A 4BB0A 5BNWA 2QROA 4HDSB 4LBZA 1UKBA 5FOWA 1FVFA 1I4LD 2OZPA 3FVTA 1Z34A 3C5WP 4OB8A 4B6GA 3Q3IA 5JI3E 1LQ2A 1C0IA 3OEYA 1XNQB 1HY3A 3DWEX 3ZXUB 3TQOA 5I45A 2H2FA 1TVEA 1GG9A 1JMKC 4YJGA 3U60B 3GCGA 1VYHA 2Z95A 1DPGA 3MLAA 4EYQA 1UMKA 3UV6A 2B2XA 1BYIA 4JJ8A 3M6FA 3PNMA 4OPMA 2VT2A 1R9MA 1WNTA 3F6SA 1T5LA 1US8A 3K6JA 3CB2A 3TVDA 2CVZA 1KTIA 1BXGB 2R84A 4FFRA 1AUOA 3OCXA 3K0SA 1JHYA 3B36A 1M67A 3TSCA 4BP1A 3V7YA 4MYHA 1HYEA 2ZRCA 4G37A 2E55A 4AJ9A 3IPCA 5IAGA 2NUTA 2C4WA 3CCCA 5FJJA 1L7QA 3WK8A 2QMHA 1H1TA 1U1DA 3LQ4A 3W77A 5IC4A 1A9YA 1RM0A 4K3VA 2FRDA 3VVLA 4XW2A 2HJRA 1PJBA 2IHKA 3O8OB 1RXUA 2IPNA 4W8GA 5HA5A 3VR0A 1DBQA 1O97C 1RAHA 3DE2X 3H5VA 4HUQB 3WKEA 4EUFA 4LG1A 1XWFA 1VM6A 2PT5A 4J3FA 2J6IA 4JLAA 4LDQA 4WOCA 5FOTA 4KN6A 4CDNA 2ATEA 1KAHA 3ZG6A 5FUVA 3NBFA 2KPOA 2CJWB 2YOHA 2A0KA 4QJ4A 4F84A 5KVCA 2AXEA 1D4AA 1GNSA 2IZ7A 3KT6A 5CVTA 1E6CA 4UW9A 2V6JA 1L8XA 1SXIA 2ORWA 4R1TA 3G0OA 4N6NA 5KNLA 1YRYE 3K9LA 1SBTA 2R9VA 4U2BA 1T5SA 3R6DA 1KBOA 4JJFA 1E0DA 1NIPA 1LVGA 3OTHA 4ND1A 2X9NA 1VCOA 4OXQA 4S12A 2C8KA 3U61B 1KI6B 1ZW1A 3MCZA 4HEQA 4Z4QA 1N1GA 3ZPXA 4IHJB 4M83A 2CF6A 1LPSA 3TZQA 3IOYA 4LKRA 4DADA 1BU8A 4KIUA 3LSTA 5KSWB 4I1VA 4F04A 3W8EA 5JWHA 1XRLA 3JR3A 2P77A 5I4CA 5EYPB 1F1JA 5IYZA 4ZMBA 1K92A 3QE2A 4PM4A 3P0HA 1XZAA 4KOEC 5IUNC 3MSCA 3SZRA 3EDQA 1MPTA 1R6TA 1WQ4A 2DETA 2G40A 4LC0A 2IH4A 2AF3C 1OXMA 1OSNA 4NYJQ 3BMOB 1TOAA 2L0XA 5EUQB 4EZIA 1RXSA 1GGJA 1U0TA 2BTQB 1Q14A 2PGOA 1LV8A 2PMKA 3NRJA 1IM8A 2W48A 3E7PA 5T3UA 4LVOA 2PFKA 3WK5A 1AK9A 1RSZA 3K32A 4Q15A 4PNZA 3AFIA 2CEAA 4ZEVA 2W11A 3HB4X 3DEYX 4GWLA 3OJFA 1GUBA 1EHIA 4O1MA 3V3KA 3MINB 4ZCQA 3GJRA 4W7IA 4ZP1A 3CISA 4HZUA 4EHIA 1CZKA 2E5WA 1Z2CA 1ZOLA 2PMCA 4RTSA 1K9SA 2MSEB 1Z2NX 4P2GA 4E2WA 5J47A 5BMOA 1SAYA 1IN1A 5EERA 4X3CA 2GF0A 1MO6A 4JD5A 5K3DA 2CB0A 3ZNNA 2RH9B 3BGIA 3CR3C 4JA0A 5JR3A 2GO7A 4XCQA 3WGNA 2Q5IA 2QUJA 3T0IA 1P7WA 1RPAA 3CPEA 2QN3A 3LW8A 4UD2A 4OQMA 4YWJA 3A27A 3RC7A 1NWCA 3X1XA 1WIWA 2EDCA 5JZ9A 1QV6A 4QRHA 1T6XA 1FX0A 4UUMA 4CIAA 3S4YA 4UREA 2F8LA 2B8TA 2GVDC 2IXGA 2XA2A 4G2TA 4N3NA 3CN7A 3DCNA 1XL1A 3L1KA 3R7NA 4C05A 1OH5A 1NVVR 4ESVA 1EFTA 4M46A 1XE3A 2Q1WA 5K8UA 2PL3A 2VA9A 4HTAA 4MUHA 1C0LA 1FJXA 1G4HA 2IX3A 1JLKA 1UXOA 4HAWA 1WXXA 5BQFA 1KY3A 1HPLA 2RSLA 4NZOA 3VTZA 4DB4A 1L4EA 3DLCA 3GFSA 2QN6A 3N86A 1JDSA 3TWOA 3ZXYA 3PC3A 2JFVA 2VZ0A 3IPRA 5B37A 1CR2A 1D4FA 3WAGA 2FEPA 3W0LB 3T9EA 3NLLA 4NFHA 3OCZA 2RGRA 2RJNA 2GLTA 1V5GA 2W93A 2X4DA 4G9BA 4YECA 2IZ1A 5ALYA 5A3SA 3USCS 3W5UA 4DRXA 4YRZA 1NX9A 2JAXA 3QSGA 1DDIA 4WEQA 1GL3A 4XVRA 5JNRA 4K9MA 3UPDA 2FPLA 4TWBA 5HM8A 1TVMA 2AQHA 2W2TA 4P2BA 3W5JA 2IY9A 4IQ0A 2WZBA 4P33A 1I0LA 4JLSA 2GM4A 1CUVA 3EDRA 3PS9A 3C97A 5DX1A 4HDMB 2WU3A 5G40A 1ODJA 1UDAA 1VSQA 1RW4A 2ZSIA 1XHFA 4OGWA 4CEHB 1JALA 5J4HA 2SNIE 3KR0A 1AXRA 3VHLB 4M3NA 1H9BA 3VR2A 1WTAA 4PFJA 5CM2Z 4G09A 3AQIA 1BMTA 1OBHA 4U5XA 1NAIA 2CZCA 3UV3A 5CEFA 4N48A 4V1CB 1VMEA 2GYUA 3EUWA 4UASA 2Q2VA 3RBAA 3LPMA 8ABPA 4PRYA 3KETA 2V7GA 4FKZA 3TRKA 1VC2A 2YMMA 4B3JA 1P73A 4J4HA 1PVOA 5E3IA 2VQ3A 1JEQA 1TK2A 3FCAA 4L8VA 2P0EA 1P61B 4KPGA 1RD4A 1CNFA 4PC2A 5DN6D 1ULHA 5FPHA 1RC1A 5BSWA 2APJA 1OX6A 2HQSA 4FLFA 5C9ZA 1Z2DA 2PKEA 4BFWA 4DZZA 4U3JB 2L19A 3M8KA 4WFIA 3H97A 2G80A 3QWAA 2YVKA 3F78A 4RJJA 4XH9B 4PO1A 2MYNA 4TWIA 3V55A 4DMLA 1HTBA 5KNCA 2VHYA 3CNNA 2VA8A 4HZIA 1NV9A 5HFNA 3H1FA 3SICE 4IDEA 5G41A 4Y2SA 1CQIB 4ZRNA 5CB0A 5L51A 3ZGLA 1M76A 4JELA 3ECCA 1OLUB 5LA6B 1T4BA 2GZRA 4BTEA 4R8SA 1OA0A 5LZ5A 2AUNA 1WB4A 2DQZA 2NO6A 2QL9A 2EWMA 3VGPA 3WL8A 4ARVA 3LOQA 5ED0A 3UFXB 2IVZA 3WC4A 1NJ1A 1JZSA 2H6EA 2J7PA 4HFMA 5CW1A 2HBQA 3SM3A 4FCVA 1KJYA 4O4LA 3H99A 1C9JA 7AT1A 4ZI7B 1ZSYA 2O2GA 2VP2A 1OVMA 1XZCA 2IUEA 4ON9A 3ZEIA 2XB2A 2ODEA 2V9CA 2VTKA 4JL8A 2PZFA 4WH0A 4DCJA 2FWMX 3A1WA 4G23A 5IAAA 3I5XA 2GSDA 5ILGA 1JWLA 3C3CA 5IJAA 3ZY4A 3OSUA 1U6IA 2XSZD 5DSTA 3KFVA 1DNPA 1IC6A 4JJGA 3VA7A 1OXTA 3DJYA 1MAHA 1ETHA 1OWOA 4AO7A 4CBVA 3DBOB 4K86A 4UNPA 1ZU4A 3CZCA 4PYQA 1E6WA 3GFPA 1OT5A 2HZ7A 3AM5A 3CX4A 2MMGA 4MAAA 3W90A 5L53A 1Z2EA 1WU8A 3K0AB 3QV2A 2JDID 3DAYA 1WEHA 1BIFA 3KOWA 3LWZA 4JP3A 1TYBE 4IVNA 3E7XA 3UN1A 4LEIA 4Y2TA 3SD7A 3WXMA 4EJSC 4E0BA 5A06A 2WAYA 1CZNA 4QC2A 5DN9A 3DDNA 4Y6SA 3WGUA 1G6HA 1WJGA 4FI3F 4I1SA 5DHSA 1U0EA 2Q6TA 1RPZA 1VHTA 3DEJA 4EG6A 2I3AA 3LI2A 1DFIA 3B20A 3C3XA 4I2NA 1KC3A 1SUIA 4CMEC 3MFQA 4MDHA 3AVOA 4IMIB 4C07A 2H2AA 4IINA 2B34A 4MR8B 1PJ3A 1ZJ6A 1PYGA 4BNUA 4C0AC 1W1IA 3ZZ0A 2OAEA 1UT6A 1WX1A 1KAGA 3BWEA 4O4JA 4YJDA 4EX7A 1OV4A 4E5SA 2A1UA 3AONB 2RGUA 3NFYA 3Q7EA 2P9BA 1JDPA 4LC9A 1YT5A 4NONA 2K7ZA 4MS4A 1M0EA 2YMQA 5AUOB 3TNJA 3GZJA 5CNIA 5DULA 1VPEA 1R0LA 2GQ0A 1IZ8A 2H5JA 2VKQA 1ZK2A 4MQ5A 4FHCA 4JITA 1JVBA 2VDWA 5E4TA 4WIAA 1C3JA 1VJ1A 4LYYA 3ZV6A 2WVAA 5K8JB 3I45A 4KPFC 1SOVA 5IN5A 1G38A 1D6JA 1YMQA 1GGVA 4J0GA 3D5EA 4EGFA 1BWSA 3LH5A 1J39A 5TGTA 2YCLA 2J9ZB 3PRHA 3P9PA 1C30B 1RM5A 1VYUA 4H59A 3OJEA 4OP3A 3P0JA 2BGIA 3L1UA 4X8HA 2XQJA 1Q1NA 2ID7A 5DCYA 3WGJA 2V7UA 1YB5A 3PTZA 3RREA 3USZA 4TT8A 3L8FA 2QUIA 1MO5A 2CLIB 2WWHA 3L41A 2HMTA 1X7YB 1AQYA 2R6FA 3NHLA 4KODA 3VSCA 1QAMA 3QV1A 3WRYA 2FR1A 2WWVD 1G7RA 1FP4A 4PRZA 4F6RA 3S55A 4C0BA 4FE7A 3GP3A 4QJ5A 1NYRA 1XI2A 2Y1WA 3RVQA 3FTFA 1HUQA 1IZ7A 1JA0A 5JIBA 2WIJA 4EVSA 3G0IA 3I1IA 1AU9A 1FNBA 3HZHA 2P6UA 2KI5A 3LA8A 4N8DA 3GGDA 3I9NA 3UHJA 4YR7A 1UJBA 5A2GA 5CDUA 4OHYA 1M33A 1AZSC 1TE2A 1CS4C 4GC9A 3TLZA 1ZSNA 4WADA 2XWQA 2YXEA 1W85B 2IEBA 3CNHA 3UFBA 3OIFA 3SIWA 5LM3A 4PFSA 4XQ9A 3MTEA 3MWYW 1UH5A 3QVGA 5H3LA 3VH4A 3NBUA 1E3WB 1LPPA 3PHCA 5EINA 3S2SA 2CZGA 1QWOA 4B6EA 3U7RA 1E62A 1Y48E 3ILVA 4ACBA 2J6BA 3FZEA 2CXXA 1U7TA 3PD1A 2Q45A 1XVIA 5FF9A 3GUHA 1BHJA 1OWNA 3F0TA 3OTGA 3ZC3A 3F5QA 5BNIA 4FDAA 2BGTA 2AFHB 3CV3A 2IIPA 2WICA 1EQUA 2XAUA 4AJOA 4ZAGA 1XMXA 4PAQA 4Q1DA 2B7CA 2LDBA 4C6TA 4BO3A 2QSUA 3BWCA 1F6BA 3RRFA 3JQAA 2WUEA 2QD1A 2R44A 2W4MA 4JR0A 1BEUB 2VO1A 2HHAA 5F23A 3AVTA 2BBWA 4RA9A 5F7JA 4BMZA 4M9SA 2COUA 1XRSB 4QXOA 1IEQA 3FPFA 2OCDA 5AIAA 1A04A 1EFPB 2C95A 2DFPA 3IE0A 2DR3A 3AR4A 3UC5A 1YRAA 4AUMA 3C5CA 5DCWA 5EI5A 1B00A 3C70A 3QLVA 4P80A 5AW5A 3V7NA 1SHZA 4MCJA 3WIDA 1BMQA 4FI3C 1N77A 5TQ2A 4FS3A 4EO7A 3VYSB 1LX6A 1VB3A 3JZFA 3NBZC 4R7GA 4B81A 4IRUB 3GO4A 3LZCA 2C9YA 3NHBA 4DLWA 1DSSG 2BEWA 3ACCA 1U8ZA 1D9XA 1CEEA 4AN4A 1SQGA 5KTYA 2XVXA 3UXEA 1EJBA 5C5IA 1N7GA 3JS5A 5JAOA 3BB4A 3BERA 1X7ZA 2ZVPX 1E2IA 2R96A 3BBLA 3FCOA 4A7PA 4DDUA 1JU4A 3K0CA 1RE1A 3AVVA 3E22B 1WZCA 2P1DA 2R751 1LQTA 1HEIA 3K0HA 4BFVA 1GPH1 1LS6A 5AVXA 2HX1A 4YI5A 2EJTA 2YRFA 3FYUB 1GUFA 3MQFA 4F5DA 3RC1A 1CUZA 2BT4A 1WNFA 3VR2D 3WLAA 4QOJA 4RYLA 4DLAA 4J0QA 4X41A 5I7RA 4BWVA 2OCLA 3I83A 1J5EB 4J91A 3KTFA 5J40A 4KPYA 1IOVA 2J33A 2IHJA 2JGNA 2H0AA 1JQ5A 5LYJA 1E9VA 3TD2A 1JQAA 1KDTA 1P2DA 3KHTA 1NR1A 4JXKA 5A5FA 5JH7A 4I4TF 3P9NA 1K1EA 2PZ8A 4DR7B 4G6ZA 4LGVA 2V6FA 1NKTA 2WJYA 2CMGA 1X74A 1ZUIA 2Q9BA 4J16C 3OQVA 2B8EA 3GROA 3G49A 3STVA 3MJCA 4FWTA 3MT0A 2CD9A 4RXTA 3ZJVA 5CD9A 4PX5A 4OO3A 1BN6A 2UUAB 3MWFA 4CMIA 3HVUA 4ER6A 1LVHA 3ANMA 3I37X 3C5VA 3UB2A 3ZWAA 4M0UA 4PRKA 1SQSA 5J2TB 1U81A 2FNAA 4QXMA 3ZQJA 1L7VC 4FQ8A 4C3VA 1XPRA 3QPCA 4NMXB 5MFPA 2MINA 2PN1A 3VZBA 1RKQA 3U5TA 1QGED 1J07A 1EGMB 1N6IA 1Z38A 2PX3A 2PGXA 4UTXA 1E9BA 3C3MA 3HQ4O 1LLFA 3NJRA 3BMXA 3E7WA 3RG8A 1XTPA 3GWZA 3ZZ1A 1G5PA 3MCUA 1YBVA 2A67A 5FRDA 1BX0A 3F74A 1DRWA 3WWEA 4TTIA 4DT1A 3KAKA 1HTTA 1QIJA 1VBFA 5ALGA 4TL7A 3JQRA 1HGXA 3L0SA 2DGDA 5K4AA 4CE6A 2F64A 1A97A 4KOAA 2C1XA 1PL0A 1T29A 4UNSA 5G4KB 5CB4F 4WBXC 3ESBA 1U2RA 2ZK7A 2A9FA 4Q47A 5ENVA 2IYYA 4JGGA 4YAJA 5D7BA 3ZY3A 1HC7A 1UZMA 3QELB 2RHWA 4L28A 1K89A 1YOBA 1WD7A 4TXLA 4X64B 5LQAA 4C03A 1UOPA 1E9CA 4TTQA 4BRWA 4Q82A 4EI9A 2FEWB 5EHNA 3O03A 2P3LA 2VBFA 2WA2A 3BIXA 4XIGS 1WUIS 2DHCA 1KS9A 2BHRA 2V5UA 2OMEA 2W2VA 3KUKA 3D8SA 3B53X 2WZCA 3NHFA 4FSHA 4GPIB 5FBWB 4E5KA 5IXSA 1D8AA 3CSSA 3PPWA 1ORWA 3PQDA 4OQ4A 4XCXA 4MV7A 1BKYA 1KEZA 2VT7A 2WF6A 3MXOA 2D7CA 2Y6UA 3GCZA 3PUWA 5KTSA 2E85A 4NR0A 2YHSA 5ESRA 3N75A 5LB4A 3RRMA 2F1RA 4Z7JA 3L8MA 2IF0A 3NTXA 1DJNA 3Q12A 1XPOA 1HZZA 4YP1A 3VYVA 3HXLA 2QRHA 1LC0A 3Q8XB 4OI4A 3ZHCA 1GNLA 4Y2YA 3H8VA 3LDHA 3NH6A 1QVWA 2VBIA 3F67A 4MRNA 3EXHA 4AP5A 4YTEA 1USKA 2IY7A 1MORA 3IAS1 1I2BA 3KKQA 4PSUA 5CA0B 4MO9A 5HKOA 1AZWA 1M8JA 2YJ4A 4OA5A 4V39A 4X00A 3JD1A 3ZUPA 1QDUA 4TROA 1P8AA 3DP9A 3IDQA 5JRDS 3CEJA 3T5GA 1ONOA 1B0PA 4LXTA 2M6KA 1GTJ1 1S2GA 4Y2GA 4X71A 3QMWA 2O8FA 4YXWA 4CM3A 3GN2A 1NQUA 2B1GA 4JEUA 4B0PA 3U6KA 3FPLA 3OFKA 521PA 1EAYA 3ZE9A 4K2AA 3G13A 1O8BA 3NBMA 2PAFA 3I9OA 2XE4A 4GOOD 4FMCF 4RD4A 2QD2A 3BE5A 3Q5GA 1Q0PA 4U8GA 1NZDA 5AVYA 1YCFA 1NXTA 4P5PA 5BYAA 3AVXA 1JG1A 4V0SA 1XJ5A 4D6XA 2ANBA 4EJMA 2YVQA 1WUYA 3EW9A 1DKUA 5FFNA 5KYYB 3DLIA 2AJ8A 3AI7A 3JARA 3PD7A 3QU7A 3U62A 2PZLA 2VDJA 3C6YA 3F9IA 2OCGA 5BNZA 3ELYA 3S44A 4G25A 4GMXA 4NZ9A 3DT6A 1WEKA 3X3HA 1P4JA 1UOOA 3K94A 2QG9A 4NQZA 1K8YB 3IAUA 4M1YA 1NC1A 3RRYA 3TPFA 1AMOA 4Z6KA 4M1WA 4YT4A 3DE7X 1CZOA 1BA2A 2WP8J 2GPNA 3LQKA 3KQHA 4KO3S 4M1MA 3SSNA 4BMDA 5LUAA 1MFZA 3PF8A 3LX6A 5F5LA 5JANA 1GG8A 2D1RA 3B6KA 3H83A 3HBLA 3KAPA 1IAVA 1U8YA 4DUGA 1G41A 2WILA 4QBKA 2PEZA 5BSHA 2CNWA 1QPGA 3A6LA 3CUYA 3FLEA 3Q98A 4IQ8A 2B1JA 2PGJA 3MBIA 3VR3A 2GJ4A 1F7UA 1M8PA 1QG0A 2PE5A 4KLCA 4BP9A 4J49A 3CUTA 3HB5X 2PX0A 1REQB 3B1XA 1QBKC 3UXHA 1SCUB 1FP1D 1CU1A 1JPNA 2PL1A 4M7OA 4H7JA 4L08A 4AZ0A 4ZGBA 4BAGA 4JLDA 5BR1A 4LYHA 2PEYA 5JQGA 4FYVA 4OQDA 1QZ3A 5GZ6A 3ZVRA 3NWEA 1M2OA 3KOMA 4D26A 2ROQA 3JYQA 1MQ8B 1C0KA 1RYHA 1ZH8A 2ZE7A 5H9WA 3KQKA 2ZJOA 3G7NA 3JQAD 2OBLA 3R3XA 2I1LA 2CXUA 3GA7A 3AIOA 1P6QA 4CL8A 2J9RA 2DQ4A 4ZKEA 4DKXA 1T15A 1RWKA 2HIGA 2R66A 4YV0A 1YZNA 8ATCA 2N46A 3N2KB 3RRXA 2AYZA 1KYYA 2P9HA 4G24A 2D2FA 5KTPA 1PVDA 1SKYB 5DLYA 4N5DA 2PBZA 1NWHA 3FBGA 3PDCA 1QU2A 1JHDA 2HO4A 2V9PA 2GN0A 3FHOA 3ZCUA 1CHDA 3E70C 1NVKA 1S2MA 3AF6A 4F56A 1D0IA 4BZPA 3FYHA 4P38A 1NBEA 3QEAZ 1DJPA 4L85A 2FPIB 2X8JA 3GC6A 3NAQA 5LP1A 3PGXA 4RCVA 3LGSA 3HCAA 2X6RA 2A78A 1R10A 1Z0DA 4RHEA 3U4GA 2IBTA 1BXRB 2IWHA 2WDPA 1K8RA 4UMEA 2V59A 4XWWA 2O3TA 5EESA 2IPLA 5IVIA 5KAMA 2P62A 5P21A 3LX5A 2KYRA 3RARA 3U7QB 5SY4A 4LBVA 4KB5A 2MR5A 1VI2A 3UPTA 4GU5A 2BHTA 1DL5A 3OT1A 3KAJA 4BVHA 2AOXA 2E49A 1Y4DE 5IVPA 4DJAA 3SR4A 2O8CB 4QGSA 1N2EA 4GUAA 2WNSA 3VOTA 5HG0A 3SI7A 1Q7RA 5A02A 2DQSA 1GPJA 2FPPA 4BVBA 1IB6A 1P9LA 1NDQA 1LC3A 5CLFA 1EVIA 4LY0A 4YRSA 5JS6A 2DXIA 4HH1A 1T4DA 3AW9A 5B4UA 2YZ7A 2DPLA 1F2UA 1VDZA 2VYVA 1V45E 1ZCJA 1LJLA 1E6UA 2BZSA 3C48A 1CUYA 3F4BA 5CK4A 4BJ5A 1X1EA 4CQMB 4Z5XA 1U6KA 5JNTA 4G5SA 5THXA 3ZE0B 2JHAA 2ZIVB 1MJHA 3PQ3A 1FLNA 3HV2A 4C2BA 3ZHSA 2ZW9A 3QK7A 4G5QA 1QLHA 3TW6A 4D9BA 2F1HA 3LGXA 4B17A 4RMJA 2TYSB 3CVJA 5MGBA 2UYCA 3F71A 3V8QA 3QSYA 1OBVA 1XTTA 2A5YB 1TEHA 4UMFA 2PSEA 1PGPA 3HUDA 1QHHA 1TQ8A 4CT0A 1G59A 3P0FA 1OJLA 1SHUX 1TVKA 3PA8A 3OIWA 4NJEA 1EFAA 4LMAA 3GPLA 2QVBA 4MS1B 1R0CA 5ILQA 5KTKA 4BPBA 3NTRA 4AKGA 4YUYA 4G0YA 3OKCA 5HKKA 4Y2XA 4XQCA 1PZFA 2JIOA 3WI7A 3DVQX 4AYXA 4PBSA 4KQ1A 1Z2OX 3BDIA 4PLGA 3W1VA 2Y4OA 3TW8A 1HYGA 4BE7B 4D3SA 3UJNA 1WMAA 3RTDA 1UEJA 1IOZA 3LC1O 6PFKA 2WIFA 1VRCA 3GLIB 3PQEA 4LISA 3AEQA 3B2QA 1WDKA 3JQFC 3LL4A 4JH0A 1VI5A 1X2BA 5TE9A 2VHCA 2MDTA 3WADA 4KRXA 1XDDA 1Y1SA 3R7FA 4Z3DA 2WD8A 5DE3A 4YAGA 2ZIGA 4BXOB 4DV7B 1NYTA 3R5JA 5TQJA 2XNHA 2A5LA 5BUQA 2COKA 1MAWA 1PTKA 3Q3VA 2O48X 2UZ0A 4HB0A 4Q3NA 4B0OA 4A15A 1VMDA 4XPZA 4F9FA 2VK1A 2YQ5A 4TYNA 3EYWA 4UM5A 3UMRA 4IJ6A 5J4LA 3IGFA 3GG2A 2IYSA 1P62B 2XADA 2R8BA 5KYKA 3UBTA 1N6LA 4ZV7A 4EFNA 4O4HA 5CFPA 4TRJA 2CV0A 4MW2A 3AZQA 3M6AA 1E9AA 1KI4A 1LI5A 1AT1A 3O1HB 4CI0B 2BGLA 4EL5A 1DKMA 4L5IA 4I08A 4HXGA 4UXIA 3TIXB 1V26A 1UR5A 3SPXA 3VC3A 2C8JA 4QUJA 1KI1A 1IN4A 2C7BA 4EENA 1Z4KA 5JQWA 2H29A 1CXZA 4MW0A 3W5HA 1S2DA 3M6IA 4QQ8A 3UJBA 1VPVA 1ZY2A 5HW0A 1E1LA 2IYRA 3R5KA 4FINA 3ITNA 3RT7A 3U1VA 2X9VA 3VI3B 1N6OA 1OXVA 4I9UA 2VZ9A 1DAFA 1JAZA 5JS7A 2I29A 3UQZA 3PA6A 3SYRA 2IK8A 3BRQA 1EBBA 4MCHA 4MR7A 4AZSA 4G3XA 4R2HA 5B6IA 2C9DA 3I58A 5COAA 2Q4EA 2X2FA 3GZNB 3PUJA 1XK6A 2D3WA 4OSPA 4B6JA 2V98A 4YXWD 1NFQA 2Q7OE 2QX4A 3VKGA 3RYFB 3TF5A 5C5CA 1KBQA 1ISJA 2HW8A 4FJ1A 5H1YA 3PGMA 4G5GA 1O77A 1N8NA 4E2YA 1AC5A 3L9WA 2CLCX 1A9XA 4IFTA 3ZLUA 4HK4A 1IZ0A 2ASEA 3DZFA 4DA6A 3ODPA 4FR0A 4H77A 3THXB 4KDRA 1WZNA 3KE9A 3UWOA 2OMKA 1MGPA 3P0IA 4JOSA 3A10A 1X92A 4R0NA 4UBKA 1TUEA 2EERA 4MVJP 3RIEA 1SIWA 6Q21A 1SXJC 4P4LA 4QYIA 4JUFA 4PTYA 3T95A 3K3PA 3TW0A 4IKOA 2VFAA 2X41A 4JC8A 3BFXA 4HYEA 4ZO4A 3K16A 3HCOA 5GJCA 2XXJA 4N82A 2GR9A 4YHBA 2V4MA 2FWNA 3PR3A 3HI4A 3QU4A 3M1AA 1NT4A 4FQ5A 5EFOA 4PWZA 1XEWX 2ZQYA 3KXPA 3M6MD 2ATVA 1D2EA 1GAQA 1V9LA 3C3PA 3N6VA 3Q3CA 2CVHA 3TQFA 1OQAA 1Z82A 3C8DA 2FCRA 2ZGVA 3GD5A 3ZI4A 4ZYXA 5A3VA 3UICA 4LJKA 1UBGA 3MBOA 2NLOA 4XB6B 3AR5A 5IARA 1UK9A 2QG4A 3U3DA 3WRXC 3L7IA 3S99A 2CNWD 2Z09A 3PDWA 3EEOA 1JKFA 3H7IA 4P4TA 5F2EA 1E99A 2WHXA 2TSYB 2XT6A 2G0NA 1H5QA 3DVAB 3HU2A 3IIIA 4KO8A 4UXJA 1LBQA 1ZIOA 1OIXA 3S2YA 3ZD8A 1G2QA 2WWTA 2Q7XA 4KVAA 4LMPA 1FRZA 4IP0A 1KVTA 4BO0A 3IUPA 3NNNA 5J3JA 4XDZA 2B92A 1YB4A 5LOVB 2BRUA 3AL2A 4EBFA 1OC2A 3GMSA 3ETHA 5A05A 1TQDA 1IVYA 3IDAA 4EAQA 2Q4OA 4FYMA 3MTGA 5JRJA 1I7PA 4GE0A 2GK4A 3RSSA 3TM5A 4UUNA 4BGDA 3N0RA 4B3BA 5F1PA 2VN8A 4LVCA 3QVMA 4HRAA 1L7EA 4MVJG 2G4LA 3TBFA 1GPLA 3R6GA 1XU9A 4QJ3A 1WY7A 5KSPA 1IU9A 4CM7A 1ADBA 1RHRA 4ZT3A 5EPOA 5ULLA 2G6TA 3D4LA 2D1SA 2D74A 1DEOA 3AHJA 2OV1A 2OZVA 1SBIA 3H5IA 1N3IA 1U5BB 3VO8A 5KYWA 3UGTA 2PJUA 2WD9A 5TRTA 2H85A 2VKTA 4KMOA 4L95C 4REMA 2M1XA 1NXOA 4W9NA 2YWXA 1IJKA 2XNDA 1HDZA 1OZFA 2EFYA 3QX9A 1BDIA 4KXNA 3VR1A 2XMGA 1ECLA 3BWXA 1V48A 5KMGB 1EKXA 1BW9B 1QV7A 2CE2X 4NDZA 1XZBA 2C2GA 2LTAA 2O2JA 4PZYA 3R09A 5EIEA 2O07A 2DLCX 3EVGA 1L3IA 1CB0A 4HGYA 4JROA 1BX3A 3R23A 2XGMA 3CEHA 3MF4A 2I6XA 4IYRA 4E4RA 2E4ZA 2H3HA 2P2DA 4MA4A 4LJSA 3UXYA 4PN3A 5TPZA 3TB4A 5HOQA 5JD4A 2F43B 3ESCA 1X0VA 1MN6A 3TBHA 1FXUA 1VIVA 5AKXA 2A3RA 5E3JA 1Y5LA 3C7TA 4O59O 3SC4A 2ZTLA 1GRCA 5AM3A 4GL2A 1PT9A 1MJFA 1P4GA 2VF2A 3H5WA 1BCRB 3OLCX 4G86A 2BMFA 2V7QD 5CB6A 3KZOA 2ZE5A 1DC6A 1FDOA 4Z99A 3BDVA 5AM1A 1HQKA 3LDUA 4TN5A 2E18A 2HRZA 5I7EA 2XZLA 2JI8A 2Z30A 3PXXA 4DR4B 1ADCA 4PGHA 1I1HA 1QZUA 3V4RA 3KB1A 2PNFA 4MITA 4RVFA 3D0RA 4IF6A 2RCYA 4ZGWA 1TF5A 3CZQA 1K4KA 1XEWY 2Q6VA 1MNAA 3Q3EA 4NAUA 2OQVA 4RXUA 1DGQA 3U81A 4EG4A 1U1GA 3BKXA 4MIKA 3FPBA 3VKUA 2HBZA 5JBNA 2YH2A 4L51A 4U9IS 4MV6A 2VUTA 4B31A 1GQRA 3OZGA 3IO5A 4NCHA 2BE7A 2C2HA 5JXGA 3K6SB 4RULA 3LDAA 2ODNA 2KLBA 4YK7A 5BOSA 1CUEA 1YASA 4LSZA 1EG2A 4O4LF 4QU0A 5DRYA 1TJ4A 5JPIA 1HT3A 3U19A 2ZJ1A 5HKKD 1OFUX 5IFKA 5BY2A 4E4TA 1X14A 3RTBA 3O5AA 2RHGB 5CFNA 2JBWA 1H0RA 1QUEA 2DTEA 2PS1A 2PKYX 3EF1A 4RQBA 4A2CA 4E5UA 3WMEA 1FUKA 1U0HC 3LD9A 3AY0A 3HA2A 2AMVA 3BOSA 4HB2A 5AVJA 5HKBA 3ZVNA 3THWA 1J1ZA 4M9ZA 4ONEA 3DQQA 3HKBA 4J8PA 4GI1A 1RQ2A 2R11A 3NTUA 4HXFB 4I8DA 4NK4A 5ICGA 5IVHA 3DV0B 3FLAA 3WWYA 1SC6A 4AG5A 5FLEX 1GRRA 4KN5A 5CVEA 1QX4A 2EIXA 2FFAA 1IXSB 2W6OA 2ZB3A 2WTBA 4H31A 3D3JA 1G7SA 4C89A 5IEBA 4CV0A 3DDWA 3AH8A 2QP3A 3WTBA 2J3KA 3BXZA 4CFYA 2X5OA 2AYYA 3C3JA 2D7JA 1ZHFA 2C96A 2W6QA 3S8EA 3SCZA 5IZCC 2AEMA 2K5UA 1KXZA 3DLAA 3DYIA 2PMFA 3QVTA 2HI0A 2D0DA 1SCQA 1CTQA 2FEMA 3FGPA 3ICEA 1NQ5A 1BJRE 1OR8A 1TUIA 4OH1A 4BNDA 2IODA 3DZJA 3S2EA 4Z4EA 1WXQA 3W5BA 1I5RA 2XWJI 3R4CA 3WGKA 3UMVA 3L6CA 4KQWA 2ZSUA 3A3PA 3QEMA 1QP7A 2Q4BA 3U40A 5K8VA 1IHYA 2GJAA 2O06A 1JWBB 3G9UA 4M4SA 2PMWB 2XZDA 3G7UA 4O4JF 5MDHA 1DTSA 4KI0A 4Q4HA 1R2QA 1SIBE 3IP9A 3R3JA 2Q2QA 1S8AA 3R6WA 4LRYA 5F1KA 3I39X 4S05A 2H4WA 3BB3A 2DFTA 4MI3A 3UANA 2FN8A 1SEVA 2O2DA 2X0NA 1LDEA 3PFBA 3R3YA 4BP3A 3OLZA 3F6PA 3GRPA 4TSKA 4WY2A 5L3ZA 1MTOA 2ORVA 1A9SA 1KEPA 4M53A 4A8HA 4F5YA 1PSZA 4E12A 4HX9A 4DR2B 2OO3A 4HDSA 1T9HA 2ZUVA 2RKBA 5L3SA 3ZD7A 2FOXA 2G72A 3C39A 4BBJA 3HS3A 4DQVA 1G8PA 4XIYA 3W79A 4AJNA 5JAHA 2AUMA 3E5NA 3FNQA 1RZ3A 2VPIA 2XCLA 2P3OA 3GY0A 3NIBA 4K6OA 1CY1A 1ZRNA 4N4AA 3TTTA 4DILA 4JC5A 2ETVA 2WAMA 2FP3A 1RXVA 3OX1A 4QPDA 1T5IA 3MQ4A 3NC1C 4MEAA 1E98A 1UK8A 3JY6A 3GRVA 4YCNA 3ZK8A 1T0JB 4WZ6A 3AHGA 4QWMA 4IIHA 1BXGA 1U2ZA 1P2GA 4CTJA 3IR5A 4E4YA 4KYTA 3M2TA 1RWOA 3AIMA 3ZNOA 5CXSA 2JEZA 1JHXA 1SXGA 1MENA 1AJEA 2QLJA 2OB1A 1II8B 2BMDA 3LYUA 2WUDA 4P1ZA 1AKWA 1ENPA 4DDMA 2IU4A 2R7MA 5BNTA 1G8MA 1KZ9A 1U0JA 2QTLA 1E2DA 3OSZA 2A4MA 3K96A 1QB8A 5IUKC 1IB0A 1PK7A 2QPTA 3O8OA 1JVSA 2FUNB 3EGIA 4HUQA 1UP6A 4FSDA 3C5EA 3RRBA 1UPUA 3PFNA 3A1NA 4ZOLF 2AFHE 2PMEA 5I7WA 2O8VA 5JYBA 2AFVA 4BO5A 1XT6A 1TB4A 5C8VA 2CJWA 1F8XA 4ZZ3A 4EG1A 4PLTA 2XUFA 1CUUA 1WZEA 2JD1A 4C0QC 1NVDA 3HY3A 4CMJA 3ELDA 3FHCB 2CMDA 4MYCA 1GL9B 1DMRA 3KS9A 3P1JA 1E3EA 1FYXA 2ZUSA 1ZN7A 3GIWA 4Q4DA 1UJ2A 3ZWMA 4RTLA 1T10A 4Y9UA 4BV9A 4C7KA 1NW5A 3IVXA 4KXVA 5GGYA 1EE9A 2I1VB 1EWQA 1J4AA 1KI6A 2Z2XA 3HYTA 1WDTA 3QXGA 1RWNA 2XMSA 4IHJA 4LHWA 4WERA 3W3ZB 1URPA 1VECA 3L0BA 4GMKA 4ROSA 5DDIP 5LZ9A 4DMKA 5BN5B 2PZBA 3SYTA 4C0SA 1F9EA 2A59A 2J0VA 2FHSA 4CF3A 2NNWB 3C14C 3LZ6A 4FZRA 1S2OA 4W9MC 4DCCA 1M6VB 5GJBA 1CZUA 1U3UA 2XWBF 2I6TA 3FLBA 3S7TA 2F7SA 3TLCA 3TPCA 1HRKA 2YINC 3C43A 3OJOA 4IHAA 4RETA 3THSA 2GEFA 3PFFA 1CW2B 5F35A 3M5CA 2HGZA 3BMOA 4TVKA 2BTQA 1YUNA 3DZBA 3U26A 2HV8A 2XCOA 3DAFA 1AOXA 1XTSA 2UU9B 1H3NA 2BGKA 2GD1O 4CL0A 5AK0A 3C1UA 2YBEA 1UZNA 2BMEA 2W2KB 3UAZA 1YJAA 2NO4A 5CIQA 8MHTA 2F55A 1GCOA 3CWCA 4UUAA 1YI0A 1ECJA 1XZDA 4ZREA 4RY2A 4BOYA 4DIUA 1K2WA 2WD7B 4R01A 3MINA 3ZV7A 1I5EA 2WG2A 1E59A 1Z2PX 4CW7A 1E9RA 4PHHA 3VU9B 3ANXA 4MVJE 2JI6A 3FWZA 1JR2A 4D3XA 4ZCMA 2XUPA 2XNDD 4GMDA 5LSAA 4MKHA 3IVAA 4FNMA 1NVMB 1XQ6A 4B44A 1XZGA 1YQGA 3HJBA 2O1WA 4CM9A 2K7FA 5FLKA 4FD3A 4OX9B 1GEEA 4OMFG 3NASA 3Q9SA 1FNCA 1XF1A 2VXYA 2X86A 3FGZA 2VWGA 1DOAA 2Q28A 1T2AA 5AKHA 3RS9A 4QUIA 1VYTA 1MU0A 1N5MA 2H54A 2CXTA 5DF1A 2FOLA 1LUAA 2H4JA 5TC4A 5JATA 3N8HA 1Z5GA 5GV7A 4NYIQ 5TPZD 3HGTA 2IYWA 3EH2A 3TO5A 1Z17A 1DEKA 1O58A 4RZ2A 1NUPA 2P6PA 4RIGA 5LYJF 4F4JA 3KEMA 1YKSA 4RTPA 2PLFA 1PEAA 2Y68A 4BFCA 5ECGC 4W5RA 3PNLA 2V7BA 3LQ2A 3EC1A 4K9PA 3VHRA 3MS2A 1GNPA 1FMCA 1BU5A 1J22A 2XW6A 4YCAA 1ABFA 3WLSA 1U4OA 4YMUA 2ZYIA 3B12A 5LQCA 4G1CA 1D1QA 3OQIB 3G88A 4XSGA 5ALZA 3UAOA 1E66A 1FDWA 4CM8B 1GU1A 1R9GA 2J67A 1VCNA 4DA8A 4F1JA 3S81A 2BAGA 1V2GA 2GH1A 4POAA 3E5MA 4YCJA 2ODTX 5CXQA 3K71B 2WB2A 2CKMA 4IIUA 3U80A 3FWHA 2BFPA 4DLRA 1PFGA 5INTA 4BV3A 4FJ2A 1H2EA 4AY5A 5I5EA 5EQDA 2B1QA 3ZVKA 1OX4A 3SSOA 4WNAB 4X94A 4AZTA 1MDFA 2JIBA 3BAFA 2AVDA 4D9EA 1KL7A 1KHTA 3PFWO 3DE0X 3VI4B 2GNPA 2JFPA 5DRTA 2QQ0A 2X5NA 5BSKA 5JNUA 3HR4A 3P96A 4UE2A 1A8QA 4J0EA 4WCVA 1ZA1A 1GEGA 3VR5A 1JLLB 2WR8A 4CMHA 1T9KA 4HDMA 3ZJUA 621PA 3U3RA 1GPAA 1ZXLA 4CEHA 1L5RA 4X20B 2A0XA 4W9RA 3NG1A 3F4LA 2O8BA 1Q1BA 1V39A 1W49A 3LGAA 5KINB 1LSJA 2H9YA 2NO5A 1IQUA 1BE0A 2ZETA 2IIVA 4HMQA 4TWRA 3U0VA 3UW3A 3W6NA 4TZ6A 1R0KA 1XQWA 2RH8A 5B3JC 5ECYA 3U4QB 3DP7A 4XGIA 5EE5B 1XTJA 2PANA 3LUCA 4GS5A 4FYHA 3KO8A 5H82A 5IJXA 2IYEA 5AXAA 3Q1KA 4X8LA 4DYVA 3M6UA 1FDVA 1PL6A 4HQLA 4Y2PA 4DA4A 1PDWA 4M1SA 4AS1A 3QOYA 2L69A 2MR6A 3KHSA 4EAAA 2D06A 3N58A 2GKGA 4OD0A 1PCXA 2X19A 2WEKA 4ILKA 3VPDA 3ENKA 1X8KA 3FWPA 3SXPA 2B3TA 5CGQB 4U3JA 1SU8A 3VR4A 3FAZA 2ZJZA 5J1TB 3QLVC 2F67A 5T67A 5E9AA 4AJ4A 1FFHA 1K7FB 1W2WB 4UDNA 3KB2A 4YDQA 1P1FA 4HEHA 1EVJA 1PT8A 1X7GA 1CQIA 4N18A 3WJ7A 4P22A 2NX2A 5D3MB 4AJPA 2I6GA 4EI8A 4UTOA 4W5HA 1OLUA 4M0MA 4UVGA 5LA6A 3TUZC 1ODLA 4RSHA 5DWDA 3FHLA 2GMWA 3R44A 2G9NA 3QUCA 2NXJA 1JBKA 2ZB4A 3K8QA 1PNVA 2GEBA 4RACA 3S0JA 2KS6A 3UFXA 1YZTA 5I7HA 421PA 2XYQA 1KERA 4YRRA 2BV3A 2FUKA 3CN9A 5B1IA 1JIUA 3TR5A 3BL8A 3DCIA 4KXWA 4ZI7A 2C9ZA 1G5IA 3H5LA 1KRXA 5NLLA 4Q16A 3FUVA 2JLVA 4LZWA 5FOUA 3ROFA 1JQKA 4H17A 3HY6A 3OZXA 3L7YA 4BFUA 3EG5A 3P0EA 4XYMA 1VSVA 3MAGA 4QE3A 1VG9B 3C3EA 3HA3A 4TUYB 4AY4A 1VHDA 4ZHQB 5FEUA 5LXTB 2C59A 2D2IA 4UBLA 4MRVA 3BD6A 1AHNA 2DRIA 5IRCD 1QIIA 1A77A 1FNDA 1SEPA 3TN7A 1Z6ZA 3K0AA 3KQSA 5I48A 2CXQA 4MP3A 1RYYA 3ABOB 4UXHA 4YFYA 4O02B 2AL7A 2DULA 3RYTC 4TSRA 1HRDA 2ZRBA 4ZT7A 4YAWA 4NK5A 5J1SB 1SIOA 3SNHA 5IHPA 5ICEA 1Y6RA 2ZVQX 3MG9A 4IWXA 1D6SA 2F4VB 5COQA 4BFYA 2P68A 3W4JA 4DMFA 3CKKA 3KEFA 3PQCA 5HZHA 2NZWA 3ANNA 2YICA 4FCWA 3BZUA 5JTTA 4MR8A 2DTDA 4Q7LA 4QDOA 1U3VA 1F0KA 1UXJA 5GWXA 2NACA 3D2CA 2PUAA 1SG6A 4JVNA 2X1HA 4FFPA 1FFBA 3QW4B 3BM5A 3LM8A 2WWIA 2QWXA 4GZ6A 3IUMA 4FIDA 5AQEA 5HS6A 4C0WA 3WYEA 1L4UA 1VIYA 1NBME 2RB4A 3KQLA 1X42A 1M2KA 3K9WA 1RMQA 5J43A 3ZCQA 2VHEA 2GA9A 1M72A 3OZAA 3SDZA 3IBGA 4DA9A 2DR2A 4F4FA 3H2KA 1LW6E 3V1MA 3STWA 2GFQA 1DPFA 4P8RA 4KR7A 1CJKC 2C58A 4IIJF 1XVUA 1E3MA 1SKYE 1YCHA 4FOOA 3KYJB 2QTGA 2IYFA 4ZEWA 2BL4A 1RU3A 5B30A 3GLVA 1AXEA 4K9KA 4Y6OA 1RJDA 3VO2A 3DE6X 4AYTA 1EZ4A 4RABA 2UAGA 4LJ5A 3JQBA 4OLFA 4D9CA 4DLZA 5BSEA 2GKOA 4EKGA 1AS0A 2WJ4A 4DCSA 3EZYA 1ILEA 3QUSA 2FSGA 2RG1A 3UCEA 3WB2A 3ZU4A 4RY8A 1F8UA 1WXGA 1XQ9A 2A0FA 1DAIA 1JV2B 2BHLA 2CLKB 4HXYA 2HN9A 4C2TA 1X7YA 4LFCB 1LF0A 1JQJC 2A9QA 1CD5A 3N2ZB 4WUTA 1U9CA 4OMCA 1PR4A 3SM9A 2DHDA 2HU8A 1UBTS 4CLHA 2D59A 5FNVA 2JJ2A 1B2LA 4YJHB 2REQB 3OWXA 5EWMB 1I6KA 3WIOA 1U2GA 3BWVA 5IT4A 1KZYC 4K9OA 3W2TA 4CQNA 1X1QA 2FG6C 4FGSA 3WZMA 5J4VA 2R4TA 4ZMRA 4ZDKA 3ZKWB 1CY7A 1QBGA 4RSGA 4CV1A 4MZDA 4AB1A 4EGSA 2FQYA 1HZZC 1VJTA 2FWRA 1P80A 1JYFA 1V9CA 5WRFA 3J7AC 1RAGA 2ZS8A 3QVLA 1QORA 5CFQA 3LHSA 1H5UA 2LIVA 1W85A 1JDTA 3EA4A 3ROTA 5H4GA 5KZMB 4XD7A 1NRWA 2ONJA 4TVOA 2QVCA 5LD2B 1E3WA 5A0TA 1LSSA 3LT1A 5DYGA 3EEQA 2NOAA 1U7ZA 2JGRA 4LSWA 4CM9D 3TJRA 2PQ2A 3FBTA 3QENA 2DWOA 1PV2A 3CLVA 3ZWCA 4CL2A 3AWDA 2G28A 1G18A 1VE3A 3SE7A 3ZLVA 1K75A 4LYGA 1NHWA 1JZQA 1ZICA 2FXIA 4LJAA 3NKLA 4ZOCA 1FRVA 3N7AA 2AFHA 4G4IA 4E09A 2G1UA 3UMYA 2ADFA 5AICA 3EXEB 1Z74A 4WSOA 5JISA 3LOUA 1V95A 1HYBA 1V3QE 3ZLTA 5FUQA 4OQFA 4LIPD 4ZT6A 1SBHA 1TNDA 4H08A 4ZJYA 2OPHA 2XWSA 2SECE 3G7SA 1Z7BA 3FIJA 2HFKA 1PJCA 1R8XA 4PZAA 4D3ZA 3NM6B 3B6ZA 2RGGA 4UCFA 4DJEC 1KI9A 2VCHA 1EFPA 4L8LA 1NJSA 2I71A 4GGMX 1APBA 4RKQA 4JI6B 3D3KA 1F1BA 1IHPA 4KGVA 4PVCA 4LGYA 2FPSA 3IQIX 3A1DA 4E22A 3KZMA 1RCFA 5CGZA 2E4VA 3G23A 3RK4A 3SU8A 1Y3IA 4L6IA 3TNYA 2QTHA 1V71A 3R0QA 1Z8FA 1IRXA 3UWMA 4J07A 2AJCA 1Z47A 4IZOA 4MLCA 3ZJYA 2N75A 4B6SA 2I78A 4ZYZA 3GLIE 1KIMA 2OB2A 3BHMA 2GASA 2YDXA 3ORFA 3C3AA 1RBZA 3QTBA 4J2HA 4QO8A 1OGJA 4X6LA 1A96A 1YD7A 4YROA 1VHQA 2DOKA 2Z2KA 3IR7A 4M87A 4NCXA 2B61A 2QPLA 3EZ7A 5DXFA 2X0FA 1Z8DA 4PCLA 4M8KA 3RCBA 4NENB 2IS4A 2QLLA 2AQIA 2WLTA 3E22A 4NPAA 2EBFX 2MIIA 3VR5D 4PPFA 3COJA 3RS8A 3GJSA 1E8MA 3FJOA 1Z5ZA 2HNKA 1QQ7A 1G3QA 2Y0EA 2QN8A 3HYCA 4JMLA 3FPHA 4Q66C 3ZIUA 4B34A 2Q62A 3RVMA 1E0KA 4HLDA 3ESRA 3QUBA 3U17A 3VNSA 3LP5A 3W7BA 4KMMA 4QVIA 4LCEA 4M9CA 2QKYA 3WRWA 3KJIA 1PKXA 4P7JA 3HH8A 4MVJA 2V0CA 3KU1A 3VYWA 4AD8A 1JG4A 5L4SA 1MHTA 1AZTA 3PC8A 2IS1A 1JBEA 1XUOA 2B69A 2HY7A 2VATA 3ECAA 3E6AA 4ZQFA 4C1BA 5FA6A 5KNCH 1J23A 4XCVA 3N5KA 4UVDA 2COEA 2R6ZA 3LUHA 4FDMA 4HNUA 1ATIA 2TMYA 4NTZA 4C08A 3ELBA 4EDFA 2HUNA 3IVCA 1ZXXA 2IPMA 1XCOA 1GKLA 5HCNA 1Z75A 3AFHA 1SVUA 1YR3A 5GY7A 1EESA 1DX9A 3OWOA 2FG5A 4HG2A 2YW2A 2W90A 3PHIA 1HMYA 5JYDA 1G2IA 1WS6A 4NBUA 1GPKA 3VR4D 4B75A 1W581 1YRHA 5TQ0B 3BF8A 3AUYA 3MCAA 3I28A 2IOQA 1P9WA 5HTKA 1QVAA 3SSMA 4MQLA 2QTTA 2E4UA 1NVEA 4MMZB 4E11A 4BO4A 3FSEA 4PW0A 5J2TA 4Z1OA 4YP7A 5JHHB 5ALNA 5F51A 4F4IA 4RIFA 3TNFA 1FXSA 3PZRA 4GX5A 5AKJA 2GXAA 4AJKA 3EY9A 3QPAA 3QXSA 4O2AF 3AF5A 4N54A 3JQ6A 3ZQKA 3UK2A 1CR6A 1RVV1 4PGAA 4M8IA 2BBTA 2JLYA 1SJ9A 1W25A 3VKFA 3PRKE 4ZCRA 1VSTA 3LLMA 2C7OA 1H9AA 1JG7A 1SOAA 2WIAA 4Q9DA 4L7QA 3WQBA 3J80A 3FFBA 1XRJA 2X1LA 3B6MA 3YASA 5JY1A 1OB5A 2X6TA 1KQGA 1QYCA 2JI9A 3QVSA 3KKZA 3FZYA 1ICEA 3SF8B 4P31A 5EIXA 1A4IA 2DH5A 4BCBA 4RPKA 1YA4A 5G4KA 4FMBB 4CU5A 4CETA 2G7MC 3WQRA 3WBKA 1QP8A 2NT3A 2VJMB 5BR8B 5C8YB 2ZTUA 2GB4A 3RFVA 1ANKA 1QYDA 1YZYA 2F17A 3CGGA 3QELA 4PYMA 3SFTA 2D7DA 3GGOA 1CQXA 1ESMA 3AT1A 2IYTA 1F3LA 3GJXC 1TUGA 3HC7A 4I9HA 3PEUA 4FX2A 1RLJA 4CKEA 1ZGAA 4JJ7A 3KBBA 1W76A 3Q7PA 3O93A 4M8NE 4N5IX 1GFZA 4OGKA 5BN4B 5SV2A 4D4GA 1BRTA 2F3TA 1XMVA 2ZI4A 3DF7A 3DGEC 1EPUA 3TLJA 1ST2A 5CT9A 5IDXA 1CF2O 2AUTA 2BHSA 3BG5A 4Q7EA 5KO2A 4LS3A 3UH0A 3CSDA 4BQQA 2UYQA 4I1IA 1N3YA 3KEOA 3T7DA 4EJ2A 2RGWA 3A4NA 1U4SA 2WFMA 5DM1A 3UC9A 5JNVA 2QN9A 1N5LA 5ALVA 3FYCA 3EQ8A 3TL2A 2QENA 1KYVA 4C43A 3NZEA 4KO4S 2IXBA 1H6CA 2RHCA 4JP5A 5FBKA 2XHEA 3T1VA 3V8PA 3T34A 1EFUA 4FZJA 1FDUA 4HHEA 3OE4A 2VF7A 4J0CA 4YASA 3QZUA 5CA0A 3ZGZA 1PQPA 4FMDB 4C7XA 1QHEA 2WJPA 1KEVA 2JG3A 4GUDA 2I2BA 1AG9A 2WVJA 3KNZA 5C34B 1P7CA 3ZR4B 4BATA 3KVRA 1VA5A 4HQOA 2OPBA 3K31A 4MUEA 4UD6A 4DNFA 1ZGZA 1MX1A 4KDEA 4JSYA 2VNHA 3G5AA 4N49A 4BO6A 1N2SA 3HO8A 3LLUA 4YACA 5B36A 2ZUTA 1NX6A 4RE5A 5EHIA 1SBCA 2H57A 1JLMA 4LTMA 1R4MB 5GMOA 2XCTB 5T4HA 4NSNA 1LKZA 4ALNA 3H2IA 2R25B 1VKOA 1N2XA 1I6LA 1RYMA 4MYDA 5KYYA 1GZUA 4XYLA 1D4OA 4JQOA 4NZMA 3LXRA 1RRMA 4MVYA 4XB1A 4B4OA 4UU0A 2BD0A 3SVTA 4M0CA 3HB7A 4HEA6 2I2WA 1KYWA 5IC5A 4YRJA 3UUEA 2NP7A 2L18A 4ND5A 3FDJA 2VJDA 4S2UA 4X54A 3P2IA 1LDNA 5KOJB 3LQRA 2XTZA 1H66A 3LY7A 3P45A 4IOKA 1R6AA 1QO0A 2W2NA 4HLUA 2HUPA 1G4UR 2P75A 4JJZA 4M0EA 3X1YA 1OFHA 2BDTA 2ZRMA 3DBLB 1SHJA 1QRSA 4ZEMA 2XKAA 2ZREA 5GVSA 3DFZA 4Y1RB 3CNOA 1N7IA 3W2EA 3ZHXA 1K88A 1XCBA 4IZ6A 1SRQA 1M3SA 3K0BA 3CNEA 3PUHA 4ND2A 3MWGA 4M0DA 1EGQA 4G0MA 4RV9A 4YI3A 4EMBA 4LF7B 1GAXA 4BWGA 1KDOA 5KEIA 2QYSA 5ELXA 3TD6A 3RC8A 3O4GA 1SU7A 1REQA 1QOZA 1J42A 3OJWA 1SCUA 3H4VA 5LNK6 1Y63A 2J46A 1RBMA 4I4NA 4TMZA 1ESNA 4DRZA 4A1OA 3RH0A 2VJLA 3ABIA 3DXFA 1DBIA 4MRPA 4DR3B 4B2IA 5DCLA 5M3BA 3FYSA 4MA0A 3M70A 1NBMA 3QWBA 2XYPA 1GARA 4FGLA 4RIEA 1TMKA 3A6PC 1XMIA 1RI5A 1MQ9A 2HCRA 4ND3A 3OICA 2ANCA 3N2KA 2RK4A 1QPZA 3HYLA 5FPQA 2OAP1 3HE3A 1Z15A 3L1JA 5CDSA 4RBNA 2RGNA 2CYBA 4FFMA 5EJAA 4P4SA 2EOAA 2NYRA 4KFTA 2ZJYA 3TLYA 5L40A 3LUAA 2HA7A 2NTYC 1L7NA 2Z3ZA 3CRMA 1UBRS 3GEBA 4JN6B 2WK1A 4XA8A 4YP5A 4BNGA 2X3UA 3R9KA 2NVBA 2IFTA 1O9BA 5D51S 3K2IA 1AA6A 2AI1A 2FPIA 5AVRA 1ZCAA 4QVGA 1I0IA 2GEDA 3EVFA 5B58T 1W96A 4P0PB 2O7QA 4BYGA 3S2IA 5BR4A 4MPTA 1BXRA 2PT9A 3JQQA 3KPJA 3BFKA 2HT1A 2NZYA 1F4PA 3WLPA 2O0KA 1DKLA 1LRJA 1ZN2A 1JJVA 1K5HA 1CUFA 3KKKA 1JDVA 4IX9A 4C22A 3DT8A 4K9LA 3RKRA 3J81k 3EPJA 3ER8A 4GYWA 3FNGA 1ZIYA 3GJ0A 3HCWA 4PV7A 3F2VA 3H87A 3RVLA 1TW2A 4KXYA 4NBRA 3WOHA 2IEAA 1TT7A 5KS2A 2Q3BA 3FVWA 4RU1A 5J63A 1Z0UA 4MVJD 4A8JB 4AY3A 1NJ5A 1TIKA 4L78A 2WBLC 3PUIA 4TV9B 3TDMA 2BRUC 3WKCA 1RVDA 2A9RA 1NVGA 3LFHA 4J2OA 1U7UA 4DWWA 2XAAA 1KQ3A 3HZZA 2OBNA 3AYZB 1L0BA 3PDJA 4YALA 3L8YA 3FWKA 5C1IA 2CLDX 4FDVA 3WYFA 3N0TA 1E3TA 3EIHA 4Q3CA 3SJCA 1EJ6A 1ZRSA 4IG9A 4UATA 3ZQ4A 4J0IA 1GCIA 4HX2A 1GVHA 3QMPA 5D3ZA 4CQMA 3VZRA 4CLDA 4DIOA 4YV7A 3FPEA 3R3HA 2CFIA 4GYYA 4UEQA 3B51X 3OIVA 3QG5A 4X1OA 1I0ZA 9ATCA 3FOZA 3GMIA 3RHFA 4A36A 2DBVO 2VAWA 3GJ8A 4R69A 3U16A 5JD5A 1W0KD 2FF5A 4ZMSA 1IVNA 1JE1A 1K63A 1LNQA 4DUPA 1EM6A 2P9EA 3KLPX 3V1UA 2HRRA 3WYGA 2G67A 3JW8A 1ZQ1A 4G1UC 1SD5A 4IR7A 3D3WA 3EGOA 3OZIA 1L9KA 4MS1A 2BDEA 2HV9A 2F3PA 4K6MA 4NEQA 3STYA 1KR5A 2WV9A 4G1FA 2P9JA 2PRZA 2G3YA 3E0XA 4CUKA 4AJ2A 1FSGA 1JPJA 1O95A 2AMYA 3IQWA 2LRHA 1FFYA 2NTNA 2RHTA 3ETEA 2J30A 1JHAA 2B8JA 4RK7A 3GLIA 1N3LA 2WIDA 3LFTA 2IUUA 1QE5A 1IULA 3SYNA 2W00A 1U7PA 3GLHB 5EIWA 5EXPA 2AK2A 2DM6A 1B15A 4RD1A 5G0WA 2CJXA 4FHZA 2QD5A 3WQHA 4FKMA 3BICA 5TMEA 5KNDD 4BXOA 1SVWA 3UY4A 3ORRA 3EPHA 1EEHA 3OIGA 3AHHA 4JNCA 2EEZA 1P2FA 2VBGA 2VSFA 3MGGA 3CMCO 3V1LA 4B4WA 1ZONA 3L79A 2UZIR 3T99A 1J8DA 3FTNA 2PSJA 1IUNA 3EF0A 1EDBA 4L50A 3BTSA 1JEYB 2B5WA 5EXTA 1G66A 2G0TA 5DW3A 3V8RA 1V5IA 3WMGA 2ZWIA 3B3JA 3MERA 3PDUA 4MOWA 2B3DA 4XWYA 2KBFA 1C7EA 1ZIDA 4DSTA 4RVUA 2POQX 2VWQA 4RPIA 3OX3A 5E2IA 3FFWA 3VSEA 3KM0A 4YMSA 2ZIXB 4RQUA 4BC1A 1R0RE 1VIMA 4KGDA 1M1YB 2JK0A 5FADA 1WW3A 5FXMA 5A0VA 1Y5IA 3HGMA 3NOQA 3S70A 3M0EA 4EFMA 1UDWA 1JHVA 1U9IA 5AW3A 4BZXA 2PUBA 1KYIA 2QW8A 5SY9A 2EG9A 4E6PA 5JCPA 2LUOA 5HJ7A 4UEOA 3C3BA 3KQWA 5DASA 4UHEA 2CDBA 2QORA 5TEWA 2GHRA 4ZICA 1S3GA 5IBQA 5L6LB 1H2BA 1NQAO 3TSZA 1XZMA 5CBPB 5HDBB 5FUMA 2PDAA 3NIDB 3GZNA 1UUFA 3OE1A 4ATNA 4EPWA 4YV2A 4FNAA