2H2WA

Crystal structure of homoserine o-succinyltransferase (ec 2.3.1.46) (homoserine o-transsuccinylase) (hts) (tm0881) from thermotoga maritima at 2.52 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
295
structure length
288
Chain Sequence
PINVPSGLPAVKVLAKEGIFVMTEKIRPLEILILNLMPDKIKTEIQLLRLLGNTPLQVNVTLLYTETHKPKHTPIEHILKFYTTFSAVKDRKFDGFIITGAPVELLPFEEVDYWEELTEIMEWSRHNVYSTMFICWAAQAGLYYFYGIPKYELPQKLSGVYKHRVAKDSVLFRGHDDFFWAPHSRYTEVKKEDIDKVPLEILAESDEAGVYVVANKSERQIFVTGHPEYDRYTLRDEYYRDIGRNLKVPIPANYFPNDDPTKTPILTWWSHAHLFFSNWLNYCIYQKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Homoserine O-succinyltransferase
publication title Crystal structure of Homoserine O-succinyltransferase (EC 2.3.1.46) (Homoserine O-transsuccinylase) (HTS) (tm0881) from THERMOTOGA MARITIMA at 2.52 A resolution
rcsb
source organism Thermotoga maritima
total genus 94
structure length 288
sequence length 295
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2006-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04204 HTS Homoserine O-succinyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h2wA00
2VDJA 4BIMA 4P2GA 1QF7A 1UCFA 4ENRA 3TQIA 3TTTA 3PQ8A 1I7QB 1M6VB 1VCOA 4N12A 2V4UA 4QYTA 3SF8B 4ENQA 2ABWA 4PXYA 2YWJA 3PQ2A 4RKYA 1C3OB 2XF2A 1J42A 3CYFA 4LRUA 3SOZA 4I2NA 4WINA 3PQ5A 4L8FA 1WL8A 1P80A 3FSEA 3NOVA 4L7QA 5SY9A 1IPHA 1GGJA 4L95C 1GGEA 4BFLA 4LGYA 3R74A 2R1TB 5E9AA 1K9VF 1GGHA 5IP5A 4ENUA 1OX4A 2ZUWA 5LIRA 1SY7A 1QVZA 3BWEA 4P5PA 4QYXA 1S1MA 4OGGA 3EN0A 3L3BA 1I1QB 4ENPA 2AD5A 2R1VA 1KEEB 4B40A 3F71A 1O1YA 3TTYA 4XLLA 3CZ9A 4GUDA 4Y1GA 4BTEA 2RK6A 1KWKA 1GG9A 3B38A 2ZUVA 3NVAA 3NORA 4ZDJA 2GK3A 1CE8B 1QVVA 3TTWA 4I4NA 4OQ4A 3BHNA 4AULA 3OT1B 2IUFA 1VCMA 3D54D 3PQ7A 3N7TA 4ADSG 1T36B 1PE0A 3F5DA 3UMMA 1G2IA 1PV2A 1PDWA 1P7YA 2ISSD 5K4AA 4B31A 3ZJ4A 3GRAA 3CNEA 4AJ9A 3L4EA 4AUNA 4UZSA 1QDLB 4Y1RB 4UOQA 1FY2A 3EFEA 4ENSA 1OI4A 4L8YA 4B2YA 2WJZB 4AUMA 3MGKA 2AB0A 3B3AA 2YWDA 1R9GA 4D1YA 2LXNA 2RK3A 3NOOA 4P35A 4UNIA 1T3TA 3UGJA 4L8WB 1OY1A 4GE0A 1KXJA 3TTUA 2YWCA 1L9XA 3FIJA 3TTXA 4E08A 4JQSA 1GPWB 4ZDIA 4ZGGA 1I7SB 2OR3A 3KKLA 3CY6A 3M3PA 5SY4A 4ENTA 5BV2P 1VHQA 2VKTA 1QWSA 1GPMA 2VPIA 3ZJ5A 5SYAA 3L18A 3PQ4A 1VCNA 4MGHA 3UOWA 1N57A 2VRNA 1CF9A 1QVWA 3UK7A 4UCFA 3L7NA 1A9XB 3NONA 3P9SA 4E5VA 3P9RA 3SF8A 1OX4B 1P5FA 2D7JA 1T0BA 2H2WA 2ZUUA 4B5KA 4MNTA 3R76A 1Q7RA 3EZGA 4B7AA 4ZDKA 2NV2B 4MTCA 2FEXA 4RKWA 2R1TA 1U9CA 1FYEA 3WFZA 4UOZA 2A9VA 4AUEA 2ZUSA 4ENVA 3NOQA 4OIFA 1OX5A 1IZYA 3EWNA 4OGFA 4R7GA 2NV0A 2R1UA 1JVNA 4OJYA 3MIIA 3P9PA 5DFAA 4S0ZA 5SY6A 4L78A 3RHTA 5JZOA 1JDBC 3R75A 3TTSA 4N0MA 1ONSA 3PQ6A 1PDVA 4OFWA 2VXOA 4I46A 3B36A 1Q2UA 1C30B 3P9QA 3UJNA 1P7ZA 2W7TA 4HCJA 1P81A 1CS0B 3OT1A 4P34A 3PQ3A 2RK4A 3CZAA 2GHRA 1GGKA 4WXYB 4Y1FA 1BXRB 2ZUTA 3ZR4B 4K2HA 1KA9H 2R1VB 3ER6A 4Y1EA 4P36A 3TTVA 3VU3A 1GGFA 2YWBA 4Y1RA 5JZMA 1OX6A 3EJ6A 1KWGA 4Y0NA 1IZZA 4ENWA 4GE3A 1SOAA
chains in the Genus database with same CATH superfamily
4BIMA 4AKIA 3I01A 5MN6A 2OV6A 1HWYA 2PD4A 4MI1A 4WHMA 3N0WA 3EMBA 2FZEA 2IIPA 4FNAA 4QYTA 4V1CB 1PEDA 2HR1A 2WWRA 4YO7A 4RVHA 3GVHA 3GXBA 2IPLA 3RFFA 4LRUA 4PR3A 2IYXA 1G5IA 3Q7SA 3GYBA 3ZJUA 4C4RA 1EQ2A 3BRWD 4PIPA 4YFVA 3WRXA 1WXGA 1NNEA 1JHAA 2GJKA 1GO2A 1GP2A 4EGCB 1JR3A 2BFWA 2A84A 2WG1A 3DMTC 1P8JA 5KWJA 4IZHA 1RQNA 4QHYA 4KQWA 4MP3A 5FFFA 2XI4A 3Q9LA 5JJCA 1FTGA 1NX9A 4P53A 5JS8A 3LI2A 4HGYA 1QJCA 1ZJZA 2WWHA 3PDCA 4HLNA 1SHJA 4DIFA 3CRMA 4DKJA 4Y18A 3PD0A 2A9FA 3W4IA 3VR5A 4M7PA 1DU4A 5KJEA 5HXAA 1CZKA 1KKLA 3IPCA 1QRRA 3TUJC 3ZCSA 5LMCA 4MKFA 3TW8B 4AULA 4PLZA 4CL8A 1T3GA 2HBYA 2Z5VA 3QOFA 4R41A 2OXTA 3SEZA 3AR3A 1T36B 3FJ1A 4NJMB 2CXRA 2HXSA 4H35A 3S2FA 3B3QA 4B3GA 3FLMA 1YZQA 2C1XA 4DR7B 4U0KA 1JDSA 2VCYA 4ZU6X 2WNHA 1GUYA 4NBUA 5LJIA 1QDLB 3ID6C 3VI4B 3A3NA 2UKDA 3PGKA 1C1XB 1ZQ9A 3UAWA 1PJ3A 2ZWOA 5EP4A 3ZD9A 5EMLA 4M9ZA 1X87A 1D1QA 1IDN1 3OEEA 5J58A 2VAMA 3B3AA 1GV0A 3WGOA 4V0LA 4GPEA 5LWQA 1MA3A 5BYKA 1HKHA 5KKAA 3H0KA 4YJGA 1IK6A 1XAGA 4AG5A 5EJ5A 4HFJA 1ECBA 4DC0A 1ZXXA 4NBVA 1QP4A 1EJ2A 1OFVA 2WEKA 3ROFA 2P65A 4QJ3A 3V7UA 3RAJA 4YJHA 2WF6A 4MGHA 5IVKA 1FRQA 4CIAA 1BDMA 2HWKA 3KR9A 2XOEA 2YINC 3MHPA 2Z8YM 5FBKA 2Q9BA 2GT1A 4UAGA 4ZJYA 2D2VA 8GPBA 1T4CA 2CD9A 2UYOA 2VR1A 3LBYA 4EIWA 3DLHA 2IV2X 1ESCA 1VM6A 2HF8A 2NYAA 4TMVA 5EEGA 1V8ZA 1R3UA 4GI3A 3RD5A 3AF1A 4MGZR 2BP7A 1LPMA 3ZYCA 3DZHA 2X58A 4WNAA 4ZPJA 1DEXA 4YCMA 1AHPA 1IRIA 3SX4A 4RKEA 5B2FA 3OZEA 1OGJA 2RHCA 3T5TA 2WYIA 5JS7A 2O23A 4RXTA 4OQPA 5CT8A 4YT5A 3E22A 2P6NA 1YZUA 3I72A 4HDNA 2EQ5A 2C2ZA 4K9LA 4YCBA 5EUMA 1REQA 4C87A 3RJ9A 1J8MF 3IA7A 1KSJA 1K2WA 2Q5EA 1J5PA 1WVGA 3HN6A 3SF0A 3ASUA 3OC6A 1GNVA 1NPDA 1LWNA 4P93A 1TC1A 2COEA 5AM1A 1X7ZA 1G41A 4XW2A 2PO7A 4S35A 1NTOA 3W06A 4BE7B 1CUUA 1KJ9A 4M4SA 4D92A 2C82A 1FP4A 4P0TA 1WZUA 3T7RA 3WQRA 1DDIA 4M1TA 3G2QA 3KXIA 3RHSA 1YA4A 2EZTA 1P73A 4AX8A 2H1VA 5AKZA 3PGVA 4URVR 2IPOA 3ITEA 3B9BA 4FE7A 3F2IA 4YP0A 1R50A 3AOEC 3HVIA 5F78A 1GG5A 2NVUB 3TQCA 3TQIA 4E32A 4I66A 4KQCA 5LMZA 3QEAZ 1JAZA 4BTLA 3IV9A 2ABWA 2IHKA 1UXKA 3I9OA 4RX1A 3WLSA 1KH3A 1W30A 1KK1A 2YVLA 2H6EA 1BCSA 1D0SA 1VIDA 3ET4A 2RH4A 3OZVA 5J5VA 3O9MA 3S2YA 5JYDA 2QR5A 3PUYA 3F96A 3O03A 1CEQA 3FDFA 3H8VA 3H8WA 2IIQA 4US2R 4HEJA 3HWX1 1EHCA 3QXSA 1AF7A 2PS1A 3P9CA 4I5DA 1XRSB 5AJWA 1UK8A 2JJ2A 4ZV4A 1XLTC 4BJHB 4B0PA 1E58A 2GN8A 1KTVA 3WYCA 1OU4A 1RAGA 4X1OA 2C78A 3Q7IA 1U2QA 5T5QA 4CFZA 1R0WA 4QTYA 1YJCA 2XUAA 3FCAA 5GTDA 3CEAA 2RB4A 4PCVA 1ZM7A 1FBTA 5FLKA 1ZM2A 3QF4B 2B37A 4DUPA 1H1LA 1JKXA 1NBME 1QQBA 2AC7A 2SCUA 1F2TA 4C2UA 2EFHB 4K0KB 2PL1A 5LQDA 5F7XA 3N07A 1G9XA 2AOTB 4RPIA 5K3DA 3TNYA 3A3PA 3V6LA 3TLXA 2QE7A 2A1TR 4IZOA 3ROTA 2VJQA 1WUJS 4MAAA 1YS1X 1DXQA 5K20A 4UHCA 4G0WA 1NKTA 4CDMA 2YN0A 1M34A 4PTLA 5I7AA 6PFKA 4AJHA 2VPZA 5LA6A 5IG2A 2P9YA 3WA7A 1ILEA 3DSRA 3ZV3A 5TJHA 4H17A 5CX1B 1O4WA 1P33A 4J6FA 1XBTA 1A2BA 2DFLA 3D6UA 4G1FA 2DPMA 2ZRBA 2WM2A 4V39A 4WIAA 2IZZA 3CLHA 1IUOA 3ESYA 2H16A 2IZ5A 1WW8A 2WSSA 1QGED 2P8JA 3DE2X 3VZSA 5GIPE 2QPLA 2FRDC 1UWLA 2PKCA 2Q5IA 3JVDA 4PAQA 3MXOA 4FCTA 4CQNA 3CR8A 5B4VA 3WLIA 1GVNB 3R7NA 5C5IA 1RYYA 1XPRA 3D7SA 2IXGA 1II8A 1NBIA 1XPJA 2CHVA 3A3OA 3DOUA 3FWHA 4KZKA 1AVTA 4K6KA 4MB6A 4KBFA 4PX5A 2G08A 2J3JA 1Q0PA 1KZ6A 2JB9A 4C88A 3KJGA 1R74A 1J33A 1VP3A 4YRRA 2QJRA 2WMOB 3T94A 5EZQA 3ZWCA 5BR7A 1TCVA 4P3PA 3RS0A 4CM9D 1WETA 2P6OA 1M2VA 4TMKA 1O87A 4D9FA 4PFKA 5I8PA 4PYLA 1F1BA 3BK2A 3C1OA 4R1PA 2ASEA 2EKPA 3G0IA 4O2AF 3H4TA 3RDPA 4BZPA 4JJIA 5AHWA 4UBMA 5AIBA 2MSDB 2ZPAA 3CX3A 2XMZA 1L4KA 1QFJA 2QROA 2B98A 4FSXA 5CM2Z 4PAWA 1EXDA 2VJLA 3GYGA 3ROMA 3U3XA 1Z82A 4H31A 3LCCA 3F6SA 4R01A 3VPAA 5A7FA 2GUGA 1GPAA 2FFBA 1R4MA 1GCGA 2FU5C 3QIVA 1YB6A 1EX1A 3S2IA 1OA0A 2P1DA 4PYIA 4NZYA 4ZMSA 3UUGA 5BWCA 3LXXA 4BEWA 1Z15A 2JFPA 3L8DA 1I7QB 1SKMA 2F4VB 4N12A 2KW5A 3SBOA 1V3QE 2O48X 1POXA 5CNMA 3GMDA 3A2MA 3EOZA 3AFGA 3ESBA 1QG0A 1V43A 3DZJA 4WXRA 3O4JA 1YR2A 3LZCA 3NH9A 1ORRA 4GDMA 3D8TA 2P3OA 5AOCA 1E3LA 1Y4SA 1CS0A 4P3KA 1PHRA 3FB4A 4ZPXA 2F8SA 1VOTA 3OMWA 1SHZA 4DABA 2NUPB 2EATA 4I2VA 3PDHA 2Y2VA 4XCXA 1U28A 5TR9A 2I9PA 2VH1A 2BKVA 3REFA 3GLQA 1TVKB 3DH0A 2WTXA 2C07A 4K6MA 5EWLB 5K3AA 2ZIGA 1JIIA 4MVWA 1ND6A 5I9TA 3W1VA 2UYHA 3NALA 4AW9A 3JQEA 1FTNA 1PR2A 2R8PA 3F47A 2IHTA 1KAMA 4JLWA 1ZKMA 2C3UA 3SJBA 3A6JA 4F3YA 3IUBA 1IK4A 4MV4A 4RGYA 4ZV9A 3AFOA 3K8YA 2QUKA 2XOKA 2G9ZA 1TDJA 2X86A 1Z8HA 4MUJA 3DUFB 3MAGA 4RVNA 3UEOA 1NYTA 1RAEA 2HSDA 1TZKA 3C3CA 5JCJD 5KYWB 3PGLA 1Y81A 1TYCA 2D2XA 4GNRA 1EBBA 1QIMA 1UKEA 2WI8A 4INAA 2IYZA 4JITA 1LLQA 3DM9B 4PHCA 1GLVA 3GUZA 1P6UA 3L0PA 1OKKA 1NOJA 1GCUA 2BZSA 3AJDA 4MUYA 3U0BA 4NOMA 3L49A 4QDTA 1DADA 2VJMB 3NCHA 5ERGB 4YVFA 5HRAA 4OQEA 2QU8A 1TZJA 2H59A 5CHYA 1T1RA 3MT7A 4JB8A 4B4OA 4Y6RA 1JEYB 3ZTYA 1UQTA 4DGSA 5AKYA 4YLEA 4DMCA 5IT0A 1G20E 4U39A 4RTRA 3IO3A 3T7AA 1X8JA 1LBQA 3Q87B 2HIHA 2VBFA 3R8XA 4GYJA 5LA6F 5AM2A 4OMDA 1T4BA 1RAFA 2GBIA 3PC7A 3BD8A 4X60A 3DMDA 3HV2A 4I9HA 1Y8ZA 4WZBB 1P6QA 5CB4A 4LKRA 1CJTC 2VUSA 2QNIA 3V4ZA 1NOKA 2BGNA 1MB4A 1USKA 4B3XA 4DLWA 4RTLA 3DP7A 3PUIA 1PFWA 3USZA 2QBYB 1U7HA 4N0DA 1NI4B 4YAJA 2X42A 3OHMA 3GT7A 5DH9A 3SWWA 4X62B 4E03A 3J80A 2X1MA 1UDRA 2POCA 4Q02A 4RK7A 2JK0A 3ADDA 2XSZA 2W6JA 4Q37A 2GM4A 1E9FA 1ISJA 4BHTA 5I8ZA 3AW9A 3OT1A 5CA0A 4GT1A 2YWGA 1Z0FA 1JFFA 2WUEA 3GJRA 1L8LA 1KEVA 1NF9A 1D6SA 2DUWA 2IC5A 1LC0A 2A1UB 2O6LA 3DZCA 3AUXA 3IAXA 3QLTA 4WECA 1K5HA 1XRLA 2B1RA 3RJZA 3UFBA 7REQB 1TA0A 5FLEX 3Q3VA 4GI1A 4Y6QA 2Q1WA 5IT5A 4ENWA 1N2ZA 5ENDA 1VB5A 2OKGA 1AUXA 4GO1A 3VR3D 1EQUA 3IR5A 2OFXA 2JGFA 3DV0B 1U9JA 3E1GA 3ZDRA 2ZB8A 2V4UA 4ARVA 3IIMA 4PPQA 2O07A 3AY7A 2WFZA 4WCVA 1QV7A 1AB6A 2Q3FA 3CYFA 3EZYA 1VJ0A 2QNBA 3U3MA 4Z7NB 2P6UA 1OC4A 3I37X 4PC1A 5E4FA 4DMGA 1QG6A 4ZU1X 1W48A 1RPTA 5IYZA 3HBMA 2CFSA 2G5PA 4LS3A 5LNK6 2PV7A 1H93A 1R6XA 3DDSA 4EY8A 1L4NA 2CXXA 3QI7A 5C37A 1V39A 4IJQA 3N3AC 4N3NA 1HFJA 2GVDC 3LC1O 1F6DA 5JEEA 1QHGA 2R1ZA 1WZIA 2IHJA 1LK0A 2ZRDA 3W8DA 3RIHA 2WABA 4ER7A 2B83A 2CDNA 5CUQA 3TQFA 3RRBA 3UICA 1PYGA 2YH2A 4YDHB 1WCV1 1XZKA 2DQ4A 1SVOA 4YQYA 2DUNA 5KNBA 1Q77A 1R12A 1WUTA 1EP2B 1FFGA 2WUVA 5D84A 4ZALA 1KDTA 2HK8A 1KDPA 3F5DA 1D3AA 3JQDA 4FHGA 2O8BB 3BIXA 3C7DB 2ISSD 1R66A 1BE8A 3Q2OA 3D2BA 5ALYA 5KOJA 1TI7A 4CFYA 1QUEA 1AO0A 2GEKA 1PL6A 3C5CA 4Q12A 4R2MA 2WFMA 1E0AA 3DFIA 1YMUA 4X44A 1IXZA 1KMIY 1WCWA 2AV6A 4JP3A 4PQYA 1WNFA 4ZXPA 1K0FA 3JRWA 1JJBA 3JZMA 3JSAA 1X9IA 5BRAA 1D5CA 2PKYX 3MMXA 3H9EO 3GPBA 5LDGA 4ESOA 3VKFA 5EESA 4TXLA 1LV7A 1UQRA 4LJRA 2PUVA 4DNFA 3NMUF 3CPJB 1HZJA 2DZDA 2HGZA 3GRZA 1IBRA 4HWRA 4BGVA 2D1SA 2WZBA 4OHWA 5ECYA 4ZAFA 3CVJA 4C76A 1QKJA 3RS8A 4HAWA 4FIDA 1P5ZB 4NYIR 3OIUA 4UEKA 4BFWA 1U63A 2EFCB 2D5LA 4P7FA 1VECA 2F00A 2OBYA 4P33A 5E9JA 4EG4A 1MQAA 1QOQB 4KQ9A 1E6MA 4IM7A 4QICA 1O96B 1NE7A 1U2RA 4HMOA 1ULUA 3HV0A 3MBOA 5B36A 2IW3A 2RGWA 3BK7A 5FBRB 5FUWA 2EU8A 2LDXA 1CYDA 4BVBA 1AKMA 1NR1A 2YVAA 1SULA 1E1KA 2A14A 3W5VA 4GBGA 4QPPA 2NU9A 5BQXA 3WAJA 1DAPA 1EMDA 3DAPA 1DAHA 3F67A 3NRBA 2G9QA 5BYJA 3C1UA 5BRJA 1KMMA 5L4SA 4C7JA 3I42A 4ALKA 4O4JB 1XMIA 1AK9A 2M2IA 2P9QA 5P21A 2B7LA 2BSAA 4M3NA 2JCBA 3MQFA 1N8TA 3AF4A 5HKBA 1H9CA 1O95C 5FR2A 3O7MA 4E2YA 1OH8A 3K71B 1PVDA 4RFSB 5A6SA 2P5UA 1U3GA 1GA4A 1P2DA 1YI8A 2A9OA 2R5FA 2OHJA 3FRIA 3MPOA 5KSPA 1KBOA 2UVPB 4BVJA 4DRZA 5IJ9A 4RTPA 4CM8B 1KQFA 4JZYA 4XWGA 4UUMA 4FT2A 2HZ7A 5H9VA 4LYJA 5H3CA 5DF1A 3CNBA 2XUQA 4ND8B 1YRWA 1Y4UA 3HKBB 2BSQA 3NTUA 2AI3A 5AI4A 4F7DA 1WZNA 5E6SB 1NU6A 1VSBA 5CA0F 4AZ3A 2W11A 2OHIA 2IWRA 3VSBA 3MCAA 1KI3A 4LF7B 4QXPA 2W6PA 2DFNA 4MKGA 5K0ZA 2ISCA 3UK2A 4W1SA 1QGZA 3U5TA 1XD9A 1T3LA 2EBUA 3A6KA 1H0KA 2CZCA 2F9MA 2VJYA 3VM6A 3VMMA 4JJZA 2O8DB 4BLTA 4K81B 4LJ6A 1PAUA 5B1EA 3IP7A 4GLLA 2CLIB 4LMPA 1WD7A 4NH4A 4C29A 2PRZA 3OOSA 1KZGB 1HE4A 2GPNA 2P9ZA 1IAVA 4RTKA 3Q8KA 1PT7A 2WHXA 1JV2B 1X2BA 1W5BA 2SICE 2Z1MA 3E82A 4Q39A 5HJ2A 4KQHA 3V8EA 4EECA 4ZI7A 1TEVA 2WJAA 3QIAA 4F06A 5BMVB 3PX7A 2HXYA 3PUVA 5IYZF 2G5TA 1E4VA 3V80A 1TU3A 1C7FA 2IOFK 1VFNA 3PIIA 3U7QA 2FEPA 2ZJ5A 2R7AA 1DBIA 3WBKA 2V4MA 4RZUA 3L05A 2QRHA 5FXMA 3FIUA 2P5SA 3VO1A 5B7NA 3ZOZA 3NHBA 5JH7A 2FSFA 3U4QA 1P31A 4GOKA 1F12A 3C6ZA 1PWZA 5CVDA 4MJ3A 3HJTA 4KRGA 4YAKA 4RQTA 1M7BA 2C88A 3G85A 5FPSA 5I7HA 2HZBA 3AHDA 3BB3A 4GYWA 4WZAA 3Q3JB 2YICA 1KL7A 3UAOA 4E08A 2BUAA 5E4YA 2A2ZA 2MOKA 2CMFA 1C9NA 1XZAA 2HU7A 4KC0A 4BECA 1X0XA 4OQLA 1Q22A 1MR3F 4JLAA 2OZLA 4FDUA 3TVDA 4XZ3A 4UULA 3TW0A 3VU1A 1E6WA 4INOA 3U3RA 2WDPA 1R6TA 4IINA 3LQ4A 1BE1A 3H19A 4KEAA 4YAUA 2NTVA 2PBRA 4DMRA 1NM5C 3NIWA 4QFCA 2YRXA 3NATA 1GPLA 2WP8J 1PCXA 1X1RA 4JXZA 3L1VA 4ZJUA 4DV7B 2X76A 4I4LA 3HB7A 4MRAA 5KQSA 1NGSA 1ZMBA 2QYHA 1YC5A 4DUGD 3DBOB 3HDYA 4O59O 1JHRA 4P58A 4PSUA 5H82A 4JLUA 3AR5A 3RAPR 4D8VA 1NJ2A 5HE9A 4YONB 4DCMA 4D45A 2WTAA 3U61B 3RRZA 4C3VA 2ONZA 4W8GA 1FNSA 4EHIA 1H4QA 4X1IB 2GSDA 3DE7X 1LEHA 3FFBA 3GJ7A 4JXJA 3EGXA 1MXHA 1GG2A 3IULA 1ZGAA 4RFVA 5JSZB 4BXOB 1E5XA 4ZOQI 3V1MA 1U8XX 1D9ZA 4QSMA 4RIIA 4PXSA 3BCSA 2PJRA 1NV8A 5TQ0A 3ENQA 2G67A 3F3SA 4F4FA 1GQQA 4TQUS 1F8YA 4AY3A 4R2JA 4B46A 4RCYA 4P9NA 1PWXA 4YQEA 3GUUA 1XDWA 1EZZA 4HMQA 5KPJA 2B4YA 4G1MB 2I1QA 4IDCA 4IRXA 1RZ3A 1RXSA 2XTNA 1WXXA 1YUNA 3S1SA 4IDQA 4DHWA 4CIXA 2FKAA 2P75A 4LA4A 3BEOA 5AI0A 3QRWA 2VWPA 1E5VA 4CMJA 1W52X 1CPYA 1QTRA 5C31A 4A5OA 2PEYA 1XT6A 4C7XA 3G9XA 2MR6A 4KHPB 3BS4A 3LLSA 3TZKA 2DECA 1RJEA 4AX4A 3MWGA 4BP9A 5BSVA 2FE1A 3V6MA 2H4XA 3CINA 3GJTA 4X93A 4PWZA 4ALMA 4EYGA 1E2FA 4JP5A 4LMBA 4NFYA 1F38A 4RH3A 1Z4MA 4DXAA 3K6SB 1RYBA 3BTSA 4GIBA 5EHQA 3IMCA 1DTWB 1LBEA 4TTPA 2P9BA 3R7WA 2FXIA 3LWZA 2JLBA 5M3BA 3VJLA 5KQPA 3I3OA 4R9RA 4TSFD 2OXFA 1M5UA 3V7WA 2QPOA 2RGNA 1QE3A 3B2QA 3BGDA 3BGIA 3ZNPA 1WVIA 2WD7A 3WL4A 3WNQA 5BV1A 3GELA 3I5MA 3TFQA 1T6ZA 4WKGA 3PENA 3TH5A 2I80A 4U7GA 4I99A 1FUUA 3WLLA 2DTDA 1FE8A 2IQ5A 2BI4A 2FOIA 2WSBA 4HLDA 5JW6A 5F2OA 4R8LA 4Q4CA 3OJLA 3C7CB 1KS2A 2VXCA 5EIBD 5E3HA 1CUCA 3A1FA 3FOEC 2OFFA 2I2CA 3SVZA 2GOYA 3K0AA 4PBTA 4UFNA 1L5LA 2ZRGA 1QYCA 3OX1A 1KYTA 5DSTA 2OECA 4BLWA 2XKKA 4TM7A 3R8CA 4OG2A 4BASA 1MHTA 3FTNA 4L8LA 4ZVQA 3ZHOA 2A92A 1J2TA 2QTBA 3PRKE 3UV3A 4ZI7F 4F9TA 1V9LA 4L3OA 2EXXA 1J22A 4IGIA 3WRXC 3IQIX 1PP4A 3N6RA 4RIFA 1MABB 5K3SA 4CU2A 2ORYA 5K51A 2QY9A 4FGWA 4E7OA 1NMYA 4N47A 3IT1A 3VTZA 2QL9A 3GH3A 2CDBA 2CHQA 4AG3A 3FWNA 2QL7A 2FG5A 3A0RB 3WIUA 3E9RA 2VP6A 2VYNA 4RVUA 2JVJA 2NGRA 3EXHA 3WADA 4KQ6A 3P9RA 1RYMA 1V6CA 3K15A 4OJTA 3V33A 3WDMA 1EUYA 1WXWA 2C7GA 3WGVA 3R6DA 3LSTA 2XYPA 3I1FA 4PGMA 4HAXA 3IEXA 3N7AA 4O8CA 3FUCA 2X5NA 1ETHA 3HN7A 4LY0A 1WS6A 1HUQA 1UAYA 4B35A 4W7SA 1JJ7A 3JW8A 1N1MA 4TV9B 1ECFA 3EG9B 1Z29A 1SOWA 3UT5B 1U2GC 4QPNA 4RANA 4ZO6A 3I9JA 4UPVA 4ZCIA 5TF0A 3FCUB 1AQ6A 3DL2A 4FD3A 5DN6A 5FTMA 3ODPA 1SIUA 2ZI3A 3GQVA 2G0NA 3DFZA 4DTIA 4QRIA 1CLEA 5DP1A 1OGIA 3JAKA 2Q3MA 2WIKA 1M2OA 3AM4A 4UCWA 1RI3A 5HDBB 1XTPA 3U7HB 1WKVA 6CHYA 4HUTA 2AN3A 1OPXA 1NJGA 3UKDA 3RUFA 3AJ9A 1QHXA 3H2JA 2PLRA 2HMAA 3TPZA 2BOVA 2YJ5A 3DD1A 3MCWA 4BLQA 2WSYB 4ALLA 1Y5MA 2O57A 1EWYA 3C3MA 4ZVMA 4AMBA 3BSYA 2YQ4A 4RD1A 3EXFB 4IRMA 3SFTA 3WL8A 4CIYA 3E8MA 5JCOA 2QHXA 1KJQA 3C8ZA 2XCQA 5IZ4A 3X44A 1MKYA 4DVGA 3H42B 2IHUA 2H5IA 3SLGA 4A36A 3PC8A 3A58B 4MGYR 3UWMA 4WOCA 1JKJB 4KR0A 1P91A 2AFHA 1VLMA 2SKDA 4LF4B 3LQFA 2EWMA 4TPKA 3FBWA 4HQNA 2D1TA 4D5GA 2QV7A 2RSLA 3TBHA 3VAYA 4TUYB 5TVKA 1Y0BA 1MW8X 2Q0QA 4Q1FA 4B3BA 1FC0A 4YALA 3SZ3A 1X8XA 3TLKA 2XZPA 4DCVA 5ISMA 5FH9A 3PVSA 1E89A 3WG9A 4K46A 5BV8A 2WVGA 3EAQA 4QYXA 3C15C 3ZIAD 1KU6A 2QZZA 3AU9A 4QDZA 4E46A 5BMOA 1QU2A 3EDYA 4PYNA 5C8YA 3B13B 4EKNB 3RU9A 3W5DA 2IA5A 5F3WB 1PZHA 1ZH8A 1UDAA 2PX6A 4IDFA 4JT8A 4FKBA 1ZUIA 1V5IA 4O2RA 2HNAA 3RRXA 4LOKA 3IOMA 1R10A 3IB3A 1CT9A 1O5IA 4BUCA 3O47A 1UPUA 1KEUA 2JFXA 5BP7A 2JAOA 3BJEA 2BZGA 3EISA 2WKWA 3ZBQA 3LJKA 2PZFA 4Y9TA 3GFVA 2PMKA 3U9LA 1EDBA 3AVWA 4GRDA 4FTWA 4NBNA 3AF2A 2PL5A 2XZDA 1IY2A 3SYNA 4HDSB 3OJOA 2J3HA 2PLAA 1QGYA 1TVEA 4P35A 4Z0PA 1M0EA 5CBKA 1FJHA 3BMQB 5IJ0A 3A1SA 1LW6E 4UUBA 1MLDA 3V2GA 4LFCB 4ZCPA 4IHJF 3IAM6 2XUPA 2E18A 5NLLA 2GXUA 3ZJ5A 1PJQA 5ILOA 1PQ4A 3SC3A 1A1VA 2R6DA 2I91A 2X0RA 3A27A 3KJIA 4UCFA 3TNJA 2X15A 3J81k 2ZBVA 4Z1OA 4MUEA 4QQNA 1JB9A 4BZXA 2H9IA 5LYYA 2LPMA 4KLZA 1CEEA 4CLOA 4YASA 1T26A 5B1IA 2YX1A 1LPBB 3QKRB 4H77A 4JQCA 2XQFA 4CLRB 4WDRA 5I01A 1ZI8A 1W7AA 1GSIA 4OB8A 1A3CA 2VZ9A 4RABA 1YVPA 1YHYA 1YS6A 3C3BA 1L9KA 1DAEA 3QBTA 4O08A 4NARA 3ZU4A 5C1OA 1ISRA 1VKHA 4TX1A 4F5YA 1MNAA 2QY6A 4RENA 4URZR 2FJ0A 1PL0A 4YRNA 4BUJA 2ZYVX 2BCGY 5AW0A 3LPDA 1XHEA 1JQLB 4FGKA 2QTTA 4U8HA 1B26A 1EFVA 3TTSA 2J9ZB 1G7CA 3O74A 1G3QA 2AVNA 2VHWA 5GJCA 3P2KA 1TQHA 3S70A 1Z7BA 1IHOA 3OICA 4WH0A 2GZ2A 4E33A 2AG8A 1RHQA 2W6IA 2XWBF 3GAZA 3QQPA 1BIFA 5IJAA 3RC3A 3QMPA 3K16A 3RTGA 4DA0A 2FQ1A 2X3YA 6REQA 3VTKA 3AERA 4QQKA 2E4WA 2MU1A 4UW9A 2YWFA 3GD5A 4H4EA 2HFKA 3ABZA 1P3DA 1DIGA 2YWBA 3HYRA 4JU8A 4TMTA 5KCZA 3TRHA 1GEEA 3NXSA 4KOAA 2VZ0A 2PUHA 1TJ4A 1KZHA 1DEAA 1M1YA 1E2LA 1PDOA 1Y3FE 4HSGA 2Z2KA 4KW7A 3OY2A 2CUNA 2QTZA 3PBKA 4CIBA 4MP8A 4L57A 4Z3DA 5IKOA 2C9YA 1BO6A 5K8JB 1JYSA 1YGPA 2WJHA 4I5GA 1Z0ZA 1YK0A 4KMSA 3RC2A 3OG9A 4DMKA 2XCUA 1P8AA 1TYDE 1KY4A 2AW5A 2RJ3A 7ABPA 1L2TA 4J91A 4YQZA 2ECKA 5DJ5A 1ZYUA 5C34B 4DLZA 5HZMA 5C2JB 2OO5A 3AR2A 2WAMA 1J1ZA 4QOJA 1L8AA 4XD7D 4YC7A 5JAUA 2OV3A 3JQRA 4FP9A 3S29A 2H7YA 2QR2A 2ZJ6A 1WV1A 1TM4E 2I4IA 1XMOB 4BMNA 1I0LA 4U7FA 3GLIA 2QG4A 1JQKA 1SWVA 2PBLA 1WY5A 1JPUA 4XDHA 1VKNA 1RAAA 3MBKA 4GUDA 4L85A 5KHAA 3GZNA 4FC6A 2NXEA 1TD1A 3ZQKA 3D3WB 1KPHA 4PNHA 3WTBA 4E5PA 4GDFA 2WUGA 3I6ZA 2WWYA 3RH0A 4AS2A 3R6WA 4Y7CA 4OATA 4KFSA 1Y33E 2Q3BA 1CRQA 2JG3A 1GAQA 4J2HA 4UU8A 4C03A 5IKMA 1EFAA 3QEBZ 3W5JA 1A8PA 1AM4D 4GP7A 4ZWNA 1GDDA 4EBBA 3BIJA 3HKDA 3QX9A 2D59A 4FX5A 3WBJA 4F92B 5C8YF 1FMLA 1ONNA 1UPAA 2EZ9A 5DYIA 1T0UA 3UK1A 5HUQA 3HCOA 1N8KA 2XT0A 2O8NA 2OT3B 3MILA 4FCCA 4BO4A 5EMHA 4KITB 3GQBB 2XQJA 2FHPA 3GLKA 5CW1A 3LKDA 5B4TA 1U0OC 2C96A 1ESEA 1QE5A 3LWDA 2BFEA 3GGPA 4I4CA 3RS2A 1G4AE 5G4LA 5I9LA 3W5AA 4Q9IA 3BRCA 2R8XA 1LFAA 2I8LA 3I73A 4XB1A 1I1NA 1QH0A 3FCYA 4X6UA 1JFVA 1II9A 1Q7RA 5JU6A 2JHCA 1YIOA 1BEUB 3GGJA 4CQJA 2VO1A 3ND5A 4RKWA 2HJRA 1FYEA 2X8AA 4WCFA 3PDJA 2J8ZA 5JASA 1RHRA 4TWRA 5A4KA 1TQ8A 4I8DA 3K70C 2H2HA 1AKVA 1BOOA 5I9MA 2CZQA 1QG2A 3UF0A 3DOCA 3I2KA 5IT4A 1DKQA 5FL3A 5FTJA 1DC6A 4JNCA 4QRHA 4Y9RA 4I1UA 4NYMQ 1N6IA 4UEQA 5L3RA 3FGOA 2X2OA 4NS1A 5BT9A 5BOSA 4YX9A 4OO3A 5EGSA 1NVEA 2X8LA 5DRYA 4Q48A 3MGCA 3WWDA 1Q0SA 5KNCA 2QAIA 4IAOA 4DNQA 3C97A 1SBNE 4EUSA 2BTQB 3GLVA 1EJ0A 2BUBA 2CJYA 1QAQA 2C1EA 1E63A 3RIXA 1OWOA 3L8ZA 1DAMA 1CJBA 2VYFA 4UTXA 1YMVA 1XP5A 2XMPA 3TLMA 2VC2B 3KO8A 5EKXA 5EY5B 1AUVA 3BE8A 2DQSA 1PUJA 2ZW9A 4FC7A 1THZA 4FFWA 2FPLA 3NVKI 3O2SB 5E8JA 3RYTC 4DQUA 4YMGA 4ND7A 3G2KA 3H0CA 2X4LA 1UZAA 2RHTA 2P4SA 4OHZA 4TLCA 2ZTUA 5F4ZA 1MO5A 3ZDDA 1B3BA 1O94A 4YV1A 1JHVA 1VG8A 3H1EA 2O5RA 2PD6A 4KLNA 2ZTMA 2VAPA 4UCQA 2YC4C 3DE0X 3LUDA 3RTCA 4FJ1A 4CDNA 4YUYA 5JPDA 5K5EA 5AQEA 4ZI2A 4OSPA 3ITDA 4FHZA 3P0HA 1V41E 2IGBA 3WIBA 3DZFA 1SPXA 3LV8A 4RTMA 4LMRA 2Q21A 4GI5A 1JHPA 4MAMA 4C7OB 1N33B 4GWGA 4B44A 2AXEA 4DR1B 4WV3A 3PJGA 4GWLA 4B09A 4QUHA 3B52X 1Q1QA 1S9HA 2B25A 3CURA 5C32A 4NEGA 4YB8A 1QCZA 1KI7A 2PLFA 3VHXA 4BLVA 3O8LA 3I1YA 3FFXA 1OW3B 2Z09A 2LCIA 3TSYA 1WXQA 3WDSA 1ESZA 2CK3A 4EHNA 2YVQA 3OE4A 3UMYA 3KYDB 3RK4A 1PWYE 3W5HA 2B4QA 3SSAA 1D8TA 2PT6A 2QYTA 3BPSA 5BSEA 4KFUA 3GP3A 4Y6PA 1QH8A 4MKHA 4NK4A 4MZXA 2P6RA 1Z7GA 2IVFA 4DLNA 3PDWA 4HXEB 5DNYB 2E4AA 4Q1AA 3WO0A 2I34A 1ODKA 1L7PA 2FN3A 2QZ4A 2NUAB 1I2CA 2DULA 2ZYHA 3ORHA 3D8RA 4LJYA 4DT1A 2ZJ8A 1R18A 4URWR 5U1PA 5EXXA 4EG5A 1R5BA 2WKRA 3BXEA 2FFQA 5LQRA 1MFZA 2NT4A 1YR7A 2DPLA 5EKUA 1EHIA 1GNLA 3ML1A 4OH1A 1YULA 1XL0A 1P29A 3ZNOA 4OSEA 3LECA 5T7BA 1EG7A 1Z6PA 3N75A 3DYVA 4TYPA 2IYLD 3KALA 3TEFA 4ARAA 1Q50A 3SFVA 1IN5A 4P4TA 1Z4IA 4RWEA 3B53X 2I4RA 3DHYA 3UMBA 3IQHX 2IK8A 2PZJA 3H11B 3R5SA 5IVHA 4BKUA 4YT4A 4B75A 3FFAA 2XTZA 2PT7A 1TF2A 1HG1A 3LFTA 1K7SN 1RR6A 5GY7A 3VNBA 4IYJA 2AIRA 4PG5A 1KVQA 1MRNA 1UXJA 2X9VA 4IFEA 4OKSA 1VG9B 3GNTA 3LDFA 4RD3A 2J0EA 5IK2A 1C3EA 1CZNA 1N1GA 4KMMA 4M21A 1M72A 1HMPA 3H3JA 5A5GA 4NC9A 3CG0A 2XYQA 4URYR 1CE8A 1V1MA 2ZR7A 2QRZA 2XF8A 3TQHA 3V1KA 3TBKA 4AP5A 2P6MA 2RK4A 2KB0A 3GLHE 1KR2A 4Z86A 4QUKA 2W6OA 1CVRA 3L6BA 5FUBA 4FOPA 2PLNA 1JBQA 4B47A 4F4IA 4J1SA 1VLVA 4DLAA 1P72A 1VFPA 1KXZA 2XPCA 3A1UA 1MJGM 1XXHE 1KFJB 4GRAA 1UPCA 1UP7A 1T9DA 2GCOB 1YKGA 3N8IA 3SC2B 1MJFA 5K05A 1NYQA 3HL4A 2PSDA 4GQBA 4BNVA 2AR0A 4KI0A 3WR5A 4C9BA 1L4HA 2AF3C 2I1WA 3HVUA 4N7RA 3M8KA 5SZHB 4C6TB 3MLAA 4URHA 2GQ0A 1J4AA 2QLJA 3OECA 5K3EA 1BDJA 3UJBA 1H2YA 4E88A 2EL9A 1PS8A 2ETVA 1D2CA 5JCZA 1H65A 3VPDA 2R8YA 1QYIA 1OX4A 2FQYA 1JLLA 5DEIA 2JJQA 3G6KA 4RIGA 4RZ2A 3AB3A 5DYWA 1RLUA 2PWAA 3CE6A 1E2MA 4WDQA 1K88A 2OCGA 1Y8CA 2CMGA 2YV4A 1VYVA 3KXPA 3L02A 2BAGA 3HFRA 4RYDA 5G0WA 3N2IA 4OFXA 5G53C 1B0PA 1I24A 1UT5A 1YONA 2JAUA 4MQLA 4WKPA 1QBGA 1NY6A 1WM1A 5L6MB 2O7RA 4OP1A 1WDTA 4U2DA 3CCCA 2CL6X 3JAMA 2ZRQA 5EG5A 1Z33A 3KK0A 1K92A 5JI2E 3TSCA 4OV6B 1YTUA 1JPVA 3GVCA 4YAFA 1GTJ1 3W77A 4NP6A 2GERA 4Z4QA 3QSYA 4KNYA 1ULTA 2WQZA 3IOCA 5L40A 2GCPA 4COKA 4LCBA 5AHXA 4HNTA 4RGQA 4RD2A 2AE2A 1YB5A 1IY9A 2W2OA 3G5AA 3GJXC 4JBLA 9GPBA 4KXLA 4FZ5A 5LJLA 3QE0A 4OOEA 5KJCA 3F1KA 4F1JA 2AVDA 1KXJA 4AJ2A 1BG6A 2Z8XA 3EYAA 3NPAA 4LEIA 3G2HA 1M8JA 1OXVA 2V7QD 5EQJB 4CL2A 1YTLA 3NFRA 3TYXA 3SZRA 3WJ7A 5K03A 3B7WA 3I83A 4HKTA 1GQYA 5DISB 3SJZA 4R1UA 5GJVC 4EO9A 2ZB7A 3IIKA 1YZGA 2WWTA 3E1SA 4B4DA 5U4XA 2IYEA 1T1JA 1Y1KE 3A6LA 2MCFA 4D6XA 1NXVA 1TCAA 5TF4A 1HL3A 1KERA 1RPNA 2VLIA 3I6YA 4NXMB 3ZW8A 4JY7A 4B7AA 2QN9A 2X5OA 4Z9FA 1R9JA 3PC3A 3LVRE 2H7VA 2CXUA 5ELLA 1IHYA 1IBMB 1CP2A 4N18A 3KE8A 4EI9A 1E96A 1KDRA 2P2NA 3ZJTA 2FEWB 1KQ3A 4EOGA 3ZEAA 3ORQA 1NW7A 1N6LA 3GRRA 1KSGA 5HM6A 2H4FA 3KUDA 2L18A 4G5QA 1T5BA 4LXYA 5DNUA 5HKKD 1FP7A 2R7LA 2ZJ4A 3DEAA 2HTFA 4RZSA 3TRJA 4JXXA 1N5OX 4TTVA 1YBFA 2B6NA 2E1PA 1EH5A 5EE5B 1Q95A 2E4XA 2NNLD 1KDZA 3VHQA 2BI7A 5KX5F 3F4LA 3HDVA 4GZ3A 5AVWA 5C7IO 1YBMA 2OBXA 3EGWA 4P36A 1GFSA 4L2IA 3VPGA 4ERNA 2W9XA 2ZBQA 1PIWA 4HFRA 1DS6A 4Q3CA 4XWOA 3FTEA 1UANA 3FDIA 4K2AA 4ZOLA 3HA3A 4V1CI 4RQUA 2HMSA 1G8AA 3PTZA 4M0UA 3R6LA 5CVEA 3ZNNA 2HHHB 3UBTA 5THXA 3NU1A 1XCPA 3V55A 2E87A 3IMFA 1DAGA 5IDWA 2K7ZA 4RKYA 2CDCA 3JALA 3AESB 5CRIA 1ZR4A 1CNFA 2NADA 3P27A 3WL7A 4OK6A 4YP6A 3ORYA 3U13A 1M5TA 1TUEA 5KDDA 2NWQA 1LPAB 1CJMA 1VQ1A 4L6AA 2J6CA 1KAQA 2QS9A 1O6BA 2IEGA 3B2NA 3U1BA 2DCUA 1KZYC 3AL3A 2QAGA 5GJBA 2OHGA 2B94A 2WLTA 1SUSA 2NO6A 3O38A 5H0IA 3I4LA 3KU1A 3EXEB 4PQGA 3ZHXA 3FYTA 4OQQA 2AXQA 2FW9A 3CBQA 1JDZA 3SMQA 1DQSA 2BE7A 1XNJA 3CZ5A 3FX2A 1NVBA 3M2PA 4KLAA 4LZAA 2FMXA 5E6UB 5BNZA 2BONA 3NWPA 1PBNA 1UKVY 4B3RB 1SK9A 1MVLA 1X3LA 4GHWA 1ODIA 3KKOA 1QQ5A 1QE0A 2YXEA 3MJRA 1D4AA 2HHLA 4P7GA 4H0FA 1QSGA 2XODA 1T35A 4OQDA 3MTIA 1K7EB 1A72A 1HDXA 3UOGA 5SICE 1G0OA 3G2MA 1H6BA 1V7PC 3L0DA 4FGUA 1R4ZA 2ZUCA 2VHQA 2JA2A 3EEOA 2HTEA 2FPKA 2ROQA 3C3KA 2CSXA 1ZOPA 2IDJA 4WKBA 3VZCA 3N58A 5DHUA 1AK2A 3ZHCA 4UTVA 2FLVA 2PXCA 1U3UA 4XYGA 4ZQHA 5EXPA 1G7RA 5A3QA 3B85A 1Y9JA 1K0UA 1LPPA 3WB9A 3FTFA 5FQOA 4RNDB 1SU6A 2OBMA 5CW2A 3II6X 4AY2A 1PZEA 1J1UA 1NNLA 3NC4A 4R3NA 1RWNA 1TNDA 1AX9A 2JAWA 2JCVA 1QK3A 2Q8NA 4OMFG 4WK0B 3U4DA 4BNLA 3UB2A 2W0MA 4L3WA 1IMJA 5AK6A 5I9IA 1GDTA 3WJ1A 2JD1A 1BW9B 1M2KA 3WKAA 5E6RB 2BM0A 3GIWA 3IUNA 2A35A 3LQ1A 3CNQS 1GYRA 3ZY2A 1X7WB 2EP8A 3K6KA 4RIHA 3RWMB 2WZCA 3FI9A 5C5CA 2VJDA 3ECCA 3HVKA 4ZODA 2C5SA 3H9BA 1XYYA 3VU9A 3GW8A 3ZE9A 2DG2A 2GBLC 3H5IA 2BPOA 3T1NA 3EF1A 5A4AA 1YVUA 2IJGX 2QI9C 1R4NA 5L3SB 3RB8A 3C8MA 4XGIA 2JD2A 3LBIA 2XXAA 4GH5A 1NIPA 3LK7A 5F1OA 2H7XA 4M49A 4YRQA 1T13A 3PI7A 4BKRA 2TS1A 2L0XA 3W0LB 1MVNA 1LQTA 2VN8A 2X9QA 1HGXA 2IIVA 2GZAA 2HK9A 2XOXA 4B76A 3F4KA 4JX8A 3I58A 4Y2TA 3OT4A 5LZ2A 1TUIA 2A6PA 1BXRB 4U5QA 3DYBA 4AIIA 2IBSA 4REQA 2PMEA 5BN1A 5H1YA 4H27A 4X7RA 3SZGA 1BHQ1 1XTQA 2BBWA 2CLDX 4R1LA 3EJ6A 2Q2WA 1E3JA 4J2TA 4RE5A 4Y1RA 5IN5A 3ZJYA 1EFUA 1XEWY 3I2GA 3WRYA 1RWWA 2JEYA 5L6LB 3KV1A 4MVJI 5L53A 5EIAA 2A9QA 1FZQA 3ZKWB 1WMBA 1IMOA 3U9TA 1WHTA 4TS9A 1FNBA 4A2PA 1H8ED 1PJZA 3HTXA 2FMHA 3KKKA 4JLBA 5LIPA 1C9YA 1P1BA 3CW9A 4YCAA 4L4XA 2FR1A 1JXOA 2XUOA 4TMWA 2AWOA 4B6GA 2FWMX 1BAPA 1T5LA 1W4LA 5EJEA 4LCJA 3KLOA 1NT4A 1Y6ZA 3TZCA 4BEVA 4ENUA 2BFFA 4ZOLF 3T7CA 3VU8A 3WK5A 3MCTA 4LG1A 2WPDD 3RROA 4P5EA 1K8QA 4DLUA 4QFDA 3OEHD 5T57A 4CTNA 1XN1A 5DXJA 3RQSA 4QPDA 2D4HA 3DGFC 1ZXLA 2ZB2A 3FRJA 1SQ5A 3QITA 5ALXA 5AM4A 4BB6A 4DEXA 3AMVA 1BS9A 4I50B 2ZBRA 3T3HA 4GGOA 3UWOA 1EDEA 1R2QA 4HJRA 3F9RA 4C6HA 5LFAA 2CLLB 3D54D 1JR2A 4FW8A 5J1SB 4G0XA 2IEYA 4TQ9A 3T12A 1E8MA 2NN3C 3ND9A 1JEDA 2JJ1A 3TLGB 5LR6A 3QNMA 4MVJG 4MYHA 5DK4A 1IHUA 3IAAA 3F8TA 4EMTA 5D3ZA 1JF8A 4WACA 1M2NA 2AQ8A 2G6TA 2VJCA 5CVVA 3QEMA 3X1MA 2Y77A 3HBNA 2A0FA 1VBFA 3OF3A 3UT6A 3PC8C 3O91A 4IDNA 2IZ0A 3QLUA 2HQSA 4QL3A 5AVQA 5CFRA 1PFYA 5I6DA 3C8HA 1A7KA 1Z45A 2GNAA 2OL4A 2ZAGA 4V0SA 5EUCA 1J9GA 2PQ2A 2SBTA 2Y3IA 4XM1A 3WGLA 5IHPA 5NULA 1NMEA 1Y48E 1V48A 3EEFA 1XHLA 4PWYA 2PSFA 1BE6A 1N2GA 3CF2A 4CU5A 1MO3A 2DT8A 3ZYZA 1MENA 1ZEMA 1ZGBA 4AM8A 1UEXC 6NULA 1TPZA 1XZIA 1T6XA 1IUPA 3GLFE 2WD9A 2KYRA 1TO6A 2JIZA 1FDTA 3DPUA 3GRPA 5A3VA 4LZLA 3TSAA 1IY8A 2HXGA 2Q5JA 1U7WA 1OTYA 2Z2ZA 4JCOA 4YDQA 3AFMA 3OKPA 2TMKA 4ML3A 2P2CA 3RUIA 4TL8A 3MQ4A 1RPAA 3SBXA 2W83A 1CR1A 1NP6A 2PUBA 2FN9A 1IQUA 1MAAA 2OC4A 1US8A 2VT6A 1HDIA 4KXVA 1CY4A 2KLHA 3M3DA 2NPFA 3DB1A 3WFZA 4FEAA 4JXKA 3VO9A 2ZTVA 3KAPA 4ILEA 3ANLA 3BMCA 4KWCA 3X1YA 2AFVA 5DX1A 1TT7A 3SM9A 2RMKA 2VQSA 3FGPA 1CVLA 4MDYA 2HBQA 3NBAA 4IILA 3DNPA 4N6NA 1AZSC 3DTVA 1C30B 3LGSA 2FFHA 4RL4A 4HN9A 4KNVA 2JZOA 3PGMA 4J43A 4ZT3A 2OQVA 4D79A 5ECDA 3DXXA 2WVJA 4PVDA 3KZ1E 3PNOA 2WAXA 1P9OA 2XQKA 1CIPA 2J1LA 1W73A 4IIXA 4K86A 3RTDA 4BNUA 4CMAA 5L45A 3VXKA 3GC6A 4JB3A 3C4VA 3G02A 3RT1A 4C04A 3U9SA 1D09A 4YJGB 4DCTA 5J2TA 4AZ0B 2BIFA 4QXQA 1P45A 3DUWA 4LK2A 4Z9AA 4B6OA 4JJAA 3ROPA 3X1DA 1AQJA 2GD6A 2XUHA 1OI7A 2ZK7A 3B3FA 3N2ZB 5DYGA 1QO7A 2CLEB 3FUTA 4YJHB 3AR4A 3VFDA 4W9MC 4E51A 2WJ6A 2R87A 4KTTE 1W19A 2LDBA 3EVCA 1XZFA 4HB4A 4ROTA 1MDFA 1T4CB 3DAHA 2Q62A 4P8RA 1P75A 2FMUA 2EAUA 4UFOA 3K35A 2IS6A 2PKWA 3KDSE 2FQXA 4Y2VA 2CJWB 4AFNA 2E82A 5LQSA 4UQOA 3O1LA 3PE3A 4MWGA 2BP7B 3WMGA 2Y68A 3R09A 4WNAB 1XV5A 2XZLA 2OLEA 1G7SA 3KLBA 2XECA 1NYLA 3LM8A 5I4KA 1N32B 1IG3A 1T0PA 3L8HA 1EVIA 4AF8A 2O8CA 4OF4A 3OCJA 4QO7A 1GL7A 1DDOA 1JDNA 2B1GA 2G8LA 3E22B 2VZEA 1SVKA 3GBSA 4HDNB 4RD0A 2O3RA 3TKAA 1REQB 2XCRB 1XU7A 1ZR2A 4L07A 3F8SA 1FXUA 1Z9BA 1PK9A 4ZI5A 4TKMA 4H3HB 1UBUS 3CR7A 2XMGA 1X7ZB 1X0VA 4DV6B 4J6EA 4NI5A 3MS4A 1UBGA 2BH2A 4WBNA 1ZWKA 4P31A 4AJEA 4EJMA 1AC5A 2OC9A 2ZIEA 2G5GX 2XE6A 1OWNA 1ZJ5A 3E48A 4KWHA 4BO9A 1UFRA 2PIAA 1XMJA 1N2HA 1KEWA 4G0ZA 4FNGA 1U1GA 1K63A 5HCIA 1KP9A 3B1JA 1RM5A 4O1IA 2GETA 4EHFA 1MX3A 1SAYA 4LSWA 1QIJA 2H4YA 3ZLUA 4QBKA 1W6UA 4MR8A 3QYPA 3WAGA 3IV6A 1W36B 3QA3E 4DBLC 4KAXA 2CWDA 5FOWA 2WP0A 5AO9A 3FOZA 3KYJB 3W6NA 4ER0A 1U4OA 3WGMA 1BCRB 2IOFA 2W6MA 1BCSB 2JH9A 3LBNA 3P0RA 1EUZA 3ADBA 3CPSA 4LI0A 4MRMA 3EXAA 4BKOA 2GK7A 2Q5LA 4FU0A 1E6CA 2Y71A 4JODA 3R7DA 3UHAA 4OKIA 2IY7A 1TAHA 4OGLA 3EMDA 3KEOA 1E6UA 3STWA 2Q3EA 4RLQA 3TAXA 1L5WA 3B60A 3OZTA 4JLPA 5HIJA 4CQLA 5IBCA 2QL6A 4XH9B 2F55A 3G8CA 3G9ZA 4YI5A 2AUTA 4BUZA 2HLPA 4QE3A 1PS0A 3WI7A 4Q9AA 2XWSA 4CF7A 2PU7A 2ZKIA 3MT0A 1NASA 4G56A 4B3IA 2CHGA 4E7PA 3TLCA 5I9SA 1H1LB 2I03A 1S1CA 2SCUB 2GSWA 3X2SA 1F2TB 3OQPA 1G5HA 2UYYA 1LFDB 3RGGA 4A3SA 2G0TA 4Z1MD 5FWXA 2KX7A 3UOAB 3OLYA 1T9HA 4UNNA 2G9NA 1USWA 1XDSA 3HQ4O 3HXKA 3I9V6 1FIUA 1SZCA 3DOHA 5KNLA 1KO7A 1WPQA 2FJPA 3BQNB 1A4RA 1G0NA 3O3CA 1UAAA 5E0KB 1ORVA 2IYTA 4F04A 1DJPA 4MPJA 1M34B 1XJQA 1VB3A 3C7KA 1IPFA 4ROSA 4XPIB 5EI5A 1E1QA 4F9EA 1N7GA 3V4OA 1TM2A 2YWRA 3MB8A 5K8IA 5LU9A 8ABPA 1L1FA 2ZR8A 1Z39A 3DDZX 4LAFA 4OBBA 2M6LA 3T41A 2R9VA 2OBFA 1CUDA 4IVNA 2FB9A 5F77A 2R6AA 3PB3A 3D2LA 1D6JA 4E2WA 2YOHA 2C7RA 1NRXA 3W8FA 5M2QA 3TZQA 1QQ6A 4BN0A 1O2DA 3GRFA 4LDQA 4LY9A 1VCOA 1CUGA 1ZAKA 2WZQA 3OF2A 1FCJA 4HEQA 4YXWD 1HE8B 2ENUA 5AVXA 4MYDA 2DJIA 3A3YA 3CB2A 3PTLA 4H60A 1H2EA 2DR0A 4UHJA 4WCFC 1T3SA 2VRCD 2OG1A 4EW1A 1II8B 1YA8A 4DVJA 4EEXA 2GBCA 1IEWA 2VFAA 4AQDA 3NC0C 2W00A 3W6UA 3ENZA 1P1HA 5EPOA 1LD3A 3VZRA 4GX0A 2ZSKA 1B00A 2DQKA 5ADVA 2RI0A 3ZBPA 1J25A 5BSUA 4DARA 4HYTA 3IKVA 5CLFA 3I9FA 4ZOEA 3BB4A 2HPAA 5MFPA 1LLUA 2QXYA 4KVGA 2XUIA 4QAJA 3V8MA 2AXNA 1DGQA 2FZWA 1LV8A 3L7CA 5ALPA 4G5OA 1MB2A 5F9MA 3T7JA 2NQTA 1Q7GA 2FUKA 2CFTA 3JYQA 4HY3A 1JRLA 2ODQA 4KXXA 4EH1A 5INTA 5DBEX 3OWXA 2HMYB 4B6QA 2P4UA 4FWBA 5AVOA 1RI4A 2YZKA 2IP4A 1WAMA 2QYSA 3JQ8A 3BIWA 3DWGA 3MCUA 3CNEA 5AW8A 4NEQA 4Q21A 3F7NA 1IEQA 1X3SA 2Q99A 3QUAA 4YBRA 3IUMA 5EGNA 1G8MA 4EW2A 4BJ5A 2VA9A 2ESRA 1Z5NA 1FDSA 3THWA 1R4MB 2DVMA 1BD4A 4CUJA 1KJWA 3TQOA 2E7ZA 5JQWA 4Q9DA 3L4JA 2VDNB 1IL0A 1I5RA 1RSZA 2ATEA 3NDBB 4OMCA 3ZWVA 3BXOA 3QLVA 1F0KA 3FVWA 2JHGA 2VJNA 3MMPA 3ADOA 3COJA 2YWCA 1F4LA 3CC8A 1OI3A 3LKZA 4LXXA 4WXPA 5JE8A 1NVAA 4JI4B 4OM8A 4DANA 4WBNF 3T1HB 1VBKA 3VZPA 1K5GA 1UPBA 4YJ2A 3LY7A 2C3OA 3QOXA 1YC2A 3OCVA 3QY9A 3NTVA 4WK6A 5C1IA 3O31A 1NOIA 2YHIB 4M99A 5A5EA 5C7OO 4NCHA 1QFSA 2ZEJA 2Q4EA 1TGYA 5EJGA 1LRKA 1ISMA 2GD0A 2OUKA 1EDOA 5JJKA 3BF8A 3F5MA 1WOYA 4L51A 4MEAA 4LXIA 1C9MA 5JNLA 1RYZA 3AEYA 1M6WA 4QUIA 1HDZA 1CV2A 1PZNA 4Q1BA 2D0OB 1YZVA 2C54A 4J0HA 4KR3A 2L2QA 3H5LA 2ORIA 1H0HA 4HNHA 4NYMR 2V5VA 2RHOA 2Y9PB 3BMNB 5EWJA 3QPCA 1RXWA 1GPH1 1M0TA 2IEAA 3VA7A 3MWJA 4IGKA 4OJYA 2WYVA 3LUPA 5M29A 3MIIA 3R5HA 4KYVA 1JHOA 2X8BA 3K2EA 2A3NA 1RYFA 4PZ9A 1DEHA 5D2CA 1O9GA 5AKJA 4DA7A 2B78A 4AP9A 1I5EA 2JCXA 4QTZA 1V8OA 4ITVA 4JROA 3K70B 3OLXA 4FM9A 2OQ2A 2VDPB 3GUHA 4E31A 3RVPA 2C7QA 3DFFA 3VJKA 3ANSA 1YIDA 3RU2A 4Q18A 4IZ6A 3SG0A 2WVHA 3M6XA 5DM4A 5I45A 2BHRA 4ICIA 4H3SA 2O50A 1OROA 5KNDH 2R7NA 1P7VA 3VYWA 2UZ3A 1IZ8A 3KKZA 2QWXA 3T3GA 1M6HA 4QULA 4UBIA 2HOQA 5EWMB 4R9UC 4GOOD 1YU6A 5L8VA 3GXOA 1P77A 4CCWA 4EHHA 4NAVA 4CDRA 1GQSA 2IYFA 3OQMA 2PH1A 4R7TA 1SOAA 3J7TA 4RPHA 5G3ZA 3B9QA 4RF5A 5KHOC 4OCZA 2F1HA 2VDLB 3VR4A 3K0BA 1TM5E 3QPBA 1DAIA 1WW3A 4IEEA 5G40A 3VSCA 1RZRA 1N34B 4R69A 1P4JA 3HCCA 1UBJS 3LKVA 4GR4A 2XKAA 5LNK1 4MQ5A 3PWZA 3D6AA 1KJ8A 3O2JA 1MMFB 3QUCA 1K1EA 2ZQZA 4IKEA 3I76A 2X0JA 2HJ9A 4RVGA 2C8JA 1EM6A 4X3CA 5FTLA 3FYUA 4KGDA 1VPLA 5AKGA 3TEJA 4HOYA 2YZ7A 2CHUA 3PR3A 3LUBA 1FS5A 4M6WA 1E3EA 5DLDA 1D6NA 2YR0A 5JMOA 1O8BA 3G23A 1MJNA 4MHTA 3OIGA 4Q7JB 3F71A 2OFPA 5LB4A 3AO0B 4HAOA 4RF3A 4F9GA 5BWOA 5EHZA 1WZCA 5HIKA 2I6XA 3A6GA 1F1JA 2ZU0C 4PPGA 2A4MA 1USUA 1OHHD 2X8WA 3NAGA 3PT9A 3QK7A 1QIFA 4JVNA 4V02A 4GOJA 4I1VA 1K06A 1Z5ZA 3BWCA 3WLPA 1QQ7A 3OT1B 4L5JA 4AKSA 1RQ7A 5CA0B 2W5UA 3MOGA 1CJUC 1P1FA 3ND8A 4JT4A 5FA8A 1JFFB 1H5NA 3IQDB 4MW9A 3VOSA 5I3CA 1FYFA 2ZIZA 3PLRA 3QEJA 3QU5A 3TJMA 4QT4A 1K89A 2HWYA 3ME5A 2QEQA 3KJQA 3BULA 4NV3A 3R9WA 2PZMA 1AHNA 4XE5A 5F33A 5B7GA 3NM4A 4C0SA 2PANA 2CJXA 2REXB 3P19A 5JLJA 2FPSA 5H8WA 4HADA 3W5CA 2OCLA 1DKRA 3WFJA 1YS2X 1RRMA 3NBUA 2BEVA 4J3JA 2G04A 2O3JA 4W1PA 2ZVJA 5TGTA 3VR5H 3ZGZA 3HWWA 4UHEA 3EF0A 1RBMA 4B32A 4CTMA 1NUUA 1Q6YA 2J85A 2H2GA 1JEJA 1HH4A 3LC7O 1NW3A 1U8EA 3LK6A 4R5MA 4U2CA 2O5VA 4BVKA 4NZNA 2V58A 4OXRA 3DLPX 3GFGA 4OI0A 1N25A 5ALTA 1OIVA 2VF8A 1IONA 2VJAA 1TJPB 3WGTA 2J5BA 3B9PA 1WXIA 1SXIA 4CTKA 4LXHA 1G4UR 4O1HA 4C4AA 5ES3A 3HJNA 3OM1A 1E66A 3K9GA 3WQBA 4F8JA 1TZBA 4P38A 5B6JA 3RIYA 4F8EA 3NH6A 2BF4A 3SN6A 5FPYA 4QQRA 1FLDA 4NPAA 3TIXB 3OY7A 5CFLA 5AW5A 5BV0A 1UM9A 3SK0A 1B73A 1RYNA 3VPSA 1AH2A 1JVNA 3QOYA 4QLBA 5JT1A 5JMPA 2PWZA 5A2QA 3MZ0A 5GGXA 2K4MA 3L7JA 4FFBA 4L78A 2BDUA 3QVUA 4F4UA 3KETA 3NDIA 4E1VA 5EJ8A 2PYDA 3QELA 4YRKA 1YBHA 4ZRNA 3F7OA 2ZYAA 3T54A 3G2NA 5BURA 3HK2A 4YRCA 1O0SA 1OAOC 4GZLA 4IIJA 2MINA 3JAWA 1X19A 3W2FA 1ZUWA 1GGKA 2C3MA 3CX7A 5EXSA 4Z3KA 1SK8A 3CCFA 1V4BA 1ABBA 3W78A 1FSPA 5F52A 1GGFA 3TNFA 3ZPXA 4MA0A 5GQSA 4BC0A 5COQA 2NO1A 4WN9A 5HE8A 1NL3A 1R7RA 5EHNA 2O8EB 2MTBA 2GVZC 3ZD8A 1S4QA 4FDMA 2IEIA 2MSLA 1E92A 3I01M 4XM0A 3TIIA 3W9SA 3U39A 3Q0EA 1ENOA 3AW8A 1O97C 2C4UA 3BA1A 3IQZA 3Q8XB 3AYZB 3E81A 3QXGA 4GUAA 1IZ7A 1N5IA 3CH4B 4NZ9A 4H6VA 4QKQA 3WV5A 1FYVA 3GIDA 2ZYGA 3DLTA 3BWDD 3NOVA 1U5AA 3OOEA 3AHIA 5BN4B 3D81A 2E85A 2C9OA 4KL8S 4LY3A 4X90A 4BNFA 4JELA 3BMOA 2YIDA 1DWPA 1ECJA 3GFRA 3LH5A 4UUPA 3FPKA 3UTCA 2ZJ2A 2ZUBA 4X54A 2WHRA 2GTHA 3R9KA 1S1MA 2P77A 4OGGA 2NU9B 2DFPA 3ZBTA 1Z4QA 3AUYA 4UPDA 1HXHA 4TV8A 2FUEA 1Y42X 5H7XA 4FGZA 2ATVA 3RBAA 4MEBA 2WHQA 3QPDA 4IOLA 4X20A 1ZP6A 1BROA 2JFNA 4PYQA 3C41J 3UJ9A 4R2XA 4EPWA 2CB0A 3CV3A 3MJFA 4OLBA 5AKXA 1ZSYA 1VXRA 3GAFA 1P18A 4V1CA 4HPWA 4FJ0A 1KIAA 4WCDA 1W94A 2GNPA 5DNAA 4BYGA 5IJ9B 4Q9KA 5EYPA 2D7DA 4AUNA 1M2GA 4PZAA 4MDFA 4PHGA 3D3KA 4BKQA 3KOMA 3OPMA 3ZHSA 3QY0A 5KJ1A 2PWYA 1B14A 4V0MA 4P4NA 2Q6VA 2WKQA 5F76A 1J8VA 1HEIA 5JJIA 2XW6A 3CVUA 4Q24A 4DJFC 1W87A 5EUBA 5LQAA 4BCCA 2RC6A 4FOOA 1TIPA 3R77A 1VL8A 2J4CA 3DEHA 1QPBA 3TECE 4HGPA 3DULA 2Y27A 4BQOA 4FSHA 2APJA 3DW3X 4J16C 1QJ4A 5AI5A 5E7QA 3GEIA 4UTRA 3G13A 2Q50A 3NTLA 4W5WA 3ACDA 2V7EA 3GEEA 3L5OA 4AYWA 4EW3A 3FDXA 1Y1RA 4UXHA 1VCNA 1Y1PA 1ORIA 2QAGC 3BSFA 2MYUA 3PE4A 1ECPA 4KRYA 3H2SA 3M49A 4NENA 1OIWA 3OE5A 4LQ4A 4CI9A 3EK2A 1VE9A 1L7VC 2QN3A 1U5BB 3EBOA 1T36A 3GWZA 4CEHA 1PI3A 3I0NA 3KX2A 1VSVA 4PSKA 3NBYC 2X6TA 4R51A 2GHQA 2PH7A 4EHAA 3MBIA 4ZDKA 1WVMA 3CGGA 3ZI4A 1Q57A 2HQ1A 4IIDA 2PKRA 3CM0A 3EC2A 2CL7X 4HATA 4O8ZA 2D06A 3DEKA 3GCZA 3GJ5A 4H9GA 4O3MA 3OHPA 1VGVA 5E7JA 1T1GA 4ZI7B 3O8NA 4QEKA 2YTZA 1RPZA 1NDHA 4IL5A 3L0BA 1ZPDA 2ZFUA 1NUHA 4IF6A 4QPCA 1ISPA 1T24A 2VAWA 3AR7A 3TL3A 1CU1A 4HXFB 1J2RA 2KMLA 3ZXYA 2BGMA 3CLTC 3U7QB 4A23A 2YJNA 3K53A 5LQKA 3PEEA 4WK4B 3ZHRA 5K8VA 1O95D 1OFGA 3E9DA 4QARA 4LRTB 4Q1DA 2Q8QA 1D0VA 2Z2XA 2BUCA 3SHWA 1QRUA 2H9AA 1Z13A 5JH7B 5K0SA 3U4QB 1BU5A 1FLNA 2PZBA 1DXOA 5FBQB 2QW8A 3ES9A 1YSCA 3JQBA 1YFKA 4OL9A 1YS7A 4FMDF 4BNKA 4P0PB 1KIMA 4WZAB 5EMNA 2JASA 3QV2A 1JQEA 4JL5A 4IXTA 3LP5A 3LYHA 1KIFA 3IELA 4WY2A 1KYIA 3ZNQA 2QZJA 3HJGA 4G0QA 4P3XA 4XRGA 2JLSA 1UBHS 2C3YA 3EEYA 4C4PA 3EPKA 2CV0A 2YZ2A 3FHJA 3SNKA 4MIKA 1GUDA 4MW0A 4X91A 2E4UA 2OZLB 4PONA 5JSHA 3PQ8A 1N6HA 4UUNA 1E8NA 1XCLA 4PN7A 5DASA 5H3LA 4IIJF 5AJTA 1HQKA 4RD6A 2BGJA 2C0PA 3O8QA 1UC9A 3CTMA 3A2LA 3N28A 3MHTA 1Y6RA 4D6PA 4MUXA 4YRTA 1PFUA 2FK7A 2X7JA 2V6IA 2GLXA 1VKJA 1A7UA 1MIHA 3JR3A 3LNCA 3HBLA 5CYOA 5KOYA 1UZMA 2BGRA 3IUJA 1S8AA 3MK31 3OU2A 5IH7A 1S2IA 1SC6A 4WFJA 4FGJA 1T9BA 4EYQA 3FOFC 1IPEA 1IDOA 3KPWA 1SXQA 1VG0B 1XMVA 1VZ3A 3NUZA 4LWZA 3AFNA 3WWZA 4U3JB 2O1XA 5CP8A 4Y2RA 9ABPA 2WKSA 4P3NA 5J5CA 2I3BA 4I3HA 2B99A 3NHJA 5IAAA 3FDZA 4QLAA 2C31A 4HWSA 3G7SA 3HLYA 3AJAA 5TQ0B 2FFRA 2REQA 4MVJA 5DTMA 5DGTA 4UUAA 3WRYC 4EA8A 5KTYA 1WCXA 4I55B 5BORA 1D2GA 2ODTX 4TV8F 4RBNA 4AUMA 4YT8A 5BW4A 1TADA 3OP4A 4K6OA 4Q1CA 4UZFA 2A0XA 4PZCA 3AHHA 3HJHA 3THOA 1ZNWA 3U81A 1FB5A 5C3MA 2B21A 5EEHA 2HJWA 2PMFA 3OQBA 4CLEA 2C4TA 2XNCA 1Q3TA 2H9YA 3C7AA 2OR3A 3N74A 4IH1A 3DMYA 4D43A 1C0KA 1LQ2A 2C59A 3CEHA 3IDZA 4P4SA 4Q9HA 5IKXA 2SKCA 3JQGB 1XJ5A 1FRFS 3L18A 3AR9A 5CGZA 2R79A 4MVXA 1CCWA 2Z98A 4C4SA 4PNEA 4NESA 1VPTA 4FHEA 5T6BA 1P60A 2VHVA 4PLVA 4ARBA 2AZDA 4TKVA 1C3VA 5LOVA 2JGLA 3ICOA 4NFHA 2H06A 2IXTA 2HW8A 5KYNA 4Z4HA 4EHJA 4X6LA 4G01B 4DM3A 1JKIA 1ZVQA 3L7BA 3CLSC 3REGA 4NJOA 3NEYA 4IDOA 4WLNA 2WD7B 4U63A 1ONPA 2ZETA 3BYZA 4R1NA 1VGQA 2UV8A 3E27A 5F3DA 2IZ6A 2JS7A 2NZ8A 5IANA 1WPXA 2II6A 1Q0UA 2JFQA 3QVLA 2CC2A 2ZSHA 3DA8A 1Z0IA 2MSCB 4BV2A 2IHZA 1JMKC 3O2QB 4DYHA 4ZGBA 4IUBS 3UK0A 1E99A 2XE4A 1T5TA 1OVGA 1ZWLA 2AW3A 5FTNA 1ONSA 1G8GA 4BLOA 2Q2VA 3K0AB 3S2EA 3SS7X 1TF5A 2IYSA 3IJRA 5JDCA 2E4ZA 1JQJC 4Y2YA 2EWVA 4EZIA 4LYHA 3BORA 4QYIB 4UTZA 2V3CC 5CH8A 1FUKA 1U31A 4Q4LA 5E3IA 3HDTA 4Z4CA 1NV9A 1V9SA 2IE0A 2NAPA 1SB8A 4A15A 2PO5A 2XMQA 4NH0A 3F7TA 1RBQA 2J67A 2A88A 2C2GA 2PWBA 3BERA 4I4IA 2LKDA 2MT9A 2CXTA 3RF7A 3GG9A 1ZN7A 2Y66A 1R8QA 3JQAB 4UUOA 5DHRA 5A4IS 3RYIA 4GFDA 1UDXA 1NUTA 3EXHB 4YHHB 1YRLA 3CNLA 1EXVA 3FTPA 1U8ZA 2GKGA 1ZJYA 4JKIA 3MAAC 1JJVA 2IU0A 2HRZA 5F12A 2JI4A 2XF2A 3T7KA 3ZQ6A 5J63A 3P5BA 3WIEA 1B8PA 4AU1A 5FX2A 2P27A 3ZY5A 3M4JA 4J0CA 4GSLA 1A9TA 4CEIB 2G8NA 1Y98A 1X7GA 3SBDA 4UD6A 1KMNA 2ZBDA 1B8VA 4HQOA 4UNRA 3VPHA 5AUNB 1BKSB 1QNFA 1JKMA 3ZZMA 2JIRA 2ZZNA 1ZCJA 2D4AA 5TPZA 1Z75A 4N82A 4P5PA 2FR0A 1DLIA 3MSCA 5ABPA 3QSGA 4RXMA 3EN0A 3LDUA 4UE6A 4ZA2A 4INJA 3CZ4A 3I8OA 5DHQA 3FVTA 5HX7A 4HRXA 1FS4A 3KQWA 3TOZA 3RIEA 2PRIA 4U8GA 2RGUA 4EJ2A 3WGHA 4BTEA 2QRMA 4JKOA 5D6OA 2A9RA 3CF0A 1LX7A 2Y1GA 4Z9YA 4CM1A 3JAKB 4Y3UA 1M2OB 2BMFA 2HCFA 1VI5A 2G0AA 4A1OA 5A2GA 3HB0A 4MV3A 4F7WA 5JJLA 1WG8A 1JQAA 2E2WA 3JXEA 1T4GA 1F0NA 3LA8A 3NOXA 3LYLA 3P0EA 3OIVA 1ECGA 1K27A 4MW6A 2H1HA 5BSRA 2H63A 3UMMA 3FPGA 3G8AA 3HSYA 1WXDA 1FEZA 4FYKA 4GZ5A 4B31A 5CIYA 3G68A 3W9BA 4YWHA 5J3JA 4DV5B 2XNJA 5CAEA 2PL9A 3EH1A 1I14A 4NNPA 4WZBE 1ZVKA 2N1BA 5GADl 4MW5A 2LVBA 1FFHA 3IAM1 2IPNA 3IHLA 3VKVA 4B3CA 4MV8A 1CS4C 2P7IA 4BPBA 1KU0A 1LBSA 1PGQA 1KP2A 5EKSA 3KB1A 3AY3A 3VX3A 1KTIA 1H2RS 1QP8A 3RVNA 3ZG6A 2AFHB 3ZZTA 4MVJF 2J0VA 4X65B 4CRWB 1YB1A 1TVKA 5L7YA 3SYTA 3OBBA 3G79A 5KNBH 4XD2A 2EP5A 3TXAA 1E4EA 3IAEA 4U4AA 3B1VA 3WLQA 2DQZA 2VKQA 1UKBA 3FR8A 3VSAA 3EUWA 5IVDA 3V8BA 3VR5D 3MWEA 4TLLB 3Q4GA 1FS6A 4KO4S 2H85A 2PRSA 2XUJA 1RLTA 4EEKA 3HXPA 3EGCA 2W2LA 2BTEA 4FBMA 1NAIA 5C8YB 5LLTA 5ALJA 3V4LA 5D5PA 2YQ5A 3DUFA 4V0RA 4Y9DA 1JR4A 2VNAA 3BGWA 4OLHA 3V2IA 2NV0A 2XCTB 2B35A 3FWPA 3HA5A 5KYUA 3LY9A 3MGBA 4K3UA 3SIXA 1K6MA 3EDQA 3I92A 4MV0A 3U3JA 3UMGA 2PZ8A 3GMTA 2QP4A 3L40A 2IP2A 3OEED 4YECA 5EC8A 2FEOA 1XCMA 3LLMA 3IBYA 4NX2A 4PRKA 2V7XA 2N9UA 3D6FA 4I46A 4QVGA 1YO6A 4PS1A 5TS3A 3UO8B 3UG6A 1OQAA 3HJCA 3L7OA 3ZGVA 3RVOA 3MWYW 4IIFA 5ALQA 1X1QA 3OWOA 1NXXA 2BLLA 2QLBA 2RFLA 3EVDA 4HWOA 4QNRA 4ETIA 3AM1A 4N49A 5BVHA 3S8EA 1PBTA 2FUG1 4QA9A 3ZTWA 4EPRA 1JU4A 5ALMA 2CHFA 4R83A 3ER9A 4UCXA 1RWBA 1AGPA 1RRCA 3F5QA 3IURA 4JR0A 4QG7A 2QP9X 2R7KA 4FCVA 4RK6A 1BZYA 3UMFA 3ZHZA 4P2GA 5JCXA 3QQ5A 2O8DA 3Q3IA 4LGVA 1Q0ZA 2ZR0A 3OCYA 4J29A 3L04A 4RGVA 3LX5A 3REOA 3TLEA 1TMKA 2OHHA 4UNQA 4RFLA 3INYA 2PPVA 4BWGA 4JC0A 3QHPA 2C5HA 2G63A 4MV5A 5EP1A 3FNEA 5EFOA 2CXOA 1JU9A 4WA8A 1P17A 3PD7A 4HDOB 2VSQA 3LHSA 1H2BA 3UFXB 1FRNA 4FLMA 1JTEA 1ZLYA 2ZIUB 3FZYA 3R0ZA 3H0EA 3N76A 1ESNA 1R1DA 4C0QC 4MINA 1DQPA 1JSRA 5CXSA 4YUAA 3URMA 2PS0A 3JWGA 3WMWA 5JECA 4EB6B 3DOJA 1KEEB 1C0EA 2HU8A 2ODAA 3OIDA 4FHCA 2ET6A 2VDOB 4DR3B 1EFVB 2R84A 3SEQA 1SO8A 3HUUA 2O1SA 1IU9A 2WUFA 3R5TA 1YS9A 1OASA 4HX9A 3NVAA 1DRWA 7MDHA 3FHTA 3AY0A 1KR5A 1TK3A 3H2ZA 4M0KA 4R2WA 4E5UA 4OQ4A 3PQCA 2PN1A 3HP1A 4MCAA 1YFLA 3OQOA 1S4MA 3SLRA 3DV0A 1OPRA 6REQB 3DNFA 1WQ4A 5HCNA 3FD8A 5LMNB 4LY6A 1PQWA 3AERB 3I04A 3CZQA 1H2ZA 1CUIA 4ZZ0A 3ETGA 4N5HX 2ZJFA 1BXZA 1EK1A 3V3TA 4HUQA 1E2IA 2J3EA 1VBMA 1W36D 5DM60 3VGPA 5LWHA 3U17A 1ZC3A 3LHKA 1GGMA 1W75A 4J75A 4WESA 1NR5A 1M1YB 1ZN8A 2JH3A 1T9GR 1XCJA 1JN0A 2VSOA 3DKVA 5A62A 1EK5A 2O3SA 2ZBFA 4P3YA 1KJIA 4FR0A 5SYNA 2UUOA 2ZJOA 4Q16A 5B3JC 1J0DA 2ZLBA 4N3GA 1PRYA 1SBYA 3QUQA 4HVAA 4URUR 3LLCA 1JGTA 4NCAA 1LDNA 3OT5A 1I32A 2JJ2D 1D4ZA 3V97A 5J59A 1CFZA 4C1NA 2FJUA 4F11A 3ET5A 4J76A 5SYAA 3K1TA 5LDDC 4ESEA 1JEQA 3UY4A 4ZAZA 2JFOA 3ZS8A 1SCBA 3LP8A 3R3ZA 1VA5A 4PQFA 4RK1A 1IY0A 1RFLA 2F1OA 4V3BA 3VV2A 2B5WA 3ASVA 3FTQA 5LYJA 4UTPA 2C4MA 5B4UA 2WMDA 3QYJA 2A58A 5BOVA 3A0UA 2V45A 4A6XA 4J4HA 3WA6A 3GLIB 2RKOA 4IFBA 1X8KA 3WAKA 3OSUA 3K6JA 3U48A 2M6RA 1QFZA 2CFRA 5E1OA 5A06A 1HNXB 2J3DA 5AXAA 2QJOA 1RHKA 1R0YA 4PLHA 2KBEA 1T0JB 2QE7D 3VTAA 4J07A 3SICE 1V95A 3ZU5A 3NNDA 2FF5A 2TRSB 4UHHA 4ZTZB 5CNKA 5EQTA 2CE7A 3WNBA 4D42A 1B1AA 3KD2A 1QMPA 1YR8A 1T5OA 2BGIA 4JBNA 4R7ZA 4EO7A 1V5WA 3H4IA 4J7AA 3NHSA 3R6TA 3RS7A 5E95A 1N2EA 4O1MA 2UVDA 3HKDB 3O8DA 4MKXA 5DMXA 4DLSA 1QC5A 1AGRA 3L0IB 3UYLA 4D9GA 4JEHA 3CZAA 2WUDA 2FSHA 2QP3A 3EGOA 2YXPX 2ZIVB 4A8JC 4K6GA 1G21A 2HA3A 2WSSD 1NURA 3HC7A 1DP4A 4FYVA 2GHIA 1UJCA 2FGKA 3QU9A 4OYLA 4PCAA 4UHKA 3TI7A 2WB2A 5EZSA 3PNYA 5ADUS 3K4PA 4D82A 2BFEB 3QFCA 2C2XA 3ETEA 1NDQA 4HB2A 1N9ZA 1QFMA 4IQGA 1D4FA 2O2HA 5DW0A 3VTFA 3GT3A 1LK5A 1E69A 4DY4A 4PZLA 1SURA 4KAAA 1XQ9A 3RYFB 1FBNA 2C97A 2JJ8A 4LYGA 1PWHA 3V4SA 3B20A 4CQMA 3M5PA 4D4IA 4ZZ1A 3EQ2A 1GPDG 1GYPA 4E70A 4E94A 5JYCA 5HBRA 4WCFB 2R6HA 3LRXA 2Q4TA 1WOMA 2Q3LA 4M0EA 4RFSA 4D7AA 2P4HX 1I0ZA 1D7AA 3VDXA 1K4MA 3R40A 2GF2A 2INGX 1LLDA 3ED1A 2QNRA 4D46A 2PSSA 2J7KA 1P39A 4J94A 5T8KC 3VH4A 4BNDA 2HSWA 1SXJA 4PYOA 2GS9A 4EVRA 4QM6A 3ZV4A 1GG9A 2B36A 3HKBA 4ND8A 5BOSB 5JQGB 4JQYA 2ZVDA 3LDHA 3WGNA 3SVTA 2XB2A 5KTPA 2B9VA 2Q2NA 5CT4A 5KYYA 4DQLA 4WLOA 4C4XA 3I34X 2QVBA 3PTAA 2JLCA 3HVRA 2QJWA 2XJ4A 1X7YA 5EKTA 2VHZA 1D8AA 2VYQA 3E84A 1GPJA 3LUKA 4Q01A 3U31A 4A6PA 1ZM4A 2VAVA 3FPCA 4RSGA 4Q3AA 4YRAA 4TLAA 2QV0A 3EFEA 2HQRA 4A8PA 2QTRA 5B1SA 4HLUC 1BHJA 3DC2A 5BQ3A 3N8KA 4MYRA 5J23A 1G63A 1G1AA 2VIIA 3E70C 5FBHA 4XYEA 5G4KB 1SIOA 1U6JA 2P41A 2P2ZA 2O0HA 2XGGA 3IPXA 3OOHA 3T4PA 1EVZA 1ZJ6A 3HB4X 4G23A 1EWVA 4CW7A 5AVRA 5I9NA 5LDHA 1Q1NA 3FYUC 3C14C 4Q6WA 2C5BA 4H7EA 3P2MA 3ZU6A 4K6HA 4OK5A 4TKUB 3B5JA 3D6MA 3GFTA 3HM2A 5ALHA 3BXXA 5IC5A 4CKBA 3GEGA 4S05A 4ZCMA 3FOBA 3MWLA 1U90A 1ZSNA 2GI4A 3E7FA 3CMMA 4RLSA 3HNRA 1EK0A 5ALIA 2VNJA 3ESXA 2G70A 3FPSA 4IH9A 3AINA 4EJ6A 2ETXA 4ECEA 4F5WA 3T9DA 4WKCA 2JGMA 2PJZA 2XBUA 4UTNA 1Q3KA 3NBFA 1ZK4A 4FDVA 1A8HA 2A9VA 5C8VA 3JWJA 4IMJB 1WULS 4CETA 3K70D 4HS4A 3M4XA 3OETA 2XOKD 1TLTA 4L8GA 5A5FA 4CMIB 2WU3A 4RY9A 1YNSA 4WWHA 2XHEA 4JJ4A 1UDBA 2FSVC 4OHBA 1X92A 4U5XA 3WHPA 3UANA 2G28A 2JDIA 2RH5A 4PV7A 1XDZA 3CUUA 5K3BA 1FDOA 1PQYA 4AF6A 4GICA 4PM4A 1V7QA 4Q0MA 5JDIA 2Q9UA 3RSFA 8AT1A 4D0LB 2Z4TA 1GKLA 4CNBA 4UBKA 1KEZA 1OKKD 3BL6A 1EXMA 1PGOA 3F6CA 4XASA 2JLXA 4WXYB 2W42A 3HHEA 4Q03A 4Q1VA 2O9JA 1Q3HA 1VSUA 2C4WA 3DDWA 5JAIA 3H4VA 2QTCA 1SHUX 1DIHA 1LPNA 3L84A 4TQAA 4DT1B 4KYIB 2HM7A 1TK2A 1R6UA 3N70A 1Q1GA 2JFUA 3CKMA 3PCXA 4A0FA 3TG8A 4OX9Y 1V3UA 3FNHA 4HDCA 4UU1A 3FE2A 3R0XA 4ZT5A 4OTZA 3RQIA 3RBZA 4AJ4A 4KKXB 2J0SA 4JLJA 3KB2A 2WIDA 3ZGNA 1X94A 3AUSA 3SQMA 4DFDA 4DDWA 1BRMA 4LJAA 3S40A 2PYZA 2FWNA 4KXWA 4KSCA 1HQYE 1LA2A 3WGZA 1TYBE 2X8JA 3HHPA 3M1LA 5GMOA 2HWWA 3ZOKA 2J4DA 3K0FA 5HWSA 4ZP1A 5F1PA 2HSJA 3EDRA