1P8AA

Solution structure of the low molecular weight protein tyrosine phosphatase from tritrichomonas foetus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
146
structure length
146
Chain Sequence
AAEKKAVLFVCLGNICRSPACEGICRDMVGDKLIIDSAATSGFHVGQSPDTRSQKVCKSNGVDISKQRARQITKADFSKFDVIAALDQSILSDINSMKPSNCRAKVVLFNPPNGVDDPYYSSDGFPTMFASISKEMKPFLTEHGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords protein tyrosine phosphatase
publication title Solution structure of the low-molecular-weight protein tyrosine phosphatase from Tritrichomonas foetus reveals a flexible phosphate binding loop.
pubmed doi rcsb
source organism Tritrichomonas foetus
total genus 22
structure length 146
sequence length 146
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p8aA00
1Y1LA 3CTPA 3KCNA 3R0JA 4S04A 3GRCA 2R25B 1RXEA 2I6FA 5IUNC 1YIOA 1ZITA 4MLCA 1A2OA 1DRKA 1YVUA 3Q7RA 4G0YA 1RZRD 1CHNA 4OTZA 3H5TA 5TE9A 3RVJA 3UKJA 2FMKA 4NQRA 5EWJA 2QW1A 1MVOA 3KTOA 4RK7A 1PNRA 3SAJA 1Z18A 4KK3A 4Q7EA 3MF4A 3EQ2A 2AYXA 1GLGA 3O1IC 1JFTA 4WXEA 4RY9A 1NXWA 1M5TA 4QYMA 3KHTA 2A9OA 4H3KB 1LJUA 3O2QB 4LE1A 3EAFA 3EODA 4RY0A 4W5NA 4UHKA 1VPWA 4KQCA 5TQ0A 5BR1A 3TO5A 1DBPA 4O1HA 3SQNA 4W5RA 1YS7A 2PMCA 5JS2A 4YS6A 1DZ3A 3HK2A 2H3HA 4YRZA 3F6CA 2GX6A 4OLAA 1CEYA 3G1WA 4EY3A 4EVRA 2WJAA 2P9HA 4MS1A 4RZSA 4N47A 5HQJA 5IBQA 1JF8A 5FBKA 4RDCA 2B4AA 3LTEA 3BRQA 3D8UA 5PNTA 2JB9A 3I09A 5C5EA 1D4ZA 5IC5A 4MS3B 2WY2D 1YK1A 2PUEA 4KZKA 3OLVA 1USIA 7ABPA 2V0NA 3CZCA 4MS4B 4Z99A 5T3YA 5ED4A 3C3KA 2H0AA 3IP6A 4MR7A 3OLZA 5JNTA 5TQ2A 1M5UA 1IIBA 1JHZA 2GBPA 6ABPA 5EWMA 4LDAA 1SRRA 3KSMA 3MA0A 1DC7A 4LX8A 5TPZA 2FXIA 4IGAA 3NNSA 2YHBA 3H5IA 5GOTA 1JFVA 1U8TA 2MYNA 1A04A 1DJMA 1KRXA 3M9XA 4E7PA 2YHAA 1DC8A 1LJLA 4ZMRA 1QNLA 4JOQA 3QELA 5JNWA 2PE5A 3CG0A 5HSGA 2FW0A 4N0QA 4F8JA 3A10A 4KVFA 1L5YA 1C0EA 2PAFA 4E7OA 2W42A 5TPWA 4MQEB 3GBVA 5B3JC 1JDNA 3BBLA 4Z4EA 3I42A 4IF4A 5CNKA 4W5QA 1LBIA 2QVGA 3MYYA 8ABPA 5B3JA 3OQNA 4D6YA 1E2BA 2IPAB 2IPLA 1Z25A 1LK0A 1MB3A 1JLKA 4NICA 5I4CA 3MQ4A 1JWLA 1TVMA 2RJOA 3B2NA 5EWJB 5BRJA 2FQWA 3N0WA 1RXIA 4RK1A 3OQOA 4YV7A 3IP5A 1VRVA 2FLKA 2LPMA 3FFXA 3QEMA 4EYQA 1DP4A 3LUJA 3JVIA 4PEVA 1F51E 2FTKE 5FWXA 3JS5A 4TLLB 1NTRA 3I5AA 4XAQA 1EWTA 3A0UA 2LUOA 3QK7A 5TQ0B 4YP9A 5KQMA 1KGSA 3TB6A 3FMVA 4EYGA 1QMPA 4KREA 5DKFA 1SD5A 1GUBA 1FSPA 3HO1A 1D2AA 4G0OA 2FEKA 1YMVA 3D02A 5CNMA 5JNUA 4YGXB 1OXBB 4MRMA 2FN8A 2LBPA 4P1ZA 4EVSA 3KYJB 2L19A 4MQFA 4MR9A 2E4WA 4MS1B 9ABPA 3QLVA 1TM2A 1S8NA 1R8JA 1DCMA 5KQPA 3LOPA 2IYNA 1E6MA 3CU5A 1Z13A 3HJFA 1JYFA 3P9YA 2E4YA 1GCAA 5KC9A 2FLWA 1ZGZA 5CHYA 3CKMA 1U2PA 3EJWA 4MR7B 2CHEA 4DN6A 1ZGGA 2HQOA 1EFAA 2E4XA 3NBMA 4ZPJA 4G0QA 1ZHHA 2JVKA 5EWMB 4HNSA 2JK1A 3LUAA 3SM9A 3RVNA 3URMA 1P6UA 2PL1A 4Y9TA 3RVRA 3N75A 4QYWA 1KRWA 2A9QA 3CS3A 4RSMA 4ZJPA 2GI4A 2LIVA 4LDZA 3M9WA 3BREA 5E3JA 2FEPA 5IUJC 3CFYA 3DLHA 1JH9A 1RNLA 3BILA 1D1QA 3C6QA 4ML3A 1FFWA 4RK4A 2WMYA 2FQXA 3OQMA 3MIZA 3TMYA 2HQRA 3H1GA 1D5WA 3T95A 4LE0A 1NXSA 2MSKA 4KMRA 1F4VA 1SXGA 1NXTA 2IPNA 2JCGA 1QKKA 1URPA 2A9PA 3H1FA 3L49A 1ISSA 3QX8A 3FGZA 4N0PA 3O74A 4MYRA 1SXIA 3FFTA 4TLMB 2JBAA 3SY8A 3HM9A 1USGA 2IKSA 3EULA 4WUTA 1QO0D 5JNRA 1QQBA 1BDIA 4ETIA 1BAPA 4N03A 1MIHA 3O75A 1BDJA 1C4WA 4RXMA 4EUKA 4S05A 4N41A 1U2QA 1DBQA 2L17A 5BQ3A 2JRLA 4FE7A 1YK0A 4IRXA 2PL9A 1EHCA 2PUFA 4Z4GA 5F64A 2MYPA 4MR8A 5IEJA 2VYCA 3RVMA 4N76A 1OXKB 1JBEA 1K66A 5CNJA 3A3KA 4D6XA 2LP4Y 4Z4HA 5JS1A 3OM1A 2ID9A 3BRSA 1EAYA 1NATA 1B00A 3ROTA 3IPCA 1PEYA 4M88A 4MPTA 4Z9AA 1USKA 3T8YA 2XDYA 4MGEA 2FMIA 4MRMB 1RPJA 4YLEA 3H5VA 2QR3A 3LMKA 5FWYA 3NHZA 1QQAA 4XXHA 1NXOA 3UUGA 2RGYA 2HSGA 4WWHA 3LKBA 1YMUA 1XWWA 3O2SB 2ZAYA 4PICA 4RU1A 3HXMA 3JVDA 3LUDA 1XHEA 1ZN2A 2E4VA 4RXUA 1Z2DA 4KRFA 1I3CA 4B09A 4P98A 5IX8A 3Q7SA 3RVOA 5KWSA 3KG2A 4IMJB 1VKRA 2PKXA 3CZ5A 3GT7A 3TX6A 3O2JA 4F12A 5ABPA 4RK5A 3JTEA 2BGGA 4EYOA 3N53A 1UDRA 4PYRA 1E6KA 3HEBA 2B1JA 3L6UA 4OG2A 5C5CA 5KQLA 3IDOA 4Q6BA 3M6MD 2AYZA 3ILHA 3N6VA 1ISRA 2CHFA 4WT7A 4EYKA 1BVHA 5D2CA 2E4UA 4JASB 2Q5CA 1TLFA 3H6GA 1GCGA 2FMHA 2A9RA 2CWDA 3H75A 3IP9A 4G0ZA 4RXTA 4L4UA 5TPZD 4EVQA 2L18A 1Z12A 1RZRA 1QP7A 3DBIA 2PUDA 2R4QA 4IILA 5DTEA 3T6KA 1ZH4A 2FSPA 2JBAB 3QEKA 3O1JC 2F8SA 2P4UA 1YTUA 3QLVC 3IPAA 4JA2A 1LBHA 1VLZA 3LFTA 5KI6A 4FB4A 4DQDA 3H5OA 3MM4A 4OBBA 1JFSA 3OO1A 3CRNA 2PUBA 1PNTA 3ILYA 4MS3A 3EDCA 1M2FA 3CNBA 2FMFA 1AB6A 3LUKA 4Z0NA 3RVSA 1JL3A 4CBVA 2JVIA 3SG0A 2MSLA 4Z4IA 3OLWA 1P2FA 4MR8B 3C3MA 2MYUA 4LZLA 3N8IA 5TQ2B 3MMNA 4TN5A 4F06A 2QV0A 2IDMA 4L85A 3F7NA 3OO0A 2VUHB 2WRZA 4F3TA 1NXVA 1ZY2A 4KV7A 3GYBA 3SNKA 3H5WA 3QELB 3C97A 2VUIB 5FBHA 2ID7A 2JVJA 2O20A 1DRJA 4G86A 4PE5B 4MQEA 1CYEA 4G0XA 2NZVG 4ETNA 2L2QA 5TPWB 4RWEA 4H3HB 2MYTA 3HUUA 3RH0A 4H60A 4Z4FA 3JPWA 1P8AA 3JY6A 3RVLA 3EGCA 2F8TA 3NHMA 4HYEA 3KLOA 2QZJA 1T34A 1SXHA 3DZDA 3RQIA 1QP4A 2R48A 3N0XA 4HNQA 2RDMA 5JNSA 4KNYA 3Q9SA 3HSYA 4YO7A 3OM0A 3QEMB 1EWKA 3QLTA 4QICA 2E4ZA 3KYIB 4LE2A 5FWXB 1YS6A 4HNRA 1QPZA 2PUCA 5KC8A 3LKVA 4ZYLA 4G97A 1W9HA 4Z9BA 1DCFA 1GUDA 1U04A 1DCKA 3F6PA 4TMYA 4D74A 2NZUG 3DGEC 1TJYA 3HV2A 2TMYA 4RKRA 3K9CA 5DCLA 1NXXA 4G0PA 3F73A 3Q7TA 1HEYA 5TQJA 1FQWA 3IP7A 4OATA 3ROFA 5EWLA 4MQFB 4MR9B 4JB2A 5IULC 4QPJC 3LUGA 4RK0A 4OLBA 3OLYA 2DRIA 4ZMSA 3JPYA 1DG9A 3C3WA 3QX9A 1Z15A 4RV5A 1TMYA 4KK4A 2NT3A 2QU7A 4KFCA 3HZHA 4IMIB 1ZVVA 3Q15C 4WZZA 3GBPA 1K68A 4LRQA 1ABFA 4O1IA 1BDHA 1ZAYA 3T38A 3N0RA 3LUFA 3LUHA 3LUCA 2OENG 3CLKA 4XLTA 5DLEA 3OMXA 3UK0A 3GL9A 2PLNA 4DADA 3HUTA 3NNNA 3K4HA 4GNRA 3OLXA 4JP1A 1QP0A 3RVPA 1MAVA 1P6QA 4RKQA 3FDFA 1NXPA 2HQBA 1MB0A 1AB5A 6CHYA 2M98A 3GV0A 4UHJA 2R47A 4NCBA 3H1EA 4YWHA 3O1HB 1Z17A 3HDGA 5T7BA 4F11A 2QSJA 1Z2EA 2WB4A 3A0RB 3RVQA 3W9SA 2FEWB 3E61A 4W5OA 4NV3A 1M2EA 1XHFA 1WETA 3OMWA 5BRAA 4XFKA 2FKAA 3NNDA 1PHRA 4WXMA 3KKEA 1APBA 3DLBA 2VK2A 3HS3A 2PUAA 4NCAA 4JB0A 2OQRA 1H9CA 1ZDMA 3GWGA 1NY5A 1J56A 4Q6WA 2QXYA 1PUXA 4JAVC 4GPAA 1Z26A 4XARA 5KQGA 1Z16A 1PEAA 1U0SY 2HPHA 2NUBA 3H6HA 3KS9A 3KLNA 1E6LA 3S99A 1FFSA 5HKOA 4G0MA 2QVCA 1A0OA 4YCSA 2X7XA 3CHYA 3RVKA 4MS4A 1JDPA 2GKGA 4O5AA 3Q41A 4RS3A 5IUKC 1W25A 3VNBA 2HJ9A 3QLUC 3HVRA 3TD9A 4MAAA 4KQ9A 3QLUA 2FVYA 2FN9A 1ZH2A 1D1PA 3HCWA 2ZWMA 2NT4A 2RJNA 5GQSA 4Z4CA 3O21A 2IPMA 2MSWA 3E3MA 3GA5A 1QO0A 3KJXA 4MLDA 4RK6A 1KMIY 4ETMA 3FFWA 3VNAA 4W5TA 1FFGA 3HDVA 2PUGA 3G85A 2FQYA 4PZ0A 1JYEA 2N9UA 4RY8A 5FWYB 5EWLB 2IOYA 1ZESA 1BA2A 5HM6A 2WJWA 5DGCA 3EQZA 4EGSA 2M1ZA 2WWVD 5CNIA 4YR7A 5JNVA 1DBWA 2CD7A 2KYRA 3I45A 1EWVA 1JX6A 2J48A 3DGFC 4FE4A 4XASA 5IEBA 4KPYA 2PJUA 1ABEA 3CG4A 1L5ZA 3H5LA 2GWRA
chains in the Genus database with same CATH superfamily
4I46A 2VUTA 5E4TA 2QRGA 3VDXA 3VMMA 4EY7A 1MNQA 2B1IA 2ZEJA 2Y6VA 3F71A 2JLQA 1ZITA 3HC7A 2WYIA 4NU5A 4FOOA 2L0XA 1PKEA 5FNVF 4LRTB 4W5WA 5EIWA 1RQPA 4IEEA 1AN0A 1RW4A 2W6NA 4J7AA 5EMLA 2O8FB 3D3EA 4MUHA 3HDHA 5AP9A 4DA4A 1KE1A 5L53A 1KVSA 3Q40A 4EA7A 2GM3A 3COJA 3AB3A 1FNDA 2IIQA 4Q3BA 3KR9A 2Q7DA 4O5OA 4PHCA 1FMCA 4YHBA 1FFBA 2G9QA 1PZHA 2FZCA 4RIEA 2IV2X 4DG8A 1T15A 4GBED 4K81B 1KWKA 4BZPA 2IP4A 2WIKA 3BMQB 1ESZA 4P33A 4WK2B 4X54A 4G4JA 1LSJA 4HAUA 4L51A 1DBPA 1J8DA 1L5HB 2CCJA 4C0SA 3NHYA 1Z75A 1E9FA 1UMKA 2QYSA 4DHEA 2AXQA 2JIMA 2YICA 2QENA 1VL8A 4WV3A 4DSZA 3WLKX 5TQVA 1IJFA 3IKLA 2P41A 3BXHA 3ND8A 4JDPA 4N8DA 3SXPA 3U17A 3N9IA 3BAFA 2WJAA 4IHJA 3ZX4A 4CKXA 4A8HA 2WD9A 1MA3A 2W98A 2B5WA 2P1ZA 3KR1A 1S2LA 4I0WB 4QHTA 4ZALA 1Z83A 3I6IA 3D54D 3T9DA 1F6WA 1ULUA 2MU1A 3W9YA 4AG5A 3USCS 3IDAA 5PNTA 1C9DB 3VR0A 1J99A 3AR3A 3HN7A 3EA5A 3DEFA 3E3LA 3EGXB 4M99A 4BFTA 4EZIA 4EAQA 5FEUA 4IBOA 4YUWA 3M3DA 4V2UA 1QZTA 1T9KA 4K46A 1KJJA 4O0LA 5LMZA 3B7PA 1XN4A 2EWWA 3FHLA 1MX1A 3R3HA 2J0UA 3AILA 1N7JA 3EXHA 4ZREA 2ATEA 2GWHA 2CXPA 5AKHA 1E1CA 4KEAA 4U7PB 4ERNA 4JUFA 2LDXA 4AG6A 2ZI6A 2AJCA 2GCEA 2AMJA 3C7CB 3A2NA 4C2BA 1UAAA 1HNNA 1EI9A 1FRFS 1B41A 1H93A 1PX0A 2Z43A 3H9QA 3LK6A 4TZ0A 2O7VA 1RHMA 3CO5A 1C7RA 1U0FA 2IEZA 4W5HA 1PLKA 3RSHA 2AD1A 4ZMRA 2C00A 2B21A 3RFFA 3PGXA 3IKTA 3N2YA 3UUEA 4A7PA 3AVUA 4H6VA 1GSAA 1XGKA 3SXUB 2R11A 3OQPA 1XJ5A 4HGOA 1PGNA 2QZPA 4G65A 5JV5A 2WD7B 1CRZA 4E7OA 2W42A 4TUYA 3P2YA 5B3JC 3UY4A 1WB9A 3SQLA 4BC0A 5KU7A 4D96A 1P2TA 2FVXA 2EEZA 4H08A 1PFYA 2A5FA 3D3KA 4P4UA 2X0IA 4QYIA 3VJMA 1ODCA 1RVDA 4QUHA 1W36C 2HNBA 4MQMA 1NVVR 2CLCX 3ZKWA 3FY4A 1DO0A 3B1YA 2ZPUA 3P5BA 4AJPA 1SOUA 2IU3A 5CW1A 3HVJA 5AJWA 2C29D 1Q3KA 5CDUA 4F4IA 4B3CA 4X5OA 5SY9A 1EFHA 1NOIA 2C20A 2RH9B 2AEFA 3FFXA 1I4OA 2O59A 3GPBA 1ORHA 3RSLA 5AOCA 3R3SA 3IT2A 1F51E 2DULA 3IIEA 4HWRA 1TADA 5E0OA 5KYNA 2DHDA 1HQCA 3ADPA 3QVVA 5AHKA 3CZRA 2G1PA 3ICVA 1E3TA 4DDMA 3F8TA 4YT2A 2H9AA 3WADA 3ZHUA 3M4NA 3D6UA 1ZGBA 3JQDA 1FLDA 4JC8A 3B5JA 4K8RB 1FSPA 3W3AA 4C7JA 2ODNA 3K1YA 4KE9A 5JNUA 4Y9UA 4YGXB 2JGEA 3TIFA 3FPJA 3Q12A 1Q1BA 4K05A 2WC1A 4UZFA 1QKIA 4MR9A 4WOBA 2D0IA 4TTIA 3QV2A 1OLUA 1MJNA 3MGBA 3LOPA 4HGZA 4L02A 1TT5A 3AFOA 3GA0A 3K09C 4UXJA 2HRDA 3A9VA 2IDJA 3GUUA 3ZWKA 2BC9A 3FXAA 4CRWB 4EX6A 2ZTUA 5KC9A 4IQ4A 2J0QA 4QGGA 4QGBA 1EFAA 3OBIA 2FOIA 4DXHA 3Q0EA 2YZMA 1QVRA 4YC7A 2E4XA 3TBFA 2RHRA 1GL7A 4UD6A 2IWHA 4WAUA 2J6HA 1SIOA 4R1NA 1IATA 3RFVA 3VDNB 1VSBA 2PGJA 4D0LB 1NJGA 3CEHA 5TS3A 1CJCA 4M9UA 3RUHA 3SM9A 3ZD8A 4Y9TA 4G41A 2H8GA 5JZ9A 3JATA 3BG5A 4MGYR 4RSMA 1U1GA 1LI4A 3C3XA 4FDMA 4I1OA 2IEDA 1WDMA 4WGFA 3TOCA 1MRSA 3VU3A 4ZJPA 4RWZA 1NW8A 1FYWA 2WZCA 3R7NA 3LX6A 2WFLB 3NW9A 4X41A 1SXJE 4ALLA 2HY7A 2A0FA 1O8BA 2BCEA 2WMYA 1DBSA 2G72A 3GPDG 1U6IA 3FUXA 1V4VA 4HDSB 5FNZA 2O8EA 3PDIA 5AIAA 1U2EA 4MKZA 5KTSA 1SUBA 1NVAA 1C3EA 2QUAA 1NXSA 3R1IA 3RBZA 4DR1B 2GYWA 2R8PA 4TQGA 3FCEA 3IRVA 2JAPA 3T0FA 1E92A 1Q1QA 2YOFA 3PGKA 5IABA 1B0PA 1TOAA 1DHRA 1RAFA 2FWBA 3L49A 4I6JA 3ODPA 4US1R 5SYNA 1O89A 4QOEA 4WNIA 5CFRA 4MYRA 3WK4A 1KERA 1XI2A 4I5DA 1LQUA 4WY5A 3TQSA 1EDDA 2RB5A 3RS9A 1YFKA 4WBXC 3O3CA 5DBIA 3GJ4A 1FXWA 4NENB 1DQYA 2VQFB 1YRLA 1QCYA 4N5MA 3BD7A 3CH5A 4BY9E 4C7KA 3JQFA 1RKVA 3F2VA 4RA6A 4XB6B 5BQ3A 2WMNB 1HYGA 2MTBA 2PH5A 3OUUA 4FCTA 4JJIA 4UEJA 1LS1A 1S02A 1GQSA 2NU9B 1MENA 4S2EA 3PENA 2E6UX 4V24A 4XLZA 4YDSA 3AF4A 4LHEA 2C88A 1JJIA 3EB9A 3VSCA 3JZDA 2HV8A 3G0CA 5D7BA 2EX4A 2LP4Y 3A1FA 3AG5A 3O7MA 5ENZA 3EXG2 5ICSA 3HJNA 2CUNA 2JI4A 2GT1A 4X6LA 3TMKA 1KI3A 1C7JA 2OG1A 2Y0DA 4DUGD 1CJTC 4KIWA 2PNJA 2FDRA 3EN0A 3OIVA 4X8MA 1CVLA 1W49A 4ZANA 4A6EA 4IO0A 5BN5A 1YXMA 3L8YA 4ZI7A 4DV0B 2FP4A 3KHUA 3TW8A 1IBKB 1P4SA 4E14A 1N8KA 4MDYA 4X63A 1H0KA 3STYA 3N07A 1AS3A 3R74A 2WJHA 1MUUA 1MAWA 3I9LA 5K1ZA 3Q5GA 3FPFA 4PTYA 1HF3A 2PZMA 3DDNA 3EF3A 5CT9A 2A58A 3RU7A 2GO7A 2VFAA 2IIVA 2NYRA 4H35A 1YR8A 3DLPX 5EOVA 5J5AA 3HQ4O 5FQNA 1Q11A 4MEAA 3SPXA 3TNDA 3QX3A 2G0NA 2P9TA 2QPAA 3WMGA 4Z1OA 4DW8A 1ZRSA 3NHFA 3QU5A 2DQ4A 3E03A 4FILA 4ZICA 3FSJX 2CL0X 4RVSA 2PKXA 3GT7A 1YSCA 5I6DA 3VR3A 1S7GA 2I1LA 3P9RA 1QB8A 5DV9A 5LZ7A 3W2EA 4CLHA 1H8HD 3PJDA 5TEVA 4ZKDA 1TF7A 4C4ZA 4D3FA 1TX4B 5AI8A 1PJBA 2IOFA 3DZFA 5CXUA 3ZWAA 1R6BX 3PCTA 2PPLA 2BM9A 1B15A 1QQ7A 4CMKA 4LXQA 3KQNA 3LPNA 3E9CA 3UJDA 2CDCA 3EASA 3LC1O 1L5VA 5I47A 3NFRA 4RL4A 2AEEA 3VV3A 2O0LA 4IIYA 1CR1A 4KO3S 4JASB 1CQZA 3KWLA 5FUVA 3TUJC 1G0NA 1YBHA 3DOOA 3UYKA 3IP9A 3A6EA 3VHQA 4G1FA 5CM8B 2PRYA 2PX2A 1POWA 3LYHA 5DU2A 2A67A 1DAKA 4B80A 1G5QA 3WRVA 5I01A 1ZHOA 1QYIA 1UP4A 1V1JA 5JMOA 2C8KA 3AM4A 4R8RA 5BN3B 4DKJA 1PZGA 1VLZA 1DO8A 2AGVA 3LX4A 1QZUA 3SHFA 2X5OA 4DQDA 1BO6A 4L6CA 1ZUIA 3EIQA 2XNDD 2PUBA 3AVTA 1N33B 1XPUA 4WK6A 4D5GA 4QJBA 1AB6A 2AR7A 2A86A 5AOBA 1MAHA 1SK8A 1YZVA 3H2GA 3NAQA 3SC2A 3S28A 4NEQA 1A8SA 4YUYA 1C2YA 4IH9A 3D4LA 3UOAB 3E18A 2H0RA 5K8IA 3LPMA 2QYOA 3LAWA 3LOUA 1IVYA 1GQOA 4JCOA 4PM4A 4QOGA 3TL2A 1GKKA 1M1YE 1Y82A 5A9SB 4GX0A 3TLZA 1ZYUA 2O3UA 2OGWA 3FDZA 2QV0A 3RYIB 1IM5A 2HSWA 3A6LA 1JHPA 4EPWA 3OO0A 4IX1A 3EW7A 1J6UA 4TRNA 2ANBA 4B6OA 4OQNA 3HE3A 4RHYA 1UOOA 5AVYA 3DEZA 3TGPA 2WIGA 4H4DA 4CJXA 1OAOA 2QS9A 1NBEA 3EGOA 3QPAA 1M34E 4JLKA 4LFCB 1IOWA 1K75A 3PGLA 3G9XA 4CR6A 4CTNA 2W11A 4UHBA 3A1SA 1C4KA 4QIHA 1E5TA 1QXSA 4TN1A 1D0VA 2OXIA 3SMVA 1OPXA 3K9QO 4CQLB 4RTPA 3DONA 1T10A 1EVLA 1HOTA 1VG1A 2MYTA 4FB5A 2V3CC 2RGCA 4G5YA 2C9BA 2HO4A 3GRAA 1DT5A 1YI0A 1ZH8A 1UJ2A 4D9GA 2XWPA 4LYFA 1J2TA 4RORA 5K6AC 2Q6LA 3PKIA 4JL8A 5B36A 2F8TA 1WW2A 1BDBA 3MJEA 4ZZ3A 5CDTA 3AEZA 1C9KA 1LSSA 2H1OA 3E5RA 2VP6A 3PHLA 2XTMA 2P0AA 3N0XA 3FVWA 5LJLA 2O8DB 2HHJA 2GF9A 3N3BC 4X6XA 2OYCA 3MC1A 4DPLA 3OCVA 1AKRA 4L9AA 2X0NA 2FSSA 2QPOA 2ZRBA 5IJ9B 4M6WA 2JFOA 4DEXA 1RWKA 1P2DA 4BWFB 4G0UA 2JBHA 2YUIA 2VQ3A 3H1PA 3ZUGA 2WFZA 1OZFA 3QYJA 4GI1A 5FBQB 4QEDA 3TAXA 4DTIA 3TLBA 2M2IA 4UNRA 1DCKA 1ZINA 3I9MA 2QZZA 1QDUA 1VE5A 3QY9A 2FW1A 5EHIA 16PKA 4ENVA 1ZMRA 4NJEA 3N59A 3C5VA 5F77A 5L6MB 2JZOA 2ON6A 3B6JA 1FJGB 4BO3A 2NXNA 2N0SA 4NZPA 4Y1GA 2WTXA 2WWRA 2XVAA 1WQ3A 3CVJA 1E9DA 2IP2A 4HFMA 2IXEA 2HWXA 5FUBA 2CFIA 3KDAA 4R2HA 1QSGA 3R2JA 4F1KA 3U61B 3WL5A 5B7NA 1NSYA 1RBYA 2PKEA 3TR0A 2V8BA 1VP9A 4LSMA 3HZRA 5GONF 3WNQA 4UNNA 3AJ8A 1ZAYA 2POCA 5IBRA 3ZKAA 5ADWA 1EXMA 1TTHA 3L7JA 5EE1A 5I7WA 2N1BA 1HTTA 2AQHA 4XPIB 1DTSA 2VC2B 4YROA 5ERGB 1JSRA 1ONNA 4D81A 4OO3A 1JKFA 5JI2E 3U49A 3KAKA 1P6QA 2D2XA 5T57A 4P0QB 4U63A 1BC5A 3R09A 3WRXA 3FRHA 4BO7A 3JWJA 3S4YA 4XWWA 1VIYA 3FPLA 1XSEA 1HI9A 1MB0A 2AJLI 3NHSA 1AGRA 5DISB 4XUEA 5HK8A 3ANTA 4PPNA 1D2MA 2PL3A 3O3OB 4MVJH 1RCUA 5KX5B 3RU3A 2IP1A 2W8BB 4F11A 4P83A 4EY5A 5AM3A 1QJCA 4CIVA 1RWOA 5IKPA 1Y1RA 4URZR 4X00A 3P9CA 5K09A 2E21A 1QO9A 4MKIA 1L5RA 2BGMA 3BXEA 1TK3A 2H2FA 2YWJA 2GPSA 3D4BA 3DAYA 1E2EA 1K8RA 1JDVA 3LCCA 4MPJA 1V3TA 4M9ZA 1YTLA 1Z26A 1RHJA 2HPAA 1KNQA 4EI7A 2BIFA 5FL3A 1Y7TA 3BIXA 3QBJA 5EYPA 1Q3TA 3VYVA 1BD4A 1WCYA 2OAEA 1ODSA 1MQAA 2XHEA 4R9RA 5HM8A 1MNAA 1HT1E 2GHTA 3E23A 1AGYA 3LUPA 3RVKA 3UFXB 4CLOA 1XA3A 5DI3A 5ALZA 2O54A 5DSZA 2IGTA 4O4LB 4C5AA 2OSBA 3DMYA 2O23A 2XJ4A 4E1BA 2BEVB 4KH0A 4NH0A 5JYDA 4ENUA 3NVMB 4AF8A 1ZVMA 4MKFA 3R7SA 2AMVA 4NHEA 3SFVA 1VIMA 2G76A 1H3FA 1Z63A 4LMPA 4FSDA 2VJAA 4UU1A 5BSRA 4Z4CA 2BBSA 2C7QA 5C80A 3RT1A 4KC0A 1RM3A 3VR3D 1JAHA 3L04A 1NONA 2QY6A 1I24A 1JQ3A 4XD2A 3CCCA 4LHVA 4DT1B 5DN6A 5LMUB 2OBLA 1E9CA 5DGCA 4DANA 3GGJA 2GZHA 4EQZA 3O94A 3B1JA 3I04M 1SG0A 2AX4A 4JR1A 5H82A 3K9HA 4Q48A 2SNIE 1AGXA 3MMSA 4N7JA 4JBLA 4QARA 1UBOS 1ABEA 1L7NA 2H1LA 4MRPA 3RC1A 5ALIA 2AVDA 4X94A 3AVPA 3L8HA 3UK7A 4CIBA 4S04A 1IB6A 3GRCA 1WUTA 2R25B 5GAJA 4JBIA 2OBBA 1YVUA 2VTEA 3DEJA 2QP9X 2YX1A 2JHPA 3OP1A 4G5QA 1E32A 2BUCA 4DSOA 1MB9A 5AXAA 4CL3A 4YY3B 1O57A 3GFGA 1P4HA 1ZIDA 3GI1A 2ZE6A 4IQ0A 4MUKA 2ZTHA 4QWWA 5DBGA 3H2SA 3E3OA 3KTOA 4MUAA 2IC5A 1X7XB 2DQSA 1B8VA 2IHJA 4UU7A 2P6RA 1PNOA 3DMPA 2G9UA 1PQWA 2QQFA 1ZR2A 1N2OA 1PFUA 1NUQA 3SSAA 3UMMA 1BH6A 5K05A 3PWKA 5BMVA 3EODA 4GXNA 4LVNA 4YXFA 2GBCA 4D8XA 7MDHA 2VS1A 5TQ0A 1ZKMA 1YQQA 4GX2A 1HDOA 5KDDA 4HNAA 4D5EA 1P1RA 1L9KA 3DF7A 4I9GA 4L6AA 1N3YA 3RO7A 3IAFA 4QUBA 2PVPA 3NBKA 3RW9A 3ENKA 3OJOA 2BHTA 2JAQA 4UVDA 3BSSA 3F6CA 3WNBA 3AYXB 3EH1A 4UU8A 1EFVA 4EZBA 3IBSA 2J45A 3NWEA 4KN5A 1QYRA 3VVBA 4N47A 4IR7A 4MUJA 1ZI9A 1H6DA 1HLPA 1SGWA 1JF8A 2P6OA 2PSSA 3VH1A 3U0BA 2B4AA 3D7NA 2BMAA 2P8SA 1KQPA 1N36B 3I09A 4WKOA 3SKVA 1IM2A 1B0AA 4JJEA 1A97A 3OEYA 2YVAA 5DFAA 4ESEA 3IMFA 1B3BA 2B2XA 2DJIA 3CGWA 4CLEA 4J0EA 3WLMA 3OSUA 3OE1A 1IIBA 2FX2A 3L0BA 3E2IA 4DCCA 1NUPA 2YASA 3Q10A 4NS4A 4BMVA 1SRRA 4O08A 1L7BA 3B82A 1JEQA 4P5PA 1Y1PA 1BSVA 2BKUA 3QJ5A 4MA0A 5FADA 5J1TB 3JR3A 3LBIA 3KFLA 3QVGB 2GESA 1OLSA 4J03A 4L0MA 4CL2A 3PHJA 3SYLA 5JYEA 1EQAA 5DNYB 1EUYA 2LD4A 3IAM1 1I33A 3C8MA 4M1YA 1LDEA 2O3QA 1IULA 1PCXA 1J0EA 4JOQA 1YQXA 3ELUA 4PLPA 4PY2A 4XD7A 1JDUA 5IM5A 4HV4A 1MC5A 2XXAB 3IFSA 1Z45A 2Q2WA 3H3FA 2N46A 5E1MA 5IH3A 1I5RA 2PAFA 1OFVA 3WWDA 4R0VA 5KWVA 1Z5NA 2CVPA 3GFOA 2OPHA 3IR7A 1AKWA 2GNAA 5LQSA 5CDFE 3I3SR 1BFKA 1U5CA 2WB2A 5L7TA 1GCIA 1C9MA 2GD0A 1JPJA 3LHIA 4HWSA 3V2UA 8ABPA 3KQSA 1JTVA 2BFDA 3R6LA 3G13A 3B85A 5AUQA 1WMDA 5F7OA 1E2BA 1FTGA 1VCMA 2K7ZA 3IOBA 5BQOA 2FY8A 5DYTA 1EUZA 4I8IA 3WLNA 3P9SA 7ADHA 3K9LA 4HGYA 2KLBA 1K0FA 3A26A 2XF2A 4C0XA 3KQHA 3ROXA 1OFUX 1SUFA 1WPRA 3G9ZA 4DCUA 4FHFA 1Y34E 2GVZC 1PJ3A 5SV2A 3T5CA 3DZCA 4CF3A 4OM8A 1RJGA 4J1TC 3RRZA 1IONA 2AOWA 2CXUA 1X2EA 3D8RA 5GWXA 4TZ6A 4UC0A 3B60A 2YJTD 2PG3A 3JS5A 4YGYA 3ZWMA 2XGJA 4N6OA 1PDVA 3EG5A 4XAQA 1MAUA 3QK7A 5LQJA 2PZEA 1E7YA 2BSAA 1S2OA 5U1PA 1XU4A 1K8XB 4NYMR 4ZXFA 4DB2A 2WUFA 3VTAA 3P0IA 1PZFA 3UJPA 2VZ9A 4XRGA 2BL4A 3GP3A 4NE2A 2CSUA 3QBVA 4WI1A 3DO6A 5ITZB 3PJEA 2C1EA 5DXAA 5H0IA 1AE1A 1IMJA 1UBFA 2CLKB 2FH5B 4MQFA 3CF4A 2E4WA 2O52A 1HFKA 4XCXA 5FUMA 4NPAA 1MW8X 1CUJA 1OZAA 3PXDA 1JILA 4X3PA 1NU8A 1UDXA 1PHPA 4LN1A 1ZM9A 4FEGA 4KB5A 4NOJA 3A1UA 3GW8A 3PXCX 4UPVA 3TMAA 3J80A 3HO6A 2Y93A 5FRDA 2J87A 1US8B 3A4TA 1QAMA 2XUFA 3CKMA 3ZWDA 5DULA 3L6EA 2HQOA 4U2DA 4MHTA 3L7CA 4ZKEA 3TLCA 1QYXA 5KYKA 3B9BA 4CMAA 1DEHA 1VSQA 2JVKA 2PYIA 4JYZA 1UKVY 1Y1QA 2HK7A 1LEHA 3BD6A 1T3SA 4NRDA 1H3NA 4DAEA 3C8DA 4PSCA 3TD6A 4C20A 1BGXT 3K15A 3RT9A 1YJ8A 4IVQA 5FPYA 3RJ9A 5ALWA 1J9EA 3S2FA 1Z34A 5CB4B 3AL0C 1DKMA 1O95A 1Z4MA 4GZMA 4ZVSA 1HKUA 3UPTA 4JI6B 1RNLA 2I6TA 3C6QA 4G9BA 4ML3A 1MXHA 1MABA 3W8FA 1WR8A 3NQ41 1JAIA 2JLXA 5H3LA 4Y6LA 3RS8A 4HQRA 4P22A 5BWLA 4F4HA 3HCRA 4Q7JB 4CLDA 2XD4A 1TEZA 3T95A 3PR3A 4KSCA 4P0PB 2KLHA 4TUYB 3TQCA 5JNLA 3A4YA 4YH1A 2EZ8A 4QU5A 3ETEA 2IPNA 1T4BA 3GHHA 4B8YA 1T6XA 1VYTA 3MTDA 4LJLA 5LDHA 4QYIB 1LBEA 2WSBA 3I9NA 1G21A 2B83A 5EMKA 2VDNB 4IJ5A 4H27A 3EVNA 1DQPA 3U3DA 3QWFA 3HM9A 1YOBA 2JHFA 5ALDA 3C8HA 1KDPA 3T3EA 3PQ3A 2IUEA 2FV8A 3P0JA 1JDJA 3I6BA 1Z2CA 1ZQ1A 2AN1A 2QRJA 1YB7A 3HYNA 2P35A 3GAZA 4IIJA 5IM4F 1TAHA 1OU4A 1RYZA 3UK6A 5FORA 4FE7A 3H4VA 4UTPA 2VSNA 3G5LA 1EHCA 2WT8A 4ZVNA 1ZK2A 3ET5A 3DHYA 1RM4A 4FYMA 1G2OA 1I3MA 4IWXA 4M9SA 1RMYA 4HGQA 4V1CI 1C1XA 4OL9A 4QBIA 4B6FA 1F3LA 3KJIA 1B00A 3ROTA 4B6EA 4BV9A 1UEIA 4R7GA 5C7OO 1LC0A 1P5ZB 3FOWA 4GGMX 1SM4A 3H5VA 1SR8A 2QR3A 2J7KA 3H97A 2X14A 3UHAA 3WLEA 1CUBA 3D7MA 1OI3A 2I87A 3UJBA 3K70C 3EW9A 5J59A 3AKYA 1TT5B 3JRWA 2AE1A 3JVDA 4ZAFA 3ENWA 3U7EB 4EJSA 4KWHA 5FBWB 3K2QA 3FWZA 5T8KA 1MGPA 4YT4A 5A5VA 2XLCA 1D09A 1V1MA 3F67A 3MT9A 2E5WA 4UUPA 4X92A 3L43A 1U7PA 2VXCA 4Q3EA 5K3CA 3WLTA 3UA4A 3E9YA 2YRFA 4YUAA 2POQX 1ID8A 3BEOA 1HRKA 5IHPA 2QMZA 4L27A 3TGWA 1ADJA 2KS6A 5ABPA 1UAYA 4MULA 1EFLA 5FNVA 3VXKA 3HA2A 4CU2A 2DFLA 3RC8A 2C96A 4N8EA 3U40A 2B1JA 4C6RA 5C3UA 4YYZA 2O8EB 3U37A 3KQLA 1GPYA 3PC7A 3UT5A 2RB4A 3V8QA 3L05A 2RGEA 3PRKE 3CB2A 4D0RA 4QNMA 1QGYA 4D0SA 2ZUBA 1KXJA 1CUIA 3KYDB 3OETA 2A9RA 1R16A 1JB1A 4EVQA 2GUWA 1FYVA 4PC2A 2PUJA 3KIPA 4ZAVA 5HR5A 5JSFA 5DYGA 3DVSX 1CUHA 4LMBA 3QEKA 3M33A 4MUNA 4ZDWA 1G7TA 1GSOA 4IHKA 3LF2A 5CH5A 3ROGA 3UH1A 5C8ZA 3G88A 5LYJF 5KI6A 4EG5A 3Q5DA 4F2PA 2JGDA 3I5MA 1Z5UA 4EY8A 4XD7D 3R3JA 3CN9A 1M2FA 4RA6B 4RPHA 3UGKA 3CR3C 5LA6F 2VDOB 4UFPA 5ALVA 5JXJA 1CV2A 4G8CA 3LA6A 3C3MA 3QOWA 3V7FA 3LC2O 4XJXA 2QK4A 3D3WA 5H16A 4IGFA 3T41A 3IMGA 3KQQA 5C7YA 1N2SA 2HK6A 3RV4A 2WUDA 3G9QA 2X9GA 2P2LA 3X2SA 5AJZA 4QHYA 5LM3A 2IYYA 1YCGA 2I8LA 4JLWA 4P8RA 2ZZKA 1D6MA 1AZTA 2GR9A 3MINB 4RESA 5FOQA 3HCBA 4QAQA 1M6HA 4GG1A 2OD2A 3SSOA 2HRZA 3RQSA 4QOHA 2DT8A 4II2A 3QU2A 4JD5A 1K8YB 1KP9A 4GQAA 3RBXA 3AMVA 2NU6B 3VZDA 2HA0A 4OQEA 3E1SA 5AW1A 4YP5A 2X8LA 2O8BA 4PIMA 1Z6XA 4R6WA 4RJKA 4ZVKA 1A9ZA 4OP3A 1ZSVA 4XUDA 3AVQA 4DLKA 1F20A 1YC2A 1CJMA 1YE5A 2Y27A 4MGKR 1KQGA 3SQMA 2XRZA 3AC0A 1AG9A 2AG0A 3CRMA 3SEFA 1WP4A 1HR0B 2C5AA 3UMFA 4BX2A 3AY3A 4N7BA 1UOQA 5K0FA 3NHMA 2B4TO 3ESZA 1B0UA 3LLCA 2G40A 1FYEA 2HU8A 3C14C 4LCEA 4TTJA 3ZZTA 1Z8HA 3ZDYB 4XWTA 5EPOA 3W1EA 1UKEA 3TUIC 4DBLC 3KEOA 3T9EA 4NBKA 3UUWA 5IAAA 2F43A 1ULZA 2FUCA 3Q1LA 1ZMXA 4C9BA 3DB2A 4JWTA 1W19A 1FW6A 4R83A 1TVCA 5EL0A 2IYAA 2QPTA 1DV2A 2WZDA 4LV5B 5HFNA 4AX8A 1SD2A 4N7RA 3S1SA 3RJMA 1DGQA 1RP7A 2HSJA 4XQ9A 4C7XA 4B31A 3FTNA 3T61A 2OECA 1PT6A 3FMOB 4A82A 4WOCA 4U1RA 4NAHA 1CULC 4V0LA 3EBPA 2BJWA 5JFOA 1NRXA 2NXWA 4LJ4A 4BVLA 3SI7A 2FUEA 4UTVA 2VN8A 3R20A 4P3KA 5LZ9A 3L8ZA 3O8QB 5HIJA 2WU1A 4LJYA 1AHNA 2O4CA 2Y0PA 2H8KA 4P3XA 2ZDQA 3WLJA 1ATIA 1FQWA 3KXPA 5LPNA 4KUHA 3SHWA 1O95D 4HEA6 3RK4A 4ARVA 3J81A 5H81A 5KKAA 4HRAA 3I2IA 2CCKA 3ZWNA 4DDHA 4C2UA 3A9TA 4ZMSA 1PVOA 2VCEA 2PTGA 4I2VA 2QN8A 3EXIB 3HMQA 3SC2B 1NI3A 3KQYA 3PDUA 4GS5A 2IKQA 4F2HA 3RC3A 1A72A 1CQPA 1E8NA 2IFTA 5DNVA 5A0VA 3V1KA 1LRLA 1LDNA 3ICCA 5I4IA 1TGVA 1L1EA 1H2EA 2GXQA 3FDZB 3FWKA 3RKSA 4CEIB 3E7DA 2C99A 4DIOA 2JC3A 4F6CA 2HM7A 1Q22A 3NNNA 1JJAA 1M1UA 4YJ2B 5GGXA 4GMXA 3T35A 1BKYA 4BNJA 1Q15A 2O8DA 3IOMA 3DF9A 3NETA 1V7QA 4JP1A 4LZAA 4EI9A 2EP7A 2BGRA 1HY3A 3T7CA 3WSVA 1U1CA 2FDCA 2FPOA 4B6GA 3BWBA 1SBYA 4L3OA 1AB5A 1KI2A 1R4AA 2HF2A 5ES4B 3LVRE 4E5DA 3ZV3A 1MG0A 3NEJA 3BDIA 3LUBA 3RTDA 3JD4A 4BC1A 4BGDA 3OJCA 5HGXA 4GU5A 1Z62A 4DMLA 1HFEL 3NHPA 5G0WA 1N3IA 1O6ZA 2PNFA 1KDRA 1NVGA 2UYHA 3OECA 5HBGA 5LD2C 1Q50A 3G9UA 1PV2A 2BFCB 2QN7A 3DWFA 3GZ4A 4PYLA 4KRXA 4R16A 3TLEA 4EVIA 4ZV4A 3NNDA 4Q3DA 1W0KD 1VCOA 3D5TA 1W4CA 4EB6A 1ZDMA 1M8PA 1BYUA 2VZEA 1W96A 1HE3A 2X3YA 3FUWA 2CNWA 1HDRA 4YUVA 4ZDKA 2ILVA 3K0SA 1NLFA 2XD9A 3FNQA 3LXXA 3OEEA 4LISA 4JI3B 3C3YA 4KYUA 1QFXA 3WB0A 4ND7A 2JASA 1QS0A 3ZDBA 1XF9A 5INTA 4NMMA 2MJLA 3FI9A 4IIDA 4JQZA 1NZFA 4PYOA 2VRBA 2BFWA 3D6AA 4L5CA 2CF6A 4I7EA 5AKKA 5DGXA 5IPFA 1OH6A 2GEKA 4CODB 1OMOA 1P4JA 2GKGA 3AGQA 3MB8A 4U7JA 2CNDA 3VZCA 2O3SA 1W2GA 4KO8A 4DSUA 1IG0A 4PAQA 4F84A 2ETVA 1PVDA 3JSAA 3WHKA 1ZSNA 2E3JA 3ZHYA 4ETWA 1GFZA 1C3OB 1V48A 4NJEB 2CVOA 4JP3A 4LZPA 3ROQA 5BN1A 3KJXA 2VHQA 1RCTE 4RIGA 3AOEC 1HQKA 3BH6A 2PYDA 4JX9A 4ARUA 2OMEA 4CLRA 3AETA 2FRVA 2WFMA 4L5BA 3AKZA 3FSGA 5EXDA 3OA2A 3DHNA 4FZ3A 4AO7A 2X5KO 2F67A 5AI5A 3JWIA 1N25A 2YWRA 3PNQA 4PYKA 1K6XA 2RD2A 3LWBA 5BNWA 5K0JA 1GYQA 3HCOA 2H59A 1E59A 4W5NA 3UCFA 2QP3A 3K5WA 4MWEA 4AY4A 2V3WA 2PUWA 2R60A 5J4LA 2OOSA 2QUHA 1JIJA 2HJSA 4X62B 2SKEA 2WJPA 3Q7RA 5CT5A 4EG8A 4CETA 1XO1A 2JH9A 5B7PA 1BCSB 3R3UA 4MZXA 4OTZA 4RFSA 1H42A 1SUCA 1NXQA 1SURA 3KCQA 4L78A 4CKWA 3RYCB 1QIGA 2X4LA 1GN9A 2Y0EA 3QH4A 4LWZA 4N82A 4GM0A 4OLJA 2CWWA 4XJSA 3H42B 5HK9A 1AQNA 4ZTZB 1V7CA 3EQ2A 3ZV7A 1GLGA 3RUFA 5F73A 5A7FA 4FWIB 1PT9A 3OOEA 3DMTC 3IOEA 4Y6SA 4QZVA 2Q2VA 5KYYA 4D8YA 2OOKA 1D2EA 2HMWA 3WMFA 1NKVA 1TMOA 3I8XA 4RY0A 4YALA 4PYIA 2P2YA 1STOA 2VHWA 3H99A 3AFIA 1UMCA 1QX3A 2GJ8A 5CP8A 3ZI7A 5DGHA 5FA8A 8ADHA 1YS7A 3HKBA 3EPRA 3AFMA 4FGLA 1YH3A 5DWDA 3LT4A 3S2GA 5EEHA 4D9EA 2I4TA 1XEAA 3GXBA 4JVOA 4QNNA 4R2KA 2UVPA 4I4TB 4XH9B 3RYFB 5JDCA 3P0RA 1GWNA 4FIZA 3UMSA 4AS1A 4IVPA 1U8UA 2VP9A 3MJ4A 1I30A 1VE7A 3DE6X 4MTCA 1HNXB 3CR7A 5FBKA 1TU0A 4LWPA 3SZMA 3D8UA 2DFVA 1WE2A 1L7PA 4DXAA 2VP2A 2WY2D 2BTQA 5LFAA 1YK1A 3I5XA 4TKUA 1R3UA 1D8AA 3D8NA 5SY4A 4CLOB 2IS6A 5AW5A 1O0BA 4BV3A 3HBJA 4MR7A 4XTRA 3I62A 1MB2A 2YCLA 1JHZA 1D7OA 1L4GA 3KWJA 2JFNA 2CMDA 2G09A 3TTWA 4WXHA 3LW8A 4BMYA 1GTG1 3QE3A 3IIKA 4WX2B 2FXIA 3HZZA 4ZJUA 1GFWA 2B94A 1A9YA 3TW4A 5HKAA 2O8NA 3JVEA 4MUFA 4BKQA 5GMOA 4OP2A 4P86A 1SA0A 2FUKA 3M9XA 4E7PA 2DFNA 3DNPA 2VP3A 4PS0A 2HMAA 1WXIA 3SVTA 3ZC3A 1R9NA 3EF1A 3QELA 4H31A 2R7MA 4MCJA 5B2FA 4FYYA 1M0SA 3DZKA 1N0WA 1VKOA 3R3VA 3TW6A 1UMDB 2EYUA 5K0GA 2ECOA 3IVMA 1JPNA 4P7KA 4W7HA 5CFOA 2REXB 1YWGO 2VHXA 4NABA 3EPHA 1GU1A 1YNSA 3H2IA 3GBVA 1JJVA 3A9SA 4CUKA 5U4QA 4E5MA 2OESA 5CDYA 2Q1SA 2D5LA 2QVGA 4LSGA 1XU9A 2UKDA 5U4XA 1Y7HA 5KWJA 1LB1B 3GLHA 4Q47A 4G9EA 4UVIA 2IPLA 2PKQP 5IU6A 3G2OA 1XAGA 1JWLA 5LMNB 3KKQA 1TEXA 3MQ4A 3DWIA 3SEZA 4BVBA 2DHQA 2RJOA 1XRRA 1YUNA 3BTVA 4FDTA 5EWJB 5BRJA 3STHA 5KTMA 4HDRB 4ZYWA 1ZCZA 3USES 1OX6A 1RXIA 2JLRA 3ISJA 5JS6A 3FZYA 3KL4A 2AK2A 3BDAA 1AQ6A 3AUFA 2ZTLA 2N75A 3TSWA 4LNUA 5CEJA 3GQBA 3UAGA 2AH5A 2I2CA 2OVBA 2GEFA 1E2DA 2VHCA 3G9TA 3AEQA 5DXJA 4KWCA 1XF1A 5DM0A 5TQ0B 4IF6A 1G19A 3MZ0A 3P0HA 2GSDA 2DAPA 2W00A 2NYUA 2V65A 2YV3A 5H1YA 4YUXA 5THKA 3UTCA 4H16A 1R0ZA 2K7FA 4FNAA 4QDXA 1ONBA 4KUGA 4B1FA 3D02A 4A8JA 2JEZA 5KDLA 4B4KA 4DLXA 4E11A 5JZOA 1OXBB 1OXSC 2ZUUA 4PLWA 2LCIA 3MLAA 4FFBA 5HQTA 5FBRB 1QH9A 3SVLA 1BE8A 4IDBA 3VPCA 1EWYA 2J9FA 4DNPA 1HYHA 3O1LA 2J32A 5HJ2A 1JG7A 4KN9S 3C6YA 4DIEA 1FLAA 3F46A 3QPUA 5DLDA 3OIDA 2A5JA 4EKEA 5M2QA 2GF0A 3CPSA 1PDOA 1JYFA 1UFQA 3JWEA 3TGLA 1IXRC 1EJ2A 2I7XA 1E2UA 2YS7A 3OZVA 5HWSA 2XCIA 1SQ5A 1RWMA 3TNLA 2NGRA 3DYVA 3KD2A 1GSIA 1KO7A 5JAOA 1WOYA 1T24A 3KC2A 5DPMA 2GH1A 3LUAA 4D3DA 1Q83A 2I5PO 1DLJA 1NPDA 3QE4A 4QHSA 4V0SA 4QG7A 1IQ0A 3V4VB 2YV1A 1OT5A 4B34A 4XVUA 5GONA 8GPBA 3VPHA 2CNWD 3FDXA 4YDRA 3NH9A 5EA2A 2ZAOA 3OCCA 5T4HA 3TXXA 3DLCA 3KAJA 2A0UA 4O29A 4KPUA 4AMZA 4MCAA 2QGFA 3P94A 4PZEA 4YVFA 2GILA 4DR5B 4AUMA 3QNUA 2FQXA 4XX1A 2UXCB 3BUSA 3OQMA 3FJOA 9LDTA 1Z2OX 1NOJA 1DTEA 1HC7A 3RNOA 1NP3A 2Z3WA 3EFBA 1UFKA 2H4ZA 1CDZA 3JAMA 4CKEB 4B75A 4QRIA 3DDSA 1GQQA 1JSLA 1Z4IA 4RF4A 3WGLA 2V7TA 4CV2A 1JLRA 2BFDB 2JFWA 4FX2A 4O8CA 2YXPX 4WCDA 1ISSA 4K6HA 3KB8A 3RSQA 1J06A 4ZO4A 3DNFA 3MJSA 2HOQA 3TLGA 2J5KA 2W90A 3LP5A 4M54A 2CJXA 4O0MA 5ARDA 4IDNA 3SY8A 3WMRA 5DLQC 1GQFA 4L75A 1W8IA 1QZXA 4REMA 3T3IA 4S3MA 5KYTA 1EFTA 3R23A 3W9BA 3FSGD 4LXGA 2ZRMA 3MN1A 5FR1A 3CXRA 3HFRA 1ES9A 2FW8A 3RU2A 2PBRA 1T6NA 3SNHA 2PUFA 4PFQA 5JADA 4H9GA 1I4EB 2YY6A 1LZKA 3DKRA 4O2LA 1CRQA 1UFRA 4MWDA 1TXGA 5LUAA 3RVMA 1RRGA 3PFWO 4MWTA 2EFJA 1JBEA 1K66A 2ROQA 3DT8A 1ECPA 3EIXA 1V5IA 3FGPA 4LDRA 3ZHTA 4EMSA 2VCHA 3BRSA 3OM1A 3VQTA 4EL0A 4QGSA 5KOYA 1LTKA 1KIAA 2PAAA 3UWSA 3IB6A 3L77A 4Z4IA 2VJNA 1QOQB 4TL7A 2BGNA 3OOSA 3Q1KA 4YLEA 4DQXA 4IJWA 4IINA 2WW8A 1NRWA 3VPXA 4PLVA 1D2GA 4QODA 2JGMA 1X80A 3ETNA 4TWBA 4POAA 1XMIA 1SC9A 1AH2A 1J9ZA 1WHSA 1X74A 2FEAA 2LVBA 2XHZA 2WWGA 1XQVA 4WWHA 3CVOA 1YBVA 2IE0A 2QAGA 3I30X 3ZHBA 3O2SB 4HXFB 4MI1A 2VF7A 1XZAA 3L01A 4OI1A 2PPVA 1ZN2A 3G8YA 4TV8F 5AM5A 1BJTA 2DWPA 2ZBFA 4ASUD 1EH5A 5AHWA 1SVIA 3GF4A 3VDRA 4AZSA 4BATA 5CA1B 3U1VA 2HWUA 4TYQA 4C0KA 2GXSA 4YMSA 3TG8A 1VLMA 2Z4TA 2VAWA 3L1UA 3WGHA 2VCYA 3WNVA 3E7PA 2RI1A 5GV8A 3A70A 3AHEA 2Y1DA 2HRRA 4EPTA 5BY2A 2RGAA 3DEAA 5BN4B 1CQIA 1IJBA 3AI2A 3JTEA 4M36A 4CE6A 2ZKIA 2X6QA 3SYNA 2PWYA 3DHEA 4ZN6A 3PV0A 5FOWA 2YIVX 4X6UA 1J20A 1BWRA 3L6UA 4J9UE 4J0JA 4KLCA 1L2TA 2XNCA 3KZKA 2CFOA 1DIGA 3PC6A 4ZQIA 3KUCA 2X15A 3QHPA 1P3DA 3BGSA 1U8AA 2AOTA 3ZCVA 4N5LA 3NPMA 3GEBA 3D43A 4DIUA 1PTKA 5L3RA 3V8VA 1MC8A 4NBLA 4HT3B 2BTEA 2YFYA 3NOOA 4TRJA 4BZQA 3H75A 3SM3A 2FPRA 3Q3HA 4WN9B 3M4ZA 1Z12A 4HZGA 1YQTA 1X2BA 2GYVA 1G21B 2JGJA 4E6EA 2WIDA 3EZGA 5K2MA 3U3KA 1JA9A 1WXXA 4TYPA 2FHSA 4RYDA 2R8ZA 3I6QA 3GLQA 4DWOA 1CHDA 1XZ8A 4PBTA 4WLUA 5F4ZA 4PINA 2OM6A 4AJ9A 4BX8A 5IKEA 4EHAA 1UXIA 4IIJB 5CGZA 3O5AA 2RKBA 2VAMA 2KI5A 4G81A 2ERCA 2XBLA 2CW5A 3OVMA 5JYBA 3HG7A 3OUZA 3ZDQA 4N40A 2JG3A 2YV2A 4MGHA 4BNIA 4RHXA 2XQJA 4MW1A 1Y7IA 2P6PA 1P2VA 3OTGA 4FFOA 4G1BA 1Z0SA 4Q7MB 1HZZC 2RAVA 3OIUA 4UNIA 4BV8A 4DF3A 2CLHB 1QTNA 2VDJA 1GG8A 1MXFA 2EX0A 5LDGA 4D2IA 5ALEA 2UV8A 4IRMA 3SMQA 5CA0F 2WAOA 2O1XA 3N2GB 1NAHA 1QLWA 1WV1A 2XOEA 1EUCB 1H2YA 1QUEA 4FEYA 4TRRA 1QFYA 3AHGA 2HD4A 4N0EA 4RADA 1BX0A 5C1OA 3GEPA 4FSHA 4J0QA 1BRMA 3ON5A 3UENA 3V7WA 1NXVA 5C4MA 4OJKA 5JXIA 2HI0A 1GD1O 2B4RO 3DL4A 1P0FA 4DC9A 1ZIYA 4RH3A 4W8HA 4DVJA 4JUBA 4L76A 1NOKA 1KOGA 1O94A 4H4EA 2BFNA 1PYGA 2P67A 3FMFA 1KBOA 1Y6QA 2VF8A 2GBLC 3HUFA 4FWBA 2EKQA 4NX2A 4RYLA 3K6SA 2DWCA 1R50A 2CC2A 2JD0A 3DVAA 1XCBA 3PUWA 4RD6A 1R74A 2CN1A 1A88A 2VSFA 1ZJZA 1XMQB 5A9RA 1X0VA 4LMAA 5SYMA 4AKTA 3QKSA 1YRAA 4QQNA 2XH8A 2PA3A 3VAAA 1U8XX 3IE1A 3CH7A 3BWYA 3GROA 2AN5A 1VHJA 4IV0A 4ZA2A 1NM5C 3HZOA 1OPRA 1JLLA 2R48A 1CUZA 5KS2A 4YRCA 4GZ5A 5FNVB 1X9HA 1S2DA 1KOLA 3O8LA 5JE8A 3OZFA 2ILTA 4XIIA 1JG6A 3AFNA 3QEMB 3DWEX 2QUKA 1EWKA 2VH1A 2B7LA 1P73A 1PW5A 3EQ8A 1UK6A 3BSYA 3OCWA 3U4GA 4N1AA 1FDIA 3PQCA 3CO0S 2VDWA 4OA8A 5LQNA 4IDDA 1K5PA 4IZOA 3NHAA 3PEFA 1J25A 2HIHA 1J2YA 2OV8A 5E1OA 3RJZA 2AC2A 4GOND 1ZM2A 4M1SA 1N0VC 4WDQA 5FFFA 1FC0A 4BNVA 3QVTA 3H7IA 1SOAA 4PANA 4G0PA 2ZRJA 1CC1S 1I1QB 1Y3DE 1T5LA 1O87A 3HFSA 3G5AA 1P2BA 4DV6B 3R5TA 2Z3VA 3G0DA 3T94A 2JGDB 3IERA 2I6GA 4YA6A 2ZUEA 1A95A 3OLYA 5G4KB 1Y8CA 2PX6A 2G0AA 4EFLA 5JAUA 3G2IA 1E5DA 2W22A 1G3IA 3PC2A 4K9NA 2EKDA 2B8NA 3WP0A 4BMZA 3GLFB 1C3JA 2EG9A 1A8QA 2XWQA 1P1FA 3R40A 3AYZB 3T1TA 2R6R1 3ANSA 1DJPA 4K03A 1ECBA 3RIXA 3D3WB 4IQGA 1PFQA 5EJAA 3ME5A 1FFHA 4PU0A 1UBJS 1NVFA 3SK0A 4BBPA 4ZEMA 2PY6A 5TGTA 4K6KA 3TKLA 1GGEA 4ZQEA 4ZQCB 3TLKA 1IY2A 1O4WA 1ZWKA 1VG0B 1Y8QB 5HILA 1E9BA 3GVXA 3ZE2B 1SVUA 5C4GB 3A2MA 5IFLA 4H0CA 1WKCA 1F9AA 2D00A 4GYKA 5KSOA 2GEJA 2M98A 2PGDA 4G89A 1QIHA 3E0QA 5EKSA 5UKDA 5ALFA 1C4XA 2QTAA 4DR2B 4PV7A 2R9VA 2VYFA 4GWGA 5IMBA 1PS0A 3ZBTA 3E27A 3NH6A 4AZWA 1OROA 3PD7A 2R1VB 2FPIA 3DEKA 4HAXA 3MMXA 4EH1A 3A0RB 4IIVA 1O77A 2PO7A 2H1CA 2X8AA 4N3NA 3M1LA 4KYTA 2W2XA 3CLRD 1EFPA 4XFKA 2AI2A 1CUYA 1QGAA 4K6CA 5BRAA 1APBA 2AW5A 3S40A 1UFVA 4L5YA 5DIZA 3UV7A 2OQRA 4AKIA 4NHOA 1OTYA 2Y66A 2FDXA 4ABYA 1PX2A 2QT0A 1D3AA 1PUXA 5KVVA 4LDQA 4UHCA 5I7AA 3CNQS 2XIQA 2XQFA 3AL2A 3KVNA 4G84A 4NMLA 3KLNA 1VJCA 2F43B 2R00C 4B3XA 2QVCA 1G4AE 3GB9A 1A0OA 4YCSA 2XUPA 3CHYA 4CIAA 4I8XA 1E61A 4G67A 4GBGA 1OB5A 5DHUA 1CS0B 1L0BA 1P80A 2PT5A 3KE8A 2EXXA 4G9GA 1ODTC 1H1TA 2EJCA 2PYZA 3NOQA 4WKGA 4MH0R 5KTRA 2EJUA 3EC2A 4OKNA 4OFZA 3AJDA 5DB4A 2ZRNA 4EG3A 3C1AA 5EGNA 1KTVA 1U81A 4K6MA 4S1PA 1KKUA 3KVVA 5A7GA 2J3KA 1Z6TA 3MXTA 1RWBA 3EVDA 3OTQA 1DAHA 4MVYA 4Y9RA 4F5YA 3I2JA 1DX9A 1KKMA 2WLTA 1E2JA 2H29A 2OGTA 1A5BB 1KYYA 4OMUA 1TZKA 1GARA 5CD1A 1AMNA 3EQZA 2K6GA 1EX1A 4KRYA 4NZNA 3HCCA 4JLMA 4YR7A 4UM9B 3AOGA 3U81A 4MQ6A 4MWBA 4CN8A 5IJWA 2C83A 3PE4A 5CCBA 2BPOA 2ZJ2A 3QBEA 2FPUA 3EXG1 1EMDA 3W2TA 4EF6A 5K2OA 3UNXA 4KPYA 4YN3A 4D97A 3K5IA 4LMRA 1QGED 4RM3A 4CM7A 4D9NA 5IVHA 3R0JA 5IAOA 5I48A 3D6MA 5GJBA 3MS4A 3DZBA 1SKUA 1P5FA 3WAJA 4IHQA 2XBMA 3LVBA 3H5TA 1KO5A 5K0LA 1TE2A 3VU1A 2FF5A 1WMFA 1X1DA 2O7SA 4FOPA 4ESVA 2WDZA 2HC9A 4I6EA 2R2AA 2RC5A 3G8CA 3IAEA 4X8LA 1BWSA 4R8KA 5F5LA 3ZVMA 3MF4A 1SUSA 1S0UA 1NLMA 1NYTA 4TV9F 2C7BA 1P6XA 4H3KB 2WWWA 3D8SA 3JQQA 1NUSA 1UC9A 1YDGA 5F3DA 3ROMA 4UHKA 3UJ3X 5CU7A 3ELWA 4F5WA 3ZD6A 3L46A 4WLFA 3KYCB 1JIVA 2AFIA 3WY9A 4R3NA 4MUXA 4DG5A 5FI1B 4PRKA 1KZGB 1B74A 1DOAA 2O57A 2ZT5A 2HMTA 3FD8A 3SLKA 4F7DA 4YFYA 5EEGA 3KZ1E 4FDVA 2H3HA 4YRZA 2P75A 5KZMB 2CLFB 2GX6A 3AJAA 3COWA 3OSZA 4Q19A 3BMNB 1IZ7A 1M8KA 1QQ5A 1SUPA 1KOJA 1LLDA 3WLQA 3CNLA 1WXDA 3NIDB 4TXLA 4DDKA 1BVRA 3LC7O 1GZ6A 2HDHA 4HLUA 5HQJA 4OGGA 1L1RA 2X0KA 3A1TA 3DFUA 4OJTA 1NJ2A 2WA1A 3KSBC 2P2DA 4E6PA 2XXJA 2ZQYA 4LF8B 5AKYA 5IC5A 5G0TA 4AMVA 1QOZA 1GAJA 1O94D 3CZCA 3GPLA 1M2VA 5LYJA 5ED4A 1KZ6A 3DT6A 2SICE 3H2JA 3KPWA 5JJ5A 1M33A 4J2OA 3AL3A 3ASUA 5LA6A 2YZKA 1E3WA 1WX1A 3C1UA 3IKMB 3MA0A 4KLRA 3V1MA 4DV3B 5IVPA 5TMEA 1WD7A 3TCXB 4TMKA 5BSWA 1EM8B 2P1DA 4GWKA 1BYIA 3RI3A 1GNPA 1V11B 3N6XA 2OHVA 4UHFA 1G8JA 2DCMA 4A6PA 2OXCA 3IVCA 2RIPA 2JNWA 3JYPA 1NJ1A 2DKNA 3PYMA 2JD1A 3AETB 3TR5A 1V4BA 4J0FA 1N1DA 2HQSA 1Y3FE 5HSGA 1P44A 3LXUX 3BK1A 1T29A 1I4DD 3A10A 1CDEA 4HYYA 3WO1A 1T8YA 2GK3A 1CF2O 2PQ0A 1EVZA 2II6A 1GGKA 1R0BA 2X8JA 4EGQA 2I66A 1VSTA 3MPOA 4MQEB 3U9LA 4GR5A 3EZNA 3TRIA 2CB9A 2YXBA 4ALMA 1I4WA 1K1EA 5B3JA 2BGWA 2A2ZA 2WHPB 4PZZA 4XWGA 3EIHA 5IKOA 5JQGB 1Q7GA 4LZWA 3EIEA 2CLOB 2WUGA 5DYWA 4ZVVA 5IBPA 4CKWB 5EJ5A 2HMSA 1E0JA 1G8MA 4B3FX 2WHXA 1G9TA 3ENQA 5TNXA 2OCBA 3RUEA 2OL4A 3O03A 1NDUA 3T5BA 1CUGA 1WXQA 1DFGA 4XGIA 3TLXA 1NVWQ 4CL0A 5DOZA 1VRVA 3S5JA 4A1OA 4PG5A 5DNUA 3UWOA 3JVIA 2W6MA 3N2KA 221PA 4PEVA 4WCFB 1X39A 4Z7JA 2V97A 3ZE9A 1UMCB 3OTWA 1R6AA 1BRTA 1GZ4A 4M0LA 3HXLA 4C14A 4CV0A 1WZUA 3GRZA 5AIBA 2D4AA 5EKUA 2BH9A 1TPZA 3OC0A 2A33A 1TNDA 1VA5A 3ESYA 3FB4A 2YOHA 2UVPB 1W76A 3NBYC 3HBFA 2IEGA 2NM0A 4KX5A 4OYRA 4TVOA 1J8FA 3LCVB 4YAFA 2FR0A 2Z5GA 3JYNA 2W0MA 4GEGA 3IAHA 1JVNA 3EEFA 5K51A 1CUFA 4U2BA 1ZD9A 1YF3A 3A7EA 5KQPA 3AIKA 4ZQFA 5FCDA 3HKEA 1L6RA 2BTQB 4F3CA 4RULA 4O2AB 5HW0A 4FWTA 3R7BA 1ZJ4A 2Q0SA 3WRYC 4TT8A 5LZ4A 1OAAA 2ZWPA 4MR7B 4E94A 1M67A 3K09A 2JLCA 3Q3CA 4IOMA 4CQNA 3UIEA 3D7RA 5L4LA 1RAHA 3L8CA 4E70A 2Y4NA 4DMFA 2IZ1A 2M6RA 1OYWA 2MIIA 3URMA 2YZGA 1R3DA 2VH2A 1R5JA 4CF6A 3UBMA 5I7HA 1SA0B 2J31A 4F72A 2PKCA 2VJCA 2WJJA 4KE8A 1UF9A 3M9WA 1Y1SA 2CFTA 4M9CA 1IHOA 1W1IA 2YDXA 1KJIA 4TT3D 4X1IA 5IDYA 3TZLA 4ADSG 2GXAA 4A2CA 3PK0A 3BILA 4FMDF 2N47A 2ZDHA 4E5KA 3KRTA 3G49A 3LXRA 3QPWA 2GPAA 1MD9A 1YUMA 2CMKA 3A9WA 1JSXA 3JAWB 3W6ZA 5JCPA 1E3QA 2XVMA 3H1GA 5E0KB 3HJCA 2OFWA 3ZTTA 1GNQA 2ZBGA 3CH6A 3KYBA 2HREA 1E60A 2YYYA 1D0SA 3CSSA 3FZNA 2DCUA 3IVGA 3TQHA 4Y0AA 3GLHB 1FTSA 3RE1A 5I51A 2HXSA 4H6WA 3DM9B 1QFSA 1VHLA 4RC9A 5FQOA 3VOBA 1UJ5A 3FM9A 4OHWA 3K1ZA 4WINA 3HEMA 2UUAB 2G8NA 1HNWB 2YW9A 2EP8A 1JR3A 1CY8A 2PH3A 4CT0A 3ZH9B 1GAWA 4R2XA 2AJ8A 3WGUA 4F9FA 3OPXA 5ADVA 4AT1A 1ZIOA 2IYVA 1MJFA 1LLQA 2AT1A 3DPIA 1O97C 2FG5A 1DXHA 4PVDA 3JZAA 3MRXA 3CZ9A 4EY4A 2J3DA 1XOIA 2ID4A 2R751 2I2FA 3S70A 4EA8A 4F6RA 2JATA 3MWKA 1KKLA 1PLLA 2Q9CA 3GNQA 3L4BC 4Q1AA 1X14A 2XE7A 1KZ1A 2DHEA 5JC8A 3G7NA 1EP1B 1I01A 2ZJFA 5CG2A 1EHYA 4LRXA 3CYFA 5C35A 1PEYA 3QVWA 3LPLA 3TAUA 4A8JB 4UEWA 3D5EA 1GCOA 1W7AA 3ROKA 1EWQA 4FFBB 2GETA 4BWYA 5FIUA 2BUBA 1N2CA 4G1VA 4RPKA 1Y6ZA 1W59A 4OUKX 3Q3IA 5IDXA 1U1EA 2ATCA 2BONA 2GRAA 3E4CA 4J3FA 2GTPA 4NFYA 3K2BA 2VA8A 4OHXA 4C4AA 1IM8A 3MSCA 4P4GA 3C43A 1M8JA 4IM7A 4JI5B 1RXWA 3DQPA 3RUDA 4BYMA 3T5AA 3KJGA 3KNZA 3EUFA 3O7WA 4I66A 1EQ2A 2QM8A 1R64A 5CCXA 3H9CA 2GO1A 2R8XA 4WLOA 1H4TA 1F8UA 5CJ2A 3WIBA 5I8WA 4RKWA 1XG5A 1SZCA 2COEA 2F1HA 2L82A 1UKZA 3N2IA 4N6GA 4Q4AB 3K6KA 5LBUA 1W0CA 4AIIA 4E2FA 1TQ4A 3H2YA 4J90A 3CZ5A 4F12A 3OT1A 2ID8A 3LD9A 4O3FA 5CDHA 1Y7PA 3NBXX 3ROEA 1TUGA 4R5MA 3NAGA 3T1HB 3GBSA 4L4YA 2TMGA 4FOSA 3HWSA 2SHKA 3QG5A 2WIJA 4FQ5A 4KAFA 4KW7A 3TOVA 4BP1A 5KJ1A 5KOJA 2O0MA 4LC1A 1Z4OA 2IHTA 2IXFA 2JGFA 1CQXA 4DNXA 1M8GA 5BR8B 3ZJTA 4BXOA 1NI4A 1VL0A 1GN8A 2Z8YA 4PGFA 2PRIA 4J6FA 4BV2A 1IN8A 2E4UA 2CNBA 1F8FA 3Q87B 2HIAA 2P2SA 3PWZA 2ODTX 3IUMA 3QM1A 5ED0A 5B3KA 2JD2A 4XA8A 4Q18A 4W1SA 1XZHA 1QWSA 5E9JA 1QOPB 4H1VA 2HZBA 3FB1A 1A5AB 1OGYA 2I67A 3DBIA 3TBHA 4IILA 1C80A 3NIWA 1VBFA 3K8OE 2QW8A 3QTBA 3R76A 3KKKA 1H2WA 3DC7A 4Y2PA 2NNWB 2UVQA 3FHOA 4CTJA 4DLLA 1YTUA 1UODA 2ECPA 2NSLA 4MVWA 1J33A 1U0LA 4PO8A 2FPGB 5AH0A 2IT1A 1SIUA 3AINA 3WGIA 1GXSA 1JLSA 5I9TA 1C1YA 1OA1A 4B8WA 3VU0A 4W6ZA 1DAPA 1ECLA 4Z0NA 1QFMA 5ALXA 1MC1A 1NG1A 4D79A 3RSGA 4D57A 3OLWA 4JXJA 1UADA 1QPBA 3LPDA 3PUXA 1VLVA 3GLKA 4JEIA 3TRKA 4ZAWA 1ZR4A 3KT0A 1NVBA 2JFHA 3OCYA 2IV3A 2BZSA 1V1RA 1TYCA 1G5TA 1UZAA 5BWNA 1OA0A 3WXMA 4MVJM 2Z6UA 2Q5LA 2YN0A 3TQQA 2D0OB 3COSA 3KELA 4EIWA 1QONA 1TFRA 1ZONA 2GZMA 3TQTA 4V2IA 4OHYA 1O54A 1EVIA 1U31A 2HBZA 4Y98A 1DX6A 4B76A 2IHBA 3G5TA 4CQMA 4UUNA 4XGKA 1E6UA 4ND1A 2QAGB 3M6XA 2BLNA 1A7JA 2FA9A 4PGGA 1DQSA 5LLSA 1Z4NA 3E5NA 2IUTA 1KPHA 5G53C 4BMPB 2L2QA 4QQFA 5IN5A 2Z2IA 5CW2A 4NBWA 3IX7A 2EHJA 4XM1A 1NG9A 4MW0A 2Y1XA 2SECE 1JIUA 1TO6A 3WGNA 1N3BA 1N6HA 2D5AA 4F91B 2BBTA 2PCLA 2Q4DA 1SUEA 2XQVA 2ZSFA 3BOSA 3DEIA 3ETCA 3IV7A 3KVOA 4Y2TA 1JPUA 3NM4A 5JYCA 4JJ6A 3U4QA 1MPXA 2O2HA 5B58T 2JCYA 4C08A 1CQIB 5K3AA 4XQCA 4HX5A 2YYAA 5COBA 1IYZA 2FP3A 1P2UA 3HNPA 2AMLA 1U02A 1E5LA 1GKUB 2J08A 3EDMA 3IESA 3IP8A 3QNWA 1SHJA 4ZAXA 3SD7A 4AN1A 4BQIA 1E2FA 3MOGA 1XR3A 5FWXB 4M1EA 1C9JA 2RH8A 4RY2A 4WKCA 1L4UA 1ZN7A 4ZHQF 2QBYA 1RM5A 1KZYC 2G0TA 3GMIA 4RX1A 4Z9BA 3T5PA 2I29A 2Y1OA 3PGA1 3FTEA 3EOZA 1PTJC 4QPCA 4KWEA 4LJ5A 3CW2A 3LBHA 4INAA 4DMCA 3PEWA 2NAFA 1LTQA 5AVVA 2NVUA 3EVAA 1FX0A 2RCNA 1HNZB 4XJVA 1LWOA 2X19A 5TQJA 1M72A 3PNYA 2I4IA 2O2YA 4ZODA 4JUIA 3UAXA 2JIBA 4BLVA 1LK5A 2ZVJA 5FPHA 2FE1A 1T36A 1KFJB 1PE0A 1ZK3A 3EMVA 1NC3A 3ZVNA 1JDBB 3A4IA 1RZVA 2RIRA 3D6VA 3FPHA 4XGNA 2RGUA 2COKA 4XPZA 5IYZF 1CJSA 3Q3GE 4YRRA 2WSMA 2R85A 5REQA 5BWBA 2D06A 4RAQA 4MV7A 5E6SA 1T2FA 3U39A 4OU5A 3LUHA 1EP3B 4NYIQ 5DX0A 3AV3A 1UXHA 2J5BA 3CLKA 1HE2A 2PTHA 3OMXA 4HI0E 4L2IA 2PLNA 1M2OA 1RRVA 4LRYA 4W9NC 4KQWA 3FDIA 2PX3A 3G5MA 2ZG6A 1FZQA 1PR9A 1JR3D 3PBKA 2G9VA 4RBNA 4AP6A 4L50A 3WMXA 4YX9A 1ST2A 2O2SA 3FDFA 1VLHA 1FQKA 1JIXA 3H84A 3U7QB 3P52A 2D5CA 2PVSA 4NNOA 4XVQA 5E4YA 3TIXB 4B73A 1JECA 4HJRA 1BU8A 4TXHA 2OZLA 2Z5VA 1RAAA 1SULA 3LBYA 2JJ1D 3AGPA 3P7MA 5FKJA 4C78A 3K6SB 4TYWA 1ZGJA 3DVAB 4C89A 3NBUA 5MN6A 3DHVA 4MQ4A 4JELA 1C9NA 1QR6A 3RSCA 3P2IA 2IJGX 4MEJA 1XHFA 4E5SA 1XWFA 2C2MA 2IHYA 1W581 3OPVA 1KO4A 1CD5A 1P1KA 3MJRA 4OKSA 2ISSD 3FF1A 1ZD3A 1LV7A 2Z08A 3LK7A 4S1TA 2QXYA 3BVPA 3W06A 2W2TA 1M7HA 3E48A 3IUBA 5AJTA 1U0SY 1JLLB 2OGSA 3D0OA 4HZUA 4NFLA 5TRTA 3RADC 2CE2X 1GYPA 5EIAA 2QRZA 2VP5A 5LN1A 4Q00A 3WJAA 1SHZA 2XYVA 3LQ2A 4FMCB 4PYQA 3SS7X 3VNVA 1F9EA 3G68A 4E46A 4AMUA 3T7SA 2BEUA 2PT9A 2YW2A 1DBRA 1Z07A 5E2AA 4WZAB 1JDPA 3LGXA 4F71A 2JCBA 2Z6AA 3NXKA 2VDWB 2ZBUA 2ACVA 1V2GA 4V1CA 3HVRA 5D00A 1DAFA 1AC5A 4HWPA 2GEBA 3L8MA 4JI0B 4FFDA 4YP0A 4AJ2A 2V5AA 1RQXA 1SUWA 1W30A 3BJEA 1L4MA 1MX9A 3H4MA 4LHZA 4D3XA 1CUXA 3OPNA 4MSUA 1L8XA 4HDMB 2XNKA 5JPIA 1K6MA 3GOQA 5ES3A 2EFCB 2DHCA 3G8BA 3MCWA 4GMKA 2M1ZA 4R1SA 4L9WA 3MWDA 2NVWA 3FIUA 2CD7A 3C7TA 3S55A 2HRQA 3B9PA 3LPAA 3G7UA 3BTOA 3DGFC 2PJUA 2QXUA 3QFHA 2YQ4A 2H08A 3IJ5A 1SRQA 3QBTA 3AHHA 3IH5A 3WYCA 1H2RS 2X1VA 4N3GA 1T6BY 3QI7A 4D4JA 5B6IA 4FYVA 4GO1A 2FZGA 2YFQA 4ZVOA 5FI0B 5IF3A 2F1JA 1ARZA 3DJYA 4TV8A 4TMFA 1Z56C 4IZ6A 3ZGOA 1ZOSA 4BGEA 5A2QA 1VKJA 3BCUA 4XIFA 2QI9C 3GVCA 2BZ0A 1UJCA 2E18A 2F3SA 3QPBA 2C4KA 2H0QA 4IDCA 3I01A 3PX3A 4BLWA 1QGOA 1WO8A 2PS9A 3EVGA 4ERXA 5AW2A 4ZO6A 1M1ZA 1SN7A 4XFDA 1LPAB 1V5GA 2GZ1A 3CMCO 5DEIA 2NG1A 3WMWA 5BWMA 2JIOA 4A0RA 3OZXA 1Q1NA 1V7ZA 2V8OA 4YMLA 2C58A 3BH0A 2ZJZA 5CX1A 4PCAA 5HZGA 4ZV7A 4QYTA 5A0FA 2ZZNA 3BT7A 1GUYA 5JIBA 3ESAA 3X1ZA 3WYFA 1T13A 1SO8A 1T2UA 3QGMA 1EFPB 3ZEAA 3W05A 1VDZA 1DZ3A 4UBKA 1NJFA 5IAJA 4XJTA 4OLAA 1X1SA 3Q2IA 1A98A 3RAFC 1AKVA 1IEXA 1HH4A 3KUKA 4ILEA 3UEOA 3EHDA 2Q5EA 1YC5A 5FAXA 4R1LA 1I7QB 3BE5A 3ULKA 3WLIA 3I1YA 2P2NA 1FJ2A 2INGX 1CZOA 3IQHX 5C5EA 2JB9A 3FUTA 2Y6UA 4O4IA 4CQMD 3OE5A 3U0VA 3V8BA 1GZUA 4KQEA 2XQGA 5FXMA 2NU7A 4UDNA 3QMVA 1G66A 4IFBA 3W5JA 4ER3A 3SF0A 4V3CA 1E4EA 2VBIA 3LXMA 3MTGA 3QVJA 1DC7A 5TPZA 1I14A 3G6KA 4F3KA 1HYEA 1A5ZA 3TIGA 1KEWA 3E8MA 2MYNA 3FVVA 2DWUA 3EZ7A 4DUPA 1FFCA 4MDEA 4B3JA 4OUDB 5HJ5A 2IY7A 4BQFA 4CKYA 4KFUA 4MDHA 2NUTA 4F46A 1ZHFA 2QRLA 2VKQA 2VJYA 4CM9A 1KTIA 1R9JA 3INNA 2KBEA 3AM1A 2VT2A 2IS4A 1Z68A 4H3VA 3HO8A 1LVGA 4OJNA 3FPSA 3PB3A 1C0EA 4PQGA 1AQJA 3AXTA 3KJHA 3DMGA 2YNMA 3GDHA 4LY0A 4KOAA 5TPWA 1PSZA 5F7XA 2XDWA 1YZNA 3C4VA 1QDEA 2Q6VA 3MXOA 1E96A 4IF4A 3ZDRA 1Z22A 1M1YA 3IQIX 3OFSA 1E9RA 1GA1A 4YJFB 1ZRNA 4R3UC 2RONA 3CISA 1T9ZA 2QE6A 2W48A 4RUKA 3BXPA 1W0JD 3RVBA 4C87A 1LK0A 1QU3A 1E2QA 3KEGA 4I99A 4FC6A 4DAOA 1M6NA 1RPAA 1H6BA 3NT5A 3OPYI 3HU3A 2JJQA 2QD1A 5I9SA 5JMWA 1PZEA 1L5SA 1U28C 2BP7B 2ZAIA 4KVZA 5IF9A 3U13A 1U8FO 1Q7TA 1UPCA 4YV7A 4RABA 3H9GA 3AI7A 3CLUC 1X38A 1M34A 4AS2A 2FMUA 2VT7A 1IU9A 2DF8A 4IIBA 3MGGA 1YZLA 2G9ZA 5EIBC 1THZA 1LBTA 4J1TA 1LSUA 4TLLB 1CXZA 3M89A 2RK3A 1UZLA 2ZYDA 4YP9A 3JVVA 4PNZA 3DLIA 1E0KA 3ZXIA 2B7CA 4GVLA 3LE8A 5I3CA 4C76A 4KMSA 5L3VA 3MW8A 3A6JA 4ZT5A 3RCBA 3TPFA 1WLYA 1VYUA 4G0OA 1WS6A 2PMBA 4C0WA 3PCXA 5CNMA 1MZPA 3FLBA 4BMSA 4FXPA 5HZHA 4P1ZA 2Q4TA 4LHWA 1CY0A 2PV0A 3LLMA 3PITA 1SELA 1XQXA 2NV0A 4P7FA 1FXSA 9ABPA 2ZUSA 6AT1A 3DL2A 3UJNA 3QEOA 3QLVA 4ZCIA 5FWAA 5IVKA 4MB2A 2C97A 3OE7D 1F5SA 1GR1A 1L4YA 3OX4A 5JG7A 4YPVA 1RHRA 1YZGA 5ARBA 1UWKA 2R1TA 1Z7GA 3AHFA 4X71A 4KOEC 4EG1A 2RHTA 3BORA 3EEBA 5LJIA 4QYXA 5LYJB 5HIAA 4XR9A 5K3OA 1FA9A 1DTWA 2CBXA 2X3FA 3FG9A 2XB8A 4LOKA 4KNWA 4RD4A 3OPQA 4HF7A 4L7QA 3KTAA 2O2JA 1EIZA 4YRBA 3BQMB 2QMYA 4HAZA 4WA8A 5JZSA 2RJ3A 2SKDA 5ALGA 2WVHA 1QHIA 5CBPB 3IA2A 4WVFA 2GI4A 1ZCBA 4FT4A 3MRVA 4BRWA 3MT7A 2NUAB 4L9RA 4AXBA 1E6CA 1U3VA 3TN7A 3NJRA 1KZHA 1ADYA 4BGVA 1JH9A 1SXJD 3WLOA 2IH2A 3BSFA 2JHAA 2RHLA 2H48A 3TW0A 1WV0A 1J5XA 1NC1A 4RJIA 3B52X 2V6FA 2R1ZA 3NBZC 3NGLA 1W44A 5EKTA 4DZTA 3C1OA 1FK8A 3QLEA 4H7FA 4WA7A 5CD9A 1AT1A 1F4VA 1XALA 2WM9B 2WJ6A 2ZJ8A 2GA8A 2COUA 4DLNA 1O03A 1U7WA 3OWOA 4J7XA 3VZQA 3ADDA 1OTHA 3H87A 4XRRA 1F8GA 2IHUA 1RAEA 2DXIA 3QNMA 3UPDA 2UZIR 3NWOA 6ADHA 1T9AA 3I53A 1M54A 4ZTUB 5EKXA 1W36B 1OLXA 1O6GA 1M75A 3KUUA 4PZCA 2M1XA 4TLDA 3WGJA 3BCHA 4M55A 3C5WP 4TMXA 1LY1A 5FYQA 1PWEA 1SCJA 1NN0A 4TS1A 2JRCA 2WUVA 5CYPA 1V6SA 4M1MA 1L5GB 1LLFA 2ADMA 1UXKA 1X6VA 1NMEA 2G70A 3EEQA 1J0XO 2FJ0A 2JRLA 2X9NA 1ORRA 3N2KB 4H3SA 3JAKB 4C29A 5IG2A 5KNDH 3PLAE 1RDFA 2WNIA 3F6BX 4WNYA 3ZE1B 3DTVA 4NWIA 1SVMA 5CTJA 1IHDA 1E7QA 5EE3A 3FSEA 3UH0A 4CV3A 1ZD2P 4QTYA 1IWBB 2YVLA 4IXMA 1QMGA 4KL8S 2ID9A 3TTXA 5MGNA 1YVRA 4ZZ1A 4XSGA 1NA5A 2WWYA 4M46A 3BGIA 1QIMA 2WHYA 3BZBA 3DFFA 3QYPA 4IMRA 6NULA 5TR9A 4TMWA 2O48X 2CYBA 4HPWA 3U9SA 1V6CA 3RS3A 3V3KA 2OMKA 3ZIAA 5KSZA 2RHOA 2CXRA 1N6OA 3EIWA 5JASA 4NBUA 2IXDA 1L4KA 4PGMA 3CF0A 3GO4A 5CTAA 2B8TA 2G25A 2Q21A 3FCUB 3HKEB 4IFTA 3V8MA 5AUPB 2ZSKA 2YINC 4QDKA 4PICA 2RHDA 3HXMA 1C41A 4B83A 4HBZA 4NZ9A 3L7YA 5TT1A 4HGPA 2FAXA 4QQ8A 2B99A 5C0OE 4KRFA 3G02A 4RVHA 4B09A