1P8AA

Solution structure of the low molecular weight protein tyrosine phosphatase from tritrichomonas foetus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
146
structure length
146
Chain Sequence
b'AAEKKAVLFVCLGNICRSPACEGICRDMVGDKLIIDSAATSGFHVGQSPDTRSQKVCKSNGVDISKQRARQITKADFSKFDVIAALDQSILSDINSMKPSNCRAKVVLFNPPNGVDDPYYSSDGFPTMFASISKEMKPFLTEHGLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein tyrosine phosphatase
molecule tags Hydrolase
source organism Tritrichomonas foetus
publication title Solution structure of the low-molecular-weight protein tyrosine phosphatase from Tritrichomonas foetus reveals a flexible phosphate binding loop.
pubmed doi rcsb
total genus 22
structure length 146
sequence length 146
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p8aA00
3JVIA 1BDIA 1URPA 2X7XA 3LUJA 1LBIA 3MA0A 1T34A 4M88A 4MRMB 5IUNC 3H5LA 4KZKA 5TPWA 3OMWA 3HDGA 4KV7A 5CNIA 1K68A 3MYYA 2L18A 5EWJB 3RVKA 4G0OA 3Q7TA 4DN6A 5KC8A 2VK2A 3CZ5A 4MPTA 5TPZA 3OMXA 2IDMA 3HK2A 4D74A 1DCFA 2H0AA 2WWVD 4MLCA 1K66A 3L49A 4H60A 4RS3A 1Z16A 5KQGA 4TN5A 2HQRA 5KQPA 3HSYA 4Z4CA 3I5AA 1TLFA 1U2QA 3KYIB 3LKBA 4S05A 1ZAYA 1DBWA 4LE1A 1ZGGA 4N0PA 2QVCA 5GQSA 1ZITA 3H5OA 2QXYA 4NQRA 1BVHA 4MS1A 3OLVA 2RDMA 4G0PA 2QV0A 1OXBB 1JFSA 1L5ZA 1Z15A 3T6KA 5B3JC 3KCNA 5DKFA 1MVOA 2JB9A 3CFYA 4MS1B 3HUUA 3IPAA 2FMHA 4RKQA 4JASB 1RZRD 1PNRA 1JDPA 7ABPA 1S8NA 4YRZA 5EWMB 4UHKA 2PUGA 2VUIB 1PHRA 4IMIB 3UK0A 5DTEA 4ETIA 2PUEA 2F8SA 4RDCA 3W9SA 4LE2A 3KYJB 5KWSA 4JB0A 5KI6A 3N8IA 4EVRA 2A9PA 3BRQA 1EFAA 1ABFA 2L2QA 3A0UA 2GBPA 3JPYA 2H3HA 4LRQA 3KKEA 1EWTA 3F6PA 3LUKA 3QLUA 2WB4A 1DRKA 2B4AA 3VNBA 1XHFA 4DQDA 2IPNA 4JOQA 4YLEA 3F6CA 2GWRA 2NUBA 1QPZA 3KHTA 1NXVA 4RXUA 5FBHA 2Q5CA 2FN8A 3E3MA 4N0QA 3KSMA 3DGFC 3KG2A 3S99A 1OXKB 4N41A 3TB6A 4KPYA 4RWEA 3GT7A 1P2FA 5FBKA 2W42A 1JYEA 3CZCA 4EVQA 3CG0A 4WUTA 1QQBA 2CHEA 4KREA 5BRJA 1R8JA 4PYRA 2FVYA 4MR8A 4OLBA 3OM0A 1NTRA 4NICA 4G0YA 1DBPA 3L6UA 3HXMA 5BQ3A 1QNLA 4YWHA 1BAPA 1Z17A 2LBPA 1JYFA 1TJYA 3UKJA 2KYRA 4MR8B 4NCBA 3HM9A 4L4UA 1UDRA 2TMYA 4MYRA 3O75A 3FFTA 3G1WA 4LZLA 4RY9A 1D1QA 3F73A 1YVUA 3K9CA 2PLNA 1JBEA 1KGSA 3OLZA 4MS3A 3TO5A 1DJMA 2WMYA 4RY8A 2ZWMA 1QP0A 1JLKA 3JS5A 5C5CA 2PL1A 3A3KA 2JK1A 2HJ9A 1U2PA 1NXPA 3QLTA 5JNRA 1PEAA 6ABPA 3KLOA 3R0JA 3T95A 3OQOA 2QU7A 3H5WA 1B00A 4KQCA 4F11A 5HKOA 2FQYA 1JWLA 4W5QA 3HCWA 2PAFA 4KMRA 5BR1A 3NBMA 3EODA 3RVQA 3C3WA 4FE4A 4H3KB 1NXOA 2F8TA 1Z13A 1A0OA 2CWDA 4YS6A 2OQRA 2JBAA 1F51E 4JA2A 4Z4IA 1EWVA 3IP9A 3LUCA 5TQ0B 5FWYB 4ZJPA 3FGZA 2FQWA 4KK3A 4EYQA 4Z9BA 4MQEB 4MGEA 3FMVA 3OO1A 2YHAA 3LOPA 4XLTA 3BBLA 5JS1A 1ISSA 1W9HA 3SY8A 2JBAB 4Z0NA 3URMA 2IPMA 1ZVVA 1NXXA 3OLYA 5EWLB 2FMKA 4W5NA 5D2CA 4WXMA 3CG4A 4H3HB 2HQBA 5JNTA 4QYWA 3H5VA 1USKA 4N76A 1QKKA 1ZESA 2P4UA 2JVJA 5EWLA 5CNKA 5C5EA 4IMJB 3OO0A 1M2EA 2ZAYA 4NV3A 5CNJA 1U0SY 1CHNA 4RK5A 4OTZA 2FEPA 1ISRA 1D2AA 1YMVA 1A2OA 1DC8A 4G0MA 4LX8A 1XWWA 2BGGA 4RV5A 3JTEA 2RJOA 1RPJA 3QEMB 1DC7A 2E4WA 4YO7A 2A9OA 5JNUA 1LK0A 2LIVA 4TMYA 4ZPJA 1DP4A 1NY5A 5IX8A 1TVMA 1FFWA 4D6XA 3GYBA 2PUCA 2V0NA 1YK0A 5TQ2B 2E4UA 2HPHA 3ILYA 2E4ZA 5IUKC 1Z25A 3MMNA 3NNNA 5KC9A 4ZMRA 3H1FA 1GCGA 5CHYA 2P9HA 3C3KA 3IDOA 1Y1LA 9ABPA 3H6GA 3HV2A 4NCAA 2IPLA 3O74A 4FB4A 1XHEA 4JB2A 4RKRA 5JNVA 1QMPA 2JVIA 2MSWA 2NT3A 1VRVA 1USIA 1IIBA 4MR7B 4O1HA 3RQIA 3DZDA 5ABPA 3I45A 2IPAB 2FTKE 3O21A 4TLMB 4IILA 4QYMA 5FWXA 3M9WA 5GOTA 4OLAA 3MQ4A 3RVPA 3NNSA 4B09A 4KRFA 4OG2A 3EJWA 3ROTA 3GRCA 5TPZD 4MQFA 1ZH2A 5HSGA 4ZYLA 1ABEA 1QP7A 1BDHA 4OATA 1J56A 2PKXA 4PZ0A 3SM9A 1JHZA 2MYTA 1KRXA 1YIOA 3LUDA 3EDCA 2QZJA 2PUDA 4KFCA 1PUXA 2FQXA 1A04A 4RU1A 1EWKA 1JFVA 1YK1A 4MRMA 4MS4B 2L19A 4EGSA 1JFTA 1C0EA 1E6KA 1GCAA 2R25B 4YGXB 4RK7A 4RK0A 1FSPA 1P6UA 3O2JA 3QELB 3SAJA 3SQNA 1QO0A 4G0ZA 3N0RA 4MS4A 1GLGA 4WWHA 2B1JA 2M1ZA 2N9UA 4GPAA 1P8AA 1Z26A 5JNWA 2E4YA 3EAFA 4Z99A 5T7BA 3GL9A 1DG9A 3QELA 3QX8A 1YS7A 3EQ2A 3G85A 4MR9B 1YS6A 3Q7RA 1SXGA 2DRIA 5BRAA 4YR7A 2R4QA 2FW0A 3KLNA 5EWJA 1ZN2A 1C4WA 2OENG 3Q9SA 4F06A 2CHFA 4JAVC 5TQJA 1TM2A 1Z2EA 4MR9A 4FE7A 2JVKA 2MSKA 1APBA 3RVMA 2L17A 4QICA 4XARA 1D5WA 1KMIY 1AB5A 1QO0D 3Q15C 4Q7EA 2JCGA 1BA2A 1Z2DA 2WJWA 5EWMA 2I6FA 2PL9A 4E7OA 1JH9A 3N0XA 4WXEA 3VNAA 3H1GA 4Y9TA 4EUKA 1SXIA 4YV7A 4KQ9A 4S04A 1FFGA 1D4ZA 3KJXA 2M98A 3O1IC 1F4VA 1Z12A 3JPWA 4HNRA 3EGCA 3OQMA 3LMKA 1L5YA 3QK7A 2PMCA 3HDVA 4O5AA 1JDNA 3FFXA 2ID9A 2QW1A 3IP6A 4ML3A 1LJLA 5IBQA 3CTPA 3N0WA 1MB3A 4ETNA 3LUFA 2MSLA 3H6HA 3HO1A 2IYNA 3MM4A 3CNBA 2AYXA 5ED4A 3O1JC 2WJAA 4RXTA 3T8YA 2FXIA 3IP7A 3EULA 1NATA 1PNTA 3H5IA 2FN9A 3T38A 2O20A 1LJUA 3KS9A 3QLVA 4RK1A 3Q41A 3LTEA 3RVLA 3RVJA 5IUJC 3SG0A 1SXHA 2IOYA 3QEKA 3NHMA 3DLBA 3MF4A 2IKSA 2R47A 1GUBA 1I3CA 2HSGA 2PUAA 3OLWA 5B3JA 2AYZA 4Q6BA 3N6VA 1FQWA 4RXMA 1W25A 3HEBA 4PE5B 4WT7A 4IGAA 3RVRA 2VUHB 3LKVA 4MS3B 4N47A 3JVDA 1KRWA 3DBIA 4IF4A 3C97A 4F3TA 3CU5A 4Z4FA 2HQOA 4GNRA 4YP9A 4G0XA 3D8UA 2R48A 2RJNA 1FFSA 3O1HB 2A9RA 3GWGA 3HZHA 3RVNA 2QSJA 5DLEA 5KQMA 3EQZA 4W5TA 1JX6A 3MIZA 3CLKA 1U8TA 1DCKA 5T3YA 3QLVC 3E61A 2RGYA 3I09A 3UUGA 4DADA 3HJFA 1VPWA 3JY6A 1D1PA 2QVGA 3M6MD 4QPJC 4KVFA 5FWYA 4E7PA 3NNDA 3BRSA 3H5TA 4MAAA 4PEVA 3QLUC 4XXHA 3GV0A 2FKAA 1ZH4A 1MAVA 4RY0A 4CBVA 3TX6A 2GX6A 5I4CA 1TMYA 3ILHA 5HM6A 2E4XA 3TD9A 2E4VA 4G97A 5JS2A 1NXSA 4KNYA 3BILA 1U04A 2MYPA 3M9XA 4RZSA 1RXEA 1CYEA 4Q6WA 1RXIA 1SD5A 1GUDA 1NXWA 2FSPA 5F64A 3ROFA 3RVOA 1P6QA 1ZDMA 3DGEC 4PICA 5TQ0A 4XASA 1EHCA 3F7NA 4W5RA 1QP4A 1DCMA 2FMFA 4W5OA 4MQEA 3LFTA 4HYEA 1E6MA 1WETA 1VLZA 3B2NA 3D02A 4P1ZA 1E2BA 3LUAA 2JRLA 4N03A 4TLLB 2YHBA 1CEYA 4RK4A 3FDFA 5IULC 1AB6A 4IRXA 1E6LA 2FEWB 4HNSA 4RSMA 2FEKA 4MLDA 1H9CA 1NXTA 4Z4GA 2FMIA 4G0QA 3O2SB 5TE9A 4L85A 1PEYA 3GBVA 5E3JA 8ABPA 1USGA 4ETMA 2WY2D 2NZVG 2LUOA 4LE0A 4F8JA 5CNMA 1M2FA 4D6YA 2ID7A 4O1IA 1BDJA 2GKGA 3HUTA 4XFKA 4Z9AA 2VYCA 2PE5A 4EVSA 3P9YA 4JP1A 1ZHHA 3OQNA 1LBHA 3RH0A 4LDZA 4P98A 2PUFA 3GBPA 4OBBA 4KK4A 3LUHA 3QEMA 1QQAA 3DLHA 3O2QB 1JF8A 1YTUA 4EY3A 2FLKA 1VKRA 3CS3A 3N53A 4Z4HA 2CD7A 1RZRA 5JNSA 5IC5A 5TQ2A 2GI4A 4HNQA 3Q7SA 3C3MA 3GA5A 3LUGA 2NZUG 4EYKA 4WZZA 3HVRA 1MB0A 3BREA 3KTOA 1ZGZA 1JL3A 5FWXB 2NT4A 2J48A 3C6QA 5IEJA 2LPMA 1Z18A 2MYUA 1M5TA 4UHJA 3IP5A 3A0RB 2FLWA 3HS3A 3IPCA 2LP4Y 1HEYA 4MQFB 4Z4EA 4G86A 1SRRA 3CRNA 1ZY2A 4XAQA 2PUBA 1M5UA 3I42A 3OM1A 3QX9A 3SNKA 3K4HA 1YMUA 1DZ3A 2MYNA 3N75A 2QR3A 4MR7A 2PJUA 4LDAA 3CHYA 4YCSA 3OLXA 4ZMSA 3RVSA 5KQLA 5HQJA 2A9QA 2WRZA 5IEBA 3NHZA 5PNTA 4F12A 2XDYA 4RK6A 4EYOA 1DRJA 1MIHA 3H1EA 1RNLA 3H75A 5DGCA 5TPWB 5DCLA 3TMYA 1DBQA 3A10A 6CHYA 3CKMA 3FFWA 1EAYA 4EYGA
chains in the Genus database with same CATH superfamily
5HZKA 1YA4A 1URPA 1M2OB 3GCXA 3JR3A 1U2ZA 3WYAA 1FQOA 4AY6A 2Q0HA 3O3NB 3U17A 4M88A 4NPHA 1CIVA 2WTMA 2GZDA 4OM7A 1I33A 2FQ1A 1UT6A 5B37A 3GFQA 4DWOA 4GC9A 3A37A 1K68A 1G16A 4PYKA 3VDXA 4WY8A 3VMMA 4G0OA 4ASUA 4JXKA 4CKEA 4HQFA 3WJ1A 1L5QA 5HIAA 5EJMA 1IN1A 1W87A 1P3DA 2I3ZA 3DKRA 3E7FA 3HLYA 1RLJA 1RQXA 3JALA 4MCAA 1N34B 1HDIA 1K66A 1V3VA 2OHXA 2WUFA 2V45A 4Y2GA 1J9EA 1ESDA 4OHBA 2BGTA 3TZ6A 1TLFA 4CYMA 4V39A 1LFAA 4JI3B 4AUKA 1D9ZA 2C54A 1PL8A 4LE1A 1ZGGA 1JECA 4G5YA 1G41A 4RCVA 4PM4A 2HJRA 3DPSA 3H2IA 5EJ4A 3DE6X 4X00A 2W2LA 4WINA 4AG5A 4YRDA 2RDMA 4JLOA 5SY4A 4R3WA 3M6IA 4BDSA 2GEVA 4KN8A 3NT5A 3RHFA 5IF3A 4A9AA 2EZ8A 1PR0A 2JPDA 4O08A 4TS4A 1XUOA 2BFDB 2ACWA 1OFVA 3R41A 4YB8A 3V9AA 2X23A 3ZNQA 2X1VA 1YS1X 3GH1A 1Q0RA 3P9SA 4UDYX 3KJEA 5T4HA 5KTYA 3WK5A 1V5IA 2EKQA 4CMCA 2CL0X 5EHGA 2BFBA 1V35A 5EIOA 3AM1A 2XMSA 2WC1A 3V6MA 2YWCA 1SIBE 3N6RA 3T7AA 3N8IA 3DLTA 3BORA 4FONA 3TPCA 1QBKC 4ZVKA 1EFAA 2QTRA 4DZTA 3A0UA 3NIGB 4A8JA 2JJ8A 3SMQA 4PO1A 3ZE1B 2PT9A 2ZSKA 2OKGA 1N3YA 1T1IA 2EBFX 4EHHA 2WWFA 4F4JA 3DB1A 1DBSA 1N2JA 2AXQA 1OF1A 4LMPA 2VDUE 4BLQA 2PG3A 4ZARA 2YMLA 1JTVA 1UJ2A 4W7IA 1N7HA 1SC6A 1JHXA 1E3EA 3DDSA 5F9FA 1FVOA 1UANA 3K9LA 3K0CC 1AH2A 4F5EA 1AGPA 3HRKA 2FPWA 3KZ1E 4HN2A 2QQ5A 5M7EA 4AS3A 4MUEA 3HBNA 5CTAA 4B85A 2I91A 1N6IA 5B7QA 2IKQA 4E2YA 4NKRA 2QG4A 1ZVMA 1GXSA 5FBKA 3OZUA 5G1OA 4M8LA 5DZSA 4PLPA 2CHEA 2FNAA 4GVXA 3ZS8A 4IQGA 3HI6A 3VMFA 3LBAA 4RL4A 2QAJA 3RSOA 2Q7DA 5L3SA 1Y9DA 4JXXA 2AWOA 2ZJZA 1H8ED 2ADMA 4BQOA 5HUHA 2XKBA 4ZTUB 4D41A 5CURA 2ZUDA 5KX5A 2E5WA 4MR8B 4L22A 3NU1A 1RTKA 3EE6A 2A9FA 1Z5UA 2QQEA 3KZXA 3M0EA 2OR3A 5HOEA 1GA6A 4XVHA 2XUZA 4CQNA 2YXNA 3QU4A 4C88A 1VHQA 1BJKA 3PTLA 5T4EA 4ROTA 4BAUA 1R66A 3OF5A 4OX9B 2G1UA 3TIVA 3HCNA 5CYOA 4R0MA 1N0WA 2IIVA 3FOEC 4IUCS 5KTRA 1Z63A 4IIVA 4OHXA 4KDFA 1Q1QA 1E18A 1PEAA 1Y8QA 2V96A 1OHHA 1X8XA 3KLOA 4JSRA 5A9RA 3OQOA 4ZEXA 3H5WA 1LWOA 1KR2A 4YJ3A 2G72A 4TKZA 1B6RA 4HDNA 3V8MA 4HTAA 1QSGA 3GD5A 3MGKA 4D8XA 4R01A 4LRWA 2FSIA 2WKRA 1R0BA 1NONA 1XRLA 1GFWA 1YTLA 2W2NA 4FX5A 1DDOA 3P5BA 1O9BA 2QVZX 5JYEA 1KAOA 3AVWA 3WAJA 3WGIA 3IPRA 1P4GA 8AT1A 4DLAA 3FNIA 3RKRA 1K4YA 1MNAA 5KUTA 1MV8A 4QRDA 1TTQB 3GJQA 4G1UC 4MUGA 1PAUA 4A8JC 1AZSC 1NKTA 5I9LA 1OFUA 1ZJ6A 2Q29A 1ISSA 5J5VA 4YP6A 4UATA 2QR5A 5F9HA 4RW0A 3G0HA 3ND9A 1M67A 4P38A 5JHHB 1RDFA 1BC5A 2FMKA 3DULA 1OLUA 2FFHA 1H6CA 3FZQA 3PXXA 4JT4A 1GZUA 2CE7A 3MTJA 2XKJE 3VUFA 5JNTA 4QDXA 1VE5A 2YV4A 4EJMA 3ZDBA 4HNGA 5AXCA 5K8TA 3QRWA 1QVRA 5HF5A 5JQGA 1BHJA 3B36A 2CN1A 2ZPAA 3L4EA 1UMBA 1J2YA 1E79A 3K0EA 4UEQA 3UOWA 4DDKA 3L40A 4J6EA 2IXEA 2FDRA 3L8HA 1NW8A 2OZLA 3L6EA 3NHAA 4YHHB 1B2RA 2CFCA 1W35A 5LJLA 3IL2A 1I4EB 1N77A 3QEJA 4IXNA 3TXAA 1QAQA 4KBYA 1U0NA 2QGZA 3HDHA 4J4TA 3VDQA 3W7BA 4EI7A 1P2UA 1XLTA 7MDHA 1W36B 4V02A 2EFJA 2HI0A 4A23A 3BWDD 4KR2A 4G4SO 3ZV6A 1F6BA 1TVMA 1UZMA 1E3JA 2OLEA 5CMLA 2PLWA 3VVCA 1N36B 3K1TA 3G68A 2Q6KA 1VYVA 2YXPX 3B51X 3FY4A 4RJKA 4U3JA 1VECA 1R8XA 2P9HA 1NUUA 1A3CA 2Q1UA 3ZY5A 1NU6A 1X39A 3QFRA 1QE3A 3UK6A 1R74A 1G9XA 3D8SA 2AK3A 4UNNA 1CB0A 3PCXA 4I6EA 2X19A 1SHUX 4B3MB 2CLCX 2YNMC 3SKYA 5B4TA 2AMJA 2DULA 2XW6A 1A72A 4QVKA 3S2FA 2GKSA 2NNLD 3RQIA 4XYGA 2Q5HA 1E2NA 1GNTA 1XVIA 5LDGA 1JKMA 1ULTA 4OSEA 1GRQA 1M34B 4YIHA 2R4TA 2VPZA 4DV2B 2GCOA 4LDQA 1MH1A 4ESHA 5BW6B 3AHDA 5C8YF 4YJHA 1NIJA 2XUHA 3HVJA 1ONPA 4O4LA 1W0KD 3V2IA 2PUDA 1L8QA 2ODBA 2RMKA 3NONA 4ZQHA 3ZU3A 4G1MB 2PD6A 5DWQA 4P7GA 1A04A 2CHGA 2XMBA 5JSYA 4CCYB 3QX7A 4EMUA 4Z7JA 5IG2A 4X20A 2ZT8A 1RYZA 1Y5RA 2OYSA 5JT1A 3G2MA 1YHZA 3P9PA 6REQA 1QX4A 2VJMB 2FW1A 4KV9A 4Y3UA 2PSSA 4JY7A 2YV5A 3GMSA 5AJVB 5LWQA 1XMQB 3G6KA 3VPCA 1TJPB 4YUXA 3O8BA 1JAHA 4K9OA 3WIBA 3WY9A 3VV2A 4G1VA 1LC3A 2XVMA 2ODPA 2O8DA 1A9ZA 2EEZA 1AF4A 1FNNA 1ZIXA 2L82A 3PX3A 4HDSA 3WJ7A 4ND8B 4IQ8A 5D8DA 4R1UA 2HLDA 2QZ4A 1YS6A 2YUTA 1SXGA 3QYFA 2NLOA 4BFZA 4A36A 1RJ9A 4O25A 3O8QA 1GLVA 2CB9A 5FIUA 5GY7A 1YONA 1QNFA 3MWEA 3U81A 2NU6B 4FFRA 4NXNB 1C4WA 2CJWA 4J75A 2YWFA 1F8YA 4S2UA 3QUCA 5L7YA 1C7RA 3B3QA 1NBMA 4JAVC 4DDHA 3JQFC 3LHKA 4X54A 2XXAB 2B3DA 3MCWA 2COKA 4MQ5A 5FT9A 3ZCQA 5TRTA 4QOEA 4DV4B 4BNUA 3DBLA 3U6KA 1YAHA 4R2WA 2L17A 2O0JA 1M2VB 1DTEA 1PJ8A 1WSAA 3QHPA 2OFFA 3BCSA 3ZGLA 4EY4A 1MDFA 4H6WA 5FLEX 3B6KA 1Z2DA 1MIOA 2FB9A 2WZBA 1J9GA 3JD3A 4GZMA 4HMOA 5IN5A 3SEFA 1KZ6A 5HZGA 1NJ6A 3UT5B 3DKPA 3SM3A 2IYZA 2YNMA 3DBLB 5TGTA 1YO6A 4LZZA 5JLJA 1FFGA 5THQA 2PR7A 5KX5B 1PS9A 3COPA 3WICA 3VHRA 1QYWA 2QU8A 1MC5A 2QUJA 4KUHA 4DMKA 2TRSB 4CL3A 1O95D 3LHSA 5JNLA 1FMJA 4N9WA 2XHEA 5BVHA 2WF6A 3PEWA 1B8PA 5TSDA 1FNBA 1ZS9A 4IJUA 1R0ZA 4QHYA 5IBQA 4ETWA 2XB8A 1WLSA 5LZ5A 3A14A 1LWNA 2QD1A 4KXLA 4DV5B 1U65A 3G59A 1E9RA 3TI9A 3RTDA 3K0SA 4LJRA 1NLZA 2ZTHA 3VZQA 3I9OA 1DTWA 4GFDA 1HF3A 3OIGA 3CZQA 3HL0A 3IR6A 1J5EB 1IEWA 2XT9A 1VQ1A 1M2WA 4P8RA 3FVVA 3ZQ4A 4ILEA 3SE7A 2WKPA 3UGJA 3PQ3A 3HGTA 4CUKA 5GJBA 5J1SB 1GXSB 5I47A 4CQLB 1FTGA 1A7AA 4Q9AA 3CX4A 1OD6A 2GN2A 2XEDA 3QGMA 4AD8A 2EBUA 1CIJA 4ZVMA 2P35A 3A6LA 1P7VA 5CUQA 2BGJA 2GN8A 2O2YA 5ANRB 4DCPA 4PHFA 1V1MB 4O6VA 2I1LA 2KHZA 1QQ7A 2HLNA 2DB3A 1WUIS 1NW4A 2XOEA 3N6VA 3WWCA 2QTZA 2HL6A 3PBKA 2Y2UA 1GSAA 2Y1EA 3L79A 2HF9A 4X6XA 1VBMA 3QU7A 4IJWA 3AF6A 2E3JA 4QX6A 2ZAIA 2I6GA 3R3SA 5C4GB 4HX2A 3T5GA 3HMQA 3IPYA 4HADA 2C8JA 2TS1A 3RFFA 5G53C 1C30B 2DR3A 2PD4A 2X1HA 2DF8A 4GVPA 4JEMA 4DJEC 3EK2A 4ER5A 4LJ8A 1C8LA 3LYAA 4MGYR 5IW8A 1TMGE 3ICPA 4C7OB 4HK4A 1HTTA 3C6MA 3RVNA 3IAXA 3INTA 5J9FA 3K6SA 4M36A 3IVAA 2QROA 3ZX5A 5LCXA 1NJGA 3UUGA 2AVNA 3FBTA 2G5PA 4PAQA 1ULUA 3DE1X 1GPLA 1RIFA 5BUQA 2XA9A 1E1NA 1YBVA 1YZNA 3L8ZA 2RAUA 3HU5A 1QV9A 4Z49A 1E2EA 5ILQA 5TB5A 1VPLA 1NI4A 3N8DA 1Z0FA 3O92A 5EKXA 3GJTA 1TFUA 4CLRB 4RD3A 2C98A 1X9GA 3FDIA 4N5MA 4L9WA 3TX6A 3Q87B 4N6NA 2R1VB 1SBTA 3EXEA 5BSTA 3SR0A 2YJZA 5KPJA 4RVSA 1HRDA 1DEOA 2B4YA 1IM5A 3FPKA 3V4FA 3WKBA 3HCAA 2GCIA 2P2NA 5G3ZA 5JATA 1BJRE 3RVOA 3LGSA 4BNWA 2V03A 1P7PA 2R68A 3D3JA 1OBVA 4PTZA 1OI2A 8MHTA 3UMGA 4Z3OA 1OKKD 1YVEI 3R7WB 4MI3A 1OREA 5EHIA 4DCMA 3DUFB 5JJCA 2VQEB 5JY1A 1C3VA 1E4VA 4ZDKA 4DR6B 2GPAA 3ENQA 4RUKA 3RROA 1KJYA 2JD0A 5THXA 4DLTA 3ADBA 3G8AA 2YOGA 4HP8A 1SVKA 5BRNA 4P33A 2FMIA 1TCUA 3BL5A 4E31A 1W4CA 3AL2A 3AKYA 2C97A 1R5NA 5A5EA 4DUYB 1WY7A 4DIMA 4KE8A 3NYWA 3FYCA 5CIQA 2XSZA 1KIFA 2E48A 2HRQA 3BGWA 4IV8A 3KEFA 1W5FA 2YJTD 3L7NA 3LVFO 4XUCA 5DHPA 3PA8A 4BB0A 4LTNA 3VU3A 4IIUA 3IS3A 3PXGA 2PSEA 4EVSA 1N8SA 3UTDA 2OM6A 4DA0A 2H52A 2YS6A 2GYUA 3STHA 4JXJA 4CM6A 4Q3KA 3OQNA 2Q3JA 4P98A 3BTVA 1EFRD 3GOQA 2XXJA 1U7HA 4QGFA 4DDVA 3SEZA 1TECE 2DFNA 3PWSA 1IVSA 2YYZA 5J5AA 3RT9A 2XOKA 4DOMA 3GJ3A 3RYCA 2C82A 4ZOLA 1SCBA 5CITA 5JD4A 4P82A 3ZXYA 1E2DA 2DJIA 2JGJA 1ES9A 1LU9A 3NRJA 3K6JA 3BB3A 3ZE0B 5EQDA 1CUWA 1KJ8A 4R68A 4EYKA 5AVYA 4IFBA 2Z3WA 2Q3CA 1PJBA 3ZWBA 2CLIB 1Z28A 2MYUA 3L0DA 3BQMB 1CJKC 4E4YA 4AY3A 5K8JB 1U3VA 3CUWA 4QUDA 5CLHA 1YDMA 3DAPA 3C3XA 3AYXB 3F9IA 3HNPA 5L6LB 2ENWA 1E7QA 1SK8A 1Z37A 2PUBA 2C4MA 2X8AA 2PBRA 3D8NA 3SYLA 3WJAA 4R8LA 4F56A 3S1SA 2CLMB 1Z62A 4JLVA 4ZO7A 4GXRA 5EKUA 3UV7A 3SOZA 1GZ5A 4BECA 4YRCA 1T9CA 2F90A 4DF3A 1H2EA 3MMSA 1T0JB 2O5VA 1IIRA 3I58A 4FNAA 2HDWA 3S70A 2ZIXB 2AZTA 2A0YA 4GGPA 1P2DA 4HZUB 4M9XA 4DUGA 3OEHD 5CT8A 2XRMA 3DL2A 2X8WA 4U00A 3FJYA 3ZQJA 3BERA 1SXJB 3T5MA 4E88A 1FRFS 5A71A 4YY3B 5EIBC 1X7DA 3KSDO 1XZFA 5H3CA 4EJSB 2BH9A 4E4RA 3H5LA 3BD7A 2GT1A 1J5PA 1SH7A 1TA4A 3N2EA 4BUJA 2WEKA 4NE9A 4RKYA 2O0HA 3LUJA 2ISQA 1EU1A 3O38A 4QGSA 2NXCA 1VIMA 3LWZA 3HJGA 4AS1A 2YWBA 2H2FA 1SCDA 3HWSA 3IHKA 5U1PA 1GAWA 2D1TA 3VX3A 2L18A 4A26A 1XTUA 5HCIA 4KXYA 3I01A 4BNMA 4EDHA 1DIAA 2X2OA 1CV2A 4XKJA 4EWLA 5A5DA 4JUIA 3FG9A 4F4HA 2J7KA 4WK2B 1JIXA 1NMEA 3TQTA 1E1KA 1ODIA 5CB4B 4ZANA 5G40A 1OVGA 2HUNA 2OV2A 2FK7A 5CR9A 3ZDRA 1R27A 2XVYA 1WPQA 3QBJA 1O89A 4DW8A 1R8QA 2EX1A 4LNAA 3FRHA 5FFFA 2YIVX 1IEXA 3U9TA 3A1WA 1TUEA 2I4RA 1JDVA 1GSIA 3JZIA 3AOEA 4DCSA 4H1WA 1FVFA 1VDMA 4EI8A 5IN4A 2QL7A 1NJSA 2R8ZA 4M89A 3RS5A 4DM7A 1CC1S 4CKWA 5K99A 1X42A 2GJ8A 4NAUA 4KB5A 4R16A 4UE6A 2PN1A 2QRJA 2FOXA 3V5NA 4BO7A 1RWBA 4EPTA 2JFYA 4FYJA 3L0IB 4JOCA 3UXYA 4YCNA 4AMVA 1NTOA 2HIHA 3HLKA 3ONWA 3L4KA 1M6EX 1IJFA 3QE4A 4RX1A 3IP1A 4JASB 3U3ZA 4KGDA 1XZGA 2CVOA 4JIMA 2YVUA 1G1AA 2HR1A 5LVAA 2R751 3HY3A 5DMXA 1RACA 5ICEA 2DAPA 3OOYA 2C7VA 1PHRA 1CUIA 1S3FA 3T1HB 4I7EA 4RDCA 2W2XA 1XN4A 4O2AA 4N3AA 4Z8YA 2JHGA 2FGKA 1FLDA 3PU6A 4OO3A 1CT9A 2XCLA 2YMMA 3R0VA 5JARA 2OAEA 3KVYA 4K0RA 4N39A 2BFBB 4P5EA 4NBNA 4QUIA 1WU8A 3BMQA 5LQRA 4OH7A 1II8A 3R9XA 2BZ0A 2HLHA 3LUKA 2HCBA 1DRKA 1KYZA 3L0PA 1P4AA 1PYGA 3W1WA 3ROZA 4ASUD 1AQ6A 1ZO8A 3JD1A 2WWWA 1XJWA 3BA1A 3IQWA 5ALXA 4YCMA 3JAWB 2RCYA 4QG3A 2HO4A 5CFZA 1RXWA 3TLBA 2REXB 3B70A 1NJ8A 5DBEX 4YR9A 1EFVB 2VR1A 1JFLA 1PKEA 3LXRA 3KSMA 4WH0A 4BMCA 4IXMA 1B15A 2EQ5A 3S99A 5IT4A 3DDUA 2Y0PA 1BVYF 3GT7A 1JSRA 1P1HA 5CT6A 1P2FA 1FPMA 3KUCA 4JT9A 1BX3A 4YYZA 2VKTA 2D74A 2IP2A 1E3IA 3WYBA 1YVPA 4HPXB 4WX2B 3AVVA 4MR8A 4GP6A 3LT1A 2H18A 3OH8A 1SXQA 1NTRA 4NCHA 1AKWA 2YW2A 1KEEB 1PGJA 2YW9A 4BU1A 3DD5A 5LQCA 4FMBB 4GR4A 4E30A 1MENA 3NOOA 2B34A 5CVDA 4X8OA 4UEWA 1YUMA 3LZCA 1M66A 1XMOB 2A6PA 3NHUA 1G5HA 1E6UA 3B7WA 5JS8A 4J2HA 2PMKA 1EVLA 3UFXA 1TYBE 1U7UA 5F1PA 2G76A 5BUZA 1U5BB 1LD3A 3EXAA 1EHIA 4K28A 4LX0A 1PTJC 2VOJA 4PG4A 5AOVA 1UZAA 5TT0A 1KGSA 3GN2A 2O2IA 2AW5A 2BGMA 4M46A 3WTCA 5FBZA 3W8NA 1NZJA 4BGUA 2GMWA 3I92A 3K72B 3QLTA 2CFTA 1VSUA 1KQOA 5K51A 1DT5A 1O77A 2ZYAA 3ITEA 3ST7A 4EY8A 5EJ5A 2QJRA 1TO1E 1V6CA 4F2PA 3QWHA 2YZGA 2ZBVA 1KKMA 3KWJA 2ZYRA 1J25A 1R7RA 3GJ8A 4MYSA 2GM5A 5KHLB 3J81k 1L2TA 2CUZA 4D99A 3I37X 4H3KB 1NXOA 1SG0A 1A0OA 1LGYA 1Z13A 5H4HA 2QQGA 2CWWA 3I8OA 3L1IA 4KWEA 5DI9A 4YCCA 1IHXA 4JI5B 1QF7A 2BJVA 1PI3A 4C3OB 1BMTA 1FBTA 1M3SA 4O2BA 3WIUA 3HY4A 4LJ5A 2O2HA 4UM5A 3CW8X 1OV4A 2IL1A 2JFOA 5CDFE 4X1IB 3BMCA 4TKUB 5GWXA 3GROA 3HYCA 2Q5OA 3ONNA 4UJ5A 3EZ7A 3KXPA 3PJDA 1Y0BA 4DSTA 1U3DA 2GETA 5E6RB 3IEMA 1G2PA 4DEYA 1H9AA 4B84A 4G0WA 3DL4A 1NG1A 1T0PA 3KCQA 5AR1A 2CFOA 1Q1GA 1XEXB 3CBQA 1MAWA 3Q12A 3THYB 4B3IA 4JQYA 3B1XA 2OP0A 2R6ZA 1SKBA 3H8SA 2Y1FA 1PJCA 2AG5A 5A7GA 1FX0A 2BGKA 3O8NA 3LF1A 4P3KA 2W8BB 2YBDA 3F47A 5JSHA 5K0TA 5EWLA 1UJNA 1DC6A 1WB6A 5HCNA 3KT0A 2UV8A 4MGKR 4HJRA 1YUNA 1JEYA 2XUKA 3U7FB 4NV3A 3ZWQA 1TJ3A 2VH2A 3AETB 2R62A 4WBXC 5J5CA 3U4QB 1C0KA 1UWKA 3WIOA 1I2AA 3PPIA 2P9CA 4BFLA 1KI6A 3D43A 2VNAA 3K9NA 4G0MA 1W5AA 2QYTA 4KPUB 2PUHA 4XFDA 2R5WA 1R6UA 5FD8A 4ALLA 4DTIA 4L4RA 1OH5A 5CLLA 1Q0SA 2J9ZB 1M6YA 4ERNA 4K2HA 2IWHA 3O8RA 3X2FA 1RYBA 1NOIA 2A7XA 2C9CA 3F3KA 5H9WA 1IQUA 1E2FA 1XTSA 1YK0A 3CKYA 4I1UA 4RHYA 4YWJA 1UP6A 2OD7A 2PZEA 1Z25A 4TUYA 5KC9A 1JR3D 2BL4A 3PL5A 5EIFA 1UM9B 3IUQA 4HDCA 1UKBA 5CHYA 1QLWA 1T4DA 1UT8A 2HLDD 3G88A 3IDOA 2CUTA 2QRZA 4MPRA 4RSHA 1KU0A 1MZVA 2DQYA 9ABPA 1IK6A 2MSCB 3AF4A 3D5EA 4IO0A 5KCZA 1B0AA 1VXOA 4D97A 1XHEA 4QBIA 1U7ZA 4JB2A 1Q1AA 4QXOA 4D4GA 5LKRA 3PR3A 5A4IS 1CZHA 1KH3A 4LTMA 4BNLA 2Z9CA 3RF7A 3IERA 5JPCA 3AJRA 1P18A 1DINA 4MR7B 1CQPA 3I45A 3EWIA 3L7OA 3U09A 2ZIUB 1GG9A 5AIBA 1Y9JA 2EJVA 2F9FA 3IB3A 1XZNA 2N47A 2X9NA 4AK9A 4CI0B 1K3TA 4BVFA 5FI3A 2ZT5A 4DJAA 3KQUA 1O58A 2VDWA 4MPDA 1EXMA 4UUQA 3E22B 4OQYA 4YRBA 5TS3A 1KH1A 2VC2B 1FSFA 1ZH0A 5IJWA 5JO0A 4HX9A 3DO5A 5F3RA 3QKUA 3DVQX 4XGQA 1TM3E 3LUDA 3QWIA 4YJ2F 3Q11A 1TF2A 3NBZC 1IZ7A 1PUXA 2VHZA 3OZCA 1ODSA 1EWKA 4JJAA 1QK3A 4QQ8A 4XRRA 2QRLA 5ALZA 4R0VA 5EIXA 4F5YA 1T8YA 4IIFA 4X1KB 4KXXA 5IAEA 4F5DA 5FV4A 3LECA 3QPWA 1FSPA 3K35A 5JAQA 5FULA 3U61B 2A0KA 4FDAA 4LV6A 1PNQA 2I2DA 4ZODA 3VISA 3SVTA 5JFTA 2N1MA 2A88A 1XZMA 3HGMA 2IUEA 4Q47A 3K1ZA 1Z26A 3FLEA 4CGYA 3ZV7A 3VNQA 2A8YA 2C2MA 1YS7A 4M54A 5JQWA 3A2KA 1AHNA 2AOTB 2GOYA 2HC9A 2ZVPX 3AL3A 1UPAA 2DRIA 2F62A 3F7TA 3SQWA 1Z6QA 1R4MB 2PQ6A 3A3OA 4PG8A 2R85A 1O97D 2H9AA 3KR2A 4L5CA 4EK9A 1SCUA 1XLUA 2VBGA 4NNPA 4OHCA 3X0DA 1M73E 2FRDC 3R44A 1FFHA 3CZMA 4D4IA 4R1PA 1RRCA 4B3RB 1REQB 1XOIA 3T1OA 3IOBA 1LI4A 4X1YB 1SY7A 1G66A 1BGWA 2QGNA 1EA5A 3HJNA 4HGYA 3DG9A 1CR0A 2P2YA 1UMDA 3MCTA 2HFKA 4WOKA 1YL6A 1VLJA 2ISSD 4JYPA 3TKYA 3CVYA 3LXMA 1HG1A 3ASZA 2Q9UA 2ZLBA 3I72A 3VSBA 3V1LA 1ECLA 3UA4A 3F8TA 1O6BA 3EF1A 4ND7A 4I55B 5I9NA 4JOBA 4JKYA 3F71A 3FFAA 4TL8A 2HXSA 4DDTA 2H29A 1E2GA 4J4BA 4X94A 3K0AA 3O1IC 2UXDB 1E3LA 1Z12A 5C5DA 3KD2A 4A6PA 1PV2A 1TEZA 3GJXC 3LMKA 1TPZA 1HMYA 2OCDA 2XSZD 2R65A 1NQAO 3PFBA 4TQUS 1TA0A 3T4XA 3QK7A 1R64A 5BWOA 2R7KA 3AGPA 3S6JA 2PAAA 2BM8A 2II6A 3B9RA 3GUVA 1WDKA 2WIAA 3LFUA 3PHJA 4OLFA 3WDMA 3JSAA 2H92A 2QTHA 5GJCA 4FFWA 5BR4A 1MO6A 3OTGA 5AW2A 1VL0A 2FZVA 2QTWB 5IARA 3ENZA 5J59A 1M8PA 3TJRA 4P54A 1L7RA 1P6XA 1Z47A 4LHEA 4C2TA 1RPAA 4QBGB 1KSGA 2RKBA 1K7FB 4ZV7A 4F9TA 5JH7B 1WS6A 3NHPA 2EWVA 1XMPA 1FFCA 3GEMA 4B3JA 3IVRA 2DWQA 1RBYA 3IA7A 4I99A 1T0UA 2PX2A 5BVGA 2WK1A 2ZWOA 4FD3A 1IHYA 1G0OA 1XVUA 2WWRA 3GZTB 4CLOB 2M6KA 3U44A 2C2ZA 4NCJA 2XNCA 3KU4A 1PT6A 5A04A 1U2DA 2JCYA 1MPTA 2JK0A 5G0WA 3EG9A 5EIHA 4ME6A 4Q6BA 4BO9A 2F00A 5JYCA 1MC4A 4C30A 1SC1A 4GOOD 1GN9A 5CA1B 2CJXA 1DI0A 1PBTA 1J24A 4ZZIA 2VT6A 3LKVA 2H17A 2VJNA 1NW5A 3AHHA 3KDPA 4L9SA 4KQ2A 2Y05A 1SNYA 2K7FA 1PNVA 4MYHA 1I2ZA 4RFSA 4BN4A 2OC4A 4DS3A 1Y8ZA 3IKJA 3Q5EA 3FSJX 4ZT4A 3PQ7A 2OHIA 1IWOA 4S2EA 4FFBB 1FS5A 3N5CA 4MEBA 4QOSA 2GS9A 3A31A 1ZGJA 5CBKA 5CD9A 1ONSA 3HG7A 3R3ZA 2CBXA 4W9RA 2BE7A 2KS6A 3C98A 1G5PA 3S27A 3UC9A 1IC6A 2G28A 4KQGA 3PTAA 5IWAB 4U2FA 2EZ4A 1E2IA 1VA4A 1NLMA 2WHPA 2XD4A 4XA8A 1RAHA 3E8XA 9LDBA 1A71A 1X8JA 3OP1A 4L5YA 1DWQA 3PGXA 3GOHA 1QIJA 4G6ZA 3SJAA 4XJSA 4Y2TA 3VR1A 4G56A 2AD1A 1B8UA 4KIJA 1YR7A 3ZWDA 2BZSA 3LBFA 1RM3A 4CBVA 2FP4B 4L4SA 4R7GA 3U0BA 4ZQBA 1TMYA 3K16A 5HM6A 2BISA 2HSDA 4ER7A 4YC7A 1DKUA 2JGLA 2ZYSA 2P2ZA 3RS4A 4F1JA 3SX4A 4LJ7A 5EVCA 4KNYA 1UDWA 2F3PA 1FJGB 5EKTA 2YASA 2G0AA 3T3OA 4I4LA 1E5XA 1KNXA 1MJFA 1MRZA 1TYDE 3A3YA 3SD7A 5JIBA 5JS7A 1LV7A 1UBEA 2XYHA 4IOJA 1L4BA 4M1EA 1BA3A 2E0IA 3DMFA 5EAIA 4F38A 2PH1A 1E3SA 1X7HA 3PE4A 5LD2B 5DCWA 2UYGA 2ZIZA 2JRLA 5IAOA 5TLSA 1Z5PA 1XP5A 3TQIA 4C9BA 1RHJA 2AE1A 1TVEA 1E2MA 4FGKA 3K4PA 1NVXQ 1Q21A 4BNDA 5T64A 2FEKA 2YWRA 1H9CA 1WUJS 1TK3A 2W2VA 4KVZA 2BRUA 2CLEB 1R6VA 2OFPA 3O2SB 4Q18A 4ZQCB 3SDSA 3W3AH 4UVDA 1PFUA 1MF7A 3VU1A 4B8YA 3U13A 1NPYA 3QOXA 3S0JA 2P1ZA 2UVQA 2AC2A 2B20A 3KX2A 3EA5A 1C7EA 2YN0A 3DVAB 3L7CA 3OFJA 4O4JF 4BNDB 5DOZA 1NR1A 5CXQA 4ZYTA 1YCDA 2H2DA 3CN9A 1DUSA 2V1XA 2WYVA 5T8KC 4F8JA 1UPBA 4CHTA 2X76A 4XB1A 3KOYA 1JN0A 3QKSB 4OBBA 3R6TA 1SKYB 8OHMA 1V41E 3NBYC 1ZJ5A 2ILTA 4UBJA 3UUWA 3VTFA 4ER3A 3K70C 4QLAA 1X87A 4J6FA 3QYJA 5K8LA 5DBIA 2XYQA 4NZYA 3KQKA 1OV6A 4WKGA 1PL7A 1TT7A 1Y82A 4D3XA 3GA5A 2NVOA 4OHUA 1YH3A 5EG5A 3KPUA 3K92A 2JIZA 4X24A 1H6AA 5KQSA 5CYGA 1ICEA 1XNRB 1RKUA 2W0MA 4HUTA 5DHFA 1EK1A 3ORRA 2H2WA 3TAUA 1TF7A 4YMIA 1PT8A 2IRWA 1ZY2A 5JSZA 1GFSA 2P79A 4GYYA 4AKHA 3C43A 5FTNA 1M5UA 5IBPA 2QUHA 4R2KA 2V8BA 1DV2A 1DZ3A 2MYNA 3LY8A 3CCBA 3MN1A 4PSAA 4TPKA 3DLIA 1R9NA 5LNK6 4FZ5A 4HS9A 3MNFA 4OOFA 1A9OA 4CT4B 5DM0A 4TV8A 5E1MA 1P4JA 2O3JA 4IFTA 4R31A 4OP1A 3T9CA 1KI4A 1XXHA 2DUWA 3MYRA 3GLUA 1SMKA 4J16C 4MITA 4OM8A 1RLMA 2BKLA 3O8CA 2BAGA 5LDHA 1TIKA 2BGLA 2JGAA 2Q6VA 4KIUA 4UNIA 4EYGA 1NWHA 3NC4A 2HN9A 4UQPA 1PT7A 1SUAA 3MBKA 2H4ZA 2VJDA 3PKZA 4V03A 1Z4MA 2Z1NA 4W99A 5F51A 2IOHA 3ORFA 2GK4A 2VDVE 4G09A 1DAOA 2H2GA 4P4UA 2V8OA 3HDGA 3GFPA 4MW0A 4PBTA 4AZ0B 1FB5A 1KO1A 3IXQA 3O3MB 3AEKB 2QE6A 1Z5OA 3IRUA 1FSZA 1X7ZB 4C4SA 5IM4F 2ZYDA 3HK2A 3L8MA 2B6NA 1EK0A 3GRVA 2BKVA 2BBSA 1Z16A 3ASUA 5EZ6B 5FH9A 1Y6GA 5KQPA 2H1HA 2ZU0C 5HILA 4Z4CA 1GG8A 3WRYA 4NF2A 1KZ9A 4I9HA 1F0YA 1P5FA 1VBFA 4GX1A 4LBVA 4BBZA 1NNI1 1QZZA 2IDJA 3FBGA 2NYRA 2H0QA 3THOA 3H5OA 1OWMA 4M7WA 1BXGB 1P4HA 1W4RA 2AF3C 4RHFA 5HE8A 1MEEA 1CXZA 1X7WA 3V80A 1DAIA 2QG9A 2BR5A 4G0PA 1E7RA 4NJEA 4BFUA 2GM4A 2RIPA 4U7TB 5JCPA 2KB0A 4GPBA 4XI9A 5AW6A 1T36A 1MLDA 1YBAA 3Q7QA 3DOHA 1PO7A 2EL9A 3LY9A 1OYWA 2C5LA 3DEAA 2O5EA 3JQDA 1FRQA 1P74A 2BM0A 3ESYA 3DWEX 3NDPA 5DNUA 1TK9A 2WBLC 2R0QC 1V6SA 3GDHA 3NXSA 3E27A 5EJEA 2CVQA 3NT2A 1HR0B 3M5PA 3ZWPA 3HRHA 1MA3A 4IIDA 2WQZA 1PV1A 4QBTA 3V8VA 3NAMA 3QPUA 3I28A 5GIOE 3SXUB 1N4DA 2F9LA 3L77A 4GXQA 4Y1GA 1BN7A 1H42A 5K3OA 3WSWA 4ON9A 2GA8A 3HADA 2CVHA 1JE1A 1V3QE 3QV1A 4GT1A 4K0KB 1PVDA 1FNDA 1ZRHA 1H8HD 4UTZA 2C3OA 1YUBA 2B21A 4FX2A 3GCWA 2H1SA 3V9PA 1N7IA 4UW9A 4IJVA 3VNBA 3O9VA 2X4LA 3HP4A 1ZX1A 4K3VA 5K4GA 1C3JA 4RQBA 5HJ2A 2QN7A 2VSXA 2VHUA 3P45A 1PR1A 4B1FA 5HIIA 3THSA 4F3CA 2IX3A 4HEJA 1OI3A 3ICQB 2I0FA 3CW2A 1E7YA 3KPYA 4KQMA 2C0QA 1V25A 2J85A 2QJWA 1XZCA 2GF9A 2QL6A 1WQ4A 5EN4A 3TB6A 1PQPA 4GSKA 4GXTA 1MAUA 3GRFA 4HTFB 3D3KA 1FFBA 5HX7A 3B9BA 5DMHA 5H68A 4TROA 1DFIA 1E60A 2ODQA 2A30A 3SHVA 4HBGA 4N8EA 3R6WA 1ZU4A 4TYQA 3SCZA 3VR0A 4FWTA 2WWIA 4G0YA 3ZVMA 2OV6A 3WK4A 2ZM5A 2XQJA 4I50A 4RABA 1FNMA 3C7CB 5BXQC 1WHSB 3WRYC 3ZCPA 1SVWA 1MA0A 3GNSA 3W2GA 2ZVQX 5AW7A 3OZBA 1YWGO 4H6PA 4BTEA 4NFYA 3NLLA 4YACA 2Z30A 1N1DA 2P9QA 9GPBA 3TG8A 5HKLA 3I0MA 1PJ2A 2BTQB 4HWRA 4C0HA 5BNTA 2VDJA 2O8DB 1L4FA 2Z09A 2J7PD 2F2TA 4Z3DA 1JLKA 1T9KA 3W4JA 1QGAA 1UBKS 2PL1A 3A3KA 4M8SA 4XLLA 3ZX4A 3I12A 4O59O 4JT2A 3X3HA 4B76A 2UUCB 5JZ9A 4KPFC 1EUYA 3PUIA 4U9IS 4Z53A 1VLMA 2FQYA 4IFIA 1DKRA 3ANYB 4BP1A 1T8SA 1WMBA 1RRGA 4RPCA 4IIEA 3B13B 2JJQA 3NM4A 3UYKA 3OM8A 5EJAA 1Y8QB 3AKZA 2KWIA 5ENZA 4BQEA 4ZYYA 4HDKB 1DC5A 5LOVA 1AM4D 2KMLA 5DI3B 1US8B 2VRCD 4H3SA 2RBGA 4PSUA 1F51E 1JLRA 1UBSB 2GDZA 2PSHA 2Y99A 1EWVA 4JA2A 4ZJPA 5ICMA 2ECPA 4XX0B 4BNZA 3K2EA 4MQEB 4OHOA 4AROA 1Q83A 3OPVA 3V46A 3O83A 3N2GA 3H2KA 2JLCA 5BXYA 4O02B 3H3JA 4I66A 4M3NA 1ORRA 4EG8A 2SKEA 3I6MA 4OHYA 5FCDA 1VBKA 2CCJA 1ZVVA 2F1IA 1BXZA 2IPMA 2XADA 1DAEA 3OQIA 3OLYA 1EEHA 2X5OA 3H4IA 3IP3A 3CISA 5F2OA 5FF9A 5JR3A 5KS2A 3UCEA 2ORIA 2PX4A 3FF4A 2X41A 4MGHA 2OSBA 1LW7A 4RFVA 2VDMB 1XPOA 1TL7C 4HUQB 1VB5A 3OY2A 4H7EA 5ILGA 4EABA 1N32B 4NU8X 2PSDA 2XOKD 1J06A 1W59A 2YY5A 3VGJA 3WGJA 4AJ4A 3JASA 4ESEA 1N78A 2IZ6A 4HQOA 2QZSA 3VR4D 1Z8DA 1SOVA 1QO9A 1D2RA 2QSUA 5J4VA 1XZEA 3UXHA 1AO3A 4OTZA 3U3MA 1O9HA 1ISRA 2GF0A 1FZQA 1YMVA 3BJRA 2ZRJA 4UPEA 3MTAA 3A32A 2V9ZA 5DOVA 4B8WA 4RE5A 1J09A 1LRLA 2ONCA 3G5MA 3UT6A 5CJPA 5AKGA 2A67A 1OAOA 3B48A 4J8PA 4NH0A 3DWIA 1Z5ZA 4AX4A 1NVVQ 1FEZA 2RHCA 3HUEA 4PHHA 3HXOA 4OBWA 2PUCA 1RRFA 3JWGA 2F1KA 2VZ8A 1N6OA 3HHEA 4UHEA 4QYXA 2QRKA 3Q5DA 3H42B 2GVDC 4G3XA 4IQFA 2BGIA 3JQGB 1UQTA 3RJMA 2FDXA 2CMDA 3H16A 5L6MB 2PIDA 2D5AA 3HV2A 2JI6A 3NHKA 4FB4A 1LSOA 4RC9A 1LV8A 2DY0A 4WLVA 5BV7A 4ZRNA 2J5XA 4MUYA 3LLVA 3IAUA 1WM1A 4ZZ0A 4NE2A 4EI9A 2JVIA 1BD4A 3BSYA 4XGNA 2QPOA 2G5CA 2IDKA 1JMKC 1DAFA 4OGGA 4J3JA 5KOHB 5K3FB 4XGKA 1KYYA 2ECOA 1XRQA 4W7SA 2ZWPA 4QTTB 4BIMA 1FJXA 2JLWA 3EJWA 3G8YA 1GNPA 4M9QA 3TLMA 4O3MA 5K1ZA 1RD4A 4WXHA 1ABEA 1FTNA 1LPPA 2XCQA 2W6CX 3FTQA 5FHQA 4QLBA 1IBSA 2PKXA 2PJDA 2YINC 5L4SA 2Z2JA 1R0SA 3S40A 4DLLA 2ZUFA 1TU0A 4TM7A 4KFCA 1ZNQO 1O57A 1XFAA 1U2TA 2FE1A 2GVZC 4ZT2A 1WNFA 1Y37A 3LDAA 2BFFA 4BZQA 4KSCA 3TQHA 1QHIA 1YZGA 5B4VA 2D0PB 1CUZA 3NOQA 1RYFA 3PQCA 1XL1A 3PDWA 1QO0A 4UMVA 4EKIA 5ALSA 2AH5A 1D6JA 4QFCA 3V7NA 1JHQA 3LC0A 1E6CA 4MSUA 1ZL0A 2O4UX 5HBGA 4OEHA 2V59A 3EDRA 4L3OA 4V0LA 4XFJA 3ZE2B 3ICEA 4AP6A 2JLSA 4JJKA 3ZEIA 3NRBA 4W5HA 4E12A 1THTA 4K5QA 2BR4A 2NZYA 4LRYA 1KHTA 1FDWA 1OFTA 4AZ0A 5CFNA 4HH1A 3SLGA 4WMLA 4V3CA 1LPOA 3SC6A 3WGKA 3G0BA 1PJLA 4M9ZA 1XL0A 3SHQA 5JV5A 1KU6A 3FZGA 4MVJM 5KHOC 3DMHA 1Z2CA 2JI4A 1EH5A 1X2BA 1VHLA 4Q1EA 3MWEB 3FJ1A 2N3ZA 1HDEA 5DK6A 4CQMB 4R8VA 2O48X 4MMZB 4Y0VA 1UBJS 1K2WA 3P94A 4NJMB 2OFWA 1IUOA 4Y2PA 2GARA 2XYPA 3ZU6A 1IXKA 4MWSA 2JGNA 1ARZA 3U7IA 4EFKA 1H3EA 4UZFA 1UMDB 2JHAA 3JPWA 4WLOA 4Y2SA 1YS2X 3HZOA 3V4VB 4E07A 3ROQA 5JCOA 4JI8B 5FBWB 4QYIA 1I1NA 1XK6A 1N8NA 4RLQA 4DZRA 1P2SA 3OF2A 1OX5A 1TIBA 3P4UA 4G89A 2QF7A 2GEUA 4CMBA 4ML3A 4NLLA 3BF7A 1JQLB 2OCYC 2QV7A 1HOXA 3LCCA 2FPOA 3Q8LA 4DEVA 2HMWA 3ABZA 3L7IA 5CP8A 2I4TA 3KP1A 3QVMA 4NU5A 4UBOA 3THRA 3SJUA 3WA7A 1USWA 4UDXX 4BS9A 4REQB 4H2DA 4OJNA 4RHCA 4ZTBA 3AQ4A 4JKIA 4DJ5X 4E2XA 1JHDA 5IF9A 1ZW1A 2JCSA 2QT1A 2YNMD 3M4ZA 4PTLA 4Y0AA 1UR5A 4MCHA 2R8XA 4ANFA 2E55A 3NAQA 3ENVA 5C7IO 3R9IA 1H4SA 2GFIA 2GBCA 3I6IA 4MVJD 2AJLI 5BT9A 2RD2A 1MKYA 1WCYA 5G0TA 4ALJA 5I5EA 1S3IA 1Y7HA 3WV5A 3EGVA 1Y9ZA 1YKGA 2Q6IA 1QDEA 1C9MA 2WE8A 1VJGA 3M6LA 3K4QA 4DXAA 1N2IA 2HSGA 2C5BA 2SHKA 1U3FA 2WFAA 5JS6A 1O8CA 4JZYA 4GX5A 3IAS1 1KEUA 3FXAA 2E49A 3CBGA 1FQWA 2OBMA 1W25A 3CV3A 1QHFA 1AO0A 2BC9A 4XSHA 4DAOA 3CMMA 3R40A 5EXEA 4I5DA 3B3JA 4PYQA 3E5HA 3BZUA 3TD2A 1A2KC 2NWQA 3CRMA 4L5BA 3LHDA 4MVCA 4II7A 1G7TA 3H0CA 3EFOB 5ESDA 4R2MA 3RQSA 3C97A 2ONKA 5JEEA 4NG5A 1PYDA 2NXEA 1BX1A 1SKUA 4ER0A 1SC9A 3LPMA 3VTZA 2ZYGA 4HQKA 2AOUA 1F0PA 2A9RA 1GZHB 1POXA 2WMNB 4OK6A 5ER6A 5C80A 3AUFA 2B8NA 2INGX 3IT2A 3MXOA 4W5TA 1PJRA 3NEJA 3WGUA 3E6AA 4A0RA 2W11A 5LQNA 3QWBA 3GRUA 3E61A 4BYGA 4NI5A 1ZOSA 2Y71A 2HWYA 5GVSA 1OU4A 3G02A 4KAAA 4F96A 1Z9BA 3LSYA 5AK0A 3LP5A 3NDIA 1CUSA 1OZHA 4MVJF 3AIIA 4OHFA 5FP0A 2H11A 2ZR7A 1SOWA 3FA2A 1SUPA 2PH7A 1E1QD 2QIOA 4J1TA 4OFBA 2OO5A 1ZR2A 3S2UA 5LIPA 1XPUA 2XDWA 3C2QA 4MUAA 1KYIA 2MYPA 4FI3F 2ZANA 3AFOA 1E9DA 3IV9A 1MJHA 3LS2A 1GDHA 1ECFA 3ZIDA 1GQQA 4RGBA 2B92A 3L8CA 5KAMA 1ZDMA 4W5RA 3OCJA 5DTRA 3PWKA 3H9UA 4NABA 5IZCA 4KVAA 4N0EA 1CU1A 2IODA 3KFLA 2B94A 5IHPA 3KUXA 4U8GA 4K9MA 2FPXA 4GRIA 2WLTA 3MAGA 5DNVA 1CEYA 4JX8A 1KARA 1D4FA 2DM6A 2VTEA 4ER6A 2VP9A 5AW3A 4HG2A 2CMFA 5I7FA 1DX9A 4E3ZA 1I80A 2R8RA 1QRAA 4ZPXA 3HJAA 3A58B 4ZHQF 3TNJA 1QFSA 4O2RA 4AKTA 2BCEA 4URYR 1SU6A 1GZ7A 1U7PA 4A5OA 4XFKA 1W5BA 3TQOA 5KYYA 2NO5A 2X9LA 5AI4A 4E08A 1RRMA 4QC2A 3AW8A 2RGCA 4AUMA 4B82A 4AQYB 3LCMA 4EO7A 3TLYA 4F1KA 1CW2B 3ONFA 1QQAA 4GR9A 2B3TA 1GYPA 4R3UC 4FYWA 2BEVB 3SSAA 1OX4B 2IYOA 4N3NA 1OB5A 2CD7A 7YASA 4UBKA 4GQAA 2CXXA 5CXSA 2VXCA 1C3OA 3C3MA 4Y2HA 4B6SA 5FTLA 5JXHA 3SHOA 3HVRA 3GNLA 2PZAA 3IPLA 3PGVA 5AJYA 1LI5A 1XJ0A 1T5LA 2P4SA 4FS8A 1BWPA 1DQYA 2HDOA 4KWTA 3MBIA 1E99A 2FVXA 4G5HA 3WBJA 1II9A 4D42A 2RE8A 5FNZA 5B7GA 1U4OA 2H00A 2VAWA 3FZNA 3LQ1A 5TVGA 4IYJA 2C5GA 2WI8A 1I7PA 2DG2A 4TT3A 4N4AA 1SU8A 2BFWA 2ZEJA 3OECA 3QX9A 3F2IA 4W82A 2ZRHA 5E7JA 1YMUA 5F1OA 4HSEA 4BMVA 5BORA 4K9SA 2Y4NA 2PRSA 2PH5A 1ZCBA 3E2MA 5AP9A 3QX3A 1KIAA 4RDIA 2J59A 2NU9A 4LK3A 1GM5A 1KF0A 2VYQA 1ZGBA 3NTLA 5F21A 5TY0A 3R7FA 2WP0A 1O94D 1QVWA 5KNCA 2B5OA 2GCOB 4GMXA 2BI8A 5C32A 2DCUA 3H9CA 4ILKA 4Q05A 3JVVA 2BMEA 3TGWA 2YY6A 3OIWA 4MVYA 3KK0A 4NBTA 4C0AC 2F7SA 5C37A 3PUVA 5K09A 1J4AA 1MTZA 3HKEA 4P81A 2FZ4A 4V0NA 3T3DA 1JH9A 3UXEA 1I1OA 1X7ZA 2GHIA 5GINE 2VCHA 3OZWA 1AK9A 1ZNZA 4QU9A 3NP9A 5F7ZA 4KZKA 4HQNA 1WVIA 3A9VA 1VG8A 1ORVA 3IILA 1I7SB 4G5FA 4MKIA 4XD2A 3BSSA 3KR9A 3V4RA 3H4VA 1H0KA 1ID1A 1L5MA 3BIOA 4DN6A 3U19A 4BEVA 1UIMA 3DT6A 4JLAA 1Q7RA 1JHMA 3KJGA 4MLCA 5DF1A 5KQGA 5LP1A 1H2WA 1NVVR 3OUZA 3PVSA 3RTCA 1H5UA 3I4LA 4P3PA 3O4FA 4FQ5A 1QOQB 2HNAA 4NJEB 2O7QA 3K6RA 1NMQA 2B5WA 3B53X 3ZZTA 3CNEA 3HU1A 1QVAA 4ND8A 4IVRA 4W8HA 1KVTA 1RT9A 4TL7A 3ZJ4A 3H97A 2P68A 3PX2A 3L8FA 1M1UA 1FDRA 1TX4B 2A84A 2PGJA 1Y7LA 1XBTA 4P31A 3VV3A 3L8YA 1W88B 3TTTA 3HTXA 1MW9X 1Z5VA 3NXKA 1PZXA 1VI2A 2OECA 3DQPA 3P26A 4X95A 4L6AA 5B3JC 4XWWA 1GGFA 3PD7A 3EPJA 5M29A 3CFYA 1T2EA 2VF5X 3OF3A 3ZCXA 1ZVJA 3UGTA 3KSAC 1NVDA 2GXUA 2J3DA 1PNRA 1QKJA 3K9WA 2AX4A 1VHDA 2IVFA 2OO5C 3AR7A 4C6TB 5AOBA 1IY1A 3TYXA 4BWGA 3NHJA 1E58A 2Q9CA 2VUIB 4Y1RA 1EVQA 5ECGC 3RK4A 1XQ1A 1Z4NA 4ZOBA 1ESMA 1Q2XA 4JB0A 2LCQA 1IULA 3RC9A 3VPDA 5KVSA 1YZLA 4B2YA 4P4SB 1OGYA 3CLTC 3FPBA 2ACEA 2Y1CA 4A8TA 4B4VA 1D0VA 3W5DA 4MI1A 2OV4A 3RK0A 3LHFA 3A1UA 4I1IA 4ADSG 4E1BA 1DIGA 3FGPA 1KDOA 3WDSA 1M1NA 5B1HA 3KEGA 3WGNA 2HREA 1NQTA 1EVJA 1H4VB 1Y34E 3D7SA 5CVTA 4ITUA 3S28A 4BO2A 4QGAA 4HLUC 4AURA 3CO0S 4NZOA 4KWHA 3BMQB 4IWXA 2PLAA 1GTMA 1ZA2A 2ZSFA 3GF4A 3TOXA 1O5OA 1GDDA 2HX1A 4F2WA 3UG7A 1VIYA 4JLMA 3AJ8A 3KV3O 5CB8A 3Q6MA 3GLIA 4KPYA 2BEWB 1IHUA 1L8XA 3DCNA 4FCVA 5EIBD 2EJBA 2AZXA 4TYWA 3EOAI 1SFRA 1U90A 4PR0A 4Q39A 2B8JA 3DT9A 4MRRA 3UJPA 5AVWA 3RFTA 3GQVA 1W94A 4CLOA 2I7CA 4S0XA 3KVOA 4DCNA 3AUXA 4NICA 2Y0BA 5KWIA 1S2IA 4PLWA 2JIOA 4BNGA 2V3CC 3R2JA 5FWDA 4DCOA 3RSFA 1C0IA 1GP2A 2G1AA 2W71A 4ZU6X 3B1WA 4BJ5A 5K0FA 3CCCA 2HU8A 1BRMA 2FPKA 1NNEA 3TVDA 1RMTA 1PR9A 4LZLA 4ARBA 4LC9A 1THMA 1RLTA 1P4RA 3ACBA 4H4DA 4DLXA 2G25A 3ED5A 4JLSA 4EUNA 3PDHA 4OYHA 4AWXA 2O3SA 2CNKA 1M2GA 1FNSA 2JEZA 4JGGA 4RPIA 3BQ9A 4B9AA 4ZDJA 4N7RA 3RK1A 3JYPA 2ZYIA 3AUKA 2B2CA 2NO7A 2W6MA 2XCUA 2ZSHA 3R0JA 4YJGA 5DLDA 4ZT6A 4E6EA 4KR6A 1KY4A 5CTJA 1NM5A 4QUEA 2ST1A 4BLWA 1GITA 2R1VA 3BDIA 3S4YA 1CZRA 1Z74A 2PAFA 3KTAA 1X1QA 1LW6E 2C1EA 3DQQA 4I55F 4JJEA 5REQA 2NUAB 5K4AA 3UH0A 3THWA 2OYCA 4ONEA 2OGWA 2HLPA 3AKDA 5IKOA 5L53A 1XQWA 4PLVA 3DDWA 2WHPB 4Y6RA 4DC9A 5BSHA 1MX3A 2I33A 2GO7A 1CEEA 1DOHA 4TV9B 4CF3A 3V8NA 4NV1A 3RT1A 1G6KA 4XLTA 1U28C 2X0NA 3DOJA 4RL6A 2C0CA 5DI3A 1EGMB 2YFHA 4FINA 2YZNA 3CR8A 2VFAA 3C3PA 1V37A 2XMGA 3GNTA 3IKLA 3N2NA 3ZV4A 4YAIA 1D8TA 2ZITA 4QWMA 1QGDA 3P32A 4WXRA 2Z8XA 4B7XA 4HLUA 3BFJA 4LSMA 4RPKA 3L82B 4IOMA 3STYA 1G18A 4FJ1A 4JP8A 2BPOA 2FR0A 2G1JA 3W9BA 3UKDA 1O96A 1QKKA 3MT0A 1XT6A 5AKJA 2FEMA 1XYYA 5C5EA 3DYIA 3GJ4A 3T9BA 2VUUA 5GPBA 1NF2A 1OOEA 1KERA 2FWAA 4HNAB 4KFSA 4A0SA 3U56A 3OCXA 1G6HA 1H2AS 3B85A 2CYCA 4D9CA 1G42A 3J7TA 4LX8A 4GI3A 3GU3A 3ZYZA 3KOOA 1Q20A 4F3YA 4AUEA 1QIDA 4JP2A 1NOJA 3JTEA 4WBNF 1RPJA 2FV8A 4P6VF 3VNUA 4QQNA 4FHZA 4R05A 5JNUA 1HYBA 3GJ5A 2LIVA 1KOGA 3I52A 3K6KA 2XMPA 3NTQA 4HR7A 2OFXA 1MOZA 1TW2A 4RYLA 3I8XA 3BMOA 3EFEA 4G67A 4HB2A 4D9JA 4R40A 3G49A 4I4TF 1QYCA 2EJCA 3NTXA 4I6GA 1ANKA 1EUCA 1U5CA 1XZLA 4YCBA 5AHWA 3ZW9A 4CIWA 1U4SA 2BMAA 1LNZA 2DR0A 2G88A 2Q1XA 2ZBGA 3IIMA 3UTCA 1JVBA 1M7HA 1RM0A 4M1KA 4EYQA 2IEBA 4TZ6A 1IJEA 1MQ9A 2OXIA 2X0EA 3FAZA 5D86A 3DOEA 5J1TB 3UJAA 3UANA 2H85A 3ZV5A 3WMEA 5DIFA 1P4SA 2HH9A 3P19A 4G8BA 4PZPA 1KWKA 2QLLA 2FWMX 4LJKA 3H2SA 5EUCA 2MSWA 1Z2AA 4BO1A 5EMNA 3KQLA 1USIA 1IU9A 3DBOB 4LXUA 1T9DA 3SBEA 2Q2VA 1G3IA 1RXSA 2GXQA 4B32A 5FWXA 4YAEA 4HWKA 1YFLA 3K31A 4D3YA 1EJBA 3PWZA 3RYTC 5INTA 1BTOA 3I05A 4B4UA 1TADA 2QG6A 4GKAA 4LA4A 3E1KA 1LEHA 4JOSA 1COWA 4HQ6A 5K3FA 3COSA 3WI7A 2ERXA 3N28A 5I48A 1EDBA 1Z4QA 1J22A 5CLGA 1OXSC 2P77A 2A9VA 3EG5A 4LMAA 4IDGA 4YP1A 4CLHA 4RU1A 3VZDA 4A3SA 1JFVA 4MRMA 1VI6A 3UB2A 4HAXA 3T4EA 1N9GB 2WU8A 3AXSA 4Q7LA 4NMMA 1P5HA 3L7MA 2HXYA 5HFAA 3VOTA 5FORA 2PS3A 5CVVA 1WBBA 1KI2A 1DADA 1U7OA 5ETJA 3SQNA 3PUJA 4G0ZA 3D2CA 1Z0KA 2ZT7A 1LTKA 4D4MA 1RBMA 1IAVA 1R9JA 2R6R1 4URHA 3LX5A 5DBFA 1ESEA 4PAGA 1XA4A 3ZUGA 3D3QA 2XYRA 3WX0A 3EHDA 1C4OA 4IL5A 1NMXA 3FCCA 4QECA 2V7QD 1PV4A 4DDUA 3DEFA 4J90A 1T1SA 4LZJA 4QFDA 4Q9JA 2Q41A 1Z2EA 2FWIA 3RRYA 2IHTA 4FB5A 4C14A 1Y3DE 1ECCA 2ZR0A 5KSPA 3BJZA 3SZGA 4I9UA 2QEQA 2ZB7A 1SCUB 4KFUA 5AVQA 3SVLA 1KR5A 5IAAA 3C3CA 4BB6A 1F38A 1M0TA 2JASA 3LOUA 4LRTB 4Y9UA 4L57A 1ZIPA 3ZN2A 1KZYC 4M9SA 3EEQA 3DOIA 3F6RA 5GONF 1JVNA 1N8TA 1XMXA 3RSGA 1KEPA 1XTJA 2IXGA 4UAGA 2J0QA 5CDTA 1HYEA 4I55A 4WNIA 2PMCA 3FWHA 3FFXA 3CZAA 3LYLA 3LYUA 1G21B 3CEHA 5CAEB 1RQGA 4ENWA 2O06A 1KAHA 2HPVA 4X61A 1QH1B 3DEYX 3LGAA 4GSYA 1I0ZA 1M2KA 3M6FA 1P0CA 1CJCA 1NL3A 2XUPA 4YXFA 4IRUB 1W4ZA 2NO1A 5BMVB 1D09A 4KMMA 3OU2A 1K6IA 5CA0B 1XKXA 2EX0A 2VL7A 1P3Y1 3F2VA 1Y6FA 1RJWA 3GEGA 4DLVA 1A5AB 3EIXA 1NATA 1W8IA 3H5IA 3MTEA 1VKJA 4RKWA 2W2PA 3TEFA 2XWPA 4PGMA 3QVLA 3B6MA 2R6CA 4E22A 1DTWB 4FS3A 4S1TA 1KZ4A 1DAGA 4YRIA 5DT9A 1PSWA 4FGWA 2R8PA 1WCXA 3B1ZA 4FMCF 4EW3A 5IYZB 2K2WA 4Z7OB 2P91A 5KNBD 1ADFA 3EXHB 5K8IA 3LDGA 3O26A 4PAWA 1A5ZA 1QAOA 4EPYA 2DTEA 3IX7A 3R23A 3WGZA 5JALA 2W6IA 4YMLA 1V9LA 1N33B 1L9XA 2Q5LA 4C7JA 4PXYA 1I2MA 2IHUA 4RVFA 2OZVA 3AHIA 3C85A 3EF0A 1EJ0A 1VFPA 3LWBA 3C87A 4GOJA 4K6HA 4YRTA 4ARSA 1XZDA 1L7AA 4P92A 3SEAA 2GFQA 4R6XA 3MJ4A 5CB4F 2C03A 3CWCA 4DWWA 3DBIA 1DWUA 3QW4B 4JLPA 2FUG1 4M8IA 1T3HA 1WMDA 1LSJA 3E5MA 3OOEA 3R0ZA 1P1KA 1EWYA 3MMPA 5KNLA 3R8FA 1BGXT 1SR8A 1V11A 1W6RA 2RJNA 2YDXA 3DKVA 3QYAA 4XUDA 5DLEA 5B5SA 2P69A 4YRFA 4RCYA 3ABIA 4C43A 5L7WA 1YR6A 5AW9A 5K2MA 1ADCA 2H48A 3QLVC 3N8KA 1X19A 1VPWA 3AFHA 3JY6A 1HZJA 4J0CA 4P7FA 4FXOA 2I71A 1JQ5A 1ULSA 3ASYA 3PYLA 4LG1A 3SZ3A 4E7PA 4MTCA 5HKBA 3NOVA 3PNPA 1KQGA 3O8LA 3HR4A 1GAEO 3ZW8A 2WR8A 3WWYA 3I83A 3BFXA 3CJTA 5DT2A 5DSZA 3X1XA 2PKCA 1NWCA 3E9DA 1JDSA 3RGWS 2P4QA 1LNQA 1UKCA 3A26A 4G8CA 4AG6A 1R6XA 1TUBA 2YXLA 4YT8A 2K87A 3UPDA 5KAPA 2JBWA 1MABA 5M34A 4RZSA 5KWJA 2VPWA 2NN3C 3GUCA 3P4XA 4NXMB 1SUCA 3E9ZA 3U3JA 4DVGA 4Q6WA 5CEEA 5B1YA 1GUDA 1M1YA 2BGNA 3SLKA 2CY0A 2O14A 2G6BA 2XKKA 4JQCA 2FCRA 1ORIA 3EXG2 1WETA 1CDEA 2V3VA 1QVZA 3ER6A 1IPFA 4G36A 4PGHA 4DCJA 4WFJA 1CJMA 1SD1A 3QOWA 2IEGA 4PIPA 1C3XA 1RP1A 1C80A 4Z4GA 4NBVA 3TEJA 1I4OA 2OXFA 4MO9A 4BQRA 4C07A 3DDHA 3R5FA 5ALQA 2QBYB 4RSMA 1U02A 4C87A 1FQKA 2W6JD 3KD3A 4M0LA 4MLDA 4PN7A 4PYIA 2YWXA 3WXBA 3UF0A 2HHAA 4YT4A 2GHQA 2I29A 1Z0AA 2AUTA 2XE6A 4PG7A 4Q0MA 4HNUA 2Z6QA 1N2CB 4YQYA 4B4WA 3AG5A 1JG3A 4MB6A 1X77A 2FPUA 2IZ7A 4Z9AA 2DLNA 2QMZA 3MTIA 2R5NA 4WZAB 3BM5A 4QKQA 2RK6A 7GPBA 1B8NA 2WU3A 4L6IA 2PMEA 3FOBA 3Q9UA 3S2SA 4YAGA 5LL6P 2O1WA 2QUKA 2KLBA 3FDXA 4PHCA 2C92A 4V0QA 5AXBA 2NU8B 1RXVA 3QPCA 2V7TA 4HFNA 2P1RA 1E9FA 4BNIA 5BV8A 4J43A 1EK6A 4S1OA 3RNLA 1I94B 1FYEA 1ISPA 4NVRA 4MUHA 2NO9A 4MK4A 3L6RA 4J0DA 2HD4A 4FSDA 5IC5A 4CU2A 3QLEA 4EA8A 4OY3A 4IWYA 3EZYA 2FZ5A 3L0SA 1M34E 3Q6NA 4M0UA 3WRXC 5KKAA 2O54A 2RGDA 3P2EA 1JHPA 2XE4A 3AIMA 4CG0A 3TIGA 1T25A 1WQ3A 1MC1A 2H7YA 3QVOA 2PJZA 5I3CA 3B3FA 4TTJA 5KIAA 4I5GA 4EF4A 4Z5XA 2J3KA 2VHJA 4P7KA 4L78A 3OOHA 3ZHRA 1NXQA 1OLXA 1V3UA 3P9RA 5HDBB 1MH9A 3SNKA 3UQYS 4D4LA 2NZWA 2AFHA 1RM4A 3T5BA 3OZEA 2ICAA 4UM9B 1N2BA 3IV7A 2ZJYA 5H70A 3FWPA 3ZXIA 4U6NA 5FFMA 2VTKA 5EJGA 5EYPA 3UCXA 3WGTA 1M34A 1ZLYA 3MPUA 2ZRMA 4OU5A 4UD6A 3FCOA 4QPCA 1G59A 1N2ZA 5JVDB 2CYBA 4MVWA 2Q3LA 1RWWA 1NYRA 3GGSA 3TX2A 4PSVA 4BU0A 3HUDA 2WNIA 2V6BA 2VA9A 2TSYB 3D2BA 4M8KA 3W34A 4U7DA 2EZUA 2O8FA 3CKMA 4BNNA 4EZIA 1MN6A 1LPMA 4F4IA 4EX6A 3T1QA 3MB8A 1CY7A 4M7PA 4K9NA 2PRZA 1T34A 3UXMA 2EDAA 2IC5A 3E15A 4O4IF 4LDNA 1N9GA 4ENVA 1HLGA 1RJ9B 5CNIA 1YR1A 3MJFA 5KKCA 3DO8A 1C14A 4H18A 4XB6B 421PA 2FF5A 3G1TA 3EX7C 1TO2E 4BOYA 1QZTA 1C0PA 3VKFA 1DCFA 1JKJA 4B7AA 5C53B 2ZE8A 2W6NA 3PD1A 3QKRA 1RWVA 3PD0A 3UA3A 2O8EA 4UM7A 3FPLA 2RHHA 3HXTA 4XM0A 4JDPA 4MP8A 5C1PA 4LNUA 2EW2A 4I5FA 5E0KB 5TGDA 1E9BA 1SUBA 1YJ5A 4C2AA 2WAMA 3TTVA 1DIOB 1NAHA 1CVRA 1Z0SA 3HCEA 3JQAB 4OL0A 3VPGA 4L5JA 4I1PA 1BVHA 5EMLA 1BKYA 2ZYTX 4C01A 5AHOA 2XTZA 3TRDA 4IAOA 4QOFA 1IMOA 4KH0A 4BVGA 4NYJR 2Z2KA 2WSSA 3QF7A 2PJRA 1D1SA 4FKBA 1EUDB 2VN8A 2X0RA 3AI7A 2PU5A 3K1AB 1C4KA 2FEAA 3PITA 3QVKA 4G1BA 4LSZA 5E6UB 1Q6ZA 4D0LB 4EHJA 5DM60 1ZRNA 4LDPA 4JBGA 1I8TA 1RFLA 1IZ0A 1VHWA 1HETA 2XNJA 4QXQA 3QH4A 4RZ2A 4DMHA 4E5KA 3VHXB 1L7QA 5EJ9A 2VT2A 3W5UA 1M10A 2C61A 4IMRA 2BVNA 1LQTA 5AJHA 5C3UA 5A03A 3ADPA 1BDMA 1P1IA 3TW6A 4V1CB 3I62A 3PWTA 1L7BA 2A9PA 1ABFA 1H1LA 2IYRA 1I4LD 4MDYA 2H3HA 1NVBA 2VPQA 3JAWA 2IYVA 3BHJA 4ZI7F 1EWTA 4A0FA 1HT3A 5AVTA 3QXCA 3BH0A 4WXYB 1ZC4A 1IWBB 5C51B 1F17A 3AESB 2XCRB 4KFRA 4DA7A 4Y6PA 4DIDA 5DM1A 1XMSA 5H7XA 2VF2A 1LDNA 3GLHB 3IT1A 2ZRCA 4RXUA 4C3VA 3T54A 4GI7A 4TKVB 3ZJ5A 1AE1A 2JKYA 5F23A 4TTRA 5D3MA 1V1JA 5AUPB 1C9EA 2PS0A 2HWXA 4HQLA 1BOOA 1R3UA 1ZCJA 2EG5A 4XVQA 4CKXA 1XCBA 5BN4B 3GGOA 4D9IA 3JQ7A 3CE6A 3I5MA 2B7CA 3C15C 3OCUA 3VHLB 5LZ7A 2CW5A 4FMDB 2X0KA 3E7WA 5K4HA 2G1PA 4W6ZA 1P73A 3WMGA 4A03A 3AK4A 3ZS9A 1I4WA 3GDWA 3ZHUA 2A5GA 1JYFA 4GI1A 5D7NA 5DXJA 3RKSA 3ZCRA 1N92A 1U1IA 4HKTA 1C3EA 5BNZA 1F14A 4L4UA 5A02A 3I8SA 1YBHA 2MWMA 3VH1A 4IDBA 4NE7A 4D43A 4B7CA 4C76A 4H1UA 1D1QA 2CMHA 3BRCA 3ECAA 3S1LA 3D0QA 1V4NA 2XGOA 5EHXA 1JA0A 2ID4A 1HDGO 2FF7A 3L06A 4RY8A 3GFBA 3WWEA 2WSMA 2PT5A 1YRAA 2C77A 3KTAB 3F7OA 4OQDA 4PC3A 4XSVA 5D85A 3UG6A 3X43A 3UFBA 1U2PA 4EOGA 4CIBA 1QIHA 3PXAA 1T3LA 2B1RA 3AB8A 3F90A 3N9IA 5KJEA 4CF4A 2D2EA 4F5ZA 1H2YA 1XAHA 2D62A 1N8KA 2PT6A 1ZEJA 4XDZA 4M76B 4YI5A 5AESA 5JEDA 1VSQA 3AVTA 3NBMA 5KVCA 2BF4A 3CE9A 3IAFA 4ITVA 5D51S 5FHRA 5H80A 1YU9A 3OCVA 2VJKA 2G0TA 4NAHA 4YMHA 3KZOA 3D8HA 4QPNA 3ESBA 3UYLA 4W1SA 4QUAA 4IIJB 3QV2A 3RUPA 5D3ZA 4Q3CA 4BXOB 2IYXA 8ATCA 2C88A 4MV4A 3WQHA 1XNQB 5ESRA 2RK3A 4MGEA 4P7BA 3LOPA 4UEJA 4WCFA 1Q2UA 3DL0A 4J7XA 4V2IA 3R7WA 3SHWA 3SY8A 2I2BA 4Z7NB 1XVLA 3B5JA 1E8DA 1RAAA 1WO8A 4DPMA 2G83A 1UXOA 1ZRMA 3AEZA 4PYNA 1KK1A 3HU3A 4CDMA 1JQEA 2GJ4A 4L75A 3NYQA 1SXJE 2IHVA 4MJXA 4DLWA 2GBLC 3KKLA 1GZ3A 2XCOA 2W83A 3D4IA 3B5IA 5AXDA 1EX6A 1X7XB 2P7IA 4N0DA 3AR2A 3ZE9A 2FPIA 2VDPB 4GSLA 5GV8A 1HE5A 1RP7A 4BZXA 2AKEA 1GUZA 4C0BA 2I7VA 1KP3A 4DYVA 1NQOA 5LU9A 2ZRQA 4IR7A 4PWYA 5TC4A 4CI9A 1U0OC 2AHOA 3KYCB 5A5GA 1F4LA 1DG3A 1GNVA 3G5TA 2ZI6A 5CRIA 2J9FB 1VKNA 4KR3A 4RELA 4QXRA 1MT0A 2B8WA 2QRVA 3OC0A 4C0KA 2VP6A 3PJRA 1A2OA 4FW9A 3ZVRA 5HP4A 4ATNA 5HQ3B 2N1BA 2NV2B 1DC7A 2E4WA 1V4VA 3ROMA 4NEQA 5BYJA 3B9QA 5F5XA 4IGKA 3W7VA 3SSOA 1B0PA 4WLNA 4DNQA 1QHEA 5E95A 5IX8A 1NY5A 3EB9A 1M8FA 4FZVA 2AN4A 1EE1A 4YAJA 3C7AA 5F12A 4RESA 1QCDA 3KUKA 2I3BA 5H8WA 3S81A 3WSTA 2ZIWB 4HMQA 2IQ5A 3NYIA 2P11A 5HIJA 4D9NA 4PZAA 4DLSA 4DTCA 1GNRA 1TXGA 1WQ1R 4I50F 3V1NA 3H11A 3C4QA 3LL4A 4QTZA 1UMKA 1QM5A 1O6GA 1TRHA 4IRMA 1RJEA 4GC5A 2OILA 2XUJA 1K0UA 1CKEA 3C7DB 1DAMA 2E85A 3IUNA 3D3NA 4JL5A 4XB2A 1J33A 3PNYA 1KVUA 4WA8A 4ZEVA 1D0SA 2F8MA 3HXKA 4D8TA 4YDQA 2PUVA 1NMSA 4FK8A 3VTKA 5C7LO 1J39A 1DQRA 1XIVA 1TTTA 1JFFA 3KV1A 1KYXA 1EG2A 1AZTA 1GKIA 2WJVA 4ZV9A 5HSGA 1LA2A 3ZK7A 4CQMD 1BDHA 2P8JA 2XLCA 5BWNA 5KTMA 2BRUC 3PICA 3WFZA 4PZ0A 1D6NA 1CEQA 1C1DA 1W5EA 3A8TA 1CZNA 4MRNA 2Y1KA 1JA9A 3F0TA 2AFHB 5B1IA 2ANCA 2Q5JA 3QFTA 3A6PC 4ZD6A 5IRCD 1IE3A 1XMIA 3D64A 3JVEA 5JG7A 3R8XA 1BW9A 1E69A 1PGPA 2A57A 3NORA 3HP7A 1XVTA 2OXCA 3AXTA 1SCAA 4GR5A 4EHAA 3ZWYA 1P6UA 3O2JA 3PRHA 1ZOOA 1KDVA 3RAGA 5G0VA 1NOKA 5K0LA 3QNUA 4F3NA 3Q3HA 4UARA 3UMFA 1KI3A 2DJ5A 3BXOA 3ZDAA 1ZMTA 1OAOC 121PA 2VA8A 2QP3A 4KO1S 4OIMA 5B2EA 1HQKA 4CKBB 1E92A 2VYVA 5HTKA 2I2FA 4RF5A 1ZUNB 4AZSA 3EQ2A 2GN1A 4NZZA 4YV2A 4E5SA 2H8KA 3PDIB 3UV6A 1VRWA 1HQDA 5L45A 4RIGA 1EX7A 1KAQA 2PCJA 5IP5A 5T4FA 4BN0A 2CHFA 1Y3HA 3BFVA 3RWBA 2PX8A 4DIOA 3R7AA 1M1XB 2X8BA 4J76A 1CUDA 4UTOA 2F55A 2WG2A 2I3AA 2UZ3A 2ETVA 2XJ4A 1P2TA 5E6UA 5EXTA 3U4IA 1LQ2A 4PZZA 1QO0D 5BW8A 2V1UA 4O4IB