1P8AA

Solution structure of the low molecular weight protein tyrosine phosphatase from tritrichomonas foetus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
146
structure length
146
Chain Sequence
AAEKKAVLFVCLGNICRSPACEGICRDMVGDKLIIDSAATSGFHVGQSPDTRSQKVCKSNGVDISKQRARQITKADFSKFDVIAALDQSILSDINSMKPSNCRAKVVLFNPPNGVDDPYYSSDGFPTMFASISKEMKPFLTEHGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein tyrosine phosphatase
publication title Solution structure of the low-molecular-weight protein tyrosine phosphatase from Tritrichomonas foetus reveals a flexible phosphate binding loop.
pubmed doi rcsb
source organism Tritrichomonas foetus
molecule tags Hydrolase
total genus 22
structure length 146
sequence length 146
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p8aA00
3HM9A 2W42A 2NT3A 3HUTA 2JBAA 3O1HB 4D6YA 5C5CA 1YS7A 3EJWA 1EAYA 3IP5A 4RK0A 5CHYA 2L19A 4IMJB 4RZSA 4F12A 4EUKA 4ZJPA 4ETIA 1XHEA 3CG4A 3RVJA 5FBKA 4EGSA 2PMCA 3C6QA 3RVKA 3N0XA 1E6MA 3QELB 1P6QA 2QSJA 4JASB 1DZ3A 4MR7A 3EDCA 3H1FA 3E3MA 1QO0D 1BDJA 3RVRA 1YMUA 1ABEA 5IEBA 2JK1A 1MB0A 4WWHA 1RXIA 1ZH2A 3MM4A 5CNIA 2ID9A 2WJWA 5DKFA 2IYNA 3O2QB 2LPMA 3A10A 3T8YA 3NNSA 2RDMA 4MQFA 4S04A 4G0XA 2JVIA 4F8JA 3KJXA 1R8JA 3GL9A 3LUKA 2VYCA 1DCMA 3LKBA 3IP6A 2LIVA 4HNRA 4MR7B 1U2QA 4OG2A 2HSGA 3IP7A 3H1EA 1RZRA 1YMVA 4HNQA 4KVFA 3LKVA 4MQEB 3OLZA 2QV0A 1ABFA 4PYRA 2JCGA 1OXKB 2L17A 2R25B 3JY6A 1SXGA 4JB0A 1EFAA 3HO1A 1T34A 1SXIA 4H60A 5BRJA 1Z25A 2A9OA 1DJMA 1JDPA 2FMKA 2Q5CA 3LUGA 1DBPA 2QVCA 1QNLA 5IUKC 5GOTA 4KFCA 3O21A 4HNSA 5E3JA 1E6LA 2FQYA 1NTRA 3GBVA 4Z4HA 2FEWB 3H6GA 4G0OA 3URMA 3Q7TA 4RDCA 2J48A 4UHKA 5C5EA 4JB2A 3HJFA 4LRQA 4LE2A 5FWXA 1YIOA 2FLWA 1Z17A 4XFKA 5DGCA 1DRKA 5ABPA 3N8IA 4KNYA 3C3WA 1C4WA 3FFTA 4NICA 2FQWA 3SQNA 3BBLA 3QEKA 3IPCA 5TQ0A 4NCBA 1JYEA 2CWDA 3MYYA 4PE5B 5HQJA 3HEBA 2FEKA 5FBHA 4MS4B 5EWMB 2PUAA 1DG9A 1D2AA 2YHAA 4ML3A 5FWXB 2HJ9A 3A0RB 3O2SB 1LBHA 4KREA 3OO1A 1EHCA 1NATA 3IDOA 3OLWA 5KC8A 3LUDA 3P9YA 3DLBA 4MLCA 4MS3A 2V0NA 3TX6A 4G0MA 1ZHHA 3CFYA 4OATA 2PAFA 2NZVG 3JS5A 1URPA 1NXPA 5EWLA 1JHZA 3RVPA 4MGEA 3BREA 4OTZA 3MIZA 1U04A 2IKSA 4TN5A 2FMIA 1GUDA 1XWWA 4RV5A 1FQWA 2MYPA 2FQXA 3QLUA 1CEYA 4ZYLA 1EWVA 1DCFA 1VRVA 1W25A 4FB4A 2FMHA 1SRRA 1DBWA 1JDNA 2IPAB 1I3CA 2RGYA 3GV0A 2X7XA 4ETNA 2DRIA 3L6UA 4TMYA 5JNUA 3CHYA 1JYFA 2JVKA 3OMWA 4N0QA 2RJNA 4TLMB 5TE9A 1W9HA 3I09A 1XHFA 1JWLA 4Y9TA 3CS3A 3F6CA 4KK4A 1JL3A 2GI4A 4QYWA 4RY9A 5D2CA 2JRLA 3RQIA 1QQBA 5TPZA 3CNBA 4YV7A 3HV2A 1USIA 3LUAA 5BRAA 3KLOA 1GLGA 5TPZD 6ABPA 4RKQA 4Z0NA 1H9CA 3F6PA 3H6HA 3HUUA 5TQ2A 1VKRA 1DBQA 4NQRA 3N0WA 2FTKE 1M2EA 9ABPA 5KQPA 2GBPA 1USKA 1ISRA 2B4AA 3A3KA 3N0RA 2PE5A 2IPLA 1GUBA 4F3TA 1Z26A 2LP4Y 4S05A 5T3YA 3BILA 4W5QA 4H3KB 3C3MA 1MB3A 4E7OA 4EYGA 4MRMA 3Q7RA 1QO0A 1SD5A 4IF4A 3HDGA 4LZLA 3JTEA 4O1HA 5TQ2B 2PUFA 1LBIA 2N9UA 4JP1A 2B1JA 5F64A 3I45A 5EWLB 5IBQA 4D74A 3OLXA 1NXXA 1Z16A 3EQ2A 1EWKA 3T38A 1YK1A 4LX8A 2GX6A 3IPAA 4LE0A 4KPYA 3KHTA 5BQ3A 2JBAB 3NHMA 4EYKA 3CU5A 2RJOA 1A2OA 4EYOA 2F8SA 4JOQA 1YK0A 1VLZA 3B2NA 4G0YA 4TLLB 2HQOA 4YLEA 5TQJA 4KRFA 4GNRA 3LUHA 3OLVA 2MYNA 3QEMA 4IGAA 3LOPA 2E4YA 3N6VA 1PEYA 4Z9AA 1PNRA 1Z18A 2CHEA 2IDMA 2PLNA 3SAJA 1ZGGA 3T95A 1Z2EA 2KYRA 1Y1LA 4KZKA 2VUIB 1JX6A 3EODA 2IPNA 3CZ5A 2E4VA 4MLDA 1ISSA 3G85A 3GRCA 3FFXA 4MQFB 4P98A 1TVMA 5KWSA 1USGA 3KG2A 2M98A 3RVOA 2R48A 3FMVA 4Q7EA 3ROTA 1LJLA 4RSMA 4WUTA 3RVLA 4N0PA 5DTEA 1BA2A 1D1QA 3KLNA 4FE4A 3F7NA 4RK7A 3CG0A 3SY8A 5JNSA 3C3KA 3NHZA 5ED4A 1ZAYA 5I4CA 3HCWA 3HDVA 1NXTA 4XARA 1ZITA 1JFVA 3OM1A 5JS1A 1M5UA 5KI6A 4KQCA 2VK2A 2M1ZA 1J56A 5JNRA 2CD7A 3RVSA 3JVIA 4ZMSA 2ZAYA 3O74A 5B3JA 4G97A 2HQRA 3RH0A 2PL1A 4MYRA 4RWEA 3HVRA 4KV7A 1YTUA 3DLHA 2JB9A 3HZHA 2L18A 1S8NA 4MR8A 3KTOA 1ZH4A 2IPMA 3N53A 2LBPA 4N03A 1FFWA 3LMKA 1CYEA 3QLTA 1QKKA 2O20A 1BDHA 5TQ0B 5KQMA 2PKXA 1ZY2A 3CKMA 1ZN2A 2A9RA 4PEVA 2VUHB 3QLVC 4YWHA 1Z13A 5TPWA 2CHFA 4DADA 4RK4A 3UK0A 4KMRA 3KYJB 4LE1A 1MVOA 2WRZA 3EGCA 2HQBA 4UHJA 3H5LA 3I42A 3HS3A 2NZUG 3NNDA 3TO5A 1APBA 1U2PA 1PHRA 1GCAA 3Q15C 1B00A 2A9QA 4MS3B 4NV3A 3GWGA 4YRZA 3O75A 3E61A 4L4UA 3MF4A 4F06A 4M88A 3CRNA 5IEJA 3UKJA 1IIBA 1P8AA 3N75A 3H5VA 1A0OA 2IOYA 4QICA 2MYTA 1L5YA 5DLEA 1VPWA 4IILA 5DCLA 2GKGA 4QPJC 3RVMA 4YS6A 2E4UA 1TLFA 3DBIA 1GCGA 3QX9A 3G1WA 4Z4EA 3TMYA 1E6KA 3MMNA 4YO7A 1HEYA 1LJUA 1TMYA 5IUJC 1BDIA 3M6MD 5JNVA 1JFSA 3SG0A 3O2JA 1RXEA 3JPYA 5IULC 1EWTA 1DC8A 2LUOA 2NUBA 2AYZA 1K66A 4RKRA 8ABPA 2I6FA 1P6UA 2FN8A 2TMYA 4RK6A 2PUEA 2R4QA 4G86A 3EQZA 3OM0A 4HYEA 2WWVD 5GQSA 1QMPA 1ZVVA 3QLUC 3KKEA 3W9SA 3OQMA 1DP4A 4ZPJA 1NY5A 4EVQA 5T7BA 4YGXB 3TD9A 4Z4FA 5EWJA 4EYQA 2E4WA 1NXSA 2WY2D 2E4ZA 1QQAA 3SM9A 5IX8A 3Q41A 3UUGA 3M9XA 1RNLA 3QK7A 1JF8A 3JPWA 1PNTA 3K4HA 4MR9A 1D5WA 2QVGA 1NXVA 1PEAA 1OXBB 4MS1A 4RY0A 5CNJA 1UDRA 4PZ0A 1BVHA 4JA2A 4OLAA 4MRMB 3GA5A 1C0EA 2FW0A 4P1ZA 1DRJA 5EWJB 3CTPA 4LDAA 1KGSA 2P4UA 5JNTA 2HPHA 3NBMA 4YP9A 3OMXA 3ROFA 3DZDA 1AB6A 5KQGA 2A9PA 1AB5A 3I5AA 4MR9B 4QYMA 5HSGA 1RPJA 4N76A 3HK2A 1M5TA 2MSLA 5KC9A 4MS1B 1BAPA 5BR1A 2FXIA 2QZJA 4ETMA 1TM2A 2ID7A 4XXHA 4D6XA 3KCNA 5IC5A 3GT7A 4DQDA 3D8UA 3OO0A 4MQEA 2QXYA 3Q9SA 4O1IA 2OENG 1KRXA 1A04A 4W5OA 3QEMB 4IRXA 3NNNA 2MSKA 4ZMRA 4WT7A 3CLKA 4XLTA 3QX8A 4G0ZA 1DCKA 3LFTA 2WMYA 1KRWA 3O1JC 3H75A 2H0AA 3RVQA 3BRQA 2XDYA 3IP9A 3JVDA 3RVNA 3HSYA 4FE7A 4E7PA 1M2FA 1P2FA 2PJUA 1U8TA 3FDFA 2E4XA 4Q6WA 3D02A 1K68A 1FFSA 3H5OA 4NCAA 2GWRA 2QU7A 2FEPA 4W5NA 1QPZA 2AYXA 4GPAA 3EULA 3F73A 2F8TA 3ILYA 4N47A 4EVRA 1F4VA 5KQLA 1RZRD 1JFTA 4MPTA 4OLBA 1PUXA 3TB6A 3H5TA 4RK5A 4EVSA 5PNTA 3QLVA 1SXHA 3OQNA 3MA0A 3SNKA 2PUBA 1WETA 2YHBA 3DGFC 1FFGA 4W5TA 2FKAA 5JS2A 1ZESA 6CHYA 2FN9A 1U0SY 1Z2DA 3GBPA 3Q7SA 4MS4A 4RK1A 4XASA 4LDZA 4Z9BA 2ZWMA 5EWMA 5JNWA 1E2BA 3H1GA 1CHNA 3FGZA 2PUGA 1ZDMA 3ILHA 2PUDA 1ZGZA 3DGEC 3BRSA 3LUJA 4G0PA 4B09A 4Z4CA 3H5WA 3CZCA 4Z99A 5IUNC 3O1IC 4XAQA 2R47A 4MR8B 4F11A 3L49A 1JLKA 1LK0A 2WJAA 1MIHA 2FVYA 2MYUA 4RY8A 4Z4IA 2BGGA 2FSPA 2WB4A 2QR3A 2FMFA 1QP0A 1JH9A 4MAAA 3MQ4A 4DN6A 3HXMA 4RS3A 3FFWA 5B3JC 1JBEA 4CBVA 4KQ9A 1Z12A 2OQRA 3EAFA 5FWYA 5TPWB 1Z15A 3K9CA 1TJYA 3A0UA 3M9WA 3LTEA 3OQOA 2QW1A 2L2QA 3VNBA 3T6KA 3OLYA 3KSMA 1F51E 4YCSA 3H5IA 5CNMA 4JAVC 4G0QA 2PUCA 2P9HA 1YVUA 3LUCA 1L5ZA 2NT4A 1D4ZA 4H3HB 1NXOA 7ABPA 2FLKA 5FWYB 1QP7A 2JVJA 4O5AA 3GYBA 3C97A 4WXEA 1MAVA 4EY3A 3KS9A 4W5RA 5HKOA 4WXMA 1QP4A 1DC7A 4WZZA 3R0JA 4RU1A 3LUFA 2H3HA 2MSWA 4IMIB 4RXUA 4Z4GA 1D1PA 3VNAA 4N41A 1FSPA 4RXTA 3KYIB 2PL9A 1KMIY 4YR7A 4L85A 4Q6BA 5CNKA 5HM6A 3S99A 4OBBA 4KK3A 1NXWA 1YS6A 4RXMA 3QELA 4PICA
chains in the Genus database with same CATH superfamily
5GGYA 2VHZA 3N59A 1YV9A 4DDUA 1V16A 1VJDA 2H1CA 2CXTA 3KVNA 1TZCA 4LJ7A 3CH5A 3PC8A 2YFQA 1GAJA 5KYYB 2GBGA 2VSOA 3KKMA 5DDIP 1KU0A 3ZVNA 3O38A 3DEFA 1D7AA 3PSAA 1H6AA 2ZW9A 3JQ6A 3HU1A 4HEQA 5H3HA 4EPRA 4KXMA 2H5EA 5F33A 4M98A 4U2GA 4CV0A 2XMBA 3OEYA 3X2SA 2C2MA 3RHSA 3QMPA 3CEJA 3M6AA 1WHTA 2QMOA 5E2IA 1V5IA 3H1FA 3ND5A 4TWZA 4GMDA 4P3XA 3TNFA 4QKQA 4J7CA 3OE4A 1OUMA 4ZOBA 5IEBA 1FW6A 3FZNA 3X0DA 3BAFA 1RXIA 3EVDA 4H1UA 1Q0HA 1R4NB 1DFIA 1OBHA 4I6GA 1QRUA 1TYZA 5DKFA 5DHSA 4WKBA 3H05A 4QX6A 2EG5A 4ZAWA 3IBSA 4RJIA 3AUTA 3S1AB 4CQMD 1L6IA 2JVIA 2O07A 2D06A 1BHQ1 4FEGA 1I0IA 2AX4A 5AM4A 3RLIA 5AJZA 5BPHA 4GQAA 4O4LA 4B3IA 1E2QA 1NW5A 4YRFA 4XVUA 2C4MA 5BQ5A 1WUJS 4WKOA 3AL3A 3C85A 1FP6A 4NCJA 5CDUA 2BGGA 4AYXA 1EESA 4JBGA 3GXBA 3LKVA 4DRXB 1CJTC 4URWR 4ZVKA 3NWOA 2QV0A 1MZVA 3IQHX 4KGZA 5F2KA 2RHMA 4MB0A 4P35A 2A94A 1XHLA 2GJKA 1V1MB 2BKVA 4I55A 4CKEB 1VJ0A 5FPYA 4HQKA 4HB0A 4G89A 1IY8A 3PEUA 3JAMA 2IZ5A 3GNQA 4BP8A 2HLDA 4HNSA 1ULZA 4DV3B 1E6LA 4HBGA 2QRLA 3T7SA 3LYLA 3GBVA 3PUYA 4KLNA 2JFGA 3KXLA 1EFLA 5JCPA 1MNAA 4C0KA 5HX7A 4LF4B 3IUPA 3TTUA 4R2WA 3U40A 3R4VA 2ZBVA 4CLRB 5G41A 4OA8A 1QF9A 3WQBA 4II2A 4AJLA 2LCQA 3U7GA 2C4WA 1G3IA 4LN1A 1MOQA 2XZTA 3ILVA 3KBBA 3CXUA 1JEJA 3FRJA 5ABPA 1QZ3A 3BGWA 4NVRA 1Q1ZA 4XWAA 5P21A 1MAHA 4OAQA 4EM6A 4NCBA 1JBKA 2DKFA 4GSLA 3TAUA 1UZUA 2XGJA 3DMRA 2DWUA 5C18A 1E0JA 3B53X 2OV6A 4GSKA 1Y8CA 5ECYA 3PWSA 4KQWA 1PS8A 1GAWA 1SCDA 5HQJA 3TXYA 2BI7A 1SHUX 5DM2A 2D3TA 3AY0A 3R74A 1CQIB 5KYTA 3T3GA 1ZPDA 2QJFA 2QY9A 5G1OA 1LBHA 1ACMA 4MUFA 1FJXA 1FUIA 2XNDD 2OYSA 3LUDA 1Z82A 2VTEA 2WJYA 3W2EA 1W48A 2RGRA 2XQVA 3CFYA 4IVRA 3P4YA 5D7NA 5ER9A 2HLPA 4YC7A 4MGEA 3T5TA 4H3SA 1W96A 5JAIA 2I29A 4OTZA 2DR3A 4RHFA 3ZDZB 4D4JA 1VYUA 3U7RA 5FCDA 3K8YA 2R8EA 3ZGXA 5BN4B 4CLOB 1ABBA 2BM8A 2ZVQX 2HWWA 4FQ8A 5JE8A 3N2EA 1QONA 2RB5A 4XGQA 1VRVA 2QYOA 1U5BA 1KJZA 2OZVA 2GLUA 2DRIA 4MJXA 4OSPA 1JZTA 3L6UA 2NQTA 2WZCA 5L3VA 1RYNA 4X44A 3DM9B 4CTOA 1WZCA 4UM9B 1JVNA 2RHBA 3R5JA 2XDQA 2JRLA 3RQIA 2VO1A 4X84A 2NO6A 1UXKA 5TPZA 4MKIA 3EGDA 2X8AA 1YZHA 3KAJA 2HLHA 5BVHB 1GLGA 4RSRA 121PA 2JFPA 4IAOA 1RI4A 2R1ZA 4L5IA 5JHGB 5GIPE 3BD6A 4OQQA 1M2NA 1VKRA 1JMVA 4UCXA 4OYLA 3KTFA 4M7PA 1IH8A 4MQ5A 5EINA 1T3HA 4JQYA 4M1KA 4GUDA 1ZGCA 2CV0A 2Y2VA 5AVKA 2ZYAA 3DOUA 1UUFA 2VQFB 2OHFA 5IMSA 1P81A 1Q19A 4H3KB 1E2EA 1PRYA 1JFFA 1IYZA 1QO0A 1GZ4A 3QA9A 4NPHA 4RUKA 3WRYA 1I4DD 2HRZA 1AMNA 2HNAA 3EA4A 3CUYA 3RABA 3QENA 2HF7A 4N5HX 5BSUA 4IQ0A 1U02A 2FPMA 5F64A 5L7TA 5G1NA 1SUAA 4GZ5A 4KZPA 2OKCA 1Q1NA 4B3SB 2N3ZA 1TEHA 1JIIA 2OGSA 5JADA 5EKTA 5EIEA 1IPFA 3RU2A 3L93A 3PFCA 1XKLA 1JHYA 2IXAA 1E2PA 4FEEA 3H6KA 1T36A 3L7KA 4BYGA 4NARA 3MMXA 3QBVA 3CNOA 4QWWA 3OF3A 5JZOA 1DGQA 1JS1X 4ER7A 1U2GA 2IHKA 3N39C 1SELA 1B42A 2HMVA 3LOPA 1CUBA 1R0SA 1YCHA 1XA0A 3ZGLA 4I5DA 3SNHA 1ORDA 1NYLA 1QLHA 1NULA 3LK6A 5KSZA 2JRCA 3ETCA 2V59A 1VLQA 1VMDA 2BMEA 4GRDA 4QWMA 3AU8A 2PQ6A 3H18A 5AHRA 3WIOA 4BNWA 1ZUNA 3BWVA 5MFZA 1K98A 1P7ZA 1R16A 1T91A 3DAHA 2DYKA 3QG5A 4EY4A 2BKUA 1JHQA 1W87A 1ZD4A 2A78A 3C5CA 4G2NA 4ZPXA 1Q20A 5KOYA 1QG0A 1TKBA 2HN9A 2XB6A 3I5UA 4HSEA 1KH1A 4JXKA 3ZS8A 1I33A 2QF7A 5KAMA 4TWBA 3BGOS 1XQ9A 3EXFA 3SLRA 2J41A 5KNCA 3K71B 2PUHA 3B6MA 4YRMA 1AJEA 3TZEA 1XL0A 3CKLA 1RPTA 2ILTA 3L84A 5CB4F 4FVTA 1P1CA 3K6SB 1HLGA 2XJ9A 4WKNA 3GRYA 3CG0A 1T0UA 2ZRNA 1G20B 2G80A 1AVTA 3ASZA 2Q2OA 3NHZA 3NX4A 5KCMA 4C4YA 1IQPA 3E7WA 3IUSA 3O3NB 4QYTA 2XTNA 3U17A 3UWKA 1S2IA 5A6VA 2ZCVA 4ND2A 4IYRA 1Z08A 2V7TA 2YWGA 1RU3A 4UU7A 2IYOA 2I4LA 1X9HA 5MGBA 3JAWB 2D0DA 4TQAA 2ECOA 3OX1A 1WD7A 2PGIA 3A26A 4YJ3F 2AUMA 3NTLA 3ZWOA 2XMQA 2OZKA 1QCCA 2JFFA 3H17A 2RK3A 3FNBA 3VSEA 3JQAD 3IMEA 3VR4A 4DBVO 1DS6A 4FPXA 4XIGS 4ZVTA 1L8OA 3O8DA 5CEEA 2C77A 1XI2A 3KT8A 3O0DA 5KNLA 2H7CA 2AV6A 3JQ9C 5AVQA 4M99A 4ZZ1A 1NDHA 1OX5A 1SMKA 2O20A 4YP6A 4BNUA 5ENZA 5KNCH 5FO1A 2BR5A 2G17A 2OXRA 3GOQA 3IAXA 1PL7A 4U4AA 2H1FA 2W9XA 3U3DA 2VPWA 4K9OA 7MDHA 3ROQA 5J3JA 1G9XA 1G5HA 4P58A 4RAQA 4DADA 4FYXA 2C7VA 3B1VA 4RA6B 3EGCA 1A3CA 2GK4A 3WV4A 4DQVA 3C7DB 4LOAA 1MDBA 5A4KA 1BYUA 5AK4A 1PHRA 2BN4A 1GCAA 2HSWA 3OX2A 2FSUA 2OUIA 4I2VA 1AGRA 5FLKA 2P3QA 1SVWA 2ZBRA 4MULA 3A70A 4JJAA 1QS0B 3ZHCA 2R1TB 5ECWA 2QX6A 3CRNA 4J0KA 3VR4H 4FNOA 5IAAA 2HGSA 3JD1A 4J94A 4OO3A 3L4EA 3WS7A 1O97C 4QPJC 1NX6A 3OIVA 3HCEA 3PHCA 4YS6A 1N34B 1X3LA 3QX9A 4FKBA 1K5PA 2BF7A 3EMDA 3SD7A 3LIPA 3RV3A 4UE2A 4P3KA 1UAAA 3N87A 1M0SA 2J31A 1BDIA 3DE5X 4IV8A 1GL6A 2VHXA 1GAQA 3DDHA 4UE3S 4Z0HO 2DUMA 4GT1A 4LCEA 5HF6A 2VRWA 1EP3B 1PWEA 4KC0A 1GDHA 3SDZA 2H2AA 3EMBA 1ECPA 3VYVA 5JD3A 4NV1A 4NBUA 3QKSB 1C81A 4N6GA 5FBLB 4BLTA 1BWSA 1FSGA 1HBJA 2PT7A 5LP6F 4RACA 5JYDA 4B45A 4D45A 1D7OA 3L8CA 1QMPA 3FCOA 1VJ5A 1Q0QA 4QEZA 2JS7A 5E8JA 1NY5A 1SXJA 2OFPA 3LKDA 2Q2NA 3G89A 4LJ5A 1ZCZA 5F7JA 5AP9A 1WDTA 5AKEA 4YN3A 5JDCA 2H48A 3TPZA 2DAPA 1M7HA 2CF6A 3ACCA 2YQZA 5DWDA 2BGUA 3ED1A 4HXYA 3PDCA 2OZPA 2QEQA 4FFPA 4UZSA 5DI9A 2NPFA 4PX5A 2CNWD 4BPBA 2Z4TA 1OIWA 1NN3A 2C5BA 3IKJA 1HT2E 4W6QA 3CXRA 4K86A 4W63A 5GV7A 3ZJ4A 1BVHA 5KTRA 2PYZA 1U0LA 3AG5A 1G2QA 1C0EA 1EVKA 2O3JA 4GR5A 4AKEA 4HMQA 3P32A 3KPYA 3BTUA 1Z0DA 1G1MA 4YP9A 1W88A 1OJ7A 2WUWE 3LDHA 2HNKA 1NR7A 2O06A 2YXPX 4TL8A 3BGIA 3ANMA 4KYTA 2HCTA 5L4LA 2CF5A 4ZDKA 1LF5A 1ZBDA 1ZJJA 4MKZA 4NF2A 5KC9A 3IE2A 2VWPA 3DNFA 5JSHA 2BF4A 4MDHA 1Z0KA 4GKKB 4BB9A 1SC9A 4AUMA 2JLUA 2B4YA 2HR1A 2W8ZA 5LKRA 2HWXA 2H0RA 4GR9A 3ZE7A 1KS2A 1V8FA 1XLWA 2POQX 1SCKA 4G07A 2OOSA 1QF7A 1GR1A 4BLVA 2OLJA 2LGJA 3UMVA 1SOUA 1LDYA 2AF3C 1J2UA 4WBSA 5BV1A 3RVQA 5A6SA 3WL4A 2BSQA 3PBKA 1ZL2A 3TECE 3PV0A 1F60A 2N42A 2P8SA 3I2KA 1CZNA 2BIFA 3AMVA 3JZMA 4J43A 3TK1A 3UMSA 5IM4F 2DJIA 3KPJA 3TBHA 1B8VA 3OZIA 2NQ2C 3WL8A 4LMPA 1GVHA 3HXKA 3AETB 1XJ0A 1D3AA 3P27A 1T9BA 2OCBA 3DAFA 4N47A 1EA5A 1A9XA 5FX2A 4EELA 3QXJA 4RHTA 3W5DA 4A1FA 2EZ4A 1P4AA 2GEDA 2YMQA 3WGJA 1OI7A 1MQ9A 5DRTA 4FHDA 5LR6A 3ENNA 2X77A 4J0IA 1JQJC 1I3OA 2OD7A 4MEBA 2FDXA 3I62A 4YT5A 5E1BA 1TF7A 2F2TA 1PQPA 4US1R 3WLHA 5E2AA 4D2IA 4I1SA 2R7NA 1AKWA 2CL6X 3H4VA 3Q6NA 4B3JA 5E7QA 2W70A 3TCXB 1Y7IA 3TXXA 3C15C 5ALQA 1P33A 1CETA 1U11A 1ZIYA 1F9EA 3I3SR 2Z3VA 4KDFA 4OQYA 3T4PA 4AYWA 2UYCA 1H23A 2OCLA 1CQJB 2RKBA 10MHA 1TCVA 2XUKA 5LYJF 3C5HA 4LKOA 1W1WA 2OZEA 3EZ2A 4NU0A 2YDYA 3RJ5A 3SSNA 2C2GA 2NPIA 3FB4A 4NZMA 4Q7MB 1II8A 2QL7A 1JSCA 2HA2A 2ZAMA 4QELA 3RUPA 3ONNA 2B25A 2XR1A 4F9GA 4TYYA 1CEEA 4URHA 2AFIA 3HCAA 1JKIA 3X1YA 2IF2A 1GCUA 1K5HA 1S96A 5EJ6A 2P6RA 1ZH8A 3HKCB 3GLHE 1J0BA 2P9TA 5JU6A 4Q34A 4AWBA 4DXAA 4F4IA 2ID4A 4NDAA 5E4FA 2I78A 5JLAA 5BV8A 1PFQA 3FSJX 4GQIA 5JXJA 1TJYA 5LP6C 3O4HA 3OQOA 4MVJI 1O5TA 4XLZA 3WK4A 4CIYA 3EVFA 4J03A 1T4DA 3UBTA 2WFLA 4LISA 1LCIA 3BXOA 4YJ2A 1R18A 4B6OA 8ATCA 4GZ3A 1XU4A 3HZRA 1XTVA 4I1OA 4WK6A 3WISA 3WWYA 1YF3A 2FPOA 1MH1A 3M5WA 4LC0A 3EX7C 3TZBA 3R75A 2FLKA 4OLJA 3F5SA 1I4OA 3ONVA 4UD6A 3R7DA 4LAFA 3H3XA 1WU7A 3BH7A 5F7ZA 3S2IA 1C0LA 4OPMA 4MRRA 4OK6A 4WBNF 5KIAA 2OEPA 3RT9A 3ZDDA 5JAMA 3HVKA 5IYZB 1X1SA 2BEUA 3AHHA 4BUJA 2VL7A 4RXUA 3T3EA 3TAHA 3TWOA 1N7HA 2MINA 4Z4GA 4CIAA 4HKTA 1VL6A 2WHPB 4JJ4A 1IPEA 1IZ0A 2JHPA 1T4CB 3BDVA 2PL9A 3FNFA 5C4GB 3BL6A 1EDEA 1W8IA 1QP8A 4JB3A 4TKVA 2XWQA 3U4DA 3ZWBA 1BXGB 1COWA 2DBVO 2H85A 2QGNA 1SVIA 3PQ8A 3UJBA 3OBIA 2X9NA 2RH5A 4IUCS 2WUGA 2BJVA 5JAHA 4AP6A 4EG6A 2PFSA 3H4MA 3GYGA 1F2UA 1Q91A 2OXFA 4IXNA 4EHLA 4DMHA 1OLXB 2C7BA 1B3BA 2JBAA 3O1HB 4GX1A 4RVFA 2ECKA 4O2BF 4WK4B 5EZ5A 5JCOA 4BTVA 1J8VA 1KETA 1P5HA 1TA9A 2KI5A 2L19A 3KAPA 4A16A 4D8XA 5MN6A 1X7DA 2ODPA 1KZHA 5EJMA 3LRPA 3GOHA 2YWCA 1FVXA 1T4GA 1XXHB 3OUTA 7REQA 3ZXXA 1E6MA 3R6GA 3TR6A 4A26A 1WLSA 3I73A 2FPGA 1T9AA 2P9ZA 3SEQA 1AA6A 1QIMA 3HXOA 2A3RA 2Q6TA 2B2CA 2Q3EA 3GFTA 3M1AA 1VPLA 1BXRA 3PUZA 4D79A 5LQRA 3ZHXA 1QRSA 4DEVA 1TEXA 3BFKA 4YDQA 4LRTB 1GFIA 1A4UA 2OC4A 4O2AF 1HY3A 3GJYA 1XYVA 3IPYA 1A8SA 2LRHA 4D44A 4F7WA 4F04A 2R1UA 4DR4B 3EFHA 3WX0A 4ZEVA 5LZ4A 4AJHA 1AQUA 4G9GA 1P0MA 3TLGA 4LXQA 1ND5A 2XADA 4O2LA 3QUCA 2WSLA 1K9SA 3RRYA 4WAUA 1QSGA 1DFHA 1AQIA 2A35A 4ND7A 1KQNA 3JD3A 1IQRA 3OLZA 1FE8A 1EFRA 1GO2A 1E0KA 1ST3A 2VJOA 4HJRA 4DMRA 3T5AA 1X87A 5GM1A 3WB9A 4BNXA 5LB2A 3QHAA 3RYFA 2GBIA 1KF0A 4H60A 2ENUA 1YTLA 3CE9A 4M0MA 4U7JA 3DKPA 5AHWA 4BRWA 4CM7A 1TA0A 4UVGA 1SQ6A 3CVUA 2EV9A 3OWHA 5K4HA 1KHTA 1PT5A 2I9PA 2RGAA 2Q5IA 5IUKC 5E6UB 3TMKA 3ZQUA 5JQGF 3E5MA 5JS6A 1ZIXA 3CEAA 3EPJA 2BMAA 1TGYA 2ZWVA 1E1LA 2O1SA 4F9EA 1RAEA 5HJ7A 1DKLA 3NLLA 5JJKA 1L5SA 1G1AA 1XZBA 2FLWA 1OH8A 1NAHA 3U7HB 5FL7D 3E23A 2PV7A 4JK3A 4E33A 4E70A 2IHJA 3ABIA 3FI9A 4R2JA 4Q4DA 1P2BA 1X15A 5HR5A 4NICA 5J2TF 1DQNA 1QAMA 2PQ0A 2HK8A 1T8PA 2FZ4A 3V1YA 4NR0A 4QRHA 1NBWB 2Q5JA 1E9DA 1NKVA 4Q1FA 1O54A 2AXEA 5F5NA 4DA4A 3SVTA 4PU0A 5DEOA 3PR1A 1J39A 2AEMA 3NYRA 5EWMB 3A32A 5C7YA 4OMUA 5DTRA 3R5XA 4C21A 1ZRHA 1ZMOA 3IDOA 2AQHA 2UXBB 4WNIA 3COJA 3OFVA 3RODA 2XCUA 3B9PA 3HTXA 4ZQFA 1URPA 1VIVA 4MVJE 2X2OA 3TTYA 1E1KA 2B0CA 2V4UA 5EYPA 1XD9A 1EHYA 5AYVA 2ARKA 3V6MA 4QLBA 1QIKA 2Q5LA 3G68A 1G16A 2IU3A 1FQWA 3A4VA 3CM0A 4FYKA 4ZDJA 2AJBA 1E18A 5DVZA 3MGCA 4OXIA 1H4TA 2FZKA 1FYEA 4RMHA 5FNVB 3UV7A 4FB4A 4JC8A 1FX0B 5A5EA 4CL8A 1PDWA 3BIJA 4QPZA 3CWZA 3VR2D 2P69A 3NV7A 3OQBA 3VKGA 5IVIA 4KBYA 2G36A 4Y98A 2ACKA 4REMA 4PYMA 1YS4A 2Q6KA 3AF0A 4R98A 2HMUA 3LQ1A 1XJWA 2X8WA 5EUQB 1U65A 4ZQGA 5KJFA 1RKVA 5M5BA 2EIHA 4N8DA 1VL1A 3TTTA 1A9OA 2OT3B 1YQDA 4PNEA 2O8CA 5BRAA 4RZ2A 6ABPA 4RKQA 1Q0RA 3VKHA 5JXWA 1NVXQ 5ITWA 4YRAA 2WYIA 3P7MA 4UREA 2JD0A 1G63A 5J1TB 5EZYA 3HKDB 3OP4A 2XQGA 3LQYA 2O7VA 3EH1A 1ELOA 2AOWA 4RD3A 1PI3A 1RRPA 1Y4SA 1USKA 4M1OA 4QNMA 4RSGA 1KFBB 3DT6A 5EQFA 5F5XA 3WL7A 5A0TA 1H2YA 2B2NA 2IPLA 4UBMA 3KOWA 4E1VA 1GGNA 1R0XA 3LPNA 3UGQA 3P0FA 1IIRA 1ODIA 1FMTA 4EYGA 1XP5A 5MDHA 3R20A 4Q9KA 2EHJA 2W2QA 1VE9A 2XBLA 3KOYA 1AUQA 3PDIA 4LDPA 4BNNA 4HFMA 1QFXA 2QGFA 4Z1MD 4XWWA 3SC2B 1C30B 2GAIA 5A7GA 3L8MA 3AY6A 4B35A 1JKJA 1L5WA 3OIGA 4X92A 4ZT4A 4KE9A 2H63A 4EYKA 2EAUA 1OILA 1TRKA 2F17A 2GZRA 2YOHA 2XF2A 1HFEL 2IEGA 4AU1A 2PUTA 1UMCA 2Y1KA 1XRQA 3B2NA 2PEYA 4IZIA 1QHYA 4BQFA 3ZOZA 4D4HA 4ZK6A 4D4LA 2C0QA 1LU9A 4CN8A 1P0IA 2P77A 3LLUA 4AMZA 2X6QA 1PLJA 3SR0A 4XTRA 2Q8PA 4RLSA 3GLIE 1Z18A 2I4IA 4PSDA 4WTOA 1QHSA 4N3GA 4FYVA 1L5HA 4R2IA 3SS9X 5DLYA 1AUOA 1KAQA 5H5JA 1IONA 2IYRA 3QJGA 3RIXA 1RYZA 4PRYA 5FLEX 4AZ3A 1DU4A 2GD2A 2ECPA 2WR8A 2WMOB 3HO6A 2LV8A 3CH6A 1T13A 3BHIA 2P9JA 1UOOA 3DL2A 3FFXA 4LQ4A 4F86A 3EH2A 2TYSB 2Y76A 1E6CA 1Y3IA 2BFDB 4YUVA 4HLNA 4DZRA 1WRBA 1Z5VA 1ZK1A 1L7EA 2JARA 2YV3A 3EA5A 1AUPA 4W82A 1IN7A 2ACWA 1Y89A 2D1YA 3H1TA 4LYJA 2GCNA 3RAPR 3EASA 2R8PA 2ASEA 3WYEA 1BA2A 1INLA 1KOJA 2ZSAA 1A9PA 3JQQA 5L45A 1CZKA 2VZEA 3Q1LA 2PRYA 4LYEA 1GGHA 2DC1A 3L6BA 4CCWA 2WB2A 2WWGA 2PV0A 4BNKA 1B8NA 1IMJA 4POAA 5B4VA 1IMOA 1ORHA 3A2LA 1NF3A 3H11B 1N4DA 2H4XA 3HADA 3N07A 2IS2A 5KYWB 2AGVA 3M2PA 3ESDA 1CRQA 5IN5A 5K6AC 3MW8A 1YTUA 2H16A 3M8KA 2I2XB 1ZI9A 3OFSA 2Q41A 2WHQA 1GGEA 3KTOA 3VZQA 2P8JA 1Z7GA 3CEMA 1V5EA 3PU6A 4WFQA 3N8GA 1Q7RA 2FFAA 3VC1A 3W8DA 2NUPB 1A5BB 2OHVA 3GZNB 3N3AC 2DY0A 3RSFA 2LBPA 5E9WA 2WJGA 3VUEA 5I8WA 1NFRA 3WYNA 2AE1A 1BGVA 3WR5A 4ZEXA 2OM2A 2VLBA 1BFUA 4HQLA 3T4EA 2FRDA 1B16A 1CUAA 2GRUA 1F14A 2HDOA 5HE9A 1R8SA 3TUZC 3KQQA 1YQUA 3D3NA 2G1JA 4JI3B 2A9RA 3QLVC 4YWHA 5I45A 3D6TB 4KXNA 2MSCB 1T4BA 2WRZA 1D2RA 5DNAA 2NXCA 3EXHB 4YV2A 2VSXA 1LEHA 5CH5A 3E35A 1N57A 4XM0A 1RPZA 1N6PA 1B00A 3V8MA 3ZHVA 3R7WA 3W2GA 4JEIA 2CXRA 3NHBA 2R8ZA 3EVTA 4YRZA 4FKMA 3JQ8A 2YBEA 3V1TC 1RYHA 2ZI5A 1IXSB 1GUZA 2R751 4FYPA 1U2DA 1WEKA 2YV5A 3WIVA 1ESDA 4FDUA 4B5LA 2AB0A 3MJDA 1WDWB 4BLPA 2HXSA 3KWJA 4QICA 3DTVD 2X3UA 2O5VA 1W52X 1UJBA 4GX2A 1V1RA 2XY4A 4IILA 1XWIA 4B75A 3VPBA 5LWHA 2E4UA 1BYIA 1GCGA 1N1MA 1ZUD1 2IJGX 3G1WA 3IIIA 2DPLA 3L6EA 4YTEA 3TL3A 1HEYA 4Q3AA 1MDFA 4ARUA 1NHWA 4UHEA 4EMSA 2FUG6 1NYTA 4KVGA 1NJ5A 1XALA 1PUIA 2XE8A 2WWRA 1YHNA 4BLOA 3N2KA 4IIFA 2J32A 3DEKA 3OTIA 5EJ2A 4F9FA 4EKYA 5LMUB 3AOGA 3VAAA 2FN8A 3AUFA 2ZBPA 1CUSA 1L7DA 2FAXA 2VKTA 2ZRJA 1Q92A 1U7UA 2ERYA 3S7TA 3LSTA 4J0DA 3QLUC 4UUAA 3ZV5A 4RZIA 3ZH2A 5FR1A 2Q0QA 1XTRA 4B1FA 1QO9A 4EYQA 1EH5A 4D26A 2O0HA 1U3DA 1RI3A 1TKAA 4PYQA 3A9SA 5I9MA 4DLLA 4TWJA 3V4PB 1DIAA 2EHDA 1LWOA 4UEJA 1IY1A 4MRVA 3W78A 4HG2A 3DE2X 3PQFA 1BROA 1R6BX 5LXTF 4CG1A 4DC1A 3IUBA 3D6NB 5INTA 1IZZA 3H9JA 3I6ZA 3IO5A 1OFTA 1AMUA 4Z4HA 4Z9FA 4KWEA 1X2BA 4LHXA 4J1NA 1TT7A 3FSGA 3VPGA 3FDIA 2IVZA 3WLRA 4EENA 1O08A 4JYMA 1U9IC 4CNBA 4OQEA 1Z2NX 3PNLA 2FVXA 5HXAA 3HPQA 1U4NA 3RCBA 1SC1A 1OPRA 4G09A 5E1MA 5DPMA 3I5AA 1TMGE 1M8PA 1X38A 1WPQA 5HSGA 1MIOA 2NVBA 1HZZC 1PFGA 1TTHA 1ZXXA 2BMDA 3F4KA 3MBOA 4Q15A 3HN2A 1I4TD 2QZJA 4DDWA 2A4KA 4UAVA 3OF2A 4ITVA 1JEAA 1SIOA 3PC8C 4D9HA 2OV4A 1TIBA 1XZ8A 3GGOA 3I1IA 1DSSG 2UKDA 3CLUC 3NXSA 4O1IA 4R71A 1J21A 5IAJA 4LNUA 5HK8A 2HDWA 1RZUA 4OF4A 2A9FA 4R1PA 3TLYA 4Y1RB 1CY7A 1AIPA 4CEIA 2Z2ZA 1TCCA 2XPCA 3FWKA 4HGZA 2OXIA 4CTNA 4EUSA 5G40A 1GPUA 3G6KA 2GNPA 2ON6A 5JZ9A 1N6RA 5EJEA 5AOBA 3RBXA 3TZCA 1NBOA 4J07A 3PGLA 3IP9A 4EBBA 1GPLA 4WGGA 5HKBA 2DWPA 5JAOA 3KVRA 3PF8A 2VHCA 1M0TA 4W7HA 3L82B 4TQUS 5CM9C 3VO1A 5KNDA 3DHNA 3NT4A 3GX1A 1F8UA 1K68A 1B6SA 1QGZA 3O73A 2CDNA 1RXVA 4F6CA 2QU7A 2YZMA 1GZHB 1FFAA 2A0UA 3GFVA 4EEKA 2C5FA 2AJDA 2HJGA 1KC1A 3T99A 2WTUA 3LE8A 2PGXA 1E5XA 1JLRA 3D8SA 2XMGA 1NR1A 1W0JD 4EAAA 1MB9A 1HNZB 4PS0A 1GSOA 3PI7A 3JZAA 1ODTC 4QLAA 1A2QA 4Z3DA 4EVSA 4PQFA 2YMMA 2PUWA 1UBEA 3GRUA 2PGAA 5BYAA 2ANBA 4S35A 4HDAA 1L1FA 1BMFD 3LBYA 4IOJA 1G64A 4E14A 5F23A 1Q6ZA 2Q1WA 2I2AA 2EBHX 2FN9A 4CL3A 4KRGA 1TGVA 5K3AA 3H1GA 3ZWXA 1Y8QA 1IWOA 3R76A 4PLVA 1NUPA 2ZZKA 2HA6A 2ZQZA 1DQZA 3LY8A 1SHKA 3L7CA 2MT9A 4IDBA 3VH3A 4H6XA 4FHEA 1KEKA 1ZHOA 2QLBA 2O0JA 3BGDA 3H5WA 1ZZEA 2A5DA 2JIPA 5B3LA 3K70B 4NBRA 4KSBA 4A8HA 4NOLA 2IXGA 3G1UA 1J9GA 3P0IA 5KNDH 1F7VA 4WLFA 1QOZA 2A84A 3PLNA 4JMLA 4MQBA 1Z6YA 3GMDA 2QVLA 4U02A 4YACA 4BZZA 3CVYA 4M7RA 5F1YA 1BFKA 1E94E 2FPSA 2HWUA 2VBCA 5IXYA 2CNLA 1HT3A 2X4DA 4D8WA 5EESA 4E32A 3SKXA 3V2UA 3D5TA 1Y1QA 1C2TA 1FDSA 4ENSA 4ZDIA 2H2IA 1T1GA 2VC2B 2OQ2A 1JPJA 3U56A 4AY5A 2QOEA 1O97D 1IXKA 2W98A 4CIBA 2UV8A 5B4TA 5HOEA 4PQGA 1UQUA 2PO7A 1JXOA 1MQ8B 3TQQA 5IXJA 4MV0A 3LTEA 2JIBA 5ALMA 1W59A 1FVOA 1YS1X 3D0OA 4I08A 1F3LA 4N48A 2BJWA 1VE6A 2QZPA 3C8ZA 3E84A 3E0QA 3VUFA 3R6TA 4RPIA 1UZLA 2Q49A 2WDZA 1JV2B 1GQRA 1B15A 1ZQ1A 4BVBA 2V4ZA 1YVUA 4YJGB 2Q3HA 4AX8A 5D7BA 1DXYA 2QMQA 5BSFA 4BUZA 3HO8A 3GFQA 2G82A 4FQ5A 1H1DA 1YOVA 4Y6PA 4NJOA 1BDBA 2Q28A 3D6FA 3RTCA 2JFUA 3PB3A 4RHXA 1D8TA 4NBTA 5KX5F 3NP9A 4BNJA 5JMOA 1R9GA 2H3HA 1TD9A 3T1YB 3OZEA 1GYQA 4DBZA 3C3CA 4RM2A 4LXIA 4HNAA 4KIJA 4KI0A 4I8XA 1K1EA 4F3YA 5JI2E 5JROA 4WCDA 2GM4A 4E4TA 4XVHA 3JASA 2OQVA 4TXJA 3VNQA 1VHWA 3OD5A 5JY6A 4KWHA 4RGVA 2PKEA 5JG7A 2RGWA 3BWCA 4V0SA 4PAGA 2XQFA 3SKVA 4FZ3A 2Z6UA 3ZWQA 1Z4MA 1ADBA 1JR4A 2X4LA 4H17A 4ZCLA 1Y6GA 3ZHRA 4B6GA 5KSPA 2G7ZA 4IJKA 2AQ8A 2XHEA 3KSZO 4H35A 3QUQA 3VBCA 1OU4A 2F3TA 4K8RB 4F71A 4F12A 2ATEA 5ALYA 3N0TA 4EG4A 5CK5A 4BVLA 4Z6KA 2RAFA 3QE4A 3EAGA 1L5MA 3ZNPA 4MGKR 1KVSA 3QELB 1JJBA 1TEVA 4TYQA 4G4JA 3M1YA 5E4TA 5E7MA 2H29A 4E88A 4X1YA 2EJUA 3JXEA 5IK2A 4I6JA 3RVRA 4TLCA 4OHXA 3DLPX 3E53A 2BUBA 4PFSA 4HCJA 4OHMA 1E5VA 1VJRA 5FB3A 5KU7A 3UGJA 4L6AA 1M75A 1RWOA 3PX3A 1CE8A 4C43A 3U19A 4BE9A 5CDYA 1OWPA 3ISJA 2JFXA 3CURA 3L0OA 4LRUA 1WCV1 1Z7WA 1AXRA 3HYNA 2Z2KA 3HU2A 4CHGA 1ZU5A 1FXWA 4P4GA 5AXBA 1UQTA 5H82A 5F1PA 1U7TA 3LWNA 1DCMA 5HG0A 3LKBA 1R4MA 4GICA 2QDXA 6LDHA 5F51A 1IUNA 2ADOA 2NPOA 1NFQA 1MQAA 4KLAA 1NJ1A 4H0CA 5LQSA 4K28A 5J9FA 1QH1B 4DUGA 3G79A 1FDRA 2HSJA 2AL7A 2YWEA 4OK5A 3EOAI 4PZZA 3RROA 1K5GA 1GNSA 3WL6A 4DDVA 5KOJB 1Z6GA 4NNJA 1E62A 3QF4A 2FOXA 1E64A 2ERXA 1J5PA 1QFYA 3HB7A 2WG1A 4BNMA 2L17A 3JY6A 5JO9A 1U2GC 4PX2A 3HO1A 3B3AA 3COSA 4CMAA 1RLTA 3M81A 5ALTA 4D9FA 4CMJA 4D9CA 2C7RA 1QNLA 3WRWA 1NNUA 1G55A 1U8AA 3P19A 4Q3OA 1CY2A 3RG8A 1QAQA 3T61A 3TCNA 2W8BB 4G8BA 3OAAD 4MH0R 2C2YA 4CKCA 3A14A 1MKYA 4MHTA 4L8WB 3BSSA 5K3BA 4I9NA 5FFNA 1J8QA 3GGDA 1L5FA 3QY0A 1G5TA 5HQ3B 3TLCA 5B5SA 5JPDA 3WGIA 1V4NA 4EW2A 2LXNA 1Q5PA 1T8YA 2ZPUA 3RGWS 3NWBA 4R1UA 2IHUA 4P53A 2CXXA 1C4WA 1JEDA 3TEFA 3RYIB 4YCNA 4RC9A 1IN5A 2CWDA 2WUEA 2VNSA 4JVLA 1QC5B 2DUUA 5ALGA 4NI5A 1M2OA 4ZK2A 2YIJA 2QK4A 3ZY4A 3QF7A 2O14A 4AECA 3BTOA 1JIUA 1N8TA 1ZR2A 2HYDA 5JAUA 3K9LA 2FP4B 1RWMA 3TX6A 5K0JA 4B4DA 4IHJA 2AUNA 2PPVA 2FV8A 2A5LA 2P78A 2QR5A 2WVGA 4OATA 2D2IA 3O8NA 4PLPA 1F2VA 1VCMA 4FWIB 3DP9A 1KY5A 4ZQIA 1N0WA 3IAUA 4IW3B 4P4TA 3RRFA 5B12A 4M6WA 1E60A 1NZFA 4KQXA 4G85A 4RF4A 3U7QB 5B1IA 1G3MA 2WM9B 3D3WA 3G7UA 4LWQA 3VU1A 1T5OA 2BFOA 3OY2A 3UG7A 3J81A 1VKJA 4KXXA 2Y4NA 4FFVA 4JIMA 1UJ2A 3EF0A 1XEWY 4D3ZA 1WMDA 1SRRA 3COZA 3E8MA 3UWDA 2C2ZA 2DTDA 3WMFA 1EVLA 2ZBGA 3QRWA 2H4JA 2XCLA 2IZ7A 3IALA 3I09A 1EVJA 3K1YA 4OKIA 2JIZD 2B8WA 2UZ1B 3T7DA 5BQFA 4V39A 3OI7A 4R1NA 3AF6A 3WKDA 1DCTA 1QTRA 1THMA 4HB4A 4CG0A 4QSMA 3TIFA 1WQ1R 2AFHB 3I0ZA 1EK2A 2V7GA 2AK3A 1JLSA 3FPJA 3KLOA 2W7TA 1CDZA 4MHSA 1A76A 1YB4A 3SQDA 3KQKA 1KWGA 2OBLA 3PXXA 4I81A 4BBJA 1VA4A 3AUAA 2PX0A 5KJEA 1CIVA 1R8YA 1SVMA 2CHUA 2Y1LA 3GVCA 4IDCA 5DXJA 5DTIA 3DBHB 4K88A 2B5OA 2PGJA 3W8EA 3PGKA 4PHCA 2GS9A 1IHYA 4YLYA 4CXMA 4L4ZA 3BB1A 3N7AA 5FQNA 1DL5A 3AJDA 3BXGA 4TTVA 5T3YA 2OKGA 3D6HA 3W7AA 5CU7A 3Q7IA 1GAEO 4UTPA 1J5EB 4OHYA 2YJZA 2BM0A 4RTRA 3FYHA 4EFDA 3ZKAA 3HB4X 4UXJA 2FPIB 1HLDA 3HE3A 5HBRA 3OZGA 1Y7HA 4FGZA 4BNIA 4M36A 1WKCA 1IJEA 5EJ7A 1QOQB 2OGUA 4LV5B 5IJWA 1ZRNA 2RJOA 3PJDA 5AT1A 5IMBA 3QMVA 3TKLA 4WECA 4U5QA 3E9NA 1BMQA 1DTWA 4XW2A 1YVPA 1CJBA 4Q3DA 1JE0A 4P5EA 2C97A 3NATA 2AOUA 3O95A 3R0XA 4R0VA 2PRJA 3TI7A 7ADHA 3BG5A 3GRRA 4I1IA 3I9OA 3ZCSA 1SXJC 4YJ2F 2AC4A 4JYAB 5KTYA 1JR3A 4L51A 4QO7A 4OB7A 1R6DA 2XWSA 3DWFA 3IUNA 2CFIA 1SCAA 2JHAA 1XJQA 2Q3BA 3DMHA 3MINA 4EB6A 1XMPA 4CIVA 1P9OA 1BCRB 4F3NA 2QM3A 4LOLA 1NQWA 2P5YA 3D8NA 4OL0A 4HLUC 1ECFA 1CFJA 1JQAA 1NU8A 2REXB 4KZKA 4PZUA 4OFZA 1JX6A 1W85B 1BFDA 1C8VB 3KKZA 3CZ5A 1UK6A 3R9XB 1SD2A 1ODJA 3GJ5A 5ALKA 1JZSA 4US2R 4XJVA 1HX7A 3G82C 2FG5A 1NT2A 4I50B 1J8YF 3N7TA 1FQOA 2FCRA 1KYIA 2MWMA 2V03A 3IT3A 5CJPA 4EZEA 1N75A 3HVJA 2GJAA 3KSBC 3GFBA 1PJQA 2QSUA 2XMSA 3IBFA 2DP4E 3TINA 2UVQA 1T5LA 3RYCA 1R9JA 4N0PA 4LVOA 4QU0A 1YH3A 1H2HA 4RK7A 4AS3A 1NW4A 2PSFA 4FMDB 4JQOA 4OMDA 2OO7A 1YZNA 3NPAA 4JZYA 2ZJ1A 4L08A 4LZNA 3RHFA 4F8EA 5HS6A 3OM1A 4K6OA 1E69A 2QRHA 3F8TA 4RD2A 4F7DA 4IDGA 1XK7A 2WJPA 3I9JA 3KZCA 4HAXA 3AIMA 5FORA 3ZV4A 4G97A 4R01A 2GEFA 4TTSA 1SH7A 2HQRA 3SEAA 2H8KA 5LVAA 3HY6A 3IAEA 1XZMA 1XKTA 4B2YA 1G291 5F4BA 1G4AE 5I9SA 3HZHA 1VCIA 4Y2RA 3IESA 1M9NA 1M2VA 1N0UA 3GD7A 4MR8A 4MI6A 4PG6A 2GNAA 2HBRA 3S55A 1VHTA 3QE0A 4DLNA 4CEJB 3A4YA 4AKHA 2QGZA 1WMBA 4HNGA 2FZVA 1EFPA 2GKSA 2NAPA 4O4IA 1H94A 4JLOA 4X1IB 4M0KA 5AM3A 2RIPA 4N03A 1FFWA 4CF4A 1RYMA 1QZZA 2RI6A 3CX6A 2V4MA 4AMBA 1QKKA 3AEQB 2CMDA 1TFRA 4JT4A 4X41A 3ZGVA 4IEEA 4AROA 1OZFA 5FKJA 2FSVA 5LCXA 5JV5A 5B1DA 4Z2YA 1NV8A 2EJBA 2XZPA 4BMOB 4RTLA 4CW7A 2XNJA 1WXEA 4Y2XA 3B2QA 1H4VB 2PZLA 4I4LA 1GV0A 2GR9A 1OH6A 1XQXA 3KZVA 3RUEA 3VHXB 5EMMA 3VYRB 1IN6A 1PLLA 1GZ5A 3UY4A 4BZPA 3IEVA 4AICA 2HKIA 5E9JA 3S2GA 4E11A 5SY9A 1SVLA 3SYLA 5DIZA 5CEJA 3PT5A 1P31A 1X8KA 2I6UA 4TV8F 4UBNA 2ZUEA 4FOSA 1JHUA 3OA0A 1N2CB 1RRKA 1Z56C 2MMCA 3DULA 5BW4A 2Q45A 4AJ9A 1OFVA 2AD5A 1EZ1A 2I67A 1KH3A 2QTRA 4RCZA 3S29A 1NRIA 2ZCJA 4ZIRA 3DR5A 3PT9A 4J6EA 3TSYA 3TZLA 3B6KA 3FFAA 1IJFA 4UHDA 5KTSA 1O5IA 2FFQA 4IPTA 3K0AA 1OGJA 3BFVA 4MZDA 3VZPA 2B6HA 5C51B 3ZUPA 2EF1A 2R4TA 1X3SA 2CMGA 5HIAA 2H2GA 3TXAA 4QOHA 2GSWA 5KPDA 1HNWB 1L7AA 2D5IA 3ZX4A 3FUVA 3E5RA 1R0BA 2REBA 1ECLA 1FP4A 1RM4A 2JFQA 4EQ6A 5IH7A 3AF5A 3M4XA 1DWUA 3R3SA 4ALNA 2NW6A 1P6UA 1PR6A 3NWPA 1EXVA 4A0FA 4P7GA 2GRAA 3W5JA 1VL2A 4KODA 1U7OA 2XUAA 4HDMB 4UMEA 1ZVQA 4JBNA 1XAJA 4L5BA 5KYYA 2X2FA 4YGXB 5U4QA 5EWJA 4D96A 4KYUA 4AUEA 1W29A 1VMEA 2VYND 2JCSA 3Q41A 2DXIA 4R8SA 2AKYA 2ZSUA 3QK7A 2RGUA 5J59A 3V4SA 1NXVA 5COAA 4RY0A 2NNLD 1E7MA 4TMXA 3TFOA 5G53C 2GVNA 1I2CA 2QJTA 2R5WA 2BEVB 1KE2A 5LKAA 2PTGA 4EPWA 1UBCA 3SE7A 1XTPA 4P1ZA 1R4NA 5AKLA 3CISA 3LPDA 4LDAA 4F4DA 4CNQA 3MK31 1FDWA 2ZJBA 4IIJF 4BBZA 4E5UA 5BQOA 1AB5A 2CYBA 2DBZA 2ZJOA 3PA8A 4GOND 4FR2A 1L5VA 2C5AA 4GP6A 3E18A 5NLLA 4D4KA 5EAIA 3L8FA 5KHLB 1YE5A 1XELA 2P4SA 2XVMA 3C3BA 2GM5A 1E3WA 1OTXA 2C8VA 1SCIA 3CWQA 2XDAA 3KCNA 3TOVA 5IC5A 2OCDA 4HAIA 3UYLA 3RFUA 4QFBA 3FPSA 2RG7A 3PQ3A 3C7AA 2QXYA 4DRXA 3QITA 4FMCF 1E2LA 5JCOC 4F5YA 1E6WA 2C83A 3LPAA 1KRXA 2UVDA 2UYQA 2IQIA 1A4RA 1A8PA 1P77A 3FIUA 3HUEA 5T3UA 2D0IA 4LJ4A 4CKEA 1WNTA 4ZYXA 5SY6A 2I9KA 4BZWA 2IU4A 3DOOA 2QLLA 3UHPA 3VH2A 1SPXA 3IV7A 1MBZA 3LWBA 4H7KA 3W5UA 1K3TA 2VHWA 4WJKB 1T1IA 1ML3A 4TL7A 5HIKA 4U2EA 4GG1A 4XX0B 4TGLA 4DRYA 1ONSA 2QAGC 3DHYA 2V45A 3FDFA 3PYXA 4ARAA 1NVUQ 2WD8A 3FHTA 1O8BA 3NOVA 4TROA 5T4EA 3GEEA 1YFZA 1POWA 4CLRA 3WC4A 3QOWA 3ZDFA 4QGHA 2B1IA 3DYVA 5JRJA 1VBFA 3WY9A 2ZRPA 1YRAA 3OTOB 3QNUA 3PG5A 1CJUC 4A82A 3H5TA 5L6LB 1I9GA 2EX0A 5ELXA 2DR0A 4HAVA 1G8YA 3I1JA 4YAWA 4WOPA 1WDLA 3PJGA 1NAIA 1XNJA 1YDMA 1DKOA 1PZNA 2PA3A 2WP8J 1JBQA 2ZREA 3B1YA 3MSCA 4JROA 4AP5A 4X7PA 4B4VA 1FSZA 2FKAA 3DVSX 4XI9A 1Z4KA 1N5MA 1ZESA 2AG1A 3D3QA 4RIIA 5JS2A 4PW0A 3NUQA 3MJTA 3LBHA 1CHNA 3EG9B 3ZW8A 2OMKA 3VYUB 5IDYA 1SBHA 1NOJA 4D7AA 5TF0A 1W2GA 1ORWA 4X0EA 4TV9B 3FD8A 4NPAA 1JHDA 2Q2QA 3I8SA 4V0QA 1ATZA 1X1EA 4PXAA 1GNLA 2E6UX 3T5GA 5FPKA 5LJIA 3TGPA 3ETGA 4DMMA 2FVYA 4Q37A 2VXBA 5CAEA 4MQ4A 2BFFB 4XR9A 2QE6A 3HLYA 4RV4A 1OASA 3KLPX 4IXWA 3ROPA 1FZQA 3MXOA 2H0QA 5BN4A 3HJNA 4CLOA 1OHHA 1QVRA 3ZJ5A 4F8YA 2D74A 1D4AA 4YMSA 3NPMA 1JDBB 2GPNA 3FLMA 2GASA 3A8TA 1OLSA 3DHWC 4OUKX 2MR6A 3OF5A 1JBEA 3DO6A 1UKCA 3AGQA 5KTPA 1Y9EA 3TW0A 2IP4A 3MLAA 3V5NA 3UXMA 4RD6A 2XT9A 1FJ2A 4B87A 4EG0A 2JI7A 3MJVA 1Q1AA 1Z38A 4CTMA 1KA9H 2V1XA 4DTIA 4X60A 1SIUA 2V7XA 1F51E 2O2XA 3BHJA 3PTAA 3ON5A 4ZVPA 2GCPA 2HBZA 2WJ4A 2ZXEA 1WS6A 4XQCA 4DIKA 2C58A 5BVHA 2DH6A 1T0JB 1ZINA 4EKGA 4BX9A 3ZVMA 3AF3A 2VHEA 1NVTA 4G1BA 2LE0A 4D5GA 4E4YA 3BWXA 2C2BA 3CF2A 3EZFA 1KGDA 4OHWA 4IKPA 4KQFA 2QI9F 1HMYA 3A1DA 1KDTA 3B48A 4O5AA 4ZCPA 3UB3A 1PYOA 3VMFA 5C9ZA 1QP4A 3PNQA 1KY4A 1H8HA 1AKMA 1EG7A 1DAMA 2R9VA 1LZLA 1XO1A 3O47A 3FI0A 5EXXA 4AJKA 3ISTA 2GEJA 4GHWA 3VA7A 2OFOA 1L7RA 3VNAA 1FC0A 5HZHA 2R97A 1Z6ZA 1EBFA 4IDEA 3ZOKA 4EHBA 3L40A 2V6MA 3OHPA 1QUEA 4OBBA 4WK2B 3PR2B 3TGWA 1HSOA 4NCXA 1XSEA 1EP1B 4RIHA 1OBVA 2G70A 4AG6A 1K8QA 2K6GA 4ZRNA 5BV2P 1UBJS 4O4JB 4KAFA 3JZFA 3F9RA 3IV6A 4GECA 4KXYA 4D6YA 5AVXA 2PJRA 3NV9A 2A86A 5CHYA 4ZZIA 3EIEA 3DMGA 4RPHA 1NMSA 2GCOB 1VM6A 1YR6A 5LYYA 3H9BA 1JIQA 3GBSA 3NFYA 1XHEA 3PQEA 3HBJA 4I4TF 4N40A 4EA9A 1FEZA 2MSDB 1L4EA 3HSSA 3ICPA 2YWFA 1J2RA 3JYPA 3OFKA 4EGSA 5CLJA 3AESB 3HYTA 1GUAA 3WGTA 5DWVA 3LCMA 2QSJA 3PRJA 3P5SA 3CLUD 3EDCA 4YB8A 1KJNA 2O54A 4EG8A 1YMUA 1TQ8A 1ABEA 3TLEA 4D1YA 5JH7B 1P61B 3BJZA 3IXQA 4JWTA 4YRKA 2O2EA 3Q87B 1FS6A 3U5TA 1KK3A 4N0DA 3TLAA 5E3HA 2O5CA 2IYNA 2EBFX 2OOKA 4E3ZA 3KHKA 1HQDA 1RHMA 5ESRA 1PR2A 1ZI6A 5E7IA 5DNDA 4MYUA 5D86A 1TLTA 4MR7B 2Z08A 1EJ0A 2ZATA 5J2UF 1TJ3A 4ZQBA 4FXOA 3ITDA 4ZAZA 5TF4A 1AKEA 1Q7GA 5JISA 3V1NA 2IEZA 2PZ8A 3NOOA 1G20A 1RTTA 2C29D 1L7MA 4BNHA 1NWHA 1ZOPA 1TUEA 2DPHA 1A8HA 1P0FA 1Y33E 2B98A 2E9SA 2NTVA 4X8MA 4ZCQA 2ZIUB 3TVTA 3ZWPA 4Y2GA 2EW1A 1P9RA 2AFHE 1FFYA 3U4QA 3E7XA 1XCOA 1SVKA 2BR3A 3DZGA 3H2HA 2FMKA 5LA6A 1Z4OA 3JAWA 4YPVA 3EVAA 4L73A 4TT8A 4NBLA 4UHCA 1LNZA 2OCPA 3GRAA 2WFMA 1M7GA 3NP7A 1NBAA 1DOHA 3ZJUA 2ZIWB 2ANCA 4OCZA 4MDEA 3L7LA 5ICFA 3SZUA 4BQRA 5C5EA 3INRA 1U7XA 4Y9UA 2I7XA 3AGPA 5DK4A 4EI7A 3KSDO 4YASA 3REQA 2IH2A 2OORC 3PE3A 1GKLA 4CQNA 1ZFNA 2HLDD 4FLEA 2ZYHA 1GGVA 1N1GA 4IUYA 1TYDE 1YI8A 2W2OA 1SUEA 2O8NA 5I4IA 5JMWA 4TM7A 2RC5A 3OLCX 2VTDA 3LC2O 5EXPA 4ADSG 3U3XA 3RKRA 4UARA 1DG1G 1KBZA 5JYEA 3MYYA 1S5PA 1KVRA 3VX3A 2GDZA 3QU5A 5E1DA 4BB0A 1M73E 4H7IA 1YB7A 4LC1A 1CJVC 3N8NA 3HNRA 1YUMA 1WSBA 2ZYUX 4NS1A 4RA6A 5HFAA 3LVQE 5DP1A 3WMWA 2HYIC 4F5DA 3JWJA 3W77A 1KPGA 4EPVA 1XTTA 3AVUA 1H0SA 2YWXA 3R8XA 3U62A 4AJJA 4N12A 1U90A 4MRPA 5ADVA 2C92A 2QRQA 3KIPA 4BFVA 4CV3A 3LUBA 1N6IA 2DULA 4JI2B 2G3YA 1UANA 3QSYA 2GYVA 3VKFA 2AZXA 1SD1A 1HA3A 4FIZA 3TLZA 4AFNA 2PX5A 5CB8A 4TVBA 4C7OA 2QY6A 3IRUA 3GQBB 2B30A 4NDNE 4RMGA 3Q8XB 3BH6A 1QCYA 3IOYA 5B2ZA 5FLXA 1J0AA 1KEWA 5LQJA 1HOXA 2ID8A 2NAFA 3AHGA 2JLCA 2XUOA 4P38A 2PRZA 3RS7A 1IBRA 1SBIA 2X7XA 1ENYA 1ZCFA 2X8BA 1T3ZA 5JNUA 3AZPA 3RS5A 4WLVA 3QPDA 2VSNA 3ZV3A 3TJZA 1BQ3A 3DZ8A 1EGMB 1B76A 5BSWA 1T2EA 2WJIA 1JL3A 4QYWA 4DABA 2BFEB 3R3UA 3QKSA 1L4NA 5ELLA 2QUJA 1VHQA 3GLGB 3E22B 1WY5A 2HZBA 2ZBFA 3MGBA 3THRA 4K1LA 3QEBZ 1QRTA 1H9CA 3ICWA 3MTQA 3SM3A 4W6ZA 4ZALA 1R5BA 1DBQA 2XQKA 1D1TA 3MGGA 4JDUA 3LGXA 2X86A 1CJKC 2XRYA 1U2DC 1C4XA 2I80A 5J63A 3U16A 2J5BA 2NU8B 3MHPA 1Z37A 3E4CA 2JLAA 3A58B 3BH0A 1KEPA 3AC0A 3LS2A 3GLVA 4M22A 4H59A 4LF5B 4PIMA 1U3WA 1W4LA 3LTNC 3DCNA 4FBLA 5A4DA 1CDEA 1SD5A 3CBGA 3RS8A 4B4UA 4QBGB 3ZZUA 3HDGA 1JQLB 4NYMQ 3H2IA 4DW8A 5EJ4A 2PUFA 4JP1A 2F1HA 2VJAA 4Y6GB 1UCFA 2UYOA 3IOEA 4D74A 4L0QA 1M0EA 1Z16A 1CR4A 2I4TA 1RD4A 2NO7A 2B4KA 3QG1A 4IJWA 3T38A 1B0AA 1NPYA 1NW7A 3EDRA 5CYPA 3TRHA 2J0EA 4XCQA 2WG0A 3NBYC 4WZAE 1RM3A 5KVQA 1L4LA 3K31A 4GGPA 1CQPA 2ZOSA 4E31A 3EG5A 4QVKA 2IBSA 3IIKA 2J5QA 4X7BA 1VRCA 4X91A 1YK0A 2F8SA 1LGYA 2JGAA 3R8CA 3K1AA 2CB9A 2CVQA 1OR8A 2ZROA 4CIDA 5AW4A 1XNHA 3LUHA 4KVAA 4BCDA 4R3NA 2VNJA 2JCBA 1IG3A 3SBEA 3S1SA 1S8AA 1E2HA 2QE7A 3OQ6A 2BE9A 3NAZA 4DWVA 4FGSA 2FA9A 4C0XA 5LBTA 4INAA 2KYRA 1WO8A 5EHXA 2GPYA 3ZDXB 1E4VA 3CRRA 2CLMB 4D4MA 3I8XA 5A5DA 3M4YA 3R7BA 2ENWA 1ZNZA 3R3VA 3TTXA 5HUHA 1OZHA 1U6JA 4MLDA 4TTTS 1USGA 5EZ6B 4KN8A 2E6KA 3STHA 2OSVA 4CVNA 2C0CA 3ABZA 1JVSA 1OY1A 1VTKA 3C6BA 2F3PA 1N7JA 1V11A 1Z35A 3NORA 4FI3C 4N6OA 4PS1A 3SEFA 3JWHA 2A59A 4TOIA 1MW8X 4L5JA 5AK5A 5CFMA 1U2TA 4B9AA 3BAZA 3LNCA 4JQCA 4C78A 4DMFA 3FBTA 1YR8A 2AQIA 2KW5A 4DIOA 4UEOA 5FFMA 1LBEA 5KNCD 3MS7A 1M34E 5DHAA 3AUUA 3IB3A 1UODA 1AQLA 1QRRA 1M5UA 5F4ZA 3ZD9A 2VT7A 3HXMA 3U9TA 2A3NA 4PHHA 2X8JA 3NVDA 3IFSA 5B3JA 5BUSA 4FUQA 4DSTA 1UDCA 1C8KA 3RH0A 4M9CA 1ZICA 4ZI2A 3C6ZA 4KV7A 4MGYR 1XEAA 5JAPA 1GTG1 1PFWA 1VPVA 4MUBA 2GHQA 1G7TA 4HMPA 2ZITA 2FEXA 2PEZA 5C1BA 1KS9A 2ZBUA 2JAXA 4RZ3A 2DFDA 1NQAO 1S3FA 4ZCSA 1BH6A 1OVMA 1I5EA 3FVRA 3NCTA 1P2SA 2D7JA 3RUDA 1IM5A 1ZCAA 3K09A 4M49A 2WV7A 1XMIA 2K5UA 4D4IA 4JWKA 3HA5A 1OROA 1CSEE 4KQ1A 5IT5A 3HRIA 1K9VF 2CFRA 4UDYX 1ID8A 1VIAA 1RCUA 1GM5A 3HKCA 3VR4D 4B33A 2DF8A 3P9KA 5KQMA 1CW2B 1UDWA 2B5WA 4HR7A 2OGTA 5CA0A 4O2RA 3BWEA 1MEEA 4OH1A 5FOTA 2JCVA 3TFWA 4LW8A 2CMKA 1G7CA 1DAEA 3GUUA 1TQ2A 1U2PA 2RGNA 2BFCB 4I3GA 2WQ6A 1Z0SA 2DSNA 2WF6A 3S27A 4JJGA 2A9QA 3QFSA 1GQFA 1FCJA 1U3CA 2HA3A 4EO7A 3I37X 4NNPA 4R51A 4GPIB 2AVDA 1B0ZA 3E3NA 4RH1A 1PJBA 3CRZA 3R5KA 2QW0X 3AKYA 2BR4A 2B5VA 3BHMA 3QW2A 3F96A 4A6XA 1BOOA 1I4EB 3CB4A 4KFUA 4MA5A 1Y8RA 2J3HA 4OI2A 4R1TA 5DBEX 2IU0A 5C1PA 3QPVA 3T3DA 2HHLA 3A3PA 1E9RA 2P2LA 5IYZA 4ENTA 2GH1A 1R6TA 2QLFA 1VG8A 2QPTA 3TMYA 2WHPA 1LDNA 3KLBA 3ED5A 3OEHA 3BXPA 2P0AA 2QLJA 2WSBA 3H2KA 4IFBA 4OJMX 4PO8A 4BRSA 5JNVA 2R0QC 3ENQA 3ODGA 1LSJA 5BMVB 1BXGA 1X1TA 5HJ2A 1PFKA 3RGGA 2M6SA 1UOPA 4H16A 1ONOA 2BFPA 4RPKA 4EQZA 1YAJA 3OZTA 3HDQA 4GAEA 3KVYA 4L28A 3RJTA 4IJQA 3AKZA 2PS9A 3NRCA 1GL9B 3L01A 1N6HA 1FU8A 4HYTA 3HB1A 5BV7A 4PTZA 5LNK1 3VBEA 2WOOA 4MYDA 5ESWA 2ODEA 1DLIA 1SG6A 3NYQA 4C0WA 2EP8A 3AQIA 5J43A 2YZKA 3A6KA 2QRMA 4KGXA 2BTEA 1GSIA 1EVYA 1XXHA 2AEFA 1BW9B 1K5DA 4LJKA 3SSMA 3AEKA 5HKLA 4WLOA 5H0IA 5HRAA 2VJYA 1NUQA 1SXJD 1XE3A 4JYPA 2VP2A 3H9QA 3UJ7A 3EVBA 2PT5A 1YKFA 4ND5A 4QC2A 3NGMA 3V1UA 4CT4B 5KHOC 4OLAA 2VOEA 2IZ6A 1KSFX 2ZU0C 2IZ0A 3NIDB 1JI0A 2ZRCA 2I71A 5M3BA 3C6MA 1SBCA 4PZ9A 2RHCA 3LFUA 1UKZA 1ZNWA 3E3LA 3VR6D 1EYZA 4DC9A 4E5NA 2IS6A 5FPHA 1P73A 2HTFA 2NSYA 2X40A 4GRIA 5DE3A 3LDFA 2CY0A 1SVUA 5LP1A 1VE7A 1Z83A 4MR9B 1H2BA 1M6VB 1EK0A 1RBZA 5KQSA 1ULUA 3OPQA 5KVAA 1E3QA 3EEFA 3JYHA 2M32A 1XTKA 5FT9A 4TKZA 1SOWA 2Q7OE 3EGWA 5BR7A 1R27A 1V8OA 2Q9UA 5I7SA 2FW6A 3KV3O 4HJXA 5FL3A 2BMJA 5JOQA 2AQKA 4RTQA 1M10A 3AO0B 1S3GA 4KITB 1PVOA 1PF7E 1PZHA 2G76A 2QHXA 5T6BA 2F3QA 5DNEA 3RNLA 2DOKA 1DIHA 2X1MA 5L40A 1CPYA 3QTTA 4UVIA 2BYTA 3FCEA 1KRWA 3NDRA 2HWKA 5AIAA 3HHEA 3O9VA 4AC9A 1G41A 2XQJA 4FE3A 4L22A 3F2VA 1W75A 1XZHA 2WTAA 2A5YB 1NVEA 3CRQA 4ITRC 4Q4JA 1M2FA 4EZIA 4LRWA 1P2FA 2DWOA 4IZ6A 1HC7A 2J87A 1RAFA 4PQYA 3IIEA 1CQZA 1LY1A 2IPOA 4Q6WA 4X61A 3GGJA 1GL3A 2JAPA 3MJCA 4O8CA 2Z95A 4PPQA 4WFIA 3UJPA 3T54A 3V7UA 4ZO9A 5DGXA 2A5GA 4QUEA 4U2DA 4KE8A 4QXQA 5DFAA 4B8ZA 1SM4A 2W71A 3HJRA 4EABA 1QPZA 2F3RA 4RZHA 1TQ6A 2O50A 2ONZA 4H7HA 1LA2A 4LI0A 1JU4A 3SPXA 3TB6A 2A88A 4FFRA 4IH4A 4Y2TA 3UJ9A 1RBQA 2H8GA 2YN2A 2Y05A 4KG7A 4QTUB 1NP7A 4PFKA 5T5QA 2HZ7A 3PK0A 4MYSA 3EHDA 1K97A 4OAPA 2XSZA 4OU5A 4U2FA 3TNLA 3VR1A 5FUYA 4C0SA 1ORTA 1CY8A 3ZHSA 1BMTA 3K0CA 3BJEA 5EWMA 2D1FA 1JKXA 2I6SA 4WVFA 5LBIA 3RUFA 3I9V6 4LBZA 3CVJA 3H9UA 4M7OA 4YALA 3W6PA 5C8YB 4BRZA 4BGEA 4N6NA 3TSCA 3DGEC 1CJSA 4OP3A 1RHJA 4XQEA 2WA1A 1YU6A 3MCTA 2GGSA 3QYFA 4RLHA 3CZCA 1Z45A 1JIKA 1E2IA 3UJAA 1H9BA 5ALLA 4ZYUA 5CR9A 3B1ZA 2XE7A 4GMKA 3QKTA 1Z6PA 4BNDB 5B7GA 1C2YA 2GJSA 1G8AA 3I9MA 5DX0A 1RRFA 1Y1RA 3VV3A 2B8TA 3CONA 2ZJ4A 2ZB3A 3FOWA 4FINA 3VO2A 4FJ0A 4XGIA 5C37A 2ZTVA 5J1SB 2QT0A 3MZ0A 1NMEA 3CMMA 2DLCX 4HTFB 5ALRA 1E59A 2VBFA 3OFJA 4UHFA 5ILQA 1PSZA 4F97A 2XUQA 4CKBA 1RWQA 5FNVA 1NPDA 4YUZA 3NDJA 1FX0A 4Z54A 2VNHA 1FS5A 4BECA 4E21A 1AA9A 2QTMA 3DC2A 4ES6A 2Q29A 4NZZA 3GI1A 3GPDG 3KSUA 2ZZNA 3UOGA 5TPWB 2JFZA 3PCXA 4ZVQA 2KJQA 5C7IO 3N2LA 3QXCA 2Z1NA 3OOJA 1AZLA 1Y82A 1GG8A 3IXLA 3PNMA 4EF5A 2A1UB 1SA0B 2DBQA 4C07A 3GUVA 2G9VA 2JGKA 2ZRGA 3R7AA 1ECBA 1E79D 1QGED 1WUKS 2PL3A 2OYRA 4JAVC 2BBTA 1RVV1 3BWYA 2VBIA 1TMOA 5FUQA 1EJBA 2QLMA 4UCFA 5DT2A 2BJHA 2WYUA 1BNCA 4PAQA 2MSEB 4GX0A 2AE2A 2HV8A 3HKDA 4G4IA 4RKWA 1D4FA 5IDWA 1QQTA 2G71A 2WJHA 2XA1A 3HBMA 1N9KA 3M2TA 4JLAA 5FWYB 3TW8A 5A4MS 2HUPA 3AZOA 4GGMX 3VZDA 4WXMA 4A8JC 5HKOA 1DC7A 3PZRA 3HNOA 5AH0A 3VYSB 3OTQA 3AINA 2G04A 3PD1A 1JA1A 4FYWA 4FZJA 4AJOA 3Q6MA 3FXAA 1ICIA 5DT9A 1A7KA 1NIPA 4AQYB 4EB3A 2ZSHA 3UWSA 1I0ZA 4L85A 2ZT5A 2C3YA 1ECGA 4RELA 7AT1A 2O5EA 2GZ2A 3LO8A 1JKFA 2IXBA 4JI5B 2PRSA 1NXWA 4HXFB 1YS6A 4DUZB 3EMVA 2PSHA 2X9GA 3BUSA 3HM9A 2NT3A 3DNMA 4NH4A 4IUDS 4CM3A 3UUWA 4DL9A 1N8NA 7ABPA 1OLOA 1DX9A 2QYHA 2ZUSA 3GU3A 4JLPA 4DB4A 5CBPA 1G5FA 1NURA 3OTGA 1R8XA 1XA3A 2FJUA 4JBXA 1GTRA 1T2NA 1IAQA 5DEIA 1R5OA 5A4AA 1IM2A 5DI3B 1VXOA 1L7QA 1T26A 4KB5A 4UUOA 1G42A 3EVZA 4ZARA 5FBKA 1NF9A 1UWCA 1HLPA 3ASYA 5T64A 1GDTA 4NENB 4JI4B 1ZIPA 3KEFA 3N9IA 1R6VA 4EJSB 4IKOA 1JAHA 4LSWA 1V16B 1XLTA 4R9RA 2W6ZA 5BRJA 4BIMA 1IZ9A 4BTEA 4C2BA 5CD1A 2JK1A 2O8DB 4D6PA 3FAKA 3N1UA 4ZXFA 4J1TA 1EUZA 4YUWA 4MWOA 2LPMA 4LDQA 1UC4B 3WGZA 2FRXA 4TS4A 2HIAA 4G0XA 4GPTA 4JI1B 2WWTA 3R7NA 4EFKA 5MGNA 3I5XA 3AERB 1U63A 4WOKA 3L4JA 2CVHA 5I5EA 4ND6A 1VHLA 2JEZA 2BZ0A 3WNBA 3E9ZA 3GZJA 3CZ9A 5IHXA 1WHTB 5C8XA 1PK9A 1W1UA 1Y3AA 1CF4A 1DXOA 1M83A 2WDPA 3PP8A 2NGRA 4HQFA 2GAOA 1KZGB 3IS3A 3ND8A 3FSRA 4HNQA 4KVFA 4MQEB 4MRNA 3I28A 3REGA 2VRCD 4GXTA 5BNWA 4DB2A 1UBLS 3KALA 3DE6X 3I2HA 2R25B 4JB0A 2CE2X 2I7TA 2REQB 2VJBA 2IHTA 3ESYA 3IDQA 3PPWA 3ZN2A 1MA0A 2XGSA 1U8XX 2VDPB 3R40A 4MUEA 1U1GA 4Q3EA 5F2NA 3B52X 3KXPA 4C6HA 2JKZA 2Z8XA 1SCJA 1F5SA 3H11A 2HWYA 2IYUA 1A69A 5KYWA 1JHOA 1S2NA 2YCLA 3E5HA 3HL0A 1P62B 4INZA 4D99A 2ZS9A 3EGVA 5AXCA 2OHGA 2C9MA 3IBTA 4N4AA 4CM4A 1QVVA 4JN6B 3IQDB 1PWXA 2DLNA 4UOQA 1KR5A 3ZLTA 2P9QA 3IDSA 4DCMA 3SU8A 4L27A 4B6RA 4UPEA 4FC6A 1Q44A 4GWGA 1THZA 3EE6A 4KAXA 1CBUA 4L0MA 4ZVOA 3CTMA 5AM0A 3FUCA 3VSDA 5BR8B 1MJHA 4W5JA 1XCGB 3ZXUB 2CFTA 4KNYA 1JDVA 3OZ7A 1PG2A 1CKEA 3OJXA 2OAQ1 2QM0A 3BBLA 5B53A 3THWA 1CZRA 2VDVE 1JYEA 3JWIA 1IN4A 1ADFA 5GZ3A 5LC1A 5KTOA 5B30A 1A96A 1IN8A 1YJCA 3HCPA 4H77A 5L9AA 1ZLXA 3COYA 3WZ2A 5C34B 5H9WA 5YASA 2IK8A 1BS9A 3K92A 4KFRA 1EHCA 3HXLA 1KY3A 3RQSA 2NYAA 1H0RA 3P9YA 1W4CA 1FXSA 3D9QX 4QNRA 3VFDA 5L53A 2XRZA 3LYAA 2EJWA 1SBZA 1ZSNA 1WLYA 1H2RS 1W5TA 4RJLA 4XZ3A 4COKA 1DV1A 1KTVA 4LVCA 4I9UA 2VZ0A 3UJCA 1JQEA 1JHZA 4BMDA 1LPBB 1OXMA 5K5EA 1UL1X 2FDRA 3EA0A 1EFHA 1ZVJA 3EZYA 4P86A 2GHIA 5LIPA 2AT1A 5ITSA 3QLEA 2UDPA 3VQTA 1F0NA 5C3UA 3Q5DA 3ZE9A 3O4JA 3VO9A 3FZYA 1EFVA 3GR6A 3OJLA 3OZFA 2CK3D 4TYMA 3IYLW 1UIRA 3I4FA 3W6ZA 3RTGA 1VCNA 2OD9A 5AFSA 1TD1A 4I66A 4WL0A 3DCIA 4Q1CA 4YONB 3JD4A 1PT6A 4N0QA 1OFIA 4IJVA 4IS3A 4TLMB 1V4BA 1XHFA 2VP3A 5EHIA 4AZWA 4CCYA 3UC9A 4AMUA 1GPH1 2FSVC 1HFJA 2PWAA 2I7VA 4H18A 4PCUA 4E2FA 3B1KA 1XROA 3W6OA 5BNTA 4H4EA 4BMPB 1O6CA 1QQBA 3KQSA 3KP1A 2CWWA 3O31A 3AR6A 4HDNA 2V6JA 3B13B 3VAZA 4CIWA 1NJSA 4CR8A 1ZOIA 3I01M 4H7JA 3AX6A 4QYIA 4EG1A 6PFKA 1SQFA 2CJPA 3AILA 2Q5OA 5FA6A 1M1YA 1L7VC 3ZZMA 3E48A 3F6PA 4PSCA 4BQIA 3IHTA 1IY0A 2XUIA 1YVDA 3ZKWA 3K30A 5LD2C 4QULA 3MWEB 4B2IA 5HHTA 3OJWA 4Z86A 4QQNA 5CTAA 4ZT5A 4XGRA 5J5AA 3MD0A 1EE2A 4GH5A 2XDQB 2FRVA 1GUBA 3B2EA 2UXDB 4BAZA 1JPVA 3AB8A 1GQQA 1TE2A 3CLRC 2JAWA 4X97A 4I3HA 2FXVA 4J7AA 5IKMA 4EDHA 3QPAA 3U7JA 1QAOA 2FGKA 2JH8A 1L7NA 4LZLA 4OBWA 2WTBA 4OJTA 2PWBA 1LBTA 3C8MA 3DCYA 5DX8A 4D9KA 1Q7TA 1OFGA 4CI0B 3EXEB 5B55A 4KR6A 1X1RA 1UP4A 3G2LA 2VZ9A 4JKYA 4WQMA 2X0EA 1TU4A 1ZN9A 3HLKA 4HATA 2W4QA 4ME6A 2EOAA 4OSEA 1GNQA 4RS4A 8ADHA 1FFHA 1Z0FA 2WYHA 1JHXA 1Z5PA 3BZUA 3CH7A 3I04A 4FCVA 3RHTA 1EQUA 4CLEA 2EKBA 3UATA 5DP2A 1JFFB 5IUJC 4D80A 2A9JA 1C3EA 4B3DA 1M7BA 2CYAA 3B3FA 4J49A 3STWA 2XAUA 2MYNA 1M1XB 4D8VA 2ZS7A 2NU7A 3L04A 1JFRA 4Y1RA 1HRDA 1AS2A 1NUHA 1T8SA 3HB0A 4DIBA 4DR6B 1YIAA 3CT4A 4ZHQB 2VPYA 4AZTA 3DPSA 3PHIA 2PLWA 4IXDA 3ET5A 1WX1A 2GZSA 3D8HA 1W49A 2YICA 3B12A 4L76A 5EKDA 1KNQA 3B9BA 3ROEA 1CNMA 3B5EA 1Z5GA 1TADA 2H7VA 1ZNXA 2YW2A 1E2KA 3HCDA 4L9WA 4P98A 5IM5A 4ARZB 2M98A 2TMDA 4E5SA 3FMVA 1ZQ9A 3VSAA 2BCGY 4JOSA 4Y2SA 4WCFB 1D2CA 1U2EA 2FU5C 4QGBA 3W4KA 1AT1A 3KUDA 4RZUA 3PNVA 4XGKA 1JECA 3DAGA 3QPBA 4PR3A 1OZ0A 2JFVA 4PAOA 2SICE 1P1BA 4P7BA 1KI2A 5TS3A 3SYNA 4FE4A 1FLAA 4L2IB 5K3SA 3CMCO 1GPMA 1L4FA 4AK9A 4BEVA 3THYA 5ANRB 3VO8A 1VE3A 3ZZTA 4KRYA 2JGJA 3AFOA 2QYSA 3HHPA 3QP9A 5ICEA 1GY8A 4YP5A 4BQEA 3OHMA 1XFDA 2ZDGA 3MNFA 2YX1A 1CUGA 4GI2A 5IDVA 3EXFB 5AKXA 5KBYA 2VDKB 2YS6A 1GZ3A 3NVMB 5KZMB 1O57A 4QREA