2QD2A

F110a variant of human ferrochelatase with protoheme bound
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPAIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
molecule keywords Ferrochelatase
total genus 136
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd2A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd2A01
3AQIA 3HCNA 4CCSA 3HCPA 1LD3A 3LYHA 4KMMA 3GOQA 1HRKA 1TJNA 1L8XA 2QD2A 2PO7A 4F4DA 2Q2OA 2XWSA 2AC2A 2QD1A 1C1HA 2QD5A 2AC4A 2HRCA 2XWPA 2HK6A 4MK4A 2H1WA 2XWQA 1N0IA 2Q2NA 4KLAA 2Q3JA 4KLCA 2XVYA 2XVZA 2PNJA 1C9EA 3HCOA 4KLRA 2H1VA 2DJ5A 2QD3A 3M4ZA 3HCRA 1QGOA 2C8JA 1AK1A 2HREA 2XVXA 3W1WA 2QD4A 2PO5A 1LBQA 1DOZA 2JH3A
chains in the Genus database with same CATH superfamily
5CA0B 4ENPA 1NU6A 2OO5A 3ZNOA 4CQLB 4Q01A 3AHFA 1PGNA 4M6WA 2L18A 2O5VA 3I32A 1JBKA 3LG2A 3PFFA 4OM8A 4HDOB 3C6ZA 3KLNA 2WD7B 3WMXA 1ZIXA 2O5EA 4ZVTA 4JAVC 5C2JB 3U39A 1YB1A 4KLZA 2X13A 1QLHA 4ZRMA 2ZCJA 2C92A 3NGLA 1KI8A 4TV9B 3U1BA 1F48A 3B5EA 4RIHA 5HKOA 2C9DA 2HAEA 4Q02A 1WB5A 1L5OA 2FZWA 2R8OA 2P5TB 4N7MA 5DLQC 2YS6A 1KFKB 3KYIB 1I0ZA 4OFWA 4YRIA 2AYYA 4F96A 2CVPA 2ZRMA 1EUYA 4B40A 5CA1F 4N0DA 4NE9A 2X8JA 3ESQA 4UEWA 3TVTA 4A7PA 4RSHA 1P5HA 3PJRA 2V6IA 1A97A 2D62A 3FYCA 5AOAA 3SIXA 3LFHA 2NUPB 1G5PA 5GOTA 1R6AA 5DNWA 1KI1A 4BLWA 1KJNA 2AN1A 3KB6A 4YIKA 5FX2A 3VBCA 4FFWA 4QTTB 5KVCA 3PHGA 4J90A 2VCHA 4LYDA 2PX5A 3FFWA 1OZFA 4Q4AA 4GUDA 2FRVA 2OWEA 2IIBA 3MJRA 4BKMA 2I8LA 1RHUA 2UXDB 1V3VA 2J7KA 3AOGA 3BD8A 3ZTYA 1P60A 2C83A 2VSYA 2X6RA 3D0KA 1HT3A 5TT0A 5ITVA 2QMUA 1XI2A 2V7WA 2HQBA 4Q3DA 3HDTA 3ETCA 2C7BA 1H3FA 1MX3A 5KCZA 1G4AE 1E59A 4IOJA 5BMOA 4IOMA 1T36B 2VQ3A 3W2TA 5J3JA 3K5PA 1K7FB 4AD8A 3PU6A 4D8TA 1A2BA 2L69A 4BNIA 5GJBA 4IXDA 4FPXA 4IJ5A 2JLRA 1TM7E 4BLUA 3OX3A 4BE4A 4XWWA 3ABZA 4G8DA 3OZBA 4HMPA 4X6UA 1IM8A 4BJ1A 4KLRA 4RY8A 3T5MA 4CIDA 1U8AA 2NWQA 5EFZA 5TT1A 5EZ6B 3CLRC 5GONF 4W1PA 4L9SA 4MR9B 2PD4A 3H3JA 2M6LA 1MO6A 1YQWA 4FFBA 4CL0A 1CV2A 4DR5B 1JUDA 4PCAA 4QOFA 1YNOA 3L9WA 3EHEA 3ZDZB 2DBZA 5C8YF 1V8PA 1Y3FE 4LYAA 4TTIA 4MARA 1EFDN 1E5QA 1MU0A 3L7KA 5FPTA 1S2DA 4ZAFA 2AJCA 2QZZA 4PZCA 1QH1A 3SNHA 2FPGA 2J87A 5CU7A 3ZW8A 4BBAA 1JS1X 2R7AA 4XASA 4LAFA 4M4SA 3KCQA 3FRHA 2JJ1A 3E5MA 2GM3A 2GBGA 4LCJA 2AUNA 1HZZA 2I2DA 3DOCA 3GFBA 4FKMA 4G1BA 5IJAA 4F9FA 4QKQA 2GBCA 4EG5A 1KJYA 4MKGA 4N8EA 3ADKA 2WOJA 4E1AA 4YHHB 1PFKA 3U40A 3DUFB 4JUCA 1XJ5A 3P2KA 1U3DA 3NT4A 4YR7A 4P7FA 3RV3A 1R0LA 1YD7A 1D2RA 4IEEA 1NVGA 4D8VA 4YMGA 4GU5A 3IAUA 3ZIDA 3OO1A 1UP7A 2CLLB 3FROA 4RGVA 2DVMA 4LHSA 1GKUB 1RXEA 1AMUA 1SG9A 3R77A 3A9VA 1R4ZA 2NTVA 2NSYA 3ANSA 4CHTA 1PLJA 3FBTA 3M9XA 4LZJA 4OH7A 2V1UA 3T9BA 3WB0A 5FHRA 1VC2A 2WSYB 4IVNA 1U0JA 1JPUA 2QVLA 3V2UA 3C43A 2X5OA 1N2EA 4L3VA 4RVOA 3SFZA 4G0UA 1PK9A 4OJQA 4KO1S 4JGBA 4PRKA 3TZHA 3BE5A 4G4SO 2XQGA 5G02A 3VFDA 1FP4B 2W83A 1X1SA 3ABRB 3Q12A 4REQB 5FL7A 3VO1A 2RGWA 3GPIA 5CFPA 1I4TD 3GGDA 3RDPA 1WM1A 2V7XA 2R8ZA 1CR1A 3RVJA 4ARVA 3CKKA 2C8KA 1DZ3A 1U99A 5EIEA 4UAVA 4F46A 5KUTA 5ALOA 1CZUA 3MJSA 2AH5A 2PRYA 1IZ7A 2H7CA 5HQ3A 2UYQA 3UJHA 3O8NA 1L5ZA 1M83A 5ERXA 3KZVA 1MRNA 2JZNA 5EG5A 3X1ZA 3EOBI 4TL6A 2DGDA 3A1SA 2C9YA 4RF4A 1KQFA 2XYPA 4GZ5A 2WI8A 4AJHA 5LQAA 3V8PA 3GD7A 4YEDA 3GWGA 4HGYA 3MHPA 2PMKA 3FOWA 3AM3A 3DO5A 3SYNA 2GFIA 4E6EA 1Z0UA 3JZIA 1B0PA 3JWGA 3CRMA 4FE7A 1P72A 3E5RA 4J75A 2IUEA 4OP2A 2XYRA 2VDWB 3V3KA 2C4UA 3AHGA 4PLZA 1FYWA 1IUPA 1NULA 1LLFA 2Q3FA 2W90A 5AHOA 4ASUA 3J80A 3ESCA 3AOEC 2R86A 2JD0A 3F4LA 2G63A 3AV0B 3EXHA 3N28A 4L3OA 4YHBA 4ZZIA 1V8OA 5KSPA 1E2HA 1PQUA 1UT6A 3JATB 5DYIA 3IOBA 4YP9A 1KORA 2B35A 2PGXA 2Q2NA 3NU1A 3DHNA 2GCOB 3H99A 3OJEA 4U0JA 1IWOA 1LDGA 3GQBA 4UDXX 3SHFA 1XU7A 3DONA 4C7VA 4RKWA 1MX1A 3EQ7A 5EUQB 2TMYA 1EWRA 2P9JA 3GLQA 3DE7X 4P8RA 4ZVOA 1KC1A 3JQGB 1DC7A 5G4LA 4Q3OA 1E9RA 3WGJA 2F67A 5IJWA 1BXRB 3F47A 1L7RA 5ILGA 4ZYZA 1BMDA 3OPYB 4M7OA 5DT9A 3WQRA 4JBLA 4DMKA 1OH5A 2VDUE 3AHEA 4LBZA 4EHAA 5EZQA 1GPAA 4B7CA 1X3SA 1CEQA 5F7ZA 3GRAA 1YV9A 5ESRA 4LZLA 3RRYA 3NM4A 3QLVC 1EB8A 1G6OA 5AH0A 4X93A 4LVCA 4W8OA 3LQ2A 2JHCA 4P5DA 2WVJA 4CF3A 4HDCA 3S27A 1ZCFA 3MUFA 1X6VA 4HSEA 2QHXA 5A1TA 4JK3A 1YK0A 1LPPA 2R8EA 2Z8YM 5DSXA 1C3OA 4DCNA 4FHCA 5FLYA 4YC7A 3VH4A 3ZZNA 4HXFB 2HY7A 1W5BA 2ONKA 4B6EA 1Q7TA 2W6QA 3AF2A 4N5NA 3LX8A 3KPUA 3LX6A 1JPJA 2RHLA 2PMEA 1L7AA 3NWOA 4P36A 1V5FA 4GKJB 4K6FA 4BPRA 1I14A 2BGRA 1X80B 3JYPA 4OQQA 5CNJA 1RJ9A 2ZAYA 2AJTA 4HDMA 1CB7A 2C5FA 1W30A 4ZCTA 2JGNA 4Y6GB 4G0NA 4YVFA 4I5DA 2ON6A 1E8DA 4AMGA 5KPDA 1NQWA 1QGUB 4BCDA 4TTVA 2AG8A 3F74A 4KODA 4NEHB 5FI3A 4N3AA 4H1UA 3TJMA 2H4FA 4EPTA 1PFWA 1XKQA 1DJPA 2GF0A 4S1TA 1Q1GA 2FW8A 5AW6A 4RFLA 1KOGA 1W5TA 1BHO1 1E9FA 1JB9A 6CHYA 5F9HA 1ULTA 3P0EA 4TWAA 4A3SA 3OJLA 4KRYA 3RYFA 3PXXA 3SFVA 2VQDA 4DNFA 2WOOA 3I23A 2UZ0A 5LD2B 1XZ8A 3B36A 1BX1A 1EGVB 1JJFA 2BBTA 2RHDA 4OQ4A 4ZI3A 2H5EA 2XUPA 4LJ8A 3V46A 1ZA2A 4PIVA 3JVEA 1EZ4A 5BVGA 1B3BA 1NLMA 5HDBB 4L75A 3AZQA 4REMA 1GPYA 5IX8A 1QZUA 2QYSA 5GOZA 4B3SB 1OLXB 1EFVA 3GGOA 1NA5A 3PTLA 2C8JA 2COEA 3IBCA 4I4IA 1HE2A 5FD8A 5LYJA 3ULKA 3LM8A 3B3AA 3E9CA 4JVLA 1DXYA 3OAAA 4MH0R 4QOEA 1DKUA 4AZ3B 4BN4A 2QOEA 4R31A 5IC6A 5U9CA 1WQ4A 2JIQA 1AV7A 3NIGB 4QD3A 5J5CA 2QN9A 1HG0A 1YOVA 3BYZA 3OD5A 3Q11A 4MWDA 3MCTA 2WJ3A 2HK6A 1P7YA 4QPZA 3ZCXA 3AY3A 4Q9AA 3HPQA 2RHGB 1O6CA 2AXEA 2YJGA 1EXDA 5JQWA 3CKMA 3EVGA 1VE5A 4AJJA 2NV0A 4RLHA 1VG1A 3L07A 4ZO8A 4CQMD 3W05A 4E4YA 2W2MA 3MWYW 1HGXA 2BJWA 3DZHA 3FG9A 2EV9A 2P7HA 1EZ1A 1RMQA 1Y3DE 3GR6A 4P08A 2CSXA 1T5BA 1Z7WA 5E9AA 4LY3A 7MHTA 1W4RA 1O9BA 3BXGA 2PHZA 4XUGB 1Z7YA 1XZLA 3VNVA 1WCIA 2G9ZA 2WHXA 2XTMA 3AFHA 2ONCA 3JQDA 1OY1A 3JRNA 5CX1B 3QU7A 4ZODA 4GVPA 4C76A 3R0XA 2OXCA 2C2BA 1XMPA 3K2EA 3KVNA 3WLKX 1X38A 2GN1A 3OKAA 4ITUA 3EVCA 2XDAA 4LXGA 1HNXB 1WCWA 3UXEA 4ZZ2A 4HVLA 1B8UA 4J0QA 1XLTC 3CLKA 4OB6A 4QGBA 4LYYA 4RC9A 4WI1A 5ADVA 3R3UA 1SXJC 3N2IA 2I4OA 5CEJA 4QBFA 3MILA 2PA0A 2ZI6A 4ZVPA 3WJAA 1QH9A 3BWDD 1JJVA 3R8CA 3TXYA 3TM4A 5FTKA 4A0FA 3EXFB 3DDZX 4L76A 1P0IA 2KHZA 3K0FA 3OM9A 2AJBA 2QD4A 1XA4A 2QVGA 1VBMA 2OE2A 2XGSA 3MD0A 3LCRA 3IR7A 4Y18A 5K09A 1PJZA 1O6GA 2ENWA 3IKMB 4R7ZA 3NGMA 3HUTA 5JNUA 2HYIC 5ESXA 3ZVMA 2E0IA 2FOIA 4DFDA 3W5BA 1SRRA 1JNXX 4GMFA 2VRNA 4JB3A 1K6JA 1XD9A 1DIBA 1KF0A 4FINA 4GXTA 4YACA 2IQ5A 1ES9A 1VYTA 2HDOA 5DI3A 5DGTA 1HF3A 2JI8A 3EBOA 2P90A 3D1LA 4FX2A 4MQEB 4RF3A 1SWVA 2XHEA 2WWTA 1KKUA 4Q7EA 3MHTA 4RZUA 3K6KA 3DTVA 2D7CA 1QG6A 3AEQA 1KNQA 3KQSA 2DRIA 4OP3A 1UQUA 4KQJA 5H02A 4Z6KA 621PA 2CVOA 4MYCA 1U5AA 1D6SA 1K0UA 2A4KA 2F1IA 1MO2A 1IN8A 2OO3A 2Z4SA 4HP8A 4LYHA 4MO9A 2CEAA 1PJLA 3UOWA 4CUJA 1L4UA 3CB2A 2VRCD 9MHTA 4OOEA 3REQB 1ADCA 2WBLC 1ORDA 2ZRDA 4PR0A 5E4JA 4EFLA 2MSKA 3FB4A 2PE5A 1JJBA 4PCVA 5GVRA 2F6RA 1FEZA 3WGUA 3A6DA 4LY9A 3K0SA 3EQ6A 5C81A 4ZTUB 4D74A 2VZ9A 1WXWA 1L0BA 4JI8B 5AXBA 2NU8A 3OTOB 3X1XA 2O8EB 1IM5A 3SQOA 3H2ZA 1J9EA 1E3LA 2OBBA 3VV2A 4CFZA 4CETA 1HZZC 4EX6A 3SLRA 1QQBA 5TEWA 3K5HA 3W0LB 5KEIA 2UDPA 1GFWA 4YDRA 5EJMA 3BFPA 2ZUFA 4ZC8A 5HKKD 3IP5A 1EVJA 2NXEA 4QQ8A 4YYEA 3F6YA 2YWEA 2WZDA 3S68A 1OT3A 1TJ4A 3O9VA 4UCWA 5JSYA 4BLVA 2JH3A 5L7TA 3DZIA 3RYHB 3CVOA 1GZ4A 4W9NC 1QBKC 3CYFA 3HJGA 4FJ1A 4QU8A 3RIGA 3DKVA 4LFCB 1FW8A 3VISA 5D1HA 2KX7A 4KTVE 5JMPA 3OQMA 4ZAGA 2NUBA 4GQIA 5BNWA 4BYGA 4K46A 1W1IA 2V8OA 2WZQA 4EUNA 4U3JB 1UXGA 3C1TA 2VHYA 1DZIA 3HV0A 4FDLA 2ZUWA 4LDZA 1E7MA 4R83A 4BQIA 4F2HA 3RRFA 2JDID 4IGAA 5EUCA 2O57A 3Q15C 1C9YA 3TLYA 2I3ZA 4HB0A 5CVVA 1DBVO 1L4NA 2CNNA 2NACA 2QX8A 1Z4NA 3IIKA 3K5IA 4JB0A 1Q74A 4OKSA 3U80A 1EWQA 5AUQA 2WSIA 3I04A 2J6HA 1Y4UA 2X3UA 4QYWA 3SZUA 3UMFA 4B85A 5IHPA 5LU9A 2KWIA 1XDWA 2OT3B 1U2RA 2BKUA 3DLCA 3GLKA 4HAWA 4LDNA 1YHYA 4JI5B 3AFMA 1U2DA 1JLKA 2YZ7A 3L6EA 5BW6B 5K8UA 5LWHA 3GDOA 1TUBA 3V42A 4CF7A 4BVKA 1XZPA 4BLTA 4XR4A 1A88A 2PZAA 5DPMA 4KIGA 3NC0C 4O2BB 1UWKA 3FOAA 3IVGA 4F4HA 1J0XO 1VYVA 1ZSYA 5JSHA 4JSYA 1HM5A 1UDAA 3ED1A 2XGOA 4WJKB 3DEJA 2XYGA 2D54A 1TZBA 1KC3A 2QUIA 2B99A 3AR9A 4WLVA 3N0VA 3T4PA 5HKBA 5F78A 2IOFK 3W9YA 2QIPA 5EVJA 5L4NA 3PUZA 4GBJA 1A27A 5CTAA 2R48A 2WJAA 3FDZB 4RKRA 1M6VB 1TC1A 4OKNA 1MC1A 2R66A 2BELA 4DRZA 3LVFO 4RFSA 2G7ZA 3HVRA 1U8ZA 2CXPA 5DYGA 2QORA 1M73E 4ZO4A 3X3HA 3PX7A 2VHWA 2H8KA 2R7NA 1BXGB 2R6JA 1JHOA 3MT7A 4OJYA 1GZDA 3RGGA 4IYRA 3E0XA 2B2XA 5FADA 3MN1A 2QRGA 2EF0A 4O8CA 4CMGA 4P2BA 4Z2YA 4BLPA 1IY9A 2ZSHA 4RY0A 4L28A 1CQIB 4FYWA 1T1EA 1MQ9A 4IQFA 4EY6A 5IEBA 5LQSA 3PR1A 1RHRA 4R4JA 3CV3A 4KO8A 4DRXB 1Y80A 2P9FA 3O1HB 4O1MA 5DZSA 1LI4A 2DLCX 3ROQA 3UC9A 5AMXA 5AKJA 1NDHA 2YOGA 2ZITA 4MAFA 3HSKA 4J7AA 1B6TA 2GI4A 3ROGA 5AD1A 5M29A 1EBFA 1SD2A 2YMQA 3F7OA 3G8BA 4B31A 4TWBA 2Q21A 2GPYA 1VM6A 5CA1B 2A0FA 2KBFA 3FIJA 1OXVA 1EDZA 1XRRA 1G18A 5AW4A 1XU4A 5IDXA 5GGXA 4FZJA 1QHNA 2NU7A 3QOWA 4IKEA 2V7QA 1ZESA 1LS1A 3GVIA 1AKUA 4IMRA 2AN4A 2KLHA 2OCLA 2FZKA 3D6MA 2G0AA 2GHIA 4NZ9A 2EWMA 1OJLA 1U5BB 1X42A 1O7JA 2OCXA 2PUDA 3TQCA 5CBPA 1Z0SA 1A5ZA 3AB3A 3IALA 4D98A 3IMCA 6REQA 2QX7A 1TL7C 2HSJA 4LOIA 1XTUA 1J8VA 3KSAC 1G0OA 2ZE8A 4GYWA 1KFJB 2JS7A 5LA6F 2LNDA 1NL3A 3R20A 1V5EA 1QSGA 4ARUA 4BVBA 1BFUA 2JGAA 2P9YA 2HMAA 1X7WA 4NH4A 1XR3A 1I6WA 1RWPA 4BCBA 4FEAA 3I4CA 4KXXA 1L7XA 1G3RA 1R7RA 2A9KA 1LB1B 1X7HA 4HTAA 1CUGA 1MHTA 1LZLA 2JLQA 4BP9A 1LQUA 3H3XA 1N6PA 1QYRA 4B46A 5JJKA 3QGMA 2INGX 3O8OB 4I1SA 5DNAA 2ETVA 3O1JC 4HDKA 2IWHA 2QEQA 1GPMA 2NT4A 2PA3A 3Q7SA 1KSJA 1Z2PX 3LY7A 4KCGA 1OKKA 4MKXA 3THSA 1XA3A 3TTXA 3HSSA 5CVJA 3I9NA 5DLEA 1SKMA 4XRRA 5REQA 4GYKA 1AS3A 3HXMA 2W6PA 3FYTA 3LZCA 4PLYA 1P1CA 3NWJA 2CV2A 1IN4A 1VL6A 4LJKA 2ET6A 4AQDA 5KAMA 4QODA 4CW7A 4EW6A 4DV4B 5TEVA 2FMHA 4ZOLF 4R9UC 5EZ5A 4BMCA 5JJIA 4KXYA 3ESDA 4TM7A 3HJFA 1JDBC 3U9SA 1HMYA 4EL0A 2FSIA 4WNIA 4TKLA 3A36A 2ZVJA 3FLAA 4IQ0A 2FR8A 1BVUA 2DG2A 1Y89A 1M2KA 2IHKA 1PYDA 3BMOA 3C85A 3IKVA 3NHAA 1W85B 4KV9A 4TKVB 1NQVA 2PTGA 3PYMA 4DLWA 2LPMA 4YV1A 3HGQA 4P1ZA 5I8PA 2WE7A 4IEFB 5A5GA 1VFNA 4ZQGA 3RVDA 3UENA 4RTRA 4UC0A 2Q1XA 4QICA 3WAKA 1U11A 2VUSA 4M7WA 3U60B 4M1MA 4L5JA 1BFDA 5U4XA 5IYZB 2HWWA 2P7IA 2VPYA 3MUEA 1F6BA 4P83A 2FPIB 2AXPA 3N07A 1CLUA 2NU6B 2XUKA 3LW7A 4QFBA 3HDVA 3K09C 5ABPA 2WYOA 2VDNB 3PFKA 4RANA 2RH4A 3S1AB 4OU4A 1EB9A 2GN0A 5HRUA 2XB9A 4AKHA 5TGDA 3FVTA 1P3JA 4HQNA 3GFQA 2HTEA 1OH7A 5KMGB 1DKLA 3EZXA 2NX2A 3RS0A 2X7XA 4RHEA 1GO2A 2F2TA 4M8LA 2Q0XA 3KJIA 5G1OA 3FVVA 5U4QA 4E5MA 1S89A 1ZS9A 1U65A 4I5IA 3LUHA 4Z86A 3TFOA 1LSSA 4BB0A 2H4WA 2YFYA 1JH9A 1U0HC 3BDVA 2UYHA 2FA9A 1PS8A 2RKBA 5TQ2B 5CK4A 1TM1E 4FUQA 3KAQA 5L9AA 1E9SA 3AINA 3K7EA 4CWAA 2H2IA 1DP4A 1EEXB 4YJGA 1LVGA 3V7YA 1Q17A 3I2HA 4H3SA 1GLNA 4DDTA 1T3SA 4CV2A 1DX9A 1E92A 3ZOKA 2FP4B 1B73A 2VQSA 1XQWA 4PIMA 1ZGCA 5FNZA 1MO4A 1FRFS 2NPOA 3LW8A 3WK6A 5KYNA 1N2GA 1QC5B 4JLBA 3RVNA 4BGUA 4TM8A 5IBPA 3EXEB 5EFOA 2FFRA 4IDFA 3PCRB 4GE3A 3UMGA 3JSXA 5B58T 3SKVA 3Q7EA 1F12A 4DABA 1OI4A 4DIMA 2OECA 3LYLA 3VDQA 1RBZA 3KPYA 4LVUA 4BO6A 3AKZA 1I3KA 1DQSA 1H5QA 1LI5A 2TSYB 4PG6A 4Z9XA 3TX2A 3ZIAD 4K9QA 3LUBA 5A6SB 4XQEA 5KYXA 2FPUA 2WJJA 1UKYA 3WG9A 2ZT8A 3MTDA 4M54A 1ZC3A 4U39A 1D2NA 1GHTA 5DTEA 5AJUA 1TUEA 1JECA 2R60A 1A9YA 3KHUA 3T0GA 4EPVA 3K0CC 2Z04A 3KHSA 2G80A 4H0NA 4Q9DA 4X24A 2A5LA 1EYZA 2QNBA 1KJQA 2Q6TA 3B6ZA 4IZOA 4F2PA 5ALVA 1DOZA 1KAGA 1H6BA 4IFBA 2G6BA 2ZUBA 5JECA 1P9LA 3PUIA 3HQ4O 3LPAA 1U98A 4GYYA 1N4AA 2BUBA 4RK0A 3WWPA 1ZGHA 5JSZB 1BCSB 1L8LA 2YXNA 3GA5A 1EP9A 3LY5A 1IHYA 1O2DA 1RWVA 4HDSA 4I55F 4HN2A 4LISA 5AM3A 3IKTA 2GPAA 821PA 3JXEA 2I03A 3D3KA 3NGXA 4DVJA 3AHHA 1LDYA 4TSRA 1PU2A 1XZCA 1ZD3A 1RQRA 4FYJA 3WL6A 5TJ9A 1W35A 1I6LA 3DE1X 4QNMA 4JV5B 4Y6PA 2AI1A 5F52A 3UUEA 2IU0A 5BSVA 1AVTA 4EF5A 3OESA 5HFNA 1W4AA 4L5CA 1Z62A 2VF2A 2VWQA 2X42A 5A4AA 2EGHA 3AR6A 4UNPA 1HC7A 1U1DA 2Y99A 5FPYA 3RIXA 4K9KA 4DNQA 1CEYA 1G5QA 3ZY4A 4AO7A 4YJFB 4UATA 3L43A 3GGPA 1BDBA 1ZGJA 4R16A 3TEJA 3DQZA 1Q0SA 5TQ0B 1P9WA 1D6MA 1DXOA 2OESA 3T5DA 4D4KA 2BJVA 3ZZ0A 2IBSA 2R5WA 3GP8A 3HB1A 4GPAA 4X7PA 1RWQA 4EVRA 5IKXA 1D5CA 2QRHA 3HJHA 3JD1A 1SCDA 4FIZA 1R6BX 4MVJG 2GN6A 4ZGWA 1T1RA 3OTIA 2AKYA 4FMDF 4N18A 1OBOA 1RJWA 1GIAA 1SU4A 5KWVA 1XMSA 1I2BA 3UHOA 1GSOA 3IP9A 2ZBVA 2O8NA 2CDNA 2I67A 4NBKA 3I2YX 1Z5GA 4D9IA 2HOQA 1Q20A 4Q4DA 2NAPA 5JNVA 3L7MA 1ORWA 1CERA 3OOSA 5A6VA 2P35A 2EFHB 4O4LF 2X0FA 1YQUA 3QLTA 3E7DA 2VHJA 1BROA 1VRVA 3CIOA 1GP2A 4RHCA 3X2SA 4BKRA 4UAGA 3QKSA 2WMOB 2CCJA 2RAVA 2QPTA 3IT2A 1RJEA 2PJUA 1HOXA 1R8YA 3KKPA 3TUZC 2R6CA 4IDBA 1KRWA 3RRJA 1JFVA 3OZ7A 3K9GA 4EW1A 4ZJUA 1BU8A 2E89A 2ZJBA 4Q0MA 4ALLA 1QH1B 1IYZA 1VE9A 2ERCA 3D9QX 1V6CA 4GMXA 5HCNA 3WRXA 1OXSC 3H5IA 1HZJA 1SD1A 1TM5E 4XWTA 3TE7A 4BP8A 2W2NA 2IA5A 3AY0A 3NRCA 4GLLA 5CCEA 2IXBA 2GJKA 3LP5A 3U61B 2VDPB 4CTKA 4MWTA 2BFAA 1MTOA 1NHWA 1DL5A 4WEQA 1NVFA 5ECYA 5HIKA 2OXRA 3MS4A 1Y42X 5CCBA 2YUIA 4DADA 4ZVKA 2D4AA 2QN7A 4GICA 1M8JA 4Q18A 4DCUA 4E7OA 1K8YB 2EF1A 3T3HA 3DAFA 3O4GA 1ABFA 3AW8A 1QIHA 4V3CA 1RW4A 3RKUA 4PPFA 4B0PA 1YL6A 2J7PD 2ZFUA 3B1FA 4KDCA 5AK5A 3ECSA 3V7WA 2H00A 3KRTA 2CXRA 3OETA 2G4LA 2IEGA 2ZB8A 4BB9A 1RVV1 3GNTA 3LT5A 1N2IA 3LVRE 3TYXA 5CCDA 3WYGA 2R84A 1E2NA 3PITA 5EJ4A 5EPUA 3HKEB 1E1CA 1EUDB 4H2DA 3A1UA 4IVRA 2EZ4A 2VSNA 3H97A 4JQOA 4HQ6A 4FS3A 4YV2A 1Q0RA 1NVXQ 1Q95A 1QQ7A 1CE8B 1J33A 3KQUA 3THXA 1VLMA 3QVXA 2DFTA 1YIOA 2I29A 4DEYA 1EFPB 1T35A 3KOWA 1ZRMA 2W2KB 3QFSA 2VHQA 3W6OA 1M2HA 1ST2A 3ZXYA 2PKYX 4ILKA 1OYVA 5JO0A 3HABA 1RR6A 2ZXEA 3GAAA 1RHKA 1RYYA 1USVA 2MDTA 4O4LB 5GJWC 1JIQA 1PK8A 2HF2A 2I2BA 3KC2A 4TT8A 4L72A 3S2YA 4M99A 4RTJA 2B6HA 3H9JA 4FGLA 3ICEA 4CMHA 5AICA 1G9XA 1E1QD 2QX4A 4O4JB 5EHXA 3AI3A 1NUHA 3IP8A 2OP1A 1MFZA 5CG1A 1R6TA 4N7JA 3NWEA 2WF8A 1N33B 3PNOA 5F98A 4FBLA 3IV9A 1JSRA 3AWIA 4L2IA 1LUAA 1IPEA 4AP5A 4MPDA 3T1VA 4MW2A 3GJ3A 4C7XA 5TB5A 1SKQA 1XTRA 3NUGA 1P5ZB 4M6WB 3A6LA 2C78A 1V1JA 4UZSA 5DHFA 5C52B 4HF7A 4NCNA 4XWGA 4YMTA 4CKCB 2VQFB 2ZG6A 4MWGA 4D8WA 4RK4A 1O8CA 3ONWA 1G8GA 3UGQA 1GCGA 4R1NA 2C61A 3E8XA 3IVAA 4DMCA 5EJ6A 1AZTA 5KHAA 1AA9A 2O8BB 1UPUA 1F9EA 2A5YB 1TRHA 1YI1A 4Z3KA 4TS4A 3WMFA 1SIWA 4RENA 1CQPA 3UJNA 2GQ0A 1NMSA 4QWWA 4OLFA 3ED5A 5E2AA 5HF9A 4DCJA 3RUIA 4OGFA 4JQZA 2J5KA 1U04A 3FNBA 3TMYA 4BLSA 2HMVA 4KTTE 4C4ZA 3MBOA 4D79A 2YL2A 2QTAA 3N6RA 1Y7IA 4YJHB 1O97C 2H2AA 2YJ3A 3VUEA 1R4NB 4GZLA 3GZJA 4WN9A 4LWPA 1GT91 1PZFA 1OZHA 4Z7OB 4C7OA 1VL0A 1XZMA 4JLWA 1XMIA 4E94A 4BGDA 3OZRA 1LDMA 3O93A 4DIFA 3F6RA 2XGMA 1YASA 1F0NA 3E03A 1U2SA 1RWKA 2ZT5A 3GPBA 3TK1A 1TF2A 1ZHHA 3DEHA 1NC3A 4OXKA 4FCVA 4QTZA 1HDZA 1LWNA 1CFZA 5KSOA 2FGJA 1LDBA 2QMZA 2XNSA 4QWMA 1WLSA 2NSLA 2GN4A 2EGUA 1KIFA 2OORA 1KK1A 2JF0A 3RGWS 1M0TA 3PUHA 4AJOA 1P5FA 3EH1A 3H8SA 2IEAA 4IDHA 4ZCIA 2NTYC 4NKRA 4DIKA 3Q5DA 1NZDA 1SC9A 3DHYA 4HFRA 4HK4A 3ANMA 3O38A 3VR0A 4U6SA 2LUOA 2DM6A 3ZK8A 3JQQA 3EE6A 4A2PA 2IOFA 2R68A 2HW8A 3L7NA 3TL2A 3D1JA 5IJ9A 1XMOB 1T43A 3L9XA 3S81A 4M46A 4KREA 2G1UA 2Y66A 4UBIA 3STYA 3WK4A 1NP6A 1ISSA 1RKUA 1B42A 4HRAA 4D7AA 3AXSA 4A8JA 3N70A 1T3GA 1VCHA 2FSPA 3H18A 2Q28A 3M6FA 5H3CA 3B6EA 4KUHA 1HFKA 3AEQB 2CJWA 3K2QA 1VTKA 2VNHA 3M4YA 4X20B 2V55B 4TVBA 3R3SA 1IRXA 1PUJA 2VYCA 3K1ZA 2FEKA 1AOXA 3HHPA 5K9ZA 3O9ZA 2RE8A 1ZBQA 3ICWA 3HUDA 5EJ5A 5LMZA 3KPWA 5LR6A 1FJGB 4NABA 5FXMA 3BIXA 2CGEA 3LUGA 1P2DA 2ASEA 5FTNA 1NSFA 4IIXA 5C8XA 4H60A 3PQ2A 2PRKA 2Q1UA 4XX0B 4YJ2B 1XEXB 4OXRA 2BZ1A 3MWDB 4P92A 4ETNA 5C46F 1U1GA 1II0A 1YQEA 1Z82A 3WKDA 2OQ2A 4A6EA 4AL4A 4LQLA 3AUYA 2I66A 1PUXA 4NXMB 3NTLA 3O94A 5J5VA 3LWZA 1USKA 3TTVA 1I5OA 3M4NA 5HNKA 2WYUA 2A1UA 3H19A 3I73A 4GS5A 1BGXT 3KHKA 3A3NA 4YMVA 5KQRA 4HPJB 4DM7A 2QX6A 2NZWA 2O2YA 4G1UC 4X00A 2VPXA 2BVNA 3HEMA 3LZ6A 4BQEA 4FONA 4YJDA 3RT9A 1FXSA 3I52A 1VL5A 4JB8A 3W2EA 3INYA 1FTGA 5FBHA 2JCXA 4NZYA 4REOA 4C0AC 1Y3AA 2F9MA 2YDXA 4KBYA 4P53A 3K92A 3AF0A 5JQGA 4IH1A 4JL8A 1Y5IA 2ZUCA 1EVKA 4KQFA 1AURA 2ARKA 3VPAA 4WN3A 5J9FA 1I4LD 4JVMA 3ORRA 3JQ9A 2FPGB 2J0UA 2XUJA 1OCEA 5BSUA 1TPYA 2HHAA 4ZI7A 5JNTA 3BIJA 3DBRB 3ANTA 5KS2A 2C4WA 2FPIA 3SR3A 4I99A 5JDIC 1OZGA 5EXPA 4MUFA 5K4GA 2OHJA 4QHYA 1VDMA 5TMEA 3R3XA 1NWCA 3DZCA 4INZA 4KQ9A 2IYFA 2O3JA 3DEZA 2Y1GA 3SLKA 3ICQB 4ZP1A 4M86A 4J6EA 4MP8A 1PZEA 4DDWA 2ZTSA 3EUFA 2OGSA 2CHQA 3CZRA 4P9NA 1SJ9A 2BUCA 3BBPA 1DHTA 4G67A 1QE0A 1O6BA 1UPTA 1WHTA 1M2OA 2OZVA 3IPYA 4NFLA 3TGPA 2LCIA 4L8YA 4MRPA 4ECAA 1NOKA 2Z57A 4CQMA 3ON5A 4B82A 4OY3A 4G86A 1J5EB 1K6MA 3CO0S 3DV0A 3Q8LA 4D9GA 2XXBA 1H4VB 4LPKA 1SD5A 5BUQA 1SFRA 2GFQA 4EIWA 1OFUX 1XBTA 2O6LA 3I92A 3NKLA 4ZOEA 4DM4A 1E66A 1SURA 1Z4LA 1JAHA 3R0ZA 2D0PB 1Z0IA 2C96A 2JHGA 4NQZA 1LC0A 1WD5A 3ZDCA 1ZSNA 4X7MA 3JY6A 1V5GA 3VPBA 1T24A 1NX6A 3DDCA 4YCAA 2J0QA 3WRYC 1IMOA 2GN8A 4F45A 1XTKA 4W5HA 5KYKA 2CV1A 4JEIA 3FCYA 1SXJB 1WZNA 3QKRB 1M6VA 2H65A 3CUVA 4F6RA 2EBUA 2PT6A 3K05A 1EI9A 4I4CA 1Z4OA 4UFPA 4JJ8A 4PRLA 1RJFA 3O8QA 1KJ8A 1QOPB 3MMNA 4QU0A 2O19A 4LOHA 3JATA 4NTZA 3OC0A 3P27A 4A5OA 1EESA 3IJRA 1I5EA 2BM1A 1TE2A 2K7ZA 4Z9FA 3EGDB 4D0SA 2GNAA 3HFJA 1GKLA 1PI3A 3ZR4B 1D1SA 2HLHA 1N7IA 3GN2A 4U7WA 4NDAA 2I3GA 2VZLA 4RK6A 5T3YA 4Z3OA 1TZ2A 3BE6A 2C2OA 1XEWY 2ZIVB 1GA1A 3TIVA 3QVKA 2DWQA 3P4YA 4PU0A 4EJFA 1NNSA 1NLZA 4OA8A 3RRMA 2DEUA 1VQ1A 4I66A 2OK7A 3FCUB 3GDGA 2QN1A 2I4TA 5C8YB 1BCSA 2EZUA 4HDSB 2EHJA 1QPZA 1ODJA 3STXA 1ZD9A 5FOVA 2JCGA 3SNKA 1E6WA 3U1TA 3PXDA 4HN9A 4JUDX 3GRPA 3SYRA 3SR0A 4EHLA 1RYHA 3ZH9B 3BREA 2WB2A 4TYQA 2Y1CA 2OAP1 2WC1A 1YRYE 5EP4A 3TCNA 4EGFA 2F3UA 3VRHA 4ZDKA 4OQDA 3FAZA 4RIFA 1J1ZA 1T3TA 3DP7A 4F9TA 1P39A 2JGRA 4TV9A 1PBTA 3A9TA 3OJXA 4FYXA 4L95C 1F2VA 3G1TA 2FQ1A 4UEJA 1ABEA 1HY3A 2FRDA 4B74A 3ONVA 2ZI7A 3VKHA 3F6SA 4R9SA 5A3VA 2QRPA 4MDHA 1B6SA 4U2GA 4YIHA 1GITA 3ODPA 3NALA 4U2FA 4H18A 3C8HA 4TTQA 3DMRA 3OE1A 1UM8A 3DTTA 3Q8XB 4J0KA 3RS2A 4B6JA 5ADHA 3RJMA 4X62B 4X63A 3A3KA 1Y1PA 2HA5A 3EVZA 3L6UA 3UHJA 6REQB 3DHVA 3QPCA 1F4PA 5A62A 2W2TA 3FMGA 4JWKA 5EZYF 5CP8A 2GZHA 4BNJA 4DSOA 5C7YA 1AGNA 1YVPA 1JQEA 2RGEA 3JARB 4RTOA 4M0MA 5DT2A 1A7KA 4PVCA 4CM4A 1AUOA 2H1FA 4PYQA 4BMVA 1P2UA 3C3WA 3EW7A 4X1KA 4OL0A 4DNXA 2YOFA 3TBHA 3CKYA 1ONBA 4S05A 3CFYA 3TIIA 3G9TA 3S2ZA 2LGJA 4EPRA 1NW5A 5CB4B 3GJ7A 6ADHA 3ZLVA 1KDPA 4BASA 1ACJA 1TEHA 4Y2QA 3KWMA 3KWJA 3W5DA 2YOHA 4TV8B 2I78A 4H7DA 3FCOA 2PUJA 2MOKA 3FDXA 2Z83A 5CJ2A 5EA2A 2IX9A 1QDUA 4A03A 4I1YA 3JQFC 5E4FA 1G38A 1WXDA 1TTHA 2BWJA 1KETA 2XA2A 4UUBA 3U6KA 4R68A 4F91B 4D97A 4R6WA 3NTVA 3TR0A 4BEJA 1W4BA 4CLXA 5JJCA 1W44A 2M2IA 1O95A 2FN7A 2POCA 3DDHA 3VTAA 4TMVA 3RAJA 4CNQA 1H85A 1PNQA 2BV3A 2OHVA 4DIDA 2OZLA 3H1TA 4YNBA 3MAJA 4Z7QB 5ES4B 1YR1A 3KLOA 1L5MA 1JR3D 4R3WA 2IITA 2N46A 5I8ZA 4BLQA 1RFLA 2FN8A 1AO3A 4MIOA 2GPWA 3S4YA 3T3PB 3R76A 3T9CA 3DPIA 5EIAA 1KNXA 1NUTA 2IL1A 3DCJA 4GPTA 3W1WA 4B3GA 3GEHA 3ZX4A 2CLKB 1KH2A 4JCOA 2H9IA 1OAOC 3IVMA 3R9KA 5HOQA 1I2ZA 2P3LA 4LCEA 3WIOA 2JFHA 5BVGB 4Z7NB 5K0TA 3TCKA 4B7XA 2J3QA 3UTCA 1IOLA 4CEIB 2YUTA 3SSMA 1T1JA 1TXGA 1G19A 2XUFA 3GLSA 3K1JA 3LQ4A 2A35A 3PQ6A 4GRIA 4IXTA 1ZMBA 4J43A 4NBUA 1U1EA 1SOUA 2FU5C 3DBLB 4HYTA 4NFSA 3TSYA 5K0NA 2P2YA 3VJLA 3S1LA 4Y2YA 1FJXA 4UASA 4ZO6A 1LX7A 3EGOA 2ZRBA 3CH6A 4UM9D 3TD9A 2XMBA 3GCWA 4BCCA 1HT2E 2OYCA 3QVUA 2FJUA 5LP1A 4NH0A 3ILXA 1FP6A 2F3TA 1P45A 3C3EA 5AI6A 2NVOA 3OCWA 2FETA 1U8EA 1XQ1A 1MZVA 3MS2A 1ADYA 4OLAA 2Q1YA 4J03A 4QE3A 1SK9A 2VZ0A 4MKIA 2AHRA 3OFSA 1XX6A 2UZ1A 3AT1A 1KP2A 1KHTA 2WMNB 3Q3CA 4IIDA 1L8XA 4PLCA 5KCMA 3DOHA 2JH8A 2IZ0A 1AHNA 3NHUA 1B41A 2F4VB 1Q77A 2X5XA 3E2IA 2J30A 3L05A 1O03A 5K6AC 4TV8F 5FTMA 2F8TA 2Q29A 1MBZA 2AOUA 4LZZA 2NO0A 2X5JO 2CHVA 4MB2A 5FI5A 3ZC3A 2A0KA 2YHIA 2C5AA 3U37A 1RI2A 1MO5A 2OSVA 1NHGA 1RBMA 3G8AA 4KBFA 4XLZA 3ZS9A 3NHMA 4O3MA 3A9RA 3AK4A 1RXUA 2QTHA 3OHPA 1NFFA 1QZ3A 1A77A 1G1MA 3IAM1 3KYJB 4YCDA 4R2IA 1JHQA 3JYNA 4LNUB 5A4DA 4I1OA 4DZTA 4JI0B 4G9GA 3OJ0A 4HXGA 1OTYA 2A78A 3QLUC 1IXSB 1Y1SA 2G0NA 3I39X 2ANCA 3CONA 3DF7A 3NNNA 2FVXA 3LGSA 3VI4B 4PLFA 2VC2B 4XVCA 3AVVA 4MQ6A 1RCFA 5CD1A 3UFBA 2AEEA 2J4CA 1VYUA 1MIHA 1SAYA 3CUWA 4UMFA 4ENUA 4DN6A 3C7CB 5ALFA 2HNAA 2WPNA 2ZR8A 3R41A 1ZBDA 4JUIA 4MUBA 3EW9A 2QN8A 3LKBA 3TLXA 1V37A 3M34A 1XJ0A 3LHDA 1HL7A 3AETA 4NV0A 4G9EA 4JXJA 3QJ5A 1PFVA 3LWNA 2FN4A 2N3ZA 3GJ4A 2GNPA 3H0CA 1BCRB 3LFTA 1VXOA 2XNDA 2Q7OE 5JASA 3I05A 5BMVF 1J0CA 1CXZA 1IG3A 1KI7A 1QBGA 2YV3A 4TLLB 5KX5B 4UCQA 4JR0A 2XQVA 5F1OA 3DBHB 4EYSA 1DQPA 2PMFA 1NUPA 5D7NA 2Y0EA 1BHJA 1Q7EA 2PX3A 2QRUA 1E3JA 1D1QA 1MQAA 4AB1A 4Y1RB 4DCCA 4K05A 4ZHQB 5JS7A 5AJZA 3LCCA 4R9VA 1W1WA 2D0IA 4K88A 5AK6A 4BOYA 2FRXA 3WLNA 3ODGA 3A8TA 3RYHA 1XCOA 2EBWA 2DPMA 2PZMA 1NRWA 3VHLB 2Q4OA 2ZETA 4TSFD 2C4KA 1CNFA 3GH1A 3QU4A 3DJYA 4WNCA 3VGJA 5TQ0A 1GXSA 2DE0X 2CUTA 5JAPA 3RRZA 3SI7A 1LU9A 3UWMA 1GAEO 5IF3A 2IEIA 2C58A 3I5YA 4JYBA 1N2CB 1OFVA 1LLDA 1THTA 3DE3X 4PR3A 4DSZA 1KMMA 2J3LA 4MKRA 5SZKB 3Q0IA 3KB8A 3KYDA 1TECE 1D7OA 1N75A 2N0SA 2WTMA 3W9SA 2UYGA 4M89A 4WIAA 4X6LA 5JY1A 1WHSA 2NQ8A 2WTNA 2CXTA 4KXMA 5KYWB 2OG2A 2IJGX 3AR3A 3E53A 4GI5A 3J81A 3ZWOA 5DN6D 4NCXA 4ERXA 2FMXA 4F6CA 3Q41A 2GCEA 4J0DA 2QXUA 4TT3A 1JQLB 2WZBA 2ZWVA 2CJWB 1QIEA 2E4ZA 2ZJ4A 1TUBB 3RC1A 3EULA 4OHWA 5JTUA 1CDDA 4KVAA 1R5NA 4C7JA 4CYMA 1H2BA 2AG0A 4GI3A 4ZYYA 1SHUX 5F1KA 2CD7A 5LXTB 1MXFA 3INNA 1ZH6A 3CHYA 1XKTA 2G9RA 2ZUSA 4FJ0A 1O0SA 2WDZA 4QOIA 3W8NA 4C3ZA 4JLDA 5KWEA 4HV4A 1LSOA 1M1NB 3PUKA 3CLTC 3BICA 4M0FA 4LSWA 5JATA 1ZMTA 3C3YA 4OHRA 2BEJA 1XDGA 3WZ2A 3FTQA 1EJ0A 2QD1A 3PPYA 5E7QA 5EJEA 3O74A 4IRMA 4W5RA 3I1FA 3MTJA 2PGDA 5KJ6A 5SYNA 1MX5A 1SMKA 1Z3CA 2EP5A 2IF0A 4KPUB 3TD2A 3P4UA 4MB6A 1BX0A 2C77A 4ASUD 3ID6C 5AOVA 3JWEA 4CV1A 1SC4A 1MLDA 3BGWA 5GJVC 3DSRA 5ITWA 3NYIA 1LX6A 2AK2A 1OTHA 2AE2A 1L4KA 2GYYA 3TLKA 1II8B 3AR8A 5KINB 4UHDA 2VTDA 1M9NA 2BW0A 5CH3A 3WK8A 4B3FX 4DUPA 4ZMBA 2C00A 1SQSA 1XRQA 1EJ6A 2JIRA 4M55A 1KWKA 1GNRA 2WTEA 1AD2A 1GNSA 5GMOA 3FUVA 2DBVO 2Z4TA 1GAQA 3ESXA 4B3TB 1JGTA 3HS3A 3BKWA 2CUKA 3U7QA 1H4TA 3LY9A 4QRIA 5E7MA 3RUPA 3WIVA 4AP9A 2E87A 5JVDF 2XWQA 3AYXB 1KXJA 2BFBB 4JEUA 3VHXB 3ITDA 4U63A 5HF5A 1RYFA 4FE4A 2X58A 2YN2A 4K6GA 4WK0B 3WWZA 4QU5A 1GGKA 1EAYA 1ICEA 1SZDA 2PLNA 3CZ9A 2UZIR 3IAS1 2Q3EA 1A8HA 4XFJA 5BT8A 1JHUA 3NBQA 3BGDA 2N47A 1GUFA 1E3TA 4Z0NA 1NE7A 5K05A 1NGSA 4TWZA 3MTQA 2I76A 4U8HA 5K3FA 4GMDA 1N7JA 2ZWAA 4X97A 3TNDA 4MMXB 3F5DA 2JARA 2JAPA 3ZDBA 4OJNA 1UXOA 3OIUA 4JJKA 4XDGA 3EZ9A 2VZ8A 4O4LA 5C1PA 1SUEA 5LOVA 1R0XA 3E9ZA 4GW3A 4XXHA 5CIYA 2WABA 2R5FA 1I2AA 3FF1A 1ZHOA 1CD5A 1MH1A 1YBVA 2GBLC 4P3YA 2Z3VA 4US0R 4QASA 3NNDA 4GOLD 1QVRA 4MS3A 4F85A 5KNCH 1RMYA 4ZAYA 3W34A 4CFSA 1WUHS 3OU6A 4BNUA 1DIOB 3IDZA 1J2TA 1PNVA 3INGA 4B6GA 4UUMA 2REQB 3RUCA 4BRWA 1CUIA 5JBQA 2H4HA 4KNYA 1ZUD1 3JV7A 1ODSA 4FBGA 3RH0A 3SGLA 4A82A 4ZYXA 3INRA 4GP9A 4KR2A 4DY4A 1GGHA 1YH3A 4AWAA 3MZ0A 3ZWVA 2I6GA 2VJMA 1CW2B 3D8SA 3S3TA 4HMOA 5K0BA 4CKCA 2O3SA 1T13A 2ZB3A 2ONZA 4OXXA 4AZ0A 3FR8A 3TS1A 5IDQA 3SC2A 1NV8A 4G1CA 3UT6A 1RE1A 2XODA 1YXMA 2CJPA 3H6HA 1Z68A 2VK2A 3BWEA 3RIHA 3RVSA 3RWBA 2RMKA 4ZVUA 3E7WA 3CWQA 4HDKB 1Y34E 4JJIA 4UVDA 3GRKA 4BKPA 4N5DA 4Z1MD 3R9WA 5ESDA 5I01A 2IEDA 2WM2A 3NR2A 5LVAA 4ARAA 1L8AA 1PL8A 3BCSA 3GK3A 3R6TA 3VHQA 5DB4A 4NENB 5FPHA 2EZTA 4OI1A 3WLAA 4OQMA 1SVWA 4YUVA 1ZONA 1QCCA 1O0BA 3PHLA 4NNOA 5C8YA 3A6HA 4R8SA 1JDVA 1QHGA 2W2OA 4X8HA 5C4IA 3IT0A 5IJXA 1T6YA 3DMTC 3ILYA 4RQAA 4YI5A 2NVUB 1FFHA 2PXCA 1SB8A 4AS3A 1H8HD 3EVNA 2M1XA 3CT4A 5TVKA 1YA8A 1GQRA 2BMFA 1G8PA 2WILA 4XSGA 2BBSA 3GHYA 3FLMA 1UAYA 1IBRA 4QPNA 5DI9A 5JMOA 2JLVA 1NBAA 1KTIA 5FTJA 5I3ZA 2WWYA 1VPWA 4UXHA 2WU3A 1YO6A 1CQJB 4GR5A 5PNTA 2RGXA 1JV2B 3WAJA 3P2EA 5FLKA 3O9MA 3ZVNA 2IU3A 1XCBA 2NU6A 2W9XA 3FPFA 1NVEA 4NK4A 5GV8A 4DV2B 4HDRB 1VE1A 4KWIA 3LA8A 1XFAA 4BV2A 3VSDA 3K8QA 4JJAA 5BWBA 3ENWA 1XWIA 1R5BA 5JCZA 1X70A 4HD8A 3RJ9A 4D02A 4ENTA 2IK8A 3LXUX 3PGJA 4PX5A 4WMLA 4UDOA 5C32A 3U4DA 4TMXA 2PXHA 5MHTA 4RA9A 2ZYVX 2A30A 5TGTA 3DEYX 3VU1A 3I2JA 3K3PA 2XUHA 5MGNA 4X0EA 4B8WA 4GBED 1SRQA 2G76A 2I1WA 4QYTA 5ALQA 5F76A 3IPRA 3OQBA 4A8PA 4ALMA 3KWLA 3D0QA 4YONB 2JCBA 4K3UA 3DGEC 4WACA 2WJYA 2QW0X 5G4KB 4TL9A 4KV7A 2B5WA 3FTFA 3EQ8A 3P20A 4ITVA 1GARA 2IV2X 4Q3KA 3T9FA 2AYXA 1G16A 2HBRA 3GVHA 4CMIA 1N8KA 1XAIA 1IEXA 1FYFA 2AQHA 3CSUA 3JYQA 3OUTA 1MOZA 1PNTA 3RROA 4ER7A 3JQAD 2XBMA 1RKVA 4ZCQA 4ZEVA 1LEHA 2WIKA 1H6CA 4WZAE 5AUOB 2H3HA 4UUOA 3T7TA 4N7BA 4HNVA 4N48A 4D45A 3KCNA 2A88A 5BNIA 2I54A 2CLHB 1MPTA 4G24A 1DSSG 1Y6JA 1VGRA 1N5KA 3OKFA 3HACA 4NRDA 3K32A 5KOHB 2JAWA 1O4VA 3FDIA 4TQ9A 5A9TA 1S2MA 2IE8A 2DQYA 1CUFA 4TL7A 4B2YA 3PXAA 2Z95A 1DKOA 3QUCA 2RI1A 3F71A 4FYVA 4DYHA 4MROA 3URMA 2ZIZA 2A1TS 2FP4A 1XQYA 2ZI3A 3D8HA 1AGPA 1XNQB 4OEHA 1PJQA 2H57A 4IG4A 3SU8A 2YMPA 4PAQA 2OO7A 2VA8A 1ODCA 4MK4A 5BP7A 3C74A 2B78A 1G8HA 4O1HA 2P69A 2WU1A 2A58A 1NW4A 2GBPA 4JFRA 1PJBA 2PRZA 2RAFA 3FDZA 3ITKA 4AMVA 4FLFA 4I9NA 3MQFA 5DF1A 4HTFA 4ID3A 3VPXA 4JYZA 1W49A 1Z8DA 1ZG3A 4Q6WA 3ICCA 3EWIA 1SHLA 2PVCA 4PYMA 5TPWB 3GLFA 4DZZA 1R9GA 1SOMA 2HDNB 3ZHBA 3RJZA 1T9AA 1GSAA 1WXGA 1U28A 3F98A 3ZWAA 1L7BA 1QDEA 4X61A 3TXAA 4CXMA 3Q40A 3TNYA 4P34A 5IKMA 5FKJA 4YRCA 3NBYC 1G20A 3FZGA 3AR4A 2QRKA 4PZLA 4JBWA 2XGGA 4AF7A 4PE5B 1G1AA 1WDKA 1UC8A 2IYLD 4LQ4A 3CA8A 3MIIA 2MINB 3NB0A 2K7FA 1MOPA 2NV6A 3BIFA 1HEYA 3KD2A 2C5HA 3UWDA 4KFCA 2JBAA 5C5DA 2Q7DA 1F1JA 1J0EA 4GL4A 3G89A 1KTVA 3HYNA 2GVZC 3C3JA 4MJXA 5IZ4A 1TCVA 2QLFA 3DEKA 4IH4A 1P75A 2JAOA 4GNKA 4I08A 4RJ2A 4RGQA 3T9EA 3VPGA 4BKUA 2YZ2A 4PX2A 4XWAA 3NQ41 1KR5A 5LLTA 4FGZA 1XRPA 3TEFA 5KNCD 1RBQA 2C57A 2I7XA 3JWJA 1S2IA 3EG5A 2VHZA 3VYTB 2HZ7A 4MUAA 3UK2A 4J0CA 4D4JA 3G2PA 4OHOA 1LTKA 1UT8A 3H11B 4X95A 4A8JB 1OIXA 4DHWA 2EZ8A 3R9XA 3VJKA 4BGIA 3RJ5A 3EUAA 2AQIA 1E2JA 3THOA 1T8WA 3BK7A 1T8SA 3WWDA 3R5XA 2BGWA 4GQAA 5KNBD 4KR6A 4K26A 4FC6A 3QE9Y 5JZBA 3GT3A 1WA5A 2UZ3A 5FI0B 4W5JA 2IYYA 2QTTA 4BYMA 4DILA 5B36A 1U2GC 3QV1A 3IMKA 1QAOA 2ZPUA 3SQNA 3EY4A 1FX0A 2UYCA 3CN9A 3OG9A 1U8YA 1Z0KA 2IWRA 3SZ3A 2VXBA 3X43A 1X1BA 4HUQA 2PR2A 5IT5A 1LV8A 4MS4A 4CKBA 3DLHA 3CZQA 1SHZA 1C2TA 2VPQA 4FD2A 4NK5A 2DFPA 1KQGA 3CX8A 2PU7A 2SNIE 3DH0A 3WRWA 3ZLBA 5E6RA 3KXPA 1VLJA 5B1YA 3OZWA 3IXQA 3O8OA 4PRZA 5JAZA 4UTPA 1E79D 2RHCA 1BGVA 3JPWA 4CR7A 4LI0A 1COZA 1O87A 4J4TA 2NP6A 1PTKA 3BSFA 4HB2A 4P22A 3HYLA 3M6AA 3PSAA 1NPTO 2OV8A 3JQ8B 4KN6A 4HWSA 3BG5A 1MNAA 1X9IA 2WAAA 1WZIA 4MV1A 4KLNA 5DHUA 3U44B 4CM7A 4X85A 4B33A 1HXHA 1R2QA 2O07A 1R5OA 1D8TA 3H2BA 1GTG1 5BQFA 2DQ4A 2DSTA 3KB2A 3L02A 1PS9A 1GXSB 2M1ZA 4HDNB 5CEEA 1N25A 6ABPA 4X1YA 2J9GA 3LLVA 1ZLXA 4F71A 1HBJA 1ZQ1A 2ZJ0A 4KQGA 3HXTA 3LC1O 1DTWB 3NAQA 3BRCA 5K3BA 3OPXA 3RIYA 3D31A 5JWRA 4JYMA 4ZAXA 3QVSA 1L7NA 1RPNA 1LSJA 2PG3A 4XYBA 3T1OA 2BY4A 1K66A 2QJRA 3KU4A 3PPVA 3OFVA 4CNBA 3EA5A 3KXLA 2RB4A 4TLBA 2OILA 221PA 2IDJA 3SSNA 1BQ4A 4ENQA 5A3JA 1VIYA 3IUEA 2BF4A 4UHKA 3MNFA 1BX3A 2Q3BA 4OUDA 4FM9A 2ZQYA 3GJ8A 2X9VA 3BE4A 4Q7QA 1FP7A 3CUUA 4YJKA 4B8ZA 3ZCQA 2CLMB 1YZ3A 2OL4A 2W58A 2OVFA 1YRBA 1N2SA 2LIPA 2ZDQA 3EMDA 2HLDD 4HAYA 4RDCA 4I3HA 1ENYA 4AKSA 5KMGA 1YFLA 2B69A 4YDQA 2XUZA 2IW1A 4E03A 1YJ8A 4E5NA 3OCCA 4R2MA 4TUYB 1WDMA 3QG5A 1RHMA 4ZVRA 3R8FA 5AM0A 2EVWX 2UZAA 5AW1A 1QFYA 4KX5A 3ASUA 3E27A 4RX1A 1NBOA 2A92A 4HWTA 2PBZA 4H3VA 1R3UA 3TW6A 3T6KA 2PTHA 1JL3A 3B60A 3EG9A 5EI5A 5FBKA 2ONJA 5A4KA 5I9LA 2OP0A 5LZ8A 4FB5A 1Y81A 4TSKA 5E6UB 3SBDA 1UXHA 3OIFA 2Y9PB 3Q98A 1U0BB 3EVTA 1W25A 4C3VA 2ODPA 3EY9A 4TV9F 4AJ2A 4IFIA 2DBQA 1CRWG 2ORYA 3HHEA 4EZIA 2Y93A 2CMFA 2YMMA 3ZDEA 1DWUA 2IZ1A 3QF7A 1JEOA 1W5FA 2M6KA 5JAMA 1ZMOA 2F3QA 1MJGM 1KR2A 2BM9A 3GAMA 4F21A 4KO4S 1BO6A 4LDQA 2XTNA 4HLDA 4ZVNA 4X92A 3RWMB 4K40A 3B82A 1G2OA 3PXCX 4KJXA 1N6OA 2OMEA 2ZBRA 4O59O 1GGEA 1JQAA 5HGXA 3VZSA 1CIPA 2XTJA 3JZMA 4L85A 3K6SA 3U4GA 1OWOA 2YV2A 5IJZA 4GEGA 2VHVA 2KBEA 1G7CA 2I4IA 5FPQA 1VLVA 4KQIA 4LZPA 2X2EA 1R74A 2Q45A 4YO8A 4AROA 4F4DA 2X2FA 1EHYA 2EIXA 2Q1SA 3OMXA 3PYLA 1XZDA 4JNCA 1J4AA 2AOVA 1XU9A 2HLNA 2B8NA 4LQDA 3HJRA 3TSAA 2VUIB 3QX3A 2CHEA 1T5IA 1TA4A 2VJLA 3L3BA 1WSBA 1QFJA 1N1DA 4O4IF 4RABA 4CKZA 2O8FA 2O1EA 3FI0A 5BWCA 1I0LA 4CEHB 1DEHA 1HI9A 4D41A 1U0EA 1MZPA 1QO0A 3L1JA 4RACA 1LPOA 2E6UX 3DVRX 1RXCA 2Y3IA 1X13A 4Y7DA 4BVJA 1A4IA 2YHSA 4ZD6A 3G6KA 3QVJA 1I4DD 2P4UA 3DYVA 4JNKA 1E6LA 2HMYB 3SX0A 1K92A 4E08A 4OHVA 4UTRA 5DEOA 3AEUA 1C1DA 4DCMA 2FLKA 1CNEA 2OFOA 3FUCA 5DASA 1HEIA 4RTNA 4INPA 1J2RA 1JG4A 3LQKA 4N0EA 3HG7A 1IZZA 4FHDA 4D9FA 1JXOA 1E1RD 1Q3TA 2QPLA 2REQA 3E2PA 1N9GA 3SVZA 2ZJ3A 3CMMA 3QBEA 2E2WA 2WINI 5FRDA 5K0JA 4KN5A 5ILQA 4ZO7A 2H1VA 2LCFA 3C7KA 3G7UA 3M1LA 3V3TA 5I4IA 1LVUA 3L8HA 1YQGA 1JSCA 2VJMB 4OJTA 1QHEA 4RHTA 4G81A 4KFUA 3A6ZA 3LLCA 2HXYA 3NHPA 2C2KA 4LHZA 4LWOA 1Y5NA 3VKGA 2BZ0A 1L5VA 3LPDA 3D4NA 2WWVD 3K70C 3CX6A 4O33A 4JYAB 3H05A 1Y8RB 2JGMA 3OM1A 4NPAA 3ZGLA 1PSZA 4ZGGA 3BJEA 3FKSD 3GFSA 4AUEA 3IHTA 3WNVA 1LY1A 1KMIY 3GLTA 1GL7A 1BW9B 5IVDA 3VYVA 2PANA 3H2YA 3VKUA 1FLDA 1GFIA 1M54A 1YZTA 4Z99A 3SOPA 1YZYA 3W5IA 5FUMA 2PJRA 4V24A 1WSAA 3SEQA 3DFUA 3TUJC 3VC1A 1PCXA 1RS0A 4N54A 1MKYA 2A6PA 1GZ6A 3FETA 4G0YA 3MPUA 4WOPA 3TZ6A 4F72A 2H4XA 1GYRA 1XPOA 5BN3A 3QOXA 2ZBPA 6GPBA 3BTSA 5KQPA 4GEKA 3SHOA 1OWPA 4RORA 5K1ZA 3CIFA 4N8SA 4NPHA 1H93A 5UKDA 3HUFA 4RELA 1K86A 1SQ6A 1V6AA 2O20A 5DJ5A 1OJ7A 4WCFC 3PWTA 3UW1A 3WLFA 2WJ6A 5HUQA 3GNQA 5AKHA 3VOAA 3C6BA 1NASA 1H23A 5ECGC 4NAUA 4BFUA 3EAQA 5KU7A 1X7ZB 1M2EA 3K53A 4KE7A 3O2JA 2X19A 4XGIA 4DA0A 3QEBZ 2I5PO 1BE1A 2JNWA 4L15A 2BMJA 4OH1A 3K70D 1QGZA 1VCOA 3EFBA 4M87A 5I8WA 4OVKA 1IJEA 1JR3A 4LV5B 4KK4A 4QAJA 3OF3A 4UD6A 3GLUA 2XIQA 2RHRA 3B2EA 3WNZA 4Q4LA 4LEIA 1D6NA 3NHSA 3EHDA 1YCGA 1P33A 1H2RS 3A1CA 1CRQA 1WR8A 3A4YA 1OAAA 3DL2A 3I9MA 5IBRA 3K4PA 5HG0A 1ZQ9A 2IFTA 3E22B 4CTNA 5DYWA 1AHHA 4MLCA 3FPJA 2ATXA 1IVYA 2QJFA 3UPTA 1UJCA 3IO3A 1H8HA 2ACVA 4CN8A 2FKAA 5IM4A 1ZOLA 2EARA 1ZK3A 4UM9B 2JHFA 1WMEA 3PDIB 1BDHA 1ZISA 5EP3A 1UMCB 5AM2A 4TT3D 2BMDA 3HKEA 1EU1A 1P7CA 1X7XA 3O2SB 5IAEA 1IBSA 3P19A 4UBKA 5J1TB 1CEXA 3VZRA 1DTEA 1TADA 1N9KA 1V43A 2FKNA 1NF2A 1TEXA 1NF3A 4QOHA 2JAHA 5JJ5A 1W36C 3O03A 3T1QA 4CI9A 3U1VA 1R4MA 1D4ZA 5EJGA 5A9RA 2CCGA 2OY0A 2DOKA 3LLSA 3HJBA 3N8IA 3SK0A 3U3JA 1WMAA 3O8QB 1OIVA 3NZEA 1IPHA 3QEMA 3SICE 1ECLA 2JGFA 1A5AB 4QO8A 3OE4A 1A9QA 1OR8A 2E5FA 3JQBA 4BNDB 4EVIA 2CWWA 2GPBA 2QX9A 3K9NA 4ND6A 1OH6A 1PJ3A 2VJAA 3EZ6A 3TVDA 4YT2A 3A1NA 4EKGA 4QYXA 1SCIA 1XAGA 1KJ9A 2WB4A 3CBQA 2O8CA 3OOHA 3RQSA 1MABB 3E15A 2ERXA 3LF2A 3D3WA 5K8IA 2V7QD 4J0JA 4BB5A 5CT4A 3W77A 2P5SA 2J3IA 3O3OB 1LGYA 4XQ9A 1LA2A 3RBAA 2O5RA 5JOQA 5KWJA 2QS9A 2YJZA 2JFVA 2X40A 5LFAA 4CF5A 4EZBA 5G1PA 4IRXA 1X39A 1TW2A 1GDDA 4IZIA 2I6SA 4R2WA 4WERA 3O2QB 3V8MA 2WR8A 1Y82A 4Z4HA 1GAXA 1XMVA 1J70A 1BCRA 4MI3A 4ZOQI 4Z8YA 3K96A 1IMJA 1WMFA 2XNJA 3NVMB 4RZHA 9LDBA 5LJLA 3O7WA 2WAXA 4XD7A 5IJ0A 5K3SA 3QWFA 4JELA 5H4HA 1PT7A 3H4VA 1E61A 3KL4A 4YJ3F 1CZRA 5BYKA 4GH5A 1ZUHA 1QF6A 2OAQ1 3FTPA 4IZHA 4S1OA 1D1TA 5DBOA 2EL7A 4JSRA 4BVAA 4FCCA 4G8BA 4HNAB 3TB4A 3QXHA 2BTEA 3LDGA 2B8TA 5KI6A 2OHFA 5CNMA 3TSWA 3FOEC 1CT9A 3WI7A 3GMIA 2QRLA 4NAVA 1EFUA 2QAGC 1VB5A 1FTQA 4D96A 1QP0A 2TS1A 1C4KA 2WHEA 1IHDA 5IEJA 2JDIA 2QL5A 4PXYA 3K71B 2CXSA 4HL6A 3BJIC 4HH4A 4NBLA 4AZVA 5LZ5A 3HYRA 1QWOA 5LBIA 3JD2A 4Q1DA 4FCTA 3UMMA 1J9ZA 4DXDA 3L4JA 1H5NA 1GG9A 4RVDA 4DSTA 3UJ3X 1QAMA 3ZZMA 2NYRA 5K4AA 5JROA 3CWCA 3H65A 5EKUA 5IPFA 1IXRC 1FNDA 3EZNA 3FDJA 1N2CA 2ZVQX 3GCGA 4ES6A 3LY8A 3PYXA 3NBAA 1WMBA 3VTZA 4D5GA 4WLUA 2D7DA 4RZSA 3L0IB 1T36A 3DDOA 4ZPXA 1JR6A 1ZR2A 4WEOA 3RU2A 3J7AC 3H1PA 5ALZA 2NSHA 3DLPX 3HRHA 2A5DA 4HFNA 3KBOA 4MJ3A 5CR9A 3TX6A 3VTFA 4A27A 3KO8A 3QBJA 2XUIA 4W1SA 5HILA 4GWKA 3VR2A 1YDEA 4X84A 2WEKA 2VF5X 4L4RA 5AXDA 2QGZA 1XCGB 4I6EA 3B5JA 3C3AA 2D2FA 3NAGA 4O08A 1KOLA 5I47A 3CX3A 6LDHA 1Z8NA 4C5BA 3ENQA 3OIYA 3INTA 2W6OA 4DDUA 1XQVA 2P2ZA 2QE7A 3COSA 2GZ1A 4LHVA 5B7PA 3V4FA 3MOGA 1KEZA 5CA0F 4OU5A 2L42A 3BCRA 3PI6A 3DFMA 3R3JA 4CIVA 5HKKA 5BV8A 3NOOA 1U02A 4X20A 3EF3A 2AVDA 3A32A 1E9BA 4Z1MA 5I9SA 3R2JA 3JWPA 3JWIA 2OPHA 4DIBA 5AKXA 2WKRA 3L01A 4WXRA 3P5BA 2P3OA 4TROA 3AL3A 4MPJA 1TDJA 1IL0A 2FUNB 4B3BA 1O58A 1G8YA 3BF7A 2BFDB 3T7DA 1JDUA 3FHJA 1VPTA 3PGA1 1CEEA 4A5SA 4EY8A 4FHFA 4LJ4A 3IHWA 1UKAA 4KYVA 1VZ2A 4GF5A 4YFYA 1F2UA 1T5DX 5EYPA 1R18A 2Z9CA 3ZU4A 1EBUA 4PCUA 1YE8A 3PE3A 5LSAA 3WK9A 1Y8ZA 5KOJB 1H1LB 1TJYA 3Q1KA 4WLFA 3SXUA 3AG6A 4W9MC 5F12A 5TQJA 2VIIA 2VT6A 4FZ3A 1WU8A 2IYTA 1QYIA 3BFVA 4ROSA 4MEBA 3F3MA 3C3XA 3U7QB 4L4YA 1ZAYA 1UOOA 4CQJA 3EFOA 1WEKA 4JH0A 2DKNA 3WWYA 4BFLA 2WF5A 3FPBA 1PJ4A 3I09A 3FYHA 1NBWB 3IAHA 5AP9A 1VYHA 1F7UA 1MO3A 1T5HX 2WG2A 4P7BA 1E2EA 4HLQB 4QGSA 1CY0A 4HEJA 1Q15A 3N7UA 4XIIA 2J6CA 4NOKA 3ICPA 1EWYA 2GO1A 4Y2JA 1MC4A 2PZ8A 4RS4A 3GCXA 4URVR 1DINA 2WJHA 5A4MS 1YQQA 2DMRA 4OX9B 5EUBA 1P17A 3N1UA 4FDAA 3WRVA 5BN5B 2WV9A 4FGKA 2HQ1A 3KKKA 1W5SA 4B4VA 2PSHA 4FOLA 1F0PA 5TY0A 3VR4A 2XB2A 2UZ1B 5HZGA 1H0KA 2NV2B 3G7NA 3CNQS 1YZQA 2LXNA 2VBIA 3M5DA 4OUDB 1XRSB 3SHWA 3ND9A 5GZ1A 3G79A 1OVGA 5JJLA 5LOVB 4FJ2A 3L8MA 1YE5A 2EEZA 4D9EA 4DPMA 1NXOA 5CFLA 2O8DB 3BXOA 4F4UA 2J5BA 1G8SA 3ROZA 1QUFA 5FWYB 5K0CA 4FI3F 2LZ0A 4OIFA 1FBTA 4OX9Y 3M82A 1PW7A 2CT8A 4A73A 3KAKA 5IRCD 2I7CA 1J2UA 5FWXA 1A69A 2A8YA 1PFQA 2PZKA 4OF4A 3WKEA 3WLTA 2AOWA 1H2YA 2Y92A 4D8YA 4L8WB 5H1YA 4QL3A 3FHTA 5EMNA 2Y1XA 3O26A 3HR8A 2V4UA 2O0JA 1VI5A 1ZN9A 1KA9H 2ZVPX 2QYTA 4C03A 3KSBC 4M0EA 3QQ5A 1GGJA 1Y9ZA 4A16A 1XYYA 3HDQA 2DR2A 3N05A 1KI6B 2ZVDA 3FAKA 3QBDA 4GM0A 3UHPA 3HVJA 2XMDA 3CZ5A 3CEHA 1RWMA 2HU8A 2B8JA 1AKVA 3EDOA 4M1WA 1F3OA 4GWGA 5CT8A 4B4WA 5AFSA 3L1HA 2XD9A 3CBGA 1XJWA 4HNSA 3TW8B 2C9ZA 3KUKA 4L6IA 1ESDA 2W2XA 2NM0A 1V41E 2YHUA 1U7TA 1OASA 4OQNA 1E9CA 5B3AA 1VJGA 3T4EA 3EJWA 3G6WA 2BF7A 1G66A 2I3DA 2VJYA 4ND4A 3X2FA 2AZDA 2ZS9A 2BZGA 3FPSA 3OLCX 5BN4A 3M8KA 4PC2A 1G6KA 1GN8A 5FFNA 2JKZA 1A9ZA 3MGBA 2Q6OA 1A4RA 3QVWA 3T95A 3S55A 4V02A 5DM1A 1TAHA 4L7QA 3D6HA 3WGOA 1BVRA 4CCSA 3C6XA 1HO3A 2ZGVA 3DD5A 3CE9A 3DM9B 4KWHA 2ONYA 4NWIA 4EGSA 1UC5B 4ENVA 2V6FA 1YQTA 3MT8A 1JG1A 2B98A 1W4CA 2FCRA 4TMZA 5L6LB 4WHMA 4B48A 4EBFA 4V1CI 5K8LA 4I9GA 4EI7A 3CRW1 1WMDA 4HZIA 1RHQA 1T4CB 3HC7A 2FR1A 4WFIA 2ZJOA 3C3KA 3OZDA 1AJEA 3BEOA 5CD9A 5DEIA 2AFHB 1E0DA 1PZMA 4DA9A 3ZKAA 3ZK7A 3MM4A 2ADMA 5GP1A 5GTDA 4INAA 3R7SA 2BSQA 3WLSA 3GGJA 4EHIA 1V2HE 2GLXA 1FVFA 3COYA 2KLBA 3RTAA 2IEYA 4B0OA 2MSDB 4AT1A 2Z56A 4MQMA 2YIDA 1WHSB 5KYWA 4Y1RA 4EB8A 1PR2A 3CR7A 4ZHQA 3GLIB 1XNGA 1JDTA 4IY1A 3T0FA 1A7UA 3CT6A 3NBUA 3RWOA 4K8RB 3VR6H 3R40A 4RTMA 1K08A 2H2HA 1GQFA 5ALTA 1E98A 2OYSA 1TOAA 1H2AS 1RKBA 2J8ZA 3JQEA 2QN3A 4F86A 3GEDA 5IC4A 3S5UA 4BRZA 1TYEB 2BFMA 5LC1A 4EB3A 2EU8A 3Q8KA 2NZ8A 4ALKA 2WU8A 3CLUD 3ZWNA 2W42A 2D00A 2ECFA 2VRWA 2I2XB 2HWKA 3EB9A 4UQPA 4B80A 4DSAA 3QTTA 3IBGA 1DJOA 1S7GA 4MCAA 2C97A 9ABPA 1RAHA 1A0OA 2BM0A 4X3OA 5LP6B 4IMPA 1KEVA 2B4KA 4HADA 3TH5A 2ZK7A 1RQXA 1C1XA 4RESA 5BVHA 3CUYA 3JYOA 3THXB 1QK4A 1LBTA 2W2LA 4QXAA 3IE1A 3QEKA 1EX7A 1XLVA 2IY7A 3KT6A 5JAQA 3MD9A 4S24A 4Z0TA 3BMQA 1XVUA 1J5XA 5CYFA 3ZQJA 1NNEA 1AQNA 4FSHA 1N2JA 5FFFA 3AVTA 5SY9A 1UOPA 1KJZA 1RIFA 4WX2B 5HTKA 4CHGA 1SXHA 3OEHA 4H1WA 4PPNA 4B83A 1OZAA 1KI3A 2O50A 3QX8A 5SYMA 1COWD 2DTDA 1I36A 3CE6A 3IP1A 3JPYA 4H4CA 5ADUS 1JFFA 3GH3A 1T3ZA 3FNFA 4JZKA 3PQ5A 1QF9A 3FWZA 2NN3C 4IIVA 3TECE 4MWEA 5JZOA 3EPHA 1KSFX 3FKQA 3JTMA 3PC3A 4V38A 1DRWA 2BDUA 1P0CA 5AVRA 5NLLA 1ZJ6A 2VCEA 4DPKA 2C3OA 2DPXA 3W5CA 3DZKA 2XCRB 2FR8C 4J9VA 4XVRA 2J59A 4C2UA 1FFWA 3CCBA 4RGBA 4KX3A 1TVKA 4TLDA 1U4OA 5F51A 3W2HA 1BDJA 3Q2IA 2AXNA 3V8RA 3SYLA 3BXEA 2AB0A 3USCS 1SUBA 2CL0X 2DUUA 3X2EA 1KERA 4QDKA 2B7BA 1PR5A 3LO8A 4CDGA 1NN1A 4ZJYA 5JCPA 4MS1B 2H63A 5L95A 2CV0A 1XV5A 1N2XA 2FSHA 2FWAA 5A04A 1MT3A 5DCWA 3VNBA 2I3BA 2FEOA 4E07A 1T0IA 4W1QA 1A9RA 4WFQA 2YN0A 2VWPA 1KYQA 3KOMA 2ZSKA 2QM7A 4GPBA 4LE0A 5EKSA 5AIAA 1P3Y1 2P79A 4M9CA 1L5RA 1C81A 4KWEA 4TMKA 4X65B 2FZ4A 3PDUA 4RXMA 1U7ZA 4GL2A 2DJIA 4XVUA 1W5EA 3L1VA 2HMWA 1G3QA 2HT1A 1CUVA 2BDTA 2MINA 2EC5A 2PL3A 3D2AA 2HSWA 3GFRA 4IKPA 3VO2A 5LM3A 4M9XA 2QT1A 2JBAB 3KJQA 3U7HB 4H6WA 1NR7A 2HIMA 4UTVA 3SJBA 4L8FA 1R0ZA 5J1SB 2Z8ZA 2P6MA 1ECPA 2B5OA 3D8UA 4JUAA 3KJFA 3NATA 1ZOOA 1EFTA 3QA3E 4TXLA 3AEXA 1YKGA 3KYCA 3CEJA 4ESEA 5JD6A 4X44A 4MUNA 1EA7A 3B1YA 1C0IA 5K45A 2HT6A 3OQIB 2XB6A 4QDUA 3C70A 1DGQA 1VG8A 5L6MB 2REBA 2V6GA 2Z8XA 4NSNA 3GEGA 5I5EA 5IASA 4RZ2A 1WF6A 2WUVA 1CS0A 1F4LA 3QTBA 2RARA 3T5TA 4ACAA 4YT4A 2X4LA 3IUBA 4NJEA 5AW8A 4BO9A 1DBQA 2OLKA 2XOKD 3A05A 3ZHVA 3A4VA 2ZLBA 1D4OA 3NUQA 3OEWA 2YNMD 1NKVA 2QTZA 1AS0A 1FDSA 2RGUA 3V00A 5JCOC 1JJIA 1ADJA 1TQDA 3AP3A 1PLKA 3I3SR 4MVWA 1J24A 1SUCA 2AV6A 1EVIA 1CY8A 2W11A 4IIBA 2UZ4A 1QDLB 3ORYA 4MPPA 4AX8A 4GXQA 1JYEA 2Q5OA 3FUUA 4MV5A 5DNEA 3WLIA 2W8BA 2W2QA 2AMYA 1OBCA 1NBMD 3UUGA 4XUEA 2XXAB 4K9OA 1Y7HA 3FYUC 2UVQA 3R3WA 1UPFA 4HZUB 4XRGA 4AZ0B 2AZTA 3AHJA 1ODLA 3GIDA 5FHQA 2OFFA 2ZB7A 3BWVA 3RABA 4GLFA 1F51E 1GADO 3Q5EA 4X6XA 3RVKA 1B15A 2HWUA 3V4SA 1GLVA 1OAOA 1W6UA 1WCV1 2JFUA 3ZV5A 3F90A 3P2MA 1YKFA 3RCBA 1YI8A 3GJQA 3P9KA 4OGLA 2IZ5A 1E6MA 1R0YA 3BCUA 4MCIA 4IHJB 1JX6A 4L8GA 5IDVA 2AN9A 3L7DA 1ZD4A 2VHXA 3RVPA 3HCDA 1OXKB 3DFZA 3U44A 4KEAA 1ZW6A 3BH7A 2HJVA 1U3UA 3VC3A 1TO6A 3K94A 3H6KA 4JDPA 4DBLC 6YASA 3IB3A 5DBGA 2XE4A 4S1WA 4BJHB 5LYYA 2Q99A 4PWYA 3DJFA 4LC1A 4CIYA 4P2GA 5KDLA 5BWNA 2AMFA 1XTQA 1RADA 3N0WA 2HADA 1YDHA 4P82A 2PKCA 3EDMA 2GAAA 1YONA 1P74A 3A70A 4TWJA 4OMFG 5IFKA 3HNRA 5HRCA 1PS0A 2D1SA 1CX9B 5DFAA 4J07A 3NNSA 3GU3A 3M6IA 4UNQA 3ZWYA 1NLFA 4C78A 2WM9B 3OOWA 3LQ1A 1EVYA 3QXCA 4B4OA 2HSDA 4PZEA 5HMLA 4NVRA 3C6QA 2I4LA 4GX2A 2Z30A 2V7BA 3GJZA 2J3JA 1CF9A 4JJ7A 4X71A 5AVQA 1ULHA 5A03A 1KMHA 1RTKA 2UVDA 3C6KA 5B6IA 3RC8A 3Q9SA 5TIIA 3PD7A 3MJ4A 1FFAA 4GP6A 4DA7A 5EJ8A 1NMYA 2X0NA 3V8EA 1K88A 5IP5A 3AZPA 4Q1BA 3EWAA 1O96B 3L0PA 2JLZA 3RFFA 4FFDA 1NXWA 1Z6GA 1ZNZA 3B70A 1B7GO 2WIJA 4LV6A 2Q0SA 4BP3A 4CQMB 4CEJB 1BD4A 5TXGA 2C7PA 1SKAA 1JLLB 2QAIA 2QR2A 2V7GA 1BHSA 4C6HA 5IARA 4J91A 1JT2A 3AM1A 5TX7A 2A0YA 1DCMA 2MMCA 3M7IA 3OZIA 5E4YA 5C4MA 2Y1LA 5LL6P 1TEVA 3K0HA 4QSHA 1NW6A 3LQRA 1XTTA 5BXYA 4Q3BA 4IDQA 1BEUB 1RLJA 2P9HA 2H4YA 2AR7A 5SV2A 5E3HA 4YI3A 2BGLA 2GRUA 3ET4A 3ABIA 2ZE7A 3K72B 2LTAA 4JEMA 4KN9S 4A26A 3TTUA 4XEUA 4DLLA 1ISRA 3CW2A 3R6DA 1ZIYA 4JC0A 3SXUB 1E5DA 1PJ2A 1P0FA 1AXRA 1QNLA 1W8IA 1KO7A 1MEEA 1OLXA 4BZXA 4PNPA 3R74A 1VI2A 2JLAA 3GDWA 1GG5A 3NS7A 5E2BA 2WHPA 3D54D 4QATA 4PGGA 5T41A 1CSEE 5TS3A 1G7SA 1MOSA 4MRSA 3HK2A 5ERGB 3PVCA 5F5NA 4ZN6A 1LSUA 3DOEA 2PSFA 1EVZA 3IH5A 4QQRA 4MRVA 1L5GB 5HZKA 3Q3GE 4B2PA 3N2KB 1ONSA 5GAJA 1P19A 1WQ3A 4GYJA 3SZOA 5JT1A 2QSUA 5ED0A 5L3QB 3I5MA 5MFPA 1NZJA 2VKTA 5JCJD 4JJGA 3VOTA 2PXAA 2ZZNA 3A6JA 1OLOA 2BFBA 1M8PA 3MELA 2HK9A 3OCZA 3PX3A 3UV6A 4QUBA 2VLIA 1O94C 3PJDA 4HUJA 1Q1ZA 3RVQA 1X7YB 3WO0A 5DYYA 3EGXA 3WS7A 4ZDIA 1B1CA 1QR6A 2JLWA 4KAXA 3LUDA 2O8VA 2O0HA 3ZBQA 2C42A 4FYMA 1SK8A 1V71A 4NOLA 1GQYA 3QBVA 4XQGA 2OQVA 3TI9A 1NI4A 1A98A 1KI9A 3BB3A 3WQQA 1XEAA 2ZRLA 3H9UA 5EXXA 1FP4A 4QPDA 4REQA 2XY4A 4LYEA 3WOHA 4DQXA 1MHPA 3CF4A 3AEUB 1CIVA 3UFXB 3N39C 4ME6A 2CL6X 4ESHA 2CF6A 4F06A 2FP3A 3B1ZA 4P54A 2Y1EA 1K75A 2ODEA 3HDJA 4QM6A 1K3UB 3KZXA 4C6SA 3WXBA 5CFNA 1G0NA 2FMFA 2HMTA 2I1LA 2IYXA 3F6CA 5DM0A 3RFCA 2PZEA 3CN7A 4HQLA 1JWBB 3L0YA 1FSFA 1RPJA 2GKSA 5EZYA 1FMCA 6Q21A 2DQZA 3HBJA 3G0CA 2PUVA 3I0ZA 1MV5A 4MUHA 4ZK2A 3L5OA 1WZEA 3CURA 2F43A 4HNHA 2QAJA 4ON9A 3ZBPA 2GRJA 2F90A 2Z6AA 1KJIA 3K0KA 3NC1C 4Y2SA 5L3VA 4QGFA 2EQ5A 3E70C 4QEKA 4H1HA 4A4DA 4F9EA 1EFRD 3G0OA 4LBYA 2X5NA 2P27A 1JHXA 1SUFA 3CM0A 5LJIA 3I04M 4J6FA 3F6PA 1T6XA 2CUZA 5MGBA 1VJ0A 3WBJA 2VK1A 2GM5A 4AC9A 3QLJA 2WJIA 1NVUQ 5E95A 5HKLA 2ZRFA 3DFFA 2NZVG 3OFNA 5DMXA 1YVRA 4HB4A 1GPH1 5FPPA 3UQYS 1A9PA 4JXKA 3T7EA 1WULS 1VPDA 3DS8A 3TSOA 2RKOA 2ES4A 4RNDB 4LHYA 1G8AA 2OV3A 4YPVA 2WSSA 4LGCA 1MV8A 2QNIA 3OE7D 3BB4A 4MR9A 3ZGNA 4IKOA 2ZBQA 3DBIA 3G5LA 4D42A 3LVBA 1O0CA 1P61B 4PG7A 4XD7D 2AL7A 5P21A 1ZI8A 1FMTA 2AG1A 2CCKA 3H3FA 4WASA 4DQVA 3KD3A 4PYNA 2VNIA 4QSMA 4WQMA 1E8MA 1UPBA 1Y7LA 3VJMA 4AYWA 5B4UA 2J3EA 2F59A 1EGMB 2RJOA 2AZ4A 2WJVA 1GUAA 1NXTA 3DD1A 1KEWA 3RV4A 1M7BA 4FW9A 4U7JA 5C53B 4LMRA 3GLFE 2RH5A 5FAKA 4ZTBA 2IYOA 2QM8A 1JDJA 2E21A 2H1IA 4I81A 5H9WA 1SH7A 1DFIA 3ND6A 3OZSA 3SPXA 4RXTA 1DOHA 2C03A 2P75A 3GXOA 4HX5A 4JU8A 4KZKA 3HH8A 2OXEA 4OHBA 1OV4A 3ZVLA 1JALA 1V1MB 4MP3A 5DYNA 1K7XB 1SIOA 4R71A 4F5YA 1B0UA 3JQ8A 2OKGA 1YJCA 3MWEA 1JHRA 3PS9A 4KLAA 1EZZA 1E3SA 4HDRA 4E46A 4C5AA 1OF1A 2HBZA 4G0OA 3QPAA 2BC9A 2ZPTX 4GM1A 2W6NA 2C9BA 3NUZA 1ZVJA 3M1AA 1X80A 1AF7A 1WKVA 4Q16A 2VO1A 4GLBA 5BNZA 2IVZA 1Z8HA 4R98A 3G0HA 2Z1DA 2W6ID 2WPDA 1EUZA 3AGQA