2QD2A

F110a variant of human ferrochelatase with protoheme bound
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPAIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Ferrochelatase
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 136
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd2A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd2A01
2QD2A 2XWQA 2H1WA 4CCSA 2PO5A 3AQIA 2XWSA 4MK4A 2XVXA 2Q3JA 2Q2NA 3HCOA 4F4DA 2QD5A 1L8XA 2XVZA 1QGOA 1HRKA 2AC4A 4KLRA 1C9EA 2PO7A 1LBQA 1TJNA 2XWPA 2C8JA 2H1VA 2AC2A 2QD1A 3GOQA 3HCRA 2QD3A 2QD4A 2JH3A 1DOZA 1N0IA 2Q2OA 2HK6A 2HREA 3W1WA 3HCPA 3M4ZA 3HCNA 2DJ5A 4KLAA 1LD3A 2XVYA 4KMMA 2HRCA 1C1HA 2PNJA 1AK1A 4KLCA 3LYHA
chains in the Genus database with same CATH superfamily
1O95A 4WCDA 3KDSE 4WOBA 2FW7A 2ZJ8A 1DQSA 2AOTA 2XRMA 4TYQA 4RVHA 3UENA 5JCJD 3QXSA 2GBLA 3K1AB 4NYJR 2PGOA 5IS2A 3GGDA 4K1XA 3EBOA 4DREA 1M0SA 2ZFUA 2IEGA 4Q4DA 3A9WA 1OW3B 2ZIZA 1YZQA 2A9QA 1JKMA 4X90A 5E6UA 4RTLA 3UNXA 2WJYA 1C0LA 3AY6A 4UUNA 4XM0A 2XNJA 5EESA 4OAPA 4FHDA 4ZALA 2KLBA 1CQJB 2WSIA 4M1SA 3RC2A 4BNVA 3K6SB 4LPSA 3IMFA 2XGGA 4KKXB 4RTJA 1XROA 1GR0A 2GD6A 1MQ9A 2II6A 2OLJA 2WSYB 3EZ6A 1FC0A 3MMSA 3N2KA 4MINA 4MHOA 5AVKA 4BNKA 3CVWA 3MJVA 2KBEA 1H0KA 1MW8X 4XDGA 3DA8A 4KUEA 4LWZA 4YFVA 3U7GA 2AF3C 5KNCD 2VQ3A 4N41A 1CZHA 2X4IA 1KY4A 1A50B 1UKEA 2BEVA 3I05A 4URFA 4B47A 2JGNA 5ALKA 4D6XA 1MFPA 4GX5A 4IJWA 3ELWA 4P3YA 4A0FA 1NMQA 3DFKA 4TYMA 4FGUA 3RUIA 4CEHB 1W75A 2FP4A 1U2PA 1P2DA 3AIIA 3E9YA 5H4HA 1N3IA 3KPJA 1XALA 4FTWA 4M22A 5H7XA 1KU6A 4BN4A 5C7LO 1YC2A 5C1BA 1EP9A 2Q8PA 4JB2A 4IDNA 1W96A 1WQ4A 4X54A 5LN1A 2O2DA 1Z0SA 1JR2A 1AKVA 1K4YA 1H8HD 1QYVA 4JBIA 3HUDA 4JX9A 4JJKA 4B82A 5DHAA 1KJJA 4HNAB 4NYJQ 4V3CA 4BMSA 3T3OA 1FTQA 4V0SA 5FA8A 4W7IA 1EAMA 3KPUA 1W36D 4X92A 1ZINA 1B41A 2QJFA 1LD3A 1SEVA 1USUA 4Z4FA 5JFGA 2ZZMA 4NV1A 1DEXA 4HQOA 5DM4A 1U4OA 3Q5EA 1OX4B 5EFZA 3MWGA 1XNJA 1JB9A 1YZHA 1N2EA 3PKIA 4QYIA 1ADFA 1H66A 4Q93A 3ADDA 4WN9B 1SOAA 4C4XA 1VSQA 2P41A 4KWEA 5IMBA 4PC7A 2IBTA 1ZZGA 3PZRA 1VE6A 1WE2A 3PNQA 4RDHA 1G8FA 4RENA 3QSYA 4G0XA 4JI0B 1XEXA 5T3UA 3SNHA 1F8GA 1KHHA 1UMCB 3OCUA 5G1OA 2J0SA 1IBCA 1X7ZA 4XUGB 1QHHA 3C1AA 4XVRA 3WGIA 1O97D 3NHUA 4NCHA 4UMDA 1Y9AA 3IRVA 1RXWA 3VO1A 2QRHA 4ID9A 5KVSA 1ZN8A 1PCXA 1TK3A 4GNKA 4CYMA 1J2TA 1H6AA 3CPSA 2R87A 1PL8A 1E1RD 3N8GA 4II7A 1BMTA 1X7YA 2IYLD 4M8IA 5JSKA 3ZCQA 1B8NA 3VU0A 2WTNA 2J6HA 3JAKA 4A2WA 1G4UR 1WIWA 2H6EA 1JKFA 3SC2B 2E21A 3M6LA 1OLUB 3B12A 2WMOB 3O4VA 2O6LA 3TUIC 4DYDA 1X70A 5AW1A 3H7IA 4DLLA 3ETGA 4R1OA 1KMHA 1YASA 3L5KA 5SICE 4BRWA 4F5DA 5FHQA 1SOUA 2PMWB 5DBGA 3SQXA 2Q0QA 3M6MD 4BFZA 1I14A 1N0IA 1NVKA 2VH5R 5I48A 4UNNA 1X9IA 3EGVA 4M9UA 5C34B 5CIYA 3I6ZA 3V6MA 1T4CB 4PYRA 3M4XA 2NXNA 2Q6TA 4NCXA 3GH3A 2A4MA 1QU2A 2FB9A 2FN9A 1X2BA 2N47A 3AJ9A 4MYSA 4L2IA 4NCIA 1WF3A 5CPBA 4BWVA 4ZDIA 3L6CA 1C1DB 1LDMA 1R3DA 3DQZA 3N8KA 2BPOA 3STXA 4CKXA 2E89A 1JMKC 1GKUB 2YFYA 3GA7A 4MQ6A 3VSDA 1LFDB 4HDSB 4PPFA 5IDYA 3TWOA 1C9EA 4PCUA 5CT6A 3EYWA 5G53C 4PNEA 4UOEA 1B42A 1I4OA 3VTKA 4B3IA 1OKKA 2GFHA 2PLRA 2COKA 3WL4A 5DCUA 1DZIA 1GUYA 4RF4A 3NC4A 1Z0UA 2FAXA 2RHWA 4IDQA 5GADl 4HEA6 1SAYA 4N0DA 4AQDA 2PL5A 4K1LA 4LJ4A 3EUWA 1GKYA 4JJAA 3R5SA 4JLVA 5C0OE 3GRRA 3GJZA 1V71A 4CM5A 4V03A 1HSOA 2FZEA 2G25A 1VB3A 3BMNB 1CY1A 1DCFA 4B73A 1Y5IA 4KHPB 3JATB 4K46A 1Q17A 3BF7A 3EVAA 1TPZA 4XI9A 5BNFA 5LZ7A 5P8WA 2CWDA 3HKBB 3QV2A 3WTBA 4RJTA 1EJ6A 2AN9A 4ZOBA 5TQ2B 4BE9A 2C97A 4J16A 1B2RA 2WRZA 1VBKA 4M98A 4CG2A 4EMBA 5C51B 1RR6A 3OQVA 1E98A 3AOEC 4MV8A 4J94A 3ROFA 4H6PA 1TIKA 2NO9A 3QV1A 1F38A 2IYYA 1V11B 1QLWA 3GW8A 3AK4A 4GX2A 4N01A 5E1MA 3UAXA 1P62B 1D6JA 1HBJA 3KQNA 1N25A 5A9SA 3R9XB 2NV6A 2JGRA 4XIFA 5D85A 3NATA 1J0BA 3I58A 4J0FA 4LXHA 3B9BA 3B52X 3D5EA 4FQ5A 3D5QA 2GD0A 2IYSA 2P90A 4FDAA 4XDYA 2L69A 3ZE9A 2NO5A 4ALLA 4ZJPA 1ZIYA 2V7XA 3WLOA 5C8YB 4OATA 3WGVA 1IY8A 2IPOA 1YDMA 2L82A 3EC2A 1UJ2A 3IP7A 4MITA 5K2MA 4DVJA 4DNQA 3KUDA 1FP6A 5DYIA 1NU8A 2VJYA 3OFKA 3IOMA 1MC8A 2RAFA 3OY7A 3MWYW 1UXJA 3QOWA 4TVKA 2CW5A 4QT4A 1DIAA 3LDFA 2YKGA 2QY9A 2Y0DA 2NUTA 1KFEB 2YJGA 2ANBA 1JGTA 1N5KA 1SBNE 2ZRLA 1DAGA 4TLBA 4B3CA 3UPTA 4XWWA 2PXAA 4DRXB 4UULA 1FU7A 2C31A 3AMVA 1TK2A 5F2OA 4IDEA 1W4BA 2B7BA 1WXQA 3EUEA 5SV2A 1ZI9A 1PVVA 4RM3A 4C5AA 4LYHA 4F2GA 3SYMA 5DV9A 3FRIA 1K2VN 5CX1B 3GIDA 3RODA 2DFVA 1ZOLA 5HILA 3R3ZA 2PNFA 2P9ZA 3PXGA 4S04A 1HEYA 4XIJA 1C1HA 5EFOA 3GEDA 3RFCA 4UNQA 3RQSA 3BGWA 2H5EA 2VSQA 3PGMA 3ELDA 4BE7B 2VF5X 3DS8A 5CB0A 5IKXA 2N3ZA 2JKVA 1Z5UA 2I4RA 5GV8A 3LI2A 3B9QA 4RTPA 4HPWA 2HKIA 3HEAA 4XLTA 1RLJA 2GSWA 4NNOA 2W6JD 5REQA 3VNBA 3P1JA 1M5UA 4FB4A 1FS6A 2AE1A 3EVDA 1TYBE 1FMTA 3CURA 2GPBA 1WB4A 3NKVA 5JI3E 9MHTA 1R16A 1QIHA 2H51A 3H5RA 1HQCA 1RIFA 3HCCA 4D0RA 1ENZA 4I4LA 3U4HA 1JEDA 5DLQC 1Z2OX 4ND1A 2GJAA 1DIOB 2F4NA 3B6EA 4PNZA 4N0QA 1C7IA 5LP6C 2ZS7A 3PFBA 4GU5A 5FX2A 5K0SA 5IF9A 1HT2E 4YO8A 4C4YA 4KHZA 1MJFA 1XKLA 2R5WA 2ORIA 2RSLA 1NSTA 4BZQA 4TV9B 4UPDA 4EUKA 5C81A 1MJ5A 4ZVSA 1UK7A 2X0EA 3K0CA 4H6VA 3Q41A 4NEGA 4RZUA 2H0AA 4M1EA 4EQ6B 4WKPA 1P8AA 1KS2A 4KV7A 1DARA 1PJRA 4AWAA 3BH0A 3TPZA 1PYGA 1N0VC 1V3TA 1MAVA 2O1EA 3OIWA 3H3FA 4O4HF 2O5EA 1M1XB 6YASA 5ENDA 1FXSA 1MQ8B 3DZCA 3F2VA 1Y3IA 3LQQA 1HE3A 3QEMA 4GDMA 1Y63A 3P0JA 3B89A 3PHJA 3GCDA 2R65A 3FTDA 2OV3A 2QM0A 1QHSA 4IQ0A 5TY0A 2JDIA 3X43A 2WFAA 3FNEA 1K6EA 3SFTA 4FYJA 3U9LA 3M6UA 4Y2UA 4F84A 2WWTA 3LYUA 3FMVA 4B5KA 3TUZC 2GXQA 3SCZA 1PTKA 1J2EA 3KQQA 2F62A 4ZHQB 4CE6A 4LDAA 3NI2A 3G8AA 5FBRB 4E5DA 1C0KA 1OU0A 2J32A 2VZ0A 4Z2YA 2ERCA 1LI4A 2BI8A 3M9XA 4BNFA 5AW0A 2YRFA 1X0VA 2Q9BA 3D0RA 4DZRA 4KLRA 4LHXA 2OBLA 1I7LA 2BISA 4M83A 4GGPA 3CQ9A 4G0OA 2A5LA 5ANRB 1EXVA 4D26A 2VHWA 3PFWO 4O2BA 3EXEA 3CNLA 1PGJA 4B3GA 2R8OA 2HSWA 3JZDA 4N76A 3ADCA 1AJEA 4B8WA 3O9ZA 1L4LA 3UUEA 3HR7A 1K5GA 1EWYA 2K5UA 2QI9F 3OJXA 2R8RA 5DB4A 1Z38A 2VJMA 4KNVA 5ER6A 2BDUA 2O19A 5JHHB 4KE7A 5CVJA 1R0YA 2O50A 2SKEA 4KPFC 1NNSA 5CB4F 3EQ8A 5JPCA 4PN3A 1TL7C 4AW9A 5BYKA 1UQTA 1NC1A 3UWOA 2QN1A 3PQFA 5ILOA 4XQEA 4AO6A 4LBZA 3E7PA 1RJEA 1QCCA 3CNHA 4NJEB 3QNMA 2OXTA 3PCTA 1YE5A 4GXRA 2R6HA 1H2ZA 2Q0SA 3CF0A 2YINC 1KK2A 1FDVA 4OK5A 5EP2A 1H93A 1MBZA 1L7XA 1XD2A 2LUOA 3I37X 3WBFA 3ZZUA 4CL8A 3ZD9A 1RLMA 3M89A 5SY6A 2H3EA 3O0DA 3N70A 4KIJA 4OLFA 1Q12A 2CMGA 5E38A 2UYOA 2OFFA 3A9RA 5EAIA 2WYOA 4HK4A 3G0CA 1Q7BA 3VPHA 3CUUA 3CF4G 3HJHA 3Q11A 5FOVA 1T4MA 3FUCA 4EKEA 2D06A 2Q41A 3OQ1A 3PQ5A 3DMPA 4OQEA 4AS3A 3NP7A 1YIAA 2XWQA 1CU1A 4IMRA 4J6FA 1WHSB 1YUMA 2X5JO 4Z49A 2P2DA 2UZIR 4BMVA 3GJRA 1N2IA 3IAHA 4MO2A 2I8CA 1KKLA 1T2FA 4HAXA 1QGOA 4MR8B 3WYNA 2PR2A 2E2WA 3COJA 4EF4A 1P33A 2EATA 3FPFA 2HJ9A 4NULA 4IFTA 4AF6A 4ZEMA 4P8RA 2DBVO 1ZXLA 1UKYA 2NO4A 4MJ7A 5EXXA 3RJZA 5CU7A 1T25A 1HEUA 2ODEA 3LF1A 3ZXXA 1Z06A 2WWHA 3L8EA 3N7AA 2PMDA 4MDEA 4UAGA 3SXUA 1Q0SA 1GFZA 2QYOA 3DZGA 3WLJA 4D9FA 1A7UA 2P3SA 3OT1A 2GN9A 1PV1A 1R0XA 1QNLA 3AUTA 4GT1A 4W1RA 5AO9A 1QH9A 1ICEA 2CC2A 2H00A 2XRFA 2XQFA 3OG9A 4UCWA 3UGJA 1M1ZA 1K7XB 3IIMA 3UBTA 4IHAA 1JWLA 4Q00A 5ALIA 4E6EA 5JDIC 4XA8A 4E32A 4C0HA 2PKQO 3GLIB 3C98A 1XHLA 3PQ8A 1NQOA 2G40A 1XD9A 3LCMA 1GUZA 1H4SA 1O95C 1WXHA 2GTPA 2ECQA 3CR3C 1E63A 2HCTA 3HJRA 4QL3A 4ZMRA 1OWOA 3KTOA 1I1OA 1N9KA 4YJHB 3B51X 2GBLC 3E2IA 3E3MA 1S7CA 4JKOA 4RZXA 4D8VA 1X1SA 2JGDB 1W4AA 4FYHA 3TGWA 1P3Y1 1FP7A 3WFJA 4JT2A 3W9UA 4P7BA 3PJFA 2FMXA 4N3GA 5DTJA 4TL8A 3RSFA 3ASUA 3R6DA 4KI0A 4TXLA 4C7OB 3QYAA 1UP6A 5ULLA 5BN3A 1PWZA 4ZQHA 3TIGA 1WDWB 4OYYA 5B1SA 1PT9A 2DR0A 2ZYSA 4O4LA 2FWBA 1XCJA 2J0UB 4YDRA 4F04A 3CUWA 4PYQA 2H52A 3EZ9A 1V8FA 3C87A 1E7RA 2GN1A 3AYZB 2HLDA 2RHCA 1KMQA 2O07A 3LCRA 1RADA 2JLQA 4OHUA 1BWPA 4MUKA 3ZHQA 4B6SA 2YX1A 3IMGA 2O8CA 3C1UA 4WZAB 1T2UA 2K2WA 4H08A 1K27A 4IDHA 4O4LF 4XX0B 1U7WA 2ORYA 4TKUA 4WSOA 1KMMA 3OQIB 5CD9A 1P1CA 2HR1A 1LTHR 1JDNA 1PW7A 1U02A 2ZI9A 3HBAA 3PQ3A 4O02B 4BO7A 3Q7RA 4CMGA 4ZJYA 1Z7WA 1ZJYA 1ADCA 1O6FA 5B57C 4M87A 4AJPA 4EG8A 5JANA 1ZUIA 1TO2E 1Y3DE 3KVVA 2VWHA 1G2OA 3L0DA 4HLQB 4Y2TA 1CVRA 2EAUA 3A4LA 2C54A 1T8PA 3ROGA 4XSVA 3K15A 4A92A 1E6WA 1X8KA 2B99A 2OB2A 1SBYA 2GJ9A 3D2AA 3GO4A 1M10A 2K6GA 4EG1A 3GG9A 1UPAA 1V35A 2FUEA 3RYTC 1VA4A 1VC2A 3W2GA 4LNHA 1N1GA 3DZJA 2AF4C 5E4FA 1WLSA 1Y6GA 1RJWA 4QDZA 1ZK3A 3UCXA 1OTXA 3AESA 3M5PA 5AM2A 2PUJA 2HMSA 2I1LA 1ZMRA 4YJDA 1Z4PX 3TO5A 2I3AA 4KGXA 4AG6A 2FF5A 4FNGA 2HO5A 3H6KA 3NXKA 3EVZA 3ZOKA 1TZMA 3D6FA 2GD1O 2VT2A 2A14A 2X6QA 3GHYA 3RHFA 4I3GA 5JRDS 3GZ4A 2REOA 2XQGA 4BPBA 4GF5A 1ZWLA 4RS3A 2QP4A 4MUEA 3CRMA 1IXSB 2C5LA 1M66A 5CTJA 3VH2A 3HA3A 4HEQA 4IMPA 3CH5A 4PBRA 4TLLB 4L5JA 3TLCA 4GPEA 1QK3A 2CK3D 2LW7A 4WLVA 3ABOB 3ZW8A 3F71A 5CDFE 3KQVA 4ASUA 1K3TA 1KJZA 4LAFA 4A2QA 1LW6E 3BIJA 3ZWYA 3RYFB 4XCVA 4OHMA 4PG6A 4U3JB 1E6EA 3F9CA 5A9TA 4GOJA 2KMLA 4OX9Y 3JTMA 1O0CA 2X0NA 3UHOA 1U7ZA 2YMLA 3FMGA 2FFRA 2YASA 2CXPA 2R79A 3IHLA 5DX1A 3ZCTA 1EXDA 5KYWB 5CAEA 1P61B 1RCFA 3BIOA 2XXBA 1HYBA 1ULAA 3GLHB 2EF0A 2BBOA 3LT0A 3Q8XB 5ILGA 2CFRA 3VKUA 1G21E 2GFIA 3FF4A 2LGJA 3IJRA 2G7MC 3M2PA 3ND7A 3OZDA 3MM4A 4Q12A 3MHPA 3HHPA 2J1LA 1SCNE 3V8NA 3UOWA 4B8YA 1NV9A 2B1QA 3GV0A 4E2ZA 1Y89A 3QENA 2Z9CA 1W4ZA 2V0CA 1Q0LA 3DBVO 3IE2A 2WTUA 3LQKA 1KI2A 1NURA 1ZP6A 4OJMX 2OAEA 2ZU6A 3AHJA 4PSVA 3GFOA 3U4MA 3G68A 5C46F 2JLZA 3EXIA 2MYUA 3FH0A 4CLOB 2GI4A 4PGHA 4LHEA 4LJAA 2FRXA 4PICA 1RLIA 3C3EA 2GM9A 4K9QA 2BP7A 1IC6A 3L9WA 3EGDA 3VNVA 1M6YA 4S1WA 3IAXA 4RU1A 3V55A 3OF5A 3TIFA 2J4FA 1HR0B 1VQ1A 3AXSA 4WECA 1I10A 1RVV1 2Q2WA 2O1SA 3Q40A 3SYLA 3LQ4A 3IURA 1E1CB 5CT5A 2G1KA 1AKWA 3N0WA 3HCRA 4TM7A 2BMDA 2A7XA 1S2DA 1XCBA 4J16C 3EG5A 4CLRA 5HOEA 3TQFA 3FRHA 5DWQA 2BH2A 3T5CA 2QM7A 1CWUA 3BK2A 3MIZA 2V03A 4BQSA 1KQGA 1LV7A 3SC4A 3ZDDA 4G81A 1A97A 3L4JA 4C6TB 1GUBA 4S24A 4YT2A 1QRDA 1KJQA 3VC7A 5HQTA 1K89A 1L7MA 2AQHA 3AJEA 4JLSA 4NONA 1E92A 3V4SA 2MTBA 4CUZA 4DV6B 1OAOC 1QOZA 4P0TA 1RAEA 1NQVA 1ZIXA 5LPNA 4NDZA 3PPWA 4NOMA 1KKMA 5IPFA 2JFVA 2RGWA 3D2CA 2VBCA 1GADO 5BSMA 4F1KA 5JJIA 3X1MA 1GZSA 2ETVA 1V47A 3EWIA 4EZEA 5FBWB 3Q87B 5IJZA 4JC8A 8MHTA 4J0QA 1CLUA 3D7KA 3L8DA 3D6HA 3LUGA 1F4LA 1FMJA 1M7GA 4LX0A 3W8EA 4CIYA 3H1GA 2BJHA 3C8ZA 1E6LA 3GWZA 1U31A 3IERA 3OEHD 2WOOA 4ZOLA 4DCMA 5BR4A 1ZDMA 5GZ3A 5LMZA 1DKRA 4HH4A 3AHHA 1B3BA 1KPIA 4DDTA 1VP9A 2A5GA 1C8BA 2XUAA 5A0FA 4DSUA 4IIYA 3DE5X 1PX0A 4LQDA 3IVRA 4EA6A 1GVHA 3KB2A 1FUYB 1GQYA 2WJPA 3IQZA 4C76A 1IDN1 3U4QB 3FPHA 2I6UA 2VTBA 1UBSB 4KFCA 2AKEA 1AQ6A 3KO8A 3PT5A 3SQNA 2RHTA 2ZIAA 1QF6A 2PZJA 3SJAA 2V0GA 2XKJE 3STWA 2YVAA 3EPLA 2IEBA 2PGDA 4GZMA 1XQWA 2F3QA 5D7BA 5FQOA 4BLUA 3L7LA 4K6HA 1JFFB 3LAWA 2IXGA 3N74A 2DUUA 3EXG1 3C6QA 1X1RA 4OB6A 1UP7A 3ADKA 3ZV4A 3RV4A 2GN2A 2IYAA 3ENNA 5A7FA 3MTJA 4QA9A 4AAYA 2CL5A 4AX4A 4CMJA 1XELA 4MUFA 1ZVVA 2R6GA 1FSZA 4Y2QA 5E6UB 3PKJA 1E2IA 3KVYA 5JO0A 2C5AA 1M0TA 5JSZB 3OY2A 3IAAA 3K1TA 1CJSA 3IS3A 4JXJA 2WF7A 3RT7A 2VBFA 3CRRA 3EGXB 1NUSA 3DEKA 1KZ7B 2IUSA 3K0CC 4PNHA 3B60A 1CUCA 5AJWA 3AVUA 2IYFA 5HR5A 1KH2A 4KKVA 4AXBA 4B3TB 2ZRJA 1EGHA 1AS3A 1NBEA 1ZH0A 3F7MA 3SDBA 1JN0A 4DJTA 2ZATA 3LUHA 2ZB3A 1SCIA 2Y8EA 3MXOA 1MTOA 4YLEA 2VH1A 3IJEB 5EMMA 5IM4A 2XCTB 3PE3A 1NASA 5FI5A 4DC9A 2H1RA 4TTTS 4MUNA 5AKLA 3ZLTA 4FT4A 2VAPA 4B46A 4KFTA 2HY7A 1MUUA 1X80A 4OYHA 5IM4F 3ZY5A 4BLVA 2OD9A 2BFBA 2FPIB 2HYDA 2PUVA 4MH0R 3QPBA 4PC6A 4R1TA 4U63A 3U4GA 3ZE6A 3ZWXA 4ZYTA 6PFKA 1PUIA 5ARBA 1AQYA 4HEHA 3LQYA 4M36A 5FP0A 2XUDA 2IHKA 5TMPA 3QNWA 2HFKA 4NG5A 4YMIA 4Y9SA 2R1TA 4NEQA 5AJTA 3K0HA 3NGXA 3WX0A 1BWSA 4GOOD 4H4CA 1E4EA 3GD5A 3GX1A 3KLMX 2QI9C 4LZPA 2OCLA 3OC0A 4FNAA 2GVZC 2AB0A 4RZHA 1JMYA 4P08A 4CR8A 3BRQA 3L6OO 4TQGA 5JWHA 4CTNA 1ZK0A 3GJ7A 3NWOA 2PH1A 3P45A 4HSEA 4LZWA 1MNAA 2XUFA 5CEJA 1SXJA 3DJFA 4YNBA 2BFMA 2VDPB 4NZNA 4CN9A 4B6EA 3DULA 1KXJA 3OF3A 3OKAA 2GS9A 4AY5A 3Q7IA 2HF8A 4DV3B 1NAIA 3JRNA 3OEED 5DWDA 1RZVA 4TYNA 1RI3A 4UHKA 3ZWVA 4Q19A 1E1MA 2WJ4A 1E6CA 4CIAA 5AHWA 2BLLA 2BGRA 2ZYRA 3OCWA 2FMTA 3BWYA 2UKDA 4EO9A 2B4YA 3FWKA 1E7SA 1X7YB 4QBIA 2ZRBA 4KLAA 3WQBA 1YQEA 3E22A 4AWXA 2DWQA 1QKKA 4L72A 1UJNA 4TKMA 4BBAA 1CF9A 1XTZA 3TQCA 4GGOA 3SX0A 2ZE6A 4PTLA 2ESRA 1PE0A 1T1RA 4F9TA 1I24A 2I62A 2VJNA 3ONWA 1RHKA 1RFGE 3L4BA 4WFQA 4NHOA 4W1PA 3KVNA 3RVLA 4C6HA 4KYIB 1SKMA 1NY6A 1IZ0A 3C3KA 1AG9A 4RPIA 2HRZA 2AW3A 1P7ZA 1DJOA 4R8MA 3WBJA 1F4VA 3R3HA 1Y4DE 3VVMA 2HIMA 1DE0A 2VYNA 4D9KA 5AQ1A 2GTIA 1U2DC 4DBZA 1KQOA 2HAEA 1RU3A 2NQ2C 3A37A 1E0AA 1UUFA 2B78A 5CDTA 3CNBA 2C2HA 2CD9A 4DIUA 4AICA 4L2IB 4FNOA 5FUQA 5BR7A 1XA3A 4B9AA 2Q3FA 1PHPA 1Z74A 2E3JA 1Y7HA 3D9QX 3H9QA 5ALRA 5EXTA 4F45A 5F7JA 3LX6A 3NIFB 4FFOA 4O6VA 3TH5A 1ELOA 2GLUA 2JFQA 3M6XA 2BCEA 3OJWA 4MRVA 4QC2A 4PAWA 3HA5A 3O8RA 2EDAA 1K6JA 4KN5A 3I01A 4POOA 3H3XA 1KI6B 4ZYVA 4IIVA 4ILKA 3W5SA 3BA1A 2EFGA 3E53A 1M9NA 3DO5A 4JLDA 2ZYWX 5J1TB 5CEFA 4GG1A 3A58B 3GGPA 1I80A 5HF5A 4ZPXA 1JV2B 1SUBA 1Y4ZA 3BJMA 2Z1DA 3K5PA 5F23A 3MGGA 1P1RA 1C3OB 3ZK7A 5AKIA 3FSGD 1I3KA 2Z43A 3B2EA 1X92A 3BMOA 3C3CA 1TEVA 3FUWA 1QONA 4PPQA 3SKXA 2OV4A 3P2MA 1CR0A 3GRFA 3AGPA 4OQ4A 2FFAA 3CYFA 1DMSA 4YAEA 3ICOA 3T9AA 1NPDA 4FLMA 2QW0X 3ZDEA 1C9JA 1IN8A 1PF7E 4MWBA 5EYPA 2ZYHA 1FLAA 1T35A 3DBIA 1QRTA 5A9SB 3KJNA 3IUMA 4W6ZA 2FE1A 4MWTA 2HHJA 3ZY2A 4MZDA 1T43A 3WGOA 3BKXA 2OCXA 3ECCA 3QVJA 1LS6A 4XFJA 4IFBA 2B61A 1V8DA 1E9SA 3G13A 3O8OB 2VHCA 4FBMA 4JNCA 5G2OA 4R3WA 5H3CA 5KNDD 4IEFB 4Q9NA 4B0OA 1OAAA 2B4AA 3RBVA 4DJDC 4Z2AA 4YUAA 4N3BA 5BUZA 4KTTE 3OBBA 3SSAA 3L4SO 5GP1A 5CDFA 1GG2A 1XN1A 5BN5B 1WXDA 4XWYA 1CUYA 4ABYA 4LYEA 3EZ7A 4YXFA 2H1WA 1Z28A 4QGHA 4E22A 1A8HA 1H5UA 1OFUA 5BW6B 5CLFA 1N8NA 2XE7A 4P4NA 1UDBA 2BFWA 1RSZA 2DQYA 5A4IS 3C3JA 2V3VA 4C7MA 4A0RA 2OPHA 2D3TA 2OAGA 8LDHA 1IY9A 5AUPB 4Q9HA 4COKA 2X0JA 5KJEA 2QROA 3H4VA 5EZ5A 4EATA 2JLYA 1W2HA 4ILEA 1QVVA 1ACLA 3RKUA 4H0NA 1UT6A 1C29B 1FFSA 1UJ4A 3QVMA 4F9GA 1UH5A 2BFEA 3EGWA 5A02A 3SMQA 1J9ZA 3F96A 3H83A 2B4QA 3NBQA 2WKWA 3PXAA 3O38A 4RETA 2UU9B 4GMFA 1RWWA 3MT9A 2PGJA 3HRIA 4IRUB 3C14C 2ZJBA 4EG3A 1A8UA 3OJLA 2C5BA 5L4SA 4R1SA 3AXTA 3KR0A 3VU3A 2B4RO 3HV2A 3CEHA 5REQB 2F8LA 3KT8A 2HA7A 1XKTA 3VR2D 4TMTA 4WK0B 5IBPA 5EHXA 1DTSA 5IJ9B 2WDZA 4K26A 1U9IA 2IH4A 1F3OA 1NJ1A 1SCQA 5A4JA 5EWMA 4LZZA 3RD5A 1UWCA 3URMA 4D98A 1HL7A 2H7CA 2HBRA 3LVFO 4G1FA 4MS4A 3ZHOA 2FSIA 2FX3A 4Z9YA 3V46A 3ZDBA 2INGX 4FCVA 4QUAA 4QEDA 4HDOB 3FYSA 2I6QA 5ARCA 2AV6A 3M1AA 4WRRA 3RB8A 4HB3A 3LRXA 4O4HB 4ZCQA 3REQA 3I76A 5B64A 1E8DA 1E79D 3OEWA 4MWZA 2IIBA 2AJBA 2I80A 3IUPA 3IE1A 2A3RA 1S9DA 1U2RA 2CVHA 1X94A 3K31A 4CUKA 2R25B 4D25A 1X1QA 1RFLA 3V1KA 1Q3HA 3ZCVA 3NPMA 3C8MA 4HWSA 5FV7A 4K87A 5L3RA 5KNBH 4TWJA 2WQ6A 3LLCA 3A3PA 2AOWA 3KPWA 4YJ3F 4LYAA 1ZW6A 1DAFA 4TTSA 2R8ZA 4MW6A 2Z8YA 2JCSA 3OLVA 1XRJA 2XSZD 4FYPA 5CLQA 4NDAA 3W05A 3OIYA 2A0FA 2OENG 3LQRA 2X14A 3O4FA 3ZCSA 4BPRA 4HWRA 4JENA 2YJ5A 3WNDA 4E88A 2JLUA 1D8AA 1Z2PX 2I9PA 2SKDA 4ZO6A 1JIKA 2D74A 2CFSA 1CZRA 1HV8A 2XT6A 1MO5A 4LRUA 2Z3ZA 3ZGVA 1EFRA 2Z4TA 3CO5A 5BVGB 1DHTA 4XRGA 3SPXA 1JRLA 1BFDA 4BJHB 1SU8A 3FBWA 1RBMA 4RTMA 2JPDA 3KQLA 4ZC1A 3O31A 2JAQA 3I5UA 2DSNA 4P4SB 3DZDA 3ZXYA 2DKNA 4GSLA 4IDAA 4LDZA 4DA6A 1QGAA 3RJ5A 1M0EA 3PICA 4G9EA 4IJVA 4CMCA 4CG3A 5CB4B 5TARA 1G6KA 3IBSA 1P6XA 5F5XA 3H2ZA 4DKJA 2VAVA 3D8SA 2VJMB 3EK2A 4A3SA 3OIDA 4G0MA 4YRMA 4TL7A 3MJHA 2Z6AA 1U3VA 1DP4A 2IP2A 3DCJA 4BXOA 4JUAA 5KC9A 1OPRA 3BGOS 3H75A 4L5AA 5DK4A 5ALFA 4EHNA 4YROA 1GJRA 2CLFB 2V6FA 3FOAA 4CEJB 4F11A 2J7PA 1JEQA 3GHHA 3ZQJA 3D6TB 3PEYA 3PHBE 4RH1A 3UMGA 4A2PA 5JCXA 3CVYA 5C8YF 5K3EA 4ZT7A 4DCJA 4BEJA 1SCUB 1ULHA 4GM1A 2H2HA 3K05A 3JQCA 3TVDA 3RC9A 3UT6A 4II2A 1WXIA 2F1KA 4D97A 1A95A 1E3TA 3IPYA 1YRWA 1CYEA 1YJQA 4DDUA 4IGFA 1PLKA 4KP7A 5B3KA 4HAUA 3STVA 2YS7A 5IJXA 1OPXA 2DQSA 1KI4A 2VDRB 4HOYA 1M2KA 3R7WA 3A9CA 4P2BA 2DM6A 4F3TA 2IV3A 2IXTA 4IDGA 1N6LA 1SC6A 2HUPA 1IG0A 2V96A 3DDHA 3OHMA 2HA0A 1FQKA 4O3FA 4ZT2A 1U0RA 2XX3A 3DOHA 3U61B 3MT0A 3MHTA 3K8QA 5ED4A 1E0SA 4J4TA 4G5GA 1JQBA 1Q3TA 3G8CA 4QFMA 3MYYA 2IF2A 3DV0A 4AIIA 4Q15A 5I4BA 2R48A 3FVRA 1NMEA 4ZVVA 4JMPA 4V0NA 3UQZA 4BVKA 4EKYA 3PEWA 1WR8A 4FGJA 3SEQA 4JOSA 4RW0A 4U1RA 1UEIA 1ANKA 2AX4A 4MX8A 4EL5A 5K99A 5FOXA 2RJOA 3CVVA 2NO6A 1P2FA 3ESZA 4NBVA 1EM6A 3LE8A 5JIBA 2H11A 5D86A 4KR6A 1KYIA 3QUSA 4L8YA 2BHTA 2ODAA 4CV3A 2D0DA 3BJEA 4TKLA 4KU4A 3P71T 2GUGA 2BFAA 1NVFA 2PL1A 3TNDA 4FFDA 4N47A 4BHTA 2R6ZA 3VU9A 4N39A 3OFNA 1J5EB 2VTEA 1C9MA 1CHNA 1NQ5A 5DSZA 3T3IA 4D3DA 1QPGA 3L7OA 2J0EA 2VF8A 3ZD7A 2ZT6A 3L1JA 2D1RA 3D4LA 3RKRA 4JC4A 1Y80A 2P9TA 3KZCA 2NZJA 4DIFA 3F67A 2VJQA 1YIOA 5T64A 2X7JA 5FOUA 3HYTA 4L85A 4OGGA 4G25A 3HO6A 3ITEA 3S2SA 2I3GA 1DIHA 3W8FA 4EELA 1X13A 1KO8A 3PEVA 3LLVA 4QJIA 4ZANA 4V0OA 2P2LA 4CUJA 2GVDC 1RXCA 5AVVA 2CBGA 2JIMA 3ZCPA 2XCRB 1J0DA 3BCUA 3I2HA 1CVIA 3OZXA 4FFBB 4NICA 2W2QA 1WW8A 3TTSA 4CQMD 4HYYA 1N36B 2VDQB 3LGXA 4KE6A 3S1LA 4L8FA 2EFHB 1ZGBA 2AWOA 2A1TR 4NG4A 4R8RA 1LU9A 4A2CA 2IQ5A 4BDSA 4Z3DA 1XBTA 2BH9A 3HACA 3BD9A 4Y1FA 2AI2A 3AJAA 4P86A 2YMQA 4QGGA 3UM9A 3KOZA 3LPMA 2Z2XA 2J9ZB 3OIVA 1MX9A 4BAUA 3JYNA 3LBNA 1U4NA 2BM1A 1Z0ZA 2GHTA 1RQ2A 1TKRA 2EYQA 5C1DA 3FAKA 1ZK2A 3BE8A 3P94A 3RVOA 3M1IA 1GYRA 1I7QB 3OP1A 4RHUA 1KP2A 2GLTA 2ORVA 3F6PA 3L8HA 2RE8A 3KR1A 1NBMD 2HU2A 4XGNA 1QORA 2FPRA 4BFSA 5AVYA 3ZH2A 5KOIA 4KG7A 4XIGS 3B36A 3OQ6A 3BHIA 5K0JA 4J1SA 2C8KA 3AZPA 2B4TO 3DZ8A 2X0RA 3X3HA 4PR3A 1S8OA 1AKMA 3M8KA 1KAOA 3S6JA 1AQUA 4QU5A 2D8AA 2QG9A 1QYDA 3RAGA 1ICIA 2Q27A 4D92A 3D31A 3T8YA 2ZTMA 2XMZA 1K6XA 3QE2A 1QBGA 1FSFA 3AESB 3EHDA 1K3FA 1U5CA 1KS9A 5BO5A 3DF9A 4EFMA 4AN4A 1AN0A 2B6HA 2IH5A 1FLVA 4BO3A 2OM2A 1ZUHA 4GH5A 5JS6A 3RVKA 1GCOA 2NSHA 5L3SA 2Q3DA 5IC5A 4YAIA 3I9V6 3STUA 1NG9A 4RQBA 1U9YA 1KAGA 1GNQA 3FHTA 3WLMA 3M82A 4A0SA 5MFZA 2GCOB 3HG7A 2C3YA 4H0CA 5EHZA 4GLOA 5AR1A 5JG7A 3QMVA 5BQXA 3OSUA 1Y1SA 4UHCA 3HL4A 4UXHA 4EYOA 4NC9A 4E4YA 4E1BA 4R0MA 1JKXA 3VZBA 1KBOA 3HFSA 5LJIA 4MUAA 5JY1A 1LDYA 3O2JA 4ZC8A 2F2TA 2YIJA 3TQOA 3ZZ1A 4LRTB 5B1EA 2PUEA 3BL6A 1MCZA 2AIRA 2VYVA 2WV9A 3CHYA 1WM1A 4X6YA 4EDHA 4BUZA 3AM5A 3EGEA 3O26A 1WD7A 4XPZA 3WISA 4ER3A 5I01A 5LLDA 1ESMA 5U1PA 3GJ5A 4HUTA 3CH6A 4MIOA 2CT8A 5ITWA 1NRJB 4RCZA 1H3FA 4TTPA 4XUCA 2YHAA 3L4BC 5F76A 2J31A 2X3YA 1TUEA 2CKDA 3VZQA 4R81A 4P5EA 3VPCA 3Q7TA 3W5DA 2Z08A 3PNPA 4IOLA 4RZ2A 4D8XA 1JE1A 1IH8A 1YK0A 4GZ6A 2X8JA 4MYUA 1N2CE 2AEJA 2GA8A 3UMCA 1RS0A 3EDCA 1Q95A 4M37A 4F06A 2VJOA 1LPPA 5B6JA 4WOKA 4ARUA 4WZBE 4HUQA 2BMAA 1RCTE 3GEHA 4JBYA 5I3ZA 2W2PA 4PPGA 5K0TA 1TQ6A 3QVOA 3GRYA 4FEYA 4RD6A 3V4PB 1NNEA 4YIHA 2BKEA 3ILYA 1WQ3A 3JX9A 5GGXA 3OURA 4OHPA 3W2FA 1XFDA 4CDGA 4HGPA 1EVYA 1YQUA 2FPMA 3K0EA 2Y0BA 4QOGA 4FZ5A 5KEIA 2Q3CA 3BSSA 3RS3A 4F5ZA 4JEMA 2BP7B 2FPLA 4YJGA 3ROKA 1DOHA 3SD7A 2OR3A 3EGDB 2BMVA 4E51A 1O95D 2M6LA 3LFUA 4EG7A 5JSFA 1FYFA 1ZJ4A 3K9NA 2OHHA 4OLBA 3GBVA 1JDJA 2QAGA 3G6WA 3RF6A 1QV7A 2FPGA 1NJ6A 3T3GA 4DABA 4PYOA 3BZWA 4MKIA 2F3UA 4BCCA 2BW0A 5ECGC 5DO9A 3TTXA 4BFWA 5JROA 4K2HA 1YULA 4QASA 4QOHA 1RMTA 1DPFA 1EFVB 3VR5A 1E6UA 1INLA 1CJUC 5B6PA 2W2OA 4TQ9A 4X3OA 1CB7A 5EHGA 2WWWA 2FWPA 3PNSA 4M1TA 3SE7A 3SOZA 3ED5A 3SN6A 4I4IA 5A6VA 4U2CA 5A4KA 3UB4A 1PS8A 3OHPA 1H1DA 4L9WA 4Q3DA 1SU4A 3W5AA 3KKMA 4V0ME 1T3ZA 4DLSA 1H6DA 5IANA 2WWGA 1H2FA 1ZH6A 2ERYA 4K6KA 3F8WA 3FETA 4K0RA 4KWIA 4R1QA 4TTVA 4RESA 3DLHA 2CHQA 4X0EA 4OLHA 3IT0A 1NZJA 3V8EA 1Y8QB 1ZJJA 3CG4A 4MVJG 4G9BA 4TLMB 2IP4A 2FTKE 3SMVA 4OG2A 4J3JA 1WVGA 1XTRA 3PNLA 3GA0A 3GFFA 3NHRA 5AJYA 3OA0A 5GQSA 5CM9C 1GL7A 2HMVA 3QPWA 1SB8A 1ST2A 4BO6A 4YCAA 4NK5A 4AJ9A 4F3YA 1YR7A 4RQTA 3PQ2A 1B4DA 1Z6YA 2A0YA 5CXQA 2O0MA 4ND2A 3CWZA 1CF2O 1G5IA 3LH5A 3K9LA 1XMSA 3DR5A 3OTWA 4KN6A 4OSEA 1UBTS 4Q1FA 3PUWA 5JY6A 4QHSA 3TLGA 5ALXA 1ZJ6A 1XX6A 4R5MA 4ENQA 1DGQA 1Q1ZA 1ZRMA 1R66A 4B31A 1DBVO 4MCHA 3UF0A 1ECLA 3SR0A 4HDRA 4B3FX 2I2FA 4L8VA 3G0GA 2PFSA 4PN7A 5B58C 3FMIA 1NI5A 5BSHA 5C32A 1AB5A 2PSFA 2VR1A 2GYVA 1AGNA 3CEMA 3NC0C 4HDNA 1IN4A 1PEYA 2C0CA 3DVSX 3F90A 3GMTA 1IAVA 4PSKA 5E8JA 4C1NA 5BNZA 4HT3B 1QH8A 4DIDA 5IP5A 1P39A 2ZXUA 1Y6JA 1SRQA 3DVRX 1OF1A 1O5TA 3FCSB 4EJFA 2H8GA 4Y7CA 3WL5A 3W2TA 1GITA 1KVQA 4BUCA 1AHHA 4O4JF 1DOZA 3EEBA 4R5HA 3TTUA 1WXFA 3GBPA 5K3FA 1W94A 1CDOA 2QT9A 3L8MA 1Q20A 1JIVA 5EUQB 3U1TA 2W8ZA 3BT7A 1U5BA 4K9NA 1JIQA 1G8JA 1U9IC 1ZM2A 4NCJA 3RS8A 2XMDA 1UKBA 4HNHA 1MB3A 1Y8AA 5JT1A 3MRVA 1AHPA 4YRSA 5EE5B 3T95A 2HCFA 1SUPA 2PVCA 4M88A 3MYRA 2XHEA 4LK3A 1NXSA 4R2LA 5FWYB 3ZWAA 3IL2A 2FZKA 2ZXEA 4TKVB 4YCBA 1LDEA 2P77A 2D5BA 3PCXA 5CP8A 2MSKA 4XWAA 1ORTA 5GV7A 3VH1A 1YJAA 1Y37A 1CF4A 2M6RA 2Q45A 4ZQCB 1H0HA 3V33A 3ZTWA 3FKSA 4KXLA 2Q62A 1UC4B 4M8SA 2EHDA 2IYOA 3A6ZA 3HHEA 4QYWA 4TM8A 3H9UA 3W3ZB 1EIWA 5A5GA 1ULTA 4JUIA 4RS4A 4OI1A 4A6PA 1Z22A 4GYYA 2WIAA 3SSOA 2QAIA 4OGLA 3X1YA 4WXPA 3NVDA 7YASA 3MJDA 2HOQA 2YVKA 1ISMA 1DX6A 3SM3A 2F1RA 1B0UA 1BTOA 1YRQA 2MT9A 3CLKA 2LTAA 4UAVA 4DQUA 5AXAA 2FZ4A 1FU4A 1OKKD 1TO6A 3KXKA 5JZBA 3GT7A 3JD0A 2FFQA 4M6WA 4Q48A 3UAYA 3LP6A 2F9FA 1Y1LA 2JJQA 3TR6A 1JUDA 2R1TB 4WLEA 2RBGA 3JR3A 1ZUWA 1A96A 2MINA 2VJCA 2HSEA 2XF2A 3GVXA 3KYCA 1GPUA 3FCUB 2O8BB 2EZ9A 4A8JB 1PSZA 2MWMA 1TQ8A 1T8RA 1U2GA 4ZZ1A 2PJRA 2C2XA 2AXQA 1NFFA 2YJ3A 3ZS9A 1CUUA 4LCJA 1SXJB 3E8MA 3KCNA 4MUXA 3TLEA 3W7BA 3TG8A 4CVNA 2XY4A 4AJ2A 2OQIA 5LZ9A 3BCRA 2PA0A 4AURA 3PV0A 4QZVA 1PS0A 1LF0A 3A6JA 3CVJA 1NZDA 1RC1A 5EJ2A 3EW9A 5HMLA 5MGNA 1XSEA 3BILA 4AZ3B 3OO0A 2PTGA 4WW0A 1CV2A 2HMAA 1I1NA 2ODBA 3OUZA 1ORHA 3BKWA 4TXNA 2A86A 2J67A 4JIMA 2WI8A 2CB0A 3DBLA 3ONEA 2GKSA 1OZHA 2ZIEA 4Y2YA 3RRFA 3UXYA 1F2TA 1ND5A 1U3UA 3BXHA 3IKJA 4NR0A 1TC2A 2C07A 4RWEA 4CT0A 3C74A 2NAFA 3USCS 1P60A 5TT1A 1WY7A 2WA2A 3T7JA 1R1DA 4HV4A 4HTFB 1EFDN 3SF0A 2VF4X 3IHKA 5DTIA 4AJNA 2OUIA 1KDPA 1R0SA 4C2TA 3AF3A 3WLHA 3HQ4O 2A9RA 3VJLA 5IDVA 3UYKA 2X1VA 4PAMA 5F35A 1GTL1 4DW8A 5FRDA 4F0JA 2B2XA 1DFHA 3EXG2 3GAMA 4OQQA 4UEJA 1YQXA 5IKPA 5FWDA 3H11B 1ISRA 4WE3A 1XNGA 4EUNA 3NTQA 4BLOA 1Z36A 2N75A 1E4YA 4LXQA 4UNSA 1A7JA 1TZ2A 4UVGA 1RAHA 2PHZA 5AD1A 2KLHA 1CR2A 1SCAA 3UJ3X 1FDRA 1ATZA 2CNLA 3SYRA 4NJOA 3LY7A 4QYTA 3LDUA 4MJ3A 2GBGA 3RIXA 5GZ1A 1P17A 2DERA 1IHXA 3B1FA 3VPAA 4CM8B 3RC1A 1NW5A 1ECPA 2XGMA 3GZNA 1LLFA 1NJ8A 4KBGA 3LY5A 3JAWA 1V96A 1YDHA 3WHKA 3EDYA 1R50A 3HC7A 3HMQA 4N6GA 3ZHZA 2BGGA 4JN6B 1DS6A 2XJ9A 4GLJA 5CNMA 3DBRA 2DECA 3BXEA 2I4NA 3ZGZA 3OSZA 2G7ZA 1EFPA 1U7TA 3ZYCA 1QS0B 3M0EA 1J5PA 2GAAA 1Q0TA 3KX2A 4N49A 3ENVA 2AJ8A 3UYLA 3ENWA 1E2BA 3BMOB 1QCYA 1W2GA 3NW9A 1C7EA 1D2MA 1VM6A 2EWVA 2GZ3A 3OKPA 5ESWA 1WEHA 3FOFC 1XWFA 3F5FA 1OXKB 2VPPA 3L8ZA 1FIUA 2J45A 3BPSA 2XUHA 2RHDA 2MU1A 2SCUA 3RWBA 2G80A 1YK1A 5EYPB 2WM8A 1WP9A 1P29A 1L7VC 1VI6A 3G2PA 3NFRA 3NRJA 1LI5A 1JJVA 2PEZA 3EY9A 4GEGA 1H9CA 4URUR 4CQLA 3F97A 3RVMA 1N2OA 5EEHA 2ZYDA 1LBTA 5AJZA 4GOMD 5HGXA 4EJMA 5BUQA 4Z1MA 4OI0A 3GUYA 4FR5A 1K2WA 3A4VA 2JDID 1RAGA 2WJHA 3E84A 3NHPA 1JIJA 1PBTA 2RH5A 5LOVA 2FQWA 1R6DA 4L5IA 4YFYA 3ICPA 1OWLA 2ZETA 4NP6A 3JSAA 5F52A 5LQKA 4V0QA 2WR8A 2CLHB 2W2LA 1IYZA 2QNIA 3L3BA 1I3NA 5ERGB 1VKZA 1QM5A 3M5WA 4IO0A 1DCKA 3PGLA 1S8AA 5EG5A 5HTOA 1FY2A 4FFWA 5IJWA 2BN4A 2V6BA 3L06A 5D1HA 4IOJA 4NX2A 2JBAB 3T0IA 3GVIA 1KI1A 3LTNC 3GB9A 1Q84A 1ZCAA 4MS3A 5E1OA 5HJ2A 4UDYX 2P2ZA 2IX9A 1RYZA 3GMDA 4WEOA 1LVHA 4H31A 1N9GA 3VSEA 4BFCA 1QQBA 1BVRA 3OZ7A 3K2IA 3FI0A 1N2CA 1RXIA 3RRXA 2F3RA 4DR5B 1EK5A 1UBUS 1YR1A 3DV2A 5HPYB 4EY7A 2QTMA 1ZVKA 2WHPB 4U9IS 2COEA 1PFGA 4NXNB 3FTFA 4U7GA 3RJTA 2QDKA 1Y34E 4JODA 1B7GO 1DQNA 1M33A 4ENTA 4WZBA 5C8ZA 2YVQA 1G7CA 1OX6A 4FGKA 2B7CA 1KO1A 2VWPA 1DWOA 4AT1A 1CKEA 4XW2A 5KYUB 1A72A 1TLLA 1EB9A 1VHQA 5DTQA 1U6IA 1CR6A 1Z5GA 3MTDA 4RGYA 4PRLA 4Q3NA 4DANA 3JYLA 3IESA 1MLDA 3KAPA 5EXDA 3OP4A 3CO0S 4B4WA 1C30B 3CH4B 3CSSA 3E03A 5HIIA 2UUBB 2NX2A 4Q66C 2GEDA 4DADA 1LRLA 4AMBA 5BW4A 2VDOB 2GVNA 3S1AA 4EYGA 2C9BA 2HJWA 4JROA 1T9HA 3F74A 1MIOB 4GBJA 4KXXA 3G8BA 3PC8A 4RDXA 1C9NA 1KTIA 4KSBA 4S0XA 2WTEA 3OZEA 3RT1A 2HREA 4WINA 3Q15C 4DNXA 2BTOA 3OU7A 3I28A 4I3FA 4OTZA 4YJ3B 5H9VA 2J9XB 1Y4SA 2OC4A 5CURA 5JAQA 2VYFA 4UQOA 2VPXA 3I32A 3M70A 4PZUA 2EWMA 2YFQA 4UEOA 4ZICA 3QX8A 4UCQA 5KTRA 3OPXA 2VSOA 3DAGA 1V37A 3IAEA 2NZ2A 3ETCA 3EVEA 3FPEA 1UODA 2MMCA 3WLPA 3I2FA 4V0MA 2P1ZA 3KZMA 4JVOA 3RI3A 4KRFA 1MJNA 3W3AA 4EHLA 2QNRA 3AONB 3UGQA 1YMVA 5KS2A 2JFHA 4WOPA 3RDPA 3A1VA 4Q0MA 1A7AA 1R8JA 2OCBA 3GZJA 5LB4A 4H3HB 4JQYA 2IV7A 3ASZA 3MWDA 1FJ2A 3IUJA 5BOSA 4DSTA 3NDJA 1P7CA 3GRAA 1AN9A 4X94A 2DQZA 1E96A 1ECGA 4ITVA 1G1AA 2JHFA 3EIFA 4URHA 4CR7A 2GN8A 4O2AB 4LJ6A 4DMFA 1GEGA 5CK4A 4HJRA 3AIKA 5HJEA 3IEPA 2C4VA 2C92A 2ZJAA 3D0QA 1HYEA 1SKYB 3NAZA 5KKAA 5D5PA 1EHIA 1WETA 3D8BA 2Y77A 3TPFA 3U31A 4D4KA 4US2R 4B3MB 1GL9B 1U11A 2ISQA 2H1FA 1QGED 2QAGC 2D5IA 4Z3OA 5AP9A 4X8OA 4D46A 4BLTA 3DHNA 1W5FA 5A1TA 4J8PA 2V45A 1U7OA 5EVJA 4F2WA 4GWGA 4LCEA 4LSWA 3RUAA 1BCSA 3WYCA 4DWJA 4RULA 1DRUA 2ZRHA 3QTLA 5CT9A 2WFLB 1LSOA 1L5GB 3EFOA 4FJ0A 1I4WA 1E58A 4X00A 4G5SA 1R4MB 1W88A 1DELA 3IDQA 4NKRA 2HK9A 1XMJA 4OFWA 3PHCA 1QB7A 5KIAA 4QWWA 2I6FA 4YV1A 1QZUA 3HBMA 4N65A 4Z4IA 1PUJA 5TC4A 1FYXA 4TLEA 2HLDD 4ECEA 2GZ1A 3UJAA 4Z4GA 1MGPA 2G9VA 3BTUA 3R8CA 1GT91 3BFKA 3S7ZA 3HDYA 4LE2A 2E82A 5EINA 3OLZA 5T4FA 2PFKA 2WKSA 4DDHA 1YR9A 2DJIA 3AV3A 3VTFA 5D3ZA 3KT6A 2QD1A 5CXXA 5AVWA 6REQA 1SUCA 1WSBA 2JA2A 4YRFA 5D8DA 2QORA 3LPCA 4BU1A 3H42B 1NDQA 2YOGA 1EI9A 2ZIFA 3NBFA 1HLPA 4XFDA 4BIMA 1L5FA 2EG5A 1HDYA 4R1PA 3RS2A 1HZZA 3O95A 1ESZA 5DRYA 1I4LD 3WHPA 3BSFA 3MSCA 1M83A 3R24A 4HL6A 2GCPA 4WBXC 1GPDG 2D62A 1BCRB 1LQTA 2H4ZA 1WDMA 4GOND 4KRGA 4UBKA 4F71A 4KDFA 5EUBA 2XJ4A 1KEWA 3S2ZA 1CE8B 3AM1A 2H0QA 1A82A 3B7WA 3F3YA 4BVJA 4YMWA 1XZNA 2V7BA 1TXGA 2YR0A 1IB0A 1UL1X 2KBFA 4MGZR 2FDXA 1RRMA 4OQLA 5EIFA 1E9EA 5AVRA 5P21A 1R5NA 4RY2A 1PSDA 3C7TA 4LHVA 2C7OA 3CXUA 3OZIA 2CDRA 1N6PA 1KVTA 4WNAA 4F7WA 2H4XA 3A9UA 2EXXA 1PR1A 2DWOA 3DMNA 3PLRA 3TCXB 4CG1A 4DR2B 2ZBDA 2A3NA 1IBRA 2CJYA 4UZEA 3HCPA 4ZVLA 1VLHA 1J20A 3KL2A 1OIXA 3N58A 1JDZA 3OX4A 3PDCA 1DQRA 4Q01A 4DOMA 3KETA 3LYHA 1AK9A 3GF4A 1YB4A 4LIPD 5B3AA 4PR0A 5LUAA 3CEJA 1QCDA 1T5BA 3E4DA 4XEHA 3LIPA 1P81A 3KV1A 3R6TA 4H6XA 4BDTA 4DDKA 3L1HA 2Q0HA 3AH8A 4ASUD 3A2KA 3Q7EA 2BHRA 2W5UA 3NUZA 4JS0A 4RBNA 3A4IA 2IT1A 3TZEA 3U44B 2CYAA 1P6UA 4JI7B 1N7JA 4JR1A 1ULSA 5KPDA 2H4JA 3O2NA 2OV2A 3P9NA 1HXHA 1ARZA 2Z1MA 4FGZA 4Z0PA 4LKRA 2CDAA 1PS9A 1L7OA 2GKOA 1KFBB 3FE2A 1RIIA 1NW6A 3B5EA 5E6SA 1J24A 2Z9DA 4CKEA 1MW9X 1JQ5A 4M55A 5E7JA 2Q4OA 4XOUA 4AY4A 1BDJA 1DUSA 5FFFA 5HDQA 3TCKA 2R1VB 4BQOA 3TW8A 1EVQA 3ELUA 1HA3A 2YUTA 1LTKA 2JH9A 5EKXA 3H4TA 3AR4A 3ZDRA 4ZI7A 1L5OA 3SC6A 2YY6A 2QG6A 1PR3A 1EDDA 1GARA 1QK5A 2AQ8A 5CNJA 4X44A 3ZBQA 4DWOA 2P9YA 1XTKA 3NTVA 5J63A 4MR9B 4PX2A 5K51A 5C8XA 2WHYA 3WV5A 1ORVA 2GRUA 4RO0A 3VX3A 4OFXA 2JATA 1AZTA 4X20B 4ZI7F 4H1TA 1YFKA 4R0VA 1XZBA 1Z7EA 3B78A 1F1BA 5FAKA 3U6BA 2KE5A 3RTCA 1AIPA 3VSAA 3D81A 4UD2A 1N5IA 2CNBA 5M3BA 1KKUA 2GM3A 4GE3A 2PX3A 4PLYA 3FIJA 3HRKA 4RVUA 3SEZA 3D7RA 3WLAA 5EIXA 1HOXA 5HP4A 5EE1A 4E94A 1AKNA 2UDPA 3SKYA 3HNOA 2VSYA 1GNLA 1AV7A 2XD9A 1TT5A 4EITA 4MUGA 16PKA 3O2SB 4LRXA 2YDYA 4HVAA 2O0LA 4U2KA 5AW7A 1P4RA 4N3AA 1YNOA 3CWQA 3PFCA 5ALYA 3WLEA 2CMHA 2QVXX 2IOHA 5C5CA 3WLRA 4LRQA 1PD0A 3N2ZB 1Y5MA 3TXAA 1KBZA 3ONNA 5KTTA 5FBZA 4C21A 3X2EA 2D8MA 5TJHA 4DVGA 4NATA 1U99A 4R84A 3WGMA 3BGIA 1G8KA 3V32A 4D45A 1O6CA 4PNPA 3LUPA 3QTTA 4BTVA 5G3ZA 4MP8A 1ZGCA 4KYTA 2WK1A 5BUCA 2DHQA 2G6TA 3EA5A 4NIMA 2BFOA 3RVQA 4W5OA 4HSGA 1J9EA 4IXNA 3HWX1 3AUSA 2QE6A 1EP3B 3QWFA 2GFQA 4F2DA 4RJIA 3T4EA 1KEEB 4YV7A 2P3OA 1BROA 3O73A 4MEBA 1XKQA 2ETXA 4EZBA 3WP0A 4JLUA 3WK5A 3GQBA 1JA1A 3WIDA 4BOYA 4HATA 4TRJA 5K45A 2Q5EA 4ZOAA 3UW1A 1VL6A 2Q6VA 3T3DA 2XCUA 3VJRA 4YP6A 3TX6A 3OPYA 4BX9A 3ZDYB 4B79A 4MTCA 3ZGNA 1OVGA 3CJRA 2HWWA 2NTJA 1U7XA 1U0SY 1J2YA 1E3WB 3DOEA 3OOEA 4EUSA 1AKTA 3ETJA 5IH7A 2JFWA 2AW5A 2V7GA 2ATCA 1TIPA 5KNLA 3FB1A 4MVJF 2DY1A 5DFAA 4UM7A 2W6MA 1GQ2A 4NPAA 1RMYA 1MABA 2RIPA 3CZAA 4MYDA 5DVZA 4CM6A 5DNUA 2QAGB 2RBKA 2HK7A 4N3NA 3QKSB 4NARA 4UAJA 2EBFX 4JR0A 2FPGB 4NMHA 3IQWA 1FFAA 2J59A 4E7PA 5A04A 2XCSB 3FNFA 4PBTA 4IJUA 3NM6B 3WDMA 1PFUA 2ODTX 1JDTA 2GESA 3D1VA 3H5TA 2EKPA 5TLSA 5HJ5A 2XB2A 3VKGA 3FPSA 2MCFA 4QOSA 3EVTA 4AROA 4RVSA 1BMFA 4MHTA 3R5KA 2FLWA 1T8TA 4BKUA 3KQWA 1G41A 1WW2A 1DKQA 3QF7A 2Z8XA 4J3FA 3STYA 5BSKA 4A26A 4Y1RA 1Q74A 4C2UA 3FGOA 3ZS8A 2FW6A 2CD7A 5L40A 2C9YA 3BDVA 3P20A 2F1HA 2PX8A 2ACEA 2O7SA 2PRYA 3MC1A 3FLEA 1XJCA 4HNVA 2QR5A 4NZOA 3H65A 4UBLA 1TEXA 2OCGA 4U2BA 3KUUA 1GZ6A 1OXTA 4E2XA 1AQNA 1F6BA 2DPYA 1J1ZA 1JFRA 2QTCA 1M6HA 1G8PA 3R7LA 3VVCA 1BYIA 1UDAA 4QO7A 5EP1A 4EVIA 1E0DA 3OM9A 2GWHA 4EY3A 4QVKA 2Y1WA 1YRBA 4M9CA 2FSHA 4C0JA 1U8ZA 4DJEC 2OGSA 3KSZO 1KOJA 1XTQA 2X2FA 2JVIA 1M8GA 4MLZA 2CCJA 2VQ6A 2F43A 4PG5A 3IX7A 2Y6UA 2QJRA 4D3SA 2BVNA 1NA5A 3OOSA 4PC3A 4JQZA 4C88A 1YQTA 1R8QA 1SZDA 3KSRA 1ODIA 3Q8LA 4KFSA 4HWPA 3QKTA 1QAOA 1MOQA 2ODWA 4MW9A 2IZ6A 1BDHA 1KPGA 2LZ0A 1A9ZA 1SXJD 4DJFC 4HLNA 1HYQA 3LY8A 1IHYA 3G1UA 1QFYA 4HDNB 1EWRA 1B14A 2C4WA 2J30A 3C3BA 4O4IB 4O4JB 4LFAB 3VZSA 1FYEA 5DP1A 3SIPA 4CI0B 1N75A 3BQ9A 1SZCA 4UC0A 3RK0A 1IY0A 2X8BA 4ZODA 2Y1XA 1C9YA 1J97A 3LXRA 1HURA 2HDOA 3I3SR 2VZLA 4OU5A 1G18A 4LTDA 5IAKA 3B3FA 4I5FA 4W82A 3HB4X 1JPJA 1TMOA 1HQKA 3HVUA 4HGRA 3KS9A 5ENVA 2FVYA 3RWOA 4MIEA 4I1RA 3WHIA 4F6RA 1YMUA 3TG2A 4BZXA 1BX1A 1NVXQ 1UBKS 4IZOA 1NTRA 4FS8A 3RK4A 1S3IA 2O3TA 4HJXA 4OQXA 3ZJYA 1DLJA 1WXGA 2BM9A 2P3QA 4QDUA 2G83A 3IBTA 3OM1A 4X3PA 1I5EA 1YIDA 4MR7B 4PO9A 5LA6B 1PVDA 1U28A 3PC8C 1E6KA 4HYEA 1RM3A 2PU7A 4WERA 5DCYA 4EG0A 4PZCA 4CF3A 3TK1A 4EGJA 1G16A 1NKVA 4XYEA 3PTZA 5FA5A 1HNWB 4TZ0A 2VYND 2EW8A 1OA1A 3FWNA 4DLAA 1CVLA 2EOAA 2AFHB 2PXHA 3PRJA 2HW8A 2I0FA 3LKVA 2W98A 3A70A 3UCEA 5KTSA 3MQ4A 1XUOA 4BMZA 3GLFE 2CV1A 2ID8A 1XCGB 4IO1A 4B5LA 4OFBA 2UVPB 4H7IA 1P4JA 1BS1A 1B1CA 1K4KA 2RHGB 2DEUA 1DXHA 3MEQA 4Z99A 2JBWA 1Z4MA 2QUIA 3D6NB 3RRJA 2BGTA 1CUZA 2JHCA 1UPBA 3EZFA 1DAKA 4OJTA 5CDUA 1AF4A 1TF7A 2PEYA 5G02A 5HHTA 3MTIA 5IDQA 3CNQS 3RJ9A 4LF8B 1E1QA 3D8NA 5FPKA 4FZ3A 2C2WA 4KB5A 2MDTA 3I6MA 3FOWA 1KVSA 4PCLA 2BKXA 1XIVA 1W52X 3SZMA 2I7VA 4QDXA 1O96A 1C8LA 4D9BA 4DLXA 1RM5A 4LKOA 1AGXA 4QNNA 3LSTA 2FR1A 3OVMA 5F73A 5FI3A 3SZUA 3W7AA 2Q5QA 4LSMA 2G28A 3NJ8A 2ASEA 2X2OA 4QSHA 4CKCA 3AVQA 3Q72A 3N53A 1ZD4A 4Z8XA 1AZWA 1L7AA 1MGOA 2QLJA 2KI5A 4FCTA 2H1SA 3WIVA 2HC9A 4AXXA 4R8VA 3O4GA 2VKQA 1UAYA 4UU1A 2IS2A 4QUGA 2J7KA 1DO2A 1ULBA 3DZFA 1ZH2A 1J25A 3BIFA 1LFAA 2EG9A 1TNDA 3ZQKA 3ND6A 3W4JA 4HRAA 1I94B 3DYIA 1SN7A 1PUXA 3DG9A 3ZVNA 2BFDA 4TV8A 1UM8A 4LOIA 2CB9A 3DBLB 3JWPA 1ZU5A 2NIPA 2PR7A 2IUEA 3Q2OA 3C8UA 4J9UE 3Q7QA 4WTOA 1ZLXA 2H9YA 5EIWA 1IEWA 2B8NA 1F48A 1I9GA 1MRZA 3Q7PA 4RL4A 3U49A 1IQ0A 4S1VA 2XYPA 3P26A 2OBBA 3RUHA 2VJBA 3RU2A 5JBIA 2A0UA 1ZUNA 1TCAA 4IGIA 4X8MA 4RORA 1HSZA 3V7WA 4H1WA 3O8CA 4YV2A 2ZW9A 3LBHA 1NLMA 4S3MA 1WKBA 1JFVA 3QEKA 1W4RA 4IDCA 4P1ZA 4S1TA 1PYDA 4XD7A 4GLBA 5E9WA 3QH4A 3THSA 3GMSA 3E1KA 4HQ0A 4RE5A 3RROA 1I0IA 2WE7A 3NYWA 2FPPA 5FFMA 3ZJTA 4XFKA 1RDFA 2F1OA 2RGCA 1SUSA 2Q21A 4INJA 2PGLA 2DPGA 3ODPA 1QGYA 1LB1B 5LLSA 4C08A 5JE8A 2VCHA 2GQ0A 4L02A 1P4SA 3CCCA 4GYWA 4MI1A 4MYHA 1WMAA 2D1FA 2JASA 5FYDA 3OE4A 5BWCA 5K4HA 1Z2DA 3QW2A 3V2HA 2VAMA 1ZK4A 4OJQA 3S99A 3PHLA 1IOWA 2FEPA 2LV8A 3VR6A 3PX3A 5JNWA 1TJPB 2C96A 2PT5A 2QRJA 4JLKA 1OGYA 2EJWA 5LQUA 2NW6A 2RH4A 1UKZA 4BLWA 1KZ9A 5KTMA 1NM5A 2ZT7A 2IX3A 3E48A 1GAXA 4GE0A 4W8OA 1Z7YA 3AERA 5DNAA 5ADUS 4PE5B 3T61A 2H06A 2CYCA 2C2ZA 2G1AA 3EJ6A 2DX7A 3A1WA 5LJLA 1YI0A 2O2SA 3FFXA 1POXA 3GAZA 2JGJA 1TQ2A 4NMXB 1TCCA 1NX9A 2RBEA 3FRJA 3MGBA 3TLBA 1DBIA 2XTJA 5HSGA 4OGWA 1GLVA 1M5TA 2L2QA 3A3OA 3DPUA 3ZJ5A 3TRKA 5KYYB 4HN2A 3SWWA 3TPCA 4PC2A 4RA6B 2X22A 4DJ5X 3DWEX 1E1YA 2DZDA 5DBEX 4G8BA 4CQNA 3UK6A 1R8SA 2YN4A 2K7FA 1JI0A 13PKA 1W87A 4MVCA 2EGUA 1PAUA 4G0VA 4XE5A 4IJMA 3M5DA 1D7OA 4ZVOA 2WIDA 5DEIA 1FFXB 4CQLB 2IU6A 4BNZA 3KLPX 1DAHA 4JZKA 5KYKA 1O4WA 3X1DA 2VDWA 2CNDA 3QE9Y 2O0JA 2D1QA 3EA4A 4WBNF 1W59A 5HFJA 4YMUA 1G4HA 1FRQA 2XYVA 4TWIA 4FK8A 1GPYA 1K98A 1L5ZA 1I2BA 2E6KA 3MWEA 3TJRA 4CCYA 2KQUA 2BZSA 1G20E 3C39A 1H6BA 1F2DA 1LJ8A 1HKUA 3EC1A 4DIEA 4ZVTA 1MZVA 2XEDA 3WE7A 4NE2A 1PR9A 2EZTA 2OXCA 1U8AA 3NUQA 4FJ1A 2VHTA 4IFIA 3KM0A 1BGVA 2HCRA 4ARZA 2IYEA 1WG8A 3ZHYA 5DT2A 1TVKB 3TSCA 4R69A 1EFRD 3ZNPA 1I1HA 4NBLA 5AVZA 4QKQA 5KTKA 4E33A 2BJVA 2X4LA 1E9FA 1AHIA 2G4LA 2AX3A 2BFFB 3TUJC 2AS0A 5BW5A 4ENWA 2YV1A 2FWMX 5JS1A 2QRUA 1KK0A 2HDNB 4FILA 2XA9A 1TUGA 5AVSA 2QUBA 4Q4JA 5GONA 3GFVA 3GEGA 3EIOA 2A9KA 3DB2A 5F7OA 2I91A 2FMUA 4IWNA 4TROA 2W8BB 2JH8A 5JSUA 1WO8A 3PL5A 2YWGA 5JEEA 1KK3A 3QYJA 4Y18A 1YDFA 4D56A 5K03A 1UIMA 4AO7A 1RZUA 3HFGA 4BVHA 1K8ZB 1L7DA 5E2IA 4YRTA 1IWBB 5EMNA 1ODCA 5A3VA 3T7TA 3N7UA 2Q29A 2J7PD 4AKGA 4B7XA 1VFNA 5BSRA 1V5FA 3MQ2A 2XVYA 5CA0B 3NC1C 1UANA 4RSGA 3FZQA 1E9RA 1FPMA 3OTOB 2LNDA 4CLDA 4IHJB 2BEWA 1WA5A 2XODA 4TS3A 4WXHA 3RCBA 4YACA 2W4QA 4I1UA 3KALA 4PLPA 1C0IA 1F60A 3PXCX 4G1MB 4EOGA 4UE6A 3AKEA 3L1IA 4H3KB 2ONKA 3EISA 1UJCA 4YUVA 2W71A 2F48A 2XB6A 1JQLB 1UMBB 1H2EA 4REOA 3DHEA 2QVZX 2BF4A 3EGIA 3KEQA 3O2QB 4KE9A 3ZHXA 4LUCA 2OESA 1KWKA 2EQAA 1XT6A 3A05A 3ZZ0A 5AKXA 1A9SA 1C4KA 4PHTA 4QD3A 1Z0IA 1BJKA 3H5WA 1D7AA 5D2CA 4IXMA 2R1ZA 4HO1X 4NU5A 2JJ2A 2Y1KA 4BP3A 3AETA 2X7HA 1A3CA 1YDEA 1Z6ZA 3G88A 5JAUA 4LMAA 3DT9A 3NUGA 4F60A 1NPTO 3C15C 3G7NA 3K4QA 1KFCB 1LF5A 3CKMA 3G0BA 2RAVA 2X77A 4I1IA 5EEGA 4NMWA 5K3BA 4BNMA 3NT5A 4Y9TA 2RHBA 4NOLA 3B2QA 2OFWA 2C20A 3BK1A 4OUDA 5FADA 3ER9A 1J7JA 3S4YA 1T0UA 2QYSA 1G5TA 3I8OA 3P9YA 3MWDB 1KSFX 1G9XA 2I2DA 3ESXA 1M2OA 3MAGA 3TKAA 4EO7A 5BOSB 4R2JA 2WC1A 3L07A 3FSJX 1JAIA 3UJBA 3PU6A 3H04A 3VR6H 3JQGA 1ISSA 1JEAA 3D3QA 3DVAB 1JXAA 4FOLA 4F1JA 1GCIA 3U16A 3CZQA 4I6JA 3HJFA 4R9UC 2Q5OA 3K5HA 3OFND 4M0KA 3ZHSA 4B3SB 3W9YA 4QGSA 2W6OA 3GPIA 5H16A 4R8KA 4RHEA 3ZCRA 1A1SA 1JQAA 3W9BA 3N0XA 2V9CA 4XDZA 1CLEA 3FDXA 3VR4A 1NFRA 1GZDA 1VTKA 2EIXA 3BAZA 3NTRA 5A5EA 2HD4A 1IN7A 3RK1A 3RNOA 3UHAA 3CZMA 5LIPA 1Q6YA 3L6RA 2QS9A 3MK31 5LSAA 3A3KA 3IV9A 3FHJA 4FX2A 1P0QA 2OV1A 3LM8A 1BCSB 1F8YA 2FWIA 2HZBA 3LPNA 4MV4A 2WJVA 2GNOA 2PTHA 2RKOA 5DTEA 2BC9A 3WLIA 2PK3A 3CRVA 5BR1A 4A8TA 1DX9A 3A1TA 4WUTA 1XPOA 4F9EA 4V1CI 3IEVA 4JWKA 2VP9A 2J33A 1GR1A 2P40A 1H3EA 2RHOA 2VDKB 4ONEA 1KMCA 1VHJA 3E5RA 3P0IA 5KOJB 2IIQA 1H4TA 2XYGA 4LJKA 4C4AA 1A8IA 1P2UA 1NOIA 1SG6A 3ZIUA 5DGDA 2VOJA 1P2GA 4H59A 3I4LA 3TMKA 3IE0A 2IYXA 4WK6A 4MA5A 1VKRA 4WHMA 3QUCA 3HI6A 4IQGA 3VJKA 3HRHA 3BE5A 4ZQIA 5E1DA 4XVQA 3AU8A 3JZAA 4IKOA 4NBNA 1K1EA 1WHTA 2FOXA 1A9TA 3NORA 3BXXA 3ROMA 4G4SO 5EIHA 1BDBA 1L8LA 5CIQA 3IMCA 2PT9A 1TM5E 2QW8A 1D1PA 2L42A 3GLFA 3O74A 4YQZA 1I3CA 5FWXA 1Z82A 3U3JA 2FSUA 3PP8A 1XQ6A 2DBYA 1FFCA 1KPHA 5FBQB 4DQLA 4L51A 3GLSA 5TEVA 2GT1A 5EJGA 3GYGA 4H1HA 1L4NA 1GNSA 1OI7A 2ACVA 4TMVA 1CZUA 1C5KA 1JI3A 2YQZA 5HGJA 2X9LA 3MINB 4URVR 4UOQA 1M67A 4QTXA 2WLTA 1M2NA 3HTXA 4D4LA 2YHBA 5GAJA 2NZ8A 3QUQA 3A2MA 4LI0A 3L2OB 1OFHA 1X14A 3ZQ4A 1U9ZA 3DE1X 2CXOA 2VCYA 1NULA 1T5SA 4KH0A 3LD9A 1N2ZA 4NH4A 3RW9A 3DXXA 4D96A 4X85A 4PXSA 2HXSA 1TM1E 1P80A 4KO4S 2OMKA 1AKEA 4G5FA 4G56A 2ORED 2C4MA 4QJ5A 3S5JA 4K05A 3B70A 2CLKB 3IH5A 2GRJA 4B75A 1ZC4A 1KORA 1XZCA 5CDGA 2VYVD 4G01B 1K08A 5ECYA 2E48A 1KAEA 5H5JA 1PJTA 2Y1DA 4AIRA 4D82A 2RC6A 5B2ZA 3MJCA 4AY3A 3W8DA 2ZJOA 2VT6A 4H16A 1Q11A 1X8LA 1Y7PA 3IVGA 1QANA 1U28C 2E9SA 5KSYA 1JSRA 2YFKA 3ZTTA 4B0PA 5AI5A 2I7TA 2QP3A 4MP3A 2ENWA 1JBQA 4YS6A 5EMKA 3W1WA 3CZ4A 3EY4A 2R86A 4PLVA 1UZLA 1W25A 1MX3A 5E6SB 3RUPA 3U13A 3VV3A 5C8VA 1JHOA 4DV2B 3EFEA 4GQBA 3KL4A 4KXFB 1DPGA 3KDPA 3ZWOA 1JU4A 3MCZA 2IUUA 3KD2A 3VKFA 2XNSA 2J3LA 3TW8B 2RHMA 1B0ZA 4NBKA 5E4YA 1WY5A 5AKYA 1RXSA 1V7PC 2DU8A 3AJ8A 2C58A 4IHQA 3SEAA 3IULA 1L1RA 4MV5A 1VPTA 1TECE 2WD9A 4PV7A 5E2BA 4CIVA 4M99A 3AX6A 1K0UA 1WMEA 4W6QA 3UOGA 3G5LA 4C4RA 1N7GA 5FA6A 1H5QA 3ONVA 2DCUA 2GERA 4MULA 4OAOA 1OWMA 1THTA 2VT7A 4XVHA 1V3QE 1ZIPA 1JQDA 2Z04A 3FOEC 3SZOA 2VP0A 3GDFA 2J9GA 2HV9A 2NAPA 2VA8A 3QWHA 5ALTA 3O9MA 4LJ5A 2GAFA 1EDOA 1K7CA 2B21A 3B82A 1FTSA 4YQEA 2GEKA 1KK1A 5AOBA 1YZTA 4X62B 1V95A 3PYMA 4EMUA 3CE9A 3VR5D 1F2VA 2G6BA 2ZRPA 3KK0A 3FZEA 1TLFA 1ZO8A 1ZMOA 4BLPA 5LXTA 4H3SA 4DXAA 4PYKA 4YUYA 3JYHA 3LG2A 5F1OA 4K7JA 4TWZA 1Y9ZA 3GGOA 1M6EX 5H80A 3DXYA 4PFJA 4RHTA 2BHNA 5CNIA 3GDWA 2X23A 3LWZA 5LXTF 4Q9DA 2RGNA 3TINA 3WWYA 3AEUA 3II6X 3NIBA 2IITA 4NENA 1FUIA 3BWCA 4G5OA 4NNPA 1EXNA 3A6FA 2PQ2A 2AE2A 2Z2JA 3D3EA 3MOSA 4GRIA 4X6XA 1Y33E 3R0VA 5D01A 3I5XA 1OH7A 4FDMA 5K3SA 2WAOA 4MW4A 5LBUA 5C1OA 5IZ4A 2FUG6 2I33A 3RYHB 3G8YA 2A67A 4BGEA 4PLZA 2OWEA 3HZOA 4ON9A 4R31A 3I9JA 3M4NA 4KPEC 2PO7A 2R47A 1OOEA 4YJKA 1FTYA 1AVTA 2BELA 3ET4A 1GPBA 3I39X 4I55F 4TMYA 1LLCA 4K6OA 4Q4AB 2VK8A 4MGEA 4R7ZA 4RV4A 4ZT6A 1KZHA 5J58A 4YIKA 3KKLA 1IEQA 3GQBB 5DGXA 5C7YA 3EG9A 4KR3A 5F12A 3WG9A 4I5EA 3UJNA 4B48A 2AR7A 5MN6A 1CNMA 3LKDA 5DI9A 5KNCH 3CTPA 1GKLA 1HG0A 1P77A 2P9CA 1QC5A 2TMYA 3OM8A 4FCCA 4JBNA 2D1SA 3DHYA 1DTWA 1OMOA 5DDIP 4DR4B 3MA0A 4ZDJA 5BYBA 3N05A 1MR3F 2NSJA 4OQFA 1AE1A 4BO0A 2PKCA 2A6PA 5EXEA 1T3LA 1NNUA 2J9FB 3S40A 3N2IA 2QKYA 3BAFA 4QIHA 1TJNA 3OOWA 3SIXA 1QP7A 4NZZA 1KI8A 5JPIA 4IDDA 1X9HA 3ZK8A 2F1JA 1PJZA 2BAGA 1A4XA 1S96A 1WCXA 1JR3E 3A14A 3EOBI 2IPNA 1XZQA 2SICE 1XLUA 4PYNA 2QMHA 4RUKA 4IXDA 4G4SP 3H2SA 1G2PA 2PSEA 3R4CA 5KPJA 4JASB 1PBNA 4GOXA 1M1NB 2V7WA 3WKBA 5KCMA 1Z6QA 2CNNA 1RTTA 5HQJA 5JBQA 1N2XA 4K3UA 5H1YA 2DUNA 3ANSA 3P2IA 2O5VA 2PN1A 2CLEB 5J2UA 1NNI1 3PLAE 4ZK2A 1U0NA 1JTEA 4Q16A 3G0DA 4XPIA 4Y1RB 3HSYA 2D5CA 1VOTA 3D6VA 3NHAA 4ATNA 1EE1A 1ZEMA 2QGZA 5CXUA 2WW8A 5ICFA 1D2RA 1M34B 1PZXA 4TGLA 4CKBB 5DM60 3ZYZA 4XTCS 3V8QA 2IKSA 3FKSD 1P7WA 2HRBA 2I6TA 5AK4A 5JV5A 4U5XA 3AF4A 4ZAXA 3UAWA 1T1EA 4KSYA 1MRNA 4PYJA 3KRTA 1RKQA 2VQSA 3I1IA 3RVRA 4CF7A 4JUBA 4RA9B 3VGJA 1IN1A 3E81A 4EHAA 3FYHA 3MVEA 1AGYA 3TFWA 1ZRNA 3EQ9A 4L3OA 4EFDA 3NHJA 1IOLA 1YWGO 1J06A 2JFFA 1AQIA 2PMKA 2XPCA 3JPWA 7REQB 3V3TA 2ONZA 1VXOA 2P2CA 1DAEA 3T1HB 3QBEA 1QMGA 4LSGA 4JH0A 3ZWQA 3P9SA 2F8MA 3FUVA 2JCGA 4OK6A 3OQBA 4HDMA 1AUOA 2XKKA 1ONNA 2AMYA 2C03A 3I9MA 3ZBPA 3QXGA 1FMLA 4LJ9A 1OBHA 1YUNA 3HDGA 1GD1O 1PJ8A 3HS3A 3AHGA 3D4BA 3BZUA 3Q6NA 1DKUA 2YJZA 3N6RA 1ZW1A 2J5BA 1WXWA 1JSXA 3ZVMA 1I3OA 4MJLA 1PLJA 3D1LA 1QX4A 1BXZA 3M3DA 5AQEA 5JZVA 2Q28A 1G17A 3TBKA 1HOTA 2Z9BA 3IP5A 2B4KA 4MS1A 3UV7A 2PLNA 4ZEWA 3UAOA 5SYMA 4DMLA 3QUTA 1W93A 3E05A 5LUBA 1UBGA 1P5JA 4NI5A 2F8TA 2X15A 3WJAA 1WBDA 4UTNA 3FDZB 3W5UA 5KWJA 1L8XA 4BO9A 1FYWA 2C1EA 4GI3A 4JVSB 1QIDA 5ES3A 3S0JA 1ZMTA 3UB2A 1AQJA 5EMJA 3QLUA 5TGDA 1KEVA 1P9WA 3GFQA 4C6RA 1QQAA 1XRLA 1WVMA 1Q0HA 2DT8A 3AZOA 4G1BA 3FBTA 3ZD8A 4FSXA 3WB1A 2P7HA 4D02A 1EUDA 3RRBA 1N5JA 2HJSA 5DSTA 2ZAOA 3H9EO 1BNCA 2PRKA 4TSKA 3ZX4A 1SXQA 4TXHA 2Z5GA 4ZKDA 2MSLA 1Z39A 1V16A 4DY6A 3RSGA 3E3LA 1FTNA 3V8PA 4C0QC 3COPA 4J75A 4BO8A 5J40A 3SVLA 3BZBA 2CHFA 2ZYUX 4MQ4A 1GZVA 5HJ7A 1P91A 1ZVJA 3SLKA 4BIIA 3R0JA 1PL6A 1QB8A 1YRLA 2O20A 1IFXA 4O2RA 5K0BA 3STTA 4EJ0A 4ZCLA 1XQXA 3I12A 4EG6A 4M1YA 4CFSA 1Q0QA 1VHLA 2V6JA 2E87A 5MDHA 3QEAZ 1O5IA 5JFTA 1PEDA 3EASA 1P72A 4L15A 1KOLA 3WGTA 3FI9A 2PX5A 1HNZB 3BXGA 2PXXA 3OZTA 4AZ0B 3ZNQA 3P5BA 3W5HA 3IKMB 3KHUA 4MQFA 1EFTA 1R27A 1ZNZA 4CJXA 1VZ2A 1X3LA 4YJFA 2D2VA 3MAJA 4RIHA 1V7CA 3I8XA 5SY4A 1CR4A 1CETA 4D3FA 4CKCB 1H0RA 1HDEA 5MGBA 1I8TA 2NMVA 2C4HA 3FLMA 2P8SA 1YU9A 2CNWA 3BL8A 3R4VA 4D4JA 4ZFNA 2HMYB 3KE9A 3P9CA 4RH0A 3O92A 5C5EA 1L5HA 4AJJA 4DXHA 2WPNA 4X61A 3OWOA 1IE3A 3UANA 3SIWA 2ZS8A 3LDGA 3HKDA 5IASA 2FN7A 4EUFA 2DFLA 4MAFA 2CHEA 3S7TA 4QTUB 4WOJA 4WJZA 3D64A 4PZLA 3ITNA 2OFPA 5JMOA 1A5ZA 2C9OA 5J5VA 5GIOE 2WYVA 3GRUA 4RIFA 1VCOA 1U8TA 4GKVA 5A3JA 3WJ2A 1E7YA 4UZFA 1MV8A 3TNYA 4Z1MD 3TE7A 2HIAA 3AOGA 5A2GA 1HE1C 3EMBA 3K5IA 2PT6A 3PNVA 3BMCB 4MICA 1RP1A 3TM5A 3VDMA 1ZUNB 5AIAA 5LQMA 1VJCA 3C5VA 4ZT3A 3TDKA 1E2EA 3L92A 3UA4A 4AJIA 4CMEA 2I29A 2F3SA 3TL2A 5GJBA 1G3UA 2W2LD 1UQUA 4FOTA 2VTDA 1NDHA 3LQFA 3PNBA 5KQPA 1VBFA 2FZLA 3NHYA 2RGRA 1VP3A 1UJBA 2W83A 3KLNA 1PJQA 2M2IA 5IAGA 1SQSA 3BK7A 5B58T 1W581 1EX1A 1I6LA 1XYVA 1NZFA 1U0HC 4KQIA 4QICA 5T6BA 3VOBA 5C80A 1Y8RA 3H8VA 4JDUA 5EIEA 2WUDA 1E89A 1R4NB 1WPXA 3FMPB 4WA8A 1WDKA 4ZIRA 5AVQA 4UM9B 2XUPA 4OLAA 3KR9A 1DADA 1Z83A 1ZK1A 3H18A 4RLFA 4FE3A 3U7HB 3N6XA 4OFZA 2CXRA 4X45A 4FXOA 4OB7A 3H2BA 3UMMA 3WDKA 3DLAA 1DT5A 4N0MA 3AQ4A 2NN3C 1G7TA 2NU7A 3MNFA 3H13A 4QEZA 1GPMA 3AHIA 1IWPB 1SZPA 2ZITA 3T52A 1AC5A 1EAYA 4CT4B 4IYRA 3GLTA 1C9KA 2W2VA 1NLUA 1CQZA 2HM7A 2Z2KA 1M8PA 1UPUA 1BKYA 5EVCA 1QGZA 2ZE5A 4WESA 3MJRA 1N6NA 1YRAA