2QD2A

F110a variant of human ferrochelatase with protoheme bound
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPAIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pi-Helix Switch Selective for Porphyrin Deprotonation and Product Release in Human Ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
molecule keywords Ferrochelatase
total genus 136
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd2A02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qd2A01
3HCRA 2Q2OA 2XVYA 3LYHA 2QD1A 2QD3A 2XVXA 3HCOA 2QD5A 2HREA 1C1HA 2Q3JA 4KMMA 2DJ5A 4KLRA 1L8XA 4KLCA 4MK4A 2AC2A 1LBQA 3M4ZA 3HCNA 4F4DA 1LD3A 2PNJA 1DOZA 2HK6A 2PO5A 3GOQA 3W1WA 2XWQA 2XVZA 2QD4A 2JH3A 4CCSA 2Q2NA 1AK1A 1QGOA 3HCPA 2AC4A 2H1VA 1TJNA 2PO7A 1HRKA 4KLAA 2XWSA 2C8JA 1N0IA 2H1WA 1C9EA 2QD2A 2HRCA 3AQIA 2XWPA
chains in the Genus database with same CATH superfamily
2I9KA 3LHIA 3DZKA 5JSZB 3WA7A 3IKLA 3QKSB 1J2YA 3GGOA 1M6WA 3F8WA 4D9FA 4KPUB 1AKYA 3T52A 3RANA 2B2CA 2DT8A 1U6KA 1BAPA 3LIPA 2ZBVA 4G4JA 1GTJ1 1IJKA 4JVSB 4NYJR 4QDKA 5THKA 4EPYA 3G9UA 1L7NA 3FRJA 1D0IA 4HDOB 5E3JA 3FR7A 1WNTA 4HEA1 4QDXA 2CYBA 4B43A 4EZEA 5C18A 2Z5GA 5AVWA 2WYIA 1U0TA 1ZI9A 4P92A 2J0SA 5C7IO 1REQB 2KJQA 3E9ZA 4X5OA 4XCQA 5NLLA 2B4TO 3E5HA 3EXAA 4DR5B 4NSNA 4I4TA 1N3IA 4J1TA 4CV3A 3GLHE 4B80A 4DC0A 4WI1A 3CW8X 4ZI7B 1OA0A 2AEFA 2PY6A 3C3JA 4E33A 4WBNB 5IJ0A 1NJ6A 4RD1A 2AF4C 2VHCA 1SG6A 1NVXQ 2ZAOA 2CFOA 3COSA 3EUFA 4S1NA 5LQAA 5HGXA 4JC4A 4B6EA 3FTFA 1M2HA 1W34A 1FB5A 2PRKA 4G0VA 2FG7C 5B30A 3OTOB 2D2FA 3PBKA 4AMVA 4FN5A 3ZWCA 2P67A 4HQLA 4YAEA 3C16C 1QU3A 4RAOA 2D0IA 1F2TB 2DM6A 1B8OA 3EG9B 4GFDA 3QFHA 2LCFA 5GONA 3EQ9A 3CF4G 3K0BA 2HMVA 2R68A 4KKXB 1IN5A 1E3MA 2ZUEA 3IEUA 2AR7A 1EIWA 5C5DA 5G3ZA 3IGFA 4LKRA 4PXYA 1JLHA 4KEAA 1SC3A 2FWAA 1E69A 3KVRA 5DI3A 3OJ0A 3LG2A 3LBFA 4LUCA 1KVUA 3H1PA 3O31A 2RHDA 1EUDB 1I6KA 1LBSA 2QG4A 1VE9A 2IOQA 2I9PA 4QEZA 2PWAA 2PAFA 3LX6A 4TTIA 3TRDA 5L3SB 2VYNA 2JVJA 3AEKB 4B3JA 2WF5A 1L7XA 3DXZA 4I4NA 2YXEA 1SUEA 3FETA 4UZSA 4RQTA 3LT0A 4BMDA 2HRQA 3RUDA 4WESA 2FEPA 2YQ4A 2AHOA 3O93A 4S24A 1NRWA 4X20B 1J25A 3QUSA 3BWBA 4DILA 5ERYA 1E5TA 5KYKA 2R9VA 1RYFA 2IVFA 2VHEA 2W58A 3BFPA 5CU7A 5LA6B 4C7JA 5BSRA 3X1ZA 2XOKA 4FZVA 2DCUA 4ZZ1A 4IIVA 4RS4A 4NXNB 4ZARA 4OFZA 4Y6SA 4TZTA 2HGZA 1P2BA 3OG9A 2OZVA 5LP6C 2IOHA 4OMFG 1VE1A 2Z83A 2W6JA 4B0OA 1TKBA 2PS9A 4X90A 2AUTA 3BZWA 5IAJA 2CUKA 3C5EA 4HFRA 2HHJA 5BMVF 5J9FA 2ADOA 2UUPA 1ST3A 2C7RA 5E38A 1CQPA 5ECYA 3MEQA 1K8QA 3K8YA 1T5IA 1P2VA 3PEUA 1CDEA 4LV6A 3V7NA 5E7QA 3LYLA 4B6JA 1RCTE 1V39A 4O8CA 1MQAA 3JQAD 1EP1B 3LFTA 3QMPA 4HQ6A 2ERYA 3ENQA 3HUEA 4GBMA 4DFDA 3I9MA 4OLFA 4XI9A 2BF4A 4BNYA 1JA0A 1F06A 4D3ZA 3O26A 3V4VB 2LXNA 4PG7A 5G4KA 4DIUA 3UHFA 4BMPB 4LDAA 1EM6A 2C8LA 1ZZEA 4P9NA 1LX6A 5TQJA 2BI7A 4WDQA 4XLLA 4US1R 1BCSB 3D6AA 5EJFA 3T06B 5HKOA 2QLJA 2XTZA 2PUFA 1XTZA 1Q12A 2D1TA 4A5OA 2ZTMA 2QN1A 3RAGA 3DOIA 3W8NA 3N6XA 3A9CA 3PJDA 1ECLA 1OXMA 3L04A 1T5TA 3T1QA 1XVLA 2X0NA 3E7WA 2D00A 4HNGA 4HTFB 4WTOA 3H2ZA 1U5CA 1D7AA 3FA2A 5FFNA 3RHZA 3T7RA 2C4MA 4QDUA 4D3DA 1L5RA 5H4HA 2ASVA 1BMQA 1P5RA 2MJLA 1GDTA 4RHEA 3QPDA 2I91A 2WFLA 5EQFA 3CBQA 1K4YA 1HEYA 2XXBA 1R5NA 5AOAA 3PNMA 2C3YA 2QU7A 3HCWA 2HMSA 1P0QA 1KYXA 5EA2A 1BDHA 1GRRA 2C4HA 2G28A 2BN4A 2Q3MA 2Y0EA 3I28A 1C7EA 3LBNA 4M7OA 2FSPA 3GDGA 2J5BA 2X40A 2P4UA 1PX0A 1RVDA 3CQ9A 4BFUA 3K05A 2OBNA 1AHHA 3I2IA 1ZX1A 3ANSA 1THZA 1YASA 1S7GA 2HFKA 4G97A 4HNAA 4M83A 4N6NA 4XFDA 4DREA 2QRZA 1BHQ1 3IBCA 2CDBA 4R54A 1L5VA 7MDHA 1T25A 2GYWA 2ZIUB 1PNOA 3CRMA 3GQBB 4WA8A 3QF4B 5CFOA 5EHZA 4BLTA 2HA7A 1NNLA 1VHDA 1X70A 3HRKA 1RWVA 2WQZA 4FJ2A 4C6TA 3RABA 1E6LA 4G01B 2OLEA 5ADVA 3IR5A 4FBLA 3A7EA 1QHYA 1RYDA 1IM5A 4JENA 3VR6D 4L3VA 5L51A 1L7RA 4HD8A 1L1EA 2VDVE 3M2TA 4Q4HB 4XJXA 1W5EA 2VJLA 2CV1A 1NGSA 1NTOA 3QOYA 3VNAA 2H9AA 1XMQB 4TM8A 2O5RA 1C5KA 1SK9A 2O50A 2Q4EA 2WAXA 3BJZA 4KNWA 1KE2A 2ROQA 3JQQA 4P0TA 3G0GA 1K5DA 3MN1A 5F51A 3CNQS 3DO5A 4J29A 4P54A 1TQ8A 3PQ2A 4J1TC 5K6AC 2GXSA 3WOVA 3IPLA 1ZD2P 2PLWA 1SHJA 2ATIA 2V4ZA 2AE1A 2QT9A 3HKCB 2EJUA 3IEKA 1W94A 1Z2DA 4IUYA 3V48A 4GI1A 5J4KA 3VZQA 1YB6A 3LP6A 4MXDA 1UOQA 4JZKA 2E5LB 1Q6YA 4NL4H 1TECE 5E4FA 5IF3A 3VPFA 4JJGA 5FOXA 4J6EA 4L6CA 2AV6A 4B76A 3TLYA 2NTNA 5AP9A 1N33B 2J4DA 4RW0A 3RSGA 5JJIA 3A6LA 3BGDA 4MUYA 4QU0A 4BO3A 1Z25A 3R75A 2QQ0A 3RSZA 2DHQA 3HUDA 4OK5A 3ZWDA 4BFSA 3LXUX 4PX3A 5HR5A 2ZS8A 3PT5A 3IPXA 2NZVG 3HJGA 2W83A 3CLRC 421PA 4ZP1A 1K9SA 2JA2A 2JK0A 2WU4A 2A9RA 3R3JA 4CEJB 2HA4A 4BKMA 5B5SA 3O47A 3SBEA 3WIVA 1UZNA 2SKCA 4Z4IA 2H18A 5DGCA 5CCXA 1CHNA 3R77A 5K3AA 5AHRA 4FHEA 3MTDA 1QFJA 1EGMB 1N1GA 4UNQA 4HGPA 3B1YA 1HQDA 4XIFA 2QRPA 3TLZA 1V3VA 3KXDA 2R6R1 3WADA 4CM4B 1I14A 3BIXA 3F0TA 4B73A 221PA 2P6NA 1BFKA 4E22A 2XODA 2W6OA 4ENWA 4EL5A 2NO9A 4B3BA 1BMFA 5T41A 2R7MA 2GPNA 2HJSA 4JLAA 1KRHA 2J6HA 4JBXA 3QXHA 5FDFA 2XA1A 1ZRHA 1BN6A 1SUSA 1T6ZA 1VMDA 2A14A 1L6IA 2JFZA 3HXLA 4GC5A 4LFBB 1N78A 4JL5A 4K9QA 4IUCS 2DQYA 1BX0A 1CCWA 2RCYA 1MJ5A 4KWHA 2WF9A 3BIFA 4ZA2A 5IZ4A 4RHXA 4RGBA 2IXGA 4BQIA 3O8DA 4OI1A 2WJWA 4MI6A 3BDVA 3T5DA 2JVKA 5IZCA 1XWIA 2CDCA 2XZTA 3H5NA 5JAHA 2FX2A 4QBHA 2XXAA 2WIDA 1XDBA 2GO1A 3KYDB 2ACKA 1SVLA 3LM8A 3VR2A 4OX9B 3ETJA 4D80A 5DASA 4EB0A 4K6CA 3IQDB 2H5JA 4FKBA 2AFIB 3UMBA 2PXCA 4LZWA 1PGQA 4CM9A 5D6OA 4YRZA 1HT0A 4HPXB 2FKAA 1JDSA 1ZXBA 2ZSKA 2DLNA 1AUOA 1UKVY 4JR0A 3V6MA 4UMVA 3Q15C 1T5LA 1AQJA 2HRDA 1G9SA 1UP6A 3NONA 1Y37A 4PX9A 4IZIA 1JECA 2BWJA 3CA8A 2P90A 2A1IA 2VDWA 2HDHA 1T2NA 5EC8A 5AOVA 3K31A 4UVDA 3TNJA 3NDPA 3UHOA 1Q5PA 2BISA 4IVRA 4KG7A 1J9GA 4UJ3A 3V4OA 1MB3A 1G8YA 3OQPA 4OUDB 4JC5A 4KR0A 3GFSA 4IKOA 4F91B 4QX6A 1B4DA 4E46A 2DETA 3EPJA 2DQSA 2YHIA 5JNWA 5KNDH 2GD2A 1WVGA 1RDFA 1W6UA 5K51A 2V7GA 2P8JA 4BMOB 3IXLA 1VB3A 3JZFA 4ESVA 3AIMA 3G1WA 2FZCA 1Y6ZA 4P22A 1TKCA 2QL9A 3IESA 1EIZA 2VDOB 5FNZA 2D74A 4NZPA 2RK6A 1Q7EA 2GZMA 1A2BA 4Q01A 2AOUA 3NYQA 3U2QA 3WR5A 3NM5A 2J41A 2H59A 4J03A 3SSNA 1FF9A 1Z18A 2R8XA 3KQQA 5JTTA 2PRSA 1VKOA 4PC1A 1W581 2GN0A 2H4XA 1KQFA 2GLXA 4G67A 2FW1A 5FBLB 5JALA 2DXIA 3DG9A 5DNWA 4LDQA 3GJ3A 3N2ZB 3HP7A 3FMOB 1C9KA 4F9TA 1YOVB 1H3EA 1JEEA 1R8JA 2E4YA 3H2BA 3LUFA 3CS3A 4RVUA 1KJZA 2AOTA 4LVUA 5F3DA 4EHFA 4BP9A 2N3ZA 3PHIA 5JJCA 1U1CA 1RRPA 3ANNA 2B34A 5HFAA 5JNSA 1J20A 4QGHA 5I9MA 1KOJA 2H7YA 3O4FA 5WRFA 2JLZA 3DBHA 1JHQA 1E1DA 4ZJYA 3K70B 2XUAA 4A0FA 1EFTA 2AFIE 2HNAA 1OT3A 4U6QA 3V80A 4WDRA 2C61A 2X13A 3COWA 1T6YA 2XRZA 2HT6A 4M1WA 4MLZA 2VF2A 1JMYA 5DT9A 5LUBA 3AKZA 4G09A 4B4VA 1ISGA 4QVGA 1J33A 1G5QA 3KAJA 3LY8A 4UAGA 1ZCJA 3UANA 3DOOA 5LL6P 4QE3A 1IU9A 1S2GA 2VYCA 4FYWA 5H16A 2Y67A 3CO0S 1JILA 4QUEA 3VBCA 2C7VA 3OHSX 3EDCA 3HI4A 1WQ4A 1J8QA 4J90A 5CK5A 5K0SA 1WIWA 4NU6A 4U7JA 5JQGF 4P53A 1IOLA 5CXXA 4ZQGA 5I9BA 1EB8A 5HILA 1XPUA 3F49S 5TEVA 4PLYA 2F3UA 3BMNA 3DAGA 4FS3A 4QU8A 2ZYVX 2ZRCA 4JI1B 1C8BA 3I2YX 4A6DA 2XD4A 2ZWIA 5E3HA 1CF4A 4ZQHA 1KYWA 3FM9A 5D5HA 1TO6A 3MINA 3WLSA 5BORA 1V1MB 1AS0A 2J7KA 3SYTA 4U7GA 1LC0A 2AGVA 3CZQA 4QBIA 3SJCA 1VFNA 1XA0A 1N8TA 3PL1A 2G6TA 1JIJA 3AEKA 4L8WB 1AO3A 1DLIA 2C4NA 2GVDC 4QODA 4I8DA 3U3XA 4BWVA 5JCOA 3BTVA 4DEVA 8ATCA 3KHUA 5EJ6A 1G0OA 1GA4A 3CN7A 5LOVF 1U2DA 4KDFA 1GARA 2O2JA 3RTEA 2B0JA 1J2RA 4U5XA 4JLOA 2WUFA 1UMDA 4GG1A 1JFLA 3ZW9A 4O59O 1PAUA 4NLLA 4OATA 3FGNA 3IEIA 3UN1A 4CCSA 4EO7A 1TQ2A 1JQKA 3KVOA 4WX2B 5E9AA 3AR2A 3AR4A 1M2NA 3I3SR 2LZ0A 4GI5A 3CLVA 4PHGA 2OFFA 1Z5UA 2WD7A 2HF2A 3D3WB 4CCWA 1DTWA 3LQFA 4KO2S 2GEVA 1TW2A 1IRIA 4PNPA 3VXKA 1PZHA 4KN5A 3FNGA 4XWKA 5AVRA 3C43A 3AVUA 4MWGA 1QU2A 4G07A 1ZMTA 4WY2A 4XARA 5GY7A 5P21A 4LCEA 3OZUA 4PRZA 1KWKA 1Z0UA 2ZJOA 2CNWD 1KAHA 4DS3A 1ZIXA 3JRWA 3OHPA 3QXGA 3KTAB 1X7DA 3H99A 3GFFA 4Y2YA 3RU9A 5CFRA 1E99A 3AIIA 4KPGA 5G0UA 721PA 4ROSA 1RHRA 3ZWWA 4G5QA 1BE0A 1QHHA 3ESAA 1DAFA 3OPYA 4ZIRB 1BGWA 2HSEA 3O21A 4WLOA 3D5TA 4ZRDA 4I14A 1IUKA 3KSRA 1UT6A 4LRQA 2OYCA 1R66A 1EP2B 1NQXA 5IH7A 3O82A 1RXWA 3L1IA 2Z3WA 1IMJA 1YQGA 3WWEA 5DX1A 4YONB 5ICMA 1SOAA 2ECPA 2ZSEA 3LSYA 3UOAB 2FP4B 2PYIA 3BGSA 4RK4A 1XXHE 1BWQA 2DPYA 5EGNA 2EIXA 1PTJA 1I3MA 4MPTA 5JDCC 4KVZA 5DW0A 4BWFB 1JQJC 2IPAB 4HGYA 3A3OA 1G6OA 2QMHA 1H65A 3W2IA 2DUJA 5G53C 3EGDA 1ODKA 3FYUA 1I24A 1AKEA 4FILA 2K4MA 3U4QB 4W5OA 4N82A 1K8YB 1GO2A 2ZVPX 4CM3A 3CUWA 2F9LA 1XPJA 3B2QA 5EZSA 3H86A 3QU9A 4G81A 3VFDA 3R44A 4BVBA 5CBPB 4G24A 2OXRA 4G8JA 2QM8A 2XNKA 3DNFA 4OI2A 4KAJA 4BNDA 4CEJA 4F0JA 3EDQA 5AJVB 3I6BA 2Q5HA 2P1DA 4TV9B 3ANMA 2C00A 2LDXA 3N7AA 2HLPA 4HX2A 2AX3A 2ZJZA 4M1TA 3JW8A 3VJLA 3ZJ5A 2CNBA 3K5HA 3CT4A 1ACLA 2PJUA 3VQTA 2GTIA 4H1WA 3NIBA 5F73A 4JGIA 4FNMA 2V5AA 4YTEA 3R3SA 3SEFA 2D0DA 3CSSA 4EL0A 1YL7A 3ZWNA 5B4TA 4MOWA 5C2JB 5C7OO 5JANA 3QH4A 4MWSA 2SHKA 1B0UA 3UJ9A 1NNUA 2KHZA 1K0FA 1GYRA 1QO0A 4ROTA 9MHTA 4MQEA 4L4XA 3ICQB 4XVRA 3E35A 5DNEA 4D99A 1O9HA 4EARA 1ZC3A 3CZ9A 2X8WA 2BD0A 2C2BA 1AGXA 2IZ6A 5ALHA 2XYPA 1IZYA 3IALA 4FHDA 4LDJA 4PICA 3TPFA 1U31A 3BRWA 2ZRIA 4MV3A 3VAYA 1JJVA 4QO8A 4XVQA 3ZC3A 5C80A 4OM8A 2DFNA 2OUIA 5FRDA 1MHPA 2DWQA 5BSWA 1AKQA 1X92A 4PC7A 2XZOA 5A0FA 2B98A 1PSZA 2BFFA 3BH7A 3L0SA 2RB4A 4MRRA 1UANA 4BGIA 3KYDA 4RV5A 4W5HA 4GC9A 3JYQA 3N70A 1NXTA 5E1DA 3ESYA 4UUNA 4B2YA 3A70A 1GT6A 5B36A 3D1JA 1QZUA 1IMOA 1YRWA 3IQGX 4QJIA 3PGJA 4OCZA 1R5BA 4YJ2B 4D5GA 1HORA 1WZEA 2C78A 4FD2A 1YL5A 2JLBA 3IJ5A 3PNYA 1YBFA 2RGWA 2VDRB 4M55A 3I5YA 4HUTA 1U65A 2GFHA 3PIIA 3E03A 3FCXA 1RHKA 4GMKA 5A5FA 3AK4A 3DCIA 4G8CA 1G19A 1XJ0A 2NUPB 4LNUB 5L4NA 3M6WA 4ZAXA 2WT9A 2XT9A 2MSCB 3ZXSA 5GADl 1EXWA 4MKGA 5E0OA 2XUDA 3SC2A 1MOSA 1QFSA 1L1FA 1CRLA 3TQSA 3OETA 4G1MB 3P4XA 3OE4A 2JLAA 1UCFA 4ESOA 5HZKA 1W2GA 3U81A 3FOBA 2WFLB 1ZJ5A 3GJ8A 1HKHA 2ZBDA 1YXMA 4L07A 5U9CA 4RGYA 4TVBA 3FGOA 1GADO 3P45A 3UICA 4PYQA 3CF6R 4MIYA 5L7TA 4LJYA 4QUIA 3LXRA 4X91A 1JDZA 2VNKA 3PFKA 3UJCA 3H7AA 1D1QA 1KZ7B 1MO2A 1VXRA 3D8BA 2CL5A 2JCVA 2PSSA 2EG9A 3F9IA 4GP7A 5TQ2B 1SEVA 5BRNA 1LBQA 5C5CA 2IHUA 5F33A 1YR1A 3PX3A 4BFXA 1E94E 4B5LA 3FMGA 4HCJA 4Z53A 1RRGA 1MRSA 3KQKA 1N5KA 3D3NA 4EB6A 3KSAC 1EE9A 4BU1A 2NUAA 1JHAA 1N5IA 1RJEA 3B6EA 3KTAA 3IR6A 3P0RA 4A0RA 4HEA6 2LNDA 3VC2A 1DDGA 1YA8A 2IEBA 5IKEA 3KT0A 3Q0IA 1D0SA 1CE8A 3FCCA 1J0DA 2XBUA 3OQNA 3LW7A 2FPGB 1GD1O 4MDEA 2FQXA 3RIXA 3PFHA 1RFGE 3PUXA 1XN4A 2O3TA 2XWBF 3HGTA 4JKYA 1C3OB 5GGXA 3PNBA 2CXSA 4G4SO 3SKVA 5L45A 2XCTB 2WP0A 1AKNA 1PO7A 2DBRA 2NU9A 1KKUA 4MVJH 2C31A 4TLEA 3PIRA 2YVLA 3SSMA 4R0MA 4KO8A 2KWIA 1N34B 1KOFA 4ARBA 2XB9A 5TJHA 3G2IA 1GPBA 1A2KC 1AMNA 1Z13A 3STWA 1S9DA 2GBCA 3VX4A 2B78A 2EKBA 4ACAA 5LJLA 4M8IA 1SKAA 2HWKA 3BF8A 2C4TA 1Q1ZA 3O90A 3V8MA 1SIBE 2GF9A 2R60A 2NXJA 2WAYA 1QANA 3GO4A 2HBYA 3PDCA 4MA0A 4R4JA 3T0IA 3WMEA 3ZOKA 2W8BB 4B7AA 5J1SB 4DIBA 2A9PA 3I05A 4LYDA 4Z7OB 5I7RA 5LZ4A 2NXCA 4COOA 2HJHA 1H2YA 4ZO6A 4QOSA 3TWOA 1P29A 3GVXA 5EQJB 3TQOA 4I50A 3WQQA 4QGBA 4X3OA 2CJWB 1IB0A 4BNTA 3DAYA 3U1BA 4MYCA 2QV0A 3IHWA 3KTOA 3CPSA 3LW8A 4KVAA 3TZLA 1JT9A 4ZYXA 3DOFA 1Y9EA 4R9RA 4R84A 5DYTA 5CT8A 1XELA 4QLOA 1CF9A 4YPFA 2O57A 3VNQA 3ZU2A 4LQ4A 1QKIA 1LSUA 4G4GA 2IZ1A 2PD4A 4GX2A 5LQDA 3KPJA 1V1RA 3HN2A 1VYVA 5H80A 1N7GA 1M7HA 4JFRA 1FS6A 2X0JA 4OYHA 5BQPA 1V5IA 2I4OA 4Q7QA 6ABPA 3RVLA 3MWYW 2P5UA 4QYSA 4KQ2A 3WKDA 2IUTA 3C3XA 3DJFA 4EYGA 2PKRA 1GZUA 1VI6A 1R5OA 2WMDA 4M86A 3EFBA 4RZUA 1Y8AA 3OICA 2X3YA 4TN5A 4TUYB 3TI7A 1BU5A 2FPIB 5JXWA 1QZXA 2DX7A 1YQEA 2GZSA 4TS1A 3UAXA 4LF5B 1GZ4A 4AZ0A 2HF8A 1WP4A 4D0GA 2KM1A 2YJ5A 5KBYA 2RGAA 2FJUA 2VBFA 1HG1A 2VTVA 3EMDA 4HLUA 1MG5A 4XLTA 4LBYA 3ZNQA 3D4IA 2YHAA 4CHGA 1NUQA 1RBZA 2CBGA 1LA2A 1BHSA 1O95C 2XAUA 3F5DA 3T15A 3ZS9A 3ZGVA 1F4LA 4AY4A 4E21A 3RVDA 1RP7A 2G9RA 4C9BA 4RZHA 5F64A 2Y77A 3ONDA 1BQ4A 1XDZA 1BZYA 1YS1X 4OXYA 4GUAA 4BMZA 1TYZA 5IAEA 3OLWA 4Z0HO 2JLRA 1CLEA 3FDIA 4J7AA 1TO2E 2YY7A 3BMCA 4WAUA 1VBFA 4XASA 1EWRA 1DBQA 3DQPA 1QHIA 1O96A 1WUKS 1XNGA 2F17A 5BPFA 5E0KB 3AT1A 1GG5A 5FX2A 4GX0A 1UEJA 1DHRA 1XTJA 1H9BA 2I8AA 2NU7A 1XNHA 4J6FA 4GP6A 4ZN6A 3CVYA 1F7UA 3QLTA 1M7BA 4H6PA 3ERCA 5K6RA 3DOUA 3KP1A 3RSFA 3OEED 1U7PA 2IIBA 2H2WA 2XCLA 3W5JA 5B6IA 2OXFA 3FVWA 3HBLA 2QW8A 4KFSA 1YZKA 4OJKA 2I66A 2QB5A 3BEOA 2C0CA 1QWOA 4QYIB 1K63A 2C2ZA 1YE3A 2PMFA 3FCSB 5HA5A 4YR9A 2G8LA 4JQSA 4QXRA 3I6YA 2XSZA 4UCFA 4XXHA 1FLVA 2GRUA 4ZQFA 3BC1A 3CH6A 3TLGB 1QH8A 2QJOA 4RTMA 1DQZA 3U44A 1M54A 2YHUA 1VLJA 5FUQA 5E6UB 2QVBA 1RACA 4MQFB 3T7DA 4NRDA 2YJTD 3UMCA 1ONSA 3GI1A 3R7WB 5KKNB 1IBKB 3LIIA 4I3HA 3ZQUA 5J3JA 4FKZA 1WF3A 2O3JA 2WDPA 1RC1A 3EXHB 3SC3A 3RKRA 4HS4A 4CG2A 1NR5A 2JBAB 2ZIEA 3WXMA 4E5KA 3NJ8A 4M0PA 2HXSA 4W63A 4PLHA 3ZV7A 3MTIA 5K0FA 2OENG 1FFDA 3IVMA 4G0OA 1QE0A 1RXEA 4S05A 2G17A 1EUQA 3ZVKA 2J0UB 1SOVA 1JE1A 2B4RO 3L0IB 1TO1E 1JEOA 3UIEA 4N7BA 3K6KA 2C1XA 1V95A 1EXMA 4B85A 1LB1B 2L2QA 2OILA 4UUPA 4Y0VA 4B75A 4IQ0A 3HZRA 4IBOA 5H3LA 5ABPA 1P0IA 3TQIA 1N2EA 1B14A 4CG1A 3IIEA 1EVQA 1NBMA 2R1VB 1JALA 1PQUA 2UUAB 5CJJA 1N2CA 2GHTA 2E21A 4PVCA 4F46A 4PIPA 3IMEA 1SQSA 4CQMB 2FG6C 4UW9A 3L8HA 1JSCA 1PDWA 3G88A 2ZJ1A 5LBIA 5BQ3A 3KC2A 5BVHB 3PPYA 2NO0A 2VXYA 4GKAA 5ITVA 2FZEA 2VJAA 3IP7A 3LGSA 2D7CA 4KQJA 3QV2A 1SHLA 2QGZA 2JJ2D 4OTZA 5A9TA 4O4LB 4L0CA 4ZK6A 3TUZC 1HI9A 1XRMA 2W2KB 4E5UA 1AZSC 5JS6A 2GK7A 4NZ9A 3NLLA 4CM8A 3GW8A 4G0PA 3H65A 4DSZA 1G0NA 4RH1A 4ONEA 3F73A 2NSLA 3B1XA 3DVSX 3IPYA 4H15A 3RYFB 1KZHA 4UEJA 2AWNA 4F72A 1RYBA 3A31A 3EZ9A 2PGJA 1Q83A 3Q8LA 1D5WA 3FBGA 2HK8A 1QP7A 2A4MA 1WEHA 5DMHA 1T24A 1C30B 3DKKA 4BRUA 5BN4A 3E23A 5ARBA 4TMFA 4MUGA 1KSFX 2JGRA 2FUEA 1U2QA 3N0WA 3BG5A 1DMSA 1JIVA 4MO2A 1DC3A 1LXCA 1W88B 2GLUA 1UFKA 2ZS7A 4NE9A 4UBKA 4K9MA 5IAGA 3R8XA 4KIGA 3IMKA 2MIIA 2QTAA 4JJ4A 4EFMA 1KI2A 2RH9B 3OFSA 4RDCA 1AQ6A 4YACA 1R3DA 4Z9XA 5C1PA 2D1QA 4RIEA 5BR4A 3IOCA 4F7DA 4LXUA 3KPYA 1S9HA 2POQX 3P97A 2G9NA 4BFLA 3E22A 1SQFA 3JQFA 3ZWQA 4NMWA 1VA4A 1VG1A 2O8BB 1UH5A 1TB4A 3VAZA 3CU5A 1M72A 3KOUA 4Z1MA 3QG5A 3KJIA 1G59A 1Z37A 3TUJC 3OEHD 5A6VA 3SHOA 3K0CA 4C6HA 3GF4A 3M4NA 3SF8A 1KERA 2B8TA 4ZOLF 5KDOA 2FPMA 2C3UA 4NICA 1ZS9A 1FXWF 1MU0A 1NXQA 1P39A 2DRIA 4GP9A 2E3JA 1BMFD 3KQWA 1T26A 3KJNA 3D3EA 1OE0A 5DHTA 2CVOA 2Q4DA 1VCNA 4LGMA 4E5PA 2AFHB 3T6KA 3RRBA 2NSJA 4MUBA 5L8VA 4KH1A 3KLNA 3OZEA 1TMYA 1PX2A 1DXHA 2OAEA 2ZI4A 4IV8A 1BXRA 1JPUA 4AW9A 1ZL0A 1F2UA 1E9BA 4Q7EA 1RHQA 1OB2A 1Y3FE 2FDRA 4MRAA 1XWWA 4HI0E 3W0LB 3WFIA 1XDDA 2GCPA 5D5PA 2G9ZA 1VDMA 3I64A 3I9V1 4DR3B 1W6RA 3TQFA 5FWNA 1SCBA 3V2HA 1SOWA 2BKUA 5FEUA 4UEOA 3K9FC 4RA9A 2H85A 3AY0A 2D54A 2V65A 3QBVA 4FCVA 2F4VB 4OLBA 4FVTA 3T94A 3AHDA 3CLKA 5DOVA 1EX9A 4CDNA 2OZKA 1Y5NA 2QAGC 3B53X 2AX4A 1F8UA 4HQRA 4K1XA 4RFVA 1EMDA 2WG2A 2AL7A 2WNIA 3BE4A 5EE5B 1CUZA 4MA4A 5C35A 3BOSA 2XT0A 3DLIA 1ZNZA 3R23A 4RFSA 1XTUA 2RHMA 3NATA 3WS7A 4L8YA 5AIAA 2WPDD 3BK7A 4LVCA 3WGKA 3N7UA 4YFYA 2APJA 5EP2A 5TNXA 3SR0A 3UHJA 1QP8A 4DR1B 3UCXA 4RYLA 1EQUA 1ZU5A 1Q1GA 1G1AA 3C5VA 4IDNA 2GFIA 5JYDA 3ED1A 4Q1EA 4QRDA 2FZVA 2OM2A 3ABQB 3INYA 3KWLA 3OU6A 3E0XA 3KSUA 2YDYA 3PITA 2XEDA 4NKRA 5F52A 5T4EA 5CVDA 1WXQA 4O2LA 1MJFA 3ORQA 2FPWA 3B9RA 3LC1O 3NOQA 5AUQA 1Y8RB 3CKYA 1HYHA 3W2GA 2YIVX 4EMBA 2Q2NA 3E3MA 3TLJA 5A4DA 4ZEOA 1YAJA 4BUJA 2EKPA 1S01A 1U9IC 2QE7D 4I46A 2NO5A 1NQTA 3THYA 2B4YA 4JKOA 4AS1A 4N76A 5FI1B 1M33A 4X54A 5JZ9A 1US8B 1Q0SA 2OV8A 3LPAA 2F3RA 4TS3A 4TV8B 3OPYB 1SC1A 4RTJA 4GR9A 4CM4A 2AXNA 3RC9A 4JIGA 1YRHA 3IAM6 1BOOA 3RT9A 5BQ5A 4R16A 3VI3B 5KYYB 1HY3A 4MS1B 1WB9A 1JTEA 4BO6A 3K72B 3AETA 1NP3A 2ZTUA 4UTVA 5BV2P 2A9KA 5IU6A 3V7UA 3GP5A 4L73A 3BSSA 3QMVA 1Y5RA 1LBTA 3RIYA 4X64B 4CMBA 4IIEA 2MT9A 1QAOA 2WOJA 3AI1A 2PZEA 5GZ6A 5A3SA 4LWQA 1N2ZA 3PC2A 1N25A 1H2ZA 2RBGA 4Z4GA 2O0HA 3I5XA 2JH9A 1Z4JA 3GP3A 1G5FA 1VJTA 3RIEA 5CCEA 1YF3A 4XA8A 1LDMA 1RXIA 3PUIA 1CFJA 2RGDA 3GARA 4OQEA 3GT3A 1FRZA 2P9CA 3A6FA 2R62A 3COPA 3NIDB 1KNXA 1AXGA 2XB8A 2ZIGA 3A4LA 3C8UA 5E2AA 2XJ4A 5TPWA 1I0ZA 1QIKA 4EM6A 4K2AA 4R1QA 1X1QA 2H54A 4IH9A 4DMCA 1BG6A 4F5WA 3O92A 1YBHA 1XB2A 1QIHA 1WXFA 4CT4B 1AE1A 4Y6OA 5AVSA 5LD2C 1XT6A 1RLTA 5EUQB 4K88A 1VBNA 3IHTA 3ZHOA 3WWOA 1A7JA 2L17A 4H7JA 1LI7A 3ABIA 3FCYA 1T1RA 4PQFA 3ZY6A 1K0UA 4JI8B 3PNOA 5DYNA 1LU9A 1CVIA 1KHTA 1Y81A 1ZBQA 3O4GA 4PHHA 4ZO8A 4BP1A 1CU1A 1X0VA 4C7OA 2NYAA 3ZD9A 1H2FA 2XOEA 5B1YA 4MULA 1PYGA 2BFEB 2BEVB 3DDHA 3GX1A 4JV5B 1JHMA 1SCIA 1RPJA 2V1UA 2BW0A 1VGRA 3JVDA 4H3HB 4U0JA 2HSGA 3RU7A 3VR4H 4QXOA 1C8VB 3HWX1 3KU1A 3G9TA 5EXTA 2J31A 4ZDIA 5AI5A 3LCMA 1Z5VA 2OQIA 1JXOA 3AKDA 3AU9A 4K9DA 4O2AB 4A73A 4HVLA 1FA9A 1I4WA 3BL6A 2PKQO 3WQHA 4TLAA 4UUBA 1U3GA 4EI8A 1QQ5A 5EGSA 3GLFE 1YR3A 3IIMA 4C05A 5B3JC 4OGLA 4TVKA 1JHZA 2BGMA 3OEWA 3G5AA 4JA0A 1DBRA 1KR5A 2BE9A 4MMYB 2RHLA 1YZTA 3FF1A 4FFWA 2I3GA 1KI1A 1IBSA 5B3JA 3RGWS 2P6UA 4BZZA 4ZU1X 5KTOA 4TXHA 1Z82A 1U04A 3FHOA 3I4FA 4WLEA 2CXOA 1M83A 1N2GA 5JS1A 2O8FB 1RABA 4H7FA 4AZTA 1W4LA 1GL9B 2X76A 1N7HA 3L82B 3G2QA 1G4AE 4HDNA 4L9RA 1H5QA 2VQSA 3Q6NA 1JLLB 2LDBA 5EG5A 4FM9A 4MV5A 3VR4A 3WK4A 4ZOQI 1T6XA 1NULA 3NOVA 4FZ5A 4M7RA 4LF9B 1OH5A 3ETHA 3R6GA 5CD9A 1A8QA 3ZW7A 3OU7A 1SCUB 2M1XA 3PEFA 2PT9A 2YXNA 1XE3A 1Z15A 4LDNA 1S1CA 3GYGA 1WVIA 2W8BA 3KFLA 2E4VA 4IVNA 4JBGA 4L3WA 5ENDA 3CJQA 4DAEA 2GO7A 7REQA 5CA1A 5HJEA 1Q0HA 1TT7A 3BMQA 1E0SA 1NUAA 3OJCA 4O4HA 4LGYA 2W6QA 2C7GA 3MUEA 2PO5A 1W5SA 3MJSA 2RKWA 3BE5A 1Z6GA 4HEHA 4B82A 1U99A 5AJHA 3R4CA 3U7QA 1VL5A 4CMEA 4INOA 2J0QA 2H4HA 2NSYA 3DVQX 5DRYA 1L4MA 3A0RB 4O8ZA 7GPBA 5F1PA 1G21E 4JBIA 5JMTA 1CJCA 3N2YA 5KWJA 3U1TA 1DOAA 3A4TA 1A76A 1KY5A 3EVNA 3PVZA 3KQYA 5LD2B 2JGJA 4R81A 4PFQA 3Q8XB 2FPLA 3IE0A 1U1EA 3NVMB 3K1AB 1OWLA 4BCCA 1EDEA 4L76A 3B78A 1O57A 3G82C 1ZISA 5LZ8A 1TCUA 4C20A 2D1FA 3GQBA 3I9FA 4FOLA 3ECCA 4Y0AA 1WU7A 1KO7A 4B4WA 4F93B 1QBGA 2YWGA 3LDGA 3ND6A 1F51E 3WRXC 1PLLA 1L8LA 3BXHA 4P32A 4M53A 4JI4B 2O8NA 3GLKA 2FPOA 1J23A 4C5CA 1FK8A 4ANFA 2VRWA 1E7RA 2QNRA 5FF9A 3KTDA 2IPMA 2C7OA 1DINA 3ICVA 5BYBA 1QAQA 2BBTA 4R2MA 4O4JA 5DHAA 5DM0A 4ZYYA 1XHFA 1WXEA 1L4KA 1UXHA 4KYUA 1P91A 1P1IA 3VPDA 1PZXA 4CKXA 4QBFA 3FCEA 2VH1A 2R4TA 3EEYA 4QQRA 1CJUC 5LP6A 3B89A 3QKRB 4PGFA 4RLSA 1TZKA 1E6CA 1F0NA 2A0KA 4LHZA 2HWYA 1W85A 2GB4A 3RPEA 3MRSA 3ZZ1A 1PUXA 3QHAA 1QGUB 3BFVA 4HH0A 3EVDA 2VKQA 4C4SA 3ZWAA 4C5AA 2XLBA 1PFVA 1ZW1A 4ZK2A 4U7PB 3EXIB 1CUWA 3IXMA 1TJ3A 3EAQA 1G21A 4W5JA 4MYSA 2UZ1B 4GPIB 1U1DA 3LLMA 1YCDA 4E5NA 2P2NA 4EG4A 2FR8C 1X1RA 4UBIA 1W1WA 3CZAA 3OIYA 2O2SA 3G8DA 3HP1A 4LSMA 2XA9A 1R2QA 2NU6A 4MQUA 2EC5A 3KKMA 2GF0A 4R3NA 3UJ6A 3CN9A 3QG1A 4M0MA 1A5BB 1WBDA 3BRQA 1KP3A 5CT4A 4D4JA 1I4TD 4HGOA 1J8VA 2XKJE 3CX4A 1M2FA 5ERXA 1KYZA 5AVOA 5JNUA 1EFHA 1DXOA 4IIJB 3FCUB 5DNUA 1D6SA 5ALWA 2ZBPA 1SKYB 1AHIA 2FNAA 5PNTA 1T15A 4GEGA 3SZ3A 5DYGA 5JS2A 2J3QA 3FWZA 4MRVA 4AP9A 2O8CB 3ZEIA 3PYXA 1E96A 1IXKA 1BJTA 2X9VA 2ZUVA 4LJLA 1NR1A 4FYHA 3RHSA 2QD2A 2DYKA 3S6JA 3KVVA 3RBVA 3BTOA 2RJOA 4TS9A 3D3JA 1OX5A 3DTVB 2NPFA 3BQ9A 1FL9A 2JAPA 1MNQA 2GPBA 1WE2A 3S5UA 4YRDA 2P2CA 2I87A 2IUSA 4X6UA 5J4HA 2H8GA 1I1NA 5JFOA 2AI3A 1L7BA 1N8NA 3X2SA 4GLJA 5EZYA 1GV0A 1IIBA 2P11A 2AR9A 3P9YA 4D9EA 1DTEA 1HE5A 1M0WA 1RYEA 2VJOA 1GGHA 3OZGA 4RVFA 2H1RA 3DEFA 4P82A 3EY4A 4A6XA 5A5VA 4LN1A 4CQJA 3V8VA 1JPVA 1XTKA 3K15A 4PCLA 3SXUA 2ZDQA 3DMTA 3JXEA 3KWFA 4Q1CA 3W3AD 4OOFA 3V8NA 4CQLA 3ADOA 3D8SA 2KYRA 4OF4A 1S96A 3RUHA 4L2IA 1QGZA 3PC8C 3WB0A 2E1RA 4L0DA 4RVOA 2DBVO 2E49A 3OJEA 4EKYA 2I54A 2PLFA 2QU8A 3K2EA 2X3UA 4C5BA 2JFHA 4WVFA 4B4UA 4JUDX 4EAQA 3DHVA 4KSCA 2DERA 1N1DA 2BKXA 4E09A 3A8TA 4QM7A 2BGIA 1BROA 3Q7PA 1DX4A 3KOZA 5KQSA 1RI4A 4JA2A 5CYOA 1YBMA 3R9XA 1DDIA 4RDHA 2F59A 4DL9A 3S99A 3OIUA 3QV1A 2EJWA 4W1QA 4J0GA 4JASB 5BUCA 1W0KD 5BV0A 3CRNA 4HUQB 3AO0B 3Q7TA 4I1SA 3NETA 4CGYA 1N32B 1KJYA 1H9CA 5BOSB 1ZBDA 3H7IA 2ZS9A 4OQ4A 1TF7A 2DWPA 2ZRJA 3HA7A 1M1YE 2QTMA 4KK3A 4S1PA 3WRWA 4ND8B 2PKXA 2QX9A 1BYIA 4QXMA 2OFPA 2LP4Y 1IHUA 2ETXA 2NAFA 2JIOA 1OZGA 2I2BA 4V39A 2XCIA 2PK3A 3MUNA 3LDAA 1QRTA 3C7DB 4O2RA 1WLYA 2YV5A 4MK4A 3W5IA 4DCVA 2Z4RA 4BVLA 1NUHA 3FCOA 1IHPA 1M2KA 2P78A 4Q7LA 1ECGA 1M0TA 3AV0B 3PWSA 4MEAA 2C0PA 2A1UB 3W3AH 1RCUA 3GIDA 4QPCA 2OO7A 2J9ZB 3LVBA 3BWYA 4HQFA 4LBWA 4DKJA 3EY9A 2YZ7A 1AX9A 3EXG2 1QHFA 2HIMA 1NVKA 2ESRA 4ZOLB 1JTFA 3UT0A 1TUBB 1OLXA 2WTAA 3KZNA 3KVNA 2G1KA 3MNFA 9ATCA 5HMMA 1ARZA 4EEXA 1Q0QA 2O7NA 3OJOA 3JY6A 4XGKA 1JYSA 3PNKA 3MJCA 1UDBA 5CB6A 2QPLA 3R41A 3U39A 1U8FO 2BM0A 5DLYA 4DCGA 3R24A 2LR0A 3F6RA 4WNCA 2WVHA 5E6SA 4DMFA 2PMDA 4R3WA 3T34A 1XZGA 3GEEA 5D7NA 1DKMA 4F92B 2CLOB 3CIFA 3FB4A 5FTLA 1HURA 4Q37A 1ISPA 4G5GA 3EZFA 2ODAA 2WKRA 1RBMA 5IM4F 8ADHA 1JEAA 1XMSA 3CJRA 3T1HB 2EW2A 1NZDA 3CSDA 4OHPA 3OCJA 2JFFA 1WSWA 1ZSYA 2QE6A 2PPVA 3G49A 3OA2A 4U2KA 1HSOA 1MF7A 2YZMA 4M1OA 4TRNA 2OWEA 5IJZA 4GRIA 3R5FA 1JLKA 3DZGA 3UT6A 4A6PA 4I55F 3RV4A 1G5PA 1YFKA 2G5TA 2Q3BA 2WKQA 2ZYHA 4IJKA 3UUFA 4QG7A 1QRUA 3A1TA 4FT2A 1Z0IA 1NAIA 1WHTB 4LPKA 4R2IA 3OEEA 4B3IA 2V6BA 5K4GA 5J2TA 3QJYA 1Q1EA 1BU8A 2VDQB 1QM5A 2EBUA 2WMNB 3BL8A 5ALXA 1KMNA 3EEOA 2C96A 2WFZA 1FRQA 1PD1A 2QY9A 1YQDA 2MYTA 2VK4A 1M6NA 2O06A 3K94A 3HKEA 3U48A 4DLLA 2B83A 5T7BA 3IAFA 3FTQA 4X20A 4L78A 2BJHA 4FI3C 1U8ZA 4X1KA 2JKZA 2G1AA 1O87A 3NVDA 3ZD7A 2GASA 3E5MA 1PNVA 2DBZA 4MAFA 2EFYA 3GWGA 3NAGA 3RFUA 3A11A 3U16A 4CTOA 1XXHB 1GWNA 1C4WA 4QG3A 2EKZA 1C0LA 2WWFA 3OFVA 2RI6A 3RD5A 3VI4B 4R71A 2H1SA 3BFKA 1NNSA 2QTRA 3L6CA 4M76B 4NBRA 4YJHB 2BOVA 5LQJA 2FZWA 4TV8A 3FGPA 3LUKA 4YAUA 1A7UA 1WW3A 2HHCA 5AW4A 1FLAA 1W4AA 1G4UR 2XKKA 4EJSC 1J90A 3IT2A 1QVWA 4MW1A 3F5FA 1LEHA 1Z6YA 2HLDD 1HMYA 2RC5A 3F9CA 3OCZA 4IOJA 4Q3AA 1VPDA 1HNZB 4HDQB 4N49A 2GHQA 5FBHA 2FQQA 2IDMA 3LP5A 4C87A 3KYCA 4XLZA 3MJHA 1U9IA 1OBHA 1JFTA 3TG2A 4IOMA 1ZLYA 3KR0A 1USVA 1Z35A 4FMCF 4A6EA 2NX2A 1TAQA 3KWMA 1W59A 3M3PA 4WD3A 2AZ4A 3DBRA 1MO5A 3A6PC 1KDRA 2PT6A 1CNEA 3CF4A 4LG1A 1B1AA 5I7EA 1P2SA 3JQDA 3SJAA 5K8UA 1BJRE 5AWFC 3RHTA 4KIFA 3OO0A 1J5EB 3R6TA 1YS9A 2PFSA 4V2IA 3DFIA 4NBWA 4Q7JB 5FULA 2I1WA 3SYRA 3WSTA 2JAQA 2BMDA 1YJXA 1XLTA 2H07A 4OUDA 1G3QA 3S0JA 1M2OA 2ZZMA 4Y98A 3A4MA 2IP1A 1KFEB 1JQ5A 3CMMA 1VG8A 3EMKA 3PV0A 5K1ZA 4E4TA 4K6KA 4EG6A 3H8SA 1YA6A 3TTVA 5EKUA 3NWPA 1H6BA 4KO1S 1OXBB 1XDWA 4I36A 4NEGA 5ESDA 3T3MB 4L9WA 4B4DA 4B3TB 3F8TA 1MZPA 5L3SA 1X1TA 1JW9B 3DTYA 4DDKA 5EWMB 5H5JA 1QLHA 4EW6A 5IT9A 2X1VA 3FMVA 1OAOA 1ZA2A 1GNQA 4FEYA 2IWHA 3H2IA 4JHLA 4UTNA 4Z4QA 3QVMA 5E6UA 1JHRA 1FFBA 2DMRA 2P62A 5LYYA 1LQ2A 3ZDEA 1QLJA 2QRVB 4EG8A 1S89A 3NC0C 1DWQA 3MILA 4X1OA 3ROZA 3PGMA 2HZBA 1SM4A 2QWXA 1E8DA 1L4YA 2ZRAA 4G63A 4HVTA 4AY3A 3TFQA 4BQQA 3LDHA 1NWHA 1VB5A 2FJPA 5BWMA 3AVTA 1M9NA 2WUGA 3R0ZA 5TQVA 1VCMA 5BMVB 3OTWA 1CX9B 4F4IA 3GY0A 2HGSA 4BOYA 1H8HA 2QL6A 4IIHA 4JUFA 2X9LA 3OLQA 3LUHA 2PSJA 5JC8A 2H4YA 4AD8A 4IJ5A 1GSIA 1KJWA 4ENSA 3X1KA 5TPWB 1H3FA 1FPQA 4Z51A 2Z6AA 1UM9B 2CLCX 4JJZA 2BZSA 4AJLA 3AQ4A 3D5QA 5JZSA 3A1DA 1OWPA 3AKYA 5HKKA 1NFRA 5E9WA 4H6VA 4G85A 3TKLA 3L8GA 3AESB 4RLQA 5KAMA 3MRXA 4UBNA 1M6VA 4F2DA 1AF7A 3IX7A 4X3PA 3K92A 4X8HA 1PJTA 3QVKA 3E3NA 3IILA 2PWBA 3ZPXA 1PR0A 3GD5A 3MS4A 1VSBA 2HBRA 2YYYA 1T1IA 3VH2A 3MBKA 1Z6XA 1NC3A 4TVSA 1RQLA 1P5JA 4C1BA 3HYSA 2ID4A 2W6ZA 3IBSA 1NPTO 4NPCA 2UYGA 3LPMA 4J4HA 4V0NA 5TSDA 3CTPA 4L4ZA 5CW2A 1E2HA 5JQWA 4E12A 4GRDA 4N5NA 3JVEA 3L1JA 1SPXA 1ZIYA 3QY0A 3GXOA 1C8KA 3FVQA 4U7WA 1FDSA 1C1XA 3L1HA 4V03A 1A72A 3RVKA 4XEUA 3TPZA 4P5DA 3N76A 3X1YA 5IDXA 2WPDA 3S1LA 1P7ZA 4O2AA 2HDWA 3C98A 3AU8A 1SXJB 5I4IA 3AM5A 5IC5A 1GKIA 1ML4A 1R00A 2WBLC 4QGAA 4A0GA 3SBDA 5CT6A 4Z4EA 4ZKDA 3LO5A 4MYRA 2V5UA 2N0SA 2QD3A 4QVKA 1QOZA 3KQUA 5BXQC 1QQBA 2CK3A 2Z6VA 3TW8A 1KSGA 5JAQA 3NTOA 2DBQA 2EGHA 5HG0A 5H83A 2DY0A 2OB2A 2VT2A 2MYPA 3WWZA 3EHEA 1Z3CA 4DJJA 3LNCA 4E1AA 1JBKA 3O9MA 4IM7A 3TTWA 3UWKA 1UJ2A 3DNMA 5HZHA 1QSGA 4P4TA 2I4RA 5DTQA 1E5XA 4ZDJA 1XD8A 1A82A 5BWOA 1RU3A 2R1UA 4DN6A 4HLUC 5I7SA 3E3OA 1TVKA 4IIJF 4C14A 3IJRA 3UT5A 1EB9A 2R65A 3RVNA 1MABA 2BFDA 3ZHZA 4TWIA 5D7BA 2H4ZA 2QYSA 1LGYA 4EG3A 4DLUA 4NOJA 4Z54A 3W3ZB 4JLMA 3UWMA 4DA4A 2ZRDA 5ALKA 3MWEB 2A5LA 4I7EA 3REOA 4CM6A 3FROA 1COWA 1R15A 1X7GA 2AMVA 4PG5A 4LIPD 2GAJA 2NTYC 4TLLB 3N86A 4WGGA 3LT4A 4F2PA 5K7SA 4EO4A 4JGGA 3W2EA 1MB4A 3O4JA 4G36A 3TZ6A 2B5WA 2GD1O 5FTKA 2FZKA 1D2NA 1GKYA 4CLHA 5CA1B 3OT4A 3ES9A 4RF2A 1MRNA 2RHRA 3IAXA 1P5ZB 2GERA 4FB5A 5C34B 2GYVA 1L3CA 4WCFA 3JAWB 4ZAGA 1HLDA 1JDBB 4MZDA 1L1RA 3O5AA 2SKDA 2ODNA 3FFAA 3RLFA 4MHOA 2BGJA 5JRJA 4LYAA 2GPTA 1VJ0A 5K3EA 4Q3BA 1ECPA 2MU1A 3L93A 4I5GA 4L50A 3A4YA 3TM4A 3VTAA 3QXJA 3D4BA 1HSZA 3CUKA 3ZE7A 1X19A 3BDIA 2WJAA 4XYLA 1ZOSA 1VP3A 2Q0HA 3BRCA 5CVUA 5TV2A 5JCOC 5FTJA 3ZU6A 2G7MC 1TAUA 3HFGA 5A4FS 2B37A 2H00A 1G8KA 2XDYA 2A0YA 5JHHB 1BXGA 1I32A 2VHZA 2VZ9A 3QSYA 1LRJA 4ASUD 1T5HX 3D6MA 1NM5A 3N8NA 4PZCA 1UDRA 4MX8A 4PHCA 3L41A 2QZSA 4QM6A 1QE3A 2RH5A 1G8MA 5GJCA 2GZHA 5DOZA 2P3SA 3ACDA 4HNSA 1BWRA 2CKDA 3K2BA 3QYAA 4V38A 3MGAA 4YFVA 5GV7A 1CUVA 3Q3HA 5TQ2A 3B9QA 5IXJA 1U2DC 2Q41A 1I7LA 4IX9A 4G5XA 5LDDC 3WK5A 4WCDA 4EB3A 3AFHA 5KNCD 3T61A 2B1GA 1S2IA 4BNUA 3VR0A 4P4UA 1C1HA 4PRYA 1RWKA 3GAZA 4ND3A 3TUIC 4GD3Q 1RPNA 2GCOB 3IUPA 3OIVA 3W1EA 2I67A 3AUAA 4RA6A 3KT3A 4HJXA 3PPWA 1AMOA 1N2CB 2D5IA 1GR0A 3NT4A 3Q6IA 1UBEA 2HDNB 3BCUA 3JQ8B 5DEIA 1JB9A 1O0BA 2KSQA 4TUYF 4XDGA 1IFXA 3DMYA 1KI6A 1M1UA 4E32A 1A9QA 2VQEB 1T4DA 5KCMA 4N47A 3KFVA 3QMMA 4XWAA 2A67A 5IH3A 3TDKA 1KZ9A 2YVQA 3LJKA 3RODA 3UW3A 1OPRA 2H52A 1ZCZA 1H3NA 1ZVQA 2Q5QA 2YVUA 2ST1A 1L5NA 4ARUA 2W37A 3ZKWB 1NYRA 3FMPB 3MUOA 4C6SA 2DFVA 2XYVA 4L2IB 2IUUA 1P7CA 1N0WA 2WU8A 3LUAA 3COYA 3OOWA 3IDQA 1SUAA 2IZOA 3IP6A 3OWHA 1Q3TA 4I6JA 2PV0A 3AZPA 3ZHBA 3NHUA 3H5LA 1BTOA 4RCYA 3ESXA 3Q2IA 1KVSA 1QPZA 4EITA 1PN3A 2WF6A 1V4VA 2MSEB 3N75A 2JB9A 4B6GA 3B48A 1JZSA 4EGFA 3FTEA 2PO7A 1JLSA 5E8RA 1SCUA 2XE6A 4OSOA 2EZTA 1A4XA 4BQEA 3V34A 1GQQA 4EYKA 1YD7A 2ORWA 1OLUA 2R8BA 2V7TA 3QPBA 2C5HA 3PLRA 4YY3B 1JAXA 5ECDA 4EW3A 2O8DA 1NJ2A 4EF6A 1I4DD 2C4WA 3QW2A 5EP1A 5T67A 2C07A 1CS4C 4GSKA 2H1IA 4KQKA 3EH2A 4GSLA 5LDGA 3CHYA 3L84A 1PT9A 3P9IA 5REQA 4CG0A 5A7GA 2VHWA 3LQ4A 1ZHOA 2UXDB 1GNVA 4IFEA 4F6RA 4IR7A 4EBFA 4MPPA 2MINA 3BGWA 4NY1A 1SFRA 1KSJA 3IAUA 4ZO4A 1KJ9A 1UKCA 2MMCA 4FCCA 2FE4A 3VRHA 1GFSA 2VSQA 2XXAB 5ER9A 5F9FA 2X3FA 4AYXA 5I01A 3PGVA 4NBVA 1I2MA 4X95A 1HT1E 2IOYA 1VMAA 1M2JA 2PMKA 1P7WA 1NLFA 3P2OA 3VPCA 3E15A 4QOEA 3HE3A 1FMCA 5JPDA 4RMHA 1DCKA 4DIFA 4ER7A 2VQFB 5IYZF 5A5GA 1V35A 1B73A 2JHPA 2XNSA 3ZBTA 4AKEA 2X0DA 1J24A 4CN9A 2ZUCA 3M6UA 4EMSA 4A7PA 4QDTA 1DQYA 3CIOA 1VKNA 2I55A 3VKUA 2XOXA 1M6VB 3PENA 5GMOA 5MHTA 1QVZA 1NN5A 1O96B 2Q5EA 4NECA 3AHJA 1WAMA 1JDJA 2EZUA 3S28A 3O7WA 3HC7A 3QEAZ 3ZXIA 4YJ3B 2JZNA 2IPNA 3LHFA 3C6QA 1VJ1A 3DEIA 1FYFA 4EHIA 1WETA 5LSAA 1DJLA 1Y3IA 4ESHA 1YB7A 3ETCA 4FMDB 1Q0ZA 1CNFA 2X8AA 3EVBA 3W05A 3VDQA 4I8XA 5F5NA 4YASA 3JD0A 3PE4A 4ND8A 2JFPA 1NBWB 2J33A 3SF0A 3M8KA 4YAWA 1OQAA 1D6NA 4L5AA 4N8DA 4DABA 2VWQA 3O2SB 4U63A 3UTDA 4LRXA 2FETA 3ZV5A 4BMVA 4HAOA 1ZN8A 5FEMA 1J00A 4OOEA 4WCFB 2CJWA 1W1IA 2I6QA 3F6PA 4AFNA 3R7WA 1RQPA 5G1PA 4E2FA 4EFDA 3CISA 4J16C 3RIHA 3DWEX 2QR3A 4QA9A 5HIMA 4C2UA 1VKJA 1T10A 1X0XA 5CB4F 1HOXA 4F3TA 5G0SA 1DO2A 4CKWA 2RHWA 3KDAA 5EMMA 2CXNA 4KQCA 1O58A 2DTDA 2X8BA 3I6QA 4DDMA 5IVHA 4BFWA 1PG0A 3OUUA 4LRWA 3L05A 3UNXA 3ICEA 3AUFA 1ZM2A 2HN9A 5ALDA 1XYYA 1CT9A 1QHSA 1J42A 2A57A 3NWEA 5DM1A 5IT4A 3K6SA 1S2DA 4ZV9A 5HFJA 4X66B 1CR2A 1W36D 4D46A 4NCBA 1YVUA 1B6TA 3JQAB 4BB6A 2GPYA 3DKVA 1QGYA 3RASA 1U2ZA 4QUKA 2WD7B 1Y1LA 3GEMA 5B7NA 2D59A 4PAWA 2ZVQX 3EZ6A 4WZZA 3SKYA 4P35A 2IYPA 5H7XA 5EPOA 3ZCRA 1JFVA 5JLAA 3DV0B 5K8TA 4PGGA 1N6HA 4OLAA 1FXSA 1UF9A 2PSHA 4FFMA 5JDIC 3T9AA 5ELMA 3BB4A 2OL4A 3DE2X 1EINA 5A0TA 5CA0F 3PC8A 5KYWB 4AXXA 1MH1A 3TFOA 1AY0A 5DB4A 4PC2A 1W0CA 4JVOA 5DHRA 3ZQ6A 4J2OA 2IW1A 4IXWA 3L1KA 1ZM9A 1GJRA 3SBOA 4DVJA 3JQGB 4XJTA 3VO1A 2DKFA 4LRYA 5FQOA 5M29A 5JBIA 3W77A 3EUWA 4E3ZA 4LXQA 4X61A 1YZFA 1KMMA 16PKA 3PB3A 4D57A 1A27A 3W3AA 1P7PA 4H0FA 3NHSA 1S8NA 3CF2A 3P9NA 4RGVA 1ID1A 2QXTA 3OIGA 5IM5A 3O1JC 3ZCUA 1OXUA 3DCJA 3BM5A 1UJ6A 4CR7A 4RESA 4IS2A 2GGSA 3KZ1E 4AJ1A 3TXYA 1RI1A 2BMFA 3KBOA 3MELA 1P4JA 3IOBA 5IVIA 1T3LA 4Q03A 1ZD3A 5IDVA 1T0BA 1WBJB 1YHYA 3JQCA 4A36A 2GVZC 4R3UC 4N54A 3H9EO 2PU5A 4YRBA 1LPNA 2VHVA 2ZUUA 3EGXA 3Q3JB 4AECA 4AT1A 5BUZA 3T5AA 4UD2A 1JHOA 5DPMA 4XRRA 5FOWA 5JH7B 4JGBA 3B8EA 5GM1A 1IY8A 1G3UA 2HT1A 3BYZA 4E6PA 2RHHA 5I4BA 3K16A 5EYPB 3IBGA 3TJMA 2B7BA 2VJPA 1W0KA 2XRFA 4MHSA 1BX1A 3DE6X 4P6VF 2R44A 1JI0A 4W8GA 2ZJFA 1Y3BE 4K6OA 4UCXA 1JAZA 2FR8A 4JJFA 5I51A 3OIWA 2OK7A 3V97A 1V8ZA 4AYWA 3KB8A 1XFDA 2MINB 2KE5A 4U2CA 4KWCA 1FFAA 1Z36A 3M82A 4OYRA 1IVYA 2A33A 3PJEA 3IKJA 1PZGA 3LY9A 5KREA 5KNBH 2IRWA 1RJ9B 4TT3A 2AMYA 2TMYA 2VBGA 5C8DA 4KX5A 3MTQA 4L8GA 4AS2A 5KSPA 3ICOA 2PA0A 1VIVA 5ESRA 1ORVA 4PCUA 2B6NA 2VHTA 3LCUA 3ZR4B 5TPZD 4RTNA 1K6MA 2IHZA 4MS4A 5TIIA 3HJHA 2VTKA 3FLEA 1TQDA 3EQZA 4FYMA 4HNRA 1F8XA 2DQ4A 2O7SA 1MX9A 4US0R 1O1YA 3CVVA 2X77A 1MPTA 2EEPA 5DMXA 4GOJA 4YC7A 4M9UA 3AYZB 3TNYA 2VJMA 3V8RA 5ALRA 2Y4OA 2Q7XA 1BCRA 5F77A 4CN8A 1G55A 1MX3A 1LWOA 1N5JA 1TTPB 1RJFA 1SOMA 3DPIA 3KJXA 1BKSB 3GA0A 5AO9A 5DKFA 3O03A 2RHOA 1RC0A 3TE7A 1O0CA 2R7AA 3N05A 1RYZA 1RPZA 3ILVA 4F9GA 1V1MA 3HPQA 5LOVB 3HBMA 2JJQA 1VPTA 3GJRA 1FLNA 1JRLA 3M9LA 3QUAA 2WILA 4J0JA 3FD8A 1QCCA 2ZLBA 1N2XA 1ADGA 3EXFA 1U7HA 4HH4A 1KDYA 4WLUA 4X0EA 3BMQB 3SOPA 4BE4A 4NG4A 5A3VA 3T7IA 1Y8QA 4O4IF 1ZOOA 2A0WA 3QYFA 2GJSA 1WPQA 3KJEA 5C7LO 5IKXA 1A95A 4DBZA 4OG2A 1SC6A 4WUVA 2FFQA 3KYBA 1J0XO 5IVDA 4LXHA 1BXGB 3EGIA 3AM4A 2V5VA 3FAKA 4P5PA 3H5OA 2UXCB 1G18A 1YJAA 4K0RA 5J1TB 1ZPDA 1ZUWA 5H1YA 1YI8A 4H3VA 2XNJA 4K3VA 1TEHA 2V55B 4O4HF 3JQ7B 4ZI5A 3U3ZA 3V2IA 1QAMA 2WT8A 1GL7A 1PJBA 5JY1A 2GI4A 1P9OA 3ZH2A 4W9NA 3STUA 4JYPA 1M0EA 3A1SA 1ECJA 2ZBFA 4ECEA 1VE7A 4DA6A 4R51A 5CNKA 4OB8A 3ZQJA 5HKAA 3U7JA 1NHWA 4FGKA 3NDBB 1N57A 1NBME 1T3ZA 1TAHA 2PUJA 3P0EA 4ERNA 3HEBA 1TEZA 1O03A 2J0VA 4MMXB 3F46A 1U8UA 3I92A 4FDMA 5DE3A 2GNPA 2IH2A 1EX6A 1QR6A 4HVCA 2GXUA 4CKEA 1F48A 1UZAA 1YU6A 4DLAA 2Q1YA 4WOKA 1QRAA 2X2OA 2DJ5A 1DEOA 4Q9AA 1W1UA 3HPRA 3MGBA 5D5QA 3ZGYA 3ETGA 2REQA 3B6IA 2IELA 3IOEA 4M0DA 3G0CA 2M6KA 1G1MA 2HLHA 1FQKA 1XZMA 2EARA 1V8BA 3FI9A 3DZFA 3IPAA 4L8VA 1OMOA 3USZA 4DMKA 4KVFA 3AP2A 2I6GA 1U0FA 3GFQA 4I1PA 1XQXA 2GK6A 2P9QA 1NKVA 1QMGA 3V33A 4H0CA 4LKOA 2EOAA 2YHIB 3EXHC 3OA0A 2Q6TA 5DGHA 4PPGA 4AWBA 2QTCA 4CTKA 4LZZA 1H1DA 2G4CA 2BFPA 1Y7LA 2N46A 2NACA 3I72A 2YWJA 2JZOA 3DO8A 4W82A 3QNUA 2A7QA 4EWLA 1L4FA 1U7DA 2NZ2A 3OKPA 3U5ZB 1E7SA 1L5SA 4XWOA 1CTQA 3QBEA 5K0TA 1PDVA 2AKYA 2SCUB 2R2AA 4WH0A 4TV9A 1Z6QA 3VISA 3NI2A 3HRIA 2CLKB 1GR1A 1EESA 3PEVA 4RLFA 4HN2A 4Q47A 4RMNA 1E9VA 2QYHA 2AC4A 3VPBA 2IY9A 1NPYA 4S0ZA 3ZHCA 2R8EA 4JB0A 4L74A 3I2JA 3TIFA 3UGKA 1DJPA 3KXKA 4KQIA 1KZGB 4GBGA 4QT4A 5LNK1 1QYDA 1F38A 2RG1A 4NMHA 2LRHA 1RWQA 5D2CA 2IEZA 1L3IA 3WHKA 5K6TA 1CZNA 2BP7B 2LIVA 3PFNA 1EUCB 1A4RA 2YCBA 3TW8B 4PX5A 1XZLA 1QV6A 4KFUA 3OCVA 4A27A 1A71A 3N5CA 3WY9A 5F9HA 3L6RA 1XNQB 2G6BA 4G2NA 4XGRA 3DOHA 1K4MA 1YZHA 2D2EA 3DXFA 4G9BA 3L92A 4DYVA 2CCJA 1B0ZA 3CPEA 2QX8A 3FYDA 4HNHA 3BILA 5MGNA 3O3MB 4UHCA 3ZDBA 4PX2A 5T3UA 2P5SA 4YV2A 3EVFA 3KT6A 3LKZA 1N7JA 2A2ZA 2OY0A 1KI4A 5CVCA 5HCNA 2Q6LA 2WP8J 1ILEA 3QE2A 2NZ8A 4UTXA 4HYQA 4DARA 5FYQA 1OCEA 4KPYA 1IN8A 3NBFA 1X77A 4ZAZA 3O3NB 1H8HD 2UDPA 4GT1A 2WY2D 4AP5A 1I7DA 1FW6A 2XQJA 3CWZA 1QX3A 2XCOA 2W6MA 4M1MA 2ZCVA 2E9SA 3DYBA 1BDMA 5EEGA 4AN1A 3PGKA 4MMZB 1M1YA 5LQKA 2CB9A 3OOYA 1I2CA 1G2QA 3BXXA 3AI2A 3RSOA 1C3LA 2A94A 3ETDA 5A06A 3T7TA 2IV3A 3P2IA 5JYEA 3LX8A 3RT1A 2BFNA 5FI0B 3FPHA 3JD2A 4LJ8A 3B6ZA 4A3SA 4HAUA 1OV4A 3KELA 1PUIA 3CRRA 2Z56A 4QIHA 1ORTA 3OM9A 4QJBA 3I42A 4YALA 2GCNA 2ZE7A 3L8FA 1I5EA 2Y0PA 4JUIA 3QE9Y 1AS2A 2FR1A 2QD5A 3ZIDA 2WVJA 1MV8A 3AFGA 1Z7WA 1BE1A 5IKPA 5LKAA 4RNCA 3B9PA 2I2FA 3C3DA 1EYZA 1XLTC 4PG6A 1LVGA 2OP0A 4GKBA 3UM9A 3UY4A 2CKMA 4NCNA 1NF2A 2O8CA 1DKNA 1K9VF 3BREA 5AKGA 2FWNA 2AYZA 2YBDA 3H1GA 3TSZA 3EJ6A 4L1KA 3AR8A 2W90A 2QMQA 3BB1A 3K6SB 1XCGB 2EZ8A 3BJRA 2AG1A 1R0KA 3NTQA 2OCLA 2ZGVA 1BEEA 5HCUA 3HWSA 3KQVA 2WWYA 2Z2JA 1P17A 2J9RA 3O4HA 3Q7IA 3DWFA 4F4UA 2I4LA 1R9NA 3RVSA 5EI5A 1U3TA 2VNIA 5FBZA 1Z5OA 1B43A 3JV7A 3OU2A 2CK3D 4HGRA 5HQJA 5EHIA 3R5SA 1ZO8A 2GAOA 2PA3A 1J8YF 3UKDA 4LYFA 4CE6A 3AUKA 5A4IS 2O3RA 3JU3A 1OXVA 2JCGA 1H42A 3O0TA 4X41A 3S1AA 3UAOA 9ABPA 3K4QA 3OPXA 3MAJA 2GBIA 3A6JA 3KFXA 4HB0A 1N36B 4D3SA 4UHFA 4A26A 4PYLA 4BKQA 5K09A 1LZKA 1QV9A 1YKSA 2BBWA 2QMZA 3R3YA 2C9MA 3MGGA 4FLFA 3O8RA 1N8SA 4U6SA 2VOEA 1SXGA 4MB2A 3ZIAA 1T3HA 2FYTA 4NAVA 1ULUA 3ER6A 4DDUA 3FWNA 3LHKA 1KXZA 2AK3A 2AZDA 2Q5JA 4FE7A 1DAMA 4TSFD 1V7CA 1X9HA 2P30A 4B8WA 1BFUA 4IUBS 5F2OA 4D4KA 1OX4B 3OPMA 1KTVA 4YA6A 3JASB 2E55A 1RXYA 5TQ0A 3VPGA 1NW7A 4DV5B 1WCIB 4S2UA 1NMEA 4TX1A 2BGWA 1NF8A 1EVKA 4Z4FA 1U7XA 2GCGA 4DV3B 2WJPA 1NXPA 2ZRBA 3ILSA 3JWGA 1OTHA 2QAJA 5JC1A 4HRYA 1I7NA 4L51A 4BNGA 5I7UA 4KXNA 4UDOA 4LOIA 5IWAB 1Z83A 3TRHA 1PGJA 1PWEA 3G8YA 4PLGA 4OSEA 4R8VA 3L7LA 3REFA 2W2VA 5EPEA 2HI0A 5EJ2A 4WHMA 1IWPB 1YZQA 4FR5A 1EGHA 4J0DA 2G1PA 2Z5VA 2X4DA 4HUQA 2YMPA 1NNEA 1XKQA 4B35A 1TQ4A 2AQHA 4YP5A 2LW7A 4MUJA 1JKXA 3H3XA 5CFLA 3KJFA 5E7JA 2V9CA 5KSWB 3WKBA 2OC9A 4NTZA 3OZRA 3AP1A 4G3XA 5FPQA 3G23A 4BY9E 4ENTA 3IOMA 2ANBA 2I3DA 3QF7A 2O7RA 4JP8A 1ZEJA 5IJAA 2RONA 5E8JA 1E2JA 3R7SA 3W04A 5A62A 4YMUA 1TM5E 3OZWA 4ASUA 5FFMA 4NBTA 3BFJA 2BV3A 3HBFA 4IYJA 5G2OA 4TZ0A 2F9FA 1W44A 3P4UA 1H2BA 3M0EA 1MAWA 3OO1A 1XRSB 4BCDA 5B1SA 1GEEA 4O4JF 2C9ZA 5IWCA 2HMTA 1DWOA 1UBHS 2Z30A 3EE6A 1DUVG 2C0QA 2P65A 3OM8A 4WXRA 1DU4A 2QYTA 2Y6UA 3GDFA 1YJCA 3NHRA 3KG2A 3W9YA 1TNDA 5HBGA 2WTBA 3CEMA 2IXBA 5CEJA 5K05A 1G8AA 3WMWA 3AC0A 2C77A 1TQ6A 2GJKA 1CUGA 4UHDA 4K5QA 3HXQA 4AY5A 4LDPA 2HD4A 5AYVA 4IWXA 4KWTA 2NIPA 4R2XA 2LKCA 1J5XA 3JPYA 3U6KA 1L4HA 2XY4A 5TMPA 2PIDA 2YIMA 3JD4A 2PUBA 2Y1LA 3LXMA 1UBTS 4WOJA 4BECA 3U4IA 3DDWA 4D9IA 4UXJA 2C03A 3AR6A 3VU8A 4MV0A 2Y1KA 4UDYX 4CNBA 3EAFA 4Y18A 4BX0A 3JTMA 2EYUA 3F90A 3Q98A 2Q4BA 3ZKWA 1SR8A 1H6AA 2ZWOA 4KAXA 1AQLA 1PR2A 3CLTD 4EJ0A 1G8JA 2AEEA 1XZIA 1M2OB 3J7TA 3QPUA 4QFBA 3PFIA 2IUEA 2PX8A 1XZJA 3OIFA 1GAQA 3OQ1A 3Q87B 5IXYA 2VHYA 2M98A 2AEMA 3CKKA 2B1JA 4JLWA 1R6AA 2Y99A 4KQXA 2QW1A 1I01A 4MIKA 3T9BA 1USKA 2PNJA 3U4GA 1JWLA 3TZQA 1T29A 3C4QA 4EPTA 4GWKA 2GN2A 4KBFA 5FOSA 2QORA 3TSAA 4DEXA 3DFFA 4Z9BA 4B6SA 3FSJX 3K9LA 2QX7A 4LYGA 4Y9TA 4XWGA 2NUTA 5HHTA 1W25A 1XU7A 2WM2A 2FFJA 2IE0A 2QBYB 1ELOA 1OASA 1UBGA 4X1IB 3ZKAA 2W6CX 1PK8A 3DTVD 3JQ7A 4BJ1A 5LP6F 1NDQA 4E1VA 3FPGA 2PSDA 1SOUA 3QKIA 1USWA 1UDXA 4XTCS 1P1CA 3A05A 3MLBA 4ZZ3A 2KX7A 3GB9A 4V0ME 2ZZKA 1TK9A 4I6GA 5GJWC 1YR9A 2H0QA 4KFCA 3W7VA 3PDIA 4UPDA 1HE4A 1R6DA 4WXHA 2PS3A 1VM6A 4ZI7F 2OV2A 1KI9A 1BS2A 2DC1A 5AJXA 3WBKA 3EJWA 3RWBA 4EG0A 1MJGA 1ISFA 1SUFA 1QIJA 3KHSA 4LS3A 3NHBA 4LXIA 1KIMA 1NN3A 1QG6A 3I5MA 3MQFA 4HQKA 5A1TA 1FTYA 1PSWA 4B4OA 4CFSA 2F43A 3TLXA 3N0XA 4D9MA 4E51A 1MEOA 3A6GA 5JSKA 4FGUA 3AF3A 4G0QA 3KKLA 4OBXA 4Q00A 3T54A 3UBTA 3HCEA 1H6DA 2RIPA 1NW9B 1Z28A 2XQGA 3NUGA 4I08A 3TSYA 3CLUC 4NJMB 4I50B 1MX1A 3LYHA 2CJYA 2GH1A 1USUA 5HE9A 1AXRA 4LMBA 3W2HA 1C14A 2ZETA 3HGQA 2C2HA 2P1RA 4QELA 5COQA 1ULSA 3WYDA 3AVVA 1DC5A 4TL8A 1TM2A 5BNTA 3CLUD 4HAVA 1OX4A 5AW0A 5JAMA 1A9OA 3N2IA 3VBEA 3X2EA 2DKNA 3WL3A 2FZ4A 3WLNA 2ZAIA 1P9NA 5K2OA 2VCHA 2C54A 4H16A 1ODLA 1V1RB 1SQ5A 3LLUA 2WC1A 4V3BA 2EDCA 4Q7MB 3R5JA 2RC6A 5H59A 3RSLA 1BMTA 2RG7A 3ESCA 2PXHA 4AMZA 4B3GA 2PQ2A 3PFGA 1CZHA 4BKOA 5EUCA 1PS0A 3P5SA 2IOFK 3N0VA 3IUYA 1ZGCA 3MT8A 5B7QA 2MMGA 2QN6A 3M6VA 5DVZA 2X7HA 3IBFA 2OXTA 4MP8A 3WSVA 1GTMA 3AF6A 5IBCA 2AFVA 1Q17A 1MEEA 2OGZA 2QM3A 1GCAA 3B7GA 4IJVA 1EJBA 4K86A 4PLZA 4F4HA 2CWDA 6AT1A 3OZSA 1KDTA 3GUYA 1UPXA 4Z7QB 1YRQA 1Z34A 4BP3A 2PXXA 3P26A 3TQHA 4PO3X 2EKDA 1R4MA 1SB9A 3HKDA 4TYPA 1T9GS 4MI3A 1J7JA 3GDOA 4WXYB 2XIQA 4F1WA 3OX2A 5E4JA 3VSEA 3K9GA 1SCDA 1GGMA 4FWIB 3BH6A 3WNQA 4DY6A 2QSZA 1TAGA 5HJ7A 1CBUA 7MHTA 1BRMA 4IGIA 3GMIA 2RAUA 3EZNA 5CPFA 1CYEA 5SV2A 3RS0A 1RIFA 1PHRA 2EHJA 4EYQA 4YV0A 2FN7A 1HEUA 3F2IA 3PX7A 3TB6A 4U9UA 1U0LA 2BEWA 4UJ5A 3N74A 4EX7A 3TOZA 2G3YA 1MMFB 2VPYA 5LP6B 2AF3C 4EI7A 1N5OX 4JI5B 3K0CC 4DLXA 2BTOA 1JN0A 4XWWA 3OZDA 3G5MA 4HZUA 4XJSA 3QRWA 4E5SA 5K3FA 1I8TA 2CGEA 3F6CA 1E59A 2CXPA 3EW9A 1OB5A 4W7HA 3EIUA 4AJNA 3D0RA 4BC0A 1SXJE 2ZRNA 4E4RA 2UUBB 4M9CA 4OFXA 3ZDDA 3MJTA 2L0XA 1ND6A 5ICFA 4XYEA 3C39A 3IT3A 2BHLA 2QRQA 5IW8A 4XD2A 1M1YB 1KY4A 2CJPA 1FS5A 4FINA 5E7IA 1V5EA 3U4CA 3K4PA 4E0BA 2ZSAA 1UWCA 4U2GA 1RMYA 1RTTA 2XMGA 3P9PA 3ZHYA 4H08A 3VYUB 4A15A 3DLBA 4GKVA 3RV3A 2IT1A 1IQUA 4FN4A 3NNDA 5LIPA 1HUQA 2JCXA 2B94A 2BKVA 3SYKA 2WU3A 1V3QE 1CW2B 3E9YA 2VHUA 1B74A 5JPIA 2NU8B 2JGDA 1QB8A 3NEYA 4ND2A 4Q1AA 3OE1A 2ZJ8A 3QIAA 5LQUA 1U94A 1YV9A 1VTKA 5C37A 5A0VA 1MDBA 2D3WA 3RVPA 5JWRA 5KU7A 4URYR 3KLBA 3NBKA 5A6SA 2RGEA 4NBNA 3UXYA 4EHKA 1YZLA 2NNLD 3ZXUB 3QLUA 5P8WA 2WPNA 4R1OA 2P2YA 1C41A 4H7EA 3HKEB 4ZCLA 3OQJA 1VRCA 4BATA 4EABA 1PR6A 3H75A 2XUFA 4BNZA 4AX8A 1O97C 5GZ1A 1K7XB 2XUHA 2WAAA 3PQDA 2PVCA 3LRPA 2A9JA 3SJZA 4ZI3A 3IA7A 4GZ5A 2WLTA 4YRTA 4TRRA 2J4CA 1MRZA 2E4AA 4HQ0A 5HS4A 3T4XA 5C1IA 2Q3LA 1UJCA 2TYSB 3IERA 5CCBA 2OG2A 4QOGA 2QUIA 1EVIA 121PA 3KD2A 3L06A 5C1DA 5DCUA 1AD2A 1Q15A 3KQHA 4E30A 2I78A 3EH1A 4AY2A 3DR3A 4RTRA 2MDTA 1KFBB 2DPHA 3GLTA 4KTTE 4M1SA 1R0CA 5AK3A 5DCWA 5JDIA 3TDMA 5TS2A 4QXPA 4F96A 5TPZA 2TRSB 3OSUA 1CJKC 4AUNA 4YUXA 1PCXA 1YJ5A 2QX6A 1K68A 3H1FA 4MKXA 3I1FA 1IEVA 2ZT5A 1JWAB 1Y9AA 3GZNA 3HBAA 2J09A 3PXEA 1P74A 2FMHA 5T4FA 5JFTA 5KCZA 5EAIA 3SHTA 2X0KA 5CB8A 4Y30A 5I7WA 1SCQA 4XE5A 5GZ3A 5IP5A 3AIOA 3UEOA 3GPDG 4F4FA 4GM0A 4IXNA 4PSUA 3V46A 1WDLA 3OBIA 1G21B 4Q9NA 4X92A 4M0LA 4XQCA 3TO5A 4B8ZA 3EDOA 5FBVB 1LSSA 1JTVA 1LSJA 2UV8A 2GZAA 2OV3A 4GM1A 2NUBA 3UPUA 2R8OA 5TARA 4AMBA 1RR6A 3HFRA 4IQ8A 2Q0SA 1VL1A 2HCTA 2NQ2C 3QU4A 1UXIA 1K88A 1TUEA 2VYND 3GH3A 4RSRA 1Q84A 5AM0A 5IK2A 1X8KA 2GN8A 2QVLA 3G2NA 1LNZA 1MX5A 3W1VA 4QXQA 3C7CB 3EK2A 1FZTA 2C2WA 1R74A 2GS9A 4UFOA 4N0DA 4OMUA 4QTTB 4BLVA 3U3MA 3OM1A 4ALLA 4X8LA 4F3CA 4ENQA 3PQFA 1W76A 3R5TA 4YRRA 3HP4A 3T9EA 4JL8A 4ZVSA 4Q4LA 1KMCA 2E7ZA 1Y8ZA 2N47A 4LHYA 1U90A 1P73A 4WXPA 4Z7JA 2IYAA 4FU0A 3CVWA 3NNNA 4MQLA 5K4AA 1KQPA 1R0RE 5ECGC 1NZFA 2V54A 3KUUA 4REQB 4K9OA 4AU1A 1W5TA 3PCRB 2VUUA 4O0LA 5HOQA 1WHSA 1RBYA 1WY5A 2QVCA 2W6JD 3HDHA 3K0FB 3NDRA 3NPAA 4NDNE 2IZ5A 4PCVA 3S2YA 4YLEA 3ZE1B 2X14A 1JG4A 4NK4A 3AERA 3ML1A 3PQ4A 4R05A 3USCS 1QRRA 3KKNA 1AZLA 4OXNA 4ZQIA 5KVQA 3RS2A 2ZJAA 3FFTA 4KLNA 1UXJA 3BTSA 3HQ4O 4KDRA 1AKWA 4RM3A 3SDZA 1OZFA 1RWOA 1THTA 2XV1A 4C0HA 1E1YA 2WIAA 2X9QA 4DG8A 1WW2A 1JHXA 1LV8A 1SC4A 3UW1A 3FPSA 1ETHA 1KGDA 3FJ1A 1IL0A 4WFJA 3KSBC 1P33A 3P1JA 2OPHA 1E0DA 1T1SA 3RW9A 3H42B 4C2TA 5U1PA 4GU5A 1B8VA 1XTVA 2YYZA 5DN6D 4GWGA 4HPWA 2V45A 1GQ2A 2MSDB 1B8PA 4KACA 4MW9A 2Q3HA 2P69A 1TJ4A 1J9EA 2IOFA 3OURA 1J1ZA 2XAAA 1QGAA 1R4AA 2C4UA 1ZUD1 4PBRA 4P4LA 4MP6A 1N0UA 2QN2A 4ENPA 5EJ5A 1JFSA 5K8LA 2AN5A 4B17A 1XXLA 1YCGA 4HWPA 5BYKA 821PA 1W93A 2NO7A 3I9OA 4LJ6A 1YOBA 3V1KA 3THYB 4OHFA 1GOTA 4FFPA 1H2RS 2C88A 1FYXA 2LUOA 3RQIA 1U9YA 2P4SA 1EFKA 4G37A 5JY6A 5JSUA 1SUBA 2WSMA 4XYBA 2BF7A 4ALJA 4DMRA 4ZCMA 1YI0A 1C1XB 1C0EA 3O38A 4R01A 1QKKA 3X1MA 4AQDA 1LBHA 2HU2A 4IDPA 4UVIA 4H77A 4YCJA 1NNI1 3SLRA 5FLYA 1E2PA 1JSLA 4NXMB 4RPLA 1SK8A 4D0LB 1FP2A 4DAOA 4LZPA 3ZQKA 4H27A 3I0ZA 3KZXA 1X1CA 3WISA 1CC1S 3GGDA 1Y5IA 1PFGA 4ZRMA 5IASA 2AOTB 1CK4A 2G09A 3ZCVA 4DLPA 2JGNA 3JR7A 2I4NA 2NYVA 4OJMX 3D8UA 5JCPA 2IYZA 2OA0A 2VH5R 4NDZA 2DSNA 2Y1OA 3DT6A 2E4XA 1NZJA 5CW1A 5BP7A 1D1PA 2FPPB 2VQ3A 3SI7A 1GPWB 2BI8A 4KHZA 1KP9A 1Q1NA 3QEMB 1B42A 1BVUA 1EA7A 1K7CA 2Q8QA 5EJIA 3WG9A 4O3MA 3HB7A 4WY5A 1SVOA 3NWOA 3D59A 4FYKA 4Y1GA 3RJZA 5JQGA 4RD6A 1FQOA 1YH3A 3DL0A 2VHXA 4LF8B 4V2UA 4JLBA 4K9SA 1UEIA 2XUIA 2D06A 2XYHA 3BAFA 2C94A 3MG9A 2Q5LA 5LWHA 1L5FA 4B3XA 3GJSA 2VEOA 4AB1A 5ECWA 1OSNA 1POWA 1AF4A 3JVIA 3EC2A 2FZ5A 5AUNB 1TVCA 4TYNA 3H3JA 4TTRA 2AG5A 1R88A 2I3ZA 1TC2A 2V6FA 4HGZA 3R9KA 5BW4A 2ZSUA 2Q3CA 4N7JA 3KLPX 4QPZA 4XKJA 2NU9B 4UOZA 1GL6A 4RACA 5FV7A 4N01A 1U3FA 3WICA 1R4NB 1O95D 4RVSA 2CL7X 4U00A 4GLOA 3G0HA 2HF7A 4ZT5A 4ZVMA 1KAEA 2OCBA 2SECE 3Q6MA 4R8MA 3M4ZA 4L08A 3S2EA 5M2QA 4Z5XA 4L7VA 4DPLA 1TEVA 2CVZA 2QD4A 3EG5A 1IN1A 4UCQA 4CLDA 1F9AA 3FPAA 2WZBA 3L4KA 4NENA 3NPMA 3NKFA 3ZZUA 4C7KA 2SKEA 3E9CA 4GPEA 4EUNA 5FQNA 4ZANA 1FRNA 3B1WA 4H17A 4RKQA 4OKSA 3L7MA 1LCIA 1YS2X 2WSSA 4ZDKA 1L4LA 2WVAA 5E7MA 5L9AA 4Q21A 1UZLA 3MJFA 1MFZA 2BT4A 4ZCSA 5KTPA 3FH0A 3I32A 2XR1A 3SIXA 3IFSA 3RFTA 1UUFA 4UCWA 1XDGA 1E6MA 1H85A 3NYIA 5I48A 5K0ZA 1FOEB 3C14C 3AFIA 1PL0A 2ONCA 2ZB4A 1T1GA 1Q0TA 1DAKA 2A6PA 4Z0TA 4O2BB 5BN5B