4RAQA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
214
structure length
198
Chain Sequence
SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 198
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4raqA00
3DEZA 1NONA 1ECCA 4M0UA 5JSQA 1HGXA 2H07A 3QW4B 1HMPA 1XZNA 2E55A 1VSTA 1I0LA 1I0IA 1OREA 1PZMA 3H83A 4Z1OA 5HIAA 4RABA 3EFHA 4RHTA 1G9TA 3OZGA 1UPFA 1OPRA 4M0PA 1A4XA 1G9SA 4P80A 4FYMA 5ESXA 3HVUA 1BD4A 1P4AA 1VDMA 5JV5A 3GGCA 5IPFA 4PFQA 3ACDA 1P19A 1ECBA 1R3UA 1ZN9A 5KAMA 4F8EA 5IAOA 4JLSA 4LYGA 4S2UA 1XTVA 1G2QA 2FXVA 2P1ZA 1I5EA 4P82A 4RQBA 1STOA 1DKRA 1QB8A 1ECJA 1W30A 4OHCA 1XTTA 4LZAA 4WN3A 1UFRA 4RHXA 2JKYA 1IBSA 1WD5A 4P81A 4X45A 3DAHA 4RADA 1JLRA 1G2PA 1QK3A 1TC1A 2JI4A 4M0KA 4JITA 3OZFA 3GGJA 1OROA 1QK5A 1GRVA 5BQPA 4RANA 1BD3A 1I13A 3ACBA 4RHYA 2VFAA 1I14A 4ZFNA 1O5OA 3LPNA 4LZOA 1J7JA 1DQPA 1QB7A 1DBRA 1ECGA 1QCCA 3NAGA 1A98A 1UPUA 4RAQA 1ZN7A 2JBHA 5EUCA 2AEEA 1U9ZA 1QK4A 5BRNA 1CJBA 1NULA 1Z7GA 1BZYA 4WMLA 1A3CA 4MB6A 4QYIB 4RACA 1DKUA 4P83A 4RV4A 1A97A 2YZKA 3GEPA 4LZNA 2XBUA 1Y0BA 3KB8A 4RAOA 4LYYA 4P84A 4RHUA 2H08A 4IJQA 1LH0A 1U9YA 1A96A 1ECFA 4P86A 5HKLA 3MJDA 1A95A 2GEBA 1P18A 1FSGA 4QRIA 5ESWA 1VCHA 1L1QA 1L1RA 1V9SA 4P3KA 2WNSA 1ZN8A 1D6NA 4RQAA 2IGBA 5BQOA 1QCDA 2PS1A 3LRTA 4KN6A 5KAPA 1AO0A 1MZVA 1YFZA 4QYIA 2JKZA 2PRZA 1DQNA 5K51A 2DY0A 3ACCA 3DMPA 1JLSA 2PRYA 3OHPA 4TWBA 1GPH1 1TC2A 5E38A 3G6WA 4PAWA 1XTUA 3MBIA 3N2LA 2C4KA 1O57A 2H06A 3S5JA 4X44A 2EHJA 1P17A 1XZ8A 2HCRA 5BSKA 3O7MA 3M3HA
chains in the Genus database with same CATH superfamily
1A7JA 5MFPA 2IYOA 4OEHA 3MSCA 1CRPA 3RKRA 3RUCA 1AURA 4BX2A 4D25A 4CGYA 2WJAA 2GS9A 5LC1A 3AVPA 2FLKA 2HEIA 3BF7A 3DNFA 1KEEA 3ETCA 5LP6F 2BI8A 3NDPA 2PU7A 2QP3A 4YRZA 1DIGA 1DLJA 4MSUA 5EP3A 2J46A 3ZBTA 1H6AA 1WKCA 2EJCA 2FPKA 3M6AA 1ID1A 2RK3A 3DZJA 3FA2A 3GJ6A 1RC0A 4BV9A 1NPYA 1ZOLA 2QX4A 1QJ4A 3GDWA 2V9PA 2PA3A 4CMIB 2IP2A 2GCIA 3EDCA 2RGWA 2OORC 2P8SA 3VAYA 2DBZA 2WM2A 1E1MA 1N5IA 1X1DA 3BEDA 1E1LA 3LCCA 4LHYA 4QUBA 2UZ0A 1CXZA 4PSAA 3RFTA 3AVTA 3OTGA 1IATA 2BHTA 3DUFA 1BDMA 1EQ2A 3QWBA 2P3LA 3WGOA 4ZGGA 1NMEA 5SY9A 3TXXA 1JI3A 1LQTA 5TT0A 1WX1A 4PWYA 1C4OA 5H83A 2ECFA 3E1GA 3ICOA 4L50A 4EH1A 5D7NA 3TQIA 3BWYA 4YUVA 3MPUA 1SULA 4EO9A 3EDRA 1ZIXA 2OBYA 2K2WA 1SCAA 5EWJB 1UC8A 3H0CA 2QD1A 3PA8A 4I81A 4YP1A 3IVXA 1YZTA 4PZUA 4FXPA 2OSVA 3BB1A 2C4TA 3W5BA 2DEUA 3R9XA 3K0CC 5LBUA 3UANA 2OCGA 4B7UA 4WWHA 5AI4A 3GLGE 1TCAA 2AW3A 2ETVA 2YZNA 3EH2A 3LWZA 3ZE1B 3U61B 4QGBA 3BCRA 4KO8A 5CBPB 1U7TA 4PX2A 5B12A 2I7CA 1U7UA 4YRNA 1LDYA 1CR6A 6PFKA 3EEQA 4V03A 3TFWA 2QLMA 2HWXA 1YZYA 2VRCD 4JH0A 1G6HA 2Q27A 1S8OA 4OXKA 1PSWA 3DQZA 3S99A 1C30B 2I4IA 1TVKA 4B34A 4MMYB 5F78A 4J2TA 1ZH2A 1KEKA 5AKYA 4CDGA 5CIQA 3ZY6A 4JZKA 2B69A 2ZBQA 1XDSA 1MO5A 3ENQA 4B9AA 2PSJA 1N3BA 1NSTA 2R47A 3QELA 4OHRA 4JYPA 5IH3A 3ZCXA 3EMVA 4CVNA 2P9GA 4XVCA 4WOJA 1Y4AE 1DCFA 1NVUQ 3DMDA 3TPZA 5BR8B 1Y3IA 2QY9A 2XTMA 1SIOA 3WK4A 2RJNA 2P2GA 3FGZA 1QC5B 1XRJA 1Y9DA 3EMDA 2HV9A 4HZUB 1E96A 4LDNA 2PMEA 3VYTB 1IRXA 1GLNA 1DXHA 2CXQA 1BXZA 3A1SA 3IDZA 3DBHB 1G6KA 1KHHA 2IIBA 3LBNA 1PN3A 1HWYA 4CKXA 1J0EA 4MEJA 5T5QA 4TMZA 2J9GA 5TMBA 3HLKA 3O7WA 2OLJA 3AVVA 5C5EA 4J0EA 5KQPA 1U0RA 2PMCA 4DNFA 1U5BA 4N7BA 1W5EA 2Y0EA 1NNUA 2C99A 2GAOA 3IQFA 5CURA 1SXJE 2VJBA 4DG8A 4XUGB 1BQEA 1XZHA 1YZVA 2Q49A 5EAIA 5EJIA 3ZHRA 1Y5IA 2ZXEA 3T7EA 2X4LA 3O1JC 1E61A 1YQGA 5KBYA 1T5LA 3WVNA 4EA9A 4YAIA 2VHVA 4O3MA 2Y71A 4BVKA 5LQRA 1XE3A 4IV5A 4A15A 4LOIA 2GD6A 2LV8A 3NH6A 1O9BA 2Z1NA 3GMIA 4FHEA 1GPAA 2XVXA 3MOGA 2PWBA 3VOBA 4DY4A 1H2HA 2Q4DA 2YV5A 2XQIA 4LJ5A 3RANA 2W58A 2XUZA 1THTA 4KPUB 4R9VA 3KHKA 1WKVA 1YULA 4PZCA 3AV3A 4MTLA 4B80A 4BGIA 1M5RA 4CZ2A 1QVRA 3PSHA 1GITA 1SCQA 4I3HA 2VDLB 1TIPA 4A16A 2BR3A 1VMAA 2JLAA 5CA0A 3IIEA 3LDHA 4KWHA 5CUQA 1ZAKA 4IQGA 4JJ4A 1PR1A 1D2MA 2LXNA 3V8RA 3U49A 5DM2A 2ONYA 5CM8B 2Y66A 4M7PA 4Z0PA 4TSRA 3SZOA 2V0GA 3QVJA 5FNVB 1SEVA 3OEWA 3QEJA 2FUKA 3DLAA 4LZZA 1DQSA 2Z2JA 4MA0A 5ALGA 4EKIA 1Z34A 5AIAA 5CFQA 2ZI4A 1DIBA 1RNLA 3SQMA 4ESOA 1M6YA 1DFHA 2B3DA 2UZ3A 4OM7A 1ZR4A 5FULA 1JSXA 2R96A 1EWKA 3E3AA 3LW8A 1V8ZA 4Y98A 4ENRA 4MUJA 5D86A 1B1CA 4PY2A 3HGQA 2DMRA 4BJ3A 4UATA 3FF4A 4G9EA 4LOJA 2RD2A 2IDJA 4TWAA 2HRZA 2PMDA 2ET6A 3GLHE 4YUWA 3MUFA 4LZLA 5IUNC 3OE4A 1QK5A 4TRMA 4IZ6A 4AMUA 5DHQA 1LTQA 1VQ1A 2TMYA 4NENB 4JUFA 3PNVA 1RBYA 3B52X 3CNLA 3UJ6A 3QY0A 3A1CA 2O1SA 1W581 4A2QA 2J5RA 1IUKA 5CFRA 4INZA 5EXTA 3IQZA 3U44B 4Y9DA 3IE2A 1NHWA 3AB7A 2SCUA 4FB4A 1P9RA 1XB2A 3VPCA 3DKVA 3VR4H 5I7AA 2CJFA 4HWOA 3OUTA 5DCYA 4F4HA 4COOA 1NNLA 1FYEA 3U4QB 5KJ6A 1Q7CA 1OXUA 2UYCA 2LR0A 2HEGA 3BXOA 3QOFA 2Q21A 3HDVA 4M1TA 3QX8A 4XTCS 3T0GA 5FADA 3ZCSA 1PK9A 4M1KA 1RQLA 3ABSB 4F4CA 4KYUA 3BRWA 4LDJA 1X1AA 1PT6A 2OGUA 4LJYA 1QANA 4RD4A 4WNIA 1HDXA 5AVYA 1MABA 2VHEA 2JGNA 2ZGVA 3C16C 3EY9A 1GAJA 3H19A 1JL3A 1W4BA 5HJ5A 1EFDN 1NW8A 5BUZA 1I36A 2G4CA 1T5HX 1LK0A 3VNBA 4LOKA 3WSTA 1YQWA 5EJ9A 3UJNA 4I1RA 2Q3CA 3JX9A 3LKBA 4UKDA 2W00A 4DV7B 3AVUA 4CDRA 1IC6A 2HF8A 3HCOA 4B7CA 3SICE 1F60A 4FFMA 1I1NA 4CCSA 4NL4H 5D85A 1GTRA 1SQFA 1SHZA 3PX3A 5A0FA 2DKOA 1ZESA 5LUBA 1WZNA 3QLUA 4I46A 2QTVA 3ZYZA 3DE3X 3TAXA 1HSOA 4L8VA 2AQHA 2GSWA 3NIDB 3VDNB 1Y8CA 2O57A 4IQFA 5FUXA 4QYIA 5ALVA 3LZCA 2JHPA 2PRZA 3GFPA 2JS7A 4BVFA 1I51A 3RIXA 2X42A 4RK0A 3I04M 1JHYA 3LIPA 5IFLA 3K0AB 1TC2A 3D3NA 4BY9E 2X5XA 1B00A 2I99A 5EQDA 1P2UA 3VR6D 3NEYA 2QG4A 3LV8A 5DV9A 5IM5A 4YRJA 4GP6A 5IXSA 1XXHB 4W6QA 4ZDJA 1YH3A 2V7BA 3HRKA 3SHWA 3EIFA 1JPVA 2CEAA 4JI2B 3CEJA 3EVNA 3L8CA 2DC1A 1JJFA 1FYWA 2X2EA 3TD6A 3T4XA 4RXMA 3QEKA 1MW9X 3H42B 4RW0A 4WCFA 3DONA 3ID6C 4XRRA 5AI6A 1M74A 3ENZA 1Y7TA 3OOWA 4Q7JB 1PKEA 3ZDFA 3CVJA 2VHYA 5BMVB 1SBIA 2D13A 3L7NA 4P80A 4TWJA 4INOA 4KRFA 1HEIA 1P0QA 1DC3A 4I66A 3M0EA 4JUIA 5JFOA 2QM7A 3MAAC 2XE7A 1KEZA 5FF9A 1EFRA 4ZXPA 2YOGA 1E8DA 3BX1A 2BGGA 5G4LA 1RLOA 3DW1X 1H0SA 1NAHA 2SNIE 2J59A 1YZ3A 1QYRA 1NPDA 3H9BA 3KO8A 5DI3B 4BYMA 5K0CA 3WLNA 2CLEB 2CUTA 5EIXA 1QRTA 3HGMA 3HYNA 4JS0A 2ORVA 1XA0A 1N7JA 5AVOA 1UWVA 1NM5C 3HXQA 3ICWA 3LUKA 1YMVA 4IJUA 2PZ8A 2ZLBA 3H8SA 2NZXA 4EW3A 1AMUA 3T3EA 3KRTA 3ZGZA 4OK3A 5K9ZA 1BVHA 5C1PA 4IDGA 3DL2A 1HDCA 3UJ3X 3DL4A 1E79A 4OLHA 2M6KA 3EDYA 2OVFA 2IEAA 5U4XA 3HDJA 5F9FA 4ARZA 4C05A 2NU7B 3DXYA 1T9BA 1PX2A 1U0TA 1Z0UA 2F59A 3AWIA 4H6WA 3K2QA 5F64A 1HDZA 5BRAA 2PUEA 2IPNA 1V3QE 5CJPA 1KWKA 4A8PA 3IKJA 1ISFA 3STWA 1GD1O 1K88A 2Q3JA 1QYVA 4PZEA 3KQWA 2WJVA 1DQPA 1QS0B 3C5HA 1FY2A 1B0ZA 2PHZA 3NBFA 4R8KA 2CNWD 3FBWA 5IASA 4RCZA 3ZLJA 1L5RA 1N6OA 3JQ7A 3GFSA 3TVDA 2XYRA 3BKXA 5CM2Z 3O21A 2LVBA 4CEIB 3RRNA 3AFGA 1I4OA 2HB6A 4FZVA 5INTA 1PJQA 3LQRA 2JGMA 2P2NA 3LXXA 2OXTA 3G2MA 3ZV5A 2UDPA 4IVNA 5BOVA 2OPHA 4E2FA 4QT0A 3Q15C 4Q4HB 3QVSA 1VXRA 2C5BA 5FJIA 4KXVA 4P0TA 4MI3A 1US8A 2E4AA 2BGNA 2ES4A 2R3SA 1PQPA 1RS0A 2P7IA 2YV3A 3CPSA 1QPGA 3PGMA 4OQZA 5GJCA 3UK2A 1D2GA 2OD9A 4HS4A 4PYQA 3O8CA 2QRJA 2W0MA 3KYDB 2R7NA 1USIA 4PRLA 3VJKA 5GZ3A 2HF9A 5HYVA 1AV6A 1XKXA 2BE7A 1PFKA 2N75A 4X61A 3ZVNA 2ZCVA 3EEFA 4BASA 2A14A 3IUJA 1UKEA 1PW7A 3HWSA 3ZWMA 4ZGWA 1QV7A 4NBUA 5CFLA 5KTTA 3O6VA 1M1YB 2I6XA 3I6YA 1PR4A 4P3KA 2PS3A 3O0TA 4Y9TA 4HVCA 1P5JA 4PO9A 4HDAA 1ORWA 3ZBPA 2OT3B 1C9DB 3SM9A 1NJGA 1M8GA 1YDFA 1J7KA 1HQKA 3CUTA 3P97A 4QBTA 3C6YA 4QT4A 3OKCA 4KIJA 1MB0A 1CQIA 3H9QA 1W0KA 5EKDA 1KDZA 3TZQA 3W8RA 5JTUA 1Q7EA 2Q2QA 4GR4A 1O0BA 2B4AA 5C81A 3HUEA 4V0RA 4YCAA 2HNAA 2O2SA 3MCVA 3VVBA 3NRBA 2GETA 2IXFA 2YWHA 3CEHA 3FKQA 1LK7A 4U7WA 3HXOA 1J5EB 5CB6A 1I6WA 2G7ZA 4Q0MA 1CQZA 5E3HA 4YJ3F 1JSRA 4MW5A 3B3AA 3HJFA 3QEOA 3I58A 4DA9A 3A04A 1GRNA 1E6CA 1KI6A 3UFXA 3WKCA 4QQNA 3WY9A 4ESHA 1P4HA 2C5LA 1MF7A 1I0IA 2DH6A 2GCPA 3PITA 1ZC3A 3THYA 3FLMA 3NYWA 4KSBA 4L78A 4XEHA 2JGAA 1DEAA 1N9ZA 1K63A 2O1EA 3DTVB 3VYUB 3U19A 4HNTA 3LT4A 1XA3A 2MSNA 2OG1A 4TYMA 4JXJA 1WSDA 2OUKA 1L7BA 1J8QA 3HS3A 4HGQA 5CRIA 2AMVA 3RS9A 2UYHA 3G0BA 1PGQA 4P3YA 1UXJA 2HUPA 3W5DA 1QHYA 4YI5A 1IHPA 1OHHA 1Y33E 5B1HA 4QVIA 1GNSA 4CM8B 3UG7A 5K3EA 1XTPA 1YBMA 3L6CA 1LTKA 4AZ0A 2QQFA 3EZNA 4L9WA 1E66A 5GONA 2R44A 1EZZA 1KI2A 4MS4A 2IU0A 2C2HA 3AR4A 4XGRA 4Q9DA 3HVIA 1KGSA 3TLBA 1QHSA 2I6GA 4ER0A 3GG2A 1XNHA 3E7DA 3NVAA 4A6PA 1GFWA 1T6XA 3TLYA 2XECA 4JLOA 2ZTSA 5FNZA 3RS7A 3WDLA 3FCCA 4RCYA 3HXTA 2NZYA 4V3BA 3ZUPA 4EG7A 4X7PA 1JQEA 1L4GA 2QRZA 3LP5A 4O4HA 4EI9A 1VKOA 1TJ5A 3TFOA 2J6IA 3OPNA 2XDQB 2P5YA 2UYQA 1C3JA 4L9AA 2XXJA 5IU6A 5FOXA 1DKMA 3MBOA 5FL7D 4BMOB 5KZMB 4TSFD 1I13A 1X7ZA 4WSOA 1Y4ZA 3LLSA 2H1CA 2DERA 1Z83A 1HOXA 1P1CA 1BDJA 2J09A 1U81A 5ILQA 5LZ7A 3JV7A 4URXR 3QUQA 2QUHA 2HF2A 4KQXA 1VL5A 4MDHA 1JHDA 2E6KA 1ECPA 4OHWA 2BFAA 2X4IA 4C0XA 2FWBA 3ENVA 3PUIA 3RF6A 1OWPA 2J87A 5KDOA 2FB9A 2OCBA 4D0RA 5DN9A 1K0FA 3D7KA 3QVGB 1I8TA 2BFBB 5EUCA 5D6NA 2P2YA 1XK7A 1KJIA 3ROXA 2FMXA 2FOXA 4NMLA 1NN5A 5CU7A 4D8UA 4JUCA 3QHQA 4YROA 3B36A 4NYMQ 1GUDA 1JU9A 5F23A 4LPKA 5CPFA 3LIIA 5L3RA 1DKUA 3PDJA 2E87A 2ZTVA 3U48A 2ZJ5A 3OAAA 2R6AA 1ONBA 3NYRA 4AUNA 3OP1A 2WG2A 3L7DA 3QFCA 4JI0B 3CLTC 5KJ1A 1TT5A 3RHFA 1GQYA 1J21A 2JIMA 2HXSA 6Q21A 4RK7A 4NCJA 3V1NA 2C84A 1PYDA 2WHEA 1Z3CA 3SF8A 5JECA 2WW8A 3TL6A 4DEVA 2C8JA 4JYCA 1V95A 1F5SA 1TCUA 2QN7A 4HLCA 3IP1A 4QE3A 2EX1A 4RY9A 1T36B 2AJCA 4DG9A 2HPHA 5L3QB 1GGNA 3ZC3A 4BU0A 3JPWA 4PO8A 4W8HA 3DOFA 1PAUA 5ALNA 1JBEA 3ZIAA 3W4KA 4A0QA 2I2FA 1UH5A 3IQWA 2ONCA 2VHTA 2CKMA 3JQAA 2YZ2A 3QU4A 1MVNA 1KDRA 2VS1A 1G21B 1Z74A 4FGWA 2UVPB 4ND8A 4QOIA 1XELA 1CQWA 2HK6A 5M34A 3LFTA 3SYNA 1QF9A 1SD1A 1W0JD 4IRUB 1EFKA 1S89A 4PYOA 3TLXA 4CLOA 2BE9A 4GRDA 5EI5A 2W8BA 4C4ZA 1RZRD 4B3IA 2DFNA 3O8OA 1TYBE 4IIJA 1PE0A 1PFGA 1XKTA 1SHJA 5EEGA 2Y6VA 3T1QA 4DR4B 1TAGA 1E6EA 1Z8HA 3LQQA 4PSUA 3F9IA 2N46A 3FZYA 3U6KA 4J9VA 4PN7A 3W5VA 2F9LA 1UJMA 5EJMA 4JBWA 2JFQA 4FE3A 4A8JB 1NUQA 3ZEIA 4DNXA 3VO8A 5NULA 2Z2KA 1J97A 1IJFA 3M6UA 1Z5PA 4QVGA 4RPKA 4CFSA 4Z9FA 3ADBA 3LXRA 4F72A 4BWYA 4DPMA 3WGJA 2H9IA 3ASYA 1OLSA 1WU8A 2BM8A 3EUFA 1NKTA 3K0EA 4KB5A 1CUXA 1QRRA 4FJ0A 2VUTA 2G72A 2O05A 2Y2VA 3K4QA 3K7EA 4N65A 4RGVA 4UBIA 4K9SA 2VUUA 3R5KA 1FSFA 2G67A 1QQBA 4GBMA 2PT6A 2Y4OA 2YOFA 2FVYA 4EHHA 1J39A 1TW3A 2XCLA 4BXOB 3ORQA 4TVSA 3K09C 5EXPA 1E6WA 2ZFUA 3HKEB 1R64A 4JC8A 3DBIA 1RWPA 2DHRA 4Q39A 4X1KB 1V3UA 3W0LB 1AF4A 1NAIA 2PUBA 5DYTA 4QPJC 2PUGA 1QYDA 2X8WA 1VP9A 1VIYA 5BYBA 5L45A 4MJ7A 1NF8A 2J7PD 5LU9A 3ADCA 3PKIA 2J3JA 4AM8A 5AVWA 1VXOA 1L4NA 1E2GA 3HN7A 1P8AA 1WRBA 2QD2A 4GYJA 3KPJA 2ZVQX 4O2BA 3TE6A 4O4IB 3UYKA 2WHPB 3VH1A 2Y9PB 3DWEX 4K8OA 5JS1A 4X93A 1BS1A 1HKUA 3DDSA 3P32A 1FP2A 3TQQA 5HK9A 5K99A 4G3XA 4CYMA 1AOXA 3B7PA 4YN3A 1V45E 2QGNA 1LSSA 4OF4A 4JVOA 3ZUGA 1Z7WA 5C3MA 2H6EA 3PHCA 1AQLA 3HYCA 4HK4A 4KMSA 2WC1A 4TLEA 3A70A 1NT2A 4CG0A 4EEXA 4L8YA 5H7XA 4MO9A 1QP0A 5HF5A 4BNWA 1LPAB 2BVNA 2I6QA 1CRWG 4BUCA 4TYQA 1G60A 3ZVLA 3E58A 3WO1A 3RH0A 5ITSA 5HF8A 4FXOA 4IRMA 2FEMA 3WRWA 1N77A 5DTIA 1NC3A 1PTJC 1FA9A 3H3FA 4IHJA 5G4KB 3KKMA 2EU8A 3C97A 3UW1A 4Z7NB 1IZZA 1Z26A 1QORA 3HU3A 3P4UA 3PQDA 3ZD9A 2GBLA 2JZNA 1E2KA 1BVRA 2RGNC 3LW7A 2VP2A 3WLTA 2CK3A 4Q66C 1UBEA 1PJLA 5C52B 1EZ1A 1FK8A 2ZB8A 3WHLA 4NZMA 4JCCA 3RSGA 3AF4A 1C7QA 4LCJA 4X64B 2JKZA 3KTAB 1B16A 2CXTA 2KPOA 3HUTA 4Y1RB 3UY4A 4DZZA 4RA9B 3PICA 3VX3A 1C3VA 2DPMA 1P7CA 1IZ8A 4UU8A 5KKCA 1EVJA 5DHPA 1XWIA 3W9BA 1XF9A 3CKLA 1HG0A 2W71A 2QVXX 2WKSA 2X8LA 3TTTA 1L7OA 4LAFA 4ZCSA 3C6KA 4NK5A 2PV0A 3QENA 4ZYUA 2VOEA 3HN6A 3VUEA 2AS0A 1GSIA 4PW0A 4KDEA 4ZICA 2CC2A 3OMLA 1I1QB 4RWZA 3CUKA 1KAHA 3DKIA 4WERA 3ETLA 3R8XA 3IAEA 2D1TA 4P08A 5KYTA 1GAXA 3ILXA 1RQRA 2P67A 1PK8A 1MNQA 4RA6B 1KI9A 2G5CA 2M32A 2HMTA 2V7QD 3AJEA 3STXA 4DC9A 1YR1A 1FFAA 1JFFA 2EARA 4DS3A 4H4EA 5C1IA 3ZHSA 3K8YA 2E4WA 1UC9A 3G0HA 4L0MA 1QKJA 4LJ7A 3D0OA 3DUWA 4J0GA 4UTXA 3S2ZA 3HY3A 4UVDA 1KJJA 1ESNA 4KHZA 4ZMSA 2RHDA 2ECPA 3WL6A 1KQFA 3GJQA 1YBAA 5E2IA 1BMFA 1W52X 3GNSA 1KZGB 3OZIA 4AYXA 3FI0A 2ERCA 5J4VA 1QB8A 2WWFA 2HUNA 4A10A 4ALMA 1BVUA 2WHQA 1EQUA 1CERA 3OEYA 4AMYA 3VO9A 3DTYA 5BT8A 2QRNA 4MPDA 1GUBA 2XTAA 2ZYIA 4E11A 1P2DA 2YFQA 5ALLA 4ZT3A 1FNBA 2CSUA 1HFWA 2C3PA 1GTSA 2EV9A 3FKSD 1DJOA 2B7LA 1O8BA 1O94D 2G80A 2WJ3A 4QPZA 2RHWA 3TK1A 2QV7A 4PIPA 2LCIA 5EHZA 3JVVA 1Y3HA 2NUTA 5CDGA 2XB9A 4MR9B 4E5VA 2P6NA 3SYRA 1DOZA 4CKEB 3IOCA 3R7DA 3MWJA 3V7FA 3UHAA 1D1SA 4IH4A 4CM4A 5AW2A 3KEOA 5K1ZA 1L5SA 5I7RA 2V0NA 3CUUA 1H1DA 1ZOOA 2Y1XA 1R9MA 3RYHB 5AJUA 3AL3A 3LTEA 5IZCA 4BFWA 4WXPA 1NYRA 3A6PC 2R751 3K30A 1HT2E 2CL0X 3B8HA 3H4VA 4MQFA 4BKQA 1WUJS 3QXCA 3Q11A 1G3QA 3R3ZA 3GLSA 3LDGA 3SDZA 2ATVA 2NZUG 3WBJA 5DEIA 3MJFA 1M2FA 3U4IA 1M8KA 1XZDA 4PLCA 2ZM6B 4NNJA 4DLYA 3D54D 4F3TA 2O19A 1E2MA 3KELA 2QN9A 5DNVA 3LUCA 1GPYA 4FN5A 4QJ5A 1UOQA 2GEBA 5AI0A 5FNVF 3SZUA 4DLRA 3GEDA 5JOQA 3H86A 4BZWA 4DY6A 2PU5A 2PCJA 2DPHA 2OBXA 4I1SA 5LYJB 2IX9A 3ET4A 3CA8A 4J16A 4IIYA 3GLIE 5TGZA 5GGYA 5BN4A 3AZQA 4DUPA 3Q0TA 1XZJA 4YMSA 3OECA 3R9WA 1H0KA 1UZAA 3CKYA 3PU6A 1ZC4A 4IZHA 3OEHA 5AKHA 3IQGX 3RRBA 5HW0A 3PRHA 3O1IC 4JX9A 3KJNA 4MMZB 1II9A 2WUVA 1ZDMA 5HR5A 3UICA 1BWPA 1F48A 4NBTA 3U9LA 3QW2A 1TK2A 3OP4A 4GP7A 3CSUA 5A0VA 3ZHTA 1KMHA 2FA9A 1NW9B 4URHA 1G3MA 2LIVA 2ODWA 5CP8A 1FRQA 4Z4IA 5ALTA 1VJ5A 3CX6A 4YMWA 4Y2JA 1G7RA 1P33A 1QONA 2M1ZA 3I0ZA 3IQXA 3SKVA 4ZAXA 2Q5CA 4IVPA 4R2XA 4WL0A 4RPJA 1AS2A 2Y1GA 4HQKA 1UQRA 2GF2A 4ZAVA 4F38A 1JEYA 4FUQA 3QPUA 3GAZA 3MQ4A 2ST1A 3QKTA 1F2DA 4PCUA 2QNRA 1UEIA 2H51A 2ZWAA 2NSHA 3K9BA 3RWMB 3VXKA 3X44A 2PMWB 3CONA 4HXGA 1KK3A 4YJKA 3RM3A 4CODB 1T2EA 4JLSA 4TZ6A 1NR5A 4N9QA 1VCIA 3A7EA 1HV8A 2IYNA 1PJTA 3BERA 4D0NA 3ZQ4A 4Q24A 1N2CA 3OHSX 3PP8A 3TDKA 3CO0S 1CY7A 1YS2X 2C2ZA 2KWIA 1HM5A 4M9XA 1LBSA 2ZJ3A 1GUFA 2CE2X 2Q6KA 1QOQB 3EZ7A 4R1MA 5H70A 4GL2A 1GPDG 2JANA 4KGVA 4PFKA 4JKIA 3P19A 1URPA 3OTOB 1EDOA 1V8OA 4I3FA 3ZW9A 3QEBZ 2VAWA 2DLDA 3Q88A 4JP3A 4MPJA 3SMVA 2NSDA 4B4VA 4DCCA 1JLHA 3CRQA 4CU5A 2I6TA 1A9QA 1V7QA 1RTKA 1XZGA 1DTWA 2FE1A 4FN4A 3U80A 1SUFA 2ZETA 2WT9A 4ND6A 3T9EA 2A1TR 3ZY4A 4BWGA 4N54A 1TQ6A 2AVDA 1D5WA 1MX5A 1SB9A 1UXHA 2VHWA 4EO7A 4F4JA 4RHYA 1TM1E 4AJLA 2IYPA 5GVRA 3X2FA 2V6JA 2H1LA 1IZYA 5JPIA 3HUDA 2BP7B 2RK6A 1F2UA 2QLLA 4PYRA 3NHSA 4Z0NA 3RBXA 4BJ1A 1P0CA 2GEJA 1H2AS 2P6MA 1KNQA 4L8LA 4KDCA 1SZDA 3HY6A 2WFMA 5BMVF 3MRSA 4WK4B 3DFMA 3ZI7A 3RLFA 1G6OA 2QUAA 2OD2A 3HA3A 1MRNA 2QAIA 1WS6A 3W1EA 5LWQA 5CFNA 1QVVA 4LRSB 1MU0A 2O8DA 5A6SA 2Y0BA 2RHBA 1TLLA 1P9OA 1KQNA 3WWYA 1NJ5A 3RB8A 5JROA 1QGAA 3LRXA 4AROA 2X2FA 3LWBA 1JYEA 4MV6A 4U2DA 5ICSA 1O95D 3I32A 4YJ2A 5FXMA 2AZXA 4BB6A 3WHPA 3A58B 1EE2A 3ENNA 1HL3A 2PKWA 2XBLA 1UK9A 1QPBA 4QG3A 1TA4A 3BIJA 2QTVB 3AG5A 3NDJA 5I5EA 2ZS7A 2ZTLA 1M6NA 1MAVA 3OHMA 2CVHA 4DILA 5FBZA 1SHTX 2ONKA 3LLVA 4BJ5A 4PZDA 4Q1DA 2CHFA 4EHJA 2VWHA 2I6UA 5FBVB 3O8BA 4H7DA 4HGYA 4ENSA 3H2BA 3I0MA 1Y8ZA 1VHJA 3K8QA 1JDBC 3ESRA 3PD7A 1QP8A 2JD2A 2I7DA 4BZXA 4DJJA 5F7JA 1ZXXA 3FNFA 5EZYB 4R3UC 4WKBA 2QTGA 5FUMA 3KOWA 3INNA 3VSBA 1F0YA 2G3YA 3KZXA 5C80A 2H2DA 1MJNA 4FYMA 3USES 1IH8A 1K6MA 3NKLA 5CFZA 4EPXA 4YUAA 2VF7A 4KXUA 1EXVA 3IV7A 3HI6A 3MXOA 1QVWA 4U2GA 3UW3A 3GG9A 4LDQA 6NULA 3VZSA 4UAJA 2VVTA 2WPDD 1W88A 3D3KA 3EXHA 3K70D 2PUWA 2V7VA 4OV6B 4YUXA 1VRWA 3CW8X 5JHHB 2BSQA 1A04A 2BGIA 3BPSA 2BGMA 2FPGA 3HP4A 3D8BA 2ONJA 5C5IA 5IS2A 3QK7A 2IH2A 2QRLA 2PD3A 1DQRA 2ACKA 1FTYA 2FF7A 4UNNA 4C6TA 3NH9A 5H02A 4MW6A 1T0HB 3PCTA 3TLMA 2IF2A 5LP1A 5JYDA 2N1BA 3B3FA 4YJHA 4INPA 1ONOA 4MEBA 2JZOA 4QXQA 3H1FA 1DU4A 1OA0A 4YCNA 2WAYA 4RPGA 5HM8A 2CXHA 3VZRA 1QH9A 4CLXA 4W7HA 4JB8A 2HSZA 2XMPA 1H5QA 4FTWA 5FUVA 2QPOA 1EA7A 2EGHA 4LGCA 1FFWA 2OENG 1F7UA 1OFIA 3FDZB 1POXA 1IOVA 3ABQB 3OLCX 4JOBA 1K6XA 3MQ2A 1KE1A 4IM7A 3MT8A 2VHUA 4GZMA 3UT5A 1PNRA 5DJ5A 1THGA 4OSPA 5FLXA 4KVFA 1E5QA 1JECA 4U8GA 1OYVA 2VNSA 5A3RA 3FTCA 2VJOA 3ODGA 4NTZA 3STVA 2NP6A 3BKWA 3C3AA 1ZMRA 3PNLA 1PEDA 1EE9A 1AZTA 1ZOSA 3CISA 2IF0A 4NS4A 1N6IA 5HE8A 4O02B 2DSTA 3RO7A 5CAEA 1M2OB 4CDMA 3U13A 1US8B 3FKJA 1JVSA 4BNUA 2JLXA 3K5HA 3MXTA 5CYFA 1U8UA 2J3KA 1ZD8A 2Y1EA 4MAAA 4HGPA 1TU3A 4A0GA 1ADBA 4AI6A 1U4SA 3KQYA 3QTLA 2PQ2A 5BYKA 4A5OA 4OA5A 2J31A 4DJ5X 3EFOB 1RWBA 1TF2A 2VSOA 3UWOA 2JFUA 1QZTA 5EHXA 1SKBA 1COWA 1MORA 2P9CA 2YNMD 3P2YA 4YV1A 1N9GA 2E4VA 1W85A 1ODCA 2C83A 1XHEA 4LQCA 3JYHA 2EIXA 4TMWA 3N7AA 5TPZA 1QBGA 4LYAA 3UAOA 1ZIOA 2GZ2A 2OXIA 1U02A 4XFDA 3X1MA 2HU8A 1V1MA 2B37A 1QXSA 3JQFA 1A2KC 1ZJ6A 3H2KA 4I1YA 4RLHA 4V2UA 3HR4A 4DF3A 2C1EA 3L6BA 4PRYA 3GPBA 2OZLB 3WGUA 4BVAA 3FGNA 3TLGA 3ZWXA 3BWVA 5T3YA 2HQBA 4FWIB 2JK0A 1UP4A 3H05A 3NUQA 3RHTA 5A5GA 4TX1A 5CIYA 3LBFA 3ECSA 4RF2A 4US0R 1BFDA 2HBYA 3U9TA 1QFSA 3C85A 3SIPA 2RI1A 2XSZD 3W6PA 4D82A 4YAWA 3WGVA 4PG8A 1Y6ZA 3QPAA 1UC4B 1REQA 3TBHA 3Q3VA 4V39A 1QU3A 3CRZA 4D81A 4ZO9A 1YE3A 5LMCA 3ITDA 3TW6A 1N7IA 1GQSA 4JD5A 3THWA 2I3AA 4NSNA 3GGDA 1VSUA 2VK2A 4U7PB 3TSWA 3BCHA 4EJ6A 5BSEA 3AL0C 3AERA 4F04A 3PRYA 5GAJA 3SX4A 4Q4CA 1UQTA 3KKOA 4UVGA 1ABEA 2Q6OA 3UGKA 5B64A 3TQFA 4GAEA 3TUJC 1RBMA 1M2GA 4HSEA 3BCUA 4MI6A 1UMCA 1Y1RA 4RHXA 3OFND 2J5XA 3D8UA 2F67A 3O3OB 3BMNB 3TNDA 3WGGA 4D4IA 3AUXA 5AW4A 3UN1A 4BTLA 3IRVA 1E6UA 5F5LA 4OB7A 1C14A 3B3QA 1KI7A 3AEQB 5C8VA 4O4HB 4AC9A 3C3XA 1MHTA 2QSUA 1GGJA 4BFCA 2AXNA 3D8TA 1HI9A 1Q0HA 3HE3A 4ZRMA 4QPDA 4RFSB 5B1DA 4E5MA 3JD2A 1WR8A 5EFZA 3E9NA 1HE3A 4RY0A 4BNVA 3TBKA 5HUQA 3FVVA 3EVZA 3TAUA 2VR1A 2VATA 2GERA 4JLBA 3AM1A 3GRUA 3TZKA 4YYZA 2DPLA 4DV5B 4LC1A 1VIAA 1YZQA 4H0CA 4Q37A 4G2NA 3M1AA 4G63A 3BMCA 4LC9A 3ETDA 4MKGA 3SOPA 2I3DA 2H4FA 1VKJA 2BY4A 5TVKA 4GPTA 5KNDA 1LQUA 3DZBA 4LHXA 5DLEA 3HKCA 2YRFA 4L7VA 4F97A 5JDCA 1VPWA 4E21A 2HTEA 2EW2A 2FMTA 1WW3A 3D6TB 3FG9A 2WQ7A 4ZJYA 1DS6A 4XOUA 1XI2A 4OU4A 4MB2A 3VC1A 2VAVA 4NZ9A 5EIFA 1WCV1 5DNEA 4GLJA 3K0FA 4P86A 5FOSA 3NTOA 1QX3A 3COWA 3S70A 1H2WA 2A0WA 2FGJA 3NDRA 4D4MA 4MVJG 1DTSA 1NMSA 4K46A 2GN6A 5DHAA 1V6AA 4KPYA 3SAJA 3N87A 1YMUA 1K75A 2EG5A 3JYPA 4B3HA 2JBWA 4ROTA 3AIIA 4S1PA 4TPKA 1W19A 2FK7A 3WLIA 4EY4A 2GCEA 4MGEA 4MA4A 4NYIR 1GPNA 2IE0A 4C29A 3KWFA 3PNKA 1I2BA 1ZIYA 3OA2A 5K0NA 1GSOA 1LDBA 3P20A 4W9NA 2O1XA 3KJZA 1KZ9A 5EPOA 4UVHA 5ILGA 2ZUFA 4GXQA 1KYTA 5SZKB 1UJBA 3A6DA 1DELA 3WJ7A 4EUEA 4UJ3A 2ZXFA 3NTVA 2ZUSA 4DQVA 1C8KA 1U0GA 1G5FA 2GARA 2E55A 3CUEF 3NHFA 4JBIA 1JFVA 4UC0A 5KHAA 1KFCB 1OASA 1T0BA 1J1UA 3BDIA 3FLAA 4AY4A 3EGVA 5J4LA 4Q9KA 5PNTA 2GUGA 3JARA 1YASA 4CLOB 3A6JA 2JLCA 4A36A 5FD8A 3GCGA 3MG9A 3N1UA 1ULBA 3F98A 5TARA 4F21A 3O8OB 3AF6A 1T0JB 1E3JA 3EODA 3N3BC 4DLPA 2CMKA 4K9RA 5BNZA 2JLVA 4YRRA 2O54A 5EZQA 5I7EA 2MYTA 3JATA 2GDZA 4Z9AA 2VPWA 5EXEA 1ZUD1 5L4NA 1G5PA 4UCQA 2IEYA 1NKSA 4MPRA 2ZR0A 3ZWNA 1P5HA 2BBSA 4DCTA 2QTZA 4X8OA 2VTVA 2Q6IA 2WINI 3KZCA 5I5GA 3ZNQA 5JD5A 1MA3A 2W4QA 2XJ9A 3I1YA 3H0KA 4P3PA 1UK7A 4B4DA 1JSZA 3GLFB 4O2RA 1EJ6A 4KHPB 1Z4PX 3OUUA 2X0JA 1YA4A 2ZT8A 2JI7A 1EYZA 3RFCA 4MR7B 2RG1A 3EEBA 1IY9A 3T4EA 4UFOA 4F4FA 4ALNA 2WUEA 4TXNA 2YBEA 4MIEA 2D5AA 2JI4A 3HDYA 3N2ZB 4ZT5A 2CT8A 1RAGA 4ZA2A 4UUQA 4DTCA 2CDAA 4BLSA 4O0LA 1FP4A 3G49A 4Q4JB 4U5XA 4UAVA 3OESA 2PD6A 4WQMA 5KQRA 1YQ9A 4TROA 4UUAA 3RUAA 4NBSA 3MGAA 4GO1A 2YICA 2EFJA 1E6LA 2B4QA 2PL1A 1J20A 2HHCA 1OTXA 3WSVA 3FNRA 4WLOA 4YJFA 5AW3A 1BA3A 1YHZA 2CLMB 3PE6A 4ZU1X 1C41A 2MDTA 3DD5A 2LBPA 4DNPA 1DEKA 5CA1B 4AU1A 1NDQA 1ZIDA 1FRZA 3WMRA 3GFRA 5DDIP 1LEHA 1SCDA 5TMPA 1ZKMA 2ZIVB 3HBNA 1BU8A 2BHNA 3ZBUA 1ZX1A 2CFCA 1CHNA 1Z0SA 2RGXA 5A4KA 2XT0A 3ENWA 4OTZA 2QZ9A 3WDMA 1A27A 4AWXA 1JJAA 1R10A 3R0QA 4B09A 2GVDC 4NFHA 4Q34A 1TD9A 4YFVA 2GZMA 2XCQA 4GMXA 3IXMA 3GUHA 2EEZA 1Y1KE 5JXHA 1IHYA 2B8EA 1WXIA 1XTQA 2PUVA 1A9XB 1LLFA 1O9HA 1RZ3A 3RASA 1EK1A 1JU4A 5LD2C 4AKSA 4G01B 1WXFA 4R1OA 5JVDB 1KU0A 3C3KA 3PPWA 3Q85A 1N1GA 1HY3A 3DVQX 3QXSA 2PBRA 2ZRCA 4JA0A 4JQYA 2X15A 3CLVA 4I55B 1EB8A 3E3MA 4LHWA 5K51A 4NEHB 4DFDA 2G5TA 3D0QA 4KITB 1U9IC 3OT5A 4WD3A 1V35A 4PX3A 5DBGA 2ZIWB 1OX5A 4HB4A 4QYTA 5CDSA 1QH0A 1TQ8A 1LX6A 3OQHA 4HLUC 1DX4A 3PQ4A 3GUVA 5TQ2B 3P9PA 1YI1A 3LPCA 3IT3A 3DEZA 1M8PA 1JVNA 3CVYA 1M6VB 3AR7A 1N2HA 3PC6A 4RZSA 5EQTA 5LZ2A 1U1FA 4J03A 4DMRA 3AJ9A 1U3UA 1ZW6A 4P92A 1T4GA 1YJ8A 2GO7A 4P7BA 2GF0A 5FI1B 1C2TA 2DFDA 2RBGA 3IXQA 4B2LA 4KLRA 4C3ZA 1ILEA 4FD3A 1K27A 2UZIR 4V0SA 4UHCA 4CM9D 4F2GA 3A6EA 4Q7EA 1HTWA 4HNQA 5IEBA 4R6WA 4JXKA 3ZWAA 2D1QA 2NVUA 1P45A 3W2IA 4XVUA 1QKKA 3JQRA 2ZT6A 3TDNA 5EY5B 3A1WA 3JQ9A 1Q7RA 2OGWA 3TE7A 4B6PA 1Y5NA 2Q9AA 2Q8PA 1ESZA 1DBPA 4A0SA 2WE8A 1U1GA 2D0PB 2V4UA 1PT8A 1W47A 4RIHA 4G0MA 1H05A 4QREA 1KY5A 5DN6A 2WTEA 1AUPA 3VYRB 1JHUA 2VNHA 4J9UE 1JAZA 2J9ZB 5JC8A 2IIVA 3BIXA 5GV8A 4F6CA 1UR5A 3QXGA 5ADWA 1T5SA 5GJWC 2H1IA 4H7JA 5I8ZA 3OJEA 1EAMA 3FRHA 3Q7IA 2VDVE 4FIDA 1GL6A 1V1RA 2C5GA 1YS1X 2D1SA 2Z1MA 3GAMA 3OH8A 3VR2A 4DSNA 5JSHA 5L95A 1KVTA 4B6EA 4BMDA 1D1QA 3GBPA 3MWDB 2CCKA 2GFQA 2YYSA 3LXMA 3EXFB 2EZTA 4LFBB 3WB1A 3T1NA 3CB2A 4Q4DA 2MSLA 4X54A 2FWJA 2VBCA 4A2WA 2AFIB 3BJRA 5KQLA 1JR6A 1T1JA 3G85A 4FEEA 5D00A 4IEEA 1PK7A 1RQGA 3C8ZA 4IO1A 1DPGA 4RVFA 3ASZA 2VYNA 3HNOA 1VFNA 4KYIB 4DXHA 2QHXA 2FX3A 2WJGA 3I0NA 4OHMA 4G0ZA 4HFNA 4A8TA 5HXAA 3M82A 3H3JA 4DB2A 1S7CA 2XVZA 1G5QA 3GFTA 3CWZA 5DTEA 3HO8A 4C4PA 5DWQA 3U16A 1EXWA 4R0NA 4EHDA 3NVDA 5G0WA 3ZHCA 1ULUA 4XD7D 3F7OA 4IV8A 3JVIA 3A6HA 5DTRA 1QQ6A 3EXEA 4K3UA 1NMZA 3PPIA 4DMMA 3CZ9A 2CXNA 4OAPA 2EJTA 1VBFA 1XWWA 2F43B 2GRUA 1DWQA 5T57A 2OXCA 5B5SA 2BMDA 2JH3A 5EE9A 4E4YA 2C20A 3F7MA 4DRXB 3AFMA 3WNDA 1USGA 2GYVA 4OJTA 2E7ZA 3QSGA 4R1QA 1EPUA 2VJAA 3DMFA 4I5FA 5B3KA 4B44A 4D96A 3L7AA 1FMLA 4E08A 1MV8A 2PBLA 3PX2A 2IYEA 3ROTA 1UKZA 5AM1A 1UP6A 1YDMA 3PDWA 3PYLA 3FPEA 4G5XA 4LJ9A 3EGCA 1POWA 5BN3B 1VFPA 1Z12A 1IIBA 4NPHA 5I7VA 4QASA 4D02A 3N76A 1SOAA 3HWX1 3L79A 3WNZA 3KBOA 4AJNA 4X95A 5IK2A 3R75A 2AFHA 4H18A 3KR1A 1CF9A 3GUUA 5IC4A 4ND5A 4HF7A 2OB1A 2AOUA 1Q57A 4JLDA 4KDRA 1W5SA 3Q9NA 5KWJA 5E9JA 3UMJA 1ZVKA 3TOSA 3U7FB 2AZTA 1Z4QA 3HA2A 4H60A 1BN6A 1S2OA 4UZFA 1P60A 2DUNA 2XQJA 4PHHA 3TNYA 1L7PA 2E3JA 3CG0A 1ZVVA 1L7MA 5D51S 2F3TA 1Z2EA 5BV8A 1XF1A 3HCDA 3LHKA 2ODEA 2YR0A 3OKPA 4WFQA 3DAFA 4K86A 2AK3A 2HA0A 3EC1A 4HH0A 2F8LA 2H1FA 2IHUA 3AP3A 1YCGA 3JCZA 3UXMA 3VBEA 4IJ6A 1SO8A 1D2CA 1T3GA 1R4ZA 1OPRA 1DIHA 2OV6A 4UMEA 1QM5A 4HN4B 5DIZA 4RD3A 4ZVNA 3A28A 3WMXA 5KWSA 4HYQA 3WGLA 1NV9A 2AKAB 3GJ5A 2AG6A 1IEXA 4ARUA 1NFFA 3WRYA 3QWIA 4B3SB 2HA5A 3CN9A 2O4UX 3WWDA 4CQLA 1EMDA 3B12A 2IW1A 3QVUA 4NE9A 5HF9A 4C7VA 5AJXA 2WBLC 5KX5A 2IYQA 1U3FA 4IH1A 3FMIA 3B85A 3P52A 3DZGA 5IBCA 1M0SA 1WLYA 2W6CX 1EXDA 2B3TA 2ZZNA 1JSLA 1QHXA 4UEOA 1TEXA 5B1EA 2O7QA 1HL7A 1HZZA 4LVNA 3VPSA 3F6BX 3CZMA 3KVVA 2F1JA 1S2GA 3OIDA 4IYRA 3GGOA 4LZAA 2XB6A 2IHNA 1C7ZA 2WJPA 3GBSA 3H8VA 2YVLA 1E3SA 3A11A 4DWOA 1GGEA 2FRDA 2YCLA 4J90A 2HRQA 5EKSA 3VYSB 5EUBA 1E32A 2IIPA 4IV0A 4YJDA 1L4HA 3IC5A 3Q2KA 1TMYA 2CEKA 2PJDA 2WJ6A 3NAMA 1ELOA 2K6GA 5J3JA 1ESDA 4IOKA 4JFRA 2QU7A 3UWPA 2EZ8A 1QHIA 3A1NA 2BUAA 2PUTA 3A32A 2I7XA 1RZUA 1O5OA 1PO7A 3B6EA 1DG1G 5CEJA 5EMLA 3NM6B 2R48A 1NX9A 4FW9A 4QGHA 3NG1A 5JAQA 3K0KA 4DXDA 2X23A 1ZEJA 1KVSA 2DWCA 2UYOA 2EBUA 3EGDA 3LUHA 5M7EA 2QMUA 4YPVA 2FWIA 1GQ2A 3L49A 5EZYF 1UPUA 1V4BA 2AR9A 5IJ9A 1WMBA 2VG8A 2XT6A 4YRFA 3SYKA 2XA9A 3S2UA 5JNWA 5HOEA 2EKZA 1QHHA 2F3PA 2V7UA 4TQGA 3T52A 5C8DA 3UOWA 1LWNA 3LX6A 4NNPA 3FOZA 3JD0A 1CY1A 1EFVB 3Q8XB 3W4JA 5EP1A 3ZGXA 3HMQA 1TJNA 3ENKA 1ZS9A 4H17A 3RVPA 3WGHA 1MHPA 4RMJA 4YRTA 3WQRA 3N2KB 5FI3A 2DQSA 4ZU3A 2Q4EA 3W34A 1XAGA 1Y6RA 3W7AA 4KGXA 1NQAO 2IA5A 2W93A 3GGGA 3INGA 2ZRKA 4HVLA 4G4GA 2IZ7A 2ATEA 1XQ1A 5LA6B 1R0RE 2GMWA 3S8MA 1AQNA 1GDHA 1A76A 1V7PC 1VCHA 1H69A 1U2RA 2ATCA 4CTNA 3ZJ5A 4EKNB 2QTLA 2XUKA 3H6KA 1DINA 3PGKA 3TZHA 1M1UA 2H3EA 3WGYA 3AVQA 1L6RA 2PRKA 1FU7A 3CLSD 4FFWA 1AHIA 4F7WA 3CRRA 2H2IA 4AZTA 1CY8A 4MUAA 2WPNA 4G5OA 4HLDA 1C1DB 4J3NA 2YTZA 3VC2A 1ZJWA 2W6MA 2D7DA 1EI9A 4DDWA 4YDSA 3QA3E 2H06A 5CX4A 4W8OA 1II8A 4NHOA 4UBJA 2IWHA 1TKBA 2VF4X 3BRWD 1RCTE 2VPXA 3H2JA 4WN9B 2C4MA 1T25A 3HKDA 3AR5A 4H77A 2Q50A 4YDHB 3RC2A 4EMUA 5ICCA 4JHLA 2Z5VA 2O8BB 4DGQA 6GPBA 3RSSA 2QJWA 2CE7A 3A4IA 3T7KA 3CNHA 3GJRA 4K9MA 3R7AA 3HWRA 4FDVA 2PGLA 4E2YA 1PR6A 4NOJA 4L0CA 3IURA 1XMJA 4DM7A 4W8GA 3CT4A 3GLTA 4PAQA 3LUDA 2IPOA 3HU5A 3VU8A 4DXAA 1WG8A 1ISJA 1E18A 1NV8A 1QFZA 1RWWA 1UIRA 2W6ZA 2ECKA 1WO8A 3ET5A 3ZDEA 1KQ3A 2YRWA 4DLWA 4KBYA 1W2GA 4TZTA 621PA 3L46A 1A5AB 3UGJA 3ELBA 1S0UA 3REGA 1W9MA 5JJLA 1U0EA 1SKYB 1JI0A 1GXSA 2HJSA 1O8CA 1STOA 2YJTD 2HIAA 3AJAA 4MYCA 1WF3A 2BHRA 4A2CA 4UREA 3NPAA 1Z18A 4U3JA 2IH4A 1BU5A 1W6RA 1V11B 1VYTA 3WK8A 2VXBA 3RVBA 3B6JA 1DMRA 1Y81A 5LR6A 3FYSA 3KEMA 4HTFB 3AESA 1QFMA 1SG0A 4LBWA 4LJLA 4P0QB 4W5TA 3VSAA 4RUKA 5JEDA 1ZJ4A 3CT6A 1AS3A 3N5KA 4AFNA 2IFTA 5I3ZA 1RTTA 4XGNA 4X20A 2MCFA 3NX4A 4G4IA 1L3IA 2Y68A 4YWHA 2OCLA 2WFAA 4LXQA 3IEXA 3KD3A 1EM8A 1G7SA 1JSCA 1G3UA 3VPDA 4EATA 3AHFA 4C6HA 1N6HA 4IXNA 5JALA 3RHSA 4YX9A 2V4MA 4U9IS 2P35A 1VL6A 2XF8A 2IPXA 3A9WA 2GNAA 4F46A 3DOHA 1HURA 3FTQA 4A4DA 2GYUA 1RJGA 4I1PA 4QAQA 4CKCB 3MWLA 3EWNA 5EE5B 2WSSA 3ISJA 4LE0A 2XDYA 1GTVA 2CLKB 3A1UA 3FCXA 1NZDA 3BK7A 3BDAA 2PKQP 3CINA 4R41A 1ZUHA 3U3XA 2PJZA 1KZYC 4BN4A 1OH7A 1O4VA 3ELDA 3MJTA 3RU9A 2G1PA 3QOXA 4HS9A 2OORA 1THMA 4M38A 3OURA 2CBGA 3N9IA 1E1DA 1H85A 4M9CA 4FQ7A 4BEJA 1R6AA 1Y0BA 4D45A 2Z1DA 1E79D 1K6EA 4AJJA 5KMGA 1J23A 3VTFA 3TGPA 1NLUA 2OB2A 3FNHA 3ESYA 3ZDYB 4B5LA 3AVYA 3ZQKA 2QRPA 1LD3A 1UPXA 1D6NA 3GNTA 4M9UA 4WK0B 2H92A 5GONF 4PQYA 4UE6A 3VV2A 3WLJA 1MC4A 2PXCA 2R6CA 1X19A 3B1VA 3IPRA 3K1TA 4IXDA 1D0VA 1L8XA 4RSHA 4ARBA 2BTQB 4IH9A 2GKGA 1Z5WA 2QK4A 4NU0A 1Q0TA 3QBTA 4IJMA 1M54A 2P0YA 1N9GB 4P35A 3V4OA 3BQNB 2QSJA 3K0CA 3PHBE 1KOGA 2O7VA 3D0RA 1GPUA 5EWMB 3C39A 3T7TA 3FTNA 1VKZA 2GLXA 5KJEA 4BPRA 1ZM9A 4OJYA 1XZ8A 4O4HF 3VBCA 1OGJA 2FAXA 3ZGVA 3HXPA 2QZSA 3V4SA 1RPJA 1WVGA 2Z2IA 4KP7A 1NJSA 5F98A 1U0SY 1Y5LA 2G1UA 5DT2A 2NZVG 1WY7A 3VKVA 1H3FA 1UOPA 4K9LA 3QU5A 1SIWA 2JC3A 5KOHB 5CITA 2YRXA 3UPTA 2WIKA 4O2AB 2DT5A 4OFZA 3GT7A 3AF5A 3EHDA 4U7HA 4X60A 1CY6A 2AI2A 3G8CA 4UUPA 1BCSB 5FPPA 3B2NA 1MT0A 4PAGA 2XMSA 4CKWB 4QECA 2BFWA 1Q0QA 4GMFA 5JNVA 1P4JA 1SC4A 3PUZA 3SG0A 1FQOA 3DO5A 3QFRA 1F17A 5I7SA 2GN0A 1T13A 1VYUA 3ESQA 1NUHA 2GK3A 4OL9A 2XQKA 1W0KD 3ZEAA 3F73A 1ZITA 2X19A 3L1KA 2VP4A 3WO0A 4HQLA 1BRTA 2G07A 4DA0A 4KBGA 5D84A 4F3NA 1IWBB 1I5EA 2AWNA 1BQ4A 1F4LA 2PEYA 1P2FA 4O4LA 2I4MA 1C50A 5JSZB 2EXXA 4EB8A 2FLWA 2O8CB 1U28C 1X7HA 4DWJA 1IBSA 4JIGA 2KBEA 1L7XA 3L0CA 5LZ8A 3O03A 5IUKC 2ABWA 1JDVA 1U5CA 4M83A 3OOJA 4O8CA 1NXOA 3VHQA 4B2YA 4NICA 4L8GA 2OO5C 2QTFA 1T4CA 2G17A 4IILA 5ALQA 5THKA 4PNPA 4RTSA 1THZA 2J33A 1MO4A 4HC4A 2VFAA 2IU3A 2VIIA 3AILA 5I9TA 2HA7A 7YASA 3CXRA 3ORYA 5B57C 1USUA 3N07A 1DKPA 1HYHA 1AUOA 5JT1A 1OHHD 4RKEA 2NO9A 4E1VA 1UKCA 3MAGA 3KSAC 1EVLA 4CL2A 5ANRB 7ADHA 4ZEMA 2E4UA 2X8JA 2W7TA 1CQXA 1RR6A 1YB6A 2WJHA 2X4GA 4J6FA 4PPNA 4S12A 4L4RA 3RJ5A 2UAGA 2C98A 1M2JA 1U2DC 1S5PA 2G06A 1HDGO 1K8RA 2G71A 3HJUA 4IIEA 4L85A 4ZOCA 3SS9X 4L02A 1LPSA 2Q9CA 2Q1UA 2PX8A 4MWDA 3ZIDA 3BHMA 4GMHA 4QPPA 4OLBA 3D1JA 3LYLA 1FEZA 1KAOA 3R20A 4FSDA 2CLCX 2VBGA 1RYNA 4OHYA 3IXLA 3VU9A 1BXGB 3PRJA 1RQ2A 1SVSA 4FLFA 3EOZA 3T4UA 2V74B 2XF2A 1JBQA 1QNLA 2FDRA 2MU1A 1HRKA 1D6MA 1P61B 4JLMA 3UENA 3T1VA 2VQEB 4IOJA 4K9NA 4PG7A 3TX6A 5JSKA 4ZI7B 3HBJA 3JPYA 3GXBA 2YY7A 4MRSA 4KQGA 3HNRA 3R7BA 3ROFA 3KB2A 4CMBA 5KQSA 4K9KA 2H65A 5KOJB 3H2IA 5LFAA 1HNNA 1UWCA 2RHLA 4HGZA 4JBXA 4F1JA 3NGMA 5FO0A 2PL3A 4RYLA 2DY0A 3O2QB 3B9QA 3SYLA 4HNVA 2Y4NA 3KYBA 1G41A 2JLUA 3PNQA 1XRMA 3CE6A 4HDSA 3EZLA 2CCGA 1C1XA 2FCAA 2Q5JA 3NTRA 2FSSA 3IPCA 3WYNA 5BOSB 1SWVA 3GCWA 1RXIA 3PV0A 4YT8A 3KOZA 3IKTA 3DKKA 4EP1A 4XTRA 3OE7A 2K7FA 1M2WA 4C0HA 2HSWA 1FTNA 1CK4A 4OBBA 4I50A 3ZE0B 2Y92A 4C14A 3F97A 4U7JA 1D3AA 3URMA 3KOYA 3R2JA 4B7ZA 1I0LA 4JB3A 4TT3A 2RAVA 4C4AA 5C2JB 4URWR 1OXVA 5J1SB 3FI9A 3RREA 1BGVA 1G64A 1QDEA 3VU3A 1PG5A 3KLPX 1GOTA 4HWGA 1XCLA 2E18A 2KSQA 4OUDB 4GOND 3E3OA 5AXBA 5ETJA 1IEVA 3TRKA 2OVBA 4BQRA 2VYVD 2J5BA 2ZS9A 3GQBB 4UD2A 1CR0A 1MAHA 3JZAA 4FQ5A 1T3LA 1U7WA 1WEKA 2PRSA 1XVUA 2WQZA 2BDUA 3D6FA 3L8DA 4K05A 4IXTA 4UAUA 3MMXA 3FCOA 4UHDA 1QHNA 4A0HA 4K9OA 4LJAA 3F6PA 2VDWA 5FPTA 2JHCA 4L4SA 4BFZA 4EGSA 4M9QA 4MAFA 1WNTA 3N2EA 1GR0A 3VI3B 4Q47A 4S0XA 3BGSA 3DTTA 1I7LA 3NAQA 3DLCA 4K3VA 1YDHA 1K9SA 1XVAA 3MJRA 2UUAB 2AA3A 2W2PA 1A2BA 3JQAD 3GOQA 3BTOA 2ENUA 5T3UA 3W6ZA 4BNYA 3ZDBA 1GGVA 3HYTA 4IHJF 5EMNA 4REQB 1VG1A 4EJMA 4KEAA 2OC4A 1B8NA 3KL4A 2OL4A 3RQSA 5JVDF 2VAMA 3B70A 5DKFA 2I2BA 3WV5A 1YACA 3HVHA 2IU6A 2VUIB 3B78A 1NDUA 1T9ZA 3QF4B 1WM1A 3CCFA 5DBFA 3ZQJA 4IDNA 2IBSA 3A6GA 4HOYA 4RMGA 3D8NA 4IXMA 4Q7QA 1NJ8A 3R6GA 3NKVA 1S2MA 3HA5A 3F71A 2BW0A 3OCVA 4DDTA 4PHTA 3GW8A 3ICVA 2JFNA 1MGPA 4RZ3A 1F20A 3U60B 1HO3A 4CE6A 2XR1A 4DMHA 3CNQS 1E4EB 2XI4A 4RU1A 4XR4A 2O7NA 3JSAA 1EK2A 1Z4IA 1RBZA 2H1HA 3IJRA 4DIEA 4I1OA 2V5UA 3M4ZA 4IXWA 1HE4A 1SWWA 4D9FA 2NO6A 4HLQB 1UF9A 4KODA 4NIMA 4WVLA 1XWFA 4H0NA 4HRVA 5CM9C 2NU8A 3D0KA 3UGQA 5KTNA 4FLMA 1I4WA 1DAMA 2V8OA 4CI9A 5IAKA 2B8JA 4M8IA 3WIBA 2RJ3A 4WHMA 3OQOA 3DNMA 4N0QA 5KPDA 3GVIA 1T1RA 2XMCA 3CZ4A 1NLYA 3KJIA 4JKYA 4RVDA 4I4TB 1GUYA 1W4RA 2R85A 3GEPA 3LHIA 2H0QA 5AKLA 1SKQA 4GM4A 1HOTA 4P4SA 4L72A 1JZSA 4TYPA 3TD9A 3RC9A 4WZAB 1P62B 1P1FA 1NM5A 2FEXA 3HO6A 2XTZA 3F8TA 1BCRA 2Z8XA 3P9ZA 4AG3A 4HDKB 5AMXA 2ZU0C 4NMXB 2OD7A 3PUXA 2YZGA 2C8VA 1AZLA 2H2GA 3SFTA 1Y98A 2ZUCA 1DLIA 2BV3A 3BGVA 3JD4A 3H65A 1FSPA 3QPWA 3UEOA 3ANMA 1EJBA 3TZEA 4DQKA 2ZSJA 1Z2OX 2PH7A 4RTPA 3N3AC 4XQGA 4BFSA 2A5DA 2Q4RA 4G5QA 5JZVA 2WZBA 1L4UA 1V4NA 4IS2A 2JFGA 1O6BA 2ZKLA 1GL9B 2NOAA 3AR2A 4DE5A 3H8JA 3P9RA 1JBKA 1J0DA 3IT2A 3AMVA 3V8QA 5M04A 3DCYA 2ORYA 3DV0A 1JT9A 2R7MA 4TTSA 3P0FA 1NMXA 4KTTE 1C9YA 4RK5A 1RJ9A 1HMPA 1K3TA 1XAJA 2TSYB 3RF7A 4Q93A 4TTPA 3V32A 1Z2DA 4MYHA 1WU7A 3BMQA 4ZVUA 4FMBB 1G9TA 1KBZA 1CUSA 2Z83A 2EWVA 1E64A 2R84A 3LP8A 1A1VA 5FAXA 3UMRA 1DRJA 2ZRAA 3HCAA 4HR7A 1MFPA 1XZIA 2BMAA 3C3DA 4DZRA 1N2EA 2VN8A 3GZJA 3CC8A 3S2FA 3PL1A 2A67A 4RKYA 2YJ6A 2H4XA 4D4KA 1WV0A 2XGGA 3PNYA 3WGTA 5I6DA 1J5XA 2PVPA 3PFCA 3EZFA 3GH3A 4MYSA 2BBTA 4B43A 1OCEA 1A71A 3DEJA 1FFSA 5A4JA 1X87A 4K03A 3LX4A 1C0PA 2R5NA 2V9CA 3C2QA 4HADA 4QYSA 1H8EA 5ER6A 4RQBA 4EB0A 2H57A 2GPAA 3NO4A 2FX2A 4JVNA 2QB5A 2ZSIA 5H82A 3P5BA 4KFRA 4R7TA 3EGOA 3LUGA 1N2GA 4QYWA 3WLRA 3L1UA 1T0PA 1TA0A 1YVRA 3TTSA 3D4OA 4P4GA 3KLOA 4X1YB 2OBNA 4L1KA 5DYWA 4PR0A 2NP7A 1D2NA 3NTQA 3MOSA 3NBYC 5EHGA 2FN9A 5EHIA 2HU5A 2G7MC 3IDFA 3ZDCA 2I78A 2BZ1A 4I4NA 3B53X 2IY8A 4YRLA 1BFUA 3MUOA 4KDFA 4L73A 1EX6A 2FF5A 1P1RA 5B4TA 4ZFNA 2CXRA 2I55A 1T8PA 2Q3FA 5CYPA 5AXCA 1DWUA 1G2OA 1MB4A 2JGJA 1L5QA 2BDTA 3IELA 5HDBB 2CHQA 2ZRJA 1NSYA 1ADGA 1C9KA 4D2IA 1P2TA 5LQKA 3ESXA 3DHNA 4AD8A 3O47A 2O8EA 4ETNA 4BNZA 1BMFD 2BFEB 1SXQA 1KH2A 4QTXA 1QRAA 4WZ6A 2CWDA 1FDSA 4N5IX 4ILKA 4PINA 3TLJA 1IBMB 2PUCA 1IIRA 1PV2A 2QM8A 3JSXA 3L6EA 4PCVA 4G84A 4UOQA 2VC2B 4G0VA 1IULA 1NUAA 4RACA 1ID8A 3B7GA 3BDVA 1Z56C 4D5GA 3U56A 5A9TA 1NNI1 3NGLA 4JEHA 5I7FA 4JENA 1BAPA 1RHQA 3TTXA 4D57A 4PN3A 2BMEA 5C34B 3K6JA 3DAYA 1IBCA 1OXSC 5FI5A 4EA6A 4J0CA 4BO7A 2AOTA 4JC4A 5IWCA 2AWOA 4GQAA 4D9GA 4DA6A 4TS4A 1G4UR 1QYXA 1AA6A 5TY0A 2QZPA 1BRMA 2VWPA 2QVYX 5H59A 3VPAA 1ZH0A 3CVWA 4NABA 4C2AA 4RJKA 2AX4A 1M8FA 3LY9A 1R88A 4D98A 6ADHA 3II6X 3IPYA 4GOOD 5BR7A 4CF3A 1UPTA 3GEHA 4YBRA 3D02A 3DLBA 2O0KA 1DIRA 3H7IA 4B3XA 1MR3F 1ZD9A 1HYQA 4S35A 2BUCA 5TF4A 4BCCA 2JLSA 1BDIA 1L5MA 1XPJA 3FWKA 3KM0A 4HH1A 1Y3DE 1R6VA 1OZGA 2R6GA 3LUJA 3PXCX 2UYYA 2QQEA 4GC9A 4W5JA 3ZR4B 3NHLA 4JLJA 5HX7A 2A9KA 1SFRA 3L6DA 4BKUA 1AZSC 5FJJA 2GXQA 4KE8A 4Q3CA 3SVLA 1DPFA 4B35A 4BO4A 2MSCB 1XGKA 4JUBA 2PQMA 1E5DA 3G7SA 4XD2A 5REQB 2GVNA 5JHGB 1ZOIA 3FVWA 2JLWA 1E1QA 1R8QA 3KXKA 4AK9A 3MIIA 4JBYA 4H3HB 4NZPA 3QVTA 4TRRA 4XUEA 1XZMA 3OU2A 3ANTA 4JLNA 4FDAA 3C7TA 2F3RA 4L6AA 1BD4A 1ODKA 4C04A 4TMYA 2J6CA 3BMOA 1JPJA 5KYNA 4LCBA 4CKBA 2PX6A 1JS1X 1LLQA 1F3OA 3OZWA 5FWNA 3L92A 2PH3A 2WLSA 1MXHA 2FMIA 2ZW9A 4B6OA 3A1DA 4Y0VA 2J4DA 2N1MA 1NOKA 4Y2YA 2ZATA 1KK2A 3FR8A 4OMUA 5CH3A 2XNCA 5FP0A 2WD7B 4LTDA 2C9BA 1YJXA 1RRGA 4AZSA 1DRUA 3SCZA 2I0FA 3GNQA 3FHLA 1NY6A 4IKOA 4TM7A 3H1BA 5BQ5A 4AULA 3S8YA 2D8AA 3GVXA 5TT1A 4GPIB 2ZRBA 4ZYLA 5LKRA 2Z4SA 1MZPA 5A5FA 4DLVA 5MDHA 2COUA 3NP7A 2OG2A 2BFCB 1W5FA 1D7AA 3CURA 3ADKA 4ZOLA 1X7WA 2YUTA 3O2JA 3P27A 4GGMX 4KO1S 1UZLA 2BMJA 2RB4A 1BA2A 1IDOA 1YRAA 4JL6A 4DR3B 5F21A 5JZ9A 1C3EA 2GBFA 2Z95A 3L7KA 2HU2A 3ZK9A 1Z8NA 4TKMA 2VSNA 1M8JA 3UJ7A 1VKRA 1ZJZA 1KYZA 2G6BA 2ATXA 2Z58A 3IKLA 3UF0A 1D7OA 3B82A 5BSWA 1EBUA 4U7TB 1FU4A 1V41E 3RFFA 5JZOA 1K2WA 3HL4A 1UMBA 4L9SA 4JL8A 2RHHA 4AIIA 1IVSA 2YYYA 3G79A 1U8AA 4NVRA 3SZGA 1AKWA 1WXXA 2AEFA 1M3SA 1Y80A 2VZEA 3RYTC 1IONA 2YWGA 1Y1TA 1ZGBA 3ESAA 3Q72A 3TKLA 1ZI8A 5B3AA 3LX5A 3QEMA 1TL7C 3OX4A 1QVAA 2HRDA 4LXIA 4QXAA 1TK9A 1I3KA 1D0SA 1IAVA 2XOEA 3D2LA 1N2IA 5L4SA 1F2TA 3GIDA 2ZRGA 2NU9B 1TAQA 1Y4DE 2CJXA 2RONA 4ZCQA 4AZ3A 1H2YA 4CT0A 4DMKA 4XZ3A 2CSXA 3EEYA 1FSGA 3FSEA 1CZNA 2VEOA 4W5OA 4JSRA 2Q29A 4YC7A 1B73A 1YBVA 3IAXA 3S8EA 3K09A 1MMFB 4MCJA 5EG5A 4RS4A 5EZ5A 4B0PA 3H04A 4ZEOA 3LG2A 1IEQA 4V0KA 3DJYA 4OLFA 3E53A 4UM9B 4Q3BA 3ZDQA 1I3NA 1TXGA 5F2NA 3KQPA 3KKKA 4B84A 3EBOA 1AU9A 1CR2A 2P5TB 3MZ0A 4K2AA 1OI4A 4WIAA 3A1FA 3RIHA 1GPH1 2ZSDA 3WXBA 4B32A 1YZGA 2J8ZA 2X2PA 5KVCA 4PE5B 3PUVA 5HJ2A 4ZTZB 2XXAA 3RT1A 3DE7X 1QIJA 1XL1A 5KINB 1Y9ZA 3PR1A 4RK1A 4OHOA 4F1WA 2ZYAA 3EA5A 1DAPA 4WUTA 2RHMA 4BJHB 1GFZA 2QN8A 1I7DA 2P4EA 5LDDC 4RGYA 2XQGA 1K66A 2ZIXA 3W5CA 2H1VA 5IF3A 5DBOA 4Q3LA 1J1ZA 3WGKA 5AVVA 1UT8A 4WACA 3WOVA 3TLAA 1BGWA 4HYEA 5EHNA 2XCSB 4E31A 1OX4B 5E95A 1A8UA 3D4BA 2J9FA 2MYPA 3J81k 1K7EB 3ORSA 1QZXA 1FXSA 3BIWA 5B6IA 3PIIA 1XDZA 2OHGA 3IBFA 3EG9B 3LYUA 1SVUA 5HKKD 5AVSA 3G5AA 2OAQ1 1X9GA 5HMLA 1ONSA 4MZDA 1AUVA 4ZOBA 4LRQA 1OXTA 3ZGOA 5KNBD 3H9CA 5JRJA 1PVOA 4BPBA 1SPBS 1PTJA 4FLEA 4DMUB 4B31A 4NI5A 3CX7A 2C9OA 4AJHA 3O2NA 3KXDA 5JSUA 4GE0A 3KUDA 1V7CA 2BGUA 3IKMB 4HKTA 2RGNA 1EA5A 3GLKA 3GELA 3O83A 3PGJA 2PKCA 2HDNB 2RHRA 2CHEA 3FYCA 4J76A 3T38A 2FEWB 4Z4CA 2Q6TA 4V2IA 4RSRA 4CJXA 2WVAA 3BSSA 4CIBA 4TKVB 5JISA 3OX3A 4N0MA 4TTJA 3UKOA 5IYZB 4BFXA 3JQDA 3I61A 3E27A 1YL5A 2FHSA 2PL5A 3LFUA 1G18A 1P3DA 3CF4G 3CTPA 1X9HA 4KN8A 3ZCQA 2EIHA 1PJBA 2JLYA 1KORA 1JA0A 1QGED 1YRQA 1UBHS 2EGGA 2VJLA 2Y76A 2QY6A 1N0UA 2A5YB 1PNTA 2B99A 2WTNA 2ZWOA 4OSOA 4TTTS 3H1AA 3Q1KA 4X0EA 3RUEA 3TQCA 4HNAA 1NN1A 4MS1A 1JAXA 2XGSA 3KFVA 3GJ3A 1IQPA 4CHGA 2WABA 2ZBVA 5LYJA 5JWRA 1ZI6A 1NW5A 5HFAA 3AHCA 2BFFA 1A77A 1Z6YA 1OLXA 3DE2X 4UNIA 3WZMA 4MYDA 4DYHA 2WB2A 4BECA 1DT3A 2WMDA 3S29A 4XRGA 2GPNA 5EVJA 3ER8A 2QRMA 4YRAA 4RNDB 1R6XA 3ESBA 1JQBA 1BMQA 1WHTB 2ISSD 2YIMA 3W3AA 4MP6A 1RPNA 2P9YA 3CF4A 1PR3A 3DAGA 4P4NA 2O5CA 3OC6A 1KZ6A 1GEEA 1ZKDA 2O2JA 4HDRB 4O2AF 4AJPA 4H1WA 5IXYA 3RAPR 5JAZA 5LQJA 3PKZA 2VRNA 3B1YA 3EG5A 2BMFA 4L5IA 2YZKA 5SZJA 3R77A 3GAAA 3PVSA 4YT2A 1KMIY 2KX7A 5IDQA 4DR2B 1QAQA 1RW4A 2F1HA 4ZVOA 3CR7A 1YOVB 2HL6A 1OBFO 5FPYA 3H97A 4C7OA 4YK7A 5CVJA 1PEYA 3KZ1E 3WDSA 2QPLA 1IN7A 4NMMA 3N2IA 3RT9A 3P9YA 4ZZ2A 3GJXC 1JTVA 3RGGA 3WE7A 5IULC 1EUCB 5FYDA 1TW2A 1EDEA 3PUJA 5G0VA 1AXGA 4CQMA 3UUEA 4KMRA 4PVDA 2P2CA 2PQ6A 4QDTA 2C5HA 5U9CA 3FDJA 3LRTA 1LS6A 4U5QA 1FS6A 4JEIA 2L0XA 1YFZA 3KD2A 1MXFA 1OOEA 2IOQA 3LF2A 2E2WA 1I24A 3MWEB 3BQ9A 4TUYB 1V3TA 1R4AA 2Z4TA 3PS9A 2B36A 2R4QA 5L40A 5LPNA 1OV4A 5EWLA 3UIEA 3I2YX 1OLUA 1ZGJA 3RR2A 3AK4A 4PLVA 3MILA 4HGOA 3U4AA 2UUPA 1TMKA 3PGXA 4AKHA 3HFRA 4E5YA 2ZT7A 1N2BA 5AT1A 1UPBA 3S2SA 2XUJA 9MHTA 1KOJA 1TM4E 3V2GA 1I1OA 1Z63A 2OHIA 3HKBB 3VYWA 1GYQA 2YXLA 3OFVA 1ZM3A 1GDDA 4N3BA 4AX4A 4FGJA 1JHVA 3PNPA 1MVOA 4L57A 3U7QA 3A2NA 2C1XA 3WDKA 1LS1A 1MO6A 4XIGS 2B2CA 3E1SA 3MTGA 4J94A 3UUFA 3IBSA 3MTAA 1DT5A 1R9NA 2HYDA 3JASA 3QNWA 1U2SA 1FMCA 2VK4A 4GX1A 1COWD 6REQB 2WU1A 1A8SA 1YOBA 3NBXX 3A37A 4P4UA 3V46A 2P5UA 2OXEA 1KQOA 2GBCA 2XYPA 3PJGA 1T8TA 3RYCA 1XZBA 3N2GB 4GLOA 4WY8A 4GC5A 3GJYA 1PWEA 5ENVA 4KAAA 5TPZD 1ZRHA 1VTKA 2Z3WA 1VCOA 1W30A 4WX2B 4JJGA 4QKQA 5K0LA 3HQ4O 1KFEB 1M67A 2VPTA 1RDFA 2CUNA 2JARA 2E0IA 2IIQA 3BSYA 5HF6A 1K7XB 1IY1A 1B93A 1K92A 1L9KA 3ETGA 2P1RA 4TRNA 5AJYA 5L7WA 4ZKDA 3C1TA 1J6UA 1JLRA 2C4WA 1TC1A 2ZUUA 4NE2A 1ZMTA 2V6BA 3FIJA 4K7JA 4Q1CA 4WGGA 4ANFA 3VJMA 5ERXA 3B38A 1M6HA 4IKPA 5CVCA 4HXEB 1JXOA 1QRDA 1WULS 4ZO8A 1UBGA 4DIUA 1GL7A 3AV0B 4MR8B 4OOFA 5AD1A 4RK4A 1AQJA 1TQ2A 5BN5A 5E8RA 4G0XA 1SVMA 4KQEA 4RVCA 1L9XA 2ZBUA 4FKBA 1J07A 4IIDA 2IH5A 1OMOA 3SHTA 1UODA 1MDBA 4ZN6A 4Z99A 4JP5A 3VNVA 3ZWKA 3HR7A 4FDUA 1ZHFA 1N2CE 4NXMB 4EPTA 3A3PA 5KNCD 5J2UA 3EPHA 1FP1D 3EAGA 3NOXA 2X5NA 3KLBA 4YAGA 2DPXA 4Z3OA 1VGVA 4U6QA 4GUAA 5CEFA 1YC2A 421PA 3AF1A 5JCZA 3EY4A 3GZNA 1JHOA 5KYVA 3PFFA 5BV0A 3BYZA 4PLTA 5SY4A 4KK3A 4YRBA 1DMSA 7MHTA 5D1NA 4XX1A 3FNGA 5C0OE 1F8YA 4P84A 1RRPA 5GJVC 3TR0A 1QFXA 1MB3A 3LS2A 4TTAA 3KSZO 5AK5A 4FR2A 3DEYX 2OGSA 1MIOB 1FC0A 2HNKA 1WPGA 1HTTA 4PNZA 3W90A 5K20A 2AUTA 4BZQA 2PSSA 3RS3A 3DDWA 5CB8A 5K8IA 4EG8A 3L8EA 3DF9A 3O5AA 1S1CA 2ZYWX 2X1HA 4IUBS 3NIWA 4LQ4A 2CB9A 5ALEA 4ENWA 1AF7A 4CMHA 5C8YB 3LPDA 4OFBA 3RI3A 1P5RA 1O6FA 4P5EA 4Y6PA 2O8FA 1I2ZA 4XB1A 1MQSA 1P7PA 5C1DA 1ZGAA 2HIMA 2HX1A 1XUOA 4JA2A 4DBLE 4E3ZA 4EA7A 1IXYA 3KXPA 1E1YA 2GAAA 2HZ7A 2LD4A 5ALFA 5ULLA 4Q15A 4BX9A 1RKVA 3SJZA 3VISA 9LDTA 3KPYA 2B5VA 4EYEA 4R1SA 5KNDD 1DVRA 3DA8A 3LCUA 4WKNA 2ERYA 2GCGA 2RI0A 3U3RA 5EZ6B 3VPHA 4M0UA 4V0LA 3ISTA 4M21A 4TMVA 4WBNA 4LCEA 5ADUS 4B76A 3S5UA 3PYXA 4HWKA 2X9QA 1VE7A 3QKRB 2VPYA 3SDBA 4WESB 3V6LA 2D5IA 4PCLA 3A3KA 3MJVA 3S2GA 4MV1A 4RJTA 4LYJA 1TF7A 2G0AA 1WF6A 4I9GA 4MIOA 5EHQA 3UC9A 3RKUA 2UZ1A 4MROA 2IRWA 1Z0DA 2O3UA 1KYIA 1M2VA 2YHSA 3COVA 1QRUA 3C4JA 4F5WA 5CH8A 1TX4B 4MQMA 4ZV9A 2RH5A 3T0IA 2IXGA 1E5XA 4B3BA 4ZOQI 2Y1DA 1E0KA 3SEFA 3L77A 1Q7TA 5EXSA 3RRMA 3FUTA 4ZYZA 4I4TF 3WYDA 4ADSG 4WZBB 1M66A 1GQOA 2B21A 1ORVA 3FAZA 4LJ6A 4G8CA 3W8FA 3OTWA 3KQSA 2PPLA 4ABYA 3U31A 5EKTA 4US1R 2WF9A 1YB4A 2A30A 2JAXA 2VNKA 2X9VA 3L5OA 2FUCA 4YQEA 3ZVRA 1O96A 3CZAA 5AI9A 3L07A 1JG1A 1UK8A 4QXPA 3VR5H 4DQ0A 1PZGA 4WNAB 2IYWA 1O87A 3SLKA 1DUSA 4IVQA 3GFFA 3ZKWB 1WOMA 1P0IA 1RCUA 3E05A 5BN1A 5KTSA 4CF5A 3ASVA 3R8FA 3JQQA 5I51A 2QUIA 2DWOA 3IUYA 4XLZA 1EX7A 3FOAA 1WSBA 3WRXA 2WUFA 4PCAA 1YAJA 3WV4A 4EEZA 1N2JA 1SXGA 2GPBA 1T8RA 4YGYA 2GA8A 4K40A 3BJZA 5CGZA 4D46A 2AXEA 5HQJA 2JAHA 4QXRA 3U0BA 3LOQA 3FPSA 3GL9A 3PHIA 3JALA 1A7UA 1N4DA 1I94B 3WB0A 3MJCA 4GNKA 4DEXA 1GZ5A 2P4QA 3W5IA 2FMHA 5D8DA 1Y1QA 2ZYGA 4WBXC 3ZZNA 1RMQA 4M8KA 5C1OA 3TM5A 4DYDA 5JY1A 4BNNA 2VZ0A 2WSIA 5F2KA 3I09A 4ALLA 2NSJA 2A7QA 1GY8A 4KQ2A 1UC5B 2C2MA 2P6UA 5D87A 2GCOB 2XIQA 3CNBA 1Q50A 3NEJA 4YNBA 5FHRA 1SH7A 5EE1A 3REQB 3TNJA 4P83A 1KJWA 3R5JA 3G89A 1DKNA 2A0FA 2QVZX 1D07A 1RM0A 4I6JA 4LOLA 3TR5A 3TXAA 5BQFA 1N9KA 2HWUA 3WZ2A 3L1IA 4YRQA 4RHUA 3AIOA 4HQNA 2J9RA 2BGJA 5JWOA 4F2WA 5L6LB 1A96A 1U7PA 3CW2A 4D43A 3NOVA 4Q4AA 2Q8QA 1X3SA 5FWYB 1VPLA 2F90A 5AK6A 3M9LA 2P0AA 4HNGA 4JNKA 1WJGA 1ABFA 1KO7A 5ESWA 5L6MB 1G9XA 5IANA 3QJ5A 5CLQA 2IYXA 4E13A 3WB2A 5JEEA 3GA0A 5DNCA 4YTEA 5EC8A 1UBCA 2PX3A 4FJ2A 1IPHA 1I3MA 1X74A 3AHJA 3EDOA 1YJQA 2FEAA 4M7WA 1RD4A 4BEBA 1RWOA 1GZUA 1RYBA 1O94C 3GGPA 2VDMB 4FMDB 2X7XA 3PFWO 2YWRA 3HCRA 1WB9A 4IDDA 4UHFA 4RETA 2I76A 5K0FA 1LXCA 3I42A 1YQEA 4QIHA 4L27A 2C4KA 4B6QA 1L7VC 1F9AA 2CZQA 2GEDA 4EPYA 2JH9A 5A4AA 5I7OA 3GLGB 4E15A 4Z0HO 2X3YA 3SHVA 4KWEA 1NBMA 3PWZA 2ZAGA 4E5SA 5IM4A 1KYQA 1E7MA 4GPZA 2Z30A 3NEPX 3S28A 4BN5A 1DTEA 4KE6A 2EFYA 3P1JA 4D4HA 1TPZA 3GT3A 3URKA 3WNCA 3ZV7A 2B30A 5HIAA 1JLKA 3ELWA 5EMHA 4R69A 3PCXA 4OGWA 4OKIA 1Z0ZA 3KTFA 1OI3A 1RJWA 4PSVA 4U9HS 3BRQA 1ZI9A 4XWYA 5FBKA 3U17A 3F2VA 4BE7B 5K2MA 5F3WB 3M6MD 1NRWA 1CETA 1LCIA 2EFEB 2EATA 7REQA 4O59O 2ODAA 5KDLA 3PEUA 3BWCA 4OX9B 4CG2A 4G1UC 2HH9A 2B8WA 2DVMA 4DQLA 1AGNA 4YMGA 3M9XA 4R81A 3KQLA 2IHKA 4R9UC 3UZUA 3CZCA 1HG1A 1K9VF 4C30A 3RT7A 2OGTA 5K4GA 4EUFA 1X7XB 3MGBA 1O7JA 4ZK6A 1ZOPA 1PLLA 3HB7A 4O63O 4JT8A 2GFIA 4R7ZA 5J4HA 3RBVA 3M1YA 1T2NA 2PX4A 1M76A 1E98A 2OCIA 4TL6A 3CEAA 3FCEA 3T06B 5I4KA 4KOAA 4V0NA 2ZPAA 1UIMA 2JCVA 3I9LA 3DB2A 3P2JA 4UTZA 2C0CA 3IS3A 5LYYA 5JZBA 3G7UA 4V0OA 1C1YA 4IMPA 4O3FA 1SU4A 4D99A 5C53B 3UPDA 1IOWA 1VG0B 1RJFA 1F6DA 3TINA 4TMXA 1SXJB 2JIBA 2ANCA 2VXOA 4E30A 5AHWA 3WA7A 5HRUA 3SE0A 4QJBA 2D5CA 3LDAA 2XMDA 1FYXA 2AR7A 3VR4A 2ZTMA 4JDUA 4KSYA 4EVSA 3ABIA 3H4MA 4EFNA 2ISCA 5HIJA 3A4MA 2OBLA 4A03A 5T67A 3NWPA 2E4ZA 2Q5OA 3IIIA