4RAQA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
214
structure length
198
Chain Sequence
SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 68
structure length 198
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4raqA00
1DKUA 4S2UA 2E55A 1L1QA 4ZFNA 1G9SA 2JKYA 4M0PA 1ZN8A 3GGJA 3MJDA 3OHPA 1I13A 2WNSA 1FSGA 3O7MA 1U9YA 1MZVA 3ACCA 2JBHA 1P18A 4KN6A 1L1RA 4P80A 4PFQA 5IPFA 1U9ZA 4P86A 4RACA 1I0IA 2PRYA 1V9SA 1ECCA 1IBSA 1A95A 1NULA 3LRTA 5KAPA 3ACBA 3GGCA 4RHTA 1HGXA 5HIAA 1XZNA 3QW4B 4LYGA 4M0KA 4P81A 1BZYA 1A98A 1XTTA 5BQOA 2XBUA 3ACDA 4P82A 1A97A 4RANA 4RHUA 4LZOA 1CJBA 4RQAA 1VSTA 1ECFA 2PS1A 3OZGA 1J7JA 1UPFA 1DBRA 1BD3A 1A96A 1PZMA 4RADA 1VDMA 1D6NA 4X45A 2H08A 2EHJA 5IAOA 4FYMA 4RAOA 2PRZA 4OHCA 2VFAA 1P17A 1ECJA 1WD5A 2IGBA 4JLSA 5EUCA 1NONA 1R3UA 5KAMA 1ZN7A 4Z1OA 4P3KA 1O57A 1XZ8A 2H07A 4M0UA 3GEPA 1OREA 3KB8A 1O5OA 1A3CA 4WMLA 1QCCA 4JITA 1QK4A 4F8EA 1A4XA 1UPUA 1QB8A 1QK3A 5ESXA 2HCRA 1LH0A 5HKLA 1Z7GA 1ECGA 1G2PA 4RHYA 5ESWA 1QB7A 4RQBA 5JSQA 1Y0BA 3H83A 1DQNA 1VCHA 4LZAA 3DAHA 4RHXA 4P84A 5E38A 4RV4A 5BRNA 3S5JA 5BSKA 1ECBA 4IJQA 4QYIA 5BQPA 4WN3A 2H06A 1BD4A 1UFRA 2FXVA 1OPRA 1GRVA 1YFZA 3NAGA 4RAQA 1QK5A 1AO0A 1ZN9A 1P19A 4QRIA 3HVUA 4QYIB 4TWBA 1G2QA 1P4AA 1W30A 1G9TA 1I14A 2GEBA 2C4KA 3LPNA 1DKRA 1TC2A 1GPH1 1JLSA 5JV5A 1DQPA 4RABA 3DMPA 4PAWA 4LZNA 1XTUA 2JI4A 1I0LA 2DY0A 3N2LA 1OROA 3EFHA 3G6WA 3MBIA 5K51A 4X44A 3M3HA 1QCDA 1JLRA 4P83A 2P1ZA 1STOA 3DEZA 1HMPA 1XTVA 2JKZA 4LYYA 2YZKA 4MB6A 2AEEA 1I5EA 3OZFA 1TC1A
chains in the Genus database with same CATH superfamily
3G9TA 4N76A 2I1QA 1BCRA 1XMJA 3T0GA 3BFXA 1KO4A 4CM3A 1EE1A 3ZPXA 2HWKA 1ZN8A 3RVKA 3KPUA 2D2VA 1IJFA 1B8UA 5C81A 4QGGA 1DO2A 1KKLA 2JI6A 2OHHA 2VH2A 3OPYB 4FC6A 2GO7A 5H4HA 1U9YA 4B5KA 2EYUA 4MWOA 1MA0A 4HDNA 4RUKA 1FP7A 5DGTA 5EG5A 3QYFA 4YGXB 4RKWA 4ZOLA 3N7UA 4I50F 5FWXB 4QPCA 1CDOA 2ZBUA 2PVCA 1H05A 1DZIA 1J2EA 3R5SA 2M2IA 1OBHA 4CCWA 1TM4E 3BF7A 1KQ3A 3JWPA 3PR3A 4J0HA 2B5WA 1TMGE 2Q1SA 1CBUA 4KQ6A 4JYPA 4XIGS 4YH1A 3SXUB 1NBEA 3U37A 4E15A 1NLFA 3L82B 4RWEA 1EAMA 5EMJA 2P69A 3K2EA 2ZJ8A 1VGVA 4NONA 2A7XA 3AL2A 2HGZA 3A06A 3MIZA 1FOEB 1TK2A 1IEVA 2CE2X 3DKKA 2QB5A 2F43B 2QLMA 2AI3A 4POOA 3NT5A 3W0LB 3NNSA 4X45A 4O4LA 1E2LA 4AN0A 4IKEA 3MCTA 1TZCA 3AHEA 4M1YA 3VTFA 3TIVA 3RDPA 2JVKA 3HDYA 5TVKA 1JH9A 1HG0A 5DBIA 2Z4SA 1ZVQA 2KLBA 4J03A 4YGYA 1OLOA 3HKEB 3IAEA 5C7YA 1ZOSA 1GWNA 2WYVA 2Y68A 1WBDA 4Y1EA 5AK0A 4BVAA 5TSDA 3WRWA 1TZBA 1EP3B 2DLCX 1EQUA 3I9OA 5FA5A 4MV5A 2CE7A 1RP1A 4OSPA 2F6RA 4YFVA 2GKSA 3CNQS 2JARA 3GAZA 9GPBA 1A9XB 1N6PA 1M54A 2HHAA 1S3FA 1I2DA 4KC0A 1QANA 3EIXA 4CMBA 3VR3D 1ES9A 4INAA 3WHLA 3FLMA 3GJ8A 2YYSA 2I71A 4KKVA 2X6RA 5K03A 3P0FA 1AD2A 1B2RA 2JIZD 4CQMA 3G2IA 3IE0A 2WYOA 4I50A 3W7AA 3WLNA 3AKZA 2I4IA 4MGEA 1PAUA 3TM5A 3ZK8A 4UVEA 1JQEA 1ZHHA 4JSRA 1JH8A 4F6CA 5HSGA 2C5LA 5I6DA 2FP3A 3MHPA 1Z8FA 2RGXA 4H17A 1D4OA 1UPCA 1K6JA 4WHMA 3SYTA 3BQ9A 4U6SA 4EYKA 5IZCA 1W4ZA 4Q15A 4RIEA 3UMBA 3NJ4A 4RF3A 3ABSB 5IXYA 1WCV1 1GTG1 1JIQA 1RRPA 2Y0EA 3IKMB 3OT4A 4UU0A 5KYUA 3TTWA 4POAA 1HURA 2VK8A 3I1YA 5BRJA 5HJ2A 3ZCRA 5K05A 3DOOA 4TRJA 3M5PA 4FJ2A 2HAEA 4AICA 3P4XA 5KYXA 2YRXA 1PG0A 2H4XA 4Q3LA 1ESDA 2PL9A 2WMNB 4Y2VA 3STHA 2RAPA 4PO9A 4L07A 4G1EB 1P8JA 4W5TA 1O0SA 5EJGA 1RM4A 3E9CA 3UKOA 2V1XA 3HACA 4KTVE 1Y5RA 1JG4A 1Z4JA 1UJMA 2I1WA 2Y0DA 2GFIA 2BHNA 4MMZB 4A4DA 2J7PA 3PDWA 1ZYUA 4UMEA 1YZFA 4H9GA 4E32A 1OE0A 3ZBTA 2I22A 2VXYA 1PV1A 2CNKA 3PA8A 3U3XA 4BBAA 2C8KA 3KZCA 3AM4A 1G8FA 3IQXA 4Z3OA 2ROQA 5C3MA 4HG2A 1H2BA 4X3OA 2AYXA 1GRQA 1XLTC 3R24A 1N2CE 1KBQA 3QFRA 3F5FA 4MVJD 4WFQA 1U2PA 2FFQA 2Q3JA 3RJMA 4WEQA 1XEWX 1YCHA 5FYQA 1UJ6A 2BF4A 2WUFA 4TUYA 2PKRA 3FSGA 3H8SA 1Y8RA 2I03A 3H6GA 4K9KA 4EENA 2J4DA 4MV0A 4V0LA 1QHNA 4CV0A 1QO7A 3OKAA 3OD1A 4RMIA 4ODIA 5KCZA 2HUNA 5AKEA 2F1IA 1L5YA 3UK7A 2EZTA 4C2TA 4DR7B 1DDGA 4TL9A 4DSUA 4BMNA 5DXJA 4KOAA 2Q1YA 4ZJYA 1PQWA 1UBLS 4QPJC 1GP2A 3SR4A 4YQZA 2CUTA 2HGSA 2FJUA 1W2HA 3NASA 1JFRA 4ZEXA 2VJQA 1NNUA 4RMJA 5AM0A 3V1LA 1FJXA 4L08A 3CSSA 2FUNB 3OY7A 4XM1A 1B0PA 1N1MA 3NWOA 4A26A 5HX7A 3OZGA 4OKSA 3WYCA 2HHHB 1J7JA 2ZR0A 4MUKA 5AVXA 2Z5GA 1OI7A 5JMOA 3IPXA 1D6NA 5F7OA 1ZWLA 3FG9A 4KQCA 5CDYA 1M7GA 3KKKA 1OTHA 5B30A 1CF4A 1QHHA 4HWGA 1OH8A 4XARA 1GDTA 5FJJA 1JQ5A 5DH9A 4A5OA 1GVNB 4ILKA 1H2HA 1BOFA 3ZBPA 1Z4KA 4WFIA 5BNZA 2WLSA 4DR5B 4YREA 3G88A 5CPFA 2NP7A 3DM5A 2C3OA 3ZJUA 4GQIA 3K20A 3MPOA 4G1UC 1UT6A 4HP8A 3TNFA 1IVSA 4U0JA 3C45A 1WXIA 2FPIA 3V7UA 2H5JA 2GTHA 4HQ0A 5TT1A 4AY5A 2Y0BA 3KUKA 5HGXA 1F4LA 5IT5A 5LVAA 1XC7A 4UU7A 4M7OA 3LCUA 1QOQB 4WNAB 3SS7X 3VISA 2NU7B 2UDPA 3I2JA 1R8QA 1XSEA 3OU6A 4L8WB 3A3KA 3SD7A 4BEVA 1QGOA 2V74B 1J5PA 2CZQA 4RV5A 3PJRA 1Y3HA 2V65A 4DY6A 3EMVA 5J2TB 1EDBA 1IY1A 2PXXA 4EGJA 1S4QA 1VMEA 3H2GA 4QATA 2EJBA 7ADHA 4YRLA 4LXIA 4A23A 1GGMA 1YRHA 5DRYA 4BNVA 2PXCA 3FKJA 4RH3A 1KJJA 5ALSA 3I1IA 4CCYA 3IMCA 4TVOA 4GPIB 3RUDA 4OJMX 2HO5A 3UYKA 2VA9A 3T7CA 1Z7YA 2BGRA 1Z0JA 2OQ2A 4LSWA 3U3JA 2HV8A 2JHAA 4PX5A 3T35A 5K0EA 1BVUA 4LMRA 1GLVA 5SY4A 2VJYA 1MJHA 5HDQA 4N3BA 3S6JA 1SUDA 1ZUIA 1JHYA 1GQFA 1UM8A 2O1SA 3C2QA 3ML1A 3ZU2A 1I33A 4CEJA 5JS2A 4LZNA 3CCCA 3W90A 4MV4A 1KNQA 4ZAFA 1Z56C 3JASB 3ZGNA 2A0WA 2HRRA 1VJ1A 2X86A 2PGNA 3UJHA 5J4YA 2IH4A 1EE9A 4EAAA 1KMHA 2JDIA 5JCPA 4FD3A 3QEKA 1NVTA 1RWQA 1SCUB 2JFUA 1K6MA 2RFLA 2WYHA 4Q19A 5IUJC 1C9EA 3OA2A 4OQXA 1K9VF 3H9UA 2IIVA 2Q9AA 3HPQA 3KJGA 5IBRA 1C0KA 1P91A 4FYXA 3Q8WA 4Y9UA 1WXGA 2P77A 4BY9E 1ZHFA 3AR2A 1EG2A 1EGMB 3CONA 3OOHA 4PONA 1XU7A 1TO2E 2Z2ZA 3V8QA 3TPZA 4CLOB 2NO0A 1V3UA 4AJ4A 3CZ9A 4N3AA 3I72A 4YDSA 3UOAB 1RJEA 3W7VA 4D8UA 3IBCA 3OJLA 4LYAA 2BFNA 1JFFA 5EN4A 3SC3A 4HSEA 1FJHA 3MK31 3BMQB 4NV3A 1ISFA 1WKBA 3HZHA 1IUPA 1S2LA 2GM3A 2HRDA 4KMOA 4WZAB 2NZWA 2PD3A 3I6YA 1OBVA 1IN7A 2OORC 2B2CA 2O3JA 1L5RA 3KYDA 3SG0A 1HNWB 1BQ4A 3N2GB 4FWBA 3REOA 5K3SA 5AMXA 3VQTA 3HUEA 3AJRA 3DAGA 4PHHA 3FHCB 3MWEB 1C3OA 4O63O 3I6ZA 5DF1A 3SZMA 2ZXEA 2GNAA 3KKEA 1QHFA 2I76A 3CO5A 3RV4A 3VPCA 3MCAA 2EBWA 3UMVA 3ANMA 2JNWA 2PX8A 5FV4A 1CR2A 4DDTA 3SF8B 1F51E 3AV3A 1J42A 3OOJA 4YCCA 4P3OA 4CLDA 3IDQA 4EQ6A 3PEYA 1YDHA 3C1TA 4Y8VA 2WUWE 3SSMA 1EFRA 1U90A 4MS3A 3MWJA 2WG2A 3VBCA 4ZQGA 4GH5A 2B2NA 4BP1A 2QQGA 2DPGA 3T4UA 4DRZA 4EEKA 5JRDS 3A25A 4PZZA 2FPUA 2GUWA 2QAGA 4HXEB 3LA8A 2IS2A 2J0QA 4N48A 1E20A 3U7HB 4TZTA 5DNCA 1OFHA 2IE0A 1LD3A 4P6VF 2Q6OA 5D7BA 3WGYA 1UBFA 3MTJA 1VPDA 4F3KA 2F8SA 4HLCA 1QCCA 2XVYA 4GLLA 1T29A 2BZGA 3ZKWB 1QP0A 4MV8A 5ICCA 2KYRA 2XAAA 2WF6A 2YYAA 4NCJA 3EZFA 1KR5A 1NYLA 3H1PA 5AKGA 1F7VA 3OSZA 1FMFA 3FROA 4DT1B 3PFCA 1TQHA 4PBSA 3KEQA 2FUEA 1E1YA 3EXFA 1RTKA 1DKQA 3ZZ0A 3IBGA 3U2QA 3A26A 1PG5A 2ZT7A 1EPUA 3SEAA 3VYVA 3QKWA 2BT4A 4JHXA 4JI3B 8ADHA 2OWDA 4XOIA 5BSKA 4NG4A 3U5ZB 4I55B 1VI6A 2PRJA 4YRAA 1MAHA 1W9MA 2GLTA 3D6HA 4EKIA 2XXAA 5ADHA 4M86A 2YVAA 4IIBA 2AC7A 1B41A 3NKLA 1E62A 2ZJ4A 4G1VA 4RETA 1H1DA 1Q95A 1TUBA 2VSFA 4OI0A 3FNGA 2PN1A 3CVOA 2A5FA 2ZSBA 3KQWA 4UEOA 3HLTA 3RS7A 1DQPA 4KYVA 2VDUE 2V7QD 1A9YA 2PUJA 4EB3A 4LKOA 3V8RA 3EXHB 3DT8A 3COPA 3QEMB 1X14A 4PRLA 5DO9A 1Q0TA 5C9ZA 1G8JA 2CXOA 1FRQA 1TZKA 4QRDA 1Z0ZA 3L7NA 3QVKA 4KVGA 3DR3A 4MVWA 1YU6A 5TIIA 2QUZA 5C7OO 2FN8A 4C0BA 2B0CA 2SCUA 3H97A 3QNMA 4MDHA 5BT9A 4AIRA 5HZHA 1W1IA 3EQ7A 1BHQ1 5IP5A 4QTXA 4Z53A 1XNRB 1UJ2A 3OTHA 4UCFA 1G60A 5LP6F 4M54A 4ERNA 4FC7A 4JFRA 3OHPA 1ADFA 4R2KA 3A6FA 1ZW6A 3WNDA 5IJ0A 5KHOC 1YTUA 3BBPA 1YHYA 2G67A 1VIAA 4C78A 2Z5VA 4DLNA 2V7PA 3AHIA 4G5HA 3OTWA 2IY7A 1GSOA 3LBAA 1X7XA 1H9CA 2PHZA 4RW0A 2QRJA 2XE7A 3IPYA 4NBKA 4Z1MD 1TU3A 5HM8A 4R3WA 2FB9A 1BYUA 2VHVA 3U17A 3WADA 4OCZA 5AW0A 3RSHA 1Z2CA 3MVEA 4Y2JA 4C7KA 3UHOA 1Z5VA 2QYOA 1ETUA 4HLUC 1V71A 2CJXA 4UHJA 4U1RA 3ONWA 5EGNA 2UZ1B 4RIIA 3EDOA 5LWHA 3FKQA 5IDXA 1QIJA 2W6QA 5JWOA 2YC4C 3T41A 3U3DA 1XQ1A 2POCA 1CNFA 4L28A 2FDXA 5CIYA 1KQPA 1M1UA 1M1NA 2AE2A 5AKZA 1W36B 5K0LA 4PX9A 2JAUA 3ND7A 4FJ1A 3VU1A 4NDNE 3OPQA 2ACWA 4DQUA 1JXMA 3GMSA 1T9CA 3CUUA 3QLUC 3V1TC 5L3SB 2H5EA 4I4TA 4RDCA 1ESNA 1W4LA 2FR0A 1B3RA 1IBCA 4E5PA 4H27A 2JAXA 4BPRA 3NDIA 4HS9A 3E9EA 1XXLA 3GL9A 4HH4A 2WM8A 4FWIB 3MMSA 5JNUA 1K8RA 4CG1A 1FLNA 1KYVA 2QVCA 5DGXA 4PAGA 3VZBA 4ZOBA 4BFLA 1KS9A 1RYNA 4UBOA 2OLEA 5H3CA 3LCCA 4H7IA 2J32A 2W2TA 3JQAB 3PVCA 4DJ5X 3QEJA 2EDCA 3FYDA 5CD9A 5LP6A 2RD2A 3HUTA 4DBLE 5KQRA 4RXUA 2YW9A 4TMYA 3RLFA 1E6CA 2A4KA 1QH0A 1CRLA 3DLIA 3I4CA 4UUQA 3NM4A 4Q3AA 2GLUA 2ZR7A 3LWDA 2YMLA 4I4CA 1EU1A 2QY9A 3K70C 3X1YA 5DLEA 2W93A 4EJ6A 1S3IA 1DAOA 1AUOA 3OIYA 1NC3A 4LBYA 4PGAA 2VQEB 1UK7A 1JWBB 1DJLA 2I2AA 2VWQA 3GPBA 3C70A 1XELA 1JHOA 3E6AA 3Q72A 3G3EA 3Q7TA 4BATA 3DBHA 3WAJA 2Z3ZA 2CV2A 4JYZA 3DZHA 1W36D 1W5SA 3B1ZA 1BHJA 4MQEA 4ND6A 1DBIA 4RHCA 3AM1A 3QRWA 5BMOA 5HUJA 1HI9A 1U8YA 2HCBA 2I6XA 4NEHB 3EIFA 2CVZA 1NMXA 1ENPA 1MAWA 1Z5ZA 1E2PA 4LNUA 1ZD2P 1G5FA 1XZEA 5BN3B 4PWZA 2WA2A 1UBJS 4EPVA 4LDJA 4GECA 3L93A 4JLOA 5A4IS 3WL5A 5KQLA 3RFCA 5GWXA 2CK3D 3GCZA 1PJSA 3M7IA 4OMUA 4OYRA 1RXWA 3VNBA 3GGGA 2OG1A 5SY9A 3ZBQA 5KWJA 1OTYA 3E9NA 4B3FX 1G20A 2GILA 2XEDA 2O54A 3UMYA 2HMUA 4LYFA 2HRBA 2NW6A 3RBVA 2XT9A 5DNYB 4MV3A 1MBZA 1B15A 3NEYA 8GPBA 1X80B 1DGQA 3O94A 4CIWA 1CIPA 5K3FB 2BSAA 1FMTA 1UBCA 4E12A 1VJGA 4XI9A 3DZKA 3GDGA 2XR1A 2D8AA 4KV7A 4YAEA 2VH5R 3ZHVA 3EIUA 3H65A 3SJUA 5B36A 1DZ3A 2BZ0A 1PI3A 5DW0A 2XZTA 1DUVG 3A3NA 3MGAA 2CBXA 4LFCB 4BTEA 2QR2A 2CL5A 3QVUA 4BNZA 1GU1A 2Z1NA 1TIKA 5FYDA 3CLVA 2QUJA 2XF2A 3U44B 4MV6A 1U3DA 2EGHA 1Z0SA 4YJGB 1LW6E 2FEMA 2OY0A 1CW2B 1E77A 4HYQA 5G0TA 2QGZA 2X7XA 2DBYA 2HWXA 2ZLBA 3AR5A 3B3FA 3FSEA 4L4RA 3UY4A 1Y9ZA 2WP0A 2Q3EA 4M46A 5DTQA 5BN4A 4PGHA 2XGOA 1E2MA 4GSLA 4C6SA 1J8DA 1I0IA 4MVJG 4IOKA 4WJLA 3CVXA 2NO4A 3FTPA 4RX1A 2DYKA 1AU9A 1N8SA 2P5SA 1HLPA 1SR8A 2OFWA 2AVDA 6GPBA 4IJMA 1QCZA 2C0CA 4DARA 4IOMA 4EW1A 4Y6OA 1OYWA 3RG2A 3PGLA 4G8JA 1FYWA 3U48A 5BQFA 4O3MA 1XZPA 1ISJA 4ZOEA 2CKDA 3GLSA 4OI4A 5IAGA 4IZOA 2W2KB 4ZRMA 4QYMA 4Z0PA 3L7BA 4MTCA 1YVEI 2WFAA 3B36A 3K6SB 2E5FA 3T5AA 1W0CA 2P5UA 2WF9A 3RSCA 1Z6ZA 1XN1A 2VNSA 4IJVA 3AF5A 3ZY5A 1ZJWA 2E9SA 2KM1A 1O94C 3TL6A 3E2MA 3L7AA 4YXFA 3D3WA 4K87A 2HD4A 2AOWA 2QDXA 2P9QA 3KETA 4KO8A 2REOA 1PP4A 4BX3A 4C0WA 3DB1A 2C3MA 4HXGA 1C9NA 2NXCA 4S24A 3CPSA 4OJQA 1NX9A 2QNBA 3IP1A 5B4TA 2NXWA 3TRJA 3IOEA 4NCAA 4AMUA 1M0SA 4ALJA 4C88A 5K8UA 2Z8XA 4OGKA 5E8RA 4Z4CA 1I6WA 3H5TA 2G88A 4O2BA 1ILWA 1VA4A 3FLBA 3FDFA 1Z7GA 3QENA 3KSZO 3DCYA 3OJXA 4KL8S 1JG1A 3TBKA 2JJ2D 5LZ8A 5IWAB 2Q6LA 3IL2A 1YCDA 4E4TA 5BYAA 2V6BA 3G8YA 4BQOA 3SQWA 4AWAA 3QJYA 5I9SA 5EHZA 1XXHB 4FN4A 3D7MA 4G1CA 1RVV1 4R6WA 5D8DA 2VNKA 3DUFB 1ISRA 1OAOA 2WHYA 2ZT6A 3HJCA 4HZIA 2UYOA 3ZHZA 3MTBA 3PZBA 1BMFD 5GONF 1JXQA 2XT6A 4RMNA 2ZROA 1JG6A 5DM4A 4UNRA 1QYDA 4YUAA 1G3UA 5FL3A 1LGYA 3W8NA 4PZ9A 4JI6B 1MX1A 2FWNA 2PV0A 3S2YA 3IDZA 2J3JA 3PDIA 3STTA 4ZQFA 4CMHA 2RHWA 4CLEA 4D3SA 3JARB 1O0CA 2ZWAA 4BE4A 1TJNA 2FI1A 3A28A 1IU9A 3B3QA 3DXYA 3LV8A 4EG5A 3GXBA 1T15A 4RGBA 3OJFA 4JHLA 5JD6A 2VT2A 3HNPA 1SVKA 2I6FA 2EXXA 3HFGA 1XTUA 4YMWA 2FGJA 4KR0A 3MSXA 4TS4A 3S0JA 1Z15A 3SHWA 5JQWA 1BVYF 3KXIA 5A05A 1VFNA 3K6KA 5BSEA 3Q88A 3K9BA 2GYVA 4HH3C 3SXUA 2YXEA 3HABA 4JGGA 1NJ6A 4MW2A 2RGRA 4JQOA 4QJIA 4UMFA 1QVZA 2OV3A 3JQ9A 3OCCA 4TWRA 4DQLA 2FMKA 2PVPA 4R9SA 2AG0A 4R7TA 5F3WB 2IPXA 2JKZA 4I1YA 3R3ZA 4N0QA 3DMTA 1XV5A 3PB3A 4J1SA 4YFYA 2F55A 3GQBB 3RU9A 2NNWB 4PSUA 4RNDB 1E5QA 1DIGA 1XT6A 2DTXA 2HF7A 2X6QA 3HYTA 3ZU3A 1EIWA 5KTTA 2JKYA 2BM8A 1BGWA 4IEFB 5JC1A 3G0GA 2RDMA 1P0MA 2WV7A 1R4NA 1UEXC 3INGA 3R7WB 3I32A 1SU7A 3WA6A 1I30A 3ZG6A 4M1OA 2V6MA 1IK6A 2VRWA 3LW8A 3VO2A 3ROMA 3T0FA 5CT9A 5E1DA 4EM6A 2WE8A 1G20E 1DT5A 4Y0NA 1EFLA 5UKDA 4CM9A 3TM4A 3WR5A 2AL7A 2FDCA 1FXWA 3CPJB 5GONA 1WMFA 1V1RB 2FPOA 1LRKA 3AIKA 3VSAA 2X0RA 2H1WA 5IAAA 2VLBA 3BSWA 1IONA 5FBQB 4ZI7A 2I91A 2LRHA 1R6XA 3NHYA 3WJAA 4WLVA 1XCPA 5A9TA 2JFYA 3IAUA 3Q3GE 2ZSKA 4WBNF 4KBFA 2IKQA 4JC8A 4TYMA 4BGUA 3GRKA 2AN5A 1L8AA 2IHBA 1JDSA 3OAAD 5HCUA 4U63A 4D6YA 1E3TA 3AEUA 2JAOA 3OH8A 4BKRA 2WINI 1LPOA 2ST1A 5FBHA 4BVHA 1Y37A 1P7WA 4Q3BA 1DFIA 2R96A 4V0ME 1Q17A 1E1QD 2C7PA 4A8HA 1YAJA 1G6HA 5BN1A 1PX0A 2GPAA 4UU1A 3A6PC 4LA4A 2FWPA 1W96A 3L4BA 3OT1A 5K99A 5F21A 1LWNA 1UXGA 1E5XA 5IW8A 1MQ9A 4RF4A 3CLHA 3F73A 4KZKA 3E18A 3OCJA 5BSRA 1U31A 2X1HA 4REQB 1R0KA 2IEGA 2YR0A 3N5KA 4S12A 3L1IA 5L7TA 2F7SA 2HJHA 3EX7C 5CK5A 2DQSA 2QMHA 3NHSA 4KQEA 1UDCA 1VP9A 3EDCA 4G1MB 2WT4A 4UEWA 3FHTA 1RYEA 2MYNA 2CXHA 4GXRA 1WMAA 3A1SA 4QOSA 4H1WA 4IDDA 5H7XA 3TQRA 4BVFA 1ECGA 2YICA 4YBRA 3EA5A 4Z7QB 1HTTA 1ESMA 3DF9A 4RFVA 3EUFA 3WVNA 1ZH0A 1XTPA 2V4ZA 1CE8B 4UM8B 5HIIA 1MAVA 1J0AA 2FQWA 4X7MA 2VJCA 2QG6A 4CDMA 2JJMA 3E2IA 2RHTA 3S5JA 3TG8A 3AI7A 3PD7A 1TE2A 3FPKA 4XCXA 3I12A 4X6XA 3A2KA 3PG5A 4GM0A 5LQJA 3BT7A 4Z4QA 1IATA 1UBTS 3JQEA 4FYYA 4XYEA 3H2SA 3BMXA 4UEJA 3PIDA 3RK4A 4CTOA 4EAQA 4F84A 4WBNA 4LBWA 2XYVA 2Z3WA 2BV3A 1QC5B 2GETA 2VJPA 1LDEA 1P7ZA 2B8WA 4ARBA 4BP8A 1INLA 4M49A 1MJ5A 3MTGA 2Z09A 2F64A 1DKMA 5KJEA 1R00A 1RIFA 2A33A 1EI9A 3FW1A 1HL3A 3KB2A 4RE6A 3AONB 3ZHXA 4X95A 3ABZA 2PBLA 4BU0A 4AY6A 4YNBA 4JCOA 2DY0A 1B3BA 1KYTA 4YLYA 4YV0A 3UV3A 3DZGA 1NWCA 3HCEA 8LDHA 3AHFA 1JG2A 4GOLD 1W7AA 1WOMA 4ZI2A 4KLZA 3WXMA 2I3GA 1UKZA 4PC7A 1MC8A 4YYEA 4R8RA 3WMXA 1GVHA 2A94A 4Z99A 4B6OA 3KQLA 3ZD9A 2X0FA 1H5QA 4AKSA 1F6DA 3T3NA 1NWHA 3C39A 3FZEA 4INPA 1E6KA 4MUAA 3H9CA 4EWLA 4DV3B 3RD5A 2QRMA 4QXRA 5FFFA 3CNHA 4YCJA 2VDOB 3VR6A 1RE1A 1JYFA 2CMHA 3FZYA 3E05A 1ZESA 2PZFA 3X3HA 3D2AA 3Q6MA 1IPHA 3RC7A 2WJAA 1UAGA 1VRVA 1NATA 1OVMA 3HP4A 3NKVA 1P5JA 3QQ5A 2AOTB 2NOAA 3IQFA 4NTZA 4XYGA 3W6NA 1TVCA 3UZUA 4GRAA 3S1AA 5A2QA 1P6XA 4XJXA 4JBGA 4P5DA 3E4CA 1PFUA 1C30A 2E18A 2GJKA 1NUQA 5LQCA 2GS9A 1YVPA 2KBFA 1KI2A 4DNQA 3OPMA 1GQOA 1SQ6A 3OP4A 3OFJA 3R0QA 4CM8B 5B64A 1QUEA 1LVHA 2E4ZA 4WNAA 3R0JA 2R86A 4JP2A 3G79A 5CT8A 2UXDB 1MF7A 4WDRA 1C3VA 3CV3A 4V3CA 4CR8A 4WSOA 2GAJA 4GR9A 1NVMB 5D5QA 3UA3A 1J0EA 1LTHR 1QH9A 2JAWA 2WIBA 1UPAA 3DLAA 3LPAA 4QC2A 4AVYA 2CFOA 3H1AA 3O0TA 5JEDA 3MTEA 3VR4H 1FF9A 4LWPA 4JCCA 4P98A 3MWYW 2DFNA 1QKIA 2E1RA 5H0IA 1FVOA 4Y9TA 4M7WA 5BR1A 1IHPA 4QXOA 2JGDB 3T9EA 4I3FA 2WQ7A 2AC4A 4MW9A 3G2KA 1VZ2A 5SY6A 3EGXB 5KAMA 1RR6A 5TRTA 4B79A 3H18A 5JFGA 4GC9A 3RW9A 4G4JA 4MYSA 3ER6A 1J24A 2HQRA 1QH8A 3HYRA 4FQ5A 1ZIXA 5JU6A 4EGAA 2HIGA 3C3AA 1CQPA 2GD1O 3AF1A 3JCZA 4K9LA 4WOKA 4NAUA 3KBBA 4R9UC 1NUAA 3QU5A 1PV4A 1QB8A 2R6DA 4DCTA 4OI1A 2W22A 1WVMA 3WMWA 2J45A 3PNMA 3HCWA 1E8MA 4E22A 3EEBA 1W0KD 5LZ5A 3EVEA 3WRXC 1J1UA 3GXOA 4CN8A 3O47A 2VHTA 4D9CA 4PC6A 1TTTA 3IVCA 1Q12A 1MA3A 4I2VA 4P7JA 3VXKA 1ICEA 1RPAA 3GFVA 4XB2A 2WTEA 1T3GA 2D13A 3HG7A 4PLZA 5IMBA 3VR5H 3FPJA 4JWKA 1B14A 3JD1A 5BQPA 5IF3A 2FSUA 4DMFA 2EARA 2PYDA 1QM5A 1SKUA 1V48A 2QTMA 4QDKA 1SZPA 3NVDA 1TYDE 2VZLA 3LXRA 3GLVA 1Z2PX 4RAQA 4BQRA 3ESXA 3K9WA 3TSZA 5DHRA 4BWYA 5D86A 3Q2OA 5TV2A 4UHEA 3FX2A 1U04A 4I3HA 2N1BA 4AG3A 2O0KA 3AI3A 1QE3A 3I58A 3L0BA 5AKIA 4YJDA 1PK7A 3TR0A 4PHTA 1WPQA 1DUSA 3RM3A 2BGUA 3E58A 3ENQA 4GNRA 1BNCA 1E79D 1KDTA 1UM9A 1F48A 3NC4A 4EEXA 4TWIA 1YL5A 2ECPA 4L4XA 2QI9C 4MICA 1Q20A 3QHQA 3BMOB 5JHGB 5JD5A 3D3KA 2X7HA 1EGQA 1W85A 4DJTA 4CKWB 3YASA 5AW1A 2EP5A 4KGZA 2KQUA 1DI0A 2GHIA 3ZQJA 2JLCA 1CFZA 1EM8A 1Z0KA 4JR2A 4NMWA 5LYYA 3DO8A 3T7EA 1FLAA 3TTYA 4ASUA 5L95A 2DXIA 2QLBA 2CT8A 1DG9A 1TC1A 1D6JA 2XZDA 4BVBA 3R9WA 3SC4A 3D3EA 2BL4A 1LDYA 4G8CA 1KYXA 4C08A 4LY6A 1IY2A 4BX8A 4DQ0A 2QAIA 3EEQA 4QKQA 1HYBA 2RHOA 3ROGA 1N4DA 1SU4A 4P4TA 3WQQA 2AJLI 4BMXA 5CEFA 5T67A 4HQKA 3K70B 2DLNA 2OBXA 5CNJA 1GZ6A 1YZKA 3H2BA 1G5TA 2C04A 1L1RA 1EVEA 2GN0A 1ID1A 2NZUG 3GVPA 4GUAA 4X63A 2JZOA 1IL0A 4YRMA 2CCJA 4MW6A 5F33A 2VBFA 4EEZA 1CUVA 3NBYC 1RM5A 4UNNA 4LJAA 4M0CA 4YRRA 4IUBS 1AM4D 1R0CA 4Q1BA 3UPDA 3UTCA 4ALMA 2CVPA 2Q6KA 3ZWDA 4M3NA 1Y3AA 1KC3A 2AN4A 4EPXA 3ZWPA 2R25B 3Q3IA 4KWIA 3QBDA 3KOYA 3SFZA 4D5GA 3F6YA 4WK6A 3QA3E 3ZJVA 3N76A 3WRVA 3QPUA 4I2NA 1H66A 1I0ZA 1QV9A 2RGEA 1MB2A 1Z4PX 2J1LA 3TLZA 1MT3A 2R1ZA 1AX9A 3H1EA 4HXFB 5EA2A 5KHAA 1JDVA 3ESZA 4X20B 4B34A 1VL6A 3EE6A 5GM1A 2FSIA 4D3DA 1W9HA 1MO4A 2J09A 2VTDA 1YR2A 3A9SA 5TMBA 1ZVKA 2YHIA 3EG9B 5EINA 4EX6A 5DYTA 4QYXA 3L5KA 2ZITA 1BN7A 1YSCA 1FU4A 3BK2A 2DZDA 3LGXA 3KSMA 3USZA 4ON9A 4YJ2F 1AOXA 2A8YA 2X9VA 5JXJA 5KPJA 1IIRA 4F72A 2D1RA 1KVTA 4WLNA 1HQCA 3K9FC 1HUQA 1IG3A 3INYA 1DTWA 3PC8C 4LPSA 2PX0A 3BZBA 4OKNA 1HFJA 3KHKA 4TXHA 2IPMA 4NU0A 4Q37A 4N1AA 3LCRA 4ZJZA 4E33A 2IYRA 1V5GA 2W00A 3OWXA 1KE2A 3E7FA 4I5IA 1UMDB 1YACA 4D9KA 4EHJA 1DWQA 3C1AA 1Z0IA 4BCDA 3I28A 3ESBA 4U7PB 4E1VA 1G41A 1CUAA 1Q7EA 3ETLA 3EXEA 1OV4A 2G17A 3LG2A 3CN9A 1QG6A 4PSKA 3CZMA 3L0OA 2MIIA 3ZVRA 4EKDA 1R9GA 1WXFA 2VPYA 1CUHA 1PZNA 3LBIA 5FXMA 1ZCZA 1M8PA 4FGSA 2B82A 3AVOA 5ALMA 5EEGA 3FNEA 1R66A 3PX2A 3BJZA 3RSQA 5EXEA 2G1UA 1S3GA 2EWWA 3OC6A 4LSZA 4OHXA 2BDUA 2VF5X 3LO8A 2AG5A 1P33A 3DAOA 1UC8A 3SNHA 4JLBA 3ER9A 1I3CA 1Q1AA 1EVIA 1GPH1 5JV5A 2J67A 3DS8A 4MKIA 1QJCA 4H2DA 3TRIA 2BN4A 2WIGA 3A1TA 3WWDA 1RJFA 1U7PA 3CH4B 4AP6A 3LX4A 3W1VA 1NVGA 4W4TA 3L8MA 4MB0A 5EWLB 1XKLA 3CEAA 4BE7B 4HBZA 4BNIA 4BHTA 4ZZ1A 2Q45A 2UVPB 5B1YA 1PDOA 1SOAA 2WM3A 2ODBA 5ICMA 3VR5A 4OH7A 4X6YA 1YQWA 4U6QA 3NDJA 3VHXB 2R4UA 5CAEB 3NVKI 5ITWA 3SIXA 3NJ8A 4TMTA 2ENWA 2O2ZA 3AGQA 3PPYA 1C4XA 1FNMA 1KZ1A 1SUWA 2BGIA 4WCFC 1UPXA 1ZUHA 2QV7A 3GNSA 2G08A 4NBWA 5DNUA 2ZBRA 1U1IA 3FTEA 3F3SA 4ZGBA 2DR0A 3TE7A 1N1EA 5J59A 2A9FA 2PWYA 2XCIA 3OU2A 2QENA 3UXYA 4AYWA 3UA4A 3TIFA 4CL0A 1DB3A 4D8WA 1G6KA 1FFHA 3RCBA 4CFZA 5HG0A 4F91B 1Z7WA 2C94A 2CCKA 4R1TA 2HU7A 2V7GA 3HGTA 3OPNA 1NF3A 3DE3X 3O3CA 5ESRA 1OI4A 4IJ5A 3E7DA 4C4SA 2JC3A 4KXYA 2QF7A 2XUPA 1GZ7A 5KDDA 3ES9A 3K9QO 2X77A 3S7ZA 3OJOA 2NYAA 2H1CA 4FK8A 5KYKA 3E5RA 5JBNA 4QFDA 1E4EA 3LS2A 5D51S 4WLEA 2FPMA 3WFJA 5HZMA 1YDEA 5CHYA 3N0RA 1QS0B 2EF1A 3UT0A 3OF3A 3H11A 1QV7A 1JALA 2BFBA 1ZM3A 4IDCA 1XZFA 4YY3B 5DN6D 3K0CC 4J4HA 2DHCA 1IJKA 1V16B 3S5UA 5HOQA 2IKSA 4PIMA 2CYBA 2V98A 2WJ6A 1YI8A 2V5AA 4OFBA 5H8WA 5DSZA 1Y82A 3HY4A 1ODSA 4RO0A 3AY7A 1Z28A 2AW5A 2JCXA 1X0XA 1PSWA 2WW8A 1ZOPA 2GD0A 1RWWA 2NTYC 4GYWA 2P9TA 3HKBB 4TTPA 4LI3X 5CYOA 4N0MA 5DEOA 5ES3A 1BRTA 3W6ZA 1DVRA 3GFSA 2ODWA 2F90A 2B5OA 3PVZA 4UNQA 4HQ6A 5J23A 4CTJA 1LQUA 3O4GA 2AFIB 3DVAA 4UMDA 4URUR 2CDNA 1Z35A 1PGNA 3QE2A 2FLVA 2G1KA 4Z8XA 5HFAA 1J70A 5GGYA 2UXCB 1VGRA 1XYGA 1ZH2A 1K9SA 1LQ2A 1HE4A 4RY0A 2BTEA 2Q5LA 3TOVA 1YQ9A 1PO7A 4OL0A 1VB3A 1X70A 2QD5A 3BEOA 3UT5B 2NZJA 5BW4A 3MJFA 8ABPA 2WJPA 1O6BA 3JWEA 4D57A 3K5WA 1WV0A 1ECBA 3L6DA 2PR2A 4B4OA 2B4AA 4PBRA 1Z08A 3L1KA 3O82A 3PQCA 1MN6A 1IXRC 3K8OE 2QT1A 3T9CA 3D6TB 4QRIA 5C0OE 4EPTA 4V0KA 3IQHX 2X3YA 1G9TA 3WQHA 1V1MA 2NXJA 4E5MA 2VWPA 3U7RA 1GN9A 4WZBB 5HXAA 4F71A 2JGJA 5EZYA 3GLGB 2CJWA 2OGSA 1N5KA 1JL3A 1K63A 4DG9A 1NQOA 2XWPA 5K8JB 1UK8A 1D2MA 1KORA 4E1BA 4ZAZA 3B9PA 3AR9A 3ETCA 4C6HA 2MYTA 8AT1A 1JG7A 4BBJA 1SB9A 3EVNA 3GGDA 3KQOA 4UZEA 1Y5MA 1UAAA 1J56A 2B36A 4OHUA 3WYFA 1GITA 4FWTA 3GN1A 4ID9A 1W4CA 1RAFA 2V03A 2NGRA 3L7OA 3CLUD 2R8RA 1NUPA 4G4SP 4KO4S 2YOFA 1CUFA 3M6IA 5E9QA 4F5ZA 1E6MA 5BVGB 3HE3A 3ZCPA 4DS3A 1TRHA 1PV2A 1JQ3A 4NY1A 2IP1A 4KE8A 4NMLA 4CKEB 5JJCA 3QMMA 3HA7A 2ZG6A 2G70A 5DGCA 5HMLA 1Z4IA 1JA0A 2OZVA 3UG7A 2ZIZA 2R7KA 4F5EA 1A9ZA 1ZGHA 2G40A 1R3DA 2FMHA 3QJGA 3Q9LA 4UXHA 3LUDA 5HCIA 1RD4A 2IYQA 3FAZA 4G2NA 3AFOA 5CD1A 2VS1A 1N0HA 4DHEA 1E3WA 3KCNA 2ZRIA 3OPYI 4M36A 3NWJA 4R8MA 3DDNA 4QPZA 4AG5A 1HZJA 3C48A 4OLBA 3CLSC 3FMVA 4N47A 1Z13A 1EHIA 1U0RA 1GNTA 4O4IB 4OU4A 1BDHA 1HC7A 1CUYA 3I8XA 2AXNA 2JJ1D 3I9MA 1DDIA 1REQA 3P2KA 2XNJA 1RZRA 3GIWA 5GV8A 5B2EA 2A84A 1BD3A 1UCFA 3Q15C 1OOEA 3GRAA 5I3ZA 1C0EA 1N7GA 3LCJA 3FPEA 2GKGA 3M4YA 4HDRB 1R27A 4KPUA 4MS1B 2Q3DA 4J0QA 1UAYA 1RKXA 4EA7A 1F9EA 4JI4B 4DUPA 2BEUA 5GVRA 4OHCA 3RK0A 5K8IA 3TK1A 2I55A 3ONNA 5L3VA 4DMCA 3AF0A 3M5CA 4QU9A 1OZFA 1SCKA 2C1EA 2R2AA 3H7IA 3LSTA 3LWZA 2X15A 3VPXA 3GB9A 1S96A 1EP1B 1WDTA 1IM8A 3P5BA 4DGSA 4IAOA 1L3CA 3C98A 1A69A 3H9GA 3NYRA 3R6LA 2Z1DA 3PJGA 2ADFA 3FYUA 3HEBA 2J7KA 2CLCX 1DX4A 4F8YA 3BHNA 4PAMA 1G5HA 4QQFA 1MV5A 3L6RA 4QFBA 1I7QB 3RS0A 1I7SB 3NFRA 4AWXA 1L7PA 1Y0BA 1X13A 4CIYA 2RGNC 1UJBA 4BGEA 4OFWA 2O2CA 1HDZA 3FMGA 2PGDA 2XCLA 2JPDA 4X8LA 1Q15A 2NM0A 3B60A 2ETXA 3RS3A 2Y0PA 1NDQA 4W63A 3VNUA 4TMKA 1T5LA 1VYTA 3IHLA 3KZ1E 4I6EA 2OQVA 5BXYA 1E60A 1R16A 2O8DA 3EVFA 3EXIA 4D79A 1RRGA 2AZ4A 1L4NA 1YFZA 2FWRA 3MJSA 3WLFA 3FYSA 3OMLA 2AFHB 2MINA 4GPZA 3RKSA 5M2QA 5FOTA 1PWZA 3MILA 3F6BX 2V3VA 1Q3TA 1X8LA 1I14A 1PEAA 3INRA 4U2CA 4Z7NB 2FDRA 1FBNA 3H2HA 3Q11A 2GN8A 3CHYA 3FPHA 2P40A 1XMOB 1K68A 1VIMA 5G41A 2JBWA 3PUYA 3QUBA 3WJ2A 3IVMA 4NS4A 4FMBB 3QPVA 3G9ZA 3FYTA 3U16A 2FSSA 3EQ6A 2VEDA 2WF8A 2CW5A 3O1IC 3P45A 4MR9B 3D4LA 4N0DA 5EUBA 3V4LA 2J6IA 4K8OA 2QZZA 3MT7A 1YDWA 5B1IA 3FUTA 1R37A 1E61A 1LLUA 3PF9A 3VFDA 5CP8A 3W6OA 1QR2A 1NI5A 2COEA 2H5LA 2A1UA 2JIMA 4LRQA 3VHQA 4XWOA 5H16A 5TJHA 4OOFA 3OEWA 4Q47A 2C2ZA 5FTMA 2J3DA 2B99A 4Z5XA 2BTOA 2D06A 2O5VA 4OYYA 4M9UA 4Z4EA 3KKMA 4BQSA 4QARA 4FFLA 2OPHA 4BN0A 2XMSA 1D4ZA 3N5CA 1GV0A 4FHZA 1E3QA 1CQIB 4UTZA 3WGMA 4Y6LA 3A11A 1OILA 2H4WA 1RI4A 1Q22A 4B7AA 4FKMA 2ZQZA 4GBGA 3RGGA 3BXXA 3C3EA 1HE2A 2CFTA 3JQGA 4L75A 2YFQA 3UJNA 1XZHA 2ERYA 4J7AA 1P2FA 1YQTA 4GOJA 4KBGA 2PS3A 2C8LA 3NV7A 1ML4A 3RJZA 5TLSA 1WPRA 3HFJA 4FYWA 1XAIA 4BCCA 4J1TC 5KYWB 1L6RA 3HA5A 1LY1A 3OZCA 2ZIXA 3QH4A 2PA3A 5G1PA 2YWEA 1KGSA 5LA6F 4CMCA 2OECA 4CKYA 4BOYA 1VYUA 2FN7A 3LUBA 2NVOA 2VP0A 3BPSA 1XYYA 3K1ZA 3NNNA 3NANA 1KMCA 3DO5A 4M9XA 2GDJA 3NDPA 4BMPB 5KVCA 1UQUA 2P9HA 4NZYA 3B1YA 1EHCA 4E21A 4MUJA 3DXZA 2QZ9A 3F5QA 3PNPA 1CEYA 3EVTA 5IK2D 1ZI6A 1U2EA 1GFZA 3TD6A 1YZUA 1BAPA 2QRQA 4RA9B 2GD6A 3FNIA 4KYIB 2B69A 1G66A 4GZ5A 3SHFA 3FSJX 3RR2A 3AVPA 3P94A 3PNBA 3GEPA 4R2HA 3RLIA 2VCHA 2WU3A 3OBIA 1E69A 3J7AC 3OQOA 5CB4B 2VNAA 3ABQB 3DHEA 2NYVA 2Q49A 1P0CA 5C7LO 4QBHA 3UAVA 1P0PA 4JVSB 3EOBI 3LT5A 1BW9B 4GGOA 3A4NA 4NXMB 2DPMA 1FXUA 3TW0A 3KL4A 1XVUA 2W2LD 2I6UA 3GLFA 1UZNA 2YVQA 2R8BA 3PEUA 4A2QA 1L4MA 1UKVY 5FPQA 1QZ3A 4B3HA 2K4MA 5CDFA 2AUMA 2FG5A 2IP4A 5CURA 3WKBA 2C4NA 2XUHA 4EARA 5HBRA 1GKLA 3VZCA 3E61A 5AP9A 3ILHA 4LCEA 4XCQA 1DEOA 3O95A 2OR3A 1L8XA 2BAGA 2J3MA 3ZK7A 1ISMA 1N2SA 2QTZA 2RHDA 1RI1A 4F6RA 2EP7A 4DUYB 4NZMA 4XPIA 1U7HA 1FQOA 2WA1A 3BHJA 4G4IA 3N0XA 1KSFX 3E70C 1S1CA 1DUIA 1NMEA 1PGJA 5K9ZA 5JTTA 4PZCA 1OA0A 1L4BA 3PUVA 1QPZA 4NABA 2OHFA 1UWCA 3F5MA 2WJVA 3DO6A 4LXQA 4PGMA 4CMEC 2UZ4A 5DI3A 2IYTA 1RZVA 5JRZA 1M2EA 1W5AA 1CR6A 1OYYA 2Y1LA 2IBSA 3TUIC 3AY3A 4CEHB 3CEPB 1KNXA 1ZUD1 3COYA 2GESA 4ZV4A 3L1JA 3MBIA 2OAGA 1H23A 3R20A 2FN3A 4QDUA 3IDSA 3QMWA 4E5KA 4QGAA 2XCTB 1D2EA 4AJPA 4CMIB 4NBLA 1HX7A 3MS7A 2BGMA 3KELA 4TT8A 4KXLA 1POWA 2YXLA 2OHVA 4DMMA 1FNCA 4J6FA 1IWBB 1KI6B 5DYGA 2UUPA 4H35A 1XZLA 2IIBA 1RE0A 4R7ZA 2XYRA 2B1GA 2G6BA 4PTYA 1XF1A 2D7CA 2UZ3A 2PT7A 4KEAA 3FVWA 3OX3A 4WAUA 5KDOA 4K9NA 1L3BA 1II0A 5JMTA 1AURA 1V1JA 2OEPA 1MB9A 3BHIA 3L0YA 2OVBA 4LGYA 4ZT3A 4KQ2A 3THRA 2ZULA 3MINA 5A9SB 3KBOA 4RTOA 2G72A 3QVSA 4J2HA 3JXEA 1V9SA 4NE9A 1QTRA 4EB0A 1YJXA 1DKPA 1W1WA 3TINA 4BVLA 1N25A 4ETMA 1GR1A 4E7OA 1KH3A 4OSOA 4WQMA 4FFSA 4GBMA 1A7JA 2OYSA 2NPFA 2Q2NA 4C4RA 5BN5A 3PC6A 4FDUA 3ANSA 2OXCA 3EASA 4QGHA 5DXAA 2FG7C 4EL5A 5JS8A 3EY4A 2BW0A 1L6IA 2GBLC 3N7TA 4IF6A 3BFPA 1MOPA 3I2HA 4X7BA 3AI1A 3ZCTA 4DY4A 5LXTB 3COJA 4JI0B 1LK7A 1M2OB 4EF6A 1F5SA 2PUHA 4B43A 2BWJA 1P1FA 4ARAA 4R2MA 1CJVC 5AHXA 1MH1A 2FN4A 2NTNA 2EWVA 3ESRA 4BAUA 2G9ZA 4GRIA 2O20A 3E81A 4HLUA 2WTNA 4P5EA 5ALUA 3W6UA 4DG5A 3MBKA 2NPIA 1UMBA 4TQAA 4ZVQA 2VAMA 3GNQA 5CM9C 5F76A 2OMEA 1JPVA 1T1JA 1ZK4A 1Q0LA 4JLSA 1R18A 5ARCA 5GV7A 4ARZB 2H52A 3TUJC 1QAMA 3TTUA 2RHMA 3U6BA 4F93B 2Y76A 5LBUA 3UG6A 4G0MA 2GBIA 3D4OA 4RJKA 1EESA 1GUYA 4H7KA 5AM4A 4BMSA 3T5DA 2QQ5A 3MMPA 2P2DA 1SOMA 1K0UA 3L9WA 3MTQA 4F6LA 1QGED 1XI2A 2XADA 4N82A 4Q1FA 2CBGA 3BWXA 4LYDA 4P3NA 4OV6B 3OFNA 4BL5A 2WWIA 1XPRA 3WSVA 4LRYA 3ZE9A 1AY0A 1QO0D 4MKRA 3IJRA 1AQIA 2C8JA 3FCUB 2TECE 3N70A 4BUCA 3WLHA 1O95A 2RK6A 1KHTA 5BMVF 4WBXC 1FX1A 4IXTA 4B17A 4YCSA 2IOHA 3MN1A 4H1TA 2JGAA 4JX8A 3RSLA 4UCXA 3ZDYB 3QVGA 2GASA 3JQPA 5EJ8A 2ZUEA 2LDBA 4D92A 1UFRA 2BFFB 2C31A 5CVTA 1UBNA 1TI7A 4L8VA 2GEJA 2HH9A 2C82A 4PVCA 1GXSB 1L5ZA 1DBQA 3OCVA 2XLCA 4LKRA 3MT0A 1K3TA 2CNLA 4HLQB 4B3RB 4AF8A 2AIRA 4QX6A 1TAQA 2CXPA 3BMCB 4HAVA 1JHZA 2OHOA 1AVTA 3DZJA 4QQ8A 4ZPXA 1M34B 4URXR 4MUGA 2RBKA 3PXBA 4PNZA 1LPPA 2GTIA 2IYUA 3N2NA 3T3MB 3GLFE 4DDKA 1WW2A 2V5UA 3RU7A 5M34A 1N6OA 3HB5X 5JMWA 2ZZKA 4G0UA 2A0FA 3Q5EA 3WX0A 3DBLB 1E7QA 1U2QA 2E37A 2QTHA 4WVLA 2GFQA 4R8SA 2FCAA 2ON6A 5BUSA 4PCUA 1C41A 5JYEA 1XIVA 1ESEA 1U2GC 1BWSA 2XUAA 5KYVA 4F9TA 3EWIA 3V7NA 4PZ0A 2GEVA 1I24A 4E46A 5K5EA 3RHZA 8MHTA 1L4YA 3G2PA 4B9EA 4CG0A 4X20A 3KSAC 2FMUA 2ZTLA 4K9DA 2GSWA 2R68A 2VQDA 2O2XA 4MAMA 2OK8A 1DRVA 4TM8A 2CLEB 2X2EA 1OHHD 3KVOA 5U4XA 4DNOA 5CVJA 3VTKA 4E30A 1M6VA 3SS8A 1FA9A 2NMVA 3CX8A 2WICA 2NZVG 5I01A 3KSBC 2NNLD 1ZX1A 3I5UA 1U5BB 3GLKA 1NYRA 2Z9DA 3H8WA 1NTOA 3HY3A 3MMZA 4IQ8A 4OJNA 5CUQA 4LVCA 4MP6A 1B1CA 4D4IA 3QVVA 4V1CA 2JH3A 1SUAA 3X1JA 3AZOA 4AJHA 3AF6A 4RGYA 3OF2A 3SHOA 4H6VA 4R6XA 3F7MA 3V6MA 1P2VA 2HPZA 4HWTA 3VH2A 3P0HA 121PA 4DIBA 3EOAI 1EVKA 2RKOA 5KU7A 5IHPA 4ER3A 1CR4A 1ORDA 1U1GA 2W0MA 4ILEA 2UV8A 4NZZA 3KDAA 4PFKA 2W6OA 4DF3A 2C59A 2QM7A 3EGDB 1II8A 1NVDA 4OFXA 4DQXA 2P65A 3MBOA 4DRXB 4DJJA 1N5OX 2F3UA 2BM0A 4BO5A 4CUJA 2LWIA 4LOKA 3RFVA 3CRW1 3UAWA 3C3WA 1R0RE 4UNPA 1I10A 4EKNB 1E0AA 2UYYA 3ZWXA 2XGJA 1RQRA 2CJFA 2FF7A 1KAEA 4JBLA 2O2DA 4TV9B 5DB4A 3H16A 4RH1A 3A1UA 1E5DA 3IA7A 4CIVA 4LGVA 3UOGA 3UFXB 3ZWWA 4CUZA 2QN6A 4XUCA 1W47A 2EDAA 3CH5A 2IRWA 2TMYA 3AUSA 3KT6A 3KXDA 3VOTA 3WWEA 4KR6A 2G71A 3H3JA 3PHLA 3KJZA 2WRZA 1T2AA 2YCLA 5IC6A 2FE4A 4Q3OA 2PSEA 1F1JA 2Q21A 4ZD6A 4ZJPA 1ZITA 3EEYA 4PZPA 2PMEA 2V1UA 2VDWB 2AMVA 5JSZA 1NAIA 3LC7O 3MRTA 4XGIA 5ESXA 3P71T 1NW5A 2R1VB 4F12A 5K6RA 1XLWA 1RAGA 2ERXA 2WWTA 1QRAA 2PCJA 1QB7A 4U0KA 1QGZA 2SHKA 1MMFB 2H51A 3AEXA 2OGUA 2EFYA 3HH8A 4Y6GB 5KSWB 1OLUA 4F7WA 1JEDA 2QRHA 2FMXA 3BOSA 4ZAYA 4DR1B 4Y18A 5ELMA 5CFMA 5KKNB 3G8BA 3HJUA 3FPAA 1Z8HA 2JZCA 3H42B 4LE1A 5FLYA 3WB0A 4JL8A 2B1JA 2OQIA 2G7MC 2PS9A 2F3QA 1M6WA 1ND6A 3PL1A 3UCEA 5DZSA 3PFGA 2C92A 3L8EA 4HFNA 3RFXA 3ZY6A 4JJAA 6LDHA 3D4BA 4Y2HA 5IT0A 3P96A 1PR2A 2BE7A 1LLCA 1NHGA 1PFKA 1WR8A 4JEMA 4LYJA 2ZTSA 1SC4A 3PUWA 5IHXA 1M2HA 2IYWA 4BIMA 2YWHA 4X91A 4TOIA 5JFOA 4MWDA 1Z17A 4C5BA 1XPUA 1CERA 2XYGA 2R6HA 3PGKA 2OESA 5C52B 1Z6PA 2ZYAA 2Y4OA 3E3NA 2O2IA 2I54A 1AG9A 1GLNA 3EZLA 1RWNA 3RNOA 5EIBD 2DFLA 4BNDA 4JI8B 4BX2A 2OGTA 2DAPA 1G1MA 2WSIA 2ZYDA 3DLPX 3N2EA 3QU9A 3TTSA 3UXMA 3P9SA 4FN5A 2O2SA 4E5UA 2V7WA 1CC1S 1DKUA 2LIVA 1CNMA 1J97A 4KAJA 5ALHA 5J9FA 1C9JA 4XLTA 3HFRA 2VJNA 4G5RA 1I4WA 3DKRA 4LV6A 1GZ4A 4N03A 1PZGA 1Y1RA 2W6JD 2Z9BA 3HLKA 4LJ8A 5HP4A 4IQ4A 4ZI5A 4A6EA 2OV4A 3W2GA 4E6PA 2EFJA 4R2IA 1RLJA 3X43A 2GZ1A 4I9GA 4YMVA 2G9NA 3AG6A 4Y6SA 5CA1A 4M1EA 3MF4A 1J90A 1XZGA 4UHCA 5HE8A 3ZV5A 2ZIFA 4JIMA 3WGLA 2PUFA 3COZA 4HGRA 4IS3A 4BUJA 4TT3A 2HK7A 4JOCA 3CEMA 3ITDA 1UXIA 3KJHA 4UUBA 4ND7A 3E9MA 1EYZA 4NJMA 4U5XA 4WKPA 5JNTA 3S3TA 1LZKA 1CZOA 3GFTA 2XCUA 2C0PA 2J08A 5LOVB 2RBEA 4DILA 4MVJH 5NLLA 1KA9H 2FWMX 1UPFA 4B8YA 1S2NA 4R71A 2IV3A 1UBGA 4HAOA 4KO1S 3AHJA 2OGZA 4RM3A 1W0JA 1QZTA 2KLHA 4KK4A 3WLJA 3U60B 1U2DC 2DOKA 3P20A 2JA1A 1G64A 1HEUA 1Z4QA 1KYQA 2VJAA 1WVIA 4RHEA 5D85A 3TJMA 5B3LA 1IOWA 1U0OC 2VK1A 3OETA 4HOYA 4NOJA 4XGNA 3SR3A 5DCYA 1EFCA 2PVSA 3A2LA 3DPIA 3E82A 3S27A 3VVLA 4JOQA 2VNHA 4M7PA 4MUMA 4EITA 3DR5A 1KI4A 2IYYA 3CIFA 3ZJ4A 1ZWKA 2ZYGA 3AZPA 4WKBA 2AUTA 3DNMA 1E9BA 2RJOA 1E1CA 3JQQA 1P4JA 1SG6A 1QKJA 3QEAZ 3JQFA 3KQYA 3M9WA 3PDUA 2FWIA 4XPZA 4F0JA 3KWLA 2X7JA 3BJRA 4NE2A 2FK8A 4TS1A 4BFWA 1NY5A 5AKXA 1P1KA 5BOVA 1VE5A 2RGDA 1GZHB 4G41A 2XTNA 3ND6A 1A5TA 4LZJA 5D87A 5EQTA 5A5EA 4CEIA 3GNTA 1GPNA 1KI1A 3S2FA 1XWWA 2VYFA 3KZVA 3KZMA 3HVRA 3WYBA 3P27A 1SUIA 5KX5F 1PVVA 1P4RA 1RYDA 4FMDB 4EK9A 3TECE 2XKKA 1R9MA 4JFAA 2WKRA 5ALQA 4AS2A 1CRWG 4PNPA 4RVSA 2PGJA 3KQQA 1U3CA 5IJ9A 1XEFA 1F6WA 4JODA 1LX6A 4BLPA 4Z7JA 2Q5IA 1GIAA 2O23A 1LSOA 2PJDA 4LHSA 4TL8A 3C4VA 4WI1A 2BMAA 4CXMA 1NVXQ 4O08A 1SA0B 3KYJB 3T3DA 4ZOCA 5AO9A 3IXLA 3RWBA 4BJ1A 4C4TA 4XTCS 2ZSUA 5F2KA 3LLUA 4EF4A 1ONNA 3DWIA 3FTDA 1D6MA 4KDEA 2R6AA 4ZT2A 3IJ5A 5KWVA 4EKEA 3MJ4A 5FOUA 2ZKIA 3M82A 5AK5A 3TFWA 1BKDR 4CF4A 4EIWA 2PZKA 1LRLA 3RTCA 1UMCA 2VQ6A 3QOXA 3GR6A 1L4HA 4EF5A 4J7UA 2LP4Y 3I9V6 4BB5A 1JR3D 2HA2A 2KE5A 2VUIB 1TYBE 2V45A 5IYZB 2Q1XA 3UNXA 3K0AB 4OO3A 1T9KA 2YZKA 1EBFA 1OXBB 2IY9A 2VXBA 3DL7A 4KTTE 4MPDA 4UAGA 4YP9A 3RJTA 1H3NA 2CXXA 3M6LA 4KXQA 2GM5A 5JXIA 1N3BA 1B8OA 3BGVA 4OGFA 1DXQA 3K9GA 3LLSA 4YRFA 3ZX5A 5IVPA 1K5HA 2OZKA 4UQPA 3VR3A 3ZGYA 2E85A 1LQTA 3R5KA 5KVQA 3ACCA 4XJTA 3HXMA 2DTEA 3H4MA 4HN2A 4HNUA 3B38A 1I5RA 4ZTBA 5J58A 3K8ZA 4L57A 2JIZA 1FYFA 5JZSA 3F2IA 3TLCA 1RS0A 1Q1ZA 3LXXA 1P9LA 3O38A 3CF4G 1JAIA 4MVCA 1J8QA 4KWHA 2WLTA 1IY8A 1JHUA 3ACBA 5BWLA 2AV6A 5INTA 4DL9A 1L8OA 4HO1X 4U7TB 4RORA 3WHIA 5F12A 3UANA 1G59A 2Q2VA 3ILSA 1DINA 4RZHA 4CLRA 2NP6A 4ZCLA 3THYB 5D6NA 1SHLA 4TKUB 2HN9A 1OD6A 2PPVA 2EQBA 3ETDA 5B7NA 1A8IA 1KMNA 3GAMA 4I99A 3VV2A 2CNBA 1LK0A 3CLUC 2H29A 2GCPA 2QTTA 5IAEA 3WO1A 1YZGA 3N3BC 3FOFC 1SPXA 1EJ2A 4EY4A 1T8PA 3VC7A 4ITRC 4E2XA 5IAOA 2G1PA 4NYMR 4ENUA 3BEDA 2Z0MA 1P1IA 1VCMA 5C1OA 1JDPA 4C0AC 4BMZA 1ECJA 1HOXA 1NA5A 1XQXA 5JLAA 3AVVA 3GJSA 3K0EA 3LP8A 1LPNA 1WVGA 4Q9LA 4FILA 3RRYA 5KI6A 3P97A 3WNZA 3I0NA 4HMQA 2VL7A 5ER6A 4ICIA 3GRPA 2AFIE 2XUJA 3TL2A 1ADJA 2GSDA 2HLNA 3BMNB 3I52A 3EHEA 1KYYA 3RI3A 2IH5A 2D59A 4Y1FA 1OI2A 5K0BA 3G85A 1NAHA 3OQHA 5AD1A 4MVJA 2B35A 3HGMA 3STWA 2ZE5A 1ST2A 4ND8B 1VL8A 4Q12A 1E3LA 1Z33A 2QXYA 1NURA 3O3NB 1HOTA 2PD6A 5EJ2A 3VI3B 2EZ4A 4NU5A 3JRWA 2ZBGA 5TEWA 5I9NA 1NQUA 4FS3A 1A5AB 3AUJB 2C7GA 4EG1A 5HM6A 4GM1A 2EC5A 5ECWA 2EX1A 3T4PA 5ERGB 3NBQA 2AQ8A 2W8ZA 1WDKA 3NJRA 4EUSA 2JLYA 5EJ7A 4O1MA 4IDNA 1G21A 1N5IA 4REMA 2O8FB 2W37A 3F9CA 3A9TA 5G0VA 4JXJA 2ODPA 4M6WA 3HCAA 1KJQA 2EFHB 4YBZA 5A03A 5GVSA 2C03A 5K1ZA 4ANFA 1JLMA 5BWMA 4TMFA 2BPOA 1PE0A 3H9QA 3WNVA 5E4FA 1Z6TA 3SYRA 4LOLA 2XCRB 4AQYB 3GJ4A 1SZDA 3UB4A 5ICEA 2FQQA 3JTEA 5LQUA 1Q6YA 4NYMQ 2VQSA 1AK9A 4KVZA 2H1SA 4S3MA 3QX3A 1GAXA 4JJZA 4TGLA 3VHLB 3WGOA 1EQ2A 1M1ZA 1BEUB 1YKGA 1YB6A 4G8BA 1W2WB 4WX2B 3MYRA 2CNWD 2Z2YA 4AX8A 2QOEA 5KPDA 1ZONA 4CIBA 3IRVA 2GK6A 2NVUB 4OQLA 4BEBA 2PT9A 1P31A 2VQ3A 3QSGA 3JALA 4J0FA 1B7GO 4UC0A 2MSEB 1BMDA 2IV7A 1Q77A 5LM3A 2GD2A 5ARDA 2B21A 1L4UA 1LS1A 1CHDA 4YUVA 1F2TA 2JBHA 2A92A 2YJGA 5DHSA 3FOAA 3QNWA 4DMGA 2AZXA 4YUZA 2BELA 3AG5A 4Q02A 1OAAA 4PFQA 5JVDB 1NFFA 3W5UA 5JS6A 4II7A 5AVJA 3R6TA 5L4NA 1QKKA 4G81A 3GFGA 3I04A 4KE9A 2JF0A 1ENYA 5BUZA 2FV8A 2OOSA 5CBKA 5AOBA 1JSLA 5T4EA 1IZ7A 3GRYA 2EVWX 4A82A 2G82A 3G5MA 3TZQA 1GO2A 1RJWA 5BSGA 3QWIA 3OQ1A 1CEXA 4JOBA 5LZ9A 4TV8B 2IX9A 3BCHA 3FUVA 3Q6NA 4ZDIA 2QE7D 4FIZA 3EHDA 5IULC 3MRSA 4FONA 1OU4A 4I46A 4LDPA 1EBBA 4NMXB 3U4AA 3RT7A 1H3EA 1H8ED 3TSOA 1V35A 1PS9A 2X0KA 2VHZA 1VDMA 4RS4A 5FLXA 2BBSA 3AT1A 4MGIR 3BTVA 3TCNA 3K94A 3H75A 1W48A 1JHQA 1OFGA 1FFXA 3BRWD 1XUOA 2A5YB 3DGFC 1Q3HA 2Y92A 3JQ6A 3W2HA 3I23A 1W93A 2BMVA 1T9HA 4M8IA 4B32A 3PE6A 1HDOA 2W2PA 3I6IA 1UDWA 5AXAA 1XRMA 3VU0A 5CJPA 2FMTA 4HY3A 2DX7A 1H2EA 1JPNA 1C8BA 4DLZA 1RJDA 4TLMB 5FORA 3B1WA 3A4YA 4PIPA 2QTRA 5THKA 3GLIB 2BSQA 1FFDA 1NUSA 1VXRA 4F8EA 3KKOA 4KDCA 1S8FA 2QTFA 3R2JA 4LDNA 4KSBA 4LSMA 3V3KA 6NULA 4J0EA 3F90A 5K0ZA 1W6UA 1C80A 3EQ2A 4P32A 5AICA 1FU8A 3QYPA 2G0NA 4W5JA 4ER7A 2O8EA 3DBVO 4JJ6A 3M6WA 5BXQC 5KJFA 1T8RA 4B3MB 4Q1DA 4DZRA 1K7CA 5JAQA 3L18A 3AFHA 4J3JA 2AFHE 2PR7A 3L0DA 4EABA 3D7NA 3H6HA 2OT3B 2P2SA 3QMVA 4YJ3A 4D6PA 3PEEA 5ESDA 3T1QA 5JQGA 4JP5A 1QIFA 4YB8A 2J5BA 3CMMA 5DTRA 5EWJA 3QKRA 4DGQA 5BSWA 1AO0A 4NE7A 4UTPA 3ZHUA 1BXGB 3MRXA 1VE6A 4M1KA 2K7FA 2QQFA 2R5WA 2BEKA 1KK1A 1LK5A 4EHNA 3AL0C 4HN9A 3LDGA 5JZBA 1TZMA 3GYGA 3IOBA 4IGKA 3CS3A 3GLHA 3Q7RA 3QV1A 4PAWA 4KGXA 3D8TA 1RAEA 2H6EA 2QTWB 1O6ZA 3KVRA 4HWOA 4HTAA 4M21A 3RS2A 2L18A 2M6LA 2BLNA 3QFCA 1ZPDA 3L7DA 2DVMA 1CS0A 1OX4A 2WJYA 3PNVA 3NNDA 3UK1A 4OAQA 4EJFA 4MRMB 1J8MF 2BTQA 4JXZA 3KDPA 3HNOA 2HHLA 4OQMA 4PPNA 4EYGA 2P6RA 3LKVA 4WADA 4DTCA 4NNJA 2HPHA 3KVVA 3AI2A 2YIDA 1G21E 1YR8A 1SKBA 4P3PA 1UR5A 1G8PA 1Z5WA 4L50A 1YXMA 1OWLA 2C61A 4GO1A 5CLIA 5REQA 2TSYB 3RUAA 4DLLA 4AMZA 1VSQA 2AW3A 4L3VA 1EWRA 1T4CB 1AUXA 1TA4A 2FPSA 3NTVA 1GPBA 5ULLA 4ZKEA 4FXOA 1Y33E 1Q6ZA 2D1YA 1LNZA 4HAYA 4RY2A 3DKPA 2OILA 2PA0A 2Z9CA 2ZSIA 4OQPA 4AYTA 1YS9A 2C9DA 3EAFA 3NVMB 4FSDA 5EIAA 2VTKA 2Q3FA 4J29A 4WCFA 4D97A 1FPMA 1WF6A 3SQLA 4BRUA 2ZYWX 4QPNA 3FHJA 2DSNA 3KEGA 4GBED 4RFSB 3PQ8A 4CF3A 1XCJA 1ZRMA 2JGKA 1IZ0A 3EK2A 3TXAA 1B1AA 3D8NA 5AI0A 1JB9A 2JFGA 2Q3BA 3OURA 3LNTA 3NHPA 4HDMB 4UUMA 1N4AA 1XD8A 5LQKA 3A1VA 4A27A 4OJTA 2M6SA 1QFJA 4DZTA 3CRRA 3JZIA 4BV9A 1EDOA 2V7QA 1L8QA 5J2TF 1T6XA 1C0PA 1JIXA 4HD8A 1VKJA 4GGMX 3RUIA 4QTUB 4MI1A 5ALEA 1P1BA 4YJFB 4F4IA 1KZGB 2HQBA 5HDBB 3M81A 3LGAA 3Q6IA 3RG8A 2GARA 3F49S 4Y2YA 5BSMA 3RUHA 4CI0B 2RHLA 4PSDA 1B74A 2EJWA 2IOFA 4MPPA 4DBZA 1E1NA 5JPCA 1QIIA 1WB5A 3NCHA 4NBVA 4BFTA 5CYGA 2BDEA 1NLYA 2BBOA 5K09A 1RXSA 3I45A 3OM0A 5IEBA 5ICSA 3STYA 2CSUA 3OJ0A 1C9MA 4BXOB 3K0CA 3KKLA 1GT91 1V9LA 2AMYA 4IP0A 4G01B 2PWPA 2ODTX 4K6GA 2Z5FA 2W42A 5ICGA 3JRNA 2Q07A 1I5OA 3PXEA 5KTKA 4DR4B 1X42A 5CR9A 1UC4B 1YI1A 4Q3KA 1Y7TA 4RD3A 1RHMA 3ZU5A 4ZVRA 2HMTA 3P1JA 1ULZA 1EJBA 4G5SA 2HSDA 4HCJA 2H1OA 4RLSA 5IM5A 5KNCH 3AQ4A 3TQOA 5LDHA 1Z7EA 2BGJA 5J2UA 5EMMA 5C2JB 1SHUX 1EWYA 2Y1EA 3L07A 1JMVA 2WM2A 4WXEA 5BURA 4K2HA 4QG3A 3OWHA 4ZYYA 3HHEA 4NKRA 2ECQA 3FLAA 4V03A 1OPRA 1Q83A 5C8YB 4MAAA 1XZDA 4TTTS 3GFQA 1E6EA 1R7RA 1SN7A 1UP7A 1GUDA 2ATXA 1DIOB 4OLAA 1TKRA 3CPHA 2KB0A 5GIPE 4W9RA 2B8NA 3BE8A 2XDQB 3FKSD 3GCDA 5FD8A 1TXGA 1G16A 3OM1A 1GARA 1KFKB 2OCPA 2GJAA 2PTHA 1DKLA 2I7TA 2WC1A 3LW7A 4GZMA 3C15C 3D4PA 5ALDA 1WB9A 2J4CA 5EHXA 5KUTA 2FUKA 3E23A 2XIJA 3DE7X 3Q2KA 4BVJA 1Z0UA 5ED4A 1B6GA 1I8TA 4JVLA 3RBXA 4QHTA 1CEQA 2IZOA 2C20A 3TDKA 4CTNA 2WT8A 2H48A 4L5JA 1RC8A 3N8NA 1MC4A 1UUFA 2HMYB 4Q7QA 5K4GA 2GJ9A 2ZS8A 4X8HA 4BNJA 1P1JA 2EJTA 4L7QA 5EXXA 3L7LA 1N3YA 3ESYA 2O4CA 3LYLA 3BXPA 3TQIA 4EA8A 3SSAA 2ZCVA 1G0NA 4EFMA 2YRWA 1JXAA 4UDXX 4IGFA 5HWSA 5L6MB 3E22A 4ND3A 1J09A 4GU5A 4LJKA 4Y0VA 3FRIA 3W2TA 4AY2A 4HNQA 4I4IA 4JZYA 1X2BA 2PQMA 1BA2A 2J6CA 2QZJA 4JC4A 4MWBA 4WDQA 4X8MA 3FTCA 2ZM6B 4X41A 1CJSA 4WNIA 5JROA 3G9UA 4JUAA 3GLHE 1RAIA 4B6GA 1RKVA 2PUVA 2VF7A 3PGXA 4E09A 1QPBA 2WJHA 2X5KO 1EFPB 1GA4A 1ZMRA 4ZEMA 3M1LA 3KUCA 3FR7A 4Z9FA 1N8KA 3EVBA 3H5IA 1Y5NA 3QXHA 4B2PA 4D4LA 4ZVPA 3PDJA 2HK8A 5DRTA 5G4KA 3GELA 2R8YA 3UO8B 4F4CA 3EIOA 3Q40A 3DPSA 5TE9A 3NYWA 3CNNA 3OE4A 1EK2A 4A8TA 4CODB 2DERA 5CNMA 2JIDA 1ECFA 5BNFA 2O57A 3ZV7A 3QTBA 2GN4A 1CB0A 2CK3A 3GJ5A 3KX2A 3T7AA 1F2DA 3DZ8A 3GA5A 1MO6A 5JBIA 3ZC3A 3EZNA 4XGQA 3OEED 1D8TA 5E9AA 1H1LB 2NUPA 3QP9A 1BMQA 2CDCA 2XOKA 3A37A 4M87A 1YE3A 4ITVA 4RXTA 4XIJA 1YMQA 2RKBA 4P2BA 3REQA 4JB3A 3IUEA 2IGBA 3PQ4A 4RCYA 2EWMA 5EQFA 5DNVA 4F04A 3AVUA 4Q66C 2OV8A 2ACKA 1YQDA 3LQ1A 1KTVA 1W46A 1FP1D 1WBJB 2PQ2A 1T36A 3B3AA 2CV1A 2JW5A 4EHLA 2JFXA 3RVJA 4GF5A 3UMSA 4X54A 5HS4A 4DC9A 3AFGA 1X15A 5EVCA 4ENSA 1TOAA 2FETA 1ESZA 1RDFA 3ZYCA 1R8SA 3O4VA 5EP3A 5HCNA 3DL4A 4BTVA 2YBEA 2J6HA 1VSVA 3WLSA 4IIDA 4MJLA 3F74A 3ND5A 4IIJB 2XIQA 1E7MA 3FWNA 3H83A 3ZGXA 2IZ6A 4NCIA 3V4RA 3UAYA 4L74A 3BRSA 2DWQA 1JE0A 3JVEA 2C78A 4Q9JA 3T38A 1M7BA 3WKAA 2ZVJA 1KBZA 4FGUA 2H11A 1N6NA 2XCSB 3HKDB 2POQX 1Z3CA 1X74A 2OLKA 1UKCA 2QNRA 4G37A 3N75A 1VP3A 1GUAA 2ZR9A 2AOUA 3WOHA 2FG6C 2ZAIA 4QXPA 3VR2D 4RZQA 1IEWA 2VN8A 1BTOA 2HCTA 4B87A 1O9GA 1PSDA 3G2QA 3LKZA 2RGNA 3AUYA 3PPWA 3N8HA 3OX4A 4FFBB 4K0RA 4RF2A 5E7IA 1CQZA 1QVRA 3IAM1 3V8MA 4F4FA 3WRYC 2GTPA 5AXDA 1G3IA 1SQ5A 3M4JA 4PX2A 3UXHA 2P78A 4YRNA 4A0GA 4ZJUA 5JE8A 1CT9A 1QP4A 3D7RA 2OWEA 4OH1A 4E88A 2CDAA 2H3HA 2IDZA 2Q2WA 1U1FA 2R11A 1J23A 1VJDA 3V42A 4OGLA 4G0ZA 2PRSA 2ZP1A 1P5RA 2WSSD 1CVLA 3ZXYA 1Y89A 2QEQA 2Q4EA 1DAKA 4KQKA 4Q0MA 4X00A 3VRHA 5IZ4A 4C3VA 4PFSA 5ALFA 3TNYA 2X8AA 4DIKA 3NHZA 3LYHA 5E6RA 3DOJA 5JPIA 3V2UA 1LPMA 4QNRA 1SVMA 2QUBA 2YV1A 3IQWA 4WJZA 1UINA 1C8KA 2JZNA 3B1FA 2RHBA 2H4FA 1G8YA 4MDEA 1ATIA 4S1WA 3DXXA 5K6TA 3KJQA 2QD1A 1Z4MA 2B37A 2VDJA 3C6KA 4UREA 1T3LA 2HWYA 3IDOA 5E7MA 4ZAVA 3RU2A 3IODA 4DMRA 4IMJB 2M9MA 1D04A 2GPYA 3OE7D 1QYIA 3A7EA 1YJAA 1ADGA 3KLOA 1X0VA 2HZBA 3B70A 4JD5A 5H3HA 4AS3A 4MR8B 2XDAA 2H2WA 2A1TS 2QMOA 3Q7SA 4J91A 4MUXA 5EIBC 1YCFA 1F8YA 5KINB 1F0YA 3M9LA 4H7PA 2OCGA 2MJLA 4JQSA 1AQYA 2F3RA 4LI0A 4YCAA 5EYPA 2F2TA 4O2AF 4ZYZA 5ELLA 1JU4A 2ZZMA 5FPYA 4YIKA 1U0HC 2A9PA 1EK5A 3EXG1 1L5VA 3G5AA 3TOSA 3NW9A 3ZWAA 2O3RA 2Q3HA 2ZQ5A 3HSSA 3BK1A 2HF9A 2NZ2A 4JU9A 3U9TA 4DCNA 4F2DA 2XKBA 3LUJA 1JJAA 4IDPA 1P62B 1V41E 2AF3C 2WSBA 1TJYA 2ZAYA 3DHYA 1Y1PA 1IQ0A 1T1GA 2YN2A 3KJIA 5ERYA 3TLMA 1ZJ4A 1NXQA 1G1AA 1UBSB 4O33A 5TQ0B 1KVUA 3AWIA 3ABRB 2HDWA 3N2KB 4CMJA 2GA9A 4KIGA 4JI7B 4Q18A 2FVXA 2PWZA 2QXUA 2BY4A 4W8HA 5JD4A 3RT1A 1O7JA 3JPYA 5CFPA 1KQFA 4FHDA 4PX3A 4J4BA 3DYVA 5FOXA 4BASA 4B3JA 5LMNB 1WQ1R 1NMYA 1YRLA 3IXQA 1M33A 2VRNA 2PH7A 4K86A 3U4QB 1FFYA 1A77A 1ECPA 1KOFA 2VUTA 4GP7A 2I3ZA 1AUVA 2IUSA 2PMFA 3ONVA 2OZPA 4LZAA 2IUEA 4P84A 3WLKX 4DRYA 4IM7A 4DWVA 1JPUA 1ZMTA 2FZEA 5SZIA 2PUTA 3VX4A 4QXQA 1X8XA 4WW0A 1FS6A 3WDKA 2TS1A 1U0LA 3D9QX 4C7XA 2BEVB 2OP1A 3EGOA 4DC0A 4JL5A 4XR9A 5FOQA 3PDCA 1W76A 1WBBA 2F8LA 3S40A 1RHKA 4LWZA 5FL7D 5A4DA 3OAAA 5TMDA 3W34A 5KYYB 2VP2A 5GZ6A 3W4IA 4MUIA 2GCIA 1KI8A 3KHTA 4GMDA 1I1OA 1E1QA 4O2AA 1Q7GA 4XSHA 3SFVA 1AKRA 1VKOA 3RU3A 4BRSA 5F5XA 4ZCMA 4TXJA 1T3SA 2XGSA 1T1SA 3DEHA 1I0LA 2B4QA 1R0ZA 2ONKA 2ET6A 4ATNA 3PBKA 4DJEC 5FTKA 2MSCB 3FSRA 3MC1A 4G4GA 4GLJA 3S4YA 5MFPA 4GPBA 1XVLA 2WMDA 1TU4A 2OD2A 4PYQA 5ALXA 4CMEA 1TO1E 5BOSA 2G04A 4IDQA 5C46F 1KY2A 3EAGA 4YT4A 4BC0A 5FBVB 1BA3A 1AZSC 1H85A 2AEEA 5I7OA 3ZNOA 2Q1UA 3F4BA 2QLFA 3KLNA 1KSHA 1J2JA 1Q7CA 2G7ZA 2HBZA 3GDHA 3JSAA 4TRNA 4N8EA 1S2MA 3UMCA 5E6SA 1K66A 3U61B 3G0DA 1O54A 3JAKA 4FDMA 4CM5A 2ZTUA 5IASA 4X1OA 4C7BA 2X8WA 2QPAA 2RMKA 3CT4A 4ETWA 1ZGJA 5JLJA 5JT1A 3IEUA 4JNCA 1Y3IA 2O1XA 3NC1C 2V6JA 3RRNA 2EKLA 3FPFA 3MLBA 4KU4A 3RTGA 3UJ3X 3FOBA 4AN1A 1QHYA 3H3FA 4LXXA 3UWKA 2XE6A 3HXKA 5BYBA 3ORHA 1F4VA 1QGUA 1L2TA 3LD9A 1VLZA 4ZDJA 1R74A 2VRBA 1KETA 1AC5A 2FX3A 5E0KB 3RS8A 4YLEA 3W77A 3D8SA 4X6UA 3UPUA 3WBKA 3T7KA 4WBSA 3OLVA 1RLTA 4PGGA 3R6GA 5E0OA 4DIFA 4F3TA 4QBGB 1IBRA 4B6PA 5I45A 4NP6A 2QGNA 2QJOA 4HAWA 4XVRA 2WJ4A 2FUG1 2ENUA 5JARA 2ZRPA 3LX5A 5FLKA 3U0VA 4OQZA 4YAFA 1S6YA 3O2QB 1KY5A 4HX5A 5EJ4A 4BO4A 4X66B 1W5BA 5IZCC 3OICA 1Z2AA 3I9LA 4GHWA 5BY2A 4ESHA 3U9LA 1M2KA 4K3UA 2NACA 1JBQA 2EHDA 3IMKA 2I7DA 4HT3B 3AKCA 1FDRA 9MHTA 1HORA 4NLLA 4EHIA 1YL6A 3MLEA 1AE1A 3K4HA 2GBLA 3UAGA 3Q87B 1TKCA 1XL1A 3O0DA 1NONA 2HLDD 3WGVA 4D6XA 2DPYA 1N6IA 3GEHA 2CHEA 3BYZA 3B6EA 1SQFA 3C5EA 3ENZA 1UIRA 4P4NA 4ROSA 4ARVA 2L0XA 1WXQA 4FDLA 3EF1A 3EGWA 4X9XA 2I6TA 4MVJM 4W5OA 2Z2XA 3DUWA 1RM0A 4LTDA 3TCKA 4HZGA 1L5LA 4CUKA 4R8LA 4PN7A 1K7FB 2VOEA 5JCXA 1P4GA 3NOOA 1YMVA 4CF7A 3U4HA 4MIEA 1N0IA 2ZYRA 4BIIA 3DAYA 4FYJA 4HNSA 1CUZA 4HDKA 1SKYB 1OXMA 2VPXA 3O1HB 1SFRA 1PW7A 3D43A 2H3EA 3O92A 4GM4A 4GX1A 4P0TA 4BV2A 4DQKA 5F23A 3PP8A 1RBYA 3F6RA 5JYBA 4LJLA 2OCXA 2Y05A 2YWFA 4UCQA 1B26A 1NQTA 1KSGA 4B85A 1A5SB 2IX3A 1NZDA 4JUIA 1RYYA 2OTCA 4IX9A 1ZJJA 4WNYA 4RLHA 1UWKA 3JSXA 1GA6A 2P41A 4B4UA 6Q21A 4H59A 4EB6A 1YBAA 2FH5B 2I6GA 2Q8QA 5HRUA 5L3ZA 2VR1A 3UHPA 3GEBA 1S3SA 1J0XO 4GYYA 5FEMA 3L02A 4EO9A 3CWQA 1VL5A 3LQ4A 3NIDB 4U4AA 3ZQ6A 1V5EA 2QVXX 4J2TA 4QGBA 1HRKA 4W8OA 4YAOA 2REQA 1NQ5A 4TRRA 4WY8A 5IVIA 3H2ZA 4E5VA 1VPLA 3GBSA 4CR6A 1L4LA 3ANNA 3LKBA 1TM5E 2B8TA 2ICAA 1LDGA 2IQIA 1XGKA 4M0MA 4FDAA 4BN5A 2X5XA 2VYNA 1Q92A 2EX0A 3RYIB 1GPYA 2I62A 4KW7A 1OC4A 1Z06A 2XVZA 4M37A 3O31A 5HIMA 1YZYA 3ZI7A 3ZCVA 2C54A 5LJIA 2WAYA 2QUHA 3EOZA 3T99A 1GNLA 1ORVA 2BJWA 4NPAA 1XWIA 3W05A 1P1RA 1ZA1A 1Z5GA 5EZQA 1PWXA 4WOPA 1JE1A 1PJ2A 5E6UA 1WSAA 2GNPA 2QU8A 2QW1A 3IMFA 3JAWA 5DX1A 3RUPA 5DYNA 5CEJA 1H2WA 5AJHA 1ZHOA 1Q0ZA 4M0PA 4BJ3A 3LZ6A 3UAOA 4Q39A 4CFYA 3MJDA 4BMDA 1NP6A 1W0KA 1BE8A 3G7UA 2Q6IA 1HT2E 2JAQA 3QLVA 1YIOA 3I04M 4FPXA 2ZVPX 4J1NA 3GZ4A 3UUEA 1U2GA 4KFTA 1NR7A 3H5AA 3HCNA 1YB4A 2XYPA 4KQHA 4ZCQA