1F2VA

Crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
209
structure length
209
Chain Sequence
b'PEYDYIRDGNAIYERSFAIIRAEADLSRFSEEEADLAVRMVHACGSVEATRQFVFSPDFVSSARAALKAGAPILCDAEMVAHGVTRARLPAGNEVICTLRDPRTPALAAEIGNTRSAAALKLWSERLAGSVVAIGNAPTALFFLLEMLRDGAPKPAAILGMPVGFVGAAESKDALAENSYGVPFAIVRGRLGGSAMTAAALNSLARPGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRECORRIN-8X METHYLMUTASE
publication title Crystal structure of precorrin-8x methyl mutase.
pubmed doi rcsb
source organism Pseudomonas denitrificans
molecule tags Isomerase
total genus 68
structure length 209
sequence length 209
ec nomenclature ec 5.4.99.61: Precorrin-8X methylmutase.
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02570 CbiC Precorrin-8X methylmutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 1f2vA00
4FDVA 1F2VA 1I1HA 2AFRA 1OU0A 2AFVA 4AU1A 3E7DA 1V9CA
chains in the Genus database with same CATH superfamily
1DPFA 2ANBA 2BI7A 5BXQC 1NDQA 3ZDXB 4AY3A 4JSYA 4MZDA 3EEYA 2FPRA 3WAJA 2EJTA 1TO1E 3L6OO 2ZBRA 4TTPA 1GU7A 4OYHA 3SXUB 4OJNA 3VC1A 4DEVA 4Y1FA 3G2MA 2OENG 3EA0A 5D3MB 3K9WA 5KPDA 1T3TA 2YXLA 2VTEA 4Q7KA 4A0FA 4O4HB 3NOVA 1R10A 4TLMB 1OA1A 1AUOA 1R0CA 3FLMA 3WHLA 1ZGHA 4YCBA 1W0KA 2WMNB 5BYKA 5KJ6A 3DFUA 5IS2A 1XL1A 4O5OA 7MDHA 3ZWQA 4WFIA 3PFBA 5JXWA 4RVCA 3NVDA 2BEWB 2V6BA 5JNVA 1JA0A 1QLHA 3L4BA 1KQNA 1D2MA 2EJVA 1CY8A 1E1KA 2OCYC 3O8LA 1IB0A 4KV9A 3S1LA 3V4VB 3DEKA 2JD1A 1V16A 3QY9A 3B6KA 5EE1A 5BR8B 3P9SA 1CQPA 3ZHTA 4POOA 2YDXA 1L5MA 3A9VA 1GAWA 2IWRA 4AUEA 2WTNA 1R0XA 4R5MA 2CLOB 4TS9A 5DLQC 1UMBB 2GPBA 2QBYB 1XV5A 3PSAA 3QMVA 1FDRA 3ENNA 1QYVA 5LZ7A 3FCXA 3EF0A 3MFYA 1TADA 3T0IA 2PPVA 4RD1A 2QX7A 2JLRA 5DM0A 4DMHA 3S68A 1DP4A 3UMGA 3RU7A 1E3TA 3B12A 3ETJA 1KSGA 1WV1A 2C7GA 4HRVA 1E62A 4ESHA 4LOLA 1Q0ZA 4XUDA 2FP3A 3VUFA 3LX5A 2O4UX 3N07A 1XCLA 3E03A 3U3JA 4MIOA 2IELA 3KE8A 1XBTA 4KWIA 5BUZA 2AW3A 4O59O 5KQSA 1VHWA 1SIOA 1YOVA 2DTXA 3E22A 3OG9A 5HJ2A 4EMBA 5JAOA 1SIWA 3E2IA 4BO4A 1BGVA 2Y4OA 1HE8B 3HY3A 3IELA 2XA2A 4HVTA 3STYA 4BFWA 1DB3A 2NV2B 3AXSA 4PQFA 3MSXA 5EE0A 2AKYA 5EMMA 4LFBB 4D4IA 2OGWA 3D1VA 1LPSA 4XIJA 5SY4A 1DV2A 4HFJA 4B45A 1H2EA 1AM4D 1GNLA 2EX1A 2JEZA 4BX0A 1IN1A 2ID9A 1UDRA 2X0RA 5GGXA 2H11A 1MVOA 4BMVA 3ELUA 2DUUA 2JGJA 4G1CA 3LPMA 4LJ9A 1J42A 1M34A 4UDXX 1NP7A 1OLSB 2Q07A 1RACA 3H0EA 1RXYA 3KUKA 3KXPA 4Y18A 5H9VA 2C5GA 1M7BA 2V6JA 3RQIA 3RVOA 1YZFA 3DCIA 4HXEB 4Q3BA 4YMUA 5ECWA 1YH3A 1JYFA 1DC3A 1EK2A 2OOKA 1PR0A 4IPTA 3W3ZB 2Z5LA 4DGSA 3AVOA 4YUXA 4KAFA 4EHLA 4YRMA 3ER6A 3UHPA 2OBYA 4DXAA 1H2AS 1P80A 3DE5X 3PRYA 1OTYA 4MUMA 4R4JA 4B35A 4DIKA 1YV9A 1FLNA 3DEYX 4ETNA 3AFOA 1UPUA 1HE4A 2UYYA 5H3HA 2QZ9A 4KGXA 1EX9A 4RGBA 1BYIA 1PTJA 1FTYA 4KX5A 4P7BA 3S2SA 1T8WA 4BQOA 1YA4A 3BBLA 4I3FA 1JRLA 3FF4A 3K96A 4KK3A 2X58A 4JASB 4EHDA 2BZ0A 3Q87B 5DYTA 3HBNA 1D4AA 1HQDA 2GCIA 2UXCB 3GGPA 1KO1A 3FTDA 1P61B 1WHSB 1XZPA 2AKEA 3L79A 4ARBA 1UBCA 1ZOIA 3WK5A 5LU9A 1KYIA 3UHFA 4RTRA 2GK6A 4F6LA 2XCQA 4K05A 1EB9A 5JZMA 1XZAA 2JFOA 2YC4C 2X1LA 4V1CB 3SXUA 4F2WA 2Z5FA 3ZDAA 3DZDA 2V1XA 4BEBA 5EXTA 4TWAA 3BKXA 5D3MA 2XYVA 4LYGA 3E5RA 4HS9A 1KAOA 4O4HA 5LXTF 3K6SB 4I9NA 1TCUA 5FOVA 4QFCA 1VJ1A 1PFUA 4EJMA 2EGUA 2YVQA 2F9LA 4GUAA 3JU3A 1R00A 1LK7A 2ADMA 2BEWA 2NO9A 3AF1A 5GVSA 1M1YB 1ZD9A 1M2EA 2AB0A 2RHDA 4C2TA 3H3JA 5BSGA 2A9KA 1EEXB 1RRVA 4TLCA 1RQNA 1YQEA 1OD6A 2VSYA 2XUKA 4F5YA 1TTTA 1WMSA 4DV3B 3WG9A 3IIKA 1ZRHA 4IHQA 2IZ7A 4Z99A 1NC3A 1K6EA 1TRKA 1UMBA 2N42A 3JSXA 4JSRA 1YS2X 2PWZA 3DOEA 4Q5IA 4AJHA 5HK9A 1ZNYA 1BS1A 1A9ZA 4NV1A 4M7WA 4KEAA 1E4YA 3MBIA 5LB4A 2QR5A 3TZEA 3C5VA 1J49A 2HH9A 2EEZA 3I2GA 3O3OB 4HKTA 5HYVA 1CHDA 1GPJA 3SIPA 5L4NA 3PKZA 1Q15A 1TYEB 3FPKA 1EFAA 3O2SB 1J9EA 2IOQA 3BERA 4RHYA 3ZUGA 1XXLA 1GV1A 1LB1B 4FYIA 5ITVA 3IUPA 1XFDA 4LE2A 2FSVA 1CUWA 4K6MA 4PO1A 5FEMA 2B5WA 2P9JA 2C7VA 3P52A 4J0DA 3LUDA 4X8HA 4DZRA 2BBOA 2GN6A 4CM1A 4RHEA 3GMTA 1GZHB 4GE3A 3PE4A 5CA1F 1R0WA 3BJEA 3V8BA 3WGQA 2IBMA 2GK7A 4GXTA 3DCYA 5FJIA 2ZSEA 3DVAB 4RYDA 5IM5A 3WGTA 1MJGM 1SHTX 1H2WA 1PEKE 2YNMD 3WLHA 2BI8A 2BMWA 1NUAA 4KXNA 4MW6A 4NV3A 1Y8ZA 1F7UA 3AJRA 4LK2A 1N1EA 4J0QA 4JX9A 3VYUB 2H1SA 3QA3E 1D6MA 3OCWA 2H7YA 4C6SA 5C3MA 4TYQA 3ZHRA 1BW9B 1U6IA 3AUKA 5H59A 4QEDA 5ALJA 5DVZA 3GD5A 1E1DA 1XDSA 3KT0A 3DJFA 3WK4A 3VJMA 4AJOA 4QIHA 1KWGA 1OLSA 3P9KA 2YQ5A 4MA4A 5DZSA 3I9OA 1E2FA 2WD8A 1P19A 4C0HA 2QMUA 1TJPB 1K0FA 3ANSA 3V4RA 1WTCA 5MGBA 3GVIA 2QRUA 3FBWA 2Q5IA 3OPQA 4ODIA 2V7EA 1SB9A 2DULA 3N86A 2QTMA 3QVSA 4Q66C 3H87A 4UBNA 4XX0B 5BR7A 3FPJA 5HIAA 4E5YA 3RRNA 3L4BC 3DM9B 3I1YA 4LOJA 4OFXA 3HWSA 2O14A 3C4QA 4QQKA 1LPAB 4KRXA 5EJ4A 5DYIA 3U4GA 2ZB8A 2PH5A 3DT6A 4GLFA 4ETIA 2CV0A 1AXRA 1J0DA 1JSRA 3FZEA 2DHEA 4QUIA 3RU2A 4DSNA 4MUJA 1F51E 1ST3A 2P27A 3AM4A 4WKOA 5CT9A 3MAJA 4J03A 3T5GA 4IDQA 4CL0A 1QYDA 2WJAA 3WGVA 5EINA 1B6TA 1EEHA 4GWLA 1XKXA 4OQYA 4N5LA 2XY4A 4ZOEA 2XODA 4AKEA 1WHSA 1CRWG 2CLFB 2M9MA 4YJ3B 4EB6B 2H7CA 1W4BA 2XUGA 2VP0A 2PL3A 4ID3A 1Z4NA 3EZLA 1YZUA 4EHAA 3IILA 3ZU4A 3ZJ4A 1RP1A 1GV0A 1SUBA 1FUYB 1XHEA 2G67A 3QVKA 4D6PA 2GR9A 4V1CA 2FTKE 4F4IA 2VJCA 2JGAA 3A9UA 1D1QA 4Q4JB 3DAOA 4HNAB 5IJWA 3VSCA 1Q0PA 4D4MA 5JSUA 4I5FA 3IOYA 3K6SA 2VHTA 4GEKA 3AG5A 2JIMA 2QN2A 1OWOA 2VDVE 1C2YA 3UG6A 1QFJA 1C1HA 1DCKA 1HFEL 2RCYA 3EHEA 4HAOA 2NUPB 5EJ2A 3EMVA 4G01B 1BN6A 4YT8A 3JCZA 3ANMA 1U6KA 4QL3A 3DW3X 3RT9A 4ISCA 1M1YA 3U3XA 2HB6A 4XM0A 4WCFB 4LWQA 2O2GA 2J3EA 1DT3A 4XSHA 3QU7A 3LC7O 1DKQA 5COAA 2H16A 5CDGA 1TZJA 2Z8YM 4DLUA 1F8UA 4MYDA 3QLTA 1Z68A 4FYMA 5LWHA 2VAPA 3FOWA 3QELB 4PZZA 1BKSB 3JPYA 3EMBA 2QWXA 5LOVB 4KLCA 4M4SA 4I1RA 1XLTA 2ONCA 3NJ4A 1TZCA 4WEQA 2G6BA 4EG4A 3L07A 2P6NA 3N76A 2OFFA 5KNDD 2R66A 2IKQA 1YDWA 4TYWA 1J09A 3W5IA 2LIVA 4M98A 1M2NA 5DGXA 3FZQA 1T9GS 2QMEA 2VCEA 1YA6A 2GCNA 1YCHA 1ZNXA 1YVEI 4I1OA 1QS0B 1YZLA 3E5NA 4E70A 4TWRA 2CVQA 2EP5A 3T7KA 4IKEA 4QUGA 1C0IA 2BONA 3HCNA 3RGGA 3TPFA 3U80A 3WK8A 4COKA 4INZA 2OTCA 1E6LA 1Y6FA 1XMOB 1CEYA 2C5BA 2I66A 4Q1BA 4XR9A 5UKDA 5AW5A 2QL6A 1UBNA 5KCMA 3DVAA 1G4HA 2FF5A 3B7PA 3I6BA 3R74A 5TARA 2BDEA 3LJKA 4REMA 3ZWKA 4YJ2F 3EBLA 4DQUA 2GEKA 3GUYA 4Q19A 1PJTA 4HLCA 5SYMA 3T1YB 2HHAA 4N6NA 1SCQA 1WXQA 2XQKA 4X0EA 3TPCA 3V8VA 2I2FA 1I30A 1E1QD 2XGOA 4FILA 4ZYYA 1BW9A 2ZWIA 3OF3A 4GI2A 2H1FA 3BCHA 1JJAA 1GVNB 5D7NA 4DPLA 5K0FA 3S7ZA 3U7QB 4QTZA 3MS2A 3ZJ5A 4E5SA 4DJAA 2VNIA 5JADA 3D54D 3H1FA 4B3BA 2ZDGA 4O2BA 4OHXA 3ZDCA 1ECLA 3K5HA 4FBLA 1NDUA 4I2VA 1VMIA 3QXGA 1ND6A 4XX0A 2O4CA 3ADBA 3DB1A 3UM9A 3C3YA 2VHWA 3CX4A 1E5QA 4IICA 4RKEA 4CG2A 4EI2A 1XUOA 1R4MB 4GKKB 1W2WB 3F6SA 3QX8A 4JBIA 2MYUA 5F3WB 2Q3JA 3AWDA 4C7OA 3I2IA 1LH0A 5A05A 4TMZA 1L5QA 2WHYA 1WY7A 4JFRA 2KPOA 4EI8A 4BOYA 4EF4A 5ICEA 4LY6A 2FMKA 4M53A 3UC5A 2JAWA 3U1VA 1GKLA 5D6NA 4QGFA 1JIQA 2RKBA 1JUDA 4YJ3A 1KQ3A 2JARA 4EB6A 2DCUA 1NW5A 1T2FA 2VYFA 2FSVC 1SK8A 5A06A 5E4JA 4CBVA 3MIZA 3KQUA 1DAPA 4HQ6A 4B3MB 5EJGA 1AK9A 3A4YA 5MN4A 2IGBA 1GGVA 3DC2A 4MV0A 5D5HA 5F33A 4YUZA 1GDTA 2C9OA 4ZHSA 2A5YB 3TQQA 1PR9A 1YHNA 2DC1A 2HFKA 3QY0A 4P3XA 3FFTA 1SZDA 5C1IA 5JAIA 5LMZA 1BRTA 4PRKA 2ZSDA 2NUPA 2CGEA 2OCIA 4NZNA 1CERA 1C7QA 5CLJA 5HQTA 1TOAA 3WA6A 1CQIB 1U1EA 2AXNA 5DMHA 1ZO8A 3D3QA 5P21A 3FOZA 3DPIA 1ZGJA 1G55A 2IX9A 2VRNA 4WCFA 4MUHA 3S70A 2G76A 4L0CA 4MRVA 3RYCB 1L8LA 4FJ1A 3DMPA 1O0BA 3ZD6A 1DWQA 4EHBA 4EVSA 1PCXA 1E2MA 1FOEB 1XL0A 5FOUA 3RBXA 1CR6A 4BQIA 2X22A 3THSA 3LHDA 7AT1A 3NNDA 3FPHA 3AFHA 2JGEA 4GBGA 3QELA 4NYIQ 1QONA 1WABA 4OLFA 4UAGA 3T7DA 3NWJA 2FG5A 4XRGA 3L18A 2A0WA 5LOVA 3N74A 3JQAD 4K3UA 4LJ4A 8ABPA 1PV2A 2W2OA 1RWOA 1DQNA 1JALA 1XKLA 4FGZA 3II6X 1ZC3A 4OI0A 1V48A 1YI8A 2DR0A 3HXOA 4QATA 5JVDB 1LNZA 3EB9A 1UBUS 2BSXA 3T95A 3FLEA 1TNDA 3LVFO 3FY4A 2Z8XA 1EVEA 5DNWA 1KJ8A 3VX4A 5JXIA 2AT1A 3L0PA 1QS0A 3OKCA 4PBSA 1Z8DA 2VPQA 3G0BA 5IBRA 3TEJA 4NEHB 5C4IA 3Q40A 5C8VA 4QNMA 1YR8A 1TO6A 3U9LA 5DF1A 2FI1A 4RGVA 1FNMA 5COBA 2HMWA 1Y9ZA 2UVQA 4D9CA 3PPIA 3BHMA 5AD1A 5AW1A 9LDBA 2EFJA 4FQ8A 3LZDA 4D8UA 1EK6A 4GKAA 3N2GB 2HA6A 3K94A 1EP2B 1R1DA 2VPTA 1J0EA 2I7XA 2EDAA 3F71A 3IT0A 1P29A 3LI2A 3LXXA 2FMFA 4ZYWA 3U7QA 1FTWA 3SC2B 1PJAA 1Z6YA 1CZHA 3GT3A 3IPAA 4X97A 3DHWC 5F5NA 3MWEB 3HJGA 1BH6A 1L5WA 4P6VF 4X5OA 3WIEA 4YRAA 2YWEA 3ESQA 3MHTA 2RGGA 4V0ME 4JJ4A 1RDFA 3REOA 3L3BA 2ZXFA 1VLLA 1YQQA 3PHGA 3AJDA 4XRRA 3T6KA 4OATA 4O5AA 2BMFA 1R8JA 4AXXA 1ABFA 4RK5A 1R4MA 2NTYC 2R5FA 1ODCA 3K9BA 4H59A 3IPYA 4L4UA 7YASA 3UJBA 1VLJA 3ECCA 1ZKMA 4MIEA 4MI9A 3SBXA 2YBDA 2O8DB 1WY5A 1VIAA 1E79D 2HF9A 3OFNA 3S2YA 1SUCA 1P4HA 4LRYA 2BGLA 1Q57A 1TDJA 3H5VA 3AUYA 3F98A 1UINA 4JT9A 5FBHA 1RXVA 4M0LA 3HFSA 1OAOC 2N3ZA 1QV7A 1AS0A 4RF3A 2B34A 4I08A 1JJ7A 1N4DA 1QZTA 2IZZA 5TQ2B 1XLTC 4QDZA 2ZSBA 2E37A 2NVBA 4PF1A 3F5DA 1H3FA 3OEHA 4OPMA 5KOYA 2GB4A 2NSHA 4G41A 2IV3A 3RRYA 3X43A 2R47A 1CX9B 4FNMA 3DMRA 4KXMA 4AJLA 1PR1A 3HZRA 4QPCA 5AUOB 1DDGA 4M1TA 4OHVA 1SURA 1VGQA 1W76A 3AR2A 1KZ4A 4EECA 1YWGO 4EUHA 3R8CA 1Y89A 3HRIA 3VPSA 1QG2A 3G2NA 4X1YB 4URZR 4M0MA 1WF6A 3HEAA 1A88A 2PIAA 3ORHA 4JDPA 4JIGA 4D8YA 3L4KA 3BE4A 4PYKA 5JUWA 4Q1AA 3C70A 3FKSD 3VX3A 4NMMA 1QTIA 3N6XA 3QLVA 4OI1A 3IALA 3GT4A 2YWFA 3ND7A 4C6TB 5AJTA 3OE7A 5DTIA 1FRNA 1CQIA 1TA4A 1RIIA 1U0JA 1GR1A 1ATIA 3L7YA 3RC7A 3Q7RA 1XMXA 3WWPA 2YOGA 3D8BA 2ZI4A 3RYCA 4EJ2A 1JDUA 2G71A 4IMIB 3ZHYA 1T8PA 3UCFA 2W90A 2APJA 1GAQA 3RU3A 3FB1A 3T9BA 3HC7A 2JG3A 1C1DB 1W581 2G5GX 4RIEA 1CY2A 1SVIA 1VE9A 2H4XA 3A9SA 3ITEA 2GAAA 1GT91 2XW6A 3I2FA 3PJDA 4GQIA 5B58T 3T4EA 3TAHA 3V9AA 1N6OA 3HM2A 1NG9A 1UC5B 2P9EA 3QYAA 5H16A 5JVDA 3IODA 3L8ZA 2CDBA 5DM1A 1Z5PA 4IXTA 2FUKA 3SZOA 4AURA 3DOHA 3VKFA 5BNZA 2CDRA 1GAXA 1AB5A 3CF4A 2BWJA 2EF0A 1LVHA 1JLHA 3P0EA 2NSJA 1PHPA 2WM8A 1I10A 1E66A 1WCXA 3CPJB 3PQ2A 4OSOA 1EM6A 1Z2AA 2WUFA 3C8MA 3GFTA 3QVGB 1OILA 1SAYA 5IUKC 1F2VA 3AY3A 4NYIR 1DWOA 1T8SA 2FMHA 4H35A 4GMDA 4AJ2A 3ZLUA 3D8RA 2BJWA 1WKCA 1L4UA 1SQFA 4K6HA 2DWPA 5C32A 2UUBB 5TGTA 4O25A 2ZP1A 1UDWA 4KIFA 4LF9B 4DRXB 4LECA 1V3UA 2IZ6A 4EJ6A 3ZJVA 1IPFA 3EW9A 3N2GA 4BATA 3JQBA 2ZYUX 4RPIA 5A2GA 1VHTA 2NXCA 4MGKR 2MSWA 2CHQA 2P7HA 3NAZA 3OZGA 4ZVTA 1V0JA 4B32A 3CRQA 5CK4A 4YT2A 1AS2A 5FCDA 1JJBA 1PG2A 1JG7A 1P8JA 4V0LA 3ESAA 1GYRA 3SC2A 2XMGA 4HJRA 4X6UA 1VCIA 3VVLA 3MWEA 4B3HA 5JARA 1W75A 3FNHA 3GP5A 2QJWA 5K03A 3VOTA 3CVWA 2OC4A 3UHJA 2Z5VA 4AECA 3IVXA 1IHPA 3LQRA 3HO1A 4BP8A 4OP1A 4MKFA 2OL4A 4WADA 1EWTA 1KAQA 3B2EA 3IBTA 4ZEWA 3IO5A 3K1AB 4TUYB 3ZQKA 3BOSA 1PT6A 4B4UA 4WCFC 3J81A 1HX7A 2JFFA 4EABA 3DYIA 2QMQA 1PEYA 4KQ9A 3BG5A 5ALQA 5JWHA 5C46F 1PL6A 4D2IA 1Z0IA 1IJBA 3PDHA 2O8DA 1KHHA 3EF3A 3KSUA 4DQVA 3LGSA 3SXJA 1QGUB 1Z25A 1U94A 4ITVA 2C2HA 3R5KA 5P8WA 4YRGA 5L8VA 3RVPA 3D3JA 4IF4A 8ADHA 4X66B 2OQIA 4L4YA 4M9ZA 1VPLA 5TQ2A 1JH9A 2PRSA 2AF3C 2GJ9A 4FYPA 5ESXA 1HGXA 1EUDB 2OZKA 1EUQA 4FFLA 1ZM2A 2WWTA 1T0BA 4R05A 1VE1A 2Z83A 1U8UA 2VJPA 2W2XA 1R5JA 3AI2A 3SQLA 1R3UA 4GR4A 4CN8A 1CR0A 1N5JA 2V7UA 3CWCA 3TW8B 1QWOA 4YH1A 2QGNA 4BNFA 4XUEA 1P7CA 4H17A 4B48A 2H1CA 2FN8A 2JIZD 5F2NA 3A04A 1FL9A 1FQWA 2RB5A 3IOEA 3HR7A 4L6IA 3SX0A 4QT0A 4LZNA 4JYBA 1T2NA 3CLRC 1HNWB 1RIFA 4X1YA 2X8LA 5CCBA 5MDHA 4Z53A 1I0IA 2J3QA 4XFJA 2FX3A 2ZUDA 4EW6A 1N8NA 4RM2A 1NBOA 2QN7A 3MLEA 1VSVA 1WDLA 3BEDA 2PEZA 3MJCA 1GCGA 1R66A 1IOWA 1T1SA 4C6TA 2V6GA 3OPYI 2PUVA 2ODPA 3IAFA 5CA1A 1RI4A 3CEMA 3SCZA 3O2QB 4NG5A 1GNSA 4AM8A 3RVJA 2VUSA 2XEDA 1UMKA 1K8XB 3CXUA 3DFMA 5L45A 4DUGA 1PW7A 1QOQB 2IK8A 2HL6A 1T9GR 3C7DB 3QG1A 4BTLA 1GPAA 4Z5XA 1DAOA 3VRHA 2B4RO 1C1DA 5HW0A 5KEIA 3X0DA 2QDKA 4M1EA 4K0RA 4M87A 2F3TA 2VZ0A 3SSOA 3MTAA 3WHPA 3B1VA 1ORDA 5CJ2A 3T1VA 3LWZA 3WKAA 4B74A 1RZUA 4EELA 5A6VA 5AKIA 4NHOA 4O8ZA 1CDZA 1IFXA 4XTRA 1RYZA 3IIEA 2D2VA 4M55A 5HE8A 2P9TA 1BOOA 3PVZA 2A3NA 3UTCA 2GEBA 5T7BA 3R0VA 1DRKA 5BSFA 5BW8A 1RS0A 3F8WA 2HDHA 3QVGA 4HEA6 4JC4A 3M3DA 5JSHA 5LM3A 3OQHA 1TM4E 1QGAA 2JJMA 4I5IA 4EDHA 1D0IA 4N47A 4A6DA 4D4JA 3OQBA 4FB5A 4WOJA 2GM4A 2FV8A 1FF9A 3HA3A 1DJQA 5MN6A 3IA7A 4BUJA 4CHGA 4DRXA 1XP5A 2F2TA 2IYLD 4TMYA 2B5VA 3IURA 4PZPA 2DRIA 1UWCA 5GOZA 4R2HA 2FK7A 1DOAA 2B92A 2HK7A 3LC0A 4JT8A 1RVDA 1GLNA 2VXOA 2Y9PB 3O7MA 1YDGA 4N5NA 4P0TA 4ARZB 2C2MA 4B6RA 4G2NA 2PH7A 1J2JA 4UZSA 3VQTA 1GGHA 1QSGA 4IH4A 5GIOE 3AKDA 1TX4B 4CFYA 2HHLA 1BRMA 1R64A 1Y1RA 4FFMA 4KFTA 4AQDA 1O95A 5EQTA 4HEJA 4EJSB 3AY6A 3PG5A 4HEQA 1NSFA 2RE8A 1GTSA 2EAUA 1ODTC 1RSZA 1N0VC 1U9JA 5LZ8A 2OMEA 2PUWA 1MB4A 2JFUA 4TLEA 4MYTA 2QVCA 3TXAA 1PTKA 5G4KB 5LD2B 4OK5A 3NBFA 4URWR 5BN3B 2NUAB 4YBRA 5B3AA 3K1AA 2HLHA 2A4MA 3P9NA 4IEFB 4TUYA 3ZV5A 1SIUA 3MG9A 4HAXA 4BKPA 2ZS9A 4G1FA 3VR2A 2QD5A 1ZMTA 4CM5A 1YHYA 2HA5A 2BFEB 3I30X 2IWHA 5CTAA 1S8FA 1TPYA 2FSHA 2WF6A 3BAZA 3CNEA 1QGUA 2CNDA 1XTTA 1L1FA 5AESA 1GUFA 2MYNA 5HM6A 2VYQA 3FDIA 3BGSA 4IQ0A 5FTJA 2UZIR 4F4FA 4G9BA 4D3SA 1XMIA 3NBZC 3PWTA 1H05A 1GL3A 1X7HA 5HOQA 1YSCA 1EUDA 4LX0A 3GLFB 2HGSA 3TOXA 4Q93A 3ZLJA 4IIVA 2AG0A 4AT1A 4KMRA 3L49A 5K3BA 2G5TA 4IIUA 3TRKA 1P1FA 3OCZA 3TW8A 1YVPA 5I9MA 1H2XA 2Q0SA 3RVKA 3BTUA 1J8YF 3KG2A 4O4IF 3QXCA 1U7PA 1BO6A 1LJ8A 3A1DA 3BQMB 2C2OA 3FX2A 5T8KA 3VH4A 5FI0B 1ZU5A 2FUCA 5IC6A 1CRQA 1WS6A 5TQ0B 1W30A 2CNOA 3OZAA 3H19A 2OHHA 4DLBA 5CFQA 1HQYE 3A3PA 3R44A 3ODGA 4QTUB 3FAKA 1NP3A 3G8CA 4H1UA 1VG0B 1DWPA 1P9RA 4NRDA 2QTFA 4YJKA 3JQBC 4FFRA 4IV8A 5FB3A 1GM5A 3ABOB 1SMKA 2XDYA 1QWSA 4YPFA 3NT2A 3IUQA 3VYWA 1RPZA 3NC1C 3V8MA 5KZMB 4D9HA 2RHHA 3LWNA 4S35A 4WN3A 1RWKA 2GX6A 3FGOA 3K09A 1ZXXA 1CZOA 3OZSA 3CMCO 1PFGA 5KREA 4JVOA 3S1AB 3HDJA 3G6WA 1NXOA 1Q3HA 2F7SA 4I6EA 5CNIA 5TE9A 5ELXA 3ELDA 3AIKA 4NARA 5A4FS 1U3DA 1N6PA 1J99A 1Z0ZA 1G2IA 2DPMA 1PBNA 2VBFA 2VHZA 4J76A 4N3CA 5EUMA 3ZK9A 4CMIB 3FVTA 3Q0IA 4FYVA 4ENSA 4W8HA 2VWPA 4LRSB 1PS0A 5ILGA 3P97A 2P2YA 4RTSA 4YHBA 4YVFA 3FTQA 3LSTA 4FFSA 3W78A 2OD2A 4BQEA 1ZWLA 1RZRD 1K3TA 3N9IA 4GP6A 3WQQA 5ILQA 5FIUA 4DLYA 2RAUA 2YN2A 1K7FB 1E9SA 4FJ0A 2CEAA 3JYPA 4GPZA 2Z9BA 5HF5A 1QGED 3RREA 4TVSA 2VYND 2QP3A 3U1TA 1I2MA 3P9QA 3PVSA 2RHWA 3BVPA 2X0JA 2O7NA 3ONNA 4GR9A 3E3NA 1EFUA 4K6GA 3FRJA 1S02A 2XA9A 3OPVA 1W0JD 2WTXA 4XI9A 1AA9A 1X0XA 2H4HA 1P9LA 1VBMA 1JLSA 5FOXA 4RFLA 1QHXA 1ZR4A 5IVKA 4J16C 3EVBA 4OHCA 4BLPA 3TGPA 4ARZA 3H1AA 1ML4A 1JQ3A 3D3NA 4ZT2A 3OA2A 3CUKA 3DQQA 3UXMA 4IUDS 4RDXA 3UGTA 2QU7A 2OCKA 2VP3A 4LVNA 1V9CA 4NMHA 4WOKA 3LHIA 4HDNB 1ZOOA 3KHTA 1FZQA 2LDBA 1K8QA 4H6WA 3TH5A 3UJPA 4C2BA 2Y1KA 3LSYA 4XWGA 2EQAA 2O5RA 4G1EB 2BEUB 2DUWA 5HF8A 2Q7OE 2FPWA 3TPZA 5DI9A 3AIIA 5ENDA 3CLSC 5G4KA 2L0XA 2PX4A 2NUAA 2AHRA 2ZBQA 4LRUA 3L5OA 2CUKA 3W5SA 5BN3A 2WD9A 5C8DA 3L4EA 5K2MA 1AY0A 4PONA 3S5UA 4DEXA 3U7GA 1F0YA 2C04A 4CI0B 3PNKA 3DKKA 3DR3A 1EKXA 1MF7A 4JV5B 3QXSA 3RYFB 1ADGA 2JL1A 1U9IC 4NEQA 4JA0A 3TNJA 4CT5A 1IN4A 1A7KA 4LZAA 2R8EA 4U2FA 3VC7A 3EZFA 5I3ZA 3QU4A 4WZAE 1N3LA 4Y2GA 5LZ4A 2HX1A 5CXUA 3WL5A 1QRTA 3I9LA 3ZBTA 3GLFA 1P4AA 2QNBA 1CUZA 3KOYA 1MXFA 1ZIYA 2P62A 1SKUA 4GRDA 4UVIA 1X7XB 2XF8A 5AUQA 2HA2A 1G66A 3KDSE 2VK4A 1JWBB 2ISCA 3E61A 1N36B 1B8UA 3I8XA 5DNDA 1J23A 1SZCA 4XUCA 5INTA 1BROA 3JTEA 3FPLA 3PP8A 2YHAA 3I9MA 2QSUA 3MB5A 1PVOA 1TJNA 2Q3BA 1JVNA 2I2XB 1PJBA 3DZIA 4PC3A 5HFJA 1U2EA 3RRZA 3RRXA 1TQ2A 5TQ0A 1YMVA 3ZCRA 2UZ4A 3B9BA 5TF4A 3S2IA 1UPBA 4GG1A 3AU8A 1E2BA 2CF5A 1KSFX 4RLQA 4UHDA 4PPYA 4LGMA 4UE6A 3TR0A 2CVFA 1QR2A 3OJ0A 4HNQA 5CT4A 5JV5A 5A0VA 2FZCA 4MPJA 4X92A 1YQDA 4QOFA 4QDOA 4WLOA 2OR3A 4Q7LA 4JLMA 2NYVA 1ZN2A 1L5ZA 2PBZA 2WU8A 3GN1A 5EZ5A 2XYQA 4CR7A 1K9SA 4LF4B 4KN8A 3WLPA 1DDIA 1KDRA 1N2CB 1OMOA 1RHUA 3KBOA 4FC6A 3S44A 3VR4D 1S2GA 3S1AA 3GGGA 4JBHA 2YZ2A 1O95C 1CLEA 4AB1A 1WSWA 4EYEA 2QN9A 5FBQB 1MAVA 1Z08A 3OZ7A 5REQB 2YHBA 5ALYA 4CMIA 4RJJA 3ZGYA 5ULLA 3IESA 4JA2A 4N8SA 3BJMA 1B2LA 3LGXA 3VTAA 3WGHA 1VDMA 4TSFA 1ZD5A 5MHTA 1U7WA 1ZIOA 1PS9A 3E4CA 3EUFA 3I04A 4HK4A 4ASUA 3GDFA 3EARA 4LJAA 3ZDDA 1L9KA 2WZCA 4QDTA 4NDZA 3E53A 5C7LO 4J29A 2Q9AA 3GROA 1L4KA 1XCJA 2QZJA 4A27A 1CULC 1TM1E 1VJCA 3W5BA 2G36A 2PS9A 5BUQA 3WOVA 2R9VA 3AXTA 3M9LA 4ENVA 2VQDA 3ESBA 2C7PA 2Y1FA 2ZTHA 4D25A 2BM0A 4RJLA 1AQIA 3RAFC 4XM1A 5K6TA 2HFJA 5TIIA 1O87A 3KKOA 5ALLA 1NJ8A 3GMSA 3EQZA 2ZW9A 5EERA 1P4SA 2P30A 1IDOA 3NOOA 4LOKA 4QUAA 4ZI7F 3RS4A 1XMPA 3GUHA 1F38A 3ZLVA 5A4IS 4DLRA 2HADA 4KQFA 1LWOA 4OQDA 2OXTA 5ADWA 5JU6A 1P6XA 3U39A 2O0JA 2PD4A 1T0JB 4M9XA 4GYJA 1KIMA 5LZ2A 1SKMA 5SV2A 3ZU5A 2FR0A 1P60A 4C7OB 3KVNA 3NTUA 4M89A 4EX7A 1QG4A 2FJ0A 3EHDA 2P0YA 5T8KC 1AVTA 3EEOA 3N2LA 4WERA 4DZZA 1I33A 2P3SA 1QDUA 5FL7A 4ONEA 5F51A 1U8EA 2GZDA 4HDNA 4ZGWA 1QV6A 2CXRA 3LZ6A 1Y3FE 4OQLA 2IZOA 3E82A 4DXDA 2C9CA 1LTQA 2BEUA 3OHSX 3A58B 1ZGBA 1G3UA 3SZRA 1Z16A 5B1DA 3C8ZA 2PFSA 1W73A 3ER8A 4O2RA 2LZ0A 4JWKA 3RSGA 1MG0A 4P7JA 4H4DA 1RAFA 2BISA 4HFNA 1QIHA 2G0TA 1LLCA 4MB2A 4ZC8A 4D8XA 3QI7A 1U0SY 2B1JA 3PF8A 4XQEA 4DCOA 5F2OA 1K8YB 3MGKA 2ZWOA 1ID8A 1M6NA 3K1JA 3RYFA 3H3FA 3MTJA 4OXIA 4AYTA 2NTJA 5D3ZA 2OQVA 5EGSA 3A4IA 3IOBA 1ISIA 1MRNA 5B2ZA 2D3TA 4QQNA 5AXAA 2DTEA 3DZ8A 3Q7PA 1TM2A 3DWEX 3Q0EA 5LNK1 5CGZA 2B8JA 1JSCA 1V7QA 1Z0DA 1RFGE 2NQ2C 2X1HA 4KQ1A 4EL0A 1IHOA 3HO6A 5DHTA 1DE0A 3E7WA 1TYAE 5LA6B 3WKCA 4JLDA 1X7XA 3DBIA 2V1UA 2GCOB 4MJLA 4LF8B 2CK3D 3CBGA 4DLPA 1ENZA 2JZCA 4N48A 1TQ4A 1WKVA 4F4HA 3H7IA 1XQ6A 1K8RA 2BHRA 2PY6A 4YBZA 2JHPA 4GP9A 4CF5A 4D02A 4L57A 3SDBA 1GL6A 3A6LA 4AF8A 1X1AA 2O52A 4Z7QB 3QNUA 3HU2A 3JQPA 5JBQA 2CHFA 2B78A 3BAFA 1NN1A 3GP3A 1OI3A 1RXSA 4Z9XA 4KFCA 2PT5A 4KZPA 4K3VA 3A9RA 5AO9A 3JQRA 3VPCA 1P5JA 1YS7A 2KWIA 2GT1A 3WMRA 1RWMA 4M37A 5H81A 2GZ3A 1UAYA 1CT9A 3GZJA 4KQ2A 3PJEA 3TTVA 4B4KA 4ARUA 1T9CA 1Y7LA 3NHLA 3LNCA 4JNKA 1E7SA 2XOXA 3ZX5A 2VK1A 5C80A 5LN1A 1IN6A 3ZY6A 3K2QA 5C53B 1HR0B 2CLCX 4BPRA 4GGPA 1N2CA 5K3OA 1XTPA 1DCMA 1SKAA 1DTSA 4BCBA 1UDCA 3WZ2A 3WNQA 4JI8B 4FCCA 4TMXA 1RQRA 2ZAOA 4ZT4A 5REQA 3EPKA 3UZUA 4ZCRA 3ZVNA 4G8CA 5EAIA 1FFBA 3ENWA 4R41A 2WIBA 3SHWA 2FPPA 3HWX1 2I8CA 1S9DA 2JHFA 2UUOA 2IHKA 4D4HA 1OU0A 3K73O 3KS9A 4B3RB 1GEEA 3RHFA 2KM1A 3W6ZA 2E82A 3PGMA 5G0VA 3IVAA 2EW2A 5L6LB 3S2EA 2XMSA 4G5OA 2GBPA 4QBIA 3I34X 1CF9A 5B1EA 3H1GA 8LDHA 4U2EA 3T12A 3BZWA 1IOZA 3DBHB 4AS1A 4NBSA 2PQMA 3DXXA 2YXDA 3T7EA 4TV9F 2JCGA 1CS4C 721PA 1GWNA 1KMCA 2V54A 3L02A 1QAQA 4NFHA 5D86A 3I6YA 4U39A 3WI7A 3JYOA 2I7TA 5JAQA 2YV3A 2FSUA 5AW4A 4OIMA 4LJ8A 2V4ZA 2WIGA 4GBJA 2CD9A 2JH3A 3P1JA 4B33A 3NGXA 4BO5A 5MF6A 4EWLA 3UGJA 1M6YA 2C4UA 2QD1A 2W6OA 3EA4A 5HTKA 2C2WA 4KR3A 1U2TA 1U90A 2DBQA 2V9CA 2Z2ZA 3HVIA 3ST7A 4BE4A 2CJPA 1Q12A 2CNWD 3IAXA 3A37A 2BBSA 1H9AA 1SEPA 1TA9A 2F43B 5C34B 5GJWC 1ENPA 3CLUD 5C9ZA 2GAIA 3RRMA 1B8VA 2IYUA 3PQ8A 1MH9A 3COYA 2IH5A 4DR6B 4LGCA 4PO9A 5BSMA 4BDTA 4C0JA 4ZDIA 5AHKA 2EP8A 1E94E 1Y3DE 4HATA 4PX9A 4D46A 1VZ3A 2P4EA 1SCNE 4D92A 4DWJA 3PICA 3C3BA 2R87A 2AN3A 5DBGA 2QKYA 2V0GA 3FUVA 3NHWA 3RCBA 1XP8A 3T5CA 2YJGA 2ZI9A 3DTTA 1X1CA 5HMMA 4O6VA 3N5KA 3VHXB 2P78A 5BVGB 3UOWA 1IBSA 4JU8A 4L4RA 4W5JA 5CMLA 2W4MA 4YRDA 3HRHA 5LA6A 5KYKA 3GOQA 3ZCVA 2GCOA 1GNPA 1ZW1A 1QOZA 4HUJA 5G0UA 2IH4A 3P0RA 3PEEA 2Q4BA 2WP0A 1H23A 3I64A 4F86A 2A84A 3IIMA 3R0JA 2FX2A 4YFYA 1BYUA 1MX1A 5TB5A 2WJ6A 1KYVA 2FG7C 3DKPA 3N7UA 1WPRA 4UFOA 4X54A 4OHYA 4H3KB 5TPZD 5FORA 4LF6B 3HYCA 1T8RA 1WG8A 1YFLA 4CEIB 1QR6A 1UJBA 3EMDA 2XVXA 2C2ZA 2DFLA 3Q7QA 4JJ6A 4K9MA 4Y7CA 3RS9A 4E4RA 2G1AA 1GITA 2ET6A 4E14A 4E2WA 1I0LA 2XTJA 4WBNB 4BU1A 2G1KA 1NR5A 3JSAA 4G5HA 1SZJG 1ZIPA 2GBGA 4JJFA 1JWAB 5K1ZA 3ZR4B 3WQSB 2IV7A 2FJPA 1E0DA 2ECFA 1N3YA 3KL4A 3E6AA 4GXQA 4BMOB 2MTBA 3UAGA 3U48A 4BO9A 2PBFA 3ADPA 4JS0A 1MOQA 3QV2A 4LI3X 2BSAA 3OLQA 5EEGA 4JI6B 1F0PA 3U3MA 5I47A 1EK1A 3IEXA 2RBKA 4CMBA 1Y3BE 3O82A 1L4GA 1C3LA 1KDPA 1YB5A 1D2CA 2HK8A 1NT2A 3A32A 4ISBA 3VNQA 1AHHA 2HJHA 3QFFA 2ZRLA 1HDZA 3NKFA 3GELA 1GUYA 5C52B 2FSFA 2ID7A 4Q4LA 1SKQA 3WGNA 5GZ3A 1KYYA 2H1LA 2ZR9A 2HEGA 4LSZA 3R5HA 2QN6A 4YJ2A 1DX4A 4IEEA 1KERA 2H9YA 1Z6TA 3LT1A 3INRA 3NYWA 2WIDA 1SBIA 5FO0A 2X76A 3UK6A 2RK6A 2QL9A 4IBOA 3DBHA 4QRIA 2GPSA 3H4MA 3DDCA 4V2IA 5HCNA 2CZQA 1J5EB 5HF9A 4P0QB 1DIOB 3N7AA 4JXZA 1MXHA 4PRYA 3SS7X 1J8VA 4Y6PA 3H4TA 4GM0A 2WY2D 1YCFA 3HCEA 4RXUA 2C7OA 1YZTA 4ZVMA 3UWSA 2TMDA 4UZFA 4MUAA 5DXAA 5GJCA 2XWBF 1XD8A 5HR5A 4F6CA 1O6ZA 5C8YF 1TXGA 4YALA 5E0OA 1JKFA 5SZKB 2QMZA 3EXIB 3QKRB 5KVCA 4PCAA 3CC8A 2P77A 3R0QA 2RGBA 2R7NA 1WDKA 4JODA 3U49A 3QPBA 4BO8A 5DNEA 2R4UA 1M0EA 2IZ1A 4ND1A 1NULA 3AEKB 2HRBA 2YICA 5EE5B 3TLZA 6PFKA 2IYFA 2F43A 1PFKA 3GG2A 2I8AA 2IQ5A 3DE7X 1TZMA 4KYUA 5D1HA 5C7YA 1RXIA 2R1ZA 4D6YA 1GA6A 4M9QA 5FTKA 1K5PA 1Q22A 3AH8A 2ZRFA 3ICPA 4YDSA 3TMAA 1UFQA 4E11A 2ZT7A 2O06A 3WIVA 1NLYA 1IZ7A 4URYR 1DSSG 2YCLA 3E27A 5CITA 1DFGA 1FYEA 4MB0A 4BP9A 2R6CA 5JAUA 2O19A 2J0VA 3CU5A 1KDYA 3QYJA 2A8YA 3BHIA 4PC6A 3W77A 3ZY3A 2DLCX 1KTIA 2Q6OA 4KWCA 4ROTA 3V8RA 2IOFK 2QTZA 1T5TA 2XDWA 4AWBA 8OHMA 1Y4DE 3NHJA 3ZW7A 4G97A 4NMXB 3T7CA 4QOEA 3Q2KA 3USCS 1L5SA 3DYBA 2CXPA 2O1XA 1UDXA 1Z38A 2AOTB 3RSQA 3QKTA 2VDJA 4E5MA 1MB2A 3ETEA 3DBVO 1VKJA 1XHFA 3H5WA 4HH3C 4YN3A 7GPBA 2JIQA 3G7SA 1CB7A 3R4CA 2VA9A 1TQ8A 3BD9A 5FKJA 2OO7A 3N8GA 5JD4A 3K5IA 2AG8A 3AINA 3QPDA 4MITA 2W6JA 4PAWA 1T3ZA 2P6OA 3COZA 4BJ1A 3DFIA 3HACA 3TNLA 4UTPA 4CEIA 5JEDA 2EOAA 1V41E 5EZQA 3KJIA 3BEOA 5DHPA 3JX9A 1XB2A 4LTDA 4BTVA 4FZRA 2HW8A 2Q50A 3E7PA 3T5MA 3VHQA 4WBNA 3UMFA 3EIFA 1YBMA 3BK7A 4ZZ0A 4I8XA 4C4AA 1JLMA 2VBGA 5CXXA 1TC1A 3FW1A 3PCRB 4ZYVA 3I28A 1W2HA 2MSNA 2Q62A 3QUCA 5GZ6A 1N9GB 1HA3A 1P73A 4IIDA 9LDTA 4XWYA 3HNPA 1C3VA 2W71A 1L5KA 2FFRA 1A7UA 3Q8LA 2V5AA 2Y76A 4IXDA 4ZI7B 1FP6A 5GWXA 1GZVA 4F0JA 4LBZA 4M9SA 3WTBA 4DM3A 2YS6A 4ERXA 3AESB 2HSDA 4BBJA 2PTGA 2H3EA 2BN4A 3NRBA 4K9DA 3G9XA 4MXDA 6YASA 4CI9A 3CRMA 1JHOA 4J3JA 6CHYA 2J33A 3QSGA 2QXUA 3HV2A 1DX9A 1Q3KA 1LZLA 1N2BA 2A59A 3KELA 4H6XA 4YP1A 5HIJA 4ES6A 1T6YA 5LKAA 1JHRA 6Q21A 1V26A 1HZZA 4IHJB 3RIMA 4YP0A 1TA0A 5ICMA 1QRAA 3BQNB 3N0VA 2X0KA 3SK0A 3LYHA 4DV4B 2PO5A 4H4CA 3M4ZA 4WACA 3A1VA 3EGWA 3M9XA 2CE7A 3BQ9A 3L04A 4JC5A 4O29A 3T0GA 3ICWA 3F3YA 4UTZA 4BLWA 4C5BA 5LDHA 1CP2A 1ST2A 3P0IA 4N01A 5DNUA 4F8EA 1D8AA 1ISJA 2K2WA 1A8UA 4PYQA 3D6TB 1C0PA 4QULA 4MKXA 3I5XA 4HJXA 3HBAA 1Q5PA 3FFWA 3EXIA 3QKRA 4YCCA 2G0AA 1EI9A 1QB8A 4XTCS 3TKYA 4EGSA 3VAYA 5DT2A 4ZVKA 7ADHA 4QYIB 1E89A 3IRVA 1FNSA 1RTTA 3D7SA 2JFGA 3ACDA 3SHOA 3Q9SA 3D9QX 4UNIA 5DISB 3AEKA 4IVNA 1BA3A 1I2BA 3MRVA 3WL8A 2ZR0A 2Q5FA 2R2GA 2R7LA 1FUEA 3GK3A 1XQVA 1ZD1A 3KWFA 4TYMA 3U7FB 3ADOA 4YC7A 3QUTA 2FPSA 4MP8A 2B25A 3NPAA 1EGVB 1V8BA 1ZEMA 1EFPB 5F21A 4CM4B 1I7NA 1VKRA 3V2GA 4JUBA 2WJIA 2HO5A 5JT1A 1ARZA 2DWCA 3K9GA 4D0NA 3GARA 5LB2A 1RC1A 2VCYA 4L2IB 4Z51A 3ER9A 1AGXA 1K97A 2OVBA 4LVUA 4IDHA 2QW8A 2IYZA 3UA4A 3AF3A 1BMQA 2ZDQA 3SC6A 4PZCA 4BZPA 3GAAA 3IB3A 4KVAA 4CF6A 1H42A 5DI3B 3A06A 2QR3A 3MS4A 2XUDA 4L6AA 2NVWA 2AQIA 2PLFA 4TTSA 1GUDA 3QNMA 4HNGA 5EZYB 4WY8A 5CVVA 2QAGB 5EWMA 2VL7A 2AOTA 2C31A 3BN3A 5AI5A 4D9GA 3B70A 3L8HA 2GN0A 2GESA 1SD1A 1RRCA 2CLKB 4NF2A 1G98A 3KAQA 2ISQA 4RA9B 4OBBA 3U4HA 4NBTA 1TEZA 1FUUA 1FIUA 2HLDA 2G82A 4RMNA 3BIJA 2DLNA 3ZU3A 4FQ7A 3FYDA 1K9VF 3M2PA 3RTGA 2F48A 4DJJA 1SA0B 3LRTA 2GK4A 1E3IA 4XSGA 2V7TA 3OTIA 3N8NA 4DM4A 4RHFA 4ER3A 4NCJA 2C42A 4TV9A 4YMWA 1KZ1A 3CIFA 1E3WA 2W8BB 3LTNC 4XCQA 3SI7A 3RDPA 1QCDA 3G8BA 2VZLA 4HDSB 3DXYA 3S29A 3TO5A 2NP7A 3QPCA 3RBAA 5IWAB 1N9GA 1TI7A 1UT6A 3U3ZA 1ACJA 1A76A 4IQ4A 5ECDA 1ORTA 3K70D 3HKEB 5B1HA 1TE2A 4DDKA 4ZI7A 4LBYA 5LWQA 4WK6A 2H2HA 3A8TA 3NP7A 2R84A 2BHSA 3VDNB 1JJVA 1DJOA 1PI3A 2DPYA 4V0RA 3AESA 3FWNA 4P4NA 4B85A 2YV1A 3E7XA 2GPNA 3AIOA 1WXGA 3ITKA 4MDHA 5CFMA 3AERB 3PPVA 4FMPA 2EHJA 3LXMA 2AL7A 4KG7A 2ZRIA 4BP1A 5A9SB 2FAXA 4AULA 1NRXA 1SVKA 2HN9A 4U02A 1H1LB 5CB8A 1TTHA 5F2KA 4AROA 1IJKA 3MTGA 1B0PA 1NI5A 4D79A 3ZWBA 2PUFA 1KQPA 4LYYA 2HI0A 3ZWMA 1VBNA 2WVGA 4XUGB 4AD8A 4QGHA 2RHLA 3EASA 4LISA 1QE5A 4QXRA 2FX5A 2ZPAA 4BFSA 1LDGA 4QFBA 5WRFA 4B83A 1KA9H 4ZCPA 1TT7A 4K9LA 3ROTA 4JNCA 1HURA 1NXPA 4BO0A 1DZIA 2IF0A 2BTQB 4M1QA 2W2LD 1COWA 4MP3A 5FJJA 2IZ0A 5HIKA 5JDCA 3PTAA 4H2DA 1NC1A 1J6UA 5AW6A 2D0OB 3CR8A 3PKIA 4Q7EA 2J9XB 3DP9A 3DP7A 1M1YE 3V42A 4KACA 2YUTA 3D4OA 4B17A 5I7EA 4GO1A 1G8FA 3LCJA 1VJ0A 4LXTA 4QYIA 4KGDA 4RY0A 4CIDA 5JNLA 2F1RA 1CUAA 4FXPA 3VDXA 1TCVA 3FWPA 1DBQA 1IOLA 3H2KA 4U7FA 3LZCA 4BQSA 1QOPB 4LXUA 1TQDA 1RRPA 1J70A 2JW5A 1L4BA 1XPOA 2BM9A 2ZYSA 1JPUA 2CLDX 4QGAA 4CDNA 4CM4A 1LV7A 3GIWA 2WSMA 4AMGA 3FMOB 1DKPA 4ARAA 4L2IA 1ELOA 4MKIA 3OIYA 2R2AA 2PJUA 2Q5LA 3HYSA 4D3ZA 2ZU0C 2CFOA 4Y2SA 2Z95A 1GZ3A 5GPBA 5LQNA 1A72A 3GLQA 4FYKA 1GRQA 4IQFA 4NAUA 1YNSA 2WDPA 1UQRA 4RDHA 1PR5A 2IOFA 4UUBA 4X93A 1EJBA 4ZHQF 2J4DA 3ZXYA 1E20A 5DI3A 4KWTA 5FA8A 4LXQA 5KYTA 3OZTA 5EZYA 3A4NA 5K8IA 2QAGA 3JVUA 3P2IA 2O2HA 1MO2A 1VMAA 2GPWA 3IT1A 3VPGA 4AZSA 1BU8A 5I4BA 2J32A 3EXG1 5KBYA 3Q3CA 3NNSA 3LV8A 1KMQA 4BWFB 2C3MA 4CU5A 1RLTA 2Z8YA 4LY9A 2H8KA 4RA9A 4R2IA 2EFCB 4N8DA 2A9VA 3PNMA 1D2HA 4PZEA 1HPLA 4ZZIA 4NCAA 2VAVA 3T3EA 1BVYF 4WKBA 3WWCA 1KO7A 2FCRA 1YJCA 2AH5A 4RHUA 3WTCA 2PPLA 1SA0A 3F90A 3U19A 2O3UA 3KB8A 3G1WA 1Z4IA 3E4DA 4NJOA 5K2OA 1HKUA 2W8BA 3EZ2A 4UM5A 3BFPA 4YV2A 3O3NB 4HDSA 3ONEA 4LJKA 3VFDA 1W6RA 4EVRA 1ISPA 3STVA 5JQGB 3TG2A 2FPLA 2VG8A 3LLCA 4ZEVA 2QI9C 3GW8A 1GAJA 1XZQA 2XH8A 2ZYGA 3HKEA 4NH4A 4B5LA 4MHTA 1TJ5A 1KIFA 3RG2A 4DIOA 5ES4B 1IH8A 1KZ6A 3IDOA 2IYVA 1V9SA 1YQTA 2FR1A 2V9PA 4A0RA 4C88A 4D96A 1E9AA 5CXSA 5DHRA 5B57C 4QLAA 4AKSA 3VA7A 2PXHA 1D7OA 1UMDA 4S12A 4H31A 1UFOA 1I4OA 1VJDA 2Y66A 3AERA 1RAEA 1RYNA 3CSDA 3R4VA 4M0PA 4UVDA 4E08A 1QCYA 3I8SA 3M5DA 1VHQA 3IVCA 2HCFA 3E7FA 3CRNA 3T94A 2DVMA 3RUAA 5A9SA 2V03A 1CUBA 3IDSA 4L9RA 5L3RA 4HZUB 1H1LA 5SYAA 5B36A 4KHPB 2ZVPX 1W36D 1RRKA 3JWGA 4OGKA 3ZNNA 1ECCA 3OX1A 3SHFA 4G1BA 1AKQA 1Q50A 1TM7E 3DNFA 3PTZA 3AHGA 4K8OA 5FBKA 4ZIRB 5E7IA 3FHTA 1H22A 1M1NB 4OQZA 1N5RA 1SHZA 2PZLA 1K27A 2V4UA 3IKJA 4MK4A 4RPHA 5T4EA 2HMVA 3DHEA 4X41A 2C98A 2IRWA 4I14A 4OSPA 1UKEA 3WGIA 4YMIA 3LRPA 4MVJF 4RMIA 2OHJA 4WFJA 2BTQA 1KRXA 4BFCA 1ESZA 1Q2XA 1YVDA 3TUJC 3LNTA 3W34A 5LP6B 4LF7B 1E6UA 3ORQA 2FP4B 1ULBA 1YRLA 4NBUA 7REQB 3GFVA 1Z5GA 5KYNA 1L0BA 1PFVA 1BNCA 4GBMA 4BFTA 2RIRA 5ECYA 1PJQA 2FMIA 1LS1A 5IYZB 1T24A 2TS1A 4N3AA 4ED9A 4R2WA 4IW3B 4K9RA 5JIBA 3PX3A 4MJ3A 1SCIA 3HNRA 4ZCIA 1X1BA 3KZ1E 3QU9A 1A7AA 3CS3A 3OU6A 4NE7A 1NPDA 1ZD8A 4FFBB 5T4HA 3I2JA 4MRAA 4DCMA 2FZGA 5K99A 5ALUA 5CG1A 3JQ7B 1PHRA 4TZ0A 2PCLA 3LCVB 3RASA 4R81A 3GJ4A 3WXMA 2AMLA 4E03A 4ZFNA 3BS4A 3EIOA 4YEDA 1KDOA 3KTAB 4DRZA 3BFXA 1TEHA 2RHCA 3MB8A 2WM3A 4F4JA 5J1SB 4KKVA 2Y68A 2ODEA 4YECA 3AETB 2BMDA 4BGVA 2RI1A 3IQZA 5EWJA 5EXDA 1WD7A 3H5NA 1HTBA 2EHDA 1Y8AA 1C4KA 3D8UA 2DZDA 3IHKA 2JJ8A 3PCTA 2JATA 3W6OA 4XSVA 3L8GA 3QBEA 3AR9A 5L40A 2MYTA 3Q15C 3PYMA 4YDRA 4U5QA 3RB8A 1WRBA 3HLKA 1XTSA 2GHRA 4D4GA 4UPDA 3AVUA 1AS3A 1SXGA 3TDNA 5BSKA 2ICAA 2YV4A 4H7KA 1E3LA 1HLPA 4NV0A 4X71A 4BLSA 5AVYA 1LVGA 2ATCA 1Z6ZA 2VOJA 4NBVA 1YAHA 2K6GA 1GD1O 1O89A 2XZDA 2L82A 4FEGA 5CNMA 5FPYA 3UPDA 4J91A 5I5EA 2A5LA 4XYLA 1HG1A 4ZD6A 1G3IA 1QC5B 1YQ9A 4UVGA 3WDLA 5AW2A 3WIBA 3ZNOA 1ZZGA 4CIVA 2XYGA 3RC8A 1NYLA 4AG6A 1W34A 3P9YA 3GJTA 3X1YA 1WHTB 4EY6A 1X6VA 3GT7A 3H04A 1TMYA 2HCBA 3B3GA 5IVDA 1KEEB 1Q11A 3IP3A 2DSTA 3SR3A 4C03A 5JDCC 4IVRA 4J0HA 2ZKLA 5A4DA 3DMTC 4AZ3B 1IM2A 1K75A 5JQGA 1LDNA 1T34A 3ACCA 2R6ZA 2GVNA 4I7EA 1M2GA 4RX1A 4DCGA 2WWHA 4QG7A 1NTOA 3B5EA 1ZQ1A 4YRQA 1YJAA 3BMNB 3TQFA 2FFJA 3WK7A 2AFHB 1T5HX 2O8CB 4OYYA 2JCXA 1LI5A 3EQ6A 4D74A 1ZUWA 5JLAA 1UF9A 3PR2B 2HK6A 4JP3A 4TTQA 1ZPDA 2WAXA 3W6PA 2Z30A 4EI9A 5HZMA 3H0KA 3DV2A 1EA7A 1W96A 2MINB 4YJFB 2XRYA 1XD9A 4CUJA 2VHJA 3HBFA 4MOWA 1TK2A 1PJCA 1JU3A 4U9IS 1C1XB 3O4FA 2HTFA 2HIMA 4L1KA 5IXSA 4TROA 2H5IA 1VGVA 4HZUA 2QX8A 3DO8A 1M8JA 3IB6A 3BUSA 1YB2A 4DIUA 5KTYA 2DQZA 2PWAA 1IZZA 4HX9A 4YUVA 4D0SA 1RT9A 1CKEA 4TTVA 3ZK7A 4ZIRA 4I9HA 3PHCA 2KQUA 1W9HA 1B6RA 1M1NA 3NBUA 3VYRB 2A78A 4EGAA 1ZMRA 4ZXPA 4UBJA 1W47A 5FA5A 2O23A 3GLUA 2DSNA 3CEPB 3FPFA 3EIXA 1JN0A 1DO0A 2QRGA 4RH1A 5AJXA 3CJTA 4N5HX 5DPMA 4BE7B 5IKMA 2NADA 2H1OA 1MNQA 2YNMA 2R68A 2R79A 3ROZA 4IDDA 4DVJA 5A3JA 4NL4H 1BQ3A 4R5HA 1O2DA 2FP4A 1FJ2A 2PZAA 4Z49A 7REQA 3WQRA 3D0RA 3DOOA 4FIDA 5LPNA 3I23A 3KYBA 5EKUA 4NCBA 3VKGA 3AVTA 2VF4X 4Y9RA 5LQRA 1NJFA 2O2JA 3R3XA 4O8CA 3SZLA 5IYZA 4KBYA 1U63A 2II6A 2L17A 2FOXA 4Q3LA 1KXZA 1MTOA 2PX8A 3WGUA 4F9GA 5KNCD 4AZVA 1K6XA 5EHZA 2JFPA 4UTNA 5CU7A 4FFBA 2D7DA 3O93A 4ZEOA 4NYMR 2AQHA 1V4BA 1VMEA 3JQ7A 3OQ1A 3U4IA 4LPSA 4MWTA 2R5WA 4A2CA 2HCRA 3CJQA 4F1JA 1Z34A 1SHLA 4I50B 5AVZA 4HWTA 1U3WA 5AVJA 2I1LA 1PJZA 3PUJA 4HAIA 2C54A 4V0NA 4B43A 4BFYA 5JSFA 4F3RA 3WHKA 1IUNA 4XD2A 4OHKA 3QMMA 1DIBA 2QAJA 1DC6A 3MF4A 3MJFA 3AETA 1AKYA 2ZIGA 2Q2VA 3C5EA 3D4LA 5FQNA 2GEUA 2OG1A 4V24A 1YVRA 3FRIA 4PZUA 1SUAA 4JQCA 1PX0A 3WC4A 2NZ2A 4QFMA 1BXZA 2PKRA 2FCAA 4KAAA 4NBRA 4DQ0A 4KMMA 4CF7A 2UYQA 3MMXA 5BSHA 2ZITA 3D7RA 3IR6A 3T3OA 2ODBA 1HH4A 1JHXA 1Y4SA 3W8EA 1IY1A 3DXFA 3PL1A 1B74A 4RQUA 4UHHA 1GL9B 1M8FA 3ONFA 1QVRA 3QRWA 4HQ0A 3WYDA 1HMYA 2PKWA 2VJNA 1R0YA 3MS7A 2WBLC 1Z06A 3SOPA 2XBMA 3UWDA 1WDTA 3N70A 5I9IA 2BFMA 5HS6A 2AD1A 1NPYA 2GETA 4QYWA 3A6JA 4WBSA 3MD0A 3LKDA 1CEXA 5HVNA 4N7BA 5CVJA 1QC5A 4TGLA 4M1SA 2D4HA 1QV9A 3MGAA 5AJWA 2O2CA 3ENVA 5CVTA 2EFYA 2TRSB 2ON6A 3UMMA 1WHTA 3UVEA 5B4TA 2ZQYA 1I01A 2QUKA 3O0TA 2O5CA 4M8IA 4NMLA 5ENVA 2HRDA 3VOSA 3ZDYB 3L7OA 1EXWA 3FF1A 2BP7B 3NNNA 4R2MA 1W5AA 3AUXA 1SIBE 4D99A 2FUNB 2JCVA 2Z2JA 3E9QA 4S0XA 4EW3A 2XRZA 4MPRA 4LHXA 2OXFA 3TZKA 4RHXA 3RV4A 4DR1B 2FEOA 4Q01A 3BMCB 2JFWA 4I4CA 2I80A 3BMNA 4QVGA 1YZNA 1DKOA 3G49A 2WKSA 4QQRA 4X65B 2O8CA 4MGYR 3VISA 1FX1A 1LK5A 1USIA 1HFWA 4YXFA 2VDQB 1KJWA 4KKXB 5EGNA 3WLTA 1R27A 4MW1A 4PZLA 2FW8A 4RXMA 4ZO9A 4R0MA 1Q0RA 2Z4SA 2IYYA 2MINA 3HN6A 2BMEA 2DHRA 4YJFA 3JQAB 3DEJA 5ALVA 2I6FA 4E5PA 1XDUA 3MCTA 1IQPA 1NU6A 1WB4A 3DOCA 3LKBA 1C1XA 4TLBA 4E13A 1VB5A 2WFLB 4RNDB 3C3KA 4S2UA 2B8WA 5KNDA 1MGPA 1SU7A 3L9WA 3U56A 4HC4A 3NDBB 3A4LA 3K9FC 2GM3A 3ZVRA 2AEEA 3COSA 5HKBA 4DYDA 4KR2A 3OEYA 5F1PA 4IGFA 3VUEA 3LY8A 2NLOA 3A70A 3KEGA 2ZI7A 2E4YA 3Q3VA 2GWRA 3EYWA 3KKQA 1YQUA 3C15C 1KFKB 3NAQA 2FMTA 2QTBA 2OBFA 3L92A 4RJTA 3DMFA 5IU6A 2Z57A 3PUHA 3I92A 3LVQE 2ESRA 4YV1A 5TNXA 1R8SA 3M49A 2XHZA 4F3CA 2FWIA 3RWOA 1AU9A 4N3GA 3WV4A 5AUNB 1HLDA 3A31A 1E1QA 1CZUA 3ZVKA 2AE2A 4JZYA 3E9EA 2GQ0A 4HLDA 5IABA 3HTXA 2NIPA 2WKQA 1S2NA 5MN5A 1A9RA 1ULHA 2XCTB 2WZQA 5CHYA 2OSBA 2WU1A 3I0NA 4HTAA 3D5EA 1LD3A 1Z74A 3B6MA 5LIRA 2OWEA 1SELA 1QGDA 4C07A 1TLTA 2P4QA 2HZ7A 3BULA 3OVMA 3H11B 1ZMBA 2RI0A 2FFQA 3F8SA 3LC1O 5ERYA 3RD5A 4BZXA 3UFBA 4YTEA 3MWDB 4DA9A 1ZP6A 4EO9A 4I50A 1O94D 4FMDF 4DDHA 4Q1VA 4I8DA 3ZWDA 1IIBA 1QYCA 2Y99A 4CMEA 3ESRA 1YRYE 2XBUA 2R6GA 3GLIB 2VTDA 5GTDA 1M10A 3CLTD 3IDQA 4D5GA 3SICE 5C5EA 4LNAA 4GLBA 4IP0A 4Z8YA 2VDUE 5T57A 4WXHA 1ZRSA 1DRWA 4UCQA 5EPOA 1Y1LA 4L4SA 4JY7A 4NEGA 1Y4UA 5ESDA 1HE3A 4L75A 2HQBA 3DV0B 5KTTA 3IL2A 1RI5A 1E2KA 2O7RA 2XITA 1NVDA 3JR7A 5ILOA 2FKAA 2ZETA 4RH3A 4OOFA 4WA8A 1BH2A 3SSAA 5GZ1A 4J4BA 3WICA 2JAXA 4HL6A 1FDVA 3KQLA 4BGDA 1HDXA 2XUZA 1I6MA 2NG1A 4ZAVA 2FZ5A 2BRUC 2JK0A 3HDTA 2JAHA 4URUR 1DX6A 3TE7A 2GJAA 2UZ1A 5IAJA 2IYPA 4MVWA 2ZEJA 3CG4A 4UCFA 5AICA 4AMBA 1F3LA 3LT4A 5DWDA 5KMGB 2COKA 4EYQA 3ZGZA 4J90A 1UT5A 2F1HA 2RARA 5TEVA 4FE4A 4GU5A 1NNI1 4QFDA 4WTOA 4KXXA 1ONOA 3V9PA 2Z2YA 2KE5A 4GMGA 1JE1A 1YBVA 2VNSA 4JITA 2AK3A 3NRJA 2BP7A 3CY6A 3VH1A 3RRBA 3UNXA 4TN5A 4LN1A 3GA0A 5LP6C 1BWPA 2W0SA 5JC1A 3T52A 3NBAA 1QLJA 2OWDA 3SMQA 2GF9A 3BMCA 1EIWA 3LLMA 3WB0A 2IGTA 3PDUA 3CH4B 1J4AA 4MW0A 3OF2A 3FBTA 2BHTA 1L4LA 4OCZA 1E3EA 1Z2CA 2PR2A 2DOKA 1A0OA 4MIYA 4MR9B 5KYYB 1RXWA 4WESB 3IUMA 3ESZA 6GPBA 4PLCA 3EGDB 1JQLB 2J9FB 1O9GA 2QAIA 3OZBA 4UEWA 3UY4A 3WAGA 4LQ4A 2PU5A 1P9OA 1Z7WA 3LRXA 3MK31 3MCVA 4MW7A 4RMGA 4YP5A 5JYEA 2WQZA 1BHSA 3G8YA 1U2QA 2H00A 5K8TA 3JQAA 4MI3A 4Y2HA 2NN3C 4NESA 3VU8A 4RD4A 3ZBQA 1B42A 3OLVA 1SVOA 5BXYA 2V7VA 2WFLA 3ZE9A 2QTRA 1ZJYA 4HLQB 1K08A 3T9EA 4O08A 5F35A 5ESWA 4CGZA 3O4GA 3VZSA 3B1WA 3CX6A 2BUBA 2EG9A 3GRRA 4L50A 4TN1A 1ZD4A 4DUPA 4F5ZA 4RTPA 4LCEA 3LF2A 5F76A 1QE0A 2XCLA 1XZJA 2Y1OA 1GDHA 2RSLA 4LSGA 4YAGA 1PIWA 5IAOA 4OQ4A 1W5FA 2HWKA 2BGMA 2ZJ3A 3VI4B 4D6XA 1DU4A 4HH0A 5AI0A 2IHBA 4RAOA 2P9CA 2YJ4A 3B3FA 2P5YA 1SHJA 3DE3X 3KKZA 3M33A 4TTRA 4Y9DA 5T3UA 2H0QA 2AXPA 5A3QA 3KLNA 2PGDA 1RHJA 4WFQA 1GOTA 3ME5A 3VTKA 1HDYA 2WM9B 3MCUA 3RFVA 3M81A 4Z7OB 4ZYZA 3RVQA 4B3XA 4FZJA 2WT9A 1NN0A 4PHFA 1JYEA 4CE6A 1HI9A 2ZE5A 1X1RA 4AY4A 3NHUA 1NG1A 2AJTA 1CVIA 3ZNPA 1NVFA 1OH8A 1EESA 1NXSA 4EW1A 3RADC 2JJ1D 3DZFA 4C01A 1QH8A 2CMFA 2AI3A 1XD2B 1P45A 4GECA 3H11A 3ZNQA 3VI3B 4QM7A 2GCPA 5CDFE 1OWNA 1GA1A 5AJHA 2J0QA 3S55A 4RIIA 3MWDA 2O50A 1UR5A 4N9QA 1KEVA 3Q2IA 5DYWA 3TGWA 5ABPA 3EVNA 3R9IA 2O2SA 2OO5A 5HG0A 3WBFA 5TT1A 3EG9A 4UAVA 4G24A 2Y8EA 1PVDA 4ND8B 2UKDA 3GFGA 3MUNA 5K4AA 3RJMA 1XRNA 3GLIA 3QH4A 3OZFA 1MQSA 2ES4A 3V34A 4EO7A 4B34A 3A6GA 4JOQA 1IZ8A 1G5HA 3UC9A 1E79A 1J90A 5D1NA 2WF5A 2CV1A 5IAEA 1XMQB 4FT4A 4A4DA 2PAFA 4F56A 3GNQA 3PDWA 4I1VA 3KHSA 4M8SA 1P3JA 1O4VA 3DV0A 3L82B 5A03A 1YZYA 2QD2A 3K6RA 3Q9UA 4LOIA 4KN6A 4N5DA 3UAOA 4AF7A 5KO2A 4PY2A 1EK5A 3TDKA 4DR7B 3TRDA 4C9BA 4NZYA 5HFAA 3RBVA 2WHPB 2D59A 3DMGA 3I73A 4I9UA 3O1JC 3KCNA 1C7EA 2NAFA 5CURA 5EWLB 4NHEA 2OA0A 1H85A 4MS4B 4G5RA 3AB3A 3T61A 1U9CA 2PYDA 4FM9A 4LG1A 1CHNA 1PQWA 1E7YA 3NTQA 5DBFA 3R5SA 1LLDA 5DGIA 5KMGA 1EFRD 4FEEA 3UXEA 5FYQA 1WX1A 4B6EA 1IHUA 2B0JA 3FMFA 5E3JA 5FNVF 1QIEA 3QWBA 2HUNA 4YRSA 1L3BA 4HQLA 4RA6B 4DMCA 2IZ5A 3VMMA 1CUSA 1N2JA 4HB3A 3JQCA 4F5WA 2C5SA 3FKSA 2LKCA 3MZ0A 1G63A 3KQTA 1AB6A 1N33B 1WVGA 3QV1A 3MWGA 4MGHA 1A2BA 4RZIA 5FR1A 1L5OA 1LFAA 5G3ZA 3HK2A 1YULA 3KFVA 4G0YA 4NC9A 4Z9BA 3H18A 3DEFA 4CTOA 5IFKA 3FKJA 4HEHA 4LK3A 3NHKA 3OKAA 5GJBA 4MR9A 1CQXA 3UPTA 3HVHA 1ZOLA 4WESA 4ZQFA 1QFXA 2OHGA 1Y9JA 2Y1WA 3G8AA 3JD1A 2J9FA 2DFNA 2DPGA 4RY8A 1MPTA 4W7HA 4UQLA 1N5DA 1EUYA 2CBXA 5NLLA 5BUCA 1VRVA 4O3FA 4OA5A 3NPMA 5IVPA 1J1UA 4WOBA 1ZXLA 2IHYA 2ZQ5A 3KNZA 4Y2UA 3SWWA 1ZOPA 1T2DA 1Z5NA 4OYRA 4RLFA 4YMLA 1MHTA 4BLOA 3TSOA 2HZBA 1NN5A 3KLOA 4C76A 1FCJA 1MA0A 1XDWA 1W94A 3H16A 1TKAA 3HU3A 2FUEA 2ORIA 4HWRA 2B8EA 5BWCA 5DP2A 1D09A 4EHHA 4TL9A 4NS4A 3SM9A 2RCNA 2CMDA 2IP4A 3SG0A 3TZHA 5FOQA 1OXMA 5GV8A 1VJGA 1P8AA 3L6DA 3DG9A 4C5CA 4G0MA 3BXFA 5C8ZA 1XRJA 2WUGA 2NV6A 1R9GA 1P17A 1G7RA 1M2JA 2P69A 5ADUS 5H8WA 5ARCA 4HMQA 4XB2A 3OQOA 1YI0A 1QORA 2BFCB 2KX7A 1V8ZA 2FVXA 1XPUA 2PBRA 3AUJB 2AZ4A 2CUNA 4EVQA 2F67A 5CT6A 5EKXA 3DMYA 4GX2A 2ONJA 1VL5A 4EK9A 3LP5A 3L01A 3OUTA 4S24A 5IAKA 4TM7A 4E6PA 4I1YA 3U62A 4I8IA 1OLOA 3JD0A 2OGTA 1OZGA 2CWWA 2DKNA 3EOBI 2QT1A 4X95A 1XD2A 3TAUA 3PTLA 5TEWA 4YDQA 2YJ6A 1X3LA 2D4AA 1EFKA 3KQMA 5C1PA 1YRWA 4QDJA 1XDZA 4BB9A 5IARA 4CPDA 2B4QA 5KTKA 3UH0A 3NV9A 2ZSAA 2O59A 5AIBA 4OUDB 4AVYA 1Z88A 2CLEB 4B3DA 2Q3MA 1OWPA 5HDBB 4QRDA 4EGCB 1Z28A 4ND8A 2DFDA 1REQB 5IJAA 1XEFA 1OZFA 5CDHA 3DHVA 3GUUA 3NHBA 3I1IA 3UGQA 3E48A 3B48A 3VKWA 4P4TA 2OE2A 2H17A 4GXNA 3GXOA 3TEMA 1XE3A 5A5VA 1G1MA 1UZAA 3GMIA 4Q4DA 4WY2A 4G8DA 1Z15A 3DT9A 4RXTA 2FUG6 4PEVA 5TS3A 4A0GA 4EITA 4RTJA 4W5NA 5IUNC 2ZUWA 3WNDA 2YVAA 1K1EA 2A67A 4Q05A 2C7QA 1KPIA 1ZHHA 3GHYA 5AI6A 2WHPA 4ZTBA 4RSRA 4G0OA 1R3DA 2ZE8A 4F7WA 3P9IA 4XLTA 4MS3B 5EWLA 5F5LA 2BFAA 3WJ1A 4MLDA 4MS4A 4KHZA 1PZFA 2GAFA 4PE5B 5EJ6A 4G23A 3W1WA 2L18A 2HSJA 2JIZA 2C1EA 4C5AA 2VNHA 1H0HA 1EAYA 2PGIA 4LBWA 4YMHA 5KHOC 5KNBD 1GG8A 4A8PA 4XDGA 2YVLA 1K98A 4TTJA 2W6MA 3GUVA 1YC2A 1VBKA 3L0ZA 2CUTA 4TTIA 3VHLB 2Z09A 4WVFA 5AM1A 5BRAA 2IODA 4QRHA 4F3TA 1K63A 5AP9A 3WGGA 2IPNA 3PUWA 1CETA 1X1EA 2PQ2A 2B3TA 3VTZA 5TGDA 3OCYA 3RAJA 2P9GA 3ZWYA 2R65A 1OBCA 1UK8A 1BA2A 1JLRA 5DEIA 1SUPA 5K3CA 3P32A 1DRJA 4OJQA 1H8EA 1J22A 3BH0A 2Y0BA 3OLXA 3WOHA 4AJ4A 5LYJB 3I9NA 4AWAA 3ZX4A 2W0MA 4HYEA 4MVJH 4OQPA 5TY0A 1GA4A 2Y6VA 2YN4A 2PWBA 4YRTA 3G88A 1L1RA 2OYRA 3ZD7A 3WHIA 1Q84A 2V6MA 1E0SA 4BZZA 3U5TA 4KOAA 4M1KA 3F7MA 4BVFA 4H1HA 3JYLA 3N7TA 3IV6A 3OZEA 4CMAA 2BGWA 1H3EA 4D82A 1SVSA 1O54A 2MWMA 2PWPA 2ZYVX 3HXPA 5F2EA 5C0OE 4BO2A 1MW8X 4JGGA 5FAXA 2PQ0A 2XNDA 2ZIXB 3KTFA 4NCXA 4B9AA 2ACEA 4IM7A 2L42A 1P0MA 3DD1A 2JH9A 3SDSA 2H31A 1FJXA 1S01A 3D02A 1QP8A 3WZLA 2IYSA 1RYHA 1PNRA 3KETA 4D81A 1JYSA 4RK1A 1CFJA 4N49A 3SDZA 6AT1A 2YS7A 1DNPA 1NJ2A 1VGRA 2XUOA 4A26A 2WIJA 4CG3A 4PC2A 1X1SA 3QXJA 3IEKA 4OXNA 5KTNA 3G85A 3R23A 4R98A 1J39A 1TYCA 3N0RA 5CVUA 5TV2A 3CCFA 3M6UA 4HNUA 2W4QA 4FFWA 1CR4A 1O6FA 1E7QA 1WP4A 1UKZA 4M38A 4DSTA 5CDSA 4EFNA 3SFTA 3V55A 2IXFA 3NATA 4ND6A 3IBSA 4IO0A 1T5OA 4XW2A 5EFOA 3SMVA 1CF2O 4XIGS 2DQ4A 1PGPA 2YFKA 4R8SA 3I5UA 3TSAA 1DLIA 2EU8A 2EZTA 4WW0A 2QN8A 4IFIA 1ESDA 4EUFA 5A7FA 1TM3E 2NO0A 4OL0A 4WPGA 4P38A 2VOEA 3G2PA 3E9MA 4R1NA 2PUGA 3IAEA 1X7DA 4HOYA 4WXYB 5K6AC 3HU1A 5EL0A 2O7QA 4OUDA 1D8TA 2G4CA 2Z6UA 4G0VA 5DSZA 1REQA 4CRWB 1VYUA 4RAQA 2N1MA 4AKTA 4QELA 4I99A 2W6ID 3KD3A 4PLYA 5E4YA 2CDNA 4X94A 1ZSNA 1OZHA 1NOIA 2BMAA 5AHXA 3TE6A 2G9RA 4LHYA 1OYWA 4PPGA 2SECE 3OF5A 2OKCA 4V0SA 3ZV4A 4BEVA 1BWRA 1TU3A 5FLKA 2DH5A 5BPFA 4H7DA 3LO5A 3HO8A 2I67A 3NASA 1PP4A 3AB8A 4XD7D 1C14A 1ILWA 4BC0A 4Z7NB 5BQ3A 4F91B 4KYVA 4YIHA 4RMHA 1Z83A 2V0NA 4OM7A 5H4GA 3Q10A 4MS3A 3GGOA 2VQ3A 1ZLYA 3VR3A 4D9JA 5CEJA 2C9MA 4J7UA 4J1TC 4OKIA 3W8DA 5E1BA 3B7GA 1UM9B 3MBKA 3L6CA 2B8TA 1JHUA 4DIDA 1GQQA 1EA5A 2IVZA 3R5FA 5C7OO 2QY6A 3OO0A 3ZGLA 4ZKEA 5J2UF 1GSIA 5DNYB 5KVQA 1PJ2A 1M2OB 4XGIA 2Q5CA 3Q6NA 5BNTA 3KTDA 5AWFC 3R6WA 3SFVA 3P9ZA 2PKQP 3TXYA 4DADA 2C8VA 1VHJA 4EB0A 1AIPA 2B2XA 3ILYA 3C98A 5ECGC 3GEMA 3O2NA 4BQNA 1Q92A 4CUZA 1XALA 3AEUB 4P5DA 3RS3A 2GSWA 2QW1A 4I3HA 5LYJA 5IPFA 1FMCA 1P0IA 3D8NA 3UICA 3HBJA 1H0KA 1P1BA 2NAPA 4H3SA 4XPZA 3SKXA 5IMSA 1TAHA 4PZ0A 1SWVA 4KXWA 4P3OA 4WKCA 2HQ1A 1L4YA 2J59A 4J0GA 1G3MA 2J3LA 1QBKC 2YJ3A 1IUOA 4K1XA 3BD8A 1RM3A 1ZGGA 1RPTA 2IUYA 3LUHA 5FLYA 3K0AB 3OIFA 2AQKA 3AJ8A 3OT4A 4WKNA 3K1ZA 1S5PA 2FN7A 4C20A 2VHUA 2XV1A 3CJRA 3VU3A 2CB9A 2PAAA 4LMBA 1FYVA 5FR2A 4MUGA 2H92A 3U0VA 4TL6A 2P3LA 2WNHA 2ZIXA 2WHRA 3VPFA 5IK2D 1MOPA 4OU4A 1G2PA 3EFBA 5FOWA 1WEKA 2X7HA 2WYHA 1T10A 1SWWA 3RFUA 3PCXA 3K4HA 4TQUS 3ZG6A 1PNTA 1SKYB 4PYMA 5C1BA 2UYGA 5CG2A 1E5LA 2NU9B 3UBMA 3OCJA 5K5EA 4ER7A 3UJHA 1EMDA 1WCIB 3DF7A 5EPUA 2VYNA 4ALLA 2R0QC 2EGHA 4HX2A 4BMSA 1ML3A 5IEJA 1PYGA 4ENWA 3ABSB 4KTVE 2VJAA 3HYNA 1TJ3A 4M2LA 5AJUA 2AOWA 1W0JA 2OBNA 3PFWO 4G36A 1XN1A 3TTWA 2POQX 3WGZA 4MUFA 1JGTA 3R7LA 2VAMA 3RVSA 1SC9A 2VSOA 3LL4A 4HFRA 2HSWA 2ZUTA 3SR0A 5K01A 1VPWA 5HUJA 1V5IA 4CM7A 4V02A 2BM1A 2C99A 4B3GA 1R9MA 1ZICA 4I19A 1JNXX 1DG3A 1DIHA 1UJMA 5H02A 3CF6R 3NIDB 2DUNA 3TLAA 1BDJA 2ATXA 1BHO1 5A5EA 1YZHA 3A1CA 4LVOA 2W37A 4P3KA 4X7RA 4C6HA 5IW8A 1YFJA 2O0KA 1AXGA 4XB1A 2QG4A 3WK9A 1QK4A 1ZRMA 3IBCA 2VUHB 1FYDA 2WFAA 1ES9A 3L6EA 4PN3A 2P6RA 4PFQA 3HCPA 1I32A 4MSUA 4F72A 3AFMA 1NZDA 3CF2A 1QTRA 4OB8A 1KJYA 1TKRA 2O0LA 3HJNA 3TBHA 4YO8A 2PKCA 1DTEA 3HABA 3KKEA 1C8VB 1YC5A 3GCGA 3ISTA 4GXRA 3ZZ1A 5KSZA 3WO1A 4RU1A 3TKAA 4Q9AA 1U6JA 3AM3A 5KIAA 3GDGA 4K9SA 5FRDA 3WDKA 1TJYA 1C9MA 3AI3A 1AQYA 5EUQB 2Y9MB 4NPCA 1AO3A 3O2JA 2JJQA 4CMKA 4G5QA 4CWAA 2XDAA 5HJ5A 4LQCA 2QPTA 5CK5A 1E0KA 1V35A 2I7CA 3AR3A 2W7TA 3DCNA 4ETWA 1OFIA 4NZ9A 2J8ZA 1NJ5A 3NWOA 4X85A 3MNFA 3DGFC 1E8DA 3NWEA 2OCXA 2O1SA 2OILA 4Q3EA 1NRJB 5KHAA 3KQQA 4OK3A 1DIGA 5FDFA 3O38A 5KYUB 3L40A 2AOVA 1CZNA 1UM9A 1CIPA 1OFVA 2A57A 3IAM6 4ENQA 2QRKA 4DJFC 3KWLA 4L08A 2ZIFA 4ZOBA 3OFSA 5BWLA 2JGIA 3IUBA 4CTMA 4H7EA 3GDHA 3VH2A 1M2OA 1KYTA 1O5OA 1GQRA 1CRLA 1R6TA 1BDBA 3G02A 3LLUA 4OJKA 1I4EB 2IUTA 5JZBA 2CCGA 5H7XA 1FBNA 2V8BA 4MEJA 4BVKA 1YNOA 1ORVA 4HRYA 1ECFA 5A3VA 2H52A 4FI3C 4RSMA 5LU8A 2BH9A 3O4IA 4OBWA 3M4NA 1WNFA 3DVRX 4RVSA 2G9UA 2IY9A 3HUUA 2XMQA 4BVGA 3WRXA 3DJYA 1RE1A 1Y8CA 2WKWA 4FW8A 4HLUC 5CX1B 1I8TA 2BT4A 3PL5A 3F73A 3UOAB 3DWIA 4CEHB 3K0AA 2K4MA 1YQWA 3N3AC 5AKZA 3DKVA 4Z3OA 3NJ8A 4RKWA 1BFKA 3BWXA 5TMBA 4CCAA 4JHLA 2PMDA 3D6FA 1LQUA 1XNGA 3RTDA 2GFIA 4NFLA 2YIMA 2P2NA 3L8DA 1QF7A 3TTXA 5TMPA 2GH1A 4B4WA 3GBPA 1JDJA 4XVHA 5KTOA 2AE1A 4Y2PA 3W1EA 1G4AE 2MIIA 4ILEA 1VYVA 3AJAA 3RSZA 3OP4A 4V0MA 1WUIS 2NU9A 2ZANA 2Q29A 3CH6A 4F11A 1I1QB 1WCIA 5DGCA 4RPJA 3UMBA 1R50A 4LVCA 3P27A 1QZ3A 2GZMA 3FUTA 4P35A 4Q37A 1I7DA 1F12A 1X74A 2J4CA 1T0PA 1YR3A 1F0NA 2QEQA 1ZJ5A 1PF7E 2VPYA 4NZPA 3WSWA 4IWXA 5GQSA 2PYIA 3GO4A 4FE3A 4X3PA 5F7OA 2ZZKA 2ODNA 1YONA 1G8PA 4P93A 2WE7A 1UC9A 2IUSA 1R74A 1JAIA 4R2JA 2GHIA 4MKGA 1CY6A 4EENA 4BJ5A 1NRWA 4P80A 2QBYA 3AP1A 2IPMA 2FEWB 1N77A 3HKDB 1DAKA 1MX5A 1CYDA 3EVGA 5B3KA 5IH7A 3DC7A 5KYXB 4A10A 2AX3A 5EJ9A 5HILA 2O5EA 1NPTO 2FFAA 2YWJA 4H16A 3VO8A 4KO8A 2C83A 4LJ5A 2RHTA 4TPKA 4ECEA 2IEZA 5M5BA 2QIOA 1XRRA 3Q9NA 5JXGA 2PL1A 4YXWD 2Q3LA 3PSHA 4HNVA 3BREA 5KYWB 3HB4X 1S2OA 2H0AA 1DZ3A 1Q1EA 5BQXA 2B82A 2G28A 3L8YA 1GDDA 2QUIA 2YHIB 1Z73A 3CXRA 1JMVA 4OIFA 4X9XA 2WWYA 4AJ1A 3B36A 3GGJA 3M1IA 4TTAA 3RT1A 3OJXA 5BSEA 4Z86A 1H93A 4IJKA 2QN1A 4FB4A 3NVKI 1EJ0A 1GGJA 1SBQA 4DEYA 1ISHA 4HRAA 1P72A 1P0PA 4FP9A 5FTWA 3TR6A 4PPQA 4DLKA 1O9BA 1L7RA 3QEKA 1Q16A 3L93A 1MEJA 1XWWA 2HIAA 2PGAA 4LKRA 5TQJA 5I7OA 2QQ0A 5K8UA 4RV4A 2HSGA 4YCDA 4BNIA