1F2VA

Crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
209
structure length
209
Chain Sequence
b'PEYDYIRDGNAIYERSFAIIRAEADLSRFSEEEADLAVRMVHACGSVEATRQFVFSPDFVSSARAALKAGAPILCDAEMVAHGVTRARLPAGNEVICTLRDPRTPALAAEIGNTRSAAALKLWSERLAGSVVAIGNAPTALFFLLEMLRDGAPKPAAILGMPVGFVGAAESKDALAENSYGVPFAIVRGRLGGSAMTAAALNSLARPGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRECORRIN-8X METHYLMUTASE
publication title Crystal structure of precorrin-8x methyl mutase.
pubmed doi rcsb
source organism Pseudomonas denitrificans
molecule tags Isomerase
total genus 68
structure length 209
sequence length 209
ec nomenclature ec 5.4.99.61: Precorrin-8X methylmutase.
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02570 CbiC Precorrin-8X methylmutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 1f2vA00
2AFVA 4AU1A 1I1HA 3E7DA 1V9CA 2AFRA 4FDVA 1F2VA 1OU0A
chains in the Genus database with same CATH superfamily
2AFIB 4YUAA 2B1JA 4MGHA 4OJQA 5AMXA 2WAYA 5BO5A 3SOPA 2FZ5A 4O33A 3WMXA 1RJEA 3K1YA 1X9GA 4OU4A 1FP7A 3D2BA 1EBUA 1GN8A 1RP7A 1WDWB 4HFNA 4M9RA 3ZQ4A 1N2JA 4F91B 1H93A 1BX3A 1M0WA 5KYUB 4Q7JB 3KR9A 3TO5A 1ENZA 4OK6A 3DNMA 3K4PA 4YX9A 2C9ZA 5KNDA 1JHAA 3VZDA 5J23A 4YIHA 4R05A 3D4NA 4X65B 5IJWA 1A4IA 5IF9A 1F0YA 2IPNA 4D6YA 4EJFA 3K9LA 3CSUA 2QD5A 3TLEA 2I3DA 4OAQA 5DULA 4W8OA 4U63A 2VNIA 3DEIA 4PW0A 3ZGYA 5DXFA 4C4XA 1UFOA 3RYFA 4DYVA 1KI8A 3LG2A 1P33A 2X58A 2E85A 5FWXA 5FT9A 1JDJA 2FMIA 2B3DA 3IGFA 5K8LA 1KH2A 1YRAA 2WU8A 5H3LA 3KUUA 5DLDA 3CO0S 1D6JA 3HXQA 1A5TA 3FLBA 3PUIA 4MS4B 4YCJA 2FWIA 1PYOA 3D7SA 1IHDA 3HBFA 2QMOA 4HWKA 3P20A 4NZZA 4E88A 1V2HE 3F3YA 3ESDA 4I3HA 3WGJA 5I8WA 3N8HA 1L5MA 1A77A 4GL4A 1Y5NA 2DPMA 3CW9A 3NHLA 4RTOA 4H7EA 3FNEA 1ZMTA 3PU6A 4MKGA 5SZJA 5U4QA 2GZ3A 4BZZA 1MEEA 3FYTA 5ALZA 3V4VB 4BLRA 5BMVA 1NRXA 3SXJA 5KTKA 4UAVA 4RFLA 2D06A 2I1LA 2Y4OA 4FFMA 4MRPA 1RPTA 1O9BA 2QLNA 5C5IA 4HB3A 3U19A 1JBKA 1Q91A 1BNCA 2E7ZA 2FR8A 2VBIA 3WYEA 5DT2A 3V4ZA 3VO9A 3IQDB 1UK8A 2HJRA 3PFKA 2W4QA 1PWYE 3PXEA 3L8CA 2PH7A 2WQ7A 2ZJAA 4PCAA 1YR9A 2YASA 1H5UA 1CIVA 1YS1X 2WJJA 4BX8A 1ZMBA 1AS3A 4B6FA 2QUJA 2RIPA 1FU8A 2CF5A 1DWOA 3VO1A 2OKGA 2R8PA 4WBXC 1QE0A 2TMYA 5CXXA 3X1YA 4BKRA 4MIKA 4A23A 4II3A 4AM8A 3CPHA 1XHLA 1SVWA 2PCJA 3DFIA 3HUFA 2H0AA 3IULA 3L0SA 4XFKA 4ZT2A 2E3JA 4LF4B 1IY0A 1KBZA 2INGX 2XGJA 4EK9A 4QPDA 4V0MA 3W5DA 5LQCA 1VSQA 2V45A 1SXPA 4EW1A 1KQPA 2Q4OA 3O92A 4P08A 5CEEA 2W2NA 4YMVA 3L4JA 1KFBB 1SM4A 3A3PA 1XTIA 3K2EA 2Z9BA 1ISHA 1FNCA 1LWOA 2C31A 3CKMA 2VTVA 3X2SA 5DNYB 3PX3A 3EVZA 1U8CB 1VLQA 1BEUB 4CWAA 3R5TA 1YJBA 1DHRA 1N92A 2QR2A 2ZUSA 1T9DA 2WWRA 3QKRA 3OA0A 1SHTX 4NAHA 2KW5A 2XUZA 4RA9B 4FZRA 4MPJA 2W11A 3CA8A 4NBKA 3AV3A 1KOFA 2GXAA 1E9AA 5K0NA 3VDRA 4OQLA 4LFCB 3DQPA 2BZ1A 3R9KA 2Q5IA 2OMEA 3KR1A 4INAA 1RCUA 2O3QA 2I91A 3B1KA 3O38A 1HLDA 2RGAA 3MMNA 1HBJA 5MGNA 3VGJA 1AKWA 2ZSIA 4CE6A 4EW3A 3G0DA 2RE8A 2O8DB 2XDQA 1W93A 1R8XA 2OBMA 1U8FO 1ZUWA 3L6OO 2V7QD 3OE1A 3QQPA 3EG9B 4F56A 2K7FA 4O4IA 3P4YA 4KSCA 4ZKDA 2VLIA 3TYXA 1Q14A 5CIQA 3PC2A 5B1DA 4K3UA 1OLXB 4D4JA 4E07A 1QLHA 4DNPA 4UKDA 3H0KA 4IYRA 1LV8A 1SVMA 5JH7A 3DC7A 1RLOA 4P84A 3IOEA 3L6UA 1C9DB 4V0SA 3VPXA 3I2GA 3N6RA 5G02A 3ZLBA 1XDSA 1F06A 1ZDMA 3PDIB 5D51S 3W2EA 2VNAA 1IPEA 1JILA 4NU6A 5HF8A 4AJJA 4ARUA 5A5DA 4AKIA 2F3QA 5KQLA 3BICA 3PUXA 4OMFG 3ZCQA 1E3TA 2CL0X 2V59A 3LX6A 4L8GA 4PNPA 4B3XA 2WE7A 5DEIA 4D9JA 3DO6A 1LX7A 4FGKA 2NG1A 4B43A 5DMXA 2I34A 3F3MA 3ND6A 2HU5A 3H83A 5FBHA 4FJ1A 4ERNA 3NDBB 2P90A 4OP3A 5LQRA 1SBCA 3KBBA 1FSPA 3R0QA 2C0PA 4C0XA 1YDWA 2CVOA 4KXQA 1ZVVA 4LXXA 2AOTA 2GH1A 5HTOA 2NVBA 5A4AA 1RBQA 3B78A 4BJ6A 2ZIUB 2AHRA 5CA1B 2IHVA 1MF7A 4MCJA 1NUHA 3ZOZA 1P62B 3RIMA 2YXDA 4G3XA 1P17A 2P2YA 2QL6A 3MCVA 3BDAA 1WXGA 1RBYA 2B83A 4C4SA 4ZJYA 2NV2B 5BNFA 2PN1A 4I5EA 1P18A 1Z6YA 4J90A 1L5OA 5HNKA 3MXOA 4Y0AA 3C14C 1FB5A 1D4AA 3QEAZ 2PZBA 4LCJA 3OZEA 4C2UA 4C1NA 1OWMA 4NV1A 3L8YA 2XWJI 3OIUA 1P7CA 1U8XX 4MW1A 3UV3A 2R6DA 2H1CA 2ZIGA 1KHTA 2BRUC 1KQOA 2AEFA 3GY0A 4L8VA 4X20A 1RAAA 2QP9X 3AKDA 1LBEA 1CUEA 3E9NA 3WJAA 2WM8A 4KP7A 4BRUA 2C2KA 4NEGA 1QC5A 5AVVA 4BVLA 4WPGA 3Q7IA 5CX1A 5BQ3A 3QITA 4AZTA 4D1YA 4QJ5A 4KBGA 5JATA 3CUKA 4KK3A 2JJ2D 1KP9A 3N2KA 4YDSA 5KSOA 1VQ1A 4JX9A 5TMEA 1A8HA 3CX4A 4M0UA 1KAMA 2Q41A 2QM8A 3F9CA 3IBCA 2G5CA 1PBTA 3BL8A 3ENVA 1HMPA 2Q7XA 2WMNB 5JO0A 4AI6A 2NT3A 3RWMB 2GKOA 5I01A 5CLIA 4N48A 1V7QA 2ZE7A 5HZMA 3OF5A 2PGNA 2ZRAA 1ZL0A 1BXRB 4KZPA 4QT0A 2GD6A 1OFGA 3MTBA 2IV3A 4MYUA 2RGRA 4RABA 4GE3A 5CDGA 3LFUA 2HJHA 3NYQA 5AW5A 1JX6A 2Q62A 4D41A 3K32A 4JA0A 5CMLA 4Z54A 1NR5A 2JGRA 2WICA 5AOCA 5DN6A 4RQUA 4IMPA 2WAOA 3TBFA 3HO8A 4G4SO 4BFVA 2WU3A 4I8XA 4Z4HA 5HGJA 1C8BA 3N7AA 3JZDA 1K27A 2HPAA 5LN1A 2NU7A 2COKA 3KKOA 3G0HA 3DG9A 5BWOA 3HV2A 3UKDA 4CFZA 3D8BA 4RFSB 5KKCA 1USVA 2ZRQA 4PG8A 3JYOA 3BRCA 3E3NA 2DFVA 4GUAA 3V1UA 5I48A 4GGPA 3USCS 4EG8A 2D13A 2EBWA 3HFSA 1WVMA 5JCOC 1CT9A 2PTHA 3ZHXA 1JXMA 3AUUA 3G9TA 2F1KA 3L05A 1JT2A 4RNCA 1E66A 3OQOA 2PUFA 2C2BA 3R0ZA 3NAGA 4KQEA 3STWA 4XZ3A 1DUIA 2NNLD 3IE1A 1TYBE 2PX8A 5AW6A 1JKJA 1M2GA 1VM6A 4ZGBA 3W34A 3HYRA 3P0JA 3UPUA 3U7RA 1ZD4A 4MJXA 2H1WA 1KO4A 4LZOA 3SIRA 4DFDA 1MVOA 5KQGA 1B4DA 3IAHA 1NZJA 5KQMA 2JVKA 2DTXA 4DXDA 5F7OA 5CJJA 4EO4A 2WABA 3JQCA 2BCJQ 3Q15C 2FKNA 3Q9NA 4FS3A 4I6EA 4J0HA 1TAQA 4PVDA 1QYWA 2GTPA 1KZ1A 2ZSDA 2C9CA 1K63A 4MUBA 4D0RA 4LVCA 3T7IA 1GCUA 1K4MA 3UHPA 1IHXA 1KR2A 3GFBA 4AC9A 4E3WA 2W2TA 1JRLA 1GKLA 1Y3FE 2JIRA 3QFTA 3ZQUA 4LTDA 2R60A 4F45A 1JG4A 2OP0A 3FHJA 2V4UA 4HN9A 1S2DA 1NONA 3MGKA 4XWGA 2IVZA 3CG0A 3HDHA 4WE3A 5AT1A 2J9XB 1SKUA 3T7TA 2AG1A 3FOFC 5ALIA 3FOEC 2GYUA 1ESNA 4RHXA 1UP4A 3GRKA 3QHPA 1MU0A 3QHQA 4EHHA 1M1YE 4KSYA 2J5RA 4LGMA 5A02A 1BYIA 2QKYA 4QJ4A 4DNQA 4RIGA 5JNWA 2XTNA 4YJ3A 2HSEA 3GUHA 3ZVRA 2WEKA 4DC9A 1M5RA 1B73A 3BE6A 3BXEA 1GVNB 3C3WA 3KDSE 3H6GA 1E0DA 5CVVA 3VPBA 5I7WA 3P2MA 4I7EA 4M8NE 1K7FB 2AN4A 4MRRA 1S3IA 2RKBA 3D0OA 4R8RA 4H1VA 5CK5A 1N6OA 4MJ7A 3SSNA 3L82B 1OI3A 5CT5A 4LVNA 1UMKA 1E9RA 3K8YA 1IG3A 3PENA 4UD2A 1ONPA 2J0SA 1PNOA 1NVBA 4TQ9A 2VUIB 1R0BA 1HM5A 2ZUDA 3PUHA 3Q7TA 4ZEXA 2EF1A 3K73O 5K2OA 2BMAA 3ELYA 2ZB7A 4YEDA 2EP8A 4KWEA 5JQGA 2XF2A 5TMPA 2WT9A 1KBOA 4DDMA 3VHLB 3HDGA 1RJWA 4LRWA 2BR4A 4HZGA 4IJ5A 3V55A 3DEZA 4YV0A 2CLHB 4G25A 2CD7A 3MJVA 1KI6B 5D00A 4XEUA 4I0WB 3WL7A 3ZJ5A 5L6MB 3T5PA 1XEWY 1QS0B 4NF2A 1G5IA 1G20B 1ZBDA 1Z18A 1TC1A 3TW4A 3HL0A 3KZ1E 1ZH6A 2C5GA 3I9FA 4HPJB 5HFJA 2RHTA 4P38A 1XP8A 4FEGA 2PGIA 4KO1S 1SOMA 4PGHA 4TROA 2QSZA 4GX1A 1FJ2A 2V58A 2VRBA 4FGSA 3RK0A 1YOVB 2JGJA 3DTVD 2NQ8A 3OE7A 3OZCA 3MTJA 2Z43A 4E6PA 1V1RA 5TEVA 3DLPX 4DCTA 1PT5A 3TQSA 4YCMA 3CMCO 4JJEA 4PQYA 3S2GA 3SPXA 3OMLA 1MO5A 1NLMA 2AVNA 4LSGA 4OQPA 1N2CA 2V7PA 3ANYB 3EBLA 4QUAA 2IQ5A 3C4JA 3T3IA 3RVNA 3INTA 3M1IA 2JGIA 5J1TB 1H05A 1Q15A 1T6XA 1R88A 2W7TA 1J1ZA 3CJTA 4J0GA 3WK8A 1GUDA 4B6EA 1QGUB 2CLDX 2JCBA 3PFNA 4IFBA 4D0NA 3B1WA 5FOTA 3WSTA 4F4IA 2JGKA 2EX4A 4IFEA 4B3FX 4PGFA 4R31A 1S5PA 1K5PA 3H04A 1C3OB 3PB3A 5K8CA 3OLQA 2LWIA 4H6VA 3TR5A 4N5IX 3GRYA 1Y8RA 4J43A 2YHUA 1ILWA 4ZO6A 3CC8A 1E7MA 1MPXA 3MTDA 1T8YA 4GWLA 1TI7A 3QVVA 4KIGA 1I36A 1Z0SA 4MUHA 2A1UB 1K3UB 4UTXA 1ZVKA 3T3OA 2J9FA 2VBGA 3THYA 2QZ4A 3U7GA 3F46A 1U7TA 1J1IA 1UIMA 3NHYA 3Q9LA 2OAQ1 3EY4A 4IG4A 5TQJA 3AOGA 1WD5A 3DOHA 5ALFA 1CJVC 4QATA 2IS2A 2VJOA 1XQ9A 3GGPA 3PXCX 4CKBB 1GKKA 3KJEA 3PBKA 4K9PA 4Q18A 5M3BA 2BKAA 1JU4A 3V8VA 3GP5A 3U61B 1Q1QA 3C6QA 3IJRA 1FTNA 1PYDA 1CULC 2FPPA 3L40A 3OO1A 2ONKA 4NJOA 4OLHA 4KSBA 1ZUNB 4KXWA 2C2ZA 2V98A 1F4PA 2Q4TA 1AIPA 4TZTA 3GT7A 2O2ZA 1MXHA 5FUVA 1U5AA 2IYXA 4A7PA 3ICVA 5GGXA 4JI4B 3EVBA 1AGYA 2BTQA 1FEZA 1U8TA 3SKXA 4W5OA 4YMGA 1JBEA 1TD9A 4JLWA 4QNMA 2C9OA 2BKXA 4XEHA 3LP6A 1L4LA 2WF8A 5DXJA 1LNSA 2DWPA 3M6AA 1YL7A 1NVXQ 1L7PA 1ZMRA 2CLFB 3R3HA 3UICA 5JFGA 3A4YA 1H8EA 3RTAA 3NALA 3SBOA 1Q1BA 2PMDA 2RGGA 4GR4A 1FS5A 3UAOA 4V38A 1FUUA 1QKJA 4F1WA 1CC1S 1S9DA 2ENUA 2ILTA 2XTAA 3IUSA 4JKOA 4DJ5X 1LVUA 5EWMA 2ZRFA 5IU6A 4MUNA 3ZY3A 1TGYA 3FDFA 2H2FA 4QFBA 1SKBA 1ULTA 2ZWAA 3BA1A 2BFWA 2KLHA 3WX0A 1BN7A 2C5AA 3HKEB 1G2QA 3FLAA 3KTFA 4N7BA 2XEDA 2NSLA 4RMHA 4C0AC 4C0BA 1FRQA 3MJCA 4LDJA 3Q87B 2B4TO 5A0VA 5B6JA 2ZYHA 4P92A 4WY2A 4CVNA 5ITWA 2O5EA 1FK8A 5D1HA 4A8JB 2VAMA 4M0PA 4WK4B 5BW4A 5JZVA 2VZEA 1PO7A 3DQQA 3FNIA 1PJ4A 4MVXA 2OBLA 2VPXA 5JZ9A 4NJMB 1ZGAA 2K87A 1PEKE 2A59A 1G291 4FP9A 3CKYA 3KOXA 4IUDS 2JLQA 4Y2JA 3MWEB 1J22A 1PIWA 1C3VA 2EWVA 4L7VA 2VA8A 4RHEA 3V7YA 3QE9Y 2QY6A 3THXA 1C1HA 1VBFA 3WNCA 4BCBA 5TQ0A 1L8AA 2PK3A 1ZIXA 3C70A 3IEPA 4H1TA 2FW9A 4X1YA 2D62A 2Q2OA 2X1VA 2I4NA 3IC5A 1GPYA 2R00A 3FAZA 3BB1A 5C3UA 3RG8A 3S27A 3AR3A 1UPAA 2HB6A 2ISCA 4AS2A 4EARA 4UOZA 1W1WA 1ZH8A 3P0IA 4ZOAA 3WWZA 4WBNA 1AO0A 5CG2A 1CR0A 1HXHA 2IUFA 5LLTA 2LRHA 2AMVA 3KB6A 3Q3EA 1XHEA 3SQDA 1M72A 4HN2A 4R41A 5KWEA 2JI4A 5BR8B 5JAMA 3QXSA 1U6IA 3AEKB 2PUGA 4E33A 5E7QA 1NVKA 3RJMA 1FFBA 3W4JA 3VKHA 1GEEA 1U1DA 2I3AA 2Q6LA 4AFNA 2RJNA 3KKPA 4KVZA 3OJFA 4YRZA 1XMPA 4ZCPA 4DMRA 3IUYA 2G40A 4P32A 5HFAA 2YV4A 3HCNA 2GBCA 4JC8A 4BN4A 4BX9A 1DO8A 2Y1WA 4XJVA 3OOJA 5BQOA 3EPRA 3SMVA 3VU1A 1R0XA 4ZI3A 5AI8A 3E81A 2A8YA 3PPVA 5BSEA 4DR2B 4GVLA 4BP3A 1QTNA 2H65A 2RFLA 1QU3A 1UBMS 4CTKA 5BNIA 3UG6A 2FFRA 4GDMA 1IK4A 4UAGA 1K6IA 4NPCA 1C5KA 4BKOA 4ENVA 5JECA 1Z8FA 1ZFNA 1G38A 2PRZA 1L5VA 2DWQA 2AEJA 1YB2A 3PGVA 4KBFA 1J20A 1RHMA 2HA0A 3BXPA 4CQJA 5IUNC 5JVDF 2JC3A 3H2ZA 3AVOA 3NGLA 2ZYIA 3SR0A 4EO9A 4Z3OA 4M55A 2QX7A 3ABSB 1U2DC 3G7NA 3M6FA 1P0MA 3GQBA 3U3JA 1B2LA 4M1SA 1GAWA 1R9MA 3AR5A 4PM4A 4GOLD 1E1KA 1TCCA 1X8XA 2K6GA 3QOWA 3QV1A 3R3XA 3EIFA 4NCXA 4PX5A 3M9XA 5FCDA 3VPHA 3F5FA 5AVWA 3CUEF 3C3MA 4FZ3A 1R8JA 3EGDA 1VLJA 4EQ6A 4LZAA 3U7FB 4WA8A 2ZE6A 4FYJA 3TRKA 2W2VA 3MNFA 2J07A 4U3JB 2FE1A 4KDFA 1Z7GA 1KVSA 2REBA 4PYKA 1F8GA 2FSPA 2O05A 2C3MA 2X19A 3HZRA 4HEA1 5D3KA 4BTEA 4OHOA 2B7CA 3N59A 4OI0A 2E87A 1I2MA 2IUSA 2OAGA 3AI3A 3GJTA 4FOPA 3I9NA 2XGOA 2WTAA 3OKCA 3DL0A 3L8ZA 5LBUA 4BQFA 1G5TA 3KQYA 4NBWA 5F73A 3UT6A 4D5GA 4Z4CA 3UXMA 4GYKA 2Z6VA 5ALJA 3IHWA 5B1IA 4I99A 5ECDA 5LIRA 4DR1B 3F5MA 5DTEA 2MMGA 4BECA 4C7VA 4CTOA 4WK0B 1YBVA 2OD9A 4HH3C 2BZGA 2JH8A 4RLHA 1FCJA 5ITSA 3JQ9A 1UBTS 2ODEA 4R8VA 5K8TA 1SBTA 1KS9A 3HL4A 4CV1A 3KEOA 2J9YB 3MZ0A 3QOYA 2CNOA 2ZB4A 1NX6A 2P4UA 3DUFB 2YW2A 4XWOA 3RTCA 2C2GA 4RSHA 2A3RA 1TVMA 2E48A 2NYUA 3HDQA 3LQYA 3TEMA 1M5UA 3W1VA 5AVTA 1K2WA 4B6OA 4UVIA 1M7BA 2PEYA 4PGMA 3T4XA 4GZMA 2QVCA 3RFXA 2WTXA 3W78A 1TTPB 1ZKMA 1Y3AA 3GDGA 1TEHA 4OLJA 1NM5A 3IVCA 4FSHA 1EQ2A 2CCGA 2ZYSA 6YASA 4FE7A 4H6XA 1NVMB 1SRQA 5HILA 5TF4A 1I7DA 3N74A 1KO8A 3BAFA 3CJQA 3F8SA 3I2HA 4RCVA 5JRDS 4AVYA 2X8JA 4W5HA 4O4JF 4J75A 3UUWA 1ORTA 2O7NA 3H9JA 4P3PA 3T3MB 1T36B 5KVQA 4YAUA 2Y1KA 3O95A 1XEXB 2C8VA 1TF7A 2MHCA 2R96A 3HY3A 4DV4B 2A84A 2JIOA 2NP6A 2FPIA 2W6ZA 3C7AA 2H0QA 4XGIA 1EDOA 1G66A 4G1MB 3HUDA 1QAOA 4NCBA 1E5QA 2Z8YA 1AUOA 3NASA 4OHBA 2WWXA 4MP3A 4U9HS 4JT9A 4H18A 1JT9A 5KZMB 3EOZA 3D1VA 3HSYA 3II6X 1SUEA 2NSYA 3KKKA 4CDGA 2D2EA 1Q2UA 3C6ZA 1E5LA 2WSYB 4A5OA 4BUJA 3DQZA 5EQDA 1LBQA 3PIDA 3GI1A 1RPNA 1TIKA 3VR0A 4MINA 2ZI9A 4HBGA 1Q16A 4YYZA 5CFRA 1UXIA 4KQFA 1M9NA 3B9BA 4H35A 1DZ3A 3ZHBA 1P3JA 2PY6A 4XA8A 1U4SA 2BEWA 4AJ9A 4D9CA 1O58A 4MVJD 3TUIC 1Z4NA 4JWTA 1F2DA 4DBLC 1C7EA 2O0LA 3RAPR 5IYZA 2QTFA 5ALEA 1W36B 5F33A 2JFPA 3ADPA 3BMOB 5GIOE 3RS7A 4JB8A 3D54D 4P2GA 4BRWA 4BNWA 3V6MA 2CLKB 3FYSA 4D4IA 1P29A 4NG5A 4B9EA 4DLKA 5BOSB 2A1IA 4EUFA 2YHSA 1TTHA 2RGCA 3MWDB 1E7RA 1MABA 1PFGA 4Y9RA 3FPBA 4Z99A 4F8JA 5ALOA 1AS2A 3ZC3A 1JLMA 3BULA 3KU4A 4J2OA 4PSDA 3IEXA 4I36A 3X3HA 1B3BA 5D5PA 2RK3A 3L0YA 3CUWA 2JLAA 4XSGA 5IT4A 1TZ2A 1F4LA 1RJ9B 3N86A 3SF0A 3NC4A 1JAZA 5A3SA 4KJXA 4PAQA 2W8BA 3V2GA 3BK7A 3LVFO 4AK9A 1SKQA 4PQRA 3SZRA 2OBYA 1JDZA 1CS0A 1JG2A 1CEXA 3OQVA 4BPRA 2JDID 4YHBA 3KQHA 4FLFA 3EW9A 2AJ8A 1XKLA 2AD5A 1ZG3A 4OJTA 4XDZA 4UVDA 1A97A 4RV5A 5EXDA 4B32A 2O50A 1E9VA 3R75A 3AKEA 3V2HA 2XWQA 4CR8A 4IO0A 1A1VA 3EXHB 4EB6A 1U6JA 3IO5A 1JEQB 2GJAA 3R24A 2PYIA 3L0PA 3A0RB 1N0UA 2FPOA 1D2MA 3HZZA 4CKWB 3AP3A 3AJDA 4ZVKA 1UK9A 2PJUA 3ILSA 3RVPA 3T1NA 3VOSA 2PGLA 2EQ5A 2QIOA 4GPD1 3EXEB 4LIPD 4QEDA 5C1PA 3S2YA 1Q0LA 1QTQA 5A1JA 5L3ZA 3TSOA 3QWFA 1MJGA 2FZKA 1O2DA 3DEYX 4FSXA 2CMFA 1KF0A 4M7WA 3AU8A 4D2IA 1XZMA 1H8HA 3UT5A 3GXBA 5SICE 1P1HA 4GI1A 3SZGA 6REQA 2Y4NA 3K9FC 3ZIAD 1FXWF 1JLRA 2OAEA 4L4XA 1P4HA 4DR7B 1OC2A 1PZXA 4IDCA 4XWWA 4LGVA 3VPAA 4FFLA 1CP2A 1X7XA 3RKSA 5KX5A 1FP6A 3OC0A 4IVRA 3WRYC 1F6DA 3EC7A 3FUUA 2AFHE 1ES9A 1WNTA 3UXHA 4YT4A 2ORYA 1XAJA 1K8ZB 1KE1A 3ZWDA 3RTDA 5C8YF 5CLGA 3ZR4B 3G79A 3T8YA 2ZULA 2A88A 1R8YA 1R5JA 4CMGA 2P2ZA 1YRQA 2H29A 1L8XA 1MFPA 1JZTA 1QIJA 1UPTA 1YT5A 2WKRA 3IUQA 4S1VA 3TLGA 5IKMA 5K0EA 2IH5A 2I87A 3ZHRA 1ZWKA 3LGSA 4QYSA 2C07A 3I1JA 2IELA 1HLPA 3D81A 1ARZA 3NX4A 2ZBDA 3QKWA 4LC0A 1YQDA 4QM7A 4URHA 1LPNA 1E0JA 3O4GA 1KI3A 4R8KA 1ODFA 4L3OA 1NJFA 2VQ3A 3R0XA 5EZYB 1KMIY 4GXRA 4EJSA 3L7CA 4LCEA 1KYZA 3S29A 4AXBA 4CBVA 5ICFA 4CDNA 4LTNA 3A31A 2A4MA 5J5VA 4ABTA 2GPWA 4G5FA 1ADFA 1J7JA 2KI5A 1F2TA 1GCAA 2HSDA 2ADOA 3GUZA 2EKLA 4EGSA 2QS9A 1RHQA 4GX5A 5K3DA 2A5LA 3A6GA 4U2CA 3EVNA 1S3FA 4Q15A 5EWJB 1N5JA 4HAVA 1C1DA 3GUYA 3CB4A 3IB6A 2HQOA 3D31A 3WGYA 4B6QA 5CFOA 1GPAA 1QZXA 4ND6A 5LYYA 2F4NA 4NNPA 2OHFA 4BO0A 1DS6A 1P1RA 1ZJ6A 4ZICA 1ML4A 1N9GA 2HEIA 5JYEA 5H02A 1XD9A 3VNBA 4XPIB 2ZJ3A 5BSRA 2NQ2C 4L27A 1ZINA 2EAUA 3PQ3A 3SHQA 1N6LA 4BB5A 2ON6A 3I58A 3IBYA 4MKIA 3WDKA 1TU0A 1VSUA 2F3PA 1YJ8A 1P8AA 1N1MA 3R5HA 2OWEA 4EJ0A 4M53A 1QVZA 5H82A 1ZY2A 3CRQA 4IHJF 4YRMA 2J9GA 4CPDA 1ZNZA 4NSNA 1NNUA 1QPGA 4FS8A 1JU9A 4R9NA 1OXBB 3HVRA 4RIEA 5IDYA 1J5XA 4A27A 1BXGA 1UK6A 3IKTA 5C1IA 1DDOA 3TJZA 1S9HA 2ZYVX 1K2VN 2YVQA 5EWLB 2ADMA 1TM1E 1G21B 1AGNA 1DUSA 2R86A 1WZUA 3EBPA 3K0EA 4O4HB 4RVDA 4G8CA 5FTKA 1XQVA 1OV4A 2IOYA 2YYZA 3KOWA 2IFTA 4FZVA 4OUKX 3ROEA 2BJWA 1EFTA 3QU9A 3JSAA 5LLDA 3DE1X 3OY7A 5A4MS 1TMOA 3MILA 3FKSA 1Z5ZA 3PWTA 3DXXA 4NMXB 4E32A 2EJWA 3G5LA 1GZUA 1RIFA 3AESA 3KUCA 3LQ2A 4LXQA 5LB4A 3W8DA 4Z1OA 5K8IA 1DL5A 3ONFA 3U56A 3BGWA 1JFRA 3BRQA 4B17A 4KO8A 3DBHB 4DEXA 3NEYA 2I8CA 4B8WA 2JJ1A 3SEQA 3D8HA 4Y9SA 3S1LA 2BSAA 2BGRA 1VGQA 1AKQA 1B8UA 3C45A 2EEPA 3EHDA 3INNA 4I55F 4ZCMA 4J16A 3RS8A 2C5BA 1LNQA 1YUBA 1EUYA 3LZDA 3OZSA 4D3SA 4CKEA 3IODA 3BFKA 2QAGB 2E49A 1GGVA 3C24A 2Q3LA 3O94A 4JT4A 1MB2A 1R66A 3R7WB 1M66A 4EPVA 5KTMA 2BGGA 3DD1A 1CUCA 4FFRA 4POAA 3D3EA 1OFHA 3LUJA 2FPGB 5IN5A 3DP7A 2XD4A 2IXAA 3PXAA 5EIFA 4BMYA 1WQ4A 3PF9A 4H9GA 3HA7A 1GNTA 1VSTA 2J3QA 3IQWA 5F77A 3BTSA 2JH3A 2LP4Y 3EAGA 2D7JA 1SUPA 2GQ0A 5CBPA 2BM9A 2YIVX 4BN0A 5AHXA 4I5DA 2DLDA 5I4KA 2WUDA 4A03A 3OH8A 2YV2A 4REOA 4MQ4A 1RAIA 1WPXA 2PSDA 6ABPA 3RO7A 1DC7A 3ZGVA 4BQRA 1I6KA 4BZXA 1C0KA 1VIYA 1SC1A 2GYWA 4TMZA 1AKEA 1XD2A 2ZXFA 5KIAA 1Z63A 4P98A 1HDCA 2B36A 1ULBA 2VUTA 4S1PA 3MLAA 3LKBA 3RE1A 2WAXA 1VA4A 1J00A 1E64A 1O96A 2AG0A 3OC6A 1Z15A 3I9KA 3O9MA 3ASVA 2CBXA 2RI6A 3EZFA 2RGYA 1FTSA 2GZ2A 4MUMA 1LFDB 4Q01A 5CB4A 5CNJA 4DADA 3MWFA 4NY1A 5I7SA 1H0SA 5BSHA 3OIVA 1N78A 1UWCA 4RJJA 4PZLA 3MW8A 1DCTA 2NIPA 3R5XA 3IKLA 3C1AA 5KKNB 2ACWA 1H3NA 4Q3DA 3NH9A 1X0XA 3FHOA 1DADA 1Y42X 3IVXA 3IKVA 5JXJA 2AQ8A 1NATA 2A4KA 2M6RA 2B8EA 3BC1A 3FSEA 1MAHA 4JOQA 3D9QX 1TVKB 2E6KA 3NHFA 3F73A 1B8VA 4W6QA 4L3WA 4PV7A 4K8OA 4OGGA 2BWJA 3LRXA 4ZPJA 3WO0A 3FZGA 3GAAA 4PAWA 1YQGA 5A3VA 4QOHA 1AQYA 5F2EA 1MDFA 1GQFA 3WHKA 2G3YA 1FP1D 1I4LD 3PDJA 5G1NA 4EELA 3SIXA 2YHIB 4ZEVA 2Q5FA 4ICIA 3SHWA 3I09A 3M1YA 4IEIA 2WINI 1F8XA 1EU1A 4ZQBA 4V1CB 3WHLA 2ZUFA 1GSAA 1T9AA 1XT6A 1KZ4A 1XXHB 4JQSA 4JYPA 1OFIA 3A25A 1X0VA 4YO7A 3RC3A 1ONNA 3ZJYA 2I55A 3GRRA 3NUGA 1PVDA 2Q1YA 1RHUA 3VYSB 3F6YA 3FN4A 5E9JA 1ZJ5A 2VJYA 4PXSA 1T9GS 2GZSA 2Z6UA 3N0VA 2JJQA 3HKBA 4R0MA 1V41E 1YB4A 4KQ9A 4WFKA 3WNZA 5HYVA 3FYDA 4J1TA 4GOJA 4TKUB 4ZQFA 4BNHA 7REQB 4MA0A 1Y98A 3OSZA 1I51A 1MTOA 3M5DA 1O97C 4G9GA 3EUAA 2JI8A 1MAWA 1XVTA 5K3SA 1QOQB 4BFTA 4BHTA 4LRXA 5AO9A 3RGWS 1XMQB 3OIDA 2ERXA 4FGUA 3IPRA 4HG2A 4E13A 4U0JA 5CB8A 4D80A 3OQIA 3IS3A 1NBAA 4B80A 4D0LB 1QGZA 3RUPA 5IJ0B 4FBLA 5TQVA 4C7BA 5KYXA 1LTKA 1YQQA 1S8NA 2YMPA 3WBJA 2X2PA 3A1WA 3ZS9A 3FOBA 2GJ4A 4Q34A 4A10A 1Z0ZA 1ZGGA 5JHHB 3CX7A 3BK2A 3EW7A 1YS2X 4Z53A 3I2KA 3NCHA 3FMPB 1RSZA 3PHIA 1FQKA 2CHFA 4EUEA 1YR1A 3GL9A 3AXSA 1E0KA 3EEIA 3WGKA 1TTTA 3DO8A 2WPDA 2FPKA 2C3UA 2XWBF 3ED1A 2G1PA 3VU3A 4IJKA 1PS0A 3LC2O 4Q3KA 4LF5B 3RF7A 2NYVA 1S3GA 1E9FA 1KH1A 1TCBA 4RSRA 2Q8NA 5DP2A 2ZZMA 2R25B 2Z5LA 4NS1A 1B23P 1DTWB 1PS8A 2GK3A 5G40A 4G36A 1G8FA 1MO3A 2W93A 4NBVA 2YXLA 1GRRA 4BQOA 3U1BA 1TCAA 3GA7A 4EDFA 3Q10A 5HZGA 4JQZA 1AQIA 2QQGA 4UTVA 1NW4A 3A2NA 3OT1A 3GA0A 3KFLA 4PX2A 2OILA 3EGXB 4U7HA 2VWGA 1I9CA 3P0EA 3KETA 1P45A 2X22A 3KLOA 3K6SB 1N5DA 5SYMA 2F00A 3ZTYA 3K6RA 4NTZA 1JIKA 3OTGA 1KRHA 1RXSA 2G67A 4U7JA 1QAQA 1QGOA 2CLMB 3PQCA 3SC6A 1H4SA 1BD3A 1PR3A 2MSLA 2VJKA 4MV5A 1TK2A 2PFKA 4IX9A 1KDYA 4B45A 4DIFA 1DEOA 2YIJA 1WSBA 1T5TA 4LZLA 3B8HA 3QVXA 1RKUA 5AFSA 1DU4A 2Z8YM 4FLMA 1SA0B 5E9WA 1H9BA 5JNVA 2JIQA 1NU6A 3BRWD 2HH9A 4PHFA 1BVUA 2AJLI 1RRCA 2PS0A 4HO1X 1OLOA 1JHRA 3PDWA 2QORA 5LXTA 5AKHA 5D01A 4UAUA 5BR1A 5CT4A 3RHTA 3E3OA 1XZQA 4FCTA 1O1YA 2YYAA 2Z5VA 4QTTB 1E59A 3LBYA 1CRLA 3NUQA 2QLTA 3LQFA 4NS4A 4QX6A 5FL7D 1J8DA 5DCUA 1M1UA 5JASA 2BGIA 1PSWA 1WV1A 1TMGE 4LTMA 2PVCA 3GB9A 3OETA 1LPOA 4CU2A 3UCFA 4DG5A 3TGWA 3UC9A 5ABPA 1E2LA 2DYKA 2FTKE 3KZKA 2GAAA 1Z62A 1U7OA 2E4XA 2PQMA 3E8SA 3WGHA 4G5HA 4COOA 2ZSAA 4WINA 1TEVA 2QGNA 1ECFA 1LLCA 1Y4DE 4FNAA 4MH0R 5IZ4A 1H0KA 5EJMA 5AKJA 3DB2A 2A5YB 5JRJA 4F46A 2VT6A 2P6RA 3E7PA 1PJ3A 5ED0A 5LQAA 4UUAA 4AN0A 1L7VC 4QOGA 3MMZA 5DO9A 2IC5A 2GILA 5EHGA 3TTVA 2PUTA 1ATZA 5KS2A 2YX1A 3TMYA 3C7KA 4AD8A 3DAYA 1YMUA 3ISVA 1Z2EA 5CK4A 5ALHA 5K3OA 3MCZA 4LBVA 2IYQA 1V7ZA 3IAUA 3L7KA 3QX7A 3PHHA 5LKAA 4M21A 1UBGA 1HUQA 3BIJA 4WKOA 2WJPA 5MF6A 1NMZA 3KJGA 3JAKB 3SJAA 2JLZA 1RI2A 2Q46A 2A9VA 2F9LA 3AR4A 4V0ME 1SOUA 3VAYA 1R27A 1YGPA 1HTBA 1L7AA 3LO8A 1FX0B 4FT2A 4MV7A 2R4QA 2ATCA 3C3YA 4LECA 4Q6BA 2P9HA 4WTOA 4X7MA 5I5GA 5HGXA 1SPXA 5TPWA 4BNMA 1T10A 2CV2A 1DIGA 3COWA 2Q5HA 3EZ6A 3MIIA 2VF4X 3VJLA 2IIPA 4ODIA 5GVSA 4M1EA 3KEMA 1GVHA 4KODA 3EB9A 4W1SA 3TLZA 5KVSA 1NQAO 2J4FA 3DMYA 4B6RA 2QI9C 1EK5A 1VYVA 3U3MA 3V7UA 3VJMA 2ZEJA 1UXHA 4Q1CA 3AYXB 3SC4A 5KNBH 4URUR 1EUDB 4RW0A 4C2TA 1I13A 2X7HA 3BD9A 3KBOA 1WV0A 5CH8A 5ESWA 3ZD7A 4YR7A 1MJGM 3KV3O 4P4SB 2J33A 2QU7A 2PLRA 1DEXA 4X63A 4YAEA 5E0OA 2W6PA 1RKXA 4KFRA 1WHTB 4PPFA 1KP2A 3MD9A 3T4PA 3EX7C 1EVJA 3AY6A 1EEHA 3MQ4A 4IGFA 3S5UA 4CM7A 5F1OA 1J70A 1EIZA 5ARBA 1NA5A 4EMTA 5KYUA 1BYUA 2CE2X 2GZMA 2HREA 3EYAA 1KC1A 2YWHA 3I6IA 1G8YA 2Z2KA 3IXQA 4MO2A 2FMKA 3T1VA 4PICA 1W87A 4EYEA 5K8JB 4GU5A 1C4KA 1IB6A 3HUEA 4TV9B 3KZXA 2PWBA 3L1VA 4OBXA 5AKXA 5A71A 5GJBA 1RQGA 2FSVC 4K9NA 4ZIRA 3GNTA 4KUEA 4PG6A 1VE9A 4XYGA 2YTZA 3EH1A 1LQUA 3QK7A 4YAOA 3C8UA 3T95A 3K71B 1ZCBA 2FW6A 1FUEA 1Z0FA 3HDTA 2Q6VA 4XYMA 4YAWA 4QXQA 3ZI7A 1ZNYA 3K94A 4MS4A 1GD1O 4TXJA 4KWCA 1Z6GA 1PFQA 5IAKA 3T4UA 3DDNA 1T5SA 1IUPA 1BQ4A 2F64A 5DNUA 5TMDA 2ISQA 4JQOA 4TTJA 1IZYA 4DTCA 3AC0A 5B6IA 4A92A 3PQEA 2XXAA 1FDVA 1N3YA 4EUNA 2RJ3A 4XWYA 4YRNA 1OIVA 2P67A 4KXFB 3LX8A 5CD1A 3QOXA 2QNBA 3EF0A 3QUQA 5EIWA 5AW2A 3A4LA 3O0TA 1WVIA 4YTEA 1D6SA 1QLJA 1RAFA 1TIPA 4R1SA 2IA5A 3PFFA 1XSEA 3H5RA 1Q21A 2DERA 2IK8A 3ECSA 2ECOA 3SZOA 1BA2A 1J25A 1U4OA 1NBMD 1QHGA 2D1FA 2PGXA 1YR7A 3AFOA 3FCOA 2QM3A 3EMDA 3O4VA 1W25A 4MWOA 2CVHA 1R1DA 1U0FA 4PIPA 1NPYA 4QNRA 1T34A 1TMYA 4V02A 2XKKA 4JVOA 4LHWA 5CLHA 1K5GA 3TX2A 1OV6A 1L5YA 3A0UA 1UT6A 3GEPA 1G8PA 4KQGA 3KALA 3K0AB 5DJ5A 4UMEA 4D57A 5KMGB 2C7OA 4QSMA 3JWPA 4NAUA 3KPWA 2XOKD 2UU9B 1P1IA 2H5JA 3DB1A 3H16A 3V4PB 4D5EA 3QPVA 5ALTA 1VKRA 5HKKD 4X62B 4EG5A 3LCRA 2OXFA 3FDXA 4TKZA 1PW7A 4C7OA 4HKTA 3TG8A 1PUIA 1ST3A 1ZU5A 4PCVA 4JSRA 4ATNA 3Q72A 5ILGA 3BHJA 1SCQA 3UMJA 2FQQA 1ORRA 1SXIA 3ICWA 1PHPA 3Q4GA 4KR9A 4BGDA 2HO4A 3OTHA 1X7YB 4EF6A 2QP3A 4WLVA 4UQLA 5L95A 5IC6A 2AE1A 3PQ4A 5G3ZA 3I1FA 3OE5A 4JKIA 4Q4LA 4ZVQA 3N2NA 2QK4A 2UUOA 4G5YA 3HWX1 4G9BA 2EIHA 1TAUA 4ESHA 2VHZA 2AZ4A 3SQNA 2AOVA 3N8GA 3EZ7A 1A96A 1JP7A 1IAQA 1FSFA 1MJHA 3FPSA 1C3XA 3PSAA 1PFUA 4P53A 1F9AA 4UNIA 2PDAA 2ZJ1A 3GAMA 4MEAA 3EG9A 9GPBA 1Q44A 1ZC4A 1CR2A 5IMSA 3Q3IA 3GGJA 1GGFA 3H5IA 3I2JA 4ZHQA 3UWOA 1A50B 1T26A 3KNZA 1OHHD 3UKJA 4RK5A 1GTVA 4FGWA 4J0FA 2OHJA 1LLUA 1YUMA 4WIAA 5HDBB 3VC2A 3VR4A 4E2FA 4WNAA 2C1XA 3K2IA 3PE3A 1YIAA 1KMHA 5BSKA 4XJXA 4GT1A 4ETMA 1CUUA 4PWZA 4DV2B 1R3DA 2R5NA 2XQKA 3IMEA 4MW7A 4M54A 1LVHA 3AHCA 4R9UC 5HF5A 1PJRA 1YZTA 2EJUA 2XD9A 3JPWA 4KLZA 4BE9A 2MINB 3R0IA 4MW5A 4WFQA 3AL0C 1NMXA 2FEAA 2P91A 4XUDA 4RD3A 2XJ9A 2OXEA 2W6NA 3MVEA 4XB1A 2BFEB 1UCFA 2QJWA 3WA7A 4RZSA 4FKZA 2I4TA 3PL1A 5JJKA 1U0NA 4DWWA 2DULA 1NXQA 3V4LA 4LQ4A 3T99A 3DGEC 1UWKA 1X13A 3WOHA 2GHTA 2XRFA 3OU2A 4YONB 5KB3A 2DECA 3DZFA 5CA1A 3WO1A 5A2QA 3LAWA 5BWMA 1Q0PA 1F1BA 3AHHA 1TMKA 5DTQA 3RBVA 5TT0A 2DG2A 1G9SA 1QWSA 2WG1A 5EHIA 5DPMA 1GZ5A 3A6DA 3TD2A 5JAIA 1GKUB 2VHEA 4G63A 3Q6IA 3FOZA 1WU8A 3MK31 5IW8A 1QG0A 2B92A 2Q3EA 1JGTA 2XMDA 3A4MA 1IN6A 4OXIA 5KYWB 2BBSA 4N3NA 2XYQA 1N5MA 3RVDA 2FMXA 4DLTA 5BN3B 4EA8A 2HHJA 4Y2TA 4F5DA 2IUYA 3THSA 5G4KB 2PMKA 5IAOA 2EFDB 2IRWA 5C4GB 1ZQ1A 3PRYA 4OEHA 4BXOB 1H66A 4YIKA 1WP4A 2HX1A 3WYBA 2M1XA 4JLMA 4P3OA 5GONB 5U1PA 1SD1A 2UKDA 3OUUA 4NJEB 1VDZA 1WXQA 3UAVA 3IH5A 4RDXA 5TV2A 4B7UA 3S8EA 5ELLA 2IYAA 3B70A 1P8JA 2BUBA 3DMTC 2GN1A 2EBFX 2VPTA 2GF0A 3DV2A 4GYJA 3TINA 3I2IA 2DC1A 2J5BA 2P5TB 1TX4B 1XQ6A 3QY9A 1VCMA 2ONYA 3KHKA 3ZBTA 2AIRA 3ZBPA 3U4MA 3NP9A 3P0HA 1ODTC 3QFCA 1G8SA 2LE0A 4WRRA 2W2LA 1ZRNA 3C1UA 4NYJQ 2EHJA 1E6MA 2FN7A 4FGJA 3T5DA 4BNJA 4CN9A 1NT4A 1RVDA 2B4AA 1X1AA 3K8OE 4OYLA 1WZ2A 3EGOA 2QZSA 4RH3A 2B9VA 3MTGA 5EVJA 3LWBA 4B33A 3EVDA 5E1OA 4RJLA 5BSWA 4DNOA 4E7PA 2ZM5A 3PNKA 4D4GA 4NFHA 5I7EA 1FS6A 2O2SA 3ICCA 1ZSVA 4H1UA 4B4UA 1F51E 3N75A 4FFBB 3F2IA 3HV0A 1P1KA 1AVTA 4RF3A 1M1NB 1OGJA 1ND5A 3C6MA 1RXYA 3DMFA 1N36B 1FY2A 3K0KA 3TM4A 3GLIE 1AGXA 5J4KA 3DT9A 1X8LA 5JG7A 3HADA 5IT9A 2DVMA 4PR0A 2DAPA 1FDTA 1LI7A 1GHTA 1J42A 4J1QA 4YALA 4XVQA 4IS2A 5H83A 1EE1A 1QYXA 1KRXA 4KBYA 4MVCA 3DTTA 3ETGA 5LNK6 2B98A 1EA5A 2OHHA 2AQHA 4JR0A 1J9EA 2FG6C 3VH3A 2MJLA 5ICEA 2WBLC 1VB3A 2I4MA 2JD2A 4E30A 1TFRA 4Q02A 3EEYA 5C31A 4F2PA 2RSLA 3JQEA 3BWEA 1YJCA 4OP1A 4M9QA 1RBMA 2QTHA 2HWUA 1L7OA 4JLPA 5F4BA 4XQGA 4XVCA 1KDZA 1VSVA 1W8DA 3HLKA 4S0XA 5EMHA 3VX3A 3CLUD 4UE2A 1RABA 1YCFA 3ND7A 3ONNA 1CTQA 2JFXA 3LUAA 4PLTA 4G0XA 4TV8A 1QRSA 2P2SA 2RKWA 4CF3A 1NX9A 121PA 1J8MF 2I66A 3BQ9A 4YA6A 4Q7LA 4YT8A 1T8WA 1XNHA 4A1OA 2D2XA 2H6EA 1W4RA 4IKPA 3FY4A 4CCSA 4TVBA 3LHDA 3UN1A 4ZOLB 4YRAA 2ORED 1R0CA 3L3BA 3I39X 2ZRJA 1GUBA 5HIMA 1I4OA 5TARA 2QVZX 4JUIA 1TKBA 5KKAA 3HCPA 1E9SA 2WJHA 2XNDD 3WJ1A 3IKJA 4D9MA 2F8TA 5DI9A 3O2SB 1VOTA 5DKFA 3WKBA 2H5LA 2FLVA 1NVVQ 2Y1OA 4DN6A 1I7QB 4YV1A 5LOVA 3N6VA 1QHHA 1FFSA 5AXAA 4EVQA 4B81A 4A8PA 1ULHA 4YC7A 3AFMA 2BEJA 2BBOA 2EX0A 4K9KA 2CXNA 1CG6A 1V39A 2IT1A 4IIGA 2I9KA 1N2BA 2UYOA 3GDWA 1HE8B 4RUKA 4XCXA 1RQPA 3MYRA 1ZOOA 1QR2A 2FV8A 4I46A 1JIJA 2W4IA 1ABEA 3PNLA 3DCJA 1L9KA 3D0RA 2OV1A 3H5OA 4HX9A 4UHHA 4CTNA 3JY6A 3R9WA 1E79D 3I6ZA 1Q6YA 1MAUA 2JHCA 3H3FA 3M9WA 2AYZA 4BBPA 4E46A 1MX3A 3SS7X 1DXOA 4MRVA 2W48A 3NIWA 1UFVA 1XCBA 4UM5A 3V00A 1XOIA 4KQKA 1TJ3A 4BEWA 1CKEA 2EL9A 4MS3A 4UBKA 1LK0A 2KM1A 3NW9A 3FHTA 4GX2A 5JIBA 3U40A 4C0LA 4RFVA 3UUGA 1EVEA 3OM8A 4HUQA 4RK6A 3X1KA 1JPNA 1V5IA 1RI5A 5FORA 3M8KA 5ICSA 2P1DA 3GOQA 4Q4AB 1CNEA 1NSFA 3P2KA 3QQ5A 5C7IO 4X00A 5A7FA 5EXEA 1KYYA 1NIPA 3N5CA 3QRWA 4L0DA 4OXYA 2J46A 1EGVB 3MJHA 3UT0A 1H3FA 3WRXC 4KUGA 3TAHA 2I1WA 1QG6A 4R6WA 3SHVA 1OX5A 1VJ1A 2QNRA 3CF4G 1GZ3A 3P32A 1GNPA 4B73A 4OHRA 2IYVA 2GLXA 4IPTA 2UYHA 2PT6A 2QR5A 3NYWA 3OTOB 3B6IA 2FUKA 3UMCA 4UHKA 5HM6A 2QLJA 1RWWA 4NU0A 2OYRA 3S81A 4GDFA 3BZBA 3ILHA 4Y2YA 1XEFA 1O6CA 2PHZA 6CHYA 5LP1A 4K87A 4L9SA 2UXCB 2ORWA 4G24A 1M6VB 2Q4EA 1LDYA 2C78A 1CFZA 1NIJA 1UZUA 3QJGA 4M0CA 2YZMA 3EJWA 2OA0A 5JPIA 2NU8B 3CBGA 3FMOB 3Q3VA 1M5TA 2Q6TA 5A2GA 1T4CB 5ALRA 1LWNA 1F2UA 2FUG1 2VI5A 4NFLA 4U39A 2G4VA 1DOHA 4JGGA 3ZDDA 1H5NA 1SZDA 2FN3A 3L0ZA 3C6KA 4MYTA 4MMYB 3Q7RA 7ADHA 2PIAA 4OQYA 1YFLA 1RQNA 3X2FA 2R44A 4RYLA 2FPXA 2ZKIA 4E6EA 2CEAA 2XCOA 1M34E 4RNDB 2Q0XA 5KTRA 1OVGA 3PNYA 2ZWVA 4ZODA 3UXYA 5JAZA 4DLUA 4BFCA 4TLAA 3GT4A 4AJHA 3AH8A 3GD7A 3WYDA 1QQ6A 2MSNA 1PVVA 2EKQA 4H27A 4UHCA 3HGTA 3EQZA 4ZO8A 4UMVA 1TU4A 5HKAA 1IY1A 3KTAA 1AUVA 4NBRA 1XCJA 1B00A 3KOZA 4LZPA 2HMYB 2I6SA 5BNZA 5BURA 1E9EA 4HRVA 4IDAA 5KDLA 5AI6A 5BMVF 1F7VA 1U63A 3ETCA 2ZIEA 4O4LB 2X0IA 3IVGA 3VR5H 3TE7A 1X7WA 1DPFA 1JFLA 3D6MA 4RM2A 3TJRA 1RM5A 3BFJA 3H97A 4ZJZA 3FVWA 5JNLA 3AF5A 4F6RA 1A2QA 1Q84A 2A2ZA 2V54A 5HEKA 1ZUNA 4AJPA 3AR8A 3ELUA 1OH7A 1E5TA 1OBOA 2IUEA 4Q9AA 2J9ZB 5TMBA 4HAOA 4OKNA 1UM9B 1W44A 3WY9A 5EP3A 5LR6A 1EE9A 3N2LA 1PP4A 2SICE 1WKBA 1Z33A 2EKZA 3GH1A 1YH3A 3P2EA 3GBVA 4LDNA 5ILOA 1Z38A 3L07A 3ZD6A 4BAUA 3OZBA 1Q19A 4LJAA 5E6SB 2YY6A 5KHAA 4TS4A 2LGJA 3E7DA 1H2WA 1H2YA 1YDEA 3MT7A 2IXGA 3A1SA 1NDQA 1MX9A 1P5RA 3IEMA 4B75A 3RV3A 4QUDA 1KXZA 3H6HA 2YRFA 3H5VA 4IMIB 5DYWA 3SHOA 3THWA 4KX3A 3KDAA 4N3BA 2MR5A 3G23A 1KEVA 1EP1B 1JHXA 1RFGE 2VAXA 2ZBRA 3R2JA 4KFTA 4QDZA 1NW8A 2CT8A 2OPBA 2JNWA 4RDHA 4C0QC 4ZCTA 1H0RA 2W6JA 2BRUA 4RH0A 3IOCA 2O8VA 4PPGA 2SKEA 3VSCA 4MUJA 1S1CA 1E7WA 2HK8A 3FNHA 4JWKA 3DNPA 1FFYA 1JL3A 5CVEA 4KQIA 5AUNB 4KREA 4D3DA 1B42A 5H5JA 4YH1A 2ZYUX 4C43A 2QVGA 5F3DA 3CU5A 4IILA 4ND4A 4CMEC 2CXUA 4YRGA 3NYRA 4ML3A 2DUMA 1G60A 3DTNA 4HC4A 2NO5A 2QTCA 3O2NA 3L7LA 1FFXA 3FBGA 2YS6A 3WBFA 3RVBA 2WNIA 3KIPA 2FWBA 3B36A 1IBSA 1KFEB 4RORA 4I1OA 4O4IF 1A5SB 2A3NA 1M6HA 2D1SA 2PUJA 4KG7A 4QUEA 5EJ2A 4C1BA 4DAEA 1M2HA 2I3ZA 4JBXA 4MRMB 1TZBA 4LOIA 1AKYA 4JYMA 4AECA 1QUEA 1N6KA 4PZCA 4YRJA 2JAPA 1HYHA 2H9YA 4YP1A 5JH7F 5CAEB 3NONA 2Z6QA 3KRTA 2X6TA 1JQBA 2AW3A 3GRAA 2CVZA 1Y5RA 2OCIA 4RMJA 2JANA 3BQMB 1VKHA 3SIPA 3NQ41 1K86A 1GQRA 2I2DA 3KKEA 1WUKS 1SIWA 5K3AA 2CXRA 4OHCA 1UKBA 2VZLA 1Y7PA 5ERGB 3ZCSA 2PVSA 2D2VA 2V6GA 3GCWA 1IJKA 4MV8A 3G9XA 3E53A 3GJZA 4N6NA 5DBEX 4A2QA 3AGPA 5JOQA 1J7KA 1TUBA 1N3IA 1RT9A 1RYMA 2O4UX 1UFQA 3LBIA 1FL9A 5JO9A 3SFTA 3W7AA 5CFQA 2X7XA 3SMQA 3K0FB 5AVOA 4EF5A 2FFHA 3LQKA 1ZIDA 5JCOA 2V96A 4IIVA 4EFKA 1J0BA 2IIVA 3TZEA 4QJBA 3S1SA 4IRMA 1PGNA 3PNVA 4LWOA 2OOKA 1DQPA 1R10A 2B7LA 3QKUA 4QLBA 5LDDC 1N1DA 1SCJA 2FEPA 4OGFA 1D0IA 5FJIA 3CMMA 3M0EA 3IAM1 3LYAA 3GR6A 4C06A 2Y67A 2WOJA 3GGDA 3DPSA 3U4HA 4RK4A 4MS1A 3WQBA 3A9TA 2GDZA 3HB5X 1Y7IA 3QKIA 3E84A 2AOWA 2QTNA 3T35A 4AMUA 1SO8A 1V9LA 2Y0DA 2QRMA 1RZRD 2NUBA 1I3KA 3AERA 4YI5A 5FNVB 4ASUD 1H4VB 3OMXA 5HE8A 1A4UA 1H2EA 5LP6A 3ZXUB 5BOVA 1E4VA 1KBQA 1EKXA 2CF6A 2DFPA 3HWRA 4I66A 2HM7A 2C8LA 1CD5A 2NZVG 1QIMA 2V7GA 5FI5A 1DBIA 3GEIA 4IW3B 3K09A 4QEZA 5SY9A 4ITVA 3NS7A 4R1PA 2D00A 5C1DA 4R98A 3WYGA 3T12A 4MYCA 5IC5A 1GCOA 1EVQA 1V4VA 1AMOA 2HRQA 3HP4A 1SCUA 1LLDA 2V03A 4EHJA 4EFDA 3BCHA 3QA9A 2XQVA 3HY4A 2G70A 4OQNA 2OZVA 4BV8A 3NHPA 1C9EA 1G3IA 1JAIA 1T24A 4GXQA 4R4JA 2AN3A 2Y27A 3LPMA 4QUIA 1YAJA 5J1SB 4MXDA 4CIDA 3X0DA 3WB9A 1XTRA 1P91A 2HLDA 2EJTA 2IEIA 2OCXA 2WI8A 3F67A 4HDKA 3RI3A 1YHZA 4CJXA 3BG5A 4OI2A 3CBQA 1RM4A 1QGAA 3DC2A 3RPEA 1CVIA 3QSYA 2BBWA 1GPWB 1N2EA 5DHRA 3DYVA 2UUPA 1SIBE 4PYRA 3QFHA 4GHWA 4A0SA 2D4AA 3OOSA 3VKWA 1DBQA 5TGTA 2R97A 2ZXUA 3JASB 1AZWA 1VJ5A 2JFFA 3STYA 1EM8A 4LVOA 3PTLA 4QPJC 2W37A 3DZ8A 3TZCA 2QMHA 3WB0A 3JU3A 3C1OA 1YA6A 2GUGA 1B0AA 2QLLA 3QW2A 1P60A 1ZUD1 3JW8A 3KKNA 3TXAA 4TSFD 4B3GA 2X42A 2ZIVB 2RHLA 1AQLA 1VPLA 1JN0A 1SKMA 4UUNA 2J0UA 4G23A 2V6BA 1Z2OX 2QVYX 2WE8A 4LFAB 4LNAA 2FGJA 3CUSA 2ZJ6A 2XOKA 5JC8A 1KZGB 1XVVA 2AI3A 1AE1A 1HL7A 3GH3A 2KX7A 2Q5JA 1TJPB 4UDOA 3DUFA 2VT7A 2CMKA 4GO1A 2VP4A 5BYJA 4OXKA 1RNLA 2JK1A 2PKCA 3DFKA 3DKIA 4QPPA 3NNSA 3FCEA 2W6ID 1ZZEA 1OOEA 1T3TA 4K0RA 1GTMA 3KVNA 1XCLA 1KYQA 3S8MA 5C4MA 4ZYYA 1XA0A 4QC2A 3RTEA 4ZI7F 2PKXA 3R1IA 4NK4A 2OHIA 4K0KB 1IN4A 2O6HA 2VXYA 3NKLA 3OEWA 5TPZD 1NF2A 2AEEA 4PFKA 4Z0TA 4N8DA 3HCFA 4G0VA 2DHDA 2E55A 3V97A 2J48A 5ALQA 2ZRGA 4C29A 5AWFC 4Z49A 2UVPB 5F51A 1K9SA 2EZUA 1A98A 4HQNA 5DVZA 2XAAA 4BASA 2NZXA 4HCJA 2CB0A 1UFRA 1W1IA 3S8YA 5LA6B 1M8PA 4JR2A 1I2AA 4PN7A 5C8XA 2VK4A 3OHPA 1QZUA 4ILEA 3T1YB 2GX6A 2HNKA 1KJQA 2QJRA 3C97A 1GR1A 2OOSA 2VUUA 4EI7A 2JJ8A 2VKTA 1V16B 4YJ3F 2R1VA 2Y1DA 3T34A 2Q1WA 3DH0A 3L6BA 2WM2A 3IX7A 1ZJ4A 2ECKA 2H11A 4K6HA 4F4DA 1UWVA 4I5FA 1XFAA 3CLHA 1NNEA 3CLTC 4QLOA 1X3LA 1J0XO 2O2HA 4RC9A 4DLPA 4J0KA 3UMGA 4XSHA 3D2LA 3GJ3A 3BMNB 4EENA 1A9OA 4OJKA 3V5NA 4WN9B 1MV8A 3NVAA 4O5AA 2ETXA 4REQB 4TMKA 4WOCA 3ZCUA 2XYHA 2VHYA 1GDHA 1PAUA 2X4LA 1HLGA 4XM0A 2OV3A 3EVFA 3M4JA 4QBFA 2BDEA 1ZIYA 2ZR9A 3BWBA 3EFHA 2J67A 3EXFB 3DCNA 1AC5A 3K1AA 3CEHA 4X91A 3UZUA 3GVCA 4C08A 1KDOA 5JQGF 1NG1A 1XIVA 1EJ6A 1GPUA 2HJVA 2OBNA 4C3OB 3GLGE 1SBNE 2R79A 4IQ4A 5C34B 4GWKA 2M2IA 3CONA 3NDJA 5ESDA 1KZ9A 1BRMA 1STOA 1SU6A 1ZIPA 3A11A 1XDZA 3CEPB 4XSVA 3LWNA 5F1YA 4A0FA 1DT3A 1IEVA 3ZTTA 1JQJC 4J0EA 1E2GA 4PLHA 1L1RA 2QQEA 3R7SA 2H1VA 1FNMA 4LJ8A 1ELOA 4GQIA 5D5HA 1U5BB 2KSQA 2A6PA 2XMPA 4GPBA 4LWPA 5AKZA 4GLBA 4QTYA 2HSGA 1U0SY 1XWFA 3ER8A 1QF7A 2WIKA 4XIIA 2C54A 3OICA 3PITA 4OX9B 5IKOA 2Q3HA 1Y5MA 2C3YA 3KQMA 3BIXA 5E1MA 1EWQA 1L4NA 3LGAA 5IN4A 3IJEB 1U1EA 1UZMA 1WUJS 1OXMA 2LV8A 4RY9A 4DSAA 2QLFA 4BPBA 3OEHA 3RSFA 2V3VA 1F6BA 4TTTS 1M0SA 5FKJA 4IBOA 1E9CA 1OT3A 1GDTA 2LW7A 3DBOB 5AVJA 3NOXA 2CLSA 2G28A 3EXHA 3ITDA 2CL5A 2D3WA 3TRIA 1JEQA 1OXXK 2AGVA 1EUCB 1MH9A 1IRIA 2IPAB 5A3JA 4DV0B 2LKCA 3KSBC 4C3VA 1M2VA 5M34A 4I9FA 3PLRA 1F9EA 3S68A 5ITVA 3LYHA 2BFDB 2EJCA 3EXEA 2RGDA 1NW7A 2C5HA 2H4JA 2WWWA 4MV6A 1NZFA 2JI7A 4RMNA 4Q3OA 3HU1A 1QIIA 2YVLA 4G1FA 4I9UA 4URVR 1N6PA 3JAWB 3JYHA 5IM4A 1KEEB 4JLJA 4KIFA 4IIUA 3PE6A 2DFDA 1GM5A 2IEBA 2LNDA 2IH4A 4D45A 4NXNB 4RTSA 4ND5A 2DPXA 5K8VA 1Y33E 3K0BA 2G82A 3NIGB 2JIBA 2ZP1A 3VUFA 5H9WA 2PKQP 1EK0A 1QLWA 1U99A 2CZCA 2HSWA 3E2PA 3NGXA 1XVIA 1S2LA 3CZ5A 3UTCA 4HX2A 1RWVA 5LC1A 2XB2A 1VJTA 4IHAA 4HRYA 1TIBA 1KAEA 1HDXA 5CDYA 2QMZA 2PQ2A 2IY9A 3U7QB 3O84A 2PEZA 5HIAA 5LZ9A 4ME6A 5BVHA 1P7YA 2VDWB 1KQ3A 3SKYA 5FEMA 3RF6A 4C20A 4ER5A 4PLWA 4YGXB 3WL5A 3O6VA 4RWEA 4DLVA 1GRNA 4XUCA 1Y7LA 1YZUA 2VDUE 1FYDA 5JEEA 4C4ZA 3LBFA 1SD5A 3OFSA 5E6RA 5AJWA 2ERYA 4ZDIA 3AUFA 5J2UA 1HR0B 2H1FA 2X13A 2Y9PB 3QBVA 1MJFA 3KHSA 1R18A 4IDHA 3Q2KA 1SUDA 4N49A 2ZPAA 5J9FA 5BSMA 1F12A 4XX0B 4Z0HO 4B48A 3TZHA 2H18A 4BMPB 3R09A 1OLSB 2KB0A 4NU5A 1SHKA 3ROKA 2VHCA 4GR5A 2G5TA 4HQLA 4K03A 2XCIA 1ZMXA 1OFVA 3F6BX 3I37X 2N75A 1PQ4A 1D07A 1IEWA 4IDQA 2Z3ZA 2JS7A 2R1UA 1V25A 4X1IA 5T8KC 3CISA 1W73A 2CY0A 5FNZA 1U2DA 1UJMA 2DPYA 4B44A 4YROA 4FEYA 2H06A 1ZWLA 1BFDA 2V8OA 3UJBA 1IOLA 2CNNA 3PZRA 4EZBA 5BUZA 1P9LA 1GA6A 2BGJA 3Q8XB 3FVQA 3CUUA 1YE3A 2Q07A 3QX8A 4KQ2A 2OXRA 1G18A 1A69A 1FLNA 2R6AA 4M99A 3RS5A 1U2ZA 3REGA 4BNKA 2QENA 3TFOA 2HCJB 2QN3A 1MX5A 4IRUB 3QUBA 1PZGA 2CV0A 3TQQA 1NI3A 2JIZD 3CRW1 1N57A 1X1SA 5FPTA 3ZDEA 4AZ0B 1TQ6A 1D5WA 2F1RA 1JVSA 2XRMA 4ND8B 3OLZA 4DZZA 2H1HA 1X19A 5GADl 1UBCA 3PT9A 1VJRA 3WGGA 3REQB 3ROZA 4M0LA 3W6OA 3EHEA 5J63A 4Y7CA 4M46A 4AN4A 1QBGA 2B0JA 1Y1SA 2I2CA 3QIAA 4BP8A 2XZOA 4RY8A 1JFSA 3K6KA 5IKXA 1V4BA 1L1EA 3UMBA 2D0IA 2F90A 1KDVA 3UJ8A 3FF1A 3RT7A 1ADBA 4OHPA 2LPMA 4B4VA 3TSWA 4KK4A 1G21A 4O4HA 3IQEA 4RDIA 2GKGA 4WZAA 5AKLA 2HFKA 3I05A 4AYXA 5FWYA 5GIPE 1VI5A 2C2OA 3ZY6A 4M86A 3ZG6A 5IRCD 3GP3A 1A7UA 2GHRA 2L19A 2XWSA 1GZ6A 1BGVA 2I0FA 1C30B 1H2XA 4OYYA 4M3NA 4UUBA 5I9BA 4X66B 3HB7A 1XNJA 4CF6A 2G36A 4DIUA 2PGAA 4MGZR 3NPMA 1P9NA 5J2TA 2IYRA 3UB4A 3DL2A 3DF7A 4E94A 1QP0A 2Y1CA 1E6LA 4GYWA 2V7UA 4FVTA 2DFLA 1DG1G 5C5EA 1JYEA 2BP7A 1M0TA 2ZVQX 1U94A 1J99A 2YWDA 2YZ7A 1XX6A 3MGBA 3CX3A 4W82A 5AKEA 4IINA 3JTEA 3W79A 1KH3A 1VPEA 3RVRA 3RAFC 2HHLA 3CVWA 4QPCA 3VPDA 2YV5A 1EFLA 2BV3A 5HJEA 2BFFB 1XAHA 2PUVA 4HAIA 4P34A 5KPJA 2GB4A 4B35A 1L6RA 1TYDE 4IIJA 2XGMA 1LS6A 4Y6PA 2V0CA 4KN9S 1I1NA 4H08A 3R7WA 3SU8A 4Z3KA 2AR7A 1GFZA 1E69A 1NXTA 5BWLA 1O0CA 3OZUA 3I6YA 5JLAA 3MCAA 3GLHB 3NTLA 1XDUA 1Z9BA 2I6TA 3G49A 4ND2A 1GZ4A 1P0FA 3NFRA 5DGTA 3H2SA 4BNGA 4OK3A 3ET4A 3TTUA 1LB1B 1QIFA 1G1MA 1PDWA 4WJKB 4MYDA 3VTFA 1IPFA 2IGBA 1CZNA 1TJYA 3HU2A 4YQYA 4RCZA 5JSKA 4AG5A 4PO1A 1YA4A 3QF4B 4V39A 2CFTA 2DETA 2O23A 3F7MA 4ZVUA 5FUXA 4KPUB 3AETB 3C5EA 2Y3IA 1ZVMA 3EFOB 2HIMA 3CPEA 4XAQA 3UOWA 4CFYA 5CXQA 1YU6A 3GNLA 4GC9A 3JARB 3OKAA 3MUEA 2C2WA 1NMQA 3QWBA 1Y8QB 1KMQA 4EHNA 1GKIA 5C5CA 2JLWA 2J87A 1SXJB 3NWEA 5JS1A 4JFRA 1PZFA 3JWHA 4L2IB 1MD9A 2ZBPA 4QQFA 5CFPA 1CCWA 1UC8A 2HNAA 2SNIE 2XOEA 5DYIA 3UF0A 1F3OA 4EECA 4ZK2A 4QU8A 1M74A 4KGVA 4GI5A 1L5RA 3L7MA 1AQUA 3BH6A 4XYEA 2X40A 1CUJA 1PI3A 2I6XA 3L1UA 1PZMA 5CNKA 1CHNA 1SH7A 2XUFA 4JC4A 3RHSA 3U0BA 1OMOA 1XCMA 4RETA 3ZZMA 2OGZA 1FTYA 1AKTA 1YVPA 1RM3A 4AYWA 2BONA 4R81A 1Y4SA 4N76A 5LP6C 2DP4E 4YJKA 1A2KC 4OPMA 2AVDA 2C83A 2V97A 1I6MA 1F5SA 3BMCB 3QG5A 4MRSA 4FGLA 4M9XA 2GCOA 4URXR 2YHIA 3VRHA 5JXIA 2F6RA 5HF6A 2C1ZA 3QEKA 2L0XA 1E8NA 2GEUA 2W2OA 3SS8A 3WIEA 1XXHA 2PUHA 2P9ZA 2IY8A 2WY2D 3V3TA 5FHQA 1U0BB 3GZNA 3ZCVA 5DLYA 1TZMA 3I61A 1U9CA 4B2LA 3VJKA 1MPTA 2A7XA 4QYWA 3WLHA 2C04A 3UXEA 2IEDA 2IOFK 1NQ5A 2I2XB 4CM6A 2M6KA 1X7GA 3FPCA 1BE6A 3QOFA 4DLNA 3HKDB 1PTJC 1H42A 2FSFA 2BE9A 2KWIA 4D4LA 5IT5A 1YZVA 2ZG6A 5H4GA 3AF1A 1FZTA 1DBRA 4MTLA 2GNOA 3EQ7A 3KB1A 3OPVA 5CB0A 2V9CA 3WQHA 5IXSA 2IOQA 5KYNA 5MN6A 3DZHA 1XN4A 2O8EB 5AK6A 2AX3A 4JT8A 2G1AA 4LMRA 4F2DA 1QGYA 1US8B 1V8ZA 1BWQA 3NBQA 3UK7A 2WVGA 2IYFA 1WW8A 3OLCX 5FPSA 5IKEA 2YY7A 4JL6A 2QRLA 3EEQA 1BKSB 1EWVA 3LECA 4UVGA 4TZ6A 5LSAA 1SGWA 2RHDA 5CFNA 4BLTA 2GHQA 4QBHA 3DZBA 3IQXA 3PDCA 2HGSA 1TO6A 2W71A 3HC7A 1E7QA 2BI8A 2C88A 1R0YA 4LFBB 5K3EA 3KKZA 2UZIR 1RRPA 5K0TA 4PVCA 3WRYA 5JE8A 3UAWA 1XELA 2OCDA 4L74A 2P7IA 3GLIB 3C8MA 4AJ1A 3NH6A 4E15A 1GGHA 1ZCAA 2HMSA 3WFZA 3C5HA 2AFIE 5G0VA 3ZHYA 1UADA 1N2XA 3L1KA 3LP5A 4U2BA 4HDQB 1JPJA 1OFTA 1VJGA 1ZXBA 4QWMA 4NV0A 3KOOA 1ZI9A 3RSSA 5DHFA 2HUPA 4P1ZA 4C4YA 4C4PA 3K6SA 3HO6A 2AN9A 1OFUA 2GZAA 3C4VA 3AL3A 2ZI4A 3L77A 3HBAA 4HLNA 2QUAA 4PZUA 5AQEA 5T4FA 2VDQB 5C18A 1X7ZA 4IXDA 1I5RA 3H3XA 2QLBA 4DT1B 3BD7A 2Q99A 4N41A 1PDVA 4MR8B 2XKJE 1AD2A 4ZD6A 4ZTZB 2XY4A 1XV5A 1F38A 2EX1A 1YR2A 3AZPA 2EERA 5EKSA 3SIWA 1AO3A 2PZFA 3KSRA 3MBOA 4JC5A 3O1IC 3A4NA 2OCBA 3QVSA 1Y7HA 1UMBA 3MAGA 1CYEA 4Y6RA 2P3QA 2Q2NA 3ZE0B 1BDHA 3CNLA 1RQ7A 2O20A 2O1SA 5DXAA 2IYUA 3ZV7A 3DLBA 4ER7A 4XJSA 5D8DA 1GLNA 2R0QC 4MVJE 1GARA 4P3YA 3ZI4A 2PX3A 4WKPA 1T4BA 2NZYA 1JLKA 2YIMA 2W9XA 2XCQA 1WZCA 4ETNA 1G63A 1L4GA 1JG7A 1YK1A 3DBLA 1D1SA 1QF9A 2R3SA 2GT1A 4HZUB 4URFA 3ESAA 2JKZA 3V4SA 2VTEA 3ZW9A 1QPZA 1M2OA 5JQWA 4ZAZA 2CWWA 3U7JA 5CVTA 2OFPA 4E0BA 4G86A 4EPWA 1L6IA 5REQB 1PEYA 5MFPA 3LUGA 7ABPA 1EFUA 2EKBA 4AO7A 1WVGA 3X1DA 1T3SA 3LXMA 4CEIB 4DCOA 2MSDB 1C1XB 1N9ZA 3PJFA 4H6WA 3A7DA 1UPFA 1X8KA 2JGLA 2DHRA 3D6VA 4Z7QB 3SR3A 3PQ5A 2JH9A 4IGKA 1A7KA 1XP5A 4XRRA 3CGGA 2VSQA 3TQRA 1K68A 1KKLA 3NHSA 3BIFA 3O2JA 3ZDQA 1MT3A 1EQAA 3I45A 4UTZA 3EVEA 1T9ZA 1VG9B 1FNBA 3VH4A 1E6WA 3LUDA 2GASA 2R48A 2CMGA 3KO8A 5ITZA 5CYOA 1Q6ZA 3BL5A 5KX5F 2UDPA 1Z37A 2I54A 3LBAA 4Z8YA 1UKEA 3VZPA 3WA6A 3TX6A 1W9HA 3M81A 1NVGA 2IS1A 5BMOA 3R3VA 3IA7A 4UD6A 3SJBA 1WW3A 5G1PA 1T4MA 4MWSA 5CJ2A 4KXVA 4XQEA 4TKVB 5IBPA 3LC7O 4RTRA 5CR9A 2FE4A 4QE3A 3TZKA 5JAPA 1MGOA 3K7EA 4H2DA 3DMHA 4GOKA 1BMDA 5EKTA 1I6LA 2I5PO 4H77A 1Z4IA 4Q3CA 4PFSA 5EFZA 4DWVA 3BD6A 3DEJA 4INZA 2YXEA 3GVIA 3X1MA 2WV9A 1IBLB 1Z7BA 1QG4A 1QE3A 1VHQA 2XYRA 1WXEA 3FCSB 2F4VB 4KXNA 5DZSA 1E2MA 4DLLA 3ZE6A 4Q7QA 5BW8A 4XR4A 3S55A 1Z47A 1M8FA 2AXQA 2H1IA 3GJ5A 5A05A 1QFYA 2H2GA 2CDBA 3K9HA 3OCXA 5TPZA 3JYLA 4XWTA 5E9AA 3SKVA 5KCZA 4ARAA 1NE7A 3MXTA 3EVAA 3RBAA 3JALB 5H16A 3AM5A 2P3LA 3FUWA 3KZNA 1C4XA 4P4SA 1EK6A 2XDYA 1MP0A 2G63A 1GN9A 5FPPA 2QT1A 2CDNA 5C81A 1GJRA 5BYKA 3FWNA 3JZAA 4IF6A 4Q1EA 3RWOA 5G0TA 1TYAE 2R6JA 4K2HA 2GAIA 2PQ0A 3JAMA 4FSDA 1JTVA 3CE6A 3I62A 2JRLA 3OPQA 4UC0A 4P7GA 1SIUA 2B0CA 2PZGA 4Q19A 4NYIQ 5AD1A 4EVIA 3HHEA 3VPGA 3W5SA 1LW7A 2SKCA 5FFNA 3TN7A 2R8ZA 4C7XA 4DARA 3KT6A 3WLTA 1TT5A 4UBNA 4EAQA 3AHFA 3G2PA 5FAXA 2W0MA 3DMDA 3GZJA 4JAVC 4LOHA 4CMAA 4D97A 4YRSA 2R4TA 1HV8A 3ME5A 3CUYA 4QXRA 1BQEA 3ROGA 1BMTA 2HRRA 1N0IA 1N4DA 4K8RB 4EHAA 4CLDA 2ZI3A 5A5GA 4B3TB 4L22A 1DRWA 1Z26A 1BHQ1 3O3OB 5JJLA 2RHOA 3RC9A 5GOZA 4BEJA 4MUYA 1P1JA 3K9CA 3FDIA 1DX6A 3L5KA 5DNWA 3NJ8A 5A0FA 1DB3A 3GEBA 4BFYA 5CDSA 1ZN9A 3AP2A 3FCXA 4EZIA 3H18A 4FFPA 1B0PA 1FYWA 5J43A 1X1TA 2GOYA 1ZX1A 4GQAA 1W5SA 2VH5R 4Y2RA 3ULKA 1LPMA 3C6XA 3AF2A 4D9IA 1DMRA 1JF8A 1MG0A 3AF6A 4OKSA 1N5RA 4LHEA 1WEKA 4B85A 3AY3A 4CL0A 8ADHA 1R9JA 4QVGA 4E5NA 4F38A 5HUHA 1E2JA 1UC9A 3QBJA 3D6NB 3VGPA 3ECAA 1WDTA 3DOUA 1OR8A 2C61A 2GRAA 4U2GA 3WLQA 1LPSA 3A32A 1AJEA 5DIZA 3DZJA 3F0TA 4B3CA 2SBTA 3G2OA 5IZCA 1KK1A 3AFIA 2EWMA 1KVQA 4FFOA 4R2IA 1NE2A 1GNRA 2FEWB 4GC5A 1CERA 4C7KA 5IH7A 1YQWA 1BCRB 2HV8A 2ZQZA 3CLSC 2VYVA 1PSDA 4O3MA 1OH6A 2QPAA 1K75A 2GFHA 2ZS9A 3LVBA 1XGKA 3A2LA 4OM8A 5EAIA 5C8DA 5IFKA 3GVXA 4MI9A 4IQ0A 3Q0TA 1YGYA 1TKAA 5AIBA 2HT1A 2QRVB 2O3SA 1MIOB 1GZHB 1NI4A 4EUHA 4X6XA 4RVNA 3UA3A 3NXKA 4IJVA 4EGQA 1P39A 1OYVA 4YRLA 3PC8C 4ZDWA 3DLIA 2FN4A 8ATCA 5FTJA 4LZZA 5E4YA 3ETNA 3FSGD 4ZC1A 1QMPA 1LDMA 1PR0A 5K3CA 2EF0A 1OAAA 2VAPA 1FYVA 4JJ7A 3E3LA 1GT91 1GR0A 5FQOA 3ZD8A 1LF5A 3MWJA 4KHPB 3RS0A 4FQ8A 1I32A 1JBQA 4ER0A 2NSJA 3HB0A 1I1HA 4L8LA 4F7DA 3KQLA 3D8SA 2KLBA 5LVAA 2GEJA 2VDVE 2ZRNA 2OXCA 2WKQA 2ZRIA 3DR3A 3LYLA 4HL6A 1R7RA 3KT3A 4O2AF 3U3ZA 2V7TA 3DXFA 2BDTA 3VSBA 5LKRA 2P6UA 3ID6C 3PL5A 1XCPA 3CCCA 5CDTA 4OBEA 3GF4A 1RFLA 4IF4A 4G81A 4JXZA 1I7NA 1D04A 3H4VA 1WTAA 1PKXA 3O8QB 2TMKA 3AF3A 5AI9A 4D74A 4OFXA 1ZONA 1G8JA 1KI2A 2CK3D 4PHGA 4Z1MD 2IPOA 4BTVA 4G1UC 1M6YA 1YC5A 1XCOA 3CPSA 1BN6A 2H54A 4BJ5A 1SUWA 4F3YA 2JHGA 7GPBA 1XAGA 3WC4A 1ZVJA 1KOGA 1ZR2A 1TA9A 4KDCA 5CB4F 2J0QA 3C48A 4BV3A 1BMFA 2YWXA 1NBHA 4LEIA 4ZP1A 5DX0A 3OOYA 4CIXA 4D3ZA 4QRHA 1UDXA 1M3SA 2VCEA 5BUQA 4FCCA 1YBHA 1P72A 2AR0A 1W4AA 1ESDA 4TVKA 2VN8A 3UWKA 2WHRA 8AT1A 4BVKA 1YB6A 4HS4A 4PX3A 3SDZA 2VQDA 3QY0A 1H2HA 2ZZKA 1W0JD 4K88A 1T5HX 2DCMA 1C7QA 1E94E 4WLFA 3ZU6A 1QP4A 1CUDA 4Q47A 1THGA 3FFXA 3SG0A 1TZCA 4YBRA 5JXHA 1X92A 2BFEA 3MUFA 1FOEB 3FNFA 4IJUA 2DUUA 1HRKA 1ZW1A 5B3LA 4FFNA 4P0TA 2X3UA 3TCKA 4MVJH 5LU9A 3VXKA 1MX1A 2WDPA 5A7HA 4U5XA 3UOGA 3VAAA 5C8VA 4AIRA 2C7GA 4I19A 4KWIA 3LC0A 3SE7A 1L3CA 1NRIA 1L1FA 2WG2A 5EKXA 3A1UA 1NVEA 3WI7A 1J2YA 2CL7X 1RR6A 3FZYA 2WFAA 3AI7A 3NRBA 5JVDB 1ZHHA 4RLQA 4KIWA 2L2QA 5CCEA 3MJ4A 3GOHA 1XUOA 1IXZA 3VZRA 2H52A 3AVTA 1XMSA 3ES9A 1UM8A 4NDZA 5DM0A 2P9QA 3K2BA 3WTCA 3P9YA 3W6NA 2FSGA 3JD0A 2IHTA 1FJGB 4GGOA 1GPBA 5JPDA 4LRUA 1M6WA 4HB2A 3MGGA 2GZDA 1E8MA 2P3SA 4RELA 4XD7D 4L57A 4C30A 4DANA 2JIZA 2NLOA 1V8PA 5G4KA 3VBCA 3PNSA 3F90A 2HSZA 3JVEA 4TSKA 2EQAA 4JI2B 1JR3D 4N0EA 5CPFA 2F9MA 2JGNA 3ODPA 4MAMA 4IQFA 4MGIR 3R9XB 2H7XA 3JQ8A 4MMXB 4XQ0A 4QELA 5AK4A 5GONA 3TCNA 5C2JB 4R1UA 3V9PA 5KCMA 5EMMA 4UW9A 5FIUA 5BORA 1JEYB 2B21A 3FTDA 3UATA 2VK1A 3OIWA 2OHXA 1NUTA 3RFVA 4D8TA 2X9VA 4KMOA 4GX0A 3RUIA 3W5AA 1HC7A 4HNVA 3LCUA 1JS1X 4MUAA 4NECA 4QDOA 5F64A 5LYJA 3QE4A 3L0BA 3SQXA 3IR7A 3QU2A 1YS6A 2FK8A 3BYZA 3TFQA 1G20E 1UPXA 1Q77A 3KB8A 2FEMA 3HGMA 1JA0A 3KJIA 3QPWA 1LD3A 1DKOA 1OE0A 3CWQA 3E5MA 3LSTA 4ZQIA 1W8IA 3HCDA 4FOOA 1ST2A 4I8IA 2G83A 2GTHA 4X6UA 2QN2A 3RYCB 3UWMA 3KUXA 4R16A 5K3FA 1KZHA 4DXHA 4HDCA 3HVUA 3Q9UA 3W2IA 1M1NA 3H7IA 2BDUA 2QSJA 3PWKA 4YCNA 3ZVNA 5HJ7A 1E6KA 3H13A 3NGMA 1HT2E 1R8SA 4XM1A 3BKXA 1HEUA 2ODAA 4JLAA 3UMVA 2HWWA 2XGSA 3TIGA 3ZWBA 2EHDA 4E70A 1MIHA 2RK6A 2V5VA 1AX9A 1EFVA 2WU4A 2YOGA 3O0DA 2QIPA 4IAOA 1CBUA 2GI4A 4IP0A 4LDAA 3RUAA 4ZT6A 3K16A 1WCXA 1Z6QA 1ZM9A 3KS9A 5LQMA 1K8RA 3KKQA 4WXHA 1F2VA 1PUJA 2YWBA 3FIJA 3KSMA 3GHYA 4NV3A 1M1YA 3GJ8A 3TL6A 5LXTF 5JT1A 4HMPA 4IGIA 1DQNA 3KVOA 5IP5A 4TS1A 3WK9A 4CKCA 1GQQA 2QE7A 1T1SA 4FEAA 4FYXA 5HCUA 4O4JB 3RTBA 4ZYLA 4W9MC 1WG8A 4J3JA 5BUCA 1LZKA 3UAZA 1PQYA 1K7YA 1MQ8B 4INJA 2QUIA 3VO2A 1KETA 2XA1A 1H6AA 1H9AA 4TTRA 4XX1A 1H1DA 2Q5QA 1IM5A 3CTMA 1IN5A 3DXZA 1DO2A 3ASUA 4GH5A 4EUSA 3FMGA 1KKMA 4YRIA 2FSVA 3F9RA 1E96A 1CHDA 1SURA 2A14A 2RHCA 1YO6A 5GZ1A 2X9QA 4UEJA 2VSYA 5FV7A 4BO8A 4HDOB 2JVJA 3WL8A 2F43B 3VYVA 4EY3A 2VVTA 2WIFA 3R4VA 2WZQA 4EGCB 2F7SA 1V11A 2OQRA 4ER6A 2GA9A 2FMUA 3FGPA 1YMQA 3PFBA 4R7TA 3U4GA 1W2GA 4G1EB 1XF9A 4YGYA 2AW5A 5AESA 4PO3X 1MT0A 5DHQA 4ENWA 5F23A 1Z5GA 2G71A 1QYCA 3PC3A 4FCVA 4OB6A 3H4MA 4GSLA 2EFCB 5IDQA 2FDXA 5JJBA 4TS3A 4JDUA 4E2XA 5B5SA 3O3CA 3M82A 2AE2A 4LRTB 2PM8A 1T2NA 5TT1A 3SJ7A 5FO1A 4CIAA 4MCIA 3ISTA 3IBSA 1GQOA 3SC2A 2HFJA 3CF4A 3C16C 4AMZA 3R6DA 2A9PA 4UE3S 3GEMA 1DRUA 4CQLA 1IHPA 1VE6A 4RE6A 4M0KA 1T9GR 2NVOA 2ZU0C 5HQ3A 3ZNNA 3C41J 5TJ9A 2E4UA 2D8MA 1DQRA 1E1MA 1AA9A 1E2IA 1NRJB 1A9YA 3BXHA 5BQ5A 3ESZA 1IN1A 3CLKA 4OYRA 5DHPA 4JIGA 1WO8A 1F0KA 1OAOC 2WFLB 4G84A 5DHAA