1F2VA

Crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
209
structure length
209
Chain Sequence
PEYDYIRDGNAIYERSFAIIRAEADLSRFSEEEADLAVRMVHACGSVEATRQFVFSPDFVSSARAALKAGAPILCDAEMVAHGVTRARLPAGNEVICTLRDPRTPALAAEIGNTRSAAALKLWSERLAGSVVAIGNAPTALFFLLEMLRDGAPKPAAILGMPVGFVGAAESKDALAENSYGVPFAIVRGRLGGSAMTAAALNSLARPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRECORRIN-8X METHYLMUTASE
publication title Crystal structure of precorrin-8x methyl mutase.
pubmed doi rcsb
source organism Pseudomonas denitrificans
molecule tags Isomerase
total genus 68
structure length 209
sequence length 209
ec nomenclature ec 5.4.99.61: Precorrin-8X methylmutase.
pdb deposition date 2000-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02570 CbiC Precorrin-8X methylmutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 1f2vA00
4AU1A 1I1HA 1F2VA 2AFVA 1V9CA 3E7DA 4FDVA 2AFRA 1OU0A
chains in the Genus database with same CATH superfamily
4ZO6A 1NHGA 1G3UA 1UM8A 1CY6A 3NKFA 3ENZA 1DRKA 3E82A 3AINA 1GKUB 4F0JA 3C41J 4ITVA 5KVQA 1G8JA 1JNXX 3ZY2A 4BMYA 3DW1X 4C88A 3H1AA 4UQOA 4EUKA 2O8DA 4REMA 3URMA 4WASA 2C2ZA 1U0OC 5DVZA 1QGUB 4EJ0A 4Z54A 1SM4A 2ZRCA 1YRBA 4DF3A 3PWZA 2E5WA 1L5WA 1XQXA 2PL3A 3KU1A 4IW3B 1Q0UA 3JR3A 4B3IA 3RODA 2P3OA 2BTQA 1QJCA 3CH5A 1KSGA 2GZ1A 3QYJA 1FLAA 3Q11A 3VZBA 1CP3A 4DBLE 3VNAA 3VJMA 3WNCA 2Z3ZA 5CAEA 5J2UA 1Z5GA 2RHTA 1XQ9A 2E4ZA 2EQAA 1TU3A 4IJWA 2X58A 4H77A 2DHRA 2CXOA 3Q3JB 3BRWD 3FNRA 3M6IA 3MWLA 4R2XA 4KR9A 3DL0A 4RM3A 3F2VA 4XB6B 1EESA 2ZRPA 1V45E 1A2OA 2Q5IA 2WPDD 3U3ZA 1DXYA 3L02A 3MGAA 3N59A 3TJZA 3WOHA 3PCXA 3ZW9A 1QBGA 3L9XA 4BVJA 4AD8A 2VJPA 3G8YA 3OCYA 4URYR 4GI1A 4ASUA 1EVEA 5IG2A 1KJ9A 3M33A 4BGIA 2BRUC 4HDMA 1Z47A 4HQLA 4B47A 5A3QA 5CVUA 3WLFA 1T6YA 1U7DA 2WT9A 3OP4A 4QT4A 1CUFA 1NF8A 1R74A 2XMSA 4ARZA 3DZHA 1DPFA 4IPTA 3TD6A 5G0WA 3QOXA 2JFOA 5MF6A 2CDCA 1N0VC 4IJVA 1IOZA 2FE1A 2QY6A 3EXIA 5CCDA 2Q6OA 3VC2A 5JJBA 3WB1A 2ZI7A 4IHKA 1YB7A 1Z5NA 2DWCA 3M1YA 4H16A 3U31A 1R9MA 4Y3UA 1GTG1 3PQ7A 4N0PA 1QTQA 5H02A 4KCGA 1H93A 1Z2PX 4HG2A 4QBFA 4CM4B 4G0MA 5BVGA 4UARA 2G72A 1G16A 2XYGA 3TR6A 2P9CA 5J2TF 5BWCA 5L9AA 3OPYI 1VG8A 1UMCA 1QXSA 2BISA 2C7GA 2I7TA 5J4YA 5NLLA 2YZNA 3O94A 1FVHA 1NN1A 1TO2E 2Q3LA 1FQJA 5TRTA 3U9LA 2PZAA 4E6PA 4HYTA 1RJGA 5EP2A 1CZRA 1XPJA 3ZWDA 3KPVA 3C16C 3PQDA 4TUYF 3GK3A 3C3KA 1TJ4A 1JQAA 1BFDA 4PC7A 5JJLA 2XDWA 1YZ3A 1J0DA 3T8YA 5EVJA 3EIWA 1T0HB 2R1VA 5FFMA 4QECA 4F3NA 2F17A 2I4OA 2J30A 3VJLA 3AEQA 2XUKA 1ONOA 5BN4A 1QQ6A 3GQVA 5ITVA 2QGZA 4JJ8A 1MIHA 5I9IA 1CR4A 1S01A 5GV7A 5KHOC 1J7JA 4G4IA 2I3GA 3QXJA 2WIAA 3R0QA 4RCYA 5E6SB 2WLTA 3HYLA 3KWLA 2QNIA 4D9IA 4LRYA 1ML3A 2X6QA 4MA5A 1XB2A 1Y3FE 2YJ3A 3A4MA 3G7UA 4XOIA 1GFIA 3MT0A 4DTCA 2V7XA 4QM7A 1I3NA 3WHPA 1PYOA 2OQRA 3BGVA 4HN9A 3GVIA 4A0FA 4WGGA 1CF9A 2QR2A 1R6TA 3D6HA 4YRSA 4G5HA 4UAVA 4ZVSA 2IV7A 1JG6A 1A9SA 1OV4A 3HB4X 5TY0A 4ZU3A 2DTEA 5JZMA 2VYND 4RESA 2PUGA 3ZZNA 1DCKA 2IUUA 1RXYA 2QP4A 4KEAA 5DFAA 3O38A 2HY7A 4CMGA 5KNBH 2BSQA 3VR3D 4LOLA 4XD7D 2GSDA 4AO7A 2GKOA 1OI4A 4M49A 1PWYE 2C4KA 3GIWA 1F38A 1VRCA 3A6GA 4G4SO 3RRJA 1D2NA 3LKDA 2H54A 1KYVA 4CDGA 4YHHB 1YS1X 10MHA 3IHWA 3OJWA 4RKYA 2OBNA 3O0DA 1POXA 5EA2A 4GM1A 4WEOA 2VEDA 3BE6A 3GPIA 2AOTA 1AN0A 1B0UA 1GGKA 5JAIA 3BFKA 4RGQA 4ZFNA 1GIAA 4WQMA 2H3HA 1F3LA 2VP6A 3EGEA 5AOCA 1LNQA 2KJQA 2VTEA 4G36A 3RJ5A 1XLTA 2FAXA 2NVUA 1QH9A 1YCGA 3AB8A 1BFUA 3EA0A 3KYIB 2ZK7A 3OAAA 2VRCA 3TQSA 2CD9A 3ZOZA 1K7CA 5CH5A 5DYTA 3RVBA 3T1QA 1BJKA 1GARA 1DLJA 1U1CA 3JQPA 4HRVA 1CR0A 3DD5A 2OG2A 3PX7A 1XDDA 3FR7A 3P0HA 3OIVA 2EKLA 1X7DA 1Y9DA 1XR3A 3FFTA 1V7CA 3HDGA 3SYKA 3TW0A 2WU1A 4B6EA 1I6KA 1FNCA 3EIUA 3ORSA 5CVCA 3GGSA 4L8LA 1OW3B 3IERA 2I2WA 5K0LA 3SFTA 2FWMX 1SKQA 3F5SA 3JQQA 3TI9A 1I2CA 2FPPA 3ZBTA 4CNQA 5DX0A 4ZOBA 3Q3VA 3BTOA 2FU5C 5DP2A 1XN4A 2AK3A 2ODEA 5HFNA 1W59A 1ODKA 1AF7A 2VH5R 3ZE2B 1I36A 1E3WB 1N6NA 1OUMA 1ZNQO 4MUJA 4MVJH 5IM5A 3DWFA 1QHYA 2CHUA 2VWHA 3RVOA 4Z4HA 3LHSA 2C99A 2QTWB 1JECA 2DR3A 1NXXA 1UXGA 2GNAA 1LU9A 3GFOA 3ONNA 3UK7A 5B4TA 5JS6A 4FUQA 1QAMA 4WCFB 4JBXA 3LV8A 3WRXC 4INPA 3OCJA 4OXYA 4DADA 1ZUIA 1J20A 5K3DA 3TSAA 2B4RO 3T61A 5FUMA 1U0BB 1JX6A 1FTWA 2YWHA 4PZDA 3GGOA 3IBTA 4WPGA 1B4DA 5J5AA 1Q44A 3KP1A 4Q39A 2RKWA 1N7GA 1O96A 3B6JA 2LKCA 3TMAA 2FUG6 2PFKA 2DBZA 1FTNA 2JJQA 1WSBA 4KR0A 1RBZA 5BOSB 1Z2NX 2B30A 1CHDA 2GFHA 3H1FA 2FN3A 3EG9A 4WMLA 1IZ7A 1IY1A 1Y82A 2DWOA 2IEZA 4FNMA 5AVVA 5HTOA 5KYKA 2WD7A 4RADA 5CLHA 5DTEA 4EPTA 2RGCA 3UBTA 4BWYA 2HJSA 3HV0A 2VC2B 2BFDB 3L79A 5J5CA 4ZJUA 3KTAB 1B6SA 4I66A 4QX6A 3LTEA 1M8JA 2Z1NA 1UBOS 2F90A 1KDVA 5EQDA 3FPCA 1ZBDA 2BR3A 5K3AA 3WGMA 5JJIA 3ZD7A 1JILA 1MOZA 1NVEA 2GM3A 5CW1A 4YALA 4ZXPA 1QH1B 3QUBA 3NATA 1DX4A 1TJ3A 4EGFA 3EDYA 4YGYA 2NQTA 3QEMB 2X0EA 1J23A 3SKXA 4JXZA 2HRBA 1GG9A 1T1RA 3ACCA 2WUFA 5BV1A 5DM1A 1F1JA 4DIKA 1TM1E 1B73A 1P4AA 2C4VA 5HG0A 1LFAA 4E15A 2VF8A 3W8FA 1Z4OA 8ATCA 1Y3HA 2VZLA 1XZDA 3UB2A 3N2GA 3OT1A 3R0XA 4BBZA 5CXSA 1CZLA 1GZDA 4WZZA 3IBYA 1L5OA 2W6ZA 2H9AA 3JVIA 2J4DA 3P97A 3SNKA 3ILXA 3ANTA 3OJ0A 4GYYA 3NW9A 3A9VA 4YCDA 5IHXA 4Q7KA 2WYOA 3MIIA 3O4VA 2J9XB 3QFTA 3W9BA 2VJOA 2QMUA 2XZPA 4CRWB 1QKIA 1RBYA 3WGLA 3RYCA 1GZ4A 4RTSA 4ZPXA 3U5ZB 4OAPA 2CUKA 1E9SA 4C30A 5AW6A 2GA8A 3SXPA 1AK9A 2RARA 2I65A 3C8DA 4Y2TA 4TVSA 4R81A 2AD1A 3RUCA 5JHHB 1KZ4A 1T3GA 3OJOA 4MWBA 4UBJA 1L4NA 4CJXA 1PZXA 1YAJA 3CO5A 4K2HA 4OF4A 2Y1XA 5H81A 4BYGA 1IUNA 1IFXA 4MAAA 1USVA 1OLXB 2J5QA 4IICA 4L0DA 1FYVA 2R7AA 3R44A 3F8TA 4JR1A 4MULA 4R0VA 4XCQA 4ASUD 3I53A 1MMFB 4P31A 3KKNA 2D7JA 3AUKA 2KB0A 5IARA 1CQIB 1E5XA 1JS1X 4A2WA 3FETA 4UTRA 4DLKA 4HVLA 4N39A 4BLWA 4F4UA 1QZZA 1M6WA 3WA7A 1G59A 4PHTA 4KR7A 1P1HA 1B6GA 4QUGA 4DLPA 4QYTA 5E4JA 4Z4GA 1E7WA 1RAIA 3W5HA 2AZMA 4KR3A 1M1YB 1T9BA 4KLAA 4OHFA 1RRMA 5TQ2A 1HNZB 1U5AA 3JQGA 3F6CA 3W8RA 2Q46A 4TRJA 3WYGA 1H6BA 3AVVA 4GRDA 4KOAA 4EMBA 4NZZA 3U7FB 2FZWA 2AFIB 3SQLA 3VR0A 4IY1A 2OZLA 2P9FA 1ZD3A 2K4MA 4YEDA 4ESEA 5H16A 2O14A 3B3JA 1QB8A 3PUJA 2XZTA 4YUZA 1NOIA 2NT3A 2PL5A 3C87A 3GLFA 1RNLA 1W5SA 3EH1A 3G49A 3X2EA 3LHFA 1L4KA 3UJ9A 2AYZA 1NU8A 2ODQA 1M7HA 4UVEA 1XL1A 4XARA 3S68A 3W0LB 4BKUA 4CUZA 3JD3A 4CWAA 3AHIA 5IF3A 4MHOA 4ZXFA 2PQ0A 4O4JF 3CH6A 3RYFB 5BV2P 4S1OA 5T7BA 4QWMA 3J7AC 3EC1A 3GRCA 4KAFA 1XF9A 2ZYSA 5CTAA 3WWYA 1RI5A 4B44A 2HHLA 3OQBA 3W6UA 3IT0A 3DR5A 2BYTA 4HFMA 5SZJA 1G9XA 3G2JA 1R4AA 4R69A 1JHZA 5I3CA 2VWGA 2X9LA 5CLFA 2YJZA 4JVLA 5E6SA 2EIHA 1JR3A 3M9XA 3MTIA 4A8TA 2ZYRA 1EG7A 1U7HA 3UNXA 3IA7A 3BUSA 5CB0A 3I9JA 1GR0A 5L6LB 2VTDA 5B2ZA 5DBHX 3ZIAA 5ICSA 1E6CA 2DT5A 4YP9A 1XEXB 5KYVA 1OLUA 4LEIA 2F9FA 2GAAA 1DAIA 3NWOA 2ODTX 2ZBRA 4FW9A 2FN8A 2J41A 2QVZX 4HVAA 2QL9A 1QQAA 3KSDO 3OPXA 1X15A 1TZMA 2QORA 4JA2A 1ZL2A 4LV8B 3S40A 2CNLA 3TEMA 4CIYA 3IKLA 3G9XA 2PGLA 4H35A 1E58A 4YAJA 3VR1A 3K9QO 4JT4A 4I5EA 2BC9A 2VATA 1M75A 4C7VA 4XM0A 3KUCA 2CXTA 2BGTA 3HLTA 3PJEA 4OJNA 4DJTA 1WZNA 4EM6A 1G6KA 4Z4EA 3VZSA 2ZJ1A 4M4SA 4PZUA 4ZEWA 1CK4A 4F2WA 1YI1A 4ZVQA 1J00A 1T25A 5ALVA 1CU1A 3C8MA 3OZCA 4H1VA 3AOGA 3EEYA 2OSBA 2YY7A 1SBTA 1W47A 4KMRA 4MGYR 5JBNA 5LJIA 3OAAD 1QUFA 2R8EA 2VRCD 3GCDA 1A4IA 3NHFA 3PFNA 4Z4CA 2IUFA 1L5NA 3JARA 3IAS6 4EPRA 2X2EA 1T5LA 2OVFA 3MJRA 2FRVA 3PHJA 1RWXA 2I6SA 2PH7A 4FXPA 4JLOA 5H83A 4EO7A 1JR3E 4YMGA 1LB1B 3G59A 3WXBA 2M32A 5C1BA 2I1LA 1A9RA 2XBMA 4ZVVA 1SBCA 2VK2A 3CZMA 1RIIA 2D2XA 2ZJYA 4ZI5A 1IN8A 3H18A 1EH5A 2IX9A 3SJCA 4CR6A 1PTKA 4DR1B 1N8NA 3FPKA 4R9RA 2Y1FA 5JECA 1P0CA 1P5FA 3H17A 3BH7A 3GRRA 1FX0A 2OV8A 2QTVA 1SHKA 2FVXA 2XE7A 3F49S 3GFVA 1RWVA 3PPIA 5FOTA 3NH9A 3DLHA 5LOVF 1Z88A 3DKRA 2R7NA 2B34A 4V38A 3K53A 3CX4A 4D0SA 3LCRA 3DTVD 4G85A 3GEBA 1LPAB 4NXNB 2ZAMA 4XDGA 4QO7A 2C58A 4BBPA 4PRYA 1T3HA 3QYFA 2ZSKA 4JR2A 4KPGA 2PMEA 1T8PA 1UZUA 1T10A 1MZVA 1RPNA 3QEJA 1F8GA 3U3DA 3WMFA 1JE0A 1LS1A 4AWAA 2BKVA 3SX4A 3D6MA 4HPXB 2Y27A 1L1EA 1T0UA 1MHPA 1OTYA 5KI6A 1DFGA 4GU5A 1USUA 4Q4JA 2TMGA 3L18A 3W2FA 2VJYA 3BX1A 4HDKB 2AJCA 4LYAA 2D1FA 1IZ9A 1GL3A 1L7PA 4BLVA 3KB2A 1EBBA 3R3ZA 3KCQA 2XLBA 4E03A 5FQNA 3QKWA 1FA9A 3E9YA 4C78A 4LX0A 1GGEA 1XNGA 3BXPA 1G8PA 3GEGA 3L8MA 1LLUA 4WECA 4DUGA 1MD9A 4YMUA 3X1MA 3GPLA 3GJSA 3OUZA 4G1CA 4HSGA 4O59O 3DJFA 2QTAA 4PWYA 1UBJS 3LO8A 1LSSA 1BX1A 1TAHA 1UKVY 3A2MA 1HOXA 1X70A 2P35A 1P0PA 2F8MA 4FQ8A 2JGAA 3Q0EA 2VCEA 3MLAA 3AI3A 3MZ0A 4D3XA 5BOSA 2LR0A 2K87A 4KACA 4KHZA 4JEHA 3HVKA 1HL7A 2VHXA 3IAEA 3ORRA 4IOKA 3T3MB 3SQOA 1JA0A 4BUJA 5IZ4A 2QTCA 4J91A 4MPJA 5EJAA 5LDDC 4GI2A 1MB0A 2EWVA 4Z3DA 1UL1X 1CB0A 2BFDA 4KYVA 5BYJA 3RKSA 1QFSA 3KTAA 3DFMA 3KQKA 3VC1A 3NDRA 1E32A 1MG0A 1O97C 2FP3A 1AA6A 3I1YA 2FWJA 2KS6A 4HUQA 4X1YA 2PRSA 5D86A 2I99A 3FMPB 2OM2A 1B41A 3AW9A 1O95C 4TLLB 5DT9A 2DPMA 3HJTA 3OTWA 3RS7A 4MQEA 2QTHA 3HN7A 4JYBA 5KUTA 4JUDX 1JKIA 3A28A 1LRKA 1MC1A 1KH1A 3CEMA 1NFFA 2NV0A 4ARSA 5KJFA 1L8XA 3CKYA 3SLKA 3O93A 2W6ID 2QM3A 1FSSA 4MUNA 5LLSA 4IDCA 5CNKA 5DGXA 3KL4A 3QUCA 3SYLA 3A1DA 2C8VA 2GWRA 3DE3X 4YYEA 2QG4A 3D6VA 4V0LA 4E3ZA 1I94B 1UPFA 3OG9A 4KYIB 2OHOA 2HREA 2GRJA 2YVQA 5IJWA 1CR2A 1P4GA 3I2JA 4AKSA 2OFFA 1M0WA 2GPTA 3SR0A 1ZNXA 5ELXA 3OOWA 2H6EA 4MVJI 1SD1A 2HM7A 2BUCA 4CTKA 2V7EA 1G5HA 1QKJA 3L46A 4IUBS 3QMMA 3LWNA 1Y81A 4EGSA 2X0JA 4G5XA 2VK4A 3AF5A 4XCVA 1NR1A 1THMA 2JBWA 1RRPA 5EZQA 3F5FA 4JUBA 1K3UB 2WB2A 1QC5B 5CT9A 1V37A 1V1RB 3CKKA 2AVDA 1XPRA 4E08A 2QMQA 5I9BA 3BDAA 1OLXA 5JNWA 2YHIB 5FL3A 2XCTB 4H6PA 4WZ6A 4R54A 3HKDA 2XXJA 3F7MA 2JI6A 2PGDA 4NU8X 3H05A 3OUTA 1U99A 4G09A 4JQCA 4MO2A 1R8JA 2QLLA 1CXZA 1ZOSA 3E9CA 2RG1A 4D9FA 3PLAE 4X20B 3VRHA 3AVQA 4ZCRA 3PNLA 1E9VA 4KGVA 3CR7A 2VSOA 1R8QA 3H9JA 1QE5A 4CF3A 4IZOA 4XWYA 1NNSA 4F4FA 1M1YA 1VSQA 1U11A 5BRJA 1YA4A 3KR9A 4BX0A 3DBLA 4IZ6A 4EHHA 3EUWA 2XDAA 4MQBA 5E1OA 4KFCA 3M4XA 5AUQA 2AFIA 3GNLA 4RM2A 1V41E 3IKJA 4NATA 4ZN6A 2GWHA 3EXEA 1UBLS 1KVRA 1LW7A 2HCJB 2RHOA 1KWGA 3OD5A 4TQAA 2FKNA 4B85A 3C8UA 3DFZA 1UADA 3SHFA 5AKEA 5EAIA 1WO8A 2ZANA 2BFWA 4BTLA 1PWZA 1NTRA 5AM3A 5JADA 1AZTA 2YWXA 3TI7A 2GJ8A 2Q49A 3BM5A 5A0TA 1HQKA 3JY6A 3BL8A 1OIWA 4MS4B 1V3UA 3QX8A 1ILWA 6AT1A 5KKNB 2BM8A 3RYFA 3R40A 3TQTA 1XA4A 3T7RA 1I14A 1VLLA 3A0UA 5DSXA 3ZHSA 2LP4Y 4R2HA 5E2IA 3N3AC 2IKQA 3QLEA 4MP3A 5LBIA 3LM8A 1O9HA 3ZIAD 4CQLB 1RP1A 2P40A 1E7QA 4GXQA 5JANA 2R7KA 3ROXA 3VDRA 1N25A 1WDKA 4LV6A 4HX5A 3IO3A 2PV7A 4UUOA 1SXJC 1N3BA 4AQ7A 2C97A 1H2FA 2HI0A 3C3CA 4OMUA 3PUXA 1UFKA 5LQDA 2Q2VA 1BHJA 1XDBA 4PWZA 2ACEA 3ZHBA 4EKIA 1Z7WA 2D5CA 2DY1A 1GL7A 2B25A 3KOMA 3OPYA 3UA4A 1BS9A 3L7AA 2D7CA 3NVMB 3O2JA 3MCAA 1JKMA 1BH6A 3QVTA 2I87A 3KAQA 3EDCA 4XOUA 2HXYA 3FPLA 4C3UA 1X7ZB 4C22A 2DUNA 5CDTA 2IOFA 2CXUA 1ZLYA 1HQCA 2WSBA 5DXFA 5I7UA 5GIOE 2CWDA 3UYLA 4BUZA 4EG6A 5AK0A 2EP5A 3TXYA 5C8ZA 4PLGA 2QRGA 1OREA 1XQWA 3AX6A 2GEFA 3M34A 3ROKA 5FORA 3Q98A 5L95A 2DKFA 4TV8A 2PD3A 1HWYA 3V9PA 5TDHA 3ZJTA 1KBOA 1OAKA 2UV8A 4CL0A 1G42A 4JP5A 1KEEA 3CGWA 3E35A 3P71T 4RE5A 2ZIFA 3O1HB 3ZBQA 1E2UA 1V9SA 3F8WA 3W9YA 4BGDA 4OB6A 3STHA 1QRAA 2AN5A 3WZ2A 1R16A 4AWXA 4Q4HB 3BD7A 2NZJA 3W2EA 4JLMA 1NUTA 3EIFA 3X43A 2IZZA 3IMEA 4G26A 4WBNA 1H5NA 1TCVA 3MJTA 5EQJB 5AVRA 1E0KA 2ZB3A 3JYPA 1W29A 1Y4ZA 2FEPA 1BYUA 3IC5A 4NS1A 5D5PA 3RJ9A 2X0RA 4XSVA 3RTAA 3DF7A 1JEDA 4GBMA 4LC1A 4WOBA 2H8KA 3W77A 1SD5A 4B4OA 1P7VA 1A76A 3EIOA 4Z9BA 5C8YA 2DC1A 1VCIA 4MS1B 3LJKA 4Q4DA 1P2BA 2BFBB 3S2SA 4K9KA 2MSKA 1RHRA 1YL6A 1PJTA 3D3QA 1VRWA 4EELA 1P5HA 3EZFA 2C3MA 3GZNB 4Y6OA 3LLMA 3CVUA 4WLFA 4R8VA 4W7HA 1KYWA 1Y1LA 3QPUA 4LOAA 1E9BA 3HXLA 2AMFA 1NVFA 2BHTA 1E3EA 3LZDA 1BS1A 1WCYA 4HP8A 4YVFA 5AW4A 1ZJJA 2XE6A 3KWFA 3W05A 4BGUA 1ZNZA 1WQ1R 4S1TA 1CV2A 1BNCA 4AKEA 3ZLTA 2QWXA 3D31A 4LHXA 1SXJA 4JVSB 1EXWA 1RC8A 4DUGD 5C7OO 1L5SA 1FEZA 4FDLA 5IBPA 3BMQB 5EFZA 4C3VA 3O4GA 1EFLA 1KYTA 4PZLA 1G8GA 1ULAA 3GDHA 3PBKA 4GPBA 3H2BA 4G3XA 1TVEA 3T5DA 2JPDA 2R0QC 2P41A 4I50F 2C00A 1FTSA 1TKBA 2HCRA 2G3YA 3N0WA 3E48A 4C0AC 1ACLA 2G7ZA 1EAMA 1XXLA 2P3LA 1U1EA 4CKZA 2SHKA 4XWWA 1KK0A 3KT0A 3DOFA 1FVXA 2RGDA 4KYTA 5DHAA 1S9HA 4DEXA 2EZ4A 4A92A 3ZWKA 3C6ZA 3DEZA 1EGHA 1FS6A 4TT3D 1PJQA 2GILA 1VMKA 2C57A 4PNHA 1FLVA 3EF3A 5JDIC 4F9TA 1ZR2A 2I0FA 5THKA 3AILA 1ZESA 5ALPA 5JWHA 3X1YA 4CIDA 2W2LA 3PL5A 1GYPA 1AT1A 2CL0X 3KVYA 1M1XB 4WKOA 4HJRA 1T4GA 4TLEA 5KB3A 5JS2A 1V4VA 2NU6A 1MBZA 3DQPA 1SXJE 1PQWA 1RYFA 4E1BA 5K09A 1K7SN 4EYKA 4PGMA 5K99A 1YR3A 3MT7A 3OP1A 4OUDA 3DT6A 4YDRA 3TX6A 5CXQA 5JDCA 1BZYA 1TO1E 2C2YA 1M8KA 2PIAA 1WTCA 3F46A 2X13A 4Q3CA 1XN1A 2GEUA 2ZIUB 1KJNA 2OXFA 1QF7A 2F48A 3P2KA 1NBHA 4HDSB 4PNZA 3MWJA 1JYEA 4QUBA 4G37A 1YR7A 2KPOA 1ZVMA 2O2GA 2R8BA 3UYKA 1XZIA 1QFZA 2BMEA 3OE4A 1XD9A 3OQVA 3R6GA 3KPYA 4K7JA 5AK4A 3WRYC 1T91A 4CHGA 4CCSA 1FQWA 2HWUA 4QGHA 3BHNA 5KWIA 4LKOA 2P6OA 5HM8A 5D3MB 4YJKA 1YL7A 1NVAA 2YH2A 4NBTA 4O25A 3WDKA 1H6CA 1YQXA 4JI5B 2VJBA 4AMZA 5I51A 2F55A 4CEJB 4LE0A 4PRZA 5K0SA 1M2FA 1GNQA 1MIOB 1DEAA 1G21E 2GCIA 4I1UA 1Q7EA 1KETA 1NYRA 4ZVTA 4ZZ1A 3RE1A 2IBTA 1PLKA 3V6LA 4TTTS 3JXEA 4O4HF 1QC5A 3BWCA 1V1RA 1CPYA 2Z8YM 1HA3A 3Q1KA 3EPLA 3E9NA 2EZ9A 1NC3A 2YCLA 2E4XA 4GWKA 4QVGA 3G6KA 3N86A 3ZHCA 4D8XA 1ST2A 1DIAA 4N7JA 3L7YA 1D03A 3NM4A 3PD0A 2A9RA 1IK4A 4BASA 3RBZA 821PA 5FAXA 2Z6QA 1KOGA 1SOWA 2Q1XA 1BVRA 5G3YA 2DB3A 4KBYA 1OH6A 4J29A 2O2DA 2A6PA 4UE6A 1EX1A 4X20A 3FXAA 2NV6A 5AKYA 4DCCA 1PJLA 4QXRA 1AK2A 1P2UA 4MJXA 3AVYA 3R7FA 3HXQA 4J1TA 1CZKA 4B4UA 1YDHA 1SPXA 4D79A 5LLTA 1IBMB 3QITA 5CJJA 1QTRA 3DBHB 4MWDA 3KE9A 3VYVA 2QA5A 4U7GA 5K8IA 3OF3A 5EJMA 3EPKA 5FIUA 4RIGA 2BFOA 1Z9BA 1ZD2P 1ZD9A 3DMTC 3HU1A 4UPDA 4R16A 4V0MA 1SG0A 2P2LA 2E1PA 2EFHB 4JI6B 3BFJA 1SC3A 4Y7CA 3ND8A 2FEWB 3PGMA 3QU7A 4MROA 1VTKA 3V1TC 2XKBA 1GLNA 4QFCA 4EJSC 4ZDWA 2D2FA 4FMPA 2SKEA 3I4LA 4QATA 4GOJA 4JYMA 3UKOA 5DHQA 2ZYTX 3FPAA 4X64B 1UBKS 2R5NA 4BFCA 3DWEX 4WN9A 3HH8A 3OQMA 4FTWA 1GCOA 4E51A 1O7JA 3AVTA 3E5NA 1QLWA 3WHLA 1XD2B 2DHQA 3DEYX 2WWRA 5JYBA 2QK4A 2KM1A 2FWAA 2BBTA 5HE8A 1YRYE 4BKPA 3DCNA 1XZFA 4MS4A 4WXMA 1U8UA 1UOOA 2FF7A 3C3MA 3QWBA 5K0CA 4WKPA 3JSXA 4NU5A 1WB6A 4V39A 1FMTA 4ZC1A 3O9ZA 3ZDXB 2OP0A 1I2BA 1SC9A 1WXHA 2QYSA 2VUIB 3WRYA 2XXAB 4CQLA 1QRUA 4X7PA 5D51S 1NVWQ 2ECPA 3FWYA 1QIMA 3G89A 3VSCA 4XDHA 2AMJA 2XVMA 4ZGBA 3KFLA 2F3SA 3QYAA 4Z86A 1J0CA 4J6FA 3VHLB 3IQEA 1IM8A 1PFKA 1IQ0A 4N8EA 1VHWA 4XGRA 5EE1A 2ADFA 2Z5FA 4ZHQF 1ANKA 2H4HA 2ISSD 3AWIA 2WINI 1B26A 3VPBA 3ZQUA 3OFSA 3UJHA 4PF1A 1HORA 2PL1A 5IAKA 1QM5A 2Z5LA 1JXMA 2H9IA 3DULA 4G5FA 4H0FA 4RE6A 4CG0A 4QUDA 3B48A 2P78A 3BGWA 5DOVA 2O2SA 2FSSA 5LYJA 3UHJA 4AJEA 5IJAA 1O3YA 2EGUA 3I9V1 2P4HX 1QLHA 1YK0A 2P7HA 1IN6A 3ACDA 3HDJA 3NOOA 3IQWA 1QIIA 1GM5A 4F9GA 1W7AA 3WYBA 4BX9A 3TIFA 2C8LA 4F1WA 1XMOB 2OBFA 1RHUA 2AFHA 1II8B 4GEGA 1TK3A 2G7MC 3V1UA 3SKYA 2VXBA 3ZCUA 1ZOLA 5FA5A 3PC3A 1AV6A 1LK7A 3PP8A 4DLAA 1COZA 1I5RA 4HLDA 4MV7A 2QM8A 2AJTA 3M4JA 2R4QA 4NU6A 4GI7A 1M6YA 4Q4HA 4V0NA 3RS4A 1AH2A 4HN2A 3A9RA 4WT7A 2DM6A 1ONNA 1VLJA 4CZ2A 2Q07A 1MN6A 2XMQA 3M3HA 2X4DA 2ZYAA 4FYPA 5AW8A 4HNTA 4GDFA 3IAM1 3S2GA 3RVMA 3GEDA 3GPBA 3EZLA 2ERYA 1X7XB 2YJ6A 1LPNA 1ULHA 4GXTA 4M9QA 1OB2A 3W6NA 3I9FA 4EUHA 3U1BA 2MSDB 2C4NA 3L4JA 1C8VB 2PS3A 3LQQA 2KWIA 4XIFA 3TAHA 2J3JA 4MS1A 4MYTA 5E95A 1D3AA 4C05A 2BFBA 3LGSA 1OF1A 2C4WA 1WXWA 2YDXA 1V0JA 2ORYA 2BH9A 4AT1A 1N77A 3KUDA 1O89A 1EWKA 3PGKA 4CVNA 2HC9A 2QTFA 4CCYA 2JLSA 4Z3KA 5IWCA 1O94C 2G82A 4L5CA 1JDBC 1KBZA 3LFHA 2JFWA 1OX4B 2PDAA 1YFLA 3VX3A 4KE7A 2BEUB 4NLLA 4I5FA 3PC8A 2MYUA 4CIVA 1U2SA 2NU7A 4YASA 4DG8A 8ABPA 3TGPA 4FM9A 2CXQA 4JB3A 2QI9C 4DRXA 1L5QA 3AESB 5DGHA 3PITA 4WL0A 3ZQKA 4M1ZA 2AFHE 2BZGA 4O2BA 3QWIA 3H86A 1W1WA 5EINA 4JMLA 4QAQA 1FPMA 2E21A 4GR5A 4IHJB 5F9HA 1N57A 1RQPA 1W85B 1U2GC 3WK4A 3UFXB 3SPXA 2W2QA 3NWPA 4OHKA 4NDNE 2Z5GA 1MJNA 3VPHA 2QIPA 4PGAA 2M1XA 3RHSA 3I92A 4R8KA 3JZMA 4O1HA 4MH0R 2QIOA 4OYYA 1F14A 3VVLA 1EEXB 4DSTA 5C5IA 5J4VA 1T6NA 2X40A 1UDBA 3NIBA 4MQLA 4DA8A 1QRTA 3T1YB 1BEZA 5FNVA 4ZP1A 2I8AA 1Q16A 3Q9SA 2ZIGA 3FTDA 4NOJA 3D4IA 2H11A 1CERA 4BV8A 3MYRA 2UUBB 2RH4A 3DXZA 4MJ3A 2UZ4A 1YQUA 1GYRA 2RGNC 4DBVO 2XNCA 3HP7A 2Z8ZA 5ES3A 5T4EA 2WUGA 3GOQA 2QAGB 2YS7A 4RK6A 2WWHA 1Z08A 2FJPA 4E13A 1KDRA 5G1NA 1JJVA 5BO5A 2HT1A 1ZA2A 3E22B 3RU3A 5TLSA 4R2KA 1UXOA 1LRJA 1HV8A 4INAA 4EUNA 1KMIY 3W7AA 1TIKA 1P2DA 4NABA 2QHXA 4ER7A 4DMKA 3QPDA 1A9YA 4IFEA 2C4TA 2YNMD 2JHGA 3L8CA 4D43A 4X62B 1C7IA 3O1JC 1Q5PA 4TMKA 1EP1B 1Y8ZA 3GT7A 1WMEA 1EDEA 4FFDA 3NBYC 1EM8B 4B9AA 2Q6TA 4E22A 2UZIR 4B1FA 3BB3A 3UICA 4Q1EA 5A5FA 1MV5A 1O0SA 3H04A 1NVVQ 4NJMB 5DRYA 4H4EA 4C5BA 2M6SA 1WA5A 1TMKA 4CM8A 4LRUA 3SEQA 2IS6A 3RC1A 5BPFA 1BHSA 4JDUA 4NZPA 1CQJB 2Z2JA 4QELA 2BOVA 1RYMA 5JG7A 5LXTF 4WFQA 5KNBA 2IELA 1SCJA 3AONB 4HWTA 2LCFA 3IV9A 2UVPB 3IOBA 1KFBB 2QKYA 3NBFA 1ISPA 2B3TA 2D5LA 3PKIA 3MWKA 4BRSA 4EYEA 4RTKA 4N12A 4UTXA 5FOQA 3RFFA 1FYWA 1YKFA 5AOAA 1R0KA 3L01A 4ZQBA 5DHUA 4RZIA 1U7PA 1Z62A 5ALMA 3SIWA 3U49A 1Z15A 4F97A 1QS0B 3HWX1 5DLYA 3QXSA 4O8CA 4ZVPA 1C9YA 1WKVA 2A4MA 3SOZA 2PD4A 5CU7A 1TQHA 5GONA 4TQGA 4A23A 4CEJA 2VDWA 1H4TA 2CEKA 2BVNA 3LRTA 4JEUA 3HKCA 3EGXB 4K8OA 1XEFA 1I0ZA 1RWBA 3H4IA 4YJHA 1Y6JA 3FDXA 4P4NA 4F46A 3BDIA 5J4LA 1U3GA 2Q5OA 4D9KA 2NP7A 3B7GA 3QJYA 1CCWA 1GD1O 1KS2A 2BMJA 2YJTD 3SF0A 4MHTA 4LY0A 4ZI2A 4ATNA 5CH8A 1MNAA 4F8YA 5EWLB 3ZWWA 2CKMA 1QGOA 2BFNA 2DPHA 1J1ZA 1N5RA 1ND6A 1SVWA 2B4QA 4MUMA 2I7VA 4R41A 1RYBA 2F59A 1FB5A 3ANXA 3AR2A 3CZQA 3LDUA 3P0IA 3QVOA 4UDOA 4AZTA 4Y6QA 2WHEA 1YKSA 3GAAA 3H2ZA 2INGX 4UVGA 2G5PA 3FHOA 3K0KA 3K9HA 4MS3A 3OKAA 4OK5A 4X6LA 5E1MA 3O8RA 4QPJC 5GJBA 1TL7C 3TRKA 4PSAA 4DKXA 2PYDA 3DBHA 3P0EA 4UHKA 4X84A 5ILGA 4JB2A 3V4LA 1AHHA 1W4ZA 3EBPA 3K4QA 4N5HX 2X4LA 1E1QA 2YMQA 4MVJA 5JD3A 2VYVA 5BSKA 4DB4A 3P26A 4N18A 4E5PA 1Y8QA 1Z7EA 2Q1WA 2CXRA 2JB9A 3GVXA 4PO8A 2E2WA 2JGEA 4F7DA 5IHPA 2WUWE 2QXYA 2YYYA 4HR7A 3C8ZA 4AU1A 4QOIA 1W0JA 4Q3AA 1GA1A 1QIHA 3DAPA 4L6CA 4MWSA 1AF4A 3H3JA 2P9ZA 1F7UA 2R68A 3HV2A 4JJFA 1XFDA 4XX0B 5TJHA 3CX3A 3H9QA 3LH5A 1GTZA 2IT1A 4FP9A 2GCEA 3N8GA 1L5KA 3IEPA 4BE7B 3G9ZA 4TS3A 1GCIA 1J56A 1QIEA 3DTNA 3OC6A 1H2ZA 2C7PA 2V4MA 3HBJA 3GIDA 1JHXA 1R5JA 3DHVA 3I2FA 4D4KA 1GU7A 2O7SA 4N3NA 4YCNA 2A7XA 1JEAA 2XOKD 5FI3A 1GPH1 3NJ4A 2PX8A 4Q6WA 3IBFA 3WIBA 3ABQB 4OJMX 3LQRA 3SXUB 2IODA 4W82A 3ET5A 2QLJA 4H27A 3T4XA 3QXCA 2I9KA 4EP1A 4NCAA 4HEA1 2XXAA 1HM5A 2C8KA 2ZRDA 4AJ4A 1NF9A 3MJHA 3QFSA 4K6GA 5E7MA 4DE5A 3AFHA 4EG5A 4F3CA 4MAFA 1NX9A 1E1CB 4Z6KA 5FWXB 3CY6A 1V16B 1Z5WA 4TS1A 3RK0A 2XF2A 4YRAA 1Z5OA 2HV8A 2WTBA 2GETA 1ACMA 1XBTA 4F11A 2IUEA 1M1UA 3HCEA 4GKBA 4IIGA 2OZKA 1Q2UA 3GT4A 1HFJA 2YZMA 2EFDB 4NICA 4CM9A 1MZPA 3K0AA 4E7PA 3Q10A 3MCWA 4KO3S 4DT1B 4DQDA 3ISJA 1R0YA 1Z7YA 3PFBA 2HADA 2LZ0A 2NTVA 3G82C 3EF1A 3L43A 5ITZB 2NMVA 2Q21A 2UYYA 4JJ7A 1ODTC 4U63A 1D09A 4BNUA 5KS2A 2QZSA 2AF3C 3B1ZA 2EEZA 4YMVA 4YP1A 1KI4A 2OCAA 3J80A 1BDMA 1ZJZA 2JD1A 5AJVB 5H7XA 5DPMA 4B31A 2PWAA 1II8A 4OKNA 4QL3A 1S02A 4V0RA 1EJ6A 1NJ2A 2DUWA 3U39A 1UPCA 2OCIA 3OLWA 3G2PA 1P1KA 3EVBA 3PC4A 5FJJA 2VTBA 2HT6A 2R4TA 5IS2A 1C4OA 1BG6A 3UAWA 3D3NA 3NJRA 1N2OA 4F4DA 3MCZA 4BB5A 4ZCIA 1NSYA 4LC9A 3ITDA 4NFLA 1Z6ZA 2DFPA 3F5MA 2V7PA 3J7TA 5F64A 4YRGA 5K3OA 2VYQA 1PEDA 2YV1A 5LP6F 2Z04A 3GR6A 3RCBA 1E2PA 1EFKA 4KO2S 3RIGA 3H5OA 1NFQA 1SMKA 3AF6A 4NPCA 2ZXEA 4M1MA 2I2DA 2W8BA 3NFYA 1QYIA 3O9MA 1PHRA 2FR8C 1SVMA 3ELYA 3M8KA 4TSKA 5GP1A 3TKAA 2ZE8A 3U5TA 2GPNA 3F71A 1S3FA 3CNOA 1FUUA 5KC8A 1D1PA 1JBKA 1OA1A 4KSYA 1XLVA 5JFGA 1SUEA 2FMHA 2K2QB 4DR2B 4YS6A 4CKBA 5IEJA 4MYCA 2BEUA 2WICA 2GOYA 2WZCA 3IEIA 4H3KB 1IY9A 4FGWA 4L4ZA 4QKQA 1OFVA 2Z9DA 4JZKA 5BOVA 3ENKA 3KTFA 1LC3A 1Y3AA 2G83A 3AESA 1RWKA 4U7JA 3WK8A 1I1NA 4H4CA 4CM1A 3ERCA 5JQWA 4UBOA 1L5HB 3SAJA 4C3OB 1ZHHA 3Q7QA 4CKWB 1JLRA 3KSBC 3G9UA 4LMPA 3K5IA 4IHJA 3W79A 1U2TA 2ZW9A 1F2TA 4HWRA 2QUZA 3SM3A 4XRGA 1BA2A 3COPA 3K94A 1N92A 4ND4A 4RENA 1NLYA 1E2DA 4N3AA 4DLNA 4G07A 2WU0A 3MXTA 1XMIA 3Q9UA 5AKHA 3SGLA 1OGYA 1SUWA 1U9IC 4KXWA 3DQQA 4JOCA 2Z95A 1AURA 2OBXA 3BD9A 4ZIRB 2AJDA 4ZVUA 2RI6A 1FOEB 1Z4NA 2R6R1 2RHHA 3CJTA 3AFNA 4C1NA 4YXFA 2DWPA 1MVOA 2VP0A 1T36B 2CHEA 3WLKX 4KN8A 4H60A 4RHTA 1IEWA 3DWIA 3OY2A 2P9HA 4KB5A 1QYVA 4MMYB 4AKHA 3ONWA 4UDXX 2PSEA 1SELA 2QTMA 5U4XA 1J1UA 1FNSA 5SYMA 2RC6A 3MGKA 4DJFC 2A33A 4ZOQI 1OT3A 2FSIA 3LYHA 4C29A 4NH4A 1E69A 1X3SA 2NO7A 4CG3A 2PE5A 1XZNA 3U4DA 3AHCA 4L5BA 3TLGB 1P4HA 3PTLA 4GX5A 1E1NA 5ESRA 4ZVLA 3IKVA 4LJ4A 3ZU5A 5JXHA 1M0TA 3D4PA 4KOEC 5JNLA 3E22A 1IN5A 3MW8A 3OX2A 4C14A 4PS0A 1RXEA 5ALDA 1U65A 3U44B 4II2A 2CV2A 1ISGA 1SY7A 5IVHA 5CIWA 2OV6A 3DEAA 1J07A 2MYNA 1UK8A 4BB0A 1PDOA 2HRCA 1SBNE 3KQMA 3NORA 1U3TA 4L73A 3UMFA 4ZYUA 3AKZA 3BXGA 2PSSA 4BL5A 1EWVA 4FX5A 3JRNA 1D1TA 2XEDA 1E18A 2R6HA 3FUTA 1A5BB 2O7VA 2BE7A 1OFTA 2ONKA 1FXWF 1JLHA 1YZFA 2ESRA 4MWZA 3FNIA 4N6GA 2FR8A 1N1DA 1OZGA 4NJMA 2JFBA 4QBIA 2W4QA 4N6NA 4NBUA 1XK7A 2B2NA 3BMXA 3WWOA 5ARDA 1E7MA 1ZIXA 2NXEA 2Q41A 1W2HA 2B2XA 3EGIA 4Y2GA 3T5PA 3RYIB 2FMXA 3BULA 5BN5B 2UVPA 1HO3A 4M3NA 3U40A 5FTJA 1IEQA 4ID3A 4IDPA 4WCDA 4YDSA 1GN8A 1RAGA 1Z8HA 5A5VA 2V3WA 2PEYA 3NTQA 4KFTA 2NUBA 3ZH2A 2HV9A 3N1UA 4E2WA 2IH5A 4L22A 1KDYA 3DPIA 4KMOA 4RO0A 5FB3A 2XA2A 5EMJA 4EY5A 3DO5A 2CFOA 3OE7A 2ZUWA 2P3QA 2QDXA 2CXXA 3EW9A 4TRRA 3U3OA 4H2DA 1EA5A 5I4IA 5AXBA 2FZLA 3UJ6A 3THYA 4Q7JB 1DHRA 3Q6IA 1EVJA 1T6BY 1XVTA 2EP8A 3M81A 2SICE 5EVCA 5BUQA 5LDHA 4AMBA 3EGXA 3ICWA 4I1OA 4ZEMA 2OXCA 4C07A 3TLYA 4XJVA 4JNKA 1EWRA 3HN6A 1O6BA 1ZM9A 1DBPA 1XP5A 1X8JA 2C07A 5E7IA 3IHLA 4QHYA 4YRNA 3K8QA 3KLOA 4TKZA 3U6KA 2ODPA 4UASA 3D3WB 5BYKA 2DXIA 2AEJA 1W9HA 4UHEA 4URHA 2GD2A 4KXLA 2J0SA 4MVJD 1E1QD 3AKEA 4DC9A 1JHDA 2VYVD 5JV5A 4QVIA 3BQMB 1WMFA 2B4KA 5C0OE 4Q02A 5CPBA 1JT9A 1WZIA 5B4VA 3NUZA 2CMDA 3ZQ4A 4DIUA 3N0RA 3S99A 1VL5A 3UIEA 1G8SA 3OQJA 1L4UA 1W0JD 4UNSA 3DOIA 5FWNA 5DW0A 2BKAA 3K1AA 3EX7C 2PM8A 2X9QA 2XW6A 1EZ4A 1M2WA 1RXCA 1D2CA 4L3OA 3PG5A 2PKWA 4X65B 1XTZA 5ALKA 1VJGA 2V7TA 3SEFA 4PN3A 1W1IA 2ORIA 3T7IA 3Q72A 2C2KA 3F9IA 1FUYB 2M2IA 3PSHA 3R2JA 4MW7A 4NJEB 4QU9A 1KH3A 5FWYB 3WKEA 5JFOA 3ZU3A 3F9CA 4JELA 4IFBA 2IDZA 3W3AH 1XJCA 4OATA 3LECA 3GLIB 2GD6A 1P0IA 4XX0A 1XDWA 2NV2B 2O2HA 4MKIA 1KWKA 2VCYA 3DV9A 4N3CA 3SQMA 2PUFA 4BWFB 2FQQA 1VKHA 2CLFB 4JGIA 3KETA 2Z3WA 1M2NA 2VDMB 1KJQA 3UB4A 5BUCA 4QZVA 1BD3A 2X9NA 3LUFA 3PFKA 4YCAA 1GV1A 3PA6A 3A4IA 3PRKE 2AHRA 2ZTVA 2B4TO 3WSTA 2I7DA 2IPAB 5BMVF 2B6NA 2O1EA 1Z82A 2HU8A 2J0VA 2I71A 3TLMA 3I09A 4I0WB 2QJTA 3UENA 5AVJA 2A9PA 3PVSA 3SXUA 1SC4A 3ROMA 4JYCA 4QUIA 3UY4A 3CLSD 1ZEMA 1L4MA 3LW8A 3TJRA 3BXEA 4M1YA 1SXPA 2FTKE 4Y18A 4B82A 1XELA 4CM9D 5DMHA 1YQDA 3KR2A 1ENZA 2VSYA 3EDRA 4HNSA 3COWA 4KN5A 1R0BA 2XODA 5FWXA 3MTJA 3JS5A 4OUKX 4ZQHA 3TQCA 1V16A 1V7PC 4MJ7A 2R47A 3JALB 1UK9A 3IXMA 4M1QA 3SZMA 4AM8A 2Z1MA 1OXMA 4J0EA 1F0YA 2FYTA 1IOLA 4D9HA 2CVOA 1IXRC 5BSWA 1VPDA 2AOUB 5GWXA 3SLGA 1GT6A 3R3WA 4IJ5A 4HJXA 4FEYA 4FEEA 3RIYA 3KQTA 3NVKI 2P91A 4GWGA 1Z6PA 3RS9A 9ABPA 3NT5A 5B64A 4GZMA 1YR8A 5FTNA 5ITZA 2I6GA 1Z8NA 1I4DD 2AFRA 5G1PA 3PI6A 5LUBA 4F5EA 5CITA 3Q8KA 3L7DA 1E1RD 3VR2A 2PLWA 1L7NA 2PVSA 3VAYA 3WC4A 3K6SB 1KIMA 5DWDA 5ALFA 3IP8A 4BMNA 4XWOA 1EE2A 3K8ZA 5G0TA 3KU4A 2CL7X 3MMSA 5CDHA 3KZ1E 3VHXB 2G80A 2W90A 3EIQA 4I5DA 3OQ1A 3KZMA 1LGYA 1EUYA 4MITA 2G0NA 2YW2A 3RRFA 2Z09A 3VNVA 3T5BA 4LHEA 3ZGZA 1KTVA 3VYTB 5JH7F 3U3MA 2OG1A 3HXOA 3K70C 1Q19A 1YBFA 4UBNA 1JQLB 2CVPA 4DPLA 2VPPA 3COSA 4HDRB 3AFIA 1OXSC 3CNHA 3ME5A 4WOJA 4X9XA 5A6SB 5SICE 5JZBA 2F43B 1M8PA 1DTEA 3PXDA 1JHOA 4XGQA 3UMBA 1E8DA 2H7VA 2W71A 1ZW6A 3O21A 1XTBA 1DUVG 2HSDA 3NU1A 4Y6RA 4WJKB 3TB6A 2Z0MA 4AF7A 4DILA 1RZ3A 1XDUA 2OCXA 2WYUA 4JGGA 3DW3X 4YONB 3HADA 3SFVA 5JISA 3SE7A 1JXQA 3FZGA 3KUUA 1TUGA 3RQSA 4ABTA 5KU1A 5KYNA 1JQ5A 4IXDA 1G8YA 4Z9FA 5C31A 3ZWBA 2LKDA 5JRZA 3EVDA 1U9JA 1A71A 3BJIC 2IW3A 1S8FA 4D9JA 4UREA 3HGQA 4UHFA 4W7SA 1KZYC 1H5UA 2IU3A 2PSHA 3Q3EA 4AJOA 4QYXA 5EXPA 4EMUA 1MKYA 3ZD9A 2N42A 3MS7A 1D8TA 2JFUA 4ZOLB 5JY6A 4QNMA 3MAAC 4B3CA 5EEHA 1W0CA 3O6VA 5HRAA 2NZWA 4QOJA 4KI0A 3Q8WA 4TMZA 2Q1YA 5IVIA 4JH0A 4DZZA 2C04A 3SVLA 3BKXA 5K1ZA 5AKIA 4GLBA 5AVTA 2LBPA 2V7QA 1NN0A 2FZ4A 3ZCRA 1VECA 3AK4A 3UOGA 1LA2A 5HXAA 1R9NA 3ABSB 4W8OA 2OZVA 4IAOA 2OGZA 2QEQA 3WB9A 3WFIA 5JCXA 4PZ0A 1NXOA 1TJ5A 3DWGA 1T36A 1F4VA 3D8HA 1CZOA 2I91A 1Z7GA 1CULC 2PJZA 4ACAA 3T34A 1T2AA 3DZCA 1KAMA 4DV2B 1ONPA 1KFJB 3RT7A 3TUIC 4TSFA 3SS9X 5KX5A 3IKMB 3ICQB 1DZIA 3KZXA 4YT2A 1NBOA 2VWQA 1EFUA 2IYZA 1B93A 2HF8A 1JIKA 3AG5A 5ALTA 4J0HA 3E15A 4AFNA 4ZQCB 4YJ2F 4D9EA 1TVKB 1Q57A 2GLTA 3N5CA 3OFJA 1KHHA 4XGIA 4ZQEA 1P17A 5K3FB 2VYCA 1I2AA 5M7EA 4RWZA 1AKQA 1KQ3A 2H0AA 3LC7O 3TR5A 1PQPA 5IF9A 1PNTA 1CUSA 1OILA 1TF2A 3M9LA 2XCQA 1KYZA 4UXIA 5JRJA 4FYXA 2QVYX 3BXXA 1X39A 3KZVA 3HGTA 5F9FA 1FC0A 3AUYA 2ZR8A 2HYIC 4X3OA 5DBOA 1QH8B 2WJPA 4ZAWA 5CG1A 1CYEA 2TMYA 3IUJA 4BRWA 1GZHB 1E5DA 1ZA1A 4NBVA 5EIXA 2OXEA 4DRZA 4LZLA 1XU7A 3HYTA 1DL5A 2JGKA 1V43A 2IH2A 5LUAA 3DLTA 3CIOA 3MWYW 1H0SA 5BN5A 1JHRA 2PSJA 2ZJ5A 4BFTA 1VL2A 1E0SA 1U90A 2FEKA 3K32A 4URZR 4B7XA 4BAUA 5EIHA 1HYQA 1ZPDA 3WA6A 5LNK6 1UBUS 1YD7A 2PQ2A 4XYBA 5A3SA 4J6EA 5LU8A 4EO4A 4JXXA 4Z1MA 1UBEA 3FIJA 3QI2A 1KMNA 4C21A 4HQ6A 3V55A 1E2LA 1ULTA 4P82A 4DWJA 3CUWA 2XDYA 3OOEA 3C3WA 5DM60 5HIKA 1DJOA 3PUYA 7REQB 5BV7A 4XIYA 3PKJA 2GVDC 1BIFA 2OENG 2GF0A 4PXSA 1ZN9A 3AUTA 3WXMA 3DGFC 1ZUNB 1JIJA 5JAPA 2PUEA 4JFAA 1N5LA 5KOJB 3KEQA 3L7LA 1N75A 2OHXA 2V6IA 2WUDA 1C80A 4OQNA 4P5PA 1XRQA 5FPHA 3SBXA 3EVGA 2EFEB 5ALXA 3B1FA 5C3MA 2Z9CA 1ND5A 1JQBA 2BM0A 4M1EA 5TEWA 4QUAA 3D8BA 2KLHA 3EC2A 3T7SA 2P7IA 5KU7A 4HMQA 1LDGA 1OYOA 2PMCA 4Z8XA 2UDPA 3RVLA 3UPTA 1VSUA 2V74B 3KDPA 1BWSA 4OU5A 1QWOA 3HYCA 3KKPA 3TZKA 1DAFA 3KZCA 4FGJA 5F12A 1G20E 3WV5A 1OYWA 1JVSA 2CL6X 5BW4A 4IDEA 1GDDA 5B1YA 1R5OA 4YYZA 2L19A 5CA0B 3BCHA 2GN1A 3JVDA 4KWHA 4I9NA 5T8KA 2QN7A 3E8XA 3EE6A 5BSGA 4JITA 5FWYA 1XVVA 4OD0A 3C14C 2I5PO 5HBRA 3CLTD 2IYPA 3GLIA 1Y8AA 3TSOA 4FYKA 1FDRA 3RH0A 1PZGA 1ZD5A 2MINA 3KQPA 4C0KA 3AC0A 4WIAA 3RRBA 2ZAGA 4OIFA 2IXGA 5K03A 2PLFA 3UHFA 4P3NA 1U02A 3L4EA 3T7EA 3GRZA 4E12A 1RE1A 3WL4A 4O5OA 4CL8A 1YAHA 3P0JA 5KQLA 1P7PA 1UFVA 3HCAA 1FUKA 1I5OA 2C3UA 4MEBA 4WN3A 5AWFC 2ADMA 3DVSX 1WMAA 1MG5A 2OFPA 4KWIA 4F7WA 4ZYZA 3GLGA 1OA0A 1H9BA 2EW2A 5JPDA 3PC2A 4PSDA 3STWA 4DR3B 3WGYA 1YTUA 3CN7A 1XCMA 1I2DA 2YRXA 2XPCA 3AGQA 3Q87B 4OQPA 1AD2A 2O8NA 2V8BA 4FYHA 3OZVA 1J8YF 3RI3A 2H2FA 5B7PA 2EBUA 1G60A 3VR5H 2W6NA 5DBFA 4RVUA 1NC1A 3LDFA 1E3SA 3I9MA 1SOVA 3SKVA 3UHOA 1YB6A 2GN9A 2JCGA 1CZHA 3A14A 3T5CA 3JALA 4HB3A 1SXQA 1Z7BA 221PA 3HJHA 3OH8A 1S8AA 1JA1A 5AESA 1JXAA 2Z98A 3VR2D 4I81A 2YJGA 2JFPA 1FYXA 5EHZA 4S35A 2UXDB 1SQGA 3HJFA 3QFFA 3QWFA 4WSOA 1C3VA 3KQOA 3NIDB 4PQRA 4QJBA 2G63A 1Q1QA 1UZLA 2V59A 4X1IA 3VU8A 4BWVA 2N47A 3AO0B 3AL0C 4IRXA 3ZHZA 3PJRA 1VOTA 2IIBA 4JYAB 5EXXA 5KQGA 4AULA 3QPBA 3TZQA 5WRFA 2EERA 2RAPA 3GMIA 4MUFA 2VZ8A 2F7SA 4M37A 3T38A 3K6SA 1N7HA 2R5FA 4K2AA 1UPUA 2B8JA 1CDEA 2ID7A 2PRYA 3ENVA 3NBZC 5HKKD 3HB1A 2PUBA 3U09A 2MU1A 1NZFA 2VSNA 1AKVA 3F47A 3IAAA 1ADBA 3K20A 1J33A 4J0KA 2ETXA 4F85A 3HVIA 5F2NA 1KDPA 2BMDA 4PHGA 2RGBA 1ZY2A 3T4UA 2P2CA 2DBVO 2OD2A 2PNFA 4GAEA 3LYLA 1F9EA 5IJZA 3ZX5A 2QUJA 1EWTA 3Q5GA 1XRRA 3MF4A 3PT5A 3NGLA 1XTPA 2B1GA 1RJ9B 1R8YA 3IUQA 4RDHA 2P4UA 2YWBA 3QVVA 5E0KB 5A6SA 3NPMA 4Y0AA 1I3LA 2F43A 1U6IA 4HLNA 3GQBB 3FW1A 3AJAA 3X1XA 3O0TA 1Q17A 4D6XA 1V5EA 1PBNA 4NRDA 2RC5A 1N2XA 4GUAA 3SEAA 3SI7A 1SVNA 2NSJA 2R86A 1ORDA 2A30A 3C5VA 3Q6NA 4FFOA 4CV3A 4DDUA 1PGPA 3TQHA 3B20A 3E5MA 1HLPA 3GFFA 3PVZA 4XB1A 4CLXA 5HZGA 1WPRA 3VJKA 5BT9A 3K0FB 4UMDA 1L5VA 5AJXA 2OZEA 4ZO8A 1AQIA 2IHUA 4K3UA 4LOIA 5LQSA 1HMPA 1DXHA 1OGIA 1MAVA 3MBKA 4PV7A 2HDWA 3BL5A 4O0MA 3IVMA 4R01A 4XB2A 4ZOLA 1DE0A 3SZGA 3ICCA 1DCTA 3M4ZA 4NDAA 4QUEA 4GMXA 3ES9A 3BWMA 1GRRA 1Q0HA 1X92A 1JR4A 5C1IA 4MIEA 4YH1A 3VYSB 3K9FC 3E0QA 1K6XA 4Y9UA 3RRZA 2UYGA 2WEKA 4R9NA 4KQ6A 4CG1A 4E32A 1G38A 3COJA 3KX2A 4I36A 1PR6A 1M7GA 3IEXA 1BJTA 4LMBA 4ZJPA 5ITSA 5LR6A 2CZCA 1Q20A 5C4IA 1PV1A 3EZ2A 3H6GA 1D4AA 3UUGA 4C43A 4YMHA 3T9EA 3VDQA 5AKJA 5ESXA 3RV3A 3HA3A 3PK0A 2DULA 2Y67A 3L4BA 1OXXK 3KOYA 1OXKB 5ECYA 2PUDA 1A4XA 1CUAA 4BNYA 9MHTA 4JC5A 3IVXA 3ZHUA 2IF2A 1EAYA 1KJJA 1PZEA 1T9GS 2Q3MA 4KLNA 3WKDA 4DIOA 1RPJA 3IOCA 1XF1A 1GNPA 5TS2A 1NY6A 2X5JO 3GNSA 4MW9A 4UBLA 4EKDA 1Z0ZA 2VPWA 2IHVA 4X60A 4I4TB 1LPBB 4TV9F 1JTEA 2GCPA 3I61A 2GGSA 4TSRA 2IXEA 3SC3A 1N6RA 1U0GA 1NFRA 3KSMA 4JSYA 5DYIA 4DAEA 1EZ1A 4O2AF 1O6FA 2JCVA 4IDOA 4PG5A 4MI6A 1I13A 5K3FA 1JAXA 3DUFA 5EKSA 1Z06A 4EB3A 2H08A 2JL1A 5BQ3A 2VS1A 1P6QA 4OB8A 4ZTZB 2HQBA 1AKNA 4REOA 1A9TA 4BE9A 1LDEA 3IOYA 4FGLA 3JPWA 3I9KA 4RTOA 1AQLA 1YXMA 1BDBA 2I3ZA 2VK8A 1QH8A 1WE2A 3RKRA 2RK4A 5CLIA 3T7TA 1DQYA 2D59A 2HLPA 3NBQA 1XZEA 2IEYA 4PLWA 4PN7A 1QMPA 1C5KA 3FKSD 1H9AA 3PGJA 5A4KA 1QHSA 3H84A 1EHCA 4IIFA 3UVEA 4EX7A 5ECDA 5TC4A 4YPOA 3V2GA 1ZMTA 2B1JA 1PD0A 4FCVA 2K5UA 3W5UA 1QHHA 3UJ7A 2WWYA 1H2XA 3ESQA 4ND3A 4M9UA 1TA9A 5JVDB 3FTEA 4C7OB 1L1QA 1YFKA 3H0EA 3QV2A 1R8SA 4L5AA 1MW8X 3LKVA 4HNHA 1FF9A 4I4NA 5BNIA 2J0UB 1EKXA 1L8AA 4J9UE 4C0JA 4BC0A 1CRPA 2EFJA 1ECJA 3GY0A 4AS2A 2JK0A 4MUGA 4UPVA 3PGXA 2HIAA 4MYSA 3PQ8A 5G2OA 3LCUA 4K9SA 5B3JC 4BWGA 7REQA 4I3HA 3PNVA 2QRPA 4MCIA 1ZM2A 2QLNA 1IOVA 2O6HA 2AR9A 3GJ6A 3WAGA 4OLJA 4AMGA 5BWLA 1AN9A 1ZUNA 3AEUA 4G65A 1ZI6A 1L5FA 5FOSA 3GLHE 3GRVA 3RSQA 4PQEA 5KYWB 1RM3A 5FI5A 1XTRA 4WH0A 2Y1OA 5DF1A 1QO0A 2ZXUA 3UCEA 1W4AA 4LYFA 4JWTA 2EX1A 1HFWA 4XDZA 4NCIA 3A9UA 2J9GA 3KQLA 1FDSA 1UPAA 1C4KA 2NSHA 4M8KA 4Q1VA 4I4IA 4YCBA 4Z4QA 3CB2A 2FK8A 3WADA 4R1TA 3LZ6A 2ZYDA 4G2TA 2YTZA 1PT5A 4LJ6A 5HFAA 1V95A 2WJ3A 5EUMA 4YMTA 2ZPUA 5IH7A 5KQMA 2XB9A 5JPIA 4AZWA 5L4NA 3EFEA 3KYDB 2RGWA 2GLXA 2HA2A 4KW7A 4LE1A 3VXKA 3F67A 3G2OA 1DAKA 1XMQB 4FT2A 1VI2A 3W4KA 2SKCA 1EBFA 2DPYA 4MLCA 4A9AA 1U8ZA 1E5TA 1SCUA 1JTVA 3ZWPA 4K9RA 4PSCA 2V9CA 1B3BA 3HYRA 4JIMA 3RHTA 3S4YA 4MLDA 3KXPA 4O4IF 4LFCB 3ZK8A 4BMOB 2R00C 2XMPA 4S3MA 2YIVX 4RIFA 3H5IA 5K0TA 1GY8A 1VP3A 1YU9A 3E4CA 1YZUA 4FD3A 3AXTA 4HTFB 4OSOA 4EPXA 5MHTA 2XZOA 4NBNA 3ZR4B 3VZQA 1SIWA 4C7KA 3E1SA 5IXJA 3KWJA 1WHTB 1XQ6A 2IPLA 3FVTA 2Q5QA 4J03A 1IBCA 5TPZD 1T4BA 2WR8A 4TKLA 1OPRA 5EFOA 1CD5A 1ZQ9A 2VAWA 3ZK9A 4OOFA 5CT4A 2Q5CA 2JVJA 1YZKA 3AU8A 1FBNA 3UJAA 1Y6FA 2CYCA 2EU8A 4DM7A 3NDJA 4EK9A 1MT0A 2WHQA 2R1UA 2H1LA 3FPGA 3ZY4A 2G9ZA 1EQ2A 2Z08A 1YS4A 3B3AA 3QEBZ 2ZGVA 3O8DA 2YW9A 1VLZA 3A3NA 1H1TA 1IZ0A 2HSWA 1FLDA 1Y7PA 5SY6A 4X7MA 3UBMA 4BYMA 3EVAA 4RKQA 5LMNB 1PDWA 3K30A 4FFLA 2ZQZA 2QN3A 3AEKB 3I42A 4PGGA 3BPSA 5JLJA 2FJUA 2NG1A 3DONA 2H1SA 1GAWA 3K9BA 3H6KA 2R6DA 4BV9A 4LA4A 4EECA 1N2JA 5IXYA 3OOHA 1U2EA 1T5OA 4IIJF 3ZI7A 4EPWA 3ADKA 1XWWA 2RGAA 4X8HA 4ND8A 3V7WA 3B1VA 4F72A 1XTUA 2OWEA 3IR5A 4L1KA 2AT1A 1BAPA 4QLOA 1FBTA 2A5FA 5DX8A 5LA6A 3ADCA 2IS1A 4W5NA 2W2TA 2CFIA 1U9YA 4H7FA 5E1DA 1KAOA 2FPRA 2OLJA 1UFRA 4OI1A 3L0PA 2WWTA 4XWAA 2G0TA 4BNGA 1GEGA 3PWSA 2E87A 4AMYA 5AH0A 3MRTA 1R10A 4B3MB 1O2DA 1LZLA 1UOQA 4KO1S 2CYBA 2ECOA 3OWXA 4KGZA 1NRIA 1SIOA 2GHRA 3QTLA 3BTSA 1N3LA 4MICA 1ITZA 3GJTA 4TVBA 4GF5A 4J0DA 1TEHA 3TECE 4TZ0A 5DASA 2OUIA 5HCIA 4AWBA 3IAHA 1NN5A 3OZFA 3QE3A 4UFNA 4J9VA 2IP4A 5FPPA 4DLUA 4KN6A 2YZGA 1GO2A 4WXEA 1LJLA 4BGVA 4RZ3A 4YAOA 2OCGA 3O3MB 5E9AA 2XUIA 1ZNWA 4NYJQ 4AS3A 2J3DA 3GQBA 2HHJA 3CGGA 3SZLA 3TRDA 1Y1PA 1DEKA 1QZTA 2V7UA 3GP3A 1Y80A 4LZPA 4P84A 2OAP1 3EEIA 1Q0PA 1K75A 1WQ3A 2VDPB 3GARA 3TM5A 1P91A 1U2RA 1CQPA 1YBHA 1BOOA 2QXTA 4IMIB 3RABA 4QGAA 4B3RB 1ELOA 1YQTA 3UG7A 4G0PA 3CTMA 4WX2B 3ONFA 4YROA 4EA7A 1NVVR 3BCUA 3OHSX 4MGIR 4K88A 2NUTB 3ZYZA 5JC1A 1NYLA 3LY5A 2DJ5A 2CV0A 1W6RA 1S9DA 2QZZA 4U9IS 4GVLA 2NVBA 1N5KA 4TMFA 4CKEB 1BJRE 3DMFA 1GGHA 1RCUA 3I4FA 3DDOA 4HGZA 1ZXBA 2VDNB 2ZTLA 2OD9A 3T54A 4ZYTA 5CFPA 3EFOB 2LPMA 4Z9XA 3HCNA 3VPFA 4L75A 5G02A 5ICMA 4WUTA 1L4LA 3FCXA 4TM7A 5AM5A 4EEXA 1S2IA 2ZTMA 4P36A 2HWXA 4M1OA 1G8MA 1PJZA 1XXHB 3WZLA 4NBLA 1DXOA 5H0IA 4YR7A 4FHFA 1CIVA 1KQGA 2Z6AA 2CHVA 3GJ0A 4DMMA 1GGNA 2ERXA 4MI9A 1FSPA 4AZ3B 4C7MA 1E6KA 4L2IA 1QX4A 3BN3A 3K9LA 1N6KA 3PXCX 5FR1A 4BZQA 1ZHOA 1B2LA 2JBHA 3G02A 1PQYA 3DB1A 4M88A 4DCJA 4EVRA 4LGCA 1HG1A 1B6RA 1U8XX 4LSMA 3B3QA 1MF7A 5IAGA 4C01A 4KU4A 1TF5A 4Q01A 2ZPTX 1YB5A 3BFPA 4RMNA 3D6JA 5DYGA 4BDTA 4YV7A 3MCTA 2OORC 2Q3HA 1V9LA 1VDMA 4I4TA 3EAGA 3WK5A 4G56A 5ALLA 1GG2A 4FHDA 3E8SA 4FZVA 1GFZA 1P0MA 5E9WA 2H1RA 5GJCA 4CLHA 4EZIA 3WKCA 1NPYA 1V48A 4LDPA 4ARVA 2HRQA 3F5QA 4HY3A 4IDQA 1AA9A 3EBLA 4OQFA 5DTIA 1HL3A 2XBUA 1Q3HA 4K9NA 3PXGA 4ZJZA 4R7ZA 1B2RA 2PO7A 5K8CA 3U26A 2FFQA 5HSGA 3AT1A 1G7CA 3KSUA 2WTMA 2A0YA 4IL5A 2Z43A 4L4RA 4AF6A 1M54A 1TCAA 1NQUA 2OV3A 1KZHA 2AN9A 3NHYA 1NHWA 5BSVA 1D2HA 3EQ2A 2FLWA 2FPMA 3AL2A 4R68A 2HTFA 4ZT3A 3HXMA 2FZKA 2IZ1A 1QWSA 4PVCA 3WYDA 1DDOA 1ZM3A 2QZ9A 3IEKA 2JHCA 2X15A 3GMSA 3EPPA 3VAAA 2LRHA 2PNJA 4K26A 1EPUA 4A6EA 2C2HA 3CW2A 1S7CA 3EXHC 5A2GA 2QSZA 1G19A 2OK8A 4IOLA 4C7OA 4LNAA 3IS3A 5T57A 1ZJ6A 3CN9A 3ESZA 3O4FA 4DLXA 1TQ8A 3W8NA 5B4UA 3O4HA 5DK6A 1XP8A 1BHQ1 2J0UA 5L7TA 4BY9E 1H2BA 3KOWA 1G5IA 4PYLA 3P7MA 4JR0A 5I8PA 2C84A 3LC0A 3UK2A 3UXYA 1U9CA 4B6QA 1CFZA 2QROA 1UWLA 3RUEA 5D3QA 5FXMA 4RK7A 4F2GA 1NMXA 2Q2QA 5AK3A 2B61A 4E21A 4E5YA 4MRPA 4QWWA 2EKPA 1QO0D 1EK5A 1TRKA 4MP8A 4JOBA 1TZ2A 4PX5A 5EE9A 5LMZA 3W5DA 2UU9B 1CJBA 2XAUA 4DY4A 5HJEA 1YZHA 2IWHA 4HB2A 1E92A 4FDTA 2Z2XA 3I3OA 1HDXA 3DZIA 3QHQA 1DC6A 2NYRA 1OWLA 1FXUA 1NMYA 5KYWA 2IXTA 5BP7A 3NNDA 1NT2A 2Y6VA 2P0AA 3A9CA 4Y2VA 3ZZUA 2B2CA 2FX3A 4QSHA 2V8OA 1E99A 2G06A 1W25A 2UZAA 3DCIA 3MMPA 1PW5A 2NZUG 5H1YA 4A2CA 2JDIA 2M6LA 4F2DA 2KBEA 5JS8A 4BEWA 1ARZA 3NP7A 1YC2A 2JNWA 2R6AA 2G8NA 1QE3A 3OHPA 4E2FA 1FRNA 3KD3A 2FMIA 4WKCA 1P72A 3NHKA 3VU3A 4BB6A 4R1LA 2BDTA 4DOMA 1ECBA 1PVDA 5IBCA 1JG3A 1P5JA 3DVQX 4KNWA 3KYDA 5FT9A 4DG9A 1N2SA 4TKVB 3S55A 3TTVA 3QSYA 3CLRC 1NYQA 1FFSA 4RJKA 2Y76A 4ZWNA 5EZYF 1KKUA 4X00A 1YGPA 1E94E 2NYAA 1LJUA 4I14A 1MAHA 1P9LA 3HM2A 1GAEO 3VTFA 1NW3A 5EHIA 2I4TA 3EHDA 4OBXA 3JD2A 1DEHA 2R6CA 3SDZA 5JALA 2WT4A 3IL2A 1RPZA 4WRRA 2Q3BA 5CM8B 4LF5B 1U0NA 3EYWA 3QOWA 1YVUA 3SR4A 3M6WA 4HTFA 2VA9A 4IEFB 1BU8A 4ZV7A 2O8VA 3MJ4A 1HLGA 4TN1A 1SOAA 4AYTA 4HZGA 2JRLA 4UMFA 5A05A 4FZ3A 4RXUA 5FBVB 2O4UX 2ZWVA 2D0OB 2RDMA 1MB2A 2AQ8A 3VDNB 1BKYA 5DDIP 5FLYA 4BN0A 1XT6A 3ZZ0A 4PFKA 3WFJA 3AF4A 1U7TA 4L4YA 3M1AA 4DQUA 1UBSB 3SHQA 3ZV6A 4LDQA 4BLOA 1APBA 2JJMA 4BX2A 2HEIA 4KQ1A 1GA4A 4C89A 1OFGA 1RRGA 1Q83A 3KKZA 2AIRA 1RI4A 2D13A 2I7CA 4DXHA 5JSFA 1RXWA 1EUCA 3SLRA 2ZJAA 3GFRA 3HSKA 4TVOA 3ZV7A 1GKYA 4JXKA 3NC0C 5KVSA 3ZVLA 2VHCA 1Y6GA 4MWTA 1TKAA 3GZ4A 4IIDA 3MJFA 1EIWA 3PR2B 3KXIA 1G0OA 1SB8A 1TGVA 3JRXA 1TZKA 4JVOA 3JYHA 5EHXA 2G1PA 5HF8A 2BUAA 1PU2A 1SCAA 4PCLA 4WLEA 5JSYA 2OC4A 4NCHA 4FW8A 2FUG1 3A31A 5SZKB 5IZCC 1JFLA 3RROA 2NP6A 1DSSG 4BFZA 3ABZA 3W1VA 1ZBQA 3ND5A 3H99A 5DWVA 5TF4A 5IDVA 3WQRA 4K6OA 5BRAA 1QIKA 1E2EA 1YVDA 2PQMA 2HZ7A 3CT6A 4I6JA 1G3QA 1ZIYA 3NUGA 5C52B 4IFIA 1FFBA 3SSAA 2YYAA 2W48A 1PT7A 3MS2A 3PXBA 1IUKA 3TLCA 4RD6A 4OFZA 1H94A 2Y71A 4R2WA 1DQZA 3DXXA 3CRW1 3NOXA 3RT1A 4CMIB 1Z28A 3AI1A 3U4CA 2L17A 3IUSA 4FMCF 3PIIA 1I1QB 3NBXX 4NP6A 5AOBA 5HWSA 2ATVA 4YRQA 2D2IA 1J70A 1H0HA 1KHTA 1ONBA 3M5WA 2R85A 5F7ZA 2QBYB 3S2ZA 1RKVA 1FSFA 1GTMA 2PL9A 3AV0B 4YB8A 3A1SA 3FFAA 2ZPAA 3FVWA 2HPZA 1DU4A 1NLUA 1IUPA 3GJYA 3I6BA 3IJPA 4PIPA 2XIJA 3A3OA 2D1YA 3G5MA 4GGOA 5HM6A 3TPFA 3HJCA 3AI2A 3R24A 3M2PA 1EDZA 3EVEA 4KQHA 3RVQA 1DWQA 3TZHA 4BO2A 1WXQA 4QDKA 4PANA 3PQEA 3WLQA 4AJKA 4D9NA 5IJXA 4BVGA 2HA4A 2BEWB 1RR6A 4V3BA 4B76A 1HLDA 3R5FA 4B7CA 3VMFA 4IYRA 1PDVA 3UMGA 2G9RA 1LW6E 2YV5A 3UAYA 2FR1A 2PH5A 3R74A 5BW6B 5JROA 5AI4A 2LTAA 4MPTA 5MFPA 3LGXA 1WBDA 3ETJA 1CQWA 2HRDA 3L04A 3HJAA 5AHWA 3WGJA 4D0RA 3THWB 1CUGA 2VTVA 4QUKA 3N70A 4GZ5A 3WL5A 5JOQA 3UUWA 3LSYA 3QTBA 2PUTA 1Z74A 5DCWA 4C6HA 4YUYA 1NTOA 1Y0BA 4CKEA 3EZ6A 3PEYA 4D8WA 3ZGLA 1MH9A 2IHKA 3FZEA 2WMYA 1P29A 3LK7A 4X54A 3EFOA 3D64A 3W3AA 4DLVA 1I1HA 2GPYA 1KKLA 2I6QA 3ASUA 1XALA 5B1EA 3MA0A 1IEVA 2PGIA 2H2AA 2FW1A 2V96A 1H0RA 1GWNA 3KLNA 1XXHA 1VL0A 1YS9A 5HGJA 1VPVA 5BQPA 3BXHA 1OFHA 2W2NA 5F1YA 4E14A 2DFDA 4ZJYA 2FN9A 4G1EB 2C5AA 2WM2A 1QYWA 3DS8A 2PKEA 1ZGJA 3O3CA 4L0CA 3R7BA 3DMGA 5JD4A 3UHAA 2ZJ0A 4AZ3A 3IT3A 1JUDA 5ENDA 2X1LA 1VKNA 5EYPA 1W6UA 3C74A 4TUYB 1FRVA 3FSGD 5ES4B 1GZVA 3ZNPA 4NENA 3NNSA 2WKQA 4UBKA 1ETUA 1R4ZA 4BJ1A 3H4TA 3EWSA 2XQVA 3KBOA 4DLTA 1QVVA 3TQRA 1Z3CA 4LOJA 1N3YA 4M99A 2Y1EA 3D6TB 2XZLA 4KN9S 4ZDKA 2J3IA 5CVJA 5BNFA 3ZVNA 2REBA 3NOVA 4L76A 3UT6A 3V34A 4FFRA 4YDHB 3GVHA 1KY3A 4RQBA 1N9ZA 1PX0A 1ZGCA 3G9TA 4W99A 4RY9A 3RSOA 3TOXA 3EXAA 4DMGA 1L8OA 4MGHA 1N33B 3AR5A 1UXJA 4EHKA 2QM7A 3DAOA 1CJMA 5F33A 2BDEA 3A6JA 1E0DA 1F6WA 1VSVA 2XEXA 4KLZA 4DLRA 3IODA 1P2VA 1UMBA 4HEJA 3V8EA 3ITNA 1O8CA 2VHEA 3ZG6A 4AECA 2A88A 4RWEA 1A8SA 3NS7A 1BO6A 1GNTA 4ZYLA 1GCAA 4HYYA 2RGYA 3TMKA 3HDQA 1UJMA 5EP4A 4AIIA 3TR0A 3WICA 3AH8A 1B16A 2GAFA 4E5MA 5F5XA 2B8EA 1JDUA 3NFRA 4CN8A 1KZ9A 4JQOA 2CEAA 2JFXA 4XIIA 2IGBA 5KSYA 4E2XA 3GRPA 4LYJA 1D2RA 3N58A 4I3GA 3S5UA 1O8BA 2WOJA 2C5GA 4U6NA 4Y2YA 1QQ5A 2O5EA 3FX2A 3JVEA 2H4XA 3A6KA 3Q85A 1U3DA 4ONEA 3C43A 3KJFA 4HF7A 5CHYA 4KIGA 4CV0A 1KR5A 3HU5A 4AURA 2A5YB 4US0R 1ODCA 3BOSA 1NMSA 4N5NA 4A0QA 3ZVMA 3WNDA 4C03A 1MJHA 2WYHA 3DMRA 3ZDRA 4DLYA 2OAQ1 2GEVA 1SUPA 4C0QC 2IC5A 1A8UA 3DE0X 3A26A 4V3CA 2JGFA 2Z2KA 2XR1A 4AZ0B 2XMZA 4D4LA 4NE2A 2ORWA 3IAUA 1WKBA 2FSVC 3LVRE 2OYCA 2BHNA 1Y1TA 2G5TA 2BTOA 4KXFB 4WOCA 2QRJA 2JDID 1I33A 1NJFA 5COBA 2IHNA 1ZS9A 3MXOA 1UOPA 1LBTA 1WV0A 2GX6A 4A4DA 4G2NA 3ZCTA 5B7NA 1DG3A 1M8FA 2IXAA 2GK4A 1TQ2A 2IV3A 3T3DA 2PK3A 3TAXA 4AJHA 3ND9A 5BSTA 1WW8A 2GHQA 2OCLA 2C95A 1MX9A 5AM2A 1H2YA 1Y6ZA 3KG2A 3WFZA 4O33A 4QTTB 5AW5A 5K0EA 2ZUFA 2OFOA 1LI5A 3QIAA 4FINA 3FB4A 3BIJA 2WJYA 5CDSA 3H2GA 2QRZA 4WZAB 1LDMA 3DKPA 1D9ZA 2JKYA 4DDHA 4NNJA 4EG7A 5L3QB 1JJFA 1KJYA 4MP6A 1A04A 2H06A 1MO6A 3C4JA 4LQ4A 4P4UA 1TYCA 4LMRA 1CUXA 3HMKA 2VT6A 3R8CA 1ULBA 2CDBA 2JHPA 4Y30A 4YT8A 2O59A 5CBPB 1TECE 4OIMA 3A8TA 4TKVA 4B3BA 2X1VA 2BFMA 1A9XB 1DOZA 1UBMS 3ROTA 421PA 3THXB 1K66A 2DKOA 2ZDGA 1VB5A 1O57A 3WDLA 1Q6ZA 1XPUA 2GDZA 5THQA 3U48A 4V1CI 1M2JA 1TYBE 5ER9A 4B74A 4ID9A 3V8MA 4YRZA 2GERA 4IR7A 1UOEA 5COQA 3HUFA 3SQNA 1LH0A 4GI3A 4MV6A 3WSVA 3AM5A 3N75A 5EMNA 3ZKAA 1E2FA 4L07A 4PSKA 2WWVD 3RYHA 4J0JA 1KI2A 4MO9A 2XQIA 3MUFA 1OXBB 2V6GA 2WJ4A 4R31A 4Q3EA 2DECA 2G1KA 3LUGA 3RNOA 2DWQA 5IJ9A 3PZBA 1PBTA 1RBQA 1Y6QA 4YAFA 2EJWA 3VH1A 5BWNA 3BEDA 2I3DA 4UUMA 2GR9A 1AOXA 1YGYA 3FCYA 3GGGA 3LPCA 3KQWA 3SNHA 3GHYA 3JQ7A 2VJLA 5DEOA 3P9CA 1KC3A 1BE1A 1UK7A 4BQNA 4AJ2A 5KYYB 1NUPA 1ZJWA 1QB7A 2YOHA 3ANLA 4ARAA 1AB6A 2ZBDA 4O5AA 3Q88A 3UMSA 1D4ZA 1UBFA 2ZBFA 1C9KA 3NHZA 3PRJA 5HS4A 1Z0JA 4J90A 2B0CA 3I6QA 3MB8A 3BMOB 3LBAA 4NONA 5TXGA 4OBWA 5F98A 1JMKC 4LJYA 5IN5A 4F4JA 3NZEA 5C4GB 3DR3A 1UP4A 3LXMA 1UBNA 3ZWAA 3GAZA 5ICFA 3P1JA 2PAFA 3D7RA 1XZQA 3FAZA 2O0JA 3FUCA 3GJ3A 3QQ5A 2ZULA 4DA4A 1OXUA 3TL3A 3E8MA 5IRCD 1DC3A 1BE0A 2B8TA 1GKLA 1PK8A 2ZTUA 3A4YA 1MPTA 3GG2A 1JE1A 5AJZA 4EO9A 1YMUA 2HN9A 4HH4A 4XYLA 5CVTA 3H1BA 2E4VA 3A36A 4EHFA 1OH7A 3A58B 4TTSA 3MHPA 1P1JA 1PJRA 2HMAA 3WJAA 3ZLUA 3P27A 3NYIA 1I3OA 3LBIA 5A06A 2VQEB 4C4XA 3EY4A 1C9DB 3R7DA 5CFNA 4JI4B 2BFFB 3AP2A 1BDHA 2H8GA 4QU5A 2NXNA 2ZIZA 3ZE8A 2FWNA 1IVNA 4CMIA 1HSOA 3A6EA 3RWOA 1VJCA 3BWYA 4Q93A 3THSA 1PIWA 1EVQA 2AWNA 1Q74A 5IYZF 3ZU2A 1U3VA 1E0AA 2NU8B 4OP1A 1X94A 2QBYA 3D8SA 4AVYA 1ENPA 3E9MA 3P9PA 5ALOA 4BLSA 5IUNC 2O9JA 2ZVPX 3QBDA 4GP9A 3RVDA 4ZTBA 1KRWA 4FFMA 1Z4PX 2AC7A 1OB5A 1WMSA 4S0ZA 5JMOA 2RGUA 2G1JA 3BS4A 2Q3JA 1YMQA 1NW9B 3VSAA 4ADSG 4HV4A 2BCEA 1SXIA 4QGGA 1E1DA 2AYYA 1HT3A 1TMOA 2BEWA 2JGNA 4HATA 4LI3X 5DTMA 4G24A 3RU2A 4YCSA 5FDFA 4RD3A 3I34X 3U16A 1DB3A 2ILVA 1PSDA 1L5RA 1K7YA 3GFQA 1TQ4A 3CRRA 1WV1A 3QTTA 1TOAA 4FI3F 2B83A 1G2OA 3BJRA 3MAGA 1KMMA 2BI8A 4UM9B 5BR4A 2DFTA 1JL3A 4BNTA 5JBQA 3G68A 1FIUA 3DHEA 4LGMA 2VPYA 3THWA 1E7RA 1DVRA 1DDGA 4KRXA 3L7OA 4OXNA 5EP1A 1R6AA 1K0FA 2AUNA 2B8NA 4U6QA 3A1WA 3E3MA 1RWOA 3BMNB 3CZRA 1CUZA 3NV9A 4OQEA 1NBAA 4IKPA 5JSUA 4PFSA 1KOJA 5B6IA 2Z57A 4OK6A 4IGAA 1KP9A 2Q2WA 4H08A 4RD2A 4GMGA 1YUMA 3KIPA 2CVHA 3D54D 4W8GA 4HBGA 4YJGB 3OFVA 4DM4A 2XUOA 3ZEAA 3N7AA 2J3MA 4EY8A 4QLBA 1G4HA 3IESA 5KKAA 2YV2A 3PYLA 3C5EA 4MYUA 1H2EA 5FWDA 1JWBB 2XGMA 3GDWA 1EXMA 3LSTA 2QVXX 2BGIA 4LSWA 2NX2A 2OCPA 4LVOA 5YASA 4CMCA 4D4GA 4X71A 4AKTA 5J2TA 4FDVA 5FADA 3ZU6A 2O1WA 1P0FA 4HNAA 3ORFA 3VR4H 2AQIA 2HU2A 1ORIA 2ZJ2A 1YRQA 2Y9PB 3GDOA 3RG8A 1O9GA 2COEA 3CE6A 4TUYA 3TMYA 2VBFA 3L0ZA 1LBQA 1F8FA 4EZEA 3B1YA 2ZIXA 1RC1A 3HO6A 4O4JB 5H8WA 3UF0A 3A6DA 5BSEA 1XVUA 1H69A 2N46A 2FQYA 1P8JA 4RPCA 3VR5A 3KJNA 3AERB 4KE6A 1LF0A 1V11B 5DM0A 2BFEA 2K7ZA 2WHXA 1E1MA 1PR4A 3W5JA 2FPWA 1IRIA 4EENA 2VNAA 2AD5A 1GUBA 3GH1A 4YWJA 4QFBA 1TM5E 4W9NA 3FOBA 2J5RA 2WKRA 1B1AA 5L4LA 3INGA 2OO5C 2JA1A 2FMTA 3K70B 3UN1A 3HTXA 4XPZA 3H83A 4HXYA 2J32A 3V8VA 1CB7A 4IMRA 3VKUA 2O3QA 3E3OA 8GPBA 1O94D 4Y67A 1B0AA 2C2BA 4HH1A 4H31A 4BO9A 1VHQA 3LDAA 1ECGA 1NVKA 1CUVA 4PLHA 3FGOA 4MEAA 4PG8A 3EEOA 5A5GA 1ZN7A