4IJ6A

Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
207
structure length
207
Chain Sequence
MVKLILVRAAESEWNPVGRYQGLLDPDLSERGKKQAKLLAQELSREHLDVIYSSPLKRTYLTALEIAEAKNLEVIKEDRIIEIDHGMWSGMLVEEVMEKYPEDFRRWVEEPHKVEFQGGESLASVYNRVKGFLEEVRKRHWNQTVVVVSHTVPMRAMYCALLGVDLSKFWSFGCDNASYSVIHMEERRNVILKLNITCHLGEFYVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphoserine phosphatase 1
publication title Structural units important for activity of a novel-type phosphoserine phosphatase from Hydrogenobacter thermophilus TK-6 revealed by crystal structure analysis
pubmed doi rcsb
source organism Hydrogenobacter thermophilus
total genus 77
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2012-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4ij6A00
2P79A 3PGMA 3IT2A 1BIFA 3R7AA 4EMBA 1H2FA 1XQ9A 4JODA 1ND5A 2QNIA 1RIIA 2WNIA 3FDZA 1SKBA 4IJ5A 4AROA 1K6MA 2P30A 2P9ZA 3GP3A 3O0TA 3E9CA 1RPAA 3BIFA 4GPZA 3K4PA 2EKBA 2ENWA 1DKQA 5CDHA 2P6MA 3KKKA 2I1VB 4ODIA 1DKMA 1UJBA 3F3KA 3HJGA 1SK9A 4IJ6A 5AJXA 3GW8A 1FZTA 2EKZA 2OWEA 2HPAA 2H4XA 2EOAA 1EBBA 3MBKA 5HR5A 2DWOA 4PGMA 2P2ZA 1IHPA 1FBTA 1YFKA 2YN0A 1C81A 1SKAA 2P2YA 4E3WA 1TIPA 4HBZA 2H0QA 1BQ4A 2AXNA 3K4QA 4MA4A 5CU7A 5PGMA 3D4IA 3QPVA 5HTKA 2HHJA 3IT0A 2P6OA 2A9JA 3IT3A 2H52A 3NFYA 2DWPA 4GPIB 3MXOA 4QIHA 1H2EA 3D8HA 3F2IA 1DKLA 3D6AA 4EO9A 1C80A 4JOBA 1ND6A 4FDUA 1T8PA 2P78A 4JOCA 5AJZA 3IT1A 1YJXA 2H4ZA 4D4JA 2BIFA 2WU0A 3LG2A 3FJYA 3EZNA 2P75A 3QPWA 4ARVA 5AJWA 4D4MA 1DKNA 1DKPA 3E9EA 1NT4A 4TSRA 2WNHA 1CVIA 1UJCA 5AJVB 1E58A 1DKOA 3EOZA 1V7QA 4PZ9A 3LNTA 1RPTA 4D4LA 1SK8A 2HIAA 5CX4A 1QWOA 5AJYA 2YN2A 3OI7A 2GFIA 2P9FA 3GP5A 2RFLA 5AK0A 2IKQA 1C7ZA 2OWDA 2P77A 1BQ3A 2F90A 4ARSA 1E59A 2P9YA 3E9DA 3C7TA 2PA0A 1QHFA 2ENUA 3DB1A 3LL4A 1QFXA 4PZAA 3ZHCA 3FDZB 3NTLA 4ARUA 3DCYA 3QPUA 4D4KA 2A6PA 1V37A 4FDTA
chains in the Genus database with same CATH superfamily
5JZMA 1IG3A 3QI7A 4MULA 5F5XA 5TS2A 2B20A 5CYPA 1PNTA 2Q41A 1J9EA 2Y8EA 4RIIA 2JFUA 3EBLA 3DNFA 5KNCA 4M86A 3GF4A 2VNHA 2W6ZA 2IYZA 2Y1LA 4ZEOA 1TM4E 2OR3A 5A5FA 2Z9BA 4ZC8A 1JEQB 3V97A 3OCXA 3ONNA 1LBSA 1ZVKA 1SD5A 4U7JA 2XUPA 2BE9A 3EAFA 1PGJA 1U0RA 2XE6A 1XHLA 3NBAA 5C1OA 3N7AA 3UTCA 5ES4B 4KI7A 5IYZB 1N9GB 2GARA 3OFVA 1M2NA 4F1JA 1DDOA 1D6NA 3CLUC 3A9TA 4XIJA 4WOKA 4RFSA 1E1RA 5AOAA 4BIMA 1R3UA 1FZTA 1BJTA 1W7AA 1VP3A 1ML4A 3N6XA 3ICPA 2WD8A 1IXSB 2K2WA 1MIOA 3WK7A 3VJLA 5CURA 4MQ6A 1W29A 3HNPA 1EUZA 3B3JA 4IDDA 4OBXA 4AYXA 4C0KA 2OCPA 3K5IA 5JFTA 2XLBA 5K7SA 3MWLA 3N2LA 1JSCA 4Q3NA 1E0AA 3Q15C 4P93A 3R4CA 2GCOB 4L8WB 1QS0B 1J1ZA 1EVQA 1YBMA 2CXQA 2GOYA 2H0QA 1OFUA 4G5GA 4UKDA 5E9QA 2Q3MA 3S40A 1W4BA 1ZUHA 2VHUA 2VNKA 3QFHA 4BKOA 3CLUD 4B85A 1V6SA 1C1HA 2PXAA 2ALJA 3JX9A 4UXIA 3OFND 2HA3A 3KEMA 5KMGB 2X6RA 1CB7A 4QEKA 2FZLA 1G0OA 2DHQA 4KZKA 3RRJA 2QUBA 4C7JA 1GT91 1EKXA 1KETA 3A9VA 1A8UA 2JBAA 1EDEA 1YNOA 1NBOA 3PJFA 4XD7A 3PK0A 3TZHA 4G6ZA 3UCEA 2Z8ZA 3CT6A 4BNDB 4M8SA 3SQXA 3D8HA 3TXAA 3GEBA 2EIXA 4EL5A 2F9LA 3U09A 3BH0A 2DQKA 3HCBA 4KN6A 1PFYA 1IY9A 1UFKA 5HIMA 1W35A 3ZWPA 4K9OA 2R84A 1HEIA 1VZ3A 1YZ3A 4IHJA 3TQCA 4H7DA 3LDHA 4DLBA 1CIVA 2BRUA 2G88A 1WU7A 1Q21A 2A30A 2R6GA 1RFGE 2WWYA 1Z45A 3NOXA 2YXNA 2XT6A 1ZK1A 2TECE 4O63O 4PHHA 4OEHA 2ZW9A 3FPSA 4Q4DA 5JD3A 2VUTA 4GMDA 1OFHA 1T35A 1WSDA 1XXLA 2F59A 3F3MA 1NMSA 1ICIA 4UDOA 2OCLA 4EG8A 2VAVA 5BNTA 3EA5A 3MCTA 1PJAA 1KEPA 3YASA 2N46A 1Y82A 3OVMA 4CTOA 1TLLA 2JJYA 2XDQB 4UTXA 4KR2A 5EUCA 3KJQA 4ADSG 4UTVA 1CJUC 1KF0A 1O77A 3ZXUB 1MV8A 1YE3A 1KEZA 2C3PA 2WSMA 3ILSA 5KI6A 4MP3A 3TTYA 3H4VA 3V8NA 5AD1A 3K0FA 1CZRA 5EXDA 9LDBA 1HXHA 4F5ZA 2GBGA 2WJZB 1XLUA 5TQJA 4AWAA 1OUMA 2WDPA 2XITA 1ZGAA 3EGVA 3ASUA 1U1DA 1NU8A 2YINC 3OJWA 4KLZA 1IB0A 2CHVA 4R1QA 5C5CA 2WD7A 2WWHA 4UOZA 3KWJA 2HNKA 3BXEA 2QDKA 4BNFA 2QAGB 2JH3A 4LHZA 1ZMOA 2Z3VA 2ZUCA 1KQGA 2Q62A 2H4JA 5K6AA 2JLZA 1RRPA 1GR0A 2GF9A 2RHWA 5FFFA 3WL4A 3LK7A 4I9HA 2PV0A 1EFKA 2Y99A 3WAJA 2REBA 3DZFA 3HO8A 4XR4A 5ICCA 4RULA 1VG1A 4COKA 3E9CA 5ECGC 3QFTA 4Z0PA 4B40A 4Z8XA 1E2GA 4EPVA 1Q7EA 4OJMX 5CB6A 1P1CA 2YHUA 4AKTA 2JD0A 5E6UA 3O8QA 1I7PA 1KU0A 1M2VB 1YB6A 2H4FA 2J7PD 2ERYA 1K0FA 3HLYA 4J29A 4UDNA 4LJRA 1TAUA 3ZD9A 4KBGA 2AOTA 5B6JA 1B6RA 1QHNA 1UL1X 2BR5A 4NDZA 4ER5A 2H1RA 2VDOB 3S8EA 3BQNB 3WTCA 5IF9A 3AO0B 5E4JA 4B9AA 4R9RA 2NZUG 2JLYA 2ZR8A 4K2AA 1KHTA 5EP4A 4Q1EA 2PS3A 3VO1A 5DX8A 3ZZTA 3WGLA 1QZ3A 3D5QA 3ZY3A 5I7RA 5L45A 3BXGA 3GZTB 1AU9A 1F8UA 4IEEA 4BGDA 1QF6A 2BCJQ 5FX2A 1QIKA 5K99A 4MMYB 1T43A 2NUTA 2IQ5A 1GRVA 2W43A 3AF1A 4ID9A 3CC8A 1L8OA 3D7SA 2FETA 4UU1A 1YCFA 5HG0A 4YPOA 1EVIA 2GPYA 1II9A 1QWSA 4GMFA 4XDGA 1L1FA 1EPUA 1E7QA 1KVUA 2BJHA 1ZK4A 3QVKA 4G07A 5ECWA 3RRBA 4UPEA 4DT1A 1UZNA 2V0NA 4DV0B 1GNLA 1B16A 1B6GA 3H8WA 4XB1A 3SZ3A 4YYEA 5M7EA 3B38A 3P97A 4U2DA 3CPEA 3BCRA 1H5NA 3IMCA 3ZV7A 3LLCA 3WL5A 4UNRA 4ARCA 4ZI5A 1O08A 1E18A 3SBEA 4D57A 1F5NA 1GTRA 4MUGA 1KDRA 4JY7A 5EQTA 1PCXA 1ZFNA 1OIXA 2FA9A 1QOZA 2I5PO 2F43B 3D2LA 3IB3A 2GLUA 2YZ2A 4GRAA 4INPA 4PWZA 4X20A 2WB4A 5EHQA 3GLVA 1PVOA 4G5OA 4O2AB 3AUXA 221PA 5E4FA 3RS3A 2ZJ3A 3O3NB 3FSGD 1UXJA 2ZVQX 4BX8A 1DE0A 4Q4HB 3RDPA 1U8FO 1FDOA 1P7PA 3LQRA 2Z04A 1QBGA 3FLBA 3PYMA 4U4AA 2Q4EA 1EZZA 5BR8B 3W3AD 5HUHA 3JY6A 1MO5A 1FX0A 1HT1E 2O50A 2GKGA 1G8HA 1XEFA 1R15A 2QK4A 5DASA 1HO3A 2ZPTX 2AT1A 3HCFA 1XZ8A 2VJCA 2AFVA 1JDUA 4Y2PA 1IXKA 3U3JA 2VWHA 4RM3A 3PNVA 4FFNA 5IBQA 3EW7A 1IULA 4KTTE 4TXLA 4DBLE 3DE3X 4W7SA 4YR7A 8LDHA 3REQA 1KFCB 2IYYA 5CVTA 1H1TA 3T1QA 2OD9A 4N39A 2D8AA 3DBRA 3HYNA 4B2IA 3WO0A 1I33A 5AUQA 1O97D 4BMSA 2JFHA 2C1XA 4G0PA 2DPGA 3D3JA 5KYUA 5I7EA 1UPUA 2P1DA 1CW2B 4MH0R 2Q7XA 3ADKA 2Y4NA 3GMTA 3ZHVA 4CG0A 3DOEA 4MVJM 2E3JA 1LU9A 1X7XB 3VYVA 3FOEC 2F1KA 1POWA 3UUGA 2QD5A 2Z4TA 3GIWA 4UCWA 3KK0A 3WRYC 4B7ZA 4NTZA 3PG5A 4OYRA 1MO6A 2JH8A 2BM9A 3VHLB 4GLOA 5I7SA 1Y7PA 5KHAA 4RL6A 5I8PA 3RIHA 5EIWA 4DLYA 3GBVA 5GM2A 1E69A 4YN3A 3HO6A 3B1XA 2ZIUB 3WV5A 4E15A 1FW6A 1A9ZA 3EXFA 4FZJA 3FB4A 4GGPA 4H9GA 1SXJB 4D3ZA 2GPSA 4BRWA 4YX9A 1WVIA 1PFUA 5B53A 1G8PA 2HMVA 4HCJA 2WP0A 3H2GA 4LGMA 3EF1A 1VDZA 4RQUA 1FU7A 1YDWA 4FNGA 1O96B 1N2CA 1JG3A 4WXYB 5F5NA 3MTQA 2FP4A 2GGSA 1Z36A 4HVCA 1APBA 2VQEB 2NTEA 4C7XA 3EGCA 1L4NA 3UA4A 1Y8CA 4Y2RA 3PR1A 3PX7A 1PO7A 3VYUB 5KX5A 2AK3A 5E6RB 2EG9A 3R40A 5B1HA 2SCUB 3BWXA 2JLBA 2VP0A 2PUDA 4NENA 1NI4A 4P6VF 3D4NA 5AM4A 3SF8A 3CURA 2QLNA 4QTUB 5DP2A 2EF1A 4N3NA 3TH5A 4LW8A 2O3QA 3EGOA 3CUYA 4KN5A 1IEVA 4ZZ3A 4I55B 3HVIA 3SYMA 5HKKD 5IEBA 4JI8B 2JK1A 3CW8X 4F3CA 1IXYA 1U9CA 3GYBA 3A3YA 3HDGA 3ABRB 4EGQA 3OZUA 1NBHA 2QI9F 3F9RA 3LP8A 2P78A 3F73A 1ZY2A 5EZYF 3CNOA 2H7CA 3C3XA 4MVXA 3RRXA 421PA 4QUIA 3RS9A 3U7RA 5JSZA 3K9FC 4Q00A 5LZ8A 2HA0A 3O7WA 3B2EA 1Z6TA 4B3XA 2QN3A 3VU1A 5E6SB 4GZMA 1S02A 2CWDA 3DM5A 3I30X 5BSRA 2VA9A 1RI3A 2Z1DA 3S5UA 3FROA 1Q3TA 3TIXB 4A2WA 3HZHA 1JKIA 1Z74A 4GMGA 2JI6A 3FNIA 1V5IA 4AWBA 4UBKA 3VHXA 3NDJA 1JF8A 3NEJA 4A5SA 3DLHA 1JGTA 1TRKA 4LQLA 2J1LA 7ABPA 2AE2A 3AMVA 1KJQA 1UBEA 5CFOA 3M5DA 1YZHA 3HWSA 1YSCA 2E89A 2BFDA 5BWLA 2FWBA 1ORIA 4NABA 1GRQA 5KHOC 2WUWE 4G8DA 4XFDA 2Y92A 4OFZA 2L69A 1GU0A 1FF9A 4F7WA 2MINA 1D8AA 2YH2A 3MT8A 3NRJA 1QO7A 4KZPA 3PUVA 3R7FA 2D1TA 121PA 1OXSC 3C8DA 3HU3A 3LCVB 5A5VA 1WHTB 2FZKA 5ED4A 2QRUA 4MW0A 4NWIA 2BYTA 1KQPA 3QPUA 3KB1A 4MI3A 3RK0A 2XUGA 4JT8A 1DCKA 3MA0A 1Z2DA 4BCBA 3J7AC 1CJTC 1PR4A 1OXUA 1FFEA 4UE3S 4JP8A 4FDTA 1OX4B 2XB9A 1OGYA 1YZUA 1EVEA 1NVEA 2R6JA 3D6FA 4WCFC 5IX8A 3K9GA 2O7RA 3HB5X 4HLUC 4AM8A 1VQ1A 4IKEA 1G8GA 4KVFA 3JQAB 1TYDE 3D3EA 1AKQA 4UVDA 1L5YA 1JG4A 3K5HA 1A71A 3N75A 5ILQA 3BA6A 3U5ZB 1HDXA 2VEDA 1L4YA 1BDMA 2VI5A 4OH1A 2VUUA 1UBOS 1Z08A 2YWBA 2YICA 3DWIA 4LECA 3ZDCA 3GJ3A 4HDSB 3SYKA 3THWA 1EHIA 3IAHA 4FDAA 4MV4A 2GAFA 4JEMA 1MJNA 3H97A 2QGFA 4HQFA 5UKDA 1XMJA 4PGAA 3AFOA 2X42A 1Q16A 4FGKA 1Z7BA 3AEQB 4NI5A 1LD3A 2JL1A 4U7TB 3WQSB 1RHJA 3E7PA 1DEOA 4RDHA 5FR2A 1M6WA 4JKOA 5DBGA 1VYHA 2IYFA 3W5SA 2BGKA 2D1YA 2H4XA 1RFLA 2K87A 4ZI7B 5FLXA 2F3UA 4C3OB 4GBJA 4JYZA 5KOJA 2ISCA 4NE2A 4GIBA 5CA0B 4M0PA 1ZW1A 3BX1A 3IUEA 1PEYA 5HS6A 1K8YB 2ZDQA 4TSFA 2P8SA 2M6RA 4TMKA 2IS6A 3PVCA 4JUIA 3ZCTA 1DQRA 2B1IA 2D5CA 2YVKA 3I76A 4JXZA 1FYEA 1LLUA 3KAKA 1M34A 3WGVA 3GFSA 4MRVA 4WKPA 3W34A 2IOQA 1CETA 3NHZA 2OD7A 2WKWA 4KIUA 3ZDZB 4DFDA 5HRUA 4DV3B 1WMSA 2NUPB 2P5TB 3KVYA 5CT5A 1DXQA 3QV2A 1NQVA 2PO7A 3O92A 4G9BA 3E03A 1IN6A 2VJBA 3H7IA 5CFQA 3KEQA 4WPGA 5TQ0A 4Y30A 1JLSA 3NHBA 2GEUA 5HTOA 3WLEA 2QSUA 3HN6A 1HPLA 1YRYE 5TT0A 4MRSA 1NOKA 4D9IA 4D26A 1JQEA 1QB8A 1VIMA 1KARA 5I9IA 2AZDA 2CK3A 2OD2A 2P68A 2VC2B 2Y1GA 4IWNA 3KALA 4IYRA 3EIUA 1KDZA 5EGNA 1U7WA 3LVFO 4JUFA 4F85A 4GKKB 3FJYA 1GL7A 4FWBA 2OGSA 2JK0A 2Q0QA 1V1RB 1JTVA 2MSLA 2RAFA 3V8MA 4MUNA 5JZOA 3N28A 5KJFA 2RGAA 3OSUA 1WCYA 3QFCA 2Q4RA 3AFIA 1Y3CE 4EJ6A 1IBKB 2DR2A 5A0TA 4O2LA 2V6MA 2F8MA 1PT5A 3DDSA 1EFTA 2D4AA 3HGQA 3IB6A 1N0WA 4LK2A 4WDRA 1SOVA 2VJAA 4XIYA 3OCJA 2FZVA 2OMKA 3ZD7A 4NXMB 4CRWB 8AT1A 3FGOA 3OQ6A 3A1VA 1KKMA 2B1QA 3AUTA 2G25A 3LLMA 4XIFA 2GXAA 1BXRB 4TV8F 5BN1A 4RGYA 5J2UA 3PIIA 3DULA 5JROA 3RC8A 4C4SA 4OXQA 2ZRFA 4IHQA 4M3NA 5C3MA 2UUAB 3DB2A 3ETDA 3HEAA 5K4AA 1YA8A 2ZWOA 3A10A 2GJ8A 2ZUUA 1T2DA 1Q95A 2J3KA 4A8TA 2OM6A 3T5BA 3QMVA 4FC7A 4UQPA 3SYNA 2G06A 2OPBA 4KQ6A 2B8EA 3UWKA 2CDBA 3G3EA 3PICA 2XZPA 4UUQA 5BNIA 4KIJA 3AR8A 4IBOA 5L7TA 3NWOA 1U81A 2VSQA 2IRWA 5DTMA 1R1DA 2WF9A 3FOBA 4FDLA 2UAGA 2AFHA 2QTVB 2O7VA 3LP5A 1X1TA 3B20A 5IVDA 3TTVA 4F60A 1P7YA 2AF4C 4YNBA 3C8MA 1EE2A 2Z43A 2BKXA 1I4WA 2PUHA 4MRAA 4RK4A 4DG5A 3EIQA 1GYPA 4HRYA 1N34B 2EX1A 4HWTA 3WICA 1KI7A 4B2YA 3OF2A 3FN4A 6GPBA 4OYHA 4US2R 4BNKA 1XI2A 4BNVA 2EZ8A 5LQAA 5JI2E 2BBTA 3CRZA 4BVKA 4QREA 4EYSA 4CLRB 3EF0A 1EP1B 4QOGA 1RU3A 4EKIA 2XZOA 3IUPA 5JASA 1ONBA 1PHPA 3NM4A 1B93A 1GGEA 4BBAA 1CY8A 2ES4A 2C4HA 3V2HA 4DM3A 3BXFA 5BN5A 1F20A 1JALA 1I30A 4HGZA 3SICE 4I6EA 4V0SA 3T7TA 4L4SA 2J9GA 3G85A 4HFJA 2Q28A 3K0SA 2O0JA 1T2CA 3QX7A 3QBTA 3VPCA 4W8GA 5KTYA 2HJHA 1OWOA 1KO7A 3KKNA 1RJ9B 1YFKA 2ZI6A 4KGDA 1X14A 2O5RA 1I3MA 2BGNA 4LZOA 4NATA 4TS1A 3AVVA 2H1CA 3RJZA 1S9DA 3CZPA 4M8KA 1TJPB 3IBGA 4FQ8A 1EDBA 3QVLA 3JQPA 2CDNA 3RRMA 3SXPA 5C5DA 1IHOA 2IHTA 3PI7A 3N8NA 3GJYA 4MCHA 1GTSA 4WFJA 2GHQA 3PQ2A 4WXMA 5IZCC 1UPCA 4LY0A 1HRKA 5DX1A 4A1OA 1N77A 2HDNB 3W1EA 2YWXA 4F9GA 4FGJA 1P2GA 3IALA 4ERXA 3CVWA 1NUTA 2EP5A 2NU6A 5G02A 3NCTA 5CCXA 1W73A 2O7SA 3OQMA 5DNYB 2V58A 1N0VC 4P08A 4QUGA 3UW3A 1JAZA 3BREA 1X7DA 3C1AA 2X4GA 4NFYA 2CEKA 1W1IA 3RSZA 5TQ2A 2OHXA 4Q9NA 3X2FA 2O19A 4IJQA 1NDHA 2X8JA 3ZY2A 4AJKA 4DWJA 4KQJA 2B37A 1PSDA 2JASA 3DO6A 3NFRA 1Y33E 1EMDA 2KMLA 10MHA 2IBSA 1E2EA 2ZATA 3TFWA 3L79A 3FOFC 2BFEA 2VATA 1HDYA 4AN0A 1G42A 2J46A 3NC1C 4CM8B 4Y0NA 5J4YA 3RHSA 1JEYB 5TC4A 2XSZA 2B5VA 4K9SA 1LJ8A 4HF7A 5JXGA 1NLUA 2RHDA 1LK0A 5HMMA 2D0PB 1GGHA 2PGIA 5L51A 2ZYRA 2YXBA 3BRQA 2O2EA 5ERGB 4BO1A 1DRKA 4L22A 3GZNB 3I1FA 4OLHA 4QDKA 1DEKA 3OT5A 3QY9A 4PTYA 5FULA 2PD3A 1L5KA 4F1KA 5HUQA 1J25A 3PWTA 3GQBB 1GU7A 3DE7X 2Y1FA 2H59A 1PG0A 1Y5MA 3H3FA 3JALB 3ML1A 2HF2A 4YJFA 5CG1A 4JHXA 1OASA 1YCHA 1C1DB 3F7MA 4OYLA 3SSOA 1ATZA 5AO9A 5CB4B 3GL9A 1NP3A 3Q5GA 2PPVA 5DT9A 3TEMA 4CL2A 2GPWA 5SY9A 2A67A 1IM2A 3AB3A 2I8CA 1CFJA 1DC4A 1E1QA 1N1EA 3PUIA 3ZGXA 4OD0A 5EWLA 4Z9AA 3CW9A 4K9NA 3Q7EA 4RANA 1NR1A 1U5AA 3GLIA 1C7JA 4N48A 3K9WA 2I1LA 4KOEC 3AP1A 4UJ3A 4YAFA 4YJKA 3ADOA 3EXHB 5FWXA 4J0CA 1W88A 2CLDX 3KELA 3UMMA 1PVDA 1B3BA 2DY1A 3QG1A 3Q9NA 4YRRA 4XX1A 5CXUA 5HMLA 4Y2QA 3L8DA 4DIUA 4EQ6A 1R6VA 4RTKA 3TDNA 2H2WA 4TVOA 1CCWA 4H1UA 2X7XA 2BELA 4YV2A 1SBQA 2G40A 2WC1A 3BCHA 5B58T 4KIGA 4D9BA 3AVQA 3LQKA 2I3DA 3X2EA 1T9HA 1MG5A 4O2BA 4UFNA 4H3VA 4ZOLF 5GGXA 1UBHS 1A9XB 5FV7A 4X3OA 1BVUA 1TUIA 1ILEA 1C3OB 3CB4A 4RIHA 2P7IA 3ETCA 1UZUA 4PO9A 1HG1A 2J3QA 4Q3LA 4A27A 2J0SA 1LBHA 4LTMA 1XPOA 4KO3S 3KPWA 3GLGE 3NLLA 1WKVA 5CVUA 3VO2A 4RJJA 2GERA 1M83A 2YJTD 4UUBA 1EDZA 3COSA 1JQBA 1KIFA 2IGTA 4XH9B 2V7WA 3MD0A 1B8VA 2R79A 4GXQA 4NBRA 2E5LB 3ICEA 2EQBA 1Y8ZA 3K0CC 4JLUA 4KUEA 1DCFA 3DT8A 5F78A 1MC8A 5JAOA 1ZICA 3AERA 3GD5A 4DLKA 4E33A 5IK2D 1T29A 3IBCA 4L7QA 5CYGA 2YQZA 5JCZA 4IOKA 4GI2A 1WPGA 2DLDA 2YC2C 3D4BA 2ZRKA 3NNNA 3PQEA 3VHQA 5LQNA 3ZX4A 3T35A 3DXXA 3M6UA 2C82A 3HFGA 4U9UA 4LJ4A 2MR6A 1FUYB 1PWHA 5AT1A 5JXHA 3CNBA 2B61A 1C80A 5JANA 1GQOA 3BXZA 2FWNA 3ZE8A 4WXHA 4U2KA 1WOYA 1I94B 3JPWA 2ADOA 4TTJA 4PZLA 3X1KA 1XTVA 5JJLA 3TMYA 1U63A 3C15C 2RIPA 3VA7A 2R5WA 3DR3A 3ZK8A 4IUBS 3TMKA 1IWOA 2XRZA 2B3TA 9LDTA 3Q6IA 3OO1A 1UPBA 3G17A 4W5TA 4CGYA 5HW0A 3CV3A 4PAWA 1GA1A 4G1BA 2YY5A 4D46A 1AURA 4Q4JA 4ZCIA 4X7PA 1R5JA 3WIUA 3UGQA 2H2AA 3PEEA 4U39A 2GEJA 5JJIA 1T6ZA 1E9BA 4X8MA 5LYYA 2OHHA 4HTFB 3CKLA 1HK7A 1YQGA 3TBHA 5JO0A 2Q5QA 4ZT7A 3BSFA 3F47A 1UPFA 3D2AA 2C4VA 3EEOA 3RWBA 1IK4A 4HZIA 3CCCA 1Z38A 2V6GA 4IVRA 5E7MA 1JLKA 1E98A 1JIKA 4KXNA 2O0MA 4E2XA 4YRMA 3U61B 3COZA 1ZM9A 3ZHBA 1N0IA 4TSFD 1GV0A 1RJEA 4B76A 1GGNA 3DO8A 5JMPA 3QFFA 1V96A 5SYMA 1KAHA 3RHTA 4D0NA 1ZRHA 1L4KA 2F1HA 3RVJA 3V32A 3OC0A 3LPNA 1D3AA 2I0FA 4FFOA 5DHTA 3Q4GA 1B23P 1G21E 3LUDA 1D2MA 4HPJB 3WADA 2CVOA 4FK8A 2R7NA 3B2QA 4CE6A 4P4SA 5JNWA 2N75A 2B34A 3D59A 1ODLA 2PUVA 4ZJYA 2OHGA 1UCFA 3F4LA 4QBGB 1GAWA 3TEFA 3DMDA 4V0ME 2WHPB 4CU2A 1CRLA 1U2RA 1ZSYA 4RTLA 1MVNA 4Z54A 3Q3GE 4B81A 5IUNC 2O8DA 3BJMA 4C0WA 1T4CB 3PNKA 1SU8A 3A1TA 4FONA 1MEOA 1VBNA 2P9QA 4FNOA 3LBYA 1CHDA 1JEDA 1KNQA 3EB9A 1ADJA 2CBZA 2HMSA 3IQEA 3OBIA 3FDXA 3PF8A 4MV1A 4NS1A 1W46A 4C4OA 4P54A 1RQ7A 5E1BA 2JF0A 5AJXA 2KI5A 4EHFA 3D7NA 4PN7A 2YZKA 1JVNA 3E8MA 4XDYA 2A92A 4I5GA 3U60B 1QV9A 4QYIA 3G9XA 1ZL0A 5KQMA 2NU9A 2VQ6A 1A9QA 1EBBA 2C8KA 5DN6A 3KT0A 2JGFA 4GFDA 1ODCA 4W7IA 1TYBE 4V38A 3JVEA 5LQRA 1MLDA 3HCPA 1DAOA 1W4CA 4F8EA 3HDJA 4PYMA 3WISA 3AR7A 1ZWKA 5FYDA 1I8TA 5LMUB 1Z07A 3LUGA 4WACA 2WIDA 3FPFA 5AW1A 1UWKA 3WV4A 5G0TA 2NTVA 1XYGA 4RF2A 4BGEA 1LPSA 3Q0TA 3MTBA 3BT7A 1NSFA 3CWZA 4FFLA 4KRYA 1TMKA 1KIAA 4IINA 4CNQA 2QN9A 2ZJ8A 3FUXA 3GCXA 2GTIA 4WK6A 3ND8A 2YY6A 3CPSA 3ELYA 4BMDA 3VPSA 1ZHHA 1O7JA 4U7PB 3PDIB 3LM8A 2P2DA 4D4GA 3H6GA 1X7ZA 4BP9A 3AX6A 3WK5A 4WOPA 4AN4A 2ZE5A 4GVXA 4X71A 3PDWA 2Z9DA 3QUBA 3GELA 3G0OA 5LKRA 3LDAA 4YRLA 4BUCA 4YECA 1WXFA 5HIIA 4KWCA 5CB8A 1MT0A 1SOMA 4C6RA 3EIWA 1WTCA 3EEFA 4IV0A 1UOPA 2XMRA 3KG2A 4JASB 1KNXA 1RI1A 2JI8A 3LHFA 1ZONA 3EVFA 4X9XA 4DW8A 4UTPA 2PUTA 1I7SB 4D96A 3OF5A 1EFCA 1Q7BA 5KWSA 2OE2A 3K35A 2GASA 1VYUA 3K8OE 4L3OA 4XTRA 2QXTA 4D8XA 1KSJA 2VBCA 2ZXUA 4YMLA 2PU5A 8GPBA 1L4GA 3P0HA 4BNTA 3ZLVA 4LE0A 4BECA 5G4LA 3W5AA 2PZJA 5JFOA 3E27A 1M73E 1EB9A 3P9ZA 4NMWA 2Q2QA 1D8TA 1ZOSA 1L3IA 3AJRA 2QRJA 2BZSA 3RUIA 1B15A 1VSVA 4P7JA 3CBQA 3M6IA 4EG6A 1UT5A 1LX6A 2KW5A 5JHHB 4AY2A 4OQFA 2QVCA 1U3GA 3RHZA 2RI1A 2BTQA 2QLTA 1CUFA 4M53A 3MMPA 4O5AA 4QUAA 4KR3A 4BNWA 2TRSB 4WBXC 2C5BA 3DAFA 3GD7A 1VJGA 1HI9A 3D0KA 3C74A 2XWBF 1Q12A 4RZUA 1QUFA 3EX7C 5AVTA 1OLUB 2C5GA 3BRWD 1XP5A 3G1UA 3I2GA 1U2QA 2AQ8A 5HRCA 1AH2A 3VDRA 3KZXA 3WSTA 4X85A 3NAGA 3K71B 2QT9A 4AY6A 5CNIA 5JQGF 2W4IA 1L7XA 5NLLA 1X1CA 5BUQA 3SS7X 4AD8A 1KORA 4YLYA 5IM4A 5IJWA 5JJKA 3TJRA 1NW6A 2DBQA 2F3QA 3DE5X 2JFNA 3OKCA 1H2FA 4O4IF 4RV5A 1L4MA 5HSGA 1LQTA 1M75A 5DM0A 5GV7A 3U9LA 3UEOA 3KKLA 2YQ5A 2ZVDA 5AI5A 1SQSA 2CNDA 2HLNA 3NGLA 1G55A 1F8XA 1YQDA 1V8FA 2RG1A 3CFYA 3EISA 2QQFA 4KMMA 4AUNA 4LNUA 4V24A 4EX6A 3WWZA 4YJ3F 5AUPB 2VTVA 5HRAA 1EYZA 4EUKA 1I3CA 3BH6A 3ZXXA 3G82C 2C1EA 1J4AA 1C9YA 4NHEA 2C5AA 2W6IA 5C5IA 2VK8A 1NQXA 1N2CE 4OHBA 1XAHA 3U0BA 3GRVA 4MS3B 4OVKA 2DT8A 3LKZA 2M98A 3KB6A 3A4VA 2OWEA 2PZEA 4F3NA 3D8RA 3K05A 3PUXA 3LFUA 3R3JA 5C51B 1SB9A 4S12A 5AK6A 1PDWA 2XRFA 2XSZD 3M81A 2JCBA 5DW0A 5EJ9A 2H1VA 2QMYA 3CO5A 3CNEA 3W9UA 1I5RA 4MR8B 2GJAA 4UM8B 3RSQA 2APJA 1TIPA 2YBEA 5AKYA 1AF7A 5T8KA 2R6FA 4UE6A 3EEQA 1TW3A 1VBFA 4Q82A 2A9OA 3GRAA 1TKBA 3IMGA 2COEA 1T0PA 2ZSUA 5KSZA 1CUIA 3KZOA 3MS7A 1VSUA 4TPKA 2IIQA 1W4RA 2GK3A 3CVOA 1CR1A 5JSHA 2WTBA 5ALTA 1NBIA 3OZVA 5LUBA 2VF8A 3AV3A 2ZSEA 1LLQA 2P8JA 2RI6A 1HA3A 3AP3A 4GYWA 5DCWA 1KOLA 5G1OA 5HHTA 2XRMA 3L7LA 2ZJFA 1JNXX 2HREA 3K1AA 3D8UA 3LX5A 5A9RA 1D0SA 2XOEA 4U63A 3T0GA 1CR6A 1U5BB 3U3ZA 2X8LA 2X1VA 3KVOA 2NO0A 4KYVA 3Q85A 4Y1FA 3ZS9A 3O6VA 2VKQA 3QLVC 5DHSA 2ZSAA 3SC6A 2ZJ4A 4F11A 1VMEA 4RF4A 4GPEA 2O2ZA 3GAMA 4DLTA 4IDBA 4J9UE 2Z08A 2Z3WA 5C46F 2CV0A 3ANMA 4K7JA 5GQSA 2PR2A 5B7QA 1KMNA 2ZG6A 1PLJA 3NIFB 4EY6A 2ATEA 4HGOA 3O4VA 3M9WA 1X94A 1XFAA 3NIGB 2ASVA 5B4VA 2FWPA 2X4IA 3HJUA 3HSSA 2DSTA 4G4JA 4M8LA 3JWPA 1NAIA 3DAYA 2XX3A 4RPJA 4AZWA 4TT8A 5REQB 3R8XA 4CEHA 4BUZA 4CGZA 5IF3A 1MABA 3A4YA 3K6SB 2HPZA 2G9NA 2G9UA 1O54A 2ZUVA 3F49S 3FUTA 4IOJA 1M1NB 1V4BA 3I2YX 1Y63A 4LXIA 3TLAA 3TX6A 1R10A 3OCVA 1TNDA 1VHDA 4DWOA 1C3VA 1FU4A 4WN3A 2ASEA 4JXKA 3KKZA 1WMAA 3FRHA 1NKTA 3KWLA 4D9EA 3RARA 1P6XA 4DY4A 1OQAA 2YR0A 4WD3A 1ORWA 2WZQA 3KJHA 2IW3A 4YRQA 1J70A 4IIJA 2JD2A 3KYCB 5GV8A 4J4BA 1HDIA 2GLXA 3UF0A 2YUTA 2HU8A 4W9NA 1MB0A 4FEEA 4NZPA 4OM7A 1OD6A 1UKCA 2JVIA 4DQUA 4FWTA 2OV6A 3W6PA 3BB1A 1YFLA 3OD5A 2NXNA 2Q6KA 4X41A 2X23A 2V4MA 2JEOA 2I2DA 4CMBA 5JVDF 3FMOB 5J2TB 4H35A 3EPRA 4UUNA 4BKMA 2BPOA 3DJFA 4WZBA 1ELOA 2VSFA 1TAHA 3P8ZA 1I4TD 4TTPA 4S35A 3ROTA 3M1YA 2CXRA 4IQ8A 3EWSA 3B6MA 4GMHA 1KTIA 4NCHA 1DAEA 2TSYB 2R1UA 1PR6A 4M9QA 4OAOA 2LWIA 4IJ6A 4DA4A 4HQ0A 3UV7A 2B4YA 4AG3A 3RC2A 4H18A 4FILA 3VPAA 1V16B 1XEWY 5LQKA 1ZH8A 2JZCA 3AHFA 1CUEA 1GRNA 1IMOA 3FPCA 1T34A 1RAAA 1M34E 1X9HA 2WIBA 3X0DA 1V47A 1X1SA 4UASA 2XIJA 3ZWMA 4CTJA 3IAUA 3G68A 1P5FA 3RAEC 2XT9A 1N6KA 4CR7A 4D8VA 4EA8A 2V3CC 1R6DA 1QO0A 2VCHA 3ZHYA 1ZSNA 4OXXA 1JDBB 4P32A 1RC0A 5EE0A 4X24A 3HA2A 3RS0A 3K4QA 4B4DA 1N2IA 2F9FA 5BURA 3KYJB 1JBKA 1XKQA 1QMGA 3EUAA 3FFWA 4CM9A 1U1CA 3PRJA 5ARBA 4G81A 1NQAO 1AZWA 2GK7A 3PR2B 4QDZA 4YQZA 3RTBA 4ER7A 1YJ8A 4KXMA 5KVAA 2J5BA 2JAXA 4MCAA 4UHFA 2DFKB 3ZV4A 1O95C 1LY1A 4PYLA 1PR1A 4LYDA 4F4FA 4IOLA 1UMBA 2VYNA 3DL2A 3O2QB 3QYAA 1KMHA 3PRKE 3F5DA 1TUGA 3GB9A 5I3CA 1YA6A 4RY8A 4EG4A 2C4KA 5C1DA 1DZIA 4LFCB 1YKGA 2NSYA 1VECA 3LG2A 4L4ZA 5ETJA 1V2HE 2QM7A 3SJBA 4LF8B 1ZA1A 5LB2A 3SXUA 4EUSA 4INJA 3WB9A 2WHXA 5H16A 3B1KA 3KWMA 1SULA 2WV9A 1CU1A 1L4UA 3D7KA 5AJVB 1QLJA 2Q2WA 1G6KA 1NT2A 1Z0KA 3RC1A 4NOLA 4FLFA 4Y0AA 4ABYA 3GVXA 5BORA 1AGPA 3DBIA 2ZQYA 4L3WA 2HA4A 4O0MA 2UZ4A 2BUCA 2UUBB 4YALA 3OM9A 3LPCA 1PUIA 3MF4A 3CBGA 4L3VA 5JNUA 5EMHA 4L9WA 4NU5A 5AHXA 5DN6D 1W48A 5K8LA 3CNQS 3JARA 3B5EA 5I7VA 1M10A 1JFLA 4X1YB 3QWBA 1NYLA 5CXQA 4XGKA 1H1LA 1VLHA 4WK0B 3ROXA 4LXQA 4MRNA 4A8JC 1SXHA 2J6HA 5HA5A 2PBFA 1Z0SA 4HDKB 3LW7A 3QE2A 1UXOA 4GU5A 1XELA 2BFAA 3GAAA 2PL9A 2V6JA 2VDPB 4GPAA 5FJJA 1T3GA 2GSDA 2VJKA 4IJMA 1T8TA 2E0IA 4MUKA 4UAVA 1JHDA 2HTFA 3QKSB 1DJLA 3T3GA 3NC0C 2PGDA 3O3OB 1V37A 3PC2A 2E4VA 3WDSA 5BWNA 1P74A 1QH1A 4JLNA 2FSSA 1W36D 3QPBA 3CGWA 1N9GA 2CXNA 1CUCA 2BSAA 3ZDAA 5EUMA 5BO5A 2PD4A 2CVPA 3RUPA 1K9VF 5JNLA 1L8LA 5CDUA 3UJ3X 3AR9A 1OR8A 3ANLA 3RKRA 3IUBA 4EB8A 2AWOA 2BDTA 3GPCA 2IIVA 1PRYA 1KSFX 3HCAA 4H6VA 1CQPA 2V7BA 1Q57A 3AJEA 2I80A 4M1WA 4PPYA 3ZYCA 4AZ0A 4U02A 4F96A 2B8NA 2JCGA 2YJZA 2WINI 4C30A 2VJLA 4XVRA 2G5PA 1NPTO 3UIEA 1DS6A 5BSUA 1NW8A 1XZMA 4AO6A 4X7MA 1KBQA 3D6JA 3IOBA 5KTSA 4GDMA 4DG8A 3HJBA 1OREA 3OIDA 4GMXA 3MERA 3JSAA 5BVGA 1U7UA 3BSSA 1DXHA 2HCBA 5ELMA 2E5FA 2RAUA 3L77A 2XEXA 1QDEA 1I4OA 1ZYUA 3LRPA 4MUAA 2OB1A 3RQIA 1YC2A 1QIHA 1T8RA 4Z0HO 4YV1A 1DPGA 4HAYA 2YCBA 1QKKA 1TM7E 2FMTA 3BHIA 1GP2A 2V7TA 2Y68A 5CU7A 4LK3A 3WWYA 1GADO 4NZ9A 1FJ2A 1YHNA 3MAJA 2KM1A 4GDFA 3ZWBA 4MUIA 3DV0B 4MWTA 1WHSB 3NIDB 3SSMA 5JPDA 4OJNA 4J3JA 4LE1A 4MS1B 5DNUA 3OQBA 3L07A 5DM1A 2XUIA 3V7YA 4C0SA 1XFDA 3MCAA 3UBTA 2VF2A 1BYIA 3CX8A 2GBIA 2QTMA 3SQLA 3A9CA 3GLFB 4TLEA 1QP4A 4EMUA 2QBYA 4MW1A 1Z7EA 5ESWA 4LXHA 4BBJA 3OTQA 5LIPA 5MN4A 1WNFA 2ZUDA 4WNCA 5CXSA 4XJXA 3V1TC 4IQFA 4ZALA 3LOUA 5IJAA 4YY3B 1ADYA 2JIPA 4N8DA 2MIIA 2CXUA 4JBWA 4A6EA 3QXXA 2DFVA 2KQUA 4FOLA 2GBFA 5FOTA 1X1BA 4HUTA 1OTHA 1U8XX 1UBNA 3A3KA 3LIPA 4IGIA 3R75A 3TXYA 4PPFA 2D5IA 1J24A 1KXJA 3CY6A 4IOMA 1RXYA 4M0CA 4O1IA 2V59A 1B1CA 1FYWA 2B0JA 4K05A 3GRKA 3L5OA 4MRMA 1FFBA 4EFKA 2EFEB 5IMBA 2VBGA 4WY2A 1WD7A 1M0EA 2W6ID 1E58A 1RYDA 1G6OA 1DKOA 2QRGA 4IH4A 1NMQA 1ZD2P 3LNCA 4JYCA 5DLEA 3RK1A 4EGFA 1QWOA 2OV1A 2FN3A 1HFJA 2WJHA 1WSBA 3I2FA 3IE2A 4ITVA 5I9SA 3BMXA 4Z4GA 1RWQA 4J43A 2C9BA 3BM5A 3FF4A 3KYDA 4XD2A 5C8YA 4BEVA 3DWGA 1QC5B 2D0IA 2WKRA 1ZINA 2GX6A 2PZBA 3E82A 4JA0A 1MGOA 1SCNE 4A8HA 2OC9A 3FYSA 1CQXA 2IPAB 3EFEA 1JKJB 1PDVA 4R9NA 2ON6A 2WWGA 2E1RA 5ESDA 3HZOA 4NBNA 2ZS9A 5JU6A 2WYVA 2X4LA 4IGEA 3SQOA 1SQ5A 3T95A 4OP3A 3RT9A 2O2SA 4NZOA 5AUNB 4Z3DA 5CD1A 1MO2A 4BB0A 3DR5A 3TJMA 4EHIA 5JC8A 3AIIA 3HTXA 2O1SA 4JP5A 3CN9A 5C7OO 1A9SA 1GJRA 1ZN8A 4IFIA 2NZXA 4TXNA 5HFJA 1W5TA 2QNIA 1P7CA 4Q37A 2I1WA 3BWMA 4NJEB 2YXEA 3DZJA 1VLLA 3RUHA 2PRZA 3R76A 2JIQA 2H1FA 4M88A 4XUGB 1N32B 4PLGA 3AXTA 1ECJA 4R8RA 5LPNA 1MEJA 1EBFA 1A2QA 5KTTA 1AKEA 1J33A 2JARA 2HA5A 2Q0SA 3M7IA 1H0HA 3M2TA 3OP4A 4L50A 4OG2A 5F3DA 3I9OA 2V7EA 3PE3A 2Q7OE 2AZMA 1VSTA 4QAJA 3FUUA 5K0CA 1ZH2A 1H8EA 1NXXA 3H4IA 3SEAA 5A0FA 1OI2A 4R5MA 5AHKA 3OTGA 1XLTC 5B3JA 3OE7A 5TY0A 5BSFA 2AZTA 4L08A 4AF6A 1VHTA 3DP9A 1TGYA 1J8YF 1RQRA 1YL6A 4KQ2A 1QP0A 3H11A 2PYZA 1Y42X 3R7SA 4ENUA 4NONA 2C0CA 4L0QA 3L7AA 4XI9A 4LSZA 1Y3IA 4YRAA 5IAOA 1WJGA 1IHPA 1OBFO 5AJTA 2YV1A 1TF2A 1U0FA 2QRKA 4GRIA 2GYUA 4PXSA 1L5FA 1F12A 2J87A 2FDRA 3KQMA 4ZCLA 4DJTA 1BHQ1 4M89A 2A5FA 2OTCA 4YP0A 5CLJA 3ICQB 2ETXA 3B5JA 3D4IA 4KKVA 1T24A 1XMXA 2BMEA 2WJWA 1PIWA 3FMGA 5KWVA 2SBTA 1HC7A 2RAVA 1OIWA 1NSYA 4O59O 1RLMA 4NJMB 1UJNA 1ENZA 5CJPA 1HNXB 2F64A 3NP9A 1TO6A 2GMWA 2PRKA 3GA0A 4QBHA 4EUHA 1I2MA 4QLAA 1FL9A 3C5EA 3ETEA 3EZ6A 5K45A 3V00A 3LECA 1DEXA 1G7TA 4AY3A 4FMBB 2C3UA 5DH9A 2EYUA 4IUCS 4JJIA 3DXYA 3LBNA 3MLBA 4QNNA 4RDXA 1DG3A 1E9AA 3AKYA 5A9SB 3FLEA 4H3KB 1E6CA 3GAZA 1Y8QB 2JJQA 3DCNA 5CCEA 4JBLA 1SEPA 2Y1OA 5FTMA 3RIXA 3AIMA 2W6QA 4KGZA 4QPPA 4XCQA 3KFXA 4XYMA 3TW8B 4RVUA 3RB8A 2CJFA 3I1JA 3P20A 3H04A 5LFAA 1J2TA 1S1CA 1WKCA 1MTZA 2PQ2A 3E9EA 3UB3A 4D9GA 4QFBA 4M98A 4CQJA 1Z4OA 3WLJA 4ZA2A 5ABPA 2FTKE 4J1TA 2DKFA 2D7JA 5EERA 1JMVA 5EQFA 1RPTA 4PHGA 3RI3A 1T6BY 2PANA 3F8TA 1IAVA 4ZHSA 3OI7A 4P4TA 3RIYA 4D6XA 2CZCA 4UUPA 4AZ3B 1CHNA 4LYGA 2EDAA 1QUEA 3T9CA 4OP2A 5B1YA 3DHNA 2CMFA 1N2XA 2PCLA 2VN8A 1ZIYA 1SBTA 2ECOA 2WIAA 1VG0B 3ENKA 4D3DA 5DLYA 4RE5A 3H7AA 5CMLA 3W05A 2ZTLA 4GMKA 1QO0D 2QVZX 2H17A 1KJ8A 5IYZF 3WS7A 1K5PA 3FI0A 1A5TA 3KR2A 4IH1A 4BTLA 2MYNA 1KH2A 1ZIDA 4KO8A 3E8XA 2ZAGA 4CF3A 1WVMA 4EQZA 3IQIX 5FEMA 4RSHA 2HEGA 5DGDA 4DNXA 4GPTA 2YC4C 2BHLA 1I7QB 2R68A 5AK5A 4TTQA 4R98A 3RF7A 4IPTA 2QOEA 2NV6A 2H8GA 5FNZA 1PL0A 4BO3A 4F3TA 2VYND 4JXJA 1KL7A 5CR9A 1YIAA 3IV6A 4N6NA 4ZDWA 1R8XA 1XDWA 4RPCA 2HDWA 2H18A 3OKFA 3TSYA 2IXEA 1T0HB 4FE3A 1BW9B 2QJFA 5ICSA 2EKBA 2ATIA 2DH5A 4P34A 2WDZA 1PV1A 4JLVA 4XQ0A 3OLCX 1RRGA 3OE5A 3DE6X 1DJNA 4YACA 5HM6A 3R5SA 5EZYA 3VZDA 4LDRA 3ILYA 4Q1DA 1NQ5A 3K9LA 3TTSA 1YJ5A 1KZ6A 4WJZA 1BXKA 1E3SA 3L8CA 3EDMA 3E81A 5G4KA 2ZRCA 3BFXA 4RNDB 4BFZA 5EJEA 1NVWQ 5CAEB 3ZWQA 4QJ5A 1JR3A 1NR7A 3GCWA 5TF0A 3WRVA 2JLVA 1EIWA 3MQ4A 3FWHA 1PEAA 1JDZA 4WEQA 3ROZA 4YA6A 4ZN6A 3A11A 4Y67A 4JX8A 3G59A 2F6RA 4JQOA 3B1FA 1KFKB 2PR7A 1P31A 2TS1A 3N0XA 3ZU3A 2QQ0A 1M33A 1NQTA 4WTOA 3VPXA 4KYIB 3L0CA 3H19A 4L72A 3KB2A 4QUEA 5JZSA 4HQ6A 1XRMA 2NACA 3ELDA 3NCHA 1CY4A 4H0NA 4QDXA 1FJXA 2NTYC 5FBKA 4R7GA 2J45A 4NFSA 3BQMB 3QVUA 1OBOA 3E3AA 4WVFA 1XK7A 1KYYA 2NSDA 3V4ZA 2QJRA 5JALA 2Q07A 1X80A 3I9JA 1YS2X 1RI4A 1XZBA 2LIVA 4RMIA 3RYIB 5KCMA 1SXIA 2W0SA 4J49A 1SVWA 2OAEA 4A9AA 4L16A 5BWMA 1ABEA 4PG8A 2VXYA 3UPDA 3L4KA 2Y0EA 3CW2A 1RYHA 3PPWA 3EDYA 2ONZA 4ZVPA 1Y4SA 2EFHB 3ANTA 2DC1A 1YZYA 3M9XA 1DKPA 1ADGA 2E85A 2VTDA 3RLIA 4U2GA 5F2EA 5KHLB 3PS9A 2WTEA 5DM70 2GZ3A 3P0RA 4DDTA 1DB3A 3PX2A 1JH9A 1ZK2A 2HCJB 1O4WA 1XJ0A 3AI1A 1UQTA 3E53A 2XMZA 3RIGA 3UT5B 1CX9B 4MJ3A 1VI6A 4NMLA 4DV6B 4EG3A 5BY2A 3I61A 3GU3A 4AYWA 4U9HS 4QYTA 4GT1A 4YBZA 3V2IA 2OCYC 4O29A 4YWJA 2I4RA 2ORIA 2UVDA 3A2MA 3S29A 5F9HA 1XDDA 1EWTA 4F0JA 3U6KA 1N6PA 4CLHA 1DBPA 2ID7A 3MWDA 4LY3A 1BKSB 3OLZA 1WZIA 1E7WA 1CZOA 1U8YA 3F1LA 3QUQA 3BKXA 4A3SA 1A95A 3L8FA 4DJFC 1E4EB 1JVSA 1GSAA 2B94A 3H9CA 4URWR 2RGUA 4J94A 1DJQA 2OXTA 4CKBA 1KZYC 1ZAYA 2G76A 1SA0B 3TQTA 3TZEA 2Q1TA 1E5QA 3MT7A 2OKCA 2P0AA 4JUAA 1XQ9A 3WHKA 2H85A 4TKLA 5KYVA 2HN9A 2X6TA 3HBJA 1UF9A 1NBWB 2VEOA 2QLFA 2XUOA 3HPRA 5DM4A 2C98A 2J9ZB 4TKZA 1OXXK 4DMCA 4EY4A 3GHHA 4Z6KA 5SZKB 5TJ9A 5JEEA 5BVHA 5AOCA 2ADFA 4JI5B 3OQHA 1K2VN 1SOAA 3H3JA 3HPQA 4FYVA 3FE2A 4K9DA 3VKFA 5KKAA 2HZ7A 4LXTA 2NPIA 2JFBA 1FSSA 5A04A 3V42A 4DSAA 4N1AA 1P5JA 1WPRA 2QAGC 4J6EA 3VBCA 2VDVE 1PJ8A 3OTIA 4AJHA 4KITB 4IL5A 3BRSA 4BCCA 2Q45A 4M60A 1HGXA 5IJ9A 3RHFA 4C4XA 4DQ0A 4FU0A 1ZK0A 1GZUA 4PLCA 2WF5A 3H5NA 2YZGA 2X3YA 3N07A 4IZHA 4R2JA 1E6KA 5G40A 3RRFA 1J8QA 1L7MA 2WNSA 4M4SA 3GFGA 3SS8A 3TOXA 3VR2A 1SD2A 2CXHA 1D2HA 2WJYA 1PG5A 4EJSB 2AW3A 4FGSA 1QVWA 4B1FA 3WYBA 3VPFA 1OLOA 4B33A 5EPUA 1YBHA 4O2AF 1FPQA 1V1JA 3AUJB 3Q72A 1N3BA 3A6EA 2P35A 3WY9A 4YRJA 2PRSA 1JJBA 3DMTC 4OF4A 4C4PA 2H1WA 1YS9A 3O8NA 3WLMA 3TCXB 3JD1A 4O8ZA 1TD1A 2L18A 1GL6A 1GCOA 3PXXA 1JPJA 1TT7A 2YVUA 1M2KA 1EK1A 1YRLA 3QNMA 4LQCA 4KI0A 3DNMA 4I4TA 2FEAA 4M38A 3O73A 4KWHA 3QP9A 2W2KA 4XB6B 5EJ7A 2GQ0A 1KSGA 4NBTA 4R71A 1D0VA 5P8WA 3OZAA 3A31A 1O9GA 4Y98A 2RG7A 2PVSA 3Q7IA 2ZBPA 3FYUB 1T36B 2FPPA 2PVPA 3SJUA 4DA8A 4G1CA 1F2UA 2FPOA 4HWGA 1F3LA 4C89A 2R96A 4HJRA 3AR3A 1P4GA 1SIUA 3R6GA 4ZVTA 1YOVA 1F2VA 4TTTS 5LXTA 1ZD5A 2V3VA 1P1KA 1BX1A 1WSAA 3UMYA 3HABA 5AXBA 4MR7B 3TW6A 1TO2E 3LF1A 3DV9A 3KBOA 5KJ1A 3CZ9A 1M1UA 3QTLA 4IDAA 5CBPA 3QUAA 3CX3A 1CERA 3TSZA 3ZE7A 1H8ED 3O83A 3GLRA 4UCXA 4WUTA 1TPYA 1OC2A 2BMDA 2XHEA 3K31A 3OE7D 1BN6A 3AEYA 1FFDA 2FX3A 2G0NA 4QRDA 4YIHA 3WP0A 4DCPA 1RI2A 1KS2A 2OCAA 5FWYA 1I2CA 2FUCA 2I4NA 2AC2A 3LC2O 4OHYA 2R6R1 3ESYA 4H7JA 1HT0A 1ISPA 5EGSA 3SVTA 3S1AA 2ZFUA 3Q3CA 2O8EA 5KTPA 4A36A 1QAQA 2WTXA 3B13B 2LCFA 2YIDA 1HE1C 1G7SA 1UT6A 3HUTA 3FTFA 3JASB 1SHLA 1R12A 4V2UA 1OYWA 2Q21A 3O3MB 4CJXA 2UYCA 3L7CA 1OU0A 1EI9A 3HCDA 2QWXA 1KDVA 1L7OA 3PPYA 4NBWA 5BWCA 5EKXA 3RVQA 1Z4LA 4HL6A 3WK4A 3MJHA 1P61B 4PQEA 3RBZA 4WZBE 2I91A 3UK2A 3DMGA 4KPUB 2W2TA 2HUNA 4IW3B 2ZB2A 4RKYA 1UBSB 2H4YA 2I65A 1ESMA 1YMQA 2IP4A 2QIOA 3BKWA 1V8BA 4UXHA 5BW5A 1ONNA 1QCDA 1OV6A 5HWSA 1AHNA 5B6IA 1UJ5A 1ESNA 2CSUA 1P60A 1G64A 1C9EA 3UOAB 3V9PA 2IH2A 4M87A 1NN0A 4OAQA 8MHTA 1GFSA 4UVIA 4MEJA 1QIDA 3SE7A 1X39A 2GO7A 1RZUA 4RTJA 2I33A 3ESRA 1M2FA 2DSNA 2A1TS 2LNDA 4G3XA 3D4PA 2GFHA 3V1YA 3ZW7A 4BV2A 4BE7B 5LOVB 3W5DA 1WCXA 1QRRA 2C2MA 1PR5A 1IB6A 2PIDA 1FNCA 2PWZA 3ZU5A 4Z3KA 2F1IA 2DTEA 1ONPA 2A0WA 4UEOA 3FY4A 2BSQA 2JCXA 1J42A 2W6CX 3ESCA 4FMDB 5ALJA 2BFOA 1AXEA 3SVZA 2RGCA 2AYZA 4W4TA 1UOEA 4DHEA 3T5DA 8ADHA 3AVWA 1NE7A 3F2VA 3AKDA 2OCXA 2PGLA 4XWAA 4LCJA 4P36A 1SWWA 4GR9A 1SXJC 3QVJA 2JKVA 5TVKA 3JAKB 5E7IA 3AR5A 4ZVQA 2F2TA 4FNAA 5BSHA 2BJVA 2OFXA 4KUHA 4EATA 5HIAA 4EYGA 4JLSA 1DRVA 1FDTA 4URFA 3VZPA 4B3CA 3GT7A 4DADA 2NV0A 2GHIA 3DBVO 3PHLA 2GS9A 3T3DA 5JAMA 1BTOA 3PGXA 2VYVD 2WOJA 4QDTA 3QYJA 3U26A 1XPJA 1DIOB 4F38A 1OGIA 2C78A 4CM8A 5DJ5A 4B3IA 3FSJX 4CG3A 3AEZA 4CKCB 1GZ3A 1SXJD 2BEWB 2P4HX 4U7HA 5DK4A 1PF7E 1A9OA 3OECA 4BRSA 1L1RA 3QMPA 4AWXA 1HZJA 5CT4A 4KQCA 5BXQC 5KREA 4BNJA 4IVNA 1VKRA 2PVCA 1BOOA 4I4IA 1H2AS 1T6NA 3GZNA 4CFZA 5EWMA 4Q7JB 4W5OA 1KMIY 2O1XA 1DV1A 4RHYA 3RVKA 3PEUA 4DREA 3BERA 1PI3A 1H1DA 3A6HA 3AHJA 1PQPA 2V98A 4Q7MB 4HDMA 4KSBA 5EHZA 1J1UA 4HH4A 4O4HB 4IGKA 4HZUB 3K0AB 1GNVA 1CLUA 3AVYA 3UAVA 2Q1XA 5IKXA 5T57A 3L1IA 1GCIA 2YIMA 4TS4A 4Y1RA 1Q6YA 4U5XA 4X91A 5ALHA 3BILA 2FHSA 5A71A 4V0OA 4LF4B 1QONA 1VJRA 5DTQA 1GQRA 4F5WA 3WO1A 1E2MA 1KVQA 4Q0MA 1WUYA 3KM0A 3W5CA 1K7CA 3K0KA 5AVKA 3NAMA 4YRPA 4QJ4A 4B6GA 1U0GA 4MSUA 1K3UB 4AF8A 2QYTA 1CE8A 3ESBA 1E3TA 4OOEA 2G77B 3V4OA 4UAUA 2QTFA 1QH9A 2O5CA 4M0KA 3ITKA 2ZSHA 4IMJB 3CF4G 1C8KA 4JQZA 1FA9A 1FFXB 1QE0A 1TZJA 5H5JA 1I0ZA 1XD2A 3HMKA 3HP4A 5JW6A 2PMDA 4DCUA 2PFGA 2EBWA 1DI0A 3PNSA 3SS9X 4ZI7F 3K7EA 3AWIA 3BFJA 4U0JA 1TUEA 2Z0MA 3C14C 3MRXA 1A04A 3PFBA 4WKBA 5E4YA 1DL5A 1DTSA 3HYSA 4R7ZA 1K6XA 3TR0A 5IXJA 5J4HA 1DBIA 1E79A 2GNPA 3B70A 4PYRA 5AICA 2EWWA 2ID8A 4XE5A 1MPTA 5CTAA 3G88A 3V48A 1AKTA 5AKZA 1G3IA 3RFTA 2AVDA 4IH9A 2D1RA 3N5CA 3PC7A 4OBEA 5EJ8A 3KHUA 2QA5A 1DOAA 3LX6A 2QUKA 3DVAA 4MDFA 1SC1A 1SBCA 3IR7A 5DHRA 5DSXA 3A1UA 5KSWB 3E1KA 2KPOA 1T6YA 1W44A 3FWZA 4OP1A 1ENOA 1RW4A 2C92A 3OX3A 3GG2A 5EZQA 4C21A 4IXDA 2VWPA 4KR6A 4EF4A 1Z17A 1CQWA 1N6NA 2I3GA 3T99A 1T13A 3CZ4A 1EFVB 1R0ZA 5CT8A 3RYCB 4GOKA 1S2IA 2OK8A 4N8EA 4GX0A 4V3CA 4WRRA 3UBMA 1MO3A 3OPYA 1X1AA 4L27A 5C9ZA 1DC6A 1BQ4A 2P3QA 5JD5A 1NY6A 4LHSA 1MAVA 1IZ7A 3EXEA 1NA5A 4G5FA 5L40A 3ER8A 3GLHB 1O6FA 2AMLA 2JHPA 5JE8A 4FXOA 4FYHA 4ZODA 3A32A 1ACMA 5JTTA 3EGXA 3ICOA 2EZ4A 4IZIA 2PSEA 4CCSA 4G2NA 4KJXA 4NBLA 4OLJA 2IEAA 3SM3A 2FW7A 2I1QA 3BZUA 4L8FA 4S1OA 2IF0A 1CJBA 1RAGA 2P27A 2FY8A 2RB4A 4Y2YA 3X1XA 3ZKWA 1W581 5FUQA 3BIJA 3LLVA 4X3CA 1HETA 1INLA 2HI0A 3EMBA 3ADCA 2PFSA 2AE1A 4NYIR 4JROA 4RL4A 4G0WA 1BS2A 4N9QA 2O14A 2J0QA 1ZMTA 4G65A 1LK5A 1FFWA 3IQDB 4KSYA 3H99A 1E9VA 3SBOA 1ML3A 5AKEA 2O8BB 3LPMA 4DABA 3BZBA 2GB4A 4FFPA 1AZTA 1M1YE 2BFFA 5ALKA 2CBGA 2KHZA 2HRRA 4C2TA 1HFEL 2V7PA 4ZU1X 1S01A 3CKMA 1JXQA 1UZLA 3KOUA 1N2GA 1ZAKA 2QUZA 3KOOA 4EGSA 5L4LA 1QDLB 1Y7TA 3FTDA 3UFBA 3G5LA 4HDQB 3AY6A 4YQYA 3VR2D 1ST2A 3RWMB 2GO1A 4BVBA 3CNNA 3IV7A 4DDMA 1Z6YA 1ULBA 3ZW8A 3QA9A 4Q7EA 1PJTA 4PIPA 2X0EA 4P33A 2OSVA 1ZGBA 4Y6GB 2ZBVA 1F6DA 3E7XA 1ZI9A 5EWJB 4RWEA 4D9JA 1Z9BA 3AU8A 4JVNA 5JV5A 4UHBA 2IODA 5KYWB 4PY2A 1ZEJA 4POAA 1GZ5A 3EYAA 4DCMA 3AVPA 4N9WA 3QY0A 5A6SA 1JILA 4QOHA 1B8NA 3LWBA 1QVAA 1T4BA 4D0SA 2H3HA 4BE9A 1V3QE 3BRCA 4M37A 3O9ZA 3IHTA 2OKGA 3T9EA 2R87A 2ZUEA 5K01A 2H4WA 1G3QA 3ILHA 1EK5A 9ATCA 1FPMA 1GGKA 4EYQA 1LS6A 1YVEI 4BO9A 2AB0A 2FQQA 1D4FA 3FCAA 5AUOB 1FDIA 4LAFA 4CCAA 2Q29A 1RLUA 3NETA 3IERA 3L41A 1U99A 1H2BA 4NKRA 2QJTA 3M6VA 1JE1A 5LWHA 4B87A 4Q66C 4F71A 3KQUA 2I2BA 4CMIA 3BE4A 4BNHA 4X6XA 3B7PA 4ODIA 2CUKA 1RC8A 4FJ2A 3GEIA 3EJWA 2IXTA 4YP9A 4AYTA 3J81A 1WZUA 4I5EA 1Y6FA 1DAMA 2QL5A 2NM0A 3L49A 5JYDA 2J9YB 3A0UA 1T2VA 1V8OA 4TMWA 4DVJA 5JH7A 1UDXA 4YGYA 3DLPX 1YBAA 3OZEA 4ND7A 5IAJA 1KQNA 1X19A 3VNAA 4EARA 4DEXA 3H17A 1IBRA 2WYOA 4MRRA 5I9NA 1WRBA 5D5PA 1RLIA 1RWWA 2V5VA 2ZE6A 2H7YA 4RQTA 1YA4A 2VAPA 1G3MA 2IHYA 1Q11A 2PX2A 1L8XA 4FYPA 5BQOA 3VR6D 4B6FA 5LYJB 4KYTA 1KQFA 1T9CA 1FVHA 4WKCA 1V9SA 1KI8A 4JWTA 3M5CA 4PBTA 2NU8B 2JFPA 2LE0A 3PTZA 5M5BA 3PFWO 1MQAA 4KV9A 3W8NA 4GC5A 1E3JA 1Y8RB 3CR7A 4C0QC 4D8TA 3T5TA 1XCOA 1O94A 2Q5JA 3STXA 4J4HA 1Z8HA 2RJOA 7REQA 4TYNA 2FR1A 2QSZA 5C1PA 4FHFA 1NW4A 4LG1A 4B17A 1F6BA 2A14A 3RVSA 3AI3A 3K30A 2PWAA 3GT0A 3A70A 1NU6A 4QEZA 3R5TA 1QNFA 4Q3KA 3TEJA 1XV5A 3IYLW 2OLEA 3TLMA 1IVSA 4JOSA 4G4SP 4K6KA 4Q1BA 3VTFA 3MTAA 2ZRLA 5KAPA 5HOEA 3TUJC 5JQGA 2R7KA 3KQSA 4QNMA 3C3WA 3V8QA 1TTHA 4MUYA 1XXHB 3KKEA 4LSMA 4F46A 3HI6A 5K0BA 3RVNA 3OJEA 4B6PA 3SD7A 5L3SA 1Q1EA 4I81A 3JVVA 4GSYA 4KQHA 4TLAA 1FFGA 1K0UA 3ZU6A 2D06A 1UFVA 1ZSVA 3LC7O 4QWMA 2X9GA 3GJRA 4O33A 3RYFB 1BVYF 2BFBB 4XLTA 5CB4F 1VLVA 3U3OA 2IBTA 5GGYA 4OJYA 1AXGA 2DQSA 1UM9B 2GAIA 2J9XB 2YYYA 3ORYA 4I1YA 2ZI4A 1QF7A 4JFAA 5ALDA 4DLZA 2CB9A 3CZCA 3BN3A 1U3CA 3O90A 4MQ5A 4B44A 1DIAA 2PWBA 5A4DA 5IT0A 1SQ6A 4ITRC 4D8UA 4LJ5A 3D6MA 4QFDA 1DIGA 4FYKA 4ZRDA 3V4PB 5A4JA 4LV8B 3U49A 2UKDA 4QBTA 3CUTA 5F12A 3AEXA 3OT4A 3B6JA 3KQWA 2NU7B 1G41A 1NQUA 1PD0A 1EQUA 2ANCA 4D4KA 2E4UA 1ZCJA 1YDEA 3UJPA 3L1HA 5F4ZA 2XGMA 1ETHA 4OLBA 3O93A 3GRZA 2RJ3A 2VTBA 4NPAA 2CL0X 4WKGA 2PRJA 4DN6A 3KEOA 1E3MA 4PCLA 3SHFA 2F1RA 1QANA 1J0XO 4NZYA 3ZNQA 3MSCA 1Y4DE 2G6BA 4RWZA 5A4AA 3EZYA 5T6BA 5TGTA 3IDOA 5C35A 2PXCA 4KNYA 3GPLA 2IH4A 2B1GA 3DBHB 1ZJ4A 2EBUA 4LOLA 2PT7A 3FCEA 3QE4A 4LJSA 1E9RA 3UJHA 1BAPA 4ER6A 1IHXA 2VTKA 1JR3E 3H9UA 3WYAA 1TA9A 3JQBA 4BZQA 4DR3B 1WUHS 4TN1A 2C2ZA 3K0HA 3ZY4A 1OILA 4ESEA 3B60A 5A5GA 5B3LA 3GMSA 1VJ5A 3NUQA 3R23A 3LUCA 3R2JA 1Q74A 1LVGA 2ZT5A 2GZSA 4OGKA 4ACAA 4W5QA 1NW9B 1XQYA 1KY2A 4RKRA 1F2DA 1PT6A 1I3NA 2BFMA 3ETHA 2YIJA 3FOCA 4MYDA 3RASA 1FFAA 1XKLA 3OLXA 4V39A 4O3FA 3VVCA 5K51A 1WCIA 2I54A 3AM4A 4W8HA 1GRRA 2VPIA 1GG5A 4HLNA 1R4MB 4MXDA 4B34A 1V5WA 1MJFA 2DGDA 3SR0A 3NHPA 3VGPA 1U0EA 4S3MA 2CXSA 2YWFA 2ZYAA 3ZTWA 2E48A 1F2TB 4H7HA 1DFIA 4C7VA 3P2IA 4F92B 5FFMA 2QX4A 4WZ6A 3KQTA 1GRCA 4NECA 1G20B 4QLBA 1XN1A 5I9BA 3SC2A 4BWGA 3KZVA 3IVMA 3DC7A 3KUUA 3JAMA 1ZNZA 3I8OA 4OXYA 3AF5A 4FX5A 4IIBA 1Y1TA 2WZCA 3OFKA 2EBFX 3E15A 3CLSC 2Q49A 4HNHA 1RE1A 1M6VA 1GL3A 2BZGA 4GBED 2I2AA 3JVIA 1A88A 1MOSA 1Z3IX 4R8MA 4A03A 3ZWWA 3EK2A 4E03A 1EFPB 3BF7A 3LE8A 4FQ5A 2PX4A 2SKCA 1E79D 2DHRA 1P5RA 4QARA 1N92A 1S3IA 1KH1A 3SJZA 5JVDA 3UNXA 1Q0RA 2ZYIA 1MQ8B 4HYEA 4IFBA 3N9IA 2BI8A 2GHTA 4TX1A 4U8HA 2X1LA 5FNVB 1TF5A 1Z6GA 4TMVA 1OBHA 1NVVR 3A26A 2EJUA 3K94A 1XJ5A 5H70A 4TRNA 3GXOA 3LNTA 2JBHA 3OEYA 3EIXA 1EZ1A 2VAWA 1L4EA 3WDLA 4BN5A 2JHFA 2V74B 5FUXA 3ZW9A 2VNAA 3MSXA 2G80A 1IE3A 1R8YA 4AXBA 1UMKA 2JKZA 3A9UA 2PS0A 4H77A 2VF5X 1GHTA 1RSZA 4PFQA 4OQNA 1YULA 4PO3X 3W77A 1KHHA 2P3LA 1Q1GA 1D1SA 3FD8A 3ILXA 4IKOA 4RK6A 3TPCA 4GP7A 5A0VA 4RF3A 2Y3IA 3M4XA 1JXOA 1WQ1R 1T3ZA 2DQZA 5JLAA 5FRDA 4EMTA 3GBPA 2O1EA 3M1AA 2ZM6B 5F98A 4DR1B 1RQ2A 1RKQA 4WESB 3M4ZA 2DOKA 1TVEA 2VUSA 3PXGA 3HP1A 5BN3A 3FRJA 1F8GA 1SKYE 3S4YA 4DMLA 5CBKA 2F55A 1SHJA 1D6MA 5KB3A 3NKFA 4ID3A 4BB5A 4ALKA 2OQVA 1ODFA 1UP4A 3G0CA 3C4VA 3CZAA 1SVNA 4W5RA 1PGQA 1W47A 3CCFA 4TT3A 4L7VA 3O0TA 1NMXA 3JZMA 3ZEAA 5JS6A 5CYOA 2AFIA 1CSEE 1TU4A 2A5JA 4NDAA 2Z1NA 4A26A 5HZGA 1NDUA 5KCZA 1NPYA 3G5UA 2QN6A 1P44A 2FUNB 3ZDEA 1XRJA 3H2ZA 3H9JA 1TJ4A 3V4LA 2W2PA 4YO8A 3TVDA 4YMHA 2DPMA 5J3JA 4MW2A 1CLEA 3ETGA 3CQ9A 3EODA 2WA2A 1RM4A 1S8FA 1TMYA 2PMFA 3QPCA 1B26A 1NKSA 3UATA 3LWZA 1BFKA 3N70A 2DF8A 1N6LA 1WBJB 3MFYA 2GK6A 3KT3A 4NYMR 4BFSA 3HP7A 4H1HA 2WHEA 2X7JA 1CQJA 2DWOA 2RK6A 5EXTA 2ZIZA 1IXZA 2AI3A 3NHYA 4XWGA 1LRJA 4OGWA 4S0ZA 3Q3VA 3FDIA 2A0UA 4ERNA 1NVBA 1WDMA 3PU6A 1GY8A 4GOMD 5BT8A 4FI3F 1JVBA 1U3FA 3BHJA 5LA6A 1RQGA 2AXNA 2YYZA 4UATA 3EAQA 2RCNA 4UZFA 4CF5A 5K05A 1ZD3A 3OY2A 4E32A 1XRNA 1RKXA 3ROQA 2HKIA 3DL7A 3H5AA 3LFHA 2HHJA 4QG3A 1FP4A 3JAWB 2QN1A 3A4MA 3GY0A 1ZNXA 4B46A 4HQLA 3CJRA 1U6JA 1Z0ZA 2PQMA 1VL1A 1E6LA 4I4NA 5CH8A 3D81A 3WB1A 2E4WA 1HNZB 1ZW6A 4KQWA 3S3TA 3V8VA 3VQTA 3KBBA 3H9GA 3QE3A 5SV2A 1GL9B 2IW1A 3L6UA 5EIOA 2CE7A 1RAHA 3B1WA 4KR7A 1E7YA 2JI4A 3SYRA 2I2WA 2GA8A 2BUBA 2RAPA 1E1LA 5I6DA 4RTNA 2HA2A 3AY3A 3DE2X 3I73A 4D02A 2DMRA 3JQCA 2R11A 4O2RA 5JCJA 3SR3A 5CA1F 2AOUB 4YDQA 3R44A 1XTJA 1NATA 2Q5OA 2QAJA 3ELUA 2YOGA 3DFFA 5H59A 1PEKE 2BGJA 4JI1B 3UGTA 2PGJA 2VSNA 3L18A 4P83A 1I10A 5J5AA 4DOMA 2WNHA 2Q6VA 4D97A 3ED5A 2PO5A 3KZ1E 3PUJA 4TMZA 3TLCA 3GCZA 4HDNA 2FMHA 2RCYA 4F9FA 1K88A 4ZGWA 1DQYA 1JQDA 1HE4A 4FHGA 1T5TA 4B75A 1TCBA 2P6UA 3DOOA 4RCVA 1NG1A 4C0HA 1I01A 1JHYA 4G37A 1TA4A 2QTTA 1KP3A 3V55A 4FI3C 1E3WA 3P9NA 4WXPA 4AICA 5HJ2A 3ZCVA 3EPKA 2H0AA 3FLAA 4FFDA 5M2QA 6ADHA 4BNGA 3BMQA 1DOHA 2P77A 3EZFA 2AXQA 3S2ZA 3I32A 4PR0A 5I3ZA 3SZUA 4PPGA 5FLKA 4LJLA 4JELA 3BDIA 4OSPA 4YCBA 3PEWA 2HWYA 2XV1A 1EVKA 2LDBA 2C3MA 2P2SA 4PVCA 1JB1A 1GUBA 1WW2A 1OA1A 1DO8A 2Q5LA 1G18A 1E2PA 1NXQA 4TZTA 3PXEA 5ALXA 4RDIA 1U3VA 1JQAA 1N5RA 1O94D 2XQIA 2FFAA 1JFRA 3ZYZA 3VU8A 4QZVA 2YW2A 1J90A 3VKVA 1YAHA 2Y71A 1SUAA 2GETA 1OCEA 1DWUA 1JDTA 3OJCA 5TMEA 4BMZA 4A15A 1QQAA 4MMZB 4NNOA 2G9RA 1FS6A 3PSHA 2AHRA 3LBHA 4NAVA 4RFSB 1DXOA 1WB6A 2A9KA 4JOQA 5CDYA 1XRRA 5F9FA 3QW4B 1NMZA 2H16A 3MBOA 1X7WA 4UFOA 1ECCA 1RDFA 3ZE9A 1XNHA 1MIOB 3F0TA 4B4KA 3M6XA 1CT9A 2WSSA 5DHPA 3D9QX 1VGQA 3IVXA 5EKSA 1SCKA 3UZUA 4FZRA 3NAZA 1XCJA 1FLVA 1L7QA 1V11A 4JC5A 3OQIA 4OHRA 3ZTTA 5B7PA 1XCGB 1WU8A 3EULA 3ZK7A 1FX1A 2VR1A 4LZWA 4F4UA 1F1JA 3IEUA 2BONA 1ZJJA 1JXMA 1GZSA 4YCLA 4R8SA 3WI7A 2ZANA 3CU5A 3JQ6A 2JGIA 2FJ0A 1H6AA 4JJGA 4RETA 3MFQA 4LGYA 3T54A 1V2GA 2V8BA 4HR7A 1ORVA 1L5MA 2GILA 4WOBA 4BZZA 3M9LA 2DECA 1N2BA 2VYQA 4RLFA 2P9JA 3TTUA 2CNWA 4RTPA 2FE4A 2X4DA 3GNSA 2JBAB 4XYGA 2A5DA 2AJLI 3N8IA 4Q9KA 4DUGA 4LWZA 1M8JA 2G04A 1X8XA 4DMHA 4YAJA 2VZ8A 3ND5A 1XZJA 2RC6A 3U3XA 3VR4D 1KI3A 2X0NA 3DBLA 2ILTA 5EJMA 5FWNA 1DCTA 4IHJB 4UARA 3NASA 4ZCPA 5DEOA 2EBHX 1M67A 2PLFA 4GICA 5EKDA 3TIIA 4E2WA 1MNQA 3W78A 2X6QA 1JG6A 2GEFA 4G0NA 3EEBA 1HBJA 3F2IA 1VKOA 2FZCA 2HJVA 1LI4A 3KLBA 5FUBA 2V03A 5B3AA 2P5YA 4N47A 1IJEA 3T0IA 5A3JA 4R16A 1OWPA 2R62A 3MK31 3TSCA 4CL8A 4LZNA 4M9RA 2GZAA 2OFFA 4OUDA 1TJ3A 4NFLA 2O59A 4PWYA 1TDJA 3H0CA 2H9IA 3G6WA 1TGVA 2OK7A 5KQPA 2A1IA 3VAAA 5DTEA 3EZGA 4A0GA 3W90A 1UP7A 3LPLA 4MV5A 5TIIA 1Z37A 3F6CA 1K3TA 3K0FB 1FB5A 5CVVA 1R00A 3I9MA 1YMVA 4UREA 5JAPA 3HVKA 2AJ8A 5BQ5A 1ZIXA 3G7SA 1ZXLA 4PYIA 3UOGA 4U5QA 1QRDA 2ZSDA 1AXRA 5EHIA 2I3ZA 3EFHA 3VH4A 2ZRAA 3DWFA 2WD7B 3C39A 5DWQA 2WVAA 1KFEB 1XVVA 2ZUTA 3SC3A 1U28A 2QW8A 3K3PA 2OENG 1QHIA 1X77A 1Y48E 3RAJA 3UQYS 3VZRA 4PC1A 3NYIA 4HNSA 3D4LA 1Q1ZA 2EP8A 2IUFA 2YFYA 4Q3DA 2IV3A 1K98A 2R8PA 1KMCA 1YI0A 3SFTA 4RHFA 4A1FA 4ENPA 3A3PA 1GFIA 4J90A 2YQ4A 4CHTA 1QYXA 5EMNA 2CCKA 3IEVA 5DNCA 1FCJA 3F7OA 3LP6A 3MLEA 1GR1A 1T4GA 4L0MA 2GD2A 3TDMA 5E6UB 3O8QB 5KSPA 4W1PA 3N8GA 2WF7A 4PQGA 4BWFB 3S81A 1POXA 3SCZA 2BMJA 3G9TA 1SKBA 3NAQA 4RA9A 4B35A 2AOTB 4QXMA 2GN8A 4IG4A 3LT1A 4KK4A 5IC5A 1Z12A 1JZQA 1NI5A 3KPUA 2PUAA 1N7JA 3FPGA 3T61A 3V1UA 2XCQA 5FOXA 1IU9A 1PJLA 2EL9A 3UKDA 1YRQA 1Z0IA 2EFYA 4ZJUA 2QRLA 4MQFA 2JW5A 2FR8C 5CNMA 5IP5A 3N0RA 4URXR 1HDRA 1GG9A 1QYRA 3KVRA 3FW1A 3T6KA 3ZWYA 5BMVA 3EVDA 2EHJA 4I1VA 4KN9S 4NMHA 2NUTB 3X1JA 4DDHA 1J23A 1VHLA 4JL8A 5JADA 2B7CA 4L51A 3H5OA 4QGFA 1SGWA 3RVOA 1I4DD 4MVJF 1OB5A 3L7MA 3NDIA 4OPMA 4DT1B 1V43A 2PX3A 1JIJA 2FPLA 3G2OA 3JVUA 3L7NA 2FLVA 4Q21A 4UM5A 4XAQA 4PZUA 3IAM6 1ORHA 1CNMA 4YJDA 3PXBA 1GO2A 3RUEA 3LT4A 1U2TA 3IBTA 4BQEA 2QL7A 3UAXA 1LGYA 4EW3A 4M1OA 1X9GA 3CN7A 3H65A 3KLNA 1JHXA 4DTCA 5F23A 1K66A 4X95A 4CUJA 1Z4QA 4J16C 4QRHA 1HORA 1MB2A 2J5RA 1IIBA 4TKVB 4LOAA 1N5MA 3U1VA 1F1BA 4PC3A 3O3CA 2XZDA 3INNA 4X20B 3VBEA 1CUBA 5EE9A 4QKQA 4ES6A 4HDRB 1C4KA 1RTKA 4K3UA 1GITA 3L1JA 2JIDA 3MJRA 4H27A 4QYXA 5IVHA 2CV2A 4EPYA 3MM4A 3OTOB 4EHNA 4ROTA 3ZGYA 4ZI3A 1IOZA 3WRXA 2P7HA 2RHCA 1QG0A 3GCGA 4QT0A 1JDBC 3QLUA 3WNVA 3LBFA 4FT4A 4JOBA 3W5IA 3T41A 3ZE0B 1AUOA 3KSRA 4CBVA 2B4AA 821PA 3U44A 2OVBA 1QRTA 3IS3A 4KRXA 4G41A 5AKJA 1FX0B 1XL1A 2HV8A 4LKRA 2AG6A 4TT3D 1X1DA 2W83A 2B1JA 5ESXA 5G0WA 4G5QA 1U8EA 2FQ1A 1QR6A 4J1SA 3C4JA 4OHCA 1A2BA 2BI4A 1QTQA 3S2YA 2YWGA 2XNDA 1AKNA 1CULC 1MVOA 1RXSA 2VSXA 2ZVPX 4JP2A 4R05A 5K0JA 1WDTA 2X2OA 2YHIB 4QXAA 5EP3A 1QYVA 1JKXA 1MEEA 4L8LA 2PX5A 4DBVO 4B7CA 3REQB 3QWFA 2GRJA 2P69A 3U9TA 4KGXA 3NG1A 3B6EA 2C84A 4QTYA 5IN4A 2RGRA 3DBRB 4OLFA 4WFIA 4B45A 1WZ2A 2ATCA 3LUJA 2BEVA 5JCOA 2Z5VA 5KYUB 2RBKA 2VCYA 2CZQA 2EFDB 1BU5A 1E77A 1CDZA 4EJMA 1QTIA 1WG8A 1P0QA 1Z5WA 3UT6A 1OKKA 1ST3A 2HMYB 4EPTA 4DL9A 5CT6A 4OHUA 2FLWA 3QUTA 4ZZ2A 2ECFA 2OHVA 2UYOA 3M82A 1N6IA 4HEJA 4BLTA 5IJZA 2YWRA 3BL8A 4DYHA 4I8XA 5AVWA 1VJTA 1S5PA 1N3IA 3BXPA 4QYWA 1TX4B 2Q2OA 3PNYA 4AW9A 2GRUA 4J0KA 4C7OA 1XUOA 4WQMA 1VM6A 4R9SA 4TSKA 2W42A 4L6CA 2MOKA 2GDJA 2OORA 3HA3A 3EXFB 2IEBA 4KAFA 3RS4A 4V0QA 5FV4A 3B1YA 4JU9A 3U3DA 4B8WA 5BN4A 1E2DA 4K6OA 4X6UA 2ONJA 3GRCA 1EG7A 1MF7A 2I76A 3VC1A 5CAEA 1JQLB 3PENA 1G5IA 1XJCA 3AJ8A 3WXMA 2PH7A 2XW6A 1CJSA 4R01A 2ZAIA 3VYTB 3TVTA 1L4HA 3A3NA 3FGPA 2C54A 3I4CA 4B3SB 1N2CB 3AI7A 3HXKA 2HRZA 4Z4HA 5JCJD 2BFPA 2JAWA 5TXGA 1GKLA 1TE2A 3LY5A 5JDIC 2JGMA 2FP4B 4CPDA 1HYEA 1MAHA 3C6MA 2X41A 4FEYA 1UK9A 4GWGA 3LAWA 5CIWA 5MN6A 3MLAA 2X8WA 3IKLA 2HU2A 2YJ6A 3VR1A 2QPTA 3KOYA 5DE3A 1V45E 3C3MA 4ZVKA 1KO8A 1E1YA 4DS3A 5KX5B 3WLAA 2OXCA 4D9HA 2B30A 1M3SA 1P7WA 2QN2A 1NI4B 4NENB 5HBGA 4Q19A 4N7BA 3MJDA 4X3PA 2MTBA 5IKOA 3SF8B 3R5HA 1Y9AA 2VDLB 4EG5A 3BD8A 3RGWS 2XAUA 5FBWB 3W8FA 1OAOA 3ECSA 1LBEA 1M6YA 1PUXA 2Y1WA 3ITDA 4BTEA 1VPTA 4DTIA 1LDMA 3QOYA 3FAZA 1K75A 3O8OA 2RK3A 4QDUA 3SDZA 2QR2A 1ZJYA 5KINB 4LHWA 5TQVA 4ZYTA 1J0BA 1V6AA 5BW8A 3ZGZA 5JJBA 2PAFA 1VGVA 1OU4A 1W75A 5JSZB 3P9PA 2VLBA 4JFRA 1VLJA 3GEPA 3X3HA 4AJ9A 4HNUA 1ZPDA 2Y67A 4MGYR 1OFIA 4XM2A 4EW1A 2FU5C 2CSXA 1NM5A 4IZ6A 4HEA6 1EQ2A 5G3ZA 3WGNA 1E60A 3ELWA 3IO3A 3LQ1A 1NBME 3TD2A 4B4UA 4HNVA 1VL8A 2IU6A 4LOKA 2C5FA 2GCGA 4XYBA 3KXKA 2XCTB 1A7KA 2QX9A 1AMUA 1US8B 1JLMA 1TVCA 3CXRA 1CY7A 4O4LA 2R44A 3A05A 1JMYA 2WAOA 3CNLA 2BFDB 1DO2A 2ZVJA 3GVIA 4IHAA 3WMFA 4TYWA 1B4DA 3PE4A 3STUA 4JVSB 1GGJA 3PKZA 2XUHA 4LRQA 2CUZA 2WSSD 4IHKA 2C29D 1C9NA 3R74A 2PH1A 2MINB 3CVYA 1X92A 3IIIA 5CA0F 1AJEA 4MUJA 4DB2A 2NV2B 3FZEA 2FI1A 1T1RA 1W4AA 2I4MA 3COVA 3Q7SA 4FFWA 2NSJA 3CLTC 4C1NA 1M7HA 5BOSA 1LSUA 3HB1A 3LX8A 1JIUA 2BWJA 2PX8A 3A6DA 1MX5A 1SA0A 1W4LA 2R86A 2QTGA 2WAYA 2J3MA 3E22B 2NO6A 4L15A 1T1SA 2ORWA 1QIJA 4NCAA 1BFDA 1G291 1UXHA 1RRKA 3BTSA 2OILA 1SCDA