3MILA

Crystal structure of isoamyl acetate-hydrolyzing esterase from saccharomyces cerevisiae
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
240
structure length
240
Chain Sequence
MDYEKFLLFGDSITEFAFNTRPIEDGKDQYALGAALVNEYTRKMDILQRGFKGYTSRWALKILPEILKHESNIVMATIFLGANDACSAGPQSVPLPEFIDNIRQMVSLMKSYHIRPIIIGPGLVDREKWEKEKSEEIALGYFRTNENFAIYSDALAKLANEEKVPFVALNKAFQQEGGDAWQQLLTDGLHFSGKGYKIFHDELLKVIETFYPQYHPKNMQYKLKDWRDVLDDGSNIMSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Isoamyl acetate-hydrolyzing esterase
publication title Crystal structure of isoamyl acetate-hydrolyzing esterase from Saccharomyces cerevisiae reveals a novel active site architecture and the basis of substrate specificity
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 93
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3milA00
4I8IA 3DT9A 4K7JA 3MILA 4JJ4A 2Q0SA 4Q7QA 1BWQA 5BN1A 2WAAA 1JRLA 3U37A 1FXWF 3SKVA 3C1UA 1ES9A 4Q9AA 1ZMBA 4S1PA 1V2GA 1YZFA 4LHSA 3BZWA 3DT6A 4HF7A 5A4AA 4NRDA 3RJTA 4XVHA 4JKOA 5JD3A 4K3UA 4K40A 3DCIA 4K9SA 4JJ6A 5B5SA 1ESEA 4TX1A 1IVNA 2WABA 1K7CA 4OAPA 1VJGA 1J00A 3PT5A 4PPYA 4IYJA 4DEVA 1Z8HA 2O14A 3P94A 4JGGA 5CD9A 3DC7A 1BWRA 2W9XA 2Q0QA 2HSJA 5HOEA 2VPTA 3DT8A 3KVNA 1ESDA 1ESCA 3HP4A 1PP4A 1VYHA 4RW0A 4RSHA 2WAOA 4JHLA 3SLRA 4OAOA 1DEOA 1DEXA 1WABA 1FXWA 4HYQA 3W7VA 1U8UA 4M8KA 2APJA 4H08A 1BWPA
chains in the Genus database with same CATH superfamily
2DJIA 1OYYA 4PCLA 4DM7A 4X91A 3RHFA 5ALHA 1QFMA 2A58A 4EB8A 3NBXX 3B2NA 4I46A 3TLZA 1IPFA 1L5OA 4LI0A 1N2CA 4ZV9A 2GXAA 1SELA 2IKQA 5DGCA 3U56A 2QR5A 4GOKA 2O50A 4OFWA 4HRYA 1YVEI 3EZGA 1M1XB 2C5HA 1JG1A 2WG1A 2OY0A 4XUGB 4PCAA 3NBUA 1ISGA 3EGCA 4OXYA 1KZ6A 1P74A 5JI2E 2HWXA 1OXBB 3EXG1 3AOGA 1FMLA 1Y7LA 3KKMA 4P3YA 4PHFA 2BJHA 4FZ5A 3TPFA 5TT0A 4QDXA 2HHAA 3NHWA 4KXWA 1F0KA 3LY9A 1SH7A 2WM8A 1G21A 1W4BA 1YZLA 4EG7A 5C51B 1NG9A 2P0AA 1WDMA 4ZOLB 5K3FB 1DADA 1QMGA 1YBFA 3GT4A 5G02A 2P79A 3KC2A 2HF7A 2WWYA 3OY2A 3B36A 1QDEA 3TUJC 1Z2NX 5MF6A 2F3QA 4O59O 3ZZ1A 3OM1A 3WA6A 1F8YA 2G5GX 3LK6A 4ZEVA 2FPIB 1GZDA 3H9BA 4U2DA 5H3LA 3PE4A 2VTKA 2YDXA 1QYXA 4TXLA 5DEOA 3G2NA 1EHYA 2VH5R 3LLVA 4GI7A 4J9UE 5FLXA 4MYSA 2VJAA 3L7CA 4E09A 3K0CA 4ALLA 3JX9A 5B5SA 2O2IA 3R0QA 1FLVA 2BI8A 3SDBA 3F5FA 4WADA 5CAEB 5IK2D 3EUAA 2YHIA 3BIFA 1X7WA 1GU0A 5DCWA 5I8WA 4K9MA 3AQ4A 4OH1A 4PEVA 3AWDA 4RF2A 4KWHA 4EBBA 3Q6NA 4LE1A 3PE3A 4KKXB 4Q3BA 2QDXA 1K5HA 1KC1A 2AL7A 1EFDN 3PT5A 5EWLB 3UCFA 1KI6A 3GJRA 3QA9A 4AJ4A 3OHMA 5LZ2A 2VWPA 2ADFA 4PU0A 1GRQA 1QVRA 4V38A 5JS2A 5LBUA 1NMZA 2R8RA 3OKPA 4L95C 4FOPA 1KPGA 3BD6A 4LGYA 1NLFA 2O2ZA 4Z4FA 2CFOA 1CEQA 5B1HA 4JLDA 3ZEAA 1BFKA 2C4VA 3IAHA 1BCRA 1KSHA 4QYIB 5F1KA 3RWOA 2GF0A 2ZLBA 4RZUA 4QFMA 2IRWA 5H02A 1YE5A 3QLJA 3IAAA 4RQBA 4B44A 4REQB 2QW1A 3AY7A 3IT2A 3MUFA 2CL0X 2VP9A 2XUPA 1W4RA 5F7ZA 1I2CA 5AT1A 2NYRA 5LQCA 3G0CA 4KO8A 1ZAYA 2OSVA 3GB9A 5KNCA 1E98A 1N3LA 2ZIXB 3DTTA 4HMQA 1W46A 3MWJA 1ML3A 5EZYF 1U3UA 1ZN2A 3KVRA 3G5LA 3JYQA 2B1RA 1MVNA 2QG6A 3CKMA 3QPBA 5TMEA 2FW7A 5L9AA 1U5AA 2GCIA 2QI9F 5B3LA 1NI3A 2I8AA 2NO5A 3QBJA 4L78A 1H8HA 3H5AA 2R79A 4WCFB 3DMFA 3VZCA 3GEIA 1IM2A 4CKWB 1IN7A 2BFPA 1O6GA 1M7BA 2PO5A 4BOYA 8LDHA 1FFAA 3G2IA 3MFYA 3X44A 4NZNA 2DRIA 2NT4A 9ABPA 3U19A 2OUKA 5KUTA 3RRMA 1NW5A 4DG8A 1YDMA 1TADA 1TEZA 3JQ7A 1OFHA 5EI5A 3TW8B 2YHUA 2YN0A 1X80B 2O8CB 2YBDA 3LA8A 1J1ZA 3MYYA 4QARA 1UXGA 4JYMA 1NY6A 3M8KA 4D46A 4OKNA 4HEJA 1C8BA 1HKHA 1JQBA 2GN1A 5E3HA 5JAOA 5LXTA 1JSZA 4RF3A 5CA0F 3C0KA 1A95A 1T5DX 2W6PA 4ZRNA 1YC5A 3IOYA 2CV0A 4LOAA 2R4TA 2QRQA 3JZFA 1REQB 2AN1A 1TQDA 2IW1A 3WGTA 4BXOA 3WL7A 3OJFA 4AG6A 4BNMA 3ZWWA 2J0SA 1U7TA 2GOYA 4H77A 3FF1A 4KFTA 4JP3A 3U81A 1XHLA 5IASA 2VK4A 4OHOA 2WV9A 2ATXA 2R62A 1XTSA 4HLDA 2PUAA 3G3EA 5JH7F 4WZBB 4BFYA 1QGUB 3WHLA 4QTYA 5K0FA 2CW5A 3KFVA 1P39A 2CLMB 1YFZA 2M6RA 3BWMA 2GPTA 3PXAA 5CNKA 5T4HA 3NCTA 3SSOA 3OOJA 1I4DD 1XYYA 2C59A 4R1LA 3ITEA 1OPXA 4RVSA 1RWWA 2QNIA 3I39X 3VV2A 4BQFA 4KR6A 2IXBA 2I1QA 1BDBA 1SKYB 1WSBA 1Z8NA 5CVVA 4RPCA 5CDFA 1G5HA 2GK6A 3PFWO 3ZHTA 4EJSC 4QNMA 1UJCA 2ZKIA 1FRVA 1YK1A 3AF1A 3BJZA 2D2IA 4L16A 3IHTA 3IQZA 4OQ4A 3MXOA 4KGDA 1K8QA 1N1EA 2B8NA 1KE1A 4ABYA 3H0EA 3H2GA 4LTMA 4OU4A 3T7KA 1NW9B 4DG5A 3LUHA 5CDSA 3IP8A 4W5TA 5J47A 1LLFA 1UM9B 4FBLA 3OQVA 4XKJA 3ZWYA 5JSQA 1KWKA 2EJWA 4XD7A 1CS4C 1NW8A 3C7CB 3Q0EA 4I4LA 1PDVA 3RIXA 1E2HA 5EJ8A 3CVJA 3L7BA 3VYUB 4PRYA 3OF3A 2YS7A 5DNUA 4MJ3A 4ARZA 1T0UA 1HF3A 1Q2UA 5DNDA 3WMEA 2PVCA 1LF0A 3NWPA 4N8EA 1DWOA 4J90A 2PE5A 3BMNB 4OJNA 2RHDA 3NT5A 1A72A 3QRWA 3V7WA 4Q9HA 3JYHA 4OJQA 4ZT3A 1R66A 2JIZD 3V1UA 1L3IA 2WIBA 4QTXA 1NPTO 3D7LA 3AUJB 4P08A 3EFEA 4RS4A 3SAJA 3KQSA 1Q0RA 4P80A 1RXEA 3DT8A 4EI9A 3AGPA 4QA9A 5CFPA 4MV3A 1AT1A 4K1LA 2KLBA 2G07A 4NL4H 3DCYA 1TQHA 1BKYA 4K6GA 3K1ZA 4IGFA 2XYRA 3HP4A 5C8YB 2J5RA 4GBMA 2OZKA 4HY3A 5LMCA 1P9OA 4D0LB 1RIFA 3B8HA 2HUNA 2YASA 2Z2KA 2PMCA 3VZSA 2WWFA 3DMRA 1VKRA 3KWMA 1ACMA 4H7HA 4DDHA 1GNVA 4UEJA 1X87A 3HYNA 2QNBA 4IHJA 4YQYA 2CLSA 4MX8A 4X3OA 1XRLA 1J07A 2D1YA 3MT0A 1FPMA 2CYAA 1IHOA 1TW3A 4YDHB 1UOEA 4NZ9A 1P9WA 2YJTD 4LZWA 1QIDA 3WQQA 2XT0A 3C6KA 3FUVA 1ULZA 3HJGA 4D9MA 3DV9A 4MW1A 4BWYA 1SVOA 4LOLA 4ARUA 1AUVA 2Y4OA 4XUEA 2QG4A 1ZNWA 2CZCA 1USKA 2ZYDA 3AJ9A 3TVYA 3E9EA 2I4IA 2W83A 1B8VA 3FM9A 4KAJA 1AG9A 1GL7A 4DT1A 4UDYX 1P2VA 4CIXA 4E14A 5D1HA 4AQ7A 2TMYA 2XCUA 1PQ4A 4Y9TA 4ISCA 1L7QA 2XDWA 3ZLUA 3EIUA 1O57A 2FWIA 4P98A 3CGGA 3ORHA 4WZAA 2RJOA 3ZHBA 2VPWA 1TCUA 3B1YA 3BZUA 1GGVA 2D13A 3PG5A 4H7EA 4CKCB 3S4YA 4XARA 1GSHA 1XU4A 1RJEA 1CR2A 2Y1XA 4JROA 2QW0X 1L5LA 4PLZA 3FHCB 5AVRA 3EWIA 4NBKA 1BOFA 1N2ZA 4OHFA 4RXTA 3UJHA 4BN5A 1HNXB 3K0EA 5HXAA 2W6ZA 4KFSA 4GZ6A 5CUQA 3DBRB 2V0GA 3NAZA 2EXXA 5EHIA 5JRDS 1CRQA 4FM9A 1FFCA 3AY6A 3K53A 4M7WA 4B5LA 2JAQA 3FWPA 4X8OA 1LFAA 2Y67A 4EI2A 2QE6A 1U0FA 4UE2A 5FPPA 1I36A 3K6SA 3DZ8A 3QYFA 4BO5A 4EJSA 4I3GA 1T3TA 3PGJA 4JOSA 1Y3BE 2WTNA 2ZSDA 2HGSA 4C1NA 2X5KO 3GLSA 1XRSB 2P6NA 2I7VA 3HDVA 3PSHA 3T9AA 3ZI0A 1M2VA 4FXPA 1VZ2A 1AVTA 2H54A 3QM1A 3NYRA 5C1BA 3T52A 5IS2A 1X8KA 3DE1X 1J00A 3E2MA 3I4CA 3NRBA 4JJ7A 3T1NA 4C3ZA 2O7NA 4WZ6A 2W70A 5FWAA 1UFOA 4O3FA 3TEFA 4EKYA 4NS1A 3WL3A 4CMBA 1DQYA 4PGFA 1PJQA 1M8JA 2H4FA 1VI2A 2YWXA 4L27A 4FILA 2ACVA 3R3JA 1SUIA 2ODTX 1E1LA 4AP6A 2VTBA 1JAHA 4JC5A 2NQ8A 5I7RA 3SXJA 1H0RA 1LSOA 4UPEA 2IOQA 3C8ZA 3RYCA 2EWWA 2OCDA 3KZMA 3DBHB 1KY2A 1UBGA 3GYBA 3K0FB 4RTSA 1HMPA 3DNPA 1VJCA 3V4LA 3QE3A 4QAQA 2FKAA 3LBHA 2HU5A 4LHXA 4Q4CA 3OCVA 2RAPA 3LWDA 1QJ4A 3CCFA 3A9RA 5A3JA 4Q1CA 4GR5A 1JV2B 2A9PA 3ZD9A 3L41A 4G0PA 1GA4A 4DJFC 4TGLA 1V8PA 1FL9A 1E6MA 4GRIA 1MH9A 1WMFA 4Q37A 2EOAA 1ZUHA 2C31A 5JG7A 2WWWA 2YCLA 3ISVA 4K3VA 1N5KA 2C1EA 2NSDA 1R7RA 2YN4A 4I5IA 5DNWA 5FOVA 4RTLA 5CDYA 3FGNA 2B21A 5BP7A 2OK8A 4EATA 5JZVA 3FUXA 3GZTB 4M8KA 1FNDA 3EBOA 1SCUA 3TRIA 3BE4A 4OX9B 1Q7TA 4G85A 4FX2A 3G8DA 3BYZA 4JJKA 5K1ZA 4BP9A 5A2QA 3JD1A 4KUEA 3WNVA 2ZAMA 4LE2A 3LKZA 3R0IA 4TTRA 2R1VB 2W90A 3IPAA 3TKYA 5I7EA 4F3NA 2IE8A 4ZCIA 2X3FA 4JB2A 2X8JA 1GUZA 4JGIA 4LQLA 4ABTA 4NMLA 3KOMA 3PXCX 1B00A 5B7GA 5JATA 3U37A 2X9VA 3GLHA 2R8XA 1Z83A 3GT3A 5CVUA 5TGTA 1RI2A 1B2LA 2O5VA 3AR8A 5TX7A 4EUKA 1FXSA 1R0WA 3QKRB 1RXSA 4CHGA 2FQQA 1ZJ5A 3I52A 1DV2A 1CDDA 2WTEA 1YCFA 3TZ6A 2YIJA 2CUKA 3AP1A 4ZCRA 3PLRA 1E9DA 4OGGA 3BHNA 3GPIA 3C6XA 1Z36A 1IQ0A 3NEJA 4HGZA 3VDQA 2HFKA 3UGQA 4MGEA 3UC5A 3VSEA 3OCYA 5A4FS 1E0DA 3LX4A 4M9XA 1XAIA 1Z6TA 3TGWA 5DN9A 1QZZA 1KY5A 1E4OA 2I87A 3DL0A 2B69A 3W7AA 3ZCSA 2QNRA 2PXCA 2BONA 3AEKA 1QCDA 1JECA 1QFYA 3MBKA 1EJBA 5DASA 3TZQA 2PGNA 3WGLA 2H92A 4GX5A 4AYWA 5CB0A 1JT2A 1UJ4A 1AQNA 2YS6A 4NZPA 1HDZA 2FSPA 2WD9A 3PJRA 2EZUA 4FFLA 2EG9A 1QYVA 3KKZA 4A0HA 1JWLA 1CFJA 5FFMA 1G3MA 221PA 3ZQ4A 1E94E 2CLLB 2FG7C 1XNJA 2X23A 3BFJA 3FOAA 4LYFA 4MQFA 3OIWA 1PJAA 2HIHA 3CU5A 3DWFA 3LC2O 4O4HB 3D8BA 5BRJA 4KVFA 4IQ4A 1RHQA 2ACEA 3HU2A 3OJCA 5DNAA 3I58A 1VLJA 1WTAA 3M1LA 1Z34A 2RGNA 1Q3HA 2JGDB 3DOUA 4NOKA 4OP1A 4P3XA 1JLHA 1QVAA 1N57A 2ZQZA 1T6BY 4YGYA 2DAPA 2O7QA 4LJ9A 4EHLA 1IZ7A 2AD1A 4HX9A 1BIFA 3LOPA 4C05A 5BNWA 2QRMA 3L1VA 2X1HA 2JGIA 5EINA 4GM1A 1K4YA 4BHTA 3EY4A 1LKZA 3B78A 3ZDXB 2G8NA 5C5IA 3A3PA 4E21A 2P5YA 4H6VA 1YRYE 2HR1A 1W9MA 2HSWA 1KJQA 2XYQA 1J5XA 1X9IA 1SEVA 4W5QA 2G67A 3GFGA 3LPLA 5HILA 1ZHOA 2Z3WA 3GA0A 4U9UA 1UZAA 1XQXA 2IYXA 5KKAA 4XIJA 1F14A 4AX4A 1ZH0A 4LNUA 1DRJA 5EJGA 2J6HA 1UC5B 3BCRA 4GECA 5F51A 3IOMA 5KEIA 4H15A 2VDMB 4CQLA 1Y9ZA 2A5GA 3AF0A 6AT1A 1GSAA 1NOJA 3CWCA 4BNKA 1BRMA 4JUIA 4KEAA 5T3UA 4IIJA 2IHUA 2Y1DA 5MHTA 4R16A 4EMSA 2G5TA 2WAYA 1YU9A 2BUCA 2EX4A 1C1HA 1PTKA 4J3JA 3U7HB 3GDHA 1T1EA 3GWZA 3EZNA 2K7FA 3PWKA 1YB2A 1ZD3A 2DFVA 1R1DA 4B2LA 1GNLA 1ZSVA 4J2HA 2A9VA 4DUYB 2QUBA 3ZHUA 1QYRA 2AYYA 1ZMTA 2YQZA 3JWEA 4KPFC 4YJGA 2CWWA 4MB6A 1M6EX 3OY7A 4TS1A 3TLCA 1UJNA 2NYVA 3H4IA 3MELA 2ZT5A 1ODFA 4WV3A 3DEKA 1UJ2A 3CUTA 4JLJA 2HD4A 5C1IA 2DHDA 1S4QA 5DCLA 2XZPA 2E0IA 1ZXLA 2RFLA 1WEHA 2P1ZA 1QRRA 2X3YA 3LW7A 3ZWQA 5LD2C 1ZW1A 1KETA 2R1UA 3NM6B 4YMVA 4L73A 3OZIA 1ADCA 1H22A 3K3PA 1VHDA 3HVKA 3LIPA 1IUOA 4IWYA 1TNDA 3ESYA 4W5WA 4R31A 1OFUX 3G9QA 3C7DB 4TMVA 3FNQA 4H4CA 1L5GB 1G8KA 1TIKA 5CR9A 1YFKA 4U3JB 1B3BA 1Y48E 4HAVA 4LGCA 1CG6A 2WYUA 3CH6A 5KTMA 3L0SA 2FAXA 1F06A 2HT6A 2HPZA 3I53A 1XRNA 2YFHA 1DLJA 2BEWA 4X8HA 1DT3A 2OEPA 5DYWA 1L9KA 2FEWB 5EIBD 2B4TO 4D3YA 1ZMOA 3GJTA 2EFGA 2GXUA 3LHFA 1QSGA 4BNVA 1DC8A 1LU9A 5K0LA 5JUWA 3AESB 3BIOA 3KR1A 1D6JA 2CKMA 2H4XA 2IZOA 2WU8A 1CUDA 2VUIB 2QXYA 4X84A 4OGWA 2HHHB 4WOJA 4X64B 2RHTA 3TL2A 4F5EA 1D0VA 3NDJA 1PX2A 4HRVA 4V03A 1QOQB 3RSOA 2PJZA 4JJFA 2ST1A 2SCUA 3WNQA 3ETEA 3LPDA 4P86A 4HFNA 4AP5A 3UT6A 5FA5A 4WGFA 4ZT5A 4FW8A 4AW9A 1SMKA 2JNWA 4AO8A 2IX9A 1EVQA 2Q0HA 1Q1QA 4NBNA 5FNVA 2NN3C 2W11A 2FW1A 3OZRA 2WFLB 2BP7A 5A3VA 3RM3A 2EWMA 1EGVB 4NZYA 4LISA 4L9WA 4BB0A 3ESRA 2RJNA 4WN3A 4F8JA 2ZI3A 1QP7A 1VFPA 1B76A 1DDGA 1DHTA 1N2SA 1RWKA 1UAYA 2YOGA 4I8XA 2YN2A 3S2UA 2Q5EA 3IVAA 3TMAA 1JEOA 1WQ4A 4LBVA 3KO8A 3A27A 4QRHA 2YCBA 4MVJP 1KDPA 4EA8A 2YW9A 5ALZA 1U0HC 3P45A 5KSWB 5REQA 1LXCA 1PF7E 4J76A 5ARBA 5KKCA 1TDJA 1VA4A 1PD1A 2PKQP 2VPTA 3A3KA 1JEQA 4RAOA 4Q7KA 3FMPB 5DSXA 1QF7A 3RVJA 2YXBA 4OPMA 3WLKX 4D5GA 5JYCA 4Z3OA 2Q8QA 4QLOA 4UQLA 4LRQA 4NCIA 1HI9A 3SGLA 4BFTA 5FIUA 3E9RA 2P6MA 2Q5IA 3NDPA 2J3JA 2ZJYA 3D31A 4QEZA 4PYJA 4YJ2A 2WJPA 4OQZA 2FZGA 5FPYA 3ID6C 5G0VA 2TMGA 1EHCA 1XZKA 2EHDA 2VK1A 2WAOA 2WMNB 4P4SA 2H9IA 2AUNA 1SBZA 3COPA 4FNAA 2GM4A 2IZZA 4G26A 2PLAA 3DNFA 4JITA 3WMFA 2DC1A 4TWIA 5B2FA 2GEFA 2ZVQX 5THKA 3SHWA 8AT1A 2IBMA 3IAEA 4NCHA 4EX6A 1AA6A 2ZAIA 3GUYA 4LRYA 4C03A 2LUOA 2WV7A 1D4AA 1P29A 3OA2A 1KBQA 2ECKA 1KEWA 4N3CA 4QOEA 2ZIGA 3SBOA 1CQIA 3B2QA 2OPBA 3HWSA 3KZNA 4DKJA 1KDVA 4ZJYA 4ARCA 2WJHA 3CH4B 2OZLB 1DAKA 1TT7A 1VJDA 1BH2A 1R8JA 1BO6A 2OHFA 4UXHA 1NKTA 3ZE2B 1BWQA 3SHTA 2H4JA 3FOCA 1KE2A 4PR0A 2GFQA 2O0KA 4BV3A 3G5TA 2B1JA 2H65A 3CF6R 4U2KA 4B7AA 2PL5A 3BIJA 5DFAA 4CIVA 4YUXA 5HK9A 2P2YA 4OA5A 1NXQA 1NQOA 1T9GS 3A7EA 4HDAA 1NW3A 2HYDA 1BNCA 1U5BA 4JT9A 1GAQA 4ASUA 1GL9B 3W78A 4QYSA 1IOVA 1JR6A 3CLSC 3M70A 4WLUA 1TMKA 1GTMA 4YCSA 1CYEA 1EIWA 1SBIA 4ITRC 4NCKA 5A7GA 1TGVA 4QYTA 1BJTA 4W9MC 1TQ4A 3ZC3A 1YTLA 2ZTLA 1QZUA 1IL0A 2HF8A 2PGDA 3GLKA 4OD0A 1M6WA 5EWMB 4DYHA 1EWQA 4FC6A 1AGNA 5BT8A 5HIAA 4MCJA 3UK2A 3OOWA 2ECPA 3IH5A 3NP9A 1U4OA 2QK4A 4XFKA 4FXOA 1IHDA 5AHXA 4YN3A 3KQQA 4KNYA 4FMDB 4Q05A 3JV7A 1JSRA 1OA0A 2PA0A 3DTVB 4RCYA 4OQPA 4P5PA 4BUCA 5JVDA 2P9CA 3PNOA 3QWAA 3L0IB 5DTQA 4CMIB 5T6MA 3ZNQA 1P4RA 2FPGB 3IC5A 3GJQA 1ADBA 4KQIA 4UDOA 2Y1OA 4UEKA 1CUXA 1ZUIA 2OOSA 2CD7A 3RG8A 2VKQA 3R3XA 4B4KA 2W6CX 5CB4A 3UQYS 3EXIB 3K72B 3AWIA 3KDAA 1N8NA 2ZRMA 2PRIA 4OQMA 5GM1A 4WNAA 5FOQA 1G3RA 2HWWA 3E27A 1XROA 4W9NC 4EHNA 4CMHA 1VKHA 4C30A 5C7YA 4JODA 3KB6A 1RNLA 3VH3A 3C3DA 4FFMA 2GCEA 1BA2A 2GPSA 4IDQA 2J6IA 2K7ZA 5AI5A 3H8WA 1KYQA 3TQHA 1GPBA 3LAWA 3AVOA 4FUTA 3RI3A 4HAXA 3COVA 4QG7A 4WLEA 2GLTA 3USES 2Q6IA 4GX2A 4E2FA 4CVNA 1LDYA 4EB6B 5AW8A 2O8FA 1MJGM 2C2WA 2D06A 1YDFA 1IZ8A 2IELA 3GEBA 4KMRA 5CMLA 3VDNB 2VUUA 2VEOA 4J3FA 3TR5A 4CUZA 3CWQA 1W4CA 2VJBA 2XMZA 3P9ZA 4H3HB 3IL2A 2ETVA 4PX5A 1Z6AA 5KMGB 1JLSA 1N2XA 1J70A 1OTHA 1UFRA 2NZWA 1F5SA 1I2BA 3WA7A 5E6UA 2PT9A 3IMCA 3PD7A 3WGKA 4AG3A 5I7HA 1L4KA 3LOQA 4KSBA 4BNLA 1C7QA 1N36B 1IPEA 1XVIA 2C9MA 1K1EA 3R0VA 5A4MS 3BOSA 3LW8A 5BYAA 1EE1A 1GCUA 2RH5A 1GNQA 3M4NA 4HEA6 3SVZA 4GMFA 3GFPA 5HYVA 1G8YA 4KWTA 4YPFA 5LC1A 3LQ4A 2AEMA 3HBAA 4Q9LA 3ZJ5A 1P62B 4BO6A 1TL7C 3U4CA 4I1YA 3H8JA 1YOVB 5DGDA 1HFWA 1HQDA 3P9NA 4NZOA 2A5YB 3UEOA 5CDUA 3ZCVA 2IKSA 1EAYA 3HBMA 2H0AA 5JMOA 1UK7A 4R1MA 4QDTA 2IIVA 2OBXA 1UZNA 2PKCA 2BKLA 2XW6A 1COWA 2VP6A 3IOEA 3NPAA 5ER9A 1EQAA 2NO0A 2NU8B 2G6BA 3K4QA 5KYWB 1E2GA 3EDMA 2DBRA 1DRWA 3ESQA 1N3YA 3M1YA 4MRRA 4I14A 1BROA 5EP1A 3L7YA 5FPSA 1YB7A 2GVDC 1L8QA 2GM9A 1EWTA 2V0NA 3CF4A 4V0OA 2RB5A 4BEVA 5IKXA 1S2IA 5AW3A 1KK2A 1LS1A 2DR2A 2BGIA 2JFXA 3PK0A 3SBDA 4Y7DA 1FUKA 2FU5C 2AJCA 5BSUA 3WQHA 3FROA 5IC4A 3IKTA 2CEAA 3FOEC 2QQEA 3D4OA 1P0IA 1AKUA 1TFRA 4J0CA 3A32A 4PLGA 4B84A 3CG0A 3CF0A 5BURA 3LUAA 3QPUA 1AS0A 3BXOA 2G6TA 3FNHA 5HJ7A 2ZBVA 3ODGA 2C7PA 5FXMA 5DCUA 1T9BA 2JBAB 1BHJA 2O1XA 3K0BA 3KWJA 3EAGA 3UMYA 3FJOA 1GQ2A 3GPDG 4RSRA 3W9SA 4UNIA 4PS0A 5AKZA 1JQJC 5D2CA 5DWQA 5A1JA 4DR6B 1XPUA 4IH1A 2AQKA 3LECA 1T4GA 1KP3A 4IR7A 2Z30A 5M2QA 4RLFA 1WCIA 5FL3A 4ENUA 1A50B 3WBJA 4YJFB 4EEXA 1FRFS 4HATA 4ID9A 4WUTA 3OPMA 4XLTA 3UJ6A 1ZI9A 4AKHA 1TK2A 4CQMB 3Q1KA 3E1GA 2C2MA 2CXXA 2VYFA 3DYBA 4IJMA 4KPEC 2GESA 1KQPA 2ENUA 1SULA 2FE1A 2WJWA 2XZTA 1K9SA 1NUHA 2FPMA 3E2IA 2G8LA 3HPRA 3IUQA 1FUUA 4GPIB 4GXNA 4YJDA 5G3YA 2OBLA 5HZHA 3H3JA 2QWXA 2NUAA 3FYUA 4BNFA 3L4JA 1Z6GA 1GGMA 4LHYA 1NI4A 2X15A 3OLQA 1VIVA 2B2NA 2CE7A 2OLEA 4L6CA 5SV2A 1A9XA 5H5JA 2YQ5A 3LXXA 4ZVNA 1AMNA 3TH5A 1XDUA 5HTOA 3CRNA 1ZM3A 1OA1A 3PNSA 4FDMA 4DLLA 4DE5A 2H57A 2VF5X 4CLHA 4LECA 3O1IC 2WG2A 4ND8A 4QGHA 3TW0A 2Z6QA 1P0CA 1VHJA 2LKDA 1RPAA 3GLVA 3O83A 3REOA 1H5UA 1UPBA 5DF1A 3PPWA 5B7QA 2AK3A 3QOWA 1UR5A 1IZ0A 1XCBA 4BCCA 3TPCA 1EA7A 1L7XA 1VJ1A 2ONYA 3NR2A 4FEEA 4N0MA 3URKA 6NULA 2B99A 2O3SA 2X9QA 3O3OB 2XNDD 2R00A 3FB1A 4PTZA 3HKEB 3NV7A 4LGMA 2G1AA 2FB9A 2B8JA 2FZ5A 2R6FA 1MX9A 2JGEA 2EX0A 2QL7A 2VRNA 3B6KA 3GR6A 3IDFA 4DLUA 4NOJA 4IYRA 4ZU1X 4F4JA 3IE1A 1N78A 1CJMA 2E48A 1KMIY 4PPNA 2EJBA 4AJIA 3L18A 4BRUA 1E2LA 1SBNE 1U1DA 4V1CB 3J81A 2JW5A 3GZNB 2OXIA 5AVSA 4KQ6A 1BN7A 2VK8A 1PLLA 4CEJB 4HJRA 2KHZA 2B30A 2Q6LA 4RAQA 1X42A 1MRNA 3JZMA 1R4MB 1O9GA 2PGXA 4BCDA 5FI3A 3GELA 3OU2A 3FKJA 3N58A 3I62A 3QU2A 4U0JA 3TD6A 4YACA 4MDEA 1H6DA 2W93A 3K4PA 2ZR0A 2JIOA 3MD0A 3WLQA 5A5GA 1U7XA 5JCJA 2FUEA 3B5JA 3ODPA 3N5KA 5TJ9A 1HFJA 2OLJA 3EW9A 3NUQA 3SC4A 3ROTA 1K86A 3LDHA 1CUGA 3W4KA 3JATB 1PR3A 2OM2A 2UUCB 1QZTA 3BE6A 3V2HA 1XTJA 3UAOA 2Z04A 3CR7A 2Z08A 3S8MA 1KL7A 5EOVA 4YJKA 2V0CA 1VCHA 3F2IA 2QMZA 3TSCA 5IJ9A 1ZN7A 2TRSB 3EPJA 1H65A 1HPLA 3BH7A 4ZYUA 4RHTA 3F6EX 3ONVA 2CBXA 1UM8A 2B4YA 3GGDA 2ENWA 3LJKA 3EBPA 3LO8A 5HBRA 1EDEA 1EUDB 2GJ4A 4LV8B 4MO2A 1UPCA 4JI1B 2PK3A 2FHSA 2C77A 1BEUB 1MRSA 1W36D 1DEHA 3SDSA 2GPNA 5T8KC 1ZN9A 2H8KA 3W3AA 2O3QA 4RPLA 4XTCS 5ES3A 1QH0A 1ABFA 3BTOA 3KKEA 3IP5A 3NALA 2RGGA 2V4MA 3W6OA 2X86A 3UHAA 4E4YA 1XF9A 4Q7LA 1GJRA 4FFPA 3ZPXA 2GD1O 2H31A 4P7BA 1QHGA 4FGLA 4GVPA 2FG5A 3ZCPA 2CFCA 4UAUA 4U5QA 2C84A 4CHTA 3D43A 1HOTA 1R9NA 3HBJA 3OIUA 3RU3A 3UC9A 3UA4A 3UBMA 4BO3A 1UT5A 4DA7A 1H4TA 4C21A 1ECPA 3ET5A 2XZDA 3AM4A 4HEA1 2Y1WA 1A7UA 2V6MA 2VJPA 3UWMA 3DO5A 3FSEA 2ACKA 1O94C 2P3OA 2QR2A 1ESEA 3K5PA 1KAQA 4IUDS 5K0NA 3FR8A 3VI4B 3O75A 1GZ6A 1TE2A 3CA8A 1PS8A 1E6LA 1E9RA 2C9CA 4NENA 4Z8XA 2IEIA 4Q3NA 1BVYF 1ADFA 1CVRA 1FLNA 2PH3A 3DSRA 3FVTA 4JHXA 2VT3A 3G9ZA 2FPPB 2WD7B 1O4WA 1VPLA 1SXJD 5FCDA 3LUGA 1IIRA 5D5PA 4D56A 4JY7A 3RROA 2IE0A 1IUKA 3ZI4A 1GEGA 1MXHA 3B1JA 4DV3B 4B3FX 4V39A 4EB3A 5FUYA 3BEOA 1TLLA 4JV5B 4PNEA 1GFIA 3ILVA 1ADJA 2G04A 3FNRA 2LTAA 4FW9A 4O0MA 1JWBB 2AC7A 3U4QB 4XRRA 3I61A 1P6QA 2QRUA 4JVMA 4AMVA 1X7DA 1I0ZA 5J4LA 3B3FA 721PA 5DMHA 1MC4A 3ILSA 5K3AA 3EQ9A 3KD3A 4DCCA 4FGWA 2WM9B 5K0GA 3TZCA 2BR5A 2CXNA 4BGDA 5D3QA 1K0UA 2E6UX 1YR3A 3BIXA 1NNI1 2JIBA 4WK6A 1HQYE 1FJGB 3UOAB 3FVQA 1ZD8A 3LYAA 1CCWA 2HJSA 3M2PA 1PNOA 1VC2A 2D5AA 4AKIA 2P3SA 3MWFA 4ZCPA 3B38A 2P2LA 3JWHA 3OFSA 3PKZA 4O2AA 3RWBA 3EZYA 1PWYE 4AF6A 1A9TA 1H42A 4IEEA 1PEKE 5SYMA 1KSFX 5ALEA 2DF8A 3DDCA 1EX1A 4L7VA 4X1YB 4ALKA 2QD3A 1U8ZA 2PM8A 1XELA 1XL1A 1WWKA 3V46A 2GUGA 1ST3A 1FSGA 4IG4A 1YRBA 4C76A 2BKVA 4IOJA 1TAGA 4CI0B 1EK1A 4C0LA 5FWYB 5DM1A 2D1SA 3E15A 1MFZA 2POCA 1WULS 1Q20A 3CRQA 3NRCA 4G1EB 1G8HA 4RD3A 4ZAGA 3R7FA 1OILA 1W76A 2H7CA 4BUJA 1DIGA 2PS9A 4IP0A 1M2FA 4R83A 1CQJB 1Z26A 1XCGB 1OZAA 2EU8A 2FPSA 2V5AA 4Q66C 1IM5A 2CJXA 2CXUA 4NDNE 1PO7A 3UJAA 1QVWA 2PUBA 2D6FA 4PLHA 4IF4A 4LSWA 4MUGA 4DR7B 3G0IA 1I33A 4XPIA 1E1NA 1P2SA 1XTVA 1M1NB 1ZWKA 3OUUA 1OYWA 3AX6A 4MV7A 4Q82A 1FZTA 4HL6A 2E4VA 5BSRA 4ZFNA 3K5WA 3SMVA 5BVHB 1IB0A 2KJQA 3CW2A 1TGYA 3FWKA 3LC0A 3NWJA 5EPOA 3U9LA 4O08A 4RVUA 3RAGA 4DBVO 3UJNA 3DXYA 3GDFA 1CUJA 2C4WA 3NWOA 1C3JA 3DYIA 4WY5A 4GOJA 1MT0A 3WYFA 1Q44A 3E2PA 5JAUA 2CYCA 3KUXA 1XXHA 4XM1A 3RARA 1F2DA 1DAEA 2BTQB 5T8KA 3EYAA 3GNSA 3U0BA 1W47A 4MWCA 1RAGA 5GONA 1Q0UA 2F3TA 1CUZA 4FR5A 2WNSA 3NLLA 1I01A 1ZKMA 5JAHA 4GP9A 4FD2A 2QBYA 1B6SA 4KREA 1PFVA 3EJ6A 1R50A 4OMDA 4C7MA 3QTTA 1X1QA 5TXGA 4IQ8A 2NSLA 1EK5A 2BGRA 2FP4A 3C3WA 1F2UB 1XLWA 3E3OA 1OHHD 4LZAA 1OLXA 3CLUD 2ZRIA 5DK4A 3A28A 3EEOA 4MDFA 1DC6A 4WI1A 5CLLA 1F8FA 1TYDE 2R48A 5LDGA 2ILVA 1K7FB 2WABA 3AG6A 3HXPA 3TCKA 5SZHB 5ICCA 4DLAA 1BD4A 4L9RA 1PWHA 2NP7A 1O94A 2WOJA 2XB8A 2BJVA 3UPUA 4ND2A 2I6XA 3ETCA 5T4FA 4AUMA 4E30A 4EG5A 4F6RA 1RXCA 1GA6A 3EDCA 5EKSA 4G1UC 3UAGA 3WNBA 3RBXA 2I67A 2P9QA 2BBSA 3ED5A 2EGUA 2GD2A 4ER7A 1P0PA 2HJGA 3EK2A 3TL6A 2B6HA 4N6NA 4C0KA 1KEKA 4DQXA 4UVIA 4F11A 3FSGD 2DFNA 4P7GA 1L8LA 4W1PA 2CNWA 3CVXA 2I33A 1TZMA 2GN8A 3CEPB 3IQDB 4KR2A 1QC5B 3IO5A 3N76A 2GK7A 3ETHA 4TUYF 3IBCA 2RAUA 5BMVB 4YLEA 4Q19A 1WP9A 3V00A 3KLNA 1CRLA 2G1PA 4BQEA 2R1TA 2CNKA 4MV4A 1EUCA 5KJ1A 4KH1A 4NV1A 3UOWA 3MJCA 1V45E 1H3NA 2ANCA 2J9FB 3LX6A 5LJLA 4XDGA 3WLSA 2B2CA 2JGLA 2WUFA 1I0LA 3B1VA 4BC1A 2DWQA 3QJ5A 2HH9A 1FP1D 5E6SA 1DO2A 2P2NA 5FX2A 2VNJA 4RANA 2YJ6A 1B1CA 2XZLA 2R97A 4E5NA 4WINA 1GGEA 5IYZA 2RGUA 1W6UA 4TRRA 3X1WA 3CH5A 2J0VA 3FDJA 2O6HA 4LV5B 4C20A 2ZDGA 2I8CA 1PK9A 2XODA 4A2CA 3O5AA 2DGDA 2YV4A 3I8XA 1KY4A 4YEDA 2O48X 5HE8A 5KTYA 4K6OA 2ZBFA 3LWZA 1V4BA 4UZFA 1NVUQ 2BC9A 3WE7A 5KTOA 2BFBA 3IHKA 1MT3A 1OGIA 1XR3A 3AR9A 5EHQA 3CT6A 4KX3A 2OQ2A 4QFBA 4QPPA 2XMQA 4BEWA 4ZALA 5EJ4A 1Q0TA 1YQUA 3GLFA 4PZ0A 2VF2A 2L42A 2ZRDA 1T91A 3K1JA 4S2EA 1NP3A 4QFCA 1QZ3A 3ST7A 1P4JA 4TXJA 3VA7A 1PJTA 4Y2VA 3FPKA 1IBSA 1P1FA 4MGIR 3O95A 1CUIA 3G0DA 3ZNNA 3KALA 2G9RA 2BGUA 3CLTD 4V0KA 1H1TA 1ZMRA 1OT3A 2CNNA 2D8MA 4HDCA 4PXAA 3IILA 1G8SA 1DDIA 1GPWB 2J0UB 1SKQA 4A1OA 5B1EA 3AR6A 1Q12A 1T5BA 2QORA 1KYTA 2JFYA 4GOND 1W34A 2QT9A 4JX8A 3M9LA 2Q2QA 3WBKA 2FK8A 2EFEB 2FW8A 3FUWA 5LXTF 2BGMA 3O8OA 4J6EA 4RV5A 1N2CE 3INTA 1JL3A 2O5CA 2RIPA 3NHMA 1RFLA 2PKYX 1EM8A 3H84A 2AG0A 4PHGA 4X65B 2EBFX 3HWX1 1AM4D 1H2WA 2BN4A 2FMKA 2NPOA 5KX5B 3OCUA 3RYTC 3QX3A 1CUVA 3GRFA 4HYEA 3QE0A 4BO4A 4DM3A 5FAKA 5IT0A 1JH8A 1Z2DA 3AEQA 3PWSA 2WVAA 3DCIA 2LGJA 3KKLA 2CVHA 3QJYA 4RHYA 5BN5B 3U6KA 1L8OA 1T5IA 3K9CA 3NUZA 4TTAA 5DYNA 1BXGA 4BVEA 4YMWA 2DBZA 1G21E 2Q2WA 4GKAA 2YWEA 2FX5A 5LMNB 1MIHA 5JOQA 2I8LA 3MT7A 3CZ4A 4L3VA 3WV5A 5CK4A 2QTBA 3D8RA 5K05A 4HC4A 2C2HA 4JENA 2MIIA 2DM6A 1G20B 4D2IA 1GP2A 1N2HA 2Y3IA 4KN6A 5AKIA 3RVLA 2JD1A 2WE8A 1OLSB 1WHSB 1H05A 3B9BA 4QFDA 1V39A 1IXYA 5HFAA 3K5IA 1OX5A 5F3RA 5IK2A 1L3CA 4JI6B 1GTSA 3ZI7A 4BVKA 3RJ9A 3ZY2A 2YZ7A 2EIXA 1BTOA 1G6Q1 5IN5A 2DB3A 1VCOA 1PYGA 1E4EA 3EQ8A 4OXXA 4KRXA 3COZA 4M9RA 4CCYB 4D8UA 3LM8A 4B6SA 1XJQA 4CM1A 2HV8A 3O9MA 5D5HA 4FSXA 1DG1G 4HVTA 1JJBA 4CN9A 1ID8A 4I50A 3E9ZA 1N3IA 2GNOA 4ONEA 4RY0A 3PZRA 5DHQA 2JJ2D 3AFOA 3QVJA 1D7OA 4ZYXA 3JASB 1KWGA 2Y1EA 1CSEE 1EFKA 3FPBA 3C3PA 3QGMA 1T9DA 4PX9A 4D0SA 3F47A 4C6RA 3HZOA 1NVBA 2IHTA 5JJLA 4D42A 3E3MA 3ZHRA 1X3LA 2RI0A 4HN9A 5D3ZA 2APJA 1E2PA 2QMUA 2RKOA 4H08A 4MCHA 4Q9IA 5I9MA 2MCFA 2CLHB 4EY3A 1FBTA 1PV2A 3BWBA 2H48A 2XE7A 3AHJA 3C5VA 4QYMA 2I7DA 2NXCA 4BECA 4DANA 3GBVA 3A8TA 1ZJWA 3BICA 3DMDA 4JZKA 3CVWA 3EH1A 5AHOA 4RK7A 4IBOA 2WAAA 2PRZA 2REOA 1SA0B 2P91A 4AT1A 3R3HA 3DZBA 5E6RA 1D2CA 1RKQA 5P21A 5T67A 3WC4A 4IHJF 1QIEA 2RG1A 3VR2A 1AKWA 1C3OA 4P34A 5BWOA 5BV2P 5G1OA 1Y4UA 1G7SA 1EBBA 2PANA 2Z56A 2Z6VA 3E84A 4UEQA 5BR1A 1BWSA 5LL6P 3OETA 2M1XA 1SIBE 4BMYA 4RTKA 4OGKA 4CF5A 4F56A 3GUUA 3BHMA 3LHIA 3PIRA 3MERA 3C3XA 4TV8A 3G82C 4FGKA 1Q0PA 5KS2A 3QNUA 2R6R1 3NI2A 3WZMA 2Q8PA 1NVEA 4NBRA 4Z4QA 2ERXA 2FRDC 5IMBA 1Q57A 1BDIA 1SC9A 2A8YA 2F64A 1ZQ1A 3UH0A 2VDOB 1FA9A 2AVDA 3II6X 4D25A 4K6CA 1KJJA 3GJYA 2VHVA 3VR6A 1GY8A 1X39A 2NZ2A 4DCSA 2QTZA 3H5LA 4Y0VA 5HHTA 2VXBA 3U1BA 4W6ZA 1YB1A 1AB6A 1LI4A 4ZXFA 5IAKA 4DV2B 4EHDA 1QS0A 2A30A 1WOYA 2G5PA 4DV7B 4S1TA 4H3SA 1DTWA 2WU0A 3OF5A 2XVMA 2AHOA 2YWGA 4L5AA 5AXBA 2YUIA 2XVAA 5TC4A 4CFSA 4N8SA 5IRCD 1M0EA 4Z86A 1IVNA 4N49A 1TW2A 3FH0A 2BUBA 3STYA 3B9RA 3W5HA 3C4VA 1LBHA 2EEZA 2JCGA 1AUQA 1Y7IA 2V7VA 2QVLA 3WBBA 3A6DA 4EECA 1U2PA 2CXQA 5CCDA 1DXHA 3KAJA 1QYIA 3PQCA 2IPXA 4GBED 3JQ6A 4PO9A 3M3HA 2Q1YA 4JK3A 2GILA 1T1GA 3VR3D 4ECEA 5CDFE 5KC9A 2N46A 4OYRA 4R1SA 4YRKA 3OWXA 4U2GA 5ALQA 2XXAB 3DFKA 3IP1A 3SC2A 4YIHA 4BO8A 2IHJA 5ALGA 3QHPA 3VR5H 4M8NE 4CLRA 3DC7A 1JR2A 1KBOA 1PEYA 4O8CA 4C87A 1QB8A 1XJWA 1ZUD1 1RM0A 2XA9A 4IXMA 3RDPA 5KHAA 3L7LA 5KQMA 2GRJA 3X1YA 3PB3A 2RHHA 3EOAI 3L6OO 4PSKA 3RYFA 5AW2A 5ENVA 5DV9A 1Y0BA 1X14A 5HWSA 2GXSA 3C8DA 1PX0A 2QLTA 1VYHA 2Z57A 3EPPA 3L5KA 4PXYA 1WXFA 4RIGA 2ZBDA 2WIFA 3TD9A 1U1GA 4IRUB 1L4HA 4EY7A 3FDZB 1TU0A 4CUKA 4DGQA 1YIOA 4IEIA 4G01B 1RDFA 4MITA 5LFAA 1XAJA 3JZAA 2I76A 2YXNA 1XRQA 4Y1EA 5KWVA 2PDAA 4RGVA 1Y9DA 2BR3A 3UT0A 2VKTA 3L1KA 4C0XA 4DW8A 4BU1A 2IU0A 2QGNA 1NASA 1CDZA 3AH8A 2RHMA 1LPAB 2RCYA 3MGAA 4OQDA 5ICSA 1TCVA 1PSZA 1XPOA 1OAOC 3PZBA 1EVYA 4G67A 4ES6A 5CEEA 4Q02A 4AROA 1YOBA 2WJIA 4B31A 1PGOA 4U63A 4G4SO 4ZI7A 3LF1A 1W93A 3GRYA 1Y7PA 1T9GR 1BKDR 3CEHA 4TKUB 5KVVA 1DKQA 4PZDA 1AXGA 5HJ5A 2BGGA 3FYCA 2YUTA 3TLGB 1L7PA 1IQPA 3D02A 4Q47A 4PM4A 3LY5A 4POAA 4HV4A 4MR8B 7GPBA 2IODA 3GCWA 4FSHA 3AVTA 3EFHA 5FUWA 3TN7A 1CIJA 5DRTA 4TT3D 2Y0PA 1NN3A 3RBVA 2YZKA 3L0CA 3DWGA 5D7NA 5HM6A 4X00A 2DEUA 1Y9JA 3ZXUB 4D9BA 1GG5A 2MSLA 1MQ9A 2AG6A 2XCQA 5F3DA 3UXMA 1X7YA 4KQGA 1M6HA 3KPJA 4K5QA 1OX6A 4IFTA 3K8ZA 3RHSA 1U99A 1D04A 1GPYA 1ZRSA 4WVLA 4PSDA 3VO2A 3NNSA 4RJIA 4KTTE 4E1AA 4E22A 2J46A 3GJ6A 4JXZA 1C1DB 2BDTA 3K35A 4ZOQI 1XKTA 1S02A 1X94A 3ILHA 3AFIA 1NBMA 3G2LA 3KM0A 3MLAA 3O8BA 3HCAA 3B1WA 4GQAA 3RSLA 2YIVX 1B8OA 5DXJA 5JWRA 1SHKA 3TS1A 2ZJ7A 5HP4A 2A0FA 3HA2A 2FRDA 1QO0A 2WJ6A 1VJ5A 1RC1A 2JJYA 3IA7A 4K3UA 4NJOA 5E4TA 4B2YA 4WZAE 1NF3A 2ZM5A 3OEHD 4GD3Q 1D8AA 2BF7A 3EWAA 2AF3C 3DVLA 4QBFA 2YWHA 1B6GA 1AN9A 1KI4A 4Z9XA 2ZRJA 5KSOA 3S2GA 3FE2A 1FSSA 4OYHA 4QYWA 5FUBA 5AVQA 2F8SA 1WD5A 3D3EA 1G8AA 3RTEA 2FFRA 4D4JA 4C2UA 3M3DA 1ZVKA 4M86A 5FBWB 1L4UA 4C5CA 1J06A 1U0BB 5L7TA 5K0SA 1NC3A 3COYA 2A94A 4LMRA 4UKDA 2P75A 2FW0A 1Y4DE 4NBVA 5EXXA 4DBLE 1UK8A 4GXRA 1PDOA 4YP0A 1JEDA 2C92A 4X20B 5CT5A 1XJ5A 3E9NA 1W0KA 3HEAA 3I72A 1YJ5A 2BUAA 3HDYA 3HCCA 4IUYA 2P4EA 1GPAA 3QBDA 3G8AA 2X0NA 5LOVA 4W9RA 1CQWA 2H4ZA 2P9GA 4YI3A 4NICA 5BN4A 1PDWA 2JGRA 2VUHB 4Q03A 3P96A 2W4MA 4RJKA 3V8PA 3W2FA 3X1XA 2FWAA 1YRLA 1VDZA 3CNQS 3QYPA 4HNVA 1HE1C 1PRYA 3O4HA 4GLLA 1BX1A 4U7JA 1T8UA 3AM5A 5KDDA 3U0VA 2ATIA 2Q0XA 2PAFA 3NRJA 4NBUA 3KTAA 3L7IA 2L82A 1JG3A 4DQUA 1R0YA 2FOLA 4XX0B 3BWCA 3I09A 5J2UB 1ZINA 3HABA 4IS3A 4YHBA 5KNDA 1BQ4A 2J32A 4OX9Y 4P8RA 1SNYA 4HDOB 4JP2A 1NMQA 3BSSA 3F1KA 3M3PA 5AI6A 3R7WB 1NQ5A 2GA9A 2IT1A 4KR7A 4MJLA 1D1SA 1T0BA 5H16A 3DGFC 2D74A 1OBCA 4KWIA 4YROA 2BMAA 3O1JC 3WAGA 1IAQA 2J3IA 4E33A 1J97A 3KQWA 2GAAA 2P9EA 1KGDA 2FFHA 1OAOA 2JAWA 3LQYA 1PFQA 5AKYA 1N2BA 1HE8B 1T1IA 3DOEA 3L4BC 4B74A 2ASEA 2P4QA 2FZVA 1X7XB 2QVZX 4IIJF 1UMDB 5LZ9A 1H0KA 2WHXA 4LMPA 1QB7A 4QOSA 4AB1A 5JASA 5JYDA 1X70A 5ENDA 3OX2A 1FX0A 1XCLA 4CM6A 3RYHA 4BX2A 4PYNA 2EX1A 3IQHX 1T36B 1P5RA 4MR7B 4MGZR 1AZTA 5FBQB 2XUKA 1R8YA 4HNUA 1I94B 4G0UA 4ZT4A 3FI0A 3RWMB 3DZCA 4R1NA 4TZ6A 2OFXA 1W85B 4OHPA 2OCLA 5BQXA 3HA7A 4UASA 3C70A 1RYDA 1CLUA 3A6ZA 3DT6A 5G4LA 3PKJA 3UHJA 3AJDA 3ZBQA 4XYBA 2EZ4A 3QF7A 1XLVA 3HKDA 1U0SY 4Y98A 2BCEA 3IKLA 2ZRAA 3GLHE 5EIBC 1Z6QA 3KPYA 2PKWA 4ZU6X 3IUSA 2CFIA 3DO8A 2FLVA 4G1FA 2XVYA 4L07A 3P0IA 2HCBA 3TM5A 4GE0A 4RMIA 2HLDD 5DW3A 5FYQA 4C4OA 2R11A 1V11B 4ESVA 3QV1A 1LNZA 4MUIA 4LMAA 3IP6A 1DCTA 2R44A 4MVJG 2C7RA 3DF9A 4RUKA 1TUGA 2ZCUA 3EZ7A 4NMWA 5ILQA 5AW6A 3BRWD 1J49A 2A0UA 3B60A 3KHKA 4JB8A 1T1RA 2AOXA 4A1FA 3QPWA 1IVSA 1FNBA 1HFKA 3S99A 2I2FA 1L1EA 2OK7A 2AMYA 2P0EA 4DLTA 3HFJA 1EP3B 1OJ7A 4HHEA 3BMCB 2Z4TA 3BWDD 3E22A 1P2BA 3ENQA 4J1NA 4OBBA 3U40A 3BQNB 2AYZA 1BG6A 3HR4A 1GSOA 3I3SR 4MV8A 4WFKA 1YJBA 3RF7A 2DKNA 1V4NA 2QENA 3P94A 4A8JA 2F4NA 2R85A 1X86B 2FSIA 2I3AA 2XQFA 3HLKA 3Q5DA 1BX0A 2A9RA 4LJSA 3GL9A 4F9TA 4ZDJA 5J4YA 5HRUA 5T57A 3GJZA 4RTOA 2O7VA 4G8JA 3L6EA 1I4OA 5FNVF 2W6ID 4U0KA 2W2XA 1IN8A 4AJHA 2FLKA 3ETGA 1S2LA 3E9YA 3HUTA 1ISPA 4OLHA 4DA4A 2VHWA 3FGPA 2PHZA 4I3HA 3W4JA 3WYNA 2V1UA 2E37A 3GN2A 4JLWA 4KPUA 1P18A 3BXGA 4OJKA 3A14A 1BMFD 1CNMA 3FYSA 3BIWA 1BHSA 2RI1A 1L4YA 3WWPA 1UXIA 4HQKA 3DEYX 3ZHZA 2WB2A 1E2FA 3S1SA 4EHAA 2ZGVA 1G64A 3GMDA 2GH1A 2NXNA 4E94A 3WJ1A 4Y0NA 4MW9A 4RVHA 3G2MA 3AEXA 2AKEA 2V6JA 1FDWA 1IJKA 4BNHA 3LQQA 3O2QB 2A5FA 2OD9A 4N48A 3BDVA 4RVOA 4EEKA 4IIDA 3KFXA 4BFUA 4YJ2F 3F6CA 4D82A 3ORSA 3HP7A 3OZFA 2C9OA 2H1CA 4CL3A 2Y4NA 5L3VA 2FX2A 2WUEA 3RC3A 1W0JD 1TM4E 4CEIA 4DYDA 1U28C 1NU8A 4FKMA 4HRAA 4DQVA 1HE5A 3OT5A 3CFYA 3DE2X 3AXTA 3DFFA 3QVKA 2HQBA 3VR5D 1RJWA 4URUR 5I9TA 1Y37A 1KZHA 3THWA 4DPKA 4BKPA 5A9RA 2A4KA 3SWWA 5I9NA 4R71A 4MUAA 1M33A 3RUHA 3LUBA 5K0TA 3C14C 2GVZC 4NEGA 3DDWA 3ITDA 4OB7A 4OHUA 3N0WA 3AFHA 2IWRA 4ZZ1A 5FV4A 4N8DA 5JNSA 1A8HA 3GRVA 4KZPA 5GV8A 2BFCB 2QTAA 4JFAA 4MDYA 5AHWA 1CNFA 1F0PA 1OB2A 3MHTA 1A71A 1SY7A 4IZHA 3SNHA 1G17A 3H2KA 1TIBA 2H1VA 3AYXB 3I6YA 4QPJC 3U2QA 4DIKA 1ZHHA 5U9CA 1BMQA 1RLOA 4RKYA 1XVAA 5EIXA 4CM5A 1SCIA 4FTWA 3ZW8A 3A4LA 4M7OA 3W5CA 1P7PA 4O63O 3U13A 2UYHA 4KMSA 4KVGA 4AY5A 1NI5A 2O1WA 3HUEA 4O4IA 1N7IA 3I8SA 1YDGA 4WAUA 1AV6A 3SXUA 3WLTA 2IS4A 3EGEA 3DV0B 4WASA 1E58A 3R76A 3SX2A 4YRZA 2DFPA 5ESDA 2PSDA 3COJA 1H6CA 2FUNB 3BCUA 3CUKA 5E1BA 5HM8A 3I9V6 1SUBA 1MA0A 3C74A 4C2TA 3R3YA 4X66B 3KJIA 4B5KA 2J85A 3MPOA 4ZK2A 5HNKA 3KOXA 3ME5A 5ALTA 3KPVA 1P19A 2AEJA 4ITUA 1Y5NA 2IS6A 4PR3A 3ZV7A 3FTEA 1HE4A 1XYGA 2IYEA 2BV3A 3UZUA 4ZKDA 1M7HA 2OSBA 1Q0HA 1QANA 5JVDF 5DU2A 4HD8A 2BEVB 3IODA 5BWCA 3A25A 1NXXA 2YZMA 4UCXA 1XVUA 2O14A 2ZB4A 1J2TA 4OBEA 2R66A 5DWVA 5FAXA 1MX1A 3B2EA 5IU6A 5JCOC 3F5DA 3PUIA 3HDQA 2PYDA 3STVA 4C3UA 5CB4F 3L02A 4Z0PA 1MV5A 4LK3A 2GZMA 2WSMA 4TS9A 3S0JA 3ZWBA 2AKYA 3E9MA 1E20A 4PSUA 4XWOA 1ESDA 2WU1A 4RHEA 1U02A 4M54A 4OY3A 3EGOA 2IUEA 1U63A 1SRQA 1JHVA 3DAYA 3GVCA 2NZ8A 3FWNA 3M6IA 4I36A 3PR1A 1QG0A 1JNXX 2EW8A 4BTEA 4UU0A 3CF4G 1YB6A 4ZTZB 4P83A 3W34A 3L6UA 4RDHA 1NWHA 1JR3D 2EKZA 2WF5A 4FPXA 4HAUA 3L06A 2Z43A 4F3TA 5EJIA 1WDLA 4QJ4A 4AJJA 2YOFA 4II7A 4AKTA 5KKNB 5IVKA 2X6QA 1FRNA 2X13A 1F7UA 1Y9EA 4C0AC 3N87A 1YR1A 3HN2A 1Z0SA 4L8WB 1NV8A 3GAAA 3H9QA 4ZQHA 3HY4A 3OP1A 3EDQA 2EKDA 4RA9B 4X94A 4EGJA 3U17A 4WW0A 1RPNA 3GLIB 3A0UA 4AJPA 5DTMA 4KYVA 1MJGA 1MQSA 5EXDA 2FCRA 2R6DA 5ARCA 1LQ2A 2HQRA 2IYAA 1NX9A 5CX1A 3WGUA 4CDGA 1ZIYA 4ZA2A 3WG9A 1JALA 4A0GA 2OO3A 4IF6A 2G7ZA 4K6MA 2YWJA 4L02A 4IHKA 1MUUA 4HDRA 1I7LA 4TQAA 3TR0A 1T25A 2OAEA 3MWEA 3AR5A 1ZM4A 4YIKA 5DE3A 5I7UA 5JAZA 4EMTA 1ENOA 4IVPA 5JWHA 3QE9Y 4I81A 1U28A 4CL8A 3PXUA 3PDWA 3RIYA 1PJRA 3VFDA 4I4TA 3WLNA 4NPCA 3PDIB 4D4IA 3CVUA 1RRMA 3HB5X 1TQ2A 3O4IA 1F2TA 1W96A 3FFTA 4XJTA 5FJJA 3Q7QA 4I5GA 2R751 4TOIA 1E7RA 3BPSA 1D6SA 2FVXA 2JH3A 2BKUA 3EG9A 1J0BA 4GT1A 1UZMA 2COEA 2B7LA 2I54A 2C95A 3AKYA 1NYQA 3ETNA 3LD9A 4QNNA 3EXG2 4C0WA 5IJ0A 2V9CA 3ASUA 4G5SA 4OM8A 4ENQA 2I6GA 1L5YA 5JBIA 4INJA 3D2BA 4IMIB 3Q3IA 4NU6A 3PR3A 2PWPA 3DFMA 2R5NA 2P35A 1GCIA 1JMVA 1XRPA 2GA8A 3ACCA 3KB8A 4FGSA 4E6EA 4F8YA 3D81A 2QL5A 3PXEA 4EI8A 3EW7A 2X76A 1VBKA 5IKEA 4Y6GB 2G4VA 4LX8A 1MJFA 1OR8A 3DEJA 5FB3A 4WERA 1YAHA 2YYAA 3ZWXA 3I9FA 1KPIA 1DGQA 1V35A 1AF4A 3EVDA 3FMIA 4OI2A 3MLEA 3VM6A 3SICE 5UKDA 1YUBA 1M2OB 4XX1A 3TNJA 3PS9A 3V33A 2GDJA 2NSYA 5KTSA 3LY8A 4W7IA 3SHFA 3HUFA 1N5DA 4PVCA 2WAXA 3UCXA 3PI6A 4BLTA 4CQMD 2X4GA 3L6DA 1UBJS 4C0HA 1YMUA 3IPRA 5DKFA 1QTNA 5IF3A 2O7RA 3UICA 5DLEA 4HVLA 5EIAA 1KC3A 1KZ7B 1U5BB 1VYVA 1V8OA 4FFRA 2DCMA 5CM2Z 3U1TA 4BJ5A 4HFRA 2PUVA 1E1CB 3AG5A 3T7DA 1CRZA 2KBEA 4RMGA 2V8BA 1R6TA 4Z2AA 3N8HA 4Q4JB 2O2YA 1T0JB 3C1AA 2PUWA 5JLJA 3HY6A 4MRAA 1S7GA 1ZM2A 3AHIA 1JU3A 1UKCA 3JRXA 5ALDA 5GJWC 3EA4A 3RCBA 1WCV1 2DR0A 4R7ZA 1E6WA 5IBPA 1MOSA 4YPVA 3FKSD 4WBXC 3ZE1B 1CY4A 1LA2A 1THZA 1XD8A 2AI3A 2HA6A 3ABOB 4I4CA 5JCOA 5THXA 4J0FA 1C0PA 3S29A 4AO7A 1DMRA 3FRHA 5ICGA 1QX3A 1XQVA 2IYFA 3ZIUA 2LV8A 3K8OE 5I9IA 2DXIA 4OQYA 1I2DA 1R6BX 2O2XA 4RNCA 2VZ0A 1KDZA 5AIBA 5IWAB 3IR5A 4L8LA 2IF2A 5ALRA 2PZLA 3UWKA 4UTPA 7MHTA 1OV4A 1TK3A 5LQSA 3ZH2A 3R5XA 5C4GB 1Y3AA 4C4SA 1YZHA 4D6XA 2HI0A 4UUPA 1PEAA 1QWSA 3VVCA 1VSBA 3HB7A 2QLLA 1YR6A 4ZICA 1QYCA 1EVEA 4IAOA 3WGMA 1VBMA 3X1ZA 5K4HA 1FDSA 1EFLA 1KXJA 3OE4A 4KUHA 4YAJA 5C9ZA 3TDKA 3THYA 1GADO 3UNXA 1KMMA 3V3KA 3DQPA 2D3WA 1C1XA 1VL5A 5I8ZA 4M1YA 4ZHSA 4HWKA 1T3LA 3DBLB 2XXJA 3H8VA 4R3NA 2Q5CA 4BLSA 1VXRA 4BLVA 1U2EA 1OWLA 3OPYA 1IRIA 1H5NA 1WX1A 2GAOA 5TJHA 4XDHA 4ZCMA 2O8FB 5E7IA 3P4YA 1FJHA 5LZ8A 4M60A 1NLMA 1DPGA 3T3DA 1Z0IA 5LZ7A 1J7JA 4MI1A 3NBKA 1I7NA 1MQAA 1L5SA 2BR4A 4QXPA 5DBHX 5TPZA 2NVUB 3TXXA 5L4SA 2XB2A 1ZR2A 4JVNA 3ETLA 1MRZA 3EZ9A 4XVQA 4O4LB 3HNPA 2BVNA 1SBTA 3AETA 3GVPA 4MW5A 4LJ4A 3R9XA 2RAVA 1VG8A 4JMLA 1OH8A 1K8ZB 4X1IA 2VO1A 2W8BB 2ZIEA 1Q2XA 2CB9A 2FZCA 4K86A 3SY8A 2HB6A 4Q3LA 3W4IA 4KI7A 2Y71A 1YE8A 2X9LA 4UZEA 3C5WP 3QPVA 3BJIC 3GPLA 2X0DA 2NZYA 3V8MA 3VVMA 2VPXA 4JUCA 4F8EA 1W36C 5JJKA 2V98A 4OO3A 3WGZA 3DXZA 2DLCX 3MJEA 3ONNA 2WHPB 4ZEWA 2L18A 4FFBB 5KOJA 3Q3HA 4C4XA 3KVOA 3T3NA 1JMYA 4R3WA 1JZQA 1KO8A 4W4TA 4YAOA 3REFA 3DH0A 4MW6A 3ZCXA 3HC7A 1VM6A 1NNEA 5IKPA 4NCBA 1SAYA 4ENVA 4LJAA 4EFMA 4YMHA 3VU3A 1MDFA 3L8FA 2XDQA 4MQEB 1VPTA 5FWXA 1R6DA 5I5EA 2UV8A 3W04A 4EYKA 3QWHA 5BMOA 1AKVA 2R6AA 2ZUCA 1NJ6A 3GBSA 2DPHA 4TZKA 4XSVA 4EL0A 5LP6C 2X4IA 3UT5A 1U3WA 2RK6A 1F12A 3I04A 4PY2A 3A7DA 2NU7A 1KHHA 4MWOA 5ENZA 2H5LA 2J5XA 5J9FA 4QZVA 4IDEA 4JP1A 3EXHC 2WUWE 2A57A 3VJKA 3NG1A 5ALLA 1U9YA 3DOIA 1SXJC 5L6LB 1XDBA 1FOEB 2F67A 5KYYA 4C4YA 4ZRMA 2VYND 1I13A 1G1MA 3ZQJA 4DMCA 3DLBA 3HXTA 1H2HA 1FQOA 3DVRX 3O2SB 1KK1A 4J7UA 1KSJA 4DXDA 1O87A 4L8GA 4Y1RA 2JAUA 2REQA 2WB4A 3U3XA 3AUXA 4YUZA 16PKA 1G291 1VKOA 2QTVB 3JQAB 3I64A 3KT8A 5F4BA 1W2HA 1CUUA 4HX2A 4Q1FA 2LRHA 5CGZA 4ZQEA 3BWVA 3NTQA 4LSGA 5GINE 1WM1A 2ZS9A 1GQFA 2XSZA 1D2HA 2AZXA 1TCAA 4IDDA 4MV9A 2YKGA 1LD3A 5H4HA 5KREA 1FYFA 1PV1A 2EATA 2ZYVX 3K2QA 3OZAA 1HO3A 3TOZA 3OCXA 1B4DA 5JS8A 3WAJA 2QJFA 2DTEA 4XSHA 4CQNA 1N9GA 2HRDA 3RSHA 4B87A 4WBNB 4BZQA 2E1RA 5IFLA 2UZ0A 1N7HA 2X6TA 3O8DA 4FR0A 3D3WA 1PJ2A 1QK5A 5CW2A 1R5NA 4MWSA 1YVDA 2VHXA 2XA1A 3DQZA 4WIAA 3TRDA 4PC7A 1OBHA 1K7XB 1UWLA 3HGMA 3JPWA 1IY9A 3GQBA 4IWXA 2CBGA 3QELB 3V8BA 3ESBA 4KYUA 4CLOA 3ZDAA 3Q3VA 1S01A 1TT5B 1USWA 1QBGA 1MJNA 4TYMA 4BAGA 4E1BA 2ZR7A 4PGHA 3FCCA 2O5EA 2JRCA 3O03A 2HFJA 5D86A 5NULA 1ND6A 4Q9JA 2A1IA 2QA5A 2EJUA 3RABA 4LMBA 2YXDA 3OPNA 3OQNA 2MSDB 1T6YA 3KSZO 3HVHA 4Z49A 1AUPA 2A9QA 4HGNA 4O2AF 4AWBA 2W22A 4LCBA 4B45A 3LWBA 3BT7A 1QFSA 3PE6A 1C7ZA 3W2GA 3RAFC 2EC5A 3HFRA 4C4TA 4RTRA 2C2KA 1XTTA 2V6GA 3B9PA 4JC4A 4NJMB 3NBYC 4DB2A 1NZJA 3SN6A 3W1WA 3WLOA 4UM9B 4MS1B 3ZWKA 3AM3A 1NXWA 3IUEA 4BRZA 1YU6A 2ABWA 4EUFA 1BDMA 4NHEA 4J07A 2FOIA 2HNAA 2JIDA 3K9NA 1KI9A 3ZUPA 2WK1A 3BMOB 4XCXA 5HA5A 5CH3A 1M5RA 3DBIA 1RCTE 1MH1A 4ZO8A 2X0FA 4I5EA 5EUBA 3N0VA 5CVTA 3E70C 1IB6A 1VL6A 4JA2A 4MVWA 2Q29A 4CG0A 4L51A 2UVQA 1QQBA 2CV1A 4NR0A 1GDTA 1AK9A 4LYDA 2M9MA 4ZVQA 3RR2A 2IH2A 2X9NA 4HP8A 4YAKA 4Z7NB 3L4SO 3ZDFA 1Q1EA 2E87A 1C8KA 3KLOA 4M87A 4NCXA 1UL1X 5J58A 3ERCA 1FX1A 4QUGA 1ZUNA 1S1MA 2BCGY 3LS2A 1Z15A 3CJQA 2Z5FA 5K8JB 1FVOA 4GL4A 4CMGA 2OV3A 1E1DA 4MQ5A 1DOHA 4OJTA 1CS0A 1BKSB 2VDVE 4URXR 1Z18A 3HWRA 5G0SA 3H4MA 2FUG6 3CLUC 4E5VA 2NNLD 2WLSA 2D7DA 4BB5A 1GN9A 4RFVA 1VECA 4CLDA 3KE9A 4CM9D 4J0EA 4AJLA 3OZUA 2WT4A 3R3WA 5GONF 2H1LA 2QUJA 3HCNA 2TECE 3JQFC 4YCDA 1NLYA 4GR4A 5DBFA 5DH9A 3RAPR 2ON6A 3H04A 3KXKA 4TKVA 2B3TA 2P2SA 3MAGA 5K6AC 3JQBC 3E0XA 1K8RA 1STOA 1BMDA 2VR1A 2YV3A 1C0IA 2JL1A 2NVBA 3AZQA 4J4BA 1CP3A 5AOBA 3ZX4A 5IWCA 3EXHA 4UBJA 1D2RA 3FPEA 2VJLA 4BTVA 4TTPA 1YR7A 1VCIA 3DZHA 4OU5A 2GKOA 4A6XA 3EVZA 1SWWA 3ASYA 1SHLA 2WM2A 3QFTA 2X0IA 4YPOA 4FFDA 1IXRC 4AN4A 3GDOA 5CXUA 1XZJA 2ANBA 3IEPA 4UCQA 4ZAWA 2V7QD 1AK1A 1XFDA 1Y8QB 1TUEA 2SKCA 4WDQA 2IX3A 4I1IA 1ZR4A 4R41A 1ZM7A 4G4JA 1L4LA 3FMGA 4B0PA 3P0RA 2PGIA 1QIKA 4CTOA 1I7SB 4IVRA 1GZSA 5BQ5A 1GRCA 4I1VA 1FYEA 2VHQA 2PA3A 3NM5A 4JEUA 2O54A 4LBYA 4DVGA 1YHZA 3KZXA 5C32A 3P19A 3KT3A 4BVFA 1KJZA 3AJRA 4CLEA 1LJ8A 1FFHA 4QVKA 4D8TA 1YR8A 2WA1A 1ADGA 2CXTA 3FG9A 3O92A 1MD9A 2QX6A 3NDBB 3N6VA 2X4DA 3UMJA 2EQAA 4BUZA 4KQ1A 2B1IA 3SIXA 1Q21A 2VNKA 4W7HA 4Y2YA 4ECAA 4D5EA 3O8QB 4E31A 1BGWA 2F1OA 3UAVA 3S1AB 1Z35A 2GGSA 2HCFA 4WGGA 5J5VA 3QUSA 1KVSA 1CR0A 4J7CA 1X8XA 4KAFA 2MINB 2A35A 3DDSA 1ONSA 5K4AA 5LA6A 5TMDA 5I4CA 4KK3A 3M9XA 4L4XA 2I9KA 4WCFC 1A97A 1HZJA 3VH4A 3KQKA 1DIRA 1Y7HA 3GIDA 4YRLA 2UYCA 1V1JA 4FBMA 5EJ2A 1S3SA 1WZIA 2IDKA 3U39A 1TJYA 1SVIA 1G5RA 5IYZF 4HLCA 4W82A 5AJYA 4CTMA 3W06A 2PLRA 2C8KA 1F0NA 2UYQA 4EA6A 4C7BA 3K05A 3V7NA 5ICMA 2NVOA 1ZK1A 4M55A 3IALA 3T7AA 2R47A 4WACA 2YXPX 3CLTC 3FCEA 4X8MA 2FSUA 2ZAOA 3U3ZA 5JWOA 4F1KA 4IMPA 2J5QA 5KWEA 1ULHA 2IYLD 1MC8A 5IDVA 3ZJTA 1THGA 2HMVA 3W6NA 3FZEA 5ALVA 4G2TA 4JJZA 5IUJC 1NA5A 1SVUA 1X1CA 8MHTA 4K0KB 3T0FA 4OAQA 1MA3A 4BWGA 1W6RA 3RS7A 2ZB8A 1Z17A 4R0MA 1HEYA 1T34A 1DS6A 2QJRA 3LDFA 1KVTA 3FNIA 4KX5A 5DGXA 1B0UA 1E0JA 5LZ4A 3FSJX 2JH9A 1BU5A 1MDBA 3QXSA 1KYXA 3E61A 1A7JA 4YCJA 5EE3A 4ED9A 4HDKB 2B0CA 4FR2A 4KG7A 2JFGA 3ZUGA 1J8YF 1V8DA 1ZGJA 4ER5A 4YY3B 3TI9A 2Q3EA 1P2FA 2Q27A 3GWGA 2RC5A 1UBTS 4Z9YA 2FQYA 1XXHE 4UUOA 1S2OA 4GOOD 3WBFA 4JLAA 3VRHA 1T0HB 4DMMA 3FMFA 3I01A 1JHUA 1GN8A 2PH7A 4PLTA 5J63A 5TPWB 3TSZA 1Q74A 3K1YA 4ZOLA 5K3FA 1ZNYA 5FA6A 2CSXA 1KOGA 2WJGA 1OHHA 2Z8YA 2H5EA 4KAXA 1ZI6A 5L6MB 3EEFA 2DUMA 4IZ6A 4YRIA 1JDBC 1A96A 4XAQA 4B80A 1PNRA 4K9DA 5AKJA 3N7AA 5F2EA 3AUKA 4KDFA 3SBXA 2FPIA 1E32A 4Q01A 1WUTA 3JQFA 3ACDA 4S1OA 4UUBA 3FBTA 4GWKA 1H2AS 2P69A 5DHFA 3KYDA 4EQZA 4RQAA 3A1TA 3BH0A 4DGSA 1K66A 4DILA 1NW6A 2O0HA 1I24A 2VBIA 3JQBA 4HQLA 5H0IA 5ITSA 3T0GA 4JDPA 1V6AA 2UUOA 5CAEA 3H0CA 4DLPA 4K9OA 2JJ8A 4PQYA 3QE2A 5TV2A 9GPBA 1IIBA 2DY0A 4RX1A 5ALIA 4ZC8A 5EE5B 3YASA 1GRNA 3TBHA 3ZK8A 5AI0A 1JG7A 4EB0A 5KYXB 1B93A 2WPNA 4Y9SA 2AQ8A 3ONEA 1O77A 3KT0A 3OOYA 4S1WA 5AJVB 2BMFA 2Q46A 2GJKA 5EWLA 2JFHA 1N8KA 4P2GA 4X6XA 7YASA 4WKBA 1OLUB 1C8VB 3W90A 1N0VC 3GW8A 2JIQA 3ZDDA 3VKUA 1HZZC 4UUQA 1G4UR 2B25A 3CNOA 4QYIA 5DCYA 4P81A 2VDKB 2CVFA 3P1JA 4NI5A 3PIDA 4LDAA 4PGAA 3DW3X 3IVMA 2IITA 4REQA 4ZQBA 1MABB 4Q9KA 1RADA 3ICEA 3ZQ6A 3R75A 2VWGA 1R16A 3FYHA 3B5EA 3GLUA 2QS9A 4I50F 4J4HA 2G09A 4E13A 4M0FA 3F7OA 3F2VA 1ZJYA 2C29D 3FPHA 3WGNA 1XMQB 4GOXA 3N8IA 3RTDA 1BW9B 4EAQA 2O8BB 2ZIXA 3JRWA 1K3TA 2PUEA 1FMFA 4G0WA 3AP2A 3NHKA 2QZ9A 4RZIA 1O89A 3SKVA 1U3FA 2HEIA 1KKLA 1PG5A 3MTIA 3O0TA 3RJ5A 2C7GA 3QX7A 4G1BA 1OXKB 2MHCA 3LC1O 4O1HA 4NBSA 1AQ6A 3NIWA 3P8ZA 3JVVA 4D9JA 3LI2A 4WCFA 1Z4IA 2R7NA 4CKWA 3M9WA 2Q7DA 2A9OA 4XQCA 2QM0A 1T9KA 5CT9A 1PSWA 1GAXA 1WB9A 2YMPA 3ZJYA 4IIBA 4PG4A 3LKDA 3D59A 4ALNA 1A4IA 1G1AA 5ECDA 4COOA 1T0PA 3SQLA 4D6PA 3K9GA 1RBYA 2X2FA 3BVPA 4Q16A 2HDWA 3EZLA 3TW8A 2DTDA 3IIKA 1ISSA 3DE3X 1X80A 3EFBA 1TF2A 2Y0CA 3MUNA 1EP2B 4Z5XA 4ZTUB 2FDCA 2W6JD 3GLFE 5KNCD 5AI8A 1RTTA 4HXYA 4PYOA 1LB1B 3D3QA 4UD2A 4IOMA 2AXQA 1NURA 1R2QA 2GYYA 1OZFA 4E32A 5FRDA 2PU7A 1PN3A 3CTPA 4I4IA 1UK6A 2HV9A 1VE6A 2XWJI 4G81A 4HPXB 3X1MA 3VKHA 1W8IA 1OFGA 3F6YA 4TV8F 1H85A 1WW2A 2F3SA 1UWCA 4R2KA 4PQEA 1REQA 4X63A 5F73A 3W2HA 1H8HD 2PT5A 3G2PA 4D41A 4QT4A 2CKDA 4JYCA 4PFSA 2H1FA 3OQJA 5C8DA 3PX2A 2QRZA 1N5JA 3MGCA 2J5BA 2I4MA 1NXTA 2JVJA 1SUDA 1XCOA 1QGUA 4WZBA 5FNZA 4QRIA 3RC8A 2V7BA 3ENNA 4L4SA 1T2CA 2GTIA 1Z8HA 3IO3A 2O7SA 3DMHA 1F0YA 4MINA 1ESZA 5SYNA 1RHUA 4WRRA 2WU3A 4PYKA 4OFXA 4C4PA 2RDMA 1GQRA 4WJZA 2ZRKA 2RGWA 5KVAA 3IRUA 2ZI4A 1NXPA 3P2JA 3DVSX 2KI5A 4KXLA 2ONZA 4AJOA 1NV9A 1UINA 1UM9A 3O1LA 4NVRA 5B58T 5GADl 5E9AA 1UKVY 3EUEA 1FFGA 1EM8B 1JW9B 3R6WA 4P3KA 4UMVA 4BLWA 1S8AA 1XD2B 3T4PA 4JXKA 2YWFA 3D9QX 4LZZA 3FCAA 1IC6A 2EP5A 3EVEA 3DAHA 2XOXA 5TARA 1NQTA 3U09A 4JLOA 1RXIA 1U2TA 2EBWA 1NJGA 3RO7A 3EIWA 3HDGA 1HDEA 2FH5B 3SLGA 4BDSA 2VZLA 1DC5A 4P3OA 4ZPJA 2F3PA 2CGEA 1L0BA 4E6PA 2ZQYA 1H0HA 4FFVA 2AXPA 4F60A 1NVVR 5DSZA 3UXYA 2W5UA 3CZAA 3OESA 4YRRA 3QLEA 4B3TB 4QUKA 1L1QA 5AUPB 1DBVO 2X8LA 1ECGA 2CDNA 4Z6KA 1HZZA 4KR9A 1KI7A 3NB0A 4FWIB 4XD7D 4G5XA 4TTTS 4S1NA 4ZAXA 4F85A 1NVGA 4IJ6A 3AY3A 2YNMD 1O1YA 5C8YA 3B52X 4TPKA 1MB9A 2VQDA 2HA7A 4NYJQ 4AKSA 4H17A 3T1OA 1ZPDA 3UJ9A 4PLYA 2HPHA 1M3SA 3JD4A 1PW5A 2QTRA 3WMXA 5ECWA 4C6SA 2P2GA 5HZKA 5KTNA 5LQUA 1IWBB 4QU9A 2B36A 2RHCA 3LCUA 3LBNA 5JEDA 5ISMA 2WFZA 1IYZA 3JYPA 2CWDA 1XZCA 2GHQA 2PFSA 1EUYA 2CL6X 4ZI7F 5FD8A 1TEVA 2CJWB 2GSDA 2VHCA 1YULA 2G9ZA 3T7EA 3KG2A 4ZV7A 4DEXA 2RGAA 2VJQA 2CHVA 1GZ5A 4UUMA 1I80A 3DVQX 3H9EO 3P71T 5JALA 3AJEA 5DT2A 3O6VA 3NXKA 3P2OA 1JHZA 3K9LA 2ZUDA 2WWIA 1TQ8A 4S24A 3UKOA 3WSVA 3WR5A 3U44B 3NPMA 5AH0A 2AN5A 4NG4A 5AUNB 2OGWA 4P33A 4QSHA 5B4UA 4LF9B 3DP7A 3GJ7A 4JJGA 5J2TB 1JPUA 2IHNA 1RLTA 3O26A 1DKNA 3PGVA 3ZHVA 4CV0A 1Y3IA 2EJVA 3LT4A 1RI5A 3O3NB 4QGFA 2H9AA 3KEGA 2ZJ0A 1JLMA 6REQB 5HDQA 5IUNC 1VLMA 2H7XA 3KOZA 4L72A 1POXA 4S0XA 1W35A 4QUIA 2ORVA 1CVIA 5KZMB 2NTEA 1GTVA 2VBGA 2C07A 2B8TA 1SOAA 1FIUA 4LVUA 1MP0A 2PH5A 2IU6A 4CKCA 2PEZA 5J40A 4FMCF 1ORVA 5DYYA 1YRAA 2DWUA 4K6HA 2JFBA 4HQRA 2OV6A 4WCVA 2V54A 3GCGA 1KEVA 4NATA 3ZXIA 3GG2A 1PNTA 1Y1RA 2QGFA 6ADHA 3DBRA 1CHNA 4G0QA 3R3ZA 3R7SA 4B85A 5L53A 3PRJA 1LBTA 4A5OA 2AEFA 5HUJA 1EA5A 4ZHQB 2Q1TA 3PC4A 3D6MA 2JDIA 3QWIA 2NVWA 4M1TA 4PV7A 2ARKA 2HWKA 4HN4B 4MYUA 4M9ZA 4XWYA 2B98A 2Z3ZA 3KWFA 4OM7A 4RJLA 4LFCB 2FX3A 1J0AA 5LB4A 3MTBA 1P9NA 4B9EA 5CT6A 1DOZA 3ZD7A 2SICE 3VR3A 1OOEA 4F3KA 3VH1A 5EJFA 1ULBA 4I19A 4B34A 3MW8A 2AR9A 1RBQA 3KB2A 2Z2XA 4MVJH 1U0EA 3F9RA 3PFKA 4M0KA 2D0PB 2B8EA 2H5IA 1ORTA 4NG5A 5D00A 3SYLA 1XU7A 3SYMA 1V5IA 3W6UA 1N6HA 2G82A 3R7AA 5BOSA 4YYZA 4NY1A 5JTTA 2EL7A 1AO0A 5L7YA 1DQNA 1AF7A 1XZHA 4L0MA 4FDTA 2CJFA 5HJEA 4Z0TA 1U6JA 1ZEMA 3SS9X 5I6DA 5ED4A 4UNNA 1XTRA 3Q8MA 4K87A 5AK3A 4KQFA 1L8AA 2G9NA 1FVHA 5A2GA 5LOVF 2XZOA 3HG7A 1O0CA 1F8GA 4K28A 3W7VA 3VX3A 3MJTA 5E2IA 1T6ZA 2PD6A 4IV5A 3DEAA 1SVSA 2XWSA 3VNAA 3QQ5A 3DBHA 4IXDA 2FJ0A 1KK3A 3K0FA 5B7NA 5CLFA 1YV9A 1XHEA 3JSXA 1IJFA 4U7PB 5EQFA 1XKLA 3TR6A 4Y1FA 2V4UA 3JXEA 4OHXA 2R7AA 3PFNA 3URMA 5JSHA 4HGQA 1SFRA 1T5SA 4K81B 1U9ZA 2HUPA 3VC1A 4F3YA 2W37A 1RVV1 3PPIA 4BJ3A 3TF5A 2Q50A 5LQNA 4LFBB 1JA1A 2OAQ1 3G5MA 4QHTA 1DMSA 1IN1A 1EWVA 3C3CA 3A1DA 3AI1A 5B3JC 3BBPA 1DX9A 3G85A 4HNQA 1WETA 2FXVA 4HWSA 4IRMA 4RK1A 1OT5A 3E5HA 3KAPA 4DR4B 1ABEA 1LPSA 2IEDA 1MTZA 5B6IA 1LRKA 5IANA 4DCPA 1YZQA 4AJ2A 4KXNA 4MUKA 5IDXA 3A6FA 1YXMA 3SE0A 3SHQA 4HWTA 4R2JA 3WYGA 2WKQA 4JT4A 4KZKA 4OQQA 1YA4A 1YS7A 2Y9MB 4IIGA 4LQCA 5B55A 3MQFA 2FQWA 3WISA 3X3HA 1MEJA 1OC2A 4RLSA 5C4IA 2HK8A 1JDPA 2VHEA 3LMKA 1F3LA 1KMHB 2R1VA 2OCXA 3ZU2A 4OGFA 4RJTA 3I37X 4BASA 1EVJA 4DWVA 1O9BA 4YLGA 3ZCQA 4QQNA 1ELOA 5E7MA 1DINA 4R40A 5M5BA 3R6TA 3ICCA 4JJAA 4AMGA 1OFUA 3OZWA 2D00A 1YIDA 3N2IA 2HNKA 3PDJA 4GX1A 4KO4S 1XKQA 1JDVA 4LCEA 3QKRA 3ESZA 3WZ2A 3EEYA 4W7SA 5LP1A 3N8NA 4QOGA 2HRQA 1AXRA 2I55A 3WYCA 2HZBA 3IBYA 3S81A 4BRSA 2XBMA 3A10A 1SHUX 1YQQA 4XCVA 4HXGA 4TUYB 2XRMA 4W8GA 2NO4A 3KZVA 3B9QA 4LZNA 4M0CA 4QQFA 4UCWA 3QMWA 4GI3A 4R9UC 5EE9A 1IBKB 1ONBA 2XRYA 3ICPA 2WPDA 3FDIA 4H0CA 4DVJA 1NBME 3SM3A 2JLZA 1QLWA 2IP4A 2NYUA 2NUPB 2A1UB 2A7QA 1G60A 3OEHA 4HXFB 3OX1A 1VQ1A 3PC3A 1PG0A 1XT6A 5JC1A 3I9OA 4LXIA 3WQBA 4U8GA 4B6OA 2LDBA 4YC7A 1GOTA 4PTYA 3WRYC 4DV4B 2G63A 3KQTA 1L7EA 1VDMA 2RK4A 5EQJB 5JJCA 1ZH8A 4BMPB 4R6XA 1DC7A 4FDAA 2IUTA 3C5EA 3CIFA 2QUKA 1TZ2A 2X1LA 4HUQB 3BK2A 4AF8A 4EFLA 1BXKA 4WOBA 2UVDA 3NASA 5G0WA 2QRJA 1WA5A 4D9NA 5CCEA 3DDNA 2KSQA 1CHDA 2B1GA 1OPRA 5JZMA 3FLBA 1ZLYA 5GGYA 2XTNA 3QXGA 4H31A 5A62A 4O4HA 4QUHA 3WVNA 1U9CA 2HQSA 4HI0E 3D6AA 2IDMA 1I3CA 1KVUA 3ORFA 2I71A 3G7SA 3GOQA 2FN9A