3MILA

Crystal structure of isoamyl acetate-hydrolyzing esterase from saccharomyces cerevisiae
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
240
structure length
240
Chain Sequence
MDYEKFLLFGDSITEFAFNTRPIEDGKDQYALGAALVNEYTRKMDILQRGFKGYTSRWALKILPEILKHESNIVMATIFLGANDACSAGPQSVPLPEFIDNIRQMVSLMKSYHIRPIIIGPGLVDREKWEKEKSEEIALGYFRTNENFAIYSDALAKLANEEKVPFVALNKAFQQEGGDAWQQLLTDGLHFSGKGYKIFHDELLKVIETFYPQYHPKNMQYKLKDWRDVLDDGSNIMSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isoamyl acetate-hydrolyzing esterase
publication title Crystal structure of isoamyl acetate-hydrolyzing esterase from Saccharomyces cerevisiae reveals a novel active site architecture and the basis of substrate specificity
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 93
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3milA00
3DCIA 3C1UA 2VPTA 4K9SA 4K3UA 3DT9A 4XVHA 5CD9A 4LHSA 2Q0SA 3DT8A 2WABA 4OAOA 4K7JA 3P94A 1YZFA 5JD3A 4S1PA 1ESEA 5B5SA 4IYJA 5BN1A 2WAOA 3SLRA 1JRLA 4I8IA 2W9XA 5HOEA 4M8KA 4JGGA 1J00A 2Q0QA 1FXWA 4RSHA 3KVNA 2WAAA 1BWPA 4Q9AA 2APJA 3RJTA 4HF7A 3SKVA 4RW0A 1ZMBA 1V2GA 4PPYA 1ES9A 1WABA 1VYHA 4TX1A 1IVNA 3W7VA 1DEXA 1VJGA 1BWRA 4Q7QA 3MILA 3BZWA 4JHLA 4JKOA 4OAPA 1DEOA 4JJ4A 1Z8HA 1U8UA 4NRDA 3DC7A 3HP4A 1FXWF 4K40A 3PT5A 5A4AA 2HSJA 4JJ6A 1PP4A 1ESDA 3U37A 1ESCA 1K7CA 4DEVA 4H08A 2O14A 3DT6A 4HYQA 1BWQA
chains in the Genus database with same CATH superfamily
4ZOLB 2J0EA 2BFDA 2NIPA 6NULA 4MR9B 2ZG6A 5GJCA 4A6XA 4OKIA 3Q2KA 2GAJA 3OQBA 3E7DA 2JI6A 3PPWA 2E6UX 2HIHA 5A0VA 3VRHA 2IYQA 1M6WA 2PXCA 5CDSA 2OG1A 3DSRA 1Q0SA 4JSYA 5GAJA 1DAEA 3H9QA 1MORA 4JLBA 4W1SA 4EDFA 1U9ZA 3MWDB 1OX5A 5IVIA 4YB8A 5IJ0A 1VLLA 2A59A 1OZFA 2HCFA 2R8YA 1GZ3A 4KWTA 4J2TA 2O50A 3A11A 4ZT6A 2MYUA 1TCCA 1DS6A 3RC3A 4ZJYA 5BPHA 1KP2A 2WABA 3FVRA 2J6IA 2NMVA 4CR7A 1QZXA 3QOFA 5H70A 4DC1A 5A6SA 1EESA 1EEXB 1QGOA 1U5BB 3F8WA 3IV6A 2QW0X 2CXNA 2Y77A 3X0DA 3V97A 3BIOA 3CCFA 1Z6GA 2N47A 4M88A 1OLSB 5E9JA 3DOEA 4K03A 3JQ9C 3CBGA 1GYQA 3JU3A 3DFZA 4KX5A 2J32A 5CDGA 5CMLA 3OE7A 1JLKA 2GILA 4YMUA 2GCNA 1JI3A 2EWVA 3ODGA 3CLUD 4C78A 4MVJP 4P92A 1CR2A 4YWJA 1JLHA 4RA6A 1JYSA 5EKSA 2XGGA 4AG6A 4DGQA 1ULAA 1WE2A 1SUCA 3ND7A 5IUJC 4BO9A 2G09A 2VG8A 1ZH2A 4XKJA 1T4MA 4KVGA 3C6YA 4YDQA 1E1RA 1RM4A 2EWMA 1NN0A 2WD7B 4WZ6A 4PTZA 5CK4A 3GLIE 3BDVA 3ZE0B 3A70A 2NTEA 3MQ2A 2FFQA 3O4GA 4WESA 3S44A 2NSDA 4G85A 1HXHA 1KXJA 1YA4A 5IBPA 2VSOA 1Z8DA 3EG9A 3HG7A 3TIXB 2BFCB 3LY7A 4FYVA 4EW6A 4PG5A 2CLKB 1R5OA 1HZZC 2CLHB 5BW6B 3ZX4A 1N9GB 4JT9A 3LIPA 4W8HA 2P6RA 4TYQA 1LTHR 1U0RA 4LE2A 4UHFA 1AVTA 2YHIA 1WDTA 3D81A 1JAHA 1Y82A 3R0ZA 1UWVA 1RKXA 3K96A 5D00A 5GONF 1J0DA 2HWYA 3A3PA 5LQKA 2ZVJA 2CD7A 4FGLA 4X54A 3UQYS 2WIBA 2PLRA 3LKDA 2W58A 4RK4A 3TVYA 4F06A 2HQSA 2BZ0A 3K0AA 2BDUA 2E5FA 3K92A 1U4SA 1W19A 2OR3A 4TKUB 3SZ3A 1H0KA 2CN1A 1MOSA 2VPXA 1CUAA 4HZUB 3K9LA 1BCRA 4OAQA 1KETA 2CVOA 3C3KA 1PZMA 1IPHA 1P4SA 4LVOA 3H2SA 2OM2A 1PS0A 1E0DA 3RS5A 1GNTA 3FPBA 3O0TA 2CZCA 3L0CA 1BKDR 3FYSA 4PSKA 4QX6A 4G0MA 3UM9A 2FW9A 3ZK7A 4F7DA 3WYEA 3IUNA 4NS1A 4R9RA 4U7PB 3RV4A 3AEKA 3D1LA 3I61A 2P40A 1CLUA 2I2BA 3QI2A 1U7XA 2HX1A 2I7DA 4LDNA 4R3NA 3TRKA 4ARZA 4O2AF 3EVTA 1II0A 4DQUA 4YUXA 3WGGA 2OMKA 3BOSA 2ZRNA 3GR6A 1BFKA 1SBYA 1GKIA 4Y9TA 2DQSA 2I4NA 2IZOA 5SZHB 4DLSA 2XGJA 2A4KA 3EAGA 1NBMD 4HO1X 2C2OA 1RACA 2QE6A 3CVOA 2CSUA 1E62A 2XCOA 4PQFA 4BVLA 4F11A 1G8KA 4YJFA 2PBZA 1TA4A 2W2TA 2QRVA 5DP2A 4MDYA 2VJMB 1T2NA 1TT5A 3IDAA 4GPAA 1JEAA 1XCBA 3D54D 4P82A 1H2XA 1L3BA 3VPFA 4DYDA 1ZR4A 2DZDA 4P5EA 1ZW6A 1HEUA 4TTVA 1J0CA 2HADA 2NZ2A 2XBMA 1KSJA 4RCYA 3COZA 1IN7A 1D6SA 2EX0A 4M9SA 2L18A 3RBAA 1NAIA 3KOZA 2D54A 3VR0A 5E8JA 2D1SA 3AM3A 2LIPA 2IDMA 4NU8X 4Q9HA 1P3JA 2P0YA 1DWPA 2O2XA 2OESA 4IH9A 4LX8A 4KFUA 1MH9A 3DPUA 5GOTA 3X2FA 4NMWA 1CJCA 4PLYA 1NSFA 1XVLA 5KOIA 3VNQA 1K0UA 4GGMX 1NGSA 5DNCA 2ZBQA 3H2KA 5DBGA 1QHYA 4TWBA 4B3RB 2C4HA 3Q5GA 4QDXA 4WSOA 3QWAA 1P9RA 4ZQFA 4Q1VA 1Y8QA 4P7KA 4FB4A 2PD6A 1FLAA 2J3JA 2WJPA 2ZATA 2GBGA 2G07A 3G0DA 4NZZA 3H1BA 2MR6A 4UBIA 3RREA 5LQSA 3ZJTA 1A1SA 3UN1A 3EARA 3GRAA 3THYB 2AOWA 3IPXA 3V8BA 3ZJ5A 4QNMA 1THGA 2VOEA 4OHKA 2B4AA 1EBFA 1Z0AA 2PGOA 3NTVA 2O0HA 2CF5A 7ABPA 3ZE1B 3QYFA 3A4VA 1J70A 3IB3A 4W6ZA 1FFHA 1G8SA 1U2ZA 2ONYA 4NFSA 5IEJA 1X13A 3LPAA 3SJBA 2QPAA 2UYGA 4I4TB 1ML3A 4OHFA 5CXXA 4ZDKA 1L1QA 5HKKD 4NF2A 4LZNA 2KLBA 2R5FA 3LCRA 4X97A 4ALLA 1G59A 3GJZA 4FDMA 3U26A 3EXFB 5F1KA 3R20A 3X1MA 4UEKA 2IPXA 1ZINA 5EMLA 5FWNA 3MJDA 2VQEB 1YQEA 5DNEA 1EA7A 2WOJA 3TTWA 3B3FA 3UJPA 4OQMA 3Q88A 5CFLA 4XSHA 4RPLA 1JR2A 4JB8A 2Q1YA 1G98A 2XGOA 3AUYA 5B53A 1NBME 4L5CA 3KQPA 3M49A 3BWMA 4M38A 3DP7A 3DV0A 2R8ZA 3HEAA 3JD0A 3PHIA 3MCUA 2HA4A 3QEOA 4P84A 4S1OA 4I6JA 4F04A 3T3PB 4XPIA 2P4QA 2W93A 5KYUB 3FPJA 2YZGA 3KTAB 2WUEA 4GPIB 2R0QC 4EHIA 1RWKA 4HMOA 3K0HA 1GIAA 1ST3A 2SCUA 3B7GA 3CWCA 3A4IA 4M9UA 4RJIA 3VR2D 3ZE2B 1H42A 4FDVA 4C05A 3A4MA 3ESYA 3P0IA 1U2SA 2PWZA 3OBIA 4PZ0A 1A0OA 4UUOA 1YS9A 1PEKE 3HB1A 3OURA 4NVRA 4F4HA 5A4FS 5I7HA 1S3SA 1XYGA 3EFOB 1JSXA 3ZY6A 4K87A 1HFKA 3CLUC 2Y76A 3NETA 2GNOA 3VDQA 1L7MA 1U1GA 4R40A 5KVAA 1A9PA 2ODNA 3T7SA 1EM8B 4RVUA 1RRGA 2YRXA 2UZ3A 4AYWA 1LPMA 4MDHA 1E7MA 2V58A 4G9BA 4UU1A 4ZT5A 2CFCA 3EQZA 1ARZA 4Y9UA 3BS4A 5EXXA 4CLHA 1WP9A 2QAJA 2DFLA 2YJGA 1JHAA 1DZ3A 2NYAA 3ONWA 3O8OB 3THXB 1Z56C 3A32A 4LS3A 1I80A 1B3BA 4AUEA 5HIKA 3R6WA 3UJBA 1KFEB 2QP9X 3UXMA 1JJ7A 1E9EA 1QM5A 3DFIA 1VA5A 2ZJ0A 4Q93A 3V2UA 2G67A 3BL5A 3TZHA 4KB5A 1UBOS 3U48A 3EN0A 4RTOA 3OICA 4KQIA 1QPZA 2Q3DA 3KPJA 4JT2A 1AQNA 4AWAA 2V6BA 3H4TA 2JASA 3V9AA 1A2QA 2GN0A 1US8B 1E59A 1EDOA 2ZIEA 3W5VA 4W5NA 1B2LA 2GPJA 4QUAA 1GPYA 3FROA 2WTBA 5CVJA 5TGTA 1DOAA 3VZBA 4BNNA 1JE0A 2GJSA 4LOLA 3SBEA 2P9BA 2SECE 2BKEA 2XMPA 3CLTC 5T8KC 4EJFA 3R77A 2F55A 3IDZA 1PFUA 2WIKA 1OTXA 1ECBA 3LPLA 5GV8A 4EA9A 1W30A 1DP4A 3KAJA 4Q03A 5BXQC 1J5XA 3QUAA 3V3TA 2QZJA 1B1CA 1DC4A 2AMFA 3EDYA 5CD1A 5GINE 3K0BA 1Y8CA 4TOIA 5ADHA 4E07A 2CXQA 2NQ8A 4EJSC 2CXUA 4FNMA 2HYDA 1AMOA 1I7QB 5HZKA 1H5UA 3ZUPA 2ZT8A 3V6LA 4DCNA 3P4UA 2CVPA 3PD1A 4A8TA 4EVRA 4ITVA 3TLCA 1QVAA 2RKWA 5JZOA 2YL2A 1WXIA 1RRVA 4B6PA 2XE8A 3B1VA 1OWOA 2QVLA 1UAYA 2CFSA 2O2ZA 3QXHA 1JU3A 3W5IA 8ADHA 1RJGA 4Q66C 4ZVPA 2BJWA 4ZPXA 5FR1A 3IPLA 3IV7A 2FDXA 4FFPA 1FNCA 2GBLA 2GK4A 5B1IA 1QNLA 4ZOQI 4JOQA 4WZBB 3GLVA 4INJA 5FV7A 1JH8A 4RZUA 2ZTMA 2RHRA 2QN2A 1PT9A 4B6JA 3DBRB 1EWKA 1DC5A 4EYEA 2VSQA 1G6HA 1ZOOA 2AN9A 5FTKA 2NTVA 4ETWA 2WJJA 4WY2A 3RK4A 1IXRC 2V9ZA 1C9EA 1JQ3A 1MXFA 2GEBA 2WU1A 3LHKA 4D9BA 2VH2A 1NP3A 1Z5OA 4LY3A 2BMAA 2XT6A 5JG7A 5AVUA 1W4BA 4EUHA 2VFAA 3FF1A 4R8KA 2BGRA 1STOA 1MW8X 5DT9A 1MIHA 3PXDA 5AW9A 4M0FA 5AI8A 4F0JA 1EB9A 4N5DA 4H7PA 1QB7A 3HY4A 1TK3A 2HIMA 1J39A 2AZTA 1P80A 3JQAB 3QE0A 3RS8A 3SBDA 3GNSA 1NFRA 4WLEA 2RMKA 4AW9A 1N8SA 2GAFA 4OK3A 3OQMA 4IIFA 3OTHA 4ABYA 4LNUA 3NU1A 3NHAA 4P83A 2P3LA 2GF0A 4LXUA 4GI2A 3HZZA 5FAKA 1KZ4A 4H9GA 5IM4F 1HV8A 2GD0A 1OKKD 5EPEA 2X6TA 4BAZA 4H0CA 1O77A 1P7WA 3N6XA 4M36A 2WWXA 4E08A 1SELA 3IHWA 4L8VA 2H1RA 1RTKA 1V16B 3DE6X 3Q40A 4PU0A 5DTJA 5DYNA 5EKTA 5H16A 1QR6A 1EKXA 2TSYB 2IE8A 4Y2QA 4IWXA 3EIUA 3NHFA 3U37A 3GUHA 1RBQA 5H8WA 3FPSA 1EFTA 3IPRA 4OUDA 5K20A 3EAQA 3EMBA 1IOVA 1E69A 4EW2A 1JDTA 2GLTA 2XUHA 2G5GX 5F35A 2CCGA 4W5OA 1QTRA 2WSIA 1Q7CA 1PTKA 2DWUA 3BK1A 4Q1CA 2AUTA 1EVQA 1H8HD 3HDJA 4B7XA 1NL3A 3V00A 1QCCA 3N5CA 3OCJA 3VYWA 5FPSA 5JS8A 3AVTA 1TIKA 2QV7A 1B1AA 4JBIA 2OZVA 3WNVA 5IX8A 2JD1A 3L46A 2WJYA 3C3AA 3PR3A 4UXJA 4WMLA 5JCXA 3UK7A 2W6ZA 3DW1X 4AC9A 1OC4A 3NBZC 2X1HA 3AY0A 3J81A 3R2JA 4R54A 1J90A 5CBKA 1IMOA 1PZGA 5FWXB 4O2BA 2BSQA 3JQFC 2HI0A 2P62A 4OA8A 1NZJA 3BQNB 3L07A 4O5AA 2NQTA 1L0BA 1TTPB 2NPFA 3K5PA 4A2PA 1O95C 1ZQ9A 5BMVA 5FWYA 2V6JA 5J63A 3ITEA 5C1IA 5AD1A 4JXZA 3Q3GE 1FBNA 10MHA 3G02A 5ARCA 1NI4B 1XEWY 3G89A 4ADSG 4MIYA 3EGDA 3F96A 1MRNA 2VJMA 4N6NA 4I1VA 1NFFA 1XCLA 2O20A 2XUOA 2DFDA 2PFKA 5BSTA 3GLIB 4ZYTA 2Q3LA 2RC5A 5A71A 5TQJA 2B1RA 2PR7A 1NJ5A 4RVDA 1GG5A 1OBOA 1FTGA 1X0XA 3ZD8A 3ZVRA 5JH7A 1ZGAA 5IHXA 5KX5F 4U0JA 1Y6GA 3IXLA 1OTHA 2P41A 3OC6A 4OYHA 2OOKA 3V1NA 1A72A 4I8IA 4JJZA 2O1SA 3K6JA 3V33A 4BV9A 4EG0A 4KHPB 1Q1ZA 3FDIA 5E4JA 1JIKA 2TYSB 4KDCA 4I55F 3KSBC 2WE8A 4D8TA 1ZIPA 3PQFA 2QI9F 3D3NA 1RLUA 2XCQA 3I9FA 2GX6A 2JFQA 1D2HA 3AY6A 4FD2A 1YU6A 4KKVA 2JHFA 2AF3C 2J5XA 1WXQA 3IA2A 5EJ6A 1FJ2A 1S8FA 2NUPA 5LDGA 1AHHA 3WWEA 1NY6A 4EFLA 1BVRA 3RNLA 3AC0A 4MI6A 2WNIA 3NWPA 3L0IB 4P4TA 1U28A 3SXPA 2WZDA 3D6UA 2BGJA 1Y6JA 2CCJA 4J1QA 5I9BA 4GNKA 1XMOB 2VDWA 3O92A 2PZGA 3THYA 1UFVA 2R87A 2RHDA 4LRXA 1IQUA 8AT1A 5ALPA 2A84A 5D3ZA 4MYHA 3UMMA 5T6MA 1L4UA 2H7VA 4S12A 1EFVB 5KYVA 2R6CA 4XJVA 4JN6B 4GSLA 1EHIA 1GG9A 1G5QA 1T0BA 2JGJA 1FVOA 2ZBFA 2FGKA 3BULA 2P90A 4I4TA 1RT9A 3UW1A 3R8FA 3AVYA 1EVZA 1PLKA 2J9GA 1JJFA 4M76B 1AK9A 2ZRCA 3GXBA 5HUHA 1PX0A 4FILA 5D6OA 5DNDA 2YY5A 1BXGA 1YVUA 3AJEA 3OCVA 4FWBA 1CVLA 1T5LA 2FEXA 4JI4B 4NRDA 2H4HA 3AL2A 4P4GA 4R69A 5DU2A 3SXUB 2RGWA 4B2PA 4YH1A 1XXHE 3S8EA 3KD3A 5TMEA 1D0SA 2RHCA 4GXRA 1U2QA 3RASA 2D7DA 1Y37A 4LHYA 4Y2SA 1C9YA 1W4RA 1ZN9A 2QN6A 4I6EA 4K1XA 4LJ8A 1YR3A 3BH0A 4IFIA 5KYUA 4ESEA 2Y1EA 4ZHQA 3F6RA 1HA3A 5IMSA 4EYKA 2PT7A 3OEEA 3TJMA 4MW1A 1CVRA 5JIBA 3BSWA 3O8RA 5KTSA 4I8XA 2I2CA 2IOFK 3HJBA 4OA5A 2ZYTX 3H1EA 4U6SA 1GA6A 3EF3A 4Z4CA 3BA1A 1YCFA 3T4XA 2ORWA 2ZRMA 4BX3A 2WV9A 3U4HA 1Y1PA 4EVQA 2AXEA 3KE8A 3UT0A 1QZUA 3OT1A 2EU8A 1KY2A 1IHUA 4ND7A 4PO9A 2BJHA 1ZYUA 1PRYA 3L6BA 3TTTA 4C06A 4KVZA 3W8FA 1HF3A 4JLUA 3TMAA 2VUUA 3EEFA 2LCQA 3KFVA 2C7PA 2HYIC 3N1UA 2QTVB 4AD8A 5FFNA 2OP0A 4ZGGA 2PZAA 1J8YF 1T0IA 2HJVA 3FOFC 3B1FA 4PZEA 1WY5A 3ROMA 3VZRA 3KKKA 5LQDA 3CWQA 4GOND 4F72A 1TQ2A 2AWNA 2NX2A 3S55A 1E2NA 1VECA 4IILA 1JKJA 1KYTA 4XX0B 3W1WA 5MN4A 2X4LA 2RB4A 4JC8A 4E88A 5TXGA 1I3LA 1FFGA 5C5CA 4A5SA 3B48A 4Q6WA 4EL5A 5CVEA 3BXHA 4RDIA 1GPBA 3IAFA 3WTBA 1CEYA 4G26A 4P7FA 1NULA 2CL7X 2AOVA 3DTNA 3EMVA 4MEJA 5AJZA 4YUAA 2GUGA 1XYYA 3T0FA 2WM8A 1YQXA 3VC1A 3GVHA 4ON9A 4DV6B 5IXSA 4UBKA 2R6R1 5JHGB 1IATA 2BGTA 1U8XX 1DC3A 4HAWA 5JARA 1E2BA 1FP6A 2ZJ5A 3EQ8A 4KWHA 2J9XB 1W9HA 2HHLA 2F6RA 3KQMA 1N9KA 1GCAA 1TTHA 4Y2VA 1DIHA 4LKRA 3KEOA 4PIPA 1Y5MA 1QX3A 2E48A 2FSFA 4NCNA 5DLYA 3F1LA 1Z4KA 3E3MA 3ZWDA 4HDKB 4RS3A 5AP9A 3CWZA 3I23A 4BEJA 3HJCA 4V0OA 4E6EA 4C3ZA 3HUUA 1GN8A 3BWEA 1SB8A 1XCMA 3ZDYB 2YFQA 4L4RA 1XIVA 2W2QA 2O6HA 1GYRA 1P7VA 4D44A 5BRAA 5DM4A 5EKUA 2E9SA 5ILOA 3TTUA 3VNBA 4KTVE 4KWEA 3FYUA 3GROA 3HN6A 3CX4A 3OF2A 4F8EA 1QXSA 4IGEA 4QJ4A 2O4CA 5AXBA 3TKYA 1L7OA 2SKDA 4DNQA 1GTL1 1KAEA 2Y92A 3MJEA 3VYSB 5JISA 5LP1A 2VTBA 5ENVA 3WYCA 4KPUB 1DX4A 2VOJA 2NP7A 1BG6A 1YIDA 3FF4A 1ZGJA 3OLZA 3I6YA 2R1ZA 2EC5A 3NEPX 1DXYA 1O6GA 2P6MA 3O2QB 1Y3BE 4YRIA 3AYXB 3CB4A 4IH4A 1F8YA 2F1HA 4FHZA 1LC3A 1CUXA 1XEFA 2GF2A 2HXSA 3B2NA 3Q3JB 4CUZA 1ZD9A 3ZV5A 2GCIA 1L4HA 4MS4B 1ZKDA 3N2GA 1MMFB 3PC3A 3ZE6A 5KVSA 2IBSA 1R4MB 3PT9A 2PANA 4R01A 4LVNA 4UMVA 4HPXB 4OL0A 1U80A 3D9QX 2VJQA 2I8AA 3L7BA 4B35A 1VTKA 3VVMA 4DSNA 3Q4GA 3VOSA 2H1SA 3QU9A 4PS0A 2W2LA 1FX1A 2IDJA 4AMZA 5K6TA 4M89A 1M0WA 4UM8B 2C2BA 1TYBE 1FDSA 1M8PA 3I09A 5EP4A 2ADFA 3JQAA 1SHZA 4Q9NA 3NOOA 4JI6B 4CKYA 1F60A 3M70A 1OI7A 1JFTA 2IXFA 3CZRA 3K71B 2K87A 3T1QA 4UCXA 4D97A 2FSSA 2OFWA 1WSBA 5LBUA 3SGLA 1AURA 3BK7A 3NLLA 2QVXX 2XA1A 2WC1A 2QSZA 2QXUA 4S05A 2VJPA 3VHQA 4WX2B 4F3RA 3T5PA 1U0BB 3ZWVA 3MS4A 4BRUA 1YF3A 2HMWA 2HWWA 2WYOA 1XF9A 4OP1A 2WTMA 1ZO8A 2CFIA 1A77A 3B3QA 5THQA 1KI4A 3MXTA 3M9WA 3AHHA 4PGAA 5TLSA 5EKXA 5EWLA 1JIJA 1XF1A 3OA0A 1AIPA 3IP9A 1SB9A 3L6EA 2QIPA 2M2IA 4TS4A 2G17A 3RLIA 3CUTA 4GP9A 1R10A 2I6SA 2C58A 3GN2A 3RDPA 1QS0A 4NBRA 2XQGA 4IJMA 1QNFA 2EP5A 2PGAA 5DFAA 1DARA 1JG3A 1TVKA 3SYTA 5AW3A 2E4XA 2DPMA 4F3YA 3L43A 1MQAA 1T3TA 4WK0B 1HT1E 1IYZA 3GJ4A 1VJ1A 3GRRA 2YIDA 4UNIA 2DR2A 3NBYC 4HK4A 1J56A 2DUWA 3I2YX 3I3OA 3ZS8A 2C42A 4O4IF 2QOEA 5YASA 3DLHA 3TGPA 3W6NA 5F3WB 1Z62A 3HDVA 5DASA 4B6GA 3PLAE 4D74A 4PSVA 2DUNA 3BL6A 3LO8A 4X44A 1EK1A 3HKCA 2B7BA 1NP7A 3Q3VA 2R5WA 2CB0A 3E81A 1N5OX 2C3UA 5B37A 4RELA 3GA0A 3VDMA 2C8KA 2BEWA 3D2CA 3HR4A 3I1IA 1XR3A 4BP3A 3AU9A 2VNHA 3WJ2A 2XCIA 1LSSA 1UBTS 2C5HA 2ECQA 3Q3IA 1IZ0A 4QASA 4CKCB 1XMPA 2CL6X 3QK7A 5JSKA 4E5YA 1NZDA 1LDNA 2AN4A 2QSYA 3RJTA 1P81A 2JGNA 1E1RD 2BE7A 2C07A 2O2GA 2QPTA 3HFSA 3E5MA 4GQBA 3DL7A 2BGGA 1H4QA 1S7CA 3GJQA 1DFGA 2ZE5A 1V9CA 1WKCA 2GD2A 3UMVA 1ES9A 1KJIA 1Q50A 2G76A 4G5SA 3WZ2A 3D8UA 1BWSA 4J43A 5E6UB 3KR1A 4RU1A 1H2ZA 3W2FA 3ZNOA 5HZGA 5KNCD 1BHSA 5JAOA 5BYKA 4MLDA 5EJ8A 3OJOA 3QYPA 3P0RA 3I34X 4QPCA 2ZTVA 5TPWB 4POOA 1SMKA 3WDKA 1UADA 2Y1GA 3TQSA 3LXUX 3KRTA 4BNMA 2UXDB 3VKUA 1AGYA 1BFUA 1Y3AA 4PTLA 1DAFA 3QTTA 4MV7A 2WFAA 3N7UA 2C4VA 3M1AA 4KRYA 3E9ZA 1QIHA 2IHJA 1CDZA 2HU5A 2JFHA 2YYZA 3ABSB 2A67A 4MYRA 3AFHA 4I50F 1IRIA 2GEFA 5CW2A 4BGEA 1XPRA 3PNOA 2G25A 4CTOA 3I32A 2VDLB 4FHFA 2WB2A 4HNRA 3IXMA 5FIUA 2GEVA 4FGKA 5LZ5A 4DQDA 2QRZA 2WUDA 3GYGA 1I94B 4OHMA 1KE1A 1XZAA 4OYYA 5EQDA 2QSJA 3T1YB 4J6EA 2XE7A 5BNTA 3WR5A 2ZWVA 1IK4A 1SVMA 2Q7XA 2G70A 3OQOA 3OWHA 3UOWA 1AGNA 2QHXA 3KK0A 1IBCA 3H1PA 3INNA 5FOSA 4JLDA 4TLEA 5ARDA 1Z38A 4E1VA 2ZYAA 4ZEOA 5LXTB 3N2YA 1J21A 4KN9S 4UUBA 1MO6A 4B6SA 2QL9A 1K98A 3A6HA 1GGHA 2RHWA 5DRTA 4BPBA 2IOYA 4XRRA 2YOFA 5TQ0B 3DEKA 3FOCA 3EEBA 4HSEA 1RRFA 4HWGA 5BUCA 1KEEA 2F17A 4M46A 4PFJA 2RKOA 1YKFA 1T1JA 1KDZA 4BKRA 2QQ0A 3AJAA 4RH1A 2EZ8A 5KNCH 5GJBA 2EX1A 2A5YB 4LCJA 4HYEA 1BX0A 5EZYA 4E21A 2Y0EA 1L5ZA 1H1TA 3SBOA 4BBZA 4MPPA 1TC1A 1U3WA 4QDUA 4WK4B 1Z5VA 4UOQA 2KW5A 3HRIA 3KXPA 2WQ6A 3EZ7A 3QPDA 5JS6A 1Z36A 4R8SA 5IAEA 4R1MA 4UEQA 4CHTA 1Z0IA 1ZIYA 4PRLA 4D96A 2ZR9A 1TFUA 1DCMA 3FY4A 3N07A 2YYSA 4JJ8A 2VJBA 1XZGA 3RYIB 1EWYA 3GG9A 1OJLA 4DCSA 4E5MA 5FUWA 1MTOA 2A33A 2DHEA 3C15C 2HWXA 4MUAA 3H0EA 5TMDA 5DM60 3NHWA 4GMGA 3E4DA 2V1XA 5HOQA 3NV7A 2OAGA 2A1UB 5F1OA 2VCHA 2X8JA 1X8LA 4IRUB 3OOWA 4V0KA 5B5SA 1T9GS 3CEPB 2QRNA 4MIKA 3AETA 5LDHA 3KKNA 1N5LA 4QHSA 1YL5A 1TJPB 4JUBA 1IEXA 4QEDA 2GYYA 4IV8A 4JP3A 4EPRA 3SIXA 3HVIA 1QV7A 1E5VA 5CNIA 3DLPX 2HJHA 1E96A 4R6XA 2VSXA 4XI9A 3HKBB 4ZU6X 4EGQA 1R8QA 4RCZA 3I72A 2O2JA 4XFJA 1OQAA 1GUDA 2LWIA 4LOAA 4UC0A 4WKOA 2PQ0A 3MQFA 2AI1A 4MNTA 2J3KA 3O8BA 5JANA 2GCPA 3G0GA 3R4CA 2CVQA 2OVBA 2FHPA 2I65A 1MQ8B 1F2TA 3UFXB 2FZWA 3O3NB 3WYFA 3D6AA 3CE6A 4TXLA 5IT5A 3A4YA 3T5DA 4AXXA 4EZBA 1U1EA 3TGLA 2CNBA 4IUBS 5DI9A 5KCMA 2I54A 3FPAA 1XXHB 4MP6A 1AV7A 1KVSA 1R27A 3BHNA 3ZHXA 4BLSA 5KKCA 5ELXA 3WKEA 1YI8A 3WLJA 1JAZA 4PSAA 3MCTA 4PG6A 1NW3A 3H4IA 1XZNA 3GGCA 1S2GA 3NTOA 3PD0A 1X1AA 2ZAOA 2R6DA 1JHMA 4JQZA 5CLGA 5DXAA 3UICA 5AXAA 4QRDA 3HE3A 3JZIA 4CIBA 2VJYA 1FTQA 2DQZA 2WM2A 4C0AC 1IH8A 2EKZA 5IT0A 1EJBA 1UK9A 2WF5A 3RWMB 3FIJA 1FC0A 1CHNA 3K1YA 3ENZA 4O4LA 3AVPA 4E3WA 1JALA 5ES4B 3ET5A 4CFYA 3ZNPA 4IRXA 1M66A 5HM8A 5KOJB 3A4LA 1GUYA 5KYGA 2D5CA 3R3UA 5BR4A 3O90A 4YCNA 4LJRA 1PLJA 1UEJA 2H2AA 3O8CA 5H3CA 1JXMA 4YLGA 4Z4QA 2VRCA 5BOSB 1UBLS 3ZXYA 2H11A 4JC5A 4RXMA 3VBCA 1CYEA 1WXXA 3RW9A 3ESAA 2PN1A 3FSEA 3CPHA 1KEZA 4DG9A 1V5GA 1N1GA 1AA9A 4X93A 4RF4A 1R0SA 1K7CA 2GPBA 2R48A 3AF5A 1GPNA 1CQJB 3MXOA 4L3VA 2VJCA 3CH7A 2P9QA 4L95C 5J4VA 1CUVA 5BRNA 4FCCA 4JBNA 1C1DB 3DCIA 4ALMA 1Z0ZA 1D6MA 4E4TA 1H4SA 2I6TA 5CFPA 4DBZA 4R84A 2JI9A 3MHTA 1ZCAA 2FFAA 3RRBA 1CUUA 3AKEA 1L4EA 2CFRA 1F0NA 4H6WA 2PL5A 2ZIGA 1T2FA 4UZSA 3ES9A 2UYCA 1QONA 2D0DA 4O1HA 2PMBA 4P81A 4EATA 1NDHA 2L0XA 1CUSA 1JDSA 2WKPA 3I9LA 3OG9A 1T2UA 3KWLA 2FWAA 2XNJA 5C8YA 3HEBA 2ZUVA 4W5QA 4K9DA 4PNHA 1R4NB 3ZTYA 4W9MC 3OMWA 4R1NA 4XVCA 2QK4A 3UVEA 5LOVF 3R23A 1Q0RA 1P73A 1TJ4A 3GGSA 3OZEA 4OI1A 3RSHA 1K3TA 4WY5A 4JUAA 3QUQA 4Q3CA 3MVEA 2CUNA 3ANYB 3O2NA 3W7BA 2C2KA 1QIIA 3PJFA 1F8FA 4F9FA 4E2ZA 1J6UA 2FW0A 1F9EA 1KJYA 3MYRA 4BKQA 1KQGA 1BMQA 5AVXA 3H5NA 1H2WA 4AKEA 4W5HA 1V7QA 2H06A 3LUHA 1R64A 1A7JA 2RFLA 4R2MA 4UAVA 3QVLA 5A02A 2ZB3A 4ACAA 4LJKA 2WSLA 5D7NA 4A26A 4FYHA 3SICE 4DLBA 3BE6A 3L92A 1MC4A 2GKSA 2Z3VA 5BUQA 2Q5CA 2IODA 3O26A 2J33A 1W35A 4IS2A 3QVTA 4M1ZA 4BZZA 3PEFA 3HPQA 3D6TB 4HRYA 1G2OA 2J4FA 5EIFA 2HGSA 3H18A 3KDSE 3GRPA 2GHQA 5C7LO 1XD8A 2BKAA 3K8QA 3QMMA 3FWHA 2R2GA 3CRVA 3FPGA 1SA0B 3NO4A 7MDHA 1F0KA 3O21A 5CT6A 3DDNA 1CZUA 2ZS7A 1DNPA 1DMRA 3H6KA 4HN4B 1U8AA 4PX3A 3QEBZ 3SYKA 3OFJA 1LK7A 5LYJA 3ZCVA 5E9WA 1AUXA 4FW8A 2XT9A 4RYLA 1HFWA 2QRPA 5F1YA 2AOTA 2IU6A 3U3DA 5BR7A 3F7MA 2QNBA 3Q5DA 3J7AC 3QA3E 1DGQA 5FX2A 4IX1A 1HTWA 2CYCA 4BJ6A 3RRZA 5JYCA 4PVDA 2BGIA 1WY7A 2GJ8A 2JAXA 2QQEA 4C0WA 5LD2B 4AI6A 2QMHA 3TF5A 4NBUA 4IZIA 2FSPA 5IK2A 1NE7A 4O08A 1CCWA 1ZISA 5EUMA 4F1KA 4DR2B 3HY6A 2ZT5A 2XRYA 4I1RA 3WL5A 2PE5A 2DSTA 3IHKA 4B5KA 1W4AA 2QAGA 3GJ0A 1ZA1A 2NM0A 4J4BA 3BXGA 3L7YA 3WK8A 4OGFA 2PU7A 4Y2TA 2AW5A 4D6PA 4GE3A 2AR9A 4LDRA 3S2IA 2GR9A 1YK1A 1L3IA 1LI7A 1VOTA 3OE1A 4CLRA 3E7PA 3ELBA 1B23P 1OA0A 3VGPA 1S7GA 3RRXA 1K63A 1YDFA 2AFRA 3TQFA 3X43A 1FUEA 4BN0A 2JFZA 4YJDA 4RESA 4JI2B 3PHLA 5AK5A 1NBWB 3DCJA 1R0BA 3Q3CA 4P5PA 5DX0A 2HO4A 4G1VA 5JJIA 1UINA 3HU1A 4O4JA 2NO5A 1GU0A 1RVV1 4DM4A 1W47A 4GZMA 3RC1A 2H54A 4N5HX 1L4NA 4NDAA 4YI5A 1C81A 1UBUS 3VISA 2M32A 3MB8A 4KYUA 1FNMA 2AUMA 4M9RA 5BQPA 3TI9A 1OXXK 4RTNA 2O8CA 3FSJX 4LFCB 1V7ZA 5C5IA 3FNQA 4YJGA 3AKZA 2AMVA 3SZMA 1K4MA 1GV1A 1PJQA 3JD2A 5KU7A 2O3QA 1E9DA 4WJZA 5DCLA 3RYCA 2H5JA 3QHPA 4Y0AA 4HLUA 2Z04A 2FF5A 2J67A 2UYHA 4RACA 1EX9A 2OZLA 4RHCA 2IYRA 4A6DA 3FXAA 1MP0A 2GZ1A 5GGYA 2QS9A 5IAGA 3L0PA 1QYCA 1GPDG 3DDSA 1DG1G 5JNVA 1J07A 5LQUA 5ELLA 2VEDA 2GLXA 4BGVA 1TYEB 1YUMA 1J4AA 3HCFA 3M82A 3PHBE 3RHSA 1NYLA 1L2TA 1LBHA 2X5OA 4WOBA 3BRSA 2ACVA 1IG3A 3GC6A 4YBRA 2CF6A 5B1YA 5K0TA 2KHZA 1WLSA 3RBVA 2B1QA 1NN1A 4EY4A 5F5LA 1GEGA 1DOHA 1Q7RA 2ATCA 1K7XB 1ZUIA 3BMCB 1ZU5A 3E6AA 4Q3BA 5PGMA 1SOAA 3EK2A 4RA9A 3KJNA 4JYBA 5CP8A 4BO4A 5AVWA 4LDZA 4ROTA 3FFWA 3U09A 1K6IA 4GXQA 1QO9A 1ONNA 2VWHA 2RH5A 4MMZB 4M1KA 4AZ0A 2JF0A 4DV4B 1KO5A 4EMBA 1HMYA 3ORRA 1JWAB 4OQPA 3U2QA 4J16C 4HRVA 1YR9A 3TEJA 3O47A 3OJLA 2ZUTA 4FT4A 5A1TA 1LJUA 5ITZB 3KOUA 4Q3NA 1PT5A 1Z28A 5TT1A 1L4YA 1ZU4A 4M3NA 3W34A 3ETEA 3PNQA 4ZYXA 4YMGA 5CCEA 3HKBA 1B74A 5TSDA 3ROKA 3IEIA 4IXTA 4ZMSA 2VK8A 2JA1A 4M0MA 1RPAA 3ESCA 2VPIA 4LXGA 4QUJA 4AKTA 3LO5A 1MB0A 2D62A 1TKBA 1UDWA 5JNUA 3TX2A 1G8FA 2WMNB 2NZWA 2O9JA 2GPNA 1GDHA 3QJYA 4NP6A 2IXDA 2QLBA 3RSLA 3W5SA 4BZXA 4B3JA 2X9GA 3PE3A 5F2KA 1GPLA 1YH3A 2D2VA 4GOMD 1IN6A 2QGZA 2VQSA 3M4ZA 1UPTA 2Y8EA 3HCDA 3I6MA 4UULA 3A9CA 1II8B 2XTAA 3LMKA 3QOYA 2B2NA 2NT3A 4PV7A 2XDWA 5TJ9A 5K0CA 3DKIA 2O54A 2ALJA 3FLMA 1D6NA 2XR1A 2AI3A 4KQ2A 5B4UA 1ZOSA 1X74A 1N5JA 3OO1A 4GX2A 4CN9A 2JI4A 3ASZA 3BB1A 1ETHA 2AC2A 3QW4B 4FLEA 4OQNA 2FUNB 2G5TA 4PBRA 8ABPA 4Z4FA 3W8RA 5BSHA 2G04A 1SZDA 2HU7A 2EX4A 3DM5A 1NI5A 3C5EA 3C85A 2BHSA 1TVCA 1CVIA 3OZFA 3IJ5A 2W71A 4F8JA 4G81A 2GBLC 4XIYA 5AKEA 1BGVA 2FTKE 4L6AA 2SKCA 3CR8A 1UBRS 3MUNA 3OD1A 4TGLA 5HCNA 3L8GA 4KRXA 3UW3A 1AS2A 3E1GA 4FWIB 3MJHA 4PC7A 1HE2A 1UJ5A 4HVAA 4JVMA 1YZ3A 5LR6A 1OIXA 3H5RA 4ETNA 1E9FA 1XVVA 2H7YA 3ADDA 2QTWB 4PG4A 2FEAA 5DI3A 4DEYA 2A0WA 2AW3A 2IYFA 3KCQA 1CD5A 1HTBA 3T1HB 2JFOA 2IYTA 2C5SA 3FUCA 3X1JA 1Z73A 3LQYA 5IU6A 3EXG1 1R8YA 3CCCA 1M1YA 1QYXA 1GG8A 3SCZA 3DXFA 3PIDA 1EGMB 3GIWA 2AE1A 1JSRA 1W52X 5AHRA 1JW9B 1T43A 2EP7A 4EECA 3GXOA 4RF2A 1PYOA 1YA6A 1NRWA 3KZMA 2F1OA 3GJ3A 4FFVA 2XZOA 2IH4A 3UAZA 4Y2HA 1KK1A 1VSBA 2PXAA 3ZDXB 1NTOA 4XYLA 1NVKA 1YBMA 3T3IA 4MR7A 1UM8A 1XO1A 5B3LA 2Q6OA 1M34E 3COVA 5DK4A 3WLAA 2JFPA 3L7AA 3QELA 1WMBA 2F3RA 1PL8A 3HBJA 1XL1A 4BYGA 5G3ZA 4O3FA 4DV3B 1EEHA 2X77A 4ZOLF 5LL6P 2GZHA 4GM1A 4JBWA 4IMJB 3MJSA 3TK1A 1INLA 1FUYB 3C3DA 4Z5XA 1MRZA 5PNTA 3GP3A 1IB6A 2RGXA 1IUPA 1TK9A 2CDNA 4J49A 4MYCA 4E0BA 2BUCA 1ATIA 3FCSB 1JP7A 1NJ1A 2FSVA 4FB5A 4HAYA 4CT5A 4C6TA 2QRKA 1JDPA 3SIPA 3FA2A 5CCDA 4DZRA 5CLLA 1J2RA 1MJGM 1KQPA 5D84A 1VI5A 1I4DD 1J00A 1KH2A 1ZH4A 1SUSA 2Z98A 1QRRA 2W6IA 4KXLA 3TN7A 1IXZA 3PFIA 5IZCA 3O93A 1OW3B 5ERGB 5HE8A 3MMPA 1E0AA 4Q48A 1XU9A 4LJYA 3DL2A 3UV3A 3GD5A 5BSWA 2DB3A 2W48A 1HE4A 1B6SA 1JDBB 1V2GA 1XQXA 3JVIA 4YDHB 3PXEA 3GAAA 1N8NA 1UJCA 3DE3X 4PSUA 5ALKA 5DX8A 1TL7C 4ZI5A 4ANFA 5FBRB 4RORA 2ZB7A 1TGVA 3AEUB 3U4QA 4Q3KA 1NMXA 2ZJZA 3KBOA 4DB2A 1NW9B 1W25A 3KYJB 1XEXB 4EELA 2V5VA 3CYFA 2VYND 3ICCA 3HNOA 2X8WA 1Z2DA 4ZVLA 3I76A 3P9IA 3GLKA 2Q99A 1QHHA 3GA5A 5AKHA 3OLVA 3GZ4A 1R9MA 3DLTA 3TNLA 3H11B 3V48A 3H4MA 5MGNA 4YIKA 2VKTA 1EP9A 1GG2A 3KKZA 2WYUA 4XQ0A 2GO7A 1XN1A 1KHTA 3QPVA 3T35A 3NT4A 1CQIB 1GQOA 3RUDA 4DGSA 2VKQA 2FX2A 4TM8A 2R8XA 3R3ZA 2ZR7A 1FXWF 4OQYA 3MQ4A 3SAJA 2VYVA 4MRSA 2W2LD 2FKAA 2FHSA 4G97A 5LYYA 3PLRA 4MQFB 4O1MA 4XJSA 1JPVA 5CM2Z 3PVZA 3EB9A 2C4TA 3DUFA 3FCYA 1T36B 4DXHA 3TRIA 4NU6A 1ND5A 4YHHB 2PZFA 4AIRA 5JNRA 4PHHA 5EIOA 2WM9B 5K7SA 4Q00A 1YZYA 4H1TA 2Q5QA 4PLPA 3WLEA 4B8ZA 1A7UA 2N1BA 5KQLA 3W9BA 4FWTA 2AD1A 3NWJA 3SS9X 4MPRA 5C51B 1Z83A 3MRTA 1E4OA 1U28C 1KVRA 1ZVQA 2NXJA 3C70A 4AP9A 4NENA 3A2MA 1HY3A 1M6EX 4UNNA 3KSAC 1XVTA 1SCJA 1M6NA 2NU7A 2VK2A 1AF4A 5TT0A 4JYPA 3PJRA 5FWDA 2IY9A 3HCBA 3Q7TA 3CR7A 5M3BA 4ALJA 3W6ZA 4ZYZA 1Q7TA 4H7KA 2BKVA 3R3SA 2ZZMA 4JC0A 2ZRDA 3GJYA 4B1FA 2OXRA 2P2YA 2Y66A 3LBHA 4OMDA 3BMQA 3A9WA 2R7KA 4HB3A 4GEGA 1GSIA 1LQUA 2J6CA 3TW6A 3UWSA 3RAJA 5HBRA 1W5BA 1N0VC 2JJ2D 2ZAGA 2VYQA 2GEJA 3IR7A 4JH0A 4M9XA 2FG6C 1PS9A 2CE2X 4LGMA 3MCWA 3EEQA 4BO2A 1JH9A 2WHEA 1Y3HA 3DQQA 3H65A 3M5CA 4PW0A 3AZPA 1NVTA 2W8BB 3V8QA 3H2YA 4OYLA 5KYWB 1LXCA 4OXXA 1N7JA 2E7ZA 1VLJA 5BQXA 3DO8A 1OASA 2MJLA 1P77A 1H0HA 2X22A 1WDLA 1YE3A 3OEWA 3ZU3A 1KAOA 2XYQA 5IVPA 3GZTB 4HV4A 5HPYB 1XZDA 4YALA 2I1VB 3K16A 2OO5A 1GEEA 1E60A 1J0EA 1P45A 2DQKA 2F7SA 4NESA 821PA 4NIMA 2HUPA 3GLSA 3JYLA 5GIOE 1NXTA 2Q3JA 2ZRKA 4QHYA 1NI3A 2A9QA 2WWGA 4OQEA 3RYHA 4M8LA 1FMTA 1KEUA 1RRKA 4G2NA 3T06B 4BMDA 2C95A 3WFIA 3IT0A 2P4EA 3U49A 2X40A 5CGZA 2V7PA 1EUCB 2C94A 1OV4A 3RHTA 4OH1A 1E4EA 2HHAA 4MUFA 2EL7A 1D4AA 1AQIA 3BE8A 4JLWA 1H1DA 3C3JA 4U1RA 5F9HA 1VYHA 3OZDA 4GC9A 3UAXA 1T3GA 1X39A 1ZUNB 3U7QB 1GVNB 1VKJA 1K5PA 1Z06A 3RHZA 4R68A 4JP5A 2PKQO 1SBHA 2QD1A 3EAFA 1P74A 1XA0A 2DU8A 3U3XA 1ZLYA 1T9BA 3QIAA 2G8NA 1JZSA 2IF2A 2JAQA 1TZBA 4FYYA 2IH5A 3RRFA 2WHXA 1VE5A 1U2EA 3G59A 3E9NA 2J7KA 4Y8VA 4D9EA 4AJ1A 3D0KA 3OCYA 4GO1A 2RGCA 1FTWA 1E9AA 2NO0A 4H77A 4JWKA 3UAOA 1E5XA 2W6NA 2ZRAA 1KDYA 2AR0A 3TOZA 3UOGA 3EZ9A 5JADA 2UVDA 1IFXA 2DKNA 3G2PA 3OX4A 2EGUA 3ECAA 5CFMA 2HSJA 2ZSBA 4JMLA 3HDYA 2PVPA 3PWKA 2C3PA 1G66A 5TF0A 2HCRA 1JLRA 1F1BA 4HPJB 4L9RA 3ZV4A 5IT9A 2BF4A 3E8SA 5EIXA 4AKHA 1HUQA 2Z57A 4R1TA 2MINA 1KY5A 4WAUA 3T1NA 4Z4IA 4AG3A 1WXHA 5L51A 2CT8A 2FV8A 2FN9A 3IT2A 5LP6F 1ZA2A 5LLSA 4GOXA 2BT4A 1NA5A 3D4LA 3EDQA 3LVBA 5IDWA 4TV9B 5GOZA 1UK7A 4CHGA 1G55A 3MMSA 4W6QA 1RZVA 3QVKA 3FYUC 1TC2A 4AQDA 5IVHA 2IS6A 3E8MA 2VJNA 1QANA 3COSA 4TQAA 5JMTA 1ZVKA 5L95A 4P54A 1XHEA 4L7QA 2RI1A 3OD5A 2IEAA 3KKPA 1FE8A 1ZAYA 4IIJB 3WYGA 2Z6UA 4WHMA 3RJ9A 3CNNA 3KQWA 3U7FB 2D1TA 3ZZ1A 1CK4A 2H07A 3VR5D 2Q29A 1WMSA 2MSCB 4RV9A 4S04A 1GTRA 2GZMA 5EXEA 4DA6A 1QGZA 4MHOA 4CDGA 1V4NA 5B7QA 1GFIA 3RGGA 4RGVA 4BVJA 3HJHA 2F3PA 3C5CA 2VI5A 2L69A 4QRIA 5FJJA 4NC9A 4BO8A 4CV2A 2R79A 1UODA 1TD1A 4BL5A 1ZC3A 3SG0A 5G53C 3QYJA 4TQGA 5EG5A 3GRZA 3LWDA 2FMXA 2HH9A 1ONOA 3PGVA 3LDUA 3SLGA 4E15A 3ZVMA 2C4WA 3CVVA 1A97A 5BNZA 3UJAA 1U7TA 2ZZKA 2X9VA 3WQHA 3RADC 6REQA 2JLWA 1JMYA 4GM4A 5CH3A 4PANA 4UM9B 1B41A 1T6ZA 1PNRA 2E49A 1T8RA 1GPJA 5BRJA 4INAA 3ZHBA 2C2YA 3L79A 3D2AA 4KJZA 3GLUA 3L84A 1ZL2A 5E6SB 2DKOA 3EF0A 4M1YA 2DG2A 2WA1A 3N2EA 4OREX 3VPBA 4ZZIA 4URHA 4DM7A 4YLYA 3H6GA 1SKUA 1GD1O 4X95A 1Z08A 2OLEA 2XGMA 4IKOA 1FNNA 2YV2A 4QOGA 1J20A 2APJA 1KK3A 1M2HA 5CGQB 3VO1A 3QWFA 4Z7JA 1RC8A 3B85A 5F78A 4OL9A 1LNSA 1YACA 3DQZA 4WK6A 4TMXA 1JIXA 3NDPA 5KJ1A 2CJWA 5IBCA 5CIYA 2PKYX 1YU9A 2Z3ZA 1XPOA 1M2OA 4D7AA 2R6AA 1X6VA 4ZOEA 1T2VA 3VR5H 3EXHA 2B0CA 4QUHA 1R9JA 4NQRA 2FQ1A 2O05A 3H1AA 1PVOA 4N7JA 4V2UA 1NMQA 1PR9A 2HAEA 3FGOA 2G72A 3FVQA 1VDMA 4ZD6A 1B8PA 2G9RA 3ZEAA 1XRNA 3DZ8A 1XD2A 3TLKA 2OZEA 4P7BA 3IAS6 3QKRA 3EXG2 3I83A 4XB2A 2YRFA 4IS3A 3MPUA 4BVEA 1R18A 1E3LA 1G3RA 2DLNA 3FWPA 1HE5A 2PRYA 3JPYA 3ANLA 1VCIA 4ZMBA 1H0RA 1GKKA 3ID6C 4RFSB 5JOQA 2VDVE 3O83A 4D43A 2QUJA 1ESNA 3BX1A 1DQYA 4BS9A 3TQHA 3ANXA 4DV1B 2WU8A 5K09A 1BJRE 1NX6A 5EQFA 4XWOA 1QCYA 2Z8YA 5ERYA 5BN5B 3RV3A 3R7NA 3UHFA 3FLEA 4FZ5A 4RIHA 3L40A 5H02A 3DO6A 4JP2A 5H0IA 4RVFA 1MAHA 2FOXA 3IUEA 4TZTA 4H4DA 4B3IA 4GYKA 4HDRA 4P7GA 3JRNA 4UCQA 3FWZA 1FSFA 3B1WA 2P1ZA 4ZIRA 2IXGA 4GR4A 3WO0A 4YONB 1M34B 1HG1A 1FJGB 2D7JA 1BH2A 2EJUA 3QVMA 4FCVA 1ETUA 1JR3A 1KI1A 2OAP1 2YWDA 4Q19A 2YBDA 4WFKA 4X91A 3OX1A 4GBJA 2QJWA 1RDFA 3FB4A 4JI8B 3WGNA 4FYJA 2O2HA 3TMYA 1ODLA 1SXHA 3NFYA 4KQ6A 5GQSA 4M2LA 4YUZA 2XQVA 5LZ9A 1CUWA 3V7YA 1PJ3A 1C30A 2AR7A 3HEMA 4QBKA 4PPFA 2H6EA 3LK6A 3QUSA 4ZRNA 3QW2A 3GF4A 5A3SA 3DQPA 1NYRA 4COKA 4EO9A 5GV7A 4UZEA 5CX1A 2GAOA 4MCJA 4D79A 2G4CA 2H17A 1X7YA 2B30A 3LQ1A 4NCHA 5BYJA 4DIDA 4LJAA 1LQTA 1IZ8A 1EFRA 3VNAA 4UAUA 3UIEA 1V1MB 1CX9B 1KKLA 2R60A 2GA9A 1NOKA 1WXGA 2WDZA 4P33A 3MUFA 2BYTA 3LM8A 1Y7TA 4TS3A 1ACJA 2CL5A 1AN0A 2XWPA 5IP5A 2REBA 1KAMA 4DARA 5JYEA 1PNTA 4UVHA 5I7EA 5K8CA 3OCCA 3K5IA 4L15A 4NYJR 2O7QA 3IAHA 2J0SA 2LR0A 2BFFA 3PZBA 4XW2A 4DSZA 3JRWA 4MICA 1AKQA 1M2EA 1W85B 2A35A 1E79A 1CW2B 1ZWLA 3EFEA 4M1EA 1ZNQO 4GLJA 4PAWA 3VNVA 1RWXA 1ZM9A 4RE6A 2V7WA 4Q7LA 3IBGA 1U0JA 1G8PA 5FUVA 2W8BA 3G2LA 3UA3A 3KHTA 4BWFB 5HHTA 5L8VA 5KYWA 4ZVQA 4XSVA 1HYBA 2GD6A 3T5AA 5MHTA 1YE8A 4O4HA 1P6UA 2AFIE 2PCLA 5FH9A 4GL4A 2C7OA 3STYA 3X44A 4OI4A 2I2WA 3FNRA 3QVUA 3AL0C 2GFQA 4EARA 2OFPA 5HIIA 4W63A 3K0FB 3EZGA 3ZH9B 4LIPD 4O8CA 4OOEA 1PFQA 1MENA 1FRQA 1RYHA 1P5FA 4ISCA 1GZUA 2ENUA 2Q4DA 3UGJA 2LKDA 4G5QA 5GZ3A 3DDHA 5AHKA 4OHPA 2CB9A 1JT9A 1RCFA 1T1EA 1PFYA 2OGZA 4GI7A 4I1UA 3WGQA 2W7TA 4UUPA 1P0MA 4XM0A 1GPUA 4CN8A 2N75A 1Z29A 3STHA 4QDOA 3K7EA 2C84A 4Z7QB 3EEOA 2OHJA 3IAXA 2YC2C 5DHAA 2WICA 3KEMA 3M6VA 1UXHA 3R5KA 4UATA 4D4LA 1JQBA 1S4MA 2JI7A 1JQEA 4ITRC 3VZCA 1S8OA 1BEUB 2G5CA 3N59A 1O6FA 3LK7A 1EDBA 3R8XA 3AI7A 1XWFA 4D0LB 4K9RA 1KXZA 1TNDA 2H7CA 3FPCA 3PI6A 4NEHB 3HVKA 1UFKA 1J8VA 3U4IA 5DDIP 1E9RA 4BNTA 5HQ3B 1K8ZB 1LNQA 3FIUA 1XAJA 3A31A 3AU8A 3C1TA 1PDVA 1V37A 3GRCA 4LV8B 5CX4A 5K3CA 3WKCA 3ZI7A 1HYGA 4CF3A 4UUQA 3KNZA 1ZKMA 3EDOA 2OV6A 4P38A 4TT8A 2JCBA 4KGZA 4PN7A 5H9WA 4RENA 4EF6A 4ND1A 4JKIA 3EGEA 1HFEL 1L7RA 1D03A 1NQ5A 1DKRA 2DWQA 4MO9A 2D0IA 3MWKA 3CPSA 2WK1A 1E61A 2GHRA 1THZA 2VF8A 4M7OA 1G0OA 4Y6QA 1AK1A 2OWEA 1N6OA 4B4OA 2P0AA 3TCKA 2A5JA 5EHGA 3ZHZA 4F4CA 2PVSA 1LDEA 2Y0CA 4G36A 3INGA 1FTYA 3D7RA 1Z34A 3EGXB 4FKBA 4UHBA 3JQBA 1P0FA 3B5IA 4BVHA 4PAMA 4R5HA 3KIPA 2BGWA 2UXCB 3GJRA 3U3MA 2YFYA 1OA1A 3ZE9A 2VT3A 1RAIA 1YASA 2X6RA 2YZNA 4LHSA 3R9XB 3TUIC 4YDSA 4CM6A 2B20A 4H7EA 2GZ2A 3AUSA 1MOPA 3HCRA 3VC2A 1BN7A 2IEZA 4JB2A 1B42A 1U2RA 2VJOA 4FE3A 1GLGA 3V1KA 4C88A 2W6OA 3P9YA 4H31A 4KAXA 4MA5A 2AOXA 5K3OA 4BNXA 1L9KA 2XA2A 2ERCA 3QPWA 1BMFD 1O9BA 5MFPA 1QQ5A 2ERXA 3OZCA 1ADCA 2R6HA 3T5MA 2LW7A 3WLMA 1YFLA 3OTWA 3SQMA 5H4GA 2A2ZA 4IPTA 3T3NA 2IZZA 1NVVQ 4HWPA 1Z7YA 4RHTA 1KJJA 5SZKB 2WU4A 5B7PA 2X4IA 3EVDA 5FJIA 5KYYA 2P6OA 4IMRA 4JJFA 1W7AA 2PYZA 4L2IA 4MVJG 4FXPA 4TYYA 4BX2A 4B6RA 4WLFA 2C3YA 5CR9A 2HB6A 4RKWA 2GZDA 3N8NA 2ID4A 2MIIA 3HB7A 2VDUE 4MUMA 4IVQA 4RPKA 1IOWA 1QOPB 4XSGA 4AG5A 5F2OA 2H1CA 4DYHA 2GYVA 4JBGA 2VHVA 1Z3CA 1RHUA 4JB0A 1Y1QA 1YDMA 3AUJB 1Z7GA 1AQLA 3TLBA 3TSWA 5CUQA 4DTCA 1JHUA 3BE4A 5JSQA 1YB4A 1SC4A 1NPDA 5CA1B 1R6AA 3OHMA 4BFWA 3V1MA 1H65A 4R16A 4G0WA 3QF4A 2GESA 4JP8A 4EG4A 5LIRA 3BJRA 4G0PA 1UQUA 1QF7A 3GRVA 4OFBA 3BSSA 2I4IA 2V7QA 3IILA 3ON5A 2HEIA 2MT9A 5DGIA 3Q3HA 1HOTA 2FZKA 3ACBA 1SIBE 3QVVA 4G4JA 4LDJA 4CQJA 2QX4A 3KHSA 5T6BA 4D4KA 3NHJA 1DWUA 2GVNA 4RLFA 2I91A 1JYFA 1T6NA 3PEUA 3B5JA 1VKOA 4MVJA 1I4TD 5JALA 3ZR4B 1J5EB 1M2WA 3VU0A 4Z3KA 2BBOA 3IX7A 2NOAA 4FI3C 3H9CA 4IX9A 3K9FC 1CZRA 1EAYA 2NG1A 4F6RA 4D46A 1M7BA 4P3NA 1YVRA 4U02A 3QVOA 4UEOA 5J47A 4RTSA 1LTKA 2UVPA 1S2NA 2IVFA 1E3WA 1VG8A 2PYIA 2EFYA 3PXBA 1UP6A 4KLZA 4KX3A 5IBQA 1YGYA 2WV7A 3KOYA 2I3BA 5HUJA 1GXSA 4B2LA 1IL0A 3C48A 1JEEA 5C3UA 4RFSA 1PD0A 4W5RA 4R0NA 1VGRA 3RF6A 3DAOA 5HM6A 3PDJA 3W4KA 2QPOA 1VIAA 3PFCA 3OFSA 1H6DA 1XDWA 2EHJA 4HEHA 4OU5A 5IDYA 3U6BA 4JVSB 1JYEA 2GN1A 3QMWA 4IDQA 1YB5A 1EZ1A 2IOHA 2UZIR 1B0ZA 3JV7A 1Q20A 4IIXA 5KJEA 4E32A 5KMGA 3QNMA 5LLDA 2HRDA 2GAAA 1NJ6A 2AV6A 3DBLA 4HSGA 5J5VA 4E7PA 3MJCA 4L4ZA 1OMOA 2ZI4A 1ONSA 2YRWA 2EKQA 1EAMA 5EJIA 3VH2A 3AJ8A 5KTPA 1Z5UA 5EJGA 3TKLA 1R74A 1BDJA 4ARIA 1WQ4A 2ZT7A 1M76A 1UPUA 2J08A 1CNEA 1XTQA 4PYOA 4HAOA 3X1KA 3JSXA 4A8JB 5LQNA 2ZZNA 2QAGC 2C97A 2Q21A 2XPCA 2Y0DA 3MN1A 3N0VA 2IYEA 1BW9B 3SYLA 3QE9Y 4XPZA 1LF5A 2Q5IA 2V54A 4G86A 1IWOA 1OJ7A 1YL6A 5DLEA 1E9SA 5JHHB 3KC2A 5FKJA 5IWCA 3ETHA 3ET4A 1AB6A 1K9SA 3K9HA 5ALTA 3U7RA 3W90A 3WXMA 1J99A 3MG9A 5ALGA 4AUKA 3KOOA 4MWDA 1D3AA 3CR3C 2EJTA 2Q5OA 4X6XA 4HLNA 3TRDA 3TTYA 2QTBA 1RLMA 2XUIA 2EW8A 1I6WA 3MTDA 4OD0A 1NNI1 3DVAA 3HH8A 1ZESA 5FOWA 3SOPA 1KRXA 3TD6A 3EA4A 2C77A 3H3XA 3CISA 5DGTA 3ZHOA 1KH3A 3I6BA 3COWA 3VMMA 4W5WA 5P21A 4A7PA 4FZVA 5I4IA 3WGYA 2W2MA 1ISMA 4GU5A 1L7BA 4N3BA 1KRWA 1SOMA 4N4AA 2IIPA 1GGEA 3TNFA 4P8RA 1HQDA 2ZWIA 4V3BA 5IABA 5KSZA 1QRDA 3RSSA 3ZZ0A 3OQPA 4BYMA 2JKYA 4CM4B 3HBNA 1A8IA 3CRMA 4FOSA 1DIOB 3CG0A 1HYHA 4XA8A 4Q4HB 1NJFA 3VZQA 4BPRA 5KOHA 1O94D 4KXNA 5LPNA 2AG5A 2C5LA 1RFGE 1H1LB 1UFOA 2X5JO 3NIFB 4HLUC 2QIOA 1OWLA 2IEGA 2AJLI 4HS9A 4G0QA 1I33A 2H85A 2YV1A 5CNMA 4EFNA 4DCJA 4BCBA 4EENA 3NV9A 4ENSA 5JWOA 4KLNA 3TNJA 2XBUA 4AN0A 3NYQA 4CG2A 2BFBA 1IWPB 2GT1A 3DL4A 4TUYB 1WSWA 1DWOA 4WACA 5FEMA 3RTEA 5JRZA 5A0FA 3IXQA 4XYEA 4TLBA 2HDWA 1GRQA 1JJIA 1TAHA 5DNVA 5JR3A 3EASA 3FAZA 1SFRA 1OV6A 1YJ5A 4NWIA 4YT5A 3J80A 3V7WA 1P6QA 1U98A 3OPVA 2X7HA 4GW3A 4GLLA 3I04A 1O5IA 1T5SA 2VYVD 2MMCA 1FYEA 2R4TA 4MJLA 1UWCA 2VNSA 1QE0A 5E6RA 3ZU5A 1Z4LA 5DV9A 2X2PA 5A7FA 3TR6A 3F49S 1U8TA 1CY8A 3QTBA 2F67A 1X87A 4AMVA 2CJPA 3DPSA 4C7KA 3ZWAA 2C2GA 2ZIXB 3U4GA 5DM2A 3RYFB 3DBVO 3OAAA 5AI9A 1L7QA 3GDFA 3I73A 3E3AA 4IICA 3JWGA 1UIMA 5ALYA 1Y81A 1ZM7A 2P5UA 4YQEA 4XLLA 2H92A 3PLNA 4AO7A 4L08A 4ARVA 3VVLA 1NNEA 2PMEA 3C6BA 3ROFA 4BNHA 1CJTC 4BNGA 4D0RA 4MVCA 1FUIA 1I5RA 4CTKA 3QI7A 3B1KA 4EW3A 5BV0A 2VDNB 4GS5A 4BGUA 2GXUA 3RARA 1SQFA 3PXGA 3M4JA 2EBFX 1QG0A 4PSCA 4KGVA 4Z3DA 4DR1B 1LK0A 1E6CA 3NDJA 3W8EA 4BDSA 4EI8A 5AOCA 2IYOA 2YC4C 4JLAA 1RRCA 3BJIC 5J2TA 1PFKA 2CKMA 1I2MA 1MG5A 1TUIA 4DJDC 4AJKA 3H17A 4D5EA 3DWGA 4IDHA 5LXTF 2MHCA 3TG8A 1XPUA 1FLVA 5DYIA 2XYGA 2AFIB 3LCCA 3UK1A 3QXXA 4B0OA 1W0JA 3TE7A 1KZGB 4UEWA 3P20A 1K9VF 2I4OA 4AULA 3BWVA 5H3LA 1P2UA 2RGRA 2RJ3A 4LMBA 3FBGA 2C1ZA 4AP5A 1Y8ZA 2E5LB 3PUZA 3ONNA 3EXEA 3EH2A 2DWPA 3CSDA 3GA7A 4KZPA 3F5MA 1XU4A 3LF2A 4BNVA 1S96A 3E9DA 3K1AA 3VHRA 4P86A 3UO8B 1ZQ1A 2O1XA 1KWGA 4TVKA 5F73A 4ZZ0A 2JIZA 3CEMA 1ZZGA 5GM2A 1L4BA 1GUBA 2IVZA 3DDOA 4U2DA 3DFMA 3WL7A 1JPUA 3AI3A 5KQGA 1JFSA 2J3MA 1HDIA 2BEVA 3SF8A 4YRPA 4NTZA 3IJEB 2R1UA 1ORIA 5KCZA 1UK8A 4MSUA 4K9QA 1HK7A 3L04A 4MP8A 1TJYA 1W8DA 4QSHA 3S5UA 3WDMA 2CZQA 4QVKA 3A26A 3AIIA 1MBZA 1JXOA 3BXEA 2HHCA 3EDRA 3FYDA 4RZXA 4OKSA 1O4WA 1B76A 1I13A 1AK2A 3N3BC 5BN3B 1DT5A 2O7VA 3EH1A 4LVUA 1A27A 4PBTA 3LLCA 4TRMA 5EE1A 3RVQA 4MV1A 4JI3B 4BVBA 1R0LA 4RNCA 4D8WA 5KWJA 2FFJA 1SZPA 1TPZA 3D7SA 2DEUA 5MN6A 2IUTA 3DA8A 3KXKA 2QENA 2FVYA 1VKZA 4G07A 1IM5A 5D7BA 3K9QO 4QXRA 3EISA 4YQFA 3JAKB 1W73A 3UXEA 2BI7A 3L8EA 4EH1A 1QHFA 3MWFA 2NZVG 5I7VA 2AFHB 1UEIA 4KMMA 4PC3A 4YAUA 1B8NA 2A1TS 2D06A 1XTZA 5A4JA 3T0GA 4GSYA 5G1OA 2BN4A 2WVJA 1TLTA 2XX3A 4F46A 4G65A 5ENZA 3D8SA 3SDSA 2VF2A 3WADA 4XVQA 5CA1A 7REQA 5E38A 5A4KA 1A9TA 2H0QA 4MP3A 4CRWB 3VX3A 1EK6A 1CDOA 5BR8B 2ASEA 1QTQA 2CLOB 2DETA 5HF5A 1QFJA 3G2MA 4TVSA 1DAGA 4NZMA 4R2WA 3IHLA 5GWXA 2J5RA 5IZCC 1IBLB 4Z53A 2IUFA 5JJKA 1RWWA 3EPHA 1JHQA 3OU6A 4BU1A 4QELA 3G9TA 4BBAA 1M9NA 4K0KB 1VE9A 4DLUA 3RVPA 3CBQA 5H83A 4GEKA 2CNKA 4M55A 1JHXA 1SXJD 2AN3A 3F4KA 4E70A 2CD9A 3IEMA 1S4QA 1J2EA 1AF7A 4X62B 1Y7HA 3VYRB 2XNHA 1T0UA 2B98A 1ZBQA 4TV8A 2C29D 5JASA 1V35A 5KNBD 2E87A 1POWA 4ALNA 4L4UA 1IJEA 1J97A 4IFBA 3GVIA 1NN3A 4QPPA 2YQ4A 1CSEE 3PGKA 4FYIA 3V46A 1CS0A 4I3FA 3BXZA 3UPTA 3P0FA 3GQBB 1XV5A 4B48A 3A9TA 4EKDA 2B36A 4K81B 1EUZA 4DW8A 4FZ3A 2QBYB 4NY1A 2ZYUX 3BGWA 3LCJA 4KR6A 2ASVA 1G2PA 2PMCA 4IDNA 3DYVA 3DZIA 4UBJA 2Q0SA 2A30A 2CJXA 3BVPA 4IFTA 1E9VA 2QVCA 1YJCA 1OFGA 1KPIA 1YS6A 4EHJA 3HJUA 2R1TA 4HDMA 4Z0TA 3WLOA 1UZNA 1KZ7B 2R25B 3H2ZA 1CB0A 2QN3A 4LRYA 4V0QA 3JQGB 3QJGA 3FMOB 1G7CA 1MD9A 3LI2A 3PHHA 5AW6A 4YC7A 4JUCA 2CV2A 4XARA 1X7HA 3BTUA 1PGOA 4Y2JA 2P6UA 2FUCA 1OXSC 1Y5LA 2ONKA 1XBTA 4IKEA 3SJZA 4CGZA 4RULA 4B81A 1GILA 3H9GA 4D8UA 1K08A 4B75A 4Q18A 1X7DA 3OLYA 3I6QA 2O8DB 3L8CA 3MRVA 1LRLA 3EHEA 3SR4A 1CUCA 1UF9A 4WY8A 1JHPA 4X1KA 3ZDDA 3BQMB 4RTLA 1A5ZA 1XAGA 4MI1A 1FDOA 3VJMA 4JYMA 2X9LA 1CZLA 4UVIA 1AQJA 1SHLA 4NCBA 4E1BA 1CF4A 2HQRA 3E1SA 1RWBA 4UDOA 4BNLA 2WU3A 1PUJA 3DXXA 5KNBH 2WJ6A 4X84A 3PK0A 4KI0A 3C16C 4NAHA 1FFCA 1ZNZA 3C2QA 4ZQEA 2YJ4A 3WWCA 3K15A 4PLZA 4UFPA 3IUSA 3L7KA 5A1JA 3ETDA 3SZUA 2C7VA 2JW5A 2RGGA 3BCUA 3FOBA 1H85A 2O8BA 4CU5A 4JU8A 1SXJE 4DJJA 2QG4A 1PTJC 1WABA 3C45A 3VKVA 4MRRA 3LA6A 1IEWA 2EYUA 3KKEA 3ADOA 4P4NA 3S70A 1NNSA 5D01A 3E4CA 4EO7A 3WKBA 2BFOA 4K9OA 1MTZA 2I78A 3C8ZA 4TTQA 1UBSB 3L4EA 3SC2B 1HNZB 1QBGA 3KKLA 2J59A 4V38A 2Y1OA 3FJOA 4FGUA 2DPHA 2WILA 3FZYA 3T3OA 1EIZA 4HKTA 3M33A 1T5DX 2HPHA 4IO0A 2ZYSA 2YWBA 5FQNA 1GTZA 2VXOA 4CNBA 3EYAA 1Z4IA 4CM8B 4OFWA 4D9KA 4B3FX 2Z6QA 3P2OA 4UM7A 3MLEA 1V11A 1Z8HA 1RPJA 3FI0A 2UV8A 1N6NA 3GH3A 1BXRB 1LLUA 2GRAA 3PNKA 4K6FA 4P4SA 4YJ3A 5T64A 1LJ8A 2FN7A 2G9ZA 1KBZA 1AX9A 2Q27A 2Q7DA 2VEOA 2EJVA 4PHTA 4TLAA 1JE1A 4E11A 1B8UA 1A5SB 4TUYA 1QRTA 5HA5A 1N0WA 3ZYCA 4HDSB 2FOLA 4GUDA 1CXZA 6YASA 4NZYA 3H1FA 1GO2A 3KR9A 4GYYA 3C24A 1M5RA 3ZZNA 3QF7A 5K8JB 2XEDA 3DEHA 3CNEA 3N28A 2H8GA 3SU8A 4A4DA 4RIIA 4MK4A 5AJXA 1JR3D 2IUEA 3GEEA 1U7OA 2P77A 5HG0A 2AHRA 3GLHA 3P9NA 3CKMA 4BTEA 4WKCA 2NU6A 4HB0A 4BIIA 3NBUA 5I9SA 4Y67A 1ZGBA 5BSVA 3MFQA 1Q21A 1H94A 1M2VB 2ZI9A 4U3JB 1D7AA 4ILEA 4LF5B 4FYMA 3E3OA 3OF5A 2QM3A 4EKGA 2H2WA 4I9FA 1WP4A 2HNAA 1RWPA 4FPXA 1CDDA 2BH9A 2X6QA 4WLUA 2E3JA 2P2ZA 1VIYA 2EQAA 2IP2A 2RH9B 4FR2A 1TXGA 1JLSA 3DT9A 4C6SA 4DDVA 2UUBB 3EIOA 5ELMA 4N7BA 4UVGA 3IBTA 3TLZA 1JZTA 3MWEB 1J09A 1ZM3A 3HU2A 4E12A 4KPEC 2I4MA 1IIBA 1VHTA 2BE9A 1Q74A 4DA8A 2RDMA 1M8JA 3WHKA 3K3PA 2ZWOA 3BBLA 4R1UA 2OZPA 5G0UA 3OECA 2AG0A 5DEIA 1JG1A 4LSMA 3UK2A 1IQRA 1WXDA 2GPAA 3RVJA 5HS6A 1UBCA 4ZMRA 4Y18A 3Q9UA 4IFEA 1XHFA 3T3DA 1B8OA 2CNNA 3L41A 3DWFA 3LW7A 3MT9A 3P2IA 2NXCA 3R0IA 1R6BX 4ZCTA 3THSA 3LDHA 1KJ9A 1PR1A 2J46A 4EFDA 4ZAYA 2ODEA 4U7JA 2N42A 3D4OA 2Z43A 1L5WA 2VS1A 2XLBA 3HI6A 3WRYA 3NNNA 1S3GA 4YAKA 2Y1LA 4JEIA 2MR5A 1I5OA 4RZ2A 5MF6A 1EGHA 2HSWA 2QT9A 2WIFA 1SXJC 1N7GA 1SAYA 1JXQA 1KI7A 1LGYA 2DUUA 4OGLA 1R6TA 4OSEA 1KOLA 5CEFA 4LCBA 1LNZA 1W48A 2VATA 2DY1A 3CZPA 1PQYA 5K45A 2ZRBA 4DQXA 1OZHA 4HTAA 4XGKA 4EF5A 3AERB 3OOSA 4BMNA 3VTAA 4JFRA 5JZMA 3W3AA 3ND9A 1UPAA 3VU8A 3ILSA 2OQRA 3TVTA 4II7A 4UQOA 2P78A 1W1WA 1XUOA 3WK7A 1CBUA 1LFAA 4LW8A 1Q77A 3A6KA 3HA5A 1JR3E 3D7MA 4INOA 1L4LA 3ROTA 5DVZA 4OEHA 2WWRA 3QPAA 3GGGA 3PENA 1UMCB 5ALMA 1VG0B 4YAGA 5IDQA 1N75A 3BCRA 1XA4A 4B09A 4ZJPA 3KUDA 2QZ9A 3LUPA 4LWZA 1W6RA 3QUCA 4X20B 2L2QA 2Z8YM 5AK4A 5BSMA 5AUPB 2WJAA 4PLGA 2HFKA 2NACA 4WGFA 4X7MA 2Q9BA 2YV3A 5DHPA 1EDZA 1GTVA 4I19A 9ABPA 3JAWB 5HCIA 1YQWA 4Z2AA 4DCUA 4ENWA 1CJSA 3WISA 2H1OA 1A9SA 3FTFA 3WP0A 4RJKA 4EEXA 5F7XA 1WEHA 3A1WA 4M4SA 4MQ5A 3LYUA 1P5RA 3GLFE 1RYFA 2O5CA 1SCUB 3D3WB 2COEA 3NS7A 5KYNA 4EJ0A 1NUAA 4FKMA 4L5YA 1YZQA 2CE7A 3C3CA 4UXIA 4PCVA 2AXQA 3MF4A 3PC8A 3P9QA 4URZR 3PFWO 5B1DA 4MB0A 5IC4A 5TV2A 3OKCA 2YX1A 4EEKA 5GJWC 2AFHA 2BAGA 2IXBA 3BGSA 3EIFA 1D1SA 3SKXA 3EFBA 3TZ6A 5ANRB 2I6UA 3UJ9A 3E9QA 3HU5A 4AK9A 3CF2A 2AX4A 4NKRA 4O3MA 4OHUA 4PIVA 1GDDA 1RM5A 2Z1MA 1L8AA 4ME6A 3LGAA 3O3OB 4LHEA 4YQZA 4E33A 4AY6A 3EXHC 2PGJA 2R62A 1ULSA 1X7ZB 2VUTA 1RBMA 1NVDA 5L7TA 3LWBA 2LBPA 2V6IA 4AKSA 2GEKA 3E70C 1WQ1R 3OPYA 2OGUA 4COOA 1GTG1 2UUPA 3DHNA 4GFDA 1P9OA 4BO3A 1W36B 3ORFA 3QV2A 1HBJA 1UC4B 2OG2A 2VNAA 4J4TA 1G3UA 4HB4A 2CLFB 3FTQA 1FDUA 1X3LA 3TQOA 3TOXA 3AV3A 1PV1A 3JR3A 5KOYA 3IEKA 1R0CA 4ZOAA 1EQUA 3UQZA 4K0RA 3OETA 1XVUA 2C2ZA 3PL1A 1KKUA 2EBHX 2B6HA 2H48A 3HBAA 4Q7JB 3R44A 1PR0A 1N2BA 5LA6B 5BN4B 3WGIA 2NXWA 4UNRA 2BDTA 2JGRA 4FDTA 4Q4AB 2J0VA 4EY3A 3GD7A 2NO6A 1VL5A 1QQ6A 3G8YA 1V4BA 1U81A 1EQ2A 2EJWA 1L1FA 1U7UA 4RJLA 1ZITA 1BCSA 1G8HA 3PTAA 3CIOA 5CTAA 4ISBA 4HNAB 4A2QA 4D57A 3ZWKA 2FZGA 1MIOA 2YQZA 4ROSA 4NBSA 1ZCBA 3NPMA 4MHSA 1CE8B 1SVLA 3A1FA 3MWGA 4Q82A 5LC1A 4Q4CA 4LJ9A 3LDFA 1MJFA 3NHZA 3KOWA 2CK3A 1YV9A 1V2HE 4P1ZA 4PN3A 2C2WA 3FFAA 1CY4A 3H4VA 4CE6A 4BNUA 3HDGA 3V1UA 5CHEA 3NEAA 3HJTA 4CG3A 4CIAA 4IY1A 3RIEA 1C1XB 2FY8A 3C0KA 2ZTLA 2J0UA 1VSTA 4F1WA 5AR1A 2B1IA 2ONCA 1MJHA 1PQUA 4OHBA 4EBBA 2J30A 3H1TA 3N2ZB 3FW1A 2BMVA 1O8CA 1OLXB 4V0ME 4C7MA 1QIDA 2VZLA 1Q44A 3GYBA 2HSDA 4K6CA 3HB9A 4MTCA 1IHXA 4RC9A 1UXIA 1J49A 2TMDA 4RPGA 1P0QA 5KYXB 3PEVA 1AG9A 1UT5A 3H8WA 3OPMA 4KV9A 4WUTA 4ZAVA 5FTMA 3WLNA 5BQ3A 1CUJA 1I0IA 5JECA 1RE1A 1N7IA 1SUWA 1OHHA 7MHTA 2AZ4A 4PQYA 1O97D 1SG0A 3IVCA 3K9BA 3KZCA 4XIJA 1RM0A 5AHWA 5K4AA 1Z22A 3HFRA 5MDHA 4RK1A 4ZC8A 1RXVA 3LYLA 3LVFO 1HWYA 2VHQA 1WNTA 2WDPA 3IE2A 1KBOA 3PSAA 3EPKA 4XWGA 3G8CA 3A0RB 5JLAA 3S29A 2P4SA 3KP1A 1HT0A 4OTZA 5I5EA 3THWB 3UUEA 1Y3FE 1E3IA 3HVRA 2BH2A 2HO5A 2Z08A 3M81A 3MUOA 1JIQA 4V02A 5B7NA 3E9CA 4FTWA 4EGJA 2VP4A 2LTAA 2D0PB 4FFDA 5H4HA 2ZPTX 1M1NB 4URYR 4ZT7A 3RSCA 3JVVA 2YUTA 2R65A 3AUAA 3L4BA 3P32A 6PFKA 4I6GA 1JSCA 2Z5FA 2ORED 1ODKA 1BD3A 1XDSA 2IGTA 2V45A 2FSUA 3IV9A 1MDFA 1C7JA 5CFQA 1IU9A 1PN3A 1AMUA 4ER5A 4JXXA 1LC0A 2V7TA 2PSJA 1BXRA 3DWEX 3OPYI 3BWDD 3LVRE 1CKEA 2XUFA 3PUIA 2XT0A 5GVRA 3UJ6A 1V47A 3QLVA 1GSHA 3B1ZA 3SEAA 5HSGA 4CV0A 3D3QA 2H29A 4ATNA 3REGA 4DIFA 2D1YA 4LF8B 2QNIA 2Q6TA 3O4HA 4NBVA 2V7XA 1HE3A 1ANKA 1J9ZA 4WZZA 3C3PA 3KEGA 1WHTB 4YMIA 2WLTA 1DEKA 2WHPB 1S8AA 1T2EA 3WQBA 3AUUA 3EZXA 3ENKA 2FPLA 5D86A 5I4BA 1LLFA 1E92A 4U2KA 4PC1A 3VJKA 3F4BA 1DI0A 3GEIA 1I01A 3T12A 4HDAA 3ZW8A 4BEBA 1MH1A 4RHEA 1YSCA 1V4VA 5ALVA 3MGCA 3A9RA 1P1KA 2X3FA 2ZIFA 3FMVA 5I7SA 2PX0A 5JCOC 1TX4B 1YXMA 2IYWA 2YVQA 3ZKWA 4U2GA 1FRZA 3HO6A 4DLXA 4YRGA 4BLWA 4L4SA 1T8YA 3RTBA 3FKSA 3QKSA 2DAPA 5JW6A 4Q15A 1YNSA 3O9VA 4J7CA 3B13B 4MI3A 3PUJA 5CYOA 3CZQA 4H17A 1R12A 4U9IS 4P9NA 4BMZA 1UBMS 2GK6A 5DIZA 3MTQA 1M7GA 3SE7A 3SJCA 1CRLA 8ATCA 1RHKA 1H2FA 1G42A 2ZE7A 3GEPA 5FO1A 1TKAA 4UPVA 1A5BB 1TGYA 2ZIZA 3WSWA 5BMOA 2JLYA 1AXEA 4BFTA 2BFPA 5F51A 5IZ4A 3VAZA 3ZJUA 2ZYDA 2OV2A 1T2AA 4L07A 5D3KA 5E1MA 4PVCA 4CF5A 2XKAA 3TZBA 2D1QA 2OYSA 4NK4A 3HKDB 3A1SA 3KPYA 4TTTS 4UHDA 5DN6A 1YQ9A 4WKBA 5K0BA 1LDGA 1VKNA 3DBOB 3UJHA 4CL0A 1USVA 1V43A 4LYFA 1UWKA 3ZJYA 1JMVA 2YV4A 3GBPA 4R9NA 4B6EA 3JQBC 1AHNA 2H1LA 3I52A 4CR8A 1ULZA 3M6XA 3I4CA 5COQA 1SPXA 1XZPA 2YWGA 4YRQA 3LPDA 3O6VA 3RQSA 3HGTA 1U0FA 3U3JA 4U7DA 1SCDA 3PYMA 4ZCQA 4DUZB 4MVJM 1ZZEA 2J07A 2YCBA 1DUSA 1JQDA 1X1EA 3QG1A 4I1OA 1FB5A 1LDBA 3JZMA 4J29A 3OX3A 4MUNA 4QGAA 5EINA 5BW4A 1T1SA 1QK3A 1NF3A 4KCGA 2FP4B 3K20A 2RK3A 3WMRA 3T7IA 3PJEA 2QR5A 3K32A 3QHQA 1OI2A 1QYRA 3IERA 3V4LA 5K0GA 1BVUA 1GRRA 1RS0A 2XD4A 3EFHA 1MLDA 3MTEA 4URFA 1QF9A 3LY9A 4K5QA 4RVHA 2DMRA 2BM8A 2HA7A 2MMGA 3QEJA 4GGPA 5C4MA 4NARA 3KZVA 4DY6A 5HF9A 1C5KA 4JLSA 2EZTA 2FUG6 3H6HA 3THRA 4QUKA 4BB0A 5JSUA 1IY0A 4KC0A 1OR8A 1PE0A 2GN8A 2D59A 3JD1A 1P7ZA 2Y05A 2DLDA 3RK0A 2VYFA 4FDUA 1XEAA 1T26A 4DSUA 3DCYA 3JAWA 3Q2IA 1P44A 2VBCA 4XCQA 9ATCA 3VDNB 3LIIA 2IHNA 4L8GA 4JQOA 1ZSNA 3BIFA 3D5EA 1X2EA 2P9GA 1SCUA 2B83A 2I8CA 3E9EA 2ID7A 1H4TA 3GNLA 1WWKA 4R8RA 3M5PA 2XNSA 3EZNA 1JVSA 3CRQA 4RHYA 3RGWS 4E46A 4F71A 3GJ5A 1U0HC 2G1AA 1KVQA 2XCSB 5J2UF 4C6RA 4J0QA 2ZBGA 2WJGA 2WP8J 3DGEC 1A8HA 4RVGA 4RVNA 4TWAA 4Y98A 2DSNA 3O95A 3S1AB 2C9OA 2GZSA 4PYMA 1J8FA 4NATA 5EXDA 4FLFA 2HUNA 3HY3A 2RJNA 3NBQA 1V1RA 1C3EA 1E7SA 2JGEA 3FTNA 1T2DA 3ILYA 1ZRNA 2XJ9A 1EQAA 2A4MA 2JFUA 3O31A 1KJQA 4HFRA 5GJVC 5F52A 1EE2A 3X1ZA 3N8IA 2V4UA 4JXKA 4H7HA 2C88A 5AICA 3TFWA 4MCHA 3NIDB 4EBFA 2R00A 1QQ7A 2GKGA 3ZTWA 4B4VA 3DHVA 3NEYA 3P27A 4DHEA 1JZQA 2KLHA 1PZXA 1X77A 2GJ9A 3KDAA 1X7ZA 4PYJA 4NLLA 2GETA 4BXOA 3QBVA 4DJFC 2AZMA 1AGXA 3QVGB 4TV9F 1GKYA 3A6EA 2HMAA 4LSZA 4GKKB 1XTBA 1E98A 2NO9A 1L1RA 1UJ2A 3DO5A 4AY4A 4CMBA 2GYUA 2JI8A 3WTCA 2WKRA 1NDQA 4DTIA 4FR0A 1RXWA 4IIJF 2QXTA 2BCEA 3AKDA 4OHCA 3FNBA 4H59A 3DR3A 4UHKA 2G1JA 5L3SA 5A9SA 4E5NA 3W5HA 1L4KA 1SQGA 4D9IA 1WCIB 5E7JA 3N0RA 5GONA 1RPZA 1P5JA 4E4RA 2R751 4DCVA 2JIZD 1BVYF 4C7VA 4Y2PA 1TM4E 4HWRA 4LBYA 4RYDA 3RAPR 4KR2A 4L6IA 4LE1A 2ATIA 1JLMA 1IHYA 2IITA 1FQWA 2J9ZB 4YP1A 3WRXA 1RAEA 3REQA 8LDHA 1FDIA 3LRXA 2V9CA 2Z2JA 3CLHA 3KVNA 4Y2UA 4N0DA 1T4DA 2RK4A 3U1VA 3AFIA 5CDUA 2ZWMA 3WLIA 3HXKA 3IALA 3L1VA 3PRHA 3UV6A 2NO4A 3DKPA 3Q9SA 3GLFB 2BZSA 4RQBA 5H59A 4LDQA