3MILA

Crystal structure of isoamyl acetate-hydrolyzing esterase from saccharomyces cerevisiae
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
240
structure length
240
Chain Sequence
b'MDYEKFLLFGDSITEFAFNTRPIEDGKDQYALGAALVNEYTRKMDILQRGFKGYTSRWALKILPEILKHESNIVMATIFLGANDACSAGPQSVPLPEFIDNIRQMVSLMKSYHIRPIIIGPGLVDREKWEKEKSEEIALGYFRTNENFAIYSDALAKLANEEKVPFVALNKAFQQEGGDAWQQLLTDGLHFSGKGYKIFHDELLKVIETFYPQYHPKNMQYKLKDWRDVLDDGSNIMSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isoamyl acetate-hydrolyzing esterase
molecule tags Hydrolase
source organism Saccharomyces cerevisiae
publication title Crystal structure of isoamyl acetate-hydrolyzing esterase from Saccharomyces cerevisiae reveals a novel active site architecture and the basis of substrate specificity
pubmed doi rcsb
total genus 93
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2010-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3milA00
2WAOA 2O14A 4OAOA 2VPTA 4LHSA 1VYHA 4RW0A 4OAPA 4RSHA 2Q0SA 1DEXA 2HSJA 1ES9A 4Q7QA 5HOEA 1FXWA 1JRLA 1Z8HA 4M8KA 3HP4A 4K3UA 3DT9A 1WABA 4S1PA 2WAAA 1DEOA 4JHLA 1PP4A 3DC7A 4JJ4A 3DT8A 1V2GA 5BN1A 3MILA 3DT6A 4K7JA 4K40A 3DCIA 1FXWF 1U8UA 4IYJA 5CD9A 4XVHA 1K7CA 2APJA 4PPYA 4JJ6A 3SKVA 4NRDA 3P94A 4Q9AA 5A4AA 1VJGA 3SLRA 1BWQA 4TX1A 1ESDA 1J00A 4JGGA 2Q0QA 1ZMBA 1YZFA 3BZWA 5B5SA 4HYQA 4JKOA 1BWPA 4I8IA 3KVNA 3U37A 1BWRA 2W9XA 3PT5A 5JD3A 4DEVA 3RJTA 1IVNA 1ESCA 2WABA 4HF7A 1ESEA 4K9SA 3C1UA 4H08A 3W7VA
chains in the Genus database with same CATH superfamily
4RESA 5AJZA 3WICA 5HJEA 5LNK6 5LD2C 1JH9A 2PX5A 1EE2A 5HF6A 5CBPB 1F5SA 3AF3A 2CC2A 2BUAA 2CB9A 2IKQA 1MAAA 4FNAA 5J4HA 4GPIB 1FTWA 1RI1A 1UPXA 3KQSA 3NKVA 4FEEA 1U2GC 3R3VA 2ZI4A 3WRXC 1QIGA 3ZJ4A 4S05A 5DM60 4UFPA 4OVKA 3CEPB 1Q1AA 2PCJA 3L43A 4MULA 4DMFA 1GGJA 3W3AA 1WETA 2A1UA 4TL7A 2ZB4A 3ZWCA 5JI2E 1PJRA 4KTVE 1X39A 1VB5A 3VKWA 1KTVA 3PL5A 4QEKA 5EP2A 5KYTA 2INGX 3RHTA 5JWHA 2D2XA 2XOEA 2Z3WA 3IMKA 4AJPA 1TECE 3C1TA 4CT5A 5GIPE 1A1SA 2VPWA 1DBVO 2A84A 3PI6A 3I1IA 4M53A 4ESOA 1CUJA 2GHQA 3HGMA 3FZQA 1XCBA 1ORDA 3LOQA 1NUHA 1MC8A 1DRVA 4PG4A 1KIAA 1BW9A 1XGKA 2A33A 2ZYWX 2O0MA 1JPJA 4HAOA 2GLTA 4MQBA 3P9XA 5C1PA 4TTPA 3NHBA 3I6BA 5BSRA 3FUCA 3G9ZA 3NT4A 4CV2A 2OO3A 3W2FA 4R16A 2JFXA 1ZJWA 1RBZA 5ICEA 1FFGA 3TLAA 4EF5A 3DE1X 1CTQA 2ODEA 2X1HA 2Y8EA 4FWIB 3MILA 1SHJA 3O5AA 2BBWA 2J5BA 2RGXA 2HIHA 3CBGA 4E88A 2F1JA 1BVHA 3DPIA 5F5XA 1HYQA 2WJAA 2CNWA 4CMBA 1N2HA 1GVNB 5K99A 1L8AA 3B8EA 4FMBB 1K7CA 1H42A 4LWQA 3AONB 2ISQA 3RUDA 4D9JA 3D6HA 4AS1A 4PC6A 1M6YA 3ENVA 4N0DA 4DTCA 3MB5A 4UEQA 1UXIA 4RV4A 1ZH2A 1P6XA 1FLAA 3OTWA 4V0NA 3RRNA 3DGFC 5DNDA 5BOSB 3QVUA 1CNFA 4IG9A 2HDHA 2CXOA 2OUKA 3FWYA 3FOWA 3LRXA 1QYDA 2OGUA 3ETJA 3MGBA 4JR0A 3BTUA 3QI2A 4LOIA 3U7EB 4K3VA 2EHJA 4KPUA 5CH5A 5JSZA 4JFRA 2R44A 4K9QA 4UHHA 2HK7A 5H3LA 3EUFA 2YN4A 4HLNA 4UE3S 5TQ2A 2UYCA 1FYVA 4Q9JA 4Q3NA 1GTL1 1SC9A 2EAUA 2EKLA 4WUVA 3HR7A 2IK8A 3PE6A 3A1DA 1CERA 1JFRA 1OI2A 4H1VA 1I0IA 4IDEA 2N46A 1PR0A 3H3FA 2GAFA 5DX1A 4CETA 1I3OA 4ODIA 1UOOA 4HWRA 1XTUA 4HWPA 2F59A 1N6KA 2PBFA 3KVNA 4J3JA 1CR6A 1CY2A 2AJTA 3EQ9A 4XQ9A 2G9QA 3IE0A 3M6LA 3MWLA 3NHZA 3WY9A 2CE2X 2XGOA 4BV8A 1CUAA 5KNBH 4AQYB 4CKBA 2G07A 2WNIA 5I7OA 3SHTA 1GILA 2I9PA 2M6RA 1MJGA 4XDYA 2O3JA 4ADSG 3V34A 3M5WA 3PCRB 5IG2A 4YUVA 1HM5A 3VMMA 1T35A 2WKRA 4QYXA 4GSLA 2GBIA 3FYCA 4UHJA 2H85A 3GRAA 5CIQA 3TQCA 1E2NA 2ES4A 3VU8A 2F9LA 2RGNC 4GOOD 4I08A 5EHQA 1BH2A 3UT0A 3IVCA 4Z7OB 5FL7D 4IV8A 4MWSA 3EVBA 2DPYA 5AOAA 2OQVA 1LSJA 4LHWA 2YQ5A 2D3TA 2IEYA 4GRIA 1BTOA 1KDTA 3WHKA 4OFZA 4A92A 3WLNA 1KI6B 1Z5ZA 3ZD9A 2GLUA 2VDLB 3T3EA 5L4LA 3MM4A 1NUPA 3NH9A 1U0HC 1LSUA 3DKVA 4H3VA 2BN4A 4G0NA 2I9KA 5LQUA 3LNTA 1ZD9A 2VPTA 3CEAA 2P6PA 4JT9A 4MJ3A 4XSHA 5FORA 3AW8A 3V8BA 4EL0A 4OAPA 3GVXA 1PQUA 3B13B 4YBZA 5HK8A 1KE1A 3GA0A 3G9XA 3VDMA 4BEJA 4Y18A 3S2UA 4ERXA 1W2HA 3FCAA 3NASA 5BWCA 3FUVA 1Y89A 3DLCA 1KZHA 5JZMA 2PKRA 1KYZA 1CE8A 1NA5A 3JV7A 2JGJA 2DLCX 2P67A 2E6KA 2AF3C 2WM8A 4RORA 3OMLA 4QDKA 1MFPA 5K0NA 2QORA 4MXDA 3N9IA 1W1IA 5CMLA 2IW1A 3VR2A 5ALVA 5EZ5A 1IBRA 2R8OA 1WPRA 3WNCA 2B30A 5TQVA 5G0UA 1PQ4A 1UKAA 2W2VA 3UMJA 1WOMA 5EIOA 3U7JA 5IUKC 2OP0A 3D1LA 2FNAA 2LWIA 1E2GA 4MVJD 3X1DA 1NFFA 4RACA 1YO6A 3LBAA 1D3AA 1Q15A 1TVEA 4LBYA 3UY4A 2AE2A 4S12A 3M83A 3D3EA 1KDRA 2OT3B 121PA 2QUHA 1AZSC 2X9GA 4V39A 1ODIA 4H1WA 3PEVA 2ZZKA 2GNAA 2PVPA 2R79A 2ZSIA 4BLVA 4M1OA 5ICGA 2ZJ6A 3FE2A 4PO1A 4QRDA 1BNCA 2MIIA 5HTKA 3GOHA 1VJ5A 3PVSA 1K6IA 2VKQA 2XYHA 2I6FA 5C37A 4P31A 3HEMA 2HJVA 2A5JA 3EXEA 2VDPB 3LVBA 3N58A 4PSKA 4BBZA 2P9JA 2VWGA 3PE4A 1PT9A 3HYTA 1QTNA 3GD5A 3QKRB 2ZUBA 4GZMA 5CLJA 3H1AA 2IZ7A 4HPJB 3TOZA 5FBVB 2G9RA 1VL0A 2ECOA 4Q9AA 4UE2A 5KQGA 3HTXA 1M10A 5J40A 5JYBA 2A5YB 3EPLA 4HN9A 4Y2YA 3CH7A 1EIWA 1L5HA 4TKVB 4K28A 3OC6A 4ZCMA 1XDWA 3FUTA 4BB9A 3TUJC 4TVSA 4F5ZA 3U3JA 4ER3A 4INZA 1ZMBA 4N5HX 4KBYA 2EFDB 5KBYA 2XTMA 4TN1A 4NL4H 4EGQA 3A1EA 1V7CA 1U2QA 1WVIA 2HMYB 1IY8A 4MYDA 2BHRA 4GIBA 3M9WA 3LGXA 5JSQA 4GP9A 2GEKA 1OGYA 3SZ3A 3IKTA 2SHKA 4C6TA 1M8JA 2QD2A 4EY3A 2D7JA 4E1AA 2DULA 3AEQB 1Z0ZA 2OB1A 1KZ6A 4BJ5A 3F7NA 4MUNA 4EA7A 4O5AA 4UD6A 5A5FA 2J3LA 2IWRA 4DDMA 2VHQA 1L7AA 8ABPA 5LUAA 3LTNC 3FTQA 3DMPA 3PS9A 2C42A 3UB4A 3GLFA 4YO7A 3F73A 2PQMA 1ABFA 1GUBA 1WVMA 2HOQA 2LR0A 2Q2NA 3WKDA 1S2NA 1PGPA 2PV0A 1IOLA 1GGEA 2KBFA 4N6NA 3UQYS 3MJSA 2P9GA 1KMIY 1GG5A 4RF2A 4YUZA 2QXYA 4P58A 2J9FA 3H8SA 3PITA 1J2UA 1XMPA 2HA2A 1AURA 4G85A 3B36A 4V0MA 1EE1A 3QU7A 5EHIA 4MDEA 1BRMA 2HBRA 2ZYIA 3ESAA 1TLLA 2DWCA 4DYHA 1YS6A 2NZYA 3RK1A 1NTRA 1ODJA 3UAGA 3H9BA 1I14A 1PEKE 5F1YA 2IBTA 2QYOA 1PFQA 3IILA 4I55F 1OYWA 1ULAA 1R9MA 2HH9A 2XNSA 4KI7A 4MPPA 4NEQA 4U7HA 4ZN6A 1CBUA 1RM3A 4WZBA 4AWBA 3AT1A 5FCDA 3KTDA 2X0DA 4C1NA 4O8CA 2Q0HA 1SBQA 3GHYA 3V7YA 2LZ0A 4MCJA 3M2PA 4NJEA 3H1PA 4RK4A 4TPKA 5AKHA 4TT8A 3E61A 1A5ZA 4E4YA 1TEZA 4CVNA 3QNWA 1KYIA 1EK6A 3UHOA 5EE9A 5HZKA 4HEQA 4PS0A 3LQRA 2D06A 1T6NA 2WTNA 4L4RA 3X2FA 4X61A 2OK8A 3L4EA 2NVWA 4EG4A 3DOEA 1YQTA 2F1IA 4M6WA 1H8ED 4U2BA 4W63A 1JA9A 5JC1A 1CF2O 3K53A 4DLNA 1P1IA 5SY6A 4P8RA 2XCTB 1WAMA 4OJKA 1HEIA 1I2AA 4QL3A 5C9ZA 3AVWA 1E2PA 5AVUA 3LXRA 4NJMB 3KTAA 4L2IB 3RAJA 2O4UX 3FSGA 4BFVA 3ROQA 1T2AA 2ZIXA 1DLJA 3QX8A 1KR2A 4KV9A 5H16A 3RSFA 4YUYA 2VPPA 4WLNA 4AXBA 1X13A 5I45A 1U1CA 4PN3A 2ONZA 2J6CA 2JVKA 2XYGA 3A4LA 3IDOA 3B51X 4QYIB 3NRCA 1SBIA 4V0SA 4GM1A 1YB5A 3EG9B 5H4GA 1A9OA 1F3LA 1A98A 3OZVA 2GUWA 2G3YA 1P4SA 2Z08A 4C5AA 2I3ZA 2RK6A 1YHYA 5GVRA 1Q0HA 2QUZA 2NU6B 5IWAB 3O4GA 5TMDA 2WICA 4IMIB 1N1EA 3T3PB 1H6AA 2R4UA 2YICA 3INRA 2P5YA 4IIGA 4QXQA 1ONBA 5DHUA 1DCKA 3HKBB 1EX6A 1XLVA 3TTSA 4BMVA 5AMXA 3C4QA 4DA4A 1UKBA 3E5RA 4DPLA 4F92B 3K1AA 1PRYA 4YCMA 1DKLA 5JASA 1I1OA 3A37A 3QXSA 2ZXEA 4UHFA 1KJYA 3B9QA 3I9V1 1OV6A 5LZ8A 5K7SA 4M46A 2QIPA 3E2IA 4Q3EA 1EK2A 3JTEA 3H6GA 5CDTA 3Q41A 4UE6A 2GEBA 1BWPA 1EFLA 1JL3A 1Q74A 3BREA 5SZIA 4ITVA 3FF4A 1W35A 3HYCA 4LDZA 3FG9A 3VVBA 4IFTA 3I52A 4EGAA 4QPZA 1BXRB 2RI1A 4GI5A 3TW6A 1TXGA 1AS0A 5EUCA 3RVOA 3KPVA 3DWFA 3N5KA 2W9XA 1R4AA 3ZGYA 2HQRA 1KHTA 5E6SA 5ESXA 1EVYA 1LPOA 1BEUB 2G67A 3OWHA 4C4XA 4CKZA 3V4ZA 3PYXA 1YKGA 4E30A 2PZLA 1C0LA 4JFAA 1T5TA 1RFLA 4KNWA 4XIJA 5TE9A 5DGXA 4EAQA 3JQ8A 1E2UA 3V4SA 4M38A 2HRZA 4QWWA 1XSEA 2WUGA 1JSZA 3EZ6A 1JLMA 3RVMA 3F3KA 4DQUA 2QY9A 3E9ZA 1S3IA 1QFXA 2GBPA 5LMUB 2V0NA 1VTKA 1S02A 2EX1A 5ICSA 4W82A 4RY0A 1V71A 2V9CA 2JS7A 3CNEA 5IW8A 1Y8QB 4YQZA 4M0DA 3EA5A 1U31A 4FUQA 4ZOLA 3NQ41 2AJCA 1NRWA 4XWKA 3AIOA 5DKFA 4MVJI 2B3DA 1VL6A 2RGNA 3P0FA 1GL3A 2XVZA 2QTNA 3P9PA 1JDZA 2IYVA 3EB9A 2O4CA 1ZQ9A 4FCTA 2X0EA 3T3OA 1X80A 4URYR 2WD7A 4G36A 4CF7A 2BGRA 5CFMA 1QS0B 3K8ZA 3AL0C 2CCKA 2J32A 2OV8A 1LJUA 3ELYA 1GN9A 4P84A 1YOVB 4OI4A 1P7CA 3MRVA 4ASUD 5BQXA 4ZVMA 3RT9A 3MJHA 4OXQA 1M83A 5I7VA 2XBLA 3N2ZB 1MOPA 4AQ7A 3Q72A 2PRJA 5DK6A 4MOWA 2CYBA 4JC8A 4YJFB 1IPEA 5HGJA 3EXIA 4EI8A 3UOWA 4B09A 2J08A 2KWIA 2P9FA 4MVYA 4RZ2A 4UM8B 2WR8A 2PQ2A 3QSGA 4OHBA 1L4LA 4WLUA 4KWEA 7MHTA 4NBSA 2VBFA 3AG6A 1TM7E 5JEDA 3NB0A 2Q6LA 3N07A 4IHKA 5DLPA 3WLLA 4GQBA 1T5BA 1FUEA 2C9OA 3BAFA 4JB3A 4MUGA 4ZZIA 5KJ1A 3VU3A 5E0OA 1C3XA 3TX2A 4GRDA 2C4MA 2J4DA 3DT6A 5AUOB 4G0WA 1VKOA 2VTKA 4ND8A 1WLYA 2AZDA 5BMVF 3FTNA 4Y30A 3SZOA 1OA1A 1V35A 2QM7A 4NEGA 4UVGA 4WTOA 4C7VA 3MCZA 4DRYA 4ZVUA 4EYQA 4G5YA 3H1FA 5HZHA 2HA6A 3L84A 4ZRDA 3RSCA 4ZJYA 1UJ5A 3Q7EA 4Q66C 3L4JA 1P2DA 4F93B 4N01A 3G2PA 2ZIAA 4F2HA 3TIGA 4R2JA 4TMFA 2AZMA 3SKYA 4CW7A 4B43A 1EDEA 3ILYA 4MGKR 1SUCA 5BUZA 4XWGA 4A0RA 3W2TA 3WSWA 3S27A 1XTQA 3WLIA 1ZISA 2IX9A 2Z8YM 3CEMA 2JKYA 3BRWA 3E53A 3OX4A 3CH4B 3W4JA 4EHJA 2GXAA 2FZ4A 2OG1A 2X0NA 5IMBA 4AUEA 2AFVA 3LC2O 3NIDB 2WMDA 5ISMA 1U0NA 5KX5B 4LEIA 4TS4A 2OHXA 3H86A 3UJ8A 2JANA 4JDUA 2YS7A 3ABQB 1PJCA 4BJ6A 2CHUA 3AYZB 3QUCA 4UVDA 2GT1A 1ZOOA 5IZ4A 1PQWA 1VE9A 3OUZA 5F7JA 3DYVA 5IJAA 2I80A 2JAPA 1E6EA 3ME5A 2J3JA 4YNBA 3UC5A 4DR2B 3Q8WA 4HQRA 1YDFA 4NJMA 1GV0A 4MI9A 2WAXA 2ZP1A 2JGKA 3RUIA 3A11A 1NATA 1KYQA 4C7MA 1ULUA 4D46A 3EX7C 2VIIA 2G4CA 4A6PA 3L79A 4DMHA 4OHRA 1FTYA 4RLHA 1JQKA 2Z4TA 2I71A 2RK4A 3PIIA 4BNDB 2ZCUA 1Y34E 3TQRA 2FETA 1RT9A 1C7IA 3VDRA 4M9QA 3OT1B 1TVMA 2AWNA 2HBZA 3CMCO 1DBPA 5DU2A 3CLUD 1U98A 3HXLA 3AEKA 3RVDA 4B4OA 4YRIA 5MDHA 4FTWA 3SJUA 4ZVPA 4C07A 4EFDA 1QBKC 3RRFA 1G7RA 3TPZA 3I9MA 1FPMA 2QTFA 4O4IF 4GWGA 2GXUA 2G09A 1C7QA 4P34A 2PMEA 5CFZA 3I42A 2OXCA 3G2HA 1K0FA 4WW0A 4LE1A 2NGRA 4PQFA 4A2PA 2O06A 1M76A 3JQBA 4A2WA 4DSZA 2WJZB 1MAVA 1Q83A 4N82A 4UREA 5IKOA 1ZCJA 3Q3EA 4HS4A 4L1KA 4AP5A 4B6JA 1GCUA 3WRXA 3IR7A 1ADCA 3KSMA 4B17A 1YHZA 2J9XB 2V97A 2CXPA 3ZY3A 5CEEA 4E7OA 3KK0A 5L53A 3UWSA 4OHMA 2HWUA 4QOJA 3R3YA 1N6IA 4I5FA 1W30A 3S5UA 5C8YF 4LDPA 1CJMA 4PONA 2QMYA 5IVIA 2WIJA 2FE4A 4A3SA 4FUTA 1FRQA 1ZZGA 4RS4A 3MEQA 3WWDA 2IQ5A 4M99A 5ALOA 1N8KA 2BJWA 2YMLA 3GEHA 3ZD8A 3UV3A 3N39C 2QRZA 1P80A 2GVNA 2H59A 1H1TA 1Z7GA 4Q19A 4KXVA 4CL2A 5DNCA 4NDAA 1HDGO 1JKJA 2IYAA 1T2VA 2Z8YA 4CMGA 3TFOA 1PP4A 1XEWY 4BEWA 5TPWB 5LWHA 3WP0A 3EISA 5DBIA 5TB5A 3KALA 5EUBA 1NVEA 5KJFA 4M1MA 1HH4A 1R4MB 1L5GB 1PNRA 1Z37A 4DNOA 1XZIA 2QTWB 2DG2A 3HXPA 3K6RA 3Q0EA 5LN1A 2CV0A 2D7DA 3D8HA 1ZGGA 1Z22A 4R2HA 4PANA 3KSDO 1X19A 3I4CA 3R5KA 4Y2XA 4CT0A 1O95C 4RVUA 3D0KA 4A6XA 8LDHA 1CJKC 3D6VA 4XWWA 1KQ3A 4GDFA 2DX7A 5AW2A 4W1PA 3MUOA 3I5AA 1LJLA 3KT6A 3ZXIA 1XB2A 3FDXA 1A27A 3D6JA 3MOGA 4ZCSA 5BYKA 4HBZA 1LBIA 4AZ3B 4GICA 4CKEA 4J90A 1XCPA 2RJOA 1N7JA 4I1PA 1V1RB 1NMSA 2ZWOA 3CM0A 5HFNA 4LOKA 3SS9X 2CK3A 3RYIB 3O2QB 3OY2A 4C4TA 1HRDA 3LO5A 1JF8A 2ZCJA 1GPYA 1SUPA 2EW1A 3AP1A 2XQGA 3EW7A 2X14A 1NN0A 3HLKA 1FYWA 4GHWA 5F1KA 2G4LA 3PICA 4RZUA 1YQWA 5HR5A 3AERB 1KK1A 2B8TA 3DEYX 3GN2A 3PE3A 3HWX1 2XGGA 3IRVA 4I3FA 2G72A 2CKMA 1I6WA 2ZIEA 3IOEA 3P1JA 4FCCA 4N6GA 5KNBD 5ESRA 1SOVA 1S5PA 3ZI4A 1J9ZA 3Q8LA 1A4UA 1II8B 3OQPA 1C9JA 2BHSA 1E1RA 2Q6OA 3JZFA 1AA6A 1MPXA 2CVHA 1F60A 3KQUA 3E48A 4OXIA 3ET4A 2GK6A 5KQLA 4DV3B 1C50A 2GETA 2CFIA 1YL6A 2WOJA 1H1LB 4KYTA 5LMCA 2ZYUX 3LDFA 3ZW9A 3OOSA 4Q3LA 2G7MC 1ENPA 1CS0A 2Z3VA 5TEWA 3SAJA 2VUUA 1ULTA 3DHEA 3OURA 2UZ1A 1N6NA 5C31A 5DM70 5JFGA 1EUZA 1P3Y1 4F6CA 2QPLA 1JB1A 1FRFS 1JT9A 3WIUA 1EJ6A 3BH7A 5FNZA 4PG7A 2OBMA 3OVMA 5DXJA 4PFKA 1ZCFA 3L7LA 4Y0NA 1XYGA 4NFYA 1YVDA 2P0EA 3HUTA 4IH1A 5JCOA 3H2JA 4Q03A 3QKTA 4JI4B 4ZANA 3HLYA 4CN8A 1C0IA 3VH2A 3B6JA 1TU4A 3GAZA 4MEJA 4YUWA 5FBZA 3UHFA 5TVGA 3FN4A 1T4DA 3DUFB 2HPAA 4G1UC 1CQWA 4HGZA 1S89A 4WH0A 4BMPB 3ICEA 4XIFA 5EP1A 4K6OA 5KJCA 4UOQA 3U80A 2V03A 2C2GA 2ZRIA 2QN9A 3NWPA 2AQ8A 2FN7A 1FBNA 4GC5A 5L6MB 2QVLA 5DOVA 3ZHUA 2ZB7A 4U2EA 2P1DA 3H8WA 1UPTA 2B78A 5FWXB 1AB6A 1VECA 2C03A 3LXMA 4N54A 5AKGA 1K6JA 3O3OB 3FCYA 2DTEA 4YI3A 1HFJA 1W29A 2QG6A 2WVAA 3K72B 4DMLA 1TX4B 2IDMA 2VL7A 3D59A 1L7VC 1BMQA 2G9VA 1GR0A 2YCLA 4JHLA 5EQFA 4BO5A 2XJ9A 1MZVA 3EWNA 3FRIA 3RS8A 1JB9A 1N5LA 2VP3A 1GG9A 1YFZA 4HSGA 4PRKA 1Y63A 2JJ8A 3KB2A 2XZLA 3DCIA 1RI2A 3ICQB 1OZ0A 1PX2A 1R8JA 2TMYA 4PG5A 3AP3A 4QX6A 3T0IA 4GWLA 3ZS8A 1A04A 3VPFA 1ZZEA 1KSFX 2VNIA 2OMKA 4I19A 4E70A 4PY2A 1E7MA 1ICEA 4GX0A 1M8GA 2NXWA 4LA4A 5C1IA 3SFVA 2XDAA 4H4CA 3HPRA 4HVAA 2XDQB 4QNRA 4UMEA 3P9CA 1KY3A 2JPDA 5DYNA 3WIDA 3OZGA 3ZGXA 4DAOA 4PO9A 4BL5A 4UOEA 4W9MC 4OSOA 4EZIA 2XD4A 2Y2UA 3WLMA 4JLPA 2JIMA 2OK7A 1N1DA 2WG2A 1AK1A 2VYNA 4BNJA 3FLAA 1TIPA 2IXGA 4MQ5A 4B9AA 4D5GA 3E8MA 2PUAA 1H93A 3TECE 1Q0LA 2XSZD 2ZATA 4MP3A 1RZVA 3OHMA 4BUCA 4EGSA 1QGUB 2VF2A 5DYWA 4BKUA 4B40A 3FUUA 1G6HA 1ECBA 3UW3A 2AXPA 3II6X 1YQXA 3LECA 3MWEB 1ISSA 1XTZA 1X7YA 2ORED 1KOJA 3HCAA 2IXTA 3O8QA 4NG4A 4BEBA 3TNFA 4CTMA 1OB5A 3EEIA 1GPAA 3KKOA 3L7YA 5A3QA 5K8CA 5K8JB 2V5AA 1QQBA 4ZQBA 4BO2A 4C4SA 4CR6A 5AVSA 2PKQP 3ABSB 3CLTD 2A0XA 1GL9B 4XUDA 2ST1A 1CQIB 4IL5A 3FZYA 3MYRA 2AR7A 1JFFA 2F1RA 3JQBC 3RSQA 2AK2A 1GZ6A 4S24A 3GC6A 3SJCA 1G8KA 2NN3C 4TUYF 1ZH4A 2DWQA 2NTYC 2QVZX 2WABA 3OAAA 5B1DA 2F4NA 1HTWA 1A97A 3HBMA 4I81A 6LDHA 5M04A 4OLAA 2IEBA 5FOUA 3DR3A 2JFBA 2XIQA 2NUTA 2AKAB 4KQ9A 2EQBA 5CB6A 1QIFA 2B69A 5TS3A 2PNJA 4F4FA 1SXJD 2GPNA 4RD3A 4ZZ0A 4K1LA 5B4UA 5CU7A 5ALDA 2Y1KA 4MQEA 2NXNA 3ZDBA 1NJ1A 2A4MA 1ZGJA 2P2SA 1EDBA 3E8XA 4E12A 2PZGA 1D1TA 4LBWA 3HCCA 1RADA 4Z54A 4X20A 3TM4A 1UDRA 4U9HS 4YJGA 3RC1A 5DYTA 1LI7A 4C0JA 4DNQA 3DMFA 2V54A 4K9NA 4AX8A 4Y2RA 2CN1A 4DZRA 4ZMRA 1NBIA 1Q16A 1CUYA 3WHPA 1ZI8A 2IYWA 2HYIC 2P40A 3L92A 5K09A 4GH5A 4Q7KA 3TWOA 1EAYA 3K5WA 4KGXA 2VDMB 4LNHA 5FL7A 4EMBA 5CUQA 2CWWA 1LK0A 4YJ2B 1COWA 1VI5A 2CBXA 2WIGA 2XZPA 4EELA 4B7ZA 4P83A 3FWHA 4TWJA 1OR8A 2WINI 2C9YA 1KAEA 1ST2A 2GTIA 5FR2A 4BIMA 1XBTA 1Z4QA 1G8AA 4Y6GB 5B3KA 4TZKA 4WXPA 3GMIA 4JK3A 5JD6A 3EIUA 2V4UA 1Y9EA 2OGSA 4OMUA 3FYTA 1JWAB 3FB4A 4R1LA 4WGGA 3RAPR 2RAFA 1QZZA 4NFHA 3R41A 3K0HA 4PCVA 3OFSA 3JASA 1CJUC 3FCSB 4KK3A 3PDIA 2O52A 3K09C 3TGWA 5JSHA 4JC4A 5BNFA 4D8WA 3COWA 1Z5VA 2C7BA 3ITKA 1D4FA 2WA2A 4RQUA 3KFXA 2OXIA 1XQXA 3UPTA 4UAUA 1F06A 1JQJC 3MSCA 2N1BA 3Q6MA 1RRMA 2FJUA 2XT9A 4EIWA 2CHVA 1KAOA 3A1UA 2BFBA 3AKYA 4NOLA 2KX7A 2CLEB 2XKJE 2W6ZA 2FSVA 5AVJA 4ND5A 3BBLA 3DEIA 1JG1A 3GDFA 5G0VA 2CW5A 3I64A 2PX4A 4ZO9A 1J00A 3RT7A 3GNSA 1CU1A 2YV1A 2IYQA 1YASA 3QPAA 1BKDR 4RHTA 2PLWA 3BB3A 2CD7A 5DMHA 2MMCA 4PBRA 3RTDA 2NIPA 4FYPA 4O0LA 2CJWB 4YRTA 1VA4A 4Q7LA 4KE8A 3RE1A 1FLNA 1X7ZB 3OQ1A 5DRYA 2GPWA 3SQNA 1CV2A 3GCDA 1E9FA 3N8GA 1J2JA 2ZS8A 1DZIA 2LKDA 2O8BB 4ND7A 1CUIA 2GN1A 4H7IA 3OCWA 4OTZA 3SYMA 1KBOA 4UTRA 5KAPA 1Z2DA 2Q1XA 3NHFA 3DZFA 3UATA 1JNXX 1CJVC 2I4NA 1PR3A 2ZUDA 1XCOA 3L82B 3PQ3A 5I7RA 1D7AA 1PJ3A 3LZ6A 1FXSA 3EPRA 2EFYA 2VRCD 3AL2A 3IAUA 4ZRNA 4US2R 4D9FA 1K7YA 1O6GA 3VNAA 4AICA 3U4MA 3GYGA 4LOHA 1GZHB 3Q8XB 1QRUA 4WCVA 1ICIA 2GVZC 1Z6TA 5AQ1A 4TYNA 4ESVA 2DR2A 3CN7A 1COZA 3DF9A 2NQ2C 2VBCA 1YD7A 1Z62A 5H1YA 5KX5A 3OKPA 4MV5A 4G24A 4YX9A 3PQ8A 4A8JA 5TQJA 3DFFA 4J1QA 2QUIA 1PFWA 4P2GA 3TUZC 4US0R 4I14A 4BV9A 4UMFA 2IIBA 2PA0A 2NP7A 5CGZA 1JAIA 2E87A 3BFJA 5BURA 2ZUCA 1SCDA 5AK3A 4N5DA 2PQ0A 1U9IA 2GAIA 2GOYA 3C87A 1M2WA 1NZJA 4OKIA 3AYXB 3ZNOA 4BKPA 4DEXA 1USVA 2B92A 5K8UA 3ZJVA 1V6AA 1N33B 1E5DA 4WXHA 2IYOA 1KJWA 1W7AA 1UEIA 1WMEA 3PC6A 3PRYA 2QROA 2JK0A 1UZMA 3C6ZA 1U2DC 3FKQA 3GJXC 3Q5EA 4O6VA 3IO5A 4PPNA 5E6UB 1GZ5A 5GJWC 1AMUA 2XXAB 4WKPA 3SD7A 4CKCA 3IH5A 1O5IA 4ZI2A 1UK6A 4FU0A 2XX3A 2AX4A 2FR8A 5CTJA 5ALJA 3W8RA 1AZWA 1LQUA 1Z68A 3PXDA 4J2OA 1LLDA 3TZLA 1VJDA 4A0SA 3I9KA 1BOFA 1TPZA 1WUIS 3LUFA 1RBYA 1W5SA 4WK6A 1ZH8A 3C98A 2HRDA 3KOMA 4JSYA 9GPBA 1U5AA 1EINA 1ISRA 2YOGA 3OM1A 2YJ5A 4MWDA 2QMUA 4HWKA 4UBLA 3I45A 3LY9A 1QFJA 4TMKA 2DTXA 3H2YA 3Q2IA 1N6RA 2A9JA 2FEOA 4WKNA 1B0ZA 3DBVO 2GX6A 1SQ5A 4ASUA 3AF5A 3VZPA 1BS1A 1FLDA 4JJFA 2IZOA 3A2LA 3JCZA 1U3GA 3B1VA 1IHPA 2CNLA 1CDZA 3AEUA 2IT1A 1KP9A 3EA0A 5D8DA 3BSSA 5TC4A 1H2BA 3KUUA 4IBOA 4EABA 1SVOA 1PJSA 2EVWX 5A5GA 5JYDA 1YC2A 3SP1A 1E1MA 4TTQA 1DDOA 1F0PA 4EB3A 3ZZTA 1WHSA 4KW7A 3RRZA 3BXEA 4GOLD 3RTEA 4CL3A 4DT1A 2ODTX 1JALA 5B58T 2XZOA 1GPKA 5EZQA 4LQDA 2H5JA 4DA9A 2H07A 4KVZA 1QFMA 1JT2A 1G21B 1P91A 2OCLA 4WINA 3TXYA 1PT5A 3WBKA 3BZWA 2A0UA 4TXHA 1U0RA 4W6ZA 3ZK7A 2EKZA 2H3HA 4UULA 1YONA 2AQKA 1RHUA 1YVEI 3QBVA 3H5RA 4ZCQA 5F9FA 4X7MA 1H5QA 1YKFA 3CURA 3RYHA 5HUHA 2H4JA 2R6AA 3DJFA 3ELDA 4LJ7A 3VYTB 7GPBA 2HIMA 4IJQA 4YCCA 4KHPB 4NYMQ 1GP2A 2C1EA 3HKEB 2EX4A 4QJ4A 1XJ5A 1PR4A 1Y5RA 3N2EA 2FR1A 4BFXA 1TD9A 2L0XA 3R7AA 1QP8A 1DMSA 3ZY6A 5JXIA 1R6BX 4R41A 4M9SA 5EL0A 4ZMBA 1AQNA 1T0BA 3CF0A 3ANLA 3CX6A 1Q7TA 1ZU4A 3PUHA 4FMPA 1P1CA 4WNAB 3EBLA 2F17A 4ZPJA 2QLFA 1L6IA 1U2EA 4Q4LA 5FEUA 3IB3A 3ZHYA 4WKOA 5IJXA 1R64A 4H27A 1WXEA 1FUIA 2GZSA 3IB6A 4I9NA 2C0CA 3KQPA 1CNEA 1GZ3A 4DSUA 2AE1A 1IM5A 1CRQA 4PPQA 5LCXA 4LYGA 2I2FA 2Q9BA 5DP1A 1CW2B 2HHAA 3TOVA 3VNBA 4Z7JA 5TQ0A 3VI3B 5BQFA 3K09A 3A4YA 2VBIA 5F35A 3KV3O 1P31A 3QKSB 1RHMA 5JHHB 2B1QA 2BKAA 4I1UA 4GKAA 4JI8B 2EYQA 5JCJD 4LGYA 2EGUA 3OC0A 4WT7A 3BTOA 1LNSA 1TU3A 2OFWA 4UDXX 1NF9A 1A96A 1TF5A 4JLMA 1NRXA 3QE9Y 3PR1A 1JFTA 3K70B 4IIXA 1JEOA 3VISA 1JV2B 3FXAA 1PJBA 4Z7NB 2J46A 5DIZA 1CK4A 3AP2A 1E4EA 1B43A 3AR4A 2DFTA 3I0NA 4ZCIA 1HMYA 1Y1RA 1YA8A 1AKEA 4EUHA 4QGFA 1KOGA 2EGGA 3WJ2A 2A59A 2GN4A 3T9AA 4MP8A 3VC2A 3LC0A 1ZUHA 4KPUB 1LPSA 4G3XA 4RTMA 4IKOA 3SXJA 4LZLA 4UEKA 2CLKB 1I10A 1QM5A 1XL1A 2PMKA 3PHCA 4MK4A 3SC3A 4NJOA 4Z4EA 2R1VA 2P6OA 4RL4A 2QW0X 2QSZA 3M5PA 3OCZA 4MKXA 1QDLB 3C5WP 4OXYA 1Z88A 1U3VA 1I9CA 1NQ5A 2WJHA 4G0PA 2GF9A 3L46A 3HJCA 2B37A 4M0CA 4RMHA 4G67A 1N9ZA 4FB4A 4ZYUA 4Q01A 3STWA 2Z83A 3JYQA 4JP2A 2C96A 1HR0B 2HIGA 1DOAA 3W6UA 4LYHA 3H2HA 5HZMA 3C6XA 2X7XA 3HC7A 4NIMA 4R8SA 1KL7A 1OU0A 4A4DA 4A5OA 3EFBA 3JQGA 4JYBA 4YFYA 2L2QA 3SC2A 4LV5B 4MV3A 1P3DA 2QEQA 2M6LA 2GCPA 3IEXA 3BEDA 3UM9A 3BGDA 5FOQA 2ZVDA 3O21A 1YBAA 4G07A 1ECPA 1L1QA 1XXHA 2A92A 1TIKA 3EZGA 1GSIA 2ATXA 5KYUA 5A9TA 5FOXA 3E03A 1SXPA 1DCTA 1RYEA 2OENG 5L40A 3H5WA 2PIAA 4RZ3A 3KAQA 4S1VA 1IXSB 3PD0A 7REQA 2W58A 2JFVA 2ZYDA 4FFNA 2IGBA 4DCNA 3SVZA 5B7PA 3C6BA 2ROQA 1K4MA 2Q99A 2CYCA 2C2BA 4ZRMA 1PT6A 5IFKA 4I5IA 4FBGA 3N2KB 5FTJA 4P0TA 1E62A 2C94A 2WE8A 2R7NA 4HK4A 3KDAA 5DW3A 1LB1B 3SZUA 1J2EA 1ESMA 1L8OA 1UXOA 3K5IA 4YP6A 1XEFA 3JAWA 2X77A 4PLPA 5GQSA 2YVAA 4M8SA 1I80A 4CF3A 1TMOA 3A4VA 1SHTX 3ACDA 2P1ZA 2Y76A 1RDFA 2YMQA 4GZ3A 4CDMA 1DFIA 1RKQA 2Y9MB 3AU9A 2OGTA 4E2XA 5L8VA 4FD3A 4YROA 1KWKA 4OCZA 1MO2A 1GL7A 4KQ6A 3G0HA 1E0JA 4YDSA 4Y2JA 1P61B 1NVXQ 1GNLA 5IF3A 2Z8ZA 4UW9A 1KFEB 2ZBPA 4LJ5A 4WADA 1B2LA 2WU4A 4MROA 4AO8A 2X7JA 1MD9A 2P5SA 4FZ5A 4AY2A 2VH1A 3HDQA 1M2KA 1HK7A 4GU5A 2IZZA 4PPFA 4UAJA 3GFBA 3UYLA 5DYYA 3EEOA 2NV6A 2D1TA 3KX2A 1CQJA 5C7YA 1QH9A 1QP0A 3L05A 4GGOA 5ALEA 2FPRA 1KDOA 4CG3A 5LKAA 4J0HA 2QQEA 1WP4A 3HDGA 2FGJA 1DKNA 4TMXA 2WJIA 4KJZA 4E32A 4RSGA 3V7NA 3REQB 2ORIA 3X44A 1YAJA 2Q5QA 3N53A 5E3JA 3HI4A 3IT3A 4FJ2A 3O47A 2NADA 3NAGA 3PF8A 2AG5A 4PWYA 1D2HA 5E6RB 4DILA 2GD2A 2RHJA 3NTUA 2OFFA 5I7UA 1A9SA 5DBEX 3T7KA 3TW4A 3D2CA 1SKYE 2WD7B 4X64B 2WKWA 4E3ZA 5JAZA 1JAYA 2H48A 2ZPAA 3GN1A 3HBAA 1R00A 4MB2A 3PQ7A 3U48A 2AZTA 3T5DA 1NLUA 4K3UA 2JLWA 1A50B 2R6HA 2Y67A 2DGDA 1B6RA 4F60A 2F3PA 3I72A 2X4IA 4P22A 5BY2A 2I1LA 3LWNA 3PXEA 1S0UA 2HWWA 1XA4A 1IK6A 4CCAA 3FVQA 4MS4B 3CLVA 5TMEA 1U2GA 4GE3A 1LPPA 3KZNA 4AJIA 3BPSA 1RRCA 3NOVA 3T9CA 3TPFA 3TG8A 1RS0A 3T7CA 4HNQA 1PL7A 1J0AA 1H4TA 2ZUVA 2G6TA 4TN5A 5IARA 3HE3A 4G5QA 2VSQA 1RYMA 4X3OA 2OESA 3DL7A 1U8UA 2O8VA 1P62B 2OCKA 1Z07A 3T15A 1E0DA 2RG7A 2J7KA 4CHTA 3KQHA 4IJ6A 3DEFA 2Q1TA 1A9XA 2FCRA 4RDCA 4DCTA 4H9GA 5DTQA 4ACAA 3AILA 4R7TA 1BX0A 1HA3A 2XWPA 3FPAA 3T34A 4F4JA 1VKJA 3RJ5A 3OECA 4HNTA 3LXUX 2WTUA 2R86A 2UUBB 3T3HA 4LSWA 4W5WA 5LB2A 1K8YB 2MSKA 2NSYA 4Z3DA 4BE7B 2ANCA 3B48A 2XMZA 1VJRA 3DMRA 1KQGA 5DBFA 4BV2A 3JRNA 3OETA 3P9KA 5EOVA 4CIAA 4ZT2A 1H5NA 1ZEJA 5K3FB 3RU9A 2BKXA 2OKGA 5C18A 4ZAVA 3DTNA 3JD1A 2QL6A 2VK1A 1P9RA 1NQWA 5D3MA 5H82A 1WMAA 2GYYA 3N3AC 2CLLB 1S1MA 2B20A 3CZRA 5CT6A 5CXXA 5ECYA 1K66A 1KS9A 1L5VA 4GBMA 3SHWA 3MWGA 4FYYA 1J42A 1W36C 4ESHA 4CZ2A 4MKRA 3NDRA 4I5GA 1EFTA 4RVFA 4MGYR 4LF4B 1U99A 2R6DA 3P2IA 3VO1A 3WLTA 1BYIA 2H4HA 4N48A 2NPOA 3I8XA 1P0IA 3ODPA 4AMGA 2GLXA 3DOIA 3BGVA 3G0GA 4CM9D 3ERCA 3RASA 1UPAA 3MD0A 2H3EA 3EJ6A 1CETA 3D8SA 1PFUA 4ERNA 2GA8A 3WBBA 5HKKD 1UJ6A 3ZLTA 1U8ZA 4RTLA 2Z6QA 4EJSB 1G4UR 2CNKA 3HR4A 3FHJA 2QRLA 3WL6A 1OFIA 5T4EA 2PWAA 1QO9A 5BV2P 1V5IA 4AK9A 3ORSA 4URUR 1BDJA 1UT5A 3DLPX 1GGMA 4OFWA 2CLMB 3PTAA 3A4IA 1HLPA 5AI0A 5JS6A 1N4DA 3ONEA 3WKEA 4JYZA 1REQB 1ZVJA 5ARBA 1Z38A 3ZE1B 4RSHA 1QAMA 4ZYXA 3LC1O 5HF9A 3U40A 2DWOA 3A1FA 3D6FA 1I0LA 2B5VA 1NZFA 4PX5A 4UDOA 1FFDA 3IOBA 2FX5A 4F12A 1E32A 5I9NA 3KSAC 1K88A 5BPHA 2WFZA 2PRIA 2ZI6A 2V6JA 1R37A 3AM4A 1T2EA 3VJMA 2PBZA 3BD8A 4J2HA 3LFUA 4EHKA 4L8YA 1G3MA 4IXNA 1G38A 2R87A 2VLBA 2W2KA 3AF1A 3CR8A 1J8VA 3GK3A 4G8BA 3FDJA 4PNPA 5DOZA 5FPPA 1ZD2P 1L7BA 1Z26A 1JIKA 2DRIA 4E07A 5K6TA 1LH0A 1FW6A 3KS9A 5HS4A 1YDMA 4IQFA 3KJFA 2OYRA 1HQCA 2P2ZA 4D0SA 3M34A 2CJYA 1AO0A 4X62B 3L8GA 1LJ8A 2Q5EA 3ESYA 1GVHA 4ENQA 2ZJ2A 1Z8FA 3FYSA 5CM8B 1VGQA 3CE6A 1D8AA 4ZI3A 5HKKA 2YRWA 5JCPA 4BO0A 2WAAA 3KR0A 3R5TA 4YA6A 4R0MA 1DBQA 4YJHB 3U56A 4R98A 4ARUA 1ZVMA 2ETVA 4MYCA 1GCIA 4Q4JB 1J0EA 1DUVG 3A7DA 5JECA 1OLSB 4OI0A 3LGSA 2Z3ZA 4OP1A 1W2WB 2QVYX 1YTUA 1SUDA 3B3GA 1NSYA 1OYYA 4Y1GA 5FA6A 1Q6YA 4BKRA 4EY5A 3FAZA 4F6LA 4CM6A 3MK31 5TPWA 3IEPA 4L5BA 1KJZA 3UMCA 4J9UE 5CYOA 4Q9DA 3HKCB 4OY3A 2Q49A 3ONFA 3CW2A 5TARA 3QKSA 3JAMA 2B4TO 4KG7A 4NV1A 1XCLA 2IL1A 2YXLA 3OJWA 3P26A 1WCIA 3R4VA 4FMDF 4V0QA 1Y9JA 3LUBA 2IUFA 3LQQA 1CF4A 2FKNA 2R48A 5I7SA 4X6YA 4XASA 2OQRA 1C8VB 1JPNA 4JJ8A 4DJEC 2JJYA 3M4YA 3EARA 4G5XA 5A5VA 5K4HA 2YVKA 3PPWA 1BQEA 2PUFA 4AJHA 1V4VA 2EKBA 3AZPA 3IDZA 4QT0A 2PMCA 2O50A 4MW2A 4DNPA 1T10A 3FFBA 1HV8A 4H7PA 1YUMA 4L27A 1K8QA 1R0XA 4REMA 3MWYW 5BYAA 1LTHR 2CJFA 1DPGA 1KFKB 3Q9NA 4C29A 1CUSA 3FZGA 1LDNA 1N2CB 4JY7A 4M8NE 3TW8B 4KU4A 3U17A 4EBFA 4ZI7F 4OKSA 1E9CA 5C4IA 2C5HA 1ETHA 1E3IA 3R44A 2XAAA 3TL6A 3W6OA 1UMBB 2O1WA 4UQLA 2VF4X 1OPXA 5GAJA 3H16A 4DDUA 4IXWA 3G68A 2O48X 2XMQA 3G5MA 4MNTA 4UM9B 3NPMA 2NUBA 2G77B 3OPYB 1XCJA 2NUAA 1QIMA 2VT7A 1SA0B 3P20A 3QUTA 3NHYA 4K86A 5FQNA 1J06A 4KGZA 2A9RA 4TGLA 1EG2A 1II9A 3QOYA 4PZ0A 1ZIYA 2FMUA 1FFWA 2QUKA 4NC9A 3T99A 4D45A 3AETA 1TF7A 5KU7A 4RXUA 4WVFA 5LA6A 1K08A 3O94A 2D3WA 3MIIA 2FZCA 3ROPA 2ZR8A 1IN1A 1SXIA 5D6NA 4V1CA 3GJYA 4NDNE 1W85A 1JLRA 4C05A 1XD2B 1Z4IA 1ZRNA 3VO9A 3WRYC 1D2NA 1USWA 2FEKA 5CLFA 4L02A 3GL9A 5F98A 1SQ6A 2H06A 4F2DA 1M2VB 4LZNA 3VR0A 2J09A 3QGMA 3SQLA 2OCAA 3C4JA 1HTTA 1UFOA 3TI7A 4Q00A 3ASUA 1X42A 1YI8A 4H31A 3TLMA 3QPWA 5E1BA 2P68A 1DIHA 1OHHA 1YKSA 1E59A 2CKDA 1TZ2A 2D54A 2PSHA 3GW8A 3JQ9C 4WEQA 1KY4A 5WRFA 4BQSA 4DUZB 4KVGA 4IGIA 5A4KA 1AIPA 2P9QA 2C8JA 5EE0A 4F3RA 3CJQA 2DT5A 4HATA 4AKIA 2PFSA 3ZWPA 3GXBA 3UJ3X 2FSHA 1D1PA 1H6CA 1UDXA 1B4DA 3DL2A 3PRHA 4JB2A 4NECA 1ZSNA 4U3JB 3WGMA 4YAUA 4L0CA 4U63A 5CT8A 2G6BA 3IALA 2WHQA 5B1EA 4BZZA 2RIPA 4DV5B 3ZE0B 5ANRB 1DJMA 1DXOA 1R8XA 5KNDA 1QIIA 2L19A 1M2EA 3B1ZA 5C8YB 1RACA 2JFUA 3HZHA 4FONA 4ZWNA 2F9MA 4PHCA 5GV7A 1T29A 5FADA 2J6IA 3D4NA 1OXVA 4JQCA 2CT8A 2H0AA 3JQ7A 3OQHA 3BORA 1NBMA 3KUKA 3OZBA 3EXHC 4NAHA 4OAQA 1GT91 2Y71A 3E7XA 2YQ4A 4KXLA 4WKGA 3TD2A 1T0UA 1W581 5GJVC 3O1LA 1NAIA 5EPUA 2BRUA 3ZWVA 3ZH9B 5CCXA 1NG9A 1J1IA 3WYAA 3AHHA 2ZM5A 4OLFA 1FZTA 2ERCA 2A88A 2QTMA 3RRMA 3ZE7A 3SICE 2VJYA 2JJMA 3S2ZA 1PX0A 3TNYA 4ZHQB 3W5AA 5ERXA 1UF9A 1QF9A 4MQUA 5BNTA 3R7NA 5JG7A 1KZYC 1UKCA 1FXUA 1IXZA 2KI5A 1NC1A 2ZUFA 3R5SA 3RVLA 5ITZB 1Z4MA 1CS0B 1K97A 1U7PA 2AWOA 2IEIA 5AOCA 3VR5H 1VG8A 1CEYA 1QORA 1MNAA 3KU1A 3THOA 4DHEA 3AH8A 1BHJA 1QG2A 3AR5A 3COPA 3PXUA 1IY2A 2GZDA 3DTVA 4ALLA 2G76A 4AZSA 4QGBA 2RGWA 3ER8A 4KXQA 3V4PB 5ELXA 4KPGA 4ER0A 5JSUA 3MFQA 1VMDA 1L5QA 3ZDDA 3QX7A 5IT4A 1II8A 2LCIA 1IJKA 1E5QA 4CLHA 5KOHB 2RHRA 1YZNA 3OF3A 4KQIA 4RVSA 1IJBA 1ZCAA 3KLPX 1TF2A 3HZRA 4KGDA 1V7ZA 2JIDA 3BTVA 4NULA 4B32A 3ZE6A 1YRYE 1ZL0A 3N74A 4PGFA 4EX7A 3JAWB 4PFSA 4Q24A 3S2YA 2QZ9A 5HM8A 4KKVA 5A5EA 3QLJA 2GF2A 2G4VA 3CC8A 4G97A 3ST7A 3BIOA 1QKKA 2HMAA 2PJDA 3P27A 1OU4A 4D9CA 3RFCA 3W2IA 3V42A 2UKDA 1P5FA 4MGEA 5GP1A 5KVAA 3VAZA 2X0JA 5FUBA 1MC1A 2PV7A 3P9YA 1KO5A 3MCVA 4PLVA 1KOLA 1J8DA 2PWPA 3FPCA 3PFNA 4WDRA 2G63A 2NTNA 5ELLA 1EXNA 2BHLA 4MV7A 4TLEA 5MGBA 3BRQA 4N18A 4L07A 4F72A 3RVJA 2R8EA 2X41A 1G20B 3DPUA 3WMRA 1L4EA 3OIYA 16PKA 4TWAA 4IINA 2MSLA 5F7OA 2OFOA 4NZZA 5ILGA 1P1BA 4MQFB 4UHKA 3TZHA 4BPBA 1RJ9B 3DAFA 4J7AA 2H17A 3TW0A 4DUYB 4NV3A 1PSWA 1AGNA 1RWPA 4AF7A 3B7GA 1AS2A 4RHYA 1S8NA 4JR1A 3W5IA 3THXB 1JEQB 1EK0A 2OGZA 1Q3HA 2RBKA 1RXCA 5EKXA 2Y1EA 4B84A 4LAFA 1NJ2A 1TCUA 1V3VA 2UUPA 3C5HA 3LHDA 3OTIA 4LY0A 5LB4A 2BMFA 3C3XA 3OZFA 3AIKA 4RANA 2D1QA 2GFHA 4CGYA 1YMQA 4IRUB 3DBHB 2ATCA 1XVTA 4MSUA 5CT4A 4C06A 4CBVA 3HI6A 2P4QA 4O33A 4UEOA 4RTNA 3DFUA 3HCEA 3RK4A 3LQFA 3WXBA 1E7SA 3KRTA 3E0QA 1WLSA 2C82A 3FD8A 1L2TA 1DO8A 2J59A 1XTBA 4FHCA 1WD7A 4G09A 3VUEA 4DSTA 4E6EA 5JTTA 1TO6A 3E58A 3MINB 3M6WA 3IAM1 1AY0A 1PK9A 3LK7A 3FWPA 1KEPA 1ORHA 1KNQA 1PV1A 1TYBE 3MF4A 3OMWA 3HDVA 1DFHA 1XZGA 1JDVA 4R2KA 3C24A 1OLXA 2QMQA 4TT3D 2R7MA 1MA3A 1XRRA 2Q2VA 1ZWLA 4QUIA 4C3OB 4E1VA 1HC7A 1UK9A 1X77A 2CMHA 1EDDA 1UDCA 2Q07A 2QW1A 2ZT8A 3G59A 4O2AF 4P6VF 1VJGA 1ZL2A 4NZPA 4QOSA 2P6RA 1UFQA 1B8UA 2A3NA 2ZT5A 4I8XA 4OXNA 4RPKA 3S44A 3VVCA 2AJ8A 2JL1A 5DEIA 5TJHA 2Y1DA 1HYBA 3FUWA 3EZ7A 5CXSA 1UWLA 4Q4HB 5B55A 1G16A 5TEVA 3WL5A 3EC7A 1DZ3A 1IVSA 4Q9KA 1GTG1 3L7BA 5IC5A 2BW0A 1SBTA 2ZQ5A 3VHRA 3V1KA 1JE1A 1QGUA 2QX6A 3CLRC 3N2GA 2NACA 4WZBB 2LD4A 2H5IA 3B6EA 1AQJA 2Q4EA 1OV4A 4FYWA 4UPVA 4D43A 2X8WA 4D26A 3SJAA 1EVLA 4Z0PA 4RGQA 2PSDA 3LGAA 1UKEA 2QTCA 3WOHA 1OF1A 1UDWA 3E35A 5ARDA 5EGSA 4JP1A 4YDHB 5FOSA 4C20A 4EKIA 4RTSA 2XEXA 4OGGA 4Y9SA 5C8YA 3TZCA 4JI6B 4CIBA 2YMMA 1EGVB 3AHIA 4Y6QA 4EAAA 3NFYA 5JSZB 2ZANA 3I6ZA 5LDHA 3F5FA 2A9FA 1QHNA 4W8GA 5EPOA 3UB2A 3CU5A 1IU9A 5HS6A 4HDNB 3G0IA 3UC9A 4BZWA 1VE1A 5KUTA 6ADHA 3MMNA 3OKAA 2AZXA 1FMJA 4Y6PA 1Z5OA 3WWCA 4X1YB 1NXTA 2ZT6A 1FVHA 3ECAA 3QEBZ 4PXSA 3ANSA 5HIKA 4COOA 2K2WA 4AY6A 2VDWA 4D96A 2Q3LA 5CLLA 4MQEB 1LY1A 1FMCA 2VHJA 1QR2A 3NTLA 2PE5A 1HNXB 4O59O 4WY5A 4YRQA 3IQXA 4D25A 2VP0A 2X76A 3C6QA 3TQIA 2MHCA 3DM9B 2VT3A 1LFDB 1K6EA 3EXEB 3F7TA 4MR7B 4OJTA 4MUAA 1RVDA 4YJGB 4WOBA 5DCYA 3ZHBA 1BROA 5HIAA 3SIXA 3ZDAA 2V5UA 1AQYA 1ODFA 1UIRA 5DW0A 4FMDB 2WFLA 4II7A 1JFLA 5D00A 2O6LA 2HU7A 2DH6A 2ZSFA 4EUSA 2B7LA 2WDZA 5A9SB 3QF7A 1O03A 2Q3BA 3MQFA 2LBPA 1OIXA 3PBKA 1SXGA 5IVHA 4JBNA 1FDRA 2EL7A 3P8ZA 4B75A 3UHAA 2QTLA 2WWIA 1CUDA 4BEVA 3T1VA 1QZ3A 8MHTA 4II3A 3OU6A 1Z2PX 1YULA 1X92A 3EEFA 3ILHA 1BA3A 4R69A 3PFBA 3BMOA 4WACA 2CUKA 4L5IA 2J0VA 4M49A 5EE3A 2EEPA 3GLGA 1NYTA 1NBWB 1RRGA 1WV0A 2H51A 2VPYA 3T4PA 3W4KA 5FWYA 4R2MA 1QNLA 1YRLA 1O0CA 2XNJA 5FOTA 1V16A 3L8EA 1ZUWA 1YGPA 2C2HA 2UYGA 2WVGA 5JAHA 1BSVA 3MMPA 4H7HA 2OXRA 2HO5A 2W7TA 3I39X 5KTKA 3CYFA 3NP7A 4J03A 1KI2A 4G4SP 3R8XA 3G3EA 4PLHA 1KETA 1B14A 3DMDA 3RU3A 4EB0A 1QRSA 1OYVA 3EVEA 1QGAA 3KFLA 1QRAA 5JQWA 5JRZA 3FMOB 1WBBA 2HXGA 3DLTA 2EBUA 4KAFA 3NG1A 2L18A 4MVXA 2JAWA 1Y1LA 3JQ7B 3CUKA 4TTVA 2JLZA 2FA9A 1OVMA 2XTZA 3F6YA 4RPGA 2LGJA 3HB9A 5TF0A 2ZGVA 1DAMA 1JHDA 3ROZA 3HXQA 4I0WB 5DNVA 4DY6A 5HM6A 4RPCA 3S2EA 5BMOA 3FX2A 4X97A 2DUWA 2WB2A 4B87A 3U31A 1Q92A 2HQBA 3G1WA 4OK5A 3PVCA 5DK4A 4RPJA 1YOBA 3OFNA 4S1WA 5JBQA 2QP9X 2GDZA 5IDVA 1YQEA 3BKWA 4IOLA 4PGMA 4NH0A 3TKLA 4KN6A 1V45E 1BH6A 1M2GA 2JAUA 3AEYA 3T5MA 1JPVA 2XE6A 5BN5A 5ITZA 1Y1SA 3K9QO 5JD3A 1XMQB 3Q15C 2VNSA 4GD3Q 3G49A 4LGCA 1XVIA 2E5WA 2Q6TA 3GGDA 2FRXA 1JE0A 1SOUA 4KQ1A 2QRVB 2BHNA 3FCEA 3IUEA 4OQMA 4MW1A 3UJ6A 5C5DA 2BM8A 4KMSA 5HRCA 1WPQA 1RNLA 5C1OA 2WP0A 1DPFA 3LKVA 2BM0A 4CEJB 3A9RA 3QFRA 3KLBA 3DZDA 1JHYA 4MZXA 4HTFA 4XLLA 5BVGA 1LDYA 1PWYE 2OZKA 2H1WA 3OPYA 3DMYA 2DYKA 3AIIA 3Q5DA 3BDIA 3TTVA 4YXWA 1EFDN 1V8BA 2IHVA 2AEJA 5KOJA 1P9NA 2EHDA 2VF5X 2I8LA 2GD0A 3H0CA 3AW9A 4HN2A 2MR5A 1P1HA 1QVAA 3E9EA 4RENA 1FDSA 2BI8A 4RMIA 3M9XA 3QEAZ 3T1YB 2X86A 1E20A 2YWHA 1H0KA 4TKUA 3HDJA 1FA9A 2FCAA 2O2ZA 4AKGA 2UV8A 4EVRA 4LQ4A 2F64A 1XF9A 3N2IA 1ANKA 3VPCA 4F6RA 3NVMB 4BMXA 3FFAA 5I5GA 3T1QA 3ZTYA 3HN7A 2CXXA 3KR2A 1Z2EA 1ACMA 4DJFC 5TGZA 4C7OB 4PAQA 2NVUA 4M8KA 3KJIA 4OI1A 1IQPA 3M4NA 1XP5A 2DH5A 4K46A 3B6ZA 1QVRA 2XNHA 3I6MA 3R6WA 4WE3A 4Q1EA 3K31A 5JZ9A 3L6DA 3GLIB 3OU2A 3UJ7A 1U90A 1SKBA 3ZPXA 2R97A 1DVRA 1GKKA 1N5MA 4N0EA 4NBRA 1SC1A 3P52A 1UKYA 2BZSA 5L95A 4QUDA 4FGWA 3LZCA 4DKXA 3WIVA 4G41A 4GBGA 2Y9PB 3DE4X 5IASA 2GARA 2BL4A 5JDCC 5AWFC 3UCEA 5HVNA 2OCPA 4CHGA 1GRRA 2EDCA 1E0KA 4WEOA 1E6LA 2TSYB 2HJGA 3NBUA 4RXMA 4J9VA 3W1WA 4BN4A 3JQFC 3R4CA 3LA8A 2HLNA 4IZ6A 4MH0R 4V24A 3SFZA 4AMBA 2WWHA 1DELA 1S3SA 4HDOB 4P0QB 3Q7IA 3RWMB 1CVLA 1TL7C 1PYGA 2PGAA 4KDEA 2OHJA 4P98A 1G8YA 4R6XA 1NMQA 2MJLA 2I7DA 3KVYA 1W1WA 4FR2A 3V3KA 4PHTA 4OEHA 1PJ2A 2H1FA 5AM5A 2OCIA 3LPNA 1J90A 1HNNA 4KXMA 2IYNA 2F1OA 2XA9A 1WMBA 1OAOA 1X7HA 3NUZA 2IHKA 1U7ZA 2OVBA 1N6OA 1J0BA 1HF3A 2QD3A 2ANBA 1BEZA 4O4JA 1BGVA 2BEWB 1W5AA 4I4TB 4WA8A 3KE8A 4ZGWA 4N76A 3AB3A 5LC1A 5IC6A 1KYTA 2GK3A 2WQZA 1U04A 3HYNA 5BNWA 4KTTE 4OB6A 4ZDJA 4CQNA 1EHIA 3CLKA 4KIWA 1KH1A 4AP9A 1UFKA 1WRBA 1E5TA 1V0JA 4EEKA 1K92A 3IKLA 3VZBA 4EB6A 2I54A 5C34B 3UGKA 4GW3A 1OLOA 1V1RA 3AB7A 3KOYA 4M2LA 1FCJA 3MTIA 4P08A 4Y2VA 2PU7A 5L3RA 1QE0A 3G2NA 3IVGA 1QQAA 3PC3A 3UOGA 4YTEA 1RM4A 3A32A 3LVQE 3W5HA 3NP9A 1MR3F 3OSZA 4MWTA 3DTVB 1GARA 3I6QA 4UU8A 3TTTA 4JROA 1XNGA 3DKIA 1Q1NA 3FYUA 5GGYA 1I7SB 1KYVA 1VRWA 2JIZD 3AVTA 4ZQFA 1G8MA 4HQLA 4XLTA 1VDMA 2I7CA 2QLTA 4C4ZA 1W46A 3GR6A 5E95A 2P35A 4R8LA 2RGEA 3P9NA 4WZAA 4XDGA 4AZWA 1I5OA 1QYWA 1ENOA 2H8KA 1D9ZA 3C3JA 3I6YA 4MZDA 1TZCA 2LVBA 1U11A 3ZR4B 5C46F 3HRIA 4PICA 5K8VA 1VKRA 2FDRA 4F11A 4O3MA 1QU3A 4XCXA 3HHPA 3AUXA 4YPVA 5B57C 3OTHA 1RSZA 3IT2A 4GPZA 4IHJF 4G9BA 3GUUA 2OO5C 2GH1A 2ADFA 1E9VA 3RYCA 2IS1A 5CDGA 1X7WA 3L4BA 2AT1A 4DIOA 1VGRA 2B4AA 4EDHA 4WCDA 5JH7A 5ADWA 3AHFA 1QMGA 4I6EA 3NT5A 3ZDRA 2F8SA 3QU4A 4IMRA 2H4ZA 4J3NA 5IJ0B 3K0KA 4HDNA 2IWHA 1ZD8A 3E3OA 4OMDA 4L7VA 4IGAA 1Z8HA 3D8NA 4A10A 5JEEA 1XTVA 1YU9A 1CJCA 2OWDA 2ZOSA 5CX4A 1RD4A 3JQAB 1FSZA 3F4KA 1HZJA 1OVGA 2AG8A 3EDCA 5C1DA 4RPHA 1EXDA 3E15A 1J5XA 4MARA 3DNMA 1TJ4A 1KQNA 3RJ9A 4DQKA 4ARZA 5KJ6A 3I5YA 2I3AA 5AM4A 4CMCA 2B1RA 2HM7A 1SVMA 1Q7RA 3QWFA 4EB8A 2WIKA 4CNBA 2TECE 2W6NA 4M22A 4RO0A 1OI7A 4FYMA 4HCJA 4XQ0A 3L9XA 2Y6VA 4KZKA 2K4MA 4KXYA 4MVJA 1L7NA 5EZYB 3U4GA 3VYRB 1X80B 3D81A 4ETMA 1A9YA 2IFTA 3QLVC 1YACA 4JEUA 5F51A 3S28A 4DS3A 1TC2A 4C0LA 1I6MA 1O9GA 4QKQA 5HOQA 2VKTA 2ZIUB 2QTAA 5HDBB 4U39A 4DMKA 1ZC4A 3EODA 4OJYA 3ORHA 3FDZA 1N2BA 1Z6QA 5GM2A 2FWIA 3OO1A 1E9DA 2QAGB 4KQMA 4X92A 1G6OA 4R1PA 3P94A 5EVCA 3RC7A 4B8ZA 5GZ6A 3VYVA 3BE4A 2D5CA 3C97A 3AXTA 3HACA 1LI4A 2X6QA 4WAUA 3N2LA 4WMLA 2BISA 2O2IA 3TSAA 1ODSA 1M8KA 4TZ6A 4OGKA 1Y3BE 3NNNA 3IMFA 5KREA 3UT5B 2ZBUA 3SDBA 2DMRA 3VSCA 5CB4A 4ROTA 1QHHA 3ZJ5A 5ETJA 4D4JA 2YUIA 2R66A 3TXXA 2BM9A 2XDWA 3IUQA 1J99A 2ODNA 3HBLA 4H59A 2MYTA 2XCUA 4RVCA 2BVNA 3F5DA 2PMBA 3N2KA 5FEMA 1MEEA 5HFJA 3DHNA 3IXQA 4GL4A 4Q9IA 3SBOA 3DLBA 3ZTTA 1U2PA 3O95A 2B98A 4O5OA 4KMMA 1H3FA 2HF2A 3F98A 3MIZA 3NETA 4K9PA 4PINA 1C7EA 4M55A 2GEVA 1OFUX 1SK8A 2VQSA 3E9RA 5ALWA 1EFAA 3WFJA 3CS3A 1JR3D 1QIHA 3UUFA 4WXRA 4WN3A 1U0LA 1RBMA 4LUCA 3GWGA 4XWTA 2HO4A 2E18A 2W71A 4FT4A 1RRVA 3M6UA 1D4AA 1HTBA 1SCIA 4PLCA 2QT0A 4WBXC 3GJSA 5DGIA 4B3CA 4EQZA 4Y98A 3K4HA 2N9UA 1V9CA 3A0RB 1I6KA 1XJQA 1YR1A 3OZEA 3H5NA 4FSDA 3ZHRA 3K0CC 4BQPA 1MOSA 1N5OX 1P1JA 1P7PA 1QG4A 1IM2A 3V2IA 5DM1A 3UJBA 3ROKA 4AG6A 3AY3A 4C6SA 1KJ8A 3KXDA 4R83A 5CBPA 1Q0QA 1TT5B 2R5WA 1RKUA 2HHLA 2CF6A 4JCCA 4P93A 5DGDA 3ZG6A 2AOWA 5SYAA 3HU2A 2QTVB 3HB0A 1OTXA 1JHOA 4YI5A 4Z8YA 1MUUA 1W75A 1UH5A 1M6VA 3V8RA 1U8FO 1CP2A 1QGED 2Q9AA 1ADFA 1R12A 1RE1A 1U8TA 2IIPA 4EX6A 1OWOA 2HJ9A 3LH5A 3DW3X 4N5MA 3ZWAA 2I1QA 2PWZA 3HR8A 3LHSA 3UHJA 3KJHA 3K8OE 4DUPA 2IU0A 1NKTA 1FDIA 2WD9A 3IMEA 3GLHA 3L8DA 4FK8A 4U7TB 5BRNA 3DEHA 5CDFA 3WJ7A 1P74A 4OQYA 2FPIB 5JNUA 1AMNA 1ILEA 2OBBA 3KB8A 4R2IA 1W0KA 4K2HA 3HMKA 1I33A 3ZD7A 3M4ZA 4H15A 4M76B 2CDNA 4FXPA 4R3UC 5JQGA 2NU8A 1T2UA 3R8CA 5JNRA 2ECKA 4L9WA 4LWOA 4B4DA 5ENDA 5DV9A 2B83A 4JJ4A 3FSGD 4B3BA 3KLOA 5EFOA 2VJLA 1SD1A 3ZUGA 3D0QA 2ZRJA 3EGOA 4HADA 1OREA 5F2NA 3SJZA 5J4YA 2W0MA 1G1MA 4ECEA 3OM0A 1USGA 4BMDA 4K6CA 1T5OA 1Q0UA 2PRSA 3MTDA 3H6KA 1W49A 3EH2A 2TS1A 4YGXB 1NM5A 1R5OA 4X60A 5GM1A 3WLOA 4UNRA 4E1BA 5EIFA 1DDGA 1UXKA 2HCBA 2FV8A 1EXVA 4C9BA 1A72A 1ABBA 3NKLA 3QYAA 3HYSA 2D5AA 1HE2A 3M1IA 4KFRA 1QOZA 1XV5A 3ZHQA 5JVDF 3C3DA 4BLTA 3O4JA 2XE7A 5DB4A 1T9HA 3ND5A 3WLQA 1ENYA 4MS3B 4QJ5A 2Q3EA 5FI0B 3GEEA 3SR4A 1J5EB 1JHXA 4KWCA 4BNGA 2OV1A 4J1NA 3H1BA 3IXMA 1Y1QA 3H13A 1U81A 3V4OA 4B35A 4FOLA 1L5SA 2C9DA 3GP5A 4HMPA 4QPNA 3WX0A 4YLYA 4NABA 2X5JO 3CW9A 3CZ4A 3OESA 3R3ZA 2ZSHA 3QVKA 1Y9ZA 1MIOA 3EZXA 2UDPA 3FM9A 1CS4C 4MPTA 4NZYA 5LYJA 4GR9A 3RVBA 1JJAA 5J4VA 4TL8A 5KB3A 1SQGA 1YMUA 3THYB 4GFDA 2FF5A 4UAGA 4D74A 2ZBEA 3ZCSA 1HI9A 1GA6A 3A4TA 3P19A 4IIBA 1CZNA 1AF7A 2XD9A 2Z2ZA 4GXTA 4LJSA 2O7RA 5EIXA 1LSSA 5TPZA 1F51E 4J8PA 1G3UA 5KQMA 4JYMA 1N2SA 3N1UA 3O91A 4OA8A 4LZAA 3THRA 3I2IA 2QRPA 4XAQA 4ARAA 1T43A 3RRXA 1L4MA 2C5SA 4ME6A 4LJRA 2OCXA 3G2MA 4RFVA 3PNOA 5D85A 4OP2A 4XB2A 4XDZA 3UUWA 2QRVA 2XVXA 3QXXA 3V48A 4CU2A 2GILA 4M9ZA 5FPHA 5YASA 4ALMA 1GLVA 4M9CA 1VPDA 2Z6VA 2R7LA 3CV3A 4QXRA 4BNHA 1G66A 2H0QA 1RBQA 4Z1MA 4DMCA 1AUVA 2QW8A 1QH8B 3L06A 3ZD6A 1XPRA 3BWEA 4IEFB 4TVKA 2VZ9A 4OQQA 2PUGA 2X7HA 4DG9A 3P9RA 1SPXA 2FK8A 4ZT6A 5AW6A 1FYFA 3QWBA 1LRKA 4B5KA 4IS3A 4XVUA 1MVLA 4M54A 3GAFA 5ALIA 3GZ4A 1P9OA 5DEOA 1DFGA 4BGDA 1X7YB 1KO8A 4JX8A 2HR1A 5ALZA 1E2LA 4XPIA 4QM6A 5KVQA 4TKUB 2Q5IA 1UPCA 4OHZA 3S2GA 3WE7A 4EO4A 1PYDA 2GD1O 4ETIA 1M34A 3WNVA 3Q3GE 1OWLA 4KKXB 4WFJA 1I3NA 2W2KB 2WSSD 3OOHA 4GLJA 1KI6A 1OBHA 3QWHA 1RQ2A 4H3HB 3CVWA 5LMNB 2IOHA 1QIDA 2P3QA 1NL3A 1WS6A 3HKCA 2F3UA 2R751 1I3KA 4JVOA 4EGCB 5JWRA 2CCGA 3PPYA 1KORA 2XCSB 1J0CA 1HEUA 2J30A 3R76A 1WY5A 2D2IA 2GBLC 4JIMA 4JI2B 1JKFA 3U19A 2GFIA 5KNDH 4Q4JA 3WRVA 3UG7A 4XB1A 4I1IA 3CWCA 3SF8A 5EWLA 1YIOA 2OEPA 1K8ZB 2PT9A 3D5EA 3QVWA 1SQSA 5BSUA 3DLHA 4QUAA 1L5LA 3DDNA 3EY4A 4BAGA 1C7JA 4TWRA 1ORVA 2P9EA 2QOEA 3TEJA 2FRDC 2H2IA 2PKQO 2HQSA 5DSXA 2YJ4A 3TQQA 4H18A 1KKLA 4F8EA 1ZAKA 1NPDA 1PUIA 4ETNA 1J0XO 4RC9A 3F8WA 4B74A 4ER6A 2AFIB 2ILTA 1PS8A 4I1YA 5E9AA 1WB5A 3QV2A 1K7XB 4WLVA 3HJGA 4E3WA 2CNBA 3KXIA 1Q21A 5JJLA 4D4KA 2REXB 3MT8A 5HSGA 3S8MA 2NUAB 1GLGA 1G9TA 1F2VA 1UPBA 2R6CA 4MS1A 5L7WA 1QOPB 4ZJZA 1JMKC 4QTZA 5ADUS 5I6DA 3I1FA 1NM5C 3ER9A 1FS4A 3NATA 1P0CA 1MNQA 3CNQS 4J4BA 4U2FA 1IBKB 1BCSA 1FNBA 3UYKA 1DWPA 3EMVA 4ES6A 2QX9A 4P38A 2BYTA 1SG0A 4OUDA 4L3WA 1M74A 2QMEA 4WFKA 4CUZA 1A95A 4JIGA 3ZGOA 1IHOA 3LUDA 3NHRA 3R6DA 4WESA 3A9UA 3I09A 2X8BA 4OX9B 1Y1TA 2H2DA 4K9KA 1NVMB 4FGLA 4D3SA 4ZGBA 2L82A 4Q16A 1NW8A 2Z30A 4GR5A 5KS2A 4C0QC 4QJBA 2PIDA 4E22A 3JW8A 1ULHA 2O1EA 3IP6A 1P29A 1E0SA 1W48A 4LJYA 4LE0A 4PFJA 2W83A 3OKCA 4CL8A 4KDRA 1KDVA 1D2MA 2HQ1A 3EGDB 1LPBB 2DUJA 2YXDA 4HLQB 2P4EA 4I5DA 2Y2VA 2Y4OA 3HA3A 4DABA 1GN8A 1ZD4A 3WGIA 3KOZA 1K63A 2GERA 2NXJA 2VRWA 2ZTUA 3L5OA 1EZ1A 1TJPB 1LBQA 2X5KO 3FPJA 5CA1A 3K0BA 4QTTB 3WLEA 2OZLB 4HLUA 4HNAB 3W9UA 2A94A 3TSCA 2R8ZA 2HK9A 3RH0A 2JFQA 3EGEA 2ADOA 2VK8A 3LYHA 4A8JC 5ICMA 1OLSA 4FFWA 4O2RA 1IEVA 3BJIC 1YZHA 2IV2X 5L9AA 1DAKA 1T9ZA 2BMEA 3FNFA 3H6HA 4F1WA 1XZDA 5G41A 4DG8A 1Q1GA 4P3KA 2B1JA 5B7NA 4U2KA 1L4FA 1NNSA 3VX4A 2JFWA 3OEEA 1DTEA 1ZPDA 3ADCA 2A14A 3F6SA 5JANA 3OF5A 3ECCA 2JCBA 4KX5A 3EGXA 4KO3S 1DC3A 5IP5A 5E9JA 1W5TA 3C48A 3OPVA 4BUZA 4DDVA 5EYPB 4ND6A 3PF9A 4J94A 4MUBA 4BWGA 3PP8A 4N5LA 2W6JD 2NG1A 2X9NA 2I5PO 2Q29A 4UVIA 3CG0A 3QKUA 4X93A 4E5SA 3LJKA 1RZUA 1Z18A 4UM7A 1CYEA 1HDOA 3REGA 1WMSA 5KKCA 4BMYA 4A1OA 1RXYA 2IYZA 2RKBA 3CUSA 1E6MA 4TTTS 5THQA 2OAGA 5BWBA 1MOZA 4GPAA 3G8AA 5L3QB 1HYEA 3G8YA 3K2EA 3VYSB 4JP8A 3ZWMA 2IF0A 2I3GA 1E1YA 1ML3A 4W5JA 5LQMA 1C5KA 1H2RS 3I4LA 1QZUA 3SFTA 1KP2A 1UBFA 1KMNA 1OLUA 2IYFA 4B79A 1AC5A 1HL7A 4ZVSA 5MN4A 1UC5B 2ZUUA 4UCFA 4NBVA 3OZ7A 1WG8A 2R2GA 1PDOA 2ZAOA 1FX0A 4OQLA 3LA6A 3FY4A 4IVNA 2DQYA 2FUNB 1ILWA 1JQBA 1KQPA 2M2IA 2V6IA 3BEOA 1PL6A 2PEZA 3GNQA 4LK2A 1KSGA 3A31A 1OI3A 1UBNA 2O1XA 3LWZA 4OL0A 5KDLA 3TKAA 3F47A 1GCOA 4XRRA 3E82A 4ZYVA 1D1SA 1C8KA 4PW0A 2EZ4A 5FFNA 5FTLA 2Y66A 2YOHA 5J5CA 4JSRA 5CVJA 3S1LA 4BLPA 4NY1A 3K1AB 2BH9A 2CMFA 5ARCA 4D3DA 1JUDA 1E2FA 3PQFA 3LKDA 3DV0B 1NUSA 3DP9A 3EZNA 4KO8A 2V7WA 2ISCA 3GROA 2ASVA 3NDIA 1EFCA 1RXUA 2WVJA 3SCZA 3A3NA 2GKSA 4YONB 1XEXA 3W7AA 1P7ZA 2F62A 4AUKA 4RFLA 4MGHA 3T3GA 2J6HA 5HE8A 4PYIA 4O1IA 3CIFA 4CF5A 4G5GA 4GM4A 4JJKA 3PEFA 5J2UA 4RTOA 3PNSA 3E9DA 3PWTA 2WM2A 2YWXA 2JFOA 4NZ9A 1KI7A 1YCHA 1SHUX 2EIXA 4DSAA 5TGTA 1SZJG 1C3VA 1G8HA 3H11B 3LDAA 5E6SB 3ASZA 2G8NA 4KHZA 1V48A 1YJAA 2I2WA 1M75A 3IHWA 5FLXA 2VF7A 2CD9A 3W1VA 3IBTA 4IIDA 3A9WA 3QTTA 4AY5A 3D43A 1F6BA 4GMHA 2IV3A 3ANXA 2YZ7A 1NULA 5AYVA 1PT8A 2VYVD 5KO2A 4IDHA 4DXAA 2FR0A 1JQEA 4D0RA 1S6YA 2ZU6A 5EJFA 2V6MA 3H5LA 2R6FA 4Z4QA 1S2DA 2Y0BA 3LNCA 3G8BA 5KNCH 2BHTA 4FLMA 2CVOA 4TS9A 2NZWA 5AFSA 4JQZA 4TVOA 2B7CA 2ZSDA 1N34B 2O2XA 4S1TA 2ZYHA 3PTZA 721PA 3REFA 2DKNA 2ZYAA 4ZIRB 1JHAA 4DPKA 5KC8A 5T3YA 2IPMA 2C04A 2MR6A 3QLEA 3ZHTA 1QH1A 1GU1A 1XDSA 4OHWA 1RWKA 3PVZA 4YMTA 4BGVA 1JXAA 4CFZA 4CLRA 2CUTA 1IN8A 5DTEA 5IPFA 2CVQA 3FFXA 4Q4CA 4NPAA 3S2IA 1TTQB 1VIVA 2EBFX 2ZBRA 4JJGA 1DAHA 1XG5A 4ZU3A 3V5NA 2ZQZA 4AU1A 3GJQA 3U9SA 3ROMA 5EJMA 1CVIA 3DYIA 1B2RA 1MGOA 2OOSA 1P60A 3RCBA 3GCXA 2FPGA 3O0DA 5DRTA 4FINA 3CXUA 4MRSA 3ZI7A 3HP7A 1JBKA 1PI3A 2PUWA 4JBGA 4RK0A 4RKEA 1YR3A 1ZOSA 1V37A 3N8HA 5FQOA 2D5BA 4D41A 3P2EA 1O2DA 4OHUA 1VJTA 2QI9F 4PX3A 1RCTE 2R85A 1UDBA 2AXNA 4MV4A 2ATEA 4BFYA 3CPHA 5D5HA 1SUFA 1PEYA 4BE4A 2B2NA 5CURA 4IW3B 2O8NA 1AX9A 4YK7A 1UINA 3L0DA 3PL1A 5FWAA 2I78A 4TTRA 2GGSA 3JZIA 4QUJA 3QVMA 1L5WA 2O2DA 5DHSA 1BG6A 3M82A 1FJHA 2FW6A 4KR2A 2B9EA 2BBTA 1N2JA 2YN2A 4PTYA 3SQOA 5IAOA 4LFBB 4ZQEA 3RFUA 1N9GB 1ACJA 1T9GS 1NNEA 4YCDA 1QKJA 3HKBA 4EMSA 4PGGA 4DMGA 2AXEA 4LJ8A 1ZG3A 1OH6A 2BFFB 1T5HX 1RHRA 1VYUA 4A0FA 3D54D 1GA4A 4RKFA 3F3YA 3LLSA 4XXHA 3UUGA 3A3PA 3LUGA 2A1TR 1M6NA 1T6BY 2PJZA 3ET5A 4GX5A 2B2XA 3CRRA 3CSSA 4HEHA 4KE9A 4UVHA 1OXBB 1I3CA 4NBWA 1T0PA 1L4GA 1SD2A 5KNCD 1UJMA 1THMA 3C41J 3GLVA 3HEBA 3NEYA 3EAFA 2IOFA 2EG5A 1P9WA 2IBMA 2N42A 1K4YA 3K9BA 4PHGA 4KN9S 3H5IA 1TAGA 4OP3A 2B4RO 5BNZA 3L77A 3ZGNA 1T24A 1LXCA 1Z0JA 1ENZA 3CZMA 2PMWB 1FMLA 3K9LA 2J3HA 1I7NA 4UOZA 3VZRA 3LHFA 4U1RA 2GMWA 3WS7A 4EM6A 3A3YA 1LCIA 2E6UX 2CV2A 4MCAA 3RK0A 4LPSA 3DLIA 1KEUA 2ORVA 2XTAA 4AZTA 3I3OA 2QPTA 4HWOA 3DD1A 3V1YA 3GVCA 2WYWA 4LCBA 5LPNA 3H9EO 5AKEA 5EIWA 2ON6A 4BDTA 3O3CA 4ZU1X 4BNKA 2EOAA 1R0KA 2FUG1 5E3HA 4ZYWA 1HLGA 2DWPA 3LY5A 4D9HA 3SSAA 2BEKA 1NDQA 1J9EA 5AXDA 2QRKA 2IGTA 2WJJA 4AKEA 2V3CC 1HFWA 4M7RA 3X1XA 3GLIE 3GUHA 2MINA 2Q1UA 3CLSD 1NXWA 2AN4A 1NUAA 2QMHA 4NHEA 1SRQA 4I36A 2QZ4A 1L1EA 3FNRA 1XMIA 1ORWA 2BAGA 4Q15A 4DEYA 3HZOA 1M3SA 2AI3A 4OU5A 2GN8A 1QYIA 1H23A 5IXJA 3PT9A 5EFZA 1PGOA 1K0UA 1P7VA 2ZU0C 1DAFA 3SBXA 3D02A 2QN7A 4YAIA 2BFEB 2G80A 2VHZA 3ABZA 4BQIA 3AB8A 4JITA 1ONSA 1NQOA 2H92A 4MINA 3CKYA 3F67A 4MAFA 4QBTA 2Z1MA 3KSBC 4TSFD 4RNCA 1ABEA 4LNUA 4AF8A 6Q21A 1QOQB 1NW9B 1XF1A 3ZCXA 2Q5CA 1AUOA 2JGEA 3GRYA 4ZVLA 3V9PA 4DFDA 1HBJA 3LUPA 4BXOB 4HNSA 3EJWA 2J6BA 3FMFA 3VC1A 2BGNA 4F45A 5LYJF 2J87A 4BNXA 4KDFA 3LCRA 3R8FA 3DGEC 5FNVA 3UMVA 3GIWA 1IONA 5DIFA 3Q2KA 5FFFA 3UA3A 1WB9A 4N3BA 5CW1A 3FTEA 3ZJTA 1WDMA 1SKYB 2K6GA 4DB2A 3GU3A 4YJ3A 2J85A 2JLBA 2WU1A 3VBEA 4KNYA 1VPWA 3EZFA 2QR5A 3E7PA 2J41A 1P0PA 4RWEA 1BVUA 3SM3A 4OM7A 4KK4A 1PZEA 1C1DA 2NZVG 2VQ3A 4J0IA 5BSTA 3RTGA 3GQVA 1E2IA 3NIBA 1FJXA 5BT9A 1SY7A 2H08A 1JFVA 3TRHA 2QHXA 2HMUA 3VAYA 3PNPA 3ACBA 2BE7A 1UR5A 4E11A 3FNQA 1MAHA 1GM5A 1K8XB 1XA3A 4EPVA 5KNDD 4DA6A 1MOQA 1ZH6A 3HJRA 3TIVA 2AKYA 2JH9A 5DO9A 3F7MA 1UPUA 2CDCA 3KOWA 4XFJA 1MP0A 3EGXB 3KT3A 3N0WA 3G0DA 4RCYA 1IRXA 2AFIA 5BR4A 1WZIA 4JC5A 4R9RA 2FMXA 4YQFA 2O0KA 1LUAA 2G1KA 4PQEA 5EEHA 5HDQA 4QFBA 5J2TA 2ERXA 4JZKA 4B3HA 2QT1A 2W2PA 3ZQ4A 2TRSB 2OP1A 5T6MA 4D0NA 3JYLA 1OJLA 4O4JF 1G2QA 4KYIB 2HQOA 4DLWA 5DN6A 4IPTA 1JIJA 2UXCB 1EGMB 1QLWA 4HYYA 4IVPA 4TYMA 3SQWA 3FLMA 3JD4A 1ZR4A 3B60A 1LD3A 1H69A 3ZHVA 3MT7A 5G1OA 1VSVA 3N59A 4IEIA 4XYMA 2PEYA 1A69A 1WXWA 3NGLA 1DEAA 1P5JA 2HDNB 2UUCB 3IQGX 4QTUB 3MRTA 5EXDA 3SYRA 4EVSA 3MELA 3N8IA 3S4YA 2A6PA 1I4LD 4LVCA 4GNKA 4PX9A 2E4UA 3ENZA 3HH8A 3NJ4A 5K0FA 1XTKA 3AEXA 1N9GA 3ZWQA 2C2MA 4WOJA 3STXA 5DT9A 4EH1A 2E5FA 3ZCUA 1K86A 4NENB 1OBCA 2JFPA 2NZXA 2OAEA 3DBRA 2AX3A 4PGAA 5JS8A 2FG5A 2BDTA 2GPAA 1JQLB 3F5QA 2DBQA 4OLHA 5FOVA 3SE7A 3NH6A 4D0GA 4RETA 4URWR 3SVLA 2BJHA 2AMVA 5HBGA 1DWOA 2CDAA 3OEWA 1YHNA 2O57A 5JSYA 1C9KA 2PJRA 4UBOA 4AMUA 4W9NC 5AKJA 4BKMA 4UZSA 2FE1A 3EA4A 3WQBA 2WSMA 4I6JA 3SX2A 1AHIA 5BN3A 5IYZA 4XUGB 5CCDA 1FRNA 4CDRA 5KYXA 2OYSA 5ALSA 1DIRA 1SG9A 1UK7A 1X0VA 2KMLA 2X4LA 4LQCA 4FMCB 2RBEA 1SVIA 4OGWA 5LBTA 1RP1A 3A0UA 5L4NA 4MGZR 5H80A 2EJCA 3AJ9A 4CLOB 1XEWX