1KHHA

Crystal structure of guanidinoacetate methyltransferase from rat liver: a template structure of protein arginine methyltransferase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
193
Chain Sequence
b'RWETPYMHSLAAAAASRGGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKSKYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanidinoacetate methyltransferase
molecule tags Transferase
source organism Rattus norvegicus
publication title Crystal structure of guanidinoacetate methyltransferase from rat liver: a model structure of protein arginine methyltransferase.
pubmed doi rcsb
total genus 65
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature ec 2.1.1.2: Guanidinoacetate N-methyltransferase.
pdb deposition date 2001-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1khhA00
2FYTA 3LCUA 3SM3A 1IM8A 3TKAA 4E33A 1L3BA 3LDUA 3DXXA 5IH3A 4E2WA 3ER9A 4E70A 5HIJA 5GM1A 4BY9E 4RVHA 1NV8A 5CM2Z 3FZGA 5U4XA 5BXYA 3R9XB 5HFJA 3SVZA 3GGDA 5DM4A 1D2GA 3KHKA 2UYQA 3DR5A 1U2ZA 1EJ6A 2B25A 3TRKA 4DCMA 4E31A 3C6KA 2A14A 3H2BA 3HCBA 5LQRA 5DM2A 8MHTA 3HA7A 1L3IA 3KPVA 3NTVA 4GC9A 3HCEA 3KPJA 1Y8CA 4IWNA 5DX1A 4X60A 5EMKA 1L9KA 2XYQA 4RTLA 2IIPA 3EVDA 3DXYA 3D2LA 1ZQ9A 3QV2A 4A6EA 3MTEA 1NBIA 5C1IA 4YMHA 5LQAA 4X1OA 3OFJA 5ICFA 3THRA 4EK9A 5D1NA 1G8SA 2AOXA 3KPYA 1YFLA 2JHAA 5DTRA 2K4MA 2KW5A 5T64A 1BC5A 1JSXA 4RVFA 5ICGA 2BR5A 3R3HA 2FPOA 2GPYA 2VDVE 4EVIA 1BHJA 3HCFA 2CL5A 1G6Q1 3GJYA 5DWQA 3CBGA 2P7HA 3P2EA 1KPHA 5EMJA 4RTKA 3C6MA 2OBFA 5LQNA 3VSEA 3P2KA 2ZTHA 4RVGA 2PVCA 1YFJA 5CUQA 3HEMA 2HV9A 1Q0SA 2I9KA 5CVEA 4ATNA 4XUCA 1RJDA 3LPMA 1SUSA 2PKWA 4OBXA 2AOUB 3UZUA 3LX6A 1G60A 2P35A 3MERA 3P9NA 5E8JA 4C07A 5K8VA 1SKMA 2IH4A 1RI5A 3LL7A 4QQKA 2IFTA 4FT4A 5CIYA 5K0EA 3DULA 4ISCA 3B7PA 5T67A 3HVHA 4EKIA 3BGIA 2XVAA 5EZSA 3LBYA 4LWPA 5FCDA 5F2OA 1KP9A 2EFJA 4KDCA 5KYGA 2VP3A 3FPEA 1DUSA 3UJ7A 2ZZMA 3GRZA 3GWZA 1M0EA 2VDUE 3M6VA 3HCCA 2NXJA 1H1DA 3DP7A 5EIFA 1XDUA 4CKBA 4AZVA 3O31A 3FYDA 5EVJA 3T0IA 3EMDA 4PCAA 3EGVA 2BM8A 3MAGA 2NYUA 2EG5A 4IV8A 3LKZA 2YXDA 2NP6A 2V74B 2B2CA 5DLYA 2ZZKA 4AX8A 4BLUA 4YMGA 2QE6A 2YR0A 4YUXA 2IPXA 1JTFA 2Q41A 4C04A 5LQCA 3E7PA 2HR1A 1RI1A 3CGGA 1KHHA 3M70A 5FA5A 4BLVA 3TR6A 1FP2A 3TM5A 2AVNA 1JG2A 5K09A 4V0RA 5MHTA 2Y1XA 4RTMA 4RTNA 3P97A 1I1NA 3NJRA 2ZIFA 2CWWA 4GEKA 3UJ8A 4LG1A 5DM1A 2PT9A 4U7TB 5DX0A 5K05A 2ERCA 2IDKA 2AN4A 2ZWVA 4DQ0A 5BP7A 3MB5A 3GRYA 2G72A 2YX1A 5D1HA 4ER3A 5CVVA 4IV0A 4MQ4A 4XUDA 2XYRA 1UWVA 1M6EX 3CJQA 3KPUA 5DM0A 4AUKA 4CWAA 3LHDA 2Z6QA 1TPYA 1WXWA 3MTIA 3KR2A 4X61A 3P9CA 3PT9A 4E32A 3V97A 2P1DA 4P7JA 2IDJA 3OZRA 1KR5A 5K0GA 3FRIA 1F3LA 3G8AA 1FPQA 4KDRA 2FK8A 4RTOA 3IV6A 5CCXA 2GB4A 4GQBA 5EHIA 1R8YA 4RTJA 4MHTA 4FP9A 4YV2A 3OPNA 2HNKA 5LQUA 1QAOA 5BW4A 5CCBA 5GIPE 2P3LA 4RYLA 5CVDA 1NW6A 2P3QA 1NT2A 1XJ5A 2IP2A 5DRYA 3PTAA 1XTPA 4M38A 5M5BA 2P8JA 2EJTA 4Y2HA 2O05A 1KYWA 4FS8A 3GIWA 4IKPA 1TW3A 3TKYA 5F2NA 5CD1A 2ONYA 1HMYA 2ZBPA 5EPEA 3BKWA 4FSXA 4GOND 4MTLA 2GAFA 3P9IA 4OA5A 4HGYA 4AZTA 4V0QA 1JG1A 3A7DA 4HRAA 4GOMD 2I7CA 1ZG3A 5EMMA 3K0BA 2WA2A 3SSOA 2C7OA 5E1BA 2QM3A 3EVAA 1AQJA 3AXSA 5HEKA 4P58A 1YF3A 1HNNA 2H11A 4E2YA 1VPTA 3HNRA 4POOA 3TFWA 5DPMA 5GOZA 3OCJA 1EAMA 3GRVA 4H0NA 3SXJA 1XCJA 2ONZA 3KQMA 4M37A 5GP1A 1RI2A 1JSZA 1XDSA 2FK7A 2FRXA 3EVBA 4C05A 3NMUF 2I6GA 1RI4A 3VYWA 4RTQA 3DMHA 3DH0A 3TMAA 2HTEA 4FR0A 4GOLD 2PX5A 3FPHA 2XBMA 2C7QA 1L1EA 4G56A 1JG4A 2JHCA 3ORHA 5T6BA 5KVAA 1I4WA 1XCLA 3ER8A 4QPNA 2OXTA 3R6TA 2P41A 3HTXA 5FULA 2VS1A 2OB1A 4B17A 2E5WA 2ZFUA 3LDFA 4Z2YA 3O4FA 3JWHA 4HSGA 3C3PA 1O9GA 3DLCA 4EKGA 1JG3A 1IXKA 3DUWA 3L8DA 3BGDA 3KKZA 4F84A 5K0FA 3S68A 5FQOA 3ELWA 3FPGA 4ER7A 2PBFA 4QPPA 3VC1A 1N7IA 2QRVB 2YQZA 4PYOA 3KU1A 3REOA 3B3FA 3CKKA 3R24A 4C06A 2IH2A 1UIRA 3ELYA 1P39A 5EMLA 2ORED 2PWYA 3A27A 1PJZA 1XDZA 3DMGA 4HGZA 4K6MA 3OU7A 5K0LA 4KW7A 4OA8A 1XXLA 2BM9A 3PB3A 4JXJA 1AQIA 2PXXA 4R05A 2R3SA 3UJAA 1NE2A 2ZSUA 2PX8A 3ELDA 2BH2A 1SQGA 4DZRA 2Y1WA 5GINE 5JR3A 3OZSA 1JQ3A 5HOQA 2CKDA 3SX0A 3BT7A 3C3YA 1RI3A 1NV9A 2PSSA 1G8AA 3KR9A 3R0QA 4YV1A 2AS0A 3KQYA 5LQJA 1SQFA 3EGEA 3Q7EA 5EKUA 3THSA 5ICEA 1FBNA 2VDWA 4PGHA 4LECA 1TW2A 2ZBQA 1MHTA 1R00A 5E2BA 2G8NA 2ZVJA 3PLAE 2OZVA 1VP9A 10MHA 3P9KA 4OBWA 4PIPA 5E1OA 2JH9A 2PX2A 3G2MA 1T43A 2NXEA 5K0BA 3GO4A 4R8SA 1X19A 5ERGB 2IGTA 2WA1A 2JJQA 3OE4A 4C08A 7MHTA 4QVKA 3TM4A 1R8XA 2LD4A 3CCFA 1FP1D 1V39A 5ICCA 5BW5A 2HMYB 3EVGA 4HTFB 4RVDA 3UA3A 2ZWAA 2O07A 3EGIA 2IH5A 3SSNA 3GXOA 3UFBA 2PX4A 2EX4A 2BZGA 3FTFA 3WSTA 1EIZA 1QYRA 3DLIA 3HCAA 5EOVA 3KR1A 1Z3CA 4RTRA 1VP3A 1JR4A 3FUUA 3CJTA 3ERCA 2C7PA 1YUBA 3LDGA 4HG2A 3TQSA 5IKMA 2PGXA 3EEYA 3KQOA 4HC4A 3T7TA 2G1PA 2PY6A 3DTNA 4MIKA 3I58A 4PYJA 2P3OA 1YZ3A 5E9JA 5K01A 5K0CA 2O0LA 2JG3A 4DCGA 2AN5A 5LR6A 4DKJA 4YUYA 5K03A 1EJ0A 1X1BA 1R18A 1KIAA 2PLWA 3HVIA 5C0OE 1JTEA 3DMFA 1INLA 5EHGA 3HCDA 1BKYA 3M33A 3PFGA 2XYVA 3UJ6A 1NW8A 4PGGA 5FTWA 3LSTA 5HIMA 2AOTA 5FHRA 2YXEA 4A6DA 3SMQA 1ORIA 3BWCA 3G89A 3PX3A 4PINA 2NNWB 4PNEA 3FTDA 3P71T 3AJDA 5EGSA 5KS2A 2ZBRA 1ZKDA 4PYKA 3SSMA 2ZZNA 3OE5A 3FUTA 1KPGA 2AOWA 5E9QA 1X1DA 5HIKA 3TOSA 3QOWA 4KVZA 3KQVA 4YV0A 3HM2A 4DMGA 2FHPA 2YUIA 1I9GA 4R6XA 2AZTA 2C7RA 2UYCA 2Z6AA 2NP7A 3LKDA 4QQNA 2G70A 1XVAA 3E8SA 5FWAA 2WK1A 5DX8A 1DCTA 3KQTA 3TPZA 4YUWA 5LSAA 1Q0TA 2GLUA 3O7WA 4O29A 1KYZA 3PS9A 1QZZA 1P1CA 4X41A 4OQDA 5CVJA 3EPPA 4BP1A 1WY7A 1ZHFA 3BUSA 3GDHA 3M4XA 1O9HA 3MCTA 3HA5A 4DF3A 4FGZA 3NDJA 3AWIA 1SG9A 1OR8A 2BR3A 5FA8A 3IYLW 3EVCA 5E9WA 3FRHA 5K0JA 3TLJA 4E2XA 3NWEA 3VC2A 1QAQA 3PFHA 4E2ZA 2OPBA 1N7JA 3B5IA 3JWIA 3RW9A 1DL5A 1NKVA 2B78A 3FUXA 3EVEA 4LWOA 4M36A 2AOUA 2O57A 4RWZA 2CMHA 5E1MA 5HIIA 4CKCA 1UFKA 2DULA 1R74A 4ER5A 5E2AA 2UYHA 2OB2A 2P7IA 3BXOA 3GU3A 1M6YA 2EJUA 2H00A 1G55A 3P8ZA 3M6UA 4HH4A 3SR4A 3UJDA 4YUVA 3A26A 3PX2A 1RJFA 3OU6A 5E1DA 1VLMA 3ME5A 2PV0A 1N2XA 3NVKI 4OX9Y 4GF5A 4KRGA 1O54A 3T7RA 4QTTB 2NXCA 3DOUA 3LCCA 5P8WA 5DTMA 1KXZA 2B3TA 3B3JA 3GRRA 5EQJB 2GH1A 3FUVA 1NW5A 3CVOA 3M6XA 4FSDA 3UA4A 3A4TA 3UJCA 2ZW9A 3BKXA 4WXHA 4PWYA 5EG5A 5KQSA 4QVGA 3PVCA 4RTPA 4OQEA 4CKEA 3HA3A 5E8RA 4RV9A 3G2OA 5EC8A 1BOOA 3G2PA 4AZSA 3BWBA 4C4AA 2PJDA 2FCAA 3E23A 4P7FA 3T7SA 5FHQA 1SUIA 3GRUA 4QDJA 3V8VA 2ADMA 3BWYA 2F8LA 1B42A 3B3GA 3KQWA 4DA4A 3G5TA 4KIGA 2UYOA 4GC5A 5DSXA 5GWXA 4F85A 1WG8A 4PCLA 5DXAA 4HTFA 4YUZA 2V7EA 4Y30A 1D2HA 3DXZA 4MWZA 2GA9A 5HZMA 4XUEA 1G38A 3OU2A 2OY0A 3MCZA 4KWCA 5JUWA 3KQQA 3G8BA 1KPIA 2AR0A 5FQNA 4UOEA 3G7UA 4PYMA 2AN3A 1WXXA 5G02A 2YXLA 2VZ9A 3P2IA 3ELUA 2ESRA 1EQAA 4QTUB 5DRTA 5DSTA 2P40A 4NECA 3G88A 2G71A 3JWGA 4GBED 5GIOE 3QOXA 4PYIA 1IY9A 2DPMA 2OKCA 3NVMB 3LECA 1F38A 1VBFA 2XVMA 3LGAA 5DT2A 3HVKA 2ZIEA 3G2QA 5FUBA 4EMSA 1NW3A 3FTCA 2BR4A 4EQZA 3C0KA 4RTSA 3OZTA 5C9ZA 3HVJA 1RJEA 3RIEA 4F86A 9MHTA 5CVUA 3E05A 2N47A 3I64A 4XCXA 3A7EA 4ER0A 1D2CA 3FYCA 4DM3A 1MJFA 2ZULA 1L3CA 2YTZA 3I5UA 4M7RA 4QDKA 2OYRA 2IBTA 2AOVA 1VE3A 4ER6A 5K0NA 2PWPA 3X0DA 3UBTA 1NBHA 3ANXA 3I9FA 4PYLA 1YB2A 2QYOA 4GUAA 3CC8A 2JHPA 1AF7A 3EEOA 2JH8A 4PIMA 1P91A 5HILA 3FTEA 3FPFA 2R6ZA 1VL5A 2UZ4A 2H1RA 1VQ1A 3B89A 1RJGA 3NW9A 4KIFA 4R8RA 5FADA 2NXNA 5EZQA 3EVFA 3K6RA 3Q87B 5KQRA 1QANA 1X1AA 3IEIA 2YVLA 4RX1A 4WVLA 5H02A 1WS6A 3FUWA 4X63A 4FZVA 3JWJA 1VIDA 3MHTA 4CXMA 3GNLA 4AZWA 1ORHA 3I53A 3KQSA 1NW7A 2I62A 2OO3A 1JQDA 3BGVA 3HP7A 4BP3A 2ZCJA 3UJBA 3MQ2A 4R6WA 5DTQA 3UWPA 3UJ9A 2CMGA 4CTKA 4C03A 1QAMA 1SVUA 2AVDA 4PYQA 1YZHA 4GOOD 3GCZA 3U81A 1ZGJA 2O06A 1X1CA 4L7VA 3SGLA 2QRVA 1PRYA 4P7KA 3LBFA 5EEGA 2GS9A 3M6WA 3NDIA 4PYNA 5EEHA 5FWDA 4E30A 5F2KA 5LQKA 2AOTB 2IBSA 1P1BA 3OFKA 3KPWA 2B9EA 3LCVB 4U7PB 1FJXA 2ZLBA 4P7GA 5DXJA 4ZTBA 1JQEA 3BZBA 2PXCA 3G5LA 3FPJA 3NWBA 4FT2A 3IHTA 5GM2A 2HWKA 2Z6UA 3KR0A 3MGGA 3CJRA 5EKXA 3ID6C 3A25A 2PT6A 4RSRA 5EIWA 3EVZA 3EMBA 1WZNA 1AV6A 2QY6A 1EG2A 4CTJA 2PXAA 1R6AA 4PONA 5B1SA 4BLWA 1ZGAA 3RODA 2ZIGA 3AY0A 3AXTA 3F4KA 3KQPA 3BWMA
chains in the Genus database with same CATH superfamily
1STOA 3H9JA 5P21A 3U4GA 4E1BA 1ZJJA 3COSA 5LC1A 4LV6A 2JA1A 9ATCA 2JLUA 4KI0A 4TLDA 4O3MA 3W3AH 1MABA 3L49A 3KZ1E 3AR6A 3GGDA 4ML3A 4NRDA 1AKMA 1PWEA 1ZD1A 1PG2A 3EEIA 5DM4A 3R7DA 3KHKA 1M2OA 1NVFA 2RJNA 4EBBA 4CLOA 3TRKA 3ZNOA 2GSWA 2ZDHA 4I5GA 2WJ6A 1B6RA 1M1YA 3M3PA 3TI9A 3W9UA 3X44A 1XD2B 4MB6A 3NTVA 4GC9A 5A62A 3SMVA 3ZXYA 2GWRA 5FJIA 1JJ7A 4FUQA 1L9KA 2CLEB 3OUZA 1I3MA 1SBYA 4WOCA 3U3JA 3A32A 4H7JA 4DVGA 1E96A 1AD2A 3WYBA 4E21A 3I0ZA 1Z07A 3WFZA 2P27A 1F9EA 1H3EA 1W5TA 2EDCA 4QOEA 2W2PA 5BSGA 3ASUA 3QVGB 1J2UA 1PT7A 1OFIA 2NPFA 3VI3B 1Z6YA 1G5RA 1OWPA 1TUBB 3UKJA 3LUCA 1KC1A 3G0HA 4QRIA 3ROTA 5FEMA 2RGXA 1T26A 2X0NA 2XJ9A 5ALIA 2RIPA 1G6Q1 5DWQA 2JGDA 4XWKA 2IIBA 3TOZA 2E1RA 4DUGA 1A1VA 1SU6A 2HSZA 4A0RA 1MC8A 4L9AA 1G3QA 1LBSA 2WG1A 3F2IA 4XQGA 5ILGA 3BHNA 2QAIA 3KXIA 3UWSA 4FMCB 3O84A 3QENA 1ZN8A 1E8DA 1V37A 5GGYA 4ZT6A 4I9UA 1J0CA 4GYYA 3ND7A 4AP6A 4JLBA 4NXNB 4ZXPA 1D2AA 4LKOA 3J7TA 1RI5A 3X2FA 2FRVA 3HYRA 2G4CA 3DF9A 3IIEA 1G1AA 3ECAA 4PFJA 3GEMA 3ZNQA 1E6KA 1OBFO 1HFJA 1E3QA 2MSEB 1V5EA 3KHUA 4EAAA 3IVAA 3LBYA 3JWEA 2DTXA 3TGLA 2J5RA 3IRUA 2WAOA 4DCUA 3VKUA 3V6LA 1UAAA 4TLEA 4EATA 2GM4A 3OY7A 4AZVA 3ASYA 4U2EA 2IL1A 5H7XA 3ZH9B 1EP1B 3LZ6A 1OROA 2WKQA 3WGZA 3VDRA 5C2JB 4DR7B 2OQRA 3CPJB 3FHJA 2N0SA 5JC8A 2Y93A 2Q5LA 2B2CA 3JQDA 5LQSA 5IVPA 2R6CA 5TQVA 2OBLA 4AECA 3PNSA 2JI8A 1H5QA 2CDCA 1DEOA 1BXRA 4HVCA 3T9AA 3S8YA 1L4MA 3GVPA 4MRRA 5C8XA 1YULA 3AINA 1XRSB 5FBHA 1R4ZA 4DM4A 621PA 2PUHA 4DDTA 1A97A 1RYMA 3KYCA 3GA7A 1OASA 3PJRA 5DM1A 4C4SA 1AN9A 4HQOA 5J43A 3GVIA 2LXNA 4PV7A 1U63A 3NKFA 3FRJA 1A8UA 3MB5A 1CUBA 1FVOA 2YMPA 4U9UA 2JAQA 3GAMA 5AM0A 4AVYA 2XUOA 2YX1A 4C14A 1N2EA 2EL7A 2FMUA 2GVDC 2BFBB 3QX9A 4XUDA 3WMRA 4B5KA 4DQVA 3R23A 2AZ4A 4EJSC 1TPYA 3QW4B 5A9SB 3E9DA 2VUUA 4Z9BA 2JCSA 5DNAA 2ZR9A 4JLWA 4E32A 1KEWA 4TXNA 1IWPB 4YDRA 3T5DA 2VXYA 5JJLA 3CM0A 2H29A 4FP9A 3OLCX 3W04A 3M5WA 4HDAA 5DNDA 1YB6A 2ASVA 2QTVB 2IUUA 4ZAVA 1NATA 1P62B 4HPXB 4XH9B 1VL8A 2VDQB 1K7SN 1LKZA 1AA9A 1QVRA 2JIZD 1R6UA 2HA6A 4IIEA 5EMHA 1W1IA 4RHCA 5G53C 3OE1A 2O05A 1I7PA 2LTAA 3IBFA 1G3IA 4FS8A 2XE8A 1W49A 1E1CB 3ADPA 1CJUC 2QG4A 1Y42X 3GOQA 1F2UB 1V6SA 2L19A 1N0HA 5AW1A 1P0IA 3DE6X 3UT5B 3A7DA 2LIVA 3E8MA 4HRAA 5CH3A 1GQRA 3V8BA 3HXOA 3ZE7A 1MX3A 3U4AA 1GPUA 1AQJA 4P81A 4XQEA 3C2QA 1Z68A 4K28A 2QR5A 1O4WA 4WTOA 2FV8A 3I73A 5DPMA 3WLMA 1C3OA 3BPSA 2HQBA 5CFMA 1U9CA 3EIQA 4M1QA 4IJKA 1L5VA 3BIOA 4JNCA 2VDWB 4U2BA 1Y8QB 1OTHA 5E3IA 2XCSB 2V9CA 1K66A 2HK6A 2ZRGA 4ARAA 2IOFK 3UY4A 3QVKA 4OH7A 1E9SA 1UT5A 2GTPA 2YRWA 3H2YA 3H2GA 4DYDA 1I33A 5J2UB 1BX3A 1EP9A 2AGVA 4MGIR 1CHDA 1A04A 5CCEA 5KVAA 2QT1A 4HFRA 1KQPA 4KWIA 3WK6A 3QH4A 5ANRB 1E0JA 1L1FA 4AI6A 4V1CA 1QE3A 4TRRA 3O4FA 4K03A 1JDUA 3QVUA 4LNHA 1Z7WA 2ZE8A 4G89A 4RU1A 4AMYA 3KOOA 5D87A 4G07A 2IV3A 3V48A 2XCLA 1HSOA 4FNAA 4L78A 4DOMA 5A7GA 3OCUA 4QPPA 4PYOA 1Z06A 3GLFE 4N3NA 4LZAA 1NPYA 4H7DA 3DOOA 3N2LA 3FCOA 4FR5A 3MA0A 4BECA 5CB4F 3SKXA 1EGHA 1XKXA 3HJRA 1SVMA 3U9TA 4ZGWA 1IL0A 3BK1A 1NTOA 4JSTA 2RGNA 4C3ZA 2NSJA 4Y2TA 2G36A 4WFJA 2J0UA 1QO0A 1OB5A 4TKVB 4DKXA 2AD1A 4TX1A 4QICA 3PPYA 4E3ZA 1O89A 3HYTA 3W7BA 5CW1A 4M54A 4M4SA 4RCVA 3SP1A 1DAGA 3WYEA 3KQYA 3VZBA 3OOHA 3GFOA 1EUZA 1P74A 3JQCA 3R0JA 1RBYA 2EW2A 1ADCA 2XA2A 1U2QA 5KOJA 2GDJA 1VP9A 2C3OA 4KQMA 10MHA 1V1RA 1Q11A 4PIPA 1RPJA 3TE6A 2C2WA 1D1QA 2Q1SA 1NFRA 3KBBA 1XCPA 5EFOA 1T43A 2VAXA 3T99A 2AA3A 3ZTYA 1Q2UA 1Y7PA 4TL7A 5F35A 2ZBGA 4Q12A 1BEUB 2WD8A 4RACA 4UZSA 2BI8A 3STYA 1RQRA 2X0RA 1QX4A 4G85A 4U7WA 3SQNA 2YV2A 3VO8A 2ZWAA 3QIVA 3LBAA 5BR8B 3WK9A 2BDTA 2HJ9A 2RHGB 5CG1A 5ILOA 4DV3B 1UXJA 3MWLA 3ZPXA 1Z8NA 3W7VA 3WSTA 4I8IA 3NYWA 3DL7A 4Q93A 4QFMA 3E22B 4DAEA 3SZUA 5L7TA 1FFYA 4LJ5A 4CTOA 1O4VA 1AE1A 1F0KA 1GUBA 1Z8FA 3N39C 1GA4A 3C8UA 3CSUA 3D8SA 4HG2A 3T41A 2K2WA 3TQSA 4OHVA 3W8EA 5HJEA 5KWVA 2BSQA 2G1PA 1MA0A 3K0AA 2B1JA 2FLVA 4F45A 2HI0A 3OFVA 4KGXA 5F3DA 2ZJ3A 3IT0A 2JG3A 4QU8A 4TUYA 4QBFA 5GV7A 3LA8A 3FR8A 2ZT8A 1UKAA 1VL6A 2J1LA 4H4DA 1VG1A 3KJEA 2RHOA 4EGJA 1PWXA 1W85B 4WMLA 2AG1A 2HK7A 3Q6MA 2D1QA 2DOKA 5C0OE 1REQA 3W2HA 1BKYA 3UAOA 3WMWA 2X1VA 2ZJZA 4DA6A 3C6QA 4BO1A 4Q16A 2FMIA 5REQB 5THQA 3ZHQA 5LUBA 4C2TA 2GZHA 4M87A 4PINA 3ER6A 3OPYB 1QG2A 3TLAA 4EJFA 5K4AA 2OD2A 1A2BA 3TCXB 2QTMA 1L5FA 4EDFA 5F7JA 1OJLA 3KBOA 1N2CB 4U63A 1H1LA 1C1XB 1UEJA 4GLLA 3TW8A 1KQOA 2PS9A 4W4TA 5HTOA 4FYMA 2Q3DA 1H4VB 2VSNA 3KQVA 4L0MA 1P2TA 1G5PA 2EW1A 4JVSB 4GOKA 4X54A 2VF7A 4U2GA 2X40A 3BCRA 4MS1A 2RK6A 2O8VA 4YACA 1CZOA 1N2IA 2UYCA 1X38A 5CMLA 5TLSA 2JI4A 1DBRA 2R2GA 2WJIA 3O7MA 1C3XA 1PSDA 3A9TA 4HNTA 1Y89A 3KQTA 4YUWA 3MMSA 4Q1BA 3P19A 3ZW7A 4EI2A 3VPDA 1E1NA 4O29A 8ABPA 3SZOA 3NTOA 1Z5OA 5IZCC 1K4MA 2AJ8A 2FSHA 2Z2XA 3AZQA 3PTLA 3SAJA 1EVQA 1CRZA 2Z5GA 3WJ1A 4YCSA 3HA5A 1KQ3A 4GOXA 3SC4A 1GY8A 4NWIA 2N42A 4LBYA 5FA8A 3EVCA 3DHNA 2WTUA 4BKQA 3ILVA 5TGTA 4JU9A 2XNSA 3VC2A 2NO4A 5C8YB 3AKZA 2NTJA 5DGDA 4D9EA 2FW8A 2XUIA 3G2IA 4ZZ1A 3BEDA 2FE1A 4BV2A 4C4ZA 4IGFA 1GRQA 1KKLA 4R9UC 2Z1MA 4YVFA 2X1LA 3PR1A 4BAUA 4KR6A 3X1KA 4N9QA 3I8XA 5C35A 2H4XA 3DZJA 3ML1A 1HWYA 2CYAA 2QLMA 1NVAA 2JFWA 4RADA 3TBFA 1JIKA 1BE8A 1P2SA 3OIFA 3K20A 1UBFA 4FUTA 2RBKA 3ZVLA 4OX9Y 3FIJA 1RXUA 2WB4A 1X8LA 1JKFA 3MJ4A 3DOUA 4MA0A 4XJSA 2FSPA 4CEHB 2R6FA 3MK31 4HB4A 3KELA 2UXBB 3EE6A 1YT5A 2YOHA 1Q77A 5DTMA 4HAYA 3L7OA 2LPMA 3L0PA 2VSYA 3K0CC 3PGLA 1BX1A 4AUMA 1J8QA 4WXHA 4X00A 3CG0A 4KMRA 2JLBA 1YRHA 4MZXA 4QFBA 5LXTB 4DR3B 4Q7JB 3PT5A 4XJXA 4G4IA 1WL8A 3PXGA 4NDAA 3EZGA 2VJAA 3V5NA 4A91A 1FX0A 2ZOSA 4MIEA 3OPYA 5L45A 4HX9A 5KYNA 3B9PA 3T6KA 4MP3A 4NC9A 1A0OA 3JAWB 4A16A 2P2GA 3HL0A 5GV8A 5CGQB 3II6X 4P1ZA 4HNHA 4W8OA 2VTDA 4ZI7F 4FIZA 2CHUA 4HTFA 2QM0A 1IB6A 2HBZA 4WESA 1KF0A 3E9MA 4PBSA 1NQOA 4I9HA 4Y18A 3ZI7A 1JFFB 1Q1ZA 4KSYA 2XE7A 1DPFA 1ZXXA 1ODFA 2OV8A 3F5DA 2JCGA 3AJRA 1WEHA 2JBHA 1N5RA 1DKPA 1OFTA 3G88A 3IQIX 3IMGA 1JJVA 3LLMA 3TTXA 4QGHA 5JYDA 3HH8A 1V9LA 3URKA 3DMPA 4M1WA 4KWTA 4P8RA 2FG7C 1VBFA 2JIQA 3N9IA 4H6VA 2RAUA 3BXEA 4XGNA 4DG9A 4M0CA 4PRYA 3FTCA 4QOSA 1RXSA 1WF6A 4JI6B 2I4NA 2VWHA 4YT4A 2AMLA 3HUEA 1K5PA 2Q4EA 3HVJA 4QQ8A 4FDAA 1IJKA 3IUPA 1DUVG 3F9CA 5CVUA 3DE7X 1UJBA 3K9WA 3N75A 4PR3A 5JNWA 1II8B 4IZHA 1E18A 3GRFA 3U31A 1P5HA 3ZWVA 2PFGA 4UBKA 2QX9A 1ZN2A 2WC1A 3C97A 3AOEC 2W6OA 1CY2A 4L3WA 4QAQA 3FTQA 3N86A 4X8MA 3H9BA 1NVUQ 1F2TB 3VH4A 4CG3A 5B4UA 3G1UA 3G9TA 3UGJA 3LWZA 5AXAA 1YOVA 2EIHA 2O2HA 4BE4A 4G1EB 2GWHA 1ZSVA 1E89A 1RRCA 1I6WA 1JLMA 5MFZA 2JI9A 4KIFA 4NV0A 5FFFA 3UMYA 5JD4A 1FDWA 5EHXA 2AB0A 1NYTA 3BD9A 4RK4A 2HUNA 4ZPJA 3R9XA 4LY3A 3ZX5A 1SIOA 1VMIA 3SJZA 2ZRIA 3QWIA 3IXMA 3L1HA 5CH8A 4HEJA 5FCDA 4IIJB 4DR5B 3OCVA 2MSDB 5J5VA 4MUHA 1UZLA 5B4TA 4DANA 4BP3A 1Y48E 3JD3A 1M2FA 3FJ1A 1BA2A 3UJ9A 4RMNA 1E3EA 2QX4A 2CLSA 2J3IA 3F8WA 3PSHA 3VSDA 2WWYA 3FHCB 3D7NA 4WLNA 1PRYA 5FWDA 1S96A 3M6WA 5LQKA 1YRYE 4PRKA 3ROPA 2WWFA 3EGCA 4PSKA 2J3HA 3UJPA 2AKEA 2P2CA 3UUEA 4XR4A 3AHIA 1PDWA 1Q0HA 3H9QA 5TJ9A 1JI3A 1WW8A 2WJAA 2BCEA 4BNDA 5J2TA 1Z0SA 1NBMA 2DYKA 3AT1A 1XEFA 1K2WA 1J39A 3RWOA 5CVTA 3MGGA 5CA1F 3AFMA 3C3WA 3CLSC 1G9TA 2WIDA 3L6CA 4E6PA 4ZDKA 2BCJQ 1XZQA 1V95A 2ZE5A 3ABOB 3FB1A 5EKTA 2A3RA 2O1WA 2OV1A 3N0TA 4PONA 2A84A 2YUTA 4LGCA 5AVJA 2XW6A 4MJ3A 2ACEA 5DSZA 1VHWA 2IS2A 1MB2A 1ZPDA 1NU8A 4W6ZA 2ZXEA 3NH6A 5HIJA 3HA2A 1M1UA 3KQPA 3VBCA 4G0WA 3OX4A 3C3CA 3AZPA 3CZAA 4GSYA 3TZQA 4AJNA 3HR8A 1TF2A 4MPPA 3SC6A 3K8YA 4LDQA 3DDZX 1JB9A 2R1UA 3ODGA 1R4MB 4TYQA 5DEOA 3WHIA 4E2WA 2F1IA 1R5BA 4UD6A 2QUJA 2HFJA 3EBPA 4A03A 2RDMA 4E08A 1P4AA 3TH5A 2B4YA 2BEJA 3IFSA 5AHKA 4XVHA 4ZOLA 5IJXA 1QH1A 5KJFA 2HEIA 4IXTA 3HDHA 1EJ6A 1HK7A 4LISA 3VDMA 4XEHA 1JDTA 2IZ6A 3B1FA 3C6KA 3H1GA 2OAQ1 4OU5A 5LQRA 3KPVA 4KSBA 3HCEA 1CKEA 1J8MF 3L7CA 3C5WP 1QYXA 5BUSA 1I24A 1N2SA 4Q4CA 4M2LA 1QGZA 3DT9A 3GNQA 3H5NA 1V16A 3B52X 1XBTA 3QV2A 4XM2A 3MTEA 1XEWY 2ZU6A 4I19A 1ZH2A 3CSSA 3FMIA 4FJ0A 2H4ZA 5K0TA 4OAPA 1U8YA 4NS1A 3VX3A 1T1GA 4EK9A 1DMSA 3E5MA 4L5CA 3S5UA 3LC7O 4RVFA 5K6AC 1IZ9A 4HGPA 4G5FA 4J9UE 3OA0A 1VJTA 4G1BA 4KXFB 2MSLA 3C6YA 4IJVA 4EI9A 1B2LA 1V7CA 2R8BA 3SR0A 5FWNA 4L5AA 3SEAA 3O90A 4IEEA 4UMVA 4JYCA 1X0XA 3TRIA 3SZLA 3WQBA 3G6KA 2XODA 3EGXB 5BOSB 2PIAA 4AF8A 2PT5A 1EUYA 2PVCA 4C6TB 3HEMA 3GRCA 3L6RA 1RHRA 3RIGA 5C80A 4C5CA 4ATNA 5TMPA 2LP4Y 3K4HA 4L27A 4CT5A 1RKBA 3D3NA 1JYFA 4ETNA 3F8SA 3HN7A 1HDCA 3RU7A 3H42B 4O2AF 1E66A 3U3MA 1UPUA 5J47A 1ECPA 3GLHE 3MERA 3P9NA 3RVPA 1YO6A 4F1WA 1D4OA 3FCCA 2HIGA 4QYIB 2WUWE 4EB6B 2JLWA 3G2LA 1CFJA 4XB1A 3DFMA 5DCWA 1UDRA 1W4ZA 5T67A 1KS9A 1F4VA 3IEUA 5CJJA 4I50F 2FQQA 3F7OA 3IAM1 2MSWA 5JEDA 3SIXA 1GOTA 1H05A 1LDNA 2FVXA 2P77A 4IJ6A 3L07A 1JLKA 4KDCA 2AT1A 2OVBA 1PJAA 2FH5B 3AVQA 3WYAA 3ES9A 4BOYA 3L77A 3GWZA 4MLCA 4DE5A 1EESA 3SHWA 1H1DA 4G4GA 2ZAGA 4HFJA 1VKHA 2GF0A 1PFVA 3DDCA 3GEBA 3OQIB 1U04A 2WM3A 3JQFA 4FDTA 3E3NA 1TKRA 5CA1B 1EBBA 2B4TO 4BLUA 3AGQA 4QC2A 2YR0A 3EZ6A 2GOYA 1QS0B 2A7XA 3R2JA 4ZV4A 4DRYA 2VUIB 1U7UA 1I2CA 2BI7A 3HNPA 3WA7A 3AEZA 1EHCA 1BJKA 4FJ2A 5E4FA 5K09A 5EE0A 1OXUA 2GYUA 1WDMA 2QK4A 1IHOA 3P0IA 2P1RA 1VYHA 3NPAA 3WRYA 2XGOA 2Q0HA 1J0BA 2Q1YA 3OETA 1HRKA 3QUBA 4G5YA 4TYWA 3M9WA 2SBTA 1JLHA 3PXXA 3D2AA 1MOZA 1P5ZB 4OY3A 2DQYA 2C2MA 1ST3A 3K05A 3OJOA 2MYNA 2D4AA 2GJ9A 3HU2A 1GPLA 2HWXA 1EE9A 2Y76A 3A4YA 3CT6A 4MB2A 2F8SA 4Q00A 2XCIA 4AJ1A 3LV8A 2XUAA 5BRNA 5F7OA 1GEGA 4HCJA 4W1SA 2XCUA 3ZWYA 1CIVA 4FMCF 1E1CA 3P9CA 2JLXA 2W2TA 2ZJOA 4TSRA 1PNTA 2G82A 3GL9A 2E2WA 3D4PA 3ZZMA 1J0EA 4O4JF 5LMZA 4U3JB 1YCHA 1XALA 4HX2A 1FFBA 2ZIWB 5ALYA 3ZK7A 4YO7A 4DBVO 3Q3JB 2B20A 5A9TA 1SVOA 3BFXA 4JGBA 3UTCA 6Q21A 4QJ5A 1BMDA 1DAIA 1RQPA 1RWOA 4X91A 1H2EA 2C2HA 2YYSA 3DF7A 5DHUA 3I12A 5TVKA 5C81A 3CZCA 1A1SA 4HXFB 2ZROA 3FJOA 3ABSB 3JRWA 3ITKA 4ZEXA 4RULA 2O1XA 3FB4A 3PGJA 2J3JA 4LY0A 4OD0A 2A57A 3K32A 3U16A 2P0AA 3IILA 4A8JA 2VYVD 4HOYA 3IL2A 2NX2A 1T1JA 2I3ZA 2VCEA 2YN4A 2GHIA 2R00A 3JZDA 3LYUA 4FE3A 4RCZA 4Z86A 4AG3A 3IIIA 4B45A 1IAQA 3FGPA 3IV7A 1SM4A 3GCWA 3OEWA 4UZFA 3AUYA 1E2GA 1J1ZA 2ZIZA 2EERA 4Z8XA 1Y6FA 1EGQA 2P5YA 6ADHA 4E2FA 2BZSA 3ZHUA 4B82A 4EYKA 4EHKA 2P9CA 3ST7A 2O5EA 1R6XA 1KMNA 4B83A 2FZLA 2Z56A 1RYZA 2C1XA 3EIWA 4P3NA 5FR2A 4EX7A 2Q29A 1GAJA 5B36A 3MILA 3C70A 5CA1A 3CBQA 1FQJA 1Q44A 4M8SA 3ILSA 3K5PA 5CLIA 2R8ZA 3JASB 2ZAOA 2DE0X 4JX8A 1QRTA 2D5AA 1GGMA 3TO5A 3EVBA 3LBNA 3V7NA 4EW6A 3IKTA 1QJCA 1T2AA 3RV3A 4ZCIA 3DH0A 4BO4A 4TS1A 3LG2A 3K1AB 3GPLA 2YJTD 2GBGA 3HO8A 1VE5A 3DNMA 4JUDX 4A5OA 4NVRA 1G3RA 2UZ3A 2XI4A 2GGSA 3MVEA 5JQGF 4YY3B 1QTRA 2RKBA 5BNZA 5TR9A 1VI2A 2PRKA 1HEIA 2O48X 1I10A 1MX1A 1DIRA 1DTWB 3E9ZA 3MGBA 3VSBA 2HT6A 2Y3IA 3O2NA 2JHFA 1QIHA 3SK0A 2Z1DA 4HSGA 4B3MB 3DLCA 4UHEA 1GWNA 3RYTC 1W88A 3OF2A 4BFZA 4D99A 3DLHA 4KP7A 4PPNA 1UBTS 3FPGA 5DBHX 2BMDA 2PZKA 2X9NA 4MUKA 2YXPX 3RC1A 3THXA 3VGPA 1ODSA 4YMIA 4ZVSA 1P1KA 1WXDA 3QPDA 3CKKA 2P4SA 2R1TA 4UKDA 4C89A 2RONA 4W5WA 1FX1A 5AW3A 5LLDA 4WNYA 4KFCA 2JIOA 2VPIA 3LQ2A 3A2MA 4YAFA 1WPRA 3BIFA 4N54A 3D02A 1X2EA 3JQAA 2QP3A 1RBZA 1Q50A 1UP7A 3RYCA 1XRJA 2QSJA 4DB4A 4E5KA 1SQGA 4R9VA 5AOBA 4Z9AA 3EARA 3ZQ4A 3HM9A 1V96A 1T3ZA 3ZGYA 1JNXX 5FUVA 1KI7A 3VH3A 3OMWA 1N78A 2ODWA 2Z09A 5CVCA 2JGDB 1N5DA 1HYBA 1OHHA 2GEJA 1Z4KA 4MXDA 4YCNA 5H4HA 1DT3A 1WBDA 1M2KA 2C59A 2YZ7A 2FQWA 3VAYA 1DAHA 4GKKB 1CW2B 4NJEB 4HGRA 3C7DB 3RANA 3TTVA 3I04A 3CF6R 3TW4A 4RY8A 3ZI0A 4JI8B 5D01A 4TRMA 3GCDA 3NNDA 3IC5A 1USVA 4KXXA 1Y8ZA 1CZUA 4H1TA 5KDLA 4LZJA 1AGNA 4IIBA 1MJHA 3SKYA 2YFKA 4TTVA 5IT4A 1JALA 4DADA 1YH3A 2O5CA 5I7AA 3TLKA 4TUYF 3DB1A 1ZIXA 2OHVA 2VVTA 3HCAA 5FOWA 1M2WA 3EOAI 4LJ9A 2JZOA 2RGUA 2PKYX 4RZXA 4GSLA 1FMFA 5I7EA 4LX0A 5HFAA 4CM8A 3ZJUA 1EWYA 2GK6A 1YZ3A 4V0NA 2FJ0A 2WTXA 3NDPA 3WGTA 1GFZA 1KU0A 1PI3A 3RYIA 1P0PA 4C6TA 3N3BC 3EN0A 4V0ME 1QK4A 4TT8A 1L1RA 4CMHA 4YR9A 1WQ1R 2CMKA 3AOEA 1POWA 3G7NA 1BS1A 2WUGA 3DMFA 6ABPA 3JQBA 5A03A 4N41A 1H2AS 3TRJA 1IUNA 3PPIA 3CKYA 5HIMA 3V1UA 1IPHA 3BHJA 3FF1A 4XFDA 1QV9A 1S01A 2OGTA 5KYXA 1PQPA 1PKXA 2R60A 1IHDA 1Z4LA 2YIJA 1FXUA 4KNWA 3M3DA 2HF9A 3TCKA 1ISHA 4WY8A 4DW8A 2YWCA 4IIJA 3UATA 4Y6SA 3R9WA 1FYXA 3FMPB 1U8XX 2WAYA 4QM6A 2I6TA 5FLYA 1EGAA 1M8PA 2WZBA 4KVZA 3QVWA 3CVYA 3HM2A 5AKYA 4RBNA 5C1DA 2DX7A 4B6FA 5F1PA 1DC4A 4RW0A 2QG9A 3LW8A 3U56A 2O7RA 2QTNA 5IBPA 3PFBA 1DFIA 4JMLA 2MTBA 1KDPA 1IRIA 1TUGA 2OAEA 3P4UA 2HSDA 2FRDA 4M6WA 5A71A 3TVYA 4OX9B 3ICEA 3UUWA 4LJ8A 5LWHA 4C1NA 1E5QA 4PAMA 4DEXA 5LSAA 4K46A 4EUHA 3BDVA 3K53A 3LT2A 1D3AA 1FRVA 4RKFA 1WW2A 4WNCA 1W8DA 2JAHA 3PUVA 3A1NA 5AW2A 4Y6PA 3KM0A 3EQ6A 1DXOA 1GT91 4MUNA 2X9LA 1LFAA 1C0PA 2G5PA 3B3QA 3OPYI 4OLAA 1OZHA 3WDKA 7YASA 2OBYA 2IOFA 4QOFA 5FOVA 3JWIA 5JWHA 1G8HA 2FI1A 2CMHA 2VP2A 1Z4IA 2GAJA 4PRZA 1H9BA 5JNLA 4X8OA 2BKXA 2Y9MB 3I6ZA 4A6PA 4P93A 5CAEB 1NXPA 3MSCA 2H18A 4OK5A 3T7DA 2R6HA 2D2FA 3K72B 2XMQA 4LA4A 5C4GB 3GAFA 1VSVA 1BROA 3U1BA 4KRGA 4QTTB 1EWVA 3B38A 5IBRA 4BQQA 4EABA 2QI9C 1ZCFA 3LCCA 1JQBA 1SRRA 3ET4A 1XMJA 1J9ZA 1NTRA 2OCBA 2QJRA 2VJLA 4OHOA 4S2UA 3UJ3X 1A5ZA 1XZHA 2OFXA 4F5WA 4CW7A 1IQ0A 8GPBA 1NW5A 1ZDMA 1EVZA 3A4TA 1RAFA 4QG7A 3QLTA 3UJCA 5EG5A 5LMCA 2EKZA 4PWYA 2JB9A 1WSAA 1Z4PX 3O1LA 3PVCA 2GKGA 2AXNA 3T4XA 4GLBA 4TXMA 3IHLA 1LUAA 2ZBVA 3COPA 1O97D 3DTTA 3EGXA 4MINA 5BOSA 3MTDA 5FHQA 3BWYA 2LGJA 4Z54A 2FE4A 3QNUA 3T94A 4MR9A 1FEZA 3UAXA 1Z6PA 4GC5A 1JHXA 2W6ZA 3AP1A 3PDHA 2VTVA 5DWVA 3NKLA 5FAXA 4HAZA 4L0CA 5H3HA 1JIXA 1KDZA 1BQ3A 1OPRA 4DARA 2I8CA 4R1MA 2C2GA 1P31A 3KEQA 4IIDA 4RUKA 5FEUA 3KVYA 3GLGB 4IXMA 3L79A 4BP8A 1EQAA 1S2MA 1QHEA 3INNA 1P61B 2O20A 1GUAA 2AMVA 1JIJA 3RNOA 3ZZNA 1L4HA 5FUMA 4UHCA 3TD6A 4YX9A 1XA4A 3F9RA 4PGFA 5DHTA 1BD4A 5AW0A 1Z17A 1I5OA 3LUBA 4W5TA 3W5CA 4BUZA 3KEOA 4N8SA 2AI2A 1TDJA 4PSVA 2CFIA 4I9NA 4G1FA 3WLIA 4G0NA 4XCXA 1UFRA 1VMAA 2PZBA 3CX7A 1D2CA 3BAZA 3D0QA 2XF2A 1ISGA 3FYCA 1E8MA 1F20A 5BSUA 3ZEAA 3A2KA 4DCSA 1K06A 1OJ7A 3ICQB 1UC9A 3DBLB 1F8YA 4WQMA 5KYWB 1NR1A 4DY4A 4A0FA 2NZVG 2W6JD 4US1R 5F3WB 1KY3A 4NBKA 2YN0A 3FNGA 3BGOS 4PU0A 4PYLA 1NR7A 4CN9A 4F2WA 4LY6A 2JKVA 4B7ZA 2FKAA 3O6VA 4W8HA 5AOCA 1P91A 3LC1O 1OIXA 2EQAA 5KHOC 5ELMA 4W1RA 2EFCB 1XVLA 3B1VA 2CXQA 2QW8A 1EFAA 3GHYA 1TF5A 3TTWA 4RLHA 2MHCA 4L22A 1EZZA 4ZVRA 2IHZA 3DZKA 3FVRA 3QM1A 4JJEA 4PLFA 1QWOA 1UIMA 3IEPA 4X65B 1L7DA 4KXQA 421PA 3MHTA 4MR9B 1N2CA 2BTOA 4LJLA 3GZNA 4CG1A 3UPTA 5JQGB 3L7AA 5G0WA 3HY3A 3P45A 4FYXA 4N39A 1S8FA 3IQFA 3MD9A 4WBSA 3HMQA 3L6UA 4DCNA 4JI2B 2BI4A 2GNAA 3OIGA 4UNIA 1NX6A 3OJLA 1KE2A 3ZQJA 5CLFA 4CTNA 4LF5B 4XSGA 4GWKA 5CFPA 3AW8A 4KBGA 2HEGA 2PKQO 1Q1NA 4L7VA 3SGLA 5BR4A 4MYUA 1H8HD 4PGAA 4ZAZA 4F6CA 3O0TA 3K2QA 1FJXA 4E4TA 1YVPA 2FSFA 3KU4A 4RM2A 1LWNA 4Q4HA 1HT0A 3T4PA 1GFWA 5KYVA 2D06A 3CZQA 1RFGE 1FK8A 3FKSD 1GGNA 2F8TA 3M6FA 1O5OA 2EU8A 3H3JA 4RJTA 5CB0A 5KTNA 3LAWA 5I4IA 3NETA 2DY0A 1MNQA 4MPDA 1IIRA 2CNOA 5FFNA 1MIOA 4DLTA 4Y1GA 5C7LO 1P77A 1R6DA 1DV2A 1LJ8A 2V7TA 3AKDA 5E95A 5KYYA 4Q1DA 1L5HB 2HHHB 2I7DA 1OGJA 1THMA 1KY2A 1W6RA 5COBA 3TQHA 2ZIGA 3BZUA 3RJZA 1PD0A 1GTVA 3BFKA 5K3FA 4JT8A 3FW1A 1C9YA 3GY0A 3TOVA 4D9FA 1J4AA 2ZI5A 4LFCB 4Q24A 2DAPA 2JVJA 2Q3FA 3KUDA 4DWOA 2VQDA 4PG4A 1JA9A 2XQVA 3SYRA 4CDGA 4BY9E 1QO9A 3JVUA 4Y2JA 1M6HA 4HH3C 5ALJA 4XQ0A 3QYJA 4AWXA 1U2ZA 2AUTA 2EKPA 4KR3A 1EEHA 4Q9NA 2CHQA 3E0QA 3QI7A 1KO4A 1L3IA 1LQ2A 2ISCA 3NKVA 3PHHA 1XDGA 5EMKA 3C4VA 2PMWB 5AXCA 2DQ4A 4L6CA 4KXLA 4W8GA 5BSWA 4H18A 5AVYA 2P30A 1N8SA 4YP9A 3A31A 1VRCA 2PX3A 4MAMA 2HRCA 4N82A 2E9SA 3U7GA 1FY2A 3BSYA 1MV8A 4DCTA 2Z83A 5ELLA 2G0AA 2IWHA 3KKLA 1K75A 2XYHA 4HEA6 4PC3A 3KPYA 4PZAA 3P5BA 1KEZA 3SOPA 2A9OA 4ETMA 2RHDA 1P5JA 4P38A 4Q4HB 2V7QD 4XD7A 3LTNC 1H2XA 2HF2A 1I94B 4BYGA 5JCZA 1Q21A 1U9IA 2CL5A 4KZKA 4RA9A 3HEBA 5COAA 3VHRA 2JGNA 1WCWA 1Y3FE 1YZYA 3GH3A 1GXSA 2H16A 2XT0A 5A2QA 5EMJA 1A8PA 3EFBA 5HQJA 1PGOA 5J9FA 3GJSA 4IRUB 2H3HA 3GG2A 4TYYA 1Z37A 4DDHA 1E4EA 3R4CA 1V47A 4LCEA 3AFOA 3I9V6 3WK4A 1K4YA 2VA8A 1LX6A 2BLNA 4JOQA 2VUSA 3UZUA 4A0HA 3TQTA 5BVHA 2GPWA 4JJIA 4TSKA 4KJXA 1USIA 3M5DA 1SKMA 1RYYA 1TIKA 4F7DA 5DBEX 3VR5D 2EVWX 1JL3A 1NRWA 3UOWA 8ATCA 1C7EA 4RLQA 1R0CA 3TD2A 2QP9X 4NBWA 4DR2B 2NLOA 2VG8A 2HN9A 3EH1A 5NULA 1HT1E 4A36A 1FFAA 2J3LA 2W42A 2A3NA 3DEZA 3SX4A 1DUSA 4CE6A 2QRPA 2R11A 5LKAA 3IIKA 2ZJ7A 3WAGA 4G81A 5C18A 2IXEA 3D7RA 2E4VA 3HCCA 3L0BA 3QFCA 1U9IC 4H3VA 4KO8A 3HSKA 3FYDA 1UOEA 1D6SA 3UXEA 2D1TA 4UU1A 1BXGA 3E84A 2B2NA 4IV8A 1XXHA 1PL6A 2WU8A 5LDHA 4YUAA 3BXZA 4AX8A 4P3XA 3MTBA 2JFZA 2MU1A 3G2JA 4WZZA 1D6MA 2R7NA 4YHHB 3DW3X 5EZ5A 3T95A 4N5DA 4UNSA 3AU8A 3UXYA 4ENTA 1Q95A 2DHRA 2WWIA 2V1UA 3K70B 1RI1A 3IR5A 1Z5UA 3IB6A 1QU3A 4BLVA 5KVVA 2EOAA 1LTKA 3RRZA 1YJ8A 1C7JA 2V3CC 1MAVA 1XKQA 2BHRA 4NYJR 3ENWA 3OQJA 3VOSA 4ZEOA 4DIBA 1T3TA 2FB9A 2EFYA 1E92A 1NVEA 3ZBPA 2ISQA 3GVCA 4BFSA 4LG1A 1U5BB 1TTQB 3KL4A 4I9FA 4KNVA 2HJVA 5DX0A 4JQYA 4Q21A 3VFDA 3EW7A 4XARA 3GRKA 4J7AA 5EY5B 2R79A 3O1IC 4FMDF 1NXVA 1Y81A 4GH5A 3G85A 3JQAB 4Y67A 3T0GA 4DRXA 3ZY3A 2MYUA 4JUAA 1T2FA 1QZTA 1ZCBA 1ZJ5A 2XYRA 3GLHA 1XVVA 5HYVA 4R8VA 2CVHA 2QMZA 3S1LA 4IKOA 3FFWA 2C9YA 4IDQA 1TIBA 3KSDO 5IKXA 4D45A 3L0SA 1A82A 1FPQA 1H2HA 3IQDB 4DCJA 2VF4X 2K2QB 5EHIA 2ZJAA 5DULA 5AM3A 4HZIA 4EJSB 1SHKA 4QLBA 2P3LA 1K8YB 1ZOPA 4IXDA 1O03A 1N0IA 4N48A 3H86A 3T1VA 2EXXA 5ELXA 2HA4A 2GKSA 3OZCA 1OLOA 4QGAA 3SXPA 1JIVA 4KPUA 3TYXA 3X1MA 1T4CB 2RSLA 1ENZA 1XROA 1KYWA 2CB9A 1V4BA 1AGYA 2QOEA 3B48A 3LUAA 3MTAA 5ADVA 1P8AA 3CG4A 4WA7A 4UUPA 1KDVA 1S3IA 4HDKB 3USES 3ILXA 1VIVA 3M6AA 2D3TA 4G5OA 4LHYA 1GZ3A 2I4OA 3EYWA 2QGZA 4GRIA 2VYVA 1CUJA 4KREA 1CB7A 1E0SA 3MWYW 4L5JA 3JQEA 1TM2A 1HORA 4ME6A 1KZGB 4DY6A 5KNCA 1LDGA 3X1XA 2HW8A 3PQ4A 3L4EA 1E1QD 3AOGA 1YVUA 5HEKA 2QXUA 3S3TA 2PCLA 1O96A 1L8OA 5ER9A 3VUEA 3U49A 5SY6A 5F23A 1EAMA 3H1TA 4N8EA 4TZ0A 3AL3A 4BZPA 1C3VA 2J5QA 3MYYA 3T5GA 2J31A 2OV3A 2JAOA 2Z2JA 3M5CA 1V2HE 2C3MA 2NZWA 3MS7A 4H1UA 1R0YA 4BV8A 1WHSA 2Q49A 3FY4A 3HBJA 4GICA 3E9CA 3TMAA 1HFKA 2D3WA 1AXEA 3TZCA 3R5XA 4KTTE 1ARZA 2X41A 1L1EA 3RVDA 2ILTA 3L4KA 2BN4A 1CP3A 1KMQA 3DC7A 5H3CA 3UEOA 3K9GA 2C95A 4LQ4A 4P9NA 3F3KA 4NNJA 4CR6A 1UR5A 3BWEA 5IF3A 4OL9A 1PSWA 1AO0A 3HUFA 2AFHB 1T5OA 2WSSA 3N05A 5JG7A 5IM5A 2V3VA 1Y4ZA 3HG7A 2EYUA 2IX9A 1TU0A 1P2GA 4IJUA 1CHNA 1YZQA 2JFQA 3EC2A 2EAUA 3VC3A 4XW2A 4O4LB 4CTMA 3H11B 3VZRA 2GN0A 5CR9A 4BEVA 1QGED 1UKBA 2FFBA 3SC2B 4X1YB 5BV7A 3SJUA 4IHJF 4PHCA 4WY5A 4Z4EA 2PS3A 1OW3B 1FDIA 2IZ1A 1UDBA 2PWYA 2JANA 3IP6A 3KWFA 3PEUA 2PL9A 2Q4RA 5CBKA 3R1IA 4DBLE 5A3RA 1U4SA 2UYYA 4LMBA 2XOEA 5EE3A 4R05A 1LZLA 3QWFA 5JS7A 3OD5A 1CV2A 4R69A 1KAHA 3K94A 3FH0A 5ABPA 4MUIA 1NMQA 1PWYE 4N01A 4IS3A 4JKYA 1H2WA 1ORRA 4IWXA 2X8WA 1COWD 3D5QA 1FBNA 4MQEB 2HWUA 4JSRA 1S8NA 2RHWA 2A0FA 4EVSA 2XOKD 4RYDA 5E1OA 4U7DA 1OUMA 2YWFA 4RAQA 2CL7X 4RF2A 1MABB 2A86A 2I87A 1YJXA 2VH1A 4D26A 1KZ1A 2YS7A 3A9CA 1AHIA 3P9QA 5IN4A 1Q1GA 5IJ0A 1VLQA 1M2OB 1XTSA 4Q3CA 3GGJA 4WEQA 5KNDD 3S8EA 4LF7B 2V7GA 5AW7A 3HGTA 2I6XA 2O7VA 2WQZA 3DDNA 4FYYA 3S2SA 1KH3A 2JFVA 3PUWA 4QULA 4ZYUA 1S7CA 2HA3A 2WKSA 1M2VB 2ANBA 4GEGA 4LDPA 4C2BA 3O4IA 3I62A 1E58A 2V6IA 1PYOA 2XB2A 2W2VA 1F6DA 3FNHA 2CL0X 3TL3A 2IH2A 1EIZA 1FTSA 1NMZA 3CEJA 5KKNB 1ZM7A 1U90A 3KR1A 5DHQA 4EQ6A 4Z51A 4L2IA 4X85A 4MGHA 3U9SA 3LDGA 2Y27A 1P9OA 5I7HA 3PFIA 3R8FA 1II9A 3WRXA 1RCFA 2P3OA 2VHZA 3W6OA 3WO1A 1G18A 2BFOA 4EB6A 4H6PA 2BY4A 1QHGA 4YUYA 1BFUA 4AUEA 2VPPA 2BWJA 2IQIA 2W6QA 4IL5A 2QF7A 2WTBA 4MZDA 2ZB4A 2ZREA 5G3ZA 5A3SA 4EW2A 3FDZA 4CI9A 1J2TA 4JBLA 3VNUA 3LWBA 4EYQA 4O4HF 2NMVA 1ZC4A 1GILA 1ZVKA 2NV6A 4UEQA 1QRAA 5H59A 1ZVQA 2EF1A 2FFJA 2LZ0A 5EUQB 3V2GA 4QBGB 1T9ZA 4BQIA 5A5VA 2YXEA 1DE0A 2QLJA 3W9YA 1XHFA 4CV2A 3PX3A 1JHDA 4PLHA 2IEYA 4D5EA 3M6LA 4Q4AB 2DH5A 5BYKA 2EEPA 2B30A 5EGSA 3THXB 1CQIA 1RIFA 1V48A 1ZXBA 3V1TC 2ZBRA 3G79A 5IAOA 4M9RA 1CYEA 2C92A 2FW7A 5C7OO 4KFTA 4HADA 1PX2A 2YFYA 3EXIB 3X1YA 3H5WA 3OX1A 4HJXA 3ZJ4A 3MFYA 4YGYA 3ZV5A 5B1EA 2ZUFA 2NQTA 4RFLA 1A8SA 2EBWA 1DG9A 1WOYA 4REMA 1YCGA 3S5JA 1Z26A 4LZNA 1PT9A 2WSYB 1O96B 1ZUD1 2QTRA 4LXQA 1C4KA 1S1MA 2JLQA 5IYZA 4OQDA 1HEYA 2XVYA 2QTHA 1GITA 5EJGA 5E6RB 1D03A 3DNPA 1E9FA 1SK9A 2GCNA 3MCTA 4GX5A 3TRHA 2XNDD 2ZYTX 2ENUA 2E4WA 2ODQA 3B2QA 2NG1A 3UQZA 4C0WA 2FMTA 2YIMA 3TWOA 2XKKA 4I5FA 3OZDA 3AHDA 3CR3C 1ZC3A 4D3YA 3MG9A 5IJ0B 3TLJA 5K0JA 1QIKA 1RJWA 3NWEA 2J33A 5JSKA 5IXYA 1ZP6A 3B5IA 1T2NA 3GBSA 1KNXA 2B78A 4NCXA 1H0SA 1M0WA 4WPGA 5KAMA 5AOAA 4ENRA 1F2VA 3UK2A 3D43A 3DW1X 2VQ3A 3I92A 1HSZA 2BELA 2TMGA 1D4FA 2HSGA 4GKVA 1R0XA 5BV8A 3HRHA 3BXOA 3P8ZA 2EJUA 1JFVA 1HOTA 2FZKA 2VWPA 3BWDD 1JT9A 3QX8A 1JE1A 1JIQA 4CDRA 1L5QA 4WBNB 1GPH1 1SZPA 1RJFA 1POXA 2G5CA 2WF8A 1F5SA 4GVLA 4IHJB 2DQSA 4PTYA 5JDIA 1Z7BA 3N70A 3B85A 1V6AA 4U9IS 2V6MA 4L9SA 3KCQA 5CM9C 1ZW1A 3GQVA 4N6NA 1T5SA 4LXGA 3LRPA 3OPVA 3MWEA 4G5RA 1O87A 2Z4RA 4KMOA 4WZBB 3R7NA 3RBZA 3W4KA 3VH1A 2G28A 2JDID 4N7BA 3FOAA 4UQPA 1IJEA 1UP4A 3WLSA 1T6XA 1A9OA 3GXBA 3U7IA 5EERA 2FSUA 2C5LA 4L9WA 1CJTC 4R1NA 4B6JA 1U2DC 1M34B 4P7BA 4EY3A 3DE1X 1CQPA 3G2PA 2W2KA 1JJAA 3MQFA 1HFWA 4IRMA 1LPNA 4XVCA 5ALQA 3ZDBA 1JJBA 3O8DA 3O2JA 2ETVA 2JLCA 5KS2A 3CEPB 4HN4B 4NG4A 3B1ZA 2A4KA 3BTUA 1HDRA 5GWXA 3QSYA 4X95A 4EG7A 2AFHA 1OX4A 2A59A 4MWZA 1G38A 1ISIA 5A02A 3AFIA 1PJ2A 1ZD8A 1HH4A 3LWNA 4JVMA 4WLVA 2AR0A 5FQNA 3FNQA 1KYYA 3W5DA 3UWKA 4OMDA 3ELUA 3TRDA 1PKEA 4GHWA 5FTLA 4DIDA 1BXGB 3JWGA 3L0OA 1CUAA 1F2TA 4XX0B 4EJ6A 4TN5A 3VH2A 2GNPA 4B3FX 5IX8A 3BXFA 1MOSA 1XD2A 5FOUA 4F11A 4DV0B 3PFCA 4KX3A 3R8CA 3HVKA 3GJTA 3MCAA 3SFZA 4BNZA 4D41A 5EJ5A 1E20A 4MWOA 5CFOA 1MNAA 2VOJA 1VZ3A 4H7IA 3OZTA 4D42A 1XHLA 4PLCA 3B1YA 2RH4A 3CURA 2Q5JA 4DJAA 3LHIA 3LNTA 1SOVA 3TTTA 3TQRA 4B3DA 3WQSB 5EKDA 1MJFA 3IVRA 5GPBA 2OYRA 1MORA 1ZK0A 4ER6A 4DNOA 1RMQA 3MQ4A 4C0LA 3CW2A 3HB4X 1YBVA 1HL3A 1A9TA 2VT7A 4QOHA 3I9JA 5B1HA 4O1MA 1JDBB 5B3JA 3SBDA 4GUAA 4CQJA 1W34A 3B8EA 4LS3A 1QHHA 2JH8A 1UF9A 3FPFA 1BYUA 4V38A 4D8WA 5DNEA 3V8EA 5LZ7A 1H23A 3B89A 2CYCA 1UT6A 2E89A 1LJLA 1ZN7A 2R1VB 2ZJ8A 4R8RA 2FSIA 2Z08A 3TZEA 3ZTWA 4CKYA 4EJMA 4L4YA 2W2NA 1WB9A 1EJBA 1BMTA 1BWSA 3EHEA 1Y33E 4NQRA 5BVGA 3ORFA 5AVTA 2EWVA 1V2GA 3GNLA 5IVDA 3UW1A 1JMVA 2FPKA 1M74A 3I53A 2BH9A 2OO5A 4TMYA 2KE5A 5HIAA 2RGEA 2ZDQA 5TPWB 3OE7A 5M2QA 3RJMA 1QAMA 2QD1A 4PYQA 2CF5A 5KBYA 4AQYB 4GXQA 1SKAA 1T13A 4OBBA 3JRNA 1ONBA 4WXMA 1UP6A 4E13A 4OHXA 1R7RA 4UE3S 2BGIA 4UMEA 3VGJA 4ZDJA 2VQ6A 4XJVA 1U5AA 3REFA 2KS6A 1G8MA 1XDDA 1HEUA 4MKRA 4P7GA 4TS9A 1A5SB 3CW8X 3WAJA 4TZ6A 1TZCA 2NV0A 1A4RA 1JFSA 1V8OA 5D86A 4B9AA 2D2EA 3RC3A 5GM2A 3QUTA 2E5FA 3CJRA 4JJ8A 5LNK6 3K16A 1VB5A 1XZAA 1YNOA 2JS7A 2OCXA 3A25A 4EA8A 3KTDA 1FYWA 4OHFA 2W6PA 3E15A 5B1SA 5KTKA 5GZ1A 3WHKA 4B47A 1OF1A 1Z6ZA 5A0FA 1MKYA 4JS0A 3IDQA 2P9YA 4M98A 2VLBA 2FYTA 4RF4A 3WNDA 1E3SA 2YMQA 5EUBA 1SVSA 5JSHA 2JARA 3TTSA 5KYYB 4KVFA 2GJSA 4AF7A 1W48A 3ER9A 4YASA 2C8KA 4R3UC 3DMTC 2D7CA 2GARA 3ZHBA 3MINB 3GLQA 3IT3A 4KIUA 1YJ5A 2ZT7A 4FBMA 4D0SA 1F6BA 4EUKA 5CNMA 3UCXA 2FSGA 4IQGA 1EB8A 2IW1A 3FHTA 8MHTA 2QDKA 1I3CA 2VHYA 4R51A 3ZCVA 4OFWA 1MQSA 3O5AA 3Q5GA 1ZIOA 2TECE 5BWOA 4PNHA 2RGGA 4GE0A 1R9MA 4Y9TA 2XF8A 1FQKA 1D0IA 2VJYA 2ODTX 1GVHA 3GW8A 2ZPTX 4XYEA 5DTEA 3PFNA 3V1KA 5IJWA 3ZWDA 1GGEA 1WSWA 2C0QA 1CUIA 2REBA 3IJEB 4MI3A 4PICA 4Y6OA 1XD8A 5E0OA 1FZTA 4PBRA 3GMTA 2BMJA 2IZ5A 4ARIA 3EIOA 5ICFA 4WLOA 1OGYA 3MW8A 1YFLA 4IKEA 4MH0R 1EQ2A 5T64A 4F3RA 1JSXA 2BR5A 2C4MA 2G7MC 4HYQA 1BHJA 1GG5A 1X2BA 2OUIA 2QRNA 2W37A 2WJ4A 1GADO 4HWOA 1L7VC 3HKBA 2PGIA 3V4LA 3P2EA 4A8HA 1RM5A 2ATIA 3QVTA 1B1AA 2D4HA 2P6RA 2OTCA 2I4LA 3D8RA 1UPBA 4HWRA 3VSEA 1Z4NA 4EY8A 2CV0A 3OP1A 1LV8A 3WADA 1O6ZA 1Q0SA 3KB6A 4A73A 3DEYX 4XUCA 4DXHA 4HYYA 4ZP1A 1X87A 3OZWA 1BDIA 4RDHA 5SV2A 1YI1A 3DWFA 3LX6A 1YRWA 4NNPA 3EJWA 3S7ZA 3U39A 4C07A 3W2FA 1FDVA 3NC1C 4PAWA 4LE0A 4NTZA 2F55A 1SWVA 3MGAA 4FT4A 3GNTA 2JCBA 4Q9HA 4BNXA 4RD6A 1G64A 1Y0BA 1LK7A 3CXUA 2JZCA 1AIPA 5H0IA 4M1TA 1C7QA 1UKCA 6LDHA 3DAPA 1QVAA 3ONWA 3ZHSA 3FZQA 5HJ5A 1ZR4A 1KP9A 4G01B 1PZFA 1BHSA 3TNDA 4O2BA 3PEYA 3CVUA 2BP7B 1ID8A 1M2VA 4UE2A 3HV0A 4J3NA 4WXPA 1MRSA 2P62A 2VEOA 2XH8A 3AETB 4II3A 1K92A 2PRJA 2DFKB 2NO5A 3BJEA 3EMDA 3L8EA 3LDAA 1S89A 1K6XA 4NIMA 3IHWA 4PCAA 1K8QA 2BM8A 5TPZD 1PV2A 3FLBA 3DPUA 3Q5EA 1SK8A 3IBGA 1VIMA 1E7QA 3HV2A 3KG2A 4HV4A 5FV4A 4GIBA 4IFIA 1CJCA 1TYCA 5AIAA 4Q7QA 1NN1A 3LT4A 1ZI6A 2XR1A 4X7MA 2BHLA 2XWSA 2JJYA 5K8CA 4JI4B 3SCZA 4V3CA 2V7PA 1NUSA 4HXGA 4LVOA 4WKOA 3RKUA 3IQHX 2PGAA 4E4YA 4XFKA 3U3KA 5LB2A 3A9SA 1RQ2A 3GA0A 1QIGA 3TJRA 1Z7GA 5KNLA 3RQIA 1YFZA 4MA5A 3TNFA 2J0UB 3VR2A 1KEEA 1ITZA 1KY5A 3RIXA 4KN5A 3KJQA 3PC6A 3JY6A 1S6YA 2C9MA 2B4RO 1G8JA 1YJBA 2XGSA 1CS0A 4MQ4A 2IS4A 5ECWA 1FX0B 4AJKA 4JP1A 1FNSA 1ESEA 3NBKA 1UBOS 1MOPA 1OV4A 4HHEA 3W8FA 3WBKA 2P5SA 3JAWA 3OZIA 2JJ1D 1RWBA 2I4RA 3PEFA 4BEBA 3RADC 1QHHB 2VT3A 2BM0A 1F3LA 3GFTA 4MDYA 3UKDA 1Y4SA 2VLIA 3K09C 4YJGA 5LBIA 1IY1A 1P0CA 1R8YA 5HUQA 5K5EA 3EFHA 2WSMA 1QCZA 1Y1TA 4QTXA 2GEFA 4D81A 3ZY4A 3BL6A 4ILKA 4IWYA 2E85A 4UPVA 2PE5A 2IYVA 5BN4A 1M7HA 4OSPA 4CF5A 3GIWA 2P75A 1T6ZA 4FEGA 1ZGZA 1B3RA 2C61A 3IP3A 3NM5A 5JCOA 3TKYA 4DCCA 5ALSA 1ZHHA 1I80A 3OO1A 1WHSB 5AW4A 2X0JA 6CHYA 5JPCA 5KEIA 3I0NA 1EAYA 4CDMA 1UDWA 1CUEA 3WYDA 1G3MA 1EX9A 1XO1A 1FXWF 4C6HA 5JXJA 3QG1A 2WA2A 3BQMB 2BP7A 2B8EA 2EG9A 1BTOA 2B61A 2WVJA 2XX3A 5EFZA 1QCDA 3K35A 3Q1KA 4IM7A 1VPTA 1G41A 4D2IA 1F5NA 1P2BA 3GMSA 4BN4A 4PPQA 1SCBA 3ZW9A 3CIFA 3WKBA 3F9IA 3LRTA 3IH5A 4J7XA 2R86A 3VISA 4ZJYA 2Z57A 1XNRB 3PQEA 2YNMC 2WMDA 2AYYA 2I6GA 3WICA 3MOSA 1F2UA 4G4SO 3CUWA 2PJRA 3N8GA 3F6EX 3R8XA 2CZQA 3FPHA 3U5ZB 4RIFA 1APBA 1ZI9A 3CNEA 1I36A 3DAGA 5DBGA 5LOVB 3WMGA 3ORHA 1VHLA 4R41A 1ADBA 4BIIA 5L3QA 3GRAA 5BRAA 2ZYVX 2GZ2A 2C58A 2ZR0A 4MI6A 3R77A 5IW8A 5LBUA 3IPLA 1SBIA 3FCAA 3PC8A 3WBBA 4B6GA 3D6NB 4XM1A 3WIDA 3KKZA 2B4QA 2SCUA 2ZQYA 4R5HA 3U26A 3WYFA 4HUQB 3HFRA 1GYRA 5ADWA 4FZRA 4QXAA 5EE5B 1A7UA 2CXPA 3B7GA 2ONKA 1AOXA 5MN5A 2BPOA 2KPOA 3T8YA 2KJQA 1IN4A 1UT8A 2WG0A 4YAEA 2ORED 4R8MA 3DMGA 1HV8A 4V24A 3OU7A 5K0LA 4PC1A 1E9EA 3EJ6A 3KKOA 3ZDZB 1YBFA 1NE2A 2X1HA 3DOEA 2YVUA 3ICVA 3T9CA 5KI6A 1REQB 4MYDA 4LV8B 1KEPA 2CNNA 3LX8A 4GP6A 4HB2A 4RIEA 4R2HA 1NYRA 3C3YA 4CGYA 5K6AA 1UL1X 3KR9A 3TVTA 4ZZ3A 4CIBA 2AYXA 1O95D 4Q4DA 3I72A 3L4BC 2D1YA 4J94A 2ZBQA 4LECA 1AKNA 2XVXA 3I6QA 3HY4A 4H7EA 5LN1A 5AXDA 3ZLTA 5D3KA 2WINI 2AQIA 3KJFA 2A1UB 4P0TA 1DFHA 1QG0A 2OVFA 3ASZA 2D1RA 3NT4A 4ZV7A 4BDTA 4NAHA 4YQYA 3HBMA 3KQNA 2DWOA 2H57A 2R6R1 1SKUA 2IGTA 1NW4A 4B8YA 3UMRA 3ONNA 2OFOA 1CVRA 4KKXB 2QUKA 2QM8A 1V39A 1TU4A 3HP1A 4L8VA 4KHZA 3WQHA 3VO1A 3FI0A 5KSOA 5FORA 1C8KA 3EVGA 4TQGA 3LKVA 2W8BB 3PGXA 1OXKB 3BTVA 2Y05A 2VNKA 5ALOA 3GXOA 2WY2D 5K1ZA 5DHRA 5B37A 5BO5A 1UPFA 4MULA 5F2EA 3MWFA 3UFBA 4J43A 2KBFA 3VJKA 2ZSEA 3RYCB 2GPJA 2Q4DA 4J4HA 5E38A 3RTEA 4JVNA 1YB1A 1VP3A 2GZ1A 4NENB 1CQIB 4XPIB 1QDUA 1RU3A 1SBZA 1V1RB 2ZRFA 3D0KA 4OGLA 4UE6A 5HJ2A 4NZNA 4UDOA 4ASUA 1XU4A 4GP9A 2JLZA 3T7TA 2UUCB 1LA2A 3ZXXA 4MVJE 3EF3A 5SYMA 3K6SA 2VZLA 4A4DA 1D2MA 3GELA 2FVYA 1U8AA 2DQKA 1EQUA 5IKPA 4I1RA 4AJ9A 3ZCUA 3VV2A 4PQFA 3DB2A 3B20A 3PA6A 4CBVA 1R18A 4MAFA 5ALLA 3IESA 3WGNA 4DMKA 4E07A 2XMRA 4HEA1 5F76A 1W9HA 4RD4A 4TKVA 4XIIA 2CLMB 5FTWA 3CUUA 1FMTA 3KOYA 2IYNA 2DPHA 2VOEA 4PFQA 2B1IA 2PFKA 3KJIA 4RZ2A 5A4KA 2LBPA 3G89A 4HGNA 2QQ0A 3FFBA 1DKOA 3HZOA 3FDIA 4FGUA 2RH5A 3PHJA 3QF4A 4TOIA 4PYKA 1ZKDA 4KN6A 1MF7A 1R66A 2UVQA 1Q0PA 4J29A 4TVBA 1BCSB 4XWTA 5FO0A 4XVQA 4RGQA 2CLCX 3UTDA 5CFZA 3OCXA 1G5FA 1T0HB 5TS3A 1LWOA 4Q1VA 3BOSA 4EO9A 5JZSA 1Z5NA 1GQYA 1IY0A 2IUYA 1IEXA 2J7KA 5CNIA 2C07A 3RS4A 4MYRA 3D3QA 3TZHA 1FDSA 1K7YA 1KJ8A 2VWGA 4ZRNA 2R1ZA 3BRQA 4CM8B 2PUDA 1C5KA 1P3JA 3FNRA 4ZV9A 3OEEA 5AUPB 3ZUGA 4B4WA 1C4XA 3Q7TA 2GLUA 1KC3A 1SBTA 4FYVA 5IF9A 1EVYA 1SO8A 2WF6A 1P9NA 2Z04A 3AR9A 1ACMA 2CVZA 5JO9A 3MHPA 3WC4A 4KUHA 1A27A 3FVTA 3GARA 4CLOB 3IP7A 1ZBDA 4ESHA 2GJ4A 1H0KA 5I6DA 3WJ2A 2BTQA 3UYKA 4DL9A 1YZFA 1WXGA 4NBNA 4ITRC 4OHUA 4WKNA 4BO8A 3H2SA 1F7UA 5M3BA 1NNLA 3IAS6 4YFYA 3SXUB 3L8HA 2YV1A 3F5SA 3SE0A 3UOAB 2MSCB 4WEOA 1AGXA 2Z3WA 1QHXA 4GQIA 3EVEA 4O4IF 2GJ8A 3RFUA 4CKCA 3K9QO 5C8VA 4I0WB 1KJYA 1LZKA 1QK3A 5KDOA 2Q3BA 3ANNA 5KTYA 4Z53A 1DVRA 2X5OA 4IJWA 4IYJA 2Q4BA 3ZGNA 2HA5A 3UJDA 4QO8A 4KR2A 2H00A 1G55A 1O58A 2FUNB 2P2DA 4JIGA 3NASA 1OY1A 3NUQA 4YRDA 4DREA 3PX2A 1COZA 1EFVB 2HHJA 4ODIA 3IEVA 1HFEL 2ZPUA 4K87A 3OX3A 4XYBA 4O4LA 2Q2QA 1Q6ZA 3RIMA 2OFFA 1O54A 3BSSA 4TL8A 5AT1A 5FBRB 4EY7A 4Z9YA 2FF7A 2R87A 1H4TA 1UK8A 3NHBA 5F73A 2VNIA 3V9AA 1KJWA 1T6YA 2ZYUX 1NSTA 1YHZA 3E7DA 1T4DA 3H13A 4HP8A 4IDNA 1KXZA 3FETA 4LC0A 4S1PA 3TNLA 1MB0A 3P96A 3CVOA 4M9UA 2NZXA 1LRKA 1N7GA 4OP3A 5JECA 3LK6A 4ZDIA 5JEEA 2WMOB 1XPUA 4YGXB 1KVTA 1NM5C 2H7YA 1RXYA 4BGIA 4Q5IA 1OH6A 3G2OA 4MCAA 1NSYA 1H4SA 4O4IB 3UWOA 3KAKA 2FUG1 1SUIA 4ZPXA 3V8VA 4DV7B 3ZK9A 4B40A 2PGDA 4WERA 3ZV3A 4QPDA 5K8TA 2C83A 3NJ8A 4DDUA 1XC7A 1U2PA 2BTEA 3EDMA 3DSRA 2HA0A 3BRWA 2HL6A 2NNLD 4CCSA 3UA3A 2F1HA 2GA9A 3N2GB 1X39A 2I65A 4I46A 4CN8A 2WKWA 1ZWKA 3FYUB 4L08A 2CB0A 3HRKA 2C3YA 1QS0A 5IEBA 1W4CA 2XKAA 4P4LA 2OUKA 4C0SA 3QWHA 3PJDA 2BC9A 3SPXA 2AJCA 5A4IS 4HGOA 2CN1A 1Z4MA 3O8BA 4BVBA 1B43A 1FU8A 2VYQA 3GEEA 2NM0A 4DLWA 4LYFA 3D4OA 1EX6A 4C7OB 4LYGA 3K5HA 4QXOA 3VO9A 2EDAA 3MJHA 3ZIAD 1QP4A 1G7SA 3RVRA 1X8XA 5FT9A 1IN1A 3WGQA 1A88A 1BXRB 3VR2D 3CHYA 2C77A 5IVHA 1ECGA 1O8CA 4YH1A 2GN6A 2XB9A 2ZRKA 2J6CA 4YCMA 2ECOA 2A0UA 2VNJA 4MV3A 1PZMA 1WCIB 1PJCA 3FF4A 2AOVA 4NABA 4CIVA 2ACKA 1NBHA 2M98A 2DCMA 1T8WA 4N7JA 2RGAA 5KWIA 1JILA 3FKJA 4IRXA 4KLRA 2PUWA 3AM1A 1FQOA 2LDBA 5K6RA 5LD2C 2FNAA 1JG6A 1F17A 1G9XA 1NFQA 4KQHA 4GNKA 3K2BA 5KNBH 3GLGA 1H2RS 3AQ4A 4LI0A 4Q3NA 1VQ1A 4HWPA 1S8OA 1UFVA 4MHOA 4CIAA 3AI1A 1C0LA 3NWJA 3EZLA 2OM6A 1G66A 2Z6VA 4QREA 4EM6A 4RX1A 4ZVLA 1XTTA 2YVLA 4FEEA 3KCNA 4PQGA 4OQZA 4X63A 5L51A 2QBYB 1H66A 3F47A 3M6MD 4YONB 2YBDA 1W4RA 4IGAA 4IZOA 1C30B 4RAOA 1ESMA 1NW7A 2NO6A 3PQCA 4IDEA 3R7AA 3WI7A 3L0CA 2AZDA 1S9DA 4CMEA 5AQ1A 3L7KA 2IPLA 1I2ZA 3RJ9A 2REOA 4RDXA 1EGVB 4IQ4A 4NZZA 5JCPA 4QDXA 2W58A 2QRVA 2X4IA 2XOXA 3ACCA 4DC0A 1J97A 2KBEA 3HJFA 1XPJA 4KDFA 5ITWA 5M7EA 3G2HA 4ND2A 4LTNA 3KPWA 5HQTA 4I8XA 1X7HA 1FC0A 1PGQA 4U6QA 3BZBA 4E6EA 3G5LA 1PBNA 3NWBA 2IUFA 4LW8A 4HQNA 1QVWA 4YRBA 3T3MB 3KR0A 2Y1EA 3SVLA 4A1OA 4GWLA 2XPCA 2R9VA 1QFJA 2FGKA 4FFOA 1ODKA 3EMBA 4U5XA 3DDHA 3OESA 4GWGA 2O0HA 1KEVA 2ZJBA 3M83A 4DZZA 2HU8A 3AXTA 3OT1A 4CV1A 1ADFA 1G98A 1LVHA 1E6CA 1IBRA 5BN5A 5KVSA 4EJ0A 3QF7A 2BE7A 3I04M 4FWTA 4AMGA 1E7MA 2C8VA 3UWDA 1U4OA 5GM1A 2FR0A 2BEVB 5CM2Z 1XKLA 1Y1QA 3PGMA 1GZVA 2HMUA 3SVZA 4JXZA 2IYSA 5G0VA 3AIOA 4CM6A 3OOWA 5DB4A 1P2UA 2QYHA 3LCRA 1EFKA 3FOEC 4MTCA 1FSPA 1RABA 4UD2A 3KAPA 3MELA 4CLRB 4X94A 2NO1A 1XYYA 2ENWA 2PS0A 1YDGA 3D4BA 5LZ4A 4QX6A 1HNZB 3U7FB 4AYXA 3Q8XB 4IWNA 1FF9A 2X7JA 3CRMA 4XEUA 5B3AA 3W5UA 4KL8S 4DSUA 1KRXA 1TK2A 3TG2A 3GC6A 4CT0A 3X43A 4KAXA 1XZBA 5H70A 3G59A 4YPOA 1T4BA 3E9NA 3UOGA 3SQDA 5KNDH 2NXWA 3BIJA 3HJTA 2K4MA 3GUCA 2PLRA 4PAGA 1KOFA 2FX5A 3Q3EA 3ZIUA 2GPYA 3UHPA 3SOZA 4KXUA 3UG7A 4FKBA 2J59A 2OD7A 1ZM3A 1BRTA 1KU6A 2GPSA 2QJFA 2YCLA 3AF1A 4ZEVA 3L6OO 2WRZA 3SQOA 2PXHA 3V4PB 3WBJA 2XVZA 3MWEB 1MO5A 4XI9A 3TB4A 4CLHA 4ZCRA 4P4SB 3IR6A 4YI5A 1YFJA 3L7DA 2FP4A 4ZCLA 4IG9A 1YAJA 2I66A 1R9NA 3A6DA 3OHSX 4NARA 4M21A 2I2BA 1EXNA 2AFVA 3HU3A 1DNPA 4OBXA 3L93A 3UV6A 4ZHQF 3NDBB 4AZ0A 1BOFA 4YLEA 5KJCA 4G67A 1JLRA 2RG7A 4QAJA 4WGGA 2IH4A 1P6QA 4A7PA 1M54A 5CDSA 3WB2A 4AJJA 1RZVA 5JMPA 2BFNA 4FWIB 4ZWNA 5BN5B 5I7VA 5K0EA 4HWGA 2DVMA 2ZRLA 1IHUA 1IHYA 4L57A 3QE2A 3H4VA 5JXWA 3KVOA 3D0RA 2DR3A 5FTJA 1MJGM 5LA6F 1QX3A 2W11A 1CDZA 2W6MA 1L5HA 3IA2A 1IXSB 3G5AA 3IPYA 3M6VA 2CJFA 4GDMA 4WGFA 5KOHA 2OGSA 1X1RA 4YIKA 4BGDA 3O31A 4ZQCB 1I7NA 1DIAA 4DYVA 3ANLA 1DB3A 1CDDA 1CY8A 2G7ZA 2CHVA 4HWTA 2YXDA 4EA9A 3E35A 3DPSA 3NHLA 3OQHA 4XUGB 4FMBB 4PZ9A 1Q14A 4YMVA 3WNCA 5KB3A 3IPRA 5IXJA 2DG2A 3AHFA 2XE6A 4LTDA 1C14A 2YIDA 3E1SA 3Q0TA 2FN9A 2UVPA 3NNSA 5FA5A 4MB0A 1JTVA 3TR6A 4GRDA 3RCBA 1QQBA 5MHTA 1TD9A 2Y1XA 1GNSA 4M1KA 4LNUB 2QSZA 3RI3A 2H59A 1QLJA 2FR1A 1X1QA 3MLAA 2ZIFA 3TL6A 4EOGA 5L7WA 1M8JA 1W2WB 3TLGB 3IODA 3WRYC 4BMDA 2KM1A 1IWBB 4DV1B 2FWBA 3R3JA 4L95C 1EFPA 1B4DA 3ANYB 5HKKD 1Y3CE 2JKYA 3C5HA 2O8BA 4XOIA 3L9XA 3CLKA 3TSYA 3UCEA 1JR6A 2WHRA 1IH8A 3M7IA 2JRLA 5B30A 5AYVA 2BGGA 4YREA 2EYQA 4OI2A 2XKJE 5C8ZA 2WNIA 1TB4A 4XWOA 3MTIA 1R6BX 1WQ3A 3O8QB 3KOXA 4G26A 4DRZA 3PT9A 4G8BA 1XZGA 1OSNA 2Q6LA 3A1UA 3CKMA 2WJPA 1QPGA 2XRFA 4FFPA 1BG6A 2IDJA 4II2A 3ZDCA 3KTAB 3JQQA 1C7FA 2HHLA 4FHCA 5IDWA 3IV6A 5KTSA 5CCXA 1KO8A 4MUYA 2GUGA 3EZ2A 2PVPA 1NAIA 1DCMA 3LQRA 1WCIA 3AVOA 3NAMA 5BW4A 4YDSA 1XR3A 5CVDA 3OM1A 2HU5A 1VPWA 3RKSA 1VRVA 2W8ZA 2OYSA 2O6HA 2SHKA 4M38A 4BPRA 3ECCA 1A76A 1AG9A 1R10A 4B48A 4F1KA 3P2JA 4KPEC 1U11A 1WTCA 1GCGA 1PHRA 4QUJA 2CMDA 1DXQA 2GO1A 2QXTA 4OJKA 2XTAA 1IDOA 1U1EA 1JUDA 1R4NA 2RJ3A 2ZBPA 1G59A 5FPTA 3B78A 2BFFB 2WYVA 1L5RA 3CRNA 1YS2X 3JASA 2W2LA 2BFDB 4RY9A 4MIOA 4Q82A 2LR0A 2PL5A 5T8KC 4OXQA 2NZYA 3AJAA 4IO0A 5E6UB 4DLZA