4BKOA

Enoyl-acp reducatase fabv from burkholderia pseudomallei (apo)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
LVPRGSHMIIKPRVRGFICVTTHPAGCAASVREQIAYVARRGPIERGPKKVLVIGASTGYGLAARIAAAFGAGAATLGVFFERAPADAKPGTAGWYNSAAFHDEAAARGLQATSVNGDAFSDEIKHKTIDAIRRDLGQVDLVVYSVAAPRRTHPKTGVTHQSTLKPIGHAVRLRGIDTDNEAIKETLLQPATPDEIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTAFTYLGEQVTHDIYWNGSIGEAKKDLDRTVLALRGKLAARGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKARGTHEGCIEQVDGLLRDSLYGAQPHVDAEGRLRADRLELDPAVQARVLELWDQVTDDNLYTLTDFAGYKAEFLRLFGFGIDGVDYDAPVEPNVRIPNLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PUTATIVE REDUCTASE BURPS305_1051
publication title Point Mutation Changes Substrate Binding Mechanism and Inhibitor Specificity of Yersinia Pestis Enoyl- Acp Reductase Fabv
rcsb
source organism Burkholderia pseudomallei
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07055 Eno-Rase_FAD_bd Enoyl reductase FAD binding domain
A PF12241 Enoyl_reductase Trans-2-enoyl-CoA reductase catalytic region
A PF12242 Eno-Rase_NADH_b NAD(P)H binding domain of trans-2-enoyl-CoA reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bkoA00
3D4OA 4YRBA 1PL7A 4N18A 2JD1A 4FFMA 3M2TA 5KJCA 5THQA 3AI2A 1PQPA 2QZZA 4Z9FA 4KDEA 4W9NC 4U6SA 1U8XX 4P4LA 3WGIA 3ADPA 1UR5A 3PGJA 4RLSA 2CNBA 3EZLA 2DBRA 4U6QA 2OFPA 3QVWA 4LSWA 3VTZA 3M2PA 4W99A 1K6XA 2WJPA 1N92A 3JYOA 4J91A 3VH4A 4CR6A 4OYRA 5JC1A 3A9WA 3WGOA 1YDWA 2AA3A 4JNKA 2JKVA 3NYWA 3DFUA 3PYMA 3RAJA 4DIFA 4PZEA 3KETA 1Y1PA 2HJSA 5G0VA 2E37A 2C54A 3S2GA 3H9EO 2NVBA 3I5MA 1HETA 1A9YA 2EW2A 2WDZA 3I9MA 4RJTA 3H9UA 2E49A 3G1UA 1DJNA 5L9AA 4F45A 1BW9A 1PZEA 1YS4A 4CM8A 1LBEA 3PRJA 4PVCA 1XLTA 2NM0A 2PGLA 4PLPA 4CL3A 3I4CA 1IZ9A 1ONPA 1ZUD1 2X5OA 3SVTA 5I7VA 5ENVA 4BKRA 1XR3A 3IC5A 3C7AA 5F1OA 3GF4A 4WASA 4R54A 3BTVA 1CETA 3QW2A 3UF0A 2BI7A 1DBVO 3AM5A 3A06A 2H9IA 3PP8A 3C8MA 4DMMA 1ISIA 2WYWA 1B14A 3OQ6A 1NQTA 4JJIA 1LEHA 3AU8A 4AJJA 4E32A 4EJ6A 2YV1A 3JD4A 2QIOA 3ST7A 3CTMA 4CMAA 4UEOA 3FBGA 3ZWXA 3NRCA 4WKGA 1BGVA 2AQKA 2G5CA 4CMGA 1ZSNA 4UVHA 1E6UA 1ISJA 1KC1A 4CM1A 4DQVA 3WTCA 4M54A 2C82A 5A9TA 3VPSA 5ICSA 2EKLA 3E03A 3ZV3A 4YJGA 2Q49A 4OSPA 1F12A 5BSEA 3WIDA 3ETEA 3ICPA 1P1FA 3EVTA 4NBWA 4BGEA 1HXHA 1DRVA 3ROKA 5GZ3A 3S55A 4XIYA 3BMOA 4HX5A 1P3DA 2X23A 2C7VA 4RPHA 3WNVA 1NYTA 3IMFA 4MVJH 3H9GA 1WDKA 3OSUA 1EQUA 3PJDA 3DZKA 1G0NA 1WWKA 5KJ6A 4FCCA 4TZTA 4JXKA 3O38A 1YVEI 2BKAA 4TRJA 4R69A 2NQ8A 1OI7A 1NWHA 2VNSA 4YJFB 4I8XA 1HYEA 3ZU5A 1VC2A 3ROPA 2Q50A 4PGFA 4QO8A 2VHXA 4BNUA 4BO2A 1XSEA 3KEQA 4UVIA 2J3IA 5T5QA 4CODB 3U62A 3FNFA 1E7YA 4I5FA 4D44A 2EGGA 3F1KA 2FY8A 3WGHA 1JU9A 1T2EA 1GQQA 1I3MA 1CQIA 3DAFA 4R9SA 4ZQHA 1IPEA 3L9WA 4JJGA 3PJFA 5COBA 1PGPA 4B3JA 4ALLA 1UXGA 4FOOA 1ZFNA 1OBFO 3WQQA 2NVUB 4ND4A 1B7GO 3QLJA 4U8GA 3DBRA 3SEFA 3AU9A 1PJSA 4FD3A 2Q99A 5BT9A 4F6CA 4W4TA 1L1FA 1T4DA 1VPDA 5KVQA 3CMMA 1M6HA 4DBVO 2OHXA 2GN6A 1C3VA 4HFNA 4RVFA 4D42A 3JQ6A 1I8TA 3GEMA 5C3MA 2HJRA 1ZSYA 4ZQEA 1K6JA 1PS8A 4CM9A 1ZEMA 4MIOA 4BV8A 4LMPA 1Y8QB 2B83A 4QEDA 4ZQBA 4OKIA 1VRWA 4HUJA 4Y6SA 1KYQA 1UP6A 3PWKA 2PKQP 4L75A 1GUYA 1TEHA 4FFOA 2QHXA 2DQ4A 4MJLA 3DAPA 5GY7A 4MVJG 4HFJA 2CF5A 2AE2A 3Q6IA 3SX2A 4CMJA 2X9NA 4Z0HO 4CM4A 3IKVA 4B7XA 5C5IA 4D45A 2GZ1A 4BQRA 4JP2A 1ISHA 2PH3A 4D0RA 3GGGA 1O0SA 3H5NA 4Y6PA 3ZH2A 4PLCA 4XEHA 2I3AA 4U5QA 1R4NB 3VPGA 2HRZA 4I1IA 3ZHXA 1EEHA 4TRNA 5AXBA 3IJPA 3S8MA 5ICMA 4ND1A 1PR3A 3D3EA 3JQAB 1SO8A 2VWPA 2CMDA 2FZEA 4YRDA 3LT4A 2ZYGA 4IXWA 1Y6JA 4IY1A 2HO5A 3BMCB 3X2EA 1N1EA 3PYLA 5JCJA 5EQDA 5IN4A 2DKNA 1ADGA 2VZ9A 2DAPA 3HDHA 4PFJA 1B8UA 5EPOA 4IDFA 1A7AA 3TFOA 4CMBA 2ZCVA 3U49A 1U4SA 3JQEA 5B12A 3OQ1A 5B37A 1KVUA 1LDNA 5H82A 3INRA 3NTRA 1Y8RB 2B5WA 2Z5LA 2O50A 4OSOA 3BA1A 4FFNA 3DTYA 2FZWA 5CG1A 4OIMA 2IE0A 4J2HA 1FDUA 3OICA 1P33A 2EJVA 4K9DA 5ITVA 2HU2A 2BGKA 4J1SA 4BO4A 1JN0A 3V2HA 4WOKA 2E82A 3GRKA 3ETDA 3NT4A 4OGWA 5L51A 3UN1A 3KYDB 4YBZA 4B79A 4KP7A 1U5AA 1UP7A 5F1KA 3WBBA 1NBOA 2O7QA 1ONOA 2YFQA 4XQGA 1P45A 4RPLA 4WEOA 3QVOA 4J1TA 1DOHA 1E1MA 1ZK3A 5BNTA 4U0JA 1U3VA 5CEEA 2JCYA 3ZGYA 3DFZA 5KNLA 5CDGA 2EERA 4HV4A 1KY4A 1GFSA 2B4TO 2AW5A 4HNHA 1C0KA 4ZICA 1GCOA 1O8CA 4ESOA 1IB6A 4RGBA 1HDZA 4Z9XA 1KBZA 1ISFA 4JBIA 5EL0A 7MDHA 3TRIA 1QYXA 5A05A 5DBGA 3TL2A 1Q0HA 3P7MA 1P44A 3NJ8A 4Y98A 5JLAA 1DRUA 4Q3EA 2DFDA 3VH2A 2NV6A 2HDHA 1U7HA 3R6DA 3ANLA 3IL2A 4WNCA 4XYLA 3DZGA 1NQOA 1MXFA 1Z75A 4ZJUA 3B70A 2W2LA 3WWYA 1ENOA 4BV9A 2C2XA 1NPTO 1FJHA 4N5MA 4J4BA 4R3WA 3WMWA 4CV1A 2AG5A 3DZBA 3ITKA 4NIMA 4IZHA 4HY3A 3PLRA 3RFTA 4Y9DA 3T4EA 1N9GB 3TZCA 3WSVA 1O5IA 1PU2A 2CDAA 3SLGA 4B7UA 1M66A 1ML3A 3I9KA 3RU7A 2GZ2A 3OECA 1T1RA 1PGQA 4I5EA 4QUKA 4CLHA 1Y9EA 3HN2A 1O6ZA 2VYVA 3I23A 4QFDA 2P4QA 4WE3A 1LRKA 2AEFA 1U28A 4HWKA 3ULKA 4O59O 2B69A 4ONEA 1U9JA 4OHUA 2I76A 1E7SA 1YQXA 4WJZA 4CM9D 1OC4A 4EBFA 4GGPA 3WGYA 2WTBA 3HB5X 1NTOA 4WPGA 4BNFA 1V6AA 1W73A 4IDAA 4IQ8A 2YHIA 4UUMA 5AXCA 1E7MA 4GWKA 2A35A 4OAQA 5CPFA 4BNNA 2O4CA 5H83A 1LDEA 1SCUA 2W8ZA 2I9PA 3AFNA 3K31A 1DLIA 3WS7A 5JPIA 2Y68A 4E6PA 1CQJA 3H2ZA 4NMHA 1H0KA 3DEYX 4YJFA 4KZPA 2X9VA 5IJZA 2BFMA 3FR8A 5KVSA 4RCVA 1V3VA 3VPHA 5FEUA 3H7AA 2VN8A 4A10A 2AEMA 2YQ4A 3DC2A 9LDTA 3GOHA 1NQAO 4BNTA 4E30A 2PWZA 4AJLA 1GPDG 3P19A 4FC6A 1ISGA 4RVGA 4OMUA 1M67A 1W6UA 4CM5A 1BXZA 3ZWBA 1JKFA 3ASUA 1GU7A 4DYVA 3DO5A 2YDXA 4HKTA 3P2OA 4RDHA 3VZSA 3GA0A 1EUCA 3GAZA 2NVUA 3HFSA 1OC2A 3D5QA 3T7CA 1GYRA 4DUPA 4WLFA 4XKJA 2W98A 2YQ5A 3QIVA 5JCJD 3VTFA 2VHZA 1HLPA 1RWBA 3AM3A 3R1IA 3TFQA 2NU8A 1MLDA 4M89A 4YYZA 4IDDA 3PJEA 4UAGA 4HFRA 1ENPA 3LT1A 3KBOA 4S3MA 4TKLA 4XGKA 4FDAA 4BNGA 3BMQB 1X7GA 3V1UA 1HE2A 2BFOA 4BMVA 5G4LA 1NFQA 3FHLA 1WMAA 3U4HA 4I9NA 5T8KA 2EIHA 3U09A 1H9AA 2JD0A 3BXXA 3WG9A 3KSUA 1I3LA 1LLQA 4GX5A 2UUPA 4AJ4A 5JAIA 3KTDA 3INTA 4QQRA 4TRMA 1WDLA 1LX6A 1XU9A 1H6DA 5J23A 1IY8A 4UEJA 5JFOA 3NDIA 4DIOA 2O7SA 2W2KA 2O3RA 2I5PO 3B20A 2FN7A 3GEDA 5AVOA 5TIIA 3GAFA 4YAKA 1C0LA 1NVMB 4JBGA 5ILOA 3WYEA 1ZH8A 1LSJA 3Q9NA 4MVJA 4YPOA 2B5VA 5C7OO 2NU7A 2ZTMA 3Q3CA 4XDZA 3ON5A 1KOLA 2P5YA 3TDKA 3ZWMA 2PD3A 1V35A 1SZJG 3L77A 1YKFA 4IJVA 4MVJP 3GR6A 3GQVA 4M8SA 4E31A 4YT8A 3DZJA 3RBZA 3WTBA 2CD9A 5L4SA 1MG5A 5KJEA 3KYBA 2DLDA 4GL4A 3R3JA 2Q1UA 3NEPX 2NWQA 3I9OA 3VH1A 3L6DA 3DBVO 5HS6A 4BMSA 2V6GA 3BMCA 1VLLA 1ENZA 1SAYA 4ILKA 4R3NA 1LC0A 2AMFA 1E3WA 2DTDA 4XGNA 4TVOA 4TSKA 4RPKA 5KTKA 4OQYA 4ND5A 3D1LA 2GPTA 2J8ZA 3GDFA 4RLHA 1BXKA 4IDBA 4A03A 1Y8RA 1JW9B 2QRJA 3E9QA 3GDOA 1Z7BA 1DC3A 2OORA 1LA2A 5TT1A 5F3RA 3WGZA 4LK3A 3C1OA 3PYXA 5T57A 4B8WA 1M76A 3AY7A 3D4PA 3CMCO 3EC7A 1I3NA 5K6AA 1X7HA 1YB5A 4PCVA 1RM4A 4WCFC 5JAQA 4JJFA 4RV9A 3ZWOA 4IS2A 2EWMA 3D3WB 4JGBA 4A27A 4XQ9A 3VC7A 5F21A 1U8FO 1BG6A 3UCEA 4TVBA 2VT2A 2E4AA 4OOEA 5A9RA 1LXCA 2C59A 1KVSA 4YAGA 1K2WA 5F5LA 1U4OA 3D0OA 1BVRA 3PQDA 1GADO 2EJWA 3LYLA 2VWHA 1VKNA 2WD8A 1DC6A 3RKUA 1TLTA 3UGKA 1LU9A 4EYEA 3CZMA 5ILGA 3WLFA 2BI8A 3CEAA 5AXAA 3DR3A 3KB6A 3WLEA 1N1GA 4JK3A 2DPHA 2GN4A 4I9UA 1AHHA 1R4MA 1HE4A 2QYSA 4EUHA 3WOHA 2J3JA 1DIRA 4BB6A 3AFMA 3RC2A 3IJRA 4RO0A 4WCFA 4R1SA 1X1TA 1HEUA 4KUGA 3PZRA 5JCXA 4FJ0A 2GLXA 4QECA 3QVXA 5BR7A 2Y1GA 3I9LA 2Y1DA 2EHDA 1XEAA 3VKUA 3WR5A 1FDWA 3ZNPA 4RZHA 4S1VA 4YAEA 2OMEA 4G65A 3I6IA 1E92A 1JLLA 1JKJA 5G0WA 3O8QA 4EZBA 3UFXA 4ZD6A 2G82A 4IQGA 1JAYA 1K0UA 2DFVA 4GLLA 2HK7A 1WDMA 1DC5A 4XYMA 2RH8A 2IDZA 4PLTA 1KEPA 1VJ0A 2V65A 3ZHBA 5KJ1A 4BKUA 2C5AA 3EUWA 4CMEA 1YONA 3W8DA 4EEXA 2POQX 1SBYA 3PI7A 1ZCJA 5HRUA 2WD7B 4P38A 3UKOA 5C7LO 4J9VA 5EQFA 4RVUA 5LCXA 4E2XA 3MWEB 4BVAA 2JL1A 5T64A 3JQ7B 2FHSA 2E48A 2QRKA 4DWVA 3EHEA 1PTJA 3IUPA 4GX0A 2Y0EA 1YOVA 3JTMA 4D41A 3AI1A 3GNTA 3AK4A 4OL9A 2FR0A 5F1PA 4DPMA 2PA3A 1ZK0A 3QWBA 3AOEC 4W6ZA 1HDOA 1V3UA 3HZZA 2I99A 5A04A 2PR2A 2V6BA 4E2WA 3WJ7A 5BSGA 3GPIA 1F0YA 1DAOA 3MOGA 3U4IA 3H3JA 4GGOA 4NJMB 2Q2VA 4YTEA 3RC1A 1YE3A 2UUOA 5FYDA 4U7WA 3UUWA 3AUTA 4HADA 3S2IA 2EKPA 4KQXA 1Q0LA 1K3TA 2P9GA 5BSFA 2GF2A 1P74A 2FWMX 2CF6A 1TT5A 1PJ2A 5DP2A 1PJBA 4YWJA 3RJ9A 3DXFA 1EZ4A 2PZJA 4PG8A 4XB2A 1QYWA 1T26A 4BNMA 3ZWVA 4CMIB 3G3EA 4UUOA 2X0NA 1HYGA 4FFLA 2VRCA 3GGPA 4MP8A 1T24A 5DCYA 5TNXA 4L76A 4YAIA 3AOEA 3FWZA 3OHSX 3TOZA 2TMGA 3CH6A 3HQ4O 1U7TA 1C1XB 3H65A 4ROSA 3TZQA 1E1LA 3DQPA 3P5SA 1VI2A 1EUDA 1NM5A 4KUHA 3ZU3A 3FTPA 1XHLA 1P1RA 2Q2WA 4CLOB 2Q45A 4URFA 3DOCA 3TZHA 1PJ4A 1SB8A 1NPDA 4DVJA 3SLKA 2PD6A 3GZNB 3L6OO 3PHLA 3GVPA 4D3FA 1KEWA 3CUKA 4MKZA 2OO5A 3D7LA 1PWXA 3MJTA 5DP1A 4R1NA 3ZHYA 5L7TA 2PKRA 4Y8VA 1QYCA 1DC4A 3SJ7A 3HUDA 4XJSA 4MP3A 1T2DA 4P4GA 3RI3A 4W9NA 2IZZA 1YQDA 4FN4A 1MV8A 5JBIA 3KEOA 1BDMA 4WLUA 2GGSA 2GRAA 3MOIA 5JDCC 3BMNB 2DC1A 3K30A 5IZ4A 4A5OA 1EFKA 2OGUA 3N7UA 4XQCA 4D7AA 3MZ0A 3W4KA 3ZNOA 1LSOA 4G5HA 5KWEA 2FR1A 2GERA 2P68A 2PNFA 3O03A 4NK5A 5G4KB 4Y67A 4BB5A 3JQCA 1DB3A 1HDCA 3C24A 2D3TA 2J3KA 3IS3A 4YVFA 5L7YA 1F06A 3ASVA 2B35A 4C4OA 3OA0A 2VYNA 1YL7A 2P2SA 1A27A 4J3FA 1P0FA 1Q0QA 2D5CA 4PVDA 5ENDA 1GPJA 5TX7A 4A7PA 3UAGA 3IDSA 1XELA 2BGMA 4ND3A 4CR7A 3S2FA 4FJ2A 4WLNA 4B4OA 5ADHA 1ADFA 1LLCA 2Y0DA 5L4LA 2VUSA 2ZTVA 1LLUA 1VJTA 4LMRA 4GPD1 5JDCA 5K0ZA 1BXGB 4FOSA 3LSYA 2QW8A 3AW9A 3JD2A 4J2OA 4RORA 5CDYA 3DTTA 2RCYA 2QX7A 2X6TA 5JO0A 1YXMA 3W8EA 1SOWA 2X0RA 5C37A 4CM7A 1CJCA 1PZFA 3Q2KA 4J1QA 1P31A 1HYHA 4CMHA 1LI4A 4RF4A 1C0PA 3FRJA 2VHVA 3DBLB 3G17A 3DMYA 1NHWA 2I65A 3RQSA 4B8ZA 1ZIDA 4OM8A 1F8FA 3VAZA 1FF9A 1HLDA 2RHRA 2X8LA 1ONNA 5CHEA 4YCAA 3ZWNA 1V3TA 1LC3A 2CVZA 1CRWG 2B37A 3GK3A 3V5NA 4CQMA 4FSHA 4AJEA 4Y6RA 1B15A 2ZTLA 3TZ6A 2XXBA 5KCZA 3GVXA 3JQGB 3KLPX 4PLVA 5JC8A 1MFZA 4UVGA 3WGTA 2YZ7A 1N8KA 3K6JA 3GN1A 3M6IA 2H63A 1DHRA 4CUKA 1EE2A 4DLLA 4PN3A 1HT0A 3DBHB 2DUWA 2IODA 4BNVA 1YGYA 3FPLA 5DCUA 1I10A 4P4NA 4JP3A 2O2SA 5T6BA 3N74A 4BUCA 4EITA 3E5MA 1I24A 3EK2A 4WOJA 2X58A 2QYTA 3PLNA 4J7UA 3EMKA 4BL5A 2CSUA 4HNGA 3F1LA 4E21A 1FMCA 2ZIZA 4RPGA 4YT2A 1WXDA 4FS3A 3L6EA 3UHAA 1AN9A 4GSKA 2GN9A 5IZCC 2OOSA 3RJ5A 3WXBA 5DOZA 1KEUA 2EKQA 4WLEA 3WYBA 3LDHA 1EMDA 5TGDA 1VSVA 4NFSA 4CM3A 4MVJM 1XGKA 2H5LA 4MIEA 4TKMA 1ZO8A 1B3BA 1Y81A 5DNAA 3LF2A 1ZZEA 1MC5A 1WPQA 2Q1TA 5KKAA 1O89A 2VCYA 3V2GA 4E5KA 2PGDA 2WD7A 1GEEA 3ZCXA 2NU6A 1J6UA 3JQ7A 4O5OA 1K5HA 4J6FA 5JY1A 1GZ4A 1HZJA 4R5MA 4DC1A 1FK8A 5G0TA 4J9UE 4TQGA 1XQ6A 4XA8A 1V0JA 1H9BA 1H5QA 2FR8A 4IPTA 4LVUA 5KIAA 1CYDA 1ZEJA 1JAXA 3OF2A 2Y1CA 3IAHA 1I3KA 1ZVMA 4YJDA 5JE8A 3VH3A 4EUEA 3OJ0A 5IZCA 3ONDA 3ZWWA 4EW6A 4WECA 5KOIA 2VOJA 4FGWA 1EVZA 2VZ0A 4RF5A 3H3FA 4N7RA 4NJMA 3RC9A 1LUAA 5JMWA 5IFLA 3PHIA 1PL6A 5HTOA 3QHAA 3U4CA 5HS4A 3UICA 3F4BA 3EGOA 1DEHA 2GDZA 1LDBA 1D1TA 2BFPA 3OJFA 1R66A 1ORRA 2VUTA 4NBVA 1UP4A 4PG7A 3OJEA 4BO6A 5TRTA 3GFBA 2VYND 4JN6B 4WCDA 3QV1A 1HSZA 2FRDA 1EVYA 3ZHZA 1BVUA 4CQLB 3ZW8A 3V1TC 1E3SA 3OETA 4BNHA 1R0KA 4AJHA 1RM3A 3PFWO 2YYYA 1H2BA 1DLJA 4K1LA 4PZDA 4JQCA 2AG8A 2OP1A 4N5NA 1Z73A 1K89A 5TLSA 1H2HA 2Y66A 1QSGA 2P4HX 2OL4A 4LRSB 4M87A 4BNXA 4IM7A 4IQ0A 3W6UA 4TMFA 1ID1A 3EW7A 3GDGA 3GZNA 5TSDA 4FBGA 3FD8A 4NI5A 3DZIA 2A4KA 3IUSA 2IZ1A 3OEYA 3DONA 3PEFA 4BNIA 1SEVA 1QYVA 3HN7A 1KIFA 1TB4A 5ER6A 3OEWA 2V7PA 2J5KA 2C07A 4B3HA 4HP8A 5B4TA 5A5EA 4BNYA 1F14A 4DREA 3I3OA 1U3TA 1YL6A 2TMDA 3OIGA 3RD5A 4CMCA 1M6WA 4J0FA 1UDBA 1YRLA 5I7FA 3BAZA 3BMNA 1V9LA 5GMOA 2JAHA 2WYUA 4FPXA 1WW8A 2RHCA 4PG4A 2HRBA 1YDEA 3GMDA 4B4WA 2PFGA 3KXDA 3RVDA 4BS9A 3GY0A 3IIEA 5DN9A 2GNAA 3GGOA 5KKCA 4ZQFA 2J5QA 5IDWA 1T2AA 5L45A 3V2UA 3DMTC 3DHNA 2H1SA 3LU1A 1PL8A 1WNTA 1UDCA 2X5KO 4WNIA 5EINA 3F6YA 4PLYA 3DL2A 1B2LA 4ID9A 1GQ2A 1SC6A 4MKRA 4R9RA 4Q39A 2Q4EA 5FI3A 4EJ0A 3TL3A 3CPSA 3A4VA 1JVSA 1QLHA 1GYQA 3ZV5A 4EUFA 3RCBA 1U2GA 4NDNE 2O2YA 1MC4A 4CV0A 2JJYA 4DQXA 1TVEA 2ZATA 3KV3O 1PJCA 3AM4A 3WGGA 2R00C 1VL8A 3OIDA 3C7DB 5A3JA 2FPGA 3QWAA 4YQYA 4AL4A 2PTGA 1A4UA 3MJCA 3MJEA 4EI2A 4MOWA 1JTVA 5IDXA 3L4SO 2B0JA 1W4ZA 2VHWA 1FDSA 1P1IA 3DMTA 3FI9A 1EBUA 1Z7EA 4OQZA 3BTSA 2R6JA 1JQBA 5HBRA 2YHUA 3BIOA 3RUDA 2C2YA 1WVGA 4YJHB 4CMKA 1BRMA 4OOFA 3C1AA 3RUAA 3ZDFA 3F9IA 1J49A 2EG9A 3TWOA 2YV3A 1N7GA 4M49A 3ADOA 4PG5A 1VL0A 3GZ4A 3R0IA 4H15A 1OMOA 2UAGA 4R51A 4E13A 2XF8A 3HG7A 5TC4A 1ARZA 3FCOA 4BMNA 4OO3A 4E5MA 5A9SB 1ULSA 2UVDA 2V6MA 3DWFA 1ADBA 1RPNA 3KOUA 3KHUA 3OIFA 3PIDA 3SC4A 3V1YA 4A0SA 1HDGO 1I5RA 2X86A 3JYQA 2DTEA 4Z3KA 2P5UA 5COAA 4EEZA 3MWDB 3VHRA 4DLBA 1E5QA 4K6FA 1B26A 4ITUA 1KVTA 1X13A 2PKQO 1JWAB 2PZLA 3SXPA 1HE5A 4H7PA 5A3VA 4GH5A 2ZJ0A 4NH4A 1GZ3A 1I36A 3B1FA 5G0UA 5H81A 3D5TA 1D3AA 1ZJYA 3FBTA 2C20A 3LT0A 3VDRA 1Y8QA 2D59A 3NT2A 5DBFA 3EYWA 3ZV4A 1GAEO 3K5PA 3KLMX 1VJ1A 5FI5A 3PDJA 4FJ1A 1DRWA 1I2ZA 1PJ3A 5CDTA 5JSFA 5IG2A 1BSVA 2Q46A 1O95A 2ZTUA 4XDYA 1EBFA 3COSA 1PZGA 4NR0A 2UYYA 2XOXA 1GTMA 1EK5A 2DTXA 2DBVO 4GKBA 4A26A 2JHFA 4MIYA 3UCFA 4DC0A 3IOYA 2HK9A 1G1AA 4IJUA 2RAFA 3RROA 3GT0A 5KJFA 2C5EA 2CDCA 4Q3BA 2YDYA 3K2BA 2NACA 3LT2A 3CZRA 4R4JA 1GR0A 3GNSA 4NQZA 3L0DA 5FFFA 4LCEA 1R4NA 2VWGA 5KVVA 4R1TA 4CM8B 5AYVA 3PIIA 2VT3A 3G79A 4LISA 1DIAA 4NU5A 3OQBA 3JQAA 4Z9YA 2NTJA 1NP3A 4NBUA 5JMPA 1AGNA 1UAGA 1GDHA 3GFGA 1J5PA 1EUZA 4DPKA 3R3SA 1N7HA 1ZW1A 4ND2A 3JYNA 4MINA 3F47A 3NKLA 1PJLA 1RKXA 3PHGA 4LN1A 3GC6A 3MTJA 3QQPA 1E6WA 1XYGA 4L8VA 1I32A 3WBFA 4E5PA 4YR9A 1NAHA 4GQAA 4Q3AA 2W2LD 4CR8A 2VHYA 3IP3A 1GYPA 2D4AA 2GYYA 2Q4BA 1X0VA 1I2BA 4XR9A 5BNIA 3WDSA 3B1KA 3ONFA 5GZ1A 3JV7A 4BOYA 1VE9A 4E5YA 2ZQZA 5U4QA 1MUUA 2HUNA 2ZB7A 4IS3A 4XR4A 5EERA 2G0TA 1ZKMA 1H6BA 1UZLA 4RVHA 3WSWA 4K28A 1HDXA 2WMDA 3LLSA 4NPCA 4ZRNA 4G2NA 3HNPA 3PPIA 4GMFA 1X14A 4CUJA 3KYDA 4CQLA 3BYZA 3K8ZA 2VYVD 4BNLA 1XU7A 1PZHA 1UXJA 1YBVA 1ZMOA 3GH3A 2LDXA 1PS0A 3QVSA 4H3VA 1SOVA 4IDCA 1UZMA 2D5AA 2IEDA 1ISMA 1PWZA 3GG2A 1QR6A 4Q3NA 2Y67A 4IXTA 4OKNA 4E12A 1YBMA 1SB9A 1PS9A 3HADA 1T2CA 3O26A 3Q0EA 4IBOA 2R2GA 4P8RA 3U4DA 3OMLA 3PQFA 3AI3A 5B4UA 3MCVA 4DQUA 3E5RA 3QA9A 1KS9A 3IP1A 1H6AA 3TN7A 1U2DA 2VUUA 3VPFA 5TQVA 4WK6A 4UVDA 5CG2A 2WSBA 2AE1A 3PXXA 3E9MA 5LC1A 4F3YA 3LZ6A 5COQA 3FNEA 2CY0A 2HMWA 5JAMA 4BGVA 2O23A 3MEQA 2I66A 4BGUA 5L53A 2HSDA 1IHYA 4H16A 5G2OA 5U1PA 4PRKA 2J3HA 1ZBQA 4DRYA 1ZK2A 2IXAA 4IJKA 3HWRA 3I1JA 5DULA 4W7HA 5ES3A 4ZU3A 4RL6A 3WWZA 4C7KA 4ZVVA 2CVQA 1HRDA 2P9CA 1N9GA 1QLJA 2DBQA 2NADA 4A73A 2PLAA 1K6IA 4L4RA 4OXYA 1OZAA 4JX8A 1HWYA 4AG3A 3C7CB 3F4LA 4INAA 5I9NA 1YJQA 3NTQA 4BQPA 4MVJF 2GO1A 3L07A 4DXHA 1EE9A 2HMVA 3WX0A 4PLFA 3JQBC 3RUEA 1LQTA 4B7CA 1A71A 3RU9A 4Z6KA 3QWFA 4DMLA 4HXYA 1A4IA 1DO8A 1DIHA 3DDNA 1GUFA 2JAPA 1IZ0A 3DOOA 3NJ4A 3OH8A 5CAEA 3GHHA 3RIHA 4CM4B 1XWFA 1R0SA 5IDYA 2CUKA 3KYCB 1NXQA 3E8XA 4OXKA 2X9GA 5JDIC 3RC7A 2DUUA 1OAAA 4QO7A 3NV9A 8LDHA 4M1QA 2BH9A 3RWBA 2QQ5A 4BNWA 4MVJD 4BO3A 1IPFA 1XCBA 3E48A 3F3SA 1UDAA 4KTVE 3STHA 2Q3EA 2YY7A 3C1TA 4YJHA 3ZW9A 2O3QA 1QRRA 3HDQA 4II2A 3CE6A 2EP7A 4L9RA 3QJ5A 1YO6A 1DHTA 3CXRA 2G1UA 1AXGA 4R5HA 1MGOA 4CLEA 5A9SA 4J7XA 5EMHA 5CPBA 4XYEA 3RBXA 1KVQA 2E6UX 3PGXA 3FWNA 4HBGA 2HK8A 4O63O 4Z3DA 2Q2QA 3KM0A 2B4QA 4ZN6A 1QXSA 4GX1A 2CDBA 1W0CA 2Z1MA 5JDIA 4PLGA 5JW6A 5L4NA 2B4RO 1U5CA 1YB4A 3AWDA 4DYDA 2A94A 5TJ9A 3EVNA 1XQ1A 1YQGA 3BMQA 3TPCA 3EZYA 2H6EA 1B8PA 3E82A 3DAGA 1UH5A 3AY3A 4MP6A 1DIGA 4GLOA 4YQZA 3H5AA 3Q1LA 1E77A 1QV7A 3NGLA 1D4FA 1PQUA 4ALMA 2Z95A 3WIEA 4II3A 2HMSA 3QSGA 2ILTA 2Y1FA 3GMSA 1WP4A 4BIIA 1PIWA 1AUPA 1JWBB 2YV2A 5TJHA 1IULA 1Z74A 3AUSA 3W6ZA 2DU8A 3JQ8B 2AXQA 3C85A 1E7WA 3WYCA 1KERA 1UXHA 2JCVA 4J16A 1QV6A 1LJ8A 4QTZA 3HFGA 2BLLA 3UXYA 1E3IA 3H6KA 3HJAA 1I30A 3DHEA 4B4UA 3ABIA 3A1NA 4RVDA 3G49A 5IAAA 3H9JA 1X0XA 2VNAA 3S1LA 1U3WA 2AHRA 5F5NA 3LC1O 2X7HA 4BO8A 2O3TA 3OA2A 1PGOA 1R15A 5I9MA 6ADHA 3BTOA 2NQTA 3NGXA 2I6TA 3KO8A 1HF3A 3CSDA 1E5LA 3NX4A 5CDUA 2A92A 3H4VA 2ZCUA 5JXWA 5CDSA 3X2FA 4RDIA 1IOLA 2HAEA 4J7CA 1QORA 3OBBA 4PZCA 4YACA 4BO1A 4BNZA 4CUZA 1ZJZA 3K92A 1T25A 4LCJA 4KQWA 4IDGA 2PZMA 1IUKA 3T7EA 1MX3A 2OUIA 1SNYA 3OM9A 3DZHA 8ADHA 1QMGA 2CFCA 1KVRA 1OOEA 3JYPA 4TZKA 5BQFA 3ENNA 2Y0CA 3O4RA 3M1AA 3JQ9C 1HTBA 3ANNA 1H93A 3BHMA 2XAAA 4GBJA 4MVJE 3GHYA 3QY9A 4NZ9A 2V6FA 3D3WA 4OJNA 2XXJA 4QXMA 5EJ2A 4KWIA 1LDYA 1GV1A 1B8VA 1QYDA 4TRRA 2OXIA 4JBHA 4A2CA 1BMDA 2GUGA 2O4UX 3JD0A 4DLAA 1HKUA 4UVEA 3HB4X 2WYVA 2Y1OA 2C7GA 4XJTA 3ZWYA 2YHIB 3QWHA 1XKQA 2G76A 1IHXA 3LVFO 1JVBA 4D0SA 1S6YA 1Q7GA 3INGA 4I5DA 1TT7A 2GZ3A 4RF3A 4KTTE 4YA6A 5JYDA 3TF5A 4FR5A 5HM8A 4D79A 3RSHA 4MO2A 4CM6A 2QRLA 2F1KA 1LQUA 3OFSA 3ZNNA 4CLXA 3JQ9A 4E0BA 4BO7A 5B1YA 1NFFA 4MDHA 3KVOA 4RQTA 3WQSB 3L4BC 1UUFA 5B4VA 5A06A 4FFPA 3T4XA 2HCTA 2QZ9A 2NTVA 4IDEA 3EY4A 1WMBA 3KSZO 1ZXLA 2HKIA 1RJWA 3QRWA 5JYEA 1HZZA 1NR7A 2ZB4A 1RM0A 4M86A 2IZ0A 4L74A 2BD0A 3QE3A 4U0KA 4E2YA 3ORFA 1CF2O 4ALNA 2P9EA 4KWHA 2EGHA 2VRCD 3RUHA 3UOGA 1PQWA 3ZI0A 3ROQA 2Q1SA 3E6AA 1DSSG 2HMUA 4N54A 1YL5A 1HE3A 1XIVA 4XYGA 2BELA 2VQ3A 3DOJA 4XWYA 1A9ZA 4J49A 5FWNA 4AJKA 1NHGA 2C0CA 3TZKA 3Q2IA 1NPYA 4Q3DA 3L4BA 5DZSA 1SEPA 2VWQA 4PLZA 4L4XA 3PDUA 1WZEA 2D1YA 1NVTA 5U9CA 1BHSA 2UV8A 4ALKA 2IEBA 2PH5A 5JS6A 2VRBA 2I67A 3QP9A 2X4GA 3NDRA 4FIZA 2JCXA 2VOEA 4YXFA 2Y05A 4NU6A 2W2KB 1D1SA 2W4QA 4ALIA 4I08A 5DF1A 1LLDA 3WFJA 1TXGA 4IUYA 2WEKA 1E3EA 3ONEA 4JCOA 3GVHA 3KYCA 4PLWA 2X5JO 1F8GA 3F46A 4XRGA 4NFHA 1Q7BA 3WFIA 2O3SA 2ZB8A 1Z45A 2FPPA 3GN2A 1DJQA 1PEDA 1NAIA 3SC6A 2FMUA 3VKVA 3C3XA 3JYLA 3IKTA 1YH3A 4D3DA 2SCUA 1YWGO 2NSDA 2GASA 1RYEA 1Q2XA 1Y5RA 1P9LA 3JD1A 2BGLA 5AXDA 3OP4A 1UXKA 1E1NA 3LK7A 1N2SA 2HMTA 2XPCA 4R16A 1YBAA 3Q11A 3E9NA 5JO9A 1QP8A 2ZK7A 3GNQA 4CMIA 5L95A 2HLPA 4CLRB 3VOSA 1DXYA 4UULA 4ZQGA 3WNQA 4ALJA 1E3WB 4NBTA 5DBIA 4YEDA 4DTIA 1L7DA 3HDYA 4KOAA 1Z82A 3FPCA 5HA5A 1NWCA 1GD1O 1C1XA 2BRUA 1O9BA 3RBVA 3ETGA 4JIGA 3AJRA 2EW8A 3BHJA 2D0IA 3W4IA 1VKOA 3U5TA 3VVCA 2IYPA 3VDQA 4KDFA 4R68A 3ITDA 5EN4A 4BGIA 4CV3A 2RH4A 4E5NA 4CLOA 4BO5A 1GV0A 2JFFA 1ADCA 2ZQYA 1E0DA 3O9ZA 2O3JA 3B1JA 1ULUA 2IYOA 3FTNA 3WJAA 1U3UA 2DBZA 1EVJA 3EAGA 2YW9A 4LRTB 3I9NA 3M1LA 4D46A 2NUAA 3FF4A 4BO9A 3W1VA 2EEZA 4CPDA 1LRJA 2PGJA 1J4AA 5LDGA 4BHTA 2FP4A 2RBEA 2G17A 1NVGA 2Y99A 2IXBA 3JQ8A 3GUYA 4GAEA 4L73A 1HDYA 3K96A 4R41A 4QFCA 1NX6A 3QWIA 4DA9A 2YJZA 2WE7A 4R1UA 4AJIA 3PVZA 4NBRA 1D7OA 3FN4A 3OJOA 4WEQA 5EIOA 4KMSA 4CQMD 4O6VA 4XB1A 4QSMA 3ICCA 5G4KA 1EVIA 3U3XA 1R4MB 3PHJA 9LDBA 3ZZNA 4RZIA 4AFNA 3AY6A 4PIVA 4KUEA 1WAMA 4WCFB 2BMAA 1BDBA 1DAPA 4O1MA 1N5DA 3GEGA 2FPIA 5A5FA 1H94A 4RVSA 5DCWA 1P1HA 1P1KA 2OZPA 4D43A 4GSLA 1XG5A 1IE3A 1PGNA 2BF7A 3D4NA 3I52A 3NTOA 3LQFA 4UUPA 5I9LA 1IYZA 5IXSA 4ZA2A 3O8QB 3FSRA 1BXGA 1DPGA 4B3IA 5JNLA 2VTEA 4GVLA 3F5QA 3OJLA 1BWSA 3NUGA 4FW8A 2C29D 2NU9A 1FDVA 2ZB3A 3ZWPA 1YJ8A 3WB9A 1B0AA 1EQ2A 1GUZA 2JHGA 4YAJA 2JFHA 1PSDA 3MJSA 1EDOA 1C1DB 3DBLA 4X54A 3U0BA 4R01A 4BKOA 2EXXA 1CDOA 1KEVA 3AUUA 1I0ZA 3BHIA 2ZYDA 4EJMA 1I2CA 2AQIA 2BFAA 3E18A 1YOVB 3LC2O 1E3LA 3JQFC 4J0EA 3CIFA 3DHYA 1W8DA 4GX2A 4EGFA 4AJPA 2B36A 1BTOA 1R6DA 2AQ8A 3MTGA 1ZXBA 1NQ5A 1DDOA 4IMPA 1UAYA 4IMRA 4CLDA 2ZJ1A 1XDWA 1R16A 3LC7O 1Y5MA 2W90A 1MB4A 1EDZA 3PJGA 2NTNA 3ZWAA 4BNKA 3UH1A 3H8VA 3JQGA 1MA0A 1MXHA 1C14A 2R00A 3S2EA 3GRPA 2NVWA 1FDTA 5T8KC 4P22A 5CP8A 3TSCA 4HFMA 5TF4A 4BKPA 4FC7A 1PGJA 4MVJI 3DBHA 1TT5B 4ZRMA 3ZWCA 1Z6ZA 3NDJA 3K2EA 1D8AA 1VL6A 5AOVA 3GUCA 3FNHA 1E7RA 4OXNA 2PK3A 4NHEA 1JDJA 5KVCA 3ZN2A 1P0CA 3B6ZA 4YT5A 5ER9A 5I8ZA 2GCGA 6LDHA 3JQFA 1CERA 1X7DA 4GKVA 4TROA 4WGGA 4D3SA 3JSAA 3SJUA 3LLVA 1WZIA 1P77A 3CKYA 1J0XO 4BNJA 1AE1A 4NFYA 1ZNQO 3TJRA 1Y9AA 1QG6A 1Y7TA 3DZFA 4G81A 4UUNA 1LDGA 1L7EA 3PWSA 4K26A 4LGVA 4PRLA 5IN5A 4NNJA 1T2FA 1WLYA 1T1SA 4DPLA 4XCVA 3SBOA 1R12A 5MGBA 1DFHA 2NNLD 3N58A 4J4HA 1CWUA 4CJXA 4PG6A 2Y93A 1E3JA 4XRRA 2ZYAA 3RUCA 1H6CA 1T4BA 3ANMA 1DFGA 2DT5A 3K9QO 5MDHA 1EK6A 5A1TA 1BW9B 4TWRA 2Z1NA 2PZKA 4FFRA 4RQUA 5A02A 1GZ6A 3NT5A 3MJ4A 5T67A 4L0QA 2LDBA 4IJWA 1DIBA 3I9JA 4YDRA 4WLOA 1Q1NA 3ZV6A 4UEKA 4GI2A 3VZPA 2IRWA 5AQ1A 3UVEA 5BSHA 2PV7A 1SMKA 4WLVA 3U9LA 3GVIA 2BHLA 2AEJA 4AJOA 1NR1A 1M2WA 4E4YA 5EESA 5ITWA 4NK4A 3LF1A 3JCZA 3GLQA 2WWRA 1HSOA 4CL8A 1RM5A 5C7IO 3VPXA 3ZU2A 4J43A 4DL9A 3ZNQA 5L40A 5TT0A 2OP0A 1R0LA 4ZGWA 2D8AA 5K6AC 5A03A 1X1EA 4Q9NA 1CEQA 1LRLA 1I33A 3JQDA 3P2YA 2PY6A 1Q7CA 3KZVA 4Z0PA 4K6CA 4AVYA 4RF2A 1GCUA 2YFHA 3I6QA 3HHPA 4YJGB 2Q1WA 3Q9UA 4CLRA 2J6IA 1LTHR 4M55A 4LW8A 3KSDO 1LSSA 4IINA 4AJ2A 1CIVA 4IGFA 3ZU4A 1LNQA 4I5GA 1PJTA 4J4TA 4E33A 3NAQA 5DT9A 1A7KA 4FQ8A 1LDMA 5I7SA 4XQEA 1GL3A 1TI7A 3BMOB 4XGIA 4MPDA 1P1JA 4C7JA 3G1TA 4UREA 2YUTA 7ADHA 2ET6A 4WUVA 1ENYA 4YRAA 3AOGA 5IF3A 4Z0TA 1DFIA 1NNUA 3JD3A 1KETA 4IGEA 2PD4A 1U1IA 5LDHA 1UXIA 3TNLA 1A72A 2X0JA 3WMXA 3RUFA 2A9FA 2AQHA 4NG5A 3RFVA 5IXYA 3PTZA 2RIRA 1B16A 3FR7A 3L9XA 2HQ1A 2VZ8A 4W82A 4IIUA 2UDPA 4J90A 3W4JA 4DGSA 1O94A 1MP0A 1E7QA 1RYDA 2DPGA 2X22A 2EP5A 1G0OA 1YB1A 4FB5A 3CINA 4Q3CA 1VM6A 3W8FA 1GY8A 2GSDA 2D2IA 4CV2A 3E1KA 3PFFA 2FSVA 3EDMA 1GEGA 1X15A 3PWZA 4XZ3A 5L3ZA 4IZIA 4EDFA 3RKRA 2GD1O 2OBYA 2WE8A 4CQMB 4RPJA 4BKQA 4JROA 5DDIP 1E1KA 4DIBA 5K9ZA 1LSUA 2JD2A 2OBNA 1S7CA 2GR9A 5IDQA 4LVCA 3DBRB 4O0LA 2FSSA 5HWSA 3PZBA 1QKIA 3UCXA 4CMEC 2CZCA 2FOIA 2NLOA 4FGSA 4XIJA 4JLWA 3H9QA 1HDRA 4I9HA 1KY5A 5GZ6A 4E2ZA 1PX0A 5CEJA 3BZUA 1M75A 5FF9A 3ROMA 3KUXA 4DBZA 1JKIA 1NASA 3A28A 1ZK4A 1AHIA 1HL3A 2X1HA 1JA9A 3AUAA 2F00A 4XD2A 4ZHSA 5I7EA 1R37A 3IQDB 2WM3A 3FNGA 1PJQA 3PHHA 3RUIA 5TS3A 4E3ZA 1A5ZA 4PLHA 2DVMA 3RFXA 1IL0A 3I83A 3GPDG 1B3RA 2ZKLA 1TA4A 4AJ1A 4MKXA 2VTDA 3WICA 4GVXA 4GWGA 2X0IA 2O48X 2JFGA 1GQYA 2J5RA 2CVOA 3I4FA 1ZSVA 5JAZA 2DM6A 3H5RA 3D64A 1AXEA 2Y1EA 3QVTA 4N5LA 1C1DA 3GVCA 1V8BA 1UJMA 4QT0A 4J1NA 4IIVA 4AICA 1XA0A 1MFPA 1MG0A 3KRTA 4QX6A 1C0IA 4XX0A 2GN8A 5L7WA 2EF1A 3V8BA 1NFRA 3G0OA 1F17A 3A14A 4F6LA 5DOVA 1G6KA 3WQRA 1KC3A 3K73O 2QG4A 1UZNA 1E6EA 4B4VA 1PR9A 3WGQA 5BNFA 4LSMA 5CFZA 3JQBA 5JY6A 2I3GA 4F46A 2O3UA 3TOXA 3H2SA 3JQAD 4XYBA 4BO0A 3VZRA 1VSUA 3PK0A 3VVBA 3HDJA 4W7IA 3UW3A 3HE3A 4OH1A 5A4DA 3ENKA 3VZQA 3TQHA 4GMGA 3MJVA 2EV9A 3DB2A 1FXSA 3GG9A 5THKA 1ZMTA 5CEFA 3BTUA 1OFGA 1SPXA 4NJOA 3F5SA 1ZK1A 4YB8A 3HSKA 1I01A 1EFLA 3RASA 5G0SA 4YT4A 4AJNA 2P91A 3PQEA 4L4SA 5I8WA
chains in the Genus database with same CATH superfamily
3D4OA 5JNVA 1CEEA 4YRBA 1OXKB 3HBLA 4N18A 2JD1A 3KKEA 5C4GB 1NT2A 3M2TA 3LQYA 5JD4A 5KTMA 2R8BA 1OBHA 2ZSAA 1Y9ZA 2WU0A 4UHFA 1GXSB 1PQPA 1FYWA 1WUTA 2GEFA 2PX8A 2QZZA 3I32A 2O7NA 4Z9FA 2OXCA 1ZICA 2TYSB 3M6LA 4P4LA 4YXWA 2JLBA 2CNBA 3C3JA 3E4DA 3WIBA 5HKLA 1C1YA 4RZ3A 2F9LA 3NV7A 3NAMA 5DPMA 4C6SA 4Q4AA 1JHAA 4LSWA 5AR1A 1CIPA 3PSHA 2BE7A 5PGMA 1W5SA 1CJVC 4W99A 2XW6A 3QY0A 1R3UA 1JHVA 1LPOA 2G6TA 2WJPA 1ZJ5A 2P0EA 2C3PA 4C0KA 5CYOA 1YTLA 3ZD8A 2ZBEA 2AA3A 1QK3A 2LUOA 2AR7A 1PLKA 4JNKA 4N7JA 3RAJA 2P7IA 4DIFA 1IZZA 2BFBB 5GM2A 3KETA 1Y1PA 1ONBA 4Q93A 1JR2A 5G0VA 3K4PA 2IXDA 1HETA 1A9YA 1XPUA 2W0MA 3TCXB 4X7BA 1U80A 3QKUA 4EVSA 3H9UA 4HSGA 2E49A 4UW9A 3G1UA 3ESYA 1KDZA 1RMQA 1IZYA 3A6ZA 4QPCA 1H1DA 3R7BA 4CM8A 3BRQA 2QL6A 2NM0A 5AIAA 3VBCA 2AK2A 2AJ8A 1IZ9A 2JGMA 1ONPA 1B74A 2C78A 3TLKA 5I7VA 3CF4G 3IC5A 3BJZA 1WX1A 1C4OA 3LA6A 3OWHA 4FP9A 1E9SA 5F1OA 4WASA 3KJXA 1O2DA 1PT8A 2X3YA 2YC2C 5HOQA 2CLOB 3QW2A 2EVWX 2Q5QA 1W2HA 2BI7A 4CQJA 2W0SA 2H9IA 3CB4A 4OK6A 4DMMA 3BEDA 1XV5A 5DK4A 3MSXA 5ELXA 4JJIA 4WDRA 4XD7D 1Y1RA 2AK3A 4MR8B 2WWIA 1SWWA 4D9BA 4CMAA 4UEOA 3ZBTA 2Y3IA 2WINI 2OBBA 3QVGB 2VT7A 4E7PA 5EY5B 1BGVA 2AD5A 1G3RA 2AQKA 1ZD2P 1DO2A 2CVFA 4HX9A 4Y1RA 5BYBA 5A4AA 1E6UA 3K1ZA 2NYVA 1CNFA 1JJ7A 1RLTA 4ZODA 2LBPA 5IKOA 3UFBA 4CM1A 2C9DA 3DLCA 4LWQA 1IY0A 5FFNA 4OQQA 4U2GA 3K70D 2C82A 3VPSA 1JDSA 3H4MA 3HXPA 1FPQA 4YJGA 2P4SA 5ALDA 4PC6A 1CLUA 3D6FA 3MGKA 4K81B 5M5BA 1MIOB 3ETEA 3TFWA 4AZWA 2J6BA 4JVNA 2HU8A 1E20A 2BZSA 5CH3A 5FBLB 3VPCA 1CP3A 1OU0A 4L4ZA 3ROKA 4XIYA 4MR7B 1X7ZB 5EOVA 3BMOA 3IIMA 1UQRA 3DULA 3O3CA 1JDBC 2HF2A 4QYIA 4URVR 3HN6A 3GFTA 3SBEA 3WIVA 2XVXA 1NYTA 3GIWA 4MVJH 3SNHA 4MPPA 2X0FA 5HOEA 3MIIA 4PAGA 1LW7A 4EX7A 3PJDA 1WWKA 2HJ9A 3MXOA 4AD8A 1TM4E 3DLPX 4K0KB 4GFDA 3OFNA 3O8CA 3DDOA 1YVEI 4BQOA 3FE2A 5ES4B 3SYLA 1KAOA 3IR6A 4FHCA 4R69A 1TA9A 5F7JA 3FUUA 5IAKA 4EFKA 1A8PA 1Y8ZA 1Y1SA 3TG2A 2E18A 4LYGA 2PEZA 1PFWA 3IMGA 3N5CA 4UM5A 3ZU5A 4ZMBA 3VNUA 1XU4A 3ROPA 2CYAA 4LDQA 5EIWA 3DTVB 2VHXA 4BO2A 1I4DD 2A30A 3OLCX 5L6MB 1FZQA 3I04A 2MR6A 3SN6A 5T5QA 1GUBA 3ZHOA 4JHLA 1T2UA 4HQ0A 4DA6A 3TIFA 1NA5A 1OYOA 1MPXA 3GH1A 4P7JA 2FMXA 2FY8A 1TADA 1JU9A 1A88A 3I76A 3KTAA 2XITA 5FD8A 5HUQA 1L7XA 4R9SA 4LE2A 1F2DA 1IPEA 3EIWA 5GOTA 1PFGA 4PEVA 4N5IX 4OXXA 4B3JA 2X19A 4ALLA 1W44A 1RWWA 1ZFNA 3CB2A 2WHQA 5IW8A 3HV2A 2ZJAA 3EOAI 1KZ4A 1G66A 2FPXA 2QLNA 3D4LA 2FW0A 4U8GA 1NE7A 5FULA 5IT5A 3R5FA 2OFXA 2XQGA 4LXHA 3AQ4A 2Q99A 1YJXA 3H2KA 4PZLA 3FZEA 4JELA 1T4DA 1JIUA 1Z8DA 2E85A 2C5HA 4QGHA 3EEQA 3LX6A 2W22A 4RE5A 2H2FA 4DBVO 5MN5A 2GCNA 1E1QD 2OHXA 5FOWA 4HNTA 2H3EA 2DWQA 1C3VA 2IH4A 1IU9A 1FMJA 3AIOA 1ZH2A 1F2UA 4G4GA 2CMGA 1MX5A 1RXSA 2PWPA 4Q47A 1N77A 1K6JA 1PS8A 2FSGA 5KWJA 1A7UA 2H2DA 5K3FB 2ATVA 4MIOA 3FLAA 4ZO8A 5ALTA 3BULA 2B83A 5IM5A 1RP1A 1TUIA 2V7EA 2O57A 4HUJA 4K9OA 4Y6SA 5C1OA 1UP6A 1RQXA 3L1VA 3ETHA 2JIOA 2B2CA 3HJTA 2QHXA 2SECE 4MS1A 2HMAA 3HLYA 1DAMA 4U9UA 2QE7D 3O1IC 4MYRA 4YXWD 4IJQA 2AMLA 2MJLA 1UAAA 1G1MA 3JWPA 4IVRA 4PHCA 4YRPA 3D8HA 2EL7A 3VR1A 1O6CA 2O8BB 1U0TA 1VJRA 1P2GA 3KCQA 1OI2A 4B7XA 1J2EA 2IS4A 4V3CA 4D4GA 3OOHA 4BQRA 4YP7A 3SM3A 1NW9B 2PH3A 3D2LA 5ALQA 4Y6OA 3Q15C 1WXEA 3I73A 3IT1A 3BFVA 2IDMA 2H4HA 2QZPA 4MPTA 3QTBA 5KQSA 1N7JA 2HRZA 4M7RA 5HZGA 3KJHA 2AV6A 3ZHXA 1EEHA 5AXBA 2EJTA 3IJPA 1WSDA 3QBJA 4DDVA 1LPPA 5A0VA 4NLLA 2VLIA 3F6SA 2YZMA 2VWPA 3VNQA 5IC4A 2FZEA 2DEUA 4V1CI 2FH5B 1B8NA 2ZYGA 2O59A 2HMYB 4IY1A 2KX7A 1SC3A 4C3ZA 3QKTA 4KO8A 2BUAA 2VPWA 4WZBA 4L2IA 4BYMA 3COZA 2RGNC 4N0DA 4XIGS 3KQKA 3A0RB 1XMPA 3ECAA 3DEAA 3PYLA 3AERB 3V33A 3F5DA 4PBRA 2DH6A 3L93A 2KLBA 3PCRB 3OMXA 3FNRA 2GPSA 2GAIA 1ADGA 1IXSB 1PFKA 1IXKA 3HDHA 3MCAA 5DISB 4EGAA 1B73A 2XE4A 4IDFA 4WI1A 4Z1MA 2ZCVA 3SHOA 3OQ1A 5B37A 5FIUA 2JGLA 3WJ1A 1CBUA 1OILA 1T15A 4I1SA 4TYMA 5H82A 1NMXA 3INRA 3M6XA 1T4GA 5BSTA 3EUFA 4C1NA 1YFLA 4FFNA 4FGZA 1DBWA 4RJ2A 1V96A 1EXDA 2IYNA 1RTTA 2P2YA 4J2HA 4MDEA 1TK9A 3MWLA 3SNKA 3OICA 4UCFA 4BFWA 4K9DA 4OG2A 4OYHA 1QB8A 5EGSA 3TM5A 4BNDB 1UZAA 5DLDA 3EFOA 3ETDA 2G1JA 2JCSA 1CT9A 4XPZA 2KS6A 2QN7A 2IBSA 3O93A 3E9DA 4JYPA 3KVRA 4KP7A 1F7UA 4ETIA 5AVZA 2DX7A 4QYMA 3W9BA 1RYHA 2F3RA 2YFQA 4P34A 5AUOB 3LBAA 4JT4A 4DV1B 1YA4A 1EA7A 4J1TA 1ZK3A 4QDJA 4RV5A 3RSOA 1XTBA 2G9RA 4IFTA 3IGFA 5AJZA 4JJZA 1AUVA 1Q7EA 1VKZA 2ECOA 3DFZA 5BWCA 2V03A 4AZ0A 1QFXA 1Y9JA 3ED1A 4Q05A 1J8QA 4MLCA 3L79A 4GDMA 3VGPA 4DNQA 2GJ4A 1CUYA 4HV4A 2NW6A 4TV8B 5ALUA 5ADVA 3SQWA 3TYXA 1U8CB 1XROA 4OJQA 3MJFA 2A14A 2GHRA 1Z34A 2OE2A 4HQFA 4M0FA 4HAIA 4E88A 2XGJA 5TARA 2J0VA 2ZSBA 1U0RA 1LLFA 1ISFA 3PI6A 4JBIA 1DKOA 5CVVA 1QYXA 3P2KA 4UCWA 5F7ZA 4Y7DA 1SIWA 2H4XA 5CA0B 2P6NA 2ZWAA 3LNTA 4NONA 4Y98A 5FUXA 5B7NA 4O4IB 4Q3EA 2YN2A 2DFDA 3ICQB 4EKNB 4Z9BA 1YVPA 3L43A 1U7HA 5KTTA 5AK3A 3QM1A 3TXXA 4XYLA 5AI4A 3NOXA 3IVMA 1D7AA 1H8HA 1XMIA 2W2LA 3B70A 5JT1A 2ZI3A 4BV9A 1GOTA 1NVXQ 2C2XA 1K75A 3PFCA 4N5MA 1WB5A 1MW9X 2ERCA 3WMWA 3ELBA 3L0IB 1Z0IA 3UUEA 3DZBA 1M0EA 3DE3X 3RFTA 4B83A 1EFRD 4DRXA 1N2BA 3I92A 3WLIA 5K3SA 1W85B 3QVJA 3T54A 4E5SA 4JB8A 4B7UA 4F72A 1AKEA 2G07A 4F56A 3KB1A 4D9JA 2UZ3A 4FU0A 4PWYA 1Z4OA 2GZ2A 4BE7B 5JQGB 1PGQA 1U6IA 1UADA 4I5EA 2PUCA 3SHQA 1Y9EA 2X8AA 2A6PA 1O6ZA 1GKYA 1Q2UA 1KDOA 2Q8QA 3DUWA 1E2EA 3HN2A 4WE3A 4JI3B 3EARA 4GOOD 4HQKA 1U28A 2VI5A 3IJ5A 1DVRA 2ZJFA 4YUXA 2C4VA 1MEOA 2W48A 4NZMA 4OHUA 4ZCSA 3IUBA 5KQGA 2WY2D 4MRAA 1J5XA 4LWZA 4D92A 4EBFA 4GGPA 1NC3A 5LP6F 2WTBA 2PGNA 1K4MA 1X92A 4QDXA 3CKLA 2Z6UA 1NTOA 4ENPA 1W73A 3ND7A 2E7ZA 2I33A 1XT6A 2YHIA 4UUMA 5D6OA 3TBHA 1T9DA 3PXEA 5DSZA 1N75A 2A35A 2J9YB 4BNNA 5CFRA 5H4GA 1LDEA 2W8ZA 2I9PA 2HF7A 5J4LA 4OXRA 1LVGA 5F9FA 2FW6A 3IV9A 2CC2A 1CQJA 4X65B 1H0KA 4YJFA 1OTXA 4RSRA 1DXQA 5AI8A 4BASA 4BX9A 2HSEA 3HB9A 2VNHA 4B35A 3C74A 1WL8A 1V3VA 1FTYA 2DGDA 2HNBA 5BT8A 1US8A 3HUTA 1NVEA 9LDTA 3GOHA 3ZGXA 4QJ3A 4RCZA 1N6OA 2Y6VA 3CRRA 5I9SA 3AZQA 1WO8A 1YFKA 3PEYA 1Z5UA 5H80A 1GPDG 5DM0A 5I4KA 2I91A 1IEWA 2R8YA 3LQQA 4QOFA 2UU9B 3LPLA 3R2JA 2DQYA 3KQNA 4KGXA 2J0EA 4X6LA 5BN5B 4TMXA 2A33A 4FMDF 4E1BA 1S02A 1JKFA 3EDOA 1HUQA 1LPMA 3KL4A 4DYVA 2JW5A 3B13B 3VZSA 4AMVA 4DB4A 3G0HA 4EJSA 4C7OB 4HBZA 4R3UC 3ZHCA 1U8UA 2A0UA 5AJVB 2WW8A 3GLHA 4KE8A 4WLFA 5JBQA 3LP5A 5IC5A 4BVBA 4JI0B 1A2OA 3WLTA 3TCNA 4MEJA 5K09A 3AM3A 3R1IA 3TFQA 3ZCPA 1GZ7A 1MLDA 4M89A 4IHJB 1MKYA 4UAGA 3X1XA 5FBRB 3BCRA 5KYTA 4XGKA 2X4IA 3EZXA 3RSQA 3UV7A 1G8GA 5G40A 5G4LA 1DOAA 4KW7A 3U4HA 3ILXA 3ISJA 4I9NA 2UXCB 1QAMA 2IYLD 2DY0A 3W90A 4ZQCB 5HMMA 1LLQA 4G2TA 3NIBA 1XP8A 5JAIA 1SXPA 4R2JA 1WDLA 4XLLA 1XU9A 3GOQA 4US2R 3TR5A 3KKMA 1TYCA 2I54A 3MS7A 2M32A 1NUQA 1W96A 1N6LA 4N41A 2J0UB 4AY3A 2O7SA 2W2KA 3FUTA 3MW8A 3D3QA 1YB2A 3HYLA 5AVOA 3OE1A 1ECJA 3Q7SA 4YAKA 3JXEA 1C0LA 2ZDQA 1W88A 3FROA 4JBGA 4X24A 1ULHA 4MUIA 1E61A 4PZ9A 2YRFA 4HZIA 4B2IA 2Z1DA 1ZH8A 5DN6D 2CMFA 1QIKA 3PKJA 3S2YA 3G5TA 4ABTA 2C2HA 1T3HA 3Q3CA 3ON5A 2AXNA 2YXDA 1E3DA 3QKSA 1TC1A 4MKIA 1VHQA 4PQEA 3RGWS 4OHFA 4ZEWA 4RMGA 5P21A 1SZJG 3TLJA 3TNFA 5C46F 4IJVA 4MVJP 5FAKA 1UJCA 3U1VA 5BUQA 1VMKA 3CBQA 1Y7HA 3GQVA 3HJHA 4M8SA 1QIMA 4MYSA 4Q1CA 2HT6A 2CD9A 1P80A 3KQUA 2EBWA 1MZVA 1DZ3A 2N9UA 3KYBA 4EYKA 1S9DA 4QM6A 5E4TA 3NEPX 4RWEA 2YHSA 3GJTA 2B34A 1E9RA 2R1TB 3QU2A 2QUZA 4B85A 3VH1A 1V2HE 5LA6F 3FPEA 1S0UA 3L6DA 1FW6A 5K3CA 3DBVO 1ULBA 4BMSA 1BDHA 1TA0A 4MWTA 1RQPA 4ILKA 1TQ2A 4E1AA 4P98A 5KQLA 1H05A 4TVOA 5TVGA 3N2IA 3TNDA 4MS3B 3VU3A 3M83A 4OQYA 1ZGZA 3IVCA 2GPTA 4KE6A 2P35A 2IUUA 3X1KA 1BHO1 1RBMA 4EKDA 3PRYA 1BXKA 1NN0A 1IRXA 2FFRA 4UCXA 2HA3A 3HXTA 1R9NA 2XUAA 2PFKA 4R6XA 4URZR 3UJ3X 4A03A 5KWVA 5HQJA 1A5BB 4ER3A 3E9QA 2H11A 2JIPA 1RHQA 3RBAA 1IHDA 1Z7BA 4BUJA 3P52A 4Z51A 2WT9A 1L8QA 2EL9A 3P0JA 1Z29A 4X6XA 4EI7A 4ZKEA 4KPFC 4JUCA 1RWPA 4KJXA 2CKMA 1PVOA 4QGFA 3PX2A 1IMOA 2RB4A 2QB5A 2VVTA 2PX5A 4P83A 5T57A 1QPZA 2W2XA 5TF0A 3EC7A 5C9ZA 2OV4A 2O2EA 2OBXA 4HD8A 5JAQA 4C5BA 4RV9A 5LN1A 1N57A 1NMSA 3UOWA 3TRKA 4X97A 3GMTA 4C5AA 3C3CA 5DMHA 4A27A 3O2QB 3VR6D 1U8FO 1PO7A 2R8OA 5DEIA 5EG5A 5FL7A 3NVMB 3ZI7A 5DNUA 3TECE 5CVTA 2FFQA 1G3QA 1QP0A 1V37A 1QGDA 2PX4A 4OOEA 5A9RA 1LXCA 3QPWA 3FTQA 2ASEA 1ZH4A 1K2WA 3WL8A 2QGNA 1U4OA 3Q88A 4DDUA 5KU7A 3D0OA 2LIVA 1GADO 3ROEA 3E58A 1TLTA 4MWOA 2WWVD 1JL3A 3R8XA 3UGKA 2DFKB 1ZUWA 7REQB 4YCLA 5JZBA 3SE7A 1J2RA 5DIZA 3I6BA 1PD1A 3NTLA 5ILGA 3WLFA 1A98A 3ENZA 3UK7A 4ES6A 4MDFA 5F4ZA 3DYIA 3WLEA 4M1WA 4BJ1A 2GN4A 4I9UA 1L5QA 4LBVA 2QYSA 4QARA 3L2OB 2Z5FA 4BQIA 4KI7A 4EUHA 3WOHA 1CEXA 1DIRA 3IMKA 3A1DA 3AFMA 4BB6A 3WLNA 4WCFA 5T6MA 1RADA 4NC9A 1BH2A 1X1TA 5CYGA 1PT7A 4P7BA 5JCXA 2NXJA 4FJ0A 4DKJA 4QECA 1R00A 3QVXA 2X5NA 3HB7A 4RAQA 5IULC 2G7MC 1A8UA 4PNPA 4I81A 4Z9AA 2H7YA 2Y1DA 4E14A 4F4CA 1QQAA 3ANXA 1FNSA 5LZ7A 3WR5A 1FDWA 3FIJA 3FMIA 4RZHA 4UBMA 4WXPA 1GR1A 2BUBA 3ETNA 5AVUA 1ZH0A 3B2NA 2Q7XA 3BM5A 4EA8A 1BKYA 3FOZA 1HFJA 1VMIA 1E92A 4ZTBA 4IXNA 5FT9A 1ZUNB 3AJDA 3T3DA 1NNLA 1Q14A 4HRVA 3MFYA 3OPQA 3O2NA 1DBRA 2I3DA 4GLLA 1I7QB 3RUPA 1WTAA 2AFHB 2RH8A 3BB1A 2Q3MA 3CUUA 3K35A 5H3HA 3RS8A 4C06A 2K7FA 1E6MA 2V65A 4N4AA 1S01A 4B76A 3K5HA 3M6AA 5JXJA 1VB3A 4JP8A 1MDFA 1R4AA 2AOTB 3V7WA 3WSTA 5HRUA 2WD7B 3N75A 1GKKA 1S1MA 3HO6A 4EQ6A 2LCQA 4S04A 3B6IA 3DWGA 2WF5A 3PPWA 3U7EB 2C8KA 3JQ7B 3LIIA 4A8TA 5MN6A 1FRVA 3D3KA 1PTJA 3EQ7A 2JVIA 5DW0A 4DHEA 2PBLA 3JTMA 2RGCA 1ZUIA 4R8LA 2BY4A 3WLHA 2GRUA 1U0EA 2ISQA 4R0MA 5B57C 3A6GA 5F1PA 3C87A 1P6XA 1DKLA 2B2XA 1CJBA 4AF8A 4EVQA 1FUKA 5EXTA 2VTVA 4WZAB 3OE7A 1GDTA 1T0BA 2PAAA 5SICE 2ZRLA 4LXYA 3NIDB 5KHOC 2QJFA 1LFAA 1KAEA 4S35A 1G3MA 3BGVA 4QXPA 2H8GA 3WJ7A 5JXHA 4TSFD 3Q3GE 3MTEA 1X3SA 2XKBA 3Q87B 2BKEA 3H3JA 1K27A 4GGOA 4NJMB 1KDTA 2Q2VA 3UM9A 1OLXB 3QKWA 5E7JA 4NCBA 1YE3A 2UUOA 2DJIA 2OLEA 1K5PA 3B6KA 2PV0A 3S2IA 2W2TA 2V5VA 3M3PA 4RK6A 1JYSA 1E8DA 1B6SA 1JFFB 1FA9A 5IBQA 1F6BA 4GNKA 1XTPA 4M37A 2CLDX 1ZHFA 3LVBA 2OO5C 2CFOA 1EZ4A 1KFBB 4GOJA 4TUYA 4PG8A 1JPVA 2H4FA 3GRYA 2M6KA 3ED5A 3K09A 4KXUA 3MD9A 3ZWVA 1L7AA 1RAEA 2X0NA 3DYVA 2YMQA 1D4ZA 3FUXA 1JEAA 4ZYZA 2VC2B 3GGPA 1OA0A 4W6QA 5TNXA 1VGRA 3QJYA 4L76A 4P82A 2JLQA 4KQCA 3ZLVA 4YAIA 4NZOA 1JGTA 3OHSX 2VA9A 4ZEMA 2OC4A 4MUMA 3TOZA 2DHDA 1PK8A 2HTEA 3PQ3A 2AN1A 1LWNA 1DRJA 5SZIA 5K05A 3QEMA 3KKQA 2YOHA 3UAWA 2PSDA 1TJYA 1VI2A 2OHHA 1EUDA 1IB0A 3SZOA 5KX5A 1FS4A 2PPVA 1GARA 3AL3A 3THWB 3T9CA 1P1RA 1YZFA 2Q2WA 3P9RA 4CLOB 2WIBA 3DOCA 1C3LA 1YZNA 2Y77A 3OPVA 4M1KA 3RWOA 4LC1A 3SFVA 2VSYA 1RRFA 1M3SA 2PD6A 2FXIA 1B1CA 1BGWA 3GZNB 1JIJA 2BHRA 2C3UA 4KIWA 2PGOA 1BMFD 2I1QA 3MTBA 4JFAA 3U17A 3MHPA 1BD4A 2VHTA 2XKAA 1GTZA 1Z6YA 2I8AA 2K7ZA 4Z0NA 3OAAA 3EPHA 3BXOA 4YGXB 3MCUA 4Y8VA 3PLAE 1DC4A 3W2TA 5B1EA 1M5RA 4BJ3A 4XVUA 3SI7A 1MB9A 2IZZA 4FN4A 3JY6A 3C39A 5CBPB 1E9CA 4YQFA 1VHLA 2BEUB 3T3EA 3A05A 4M1MA 3LHDA 3Q7PA 2RJOA 2RGEA 3FTEA 3SAJA 2V7WA 3OZTA 3PRHA 1FX0B 1NVVR 5IZ4A 1MW8X 2WSMA 2IP2A 2C4UA 2OGUA 5IVIA 4IUBS 4JITA 3PE3A 3ZNOA 3GCZA 1KMCA 1WG8A 3ECCA 1SXJC 3GLIB 3HWX1 2B7LA 2MSDB 4RY9A 2HCJB 4NK5A 2P69A 1L8AA 4N6NA 5BW8A 3PIRA 5CLJA 3C24A 3JZDA 3WBJA 4LQLA 1QPGA 1ODTC 3RK4A 1QC5A 4JC8A 5L7YA 1YRHA 2C1EA 2OAEA 3ENQA 1FUEA 1YR9A 2WUEA 3AVQA 3OA0A 2FNAA 3N07A 1VMDA 4Q37A 1S4QA 3RVOA 3WMRA 1Z3IX 1YL7A 4YO7A 5BRAA 1QDEA 4PVDA 1N2CE 1OX4A 1EX6A 5ENDA 3RWMB 3UAGA 3KAPA 3QOYA 4YJ3B 3S2ZA 2PLFA 3S2FA 3VM6A 5HUHA 4G5SA 4X8MA 4H2DA 5K4GA 2Y0DA 5L4LA 2VUSA 3EIHA 1P9WA 3JARB 1DBPA 3MLBA 4IG9A 5P8WA 3VKFA 4KO1S 5IJ9A 5K0ZA 4B3TB 1NMEA 1SCIA 4X84A 5CDYA 2ZB2A 3DTTA 3GJSA 4YRKA 5ICCA 1VJDA 1EESA 1QOZA 1YQUA 2QX7A 2X6TA 3DHVA 4QWMA 1K08A 4F3RA 3RFCA 1SOWA 2X0RA 3TOCA 5C37A 1B1AA 3Q3EA 4DG5A 5JWOA 1QFMA 4EUKA 2H2HA 1IQ0A 3IIJA 4CMHA 4EG6A 1E2KA 4X20B 1USWA 3V1LA 4J76A 2QNRA 1ZOLA 2EKBA 3AF4A 3V2IA 2HCRA 1GTRA 1L3CA 2QSUA 3DMYA 3IHKA 3L0YA 3H2JA 1R5NA 4LXIA 4F7WA 3KPWA 3ELUA 1LV7A 3VAZA 1FF9A 3LL4A 1HLDA 2RHRA 3I2IA 4U2BA 4FZ3A 4CTKA 1K3UB 4TLDA 4ARIA 4PY2A 1NJSA 1QF7A 3LKDA 1MNAA 4YCAA 1W75A 2G8LA 3CKMA 4F38A 1LC3A 4ER6A 1OGYA 2RH5A 4ZZ0A 2WHPA 2GEKA 1EHIA 3GK3A 1RHMA 1VYUA 3TTWA 2ZR9A 2IPMA 3GLGE 1QU2A 4CQMA 4FSHA 1E8MA 2DCMA 4Y6RA 1HV8A 1AK9A 1F4VA 1ELOA 4M7WA 2CV0A 4AZSA 4P58A 5M04A 4DDMA 1IBMB 3GVXA 3EY9A 4PPFA 3CN7A 1NBMD 2C88A 3KLPX 4IVPA 4OA5A 4EHIA 1MFZA 4QGGA 2HY7A 4LV5B 1CQPA 2HBZA 4KV9A 3LBHA 3WGTA 4YCDA 2HT1A 2GAOA 1DHRA 4IIYA 2WIJA 4IIXA 1TM2A 1WCYA 1YE8A 3KYJB 4UHEA 4PN3A 3CISA 4TZ6A 6GPBA 4HGZA 4DV4B 3RRXA 1HT0A 2IODA 1YGYA 2C96A 3U4AA 5CLQA 3UYKA 2ZUUA 1I10A 1YS9A 3ME5A 1P6QA 3C3WA 4RM2A 3EZ7A 4BRSA 3N74A 2HV9A 3E5MA 4JKOA 2QK4A 4BRWA 1I24A 4KO4S 2FR8C 4Q21A 2BGTA 2R6FA 4HNGA 5FBHA 3GROA 4LOIA 1G5IA 2EX4A 4QREA 1W7AA 5ITSA 3R3VA 3EBLA 3TTVA 1WKVA 1WMEA 2AWOA 3FETA 4B4DA 1J1UA 3LBNA 3IDQA 1JFRA 4NE9A 2ZRGA 3AEKA 2D62A 3WDLA 1XD2B 2FWNA 3HWSA 2EKQA 3UJHA 4D5EA 3PFHA 3M1IA 4HGYA 1TYAE 4YO8A 5TGDA 2Z2JA 4UEWA 5KYYA 5BOVA 2J9RA 3VJLA 4TKMA 3JX9A 1Y81A 3N8NA 3OTHA 3UC9A 5BMVF 2ZE8A 4GDFA 2GBPA 3I05A 2VCYA 4FZJA 2J9XB 4G6ZA 1DAFA 2PGDA 1IWBB 5PNTA 4Z4FA 3GRZA 3ZCXA 2NU6A 3LOUA 2XA2A 3OLQA 4OMCA 4OQXA 1T9CA 4N5HX 1D6MA 4B46A 1WV0A 1WKCA 2J9FB 2PT7A 5CITA 2BFNA 1MRSA 3BXPA 2CL5A 1HZJA 1JSRA 2CB9A 2GZAA 2I1WA 4HPWA 3C5WP 5AHXA 5E1MA 2AW3A 4TQGA 5EVCA 5JFTA 1U0OC 4XA8A 4ZO4A 4IPTA 1FTQA 4ND8A 3MUEA 3V3TA 3GQBA 3AHJA 4KLCA 3W9UA 4X8LA 1RACA 3OF2A 3OAAD 2FX2A 3QXCA 2Q28A 1T9HA 2I4RA 3CPHA 5GJBA 1GQFA 1C3EA 1RJ9A 1J20A 4IFIA 3ZDQA 4D6XA 4EW6A 3R5HA 4TN5A 5EHZA 5KOIA 1QU3A 3KZCA 5A2GA 1EVZA 3EA0A 1W0KA 3KXIA 4Q24A 5CLGA 2OR3A 3R23A 1QHIA 1V48A 4N7RA 5JMWA 1LUAA 2UKDA 1Z06A 2HDNB 4HDKA 3SJAA 5IFLA 2FEXA 1RAAA 3IJEB 3OZXA 5HTOA 3QHAA 4XUDA 3U4CA 2BSXA 3UICA 2QVZX 3HY3A 3OM1A 2GDZA 1XMQB 2P8SA 3I2JA 1LDBA 4YASA 4D3XA 1E9VA 3IESA 1NMYA 2Z3VA 3EQ9A 3RS0A 2BFPA 1KFEB 3FX2A 1RBYA 4G63A 3HKCA 2Y1LA 4TGLA 3OJEA 4WT7A 3TVYA 1GXSA 4C87A 4FIDA 3GFBA 4UTPA 3LXMA 4WINA 2RDMA 1Q7TA 1CLEA 2ZIAA 1DQSA 3QV1A 4ME6A 4WCDA 1EEXB 4QNMA 1W36C 1HSZA 3NORA 5DHSA 2KI5A 3OPYA 1M1UA 3BILA 4TLCA 3T5TA 2Q3CA 4Z49A 1SG0A 3PNVA 4FXOA 5J63A 2E4WA 2BCJQ 2G0AA 3OIWA 4EJFA 2VRWA 2CXTA 4XOIA 3MJDA 2JJ1D 3PFWO 1SK8A 3CGWA 1QAQA 4HNSA 1V7PC 4Q1DA 4TTTS 2WFZA 5HCIA 2HZ7A 4PZDA 3R09A 3TQCA 5DNEA 4W8GA 4XDHA 4QBIA 5LKAA 4KIUA 1J24A 2ZT8A 4I2NA 1QCDA 1H2HA 4QQ8A 4D82A 1CF4A 1QSGA 2OL4A 4XQ0A 4LRSB 3OCVA 3N2KB 4IQ0A 3TNYA 3QVKA 3ZVKA 2AG6A 4ZAGA 1YR6A 1N3YA 2HCBA 1ILEA 1TRKA 3GBPA 3FD8A 1TAGA 2NO7A 3HZOA 3DZIA 3K94A 1J99A 1LS6A 3DONA 3USCS 1ORHA 4NKRA 1SRRA 2QRGA 3HN7A 3I64A 4TYNA 1L5ZA 3IT0A 5K01A 3KSMA 5JHGB 2F8TA 1FP7A 2SNIE 3T8YA 3BJMA 2WZQA 3X0DA 5A5EA 4BNYA 3T9BA 3RD5A 1JECA 1OTYA 3AR2A 4U9IS 3BAZA 5DYNA 4C0JA 5GMOA 2PANA 2FZKA 4HXEB 1CY4A 2WYUA 1G59A 1VP9A 1UL1X 1P4RA 2NXWA 3AINA 3GAMA 1UDXA 3V1NA 4B4WA 1G6Q1 2H07A 2PMKA 4BS9A 3KSBC 3QXJA 5DN9A 2R4QA 2UVPA 3H8WA 3MPOA 4M88A 5KKCA 2J5QA 1VKHA 1RDFA 2B78A 5FX2A 1CZNA 5F9MA 4MB6A 4DLPA 2QUKA 2XTJA 2XLBA 3RRZA 3FW1A 4WIAA 1RIIA 4H1WA 2IF0A 1WNTA 4WNIA 3DLBA 1K06A 1WLSA 3PGKA 2HM7A 2MSCB 3C6KA 1XX6A 3UGQA 2VDKB 1SC6A 2PXCA 1KF0A 2Q4EA 3Q2OA 1Z68A 5FI3A 3GFRA 2R6AA 4KKXB 5FWXB 2DECA 1SRQA 3RVBA 2RGYA 2RK3A 4XTCS 3TL3A 4NXNB 4H0FA 1HFEL 5ARBA 3T52A 1M2HA 1A76A 3DAYA 3LRPA 3QW4B 1J8DA 1PN3A 4KBYA 2BL4A 4MR7A 1GYQA 3DR5A 3KJNA 3N0TA 1ZL0A 4P84A 3EOZA 3WMFA 4NDNE 1W0JA 2G28A 2OCLA 3OX4A 3OZGA 4IXMA 4YBRA 2JJYA 5ALRA 4DQXA 3A6JA 5K8JB 3RG8A 3KV3O 1PJCA 3OIDA 3C7DB 1UBEA 1V6CA 3QWAA 2A86A 5AICA 1ZD3A 1FPMA 2QD1A 3O2SB 1C9KA 3NZEA 4KDCA 5LBTA 5A4FS 1JLRA 4PGMA 1NN1A 1V4NA 1JTVA 1NDQA 1RCFA 1TTHA 2B0JA 5FB3A 2G08A 5EZ5A 1CUBA 2TMKA 3DMTA 4UHKA 2QNIA 5BW4A 5FP0A 4HRXA 1G41A 1WVMA 4FOLA 4OQZA 4WOPA 2QWXA 3E5NA 4QOIA 4UJ5A 1N6HA 1T3TA 1ZN9A 2P4UA 3AR8A 4JU8A 1JFSA 3UMMA 4BVHA 3ZH9B 3BIOA 1NULA 4WKOA 1WVGA 4YJHB 4CMKA 4PAWA 5HYVA 4ENSA 3UMCA 1P2TA 2CLHB 2CNWA 2GZDA 2WU1A 3NHKA 3RUAA 3F9IA 4OJTA 4B31A 3CBGA 1C7RA 1SH7A 2YV3A 3D0RA 4R51A 1I3OA 1YKGA 4YRQA 1SCBA 2Q4RA 3EQ2A 2XF8A 5TC4A 3WGVA 2EBFX 3M6MD 4BMNA 4OO3A 2GKSA 4E5MA 4EHKA 3KOUA 3PIDA 2AZMA 1V8OA 5TPZA 1O08A 2CD7A 4JEUA 4Z3KA 3JQRA 5ENZA 3ZYCA 5E2IA 2ST1A 3G2PA 3HI6A 4IOKA 5JNUA 1EWRA 3DD5A 1SVIA 4DLBA 3HGTA 1E5QA 4K6FA 4H7EA 3T4PA 1EJ6A 1B26A 3UMYA 3SYMA 2XDQB 3I0ZA 1PZXA 2FZCA 4BU0A 2PZLA 1N9KA 2XJ4A 1XTUA 1HE5A 2ANCA 2JANA 4QYWA 5EEHA 2ZZMA 4UKDA 1M1NB 1GZ3A 3BK7A 4HT3B 1I36A 3B1FA 2DG2A 4RS4A 1JG7A 1VYVA 3D5TA 2M9MA 1ZJYA 2VHCA 5K3FA 3PC7A 3TH5A 1CVIA 4JQZA 2PN1A 5F7OA 2BFEB 3ZV4A 1E89A 2D0PB 1W49A 2AJLI 4Q9DA 1GLGA 4X60A 4MUAA 2A3NA 1I2ZA 4D4LA 3W7AA 4YAOA 5ERGB 3GPBA 4UQOA 5AM1A 1TFUA 4IAOA 3B82A 1EBFA 3OMWA 1PZGA 3GDWA 3F7TA 1EK5A 3EPLA 4Q1EA 2JHFA 3BD7A 3D7SA 2KPOA 1PSZA 3G9TA 4JUDX 4X62B 4OL0A 1NJFA 2JKZA 3LYHA 3IOYA 3NETA 1HOXA 1G1AA 3LJKA 4TTRA 4EPYA 3RROA 1V7ZA 2GLUA 4LTDA 2H5JA 1UT8A 2RGXA 3BKWA 2YDYA 1XQYA 4TKVB 4IICA 3CZRA 3TG8A 3GNSA 1FS5A 2FMKA 2PKYX 5CB4B 5HGJA 2UUAB 3DPIA 2NYAA 4R1TA 1Z28A 3PIIA 2L19A 2GXSA 1MC1A 3AVWA 3Q9SA 3FB1A 4YROA 1GZ5A 3A6EA 3UJNA 2PUEA 3A31A 4DG9A 2YWBA 4LJ8A 3IAUA 2GUWA 4U9HS 4YDQA 1ND6A 3UK0A 4YV0A 5EJ9A 2HDOA 1QLWA 4DPKA 1EUZA 2FW7A 3G7UA 1FMLA 2ZUCA 3ZZ0A 2IDKA 2DMRA 1Y4ZA 3AERA 2ZBFA 1E62A 2CJFA 3JYNA 1XZFA 3HKBB 3W3AA 4W5JA 1RKXA 2O8BA 4LN1A 4G5GA 3COVA 1A8IA 3T5MA 2IPLA 2HA4A 4JGGA 3EFHA 5I7WA 1E6WA 5KYWA 4C6RA 5K0LA 4PSDA 1ZR4A 2A9PA 4GQAA 4Q3AA 1AQNA 1KI7A 2FDCA 2OBMA 3IP3A 3PNLA 2ZI5A 2GYYA 4XR9A 5FPPA 1BVHA 3NKVA 5BNIA 4EZEA 1BFUA 1M34B 4QDZA 3UWDA 4HLNA 4PZAA 4V39A 4ZVTA 4QVGA 2YHAA 1NXVA 3OEHA 3ABSB 4U02A 3R9IA 1J5EB 3PL5A 2G0TA 5AHOA 3T5BA 1ZKMA 2MSLA 4BNDA 2YRWA 1VIDA 4GOMD 3ZWDA 1HDXA 2WMDA 3FDJA 4MMXB 4NPCA 1U7ZA 4ZRNA 4ZCPA 5KNDD 2B99A 2IPAB 2P2DA 1TYBE 2R9VA 3HNPA 2KYRA 3KXLA 3LVRE 1X14A 3LRTA 4YCCA 2DOKA 3HK2A 4BNLA 1QO9A 3IVAA 1T6ZA 1XU7A 1ZMOA 1DEXA 1PZHA 1UXJA 3EISA 3FYCA 3GH3A 1PS0A 2XWQA 3SHTA 5HVNA 1Z0JA 1L5WA 4IDCA 4GPBA 2B1GA 2JI4A 4PR0A 1G2IA 2IEDA 3PUIA 1F1JA 4BMZA 4ZC1A 2QT1A 4B2PA 1C30A 1HMPA 3EPRA 1Q74A 2WF8A 3IQEA 4NU8X 2Y67A 4M0CA 4IXTA 4OKNA 4E12A 2H4ZA 1YBMA 4QASA 4UMDA 5JH7B 2JFNA 3HEMA 3K0CC 1VQ1A 3R6WA 5KCMA 2CFRA 3B78A 4EENA 5IMBA 4QBHA 3A26A 3DLIA 1AGXA 4P8RA 3U4DA 2DUNA 2HFJA 5JRZA 3K15A 1GGHA 4IOMA 4B3XA 4TV8A 3TSWA 4NE7A 3TK1A 4D8VA 1KS9A 2IH2A 2R66A 1L4EA 5AVQA 4JBLA 2CXXA 2VUUA 4WK6A 4UVDA 1PCXA 3CHYA 4KXFB 2EFCB 4F3YA 1QUFA 4BECA 3VSCA 2C92A 5CA0A 1OY1A 3W1WA 2O0LA 4PC7A 2EOAA 4O4IA 3DTVD 4C0AC 4JUFA 2O23A 1DUIA 1WQ4A 3Q8KA 1RHJA 1U0GA 2I66A 1I7SB 4DG8A 4DNXA 2ZULA 1U2SA 3IEIA 4A2PA 1JDBB 2IHTA 3AC0A 3H1BA 1XTSA 4PRKA 2J3HA 4X1OA 1T0IA 5C52B 1FP2A 1DV2A 3I1IA 2X1VA 5JAOA 3QE9Y 1EQAA 2FE1A 2H16A 1JHYA 4MYTA 4DSNA 1SVOA 3ZCTA 3WGKA 2AUMA 1WCXA 2EZ4A 1MMFB 1VSBA 2AC4A 3BE4A 3WL4A 1OPXA 1ZJJA 5DLYA 3UV6A 1RBZA 1D9ZA 3WHLA 1UMKA 2RD2A 4OBBA 3UA4A 2XV1A 2FDXA 4D6YA 1QLJA 1F38A 4XI9A 1W85A 2CXQA 2RHJA 4L4RA 4OXYA 2VTKA 1OZAA 4DNOA 2ZI4A 4MZXA 4AG3A 3AVTA 2WAYA 4ZVQA 4HDOB 5JQGA 4FGKA 3K0FB 2GO1A 3L07A 4J0JA 1M8GA 3N0RA 4J94A 3AKEA 4H4CA 1V8DA 3U3JA 4DLVA 1LF5A 2CT8A 3IILA 3VR2D 4N76A 3I2YX 4MARA 3E4CA 1C8BA 4M98A 4MSUA 1A4IA 1YI0A 2XUGA 1DO8A 3PQ2A 2DETA 2NXNA 2NZYA 2N3ZA 5JSYA 2IS2A 1H3NA 2HJVA 3DDNA 2F4VB 3LQKA 1IZ0A 3OH8A 5HF8A 1C8VB 1E1CA 1YASA 1C3XA 4C2TA 1XWFA 2ALJA 1YDGA 5AJTA 1F5SA 2BYTA 5IDYA 2OD9A 4CKBB 3KYCB 1BGXT 1NXQA