4BKOA

Enoyl-acp reducatase fabv from burkholderia pseudomallei (apo)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
LVPRGSHMIIKPRVRGFICVTTHPAGCAASVREQIAYVARRGPIERGPKKVLVIGASTGYGLAARIAAAFGAGAATLGVFFERAPADAKPGTAGWYNSAAFHDEAAARGLQATSVNGDAFSDEIKHKTIDAIRRDLGQVDLVVYSVAAPRRTHPKTGVTHQSTLKPIGHAVRLRGIDTDNEAIKETLLQPATPDEIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTAFTYLGEQVTHDIYWNGSIGEAKKDLDRTVLALRGKLAARGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKARGTHEGCIEQVDGLLRDSLYGAQPHVDAEGRLRADRLELDPAVQARVLELWDQVTDDNLYTLTDFAGYKAEFLRLFGFGIDGVDYDAPVEPNVRIPNLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE REDUCTASE BURPS305_1051
publication title Point Mutation Changes Substrate Binding Mechanism and Inhibitor Specificity of Yersinia Pestis Enoyl- Acp Reductase Fabv
rcsb
source organism Burkholderia pseudomallei
molecule tags Oxidoreductase
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07055 Eno-Rase_FAD_bd Enoyl reductase FAD binding domain
A PF12241 Enoyl_reductase Trans-2-enoyl-CoA reductase catalytic region
A PF12242 Eno-Rase_NADH_b NAD(P)H binding domain of trans-2-enoyl-CoA reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bkoA00
2IXBA 5ER6A 4BO8A 3GEMA 3WWZA 3JQGB 1I2CA 4E5NA 2P9CA 1E3SA 1ONOA 1JKJA 3E48A 4WOJA 3H5AA 2O3RA 5KNLA 4D42A 1LRJA 4I9NA 2DUUA 4EUEA 4J1TA 4R3NA 1I5RA 3HUDA 2CF6A 5T64A 1DRWA 5IDYA 3NYWA 2NVBA 1A27A 5TQVA 1CQJA 3AOGA 1YB5A 3A28A 3U4HA 1PJ3A 5DCYA 1GV1A 1PQPA 2GZ3A 2VCYA 5EINA 2BGLA 2HUNA 1K89A 2R6JA 4X54A 5IG2A 2JHGA 4W7HA 3ZHBA 2IEDA 1VC2A 1KOLA 4J0FA 1ZH8A 2WYVA 1G0OA 3UCXA 1F14A 3F4LA 1TEHA 4PZDA 2V6MA 3AFNA 3RUHA 1F06A 1QXSA 4HFRA 1PQWA 3C7AA 3MJVA 3W6ZA 5H81A 1N9GB 1NNUA 4A10A 4KTVE 3NT4A 3NEPX 4HNGA 1YBVA 1H6BA 2V7PA 3NDJA 3PHJA 5DOZA 1D7OA 2NQ8A 2IYOA 4U7WA 5JSFA 1N1GA 3VDQA 1ZFNA 4R1TA 3GGPA 4FB5A 1UP7A 1E7YA 2QHXA 4URFA 1QYCA 4P22A 4Y67A 1PJ4A 2AG5A 2HSDA 3MJSA 4FOSA 4A27A 4CM4A 3GLQA 2Y66A 4BB6A 1ZK0A 3GVHA 2PLAA 3GG2A 3U9LA 4CLOA 2QZ9A 3GZ4A 4Q3NA 5HRUA 3FTNA 4PG4A 3EYWA 4RO0A 1YVEI 1HRDA 2NTVA 3VZSA 3RAJA 4C7JA 5EERA 4KUGA 4NFYA 5C3MA 4XYMA 1T1SA 1E3WB 2I5PO 4U5QA 3NTQA 1ENOA 5EMHA 5AYVA 3S2FA 4HP8A 5JBIA 4BL5A 1AHHA 5ES3A 5HBRA 3KEQA 1WDKA 4LW8A 4F6CA 2FWMX 1YDEA 4WLNA 1C3VA 1N2SA 3DO5A 1HYGA 5T8KA 2Z5LA 1BXKA 1NWHA 1C1DB 2I66A 3GDOA 3E9QA 4KP7A 2YYYA 4RVGA 1HDCA 5G4LA 3ROKA 4BV9A 5I7EA 1R4NB 3DZKA 4J7UA 3VPXA 1W8DA 3ABIA 3IQDB 1EEHA 3G3EA 3OFSA 4D43A 3INGA 2CMDA 7ADHA 3DFUA 1H94A 4CQMA 5JAIA 4GPD1 3L6EA 5EL0A 4CQLB 2QIOA 2IXAA 1ZBQA 1ISIA 1CETA 3PJGA 4IDCA 4L73A 3ZWPA 4BO7A 1GV0A 4CMEA 4YAKA 1GFSA 3SX2A 1ADFA 4FGWA 4GVLA 2VT2A 9LDBA 1C14A 1LDYA 1GEGA 1HZJA 3ADPA 1KBZA 2FN7A 3BHMA 4GMFA 5A06A 1HDRA 4DBVO 3JYLA 4NJMB 5AVOA 1T26A 4UULA 1ISGA 3LLSA 2J5RA 3AY6A 4EUHA 4W82A 3QP9A 2YV2A 3C7DB 4ZU3A 3RBZA 4CLXA 3K6JA 4CR6A 2NNLD 4I08A 2VNAA 2FHSA 4LVUA 1WNTA 2G17A 2WYWA 3H4VA 3W6UA 3V1YA 3IP1A 1XQ1A 2EIHA 4B4VA 3EC7A 4PCVA 4G81A 3R6DA 4DXHA 1A72A 1ZSYA 3WOHA 4GLOA 1GY8A 1I3NA 1FF9A 3U4IA 4JN6B 5I7SA 5KVCA 5U1PA 4YRDA 1O0SA 4GX5A 3E9NA 2CDCA 2DFDA 3DZGA 1SOWA 4E2XA 2VWQA 4XGKA 1MG0A 1V3TA 2O50A 1WW8A 3Q9NA 4WLVA 1P9LA 4F45A 5IN4A 3GAZA 5JS6A 3E18A 2EKPA 3VZRA 4CM5A 3DHYA 3RVDA 3VH1A 3DDNA 4FIZA 1SB8A 4FR5A 1XGKA 4AL4A 1OFGA 4AJNA 1VRWA 3BMCA 3ONEA 4RQUA 2I67A 4M87A 1UDBA 4D79A 3DEYX 2WE7A 4JNKA 2I65A 5C7IO 1FJHA 3U3XA 2O2SA 4CLRB 1IZ0A 4E13A 2GD1O 2YQ4A 2J5KA 3FRJA 4J16A 3A9WA 2OZPA 3OA0A 5JCXA 4MP3A 2X4GA 4Z9FA 2J3JA 2Q1SA 1JQBA 5CDSA 3RROA 3GK3A 3WGQA 3K2EA 4B8ZA 1EK6A 3NAQA 5CAEA 4L4XA 2HCTA 4AICA 1J6UA 3KYDA 3RQSA 2DVMA 4E30A 3OF2A 2A92A 5G0SA 4QQRA 1Y5RA 1P1IA 1ISJA 2EJVA 2CY0A 1QKIA 4IGEA 2WYUA 1T2CA 1DHTA 4HFJA 3JYNA 1IUKA 1BTOA 3PGXA 2NTJA 1U5CA 3WQQA 5JYEA 1HDGO 3UW3A 3AM4A 3ITKA 4B4OA 1QSGA 4DPMA 2Z1MA 8LDHA 5DCUA 1XDWA 3B1KA 3U0BA 2VYNA 1ZEJA 4Y6RA 2J3HA 3PJDA 4ONEA 4YJDA 3WICA 2X9VA 2G82A 2J8ZA 2PZLA 4BO1A 3ZWCA 1RYEA 4K28A 4TRNA 2AQHA 4YJGA 5A5EA 1ISHA 1NVMB 5GMOA 4MVJA 1QV7A 1U7HA 3KETA 2FR1A 1VJTA 3ICCA 3RBVA 3Q9UA 3Q6IA 2BFOA 4M55A 3K30A 1XHLA 3G1TA 4BNGA 2O7QA 4PVDA 2WD8A 3CPSA 4IS3A 4E5YA 4NBVA 4O5OA 1O6ZA 1NASA 4JGBA 3IC5A 3PFWO 1D4FA 3L4BC 1HWYA 1UXGA 2NV6A 3K5PA 3ZNOA 4BGUA 1O8CA 2YDXA 2ZB4A 3ZHXA 1PJCA 2DM6A 5L53A 2W2KA 3WTBA 1EK5A 3VH3A 5KJ1A 1TXGA 1CQIA 4IDGA 2HK9A 1LQUA 2JCXA 1A7KA 1RM5A 3AFMA 4OYRA 3MOIA 1T4DA 4MVJF 2D8AA 1WP4A 3GZNB 2F00A 3DBVO 4HNHA 1PGQA 3QRWA 1RWBA 4NK5A 4Q9NA 2X5OA 2JAHA 4BNVA 1EDZA 4YBZA 3GPIA 4KQWA 3UUWA 4BMVA 1SPXA 1LJ8A 3I52A 2ZKLA 4MJLA 1JVBA 3KHUA 1GPJA 2AW5A 3RKUA 3AK4A 3D1LA 2X8LA 1W73A 2NADA 3ZZNA 5HWSA 4NR0A 7MDHA 2FY8A 5KOIA 3ZU3A 2P2SA 4G5HA 1V6AA 3D5QA 4DUPA 3E9MA 4BO9A 5HS6A 2HQ1A 3BXXA 3FD8A 4FJ0A 3WIDA 5FEUA 1E5QA 1MUUA 5JDIC 4J90A 3AI3A 4IM7A 1DC4A 4GX1A 1UAYA 4IMRA 3WBBA 4YWJA 4MPDA 3VTZA 4Z6KA 4J2OA 4JJGA 1R4MB 2Q3EA 1LSSA 2DPHA 3FCOA 1Z82A 2Y1EA 4FPXA 4NHEA 4A5OA 5A9TA 5FFFA 3GAFA 3VH4A 3INRA 1HTBA 3WGYA 1VLLA 3TFQA 4JP3A 3HHPA 3WGIA 5AXBA 1SC6A 1OC2A 4YT2A 1P77A 1ZNQO 3KUXA 3GOHA 4CV3A 1RM4A 3TPCA 1NPTO 1VKOA 2DPGA 3PWZA 3OQ6A 1P45A 4EBFA 4XD2A 2FSSA 2VHYA 3AI2A 3V2UA 1R6DA 4W7IA 2CDBA 1RJWA 3ZU4A 2IE0A 5IXYA 3RIHA 1QYVA 1BWSA 3D3EA 4GBJA 3HFSA 1U8XX 5DP1A 2VHXA 3EDMA 1ISFA 2Q1TA 3GFBA 3NT5A 3GHHA 2PK3A 1VM6A 4WLFA 4IQ0A 4AJLA 4PG6A 1NPDA 2UUPA 2UVDA 5KJ6A 4P4NA 3ZWWA 4BQRA 2P5YA 1K6IA 4FFOA 1PL6A 3ULKA 3L4SO 3H9UA 3IP3A 3H6KA 3QVSA 2EG9A 3PRJA 3JQAD 4HKTA 4R1SA 1WLYA 2VRCD 3FNFA 2QX7A 2EGGA 2HRZA 1HZZA 4J7XA 5G0WA 4GKBA 4N5NA 1FDTA 1L7DA 4R41A 4MP6A 3ZWXA 1LTHR 3I9LA 4D45A 4A03A 2HDHA 4R9RA 1NXQA 3GC6A 3OJ0A 3KVOA 3RUDA 1BW9B 1MX3A 4O0LA 3DMTA 3MTGA 5I9LA 4UUPA 1HYEA 1RYDA 1YXMA 2AEJA 3HDHA 2OXIA 1P3DA 4ND5A 3GT0A 2QRKA 4HFMA 3JD3A 1NAIA 3JQGA 4Z0HO 1PJLA 2J5QA 4RDIA 2GCGA 3GEDA 4BNTA 2O3JA 3HWRA 1GZ6A 3CXRA 3PJFA 4J4BA 3ZWNA 2G76A 2QYTA 1PU2A 3W1VA 3JQ8A 4CM1A 1DRUA 2PH3A 5CEJA 3AOEC 4RPKA 3GF4A 1G1AA 1UXJA 4IIUA 5K6AC 4HXYA 3I9JA 5DCWA 1B3RA 3ZHZA 4RDHA 1GCOA 2V65A 4DL9A 1V8BA 3RU9A 2WMDA 3GNTA 5DZSA 2EGHA 2O3SA 1EVYA 4E6PA 2ZTUA 4FW8A 4OOFA 4CM6A 1BDMA 1LA2A 2C2XA 3NJ4A 3O4RA 4WGGA 3STHA 4YA6A 3NJ8A 2Q49A 3K96A 3LQFA 3GUYA 1P1RA 2ZJ1A 3A14A 1N9GA 4WCDA 5F21A 1EE2A 2IRWA 4M54A 2VUUA 2E4AA 3DZFA 2WD7B 4TZTA 4E33A 3GR6A 5BSEA 2XF8A 4Q3DA 4FFNA 2BELA 2BF7A 1UUFA 1LBEA 3PK0A 1BVRA 3EVTA 4GAEA 4YT4A 1FDWA 1I3MA 4M86A 1UP6A 1PS0A 3HN2A 5MDHA 4CMGA 4FFLA 4I9HA 1CYDA 2EP5A 2C5AA 1FMCA 3QLJA 4BGIA 5BNTA 1U9JA 3PEFA 3PLNA 4KWHA 3DTTA 3ZH2A 2BKAA 3AI1A 4MIOA 1E3WA 3FR8A 1XG5A 1Y81A 2Q1UA 3LF2A 5L51A 4PG8A 2VHZA 1D1TA 3JQFC 4B3IA 2I99A 1P1JA 1HDYA 3FI9A 1UZMA 4ZRMA 4H3VA 5C5IA 3L4BA 1C1DA 1DC6A 4H15A 2R2GA 3VTFA 1R4NA 5AQ1A 1EZ4A 1YBAA 1R0SA 1TT5B 4TVOA 3T4XA 4L4SA 4OXKA 4BKPA 1VSUA 3AM5A 3RD5A 4XQEA 1E3EA 3ON5A 2YQ5A 1IHYA 4YQZA 4DQXA 1P1KA 3RSHA 4HUJA 1GYPA 5CG1A 4CQLA 2CD9A 4MP8A 2NSDA 3OIGA 5CDTA 3GRKA 4LCEA 3VZPA 4AJEA 2PY6A 5DNAA 3KRTA 1Q2XA 3QVOA 1HE4A 5H82A 3WWYA 4CM3A 5B12A 3W8DA 2C7VA 1KVUA 5KWEA 3DXFA 5ILOA 4NJMA 4RVUA 1U1IA 2GUGA 4Y98A 4OHUA 4XJTA 5JAQA 3JQ9C 1HLPA 2PD6A 1U3UA 2DT5A 2W90A 2GSDA 3EZYA 2C0CA 1BDBA 1YRLA 3ETGA 5JDIA 4DLBA 2X58A 4HX5A 1GZ4A 4NH4A 4YR9A 2X1HA 1H0KA 3CZMA 3Q11A 2C20A 3JSAA 1E3JA 2PH5A 3WG9A 5THQA 3T7EA 1Y8QB 1YQDA 4B3JA 4D46A 3RC7A 4IZIA 4N5MA 4ZVVA 1ZSVA 1NQ5A 3H8VA 4A73A 1G0NA 2B5VA 1B2LA 3B1JA 4KDEA 1A9ZA 3GGOA 2YV1A 5CDGA 3NDRA 1E7WA 3JQAB 3QWHA 4Q3AA 4OO3A 4DQUA 2Y1FA 1U2DA 4MDHA 1DFGA 4J2HA 3HFGA 4E2YA 3C1AA 4IDFA 3DZJA 4QX6A 3GFGA 4K6FA 2Y1DA 4O1MA 4YRBA 1BRMA 1PJBA 3LVFO 4W9NA 3UHAA 3LT4A 4CLRA 1IOLA 3R3JA 4RVSA 1YH3A 5IFLA 2E6UX 6ADHA 5A3VA 1GAEO 2O7SA 1QYWA 4CMCA 5A3JA 1DEHA 4ZA2A 4UVHA 3ZU2A 4JBHA 4U6QA 2Y99A 4JBIA 5CEEA 2JJYA 2Y1GA 4YJFB 3TDKA 2DBVO 4ZD6A 5L45A 5TLSA 1KS9A 5DBGA 3U49A 1QYDA 2DAPA 2Q1WA 2LDBA 4MVJM 4PGFA 5TJHA 1F0YA 1G6KA 4ND1A 5TRTA 1RM0A 2RIRA 2NU6A 3RCBA 5C7LO 3WR5A 2HU2A 4YAJA 3W8EA 2VWGA 4RLHA 4B79A 1AUPA 4K9DA 5BR7A 3FF4A 1BGVA 1PGOA 5COAA 5F5LA 1NR1A 4PFJA 3SEFA 3UH1A 3BMOB 4BS9A 2TMDA 3WX0A 1H2BA 3L07A 1U3TA 4UUNA 3SLKA 2AE2A 2XPCA 4RLSA 2B37A 2GRAA 2PKQP 3U5TA 1A7AA 4D7AA 3NV9A 5A1TA 1DPGA 4L9RA 1R16A 5LDHA 3CEAA 3OJOA 1B8VA 3QQPA 5JY1A 1E7QA 3PDUA 3JQ8B 1AHIA 1IHXA 5TGDA 5IF3A 3FR7A 4C7KA 2XAAA 3AOEA 3TZHA 1XWFA 2X86A 4RCVA 4EUFA 2EEZA 3DHNA 1T2FA 4FBGA 1HF3A 2FR0A 5K6AA 1L7EA 2X5KO 1CWUA 4ALLA 3N58A 5B1YA 2CFCA 2NLOA 5FI3A 2YW9A 5KTKA 2Y1CA 3DFZA 1JVSA 1NQTA 2C2YA 2UYYA 4KWIA 2BFAA 1DIAA 4DPLA 5EIOA 5L7TA 3F46A 1H5QA 4RVHA 4BNHA 2NU9A 3C1TA 3ASUA 4JP2A 5JLAA 3LC1O 1JU9A 5L4LA 3EGOA 1UR5A 4FFRA 3ZNNA 2DBRA 3WMWA 1WMBA 3QWAA 1MFPA 3EY4A 2AEMA 3PQEA 2HAEA 4FJ2A 3GZNA 3JQ7B 2CVZA 3TWOA 4XYBA 1XYGA 1E1KA 4Q3CA 5HTOA 2BH9A 3D4PA 1GUZA 4DIOA 4DMLA 5T67A 4P8RA 1Z7BA 1F8FA 3PLRA 4CM7A 4GWKA 2Y0EA 3WYCA 1Q0QA 4Q3EA 3SC4A 3M2TA 3JQ6A 4YAEA 2WDZA 3ETEA 4R1NA 5I7FA 3H7AA 3PXXA 3O8QB 3TQHA 1VE9A 1O5IA 1K3TA 2Y67A 4G2NA 2OMEA 2F1KA 4ZICA 1E77A 1UAGA 1ID1A 3HG7A 1ENYA 4H7PA 4LSMA 4RPJA 4B3HA 1NQOA 2J6IA 1UXKA 4TRJA 2DTXA 2NQTA 2PA3A 3PWKA 2AG8A 2Y93A 9LDTA 4WCFB 3EVNA 1NWCA 4IDDA 4J49A 5L3ZA 1QLHA 3L9WA 5IN5A 2OBNA 1Q7BA 4FJ1A 1ZCJA 4XR9A 3UCEA 4CV1A 4E3ZA 3C24A 1NVTA 1R4MA 3PYMA 4PRLA 3JQFA 2EJWA 4BUCA 3TL2A 2FZWA 2FPPA 4GGPA 1GZ3A 1LDNA 2JD2A 3O26A 4ALIA 3CSDA 4EGFA 2RHCA 4ZGWA 1EUDA 1GADO 4I1IA 4PIVA 1JKIA 1VJ0A 3RJ5A 3W8FA 3AUUA 3L77A 2G5CA 4ALNA 1B0AA 4K1LA 3WGGA 1H2HA 1EE9A 3HZZA 3KSUA 1P44A 4RZHA 3V5NA 2XXJA 4S1VA 1SBYA 3GNSA 1E6UA 4L8VA 2O3QA 2UAGA 4TRMA 2QRJA 3AU8A 1DLIA 1CJCA 4XQ9A 5BQFA 5JW6A 3ZWOA 1LX6A 3U4CA 3TN7A 2DU8A 4BO0A 4EDFA 2H1SA 3E82A 4L76A 2X7HA 3EMKA 1T2EA 1TT7A 5FYDA 1IPFA 1GDHA 2VZ0A 1PQUA 4PN3A 4XGIA 4KQXA 5DN9A 2X9GA 4XIYA 3F5SA 3OICA 2QYSA 1M67A 3LDHA 1I3LA 4UVGA 1F8GA 3BTOA 3WGTA 4B7CA 3DR3A 2WJPA 3DMYA 2A35A 5GZ6A 4C4OA 4EJ6A 1JN0A 3BA1A 1S7CA 4CLDA 4F3YA 1P1FA 3DQPA 4AJ1A 1YBMA 2ZCVA 1X14A 1T25A 1YGYA 3ICPA 4UEKA 3SXPA 3RC9A 5ENDA 2OOSA 2CNBA 4OKNA 1Z45A 3Q1LA 3N7UA 1ZXBA 1SAYA 4PLFA 1BW9A 3KLPX 1BSVA 1BXZA 1HSZA 1DC5A 4E5KA 1P31A 5JDCC 1KVTA 1LDEA 3JYPA 1LRLA 4GVXA 4D0SA 5BSHA 1BHSA 3IMFA 1KVSA 1K6XA 1ML3A 4DYVA 1YO6A 1PR9A 2B83A 4J9VA 4AJPA 4DWVA 1F12A 3P19A 3I1JA 1E7MA 4S3MA 1ZK3A 1SEVA 3P2YA 1ENPA 4PLHA 4UVIA 4QFDA 3ROMA 3TFOA 1DAPA 3D3WA 3U4DA 3IAHA 1AGNA 2O48X 3GH3A 3T4EA 5TF4A 1XLTA 4BNUA 1Q7CA 1KC3A 1KC1A 5JY6A 3B70A 4F46A 5KKCA 1VL6A 1DRVA 3DHEA 1EVIA 2GN4A 4YACA 8ADHA 4QEDA 4O63O 3ROQA 4ZQFA 3ZWBA 2VHVA 3D64A 3JQCA 5C37A 4K6CA 5DP2A 2PV7A 1Y6JA 5IZ4A 3RUAA 4LCJA 4CMJA 1WAMA 5GY7A 1PWXA 1LSOA 1QLJA 4ZQBA 2BRUA 2WD7A 4O59O 1HXHA 4YEDA 1DIRA 1HYHA 2NU7A 1R37A 1K0UA 5DF1A 3JD1A 1E5LA 2D5CA 2X22A 5ICSA 4OM8A 1X15A 3ZHYA 1UDCA 2AQKA 3E1KA 4R4JA 4YB8A 1U8FO 4GH5A 4MO2A 4J4HA 1PR3A 3C7CB 2GPTA 4AJHA 1X7DA 5JO0A 1LLQA 2D5AA 1DXYA 2P5UA 2O3TA 1MV8A 1B3BA 1B8UA 1PZHA 4GLLA 1CRWG 4NFHA 4B8WA 3D0OA 4J0EA 2GLXA 3GVCA 5CDYA 1LQTA 4J4TA 4WCFC 3KOUA 2OP1A 3LF1A 1E1LA 4UAGA 1I3KA 3H2SA 1H6AA 3E5RA 3ZV5A 1DAOA 3SJ7A 4IJUA 1MFZA 3F1LA 1L1FA 1VJ1A 1IZ9A 3UICA 1DBVO 5EPOA 2AA3A 2C59A 4L4RA 1YJ8A 3IJRA 3AWDA 5LCXA 3I4CA 1DFHA 3EK2A 1PS8A 5ICMA 5G2OA 4RPGA 4YRAA 2EWMA 5JMWA 1TT5A 1YKFA 3C8MA 2PGJA 5G4KA 4MVJP 1IL0A 4EW6A 4P4LA 3FNGA 4W6ZA 3IKVA 1J0XO 5JAMA 3MOGA 2D3TA 3PIIA 4JCOA 1J49A 5JPIA 2RH4A 3ZNQA 4IPTA 1ZMOA 2EV9A 2IZ0A 4ZQHA 5BSFA 2NWQA 4BGVA 1U3VA 3PJEA 1IB6A 4ZJUA 3WTCA 2OGUA 5HA5A 2Z1NA 4M1QA 1DSSG 1ZK2A 3TZ6A 3L6DA 4OSPA 2YFHA 1UP4A 4QTZA 4PVCA 4IINA 3FPLA 4DLLA 3H3FA 1RPNA 1J5PA 1ZK1A 3NGXA 5I9MA 3JV7A 4XX0A 3D7LA 3L9XA 3W4JA 2ZQZA 1XU7A 5I9NA 2B4RO 4DMMA 3M2PA 3I23A 3TOZA 4U6SA 1B7GO 4Z3DA 5FWNA 3PHGA 2EXXA 3KYBA 1Y8QA 2YV3A 5F1PA 1I2ZA 1Z7EA 1EBFA 5TNXA 4AJIA 4PLWA 3PYLA 3I6IA 4AG3A 1D3AA 3WSWA 3OMLA 5B4UA 4WECA 1NBOA 4BIIA 2DKNA 1EMDA 1GU7A 2AXQA 4HV4A 1QG6A 2YJZA 3R3SA 4R69A 2HLPA 2JFFA 3JQAA 2JCYA 2YFQA 3BMNB 3LYLA 2VRCA 2BI8A 5COBA 2J3IA 1Q0LA 3P2OA 1B15A 3NT2A 3NX4A 3X2EA 5CG2A 3OIFA 3Q2IA 1N1EA 1SOVA 4DIFA 4E32A 1GQQA 1KVQA 1X7HA 3KXDA 3Q2KA 4MOWA 3V8BA 1IPEA 4OAQA 4R9SA 4B4WA 3ETDA 3TNLA 3VOSA 4CMHA 4KZPA 2VYVD 4I5FA 3PIDA 2GERA 4O6VA 4OGWA 4MVJE 4RL6A 3BHJA 3PYXA 1EUZA 1EVZA 3GRPA 1FK8A 1ZK4A 3S55A 2ZTVA 1U28A 4G65A 4OH1A 3H9JA 4R1UA 2PZJA 1NTOA 1R0KA 3PP8A 1C0IA 1K2WA 4CL3A 2VUTA 4IDAA 1ULSA 3IDSA 4OJNA 4BO2A 1M6HA 4LK3A 4QO7A 5AXAA 4PLZA 5ADHA 4WNIA 4YJFA 2A94A 4LSWA 4NU6A 4RORA 1S6YA 4QECA 5FI5A 3UXYA 1XQ6A 4OL9A 1TB4A 4BKOA 3JQEA 2PWZA 5A4DA 2OP0A 1DOHA 4JIGA 4ZQEA 3UCFA 4CMIB 3ZGYA 3PQFA 3RFTA 1IY8A 4PLTA 4DIBA 4WLEA 2WTBA 4DPKA 1LLCA 1ZO8A 3AW9A 3NRCA 4YVFA 3L0DA 4BNKA 2YHIA 4WLOA 3H65A 3HN7A 4A26A 3BMOA 5AOVA 2HKIA 3AY7A 1E0DA 2D4AA 4WEQA 1Y8RB 3TZCA 4W4TA 4HFNA 3ASVA 4LVCA 1I10A 1W4ZA 3QW2A 5K0ZA 1Y9AA 2YY7A 3WFJA 2PTGA 2FPGA 3TJRA 4Z3KA 2NM0A 2UUOA 4D3DA 3V1TC 4MKZA 1XKQA 3FPCA 2FZEA 2JFGA 3LZ6A 1YWGO 2P4QA 5BNFA 4LRTB 4CMAA 3D3WB 3VVBA 1AE1A 4CLEA 3CMMA 2JD1A 3K2BA 1RKXA 3WBFA 3GPDG 4UEJA 4QSMA 3C85A 3UFXA 3W4KA 1WZIA 1X1EA 2B5WA 3KYCA 1B8PA 4XEHA 3F3SA 3JD0A 3PZBA 4QT0A 2R00C 1PX0A 4DQVA 2IZZA 2EHDA 4FS3A 4XA8A 4RPLA 1Y5MA 3E03A 1LLDA 4BVAA 1LDGA 5L9AA 4IJKA 3VZQA 1N8KA 2Y05A 2YDYA 3OETA 2WEKA 3F6YA 4PLYA 1VL0A 4J1NA 4LN1A 2AE1A 1B16A 1MC4A 1OC4A 3BHIA 1LDMA 3JQ7A 3RWBA 4CM9D 1I0ZA 5I8ZA 3TL3A 1ARZA 2IEBA 2HMUA 2JHFA 4RPHA 2Q46A 3RU7A 4Z0TA 1KERA 2FP4A 3LT2A 3WQSB 3WJAA 1VPDA 3G17A 4OQYA 1LI4A 2NACA 3PZRA 4H16A 3COSA 2BFPA 3F4BA 3O8QA 4BNFA 2P91A 3RUEA 4DLAA 1PJ2A 1C1XB 4WEOA 2DUWA 1HKUA 4A0SA 1SEPA 1D8AA 3GQVA 1PGNA 1I01A 3S2IA 1A5ZA 3RC2A 4UUOA 1QMGA 4WCFA 1GPDG 4ALJA 3VKUA 2DLDA 4AJKA 3Q3CA 5JXWA 1R66A 1YS4A 3LSYA 4WPGA 4BNLA 2IZ1A 4JBGA 1I33A 4XDYA 3WNVA 3A06A 3K8ZA 4BB5A 5DBIA 4GSKA 4RVDA 3RFVA 2X0RA 3SLGA 3FN4A 1VKNA 1ZW1A 4Z0PA 1ZXLA 3ONDA 4CV0A 5KVQA 3PTZA 5G4KB 4B7UA 2BHLA 2QZZA 3OQ1A 4DVJA 3GVIA 1KEUA 2ILTA 4Y6PA 4A2CA 3JTMA 1HE5A 1GYQA 4U0JA 1XCBA 1YL7A 3MTJA 4R16A 1B14A 2RHRA 4IMPA 4LISA 4LMPA 2Q45A 5KKAA 3AY3A 1MC5A 1FXSA 4RF4A 1H6CA 1QV6A 2V6GA 5JCJD 1TLTA 4KUHA 1IYZA 1E6EA 4FOOA 4PLGA 1ZIDA 2D2IA 1T1RA 2YZ7A 2IYPA 4CODB 1NYTA 1FDSA 3SVTA 1XSEA 1LLUA 3PI7A 1M76A 1PS9A 2NVUB 4J91A 4AJJA 2GR9A 3ADOA 3FTPA 4XRGA 4FSHA 3LK7A 1ADBA 1PL8A 2W2LD 4XIJA 3QV1A 3I3OA 3KBOA 3N74A 1YJQA 2I9PA 4FD3A 4BO3A 3NDIA 2C54A 2CF5A 1GCUA 1WWKA 4BO4A 3GMSA 4NZ9A 5GZ3A 4U0KA 4BKQA 1MXFA 3TSCA 5CHEA 1ZJYA 4J43A 3GDFA 3PWSA 4M89A 1A4IA 3QVXA 1SZJG 3FBTA 3OQBA 5DULA 5JYDA 2E82A 4FCCA 1PTJA 4EZBA 1I30A 3OJEA 4ZRNA 4IJWA 2Y68A 3D5TA 5L4SA 4ND3A 1NM5A 1UXHA 1P0FA 1KEVA 2E48A 4OXYA 1WDMA 4D3SA 4EYEA 5DDIP 1KETA 3C3XA 1LU9A 1T4BA 4WUVA 2TMGA 2RBEA 1OMOA 5T6BA 2SCUA 1WVGA 3P5SA 4XB1A 1QYXA 5LDGA 3TRIA 4AJ4A 1OI7A 3LC2O 3EHEA 3OIDA 4PRKA 4XYEA 2DC1A 3V2HA 2RCYA 3DZBA 2E49A 1IE3A 1PGJA 4KTTE 4RQTA 5AXDA 1MP0A 2HK7A 4BKUA 2ZYDA 3EW7A 1U5AA 4MKXA 1MG5A 1Q1NA 4NG5A 3UAGA 3WDSA 2P4HX 2VZ9A 3MZ0A 2V6BA 5F1KA 3TOXA 1DO8A 2Q50A 1ISMA 1GR0A 1I8TA 2QRLA 2DFVA 3F1KA 1LUAA 5TT1A 3VHRA 2DTEA 3EZLA 4D0RA 5AXCA 3VPHA 2VWHA 4MKRA 1MB4A 3AUSA 3AU9A 1XU9A 2OBYA 4Y9DA 2PGLA 2Q99A 1PJQA 4PZEA 1WPQA 1KYQA 3ZCXA 1WXDA 4LRSB 1H6DA 2JAPA 2X23A 2YHIB 5A9SB 2JD0A 1HEUA 2AQ8A 3DB2A 3ENKA 3BTSA 3UN1A 3RC1A 4KMSA 1ENZA 4TRRA 3KO8A 4NBRA 3S1LA 1OAAA 2ZCUA 1I2BA 4CM8B 4TVBA 4E5PA 4U8GA 4GX0A 2AQIA 3LT0A 2ET6A 5TIIA 1SMKA 1KY5A 5KJCA 1SO8A 4XJSA 2C5EA 1JW9B 1JWBB 2ZTLA 4GQAA 4TROA 4UEOA 3AUAA 3DBRB 2WWRA 3HDJA 4XQGA 4BNMA 3QJ5A 5B37A 1P0CA 2I3GA 3TF5A 1LRKA 2ZTMA 3KYCB 1UH5A 3KB6A 1DHRA 4YT8A 3H2ZA 4CUKA 4OSOA 1LNQA 4YDRA 5KVSA 3R0IA 2AMFA 1GEEA 2R00A 5L4NA 1QORA 3Q0EA 3G79A 4NMHA 5BNIA 4E2ZA 2J3KA 2OFPA 1H93A 4ESOA 5KCZA 3KSZO 1FDUA 2RH8A 1CERA 3H5RA 3VPGA 5IDQA 3F47A 4QO8A 1LC3A 4CPDA 4NK4A 4UVEA 5THKA 2VTEA 3ZNPA 3FWZA 1HE2A 2O2YA 3ENNA 4I5DA 4FFMA 3V1UA 4MIEA 1VI2A 4AFNA 5A9RA 2B0JA 3ANMA 1N7HA 3G0OA 4BNYA 2G1UA 2V6FA 3I6QA 3GGGA 4NBWA 5IXSA 4IXWA 3ANLA 4E21A 4DA9A 4AJ2A 2D1YA 1XEAA 2QQ5A 2G0TA 4RZIA 4XYGA 4J9UE 5B4TA 1DC3A 2Q4EA 1KIFA 1KY4A 4OOEA 5HS4A 3E5MA 4N18A 4L74A 3UOGA 4DC1A 4IGFA 4JJIA 2JL1A 4P38A 2EKQA 2C7GA 5IDWA 4B7XA 3ZW8A 3GA0A 4I5EA 4NBTA 2D0IA 2Q2WA 4ALMA 2Q2QA 3LT1A 3DAFA 4BO5A 3FNEA 2CDAA 3GUCA 3F9IA 2PD3A 5A05A 1PZEA 2GASA 4Z9XA 3IL2A 2P9EA 5CPFA 3FHLA 3BMNA 3M1LA 5EJ2A 4DRYA 1GUFA 2GNAA 1IULA 3HB5X 4NFSA 1LSUA 2I3AA 2XOXA 3HQ4O 3OA2A 3WB9A 1CEQA 3FSRA 2PKQO 4ZHSA 2FMUA 1EQUA 3D4NA 4Q39A 1M75A 1BXGB 1YL5A 3DOOA 3ZWVA 1GUYA 1N5DA 1ZEMA 4XDZA 1JA9A 2I76A 2OHXA 5F3RA 3WS7A 1R12A 2EF1A 3DBHB 5COQA 1JAYA 2PZKA 2NU8A 5ENVA 1T2AA 2O4UX 4YXFA 2X0JA 3JQ9A 4JX8A 3DONA 1HDOA 3QY9A 4TWRA 4IY1A 5IZCC 1F17A 4MVJI 3IUSA 5KJEA 1X13A 4ALKA 4GWGA 5DOVA 3DOJA 4CL8A 3G49A 4CJXA 3VKVA 3OP4A 3WYBA 4E31A 4BQPA 5HM8A 3A1NA 2BLLA 1UZNA 1H9AA 3RI3A 3HB4X 3O9ZA 4NQZA 1PL7A 3HDYA 3M1AA 4CMIA 1A9YA 2P9GA 3K92A 4JROA 1V3VA 3ZI0A 2IDZA 2JFHA 2HMWA 2Y0DA 3JCZA 4BMSA 1EBUA 1JKFA 1PGPA 4MINA 4YQYA 4FQ8A 5JMPA 1C0PA 4E5MA 2VHWA 5MGBA 4IBOA 4DC0A 2Q4BA 3HSKA 4CQMD 3CTMA 1D1SA 1Y8RA 2W8ZA 3WSVA 3JYQA 1U4OA 2GYYA 2YUTA 2A4KA 2FR8A 3VPFA 5CDUA 2C29D 2VQ3A 1NVGA 2A9FA 3ZDFA 4XZ3A 5G0UA 4JK3A 4UREA 4J1SA 4YT5A 4HWKA 1E92A 2VN8A 1YE3A 1V3UA 3WGOA 3DMTC 3OHSX 3I9KA 2CUKA 3DAPA 3PHHA 5JAZA 1YDWA 3HDQA 3EAGA 2O3UA 4BGEA 4KOAA 4ID9A 1M6WA 1QP8A 2HK8A 3B6ZA 4NJOA 5TSDA 3H5NA 3ZWYA 4WE3A 3ZU5A 1SCUA 3OECA 4K26A 5BSGA 3EUWA 4CMBA 3AM3A 1AXGA 4D3FA 3DBLB 2GN8A 4FDAA 3I9NA 3VC7A 1U4SA 3A4VA 1KVRA 5U4QA 1NX6A 3BMQB 3RUIA 2E37A 4IQ8A 4F6LA 2C07A 3CKYA 5JFOA 1HETA 2ZATA 3RJ9A 1ZSNA 2O23A 3H9QA 4WLUA 3MEQA 1MXHA 1P33A 4CUJA 4IJVA 3UGKA 5JC1A 2NTNA 1Q0HA 4ZN6A 1ULUA 4R01A 1QRRA 2VOEA 1AXEA 2GF2A 4PG7A 2VZ8A 3IS3A 1NHGA 1XIVA 4L0QA 1ADGA 1O89A 4TMFA 2UDPA 1W6UA 4HBGA 3VDRA 3TZQA 2HO5A 4EEXA 1M66A 4Z9YA 4JQCA 3ORFA 5U9CA 3X2FA 1V0JA 2X6TA 3ZV6A 2P68A 5L7WA 2HMTA 1C1XA 4XWYA 3IJPA 5KVVA 3JYOA 1PZGA 2Y0CA 4R3WA 3ZN2A 3S2EA 3NKLA 2BI7A 2HMVA 1PEDA 3O38A 1EVJA 1OOEA 3CIFA 3ZV4A 2B35A 3TZKA 4CMKA 1ZVMA 4PLCA 3VAZA 1HDZA 4EI2A 2X9NA 1UZLA 4PLPA 1T24A 3K9QO 3VH2A 3ITDA 4E4YA 1P74A 1MGOA 4YAIA 4E0BA 3CUKA 2EERA 1EFLA 2DQ4A 4WOKA 2W98A 1I32A 4BNJA 5F1OA 2ZB7A 3WLFA 4BNWA 1LC0A 4MVJG 3S8MA 3HADA 4GMGA 3GY0A 1X7GA 2B4TO 1K6JA 3ROPA 3H9EO 1NAHA 1K5HA 1CIVA 1EUCA 2OO5A 3QWFA 4XQCA 5IJZA 4DGSA 4A7PA 1I36A 3U09A 2FSVA 2VYND 3L6OO 1NP3A 1RM3A 4RGBA 5TJ9A 3UF0A 5ER9A 2FOIA 3VPSA 2Q2VA 2POQX 3JQBC 1GYRA 4NDNE 4WASA 2PR2A 1ZKMA 3E8XA 4MVJD 3INTA 1A71A 1GQ2A 1YQGA 2H63A 3DZIA 4FGSA 4BKRA 1HE3A 4AVYA 4MIYA 4CV2A 2WE8A 3MJ4A 4BNNA 2NVUA 3BIOA 5ITWA 4CR8A 4OQZA 2VYVA 1R0LA 3O03A 2HMSA 4HY3A 3RUFA 3LC7O 2JCVA 1O95A 4QXMA 3KZVA 4CM4B 4BOYA 1HLDA 4R68A 1GTMA 4UUMA 2HRBA 4N54A 3E6AA 3QHAA 5L95A 4CLOB 2QG4A 4IZHA 5BT9A 3GVPA 4CLHA 3IOYA 2NVWA 2PZMA 3PPIA 3QA9A 3D4OA 3CZRA 3C1OA 4N5LA 3F5QA 4BNXA 2DTDA 3GVXA 4RF3A 4XCVA 3GN1A 4RF5A 2OUIA 4RF2A 1NQAO 4EJMA 4I8XA 4BMNA 1HSOA 4J6FA 1XA0A 5IAAA 1C0LA 3GDGA 1YONA 4OMUA 3B20A 2HJRA 5CFZA 3DC2A 5TX7A 2DBZA 3KV3O 3UKOA 3KTDA 4BNIA 4CQMB 3IUPA 5G0TA 4P4GA 1I24A 2X0IA 1AN9A 1ONPA 1ZZEA 3HE3A 5GZ1A 3PQDA 2FPIA 1E7SA 3K73O 1Z73A 3JD4A 4R5HA 1SNYA 5IZCA 5KJFA 4WNCA 1YB1A 3GG9A 4MVJH 1U7TA 4R54A 1WMAA 1OBFO 3RUCA 1QR6A 2BMAA 4W9NC 3BTVA 3WQRA 3ZWAA 4PG5A 3S2GA 1XR3A 3WMXA 4PZCA 5CEFA 5TS3A 4YJHA 4TKLA 4I9UA 1GQYA 1YOVA 3PVZA 2VRBA 3P7MA 1E3LA 4NPCA 5A9SA 3RFXA 4GL4A 2I6TA 1LDBA 5DBFA 1PJSA 2W4QA 2FRDA 2VOJA 5F5NA 2VWPA 3H9GA 3IIEA 4IXTA 1HL3A 5JDCA 2EW8A 1X1TA 5LC1A 1U2GA 5TT0A 2X5JO 1BMDA 5A02A 2Z95A 4CM8A 2C82A 1JAXA 3BZUA 1FDVA 2ZYGA 4DBZA 1OZAA 4IUYA 1EQ2A 1TVEA 3W4IA 4QFCA 3OM9A 4ND2A 1Y9EA 1NFQA 4YCAA 1ADCA 4CM9A 2ZB3A 3DTYA 1DJNA 1PZFA 4YTEA 3HJAA 3DBRA 3JD2A 4RVFA 1ZUD1 3DAGA 3PFFA 3MWDB 5L7YA 5I7VA 1A4UA 1R15A 4NNJA 3OJFA 1W0CA 3I4FA 3T7CA 4INAA 2RAFA 3FBGA 1EDOA 1WZEA 1YQXA 1KEPA 3MCVA 3PGJA 2ZIZA 4N7RA 3SBOA 3ZWMA 2Y1OA 5JO9A 1JLLA 4WK6A 3BMCB 1HT0A 2ZK7A 2ZJ0A 3R1IA 5CPBA 2AEFA 3OBBA 4OXNA 2PNFA 3WGZA 1LXCA 1N7GA 2ZQYA 3UVEA 1DB3A 2CSUA 2GZ2A 3I9MA 4HADA 2XXBA 1Y1PA 4NU5A 3OH8A 1GL3A 3MJEA 3QVWA 1SB9A 4D41A 4I5GA 2AHRA 1GD1O 3M6IA 4GGOA 4TQGA 2B4QA 1VSVA 3H3JA 4J3FA 2VT3A 1ZJZA 3WXBA 4XRRA 4L75A 1DIHA 4UVDA 1TI7A 1V9LA 3WGHA 4IDEA 4Q3BA 4RV9A 2EW2A 3KYDB 4FFPA 2BGMA 3GNQA 1PIWA 3WLEA 4TZKA 3SJUA 3MJTA 1YB4A 1NHWA 5K9ZA 1DIBA 3OSUA 2PKRA 2WSBA 2ZYAA 1UDAA 2GDZA 5ITVA 2H6EA 4BHTA 4B4UA 2EKLA 4NI5A 3ST7A 5B4VA 5H83A 4NIMA 2GN6A 4M49A 4QUKA 4R51A 4IIVA 4TKMA 2DBQA 3I5MA 4WKGA 4EITA 3BYZA 2YHUA 2CVQA 2LDXA 4JLWA 4DREA 3CINA 5JCJA 4BNZA 1EFKA 5CP8A 3PDJA 3V2GA 4JJFA 4XR4A 5JNLA 3KEOA 3WIEA 4M8SA 4YJGB 4Y8VA 2CZCA 4W99A 4AJOA 4CR7A 1MA0A 1NFFA 2D59A 3CE6A 1E6WA 3WFIA 4ITUA 1E1MA 3NUGA 3NTOA 4FN4A 1NPYA 1V35A 1PJTA 2GN9A 1LSJA 4YPOA 2O4CA 1X0VA 3HNPA 2W2LA 2X0NA 4II3A 1PSDA 1UXIA 3OEWA 1NFRA 4ILKA 4XYLA 2OL4A 2PFGA 3ANNA 1XELA 5T8KC 5EQDA 2B69A 1BXGA 5JC8A 3MJCA 1BG6A 2BFMA 4ND4A 4E2WA 1CDOA 4XKJA 2IODA 3QSGA 1E3IA 5T57A 3VVCA 2ZB8A 3DBHA 5JE8A 4ZQGA 3ZW9A 4IQGA 2W2KB 3SC6A 5J23A 1DJQA 4J7CA 5T5QA 3JQBA 4IS2A 3PHIA 1TA4A 4GX2A 2HJSA 1LEHA 4CMEC 1DDOA 2EP7A 3BTUA 3GHYA 3WNQA 3BAZA 2H5LA 1C0KA 3OJLA 3LU1A 4FC6A 1JTVA 3QIVA 5DT9A 2QW8A 5FF9A 1DLJA 4J1QA 4Y6SA 4YYZA 3DZHA 3PHLA 3IKTA 1E1NA 3WJ7A 3I9OA 3QWIA 3FWNA 2PD4A 5C7OO 2NUAA 4DTIA 1Z75A 5A04A 1Z74A 1M2WA 5KIAA 2GO1A 4LMRA 4GKVA 3AUTA 5ILGA 4D44A 2BGKA 2OORA 1B26A 5EQFA 5IDXA 4R5MA 3LLVA 4LGVA 1ORRA 3NGLA 5I8WA 5TC4A 1H9BA 1VL8A 3DOCA 1JDJA 3U62A 2B36A 2VUSA 3DL2A 3OEYA 3QWBA 4BV8A 3CH6A 3I83A 3MWEB 4YAGA 5EN4A 1T2DA 4TSKA 4DYDA 4PLVA 1Q7GA 4RJTA 3AJRA 1N92A 1JWAB 3DBLA 4ROSA 1O94A 3BMQA 4BO6A 3FNHA 1ONNA 1UJMA 2CVOA 1BVUA 2UV8A 1Z6ZA 4CUZA 3KSDO 1ZMTA 2GZ1A 4FC7A 4YJHB 3RKRA 1X0XA 1YOVB 1CF2O 4E12A 1Y7TA 2VNSA 4GSLA 4XB2A 4IDBA 5L40A 3K31A 1KEWA 4GI2A 4KDFA 3GEGA 2VTDA 4JXKA 3ZV3A 1O9BA 2H9IA 2JKVA 3QE3A 3WYEA 1WDLA 3JQDA 2WM3A 1HDXA 3GMDA 3GN2A 4EEZA 2GGSA 4NBUA 5G0VA 3KLMX 4XGNA 3CMCO 3DWFA 5A03A 1PWZA 5A5FA 1DFIA 4EJ0A 2PGDA 4WJZA 1J4AA 4OIMA 3B1FA 1DIGA 1E7RA 3ONFA 1NR7A 5EESA 3KM0A 1MLDA 3RASA 1YL6A 3QVTA 4KUEA 4OKIA 1P1HA 3G1UA 3NTRA 2BD0A 4II2A 6LDHA 1U3WA 3RBXA
chains in the Genus database with same CATH superfamily
2FDXA 4BO8A 3ZKWA 3DL4A 1Z9BA 3B1VA 3JQGB 1I2CA 4D4KA 2WKQA 4GNRA 1K8QA 4QDTA 4TWJA 1ONOA 1PV4A 3E48A 3T9FA 2P2CA 3PS9A 2Q9UA 2IU6A 2O3RA 1JLLB 2FA9A 2CBZA 3PSHA 4D42A 3RSSA 2V8OA 2XCRB 4I1YA 4EUEA 1I5RA 2BTQB 3FYHA 4F2HA 2D74A 1RRCA 3UOAB 2BEWA 2GXUA 3NNNA 2NXNA 5BO5A 4B8YA 2NVBA 1KP3A 2IEZA 3A3KA 3KHSA 5CT4A 1Q0TA 5LIRA 2D62A 2RB4A 4HEJA 1CQJA 2R86A 3AOGA 4YRPA 1YB5A 1K66A 3U4HA 4KFUA 1PJ3A 2X77A 4IEFB 4JC5A 4D3XA 3W5VA 5HJEA 3ZC3A 3U56A 1GDTA 3PE3A 1UXOA 2C9OA 3FCAA 2QM8A 3HYSA 5HX7A 4DXDA 1X86B 4KXXA 4FI3F 2IEDA 4HDKA 3ZHBA 1VC2A 2FETA 2YHSA 1KOLA 1ZH8A 4J3NA 1HYQA 2EX4A 3UCXA 1F14A 5J47A 2XMPA 1PR5A 2V6MA 2EZTA 2Z4RA 2Z5VA 4HFRA 4EGJA 4RK6A 1W1UA 3W6ZA 5CD9A 4DZTA 1N9GB 1JHDA 4N0DA 1E4EB 2M1XA 2WUWE 3PHJA 2OT3B 1D7OA 1E1CA 1IH8A 4L02A 4DQDA 1N1GA 3VDQA 5KX5F 1WEKA 5IWAB 3GGPA 3O4IA 2QHXA 4XSVA 5M7EA 1TVMA 1WOYA 1G59A 1K63A 1WV1A 4MW9A 4TV8B 1ND5A 1QYCA 1Z12A 4Y67A 1VFNA 3CH7A 2AG5A 2HSDA 3A2LA 3KSMA 5F35A 3NM4A 4CM4A 5C1DA 2CHUA 3TMAA 2HMAA 5FHRA 4Z53A 3W7AA 4RZ2A 3LT5A 2VQEB 3K72B 2Q2NA 4Q3NA 2OQ2A 3FTNA 4JLPA 3WGMA 3EYWA 2OYCA 2FEPA 3U1BA 1OWNA 4A6PA 1NZJA 3DEKA 4I9GA 4YJKA 3RAJA 5EERA 2PO7A 3VZSA 5C3MA 5L6LB 2CT8A 4MWCA 4P92A 5KYXA 4B3MB 1E3WB 3ZY2A 3D6FA 1ENOA 1POWA 5EMHA 5AYVA 4ZJZA 5KOHA 3B36A 2W7TA 4RD2A 4MYUA 1QM5A 3IO3A 4QTUB 4ER0A 3VJRA 2R62A 1G8PA 4NF2A 4PWZA 5BSUA 4G97A 3R7AA 1YDEA 1EFPB 1L5LA 3RSFA 4F6CA 3A1SA 4Z0NA 4ZT2A 1HYGA 3P27A 2WWGA 2R7MA 4O4HA 4DDKA 2GCPA 4RVGA 2BZ1A 5I7EA 3LMKA 3UMMA 2ZULA 1R4NB 2V1XA 5FBKA 3LC0A 2N46A 2ZDQA 3P0JA 2IITA 3KD2A 1BE8A 3IQDB 1EEHA 5TQ0A 3T9BA 3PG5A 3UT6A 4MYSA 4F86A 5KBYA 4YRJA 3MXOA 5IKPA 1H94A 4CQMA 3HJBA 2IELA 1E66A 4I99A 1KY2A 1C8KA 1GPKA 2J6BA 1Z18A 2HJ9A 1WHTA 3ORRA 1HURA 4GPD1 5EL0A 2QIOA 3WJ2A 1HFEL 1ZBQA 1ISIA 3EXEB 3R4CA 4L73A 4YAKA 1H9CA 2K2QB 1ND6A 2XNHA 2ZE6A 3SX2A 3CX3A 2BGTA 2YWJA 3RTGA 1VRVA 4FGWA 4YV2A 2MSWA 2VT2A 3D0QA 4H6PA 2G7MC 4Q9DA 1YMUA 2HEGA 2PX4A 4V0NA 5BN3A 1RXIA 4YGYA 2FN7A 3DLCA 4GMFA 3D3NA 1L4EA 3S44A 4G26A 4EQ6B 1HDRA 5K8LA 5BY2A 1VRCA 4GOND 1ISGA 2YZ2A 4R2JA 1DCMA 3DA8A 3H4TA 3AY6A 2I7DA 3ZGLA 4Y7CA 1ZMXA 4C3VA 4JI0B 1QVVA 3QP9A 4M1SA 5GJCA 1D7AA 2GRUA 4JJKA 4IIJF 5K3DA 4BB9A 4CLXA 4C2AA 2V4MA 1F3LA 3OCZA 4Z7OB 5ERYA 2WAMA 1K06A 2VNAA 4LX0A 3EZGA 1HZZC 2WYWA 3QFFA 5F7JA 2ODBA 3IP1A 2XCQA 1PCXA 1VGRA 1V1JA 3HY6A 3V1LA 4I1VA 1AO3A 3W2TA 1XN4A 2WVGA 4N0MA 1QF6A 5FJJA 3QG5A 3C3WA 4JYZA 1E0KA 4PCVA 4F3KA 4FZ3A 3SX0A 4ZYWA 3AGPA 4J03A 4BASA 1A72A 1UJNA 4RYLA 3WOHA 1J56A 4Y0VA 3WK5A 1FF9A 1XQWA 1R8YA 3OC0A 3Q15C 4JN6B 3ZGOA 1BFDA 1WCYA 2E3JA 3FCXA 4PYMA 4TGLA 4POOA 5KVCA 3GLGE 3ELWA 2DKOA 3W8NA 2QDKA 1XDZA 4N40A 5CLHA 3VOTA 4BCDA 2FF7A 3HBLA 3O8OA 4J0IA 3P9IA 3MWJA 4XGKA 3MWDA 1CY8A 2BTOA 2W9XA 2O50A 1WW8A 1QIMA 3KALA 1VHJA 3NHUA 1U0NA 5C5CA 1JQEA 2Y0PA 3E18A 5JS6A 1BHQ1 5EJIA 5FFNA 4MWTA 3VH1A 1KWGA 3PJRA 3E15A 1SB8A 3BILA 4FIZA 2R8OA 1FFAA 2WICA 1OFGA 1UADA 3EA0A 1E79D 1GITA 1X3SA 2P2GA 3H2KA 4K8OA 4PQGA 3W5SA 4O1HA 2ZYUX 1UDBA 4JNKA 4HL6A 1IZ0A 4HAUA 2JGDA 1D6JA 3PXGA 4J16A 3A9WA 2IY8A 3TMYA 3WBJA 3KJEA 2P40A 1F1BA 1FMFA 3IDOA 2NUPB 1YI0A 2XSZD 3EQ7A 4GFDA 4JUFA 4D6XA 4F3RA 2IPAB 2J3JA 2P5SA 1X7ZB 2XA2A 3WGQA 2ZYTX 3Q7SA 4NMWA 3RC3A 4B8ZA 4LRQA 1H66A 2O0LA 2FN8A 3UYLA 4B09A 3MUFA 4C0SA 1H0HA 5CAEA 2HCTA 3KYDA 2IV2X 3SM9A 1YJCA 5C8YA 1UAAA 2D1SA 2L82A 3G59A 4QQRA 3DAYA 5BQPA 1ISJA 4QPCA 2NU6B 1QKIA 3DTVD 3QX9A 4IGEA 3IMCA 1TL7C 3T9CA 3LJKA 1GDDA 2GEVA 1L5KA 4IEIA 2PZFA 4DV0B 3PV0A 2FSGA 2ZI7A 1Y9ZA 3WQQA 5AHWA 1CDDA 3V4FA 3ZWKA 3CURA 4YMHA 2QBYB 3UW3A 1NE2A 5EJ5A 1XQYA 1W88B 2HSWA 1QSGA 2PMBA 1I0IA 3COWA 4DPMA 1JQ3A 4TX1A 5J40A 1G8HA 1XVVA 4MUYA 2P9BA 2FW0A 3B1KA 1ZN7A 3QE2A 5EXPA 2EZ9A 2EYQA 1CIJA 1A2OA 2R96A 2J3HA 3PJDA 2X9VA 2J8ZA 4EY3A 1RC0A 1SBCA 2HUPA 3FWPA 4K28A 4KGZA 4DJEC 4PC6A 2AQHA 2C1XA 2XJ4A 4O4IF 2QRVB 1QV7A 3RJZA 4E5SA 1IHDA 3L7NA 2WJVA 4ZZ2A 1Q1GA 5FX2A 3K3PA 1UJ4A 3D02A 1VMDA 1E9EA 3VO1A 2WZDA 3Q6IA 4YJ3F 3NHLA 3ODGA 1EM8B 1Q16A 4LXYA 4AS1A 3K30A 2DR0A 1NZDA 3LZDA 2W2MA 3N6RA 2J33A 2XWJI 2B21A 3FCUB 2ST1A 4MRAA 4Q6BA 1FYVA 4EYSA 1NN0A 4IS3A 5KMGB 1O6ZA 2XI4A 2RI6A 1G3UA 1Q95A 3PFWO 2CXPA 2O2CA 2PL9A 1S3IA 2DQSA 3MCWA 1NI5A 2NV6A 3L06A 4K46A 1W85B 2R6FA 3C87A 3R6WA 3ZNOA 1JJIA 5ALWA 4L7QA 3UMSA 4LXXA 2YDXA 4E51A 1ZNWA 3SR0A 4JBLA 5L53A 1WNFA 1IN5A 2Z8YM 1O97C 5AK6A 4DB4A 1LVUA 2VTVA 3WTBA 2HRCA 5H9VA 5C4MA 5KJ1A 3ES9A 1TXGA 4IDGA 1G60A 2C4NA 2HK9A 1LQUA 1V37A 3A36A 3G8BA 2XF2A 4PAWA 5BYAA 3MOIA 1NBAA 3QPUA 3R75A 1QFXA 4MVJF 4DCCA 2D8AA 1WP4A 3WNZA 5KDOA 2C2BA 3L2OB 1PGQA 4G8JA 1XTUA 1DBRA 4NK5A 4PIPA 1UF9A 1EDZA 1DQSA 4K81B 3IDFA 4KQWA 5BPFA 1LJ8A 1WB5A 1XYVA 4YCCA 2RHGB 2ZKLA 4QXPA 3HMQA 1IY9A 5IMBA 4MJLA 4ARAA 4DDTA 4PAGA 2Z2XA 3GAAA 3V4LA 1AV7A 2W37A 3A9TA 3KJHA 1D5WA 5BQ5A 2NADA 4JVSB 4ZJYA 2ZJBA 4YWHA 2A0UA 2FY8A 3VZDA 4PZYA 4AC9A 2CV2A 2AXEA 3HI4A 4BO9A 1ZDMA 5HS6A 5J2UB 1K7YA 2V0NA 1PR6A 3BSSA 2YJGA 4AIIA 3OX1A 4QQ8A 4MR8B 4TT8A 5B1HA 3PX7A 4J90A 1P1BA 3AI3A 4O29A 5CCBA 3SSOA 1SZDA 3HRHA 4DUZB 1PL0A 1UAYA 3ZXUB 1JJVA 3SVZA 5B5SA 4GDMA 4EPRA 1D0SA 3GGJA 2AUMA 4IMRA 2AOUB 4J2OA 2RI0A 4YFYA 4HUQB 1LSSA 5FLKA 3Q8MA 1N5MA 4FPXA 4NHEA 5KWIA 1NJ6A 2E6KA 1MVNA 3INRA 3MA0A 1FMTA 1VB5A 1HNNA 3KZ1E 4QLBA 4MWOA 4IIJB 4QE3A 1YQTA 2Z83A 5FOTA 1KK3A 1Z0AA 2WG0A 4TKUB 4B33A 1EUDB 4LI0A 4N03A 2G08A 1J8YF 4JWTA 2GF0A 3KUXA 3L0IB 3K0FB 4NPHA 3WL6A 1Y6GA 1RM4A 4GI5A 1Y48E 1JG3A 4HVAA 4LV5B 3TPCA 3AERA 3OQ6A 1P45A 4HQ0A 4NRDA 5FL3A 4CCYB 5EAIA 1Z0SA 1B0ZA 2VHYA 1KRXA 1XTZA 1OI4A 2H08A 1D04A 2UYOA 2QB5A 3BJZA 3LPNA 4W7IA 1DU4A 2XUFA 3NG1A 2CDBA 3JAKB 3QLEA 2MTBA 1SWWA 2Z30A 3L0YA 5DLDA 1LH0A 1H1LA 1OROA 1PV1A 3B1XA 1BWSA 1UBTS 3FZNA 3HFSA 3T12A 3IHLA 3KC2A 2LW7A 2AKAB 5F51A 4ZCRA 1JU3A 2OD2A 2VHXA 2WTMA 3K8QA 3EDMA 3KB8A 4IIDA 5AKXA 5E6UB 5BXYA 2V7UA 4Z1MD 5KYYA 1TMGE 2G09A 3NOOA 1J8FA 2BCEA 2PK3A 1M2VA 3KKLA 3UYKA 2UXDB 2EX0A 2HJVA 2X76A 2IHBA 4L3OA 5KJ6A 4P4NA 2ZTHA 1R6XA 4BQRA 1K6IA 3OE4A 4ESEA 3R8FA 4YQEA 4DSNA 3QVSA 2JASA 1T9GS 4ZV4A 2I7TA 2RARA 4V39A 3TX6A 3H5VA 5CT8A 2VL7A 1TQ6A 1H4TA 1EK2A 1SBNE 1NG1A 4R1SA 2FK7A 2A58A 4QLAA 1KPGA 1NUTA 3GJ8A 4Z3OA 1HZZA 1S8FA 1SCIA 2HQSA 1CZHA 4LV6A 4N5NA 5JWHA 3TIXB 1R6UA 4HAWA 4MP6A 4QUIA 3UV7A 1GA6A 4ZMRA 3A2NA 1KO1A 1J00A 2BR3A 3R9KA 2HDHA 4OU5A 3GEHA 4OP1A 3CPJB 1MQAA 4NWIA 2IBMA 4XARA 1XYYA 2YFKA 3RUDA 2VBGA 4DMHA 1HFJA 1YACA 2JI4A 4JVMA 4O0LA 2PH1A 4PQYA 4KR2A 2IVZA 3OZAA 4UUPA 1HYEA 4K6GA 1YXMA 2Y6VA 4UC0A 3MMXA 1EI9A 2V5VA 4ND5A 3ZE7A 4ARVA 2B8WA 1OLOA 2P3SA 3JQGA 5C31A 5DW3A 5FA6A 1W2GA 4YDSA 4BE9A 2JB9A 5I3CA 3GEDA 3HVJA 3Q7PA 2APJA 4BDSA 4G0XA 3R77A 4ZWNA 4J4BA 5I7WA 2QYTA 3PPYA 3Q9LA 4CYMA 2EWWA 5ESWA 2PH3A 3K8YA 2BTQA 5M29A 4WJLA 2DH5A 3ZIAD 1G2QA 3COZA 1ZINA 4RPKA 3S68A 3VVLA 1Z5VA 4J94A 1KZ7B 2V7XA 1ZD2P 4IIUA 5K6AC 2IP2A 4HTAA 2GN2A 5DB4A 4EHKA 5ICCA 4RV5A 2V65A 1UBJS 2G63A 3WJ1A 3RU9A 2HWUA 4LS3A 5C1BA 4O4IB 4H6VA 3GNTA 2P2YA 4K2AA 4WAUA 2EGHA 4GBGA 5CGQB 2H07A 1P2GA 2F55A 4NL4H 1VG1A 3UMGA 2NYAA 4CM6A 5IM4A 1DBWA 1ULHA 2A33A 3NZEA 3T35A 3NXKA 3FKSA 4LX8A 2R1TB 3LPCA 4DNFA 1GRCA 2V59A 4GMHA 1N9GA 2I8LA 2GUWA 1XRJA 2IRWA 4M54A 1W59A 1E4EA 3GFVA 1GO2A 2E4AA 3ZBUA 1VDZA 1J24A 5H70A 2OCXA 4KE9A 3G88A 3BXGA 5BSEA 4J2TA 1YS7A 5SZHB 1AKRA 4FFNA 4HB4A 3NETA 3S0JA 1XZEA 4EY6A 1UUFA 2XE4A 4EVRA 2XZTA 1K6EA 1NUQA 1BVRA 1R6TA 2ATVA 2J48A 1FDWA 4GAEA 1I3MA 4Z4QA 2HJGA 1VPTA 4HEHA 1FPQA 1YZ3A 3OZBA 4V0LA 2DHDA 3RTCA 3HN2A 4B3FX 5JIBA 2YRWA 2B34A 5MDHA 4I9HA 5FLXA 3CN7A 821PA 1TIPA 3QLJA 1FDIA 4CZ2A 5DK4A 3NO4A 1N32B 5DTRA 4W1RA 1QF7A 4UDOA 2QWXA 1VCIA 3ZH2A 5B12A 4ZEXA 2X4LA 3GUHA 1PFYA 3IEKA 1DC8A 1KBOA 3QVVA 4Q66C 5GONB 3SYKA 1E3WA 1Y3IA 4EMBA 2OCGA 1XG5A 5FNVF 4KK3A 1T29A 2HNKA 3T1QA 4PG8A 2V97A 4DMCA 3C4JA 3RIGA 4B3IA 1N2OA 3EDOA 4R0NA 2I99A 4EPVA 3H5OA 3FNQA 1B6RA 1EFPA 1Q1ZA 5ALVA 1X2EA 1UZMA 2LGJA 1CHNA 4H3VA 4C0QC 3HBNA 5BUCA 2ID4A 2VPQA 5DRTA 4H15A 2QRPA 5AQ1A 1R4NA 4O4LF 1Z6PA 3TEFA 3ILHA 2OZEA 3KQWA 4BKPA 1V4BA 1VSUA 3NVMB 4Q6WA 4XQEA 3H2IA 4M1OA 2PGNA 4QT4A 4V38A 4LF5B 3IRVA 2BV3A 3EIHA 1KI6B 3NEYA 3FSJX 1B2RA 3R20A 5CBKA 5DHRA 5CDTA 3NHZA 3L84A 4GPAA 4QATA 5HIIA 2PY6A 1TEXA 2J0UA 2JGMA 2R8BA 4QOGA 4RAOA 1Q2XA 1XZKA 3CZ5A 3AP1A 4OJMX 5A2QA 1JQJC 5DTIA 2FMXA 4CKZA 5ES4B 1DQZA 1K6MA 1SKYB 3HA5A 4X95A 1UEXC 2IU3A 3G2NA 1RKVA 4Q4AB 4X7MA 4W8HA 4JSTA 3DXFA 1FVXA 4EQ6A 4X1KA 2WJHA 3TNYA 1E64A 2Z1DA 5LD2C 1BCSB 3BHNA 3TB6A 4AWAA 3R44A 1U3UA 4JR0A 4AYXA 2P35A 2QVLA 4HRXA 1JYFA 1S7GA 2CWWA 3OX3A 3MT7A 1BDBA 1B6TA 1DWPA 3K6RA 4F2PA 1FX0A 2NZXA 1M2EA 1RQ2A 1C9KA 3BXOA 3GARA 4S24A 4M9UA 2DHRA 4NH4A 3TEMA 4IOKA 2Z3WA 5G1PA 3TTUA 4P3KA 2C20A 2PH5A 1ZGJA 1MOQA 3CYFA 2D1TA 3L93A 5G02A 4B3JA 5AKJA 4D46A 2HV9A 5CVJA 2CC2A 4ZVVA 4TV9F 3KDPA 3OHMA 4QPJC 4X8MA 4BEBA 1G0NA 3SNHA 4D8XA 2JIBA 3UJ7A 2C5BA 5LIPA 3EUAA 3TIFA 5BOSA 4F38A 4DEVA 1PT7A 3JQAB 4GD3Q 1H5UA 1TJ3A 2CXNA 4OLHA 4YFVA 3T5AA 1F6BA 2F3TA 2E21A 2OYRA 1NXSA 3NOQA 5JS1A 2J3QA 2QMOA 2PMKA 2PT5A 2Y1FA 3AJDA 3KU1A 4LG1A 2ZBQA 1DFGA 1UFRA 2VHQA 3ORSA 4BMOB 3OLQA 4AM8A 2IUFA 2P0AA 1VFPA 2X9QA 3O2JA 3DZJA 4B84A 4LXQA 1SWVA 3K4QA 3QU4A 3ZY3A 1STOA 1X87A 4V0MA 1QPGA 1BRMA 3L18A 1J7KA 3CKMA 3LT4A 3WLKX 1Z83A 2ZUWA 3FMGA 3U26A 4E07A 1DJMA 3VO2A 2NYVA 1XLTC 2F62A 5A3VA 1EE1A 4UQLA 2HHAA 2NUPA 2P2DA 4YO7A 1DEHA 3GEIA 4ZA2A 1X7ZA 2I6GA 7YASA 1U80A 3I64A 3PBKA 2JI9A 5EJMA 5IH7A 2KQUA 4I6GA 3X1YA 4CG2A 3COJA 3HEBA 5CEEA 2Y1GA 4YJFB 2DBVO 5TLSA 1EJ6A 5DBGA 1NP6A 5K0NA 1ESMA 4YJ2F 3HSYA 5D87A 3FTQA 3BH7A 1P91A 2B25A 1G6KA 2PRZA 3NEJA 3OZDA 2RIRA 2NU6A 4ND1A 5BW4A 3GJYA 3WR5A 3NC0C 5JNRA 4YAJA 2HOQA 3NOXA 4JLNA 3W8EA 1U0HC 2VWGA 4BFXA 1KY3A 4RLHA 3GLFA 1U2EA 3LCCA 3WP0A 4R0VA 1KA9H 4G1CA 4ZAGA 1FQJA 3FF4A 4H1WA 1ZY2A 3O90A 3FNRA 2A1TR 3SEFA 5HIMA 1W88A 1KAHA 3UH1A 4ZVTA 4BS9A 4C78A 4YRKA 5JANA 4E94A 1JAZA 3B9PA 4LC9A 4UUNA 5AT1A 2XPCA 5DTJA 3H04A 1RR6A 4F7WA 3U5TA 1A7AA 1NV8A 3A4IA 3WWCA 4ZIRA 4N4AA 3CR8A 1E0JA 5AHXA 2BN4A 1TZBA 5SV2A 4UM8B 1JBKA 2FPGB 3F49S 2WC1A 1MO2A 2QRVA 1TA9A 2A5JA 2OESA 4OLJA 4Y1GA 5TGDA 3FR7A 1ZHHA 5BWNA 4MRRA 4XSHA 1KXZA 1W19A 4HWTA 3HU3A 1NKVA 2JGFA 2X86A 3U3RA 4WXYB 4KIFA 1EM8A 2EEZA 1T2FA 4FBGA 1HF3A 2FR0A 2XW6A 3VAAA 4D82A 5K6AA 1L7EA 1SZPA 2FUKA 2X5KO 4ZMSA 1Z2DA 2J6HA 3EEIA 2IZ7A 2OCKA 5K7SA 5KMGA 3IDQA 4IDQA 1XWIA 2YW9A 5FI3A 4HD8A 4TMWA 2IOFA 3SHFA 5KTRA 3S1SA 2NW6A 3L0CA 2OBFA 3DE0X 4TQ9A 1DIAA 4XM2A 5CT6A 1A8SA 4X41A 3OIUA 4DCTA 2ECPA 4DB2A 4BNHA 2IVFA 3AVTA 1H05A 3L8EA 3NBKA 5FNVB 4ZYVA 1POXA 4JL5A 3N0WA 3NHAA 2Z8ZA 4RVCA 1JECA 2R6HA 1GLVA 1U90A 4YPVA 4WFJA 4MUKA 1A4RA 2DBRA 3GLTA 1WMBA 3EY4A 2NAFA 3AETA 4BVFA 5ULLA 2AEMA 3PQEA 2HAEA 2A14A 4M83A 1G8KA 3AI7A 1MVLA 1NIJA 2I91A 1E1KA 3O1JC 4E08A 1E1DA 3IHWA 1L0BA 4WWHA 3NHRA 2UXCB 1GUZA 2OO5C 4O4LB 2GKGA 3R41A 3W1EA 4OX9Y 4BPRA 2J41A 1Z7BA 2NAPA 2WJ6A 3E4CA 4N0PA 4GWKA 2IW1A 4XWGA 1RBZA 3E3NA 4ZDJA 1CULC 1PK8A 3SC4A 2C2OA 3BT7A 3TNJA 4YAEA 5K8JB 1FBNA 2QT1A 4R1NA 2X6RA 1CPYA 2BM9A 1XZBA 3O8QB 3M6AA 1O5IA 1K3TA 3DE4X 4W7SA 3B3JA 4Q3OA 3R7SA 3RTDA 4OHBA 5J2UA 2HU7A 4YI5A 4KPEC 4H7PA 3BIXA 3HG7A 3K1YA 3G2LA 4JLAA 1G6OA 1QFSA 2D3WA 4MR8A 1PNTA 1NQOA 2ZJOA 3T9EA 3QJGA 4TRJA 5FUQA 3L41A 2PJDA 4HXGA 3D6HA 3U7EB 1TYBE 3QVMA 4PY2A 2NUBA 1NN5A 2ZSDA 2AOUA 1O95C 4CV1A 1XDDA 4FJ1A 2N0SA 1YVPA 4HUQA 4LVNA 5K3AA 4PINA 1SUCA 2EQAA 3EGCA 4BUCA 2FSIA 1N5IA 3IEVA 3TJZA 2G1AA 4GKKB 1S3GA 2NZ2A 2QVBA 4L51A 4ZVPA 1CEXA 2BMDA 2FMKA 2JD2A 3O26A 5CU7A 4O02B 4IIJA 5KAMA 4ALIA 4HH1A 2ZRIA 2ZI5A 4TKUA 4OQQA 4ZGWA 2WPNA 1EUDA 1GADO 4KLZA 4CW7A 3AUYA 5LMCA 4PIVA 3ZBQA 3OSZA 1AB5A 3W8FA 3K0FA 3L77A 1V6CA 4OY3A 5J4VA 1HK7A 5KYGA 2JK0A 2E4YA 2O06A 3E2MA 2HA0A 1FRQA 3L7OA 4LJKA 5J2TF 5JQGF 3MELA 5REQB 4RZHA 1YT5A 3HZZA 1P44A 4CCYA 4AKGA 5F98A 1D2GA 2Y2VA 1GQSA 2K6GA 2XH8A 3NVDA 4TV9B 1ULZA 3GNSA 3C70A 2KE5A 4C06A 4ZYTA 2D54A 1BA2A 5AI0A 2UAGA 4D96A 3TLMA 1OH7A 3EGVA 2B6NA 3JAKA 4RKEA 3AU8A 1NA5A 1JDTA 4REQB 5BQFA 1KAGA 2XIJA 1FFDA 1JXAA 3EDCA 5LP6A 1LX6A 3V8NA 2GTPA 3TN7A 3UEOA 3W7BA 4BO0A 3GCWA 4CBVA 2Z6UA 3M82A 3EMKA 3L0SA 1IEQA 1U28C 1TT7A 2GKSA 2QN2A 3IEIA 5LZ7A 4AMBA 1Z2PX 4Q9IA 4XGIA 3REOA 2PUGA 1U99A 3U17A 5DN9A 5FHQA 4IR7A 3QYPA 3LDHA 1PD0A 1F8GA 5LUAA 3THWB 4KO2S 5LQRA 4LWQA 1YKSA 3BD7A 4IQFA 2K87A 1N5OX 4PXYA 3I0MA 4G0YA 5GZ6A 4US2R 3L7YA 3LTEA 2GD2A 1OZ0A 1XO1A 2Q5OA 2CK3A 5E4YA 3RRJA 2ORED 4EMUA 3RWMB 4EY5A 4MS4A 2GD0A 5CK5A 5CCEA 3TTVA 4AJ9A 3BDVA 4IKEA 3RC9A 2PJZA 2OOSA 3EB9A 3T5MA 4F97A 3Q1LA 1ZXBA 4BUZA 3K70C 4PLFA 3KLPX 5I48A 1IM5A 2PGOA 4FGKA 3BPSA 4TS1A 3NRJA 1GLNA 4N6NA 4TOIA 1KQNA 1GVNB 3JYPA 1LDEA 2ORWA 4FYWA 2B82A 3FUWA 3L1HA 1Z4IA 2MYPA 1BHSA 1R3DA 5ECDA 3VPBA 1PR9A 1CB0A 4B7AA 1BU8A 2BKXA 5BRJA 2Y4NA 2PEYA 1EQAA 2XZDA 3LX8A 4GBED 4NHOA 1QE3A 2R9VA 2P3QA 4YRRA 3WMRA 1E7MA 4W5HA 1DO2A 1ZK3A 1SEVA 4S3MA 2J3EA 1ZN2A 4C14A 4CT0A 3SSNA 4WKPA 5M04A 3T99A 2WKRA 3RVJA 2H4ZA 5D6OA 3U4DA 3MRXA 1AGNA 3NTXA 4QBGB 3ZGNA 4QGFA 2CXHA 3GFFA 1XLTA 2W6JD 5KSZA 4TMZA 2G6TA 3T3GA 1SKMA 1DAIA 4AG5A 3KCNA 3AVUA 4R7TA 4EM6A 1AS2A 4CIWA 1QHSA 4JNCA 5KKCA 4BU1A 4OLBA 1DRVA 5JVDF 2NSJA 3DHEA 1NVWQ 2RB5A 1Q19A 3CY6A 3W3AA 1UANA 3OUZA 2O1XA 2VHVA 1B6SA 2POCA 3D64A 3IT0A 3JQCA 4ABTA 3VUFA 1N34B 4ENVA 4D97A 4D9CA 2PV7A 2RK4A 1SUEA 5BW5A 3RUAA 4LCJA 3H6HA 3WIBA 1SIBE 1N6OA 3AIOA 2V6JA 4KH0A 4ACBA 1ZW6A 4DDVA 1UOQA 1BEUB 3DYVA 1OCEA 4AN1A 2H1CA 3A9CA 1O08A 2AL7A 5EKTA 2XEDA 1K0UA 4IDNA 1EVKA 1U0SY 3W1WA 1CUBA 4N7MA 4OM8A 5HFNA 3ZHYA 4OAPA 4A5SA 4YB8A 3VX4A 4H3SA 4Y1EA 1E3TA 2QPOA 1FPMA 2YS6A 2X1VA 1X7DA 5JO0A 1MV8A 2D5AA 1C3JA 1Q14A 1W4LA 3KL2A 1CRWG 3B85A 4UXIA 4RTRA 1EVQA 5GONA 3GVCA 2VP5A 2BM0A 3CNNA 1DXHA 2OP1A 4KJZA 1E1LA 1I3KA 4KR6A 2GM5A 3G5MA 1TZMA 3F1LA 3RLIA 3LKBA 1L7QA 1IZ9A 3ER9A 1MEEA 1BS1A 4GXNA 3U7QB 3RYCB 3BH0A 5K3SA 5D3QA 4NCAA 3DT9A 3C3YA 3ZQ6A 3PD0A 1OT5A 3CX8A 4E7PA 4KIWA 5G2OA 2IYVA 5ICMA 2E4WA 5I9TA 1YKFA 2ATXA 4BQQA 3C8MA 1X8JA 4ZALA 5G4KA 4KO4S 3T1YB 1CR2A 1TKAA 1IL0A 3E0QA 2I6XA 4P4LA 4HNQA 5DGDA 3CUWA 4W6ZA 1QP0A 2DFLA 4A15A 5JAMA 1QHEA 2ZRFA 1KI6A 3PIIA 1QCYA 3BXZA 1L4FA 4OREX 5JPIA 3UATA 1USUA 2WNSA 1ZMOA 3FE2A 4IIHA 2IPMA 4ZQHA 5A2GA 2NWQA 5BSFA 3U4MA 1OKKA 4EWLA 4UZFA 2B20A 3V4VB 3L5KA 4TXHA 3TRHA 4ZCPA 2OGUA 1CLEA 4FSXA 1EWYA 2HBZA 3I2JA 3SXUB 2N1MA 1O4WA 3DNFA 4Q4AA 5GGXA 2OHOA 4TLDA 4KQ9A 2X6QA 3L6DA 5JQGB 1OY1A 1V2GA 3F9RA 5FUYA 4DLNA 1ZCBA 4OSPA 3LZCA 3EULA 5SZIA 3TE7A 5FPPA 2IIPA 1G9XA 4KQCA 3GLGB 1HL7A 4HX9A 1M1ZA 2W6MA 4HYYA 4OGGA 2C9DA 4PVCA 5K0LA 3GYGA 3HVKA 4RM3A 4B82A 4ENQA 4FM9A 1VE5A 3GL9A 3H3FA 1RPNA 1ZK1A 1CRPA 3NGXA 5FLYA 4BAZA 3L9XA 3W4JA 1EWKA 1H2YA 1XU7A 3BWVA 1ZZGA 2ZB2A 1CUVA 3AR9A 2AI3A 1JSCA 3M2PA 4O1IA 2RD2A 5LMUB 3I23A 1OH8A 4Z4IA 1II0A 2BGGA 4ZHQF 1COWA 3PHGA 4KMOA 4RVNA 3Q7IA 2PYZA 2H4WA 2V7BA 3PRYA 3U80A 4AZSA 5JHHB 3BXPA 4P6VF 1USGA 2YOGA 2DPMA 4PLWA 4P2BA 1UBHS 1IDN1 4BIIA 1NBOA 4B3SB 4N9QA 2DKNA 4NX2A 2AXQA 5DYNA 5IASA 4XUCA 4MS3B 1QG6A 3OQNA 3LUGA 3SJZA 1U2RA 3JQAA 3Q3EA 4UAJA 2JCYA 2WHPB 3BMNB 5COBA 1MC1A 2J6CA 3EDYA 1MAUA 2J3IA 3GD7A 1Q0LA 4JLDA 1XZQA 1NM5C 1SBQA 2Q9AA 2HTFA 1B15A 1S89A 3NT2A 3NH6A 3NX4A 3P2OA 1E2NA 4MS3A 1Z63A 5CG2A 1E2KA 4EG3A 4YQFA 1TW2A 2PR7A 1XEWX 4V0KA 1GAXA 2QTHA 1N1EA 2EX1A 4DIFA 4E32A 1KVQA 1X7HA 3KXDA 3ANXA 5MFZA 3JAWB 1GAJA 3IR7A 2YWEA 4UE6A 2B2CA 4XDHA 3VOSA 3FUUA 1MOZA 2O8NA 4JDUA 1XXLA 1VB3A 2C78A 1YQ9A 2DWPA 4RL6A 3BHJA 3PYXA 1EUZA 1V43A 1EVZA 3TNFA 2WWYA 1W0JD 2FSFA 2W6PA 1XQ9A 2EBWA 3TLEA 1U28A 3B82A 4G65A 3ESAA 1W9HA 3H17A 1R0KA 3OQMA 3HKDB 3QKRB 1C0IA 1K2WA 3UK6A 3UBTA 1L5ZA 1QO9A 1ULSA 4IDAA 3P0FA 1M6HA 1WMFA 2R47A 4LK3A 3O2QB 2O2EA 2ZJYA 4HDNB 1YZVA 4YBRA 4YJFA 3NAMA 2A94A 1W75A 3UWOA 3CA8A 4DMKA 1NBIA 4LSWA 4NU6A 4BX9A 3JQEA 2PWZA 1L1RA 1NOIA 5KYNA 1DOHA 2BEVB 4FOTA 4MV5A 4CMIB 3C8HA 4NAVA 1KPIA 3MIZA 1IY8A 2O1SA 2P1DA 2WTBA 2WILA 3AW9A 1P81A 2PKWA 3L0DA 2AK3A 2AN4A 4ZOCA 5JVDB 3VNVA 1RP1A 2VQ6A 1VMAA 4LQLA 4X0EA 1D6NA 1I1OA 1L9XA 3HZHA 3RF7A 3SJAA 5LN1A 4D8VA 5AOVA 2ZIFA 1Y80A 4P0PB 3AY7A 1JPJA 1NVDA 3SDBA 1RAEA 3SIWA 4QXQA 4YIHA 2E5WA 1L7BA 1Y8RB 3F2IA 4W4TA 4AF7A 1GPMA 5AM4A 3ZDEA 1Y5IA 2J1LA 4JJAA 3B5IA 1Y9AA 2PTGA 2FPGA 3LP5A 4PM4A 4F4IA 1WDWB 1NYRA 3V1TC 2JAWA 3GZTB 4XDGA 4Z8YA 2XHZA 3UC9A 1ZUWA 1U65A 3ECAA 1IDOA 2QTAA 4IG9A 4LRTB 4UUQA 5B58T 3TO5A 4RW0A 3G2QA 1AE1A 2I71A 3SYNA 1F6WA 3DVAB 1PO7A 3C85A 1WZIA 4PAOA 4R1OA 5JSHA 2ZUDA 2B5WA 2JA2A 3VPCA 5JTUA 1ECJA 2QE6A 2P1RA 1ZI6A 3H2GA 4OYYA 5AH0A 3CRRA 4BGDA 3VHQA 4QG7A 1S01A 1AF7A 1V4NA 2R00C 1PX0A 2HIHA 2QM0A 2WM8A 5IAKA 5ALSA 3RS0A 4FS3A 1O5OA 2ZM6B 1ZGGA 4RPLA 3A9SA 1SUFA 1T5OA 1A3CA 5FNVA 3FDJA 4BVAA 5L9AA 5FI1B 5E2AA 1Z4PX 2ZAMA 3OBIA 4LYEA 3ANYB 1GKIA 2EFEB 4HDSB 4A2WA 2VATA 4U7PB 4NY1A 4LHVA 4CKWB 2W6QA 3X1DA 1YC2A 5DWQA 2JLAA 2FEXA 2R7NA 5H3CA 3TTXA 1Y6FA 2X7XA 3TL3A 4BMCA 2JHFA 1RYBA 4GHWA 1ZCFA 2GPJA 5K03A 5L3RA 1KERA 1ZIPA 4M7PA 2W8BB 5ALOA 3ZBTA 4A9AA 3SIPA 2WM9B 2K2WA 3G17A 3Q12A 1LI4A 4OQYA 2WYOA 2JLBA 4C6TB 5C9ZA 2Q5HA 4Y2SA 3K0EA 1SCNE 1YNOA 3O8QA 2Q5QA 4M46A 2P91A 2CNOA 4KAFA 2ZUCA 5C52B 1PJ2A 2RBGA 4KE6A 4P3PA 5KC9A 2DUJA 3HXTA 2DUWA 1ZJ4A 1PNRA 1FC0A 1U7XA 4DQLA 1CUCA 2VSXA 4Y1RB 3RC2A 4JQZA 1FUKA 2WAAA 3MNFA 2G1JA 3Q3CA 3PCXA 5HCUA 2IZ1A 2IDMA 3A4YA 3WAJA 3F7MA 3K8ZA 4BKMA 2ESRA 5KNCH 3IT2A 3CZ4A 1I7SB 1VP3A 3RFVA 4PBSA 3MYYA 3HCNA 3O83A 1XPJA 3T7IA 1VKNA 5B7NA 1ZHOA 2ZPAA 1QRAA 1ZXLA 5ALJA 5BN1A 2HTEA 2H57A 5AICA 5H02A 2GHQA 5KVQA 3CZPA 1GNRA 2QD4A 5F77A 3G6WA 5C32A 1KK2A 3HVUA 4DVJA 1MJHA 3WGNA 4G4IA 4E11A 2ILTA 3FBWA 3K15A 5EIHA 5CNJA 3ZHRA 4YV0A 3FH0A 2PO5A 4U0JA 2D6FA 1A2QA 4R16A 4REQA 2RHRA 4Q7LA 2OM6A 1YR7A 4LISA 1TMKA 4LMPA 2Q45A 1U3FA 4HLNA 1X74A 4TL7A 1CR4A 3NGMA 5LB2A 3HACA 3LVBA 4RTOA 1QV6A 4JLSA 2ODPA 3FY4A 4AXXA 2L17A 4KUHA 4YRLA 1CEYA 1E6EA 1PR1A 2JARA 4FOOA 5C35A 4TXJA 1MJNA 3H2HA 2IYPA 4DMFA 2SBTA 3PIRA 3SDSA 1RW4A 4B34A 2JDID 1BWQA 1XVAA 1N25A 2IU4A 4MAAA 4PS0A 1OZGA 1M76A 5AW6A 5ICGA 1UIMA 3TNDA 2GR9A 1CE8B 2W6IA 4WHMA 3TOVA 2GDJA 3FTPA 4N12A 2VNJA 4KRFA 3ABRB 4XIJA 3WB2A 3I3OA 4QWWA 2FWJA 3K1TA 2COKA 4O2LA 2I9PA 1F9EA 2C54A 2HGSA 5AR1A 3EXIB 1OFUA 4QTYA 5AVYA 4OVKA 2INGX 3TSCA 1VMIA 1DMSA 5HMLA 4J43A 3GDFA 4JITA 4UATA 2PQ6A 5C1OA 2D06A 4NU0A 1R6VA 3RYIA 4MLCA 1KQGA 2JFYA 4JBYA 1SZJG 2V7GA 2YL2A 1SUDA 4EX7A 5JEEA 5AW2A 2FMFA 3NDBB 4MUHA 5IS2A 3CFYA 3UQZA 1XCJA 3L8DA 4M53A 2A9KA 3DFFA 1W94A 4IRUB 4MLPA 1ONBA 4ZRNA 4IJWA 2Y68A 2OR3A 5EZ5A 2VIIA 3FDZB 4UDNA 5BSMA 1NM5A 3D9QX 3EF3A 3FLEA 5KYVA 3KSBC 3M34A 2R8ZA 3EVGA 4EYEA 5DDIP 4KN5A 1XLUA 2FPUA 4N1AA 2C1ZA 3DKKA 1V16B 4RGYA 2FEWB 2TMGA 4WUVA 1W96A 5T6BA 1WVGA 2KM1A 2I6FA 1Z37A 3H75A 1DX6A 3NP7A 2HRQA 1OI7A 3LC2O 1EFCA 3AHGA 4INOA 3TQOA 3UOWA 1EWVA 5JAUA 4PRKA 4EGSA 2DC1A 1ISPA 2E49A 2Z58A 3A1EA 2CJFA 1UDXA 5AXDA 4RQTA 5T4BA 3RGGA 1MP0A 1QCCA 2HK7A 3IEUA 3EW7A 4NBNA 2EG5A 4OK6A 4MKXA 5BW6B 4BKUA 5KPDA 2C4TA 4G5GA 3BREA 4V3CA 3UAGA 3WDSA 4YALA 3BS4A 2VZ9A 1DO8A 2C3PA 1JHVA 1RWPA 1LUAA 2NZUG 3VHRA 1FFGA 4XD7D 4MKRA 1MB4A 3SAJA 1K98A 1XU9A 2JLQA 4Y9DA 4DLRA 3AVXA 5HFAA 2BGJA 1WPQA 3KKNA 3NPAA 4P36A 4OHWA 1OV4A 1JHZA 1RE0A 1KYQA 2YUIA 4A8HA 5DI9A 4RTNA 2KBFA 3CVYA 4DV2B 4BFZA 4LRSB 1OX6A 3M6XA 3VM6A 2X23A 2ZSHA 3GDHA 4NEQA