4BKOA

Enoyl-acp reducatase fabv from burkholderia pseudomallei (apo)
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
404
structure length
404
Chain Sequence
b'LVPRGSHMIIKPRVRGFICVTTHPAGCAASVREQIAYVARRGPIERGPKKVLVIGASTGYGLAARIAAAFGAGAATLGVFFERAPADAKPGTAGWYNSAAFHDEAAARGLQATSVNGDAFSDEIKHKTIDAIRRDLGQVDLVVYSVAAPRRTHPKTGVTHQSTLKPIGHAVRLRGIDTDNEAIKETLLQPATPDEIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTAFTYLGEQVTHDIYWNGSIGEAKKDLDRTVLALRGKLAARGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKARGTHEGCIEQVDGLLRDSLYGAQPHVDAEGRLRADRLELDPAVQARVLELWDQVTDDNLYTLTDFAGYKAEFLRLFGFGIDGVDYDAPVEPNVRIPNLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE REDUCTASE BURPS305_1051
publication title Point Mutation Changes Substrate Binding Mechanism and Inhibitor Specificity of Yersinia Pestis Enoyl- Acp Reductase Fabv
rcsb
source organism Burkholderia pseudomallei
molecule tags Oxidoreductase
total genus 141
structure length 404
sequence length 404
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07055 Eno-Rase_FAD_bd Enoyl reductase FAD binding domain
A PF12241 Enoyl_reductase Trans-2-enoyl-CoA reductase catalytic region
A PF12242 Eno-Rase_NADH_b NAD(P)H binding domain of trans-2-enoyl-CoA reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4bkoA00
8LDHA 4PIVA 2NTNA 1Q2XA 4J7UA 5TLSA 3WYCA 5CDUA 3LSYA 4WASA 1O9BA 3V1YA 1HDYA 4BS9A 1XELA 5U4QA 2PKQO 2IZZA 4NNJA 3RKRA 4Y67A 4ID9A 3RUIA 1PWXA 1DC4A 4OL9A 4J1TA 3QWFA 2Y0CA 4DIOA 1EBUA 3WQRA 4UVGA 2FHSA 2JL1A 2Q4EA 1EUCA 4FC7A 2C2YA 9LDBA 1J5PA 1V3UA 4JIGA 4NBRA 1BDMA 1PL7A 3WYBA 5JY1A 1WDKA 3NT5A 3JYOA 4O0LA 3D7LA 4QUKA 2CVQA 1K2WA 2WD8A 1LLDA 1YBAA 3RJ5A 3OSUA 4BL5A 3NDRA 4ZRMA 3GR6A 2HRBA 4S3MA 1H6BA 4N7RA 4WEQA 5ER6A 4N5MA 4D7AA 2DPHA 3ABIA 2DC1A 2VWPA 4BNNA 1KOLA 4RPKA 1AHHA 2C0CA 4IGFA 5B1YA 2PA3A 4O1MA 2VHXA 1YB4A 2QZ9A 3HG7A 4XQEA 1AXGA 1EUDA 1U3UA 5AXBA 3RFVA 4ZN6A 4UEJA 1E0DA 3K5PA 4B8WA 3I4CA 4NMHA 3VZPA 4FN4A 2DQ4A 5F5NA 5JY6A 1MUUA 1W73A 4MINA 3AUTA 4YA6A 1JW9B 3AM5A 3TZHA 1YL6A 4BNUA 4YYZA 1ZK0A 1I10A 2VT2A 5L51A 2B4RO 4ND2A 1SAYA 3WWZA 3DB2A 2H1SA 1ISHA 4QXMA 1V0JA 5FI5A 5KKAA 3N74A 3KYCA 4ZQHA 5FF9A 5IDQA 2B5VA 3DC2A 2VHWA 4RL6A 4XGNA 3QLJA 2YW9A 4J4TA 4WLFA 1VSUA 4L0QA 3JQGA 2VZ9A 4R16A 3KYCB 4YQZA 3ZHYA 4BB5A 2CY0A 3ZWPA 1KVRA 2V6FA 4PLGA 4R5MA 4LMPA 2JAPA 3MOIA 3HHPA 4PG7A 3GN1A 1Q1NA 1E77A 4IJVA 2BI8A 4E3ZA 1Y5RA 2I99A 1YDEA 4LW8A 4BNJA 4OJNA 2WMDA 5IZCC 1EVYA 3PHHA 3WGOA 5A02A 2G17A 3BHJA 1G0NA 3T7EA 2W2LD 1NAIA 4J1SA 5C37A 4K6FA 4PVDA 3AOGA 4X54A 2AMFA 4K6CA 1ULSA 1LSSA 1NFQA 1A72A 3H6KA 3QRWA 2ZB7A 1OFGA 3P2YA 5EJ2A 1ADGA 4TZKA 4YJHA 3ZN2A 4Q3BA 2X5OA 3W1VA 3OF2A 2GF2A 4DPMA 5IFLA 4XB2A 1H93A 1OI7A 5G2OA 3VDRA 4HP8A 3WIDA 4YJHB 4E5KA 1Q0QA 3W8DA 4Q3DA 5FFFA 1GR0A 4P22A 1I0ZA 3KBOA 3BXXA 4E2WA 1I30A 2OP0A 2CF6A 4NPCA 1MXHA 3D64A 4OHUA 4RVFA 4XWYA 3IOYA 4KDFA 1XQ6A 4IDAA 3FWZA 1VM6A 2FPGA 2NV6A 3ETGA 1HDRA 5DZSA 4I5FA 5JYEA 1ZNQO 4RORA 3WXBA 4W9NC 1XR3A 1DEHA 2O3TA 3VPGA 4RJTA 2PH5A 3Q2IA 4NZ9A 4FFRA 4PLFA 2PY6A 1I33A 3OA2A 3ORFA 4IZHA 4TZTA 4CM7A 3GPDG 3MJEA 5DCYA 4RO0A 3B20A 4XRRA 2VCYA 3VZSA 4IDDA 1C1XA 1DRUA 2EKPA 3AY6A 5TIIA 5T57A 4CM9A 3LK7A 4I08A 4RF2A 4CLHA 3HADA 5DBFA 4ALKA 1C1XB 2O7QA 3E9MA 1GCOA 4A26A 3IJPA 4MPDA 5TRTA 2VOEA 4DUPA 4EUFA 4OAQA 4BB6A 3NDJA 4CMAA 1KVSA 3BIOA 4RQUA 2R2GA 4AJ4A 1YS4A 2CMDA 4D44A 3S8MA 2HCTA 4MKZA 4Q3EA 3UH1A 1ZK2A 2X9NA 2VNSA 4J43A 2Q50A 3PJFA 3I4FA 1MXFA 2VZ8A 4DBVO 1CDOA 1MP0A 4J90A 3WJAA 4U6SA 3AUAA 1RM5A 3W6UA 3FSRA 3DZHA 3DR3A 3D4OA 3MWDB 1E3JA 3SLGA 1QMGA 3H5NA 4WOJA 3S2EA 1LDYA 4AJ2A 5JAZA 2OFPA 2P5YA 1B2LA 4AJOA 4GKBA 1P1RA 1MA0A 5CHEA 4FJ2A 1ONNA 2VWGA 2Y1DA 4B3HA 4GLLA 3WGGA 4M49A 2BI7A 3GZNA 3WQSB 1KYQA 3R3SA 4R3WA 3P5SA 5H81A 2PD3A 2H6EA 2WYUA 3KVOA 3P7MA 1NPDA 2YV3A 4A7PA 1ULUA 4W7HA 4YR9A 1F0YA 1V35A 3NDIA 1KEWA 3Q11A 4BO2A 3GZNB 1L7DA 5LDHA 4CR6A 1CETA 2FPPA 1S7CA 3F46A 4IXTA 3STHA 1O0SA 2DBVO 4PFJA 1IY8A 4LK3A 1YH3A 5DULA 2JKVA 1NAHA 2PD6A 5AXDA 3WWYA 1JWBB 1MV8A 4XQ9A 5IN4A 3OECA 1U3VA 4M89A 3SC4A 5I7SA 1L1FA 5B37A 3UF0A 4WUVA 2YQ4A 5TF4A 1C14A 1P0CA 3UXYA 1KY5A 1OMOA 2RHCA 3QV1A 1LRLA 1H6DA 1O8CA 2CZCA 2YFQA 3ZZNA 1P1KA 1D8AA 4ZRNA 3ADOA 5DP2A 4LRSB 2J3IA 1LRKA 4LGVA 1NNUA 1HSZA 2BGMA 2PLAA 2PK3A 4JGBA 2QZZA 3INTA 4RQTA 3ZWWA 1QORA 2X6TA 3D4NA 3RBVA 3IIEA 3ZU4A 3O9ZA 3IL2A 3PDUA 3D1LA 1QYVA 1GQQA 1UUFA 1BWSA 1ML3A 2RHRA 5CG2A 1DHRA 3UKOA 3KEOA 2GRAA 5FEUA 3ETDA 3ICCA 4FFMA 3ST7A 4HXYA 4M55A 1ZSNA 3GN2A 4E5YA 2PZMA 1VL6A 5JNLA 1GYPA 2OO5A 2VRCD 4P4NA 3A1NA 3AU8A 4DLLA 1W0CA 2P9CA 5T8KC 4L4SA 2VYND 3KHUA 4PRKA 2JCVA 2WDZA 3BYZA 5A3VA 4E2XA 1NVTA 1P1HA 4ONEA 4E30A 1ID1A 3UCEA 1QLJA 3JD0A 2NU8A 1M76A 3V1UA 1FDSA 3GZ4A 1TT7A 1HYGA 4RVUA 5FYDA 3BTUA 4G65A 2WEKA 3NUGA 4CM1A 1YXMA 3KETA 2X9GA 4L73A 5DBIA 4RVDA 4BO3A 1EDZA 5KJEA 5C3MA 2DAPA 5L4LA 3CSDA 3ONFA 4BO8A 4EW6A 1F12A 3ZU3A 5IZCA 3DTYA 4GKVA 3WBBA 1UXJA 2DBZA 1YB1A 4GSKA 1U3TA 1DIGA 1KVQA 2W4QA 2J3HA 5FI3A 4FDAA 4BO9A 3VZQA 3WFJA 3X2FA 1PGPA 1HDZA 2NQ8A 4O5OA 3NTOA 1N9GA 1Z73A 2WM3A 3CE6A 4RZHA 3GMDA 4Z0HO 1MX3A 2P9EA 4IIUA 3ZGYA 1EFKA 1DIRA 1GFSA 2ZTMA 3V5NA 1T24A 3K2BA 4OIMA 1WVGA 3RQSA 3TL2A 1XU7A 1Y7TA 3WGTA 1B15A 1T2AA 2GZ3A 4IS3A 4RF5A 4EJ6A 1GUZA 1N9GB 2Q49A 1IHXA 1JAXA 2V7PA 1MC4A 3GA0A 2EKLA 2BF7A 4KTVE 5DT9A 1U3WA 3FTNA 5IDYA 3PWKA 4FS3A 5BSHA 3VAZA 1JDJA 1E7QA 1ZH8A 3GVPA 2D1YA 3ZWAA 1C0KA 4DRYA 2X22A 1EBFA 3K96A 2NNLD 4EEXA 1MB4A 3ZW9A 3U4HA 3EC7A 2ZTVA 4A0SA 4WCDA 1HF3A 3U62A 3PRJA 1YOVA 3ITDA 2I6TA 4II3A 3OIGA 2O7SA 1I5RA 2OBYA 4Z9FA 4CLDA 1I36A 2ZYAA 3QVXA 3KSUA 1F17A 1BXZA 1GV0A 4XGKA 1QV6A 3T4XA 5A9TA 1DAOA 3EAGA 4D45A 2EXXA 5TT1A 4E21A 3EGOA 2PWZA 1M6HA 1NR1A 2CDAA 3ICPA 4B7XA 1ZIDA 4HX5A 4EUEA 1AHIA 3BA1A 4JROA 3VHRA 2RIRA 1PR3A 5C7LO 1GZ6A 1X14A 3ZWXA 4GL4A 3ROQA 3S1LA 1VI2A 4WNIA 4AJPA 4Z3DA 5L9AA 4YT5A 1PTJA 3AWDA 3KRTA 2W90A 4DQVA 3H9EO 1DPGA 4GAEA 1Z82A 2V6GA 4ALLA 1LU9A 1E6WA 1P3DA 3IDSA 3NTQA 4R9SA 3WX0A 4IPTA 1V9LA 3G49A 3TN7A 3DZJA 3WB9A 1CWUA 4UEOA 1PU2A 3PLRA 3RROA 3V2UA 4AJLA 4JJGA 3PEFA 3ZNNA 1N5DA 4CL3A 4GX5A 5I8WA 2JCXA 1WDMA 3DFZA 1T4BA 5A06A 1UR5A 5KCZA 1RM3A 2PKQP 3JQ8A 1RWBA 3JSAA 4YJDA 1ZXLA 2VWHA 1WZIA 1U7HA 5G4LA 1N2SA 5C7IO 3C7DB 2FP4A 3FNFA 3HN2A 1HZZA 2AG5A 4KZPA 4W82A 5KVQA 1U9JA 5KVVA 3WGHA 5L7WA 1HDXA 5A3JA 3JQ8B 5CAEA 3D3EA 2GR9A 1HE5A 2PGLA 1DIBA 1R16A 3QWBA 3QQPA 4EEZA 4E13A 3GEGA 3HWRA 3CMMA 2QW8A 4LRTB 4LVUA 1Y8RA 3V1TC 2G82A 4DYDA 3A9WA 3C7CB 2Y0DA 4RV9A 3W4JA 3RU7A 3OIDA 4JK3A 4R4JA 4L4RA 4PVCA 4IDBA 3WGQA 4J2OA 5K6AC 1WLYA 3E9NA 5THKA 1Y8RB 1B3BA 2EV9A 3LVFO 2A4KA 1TI7A 3GUYA 2E6UX 4MIEA 5F21A 4GGPA 2VQ3A 3JYPA 4Y9DA 1TB4A 2J6IA 3QVTA 4RLSA 1P74A 5JC1A 4XEHA 3INRA 1PGNA 4EUHA 4FC6A 5TJHA 3B1FA 4WLUA 4NU6A 3TZQA 3ROMA 5ITVA 1QV7A 4BIIA 1I3LA 4UEKA 1H9AA 1B14A 4IQGA 4P4GA 2DLDA 1E1NA 2JCYA 4ESOA 1GPDG 3K31A 3M2PA 1TXGA 4BNFA 1LEHA 3GNSA 1B26A 4FFNA 1YJ8A 5TC4A 3TRIA 2CF5A 3WLFA 3F5QA 2PFGA 1X15A 3JD2A 4L4XA 3KOUA 3U09A 5HS6A 3Q9UA 4FBGA 1KEPA 3FPCA 1NWCA 1P1IA 3UHAA 3PHIA 4HFRA 2XPCA 2X8LA 2Y93A 2ZTUA 2JD0A 2DVMA 1JKFA 2YV1A 4D43A 3BTVA 1GEGA 4BO1A 4B4OA 2FMUA 1Q7CA 4L74A 3WGIA 4LVCA 3MJVA 1NQ5A 4PGFA 2VHYA 1HRDA 1HDCA 4GI2A 4BNMA 3GRKA 4OSPA 2OORA 2OUIA 4FR5A 3AI1A 4YAGA 1H2HA 1V8BA 4EITA 2NQTA 3W8EA 1KC1A 1X13A 1WMBA 3UCFA 1PJCA 1PR9A 3ZI0A 3R1IA 4JJFA 4WKGA 4J0EA 1U1IA 3WG9A 3GDOA 2P68A 1KC3A 4ZICA 2D5AA 1YKFA 4XKJA 2EP5A 3SC6A 4KTTE 2WE7A 3SJUA 1QXSA 1P31A 1ZK4A 2YYYA 1YGYA 4OGWA 4QO8A 4YQYA 2BGKA 3GHYA 5DOVA 1R66A 3GY0A 5L53A 1JA9A 2O23A 3DZFA 3GEMA 2HJSA 2E4AA 3IAHA 1Z75A 2VUUA 1HE3A 4HBGA 3ROPA 1MFZA 1JN0A 3D4PA 1XU9A 4BMVA 2WTBA 2O3QA 3AUUA 1XDWA 5JLAA 2J3KA 4A10A 1JKIA 4ZHSA 3OEWA 1I2CA 3WDSA 4PRLA 2GLXA 3MCVA 4H15A 4R51A 1DO8A 3U5TA 1UAYA 4DBZA 2E37A 2AHRA 2RH8A 5EL0A 1UP6A 1M2WA 3HSKA 5DN9A 3WR5A 4OH1A 1VC2A 4GVLA 1M75A 2JHGA 2AEFA 5BQFA 3CUKA 5HTOA 1HEUA 3CKYA 3ONEA 1LJ8A 1B8VA 2Q46A 4GQAA 2VN8A 4FOSA 1HWYA 3E03A 5BT9A 5L95A 4YAIA 3DOOA 3IC5A 3PFWO 3F9IA 3IJRA 2JHFA 3ZW8A 2XAAA 4MO2A 3O4RA 3HDYA 3WSWA 1E6UA 2C7GA 1C3VA 2X58A 4KWHA 1UDBA 4CQLA 4UVEA 5KTKA 1ENYA 3ETEA 4TKLA 5LCXA 3RFXA 3RC7A 1AXEA 2BGLA 3F3SA 3WNQA 3GG9A 4YT4A 3NJ4A 3TFQA 5JS6A 1BDBA 3ONDA 3HJAA 4AJEA 4BGIA 4CQLB 3FR7A 4YJGB 1EVZA 5AXAA 4H3VA 1NPTO 3NX4A 1J6UA 1C0IA 1Y81A 3H3FA 4CL8A 2O4CA 1U5CA 3EZYA 5I9MA 2DTXA 4LN1A 5IF3A 3ZV6A 5I7VA 3LDHA 3ASVA 2DTEA 1U4SA 3VDQA 2JFFA 4IIVA 2C07A 4FFOA 1EFLA 3UAGA 1R37A 1PGJA 4RVHA 1HZJA 1F14A 4IDCA 3Q3CA 2J8ZA 4KOAA 5JAIA 4N18A 4LCJA 1IHYA 1E7YA 3I9NA 1LRJA 3VPHA 3Q6IA 5BSGA 2YV2A 1U2GA 4YACA 3F4LA 3PIDA 3G1TA 2UV8A 3NYWA 4B4WA 3H65A 4XJSA 4D3FA 4NFSA 4Z0TA 3MOGA 2VT3A 4WLVA 1E7WA 3WLEA 3H2ZA 4KUGA 4Q3CA 5KJ6A 4DTIA 5K6AA 1I24A 3IP1A 4MIYA 2NTVA 3PFFA 5TJ9A 1E5QA 1PSDA 4GMGA 1SB9A 3H7AA 3U3XA 3LLVA 1PZFA 1PL6A 1PIWA 2Y1OA 2VZ0A 4BNIA 1LLUA 2D2IA 3G0OA 4PLCA 1GEEA 3IMFA 2GO1A 1X0XA 4YRDA 3M6IA 4RVSA 2GSDA 3BMNA 1YQGA 1X7HA 5ICSA 2NUAA 4WECA 1RYDA 1K5HA 2IZ1A 1CF2O 2WSBA 3CH6A 4AJIA 4CUZA 1LXCA 1GAEO 3U4DA 4Y6SA 3UFXA 4EI2A 3AM3A 1IOLA 4XYMA 1U5AA 3BMNB 4Y8VA 1KIFA 1X1EA 5G0UA 1QKIA 4DPKA 5EMHA 3W4KA 3H9JA 3E18A 3GDFA 1XLTA 2PNFA 2VYVD 3GAZA 4Z9XA 3TQHA 2HJRA 2W8ZA 4MVJA 3JV7A 5JMPA 1D7OA 3RASA 4BO7A 4FIZA 3E5MA 1ZUD1 3WMWA 2EW2A 2X0RA 4CODB 1BTOA 1PQPA 2WE8A 4LMRA 4NBVA 4IGEA 1FDUA 1YL5A 4B4UA 4AJHA 1HT0A 5DCWA 2WYVA 3DMTA 3PJEA 4WNCA 2PKRA 4AJ1A 5TNXA 3RUCA 1R0KA 2OL4A 2ILTA 3UGKA 5A1TA 3BTOA 4BGUA 4MVJG 1MLDA 3BMCA 5DNAA 2VWQA 4I1IA 5HBRA 1ZW1A 1AN9A 4BNVA 4Z3KA 4KUHA 3QVSA 4TSKA 2IXBA 4CUJA 1E3IA 1ZSVA 3BMCB 3QWHA 2X4GA 5I9LA 2UVDA 2O2YA 1RYEA 5DF1A 1T4DA 4NI5A 4JBIA 5AQ1A 5B4VA 4PLVA 5EIOA 4BUCA 3RBXA 3QIVA 1C1DA 1T26A 4F3YA 4WCFC 3LC2O 3AUSA 2FY8A 3I9LA 5TX7A 1NPYA 4HFNA 1ZEJA 3OFSA 1QSGA 4GVXA 3UUWA 1HL3A 5KOIA 3SLKA 4BGEA 1K6XA 3LF1A 4B7UA 4XX0A 5DDIP 1C1DB 5HS4A 3WTBA 4Y98A 2R6JA 1ADFA 1GTMA 1QRRA 4HFMA 4XR4A 5F3RA 3TZCA 4WJZA 3WTCA 1WWKA 3OHSX 1Q7BA 2VRBA 2NVWA 4W6ZA 5IDXA 5JSFA 5ICMA 1ISGA 1C0LA 3DBRA 5DBGA 2PGJA 3PHLA 1XYGA 1ZEMA 2B36A 1P77A 5JCXA 3CEAA 3AI3A 4HKTA 4GWGA 4CMJA 4UUOA 4ND1A 1LTHR 5A9RA 3K8ZA 3DBRB 4GSLA 3LQFA 4MP3A 4KQXA 1VKOA 2ZQYA 1ORRA 1NYTA 2D0IA 3PDJA 5BSEA 2QRJA 4IINA 4NFYA 2CNBA 1JAYA 3HB4X 2GDZA 3JCZA 3PJGA 4U5QA 4YDRA 5JE8A 3FD8A 4YT2A 1PQUA 3ANMA 3WIEA 4C7JA 5BNIA 1XQ1A 3F47A 1UZMA 2NSDA 3GGOA 2F00A 3BHMA 1U28A 1EDOA 2IXAA 3LC1O 2B4TO 4IMRA 5CG1A 4QT0A 1IULA 2VOJA 3IQDB 2RAFA 2XXBA 3TNLA 1LSOA 1ZKMA 3N7UA 2Q45A 3H5RA 3OMLA 1KVTA 1LDGA 5B4TA 4FB5A 5JW6A 2WJPA 4RDHA 3CIFA 1EQUA 3AY3A 2AW5A 4UULA 4IQ0A 4CM6A 1ZJYA 1O6ZA 3PTZA 5BR7A 4ITUA 3DAFA 4BNGA 3WICA 4D41A 1GU7A 2O3SA 4ND4A 2BELA 1RM4A 1A4IA 5L45A 3LT1A 2Q1TA 1U2DA 3BZUA 1PL8A 3KLMX 1UH5A 3LZ6A 3WFIA 1LDBA 2PZKA 2C20A 4MVJI 1BXKA 2RBEA 3S2IA 5KVCA 2VTEA 3EDMA 3QP9A 4GLOA 3G1UA 2FR0A 3PWZA 3PZBA 4J0FA 3PI7A 4J4HA 4YCAA 4YAEA 3DXFA 1WNTA 3C1TA 5AXCA 1XKQA 6LDHA 2FPIA 3LF2A 4RPGA 2UUPA 1ONPA 3BHIA 5IDWA 4U0JA 1NVGA 4UAGA 1K6IA 3ZHXA 1NXQA 1E3LA 2AQHA 3KV3O 3GGPA 4BO5A 3TJRA 2FSVA 1EMDA 4DVJA 2ZKLA 1PS9A 5JCJA 4OM8A 3TZKA 5CEFA 2DM6A 4B7CA 3FI9A 4KDEA 3U4IA 3SX2A 5TS3A 1R4NA 4H16A 1A27A 2XXJA 5FWNA 4MKXA 1B8UA 3AY7A 4OYRA 2CD9A 1V3VA 3OIFA 5COBA 1M67A 3AOEC 5KJCA 1TVEA 4DWVA 4UVIA 1O5IA 1R4NB 5JDIC 4YWJA 4E2YA 3ENKA 1J4AA 4A2CA 3TZ6A 3I1JA 4KP7A 1U8FO 1UAGA 1G1AA 2EWMA 1DJNA 1M6WA 3RUAA 3TF5A 2Y05A 3RWBA 3ZV5A 4JBGA 1P45A 3QY9A 3GH3A 4D79A 3CMCO 1WP4A 3MTGA 3KO8A 2FRDA 4JCOA 3AFMA 1DLIA 1QYXA 5ES3A 4WK6A 4A5OA 9LDTA 5B4UA 1D3AA 3T4EA 4BOYA 1A71A 3RVDA 3DZIA 4Q39A 4BV8A 5IG2A 1LNQA 1HE2A 4RZIA 4NK5A 5JC8A 2PR2A 3PK0A 2X0JA 1X7DA 2RH4A 2Y1FA 3B1KA 4GH5A 4XDYA 1T25A 4TMFA 3MJSA 1PGOA 4JQCA 4WLOA 3AK4A 4DLBA 4MJLA 5CDSA 1HKUA 7ADHA 3GC6A 1ARZA 2GN9A 4I5DA 3SEFA 4BNXA 4DMMA 1PJ4A 2ZIZA 1I2BA 3VPFA 4PLZA 5CPBA 4IDGA 1BVRA 4WPGA 5EPOA 5A9SA 1NQTA 3I83A 3JQAA 4XJTA 3JD3A 4EDFA 5ILOA 1YB5A 1IZ9A 2OHXA 5U9CA 4PZDA 4XGIA 1FF9A 1PJLA 3E82A 4MKRA 3UVEA 4IJUA 3WYEA 3ZWBA 2GN6A 3GGGA 3KEQA 1GYRA 4AJKA 4B79A 4YVFA 3T7CA 2IE0A 4BKQA 5A9SB 4WCFA 4BKPA 5CDYA 1UP4A 3JQAB 4CJXA 3CINA 1E92A 5JFOA 2XOXA 1PX0A 3V8BA 4W9NA 1HTBA 4XYEA 5KVSA 3GVIA 3QSGA 3FNEA 4CQMA 4XYGA 2BFPA 2I76A 3W8FA 1K3TA 4WCFB 2Y1GA 4WLNA 2O4UX 3D0OA 2Z95A 2HMUA 1EK6A 3CPSA 3I9JA 3B6ZA 1DC5A 1Q0LA 2HLPA 3NKLA 1XG5A 2EEZA 3UW3A 4CQMB 3WNVA 3I5MA 2QYTA 2E49A 1CYDA 3H9UA 5L4SA 3L9WA 5JYDA 3H5AA 2YDXA 1FXSA 1LQUA 4DC1A 2V6BA 3GFBA 1TLTA 4BNWA 4CLRA 1DFHA 1ISIA 1RKXA 1GZ4A 2NU6A 2YHIA 5CPFA 1I01A 4FOOA 3RC9A 4UVDA 5MGBA 5J23A 2HMTA 3VVCA 2P91A 3DHEA 5T5QA 3KTDA 1ZJZA 4XIYA 4CLRB 3C3XA 4YAJA 4Z9YA 5BSFA 1OBFO 2OZPA 4EZBA 3HDJA 3OQ1A 2I5PO 2P5UA 2YHIB 1N8KA 4O6VA 4Z6KA 3HDQA 3I9MA 3NJ8A 4M1QA 1KBZA 1VL0A 2DPGA 1LSUA 4BNYA 4C7KA 2Q2WA 1T2CA 1ZMOA 1K6JA 3OQBA 4YEDA 3TDKA 1JKJA 1BHSA 4HY3A 5GZ1A 3RUDA 3O03A 1P1FA 3LT0A 4XR9A 3DHYA 4K28A 3MTJA 3DONA 3GPIA 5AVOA 3QVWA 5KNLA 3D3WA 2B35A 3VTZA 3L4SO 4NIMA 4LISA 4C4OA 3C24A 4ZVVA 2FR1A 5I7FA 3PP8A 1U4OA 2GZ2A 3D3WB 3NAQA 3PLNA 4KWIA 4D0RA 4HNGA 3GUCA 1ENOA 2CFCA 2GCGA 3RC1A 2EF1A 5KWEA 1R4MB 4I9NA 4JNKA 3IUSA 4XB1A 1V3TA 5T64A 2ZK7A 3EK2A 3RKUA 1PQWA 1PWZA 1DDOA 3FTPA 4R5HA 3IUPA 1N92A 1QLHA 1Z7BA 2FZEA 4AJNA 4IUYA 2I3AA 2IEBA 1HLPA 1DOHA 4L75A 3K9QO 5I8ZA 5L40A 2OP1A 4HV4A 3P19A 4MVJP 5A5FA 4BVAA 2D3TA 3GNQA 4JBHA 4OXNA 5ER9A 2NVBA 3HE3A 1ADBA 4ZU3A 5GMOA 2J5RA 2C2XA 2EG9A 4URFA 1R15A 4BNTA 3H9GA 3DBHA 4FD3A 1YJQA 4J7CA 4LCEA 3LU1A 4B3JA 1H0KA 4UUNA 2YJZA 1AGNA 4DC0A 1E3WA 2X0IA 4M54A 2OOSA 4ROSA 2JD2A 1NQOA 4YJFA 3QW2A 3KUXA 1D1TA 5ITWA 2C82A 1P9LA 5JAMA 4QTZA 2Y0EA 3DBHB 3HUDA 2AQIA 1EE9A 1LDMA 4NBWA 1NVMB 2X9VA 1TA4A 5ADHA 2EW8A 1E3WB 1J0XO 4YJFB 2EJVA 5T8KA 2BFOA 3AOEA 3L6EA 4AVYA 4MDHA 5COAA 4Q3AA 3WGZA 3F6YA 1X1TA 4CM3A 1K89A 4J3FA 5JDIA 4BNKA 1F06A 3KYBA 3ZHBA 4DMLA 3H9QA 1FMCA 1N7HA 2DTDA 4B4VA 4J1QA 3JQ9C 4Y6RA 2ET6A 3NGXA 4J4BA 5F1PA 2X1HA 3E6AA 3GAFA 4ND3A 4IJWA 4RPHA 1SEPA 3RCBA 4Q9NA 5GY7A 2EHDA 1ZSYA 4CLXA 3D5TA 3FBTA 5K9ZA 4IMPA 1O89A 2HK9A 3FBGA 5TT0A 1O95A 4LSWA 6ADHA 2FZWA 2CUKA 3GHHA 4P4LA 1IPFA 1SEVA 2ZCUA 5KKCA 1ENPA 1Z74A 4CLOA 1JLLA 3PVZA 2G0TA 4UVHA 1SOWA 2BD0A 4Y6PA 1YQXA 4WE3A 4NJOA 1DC6A 2NWQA 2V65A 4U0KA 1GYQA 2Q2VA 1HDOA 4TRMA 1VJTA 1YBMA 3EMKA 3LLSA 5IAAA 4OXKA 4CLOB 4CMBA 3PXXA 3ZNQA 3AI2A 2A9FA 2VUSA 2GYYA 4CMHA 4J7XA 2DU8A 5G0WA 1XA0A 1SOVA 2ZB3A 1B8PA 4B8ZA 1DAPA 1EZ4A 4TRNA 5TGDA 1NFFA 2HDHA 1B16A 3P2OA 1Z6ZA 1P44A 1GQ2A 2JFGA 1C0PA 2PZJA 3EHEA 2SCUA 3C1OA 3OP4A 4MOWA 4CMIA 5KJFA 1RJWA 2LDBA 3HB5X 4R9RA 4XZ3A 4NQZA 4R41A 1DB3A 4E2ZA 4J6FA 2QX7A 4EYEA 2JAHA 5IXSA 1ZMTA 4YBZA 4E12A 4CMGA 3VTFA 3A06A 2CVZA 4CMIB 2P4QA 4RF3A 2TMDA 5IZ4A 1HSOA 2E48A 2QYSA 3DZKA 3PQEA 2HUNA 5A05A 1DSSG 1GY8A 4XD2A 3WMXA 5JDCC 3ZWNA 1E6EA 4DYVA 4M86A 4YJGA 1BXGB 1W8DA 1A9ZA 2NVUB 1DXYA 3PHJA 4M8SA 4ZD6A 4F6CA 1QG6A 1QYCA 2BRUA 2JFHA 2QRLA 2HMWA 2OXIA 4DREA 3JQCA 4YPOA 2C29D 3MJTA 5HM8A 2IYOA 1NBOA 4XIJA 1PS8A 3I9KA 1I3NA 4A03A 4OKNA 2Z5LA 4E4YA 1R0SA 2B83A 4I5GA 3OQ6A 3VH1A 3KZVA 5B12A 4INAA 2W2LA 3MJCA 3UCXA 2NACA 4HNHA 4BNLA 4FGSA 2Y99A 4M87A 3I9OA 4XQGA 3W4IA 3QVOA 3GF4A 3JYLA 3AM4A 4ALMA 1H6AA 2H63A 3OJEA 4DA9A 2GPTA 4G2NA 1E3SA 1V6AA 1FK8A 2AQ8A 3E9QA 3C85A 1GZ3A 2W2KA 2ZB4A 1EQ2A 3KXDA 4BV9A 4HFJA 1LX6A 3U9LA 2Z1MA 3PHGA 3A28A 2O3RA 2QQ5A 4FCCA 4EJ0A 2VNAA 4LSMA 1R0LA 5CP8A 2AA3A 4BHTA 1F8GA 1ISFA 3RD5A 1ENZA 2W2KB 4KMSA 4QFDA 1P33A 2FWMX 4NHEA 4QSMA 3ZWOA 3KSDO 1PGQA 2Q2QA 1YRLA 1U7TA 4CV1A 3ANNA 4JN6B 2BKAA 4R1SA 3NT2A 3VOSA 1KS9A 1LLCA 3DOCA 3FNGA 3VKUA 3SXPA 2Q4BA 1BRMA 3HQ4O 1BMDA 1D1SA 4GX0A 4PZEA 3ZH2A 3VPSA 4OQZA 3RAJA 3M2TA 2A35A 1EEHA 4XA8A 3H3JA 5H82A 4PCVA 3L6OO 5F5LA 1WDLA 4ALJA 2BH9A 2ZJ0A 1A7AA 2I3GA 5F1KA 2DBQA 3ZWVA 2Y1EA 4AFNA 4TRJA 4CR8A 1CQIA 4J91A 4NDNE 1NR7A 2GNAA 2ZQZA 3A14A 2PH3A 3GEDA 3MEQA 3VPXA 2I67A 4TVBA 3LT4A 4GMFA 4YTEA 3SJ7A 5DCUA 1LUAA 1EE2A 4R3NA 4RF4A 2ZB8A 2Q99A 2VHVA 4BO4A 1SC6A 5CDTA 3RI3A 1UXGA 1P0FA 3RUEA 3F1LA 4O63O 4NK4A 3WBFA 2HO5A 4EBFA 1NP3A 3ZU5A 1LC0A 4BQPA 3S55A 2PGDA 4N5LA 4DQUA 3ZCXA 4RPJA 1SPXA 2VUTA 3I52A 2HKIA 3ZWMA 4HUJA 3QE3A 4B3IA 5JO0A 1MG5A 1GQYA 1CQJA 3TL3A 1I8TA 5TSDA 1GV1A 2WWRA 3OJLA 1ZK3A 3JQ9A 2RCYA 3Q0EA 1R12A 1X7GA 3WQQA 2HMVA 4DIFA 4W7IA 1GD1O 3TOXA 5L3ZA 1JQBA 1IB6A 1WMAA 3N58A 3RSHA 1IYZA 3PYLA 2H5LA 3FF4A 4R54A 4JP2A 5KJ1A 3JQGB 1E5LA 2HQ1A 1RPNA 1GPJA 4IY1A 4KUEA 1GCUA 3FPLA 3BMOA 1ZXBA 3EVTA 3ZWYA 4BQRA 4CR7A 1X0VA 2BLLA 5EINA 2B37A 5JPIA 3CXRA 5EERA 3PIIA 1B7GO 1JVBA 3I6IA 5LC1A 1H94A 3BMOB 3RUFA 4XYBA 8ADHA 4NFHA 1Y9EA 3K92A 1LI4A 2BFAA 2EIHA 3JD1A 3E5RA 4L8VA 1ZO8A 3S2FA 1AUPA 4YT8A 3UN1A 1YQDA 2J3JA 3ZNOA 4PG8A 4O59O 1SB8A 3JQDA 1E1MA 1NTOA 4FSHA 4ILKA 4ALIA 5JAQA 1FDWA 3ADPA 4J9VA 3JQ7A 1LBEA 1PZGA 1NHGA 4GX2A 4ZQFA 5G0VA 3U0BA 4PLWA 3GVXA 3LC7O 2A94A 2DFDA 3JD4A 3OETA 4TRRA 2I65A 1Y5MA 4GGOA 3OJOA 1KEUA 1IE3A 3JQ7B 3DOJA 3EUWA 2VTDA 3G3EA 4K9DA 1ZFNA 3EVNA 2BFMA 4R1NA 4ZGWA 3KM0A 3VVBA 4II2A 1UDAA 1VPDA 4F45A 2JJYA 1IUKA 1Y6JA 4AICA 1W4ZA 2A92A 3M1AA 1DIAA 2FR8A 1NM5A 2VRCA 3M1LA 4E0BA 1LC3A 3DAGA 4MP8A 4K26A 1NX6A 2B69A 5ILGA 2I66A 5JDCA 1BGVA 2VYNA 1GDHA 1HE4A 4JP3A 2FN7A 1S6YA 1PJBA 1ADCA 3PJDA 4IQ8A 1DRWA 4IDEA 5KIAA 3DWFA 1T2FA 1ZZEA 4D46A 4GWKA 4TVOA 1T2DA 1E3EA 4YXFA 4E6PA 3DEYX 3PYXA 2WD7A 4DGSA 5GZ3A 3E8XA 2GERA 3AU9A 1YVEI 2IEDA 1P1JA 3K6JA 3KLPX 5T67A 3BAZA 1SCUA 2CVOA 4BMNA 4MVJD 3DDNA 2WD7B 4D3DA 1PJTA 3Q9NA 2GN4A 3G79A 3S2GA 1GUFA 3WGYA 4Z0PA 2GUGA 3O26A 3GG2A 3JQBC 3DMYA 1UZNA 2Q1UA 2UUOA 3RC2A 5G4KA 4DXHA 4BMSA 4FFPA 4I5EA 1QYDA 4MVJH 5C5IA 3DO5A 1SZJG 1YONA 1VRWA 1IPEA 3GLQA 4RVGA 4OOFA 3GNTA 5TQVA 2AE1A 1PJ2A 1UJMA 2Y67A 4ZJUA 1ZVMA 3NTRA 5G4KB 1BG6A 3ZHZA 4ND5A 3DBLA 4JJIA 3F4BA 1I3KA 3ENNA 4MVJM 4CM4A 1W6UA 1ONOA 4RPLA 4FW8A 4OO3A 2ZYGA 1DBVO 1OC2A 2LDXA 3PWSA 4DLAA 4L9RA 3AJRA 4CMEC 4U6QA 3AW9A 3DQPA 1K0UA 2O48X 2UAGA 5AOVA 3DBLB 3ITKA 3QWIA 1LQTA 5U1PA 2HAEA 1PS0A 4CM4B 4IJKA 4QFCA 4CMCA 5A03A 4NBTA 1Z45A 3TOZA 4WLEA 3SVTA 2HSDA 2EGGA 2NTJA 3QA9A 4CUKA 1A4UA 3CTMA 1UXHA 2NLOA 1A5ZA 2IZ0A 3KSZO 1KY4A 4ZQGA 2YY7A 2NM0A 1BVUA 3PQDA 1RM0A 4J1NA 2YUTA 2CDBA 1NQAO 3U4CA 2DBRA 3L07A 2EP7A 1T1SA 4MVJF 4XYLA 3L6DA 2D8AA 2XF8A 3HZZA 5EN4A 4CM9D 2GN8A 3DFUA 3O38A 5G0SA 3VH3A 3KYDA 1DRVA 4UREA 2ZJ1A 3FNHA 5L4NA 5BNFA 5A4DA 2HMSA 2V6MA 5MDHA 2D59A 5DOZA 4FFLA 4CLEA 4Q3NA 5EQFA 4N5NA 3GVCA 4OXYA 3WOHA 2E82A 2YDYA 4EGFA 3KYDB 2EKQA 4R1UA 2R00C 3ZDFA 4R01A 1N1EA 1XEAA 2GASA 5JBIA 3OM9A 4DPLA 2C5EA 3ROKA 1KEVA 3U49A 3K73O 3K30A 1KERA 4MVJE 4XDZA 2HK7A 2OBNA 1BW9A 2G5CA 3LYLA 1D4FA 1YL7A 1EK5A 3FWNA 3ON5A 4AJJA 4D42A 4ZA2A 3JQFC 5I9NA 4IXWA 2TMGA 2NADA 4CV0A 1BW9B 1Z7EA 1AE1A 4PLYA 1YWGO 1DFIA 2QRKA 1PJ3A 2NU7A 4BNHA 4BNZA 3B1JA 1XCBA 3TWOA 1JWAB 2YZ7A 2Z1NA 3ZU2A 2IRWA 3L4BC 4EJMA 4N54A 1Y9AA 1LA2A 4HWKA 1A7KA 1YO6A 4S1VA 4TQGA 3RFTA 2C7VA 4PLPA 1DLJA 1LDEA 2YQ5A 3JYNA 2AEJA 5EQDA 1LSJA 3BMQA 2B4QA 4E5PA 1EVIA 2EJWA 1N1GA 2GD1O 4RCVA 1VE9A 3VKVA 4ALNA 2HRZA 4P8RA 1NFRA 4OOEA 3Q2KA 3ULKA 1SNYA 3K2EA 3BMQB 4TROA 3VH4A 1PJQA 3A4VA 2QHXA 1WAMA 2Y68A 4NG5A 4UUMA 4CPDA 4NU5A 1CEQA 2C59A 2H9IA 3VZRA 4U7WA 4IM7A 1T1RA 1XWFA 1L7EA 4JLWA 3OA0A 4L76A 3V2HA 1HLDA 1Q0HA 1LDNA 2O2SA 3MWEB 2JD1A 4OSOA 2J5KA 4PLHA 2NU9A 4I8XA 1QR6A 4I9HA 5K0ZA 2UYYA 1R6DA 3HN7A 4D0SA 4OMUA 4DQXA 5I7EA 1U8XX 1UXKA 4E33A 1QP8A 3OEYA 1WXDA 1E7MA 3RUHA 1VJ0A 3H4VA 1YOVB 3UICA 4ZQEA 5ENVA 1UZLA 3PPIA 1G0OA 1GUYA 3PGXA 3V2GA 5JCJD 1VSVA 1JTVA 1E1KA 5G0TA 1JVSA 4NJMA 3PGJA 2CDCA 1E7SA 2EERA 3R3JA 4RGBA 1WZEA 4E5MA 3GT0A 2P2SA 4W4TA 1PEDA 5CFZA 3C8MA 4G81A 4BKOA 4AG3A 2IDZA 4NJMB 2QIOA 4A27A 2AE2A 3HFGA 2IYPA 3TPCA 3OH8A 3IP3A 1KVUA 4UUPA 1OC4A 3IKTA 4PG4A 4DL9A 2UDPA 2YHUA 4KQWA 4R68A 1NWHA 3E1KA 1YE3A 3X2EA 3E48A 1ZK1A 3HFSA 2X86A 2F1KA 1HXHA 1NASA 2DKNA 1XGKA 3Q1LA 3WSVA 4E5NA 1SBYA 3JTMA 3JQBA 1I3MA 4H7PA 4BKRA 1R4MA 2X5JO 3VH2A 4RLHA 2G1UA 4TWRA 1JU9A 2HU2A 2O50A 4GX1A 4NH4A 4J9UE 1XIVA 3AFNA 1HYHA 5C7OO 2FOIA 1UP7A 5JO9A 5DP1A 3IS3A 3L77A 3FCOA 1I2ZA 4WGGA 1LLQA 2Q1WA 3FRJA 4J2HA 1Y1PA 3GVHA 2ZATA 2ZYDA 4J16A 1KETA 1DHTA 1F8FA 2FSSA 2AG8A 4IS2A 4FJ0A 3JQAD 1H6CA 4PLTA 1NHWA 1B0AA 4CMEA 1CIVA 5JMWA 1MGOA 3KB6A 1Q7GA 3GK3A 4CV3A 4QO7A 3QHAA 4U8GA 2EGHA 1FDVA 3NEPX 3RIHA 1UDCA 4AL4A 2AXQA 3PZRA 3GFGA 1B3RA 5ENDA 2WYWA 3BTSA 1ISMA 4PN3A 4FQ8A 5T6BA 3LT2A 4XQCA 1HYEA 1BSVA 5L7YA 5LDGA 5GZ6A 4CQMD 5A04A 2G76A 2IODA 2PTGA 3F5SA 2DT5A 4CM5A 5HWSA 2O3UA 1ZBQA 1XHLA 5F1OA 4BGVA 3RBZA 1A9YA 1J49A 1HETA 4F6LA 3DZGA 1FJHA 2GZ1A 5A5EA 2C54A 1MG0A 1TT5A 2ZCVA 2PD4A 4OQYA 5CEJA 5IJZA 3CZRA 4K1LA 2B5WA 2BMAA 2CSUA 3QWAA 4MP6A 4W99A 1IL0A 2PV7A 4IDFA 4PZCA 1M66A 1N7GA 1I32A 2GGSA 3SBOA 3EYWA 3ZV3A 3IKVA 3ZV4A 1DC3A 5IN5A 4RDIA 4YRAA 1TT5B 3JQEA 3NT4A 4MIOA 3INGA 1WPQA 1G6KA 3DBVO 4R1TA 3FR8A 3L0DA 3QJ5A 5COQA 3TSCA 2O3JA 2R00A 3F1KA 1TEHA 4ZQBA 5CDGA 2B0JA 4P38A 3W6ZA 1GL3A 4JX8A 4E31A 2D4AA 3EZLA 3RU9A 3WS7A 2P4HX 1H2BA 4R69A 4FJ1A 2PZLA 3EY4A 3I6QA 1CERA 1PZHA 3L9XA 2Q1SA 4PG5A 4FPXA 1UXIA 3UOGA 5L7TA 3JQ6A 3JQFA 5AYVA 1OOEA 2X5KO 1OZAA 2W98A 1OAAA 2I9PA 3DMTC 1Y8QA 2J5QA 3OBBA 3ZNPA 3EW7A 1WW8A 2Y1CA 1YDWA 1T2EA 4GPD1 1CJCA 1HDGO 3OJFA 1CRWG 3L4BA 3B70A 1SO8A 1Y8QB 3I23A 2VHZA 3R6DA 1GADO 4HADA 1H9BA 2P9GA 3NV9A 2D5CA 2HK8A 2POQX 1ZCJA 1YBVA 3GMSA 3HDHA 1ISJA 5THQA 1DJQA 1FDTA 1VKNA 3D5QA 1DFGA 3G17A 5HA5A 3R0IA 3WJ7A 5JXWA 3I3OA 4GBJA 4CM8A 2AQKA 4QQRA 4A73A 1SMKA 1VLLA 7MDHA 4XRGA 4YRBA 3PYMA 3ZWCA 3C7AA 2DFVA 4CV2A 2QG4A 3NRCA 3DL2A 3JYQA 1IZ0A 1XSEA 2X7HA 3PQFA 4BO0A 2DUWA 4CM8B 4NBUA 3O8QA 5CEEA 4E32A 4WOKA 1QYWA 2OMEA 5BNTA 3H2SA 3H8VA 2YFHA 2ZTLA 4OKIA 4F46A 1BXGA 4QEDA 4BO6A 3VC7A 2NVUA 3COSA 5IXYA 3OICA 1VL8A 3DZBA 1PJSA 1EUZA 2X23A 3O8QB 4XCVA 5EESA 3TFOA 1E1LA 1VJ1A 3CZMA 1E7RA 2C5AA 2X0NA 4QECA 1O94A 3HNPA 3GDGA 4TKMA 3NGLA 1MC5A 4WEOA 4QX6A 4I9UA 2VYVA 1PZEA 4PG6A 4DIBA 2BHLA 3MJ4A 4NR0A 4G5HA 3ANLA 2Y66A 3FHLA 3RJ9A 3GRPA 4D3SA 5HRUA 1MFPA 2DUUA 3ASUA 1DIHA 4CMKA 3DTTA 2Q3EA 3GQVA 5H83A 4YB8A 3C1AA 2OGUA 2AEMA 4FGWA 4J49A 4IZIA 4BKUA 4YAKA 3GOHA 1H5QA 3FN4A 3MZ0A 3OJ0A 3DHNA 1EVJA 4IBOA 4JXKA 3DAPA
chains in the Genus database with same CATH superfamily
1NJ8A 4BN4A 4EW1A 4QDTA 1CQXA 4MEJA 5JXHA 5J4KA 5CX4A 4G09A 1KIAA 4TL6A 1ZGHA 3I01M 3MN1A 4KYIB 1VZ2A 1ZCBA 3B1VA 3GRZA 4BS9A 2V7BA 3L1HA 5CURA 1CX9B 4Y67A 3GLIA 2H92A 5HNKA 1S3FA 2GEKA 5LOVA 3OJCA 3SYMA 1QRAA 1XCGB 5D86A 3TIIA 3FKSA 4AB1A 4EHKA 2Q4EA 1UL1X 4FC7A 5CA1A 4FBMA 4BLSA 2R62A 1V3UA 9LDBA 1S2OA 1PL7A 4KQFA 3OLQA 1C7FA 3EDRA 3HJCA 5CB4F 5K3OA 2QR2A 2HU7A 1WX1A 3HVUA 1A9PA 2WD8A 1P2GA 4N5IX 3TQQA 8ATCA 2CJFA 5C46F 2MSLA 4LOAA 4DQLA 3RJ5A 2PGIA 4H17A 1EJ2A 4G1CA 3PF9A 5FXMA 1DX4A 2II6A 3GR6A 2MSCB 4PQGA 2H06A 2Q3FA 4FZVA 5C0OE 3L84A 4S3MA 1H6BA 2Q5OA 3K0BA 2DH6A 1WV0A 4TYPA 4FNMA 4DMCA 5BO5A 3ABIA 1YD7A 3AR3A 4QEKA 3R9XB 5DBEX 1KOLA 4ZJPA 5I4BA 5M3BA 1QGDA 2I4MA 3NQ41 2H1RA 2OHIA 2PA3A 1YB4A 2ACVA 2VHXA 2GVZC 4O1MA 4R6WA 5AXBA 1EUDA 4B09A 4C3ZA 3U6BA 2XYQA 1EYZA 1OXXK 3SAJA 1E0DA 2QZJA 4UBKA 4XM1A 3I4CA 4NMHA 4B6JA 3CVWA 2I7DA 1JIJA 1FTSA 1TK3A 3H04A 4IL5A 5F5NA 2CHGA 5JY6A 4RU1A 4CEHA 2ZSHA 3DG9A 1Y4DE 3G8BA 4Z4IA 1Z2OX 5CLGA 1PN3A 2PL9A 1F2UB 4TSFD 5CM2Z 1I4LD 1WUIS 1ZK0A 1ZESA 3I05A 3DNPA 4LWZA 2CHUA 1OFVA 5JSZA 4GBED 1QIEA 2E9SA 1F5SA 1VBMA 2OO5C 1V0JA 2MMCA 2QMEA 5FI5A 2ZZKA 3MXOA 2Q4DA 3KYCA 3OU6A 1AKVA 2GESA 4LTDA 1SU7A 5FF9A 5ELXA 3C5WP 2YICA 3DGFC 1YHZA 4DNPA 2EX4A 1M5RA 1JGTA 3OC6A 3CJQA 2XQGA 3WRVA 3G68A 4J4TA 4WLFA 1VSUA 1G16A 4BVEA 4F56A 3CUVA 4XLTA 4R16A 2VZ9A 1XZFA 3DTNA 4WXRA 1WUYA 3Q5GA 2CE7A 3ZHYA 1FFBA 3U7IA 1V11A 3QX9A 4BB5A 4JI4B 1KVRA 3O91A 4PLGA 2PNJA 1CY8A 4R5MA 5F3WB 1WF6A 3HVJA 4V03A 1S4MA 1KL7A 2VFAA 5FWAA 4JELA 2ZRLA 3GN1A 4JB2A 4CIDA 4QTTB 1E77A 4EGAA 1P7ZA 1FU7A 1GFIA 1SVNA 1UPAA 2J9XB 1E9SA 2V55B 1Y5RA 2I99A 3AVQA 3CUTA 3H5IA 3IIIA 1WSAA 3MAAC 4OJNA 1OYYA 2JARA 4W5JA 4CDRA 5IZCC 3HYTA 3Q3EA 4H4CA 4LXGA 5EIBD 3MERA 1RQNA 3ZHRA 1NOJA 3AOGA 3IAS1 2G25A 4WZBB 3T7KA 1TF7A 1LSSA 1NF2A 3QRWA 1DUSA 1KMNA 1L5QA 2ZB7A 2FMFA 1OFGA 3CHYA 4UNQA 1F7VA 3ZN2A 4N6NA 2P4UA 2X5OA 5HF5A 1BA2A 1LVUA 1R0RE 2P8SA 3OF2A 3PL1A 3W1VA 2QLTA 4NP6A 3FTFA 2WWHA 4Y6QA 1GQRA 1QH9A 4CCSA 4F9GA 3V6LA 2FN9A 5IFLA 4XB2A 1OI7A 4TLBA 5DSXA 1LLFA 1NULA 3VC2A 1GA1A 2JRCA 2CC2A 1GGFA 4YJHB 3WIDA 5K45A 4NE9A 2BLNA 1GR0A 1S2NA 1MH1A 1I0ZA 4B46A 3IHWA 2Z83A 2DFNA 4EKYA 1QUEA 4H1TA 3O92A 2FEPA 1V96A 2YZGA 4I99A 4UFPA 4MV8A 1MXHA 1UKBA 1XQ6A 3M5DA 2RJ3A 1M1YE 3P1JA 4DOMA 2C99A 2EZ4A 4PFSA 5H80A 1I1NA 2DFTA 3ETGA 1E8MA 1X87A 3IP8A 5DZSA 4AUKA 2NAFA 4I5FA 4RYLA 4ZCMA 1Z6YA 1ZNQO 3ZWDA 1CZRA 1Z7GA 2G83A 2LGJA 4W9NC 3VPGA 5KUTA 1UEXC 2DQSA 4FFRA 2YWXA 4IOMA 5FUYA 4TZTA 3OA2A 3ORFA 2LTAA 3TB6A 3LAWA 3MJEA 3TOVA 2YZ2A 3B20A 4IDDA 1C1XA 1E1QA 1GZUA 3TINA 1FP4A 3AY6A 1KEZA 4JQSA 4GIBA 1EXNA 4WY8A 3P0IA 5BNZA 1RLMA 4C7MA 3LK7A 2Q62A 1E9FA 1UEJA 2D8MA 2X1MA 1N32B 4TKVA 2PRJA 4YROA 5K4GA 4AULA 5ALOA 2Z2IA 1H3FA 1GCOA 3E9MA 4HDQB 5AHWA 1H42A 2VOEA 3DO8A 4DUPA 1DX9A 5FHQA 3PA8A 4OAQA 3SYKA 3OE5A 3BIOA 4RQUA 1KK0A 2R2GA 3EQZA 3PC7A 5AJWA 2B4YA 5HKLA 3S8MA 4YIHA 5MGNA 3IE1A 4RWZA 1VFNA 2PSJA 2LV8A 3IXMA 2VNSA 4RE6A 2BJWA 3H2BA 2REXB 4JC5A 3PJFA 3I4FA 1MXFA 1XUOA 3MJRA 3E5HA 4ETIA 4CTMA 1KU6A 4DBVO 3RIMA 1CDOA 3A4TA 1S0UA 2VRWA 4Q15A 2NT4A 1DKMA 1T3TA 3ZBTA 4BUZA 3STTA 5LZ5A 3I2KA 2XUJA 5AM4A 2PXCA 1WOYA 3AEYA 3N8HA 5D7BA 4L08A 4ZMSA 5DHTA 2E1RA 3VR4D 4NEQA 4UM7A 3D4OA 4FSXA 3MWDB 1E3JA 3P9IA 3H5NA 3BICA 3PEEA 4R40A 5TY0A 5JAZA 2RC6A 4Z1MD 1B2LA 3AIMA 2Q3LA 1BE6A 2XECA 3LKVA 4GKBA 4IKPA 2WI8A 5FUVA 1G3QA 3QELA 4K6GA 1V47A 3EXG2 4YFVA 5DHUA 3UH0A 4BRUA 4GLLA 3WGGA 4EA6A 4MQEB 1O54A 4ISBA 3R3UA 1KYQA 4KPGA 4WZ6A 4R3WA 4TXMA 1R9GA 1XCMA 5BN4B 2PD3A 2WYUA 2Y9PB 2Z98A 3KVOA 4L5IA 3ZGNA 5JYBA 3IO3A 2XD4A 2OOKA 2FUG1 3VO2A 3P2MA 2BDEA 4W7HA 3EFOA 1B0UA 2B6NA 4FHEA 4YR9A 3QU2A 2PGNA 2C2KA 4PCAA 1KEWA 2C88A 3BEDA 2GBLC 4ENUA 3J81A 3HH8A 3GFVA 3KT3A 3ZK8A 4QLOA 5LDHA 3CTPA 1OE0A 2FQWA 4GW3A 1XMQB 3HU1A 1HOXA 1O0SA 1T5HX 2C9CA 2HJHA 2OBFA 4M0PA 2QTHA 2JKVA 3AQ4A 1DQNA 2UXDB 3NKFA 1JWBB 1J1UA 3I2HA 3N2KB 4XQ9A 5DBHX 1TAQA 1WV1A 2FPPB 2H0RA 1X7YA 4M89A 5I7WA 4MS4B 3WLHA 4YRIA 1RYHA 1L1FA 4B1FA 2H31A 5GIPE 5F9FA 2FFRA 1E9RA 5HKKA 1H22A 5TF4A 3B6KA 3OZDA 4HQRA 2ATIA 1KY5A 2Q28A 3QV1A 1W94A 4PS1A 1JEDA 1H6DA 3B3JA 2CZCA 1OX4A 3G9QA 1GPBA 3UJ6A 4ZAZA 3ADOA 4EF4A 1U9IA 1W4CA 2P0EA 3HJFA 2J3IA 4LECA 2BSQA 3BIJA 3COPA 1Q0PA 1NNUA 2GBFA 4LGVA 3PQ7A 4E7PA 1JHQA 5JFTA 4ZDJA 3GJZA 4ZYYA 1XVIA 3EQ6A 4BIMA 1Z3CA 5B30A 1QGZA 2HIMA 2I1QA 3D4NA 4JYBA 3WZ2A 3T9DA 2B3TA 3RV4A 4QC2A 1V95A 2O6HA 4C4XA 5KWJA 2AYZA 4PFQA 3VPBA 2PQ2A 4TKUA 4LZWA 2WPDA 1XRQA 2ZYRA 1ESZA 2QEQA 3DW1X 5CG2A 1SQGA 4RTOA 3KX2A 4AY4A 5FEUA 1VMIA 1ZVJA 2CXOA 2DWCA 1VG8A 1Q0ZA 3QJGA 4ZVKA 1EZZA 2JBAA 1QAOA 3T3PB 3FVRA 3UT5A 4A6XA 3I12A 5JNLA 1O0CA 1OXMA 2FPLA 2IYNA 3SHQA 1L4GA 2HBZA 4FT2A 3BFXA 5JG7A 1JH9A 3I34X 3DMNA 2D5IA 1KYXA 2C4VA 2W2OA 3KHUA 4L4SA 2EGUA 4PRKA 2DY1A 2TS1A 2XX3A 2OHHA 4RY2A 2XLBA 5LP6F 1P1HA 5LPNA 4ONEA 1E2FA 3UCEA 2Q4RA 3DPSA 2WJIA 3JD0A 3C3EA 3FGOA 3OX3A 1YFLA 1FDSA 3GFPA 1QONA 2EJCA 2EZUA 3SJZA 3F3MA 3K2IA 3NW9A 4L3WA 4W63A 4YDSA 3OOJA 3LECA 1RRFA 1BDIA 1E96A 4KMRA 3RC3A 1M8KA 4EMTA 2XUQA 3IAM1 4BN0A 2BR3A 4MCJA 4R2HA 2E6KA 3KETA 2ECOA 2X9GA 3EWNA 4L73A 1JFLA 4BO3A 5EP4A 3CSDA 2GN2A 3PGKA 2F8SA 1XFDA 1S8FA 1O08A 5J9FA 5HP4A 2V8BA 3DTYA 1SELA 3BGIA 3ISJA 4QNNA 3K0HA 1GU1A 4L78A 3WAKA 4AKSA 1J42A 5JTTA 1YB1A 4AXBA 1TF5A 5GOTA 1KVQA 1T0IA 4R2IA 2J3HA 5FI3A 4FDAA 1DJOA 3ONNA 2O2CA 3VZQA 1QQBA 3ZJUA 1PGPA 1S8OA 4QOFA 1Z73A 2OA0A 2HQOA 1QK3A 3FSGD 3BK1A 4JWKA 5EWMA 1NXWA 1N6KA 1W44A 2RHDA 2XVZA 3CLTC 4HAZA 4XWAA 5DXJA 3SC3A 1PFVA 1FW8A 2FX2A 2ZTMA 2IHBA 2IXEA 4P1ZA 4EX6A 1RHQA 3N8GA 4H9GA 3TL2A 1Y7TA 2QJTA 1C8KA 1T2AA 2GZ3A 2XCLA 1N5JA 2ZJYA 1GUZA 1N9GB 4TTRA 2Q49A 3UG7A 3ZI0A 2EKLA 2BF7A 4ZZ1A 2IY7A 1G5HA 1QQ7A 3KE8A 3PWKA 4FS3A 4JKIA 2XBMA 3EZNA 1Q22A 3MNFA 1E7QA 4DRYA 3WC4A 2IOYA 2YL2A 3Q7PA 4MRMA 1MB4A 4XD7A 3UMRA 3U4HA 1GG8A 4Q34A 4JXXA 3O31A 4LC0A 2KHZA 3MTBA 4WCDA 2JI4A 4F8JA 3OIGA 2O7SA 2OBYA 4Z9FA 5I4CA 1OGIA 4O25A 1EX6A 1O5OA 2REBA 3TIFA 5I7UA 3QE2A 1UIMA 4KFTA 4KK3A 1E61A 3U2QA 3KSUA 2FFQA 4Y9SA 5IULC 4FYWA 1Y6GA 1G38A 1X19A 1DWOA 3EC2A 2WP0A 1DOAA 1ZD9A 4M0MA 3QE4A 3VYUB 4UZFA 1CUZA 1G98A 1ESNA 3EQ9A 4N8EA 4RPIA 4LF4B 4D45A 2EXXA 2KJQA 4BPBA 3HB7A 2JZCA 4E21A 1PNVA 4FLEA 3F5DA 2A1IA 2QGFA 4NZYA 5ELMA 2CDAA 4KEAA 1JG4A 4B7XA 1YS6A 5IC5A 2B8JA 4A0FA 5JI3E 4WFIA 3CVVA 1OBVA 2JVJA 4HX5A 5F4BA 1J2UA 4HAWA 4WDQA 4Z86A 3T1VA 1JHYA 2RIRA 2PPLA 4LQLA 1PR3A 2VPYA 2B30A 4KHZA 4KREA 3UK7A 4DQDA 2BFNA 4IO0A 3DL0A 4CF6A 2C8LA 2G06A 2IPLA 4L3OA 3ICQB 1ZUNB 2ONCA 4G0NA 3IV6A 3ZS9A 4AJPA 4MW5A 4YT5A 1ZAYA 1JA0A 1HMYA 3JYHA 3N28A 4PRYA 1A9TA 1H4VB 3CF0A 3ZH9B 5KYNA 1QGAA 2B20A 3B53X 4GAEA 1Z82A 2V6GA 4LZLA 1OFTA 4J0HA 5EMLA 3ZHCA 3FPGA 1QP4A 1W35A 1FS5A 3G49A 1CUCA 2C58A 2PZGA 3EARA 3MWGA 5H3LA 3TN7A 3GOQA 1CWUA 3SOPA 4OVKA 3UXHA 2XSZA 1NATA 1V71A 3SXUB 3PLRA 1USUA 1A04A 2E4UA 3MRXA 4P2BA 1VP3A 1FIUA 3I6MA 2E21A 2LNDA 4QGBA 1H2YA 4V0ME 1TM5E 5A06A 4HAUA 1GVNB 3M81A 5ABPA 4S05A 1P1BA 2A5DA 4L07A 2O2DA 3ANSA 4PZYA 4Q93A 2NYVA 2VWHA 1U7HA 1NE2A 4MUBA 1KI3A 1TC1A 4CW7A 1WS6A 1XZMA 3JZIA 1R0WA 3BXEA 4NU0A 4TMKA 4DR1B 1DKUA 4HJRA 1WXFA 3IOEA 4WFJA 2V97A 4LHZA 3SX0A 3HN2A 3K9FC 3M3HA 2BL4A 2CDRA 5KVQA 2BP7A 2PJUA 1FVHA 3ILSA 3JQ8B 1DAEA 5CAEA 5INTA 1WZCA 5C7YA 3L0ZA 2PGLA 4I6GA 1U2GC 2I8LA 4MGEA 1Y3AA 5GJVC 3OUZA 1IHUA 3N8KA 4E13A 3GEGA 3HWRA 4LRTB 1PWEA 1SU8A 2G82A 4F11A 4F2WA 2YC4C 4BZPA 4QGSA 4CIAA 4YREA 2PJZA 5FUXA 1X7XA 3HGTA 4PVCA 1WLYA 5AW1A 2W5UA 1UBSB 3WHLA 3IQWA 4G56A 4AZ3B 4RE5A 1Y8RB 3DVAA 1BXRB 3AHFA 4EW2A 2I4LA 3HVRA 3GUYA 3JWEA 2FEMA 3IQXA 4MIEA 2ZM6B 4B3SB 1XA4A 2C5BA 1Z28A 3LXUX 1XVLA 2J6IA 3QVTA 2G67A 3PVCA 4ZI5A 5REQB 2H2AA 4F2PA 2UZ3A 3D8RA 3R76A 3E7PA 2VDVE 3TZQA 2GZHA 5EJ6A 1KBOA 4GEKA 1CV2A 2WAYA 1QV7A 1I3LA 4ZRDA 1YS1X 2JIQA 1GGKA 5EIAA 3S5JA 4P4GA 4IQGA 2VBFA 1BFKA 2IKQA 4NCKA 2DLDA 5KTPA 1FL9A 1E1NA 3Q41A 1H9CA 1GPDG 3GJXC 4UUAA 4V0RA 2AI3A 4V0OA 4DR2B 5LBIA 2JI8A 2VPZA 3C6ZA 4FFNA 1J7JA 2XMZA 4L51A 3LYUA 2CF5A 4Y1EA 2YOGA 3NEAA 3F5QA 1SQ5A 4TZ6A 1NUTA 5D3KA 3NTXA 1WMEA 5HZKA 3NC0C 5HS6A 3Q9UA 2IYFA 1JF8A 3MQFA 4BGDA 3PPXA 3JRNA 5ARCA 1RFLA 2OQRA 3FPCA 1P1IA 2W6ID 3NETA 4LWOA 3PHIA 3Q8WA 4RIEA 3U44B 4M0EA 1PLJA 1VDMA 1QO9A 1K4KA 2NIPA 2XUDA 4MWDA 4BO1A 2X77A 2F7SA 2FMUA 1ZIXA 2H65A 1Q7CA 4L74A 3LQQA 5K0CA 1NQ5A 3GFRA 1U7DA 2PSDA 3UMGA 4HYTA 5G02A 3A4MA 3KEGA 4A2QA 2RSLA 2HRDA 5CA0A 4IX1A 1H2HA 4YFYA 5FIUA 3UOAB 4CKWA 3AVXA 1VTKA 3K70B 2GAIA 2NQTA 3EFEA 3FPBA 4RKWA 1NNI1 3SN6A 1UKEA 4JVLA 3BL6A 3VJMA 1CQWA 5TDHA 4KR9A 1NSFA 1IN4A 4NICA 4DYDA 3L8GA 1B74A 3OEHA 5C1IA 4WKGA 4CKYA 4HDNA 4J0EA 1EHIA 3G5UA 3GDOA 2P68A 2OCGA 2P5TB 3TBHA 2L42A 1J2JA 1YKFA 2V7TA 2XNJA 4G4IA 4K0RA 4XKJA 4KTTE 4Y9UA 3SM9A 3DOEA 4DDVA 2PRZA 2CFIA 4ZHQA 4DBLC 1IG3A 3SJUA 3PNYA 4UTRA 2O8BB 4NZNA 1ZRHA 4M8IA 3UENA 5BN3B 1YZLA 3IBGA 4YQYA 3M4JA 4QO8A 2BYTA 2BGKA 1KXJA 5CK5A 3GHYA 5DOVA 4D3ZA 1G5RA 3AR2A 5K0TA 2YMPA 1KZHA 3BBLA 3VTKA 2QRMA 3N2ZB 1QIHA 4D1YA 4UCXA 2NXJA 1X1SA 1Z2NX 2D0DA 2DPMA 1AV7A 2CBGA 3M6WA 4LBZA 3IAHA 1CJUC 2QRGA 3WRXA 1IY2A 1U0HC 1QOZA 2D2EA 4HBGA 5P8WA 5K7SA 2X13A 2BUBA 4EPVA 1RIIA 4HLUA 1TF2A 1XU9A 5TS2A 4POOA 3AL0C 1SUDA 1VRVA 2C0QA 1QHGA 3BL8A 2O3QA 4IIJA 4BP8A 1XDWA 1ES9A 1Z8HA 2JGFA 2WJAA 1KSHA 5JLAA 2UYOA 4XVCA 5JR3A 4EKDA 4KAFA 2PLFA 4DBZA 2C92A 1NKVA 2X19A 1OB5A 5HDBB 4OLAA 1V1MA 1CUBA 4HS4A 5IHXA 4D0GA 1E58A 5DTEA 1L5HB 4GVLA 1JYSA 2XOKA 2F3SA 2JHGA 1TO6A 5GONF 1DINA 2B0CA 3K1YA 4ZV4A 5BQFA 4QJ3A 2VH5R 5HTOA 3MUFA 3H84A 1B8VA 2Q46A 3ONEA 4Z1OA 5JT1A 1H05A 3E03A 1NU6A 4UNRA 1Q3HA 2XGOA 3REQA 3LXRA 4US2R 1AMNA 2VAVA 4MW6A 3DQQA 3G2KA 3LE8A 4D9NA 4DSNA 4LJKA 3CO0S 1QH1A 1JFRA 4G37A 3ER8A 4AMBA 1SKAA 5BQ3A 1II8A 4O1HA 2ZPUA 4IKOA 5EZ6B 4MO2A 3UUEA 4O4JA 3WL4A 3HDYA 5GV7A 1E6UA 3WSWA 4NRDA 2AG1A 5CVTA 4TYYA 2UYGA 2X58A 121PA 1VMDA 1WIWA 4KWHA 3F71A 1RPAA 4PNEA 1MO6A 5K0GA 5DNDA 2ODWA 2H1FA 3DUWA 3ETEA 2YJ3A 3RFXA 3RTGA 5EJ5A 3GPLA 2F4NA 4DV5B 3WNQA 3AX6A 5BR1A 2NO5A 1X9GA 1U28C 4OHXA 4PXSA 3NC1C 4MEAA 4X1IB 4Y2VA 1N6PA 4CQLB 2VP0A 1EK2A 2QM3A 3OM8A 1AK9A 4JB0A 4BGIA 3FR7A 5CT6A 3H13A 4OBBA 5D5QA 4US1R 5LMCA 1S7GA 3C1UA 5DIZA 2F55A 1Y9ZA 3H3FA 2I3DA 4M9XA 2QD4A 2PLWA 4WXPA 2A6PA 4LJ4A 1U5CA 4CL8A 4B2YA 2DTXA 2GVNA 3T94A 1W88B 4C05A 4XDGA 5C32A 1U4SA 3L05A 2KBFA 2JFFA 4L8LA 4AI6A 2R6GA 2VT6A 4I8IA 4FFOA 2BGIA 2DPLA 4UHEA 3LGSA 1Y42X 1N5MA 3CBGA 2JGLA 3D8SA 4JWTA 4QULA 3V8QA 3KALA 1W46A 5JAIA 4N18A 1QO0A 4LCJA 3U17A 1ZUIA 3I9NA 1VYHA 3LCCA 1YDGA 2VYFA 3Q6IA 5SICE 3VPHA 3W6NA 2XNKA 5ALFA 3TZLA 3PIDA 4PYRA 3VNRA 5DRTA 2OXRA 3G1TA 4ENQA 1KYTA 1HE8B 2ADOA 1FMLA 1W9MA 3KPJA 3NYWA 3H65A 4KLAA 1CKEA 2X4LA 4FFDA 4D3FA 4LF9B 4FR2A 3E3OA 2LCFA 4GU5A 1D2EA 1ZPDA 3CRZA 4X84A 4S1PA 4RSRA 4Z0TA 1E7WA 3PDWA 4OQ4A 4DV3B 2HCBA 4TLAA 4H7KA 4RESA 5K6AA 2CD7A 4CG3A 3KQUA 3IP1A 1Z63A 3ZQ6A 3OTOB 1PSDA 2Q1XA 4O4LB 3T8YA 1L6IA 3AMVA 4TTPA 4F3CA 2DETA 3MWFA 4KXFB 5HG0A 4OYYA 5DNUA 1XVVA 2B7BA 1PIWA 2QAIA 2OSBA 2VZ0A 1HEIA 3PCXA 3T3IA 4BNIA 2HR1A 1SVOA 5BN5B 2FSVC 3G0OA 5ICFA 5JWRA 4CQJA 3GFOA 3PRYA 4AY6A 1MNAA 4BYGA 3WRYC 1DP4A 4H4EA 1Z4JA 3ZE2B 2VHJA 2IYTA 3G8AA 4E08A 1JFVA 3CB2A 1P62B 4L3VA 5D3MA 2GSDA 3R7AA 1YQGA 2B1JA 4IVRA 4OHYA 2J3MA 5ICSA 3IFSA 5A3QA 1CF2O 4BZXA 4MMZB 2OXTA 3HYRA 4HO1X 1JA1A 1YFKA 1GAEO 4AJIA 4CUZA 4DMGA 4ZIRA 5CB8A 1S9DA 3SMVA 3I73A 3NR2A 1W36B 3AM3A 1UMKA 4N7MA 3AEUB 4XYMA 1VE1A 2ZR9A 3C14C 3BMNB 3BG5A 3D7MA 3OQIB 1XJWA 4PYMA 4Y8VA 1AS3A 5FOTA 2FMHA 2GAJA 1RXWA 2E5LB 3CLRC 3NEJA 2JJ1D 1QRDA 1R1DA 1FFYA 2WQ6A 2BONA 2OLKA 3OWXA 2JAWA 4IUDS 5K0FA 2AKYA 3E84A 1XLTA 5BSKA 4MVJA 1DAMA 2PJDA 2Q0XA 5JMPA 7REQA 4XXHA 1B2RA 1WDWB 3DZDA 3RASA 4HQOA 1MX5A 2WICA 3RSGA 2H3HA 1SRRA 3E70C 3ADCA 2VNHA 1Z36A 1W34A 4OHVA 4YUVA 1PFKA 3OESA 4CODB 3B78A 4HDMB 3ROEA 4NBVA 1Q7TA 1EDDA 3KJEA 1ZH6A 1FDUA 4ITRC 5DCWA 5HBGA 2WYVA 4GPAA 5HIJA 3EBOA 3IKMB 4GM0A 1FSZA 3RUCA 1UBEA 3LRTA 2OL4A 1EWRA 4D4MA 4EB3A 5JECA 1QHFA 2UZ4A 2QQGA 2Y6UA 4P4TA 1MLDA 3BMCA 6ABPA 2FFBA 4ZT5A 4S35A 3RT9A 4OQMA 1GLGA 3GEHA 4NECA 3R7SA 1F4VA 1ZW1A 2P78A 3IURA 5HBRA 2CFOA 3G0GA 2Y9MB 2EG5A 2ZJ3A 3UMVA 1BH6A 5CXQA 3G6WA 3VYRB 2FZ5A 1UFQA 2HXSA 4BQNA 5KC9A 2C77A 3KYJB 4LDQA 1ZSVA 3OHPA 5P21A 5JD5A 3RB8A 4Q1FA 3OQJA 5E2IA 4DABA 4YV1A 3FZEA 3I8XA 4LYJA 3VHLB 5IKEA 8OHMA 4JBIA 3E53A 2XI4A 2NOAA 3K1TA 4ER6A 3RBXA 3FKSD 4HX2A 4G0QA 4HYQA 4MULA 4Q4LA 4M0LA 3LC2O 1PYGA 1V2GA 1DCMA 2V9PA 5FA5A 3IQHX 3URMA 1XZHA 2OHVA 1FBNA 3NOQA 4CETA 1OVMA 2IYAA 4PHHA 4YMIA 5C5DA 4X6YA 4GVXA 1XZDA 3SLKA 1QNFA 3P9KA 5HS4A 4XX0A 2BHSA 3TIGA 3QLUC 5KOHB 2R6JA 4K87A 4QOSA 1T35A 4GOND 2BHRA 3RYFA 1QRRA 1UCFA 4HFMA 4XR4A 2AB0A 2IEAA 3D0RA 1U2ZA 5K2MA 2V3CC 4D4KA 1FDOA 1LNSA 4BVLA 1Z8DA 3Q10A 3TLEA 1T10A 3Q72A 4L4ZA 4OEHA 5JSFA 3DBRA 3F8WA 3PHLA 5DBGA 4IDNA 2WKWA 2W93A 3EXEA 1Z6XA 2FZ4A 4MIKA 1N78A 2IXFA 2RBGA 4P5PA 4X5OA 4CEJB 1QVZA 4BECA 1T13A 3W78A 2C8VA 3PX3A 2RG1A 4D9CA 3WLOA 3MELA 5LL6P 5KX5A 1YU9A 2AKAB 2J4CA 2VSOA 4GSLA 3LQFA 4DLUA 4MP3A 3UY4A 4CKZA 1CY1A 3TBFA 3L8HA 2GXUA 1PUJA 1NYTA 1ILEA 2FP3A 4HGZA 2R6HA 1AKQA 4HGPA 4IINA 3AF5A 2ZSJA 1IM8A 2B82A 3PDIB 4MHSA 3IVXA 1DS6A 2NUTB 4W5TA 1ZN2A 4U5QA 1V7PC 4YDRA 5ALSA 1PBTA 5E8JA 2CXRA 4YGYA 3SZRA 1DVRA 3VUFA 2F8TA 4TV8A 1NZFA 3FD8A 2CLSA 1B23P 1X1AA 1PQUA 4RTMA 3ANMA 4DIEA 3L4EA 1L4NA 2OCKA 2Q3JA 1WE2A 1UZMA 2NSDA 2WK1A 3HA7A 3LWNA 2WF7A 4PM4A 3LW8A 2F00A 3MJDA 1EDOA 2GEVA 2HXGA 1NRWA 2IXAA 3OPNA 4LJ5A 4PVDA 4X45A 1CFZA 4WKNA 3V8EA 1CD5A 3W1EA 4DIDA 5CG1A 3BE6A 3IQDB 2XXBA 3ET5A 1MD9A 1LSOA 4OGLA 5EIHA 2ISQA 5AW5A 1ZKMA 2X14A 3ADDA 2W4MA 4X3PA 1KVTA 4ZCQA 3SJBA 3D3QA 3W1WA 4KFCA 1KJNA 3HB9A 5D1NA 3AFGA 5TR9A 3DE7X 4B48A 1XRPA 4R2JA 3W6OA 3OZTA 3UAOA 2R7LA 3PTZA 1QLWA 2ASEA 1QCCA 4HAVA 3EF1A 3U3ZA 4KNYA 3CUSA 3DAFA 3BJEA 2B8EA 3CGGA 2WB4A 1Z0SA 2R7NA 2VJNA 1XJCA 5DNCA 2A88A 1GU7A 4QUDA 2QRZA 1ELOA 6REQB 3DVLA 1S9HA 1F9EA 2H4HA 1U2DA 4U6NA 1PL8A 3GROA 3K20A 2GF9A 3O82A 3W9SA 3MAJA 4AWAA 4NYMR 1P2VA 3RK4A 3RW9A 3VHRA 1LBTA 2E4ZA 2H51A 4DXAA 5HXAA 2PYIA 1NJ2A 5KVCA 4KLZA 1GIAA 1KYWA 2HX1A 2WDPA 3RVMA 4FI3C 4HWPA 3L79A 1HG0A 1POXA 4FMCB 4LMAA 1BDHA 1XRSB 4F3KA 4YAEA 2GB4A 1WNTA 1A4RA 1DBSA 4OATA 4TTSA 4CTOA 4HWGA 4C78A 5JARA 1DEXA 4LY3A 5IDWA 4RPGA 2UUPA 1ETHA 1ONPA 2C4UA 3QPDA 4TUYB 4URZR 5FTKA 2R1TA 4U0JA 1NVGA 1TMOA 3EWAA 2FWIA 3G2MA 5LVAA 3WK6A 2BMEA 2NAPA 3COYA 3MWKA 1RAAA 2AOWA 2XTNA 5IEBA 4UOZA 2AQHA 1IBMB 1YE8A 3GGPA 4BYMA 3TJRA 4YIKA 2XUKA 1UJ4A 1VCHA 2O2HA 3PXAA 4MZDA 1WZNA 2WAAA 3TMAA 5KSZA 2O8FA 2FQ1A 1E1QD 1JLKA 1OSNA 5E3JA 3KPUA 2OBLA 4B7CA 1BVYF 5KNBH 4G9BA 1DO0A 5TS3A 1R4NA 2AV6A 1A27A 3RHZA 2XXJA 4WJLA 1ZHFA 1BS2A 1J21A 2CD9A 2H1LA 5COBA 3PFNA 4Q1EA 3FDZB 4NKRA 1M67A 2Z30A 2PQ0A 1RI4A 3DMFA 2P0AA 3NBMA 4MWCA 4UVIA 2IV2X 4D98A 3C15C 2GM4A 4QJBA 5AKKA 4BTEA 1BGWA 1QP0A 3ENKA 1J4AA 5KYKA 3L01A 1N25A 3TZ6A 1CSEE 5LKAA 3NAGA 1DJNA 4EFLA 1TPYA 4UDYX 4GECA 5KOYA 2XGSA 5KSPA 1L5YA 1RXEA 3I04M 3QY9A 1P5JA 4Z5XA 2CWWA 2SKDA 3GH3A 1SWWA 1XL1A 3M9XA 4ZO4A 3TW8B 1WP4A 2X5XA 3EGDA 3MTGA 4HATA 1AQJA 4YRGA 2FRDA 3W77A 3ZE6A 5LMUB 4JCOA 3BBPA 1DLIA 1R4ZA 1XB2A 5CH5A 4B6QA 3T52A 5KAPA 4BBPA 9LDTA 1U04A 3GLGA 2PMCA 3V55A 3T4EA 4TGLA 4BOYA 4HZIA 1D0IA 1J23A 2CMKA 1G6HA 1HE2A 4LDPA 3FFWA 4C03A 5ILQA 4HPXB 2AFIA 3HKCB 3SIXA 2X0JA 1X80A 1X7DA 2RH4A 1JSRA 2Y1FA 3KHTA 4RV5A 1T25A 1BWPA 1J97A 3U56A 4TMFA 1GZ5A 1LW6E 3SR4A 2H5IA 4IEFB 2G0NA 2H16A 4AF6A 4IV5A 1YUBA 4K40A 4P98A 5THXA 6PFKA 4DAOA 1HKUA 7ADHA 4X95A 1I51A 2HJWA 1ARZA 3SEFA 5CCBA 4LXUA 1C3OB 3EZGA 5H16A 2C57A 4G1EB 2Y0BA 2XMRA 2FDXA 3VPFA 5HZGA 3SG0A 1BVRA 4WPGA 3Q12A 4XJTA 2JGIA 2BE7A 3JD3A 3KWFA 1RAHA 4HXFB 2WZDA 1HQKA 3PRKE 1YB5A 1IZ9A 4NAVA 3W3ZB 5U9CA 1HV8A 1PJLA 4XGIA 4CHGA 3WYEA 2VTKA 3WL7A 2AJ8A 3GGGA 1L4UA 2W2XA 2NUPA 4AJKA 4YVFA 4B79A 1BKYA 4E1AA 1L4YA 3PXEA 5ALYA 3DMDA 1SUAA 2A3NA 2XOXA 4W9NA 2XH8A 3QVGA 5HKKD 2MMGA 5IM4A 5CUQA 1QHNA 1D2CA 2ZIWB 4O0MA 1QU3A 3PEVA 4EL0A 4FSDA 5IASA 3KDPA 3WGNA 1NUPA 4GKAA 4WESB 5DX8A 3NI2A 5JD6A 2I54A 1NV9A 5JQWA 3SZMA 1FMTA 1YJCA 2HLPA 2X41A 4CQMB 5HJ7A 4RTKA 4RIFA 2QTVA 4AMZA 2RI6A 4QHYA 2E49A 4BRZA 1CYDA 2ZVDA 3H9UA 2GHIA 4IOKA 1XROA 1WOMA 3TLGA 3L9WA 2PMDA 3Q3GE 2P65A 2V3VA 3Q9LA 3CX3A 2B4AA 2VYCA 4DW8A 3GFBA 5BY2A 5EUBA 1PCXA 2FW6A 3AGQA 4RD4A 3NRBA 1ISIA 5CPFA 2JJMA 4CF5A 1S89A 2YHIA 5J43A 2WPDD 4FOOA 1U7XA 3H17A 4GGMX 4RQAA 5J23A 1KQOA 1SC3A 3I28A 4KWTA 4IIEA 5F35A 3VNUA 1NLUA 3KTDA 2ZCJA 3M6LA 2F9MA 3KE9A 3M6UA 3NHUA 4KN5A 3R0XA 4XIYA 4YAJA 5LBTA 1OBFO 5T6MA 5IVHA 1RXSA 4D5GA 2ZS7A 3VVLA 1SG0A 3CR8A 2Q6KA 1QWOA 2HSWA 2XWSA 3QYFA 3NJ8A 2CCJA 1NMSA 4JD5A 3LBNA 3A9SA 1RMQA 3TI7A 4AQ7A 1QC5A 2NMVA 3ZDRA 3IRUA 5EZYB 4BNYA 3D54D 1FUYB 2C4HA 1ZMOA 3L1JA 4KXYA 2BFBA 5JROA 3EQ7A 1OXTA 4YEDA 1Q91A 4ND7A 3AJDA 1XWIA 5C1OA 1G21B 1AJEA 3OTIA 1ORWA 1IDN1 3O3CA 2P9JA 2A67A 1KYZA 3R6TA 4G1FA 2IDMA 2OILA 1MO3A 3DHYA 3NG1A 5JZMA 2Q6OA 4K28A 3C3YA 4ARUA 4DUGA 4MYCA 1JKJB 1G42A 4DR4B 3CVOA 3D3WA 2B35A 2EW1A 3VTZA 2Q2NA 2ZYVX 1T9KA 1O9GA 3L4SO 4WOBA 1NJ5A 3C24A 1QQ6A 1YCFA 1F6DA 3KD2A 1T8TA 3ID6C 4R1LA 5HFJA 3ASZA 1PAUA 2ERYA 4PINA 3F9CA 3GBSA 3PLNA 5DTMA 4WINA 3HBFA 1OFHA 1ENOA 3FMIA 4IGIA 4JVMA 2VPPA 4PIMA 1VPVA 3RS0A 3RC1A 2QXTA 3HJUA 2R8RA 4P58A 1RLUA 4DSAA 3WMEA 2FZCA 3HP1A 3NATA 1TD1A 5HGJA 4B7AA 5T64A 1NQWA 2ZK7A 2H48A 4GP7A 1E6MA 5AI0A 3NYIA 1YR6A 4QYWA 2RFLA 5CYFA 2AXNA 3WYFA 3GLHB 4B2IA 1QLHA 2FZEA 4MYTA 4DLTA 2I3AA 4U9HS 4YASA 2VXBA 2P27A 5HQJA 2JGJA 4HV4A 3ML1A 4P08A 4JBYA 5HR5A 1WW3A 2XWPA 1TECE 1YMQA 3A7DA 4TLDA 4XD7D 5CDFA 1S2DA 3EIQA 4OJMX 2HFJA 2RK3A 3ZLBA 2X6RA 1ESDA 5LIPA 5ER9A 2ILVA 2C2MA 3FUUA 4I55A 2WWYA 4KDRA 2C2XA 3SQXA 2EG9A 4URFA 1SUFA 1PYOA 4I9FA 4AYTA 1F4PA 2BKEA 3QEJA 2A1TS 1H0KA 3S0JA 3T34A 4OTZA 4UUNA 1KOGA 2CLCX 4PPGA 4D97A 3BX1A 2CXUA 1TPZA 2LKCA 3RHSA 3ZHSA 4YJFA 1NQOA 3T12A 4M37A 4AKTA 3UUFA 3F96A 1I4DD 3KAKA 3L82B 4JGIA 2GKSA 3QGMA 5KYVA 1VECA 4BMPB 1UK6A 3O9MA 1ESEA 2GK6A 3OOSA 3KV1A 4I6EA 5ICEA 1TA4A 2PGXA 5CVVA 5KQSA 4OX9B 3HLYA 3D4IA 2ZPTX 2ZIFA 3I01A 3KAPA 3NVAA 4IG9A 5HJ2A 1K7CA 1Z5ZA 1ZH0A 2EJVA 3KB2A 3LO8A 4C4ZA 3E35A 4Q3AA 1W59A 5DEIA 4GG1A 3AR7A 3WGMA 2GBIA 3R77A 3SF0A 2Z6VA 4CKEB 4OFBA 5GJWC 1WU7A 3B5JA 3G59A 4PQYA 4G2TA 4BNKA 4BRSA 4MUKA 4C0LA 4JDUA 4OK6A 3H9QA 3PFKA 1BIFA 4B4VA 1N7HA 3VDMA 3RU2A 1F4LA 3NGXA 5F1PA 5EIFA 4I2NA 1YDMA 2P35A 5F78A 3A1SA 4ND3A 4DTCA 3OZUA 4ND8B 4DNOA 1YIDA 3RCBA 4Q9NA 4EYQA 5KYXB 1U0JA 2EHDA 5K0BA 3D5TA 1C50A 3DEHA 4C3OB 2B1GA 1G4AE 2XSZD 1RWKA 2FPRA 4IMPA 2FUCA 3FBGA 4LHSA 5TEVA 2PZ8A 1ZONA 2JAUA 3N3BC 4LSWA 2FZWA 4CVNA 2ORYA 3FJYA 2HHAA 3FPSA 4HWSA 3FBWA 1S3GA 5LP6C 2QTMA 2OXEA 4IR7A 2ONZA 1Z74A 4PW0A 4CLOA 1JLLA 1QYIA 1YMVA 3D3KA 3PVZA 5B3KA 5J2TB 2BD0A 2QT0A 4UAJA 1FW6A 2DSTA 1YQXA 1EPUA 1GKKA 3MRVA 2DCUA 3VOAA 3P9ZA 1CJSA 3GZJA 1ZNWA 1UDWA 3IV9A 1AU9A 4FBLA 4IYJA 3LUBA 4U0KA 5AK4A 3RK0A 3W0LB 1ZVVA 1VJTA 1YBMA 2YXPX 2QPAA 3JAWB 2I8CA 4GF5A 3PXXA 4KWEA 3RS3A 2BZ0A 1SHUX 5BQOA 1MAUA 1T3GA 3LA8A 2IY8A 3AI2A 4A6EA 4FDVA 2GYYA 2WVGA 1XEFA 4RKFA 1Y7HA 4PPQA 1ZM9A 2WKRA 3GLTA 3K5HA 5G0WA 3GEIA 4QBGB 1L7OA 1SOVA 5FL3A 1DAPA 3EZFA 4TRNA 1OZHA 5TGDA 2VHTA 3GRVA 4AWBA 1NFFA 1IN1A 1M2JA 3GRAA 1P9RA 1FNMA 3N53A 5ESWA