1Q14A

Structure and autoregulation of the yeast hst2 homolog of sir2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
318
structure length
289
Chain Sequence
b'GMASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTAQKEQLLEIVHDLEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HST2 protein
molecule tags Hydrolase
source organism Saccharomyces cerevisiae
publication title Structure and autoregulation of the Yeast Hst2 homolog of Sir2
pubmed doi rcsb
total genus 91
structure length 289
sequence length 318
ec nomenclature
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 1q14A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1q14A01
4K9KA 4V1CB 4GM4A 5MF6A 2JI7A 2Q27A 2BRUC 2PGNA 3PDHA 3EYAA 3K35A 4K9OA 3GLRA 4C78A 4TWJA 2VJYA 4BV2A 1Q17A 4J1TC 4JUAA 4K9LA 2UZ1A 2X7JA 1PVDA 2VK1A 4K9MA 4K9QA 4G1CA 5EJ8A 2FR8C 1M2HA 1PO7A 1YTLA 4J16C 1M2GA 1UPAA 2AG0A 4K9PA 1PNOA 4K9NA 4Y6QA 1Q1AA 1ICIA 1D4OA 3EA4A 3GLTA 2B4YA 2Q5LA 3D7KA 1YNOA 2IHVA 3PKJA 2VK8A 5EJ4A 5MGNA 4F4UA 5DGTA 5K6RA 4UTZA 4MZXA 2FSVC 1YHZA 4ZZIA 1PYDA 2WVGA 1U2GC 4L2IA 4IAOA 3JR3A 3ZGVA 2JI8A 4Y6LA 4UU8A 4UTNA 2WVHA 2H2FA 4GM1A 2JIBA 2WVAA 2EZ9A 5MFZA 1HZZC 1S7GA 4HDAA 4UTRA 1YHYA 4UUBA 2FN3A 4RJJA 5EJ9A 4BVHA 4RMIA 4BUZA 1V5FA 1T9AA 1V5GA 4JU8A 4I5IA 5D7NA 3E9YA 1U31A 3FZNA 2OD7A 1Q6ZA 4JU9A 2W93A 2OD9A 1YI1A 5DGDA 4TWIA 1Y9DA 4QELA 5EJ6A 1PT9A 3CLUD 4FEGA 3IAEA 1JSCA 4JUDX 1S5PA 1POWA 4BVFA 4BVEA 3HWX1 1OZGA 1PNQA 3ZGOA 4KGDA 5EJMA 5BWLA 2H4JA 2Q5OA 5K6TA 3D4BA 1SZDA 3U3DA 2A1UA 3FSJX 2AG1A 4RMJA 1Z8NA 3RIYA 4V1CI 3CF4G 4GG1A 1EFPA 2DJIA 2H2HA 1BFDA 2VK4A 1M2JA 2PANA 2H4HA 4HD8A 4C7BA 1SZCA 4FZ3A 1OZFA 1UPBA 2VBGA 2HJHA 1PTJC 4ZP1A 4D5GA 4RJIA 5IMSA 4BV3A 2QQGA 4UTXA 5EJAA 2EZ8A 4BN4A 4RMGA 1M2NA 3RIGA 2FRDC 1U2DC 4R8MA 2JI6A 4JT9A 2Q29A 3EY9A 3F6BX 4Y6OA 1EFVA 1OZHA 1UPCA 1YI0A 1V5EA 4JUCA 5FEMA 1O96B 5EJ5A 2JLAA 2H2GA 4GP9A 4KXQA 1M2KA 2H2IA 4MPPA 5AHKA 4GM0A 4X3PA 4Q9DA 4FEEA 2PGOA 4JT8A 4L3OA 2OO5C 4BVGA 1QPBA 2C31A 5EJ7A 4KPUA 5K2OA 3D81A 3GLUA 1DJLA 3PKIA 2A1TR 1PI3A 1MA3A 4X3OA 1N0HA 4JUFA 2H2DA 2IHUA 2JLCA 3U31A 4QPZA 4D5EA 3CLRD 1ZPDA 4MPRA 3JWPA 2NXWA 2VBFA 5DEIA 1NM5C 2IHTA 4GPEA 1J8FA 1Q14A 4UUAA 4IG9A 5BWNA 4UTVA 4IF6A 1O97D 1YBHA 2OD2A 3CLSD 1T9BA 3HWWA 2EZTA 1OVMA 3LQ1A 5BWOA 4JD5A 5MFPA 2H59A 5FYQA 1T9DA 3CLTD 4JSRA 1YC5A 4MPJA 4BVBA 4BN5A 1E3TA 2Q5QA 3OE1A 2VBIA 3GLSA 2H4FA 2V3WA 2Q5JA 4RJKA 5K3SA 1YC2A 1T9CA 2EZUA 2FWNA 2OORC 4QQ8A 3IAFA 1MCZA 1POXA 4O8ZA 3ZG6A 4JUBA 2UZ1B 4F56A 1XLTC 4MQ5A 4FVTA 4V1CA 2EZ4A 2JI9A 4UU7A 2Q28A 2NYRA 1U28C 4RMHA 2QQFA 4COKA 3FLMA 3F6EX
chains in the Genus database with same CATH superfamily
3A1SA 1QWOA 4R40A 4D9EA 3KYJB 5B1IA 4KFRA 5JS2A 5KWEA 1VHQA 3KE8A 5K8JB 1Q3HA 2AOTB 2BRUC 4OB8A 4PRLA 4ZO9A 1CUUA 2GM9A 2V4MA 2OZKA 3IP9A 3G9XA 4N7BA 2ZIXA 3CGGA 2IXDA 2O2GA 2W6IA 3ZE9A 2OE2A 4C3VA 4YCSA 1OKKD 2VDVE 1ZHOA 1UFOA 4GOOD 1NDUA 1T9HA 1JPNA 5KTMA 1FRNA 4IX9A 2W6QA 3W5JA 4DUYB 1QTIA 1F1JA 1QK4A 1PFWA 2QE6A 2ZZNA 4JI4B 2Q5CA 2JJ8A 1AZWA 1LPMA 2YJTD 4AO7A 3KHSA 1NE2A 4WH0A 3RVOA 4D46A 1D6MA 3PFWO 1RVV1 1D1QA 4OQNA 3ND6A 2IPMA 3KZXA 4HMPA 3ZOZA 2GXSA 2O8BA 1QX4A 1JIIA 1RKVA 1U2GC 2FZWA 4ZVUA 4OM7A 4OQDA 4AS2A 3C14C 4I9FA 3FHTA 4BQNA 1KMMA 3KEMA 2RAUA 3L9WA 1BE0A 3HCEA 3MS7A 4AL4A 4CKEA 1QO7A 5CEEA 2XNDD 4UATA 5FV4A 4IHJB 1DDGA 1OWNA 4YQEA 2VHCA 4EPVA 3W3ZB 3A1FA 4C4AA 2TMDA 1EMDA 3R4CA 1MQSA 5HP4A 4XYGA 4LMRA 4ZOQI 4B0OA 3KKOA 5ICCA 1GNVA 1JG4A 1OPXA 1H94A 2A9RA 3OFJA 4KLNA 2IZOA 4HXFB 5TEVA 3W1WA 1Z8NA 2XZLA 5BNWA 4Q3NA 1NVVQ 2VCYA 5JD3A 1FDVA 5K6AC 1ICEA 4FCTA 4HWPA 2IXBA 4GX2A 1TM5E 3F97A 2LCIA 1V2GA 3CNNA 1M66A 1T0IA 2DHDA 1OVGA 4I1YA 5CYOA 3RBAA 1VG9B 2Y27A 2CXTA 2ZRLA 3LOUA 4FBGA 4GLFA 3ACBA 1QOQB 1E7MA 4Q1BA 4XIFA 1YVRA 2ASVA 1A97A 3QUCA 3OX3A 5ITSA 5JD4A 1NJGA 3FJYA 3IHTA 1MGOA 3EZ9A 4Z1MA 1I94B 3K20A 3OZCA 1PJLA 1HUQA 3EULA 3C3AA 5M04A 1TAUA 4I55A 1V5IA 2FRXA 1MX9A 2HRBA 1VHWA 5JR3A 5A7FA 1MO2A 3OETA 5SY4A 1QHIA 1H1LB 4FYWA 2OB1A 3K5WA 5GV8A 2FUNB 2C9DA 2ECFA 4KXLA 3S99A 3TAUA 3VX4A 5LQNA 4E33A 5TQ2B 2EVWX 1JXMA 4AROA 1TJ5A 4NYJQ 3R77A 5LLTA 4KO8A 5EKDA 5JQGB 4NPHA 3OJEA 4MQUA 3ZE6A 4PNEA 1VSTA 2BD0A 3RC7A 1HYEA 1T6NA 3MWLA 4L08A 5CGZA 4KE8A 1Z5VA 2ZJAA 4PC7A 1X1CA 2PLRA 1G60A 1R7RA 3CIOA 3KELA 5K0GA 1RBZA 2BI7A 4TQGA 3VMFA 3I3OA 4K6CA 4MYDA 4AU1A 1POXA 1SA0B 3R0JA 4RA6A 2XT9A 4HXGA 2WSMA 2GYVA 1C3OB 1RYMA 3A3KA 1AU9A 3INYA 2HCRA 5AI5A 1GQRA 4PG4A 4KPFC 4B4OA 3CFYA 4J90A 1VPVA 1NSYA 1GPAA 2P40A 2XGMA 2ENWA 3FPSA 2O2CA 3TLEA 4BRSA 2VTVA 4L07A 3VNSA 1DCMA 3L1KA 1R27A 2Y1KA 5CDYA 3HVRA 4UBOA 3QFRA 3ZGXA 3PCXA 3MJRA 4TWJA 1JF8A 3OKCA 1P61B 2BVNA 1TRKA 3JTMA 2JHFA 2OGTA 1E92A 1NMQA 1OLSB 4QDTA 4BS9A 4TYMA 3Q7RA 3DVSX 4HH4A 4R0VA 2J0UB 4B4VA 3CB4A 3E1GA 2GHTA 3A4LA 4MR8A 4DMCA 1D09A 4E03A 1B8NA 2VP3A 3HA5A 2CWDA 4Y6GB 3ADBA 1NI5A 4PBRA 1A0OA 3S81A 3PQ7A 4Y67A 3VYVA 3T1OA 4AP9A 1WCYA 1T2EA 2FN8A 2OCLA 4JR1A 4QVIA 3Q11A 3ND8A 2IVFA 4WNIA 5ECWA 2JJMA 5F51A 4G5OA 3RODA 3TKAA 1LRJA 1QGDA 3SZRA 2H54A 5FI0B 2OCYC 3RS5A 2W00A 3QYAA 2JIBA 4QPNA 2HU8A 3HZRA 5DZSA 3QHAA 4QHSA 4RTPA 2FN3A 3UWOA 2XE6A 4E70A 3HBJA 3LO8A 1T0UA 4IO0A 3ZDRA 4EGCB 2W93A 4GECA 3BD6A 4FUTA 1TOAA 1IIRA 4KZPA 3RVLA 1WCV1 2Q3MA 2UZ4A 2PA3A 4EJMA 2YV1A 2ZB8A 5AJYA 4IM7A 1IBSA 3RTEA 1YT5A 3ZH2A 1FW6A 2ZS9A 2WSLA 4C20A 2EJWA 4PFQA 3U7HB 1V9LA 5FBWB 4R8SA 3LP6A 4OUDA 4PAQA 2WHYA 4ZI3A 5EHNA 3V48A 1SKAA 1RYYA 1FNNA 1SQSA 3U7JA 3MJEA 1NW4A 4DQUA 3ELDA 1YQDA 4TXMA 4OHRA 1FXSA 2C9OA 1V1RB 1A5TA 4WACA 2HY7A 2HB6A 2XMGA 3WYBA 4ZALA 4EY6A 3CS3A 4EHKA 4EELA 3Q3EA 1P91A 2VZLA 2W83A 4NYIQ 4ADSG 1EUZA 1E3LA 1DXHA 4L1KA 2PZBA 3FBWA 3V1NA 3CZ9A 4WXHA 3SIWA 3M1LA 4O4LF 5GMOA 4QUBA 4BNIA 4CTKA 4ZCIA 1A8PA 5FBRB 2F3QA 2VXCA 4Q34A 5FAKA 4JC5A 3D6HA 4KYVA 5CXQA 4NHOA 4I8DA 3PFBA 3HZHA 2F9LA 4ENQA 1QNLA 4QQKA 2XDAA 2B8JA 4ROSA 1WBBA 3GFQA 4XVUA 1Q14A 1DIAA 4GC9A 4RKRA 1M7HA 1TECE 1U0RA 3OURA 4IOKA 1PHPA 1H2ZA 1W6UA 3D2CA 5G02A 4DZZA 5I7WA 3K6RA 1T2FA 1P5JA 3KKKA 4NENA 4K86A 2QUZA 3BGWA 3BFJA 3KPJA 5CK4A 4YFYA 3SF8B 3TO5A 4FGWA 3FUVA 4HB3A 5A2GA 4ARUA 3W7AA 3ZY6A 1YC2A 1MB2A 1QG0A 3G85A 5DW3A 3W0LB 3BJZA 4D9FA 1HDXA 2OMKA 3G7SA 4ND1A 3VR5D 1DP4A 1Z3IX 1U9IC 1V1MA 5DMXA 4TL6A 1XAIA 1ODKA 1RBQA 3DZBA 4Q7EA 4MQBA 5K0SA 3A9TA 1V8PA 5BW8A 1Y8AA 2PS9A 1NQ5A 2ZJYA 1W4RA 4J0CA 3RBVA 3HKEB 4HNHA 5TT1A 3IUJA 5A7HA 4V1CB 3K8QA 5JFGA 1ZUNA 1GFSA 5C81A 1MP0A 4B82A 1STOA 4LF9B 1OFTA 3K35A 2OCGA 1BSVA 1WR8A 1HG1A 3Q6IA 5LYYA 1SZJG 5FWYA 4OLFA 3DEYX 4LOLA 1W0JD 1LPOA 1TMKA 1RHJA 2I7CA 2FMUA 4I9UA 2LCQA 1VMDA 2HO4A 2VEDA 4I50F 3RC3A 4AYTA 1ULAA 1X1DA 2CNWA 3L4BA 2FX2A 3MHTA 3AOEA 5KYUB 1K8RA 1ZUHA 2FMFA 4TTIA 2DF8A 1B6TA 2ZRPA 4LDPA 2O8VA 2HHLA 3CLRC 1EP9A 2KI5A 3DTVD 3NVKI 4P8RA 4A2QA 9GPBA 4MICA 4M37A 2IOQA 2W90A 1N8NA 3DTVB 4CL8A 4F4UA 4MHTA 3JQ6A 4HGRA 4RF2A 4DT1A 2PKWA 4Q7KA 4JJ8A 3N74A 5DM2A 3SJUA 1YS9A 5IC5A 4HT3B 2PZMA 5IT9A 1NLUA 3JR3A 3ETNA 1IBCA 2J3HA 1WU7A 2QNBA 1N2CB 1G4HA 1TIKA 5LXTB 3QEKA 1GD1O 3LUAA 4OTZA 1PT5A 3STWA 1JZQA 2CNOA 4L7QA 5SYNA 2HWWA 4E0BA 4M1WA 1T0HB 4NHEA 3DXXA 4YPOA 2ZUEA 1TKBA 4H0CA 1CRZA 3A14A 3O4GA 1D4AA 4B7ZA 4MP3A 3VRHA 5F76A 1A9QA 5I9SA 4MTCA 2XWQA 1DCFA 4AKTA 4NEQA 3O93A 3ZGOA 1GWNA 4D8TA 3Q40A 2CDRA 2AXNA 4DZRA 5JZ9A 3EEOA 4UNNA 2XWSA 4NOMA 1FMLA 1PN3A 2UDPA 3UWSA 2G1JA 3I12A 3TAXA 4XGRA 3U3JA 1ZZGA 4WOJA 5KTKA 4COOA 3V4FA 3FKSA 1Z7BA 3HCCA 2UUBB 1K8YB 3FVRA 1JPJA 4RJIA 1UK9A 4JEIA 5JSQA 4YAIA 3IQEA 4AIRA 2O48X 4HVAA 4HRVA 4FK8A 4MIOA 1VE3A 1DJNA 2O4UX 3FNFA 2V59A 4PAOA 1GSOA 1E4VA 5KHLB 4ZQCB 1YS6A 1QE3A 3IOMA 1TMOA 2WWRA 4G23A 4R9RA 1W8DA 3I09A 2O3QA 3IMFA 3A1EA 2HADA 5LWHA 3W5IA 2PZEA 1KI6A 5CG1A 2V5AA 3WLEA 3UQZA 2HK6A 1RLOA 3NHYA 1ZFNA 2P0YA 1GILA 2OGSA 3QXXA 3SKYA 5ILOA 3B7WA 3IVAA 1HE2A 1ISJA 4S1TA 3ZD9A 1NMZA 4MS4A 2I4MA 4RPHA 4Y2YA 1WP4A 1MG0A 4GPIB 2HBZA 4LF4B 3ZHUA 4KI0A 2D74A 4FE7A 1KFCB 4FOLA 4G5QA 5C3MA 3ZWQA 5TDHA 4KX3A 4EZIA 5BURA 3RS2A 1B74A 4LJYA 1U2QA 5AESA 2FZKA 4JBYA 1JBEA 1PZXA 1RPAA 3JSAA 5KX5A 3ZJYA 3DBRA 2IHZA 2DFTA 3PXUA 1DCKA 1W5SA 3JYPA 4GW3A 1RHRA 4R69A 4XOIA 3T7DA 1LC0A 3VPHA 1JFRA 4CLDA 3LQQA 3TQHA 1WBJB 4E30A 4WZBE 1R9GA 3IQXA 5T4BA 1TA9A 3RAJA 3SHOA 3IE1A 5FBZA 2X2EA 3ZCVA 1RABA 4BKRA 1GRQA 3VI4B 1KEKA 3TG8A 3JW8A 1QCYA 4GBGA 1DL5A 5H0IA 3RF6A 2F3TA 4RHTA 3X3HA 4IGIA 2NTEA 1KAEA 2WJYA 1PG2A 1RXYA 4QEDA 3KC2A 4BBZA 4G4JA 2OB2A 5DJ5A 5CCXA 2OSBA 3DTTA 3F67A 2YWEA 2MYUA 2GESA 2Y8EA 3IJPA 4PR3A 1VIVA 2DFPA 4N5MA 4E13A 1RQPA 5BV7A 2VSNA 5T57A 3A6JA 4RHXA 4LOJA 4CL0A 4IVQA 4G9EA 3O84A 4BHTA 3R3YA 4GS5A 1R4NA 2P2NA 1W19A 3K0CC 1X70A 4C14A 4OSEA 1O54A 4HAIA 1Q57A 5E4TA 1AMUA 1K7EB 1YVPA 1QIIA 3AFGA 3PBKA 2HX1A 2W2QA 1JLLB 4JT2A 1GOTA 1CRLA 4O8CA 3D8SA 4HZIA 5AI0A 1OH7A 5BQ5A 1FX1A 3VI3B 1E1QA 2HPHA 3RU9A 1ZMTA 3B20A 1GTRA 2WSYB 4E5YA 2PGLA 1A9PA 3CM0A 1ADFA 1O6ZA 3KQMA 1UC5B 1UBNA 4ZJUA 4JYMA 2FF5A 5BWMA 3QLVC 3H5AA 1CNFA 2B30A 3E53A 3GRFA 3PSAA 4JLOA 3T0IA 4AWBA 4CR7A 3QVMA 5EZQA 1L5NA 3TZQA 4DEVA 4DV3B 4K0KB 5GJBA 3T99A 4RIIA 5CIWA 3A04A 4PLTA 2AQHA 4YRBA 4V3BA 2P90A 1PR3A 2R6JA 4Q7LA 1KYZA 4PWYA 2XD9A 1SEVA 4BO0A 4XTCS 2H8GA 5JOQA 2IY9A 3VPXA 1KE2A 1IXRC 4M1KA 4Z2AA 4Q02A 2WMYA 1G8KA 4FEAA 4K88A 1USWA 1I2MA 3NVMB 2A94A 3Q2OA 4MVJE 2DUNA 3PCTA 3Q41A 1GCAA 5J59A 4F2PA 5JAZA 2CK3D 1R0CA 3ZIUA 1MJFA 2G9ZA 1GPDG 4JK3A 4Q1CA 5ALYA 3VJMA 5K3FA 5A9TA 2AZXA 2JD1A 2H0QA 3KZVA 4CG0A 5IG2A 2XE8A 3RTGA 4YRAA 4I9HA 1E2QA 5B58C 1LDNA 2VYND 4E2WA 3PJGA 1DJMA 2E4ZA 3ZOKA 3D81A 3ZLJA 2FZGA 2D6FA 1C1HA 1X80B 1EZ1A 1R74A 5HFJA 1VXRA 4XD2A 5DHQA 2DKOA 3GRVA 1T1SA 4NPAA 1Z26A 3BRCA 1UK8A 5ALXA 1F4LA 1XCOA 2P9EA 4EY5A 4EUKA 1YBHA 2RGNC 3RYCB 1LJ8A 2ZAMA 2DWCA 3ORQA 1EFRD 2ZRKA 7MHTA 3E3NA 3R8FA 2Z2IA 4DWVA 1XEAA 4YLGA 3GO4A 1EIZA 1OOEA 3I2HA 4MVYA 1VGVA 2ZK7A 1YS2X 2I8CA 5CX1A 1ONSA 3GEBA 1T3ZA 3BE5A 4AWXA 1PUIA 4PW0A 1JB9A 1C30A 3IVRA 4AAYA 1LJUA 2Q45A 3NANA 5DEOA 5BNTA 4JZKA 3MQ2A 4E94A 2DUUA 2H16A 4B73A 1WB4A 5CCEA 3WE7A 5CDGA 4PG5A 3EQ9A 5KHAA 1HSOA 1SPXA 2PDAA 5E3IA 1XL1A 1PJSA 3QKTA 1R2QA 5AW4A 2WLTA 3ON5A 1JQLB 1YCGA 2MSDB 2MSEB 5GONF 4EG6A 2QTTA 3RQIA 4JR2A 3RH0A 2QY6A 3UHPA 1Z25A 1I3CA 2WTMA 3GF4A 2VJYA 4J0KA 3VTAA 4AFNA 4WMLA 1S8AA 3SE0A 5BSEA 3ICQB 5FL7A 4MRMA 3MAGA 3FMFA 2ZDQA 1WE2A 1YCDA 2VQSA 2QX9A 2ZSEA 2PRIA 5D2CA 3U9TA 3K4QA 4A73A 3KOOA 2VDRB 2J0QA 1X7ZA 2I76A 1E79D 4XE5A 1HY3A 3HDJA 2QV0A 1IHYA 2Q4OA 5F2KA 1YB1A 1I2ZA 3DL4A 3FCOA 5JMTA 3UMGA 3FI9A 4H31A 3PDWA 1A7AA 3CH7A 3WQBA 4FI3F 1PYDA 1ZMBA 2V6FA 3GJXC 4CXMA 1NFFA 1F0YA 2C9ZA 3GEIA 2EP7A 2HO5A 3EMDA 1OH6A 1G41A 3ENQA 2RHRA 4HFNA 4BTVA 3U60B 5HOEA 3BDAA 1T8PA 3D2LA 2X8JB 3O75A 2QENA 3WLKX 3A26A 3OKAA 4TZKA 1M7GA 1U2EA 4F12A 4AP5A 1Q11A 4XFJA 1USKA 4UMDA 5JE8A 3UK7A 3COPA 4JEUA 4K03A 4A92A 1AF4A 3HO6A 1CUBA 1UBKS 3HN7A 3BB1A 2VSQA 1JLMA 4FLEA 3OIWA 3GUYA 4DC1A 3WWOA 5KI6A 3KQUA 4TTRA 1PW5A 1BU8A 2Z9BA 4FB5A 1EUDB 3IDZA 2V98A 1I32A 2H1RA 1SQ5A 2YWBA 1DS6A 5AW8A 4Q3BA 4IDFA 3FM9A 1CU1A 3KJFA 3O8BA 4P5EA 3QYFA 1B26A 5BORA 3R7WA 1JFVA 1R88A 1JNXX 1W5BA 5FHQA 4QM6A 3P71T 4Z1OA 2HJHA 1T4MA 5M7EA 3PFIA 1Q0QA 3QE9Y 2FDRA 4EH1A 5U4XA 3ACCA 2C3OA 3HKEA 3NBZC 4JXXA 2PT5A 1FTNA 1HLFA 1FTQA 2YV3A 2YZNA 2QTAA 3CEJA 3LC1O 1RKXA 3JWJA 1NBMA 1LQTA 1IZZA 4NZNA 4U2BA 4WXRA 4XQ0A 2UUCB 1COWD 2QP3A 3GX1A 3K92A 3PR1A 1W4CA 3EDYA 4FM9A 2DPMA 2PX8A 3MOSA 2BFEB 2YZGA 4RD0A 4DA9A 1PSWA 1VECA 1SD2A 2J41A 2R1VA 3CY6A 1HEIA 4FHFA 4PO1A 4LFAB 1KVUA 1EJ2A 1H3EA 3K9HA 3G2NA 4L73A 2K87A 4PFJA 5BNZA 1DRUA 2O19A 1Z5NA 1RTKA 3W1VA 3BT7A 5EE9A 1BAPA 2OYCA 4UC0A 4B6QA 3ABIA 4WCDA 3SP1A 1M2VA 1PJ2A 1PJ4A 1KHTA 2ECOA 2I3ZA 2JBAA 3KUCA 2PFKA 2VLBA 1C9KA 3LPNA 2F43B 2J5BA 3O1IC 1QXSA 1I0IA 2YC4C 3LC7O 4KK4A 1P7YA 1R6UA 4CMAA 4IL5A 1AK2A 3CUTA 3TLXA 4KDCA 3RHFA 3EVFA 4LNHA 4PICA 3CBQA 2BMEA 4MRSA 3AVVA 2ECQA 2OXTA 1ORHA 1ZKDA 2NZXA 3VR2D 1SZPA 3ES9A 1ZJ5A 3JAKA 4TMWA 2EL7A 1Z8HA 1JS1X 3O95A 5BN3B 2ACKA 1HDOA 2VUHB 4B6EA 3ZHSA 1Z13A 3PDUA 2VNIA 4HC4A 3OOYA 3BRWD 5ALKA 2UZ1B 4RORA 4EY3A 1E2KA 3MRSA 3UMYA 3MJCA 2F59A 2EL9A 1KFKB 3G5MA 3NBMA 1NSFA 5C46F 4G41A 2IZ0A 3PCRB 1G8HA 3TM4A 2DT5A 4YR7A 2XYGA 2F1IA 3D43A 4URVR 4LYGA 3ZCUA 3WAGA 5F4ZA 3TLAA 2BYTA 4F91B 4CLOB 2VF7A 1QQ5A 4WQMA 1WF6A 1JLHA 2XSZD 4KMMA 4OVKA 4DPKA 5F35A 1PNOA 2B5OA 4YB8A 4AX8A 3EQ6A 3TYXA 2CB0A 4WGFA 3C5CA 3LYLA 2WJZB 1DIRA 1W1WA 4JP5A 3TQSA 5IFKA 2ZYSA 1AHPA 1QKIA 1YNOA 3PKJA 5B7PA 4H7EA 4DV5B 2QSJA 2XNCA 3R3XA 3BGVA 1UBHS 5LZ9A 1NZDA 2DSNA 5IK2A 2GD0A 3U4IA 3N0TA 3QHPA 3E9DA 1ZH8A 3CUKA 3CRVA 1YNSA 2EBHX 2FEWB 4OGLA 3TKLA 3WLSA 4EG1A 1TTTA 4FILA 3JQ7A 1BKSB 2UYOA 1Q1ZA 2YNMD 3AFHA 3DP9A 2BY4A 3WGNA 4DAOA 4EG4A 3SC2A 3KKMA 2BKVA 3R3SA 2I2DA 5I4KA 2FPSA 3NDJA 1OFIA 4MUMA 4P0QB 4PX9A 2IHNA 1KJIA 1KO1A 3G9ZA 4JT4A 3I73A 1Y3FE 1ODFA 4G8DA 1FTWA 3VR0A 4PN7A 3DMTC 2DECA 3GRCA 3ZDEA 1SUSA 2HHJA 3A3PA 4BNNA 4ZZ3A 2PVCA 4OQPA 1CY7A 5ALEA 1IFXA 4NLLA 4U7GA 3R20A 4CN8A 2HREA 1IHUA 2XLCA 1NV9A 4A0FA 2O3JA 2PX6A 5JPCA 2OO3A 3QELA 4QWWA 2P9YA 1Y5MA 2V7QD 2FFAA 4TTJA 4BTLA 4GEKA 4BWFB 5JJKA 4M7OA 3OICA 4WJZA 2YWHA 2G07A 3VR3A 1OZHA 2IIPA 1O96B 1K6EA 1XLVA 1ADCA 1QRDA 3QU4A 4EK9A 5KTPA 1JUDA 1D1SA 3QUTA 1Y37A 3D8TA 5DMHA 2X4DA 5EUMA 1ESCA 5L40A 1KEZA 3NETA 4M9QA 2VYCA 4DWJA 3D8RA 1I6WA 3E6AA 5U1PA 3IQFA 1T9GR 4I0WB 8ABPA 4OREX 4NCAA 3VO1A 1L5RA 3KZOA 2EWWA 1Z0IA 2ZWAA 4QPZA 3ZJVA 1MOQA 4MQFA 2GKSA 1ZC3A 4KGZA 4PPQA 3SJAA 4OM8A 1II9A 3AQ4A 1FS5A 3FWHA 2BEWA 1T9ZA 3PR2B 3OA0A 1FU7A 2G83A 1QV9A 2YZ2A 1GUBA 1CUZA 2Z56A 4FDMA 4FFVA 4DMGA 2TMYA 4FT2A 1EK5A 3DDUA 1AT1A 1EX9A 1EQUA 1UT8A 3R3WA 1SA0A 4RA6B 5EE5B 3K5PA 4ROTA 3P0EA 5MN4A 4DMKA 1EFCA 1IEXA 3K1ZA 3L79A 4FHZA 2R6GA 4V0SA 3UXYA 7AT1A 4S2EA 4F2HA 2GAIA 1L7MA 1T2AA 4AJHA 4RDXA 1KOLA 4KN6A 3TRHA 3E5MA 4HQ0A 3ZQKA 1QHXA 4QVGA 3RIHA 4GYJA 5HQ3B 2IEIA 3H9BA 5ALGA 5TQ0B 1Q20A 3E03A 4CM1A 3ZJUA 2IHKA 5DT2A 4YGXB 1AOXA 3RFCA 1HX7A 4B71A 1T5IA 2GZHA 2J30A 3HDQA 4U6NA 4F8JA 2W2TA 3VSCA 1H2XA 1M54A 2CBGA 4HSEA 4O1MA 1U9IA 3ZW7A 3S6JA 4CV2A 5BY2A 2UYHA 1GZUA 3ICCA 4G1CA 1UAGA 3L18A 2A9JA 4KQ1A 4N18A 3AEKB 3VVBA 3M4XA 4FI3C 4X8HA 1U8ZA 3BL6A 4UAGA 2HYDA 4C0BA 1OLUA 1ZESA 2WFMA 1WY7A 2HMYB 2D2VA 3GPDG 3P20A 3PHIA 1QP7A 4R1MA 3AK4A 3D4LA 1Z4NA 4MWSA 1M2OA 1XE3A 3ONFA 4PTZA 1BRTA 2HMAA 4B80A 4F45A 4AY2A 4U63A 2VRWA 1WQ3A 3GDOA 3D4OA 3M7IA 1AXRA 4R8LA 4RM3A 2VQDA 3COYA 4QRDA 4M1ZA 3DQZA 2B7CA 1XEWY 2I3AA 3ANMA 3JAWA 3BQNB 4L2IA 5TY0A 4HK4A 3THOA 4NBKA 4AMGA 2WVHA 4GX1A 1W85B 4KE6A 4MMXB 4GLJA 4R3UC 4UFNA 5HIJA 4HPJB 2L0XA 1BFKA 1EEXB 1Y82A 2BHLA 4L4SA 1D07A 3W77A 5ICSA 1DEHA 1EHYA 4IUDS 4Y2GA 2J09A 2HKIA 1AKYA 1UMBA 3LLCA 4F21A 1E4EB 1PWEA 1P3Y1 2OD9A 4ZOLB 4DY4A 1N2CE 5CUQA 1QONA 1FSFA 4MJLA 4L9SA 5CVEA 1ZHHA 4BB6A 2DY1A 3ZWXA 3HSSA 1JYFA 4S1OA 2BISA 3QVKA 1V39A 3OHSX 4HGPA 5C8ZA 1VG0B 1V25A 3UAXA 2E4UA 2V9PA 2ZDHA 2CL7X 3FPKA 2OPHA 2HWXA 1SD5A 1K7CA 2QTFA 4ZC1A 5AW1A 3VPDA 4EPYA 2YYZA 1BE6A 1LK5A 1YONA 2CKDA 3ETEA 4A2PA 4OQFA 3KAQA 1TZMA 1RLJA 2V7EA 2XGSA 3ZHQA 3K5IA 2IU6A 5JUWA 4KQEA 2OA0A 5IDXA 4RW0A 3QSYA 3GCWA 1THZA 1S3IA 2PUTA 4OGGA 4MVJG 3DW1X 5CP8A 1KGDA 2F1JA 1KI8A 2YWRA 4U2KA 4ZO4A 5A71A 3F2VA 1QCDA 5A05A 5D6NA 5LBTA 4B46A 4X3PA 521PA 2Q2WA 2QTLA 3OD1A 2GF0A 2OAGA 1TAGA 1JAHA 3EDQA 3F5DA 1QKJA 3N5CA 4PBSA 5T3UA 2OFXA 4CODB 5K5EA 2DMRA 1ES9A 4PLFA 2EKLA 1Y5RA 1Z6TA 3FBGA 1ZGHA 4C6SA 3R6TA 2BUCA 2C9BA 4OY3A 4KR3A 1ZM2A 4KK3A 4E31A 1JFFB 4L4RA 1N7JA 4MW1A 1V48A 3CH5A 3ACDA 2ES4A 3LFTA 3RHZA 3V7YA 3QFSA 3DF7A 2QA5A 5EUBA 1PV1A 4BLRA 3JQQA 3V8RA 3ZV5A 3JWEA 4DILA 3LDGA 1Z88A 4BVBA 4HI0E 3GARA 3HJFA 2NPFA 3SC4A 1LPNA 3A6LA 3L6UA 4CG1A 1M5UA 3AM5A 1NC3A 1Y48E 4FIDA 4XFDA 1JIXA 1KP3A 3KKEA 4PN3A 4X8LA 1R5JA 4CGYA 3WHIA 4W4TA 3T1YB 1V3QE 3P2EA 3OPYA 1Y34E 4C4YA 2NSHA 2Z08A 2QUAA 4RQTA 4XUEA 1XQ1A 1U3FA 4YALA 2YY6A 3EIXA 4CZ2A 4P7JA 2WKWA 1CNEA 3B6IA 4FHDA 3KZMA 4JA2A 3WBBA 5A1TA 3B52X 5EUCA 3DVAA 2IPLA 1H9AA 4YXWD 3QPDA 4MA4A 4P58A 2XJ4A 3L93A 5FADA 1COWA 2P67A 3ZH9B 1E5XA 4BDTA 1VLHA 1YZUA 4KUEA 4EB6A 1J6UA 3QEMA 3QU7A 1U7PA 3ICOA 4TLLB 2UUAB 2BJHA 1K27A 3HHPA 3MS4A 3O92A 2I0FA 4G37A 4PZLA 3SCZA 5E6RB 1X1QA 1SOAA 2LKCA 1JMVA 4BO6A 2BBSA 2BHSA 4IGFA 5MN5A 2GPJA 2AW3A 3MWGA 3OJ0A 3PEUA 3CLUC 3QV2A 4B8WA 2XKKA 5JJLA 4GMXA 5FWNA 1SHKA 2C7QA 4MKHA 3KLNA 5KHOC 3M6WA 4XQEA 3OLXA 2NUAA 4G25A 4JASB 3BWXA 3HE3A 2VPTA 1I01A 4QRHA 5AW7A 4EHDA 4S3MA 1ZIOA 3UKOA 1IHPA 2YYSA 3HDGA 4TRNA 2D54A 5KEIA 3KKPA 4LI3X 2H2FA 1H5UA 1IEVA 3ROQA 3R5XA 4PYNA 5KYXB 1S7GA 3GFBA 4PNHA 5HMLA 1FIUA 2ZUVA 1RM4A 5G2OA 5MN6A 2ORVA 3SU8A 3OZFA 3VKGA 1E60A 5E8JA 3VYWA 4FFNA 1EE1A 4LX0A 3B1WA 4P86A 4Z4FA 1FQOA 3FN4A 1P81A 3H1FA 3BXEA 3BK1A 3P8ZA 4V24A 4Y98A 2XIJA 2BV3A 2B37A 3AIMA 4PPYA 1N8KA 2H4ZA 3I34X 2C7OA 2ZE6A 4JP3A 4DDWA 1G6HA 2VPWA 4US1R 3E9NA 1JWBB 1KR5A 5CA1B 2RI1A 3Q3VA 1H5QA 3HGQA 4Z3KA 4OOEA 4QNNA 2OM2A 1SCJA 3EXFB 1EJBA 1OC4A 3AXSA 1O5OA 4W5WA 5SYMA 4HLUA 4CM4B 1QH8B 2FE1A 1M2NA 3BWVA 1GYPA 3E0XA 2CLSA 3WHPA 2E3JA 1IXSB 3ABSB 2XVMA 4DYDA 3B5JA 4JUIA 1TLTA 2UV8A 3P97A 1KYWA 4XEUA 1YZVA 3GHYA 1OC2A 2PS0A 1OAAA 3NHRA 5LM3A 1LPBB 3MUNA 1QIHA 3SYKA 1EWTA 2Q62A 3ANTA 3SG0A 1OWOA 3UW1A 1WUYA 5GP1A 3BD8A 3UHAA 4RY8A 1UMCB 3OY2A 3Q3CA 4U8GA 5EGSA 5LQMA 1IK4A 4F6LA 4TT8A 2VBFA 2OHOA 3H8JA 1ATIA 1O97D 1L8AA 2X5NA 3OLVA 2J0UA 4KMOA 4L8YA 4MWCA 4RH0A 2EZTA 5AMXA 4I3HA 1U3DA 3ZEIA 4CMBA 4ZZ2A 3T34A 3TIGA 5F1OA 3FFXA 4JSRA 3ZIAD 5CGQB 3T3OA 1QS0B 2QOEA 3G2PA 4PTLA 1B8OA 3UHOA 5BXYA 5JI3E 4I19A 1KQ3A 2ZUDA 2E4AA 5K3SA 1DO8A 1XZFA 2YHSA 4PY2A 2AB0A 5BP7A 4OHOA 2G1AA 1D0VA 2ZB3A 3QGMA 4RLHA 4EA7A 5B64A 5KVQA 2JGIA 2X58A 3AL2A 3V34A 4ZYUA 1FTSA 3ZIDA 5CNMA 1A71A 1OBVA 1U7DA 4FJ0A 2X2PA 5GM1A 4PYIA 4AZWA 3KQLA 1YACA 2V0GA 1ZC4A 3LXXA 4K9OA 4UHHA 3SQLA 3K72B 1TRHA 2WBLC 4JBIA 5IAEA 1MIOA 1EDZA 1G5TA 1BDMA 1L7EA 1MC5A 2NUBA 2C9MA 3K70C 2PLNA 4HEHA 4YNBA 3SLRA 3DLIA 3K7EA 4EYQA 1NF8A 5C7LO 4OMUA 1XZJA 3CPEA 3K8YA 3VSAA 1XMOB 3TFOA 3LVBA 3H5LA 3BUSA 5DK6A 4QU8A 3T38A 4ACAA 2BGTA 4E2ZA 1MJNA 3STYA 1ZK0A 5JHHB 1XX6A 3SC6A 2ZTHA 3VYSB 1BW9B 1GNPA 1RC8A 3UKJA 3UCFA 4NFHA 1BYIA 1DAKA 2D1TA 3R5HA 4EUHA 1GPLA 2BFBB 1YIAA 2GK3A 3W5SA 3RYIB 2Z6AA 3D4NA 3PNLA 4H7JA 2DBYA 1NPYA 3NHAA 1AHNA 1IYZA 3BHNA 2BPOA 4KU4A 5B7NA 3UC5A 2ZT5A 4CVNA 4IGAA 3ZGVA 2HW8A 5HA5A 3QRWA 4JBLA 4IJ5A 3L0ZA 1E9SA 3LECA 1SVUA 3FWNA 3X1XA 3DH0A 3BFXA 3H6GA 1U0EA 3NM4A 4KODA 3PE3A 4DXDA 3WFIA 1KVSA 1J2EA 3PHGA 4RMNA 3I8XA 4KIGA 1FB5A 2W0SA 2AOVA 5EIFA 2J45A 3PV0A 4MGYR 4RYLA 5E3JA 3DJYA 4V0RA 1R0YA 1AUVA 4P38A 4JDUA 5IYZA 2D1SA 5IJXA 2OKCA 4KRYA 4QLBA 1EAMA 4L85A 4OMDA 5F73A 2EARA 4NENB 3SF8A 3IAS1 4EW1A 1IHOA 4ESVA 1NQXA 3A70A 3ZJTA 4KSBA 3N86A 3BRWA 4BEJA 1C9EA 4IIDA 2QLMA 1TEZA 2WMOB 2ILTA 3VBCA 1OJ7A 3I04A 2AR7A 1KDTA 2FZEA 3GDFA 2E6KA 2QLBA 5THXA 1VL5A 4REQB 1P7ZA 2O0HA 1OYVA 2AXEA 3E58A 3JRNA 3OT1A 3DOIA 2Q3EA 3VYUB 1ABBA 3O4HA 5A03A 5BSRA 4V2UA 1KP9A 4CKXA 4ECEA 3DDSA 1ZD4A 2AI1A 1W29A 2PY6A 1M73E 4XVRA 5CT5A 1M2KA 5JPDA 4MCJA 5K0BA 1KFEB 2FW1A 1X1AA 5J4KA 5E9QA 1HQDA 1GV1A 2OPBA 3HEMA 4U7TB 1ONPA 5DU2A 3SBDA 2QY9A 4MR9A 2FQQA 4X6XA 5B3AA 3PPWA 2O2DA 1JDNA 2NIPA 2OEPA 1BMFD 1FLNA 3IB6A 3T4PA 3PEYA 1F2DA 4B3IA 2ZIUB 3SGLA 5TVKA 3NWOA 2NMVA 3TTYA 4LKOA 3R0VA 3U16A 2PRZA 5DTJA 2ZIFA 1RM5A 1I5RA 1XWFA 3K2EA 3KJHA 4AB1A 4AN0A 2CV0A 1R66A 5FR2A 4BFVA 3WIUA 1PDOA 3CB2A 4KFTA 4EX6A 3IIJA 1NLZA 2I2XB 2XAUA 4MVXA 3IV7A 2BH2A 1BA3A 3O31A 5IKPA 3WXMA 4B83A 5L6MB 4B4KA 3A4NA 4F96A 5FLEX 5JVDA 2AL7A 4R31A 3E4DA 2X8BA 1MCZA 3HGTA 4LYDA 3FWYA 1D7OA 1FFAA 5HQ3A 3A6GA 4ZVSA 3R23A 1U7OA 3LY7A 2XY4A 4J7UA 3OEEA 3HM9A 1NBME 1EBBA 1AHHA 4FT4A 4GP7A 3WZLA 4J2OA 3W1EA 5DX0A 5KNLA 4DLUA 4JLMA 2QLNA 1XR3A 4G84A 4NOJA 1CWUA 4NOKA 3GLHA 3R9XA 2BGNA 3UOAB 1C81A 4HAVA 4S35A 1P5ZB 3PVCA 1JNYA 3RSZA 4R1PA 2KS6A 2VTEA 3AX6A 3H4TA 1M1NB 3CVOA 3VFDA 2KE5A 2GH1A 1M2GA 4K9PA 2V7QA 1E9AA 5JXHA 1RXIA 1X42A 1LS1A 3F6PA 3P2JA 3TNJA 2XT6A 4PHCA 1ITZA 4PAGA 1BG6A 2GCEA 4QXOA 4XSVA 1H6BA 1NY6A 1NXTA 1TLFA 2O7RA 5DH9A 3TUJC 3IQDB 4WLOA 5C8YF 3Q3JB 4HBGA 3ZW8A 2OGUA 2G40A 3EXEB 3ILSA 1U90A 3INRA 4HYQA 1GL3A 4JKOA 1T8RA 2CN1A 4YH1A 3R7AA 3RGGA 1Z36A 2I7TA 2ZP1A 3OOEA 5TPWA 3S1LA 1KEWA 3ZHVA 2A8YA 2G80A 4UUOA 3ZDYB 2JHCA 4H1UA 4QOFA 2C2XA 2RFLA 3D31A 2JFBA 1DAFA 1B6GA 5FWYB 1E66A 4YAKA 4JJIA 4OJTA 4UM9B 2VNHA 3I8OA 3BE4A 4QDKA 4I5IA 1AUXA 3MFYA 4B8YA 1SXQA 5FUBA 2JASA 3UICA 5HOQA 3CH4B 1PT9A 4F6RA 3D59A 4HGNA 5IANA 3E2MA 3EZFA 1JPVA 3GP3A 3IVGA 3WAKA 4XB2A 2QM3A 1GKUB 2GYUA 2Q6KA 4NK5A 2C0CA 4NMMA 5JROA 5JWOA 3PHCA 4KLCA 4KAJA 2CXOA 3GHHA 1T9KA 2DJIA 1IY0A 1NUQA 1TVKB 1TQ4A 1JILA 2ICAA 1DKQA 1UKZA 2PWZA 3GP8A 2Q1UA 4YCDA 4U02A 5KJEA 4CPDA 4F3KA 1U8YA 2GJ9A 2O3TA 2FPIA 2FFQA 2Y68A 1VPDA 3IERA 1NL3A 4M3NA 4LXTA 1U7TA 4HGQA 2C57A 2SCUA 2W2KA 5A4FS 4L3VA 2VJQA 3CLKA 4ZI2A 1DO0A 4P98A 2O14A 3ULKA 2FEOA 3OTIA 3H2HA 1JSXA 4WFQA 2YN2A 2Q1SA 1Z6YA 3IXLA 1XVLA 5LZ4A 1LRKA 1TK2A 1ZQ9A 3O73A 1TM4E 5HF8A 3EPRA 4JROA 3ETJA 2X86A 4G97A 5REQB 5AW0A 1X7GA 3VQTA 4RNDB 1BGWA 2ZLBA 1XZHA 1VC2A 2VDKB 1AUPA 1FDWA 3ESRA 2UYYA 4YX9A 5BR7A 1E1CA 3U9SA 4WY8A 5CNJA 3MS2A 3SZUA 3OPVA 4DMHA 4TVOA 2EFJA 4C76A 5JZVA 2G5CA 3C4QA 3CLTD 2D2XA 2EDCA 4P22A 1VYVA 3VJRA 5JD5A 3JV7A 4MPJA 3AVYA 5E6UB 4WESB 2Q5QA 5EIEA 5JECA 4KGXA 1ZJJA 1CZRA 2M1XA 2JJ1A 3FNQA 4WDQA 1UJ6A 2B4KA 1NVKA 2CFCA 5FTKA 3V33A 1ZHFA 2REQB 3CBGA 2D00A 2QORA 3AHFA 3KQWA 4PZPA 4AC9A 3HDHA 4BMSA 5AUPB 5ESXA 5TC4A 3O4RA 4A0RA 4PS1A 1NAIA 1NDHA 3PQEA 2ZYRA 3I9KA 2ZYIA 3ND5A 2C2OA 1A04A 3FCYA 5AK0A 4CLEA 2WWXA 4D8UA 3OX4A 4M99A 1FUKA 1T26A 3QSGA 4YMHA 2W2LD 1Q17A 4JVMA 3O74A 1TT5A 4J4BA 2CF6A 1Z06A 4X92A 4DT1B 4MWTA 4X91A 5KUTA 4KQKA 2WF7A 2RBGA 4IIFA 5ALRA 2AN5A 1H8HD 3N6XA 1BDBA 3LPAA 4GU5A 1ESEA 4XI9A 3URMA 1HL3A 3PC3A 2C99A 3HY6A 1VL0A 4ZPXA 1E1CB 1B8VA 3TB4A 1P8AA 1PL7A 1TCVA 3EIUA 2G8NA 4MGHA 4X0EA 4YECA 3L8CA 4A82A 1X8LA 1NMXA 4TLDA 1RPJA 1UFKA 3SEZA 3OECA 2HBYA 4OQLA 4V0MA 3K6SB 1BCRA 4HXEB 5FO0A 4BLPA 2JF0A 3A4VA 4IIGA 4IP0A 3HCBA 2E6UX 4HQ6A 5EEGA 4GI3A 3ZU4A 2F9MA 2X0RA 2XUHA 1WHSB 4PHFA 5DWVA 1KSGA 5HCIA 5BOSB 3RV4A 3VV3A 2HDOA 5FLXA 5DM0A 3GR6A 4EFKA 2HDNB 5H3CA 5LMNB 2ZI7A 2VZ8A 3EOAI 3BSSA 1ZI6A 3HUTA 4I1SA 4QOJA 2OQVA 1X7WA 3L0DA 3KB1A 4ZAYA 1TXGA 2YZMA 3IA7A 2O54A 3N6RA 3GA7A 1DEAA 5GZ1A 1XHLA 2QZ9A 4DNQA 1FUEA 4HAXA 4H59A 4HGZA 4JVLA 5KOJB 1F3OA 4BVEA 4X62B 1MENA 1W4ZA 4WZAB 3D2BA 1BFUA 1MH1A 4J03A 5I4CA 4ZQFA 3BSWA 1LA2A 3FPCA 3FSJX 1K66A 2LUOA 2GDZA 2YHIA 3CF4G 3TSCA 3WYFA 4AZVA 4Z0PA 4CDRA 3PE6A 2P8JA 4M46A 3F96A 3P0IA 4EBBA 1YQWA 3NDIA 4IH1A 1CF2O 4UHKA 2BFBA 4RIFA 2HLDA 4ZP1A 4NMLA 5AVXA 1E59A 2AWNA 2NSJA 2C29D 4YRPA 1I5EA 4KC0A 2VF8A 4UUMA 3LK6A 4MUNA 4ALIA 4W9MC 4RF3A 1CNMA 5L3SA 3RYCA 3ZU2A 2RH4A 2ZR8A 2JFVA 3EIOA 3WMEA 2IV3A 2I2WA 5CFQA 2HDWA 1IXYA 2YY7A 2GUWA 2QYTA 4PYRA 1PL8A 1IJBA 4LXXA 1GAXA 4LYFA 2JLCA 3ASVA 3OOSA 4G4SO 4LMBA 4PFKA 2AOXA 2VPIA 5KCMA 3A1CA 1IULA 2FI1A 3WYEA 1QFMA 3QY0A 1IWBB 1EG7A 4G89A 4IIUA 2HA6A 1OAKA 3EXHA 3ZTWA 5I7HA 1ZZEA 4GLOA 3LPDA 5FF9A 4X63A 1IPFA 2RKBA 4Q9JA 1L5FA 3ZBUA 2H5JA 1EM8A 4JR0A 1O0CA 1SBZA 2D06A 4B9EA 2XYVA 3S2UA 4QFMA 4QOGA 3A6DA 1S02A 3WL3A 1TUGA 4ZCRA 3UIEA 1VKZA 4XKJA 3JY6A 2EX0A 2XRZA 1Z6AA 1O0BA 4AJ2A 4WN9B 4MLPA 1U7WA 1B0PA 2M6LA 1LH0A 1ND6A 1OXVA 1ZN9A 4AVYA 1UK6A 2IYXA 4BC0A 4HDSB 4LWPA 3FGNA 1AS0A 2ZWIA 3RDPA 3B8HA 2GZSA 1IOWA 1RZVA 2NXEA 1OIWA 2RI0A 4UM9D 4M21A 4O08A 3OIYA 3RG2A 3ZTYA 1IQRA 1TYEB 2JGDA 4HH3C 2VP6A 5IJZA 4QQNA 2ZZMA 1IQ0A 4OH1A 3OJFA 4C78A 4BFWA 3DQPA 2P62A 2V8BA 3WGUA 1EE2A 2HJWA 3LGXA 3PTLA 1KU6A 1Z4QA 3VOTA 3G9QA 3HJCA 2WFZA 1PVDA 5INTA 3MTEA 3TE7A 4DIBA 1DGQA 5EZ6B 4PIVA 4LF8B 2O2IA 4EO4A 4HEQA 4MR7B 4DWWA 3JATB 3G5AA 2CXPA 1RI1A 1OFVA 1KDOA 3TN7A 4TTVA 4GEGA 2QM8A 3K0FA 2HK9A 2DR3A 2PPLA 2VHWA 1OZ0A 1TF2A 3IPLA 4MCIA 4WRRA 3SYRA 5K1ZA 1BZYA 3TJZA 5TEWA 3U4MA 1ZNWA 5IAKA 3GYGA 1WMSA 1VJTA 5BQXA 1BA2A 4Z5XA 2PKQP 2CMKA 3GZNB 3UYKA 3EMBA 3TNFA 3QXJA 3G5LA 5BV1A 4LGYA 4XIIA 2X9GA 4WUTA 1FSSA 4RADA 4BGEA 1HLGA 1VPTA 2XI4A 2FWPA 4AULA 2CE2X 1PLKA 1RI3A 3EOBI 1BN6A 4MR8B 2Q46A 4IDPA 4N6NA 4PE5B 1KRWA 3I37X 1NVDA 5GIOE 3BTOA 2PFSA 3BG5A 1X19A 5EMLA 4MDEA 3BYZA 3VH2A 2YW9A 4NR0A 3EMVA 5EJMA 4FSHA 5KQLA 1DAGA 2GFIA 4MVJA 1P3DA 1N1GA 1SZDA 4X6UA 3GLIB 4R2WA 4NULA 2G9NA 4MAMA 1PR0A 1G5HA 1IOLA 4P54A 3UV3A 5DBFA 1V35A 2H4HA 1DQYA 2PH1A 2WINI 3OZXA 2IOFA 4UEJA 3W6PA 3OA2A 3FZQA 3GP5A 4QGSA 3R7LA 3D8NA 4B3BA 1K6JA 4ARZA 4A9AA 2X0DA 3RW9A 4EW2A 1PZHA 2P9ZA 3FR7A 2IBSA 1VHTA 5SY6A 1VJ0A 1Y7PA 3CYFA 5AM4A 2ZBRA 3JYOA 1L5HA 1UC8A 4PG6A 3KYBA 3TLZA 1W85A 4II3A 3U4AA 1RWBA 4EA9A 1J49A 3UBTA 1UEXC 2FQYA 2ODNA 1F12A 1VE6A 2ZKLA 4O4JF 4QE3A 5AVJA 5C8XA 5FUQA 1QRRA 3HKDA 3W78A 5TB5A 1IVSA 5I8PA 1R6DA 5ITVA 3ORYA 3RFXA 2Q3BA 5DNEA 4RVFA 1S89A 1JR6A 1XELA 4MVJF 4EMBA 5AHOA 4Z2YA 4QULA 3N59A 2UXDB 1H0SA 4KBYA 2IIVA 1R4AA 4LXHA 4R51A 3AB8A 4IGKA 2EC5A 4D4HA 1KOJA 3CH6A 4C3UA 3THXB 3C3YA 3MB5A 1UZUA 3P7MA 1DTEA 4RVUA 1ZJ6A 1NONA 2P6MA 1CK4A 2E0IA 2D0IA 3CXUA 1KDZA 2AUNA 1WAMA 1KJZA 2I62A 2ZWOA 3ISJA 3IDFA 1QBGA 3M5CA 1MJHA 1VE9A 2Y66A 4WE3A 1BXKA 3ICVA 4MP8A 4B2YA 2GF9A 3ECCA 3F7MA 3ZPXA 1CUYA 4BNDA 3H11B 4CEJA 4AJNA 2HA0A 4CKWA 2Q0HA 4MIKA 2X5OA 1EHCA 3K9BA 4RV5A 2F43A 3C5WP 4LXGA 2X9NA 4KQWA 4BB5A 1YFLA 1IN6A 2B1JA 1PJCA 1KJ8A 2BEJA 3DAOA 4YQZA 1W44A 4K9DA 4B44A 3KZCA 4NE9A 3QKSB 2AFHA 4X6LA 2J48A 4NCKA 1WZEA 2GS9A 3VV2A 4K9QA 3M6AA 4BVLA 1UDXA 1EUDA 2L2QA 1W48A 2ZSKA 3B1KA 3L7MA 2BGKA 2I3GA 3L0BA 1K7SN 2I6FA 3O91A 3ZWYA 3LQFA 1J7KA 1ST2A 4K9NA 2CNWD 4I1PA 1G38A 1KIMA 2XKBA 5B1DA 3NM5A 1DARA 3N39C 1LB1B 2P7IA 4A0GA 2V96A 1ZIDA 3R76A 3ZD8A 4B7XA 3I58A 3NASA 3VSDA 1NNI1 4P81A 2ZJ8A 2ZIXB 2EX1A 1F8XA 2IRWA 4HUQB 1COZA 1P72A 3K9LA 3PA8A 1E0SA 1HRKA 3PQ6A 1YS4A 1XRPA 2XA9A 1K5DA 4O59O 1KGSA 1SBHA 2CZQA 3NYQA 5ESRA 2PR7A 3V4LA 3PWSA 1MIOB 1RAIA 2A0KA 3GMTA 1JG6A 4ND7A 4PSCA 2HHHB 2R85A 4RK1A 1FLDA 2HMVA 2VQEB 2JKVA 1Y6GA 5M34A 2A1TS 1LWNA 4HXYA 2EF1A 5A3QA 4ANFA 2VXYA 4EF4A 3FVQA 3LAWA 1JDJA 2PM8A 1QGZA 3LBYA 5KYVA 5DTQA 3P9CA 3THRA 5C32A 1EFPA 1F6DA 2XUFA 4IYRA 1VLQA 3FCAA 3LKZA 4QQFA 4YJ2B 3TOCA 3DL2A 3MLEA 3KSAC 1E3MA 3AHHA 4Y7CA 4KXFB 3ZYCA 3DTYA 4W63A 4D80A 4KFSA 1Z2PX 4L5BA 4YCAA 1P77A 3D0OA 5EZYF 3U4QB 3ROZA 1U8AA 3NBFA 3CISA 1M33A 5DYNA 2OZLA 1W46A 3K70B 3MVEA 3X2EA 1JHMA 1WZIA 4V0LA 4LJAA 5I9IA 3PS9A 1A5AB 1T5OA 2AE2A 5AOVA 2B25A 3H8VA 1ELOA 4ZDKA 3L8HA 1WLSA 4ES6A 3BK2A 2ADOA 1J1UA 2H2DA 2FJUA 3T7AA 4GRIA 3JX9A 3L4SO 4JELA 4TMKA 4TUYF 5JYCA 5AOCA 3MT8A 2RIRA 4EPXA 3IULA 4ER0A 2PL5A 2IEGA 1ZN7A 4HJXA 4IF6A 1S96A 2O1XA 5F5XA 1SCBA 1P2TA 3U7QA 1FXWF 3R2JA 2GSDA 4ALJA 1SQ0A 3RRBA 1KZGB 3UWKA 3QEAZ 3QVUA 5KNBH 3OOWA 3SKXA 4AJ4A 4Q21A 5AUNB 4GNKA 3HB5X 5IM5A 2MTBA 4JJAA 4AECA 3JYQA 4M1TA 1KP2A 4JJEA 4XQ9A 1XNHA 4KWHA 3PNSA 4JGIA 2I2BA 3KTFA 3I05A 2F3SA 4YJHB 4XDYA 3AGQA 4UARA 3D6NB 3QU9A 2O2EA 2D7JA 5GGXA 1YB6A 1SQGA 1EZ4A 1XXLA 2FSIA 4JQYA 3M89A 4M60A 4U7PB 1Z37A 5KDOA 4C4PA 3N76A 1VL1A 3QBTA 1NXOA 3ZWWA 3RTCA 2H07A 1PRYA 3HCDA 1IJKA 1KMIY 2ONYA 4BKPA 2HMTA 2VPXA 3DHNA 4IDNA 4AT1A 3IESA 2BKLA 4B79A 1KAOA 1OXUA 4L8WB 4B2LA 1M8FA 1A96A 2E87A 4ED9A 2HJ9A 4HNGA 3IYLW 2R751 5D86A 4JI3B 1Q1EA 1Z33A 3G2OA 3IQIX 1QX3A 1OR8A 3I9OA 4HSGA 1M2WA 4ZVVA 2QRUA 3LWNA 5FL3A 2GM5A 2G3YA 3BIXA 4HPXB 4I46A 2Q6VA 4L27A 2P9QA 1M1YE 1AKVA 2QROA 3FTEA 1YR9A 1KAMA 1RJFA 1U2SA 1ZQ1A 3HA3A 4AN4A 2C82A 3H4VA 2A5GA 1Q1NA 5I9LA 1JDBC 3G59A 2OORA 3R7NA 5E4JA 1I7DA 621PA 3VDNB 2J5RA 1XDGA 2FEKA 2XMCA 3IA2A 1D2CA 2PU5A 5SICE 3DV9A 2RGXA 3Q72A 4FHEA 4GX0A 4TKZA 2YIMA 4FSDA 4TV8F 2CLOB 2VAVA 3IRVA 2EGUA 4Q66C 4RA9B 4BRUA 3LDFA 1KTIA 2XB9A 3AF6A 2R1TB 2R7MA 3W8EA 2HXSA 2YWGA 1IZ0A 4BGVA 1NBHA 4UUBA 1PJRA 1EFKA 3UFXB 4FXPA 2BCGY 1JQJC 4MINA 2IZ7A 2WJVA 4Z3OA 1ESZA 4JL6A 4L5IA 4FZVA 4F3NA 5FO1A 4JUDX 4NJOA 1BWQA 3DCNA 3SZOA 1M75A 4UBKA 2N3ZA 4DXAA 4WLEA 4WW0A 1ZRHA 1CB7A 4N76A 3OP4A 3O26A 2AG1A 2RGCA 5GV7A 2H2HA 2OHXA 2Z4RA 2H1CA 3NB0A 5A5FA 3PJRA 5COQA 3D5QA 3UAOA 3KIPA 1Y8CA 5JS7A 3ISVA 4IRUB 4BCCA 1ZGBA 2I29A 1AKMA 1PFKA 2B83A 2ZS7A 2QG4A 3ZZTA 4M38A 4R71A 3RROA 3RAEC 1QVZA 1HDRA 4GDMA 1S3GA 1CY2A 3GNLA 2L17A 3E7WA 3RVJA 4KXQA 2CLMB 3JPYA 3SF0A 3UV6A 3DO8A 3FFWA 1N78A 2VDWA 2E4YA 3NIWA 1Z47A 2R8YA 4MW6A 3V1UA 4BVGA 5EJEA 1AX9A 2MSWA 2PZFA 3GBVA 4LRWA 2H1FA 1QF9A 5HRAA 4D5EA 1QMPA 3LUCA 3G88A 1GZ5A 4TN5A 4EYOA 1WBDA 5JJCA 3GC6A 4WK6A 4HWSA 5HILA 5FTLA 3T3EA 2OV1A 3AV3A 3H1GA 3VAAA 1B1AA 4M8LA 1KXJA 3D3JA 4KGVA 1YJXA 2E9SA 3W5DA 1L4YA 1I9CA 3FHLA 3H8SA 3IMKA 4M1YA 4N39A 2F1HA 3T9FA 3UFBA 1BOOA 5CBPB 6Q21A 1AQNA 4YHHB 3OE1A 3PGLA 3JQFA 2H1LA 3N8DA 1VPWA 1T5TA 3KSUA 5JCXA 2QRZA 1L7NA 4R9UC 3HR7A 3KTOA 1ZGZA 2ZAYA 4RD6A 3E9MA 4DQLA 1KYQA 1A4XA 3WSVA 4QODA 4B48A 2HYIC 2PSJA 3KT0A 2D5BA 3C0KA 3FPBA 4PQFA 3UKDA 4IIHA 3V4OA 1N1DA 4CT5A 3U7GA 2NXCA 3EZ7A 2EWMA 4RHFA 3QA9A 3ZHRA 3H6HA 3AG5A 4LBVA 1V43A 4NU6A 1QGUA 2WPNA 4TRRA 2JRLA 4MVJP 3IFSA 2JK1A 3FPEA 4Y30A 5CJ2A 2FSHA 3QUAA 4L0QA 1XQYA 5DYTA 4ND4A 5K0NA 1YDEA 3G0CA 1K6MA 3NC4A 5CTAA 2W5UA 1T6XA 2I7XA 4CM9A 3F1KA 2PK3A 2HSJA 1N0WA 3V8QA 1YTLA 1AXGA 2HMSA 2QG6A 3JQBA 1RQRA 4H7FA 3RR2A 3VZCA 5H9VA 1XKQA 4AZ3A 3KP1A 4AY6A 4KR6A 4LK2A 4A6EA 3EXEA 3F6YA 4TMFA 4BEWA 5BSUA 1AK9A 2XKJE 2XMRA 3NP7A 4ZPJA 5A3VA 4ETMA 2WF5A 1YR6A 4D0GA 1VYHA 2BM8A 2Z1MA 2ZTVA 3E3LA 3GFOA 4QOEA 5AKJA 5B4UA 2B0CA 3BBLA 4AQ7A 1ULSA 4WINA 5ALOA 2C5LA 3GJZA 5L6LB 2GEDA 3I3SR 3L8ZA 2XMDA 1NRWA 4J7XA 5EJIA 1YFKA 4N49A 1Z6QA 5EI5A 2HJRA 2JRCA 2WMDA 1MC4A 1T4DA 2GLXA 1C5KA 2EZ9A 5K01A 1N2ZA 1OT5A 2Q8NA 1HT3A 2G4LA 2HTEA 3GYBA 3NRBA 4N65A 4F9TA 1G0OA 4GQAA 4BASA 4HVLA 2AG8A 1ORRA 1QMGA 2OFWA 3DKVA 1P1RA 1T5LA 2YDXA 5JH7F 2RAVA 5ECGC 1OHHD 1NW6A 4K8RB 5J47A 5TV2A 3OMLA 1DAIA 4ZDJA 3U6KA 5KMGB 3LL4A 5CXSA 1I36A 2ZB4A 3K1YA 3ZZMA 2I91A 1ZNQO 4OD0A 2J4DA 1P2VA 2CHEA 3WRYC 1EDBA 3DTNA 3U37A 2QMZA 2Y05A 3TL3A 2R62A 4BO8A 2GN0A 1T2UA 3VZPA 3MHPA 1ECJA 1E6EA 1GUAA 4GPD1 4XIYA 3U44A 4OLBA 4EKGA 5BMVB 5EXTA 3A1UA 1E2JA 1Y1KE 1Y7HA 1M0SA 2A0WA 3QF7A 4O4IF 3R7BA 1FVHA 1XPRA 1T8SA 3AOGA 4M2LA 4ZYXA 4RIEA 3PT9A 4YV1A 1Z38A 1R00A 2CVPA 5SZIA 3HMKA 3OIUA 3DDWA 2ZW9A 4D6PA 5HF6A 3RK1A 3IL2A 4UD6A 4K87A 4M0EA 1MF7A 3H17A 4EPRA 5C1OA 2VK2A 3IUSA 2FZVA 5DXJA 2OFFA 3DVLA 2PMDA 3FRJA 2IHUA 3TTWA 4CJXA 2A3RA 5E7JA 2OZVA 1T8YA 1WW8A 2CLFB 2AEJA 5DEIA 2G0NA 3C7CB 1TPZA 1AQ6A 1RCUA 2R79A 4CM8A 1R5BA 1KI9A 1H6AA 8LDHA 1T9DA 4LISA 5KOIA 3J7AC 4D6XA 1X7ZB 3D0KA 1WF3A 3ZD7A 2YXDA 3ZHYA 4AX4A 4LBYA 4PXSA 2A9QA 1GYQA 1FS4A 1N2IA 1SBNE 2ZCVA 1MG5A 5AIBA 4KXVA 1X8JA 2BGLA 4UPEA 1VIDA 2JFUA 2VL7A 1ZOSA 3CO0S 4QUIA 5ALPA 2ESRA 1WSWA 5BT9A 4E1VA 3DL0A 2BHNA 1TGYA 3BTUA 3ECSA 2FK7A 2Y9PB 3KL2A 5KQMA 1I7SB 1RJWA 2A4MA 2RGBA 3O03A 5DCYA 3F4BA 5JAMA 3U48A 5HIIA 2GAOA 3A8TA 4PLYA 5IYZF 1A8QA 3QMMA 3C6BA 4LG1A 5FPKA 3BIFA 3DDHA 2BGJA 3ZS9A 1P2UA 1BC5A 1R4MA 4PEVA 4R5MA 3ZGLA 3CTPA 1SU6A 3DKKA 3TBHA 1CEQA 1DEXA 4MVJD 1TC2A 4KP7A 2G71A 3DMDA 1XVVA 3RLFA 4BLWA 4NK4A 4BYGA 4DR5B 1ULZA 3LQ2A 2V6BA 2GBLC 4GMKA 4W82A 2R48A 4YDSA 3ZXIA 3NALA 1L4HA 4F5EA 5KWSA 2QUBA 3S2ZA 3G49A 3O3MB 3K94A 2I2CA 4FS3A 4QUHA 1IXZA 1RQLA 1NG1A 1Q50A 4RZSA 3RNOA 4I4LA 2A5YB 4GWKA 4JGGA 3Q85A 2WABA 5ETJA 1SHTX 4MW5A 1F9AA 4TKUB 2VF4X 3DMRA 1GZSA 2GHQA 4NV1A 1KSHA 1Z4OA 4H3KB 3WDSA 4RPCA 3LCUA 4CM4A 1V8ZA 3T61A 1ZD8A 3EGWA 2H1SA 1RRVA 2A7XA 2C4WA 3GWZA 4E51A 3T12A 13PKA 1VXOA 4C1NA 3IDOA 4ZZIA 2NSYA 3O47A 3MJVA 3ND9A 4CUKA 2BFEA 4Y6LA 1E3EA 2ZCUA 2R6R1 2YVKA 4KACA 2XUPA 1E98A 5J5VA 2BELA 2F8LA 1DQSA 3QBEA 5THQA 4DCMA 3NEAA 4KIJA 4Q15A 2WU1A 2R7LA 4QGHA 4DGSA 5K0LA 1DE0A 2MOKA 3BGDA 4JSTA 4UD2A 3IIEA 1IAQA 2VYVA 4RO0A 3SBEA 4RFSA 4PGGA 2IYZA 3T1VA 4G86A 1VCIA 5GOZA 3JWIA 4N0EA 1UK7A 1PNQA 3AQIA 4GOND 5HWSA 3FVWA 1AF7A 1DWPA 1E2MA 1XZIA 2YJZA 5AM0A 5IU6A 1IHXA 1OX5A 3IHWA 1ISHA 3HO8A 1Y6FA 2XXAB 1X1BA 5LQAA 5FBHA 1WO8A 3TSAA 1ZUD1 4AP6A 1LD3A 2CHUA 3JAKB 2O6LA 5IWAB 3AIIA 5FOUA 4FZ3A 4DLAA 2LGJA 3CRMA 3KLOA 1Q0RA 1ZVQA 2IEAA 3GFTA 4TTAA 5JSFA 1SHJA 2CVFA 2J3KA 2ZWMA 3Q9NA 5IC6A 4I55F 2BE9A 2QW1A 1WULS 3X1KA 5TLSA 1GNTA 2KYRA 2ZBGA 5F23A 4N5DA 2D7CA 2V0NA 2G70A 4LJ9A 2ZULA 3P27A 2EJBA 2ZTSA 4Z9FA 3U81A 4UNSA 1ZCFA 4KOAA 2G67A 2WIBA 2ZETA 1KEVA 2ZJBA 3I01A 1JE0A 1NKSA 2JJ2D 2VYFA 1ECPA 3N0WA 3RVKA 4IEEA 2WZQA 2CDAA 2EW1A 3NNSA 4Q3CA 1Z07A 3VO9A 5BSVA 1ZVMA 4MEJA 1CW2B 2ERYA 4CLRB 4I1RA 5GJWC 2VDUE 4OL9A 1PS0A 5AP9A 5EKTA 3B85A 2WWIA 2IOFK 1DJOA 3SBXA 3VYRB 4BMCA 1VYTA 1LTHR 3LBNA 3PJDA 3ZY4A 1QRAA 2BAGA 2E4VA 4F7WA 4BV9A 1LSJA 2IC5A 3LE8A 2GK7A 4OI4A 3AW8A 3RWMB 4L8GA 1Y3HA 5EMJA 2JGKA 3B1XA 4HEA6 1KZ4A 3TEMA 1ML3A 2V7VA 5DNWA 4D4LA 1T35A 4WY2A 5ICFA 1C7JA 5EJFA 3SNKA 1A1SA 1XMJA 4BEBA 4DLPA 5LDDC 2NYRA 3ME5A 5HNKA 4D9MA 2GLUA 3E9CA 2CZGA 1RRMA 3ROPA 2P4QA 3ZN2A 3BJIC 3W2GA 3TGWA 3WGYA 5T5QA 2QPAA 3UJHA 2ZI3A 1HE8B 1V1MB 3KJNA 1GGJA 1QO0A 3AFMA 1JEQB 1CZHA 2W98A 1XQWA 3G0DA 4CM5A 4DBLC 5AW2A 3U19A 3T3MB 4AZ0A 5EJ5A 2R6CA 5EZ5A 2C61A 3T9CA 1C7EA 2XF8A 3DMFA 4P3OA 1MJ5A 4JYBA 3TJMA 5D01A 2XVAA 2AYZA 2VAMA 1OKKA 1E69A 2H3HA 2AEEA 2X6TA 2DQKA 4WVFA 4YTEA 3BL5A 5B1HA 3ZLTA 4KYTA 4DCPA 3ZDCA 3DZGA 3GGPA 2ZBDA 7GPBA 4CLRA 1X38A 3D4IA 3LD9A 3OCXA 4GXRA 4HEJA 4JFRA 4W1SA 3ZI7A 1H0HA 4Y0VA 5JAQA 1OY1A 2I4NA 2OC4A 2OVBA 4BNUA 3VMMA 2J1LA 3DBOB 1N6HA 2I3BA 2Z98A 4RVCA 1C0LA 1QH1B 1WRBA 5E1MA 1ETHA 3K0EA 2P0EA 1VSBA 3LSTA 5K3CA 1YO6A 1BXRA 4N0QA 4KWTA 4P08A 3PVSA 1USVA 2P2SA 2EFEB 2R1ZA 3GJ3A 4KDFA 3CN7A 3LO5A 4MRAA 3PTZA 2C96A 1MBZA 2Z6VA 2C3UA 4NNOA 3ZVMA 2GNPA 2AWOA 4C7KA 1TNDA 1L4MA 3CVJA 3PUKA 2VTBA 2Y4OA 2AJTA 2DFNA 1HG0A 1G5FA 2PEYA 2BZGA 1BD4A 1I4OA 3CLSC 2Q1XA 3A9UA 3OTQA 1HXHA 4JOSA 5CH3A 4UEOA 1AKRA 1XDBA 1Z35A 2VSYA 3F47A 3IO5A 1AN0A 2EXXA 1ISSA 4REQA 1E6UA 4ESEA 1O6FA 4CV3A 5IEJA 2GD2A 4PIPA 5ES3A 1Y98A 2OZEA 3PT5A 3U44B 2UXCB 2PUEA 3LCCA 1O0SA 4OH7A 2YV4A 5E2IA 2ANCA 4Z6KA 3H5WA 2X5JO 3BKXA 4JLNA 4RNCA 3LTEA 1DMSA 2ZBQA 5A62A 3PC8A 2IP2A 1NG9A 1T15A 3R4VA 4YBRA 4CQNA 3GNQA 5I7RA 3EWAA 2PGXA 2W7TA 1T3TA 1SOMA 2Q0XA 4TS4A 3GPCA 1YR1A 5JDIA 4MUYA 3O1HB 2FWIA 3KVNA 4FFDA 4UDXX 1DC5A 3KAKA 3WQRA 5HZKA 1PVOA 4EZBA 3LW8A 3FIUA 5EHZA 3ZKWB 2CFOA 4P3KA 3B8EA 1A27A 2VUTA 4IIYA 1QH1A 4ITRC 1WV0A 5F9MA 1F8FA 1Y6JA 2GPNA 1NN3A 2PS3A 5IHXA 3C1AA 4GKJB 4PZUA 2ZRGA 3ZWAA 1ZSVA 1W93A 3QZUA 4XARA 5ECDA 5GIPE 5EMMA 5B6PA 4RBNA 1J23A 3C7TA 4RXMA 3OOHA 4FEGA 3R8CA 2GZRA 3GQBA 1VDZA 4CKBB 3WNCA 2C03A 4LGCA 3QOFA 2Q6LA 4DQKA 3ENVA 4L16A 1ID1A 1XYVA 2ZRIA 3TQCA 4NC9A 4P4TA 5DFAA 2WPDA 4Z4IA 1HYGA 3E5RA 4OV6B 1C50A 1UMKA 1SRQA 2EZUA 4UU0A 4CTOA 1OU4A 1YJCA 1PUXA 4ND2A 3LYHA 4HRAA 3CNEA 3ENWA 3KT3A 4MQ5A 3UATA 1JALA 3EF0A 1GA6A 1RJ9A 3BSYA 5GPBA 4HX5A 4A8PA 4YT4A 2ZE5A 2W58A 4JB3A 2P77A 3B1JA 5IKOA 4YT8A 3FLMA 4PGFA 4BPBA 1NXPA 4MNTA 1D2NA 5IDYA 3AR8A 2GTPA 1OWPA 4M9CA 1NUTA 4G0VA 1RXWA 1EVEA 3KPVA 5GTDA 4XVQA 3C3EA 1QP4A 4FNGA 1W47A 4O33A 5IJ0B 1OFHA 3NHLA 5DHUA 4M0FA 5LUAA 4P4SA 1L8OA 1SVNA 3EBLA 4X44A 3HYLA 3LI2A 1LPSA 1NWCA 3A10A 3SVZA 1RFGE 3KZ1E 2HNKA 3Q5EA 5J2TF 2OLJA 3GXBA 1BMFA 1E1LA 3S2IA 4J3NA 4H6WA 2RHJA 2B98A 5DYYA 4JL8A 1FRVA 4ITVA 2VJOA 1Y1QA 4NICA 4OAQA 3UMRA 5CDHA 1QNFA 3ZE0B 2EOAA 5SYAA 1PX2A 5C35A 2XYHA 3H9CA 3I9V6 1AJEA 1IDOA 2XT0A 4AW9A 3LP5A 2JCGA 1J21A 2ONKA 4GSKA 1H05A 4KLRA 4XEHA 4BNWA 1QYCA 3T7KA 1UBEA 4JA0A 5IH7A 5LPNA 3NRJA 2XUJA 4NG5A 3V8VA 2HFKA 2AKYA 3W9UA 1IUNA 1C7QA 4I4CA 1U2PA 2G72A 1SWVA 5JU6A 2VH5R 5F5LA 4BIIA 3G2KA 3H87A 1EB8A 3L07A 4AS1A 3QH4A 1UXJA 2DHEA 2PKXA 1IN4A 4JHXA 3Q8KA 3HR8A 1QBKC 4ASUA 4ZQHA 4PINA 4RDHA 3NNNA 4BPRA 2WFLA 2FPPA 3A9SA 1N6OA 1S5PA 4LSMA 4E46A 5KZMB 4G0QA 1OZGA 3FDFA 2FLVA 3OHMA 5FFMA 4QNMA 2W42A 1WZCA 2ODTX 3KOZA 4WAUA 1HC7A 3DEIA 3T5CA 3GMDA 1V16A 2CUTA 4DIEA 5CD9A 3IBSA 2I4LA 5B3KA 5HZMA 4ND3A 4WBNF 3JZIA 1N2EA 4CM9D 4O2BA 3NHPA 1PNVA 1XALA 4YHBA 5K0FA 4P0PB 4AKHA 1S9HA 4IKEA 3P9XA 4FYHA 1IU9A 4J29A 5HQTA 1Z45A 4QKQA 3HY4A 4Z0TA 1SULA 2CLLB 3CCBA 3SIRA 4HFJA 4F1WA 2VDMB 3IP5A 4AMZA 2H7XA 5CH5A 1OH5A 3RV3A 3X0DA 2IIBA 3AXTA 3UA3A 1RQGA 4LY0A 1ULHA 1TLLA 3UWMA 1EFHA 4DDMA 3UK6A 2ZR0A 4LJ8A 3U4DA 2OV6A 2Z04A 4NU0A 4O3FA 3AF3A 3ZJ4A 4G0MA 3LYAA 3FDZB 4EX7A 2PAFA 2IV2X 4TMYA 3B89A 4OK3A 4BEVA 4IS2A 1QIDA 2CXRA 4FFOA 1YK1A 5IASA 1N6RA 1V8BA 4E5PA 3UB2A 4JI8B 4UUAA 3GGOA 3GJ8A 4ZTUB 1NLFA 1FZTA 1YDMA 2QTMA 3H1EA 3NBXX 5AJTA 4IG4A 2VDQB 1NUPA 4FGUA 3PNMA 2QGFA 5CT6A 2FUKA 4D9BA 4U2GA 3QXHA 3ZIAA 5HM6A 4CMIB 3IJEB 4RVGA 5CJJA 3ZVLA 4TTTS 1V16B 4NONA 4DEXA 1E6MA 2QMQA 2R97A 1EINA 3FH0A 3AR2A 4L95C 3EGOA 3OQ1A 1UOOA 2WD7B 5ITZA 1RXVA 4UHEA 2AQKA 4KN8A 2YCLA 3U49A 5KQRA 3LBFA 3BB3A 3ETGA 3T5BA 3U3XA 3EXHB 1FFXA 1FYXA 1RW4A 2IEYA 3OZ7A 1N4DA 4PG7A 5HDBB 1R6TA 4RCVA 2GZMA 1OT3A 1CEYA 2Q5EA 2AI3A 3IUEA 4ER7A 4UM8B 1J42A 3HA7A 5IKEA 1SU7A 2WAMA 5B2ZA 3S70A 5AVKA 3GELA 2DXIA 1XK7A 1Z8DA 3AEZA 3QU5A 3TLBA 1BXGA 1T13A 5DK4A 1ZL2A 1EWRA 3SQNA 3I1FA 3UYLA 3PRKE 2NUPB 4S0ZA 1FQWA 2BTQB 3THWA 1QYDA 1WX1A 3D1VA 2VT7A 3V2HA 2RG7A 1N5RA 4Z54A 4BB9A 1T9GS 2D4HA 4TXLA 3SBOA 1THGA 4QUEA 3T7CA 1BHSA 2ZRJA 3OZSA 4OP1A 4MRMB 3ENKA 5AI6A 3OTWA 5KWJA 4IMPA 1OE0A 1N25A 4JJ6A 4LZOA 2FSPA 1GU0A 3RVMA 2FG6C 5C3UA 4MUBA 3TKYA 4NCHA 4A23A 3VU9B 1C3VA 4X20A 4A91A 2M9MA 1G3IA 5B1YA 3KM0A 4WCVA 4HGOA 4L5AA 1ZY2A 2X77A 4QC2A 2CJXA 4HNRA 4M76B 5K0CA 2HRRA 2LNDA 2BLNA 2BUAA 1PWXA 3JSXA 3PXEA 3ZE2B 1XCPA 2OHFA 4DNXA 1HEYA 5EJ9A 4EABA 3IT3A 3UGKA 1ZRNA 1SFRA 4HDKB 1C4WA 2J3DA 2RSLA 2WIKA 3WRVA 2Y76A 2WYUA 4FMCF 5IARA 3W5BA 1F60A 3DLTA 1Q0SA 3PK0A 5CFZA 1VDMA 3K31A 5DWDA 5EG5A 2BT4A 3TZBA 2G7ZA 1JR3E 2X9QA 3HL4A 1QGOA 4ILKA 4OXNA 3WI7A 3ZK7A 4IDDA 4D9KA 4MAFA 2SKDA 3EGDB 3NATA 1KK3A 1PHRA 2RCYA 5GONA 5T4FA 3UTDA 3ZHCA 4EJFA 5JVDB 4IXMA 1H23A 1QHNA 3NWJA 3AFNA 1OSNA 3EGDA 2P3SA 4QBHA 4U2FA 2QTZA 3ZU5A 2W0MA 5FOXA 4DNFA 1R6XA 5K7SA 4PHGA 1KSJA 4LPKA 4UHDA 5TQ0A 4NJMB 3OIFA 4HP8A 3RIGA 1SG6A 3ZBQA 3U9LA 1KKMA 1QFXA 3G0IA 4RZXA 4C07A 3P2YA 4L72A 2TMGA 6ADHA 2VPZA 3L7AA 4AJ9A 1X80A 3WP1B 2G5PA 5FOWA 1N9ZA 1KI3A 1A2BA 1B14A 4QYMA 4C4ZA 4NBLA 1TJ4A 1JIJA 4GMHA 3RSSA 5IZCA 1J0XO 3JASA 4MPPA 4BFZA 7MDHA 4YY3B 4ZTBA 4JXZA 3TZHA 1ZJWA 4UW9A 4OYYA 1EDOA 3ZCRA 1UJ4A 2AJBA 5ALJA 5G3ZA 3UGJA 3O82A 3GG2A 1XRQA 1DKOA 3B7PA 4ZZ1A 1GQ2A 4WOBA 3A9RA 10MHA 4QATA 3RUEA 4Q4HA 2UZIR 2X9LA 4BWGA 4BNJA 3WB9A 2AVDA 3N87A 1TO2E 3HTXA 2OWEA 5DNDA 2BTOA 1U04A 5JPIA 2YJ4A 1YDGA 3QIVA 4ZEWA 1NQVA 3TMYA 1FJGB 1M8PA 2H57A 3CR3C 2C1EA 2PX3A 2TYSB 5CLIA 2NN3C 2M1ZA 3IUBA 4EYGA 1GEEA 2FZLA 1LF5A 4QXMA 3DZJA 3TZCA 4V38A 3EGXA 2AA3A 5FYDA 3DXYA 3ZGYA 1XHEA 5LNK6 3RRNA 2Q3CA 4E5VA 3FYCA 1MQAA 3EOZA 3H9EO 1IATA 1TJNA 2QLLA 2RJNA 4QHYA 1O4VA 3N28A 4O63O 2MSCB 4D9GA 1KQFA 1JEYB 2B0JA 1Y9ZA 1M76A 4AKEA 2BE7A 1RTTA 2QLTA 4XQGA 5FNVB 2R25B 1CPYA 1Q22A 2G82A 1J20A 2NM0A 2Y1FA 2BFFB 1JSZA 3FXAA 3OE4A 3TL6A 5FI5A 1E6KA 1KK1A 2QHXA 3SJ7A 3WOHA 1UM9B 1JHVA 4KVGA 5DI9A 2IX9A 4DB4A 3TDMA 1Z63A 2G5TA 2JHAA 5L4SA 1FNBA 2FGJA 4F4JA 1A7KA 2PPVA 1XT6A 1UBTS 3LKDA 1KU0A 4TLCA 3SQMA 3R5FA 2J6IA 4IF4A 1P2GA 5LMUB 2OCIA 2FW7A 4IO1A 3DPUA 3IP6A 4JAVC 2I66A 5ELMA 1D9ZA 3WWCA 4OK6A 1OUMA 4JBGA 3ITNA 4M54A 5JTUA 3ED1A 1JHDA 2PH5A 3BDIA 3G82C 3BSFA 2XB6A 5AUOB 1MX3A 2AMJA 3TJRA 4DA4A 1I6LA 4CKCA 2O2HA 4B45A 3C6YA 2FP4B 2QZ4A 3DO5A 5EIOA 2FUG1 2LW7A 4RGYA 5COAA 3DHWC 1IUPA 3QYJA 2JJ2A 4AG6A 5FUVA 2GJ4A 1R4MB 3I9NA 1E1QD 4URYR 1VG1A 3E22A 3DBVO 3SHWA 4EAQA 1IE3A 4CQJA 3JVUA 4QOIA 2KMLA 4ND8B 1CQJB 2WFLB 6YASA 3IUPA 1V7ZA 1RC1A 2V65A 3FCUB 4J9VA 2C2KA 3M4JA 3EZNA 1H9BA 1K2VN 5FNVA 4ZYVA 3Q87B 1CX9B 1U1EA 1Z3CA 4OUDB 2Q2OA 3GCDA 5AKZA 3TTVA 2OOSA 2VQFB 4Q6WA 2QRVA 1NY5A 3ZC3A 5LXTF 1FNDA 3WLRA 4LQCA 3QMVA 2ZRQA 1JL3A 2PYDA 4BQIA 4LZLA 4EHBA 3U0BA 4L5JA 3LG2A 1UL1X 1NF3A 1ZITA 4QO8A 2AV6A 1YHNA 3IH5A 2QBYA 1JU9A 3OZAA 4ZCPA 5JBQA 2DP4E 2J5QA 3KR0A 3TBFA 5IABA 3SQWA 1NW5A 2GCNA 1TCAA 2OUIA 1NX9A 1RYBA 2X6RA 4MA0A 1HQCA 4TZ6A 2WHPB 3CF2A 1UM8A 3UMFA 1Y6RA 3HP4A 3NC0C 5FOQA 4I5FA 3IXQA 3AY7A 4GP9A 5B7GA 2WSSA 3GZTB 2NU9A 1RRPA 1RM0A 1TJYA 3DZDA 2YMQA 2J4CA 3GLFB 2IPOA 2P75A 4KNYA 3NWBA 5FLYA 3AVOA 1Q15A 3HXKA 3AB3A 1YXMA 1R0SA 5E9JA 4MO9A 1JAZA 4D6YA 4JFAA 5C37A 1E2IA 1I0LA 2YOFA 1WXFA 4AY3A 2V7PA 4P80A 2M6KA 3QBVA 3BXXA 1P6UA 1EUQA 3GQBB 2WZDA 3TDKA 4IG9A 2VTBB 4UTVA 5AVTA 5JLJA 4X54A 4N3BA 1UBGA 1K2WA 3HDTA 4JD5A 3KSDO 4QQRA 4WI1A 1W35A 1USGA 2IUFA 3TTUA 5FOTA 2ZJ4A 2V03A 1IWOA 3VZBA 3DZFA 3ZE8A 2O0JA 2NVBA 4P6VF 3EC7A 4BN5A 2WKPA 4Y2QA 4FNOA 3X43A 2QPOA 1LI5A 3C1TA 3LLUA 4OXXA 3Q8XB 4AICA 5EWLA 3WLQA 2DR0A 4RF4A 1QDLB 2UZ3A 4BE4A 3PITA 2PLAA 3JQ8A 2ZSIA 5IH3A 1JSRA 3MIZA 1DZ3A 2PX5A 4GNRA 4RPKA 2NU8A 3OP1A 3MRXA 4GPBA 4LZWA 4YJFB 3VVCA 1VE7A 5GQSA 3AJEA 4PZCA 2GT1A 1S8FA 4C06A 1JIUA 3OCWA 2GZ3A 3RT9A 3WLMA 3SD7A 3GZ4A 2O8EB 5FTJA 1XU7A 1S2LA 1BS2A 4XGKA 4CCWA 5AO9A 3ETCA 3QY9A 5L4LA 3H97A 1R8QA 3RC2A 3LCRA