4L5BA

Human dck c4s-s74e mutant in complex with udp and the di-43 inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
231
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title Development of new deoxycytidine kinase inhibitors and noninvasive in vivo evaluation using positron emission tomography.
pubmed doi rcsb
total genus 90
structure length 231
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l5bA00
5GJBA 3QBTA 5CM9C 1JBKA 1QVRA 3EC2A 3B2EA 4NYIQ 3RYTC 3IPYA 1E94E 5FOUA 1KKLA 1PUIA 2P6NA 4IVRA 3UXMA 5EZ5A 2ZTSA 3U2QA 4US0R 4QGAA 2G1JA 4RZ2A 1KHTA 1KJYA 1OT3A 1COWA 1CXZA 1N0VC 3CR7A 2QSZA 4Y0VA 4RCZA 3VFDA 4HLQB 4AWXA 5EXTA 2OESA 1ETUA 1FUKA 1NVVR 1TQ6A 2VSXA 3PEWA 4HLUA 4OI1A 1YZLA 3FWYA 5C4GB 4Q5IA 3AF0A 4PAMA 1PZNA 2ZE5A 2J7KA 2JJ8A 4CEIB 5DH9A 3OESA 3BH7A 3Q5DA 4CZ2A 2OEPA 4IFBA 5JZVA 4ZIRA 4HAXA 1S1CA 1GM5A 2G83A 2W6JD 1WQ1R 1TQ4A 3LBIA 3GEEA 4KVAA 4MGYR 5F3WB 1XMVA 2IC5A 2XOKD 2JJ2D 4IOKA 4TN1A 1SGWA 1R2QA 2RGXA 1T0JB 1XEWX 3LLUA 3BB4A 4QHTA 2ZRNA 1P6XA 3VKHA 1OB2A 2IXGA 3RAPR 2ZVQX 2F7SA 3B1XA 4FCWA 4NHOA 5C4MA 4B6FA 3SQWA 4ARZA 5FOSA 1MABB 1Z0AA 2IYZA 2ZRGA 3MLEA 5AJWA 4E07A 4W9MC 4D25A 1SXJD 2QAGC 4HUTA 1MRSA 5A5GA 3SFVA 4YMTA 2H7VA 1OH6A 1D5CA 3IIKA 2J45A 1AN0A 1CJTC 5LBIA 5AWFC 4B3DA 1XXHA 4LJ8A 4HAYA 1Z0DA 4EDHA 1NBMD 5CDFA 4HAUA 4QG7A 2JLYA 3EAQA 2W6JA 2OUKA 1ZINA 2R6FA 2IYTA 3B8HA 4TYQA 4CT4B 3MGCA 4GOJA 3RVBA 1XTKA 2RGGA 3GJXC 1E9SA 4IKEA 4A9AA 3I5YA 3PEYA 4RVCA 1UBEA 5FTMA 2HCBA 4OJKA 3K9GA 1HA3A 2ZE8A 4II7A 4TMVA 2B7CA 2I1VB 1Q3TA 4MRSA 4NYJQ 3HYRA 1S0UA 4KI0A 3ZD6A 2PZEA 3NEYA 4PPQA 1J2JA 1IN8A 2WKPA 3CPJB 3AH8A 3PJRA 1RW4A 2ZUBA 5LPNA 1NF3A 3OZXA 4MRVA 1NG9A 3ZS9A 2DR3A 2HT1A 4QBFA 1HQYE 2GESA 4QJ4A 2G3YA 3RRZA 5KNDA 4DCVA 3ZQJA 4XSGA 3TJZA 3AKCA 3W6PA 5TB5A 4GI7A 2QBYA 4A15A 1D9XA 3SYKA 3B9QA 4KBFA 1NVWQ 2ZE6A 3L2OB 3M4YA 3A6PC 1FMLA 3W5IA 2ZI5A 4L4UA 1N25A 4Z1MA 4JYCA 3PV0A 4W5JA 4Q4JB 1ZYUA 4URWR 2A2ZA 5JRJA 2ZJYA 2ODBA 1TF5A 2XTNA 4OKSA 1KAOA 4PX9A 4V0LA 4LCBA 1DAMA 2GF0A 2R6CA 3IKJA 2QY9A 4B32A 2XB2A 4TYPA 5FR1A 2CK3A 3VTKA 5H8WA 2REBA 2J0UA 1UEIA 4KYIB 3U7EB 4ZO4A 1XCPA 2C5LA 3S1AB 4XVRA 1NBME 4XWOA 2ORWA 1T5IA 2ZJ8A 4LHWA 1T5LA 2A5FA 2QAGA 5EQTA 2CMKA 3RRNA 1JPJA 4FINA 2ZAMA 2VTKA 4AYTA 3PVSA 1SVSA 4Z8YA 1Z08A 2FH5B 4B47A 1KMQA 3ZIAD 3P26A 3L0OA 5HZHA 1G5TA 1YZGA 2BMEA 3MRSA 2ZU6A 4BFZA 2ZRJA 2C95A 1F48A 3R7WB 3VKWA 2H16A 1G3UA 2AFIE 5L3QB 2H92A 1GOTA 1GKUB 1Z6XA 4KLNA 4MYUA 5KNBA 3THWB 1E9BA 1LB1B 3O8BA 4BQSA 4QJ3A 1T91A 4R2IA 2GDJA 2W0MA 4PC1A 4AY2A 2A5JA 2IHBA 3FVQA 4GOKA 1RKBA 3WBKA 1I4DD 3T61A 3DMDA 3EPKA 4KSBA 4RD3A 1DS6A 4HDCA 3UATA 4E03A 4P32A 4D0GA 4A6XA 4GT1A 3SJZA 1Z2CA 1ZAKA 4C7OB 1OIXA 1P61B 2AN9A 3K53A 3WNCA 4ZDKA 2VHTA 4A36A 4HLUC 1HY3A 2VO1A 1MRNA 3WXMA 5AR1A 2QSYA 3KXIA 3WMGA 3IBGA 4BFXA 3EPLA 3U61B 2RGDA 1I2DA 4KLZA 3GCGA 1O87A 1GG2A 2V8OA 1OLOA 1E6CA 3G0HA 1VCIA 3LX8A 4MUAA 4A8JC 2FEMA 1S4QA 5FL7A 3GLFA 4AI6A 2GF9A 3OF5A 5CDFE 3GLIB 3O8DA 1LW7A 1W5TA 2ZJ2A 3ZZUA 4LJ4A 5HZKA 4Q9JA 4ZCIA 4Q48A 3PCRB 4KHZA 3MAAC 4I4LA 2FG5A 2QM8A 2QAGB 3TSWA 1NN3A 4P4TA 1ZMXA 1NBMA 2AWOA 2C04A 4UXJA 2PH1A 1WDTA 2XXAB 1Z8FA 4Y0AA 1KI9A 1A5TA 1VIAA 4JKYA 5CIQA 2MSDB 4GPTA 3DOFA 3LWNA 5CYOA 4B3GA 1EGAA 4WAUA 4Q1BA 3KUDA 4G0NA 3NBYC 4A0GA 1CTQA 2ZR0A 4TLCA 4YDHB 221PA 3A8TA 4G1UC 4I99A 5FPHA 1ZVQA 3TIFA 2PJZA 2LCFA 4Q7JB 1OFHA 4QJ5A 3PEVA 1PLKA 3B6EA 4GOXA 1XTRA 4LWZA 4XIGS 3C16C 3RSLA 1HH4A 4NMMA 2NPIA 2P5SA 3TR0A 2A78A 3KQUA 3C8UA 2F3TA 3QPWA 3MWJA 4ABYA 1AIPA 4GNKA 1SVOA 1VG8A 2RHMA 4FW9A 2WKRA 1EFHA 2QBYB 4JLOA 5FPSA 3QXCA 4TQUS 5BW8A 4TLAA 3LW7A 3QKRA 5HCIA 4C7OA 1Q1BA 3IDQA 2YNMA 2HLDA 4EJSA 2HCJB 4TWZA 3FPAA 3RANA 2AX4A 2AXPA 2CNWA 3TKLA 3TNFA 3UG7A 4DT1A 1JPNA 1UADA 1SVMA 4IRUB 4LYHA 4A0RA 4AURA 3TAHA 2ODWA 3UIEA 2WMOB 4TT3A 3DZ8A 1FTSA 5DSZA 4EPYA 1N6NA 1SZPA 4UJ5A 1E2PA 2GJ9A 4M2LA 4OK6A 1RVDA 3FE2A 1G18A 4RD4A 3G82C 2ZS9A 3RLFA 3IGFA 1U0HC 2XSZA 3FKSD 4ESHA 3WYFA 2HJGA 4FI3C 3HU3A 2NG1A 1AS3A 3D3QA 1NI3A 1DPFA 2IW3A 5E95A 4UNNA 3E5HA 3KB1A 3FKQA 2YOFA 4US2R 2QE7A 2ZI4A 4KO8A 4BFTA 3HPRA 3BB3A 4NCJA 3E2IA 4V0OA 4TZ0A 3KJIA 3KKMA 4UNRA 1VYVA 1N6IA 2HJVA 2JDID 1KI7A 3MWLA 3SNHA 1F6BA 4C0LA 4IDOA 1S9HA 3DO6A 2LKDA 3LH5A 1H8EA 2QZ4A 1J7KA 4JLVA 4LDJA 1ZM3A 5FL7D 4IVPA 2WSMA 1E2DA 2F1IA 4Q1CA 2NMVA 4NCKA 4C0HA 3OFNA 2WTUA 2IYYA 3N2IA 3E1SA 4WVFA 4A1FA 1FL9A 4IDNA 1G16A 3SJBA 3CR8A 3DPUA 4DCUA 2D74A 2IXEA 1M34E 2V6IA 4Q02A 3SOPA 5HKKD 4R7ZA 2GCOB 1OXVA 2XB4A 2IWRA 4PO8A 4RKFA 4B33A 1NVXQ 3PUVA 3U44A 4AD8A 1RZ3A 3FHOA 3IPXA 1QHYA 2J59A 2YWEA 2OILA 3B1YA 4IJMA 1XD9A 4NE2A 2BM0A 3LV8A 1KAGA 2F1RA 2F1HA 2FE4A 2OAP1 1XTIA 1CU1A 1FUUA 1YRBA 3DKPA 3K09C 4HI0E 4RY2A 5FOVA 4HAWA 5GJWC 3SBEA 3FYHA 3GLGE 1T6NA 1TNDA 1Q20A 1Q12A 4IDPA 4CGZA 1CJKC 1II8B 2C2HA 4TMXA 2HF8A 4LY6A 1FP7A 1U9IC 4FCVA 5EZ6B 4PQYA 2BVNA 5B64A 1ZD9A 3VKGA 2DFLA 4U7DA 3ONWA 1L4UA 4W5HA 1RRPA 2FSIA 1FW6A 2O0KA 3V9PA 1XPUA 4WA7A 3LNCA 1XCGB 2GEDA 4DLUA 2VF7A 3B13B 4NYJR 1V5WA 2QL6A 1Z63A 521PA 4N3NA 4M9SA 4H1UA 2REXB 4FMCB 3GEIA 3I62A 1MO5A 5FFMA 2BBWA 5KHOC 4XWAA 3U7HB 4PO1A 3H86A 4UXIA 3UMRA 3ZZ0A 1JNYA 1ZU4A 4URUR 5IT5A 2QROA 5CJPA 4EQ6B 4LBWA 2ZRAA 4TQAA 3GJ6A 3RSOA 1DARA 4P4SA 5CJ2A 5CIWA 5DHAA 1F2TB 3DDCA 2ASEA 4TL7A 3W8RA 4HLDA 4EQ6A 5JMTA 3RS4A 4TZ6A 1QVAA 5SZJA 4L9WA 1HUQA 3CB4A 2CE2X 3E70C 3FTQA 5BYKA 4MGZR 2Y8EA 3LQQA 4B2IA 4C0BA 1WE2A 3B78A 2CL7X 3FGNA 1LV7A 4C0SA 4BE7B 2FMXA 3LX5A 1MO6A 4EUNA 2RB4A 2ZSDA 2HXSA 2WWIA 4Q01A 3VHXA 1W4CA 2A3RA 1UKZA 4BRWA 2AD5A 2A7QA 2J5XA 3C15C 3LW8A 3X1WA 4R71A 3UANA 2G6BA 3QF4B 5AUQA 1DOAA 4I1SA 3TLXA 4GL2A 1QDEA 3VU9B 1VKJA 1KZGB 3TQCA 2AK2A 2RGNA 3TK1A 1VG1A 2EQBA 1RPZA 4H1VA 2QG6A 4IOMA 5K8UA 3A36A 1AM4D 3K70C 2C9CA 2C9YA 4MDEA 1KYIA 1ONBA 1G21E 4CW7A 2O0JA 3AUYA 1G3QA 3I8XA 4M1MA 3OHMA 1NJGA 1NP6A 2C98A 2CLCX 1PVOA 1RRGA 3AB3A 1OIVA 3X1DA 2DY1A 2BMJA 4GRAA 1N0WA 4JLMA 5BWMA 4QRHA 4O2LA 4FD2A 1XEXB 2ODEA 4O3MA 1ZRHA 4TLEA 2VP4A 3I3SR 2A5GA 5AJZA 1X3SA 2IUTA 2H57A 2JEOA 2D4HA 1N3BA 3DEFA 5BN4A 4G5OA 3ADBA 1TTTA 1KI6B 1GKYA 2O5VA 3KFVA 3NDPA 3CONA 3OEHA 3BRWD 4WXPA 1KGDA 1SXJA 2NO6A 1NL3A 5JEEA 4LHYA 2YC4C 1FZQA 4DLXA 5AK0A 4ZDIA 1DEKA 4Q18A 5JI2E 4WZ6A 4PTLA 2OFWA 1X8LA 1DADA 3L0SA 2J1LA 2WJHA 3R9IA 4POAA 1TU4A 421PA 5KDDA 2PJRA 2H17A 5EJEA 2ZETA 1Z6GA 2CCKA 1TADA 2XNSA 3RC3A 4A8JA 4R98A 3QENA 4BEBA 2BCGY 1DAIA 5BQ5A 5B58C 1OH7A 4B6EA 1EK0A 4FWTA 1OKKA 4PC6A 1XD8A 5EP4A 3K0FA 3U3OA 4BWYA 4KXFB 4QFMA 2PCLA 4BFUA 4P33A 3L8YA 2DFTA 4TTPA 5D3QA 2WWWA 1C1YA 2G0NA 1T8UA 4RD6A 4NP6A 4Q9HA 2JAQA 4B74A 1NNEA 2IL1A 3AP3A 4PAOA 4JBYA 1W49A 1KDPA 1Z07A 2QGNA 4MRNA 1E9FA 3IIMA 1CP2A 1CEEA 1OXSC 4GZMA 1GVNB 1BIFA 3TSZA 2Z5FA 2NO0A 2QP4A 2X1VA 3JZMA 1ZD8A 1JAIA 2QTFA 2P5TB 5EE3A 4PSVA 2FGJA 4EPTA 1CJUC 4URXR 3KJHA 5GVRA 1US8A 3U4QA 1XPOA 1N2CE 2CE7A 2TMKA 1VG9B 2J3EA 1R8QA 5KNCA 4PHHA 3FMFA 1UM8A 4JBWA 4OHZA 2CHQA 1N6PA 4L8GA 2P65A 3LFUA 1N6LA 5FTNA 2GXQA 1IM2A 1XTQA 3CUEF 3K0EA 3GLHB 4ARZB 2IBMA 3DZDA 2VEDA 4BZXA 1G7TA 2WVJA 4C3ZA 3QPVA 3NIBA 2YVUA 4M1OA 1E0SA 2GBLC 5JJLA 3K09A 2V7QA 3Q72A 5IK2D 2YINC 4IDHA 3K1JA 3V4RA 2G9NA 2JGNA 3M0EA 2W6ID 1ODFA 5JSZA 4FCTA 4QOSA 2YHSA 5C46F 3GFOA 4AKHA 1S96A 3M1IA 2ZE7A 4ZCMA 3AVTA 3FHCB 1NSTA 1ZNYA 2ERYA 1TUEA 3NH6A 2YV5A 3W90A 1QG2A 5LB2A 2FPKA 4B71A 4XWKA 1NIJA 4TYWA 3HDTA 1AS0A 4J0QA 2HEIA 2V55B 3AF2A 4D26A 1XPRA 4A0HA 4M9ZA 2QEQA 1OB5A 3I4LA 4OHXA 4QGFA 2IYSA 1E9DA 4TLDA 1IY1A 5GJCA 3OIVA 5A0FA 4KAXA 1A2KC 2ECKA 3SI7A 3TQFA 1X1RA 3DM9B 3R9XA 4MGKR 2FDCA 4PZLA 2JLXA 3U3KA 4LHXA 3CF2A 1GRQA 2ZR7A 1UJ2A 2QTVB 2ZJBA 1Z0KA 4HSEA 1E79D 1KKMA 2P0EA 4MKIA 3U7FB 3NVAA 1I2MA 3TUIC 4DLYA 4JLDA 1D8TA 1ESNA 3CWZA 1E98A 3AVUA 4NZYA 4FXPA 4A2PA 2CVHA 1E69A 4XD7A 2W83A 2W00A 4LUCA 5CYPA 1TF2A 4OYHA 4XTRA 2ZI3A 1DG1G 3PITA 4EIWA 1QHXA 4YXWA 1YZQA 5FUYA 4BFYA 3OIUA 4DCTA 3ICQB 1ZD1A 2KJQA 2A30A 1ZM9A 2PBRA 3I92A 1NLZA 3SHWA 4PQFA 2EVWX 3S1AA 5JFGA 2IS6A 2NTYC 1HYQA 4ASUA 1KMHA 3B9PA 1E3MA 2O8EA 3QXSA 2P2LA 4IVQA 3KQLA 1BH2A 2WJGA 1G4AE 3QIAA 3ZD7A 1YU9A 4B43A 2FZ4A 5JCPA 4M53A 4D4JA 2CEAA 1TX4B 1RIFA 4JLKA 3PG5A 3RS0A 2WHXA 2WMNB 4OQMA 1P4SA 1RRFA 2Z83A 3TUZC 2FN4A 3T1QA 2G77B 3QKSB 3HU1A 1OYYA 2ZRBA 4V02A 2FSFA 5FBVB 4Q47A 1AQYA 3QKTA 2NGRA 3DOEA 1X1SA 2ATVA 4UJ3A 3EG5A 1WB9A 3SDZA 4D4LA 3PFIA 2IUUA 3G5UA 3LRPA 3AKYA 1QHHA 2KWIA 3B1WA 3IIJA 5FUVA 3C5CA 5DI3B 1XEWY 2R9VA 1N5JA 1OXXK 1SKQA 1XFAA 1S1MA 3A1SA 1WXQA 3CKLA 3KKQA 3Q7QA 1DAKA 4G5RA 4K8OA 4ASUD 1P9NA 3TH5A 1GL6A 2GEUA 4LJ9A 1CR4A 3AVPA 1R10A 3AF1A 3QY0A 4DLTA 2ATXA 1J99A 2J0UB 2OBLA 2EFDB 4B34A 5CB8A 2XNDA 5GJVC 2GK7A 1U8AA 2LKCA 4EKDA 1E0AA 2UKDA 5E4FA 2C8VA 4BGDA 2ONJA 1Z83A 5ANRB 2KBFA 3TRFA 4V0NA 1MOZA 3VAAA 1AZSC 1G6HA 3WYAA 4JZKA 4MYHA 4LOAA 5EE5B 3MSXA 3ZGXA 1XTSA 4MH0R 3BERA 1YR8A 2WAXA 3R20A 2R44A 3A1TA 4JVLA 3H1TA 1T3SA 1W2HA 1XZPA 4PQRA 1E0KA 2RAPA 1NY5A 2RGAA 4JSTA 3AEZA 2QA5A 3NG1A 2XX3A 1T4GA 1D2MA 2R2AA 3THWA 3DM5A 2OCAA 2PEZA 4LBZA 1LS1A 3L0IB 4KBGA 5CB6A 2GWHA 5FBRB 2OM2A 2AHOA 1LF5A 1RC8A 3HJNA 4RKEA 5HKKA 2BEKA 2NO7A 4TL8A 4TL9A 3SYLA 1CKEA 1FPMA 2A5DA 1SXJE 3ASYA 3F8TA 4LZZA 1T0HB 3CWQA 4L15A 3CF0A 5JRZA 2N46A 4JLNA 3PUWA 1E2NA 5CLLA 2JLSA 3QE0A 1AKYA 4TLBA 1CRPA 2IYUA 1Q57A 3A37A 3DL0A 2NOAA 3AVQA 3LXXA 1JAHA 1KI2A 3QKUA 4QKQA 1F3OA 5TMPA 4F7WA 2KB0A 3SU8A 1DBSA 4IFEA 1GRNA 4M1TA 4P4UA 4QGGA 1OV4A 1KK1A 3HP1A 1OFIA 1MV5A 3BWDD 3GD7A 4CEHA 4LBVA 3CF6R 2JDIA 2EFCB 3WY9A 2J41A 1MH1A 2F3RA 3TBKA 2ZI9A 3C7KA 1JB1A 3K70B 4X8OA 1XJCA 2OZEA 1H65A 3BK7A 2WKQA 1AGRA 4U00A 2QE7D 4E22A 4CEHB 2XJ4A 3VQTA 1IBRA 3ECCA 2XXAA 4FMDB 4YDSA 1SVLA 4BLTA 4N1AA 3W9YA 3OIYA 2Z43A 3TE6A 1E2MA 4NPHA 3WHKA 1DAFA 2XITA 2WWHA 2PLFA 1CIPA 1S9DA 2X8AA 3Q85A 2F6RA 4OHVA 2GAOA 1GP2A 1OF1A 3LQRA 1WF3A 4B3XA 1W44A 3EPJA 3U5ZB 4WBSA 1KO5A 4URYR 1UFQA 2OCYC 5J47A 2ZS8A 3EZ2A 1OFTA 4YMSA 4XJXA 4Q9LA 2ZRMA 3FFAA 1GITA 1UPTA 3U6BA 1YVDA 5EE1A 1U81A 3LXRA 3KX2A 1ANKA 4PHFA 2ZM5A 4V03A 2ORIA 1Z5ZA 1XU4A 2WOOA 3MD0A 1FNNA 2BHRA 1GFIA 2ZYUX 2A5YB 1FFHA 1R0WA 1UDXA 4JIMA 1H8HA 3CRW1 4C2UA 4RSGA 2X19A 3I1FA 1FX0A 4M22A 3CZQA 3L8ZA 4F91B 2WJVA 5E3HA 2OCBA 2ZRDA 4B48A 1R8SA 1SVWA 2GILA 4CT5A 1ZW6A 1OXUA 3JVUA 3CRQA 5FUWA 2CJWB 2OV2A 4Q7LA 3SN6A 1CULC 1XZQA 3VU9A 1MO3A 1E1QA 2GA8A 2CL0X 2ZSBA 3T35A 2FPMA 3K0AA 1P73A 3RHFA 4EPXA 4L9SA 1XBTA 4F4CA 1ZNWA 1Y3AA 2EFHB 2QPTA 1ESMA 1Z3IX 5KSOA 4LV8B 4IOLA 4HZUB 2QQEA 3AP1A 4OHYA 2ZRIA 2O8FB 3SZRA 4RD2A 1W7AA 3LA6A 4PO9A 2VHJA 3VR2A 1QZXA 1Z2AA 3AUXA 1WBDA 1G291 4V0ME 4BRUA 1ZU5A 4JSYA 3UMSA 2REOA 1FMJA 3THXB 4QM6A 1KI6A 3A1UA 1J70A 5ELXA 1NVVQ 4O2RA 4EFLA 1KJWA 4HYYA 3K9HA 1F2TA 3P1JA 4URZR 1P9RA 1S2MA 4MUBA 5SZIA 5EUMA 3THYB 2OE2A 3GEHA 4DB4A 2DWPA 4BLSA 2IF2A 3WYGA 1XB2A 1HV8A 4C30A 4ZCLA 1JECA 4C0KA 4PANA 2JIZD 1EWRA 2QN6A 4G5SA 2ZR9A 5DO9A 5P21A 3T34A 5GVSA 3RC8A 3AVWA 3EZ6A 3KL4A 3NH9A 5FR2A 1D9ZA 1E79A 4TQ9A 1IHUA 2NIPA 1OHHA 4I1VA 2B6HA 1E96A 2CJWA 4A0FA 4DRZA 4HB0A 1KO1A 4LGMA 4D0LB 4NCIA 3T15A 4BPBA 1CR0A 5CM8B 3N5CA 4JS0A 4V0MA 3RS3A 1T8TA 2P6RA 1KK2A 1Z6TA 3WMFA 1TQ2A 1DAGA 2GXSA 1BYIA 5B2ZA 2PX3A 3PUYA 2BBSA 4A2QA 3F5FA 4HEJA 3A1WA 3P20A 5FTJA 5J4YA 3AGPA 3GJ7A 4PSAA 1JQJC 4WW0A 3RRYA 3NTUA 2ODNA 3LVQE 2FGKA 1NKTA 2GVZC 3OFND 4UNPA 3L82B 1U0JA 3HPQA 4HAVA 3PUXA 4OI2A 4BUJA 2C99A 3BC1A 3GQBA 3KKPA 4Z54A 5UKDA 2O8BB 2AD1A 2G88A 4V0KA 2IT1A 5JWHA 4B75A 2XEXA 3B60A 3U3MA 1JQLB 4ILEA 3EWAA 8OHMA 2IYQA 1G7SA 2W2TA 1G3MA 2OCPA 1NLYA 3BFXA 4Q03A 2WJYA 1GL7A 4O25A 1P2SA 1XMJA 3CBQA 1G5PA 4LBYA 3V4FA 2O8DB 121PA 3SBDA 1UKYA 4BLPA 4KYUA 1E2KA 2X2EA 2VBCA 2Q9CA 1XP8A 2V54A 3X1XA 1ZIOA 4EAQA 3I61A 4ESVA 1Z6AA 2XAUA 2IYWA 5KPJA 1SULA 1XJ0A 2H1LA 3OIWA 3BJIC 5G53C 2FFQA 3ADKA 1ZJ6A 1E2EA 4DCSA 3L0PA 1IJFA 2OFXA 2IK8A 2ZRHA 1N5KA 2WPDA 2V4ZA 2O52A 2CLDX 2Q3HA 1G3IA 1JEEA 3AGQA 3KJGA 3UWOA 1YR9A 4R9UC 3NC0C 1G6OA 4N0EA 3MMPA 4LPSA 3CLVA 2Z6VA 4KITB 1GNQA 4B73A 4OHWA 5C18A 1LNZA 2Q21A 1SHZA 2JLZA 1Z0FA 3QKSA 3TVDA 2YWGA 3CRRA 4R2HA 3QBVA 4GDFA 5FI1B 1EX7A 1RJ9B 4IW3B 4JVSB 1CJMA 5A4JA 2DWQA 2CVFA 1AQUA 2GETA 4FMBB 2ANCA 2XJ9A 4AKIA 5TDHA 2VPPA 4M8NE 1VCNA 1JXOA 1G3RA 4ZDJA 3GLGA 1JXMA 2XZOA 3HWSA 4S35A 1TF7A 4RFVA 1GNRA 4RJLA 4KCGA 1EFCA 5TY0A 3EXAA 4RZ3A 2ZJOA 4P3YA 1R4AA 3ZQ6A 3I32A 3P4YA 4HATA 4TTQA 4TMZA 4DVGA 1IQPA 2GJAA 2FSHA 1EFUA 4DLZA 1PUJA 4F38A 3CRMA 2FZLA 1EFTA 2JJ1A 3FKSA 2XSZD 4UKDA 3SC3A 3R8CA 2JJ1D 2QP9X 1DELA 1HTWA 2ZRFA 1GTVA 1SXJB 1P2VA 1VIYA 5EP1A 1VYTA 3D6TB 3W34A 4EPRA 3AF3A 2CHVA 5TV2A 4PHGA 3AM1A 1MR3F 4GMXA 3KTAB 4QBHA 1FTNA 5JSZB 3K9LA 1NMXA 4P0TA 1U2RA 3THYA 2VL7A 4UXHA 2VH5R 3GJ0A 3VR3A 4RFSB 5DNYB 3BGWA 1R0ZA 1G7RA 4RZUA 4C0QC 3UPUA 3GJ5A 1G64A 4E5UA 1W36B 1HE8B 3ZS8A 1Z47A 4M21A 2ZYVX 4DKXA 1VHTA 3VX4A 2D62A 1R5NA 1K5GA 2BMDA 2VIIA 4LRWA 2Q0HA 2QM7A 3QNUA 4LYAA 2JLRA 3RWOA 3MG9A 1RJ9A 5L3SB 1Q1QA 4DLWA 3UKDA 3DKVA 3FFBA 2PMDA 2EWVA 4JYBA 2GAAA 1E0JA 3CNOA 2J0QA 1OSNA 2AWNA 1G41A 2C96A 1TMKA 3EASA 4DXAA 2C9OA 2JLUA 2V1UA 3U3RA 3ZVMA 2DPXA 4BFSA 1YZTA 5DHFA 4Z51A 4Q7MB 2WPDD 1KDTA 4HUQA 4LC1A 1QG4A 3LLMA 1K8RA 1NSFA 1UF9A 2QMUA 3FOZA 3C4JA 3ZJYA 1PV4A 3SYNA 2FFBA 1G8PA 3CNLA 5C2JB 2FSGA 2GK6A 1BS1A 1AS2A 2YC2C 4JL5A 3H2YA 2G0TA 1ZP6A 3F0TA 4DZZA 2QMHA 2B92A 3THOA 4MQBA 1P9WA 3KXKA 3VHLB 1ZM2A 3DHWC 2BOVA 4M1KA 1CF4A 1E9CA 1Z0JA 5FBLB 1B0UA 2ZJAA 5JECA 1YZKA 2WOJA 2D7CA 1AGPA 4TMTA 4D0NA 4CF7A 4Q1EA 1W5SA 1SVIA 5J5CA 1JI0A 2VHCA 5KSZA 5FTLA 3BS4A 2IA5A 4FMDF 3WNBA 2PT5A 3QVVA 1NKSA 1OW3B 2IX3A 2KBEA 3A4LA 3W6NA 3I5XA 2JLQA 1XXHB 3A1VA 4DB2A 1NN1A 3LBHA 3T06B 1ZCBA 3NXSA 4Q1DA 2YZ2A 4LV5B 4MITA 1IXRC 3AQ4A 2OHFA 4Q19A 4RFSA 4UNSA 4F93B 2V3CC 2KE5A 3U6KA 2MMGA 3FMIA 5FOXA 2FF7A 1Q44A 3EA5A 2ZRPA 4D81A 5EXXA 2DHRA 3ADCA 4KU4A 1OPXA 4Q4AB 4ACBA 2BM1A 2YYZA 2KI5A 4MA4A 4KFRA 1N6HA 2AXNA 3X1ZA 2PLRA 3PEUA 3GMTA 4ZV4A 5EP3A 4MRRA 5LD2B 4XH9B 2DFKB 2WAYA 3K0FB 2EW1A 1Q22A 1RYFA 2RGNC 3CH4B 2IYXA 3L43A 2O8CA 1OHHD 5DI3A 1UBFA 2CHGA 1B23P 1Q0UA 2GCOA 3WP1B 3FDIA 2VLIA 4YMVA 3LBNA 1E1RA 3KFXA 1YZUA 4Z8XA 2FOLA 2CL6X 4ERNA 4KFSA 1N6KA 2GXUA 1KY3A 3EIEA 2IWHA 3MFYA 4C9BA 2HT6A 1VCOA 1R0XA 4I81A 3O47A 5LB4A 4ACAA 4JL8A 4FWIB 4D82A 4BFWA 5JS8A 1XMIA 3TW4A 3WMEA 3X2SA 2VP2A 3SQXA 5G3YA 2Q9BA 5KSYA 2RGCA 2CK3D 3IEVA 1SXJC 4WIAA 2SHKA 3ZDQA 3KUCA 3GLHA 2FNAA 4OQNA 5JWOA 2ONKA 4AYWA 1TPZA 1KNQA 3C14C 2ZRKA 5FTKA 1WMSA 5SZKB 1X8JA 3DVLA 4BLRA 2Z4RA 5HE9A 2RGBA 4UNQA 1Z28A 1P7CA 1IAQA 2H18A 2ZSAA 5L3QA 3KKOA 2A9KA 4QNRA 1E1QD 4PPGA 1KI3A 2R8RA 2NZ8A 4JVNA 5LDDC 4BZQA 1KI4A 3IILA 1ZC3A 2ZU0C 2QPOA 4IDQA 2QGZA 3KQKA 3SE0A 4Q4AA 4JT4A 2IUSA 4IEEA 3ZLJA 4HDOB 4TT3D 3B85A 2JJ2A 3R7WA 4M9XA 2DB3A 3QOFA 4A2WA 5EE0A 1U0LA 2E9SA 2VRWA 3B7GA 1NG1A 4AKGA 1DAHA 5H1YA 1ZUIA 2CNWD 4QHSA 2B8WA 1W0KA 4IEIA 4RD0A 1KI1A 1YR6A 1I4TD 2LWIA 4Q21A 4MGIR 2JCSA 1M7GA 1D6JA 2IYLD 4DUGD 2ZRLA 4EJSC 2W2VA 5JHGB 4KFUA 4LJAA 3QF4A 3NWJA 3BH6A 4A4DA 1F5NA 4LSGA 1O3YA 1E2LA 2DFNA 1V43A 5F9HA 3VNUA 1COWD 5FPYA 4GP7A 4YMUA 4MKFA 2NPFA 1S3SA 5KU1A 4PPFA 2AFHE 3NC1C 4HAZA 1GZSA 2R6AA 3PR1A 3CW2A 1F2UB 5DI9A 1N6OA 2VQSA 1M2OB 3B1ZA 3BFVA 1VPLA 3GJ8A 3IQWA 4LJ7A 2QRNA 3TW8B 2F43B 5AJYA 3ZH9B 1KY2A 3RS7A 2ZYTX 2Q3FA 2OXRA 4M4SA 4DWJA 4HZUA 2XTMA 1NN0A 3AVXA 1KZ7B 1G17A 1PLJA 1U90A 1VHLA 3GFTA 4LJ5A 4HB4A 4QHYA 5IRCD 4G5QA 4LHZA 1XJQA 2BJWA 2N42A 1KMHB 2XOKA 2VP9A 2OT3B 2HXYA 3OEED 3QF7A 2WWGA 1CS4C 5K8TA 4WOPA 2OBNA 1PJRA 2ZITA 4Q4HA 5BN3A 3W8NA 2QMEA 2WWFA 4QL3A 3CH5A 4Q4HB 1HT1E 5DN6A 4DJTA 2R6DA 3U7GA 1A7JA 1FX0B 1U98A 1TL7C 5AJVB 4C0AC 3C41J 5BXQC 2YJTD 721PA 3PUZA 4ITRC 5FPTA 5FUXA 2QI9C 4A82A 1GIAA 2YOGA 1OXTA 2DWOA 1DO2A 4LHVA 5BYJA 4UQOA 3IO5A 4Q1AA 2Q9AA 3SR0A 2FEOA 2X77A 1ZNXA 4D4MA 3A4NA 3AVOA 5EP2A 5AUNB 1F60A 1JJ7A 1NMYA 1JR3D 2EFGA 2N1BA 1OIWA 3H0KA 4IHQA 2C78A 2WM9B 4H9GA 4OK3A 4YC7A 2R6GA 2VP0A 821PA 5HTKA 2ZSFA 4G3XA 1XNJA 4B3CA 1S3GA 3LDAA 1SVKA 4Q00A 2J7PA 2F43A 3RS5A 2O8FA 2WZQA 2QUZA 3BH0A 4HB2A 3OAAD 4NTZA 2GXAA 3ZIAA 2IF0A 2F9LA 1YHNA 3EZFA 1UBCA 1WA5A 3BD9A 4PC3A 4GP6A 4Q4LA 4CVNA 4PR0A 2V1XA 1IY2A 4BLOA 5BN5A 5JEDA 4KJZA 1XWIA 1Q21A 1W36D 2I3BA 5HR5A 3SFZA 3ZYCA 4DSNA 1XRJA 2IHYA 3BIFA 3R8FA 3Q3JB 1PLLA 2PL3A 4P4SB 3O8CA 1QRAA 2CBZA 2WIAA 3VX3A 1ZUHA 3OE7D 5EXSA 2WIBA 1RE0A 2OG2A 2J87A 2BMFA 1R5OA 4LC0A 1N0UA 1G4UR 5IDVA 4DDWA 2PCJA 5IHPA 1JEDA 1AKEA 3UG6A 1TU3A 2J0SA 3AKDA 3H84A 1XCMA 4D80A 1U94A 5K8IA 1A1VA 4PFSA 3TGPA 2W58A 1IXZA 1G8GA 2WICA 2ZI7A 5KOYA 3IO3A 2VA8A 5KUTA 2HYIC 1J8YF 5L3SA 1LF0A 1BKDR 3QQ5A 1X86B 3BORA 1ELOA 1KK3A 2QNRA 4US1R 1NJFA 1G8FA 1OJLA 4BLQA 4EJSB 4JVMA 3EIHA 2V9PA 1GDDA 2ZS7A 1Z0IA 1KSHA 4FMCF 2UZ3A 4ZIRB 4MDFA 1MO4A 5KDLA 3RS2A 1H8HD 1P2UA 2G1KA 3KDSE 3IHLA 1RRCA 2IEYA 3I72A 2BKUA 1GRRA 1L7VC 2QQ0A 2J9RA 3NHBA 4B76A 3NKVA 4NCNA 3NEJA 1BMFD 2GJSA 3RWMB 3N2EA 4F92B 3GLGB 5L3VA 3QG1A 1ZNZA 1D2NA 1G7CA 4NKRA 2ORVA 2ZAOA 3K9NA 1FQJA 1M74A 3B5JA 4JKIA 3TR5A 4XOIA 1W0JD 5E7IA 3AKEA 4AK9A 5KDOA 2V6JA 4QC2A 2VHQA 3RABA 2GZDA 3K70D 1NN5A 4HDQB 3JVVA 2FJUA 4JBXA 4TYYA 4KFTA 2QT1A 3CX7A 4G01B 5KO2A 2FWRA 2OFOA 2YOHA 5HCNA 4TSFA 2GEVA 4WXRA 4Q1FA 1CRQA 5K8LA 2BIFA 4OL0A 4RD1A 2IS1A 3KTAA 4A8JB 2EWWA 3TMKA 2NZJA 5EUQB 3EPHA 1M1YE 4ZKDA 3C5HA 2ANBA 3CZPA 4NBSA 1KDRA 5JJKA 4RZXA 1IJEA 2E1RA 3KXLA 3BAFA 6Q21A 3EC1A 2BBTA 1DO0A 2H5EA 2HYDA 2IYVA 1K6MA 2BWJA 4XTCS 4QXAA 3K8YA 2L0XA 1XEFA 3VMFA 2K5UA 5FBWB 3N70A 4B3FX 2XZPA 4CEIA 5GADl 3KZ1E 5DE3A 3U44B 3VR1A 3CPHA 4ZI3A 1GWNA 2GZHA 4K81B 1BO6A 1WCV1 4QM7A 5L3RA 2EYUA 3SJCA 2B7BA 3LAWA 1X8KA 2GJ8A 1NY6A 3D8BA 2KSQA 2ZXUA 2W6IA 1VDZA 3Q5EA 3TAUA 4ON9A 2FA9A 2BV3A 1II8A 2FX3A 4MYTA 3FHTA 2OXCA 3AVVA 3UMFA 4MRPA 4U02A 2B8TA 3HYTA 2OSBA 2C03A 1I4LD 2PMKA 2FFAA 2WSSD 2DYKA 4CYMA 3KQNA 4OBEA 1OH8A 2O8DA 3W6OA 3EARA 1GNPA 2HV8A 4PC2A 1U9IA 3D7MA 2GRJA 2VP6A 1EFRA 4KODA 5JWRA 1US8B 3U4QB 2WSSA 5KTYA 4G5GA 5B57C 3T5GA 1WBBA 1GSIA 1YQTA 3ASZA 2ZQ5A 1S8FA 2WV9A 1ZCAA 3EZ9A 4TL6A 1DVRA 1T3LA 3NBXX 4BEJA 5G3ZA 4BECA 1W48A 2VHUA 1G9XA 4KSCA 4PZZA 3HR7A 3QUSA 3GLFE 4D6PA 1P3JA 1KO4A 1ZM4A 4W7SA 1A4RA 3LVRE 4PC7A 2QU8A 3KB2A 1KI8A 1W46A 2O0HA 3ND8A 4DBLC 1OH5A 3B82A 1CJVC 3M6AA 2XNDD 1TQDA 2J46A 5FH9A 2WJIA 4X8HA 4A6PA 1EESA 2ZJZA 4ZKEA 4YMWA 1HT2E 3QXHA 1CR2A 3ZVRA 1EX6A 1II9A 3NDBB 1P62B 3QI2A 1UEJA 2Z0MA 4M1WA 1Z29A 2BJVA 3HU2A 1AJEA 4ZDWA 3GFPA 4GMDA 2OBMA 4DLRA 5TXGA 1U99A 3SJAA 1E2JA 2QTHA 4YLGA 2NO1A 3WRYC 3EX7C 1J90A 1FOEB 2FU5C 3GLIE 1G20E 4DSTA 5B30A 5CITA 4AG5A 1IN6A 1CLUA 4DDVA 4Q9KA 1G5RA 4Q4JA 4DSUA 3PENA 1QF9A 1DTSA 3ETLA 2D7DA 1VECA 3EZ7A 4YQFA 2OLJA 4W5WA 5J4LA 4I1OA 4NDZA 1KK0A 2GCPA 1WP9A 4F4IA 1P72A 3KKNA 2PEYA 1GUAA 3T1OA 1E2GA 2ZROA 1NLFA 2RHDA 4NONA 4L16A 1KO8A 2I1QA 2JIZA 3RNLA 3CX6A 4XVQA 1P60A 1ZUNB 1LTQA 3PXGA 5HPYB 3ZVLA 1F2UA 4M9QA 1Q1EA 1XTJA 1C9KA 3D31A 4QBIA 1MABA 1QBKC 2QMOA 2RH5A 4IXNA 3GLIA 3QXXA 1R0YA 4OJQA 4EPWA 3TSOA 3AVYA 1OYWA 4K46A 1VTKA 1E2QA 3I73A 2O8EB 4Q7KA 3SEAA 5IF9A 2D3WA 1XD2B 4DEXA 2E87A 1W2GA 1YE8A 4KVGA 5FPKA 2D2FA 1KO7A 2Q6TA 4XD7D 5EXPA 1TEXA 4QBGB 2BEJA 1N5IA 1NMZA 4WZBE 1XD2A 5J40A 3Q9LA 1W4AA 1L2TA 3WP0A 5SZHB 3FMOB 4FIDA 3REFA 3QEJA 1U8ZA 3CM0A 2EYQA 5FL3A 2WWXA 1KSGA 4JT2A 1J8MF 1X6VA 4URVR 2GBLA 4CEJB 3T1VA 4DHEA 3H4MA 1XX6A 1E2IA 2ZIAA 4TTRA 2RKOA 1SKYE 1UAAA 5CK4A 1NIPA 4CDGA 1GKIA 2EFEB 1LY1A 3K0CA 1IXSB 3Q8XB 2B21A 4OI4A 5KSPA 4HUQB 3NBFA 1YJ5A 5J4HA 1Z22A 4DT1B 4OQLA 3RRMA 2GJKA 3U3JA 1IN7A 4C0JA 1IY0A 3QPUA 2CXXA 2OLKA 3QSYA 2FV8A 3B1VA 4D4KA 2WWYA 5JHHB 2PT7A 2ZSEA 1E99A 1ZM7A 2FFHA 4NYMQ 4D2IA 4M0LA 2ZEJA 4B44A 4OK5A 1ZC4A 3PIRA 5AUOB 5F2EA 1XDBA 3SHFA 1QHIA 3NHAA 1A82A 3GJ3A 5C1BA 1C4OA 4YXWD 1E9AA 1HE1C 5F9FA 4P31A 3VR5A 4QGHA 5AUPB 4LPKA 4E09A 1KTVA 5AJXA 4M1YA 1IN5A 5KYKA 2DCUA 2VP5A 2WJJA 3MCAA 3TUJC 3T12A 4DLSA 1UKEA 2DBYA 3GLHE 1G8HA 1Z6YA 3OAAA 3ICEA 1YKSA 1SQ5A 3IUYA 5JBQA 1T3HA 1W47A 3VR4A 5F98A 2JA1A 2R62A 1KOFA 2P67A 4YONB 1EFRD 2GTPA 3CIOA 1M8PA 3GPLA 2BBOA 1Y63A 2JASA 2D06A 2ZYWX 1Q1ZA 4AIIA 4B3BA 4XVUA 4MYCA 4BFVA 3V00A 5JJIA 5CLQA 2O8CB 1TAGA 1E2HA 3CO5A 2AKAB 2CCJA 1AA9A 3W5JA 2ZANA 4M1SA 4O0MA 4AKEA 1XXHE 4CEJA 2HDNB 2IYRA 2UZIR 4WZAE 4DIDA 5LD2C 1U8YA 3ZZTA 3P4XA 4OI0A 1JR3E 3MWYW 1KSJA 2F55A 1GILA 2GCNA 3EW9A 4HZIA 1QHHB 2R65A 4JLJA 4MKGA 4B2LA 3HR8A 5H68A 4PAQA 1UBGA 5IK2A 1MT0A 1P75A 2V7QD 4FN5A 3PQCA 1TUIA 2AR7A 1W36C 1G19A 2W2XA 3AF4A 3GLFB 1W4BA 5J4KA 2QT0A 4DCNA 1D2EA 2BKEA 5DLQC 3DMNA 5DISB 5FOTA 1VCMA 4AYXA 2CCGA 4LK2A 1E9EA 4AG6A 1W1WA 4DLVA 4TSFD 5HE8A 4NH0A 5JLJA 3A4MA 3OEHD 4QNMA 4X8MA 2BCJQ 2XGJA 1P5ZB 2F1JA 3BB1A 4ZPXA 4DC9A 3BXZA 1KIMA 3T1TA 1GAJA 4LI0A 1AK2A 1XEXA 1AZTA 2AKYA 5DIFA 2ZRCA 2MMCA 1II0A 4TMKA 2OAQ1 1W0JA 1CR1A 1EWQA 1FQKA 1CBUA 1E4VA 1L4YA 2BDTA 2PZFA 3RDPA 4CRWB 2HLDD 4PXAA 4NL4H 5JI3E 2CDNA 4LJYA 4DUGA 3THXA 5FBQB 1UKVY 1W4RA 3KJEA 2JLWA 2C77A 2RGEA 2AK3A 1W0KD 3I8SA 1VMAA 1YRAA 4L5BA 4OQFA 3X1YA 3ZVNA 1OKKD 3QKRB 4LYJA 2RMKA 3AV0B 3EA0A 2VF8A 2ZREA 2IEZA 4U5XA 3MJHA 2VYFA 5EE9A 1A2BA 1E4YA 5D3MB 4NYIR 1SKYB 1ZIPA 3WRXC 1IOZA 3Q7PA 4JLPA 1G8YA 1XMSA 3LO5A 2EU8A 1LFDB 1KDOA 2W0SA 1M6NA 1EG7A 1M7BA 1ZBDA 1HEIA 1Z06A 3LD9A 2MSCB 2ZJ5A 4C2TA 3MWKA 2GVDC 3QVUA 3IQXA 2P3SA 4DDTA 3AP2A 3CNNA 4NYMR 3UK6A 4IXMA 5G40A 4LJ6A 1G1MA 3K0AB 2FPLA 2PZGA 2O8BA 2JATA 1K5DA 4ZI2A 3P32A 4AC9A 4BZPA 3U60B 4C4PA 4Q9IA 2NQ2C 3QXJA 3SS8A 3IHWA 1E2FA 2QAJA 1VYUA 1E9RA 3OE7A 3VR6A 1KSFX 3KQHA 3UWKA 3R9WA 2YWFA 4TYNA 3J81k 2XZLA 2CLSA 2F9MA 2QP3A 4A92A 1QHGA 5E7MA 4PPNA 2Q3MA 1BMFA 3CX8A 1R7RA 1KJZA 1P2TA 4JMPA 2QORA 1IONA 2ZPTX 1QHSA 2WBLC 4PHTA 5TARA 2YKGA 4Q66C 3QEOA 5JS7A 1YZNA 3EIQA 3W3AA 5KPDA 1R6BX 3ADDA 1JALA 3CRVA 4KV9A 3K0CC 2GKSA 2QPAA 2H8KA 1E1RD 3WBJA 1QHNA 4PZYA 2NO9A 4X8LA 3EWSA 4GFDA 1DE0A 5FI0B 5DGXA 1RYHA 2HF9A 4RCYA 2VSOA 1N5LA 1OE0A 2MSEB 3JZAA 4S2EA 2ZUDA 4B35A 5J4VA 1E32A 1FNMA 4XSHA 4NU0A 4DSOA 2J7PD 1IN4A 2GZAA 1BOFA 1EXMA 2PX0A 1GL9B 1SHKA 1T9HA 3A58B 3BE4A 2HUPA 4JJKA 3O8RA 4GBMA 1JR6A 3BOSA 2RCNA 3REGA 2GHIA 4F4JA 2Z4SA 2OO7A 1FP6A 3FB4A 4HB3A 4JLBA 1JR3A 5D3MA 5H70A 4EPVA 3VNVA 3WNDA 1R5BA 4IOJA 5TVKA 3GP8A 3QJYA 1YR7A 2XTZA 1NRJB 4LV6A 4PSKA 3MJRA 1LVGA 3CPEA 2X2FA 4CIDA 2P6UA 2UVQA 3T5DA 3GJ4A 1BYUA 3NBZC 1M7HA 2IXFA 4JL6A 1Q3HA 2AL7A 1MKYA 4OQXA 3ND9A 4EFNA 1N6RA 3K0SA 5DN6D 2I4IA 2J0VA 1HQCA 1KNXA 4LYFA 4GZLA 5E7JA 5M04A 5L8VA 1H8ED 3FMPB 2BC9A 4MKHA 1UDWA 2ERXA 4BASA 3F3YA 4HLCA 1LS6A 1RFLA 4B2PA 1NVUQ 3BBPA 4NCHA 3LY5A 5DYGA 3IEUA 1TEVA 4DEYA 4I1UA 1OFUX 4GSYA 5JCZA 2QENA 5CK5A 1VG0B 5G41A 3TVTA 2JLVA 3OEEA 2ZVPX 621PA 2VSFA 2YWHA 2ZUCA 2D2EA 1JJVA 3BFKA 4N0DA 5DYIA 1XF9A 4JJZA 4LX0A 2IS2A 3IBYA 1HURA 3WHLA 1L8QA 1DAEA 2QRZA 3QG5A 2IS4A 4EFMA 4TMWA 5FOWA 3P27A 1WRBA 4JLAA 4DIEA 3MUFA 4Z1MD 2GNOA 3W3ZB 4DDUA 2ZI6A 1DG3A
chains in the Genus database with same CATH superfamily
1CUYA 3WK9A 3T7DA 3QBTA 1JBKA 2YXDA 2WILA 1CFZA 3EC2A 3BSYA 1U7OA 3EVDA 3MWFA 4FGUA 5EKXA 1K98A 2Q50A 3O2QB 1TYEB 3QFFA 5IBPA 4OMDA 3TLBA 1S6YA 2XLBA 2OYCA 3B6KA 2G1JA 1NBAA 1BE0A 1RLUA 2YWJA 3VUEA 3IAEA 5DU2A 2NU9B 3W6ZA 5ALTA 5KVQA 4Y0NA 3WFZA 4Y0VA 1Y9EA 4E2ZA 1YB1A 4AWXA 3PNOA 4I0WB 1FB5A 1Z2NX 5F4ZA 3V8RA 1A4XA 3IUMA 4L51A 1M2HA 2VSXA 1YZLA 1FSZA 2ARKA 3DZFA 5LA6F 3T7EA 2ZUFA 1NWHA 1PZNA 3NT2A 1EUCB 1X1EA 4B0PA 1ZJ4A 5DH9A 2I7XA 2OO5C 1Y9DA 2BZ1A 1PDVA 3NAGA 4M0UA 4MW2A 1W4LA 3LWBA 1U9ZA 4G0WA 4EHFA 3BUSA 1RYZA 1VGVA 4HAXA 2I2CA 1S1CA 4R83A 1GM5A 3GU3A 3LBIA 4E12A 1Z4LA 1XMVA 2XOKD 3HL4A 4IOKA 4MUGA 4O4JA 1SGWA 1R2QA 3JWHA 1Y8AA 3HNPA 2I8CA 2PU7A 4PLHA 2H1OA 1P6XA 5A02A 3KR9A 1K5PA 2JKVA 3DMTC 3VKHA 1T9BA 2FPRA 1OB2A 2IXGA 1TJ3A 3LWDA 4PG7A 2VZ8A 1GNTA 4FCWA 5E4TA 5C4MA 1AUOA 4AAYA 5FOSA 2VNSA 1MABB 4MUNA 4V1CB 2ZRGA 3Q2OA 4WI1A 1ML4A 1VJRA 2ZYAA 2QAGC 4JH0A 4HUTA 1ZVMA 2WYUA 1CT9A 5KMGA 3N6XA 1WJGA 1OH6A 1D5CA 4ZOLF 1AN0A 4G89A 5E6UA 1XMPA 1Z74A 4TZTA 1HDZA 4YRCA 1B8OA 1V9CA 3ZNQA 2ISSD 4Z3DA 4AF8A 4QG7A 2OC4A 3FUUA 4OYLA 2OUKA 3H4VA 4ND6A 4BL5A 1ZH0A 1XQ9A 1ZH2A 4CT4B 3BIJA 4GOJA 3RVBA 1W6UA 2RGGA 3EG9B 4IKEA 1E9SA 3I5YA 1I9CA 1D3AA 1RPAA 1UBEA 3SX2A 4FYKA 4OJKA 2FJPA 1UJMA 1GGJA 2XGMA 4AY4A 4RQBA 3WIUA 3FGOA 1Q3TA 3PCTA 4D56A 4EX6A 2HJHA 1S0UA 4KI0A 4D8VA 5MGNA 3ZD6A 4AX4A 2LP4Y 1TPYA 1HQDA 2KLBA 1QZ3A 2YZMA 3BWVA 1N1DA 2CXHA 4NZOA 4FDUA 3QLTA 1ZLXA 2DR3A 1XZ8A 1A04A 1K9SA 1I14A 3RRZA 5KNDA 4S24A 1KOJA 2LV8A 4ENVA 1IZZA 2QKYA 2Q28A 4WPGA 3AKCA 3W6PA 4BO5A 4AP5A 4EITA 4QU5A 4B17A 4BUZA 3AI3A 4LWOA 4AWBA 2QBYA 1AB6A 4A15A 2H7XA 3SYKA 3O21A 3WA6A 3B9QA 3A6PC 3KG2A 3M4YA 1S2IA 2C4WA 1FMLA 2Y1XA 2W2KA 2YJ6A 1N25A 3SAJA 3UW3A 3RVJA 4W5JA 4YUXA 5BQFA 1CUIA 1YJQA 2QDXA 4AMBA 1U2EA 2HHJA 4HOYA 2WFAA 1JYSA 1WMFA 4O0LA 4DQLA 3JAMA 1YOVB 2N1MA 4KMOA 2ODBA 3EK2A 3FJ1A 2D4AA 4OKSA 2HRBA 3CVVA 4PX9A 4V0LA 2YV2A 1JIIA 3MUOA 3MPOA 2IY7A 2ON6A 1DAMA 1RPNA 2BM8A 3EIWA 2X1HA 3PQ6A 5KREA 4ZAYA 2ECOA 1R37A 3MB5A 4TM7A 3G0CA 4BIMA 1ATZA 1CUWA 1QDUA 2O3UA 1UDAA 2E4UA 2POQX 4OA5A 5FR1A 2JFUA 3KD3A 3BHMA 1EIWA 3LHIA 1LK0A 4C05A 3M6XA 1P2GA 4TTSA 2J0UA 4UUQA 1UEIA 2D0OB 3OUTA 4KYIB 1TUGA 3LTEA 4LECA 1ZMOA 4H4CA 2W93A 2ZJ8A 4JOSA 4WADA 1TAUA 5CA0F 4LHWA 4S0ZA 2I66A 3RRNA 2XCQA 1TGYA 4FINA 1KMIY 8GPBA 4OQ4A 1NVBA 3I6YA 5FD8A 4Z8YA 1SVSA 2ZQYA 5DNCA 3RVKA 2Y1WA 2VUHB 1FPQA 2I2AA 5SYAA 1YDGA 2V58A 3L0OA 3P26A 5HZHA 5IW8A 3TR6A 3FYUB 3SP1A 1AMOA 2ZAIA 1KHHA 4CKZA 2PSEA 3DPIA 3I1JA 4CHTA 4K2HA 1O6CA 2H16A 4I1IA 1G3UA 1AGNA 3LKVA 5B1IA 2SBTA 3A1FA 4ZXPA 1LB1B 1TYZA 3JV7A 3F2VA 3LCCA 4NNJA 3RUFA 5CXSA 3RM3A 1Z56C 1VIMA 3DE4X 3F9CA 4PC1A 4AY2A 1FYFA 3AIMA 3WBKA 1TO1E 1RD4A 4KIUA 2W42A 5AVZA 4KSBA 3MJSA 4E03A 3OX2A 1BTOA 4DMHA 4WJZA 3DC2A 3SJZA 1Z2CA 1ZAKA 2ZBDA 5CCDA 4RV9A 2HWWA 5K0JA 5M2QA 4C7OB 1E64A 2IHZA 3KTFA 1WAMA 1IK6A 4XB6B 4YDRA 3URKA 2LE0A 1E3QA 2VAXA 1SQFA 4JVOA 3AR2A 1WLYA 1MT3A 3GCGA 3INGA 4OHRA 4AJ1A 1IZ7A 1GG2A 4D6XA 4F4FA 1E6CA 2YICA 3G0HA 2FEMA 4LZAA 5FL7A 2E49A 3Q8WA 2XDYA 4AI6A 2GF9A 3T7RA 1A76A 1H22A 4PX2A 3IQIX 1S3IA 5L4LA 4LJ4A 4Q9JA 1GKKA 3CKMA 3NW9A 5B4UA 5CIYA 2VJBA 4Q48A 3PCRB 1VE5A 4L1KA 5EMMA 3MAAC 4I4LA 2FG5A 4NBRA 1SBTA 4XPIB 1LLQA 5HJ2A 3GOQA 3K0BA 1E5XA 1OREA 3TRJA 4NAUA 3EF1A 5EQDA 5KMGB 3MJCA 4UM7A 3TSWA 3UBTA 3STWA 1ZHFA 4JZYA 4C6TA 4P3OA 1NURA 5DTRA 4QE3A 4BP9A 5IANA 1BVRA 3CW9A 2AN1A 1XTBA 4Y0AA 1VIAA 2YZKA 5DBOA 3SC4A 4G4SP 2A4KA 1U02A 1J09A 2C5SA 4G4IA 4QDKA 1OWNA 1FEZA 3DHYA 4GPTA 4ARAA 1EUYA 1NJ5A 1JWBB 1HO3A 1L5VA 1A8QA 1O6BA 5DMHA 3OPYA 2XT9A 4WBNF 3WK6A 2ZIUB 3CF4G 4G0NA 4A0GA 4DQVA 1ISPA 3FCOA 3I9MA 2QLMA 4YDHB 4OH7A 2I4MA 4WJKB 5D2CA 5DVZA 5FPHA 5K0EA 4OHBA 3K2BA 1Z4JA 1ZD3A 3BREA 3R8XA 4A23A 5JZBA 4Q7JB 4QXMA 2JGFA 4LZNA 4IIYA 3B6EA 1DUVG 2ZM6B 3R7FA 3C16C 4MW9A 1B6GA 1Q0LA 2VBIA 2YTZA 1TT7A 3KYBA 1LZKA 1VC2A 2A78A 4L0DA 4PCUA 1HETA 1Q2XA 2Q3JA 2XDWA 1GKLA 4GNKA 1X7XA 3H1FA 1GZVA 1IAVA 2F9FA 3H9BA 3KKEA 3ORRA 4IO0A 1SVOA 2RHMA 2JEYA 1SD1A 2QBYB 1P1BA 4DCMA 2UYYA 1QC5B 4LCJA 4YRJA 3VNSA 4CIBA 5BW8A 1JTEA 3MS4A 4TLAA 3PL1A 4UHFA 4L0CA 3RYIA 1RPJA 4RPCA 3GVIA 3IDQA 1DIRA 4D43A 2UUBB 1IN1A 3FOFC 1MJGM 3LP6A 3FPAA 2AX4A 4CKBB 5JYCA 1HYEA 3AI2A 3C8ZA 4WNCA 1JIKA 4UEOA 4Z9AA 1BMTA 1B3BA 1SVMA 1UADA 4IRUB 4PLZA 4A0RA 4BVEA 1BJRE 3TAHA 1NXTA 1P81A 3UK1A 4JT9A 5HF8A 1DQRA 2BP7B 3L7KA 3P19A 1YACA 1ULUA 3KZVA 1PFQA 4N5IX 4G65A 4UM5A 4JLUA 4G85A 2F62A 4IIJA 4DSAA 3FRIA 3IBCA 1ZLYA 2GJ9A 4OK6A 3M5WA 4BBAA 1RVDA 4NU8X 4DG8A 1I5EA 1GGKA 1MX9A 3RLFA 3IGFA 5M5BA 4XEUA 1SKAA 1SUWA 3WYFA 1T9ZA 2HJGA 3DHVA 2BCEA 3HU3A 3ITNA 1KH3A 1DJPA 1QK3A 1R64A 2NG1A 1T15A 4YFVA 3USCS 3IKMB 3U62A 3FKQA 3OMWA 4N8SA 3FTEA 2D5LA 2G0AA 2IZOA 1I2AA 3ZWMA 1USVA 4UAVA 3RSHA 3HPRA 3PB3A 1GPAA 2OMEA 3EZXA 1H42A 3FX2A 4S1PA 4TZ0A 3KQQA 3T9AA 3CNEA 3KKMA 4XCXA 5T3YA 5LL6P 5TRTA 4CQNA 2FZGA 2WHPB 5J3JA 2GBFA 5LCXA 1VHQA 3QVSA 3DT6A 4NJMB 4QT0A 3VNBA 4C0LA 4IDOA 5FKJA 2WKWA 2X6RA 4OBXA 1XQYA 3ILSA 1PG0A 1R88A 2ZVDA 3DO6A 4HN4B 2LKDA 1SZDA 4OKIA 1ZEMA 2OA0A 5AI9A 2AR9A 5KOIA 4JI7B 5CVEA 2BR4A 2IRWA 3ITEA 5SYNA 1MW9X 4H7EA 4D57A 1M2FA 5EXDA 5FL7D 1JLLA 3VU1A 3WLFA 2F1IA 5JD4A 1GGNA 3OD5A 1WD5A 1I4EB 1LNQA 3OFNA 2WTUA 1V45E 3D6AA 4GPZA 3MUEA 5IKMA 1DRVA 3VOTA 1H1TA 3JQAD 3CURA 2JHGA 4DM4A 4YYEA 1DTWA 3K5IA 4M6WA 1QZZA 3AWDA 2O50A 2FEAA 4JIGA 2D74A 2X22A 1M34E 2WIKA 5A4AA 1KPHA 4BO0A 4R7ZA 4QQRA 1OXVA 3ZGNA 3HACA 2XMBA 3GEDA 2HRZA 4L28A 4B33A 3N6RA 1BX3A 2Q1UA 3PUVA 4BO3A 2BSXA 2IU6A 4ZYZA 2M6RA 1PS9A 5JW6A 1A9RA 1XD9A 1OTYA 3LV8A 3TSYA 4AN1A 1JWLA 1PWHA 3OC0A 5EESA 2FE4A 1E7SA 2FF5A 1M2VB 5LDHA 5GIOE 1BMDA 1IG0A 2OO3A 5E2AA 5LZ7A 2A0WA 3ROTA 3SXUA 4AROA 4HVAA 3PYLA 4G1FA 1Q12A 1MAWA 5ALGA 4GR4A 4IV5A 1CJKC 1TJPB 1EGVB 2HF8A 3TX6A 5LIPA 1U9IC 4R6XA 1UANA 2IHJA 3BEDA 1ZD9A 4G8DA 4FFSA 4WQMA 3C6XA 4KIWA 5TC4A 1Y6RA 5DF1A 1KWGA 2FSIA 3ER9A 3L7JA 2IDZA 3EIXA 3LQ4A 2AYYA 3GJSA 2HWUA 3LC1O 1XCGB 2GEDA 3LNCA 3QPBA 4R7GA 3TQOA 3N53A 1JG3A 3UUWA 5C5EA 1Z63A 2G04A 1JHUA 3UFBA 3I9OA 5JAOA 1UZMA 3AFHA 3JU3A 1ODCA 2YFQA 4N3NA 3D3EA 3D5EA 3IT2A 3QEKA 4K1LA 2REXB 4FMCB 1BDHA 1R0CA 5FFMA 1VLZA 3QHPA 3A70A 4FJ1A 5K3FB 2OOSA 3T99A 3ZWOA 4PO1A 3LL4A 3RI3A 4UXIA 3ZR4B 4DV6B 1B76A 4PSUA 4P5PA 2ENWA 3ZZ0A 1KAQA 2QROA 4EB8A 1M5RA 4BNTA 3LX4A 4YJ3F 3PEEA 4F11A 1BG6A 3CUSA 3E3LA 3MYYA 3KSMA 2ASEA 4I8DA 3EG9A 4PCAA 4XR4A 3IAXA 3ROPA 1QVAA 4EA7A 2CE2X 1HDOA 5E6RB 3WO1A 4PGFA 3ZBPA 4L3OA 3H2BA 5GGYA 5BQXA 4C0BA 1WE2A 3KIPA 4C0SA 2CL7X 1LV7A 2JI8A 2VQ3A 1FVXA 1O8CA 3TF5A 3LX5A 2B4AA 1QFMA 2ZT6A 3CNBA 3DW3X 3CCFA 1DBWA 1LPMA 3KAQA 1PJAA 2YUTA 4DYDA 2C3OA 1R9MA 2A3RA 2RCYA 3AV3A 4R41A 1TC1A 1UKZA 2QVGA 1AB5A 1OFVA 1TQHA 2ZJ4A 3CJTA 3E5NA 4NMHA 2PV7A 3RTCA 3T52A 3C15C 4R71A 3QF4B 4H59A 5AXBA 3NTQA 4WLEA 4Y2UA 4RMHA 5I7WA 3FMVA 3ZE9A 4YAUA 2WZDA 3A27A 5J43A 3TQCA 2XUKA 3CE9A 1VG1A 2PIAA 3JQGA 2GPTA 3COVA 1F0YA 4MVJE 4IOMA 3A36A 2HSZA 2XMRA 2C9CA 2C9YA 4KBYA 3NMUF 3W5UA 1P0FA 1QR2A 4P35A 3BMOA 3WZLA 3O91A 2OP0A 3GN2A 3BTUA 4I9FA 4IQ0A 4MVJM 1R9JA 5EL0A 5JDCA 1Y7TA 1KRHA 2F4NA 3LQKA 3A6HA 1KYZA 1KFJB 3FRHA 3NAQA 4QUJA 2JZOA 2JFFA 2CLCX 2YIMA 3B7PA 5J2TF 5H9WA 3IHTA 1PVOA 1HTBA 3JQDA 3ISJA 1DLJA 4E2FA 4YJ2A 2C7BA 2FZ5A 1AK1A 2BMJA 2I67A 3A3KA 4J1TC 3B9RA 3QLEA 4JLMA 4QFDA 2C3PA 2XQKA 2AX3A 2ODEA 1E7QA 1TTQB 3DEIA 3I3SR 1JQ3A 1LVHA 3KXDA 4GI3A 5AJZA 5LBUA 4AF7A 1C81A 2VPWA 4W7HA 1D03A 1N3BA 1M2EA 3E18A 5BN4A 5IXSA 2C00A 1JKMA 2Z58A 4KMSA 2O5VA 2QQFA 3CONA 3OEHA 3BRWD 4M88A 1JXAA 2ECPA 4WCFC 1G5IA 4C4SA 1JDPA 1XE3A 4CKXA 5A3VA 3IP1A 4OY3A 5MHTA 1JLKA 4LHYA 3A04A 2DHDA 5IM4F 5JI2E 1GADO 3E03A 3HKBB 2PFSA 1EK6A 1SIOA 1W96A 2O2JA 4EJ2A 3MLBA 5BR7A 3GRPA 2PKCA 1TU4A 2YZ7A 1PN3A 4TKZA 5L7WA 2A3NA 5CA0A 1Z6GA 4KRYA 1NLMA 1TADA 3RC3A 4A8HA 2VDOB 2DUNA 3IQDB 1T9CA 3IKVA 3SICE 3ZZNA 4BEBA 1QX3A 1DAIA 2C4NA 2DAPA 4UMFA 4IMIB 5HKLA 1UFKA 3KPUA 1IJBA 1EK0A 3V4LA 1B4DA 2PGXA 2X8WA 4J0FA 3LCUA 3WJ2A 4YAFA 1B2LA 1VL6A 4PCVA 1HR0B 2B2XA 1CY8A 2CSUA 3FFXA 3HMQA 3OZVA 2AEMA 3DTVA 3JD3A 4UU7A 3L7NA 4BFUA 3MT0A 3LC2O 3BE6A 4R5MA 2FQXA 3SYMA 3SR4A 2D5CA 2ZATA 5BSGA 5JFOA 5LZ2A 1RWXA 1YK0A 2PQ6A 4HEA1 4Q9HA 4Y1RB 3VVBA 1MQSA 3EISA 3D6JA 3KDPA 4GSLA 4R69A 2B69A 1NRXA 5EFOA 1YZHA 2XUPA 4PAOA 3MIIA 4DWWA 1CEEA 4FS8A 4OD0A 3SX4A 3KYDA 2ZBFA 3O1JC 1BIFA 3UH0A 2QP4A 4MLCA 1TZJA 3DKKA 1JAIA 4M7PA 5JMWA 4CV1A 2ODAA 2Y0BA 5EE3A 2A9OA 2FGJA 3ZCRA 4EPTA 3L6OO 1ESEA 2CW5A 1US8A 3FIUA 1E89A 2E4WA 4X61A 3WGQA 4JR1A 1MZPA 1ZL2A 1R8QA 4H6VA 1SCUB 3FMFA 2ZUTA 3W2TA 4OHZA 2CJFA 3TXXA 3ZQUA 4ARUA 2CHQA 3MXOA 5I3ZA 5FTNA 3OLYA 1IM2A 2PR7A 2RHRA 1X92A 2NXCA 2VEDA 3H8VA 4Y6OA 3HVRA 1G7TA 4G9EA 1OWMA 4AZWA 2YVUA 4M1OA 4PYNA 1BRMA 3IAHA 2VDLB 4L07A 1QAQA 2B9VA 2D2XA 2GNPA 2V7QA 2VYND 4IF6A 4U7GA 1ORWA 3HGQA 2IITA 3OTWA 4JJGA 3QVLA 1QORA 4IVNA 4EI8A 2JGNA 2IV7A 2W6ID 2RKWA 3MCVA 1ODFA 4KQ1A 5IABA 5JISA 3RUAA 3BK2A 3A3YA 1XK7A 3PVCA 4PZEA 4QOSA 2HNAA 1XHLA 4NCAA 2PSSA 1S96A 4EVQA 4ZCMA 3DEKA 4MYSA 4ZT5A 1WXGA 5BWOA 2DLCX 3HA3A 5SV2A 3IUBA 4BMZA 2ERYA 2R6JA 3KWLA 2XWPA 2YV5A 3NH6A 1OBHA 3W90A 1XZMA 2FW7A 1AF4A 1UMCB 5AK5A 3FCXA 2IDMA 5DCUA 3HJFA 4M7RA 1K8XB 1AS0A 3TEMA 4WBNA 2B30A 3TG2A 3AF2A 3PK0A 4H08A 4U3JA 4BYMA 2XCLA 4A0HA 4M9ZA 1L5GB 4DARA 5ECGC 3HJBA 4BQOA 1YBFA 3IAUA 9ABPA 1WXDA 1WY7A 2IZ7A 4DPLA 2VAMA 4E5MA 8ABPA 2QTAA 4HRXA 5TQ0B 1A1SA 5HOEA 1X7XB 2QDKA 3H05A 3PUIA 1KVTA 3F5SA 1KFBB 4JC4A 3RQSA 4UREA 4ZOLB 2X76A 4K0RA 1CIVA 3A1CA 1X1RA 3BK1A 5T67A 4YT5A 3E53A 4ZHQF 3R75A 2FDCA 1QFYA 3MJVA 4LFBB 1IOVA 3I5MA 4CUKA 1M9NA 3CF2A 1FDOA 2ZCVA 3EUFA 1U3CA 1CJCA 1UJ2A 2QTVB 2ZJBA 3JW8A 1E79D 1UIMA 2P0EA 3COSA 4MKIA 3NVAA 4N5HX 3S2ZA 4AFNA 2LNDA 1G9SA 2VAVA 2RD2A 2ODPA 2DPYA 4BVJA 2I8AA 3ORQA 5KS2A 1JL3A 1RI1A 3CWZA 3IKTA 2VWQA 4JA0A 4DJEC 1BS9A 1E98A 4HQKA 4JU8A 4P38A 4YJKA 4EW1A 2JLVA 4FXPA 3AVUA 4JJFA 3BIXA 1YFKA 2CVHA 2GNAA 3V8MA 3X0DA 4CKWB 4Q3LA 1XVUA 3QPCA 2YMMA 2H4FA 4OIFA 2EGHA 3PITA 4CG1A 4EIWA 4GYKA 1YZQA 2ZSIA 3DD1A 3I2IA 2Q5HA 5FPPA 1X14A 1PX2A 4OXYA 1XA3A 1PEYA 2C1EA 1QRTA 2C83A 4G07A 5I4BA 2DKNA 3ZHZA 4MARA 1JA9A 1Q95A 3RTBA 5BSWA 1LBQA 4MQEA 2IS6A 1N1EA 2NTYC 3H5OA 2ILTA 1DNPA 3KO8A 2O8EA 4MIYA 4UE3S 1GUYA 3RAJA 4BC0A 4IVQA 4XGIA 5G0TA 4KHPB 1J42A 3F7TA 5E1MA 3OM1A 1VHWA 4B43A 3IA7A 3TFQA 4D4JA 1KFKB 2CKMA 2XUQA 4WY8A 1Q0RA 2BFDB 3G6KA 1RRFA 1F4PA 1RLIA 2HMWA 2Z83A 1PKEA 2WU4A 4NI5A 2G77B 4MGHA 1CUVA 4KDFA 4V02A 3SM3A 3T4EA 3OPVA 2MCFA 1X1SA 2ATVA 4PGGA 5HUJA 1H4TA 1TYBE 3NDJA 4J0KA 4ZI7A 5IPFA 1IPFA 3EVNA 3G5UA 2NYAA 3JATB 2ZVJA 1NNEA 4ZANA 1R50A 3VDRA 4I55F 3GA7A 3B1WA 2ADMA 3C3AA 5FUVA 2DLNA 2TMGA 4MAAA 4DR4B 4JI2B 2FK7A 2EJWA 1MJGA 1DMRA 1XFAA 3DFKA 3OHSX 2AJCA 3Q7QA 3C87A 4RMNA 2AUTA 1CE8B 4ASUD 3DAFA 1TZMA 1LDGA 1PKXA 5D00A 4AMZA 4F8JA 1LX7A 3DOIA 3KLMX 5G2OA 3DMPA 5BY2A 2HU5A 4FEEA 1G59A 3AF1A 1JAZA 2OBLA 4EG3A 3WZMA 3K5HA 1NTRA 3AW9A 3H75A 3DWFA 1P4JA 5E4YA 3M7IA 4OFZA 5D5PA 1L4KA 3H3XA 5E2BA 2I4TA 3PD0A 1XVTA 3NOXA 2ZUSA 4KAAA 1ORIA 1XZHA 1VGRA 1MOZA 4U6NA 1EQAA 3E35A 1G6HA 2VKTA 3KKKA 3VO2A 3WYAA 4JZKA 1OXMA 2VDPB 4LOAA 3G79A 2VYNA 3ZGXA 3L1HA 3TM4A 1N2HA 2BGIA 2PL5A 3MW8A 4GYWA 2WM3A 5LQKA 1KYXA 4EHAA 1QOZA 2ONCA 3R20A 5JXIA 2X0FA 3TG8A 1KJQA 1I3KA 3JRXA 5MN6A 4J2TA 1XZPA 2DHQA 1C3JA 1M2KA 2VDUE 3OIDA 3IVMA 3QFTA 3COYA 1LPNA 4GW3A 5F3RA 2R751 1D2MA 3HBNA 2PEZA 4LBZA 1LS1A 1KZ6A 2QG4A 1ECFA 1QO0A 3BD8A 3BTOA 4Y2HA 4I4CA 1Q7TA 2O2CA 4D9MA 4EMUA 1LF5A 4QOGA 5I47A 5HJ7A 5HKKA 2IPNA 3Q6IA 2WD7A 2FP4A 2BGNA 3SYLA 2DU8A 1K4KA 1K89A 1V6SA 3ASYA 3F8TA 1L3IA 3NWOA 1EA5A 3V55A 2XWQA 3R7AA 1HTTA 1A5BB 2N46A 1W29A 3QA3E 3PUWA 1EXNA 1ORVA 4WGGA 5GGXA 4C01A 1WV0A 1AKYA 2XMCA 3DVQX 5C5DA 3A37A 5TQ2B 2QTMA 3DL0A 2B5VA 1XGKA 2NOAA 3QKUA 3GB9A 5K51A 3FVVA 3VKFA 1F3OA 4QKQA 2Q4BA 3L46A 2AVNA 1YBAA 1IWOA 1ML3A 1T24A 2I1WA 4YAOA 4IFEA 4M1TA 5BT8A 2PLNA 4J0GA 2F67A 5FI5A 1OFIA 5JE8A 2Q1TA 3UOWA 2V7PA 3H04A 4HRAA 3BWDD 1MG5A 4C4YA 4LBVA 1Q0SA 4MP6A 4DAEA 4W1RA 1C1DB 4JUIA 2J41A 4FGWA 1G2IA 4JHXA 2ZI9A 2VDRB 3C7KA 5BNFA 1NAHA 4QYIB 3K70B 4X8OA 2TSYB 1H65A 3I45A 1GFWA 2WKQA 4JXKA 2PKWA 5BSRA 4EJ0A 4WRRA 2GKOA 1IBRA 3MOSA 5JO0A 2VXYA 3ECCA 2V3VA 5DCYA 1KP9A 5B53A 3RIXA 4BNKA 4AO8A 4YDSA 2X7HA 3ITKA 4AMUA 3GVPA 3W9YA 3OIYA 4LZPA 3PICA 3HY4A 1V8OA 1ZKDA 4FKBA 3WHKA 4H4EA 1C80A 2WHEA 3R5JA 3H1AA 2X8AA 3Q85A 1HDIA 4OHVA 2BFCB 3M5CA 5KNBH 3HHPA 3KT8A 2C2WA 3H97A 2HQBA 1WF3A 1W44A 3U5ZB 1GCGA 2AMLA 4URYR 1T2FA 1UFQA 3U49A 3OT1A 5J47A 2BRUC 2DH6A 2ZS8A 4MJLA 4IQFA 1X0XA 1PFWA 1BU8A 1TI7A 4Q9LA 4YCSA 4NPCA 4CMEC 1AE1A 1CY2A 2R8OA 4J4BA 2ZRMA 3FFAA 4K40A 4J4HA 5F35A 4CMJA 1PHRA 3VR6H 1UPTA 3TRHA 3DV2A 1WOYA 1X0VA 2WT8A 3LXRA 4R1SA 1OROA 1VRCA 1JHQA 2FPGB 2NYVA 4XKJA 3SXJA 3ZCVA 2VJDA 2VQFB 1XU4A 4ZQHA 2BHRA 2ZYUX 3R0ZA 2A5YB 3WK7A 4HNSA 4P83A 2HBZA 5JUWA 2O3QA 2Q7OE 3PXCX 3CRW1 1ZY2A 1N5OX 4RSGA 1UBOS 2HRQA 3GLTA 5IYZB 5JS6A 4C2UA 3GAFA 3CZQA 3CUTA 2D7JA 3DDHA 3F3SA 1LVUA 2ZRDA 1K6JA 3OY7A 4R1TA 3K9CA 4B48A 4BWFB 4ZYLA 1ECJA 3C8MA 4RBNA 2CLOB 5K8JB 1P6QA 2V7BA 1OXUA 4ZEMA 3TL2A 3GHHA 3MTJA 2BFEB 1C9DB 1CULC 5ILOA 5AW4A 1SG6A 2HA7A 1Z4KA 3B48A 1TK9A 4HYQA 5CDHA 1MO3A 3TX2A 1JQBA 1E1QA 4QQKA 4G0MA 5DHSA 2CL0X 4B1FA 1NXXA 1J00A 2FPMA 2WSBA 4LSZA 4MEBA 3HABA 4E6EA 5BUSA 3IE1A 2WY2D 2HPVA 4EPXA 4L9SA 4FFOA 2AC2A 2WIGA 1GLNA 1T1EA 1Z3IX 2V6BA 2XUIA 4LV8B 4MVJA 4XLLA 5I9TA 1M6EX 4BMDA 2NT4A 4H3HB 4HZUB 2AOUA 3MRVA 4BGEA 1MVLA 3AP1A 4OHYA 2BFCA 3OKAA 1Z4MA 3QE4A 4OQPA 4RD2A 3OWXA 5B1SA 1M8GA 4YRFA 1Y7HA 2C29D 3VR2A 2RI1A 2OCXA 3H83A 4CKCA 3AUXA 3RT9A 4RADA 4AM8A 4D74A 2O19A 4BRUA 2PMEA 4JSYA 3H5WA 3L1VA 1C8KA 1XVAA 4FR5A 3REQB 4QBKA 2XQFA 3PXXA 2IKQA 3L0YA 4Q3AA 3ZI4A 5BVGA 5JQGF 3W4IA 3UAVA 3TTXA 2I6GA 1JAYA 3Q9UA 5DLEA 1JLMA 4O2RA 4WZAB 3FTCA 3AIKA 4N54A 2HZBA 3SCZA 1S2MA 5SZIA 2R79A 2JFGA 5B3KA 5E9WA 4FZVA 4X71A 3T9BA 4DB4A 2GN6A 3JWIA 2IF2A 2WYVA 4YY3B 1XB2A 1ZH8A 4RX1A 1APBA 3G68A 3OE1A 3WLHA 3HM9A 2X42A 4FFNA 4EVRA 3OZAA 1XUOA 5LZ4A 3CMCO 5JNUA 3D7KA 4WE3A 4G5SA 5P21A 1G0NA 1DWUA 1CHNA 1RHQA 1KVSA 2OYSA 1XDGA 3JQFA 2YDXA 3F49S 3VNAA 3GMDA 2B6HA 3F96A 4LXHA 3EB9A 5AHXA 1CSEE 3KB6A 3S5JA 4DRZA 1YR3A 1FS6A 4FX2A 4D0LB 1Y4UA 3M2PA 1X7YB 4CQLB 2JK1A 5CM8B 1Y3IA 4JS0A 2PNFA 5LOVF 1ISHA 3HNOA 1DBPA 2Q0QA 3I04A 4WKNA 2AZMA 2P6RA 1KK2A 1Z6TA 2VR1A 3JQCA 1TQ2A 1DAGA 4R9SA 1BYIA 5B2ZA 1CQPA 3F6EX 4FDMA 1OWOA 2IQ5A 2V03A 3P9RA 4QUGA 4ZWNA 3ZU6A 4A2QA 2J32A 3GJ7A 4PSAA 4BVLA 3N2LA 4Z3KA 2LGJA 4EG6A 4LSMA 3RS8A 3LF1A 3ZV7A 3W0LB 2UVPA 2GVZC 2G36A 2MWMA 1DFIA 3DE0X 1NUUA 3GO4A 3OFND 3E1GA 4FSHA 4O4IA 3J81A 3HSSA 3COPA 3FBWA 1IUNA 1MQ9A 5EWJA 1VE3A 3JD1A 1FJHA 1CUAA 4HAVA 4OI2A 4BUJA 3VC7A 4D8TA 1OZ0A 3HCDA 4IIXA 4N5MA 3GQBA 4Z54A 1UP7A 4EHKA 1UWKA 2O8BB 5AW2A 2AJ8A 1JT9A 2HWXA 2NLOA 3OJLA 3QOYA 1GTJ1 5HRCA 3QUCA 1E3WB 3O4JA 1SU6A 1W73A 1CWUA 2E7ZA 4FHDA 4NK4A 2GEKA 1TLFA 1Q77A 1XZBA 2XEXA 3B60A 4FMPA 4EDFA 5K6AC 4ILEA 1UMBB 3EWAA 2O2ZA 1CIJA 1RWOA 4HCJA 4KXNA 4MMXB 4EL5A 4EI7A 4I5DA 5E0OA 2EG5A 1NLYA 2OCPA 3BFXA 3ZW9A 1GL7A 2QRVB 1Z5UA 3WK8A 3GCDA 3BSWA 3TPZA 4LBYA 3UMJA 3ACBA 4MV1A 3T9EA 4J0DA 4BLPA 4PIPA 1E2KA 2CFSA 2VOEA 1VP9A 1JE1A 3ZWQA 1RT9A 1JDBB 1ZIOA 1SXIA 2IXTA 1C8VB 1ZWKA 3MTAA 4RJKA 3V4OA 1BXGA 2GRUA 2RAVA 3FTPA 3TXAA 4KC0A 3UYLA 3LUJA 4QU0A 1QE3A 1UZNA 1DIAA 2P4EA 5A1JA 4DCSA 4Q3NA 3L0PA 4JELA 2IK8A 5LP6C 3T4XA 1O6GA 3T0GA 3V4SA 2O52A 3H0CA 2IV2X 3RRJA 4BJ1A 3PPVA 3NC0C 1AH2A 2VDWA 3KR2A 1G6Q1 4N0EA 3MMPA 3PR2B 2GPNA 3CLVA 2Z6VA 4YO7A 1B0AA 5EHNA 3QE3A 4KSYA 1A9PA 2DWCA 2Q21A 3DDNA 5EUCA 1P2DA 3EBOA 4EMSA 2D6FA 5HDBB 2JLZA 2H4ZA 3PFCA 4DGSA 2YWGA 1WSDA 4QDUA 4R2HA 5CUQA 1CUJA 4KEAA 1W581 5FI1B 1EX7A 1Y4SA 1Z8HA 2HLNA 4HDMB 4IDBA 1NM5C 4JVSB 4HAOA 1G98A 3DHEA 2DWQA 4JUBA 1FLAA 2GETA 4UOQA 1POWA 2XJ9A 2LCIA 2I3DA 4IEFB 4MR7B 4WCFB 3RBXA 1MO2A 1Y3DE 1VCNA 3CW8X 4M8NE 4F5WA 2C5BA 3AL2A 5F23A 4CI9A 3L92A 3MBKA 5AO9A 5EZYA 4AY5A 2RE8A 1J0EA 1YUNA 4JQSA 1GNRA 4N03A 1CS0B 1A9TA 2NW6A 1WKBA 1DSSG 4MIKA 4UVDA 1EFCA 5HM8A 1DINA 5AW0A 4CLHA 3ZQ6A 1R4AA 2M6KA 2C4VA 4HATA 4TMZA 2LW7A 2GJAA 1CY6A 2HHAA 2RC5A 1SIWA 2XNHA 3AF6A 4W99A 4JLSA 3CUYA 1KF0A 4F38A 3SZLA 3CRMA 1NBIA 4Y2YA 4UQLA 2FZLA 1U7XA 3QPAA 3R8CA 3ZJUA 5EIEA 2IEAA 2JJ1D 2PMWB 3CT4A 4R6WA 2ZRFA 1HTWA 2OV6A 4X44A 1V8PA 5FHQA 1RR6A 3O8QA 1KERA 3S29A 1WUIS 2UUOA 1JDZA 1MR3F 1QJ4A 4G1MB 5AW1A 3E9QA 3EIOA 5EHIA 1FTNA 1J0CA 1TA9A 3O4GA 5JSZB 1XNRB 1NMXA 4MSUA 1MOPA 1QO9A 2Q2OA 5IT9A 5AKEA 2DQKA 4X00A 1NAIA 1GT6A 3BGWA 3UPUA 1U63A 2CY0A 1G42A 5AOBA 2EX1A 1CEYA 3GJ5A 1G64A 4XFJA 4E2YA 2PLWA 4E5UA 1QAOA 1HE8B 3ZS8A 2YNMD 1G63A 2P9TA 2Y27A 3ABIA 3DB2A 4DKXA 5CTAA 4XFDA 3RFTA 1W88A 4E6PA 4NDAA 1R5NA 1GZ4A 1K5GA 5DASA 4YXFA 1RKUA 3T1YB 2NM0A 4NESA 2QM7A 5SYMA 3SWWA 2F48A 3N07A 5F5XA 3WIEA 1UMDA 4DMMA 4DLWA 5L3SB 2B1RA 3HVJA 4WX2B 2EWVA 3WQRA 4E5VA 3T5PA 3AHIA 1W0CA 5ES3A 1OSNA 3V2GA 1YS1X 2Q8NA 2R47A 3AHCA 4QDXA 4WN9B 1OBVA 1USUA 4MAMA 3TLMA 1LLDA 1QH1A 2R1VB 1SG0A 3C3PA 4MIOA 5FX2A 5CFRA 3Q5GA 4HN9A 3U3RA 4KWIA 2XF8A 3CVWA 1C3OA 3H5VA 1YZTA 1B00A 1KDTA 4N0MA 3AHGA 3C98A 1I51A 3RW9A 4MUHA 3WDSA 1NSFA 5TF0A 4Q39A 1UF9A 4HNAB 4A3SA 4LYEA 4KQIA 1J22A 1O77A 5DEIA 3SYNA 2FFBA 4GPIB 3H16A 4F84A 1UXHA 1VSQA 2GK6A 5D3ZA 1DUIA 2GBGA 3AUAA 3ZY6A 4AZ0A 1AS2A 1WZNA 4UHCA 2G0TA 1G60A 5D87A 3SR3A 1NUAA 1YOBA 5TGDA 4DZZA 4JOQA 4HQ0A 1OI4A 2YV1A 3KT0A 1YBVA 1JIJA 4WNAA 4ZVQA 4BCCA 2GM5A 4KQHA 1Y8RB 5AI6A 4PWYA 5DYYA 1LNSA 1Z0JA 2R60A 1JLHA 5JECA 2D1FA 4M1QA 3JAWB 3MB8A 2WOJA 1XU7A 1AGPA 2QXYA 3IMEA 4JXJA 4BNWA 5KSZA 3ZI0A 1JI0A 5ALMA 3PCXA 3BS4A 3QWBA 4FMDF 3WNBA 3CNQS 1F8UA 2XVMA 4N8EA 3MWEA 2C1XA 3DEJA 4GI2A 1H1LB 2B3TA 3WLEA 3I5XA 1U0RA 2JLQA 3LVBA 1ZJWA 1UP6A 4YR7A 3VO1A 3KQYA 2CXUA 2AFIA 1U1EA 1ZCBA 2I4LA 3NXSA