4L5BA

Human dck c4s-s74e mutant in complex with udp and the di-43 inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
231
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of new deoxycytidine kinase inhibitors and noninvasive in vivo evaluation using positron emission tomography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
total genus 90
structure length 231
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l5bA00
4GRAA 2DR3A 1M7HA 4LV5B 5FOVA 4QBGB 3QEJA 4U02A 1WQ1R 5J4VA 3GLIB 4R2HA 4G0NA 1E4YA 3AB3A 3BORA 2XSZA 4QOSA 2UZIR 4HLCA 1KMQA 3RS4A 4KAXA 3QKTA 2ZEJA 1FTNA 1B23P 1YR9A 3PUYA 4ZKDA 4EIWA 2G83A 2G9NA 5KPJA 1E1QD 5BN3A 4HEJA 1TF2A 4JL5A 2F3RA 3JZMA 5FBRB 1Q3HA 4RJLA 2NG1A 4P4SA 1O87A 2GEDA 2NQ2C 4CGZA 4US1R 4D4LA 1XD9A 4I1SA 2ZSAA 2OO7A 2VP5A 4LSGA 1A7JA 1ZU4A 1KO1A 1XXHE 2NGRA 3W8RA 3FOZA 1KI7A 1DAKA 5HE8A 4OK6A 4OQLA 2YZ2A 4QJ4A 5JHGB 2C98A 2GILA 1XJQA 2D4HA 1VIYA 4LJ6A 5KTYA 1FQJA 3I8XA 3BH6A 1GNPA 3ZQJA 1YZUA 2PCJA 1W0KD 3KKMA 1G6HA 2H7VA 3TW8B 4YMTA 3W5JA 4DLRA 2JDID 2VIIA 1G5RA 4PAQA 3HU2A 3TR5A 3K0FA 1XPUA 3RYTC 2FPMA 2GKSA 5DH9A 3THXB 2IYRA 1CBUA 5EJEA 4PC3A 1S1MA 2AL7A 3CX6A 2OLKA 3SHFA 3ECCA 2WKRA 2GCOB 3UIEA 2ZSEA 2QENA 3ZZ0A 4C2TA 4BLPA 3F3YA 2FSIA 3WP0A 3SEAA 1M74A 1FQKA 2CNWA 4O2LA 1IN8A 1A2KC 2JIZA 4HB0A 4XTCS 5FTKA 2FPLA 2QROA 1NI3A 3HWSA 1UKVY 1VCMA 4M8NE 4TQAA 2H57A 4DSNA 4MGZR 1KO8A 2AKAB 1AKYA 4E5UA 1Q57A 3RC3A 2HCBA 4AKIA 4TYQA 3VAAA 4DCNA 1W0JA 3AGQA 4DLWA 2AFIE 4OQFA 2RGNA 1HEIA 1ZM4A 2BHRA 2IYVA 3B82A 4F92B 1M2OB 2EFCB 1GRQA 4JL8A 4LJYA 5JRZA 1U0LA 4A82A 1CU1A 4BE7B 3RS7A 4D0GA 2IXEA 2A9KA 5FBVB 1WE2A 1GILA 2DB3A 1KJYA 1V43A 3GLHE 4O0MA 4BEJA 2QPAA 5TY0A 3U7FB 2WSSA 4PPFA 3I62A 1G7RA 5L3QB 3PJRA 4R71A 1ZNZA 2ASEA 4ITRC 4NYJR 2DYKA 5EE5B 4AWXA 2IS6A 1XMVA 3FGNA 4D80A 3QXCA 2VHJA 1Z6GA 2QSYA 4HLUA 4AI6A 2D74A 4HI0E 2JLSA 1CEEA 3VX3A 3NDBB 1E3MA 4F4JA 2VP2A 3P4YA 2BM0A 2H1LA 3LXXA 5D3QA 4C4PA 5FOWA 4QGGA 3V4FA 2H5EA 3LV8A 5LB2A 3BFKA 1M8PA 1ZM3A 3AV0B 4X8MA 3U7GA 5E95A 5EZ5A 5F3WB 4DB2A 4F4IA 1NY6A 3CH5A 2ZVPX 3HU1A 5B57C 4JLNA 1GIAA 3RRZA 1KK2A 3JZAA 3EPHA 1R4AA 3EZ7A 2YKGA 1VPLA 3P32A 5JCZA 1Y63A 1NN3A 3KZ1E 3DO6A 3KL4A 4BLRA 1FNNA 4NYJQ 2DHRA 2YC2C 1E69A 3QXJA 1N0VC 2A5DA 2LCFA 3ZD6A 3KDSE 3MAAC 2BIFA 2NO9A 1PV4A 3H84A 3ADDA 1QHSA 4JYBA 3AVXA 3SFVA 4CEJB 2A5JA 1G64A 3UMRA 2WWXA 4RZUA 1SZPA 4YLGA 4X8OA 2CVFA 4BEBA 3C41J 3CKLA 4JLDA 1R5BA 1U9IA 3A1UA 5LPNA 2A5FA 3R7WA 2FFQA 3C4JA 4FW9A 4JVMA 2NO0A 2QGNA 3AVOA 2IBMA 4MYCA 2GDJA 4GZLA 2BBOA 4NTZA 4HLQB 4PFSA 4A8JB 4V0LA 1FMJA 1BYUA 5FOTA 4B71A 4YXWA 3PEVA 4N3NA 1U98A 4RZ3A 3EPLA 3W90A 2R6FA 4EPWA 1JJ7A 3VKWA 4F91B 2ZSBA 1IN4A 4N0EA 3PEYA 2YC4C 4JLAA 4XWOA 1T0HB 4DKXA 2VYFA 2XNDA 3X1YA 4NBSA 4FIDA 4M1YA 3U4QB 3QKRB 1XEXA 3ZVNA 2VQSA 2HJVA 1NKTA 3WYFA 3ZGXA 2DWOA 2ODEA 2E87A 5FPTA 2JLUA 1HYQA 2F55A 2IS4A 5TVKA 3R7WB 3GLHB 1KI6A 3D7MA 1IAQA 4C0KA 1RJ9A 1VYVA 1X3SA 1EWRA 3KX2A 1NN5A 4XTRA 2PBRA 2H17A 1E99A 1KDRA 4M1MA 2J87A 2VEDA 4M9QA 4FXPA 1JAHA 1KO4A 4CYMA 2YHSA 4MKGA 4C0LA 5CIWA 3KQLA 1W48A 1EX7A 4C9BA 5FR2A 4C3ZA 1P9RA 3K09C 2QMEA 1HTWA 4G5GA 3TUJC 1NLYA 3V4RA 2X2FA 1OKKD 1ZW6A 3AQ4A 1FTSA 2XOKD 3AF1A 2BMJA 3NWJA 5EUMA 1Z2AA 3PR1A 4ZIRA 4MH0R 2PEZA 3AKEA 2QE7A 4CEHA 1GAJA 3GLHA 5UKDA 2CNWD 2JJ8A 3AF4A 4L4UA 2JIZD 2MMGA 4W5JA 1YVDA 4XD7D 4BFXA 1NVWQ 1YZLA 1K5GA 3IBYA 4JJKA 1CJMA 4DLYA 5JECA 1UKYA 1XD8A 4YC7A 2FWRA 1JXMA 4GZMA 5KNCA 3D31A 1OXUA 3KTAA 2NO1A 4AKGA 1WRBA 2EU8A 3FWYA 1Q0UA 1Z0KA 1TTTA 1H8EA 4YMSA 1RFLA 1Z3IX 1MOZA 5EQTA 2IYUA 1RRGA 2R6CA 3U4QA 4U5XA 4IOJA 3B60A 1KJWA 4BUJA 4OHYA 4DWJA 2ODBA 3BB3A 1L8QA 3ZVRA 3R9XA 1MV5A 3LNCA 3IBGA 1CR4A 3ZIAD 4ACBA 1R2QA 1O3YA 1Q1QA 2FJUA 2VHCA 4KJZA 4ESHA 2Q6TA 4HB2A 2HXYA 2C95A 1ZJ6A 1U81A 1G4AE 4P4UA 2W58A 2HT1A 2UKDA 2HYIC 1TU4A 5GJWC 1W36D 2JLXA 4ZCLA 4V03A 3FVQA 3F0TA 2MSDB 1SKYB 2QM8A 4MKIA 4A0HA 3AKCA 4A0GA 4LHXA 2ZE6A 2FZ4A 4IEEA 2CL0X 3KKQA 5FUVA 2OFOA 4AG5A 3MWYW 5LB4A 1E98A 2JATA 1E2MA 1T3HA 2G1KA 2GAOA 3OIVA 1AJEA 1HURA 3QG1A 2C99A 5DE3A 5C1BA 3TSWA 1G21E 1VYTA 4GOJA 2XGJA 3OIYA 1KSFX 1FW6A 2F43A 5IT5A 2OCYC 4BRWA 1EXMA 1QZXA 4G5SA 3P26A 1GTVA 4P32A 2ZJOA 5BQ5A 1E9FA 1TNDA 3IPXA 2OSBA 2RHDA 1L7VC 4XSHA 1QDEA 2CLSA 1KK1A 1HH4A 4A9AA 2FN4A 4YONB 2D2FA 4S2EA 1VDZA 3SR0A 2QPOA 3LBIA 2D7DA 2P6NA 4DCVA 1NBME 4HAVA 1T3SA 1OIWA 1UBEA 2OG2A 1SQ5A 2ZS9A 3CPJB 1G5PA 1G7TA 3LDAA 4PPGA 5KSOA 2VTKA 3GEEA 1MABA 2XNSA 1YR6A 2QNRA 5CK5A 1K6MA 4TTQA 5CDFA 1NBMA 5JRJA 2B7CA 3K70D 1DG3A 1KKMA 3CONA 4G5OA 3CZPA 3ASYA 1F2TA 2AD5A 2QTFA 3OEED 4LYHA 4DHEA 4XIGS 4O25A 2HF9A 3FYHA 4NMMA 4M2LA 1T6NA 2Z6VA 4KI0A 3R9WA 1ESNA 3DDCA 1W4CA 2JA1A 3OIWA 3D8BA 4U7DA 3U2QA 2A5YB 4M1OA 3U3OA 1VHLA 4RD6A 1Z47A 2O0JA 1UKZA 2X19A 4GDFA 2W6JA 2PX3A 1OT3A 2JLQA 2EYQA 1Z0IA 3EC1A 2ZI5A 3L8ZA 3W6OA 1N0UA 2B92A 4URUR 3BD9A 2GCOA 1JI0A 1HQYE 4TMXA 4KODA 3OEHA 2WIAA 4OQNA 3AKDA 1CF4A 3BAFA 2JEOA 2J3EA 2R44A 3RABA 4ZCMA 5L8VA 1JPJA 3T61A 5CIQA 3X1ZA 5KUTA 2WV9A 4Z1MA 2H18A 3THWB 4JLOA 1F48A 2UVQA 4WAUA 5KHOC 3EWSA 2WICA 1DEKA 2EVWX 2QORA 1E6CA 3E70C 5JWRA 1KMHA 1SXJC 4W7SA 4E03A 1GNQA 1ESMA 5HE9A 2XOKA 2YJTD 4ARZA 4GPTA 2QMHA 1KDPA 4XWAA 3EARA 2H16A 1JEEA 4IEIA 4TMTA 1S1CA 1KAOA 4R2IA 3I73A 5CJPA 4A8JC 1Q1EA 5K8LA 1XMIA 2F9LA 2IX3A 1UEJA 4HZIA 2D3WA 2Z4SA 4LYFA 1AS3A 5CM9C 1RJ9B 2WPDA 2E9SA 5FI1B 3TSZA 3ZS9A 2PZFA 3QVVA 3K0AA 1J7KA 4QG7A 3O8CA 3CF2A 1LTQA 3ZYCA 1PLKA 2Y8EA 5H70A 3BFXA 3QSYA 2IYXA 1U99A 1D8TA 2QTHA 3S1AB 4IXNA 5J4KA 2REBA 1XB2A 2FEMA 3GQBA 1E79D 4OHZA 2ZU0C 2WMNB 2W00A 4I1OA 1KTVA 2C78A 4EKDA 4WZAE 5DI3A 3SZRA 3WMGA 3T1OA 1GITA 2OLJA 1P2SA 4X8HA 2LWIA 2ZETA 4MRRA 3LY5A 3EZ6A 3SYLA 4B3FX 5IRCD 1SVSA 2WOJA 4LDJA 1YZQA 3AEZA 3VMFA 1G8HA 2J1LA 3RS5A 4DVGA 1G8YA 2QP3A 2VSFA 5J4LA 4BGDA 1MR3F 4HB4A 2QBYB 5H68A 4Q1CA 1KI6B 2ATXA 4NP6A 1H8HD 2J7KA 1RRCA 1AS2A 2ANBA 4H1UA 1X8JA 2P5TB 4RCYA 3TRFA 1W2HA 2MSEB 5FL3A 5EP3A 4L15A 2ZRBA 3NHBA 4MQBA 4P33A 4XVRA 4BFVA 3MMPA 1HT2E 1EK0A 1T3LA 2N1BA 4JVLA 1RKBA 1ZD8A 2WM9B 4A4DA 1W36B 2ZSDA 1IY2A 3K09A 3T06B 3VR4A 2C04A 1OXTA 1TPZA 2IYWA 3K0CA 5JS7A 2ZTSA 4D0LB 1ZRHA 1G8PA 4Q4JA 3WNCA 1HV8A 1VYUA 4MA4A 3AVQA 3B1WA 4LHZA 1L4UA 1KDOA 2KBEA 1BS1A 3ZQ6A 4XVQA 1TF7A 3I32A 1BKDR 2YOHA 4PXAA 3ZS8A 3GLGA 8OHMA 1JR3D 2Z5FA 3H86A 4RKEA 4A6XA 4Q48A 4NH0A 4LJAA 3QIAA 1ZM2A 4XH9B 3WHLA 4EPRA 2O8CA 4LOAA 1RRPA 2ZJYA 2J7PA 3MG9A 5HCNA 1DAGA 3GJ3A 1IN5A 2AWOA 4B48A 3DZDA 1NNEA 2BMFA 1A82A 3IQXA 2CEAA 3TIFA 3HU3A 4CRWB 4A0FA 3B9QA 1AKEA 3CF0A 1NVVR 1NL3A 4AURA 3AM1A 3FKQA 2OE2A 2G77B 1VG9B 3L8YA 4KV9A 3THWA 2OHFA 4RFSB 4BLTA 1ONBA 2O52A 1AM4D 1J90A 1KOFA 1ZCAA 1WP9A 2GXSA 2ZJZA 2ZREA 4MYUA 3SJZA 5CB8A 5M04A 2WAYA 3B8HA 4QC2A 1S3SA 1Z0FA 2CE2X 2DFKB 5DSZA 3T5DA 4LHWA 4GNKA 3K9LA 3HR8A 4US0R 4PO1A 4WXRA 1XJ0A 3SE0A 3RRYA 1DS6A 3GLFA 2A30A 1CP2A 4Q47A 3L0OA 1ZVQA 4ZDKA 2ZE5A 4NPHA 3MUFA 1ZAKA 2W0MA 5FUXA 2VF7A 1SVMA 3RWMB 3A4NA 5KU1A 4F93B 1DAMA 4IRUB 4PZYA 2P6RA 4OHWA 2OBMA 3BB1A 3ZZUA 5LD2B 1Q21A 2W2XA 2ZXUA 2KJQA 4CVNA 4PPQA 3KQUA 4LX0A 1NP6A 1GFIA 2RH5A 1Z07A 4AG6A 4MDEA 1W5TA 4QHYA 2R6GA 4PQRA 3E5HA 1DAHA 2I3BA 2QQ0A 3AF0A 4Q4JB 1QBKC 5SZJA 5F9FA 1OHHA 2W6ID 1AQUA 1RRFA 4Q5IA 2ZRLA 1KO5A 1ZUHA 3A4LA 2ODWA 3PITA 2EFDB 2F9MA 2ZR9A 4WA7A 1U2RA 2V7QD 1PLLA 4QGAA 2QRZA 2XTZA 2RKOA 1OFIA 2W2TA 5JWOA 2OXCA 1DVRA 1QHHA 2ANCA 1FOEB 1ZU5A 2G88A 1JB1A 5E7JA 1B0UA 1M34E 1ODFA 3I3SR 3NVAA 1YU9A 2BV3A 4LCBA 4TZ0A 2AFHE 3N70A 1J8MF 1BMFD 2B7BA 1W36C 2NPIA 4JLPA 3UMSA 3UK6A 2GXAA 2MSCB 4TL6A 4JSTA 1XMJA 3CRW1 4QM7A 2FV8A 1LV7A 2OCAA 5KDOA 2I1QA 1ZC3A 3CRQA 3NDPA 1DAEA 1LY1A 3NTUA 3KJHA 3SS8A 4F7WA 2F6RA 3LQRA 2PJRA 2HUPA 5LBIA 1RYFA 2J0UA 2YWEA 4FMDB 2R6AA 2GCPA 2KI5A 2F1JA 4JYCA 2F3TA 2P5SA 3Q7QA 3SU8A 3DZ8A 1II8A 1U8ZA 3C16C 1ETUA 4D2IA 1G5TA 1V5WA 1GL6A 4DLSA 2WOOA 4DDVA 4PHFA 1IONA 1IY0A 3AVVA 4IDPA 4O3MA 2QM7A 2AHOA 2BJVA 5DLQC 4MRNA 2QY9A 3SN6A 5TXGA 3CNNA 4AYXA 4RFSA 2GJKA 3AUYA 3PFIA 1N25A 2CXXA 2PJZA 3BRWD 4JLVA 1ZBDA 2ONKA 1Q44A 4PANA 4TTPA 3K70B 3F8TA 3QF7A 5F2EA 1GDDA 3ZH9B 4YMUA 4LV8B 1LW7A 5HTKA 2ONJA 4JBWA 1JEDA 1W2GA 2KBFA 4KITB 1CXZA 1Z06A 1D9ZA 4JVSB 1SVIA 1IBRA 4KVGA 5HR5A 5KPDA 3RANA 121PA 4OK5A 3B13B 3ZLJA 4A2QA 2BMEA 3U3MA 1YZTA 3K1JA 1XXHA 1OHHD 2AD1A 4GFDA 3U5ZB 3VR1A 1OH7A 4GT1A 2B8TA 3LW8A 1TX4B 2WMOB 3LWNA 4Q4AA 4NCJA 4DLZA 1YJ5A 2GZAA 1TQ6A 3KQKA 3B1YA 1LB1B 4DLVA 4C0SA 3UPUA 2TMKA 3GLIA 1IY1A 1WMSA 2WJYA 1W7AA 1E0JA 4KBFA 3G82C 1T5IA 3RS3A 1VCOA 5F9HA 2QMOA 4LPKA 2OM2A 1KSJA 3L0IB 4P3YA 3TSOA 1K8RA 2ZRDA 4PC7A 1OXSC 1OE0A 3WMFA 3D6TB 2EWVA 2B8WA 1F2UB 4IFEA 5J4HA 5E7MA 1KY2A 2J5XA 2OAP1 4Z8XA 3QBVA 4PQFA 1US8A 2FX3A 3L82B 2GRJA 2DBYA 2FFBA 2A78A 1E0AA 3OEHD 1UAAA 6Q21A 4DXAA 1JPNA 4KLZA 4TYWA 4C7OA 4RD2A 2KSQA 5FBLB 2YOGA 1KK0A 1G3IA 3ICQB 4TTRA 4TLEA 1GKIA 3C5CA 3IILA 4W5HA 4LJ7A 3BJIC 3RRMA 3TQCA 5G3ZA 1I2MA 4DDUA 4PC1A 2J0SA 2V54A 2V1XA 1E1QA 4URXR 1FNMA 4KLNA 2IC5A 1OB2A 4PC2A 2JLYA 1BYIA 1R7RA 3CPEA 1ZC4A 1OH6A 3FPAA 1XTJA 3IKJA 1E9SA 4UNSA 1X8KA 5LDDC 2QAGB 1VCNA 2ZJ8A 3I8SA 3QG5A 3B1ZA 4KFRA 1MRSA 1AZTA 3O8RA 4HDQB 4PHTA 3VU9A 1G8GA 2QI9C 1DAFA 2Q9AA 3P20A 4FI3C 3T35A 1AIPA 2VHUA 1XXHB 4BLSA 1GWNA 2VP9A 1X1RA 3EZFA 4JBYA 1NVXQ 3EA0A 3C15C 3AVUA 3VTKA 4CT4B 2G6BA 2Z43A 5A5GA 4FINA 4B6FA 1RC8A 1E1RA 1KY3A 5JSZB 4LBVA 3GJ7A 1EX6A 3K9NA 1IJEA 3FMIA 1TL7C 1UDXA 4Q19A 4U00A 5ELXA 5E3HA 1E79A 4K46A 3WBJA 1M7GA 2BC9A 3V9PA 1G20E 1XD2A 1XRJA 1U8YA 4L8GA 1NY5A 1I2DA 1TUEA 2GJSA 1CIPA 3W5IA 2C77A 4JL6A 2IUSA 1C1YA 1J70A 5DN6D 4UNPA 4E22A 3QKSB 2ZRKA 3H0KA 1HQCA 2XEXA 1IJFA 1OW3B 2HF8A 2JLZA 4W9MC 1FUUA 2GETA 2ZUBA 5FFMA 1SULA 621PA 3FHTA 2H92A 4LBYA 1NRJB 5EXSA 1S4QA 4LHYA 3MD0A 4HATA 4G5RA 4QRHA 4QGFA 1CKEA 4MITA 3I92A 3TAUA 3Q5EA 1U9IC 2GEUA 4IDOA 1X86B 1HA3A 2KWIA 1E0SA 5DISB 3JVUA 4KBGA 1P75A 3BERA 3T34A 1P61B 4Q02A 4URWR 4JLJA 4AKHA 4GP6A 1GKUB 1A1VA 3K53A 4Q00A 4QFMA 2OV2A 4EJSB 4JT4A 4Q7KA 4KSCA 3BH7A 3CH4B 4NE2A 1N0WA 1NN1A 1P2TA 3TR0A 2OBNA 4A2PA 3CLVA 3U6BA 1VKJA 2D2EA 3VKGA 3EAQA 2JCSA 3LD9A 5LD2C 1SVOA 3DKPA 1Q1ZA 2CBZA 4UQOA 3AP1A 5FOSA 3SJBA 4N0DA 2KE5A 4CEHB 1S3GA 2OT3B 4JS0A 2HCJB 3DMDA 3BB4A 2GJ9A 4HLUC 3TH5A 2PEYA 2J7PD 3GEIA 4CDGA 2E1RA 1SKYE 1Z6YA 4RZ2A 2CL6X 5FR1A 3ADBA 4Q18A 5FPHA 1F2UA 4MGIR 4LYJA 4MUBA 1U8AA 1VCIA 4TT3A 3BFVA 2C8VA 3DOEA 4URVR 5FTJA 1W4BA 3DKVA 1XCPA 3AVPA 4Q1AA 2JGNA 1ZIOA 2C5LA 2GWHA 3HYRA 4A2WA 2ZI9A 2RGCA 3QI2A 1E2QA 5FBQB 2NO6A 4B34A 1E9EA 2WJIA 2R9VA 1JECA 1UEIA 3KFVA 4K8OA 4LBWA 4RD3A 1NJGA 4PR0A 4FCVA 2FGKA 4B2PA 2RGBA 4LJ8A 4GL2A 3QVUA 1Z0DA 2DWQA 2F43B 3RDPA 1GZSA 1J99A 1RZ3A 2WWFA 1XNJA 1Z2CA 4HAZA 4M9XA 1E9BA 3BE4A 1Z6AA 5FPYA 3EZ9A 2FSHA 3Q7PA 4P4TA 5KSZA 1WB9A 2FGJA 3U7EB 2V9PA 1N6PA 3LXRA 2IYSA 2OEPA 2QZ4A 4LYAA 2QPTA 3R20A 5AR1A 5D3MB 5AK0A 3LRPA 2A3RA 4HUQB 3VU9B 5JJKA 4DLUA 1CR2A 4DEXA 1CR1A 3PG5A 5DHFA 2ZI4A 2QP9X 1GL7A 4NDZA 5BN5A 2Z4RA 1H8ED 4BFYA 1SXJD 2Z0MA 3VX4A 2RGEA 3EC2A 2GESA 4TWZA 3GLGB 2CDNA 4IVPA 3KKOA 3P1JA 4BFWA 1KO7A 1N2CE 4GI7A 4LGMA 2CJWA 2OAQ1 2BEKA 4TL9A 2V8OA 4RY2A 1UF9A 3KKNA 2GXUA 3KB2A 2LKCA 4EFLA 1JBKA 2XB2A 1Q1BA 1ZD1A 2DFLA 1LS1A 3KB1A 3O47A 5AJVB 2FOLA 3PUVA 3QXHA 2FSGA 5EE0A 3KTAB 3FHOA 1M7BA 3U7HB 2FFAA 2OESA 1KI4A 2P65A 3A58B 4PAOA 3NBYC 5JCPA 3GLFB 1QHGA 1TF5A 3Q5DA 1LFDB 4ESVA 1TADA 1E2GA 2N42A 4TMVA 4RD4A 3CRRA 4WZ6A 2VHTA 1COWA 4G01B 4IJMA 1S96A 1E9AA 5C4MA 1NVUQ 3OAAA 1LS6A 2SHKA 3DOFA 2J0UB 1U0HC 1XDBA 4RZXA 2V1UA 2RHMA 5FBWB 2G0NA 1P4SA 1Z0JA 4DLXA 1I4LD 3EIEA 1BOFA 2LKDA 1W0JD 4GMDA 5L3SB 5EE3A 2H8KA 3DL0A 3QEOA 4D6PA 1HUQA 1K5DA 1XCGB 2A7QA 2ZAMA 1GG2A 1ZP6A 3EIHA 3QQ5A 5EE9A 2P0EA 4C0AC 4EPXA 2AK2A 4PPNA 4B6EA 2J45A 1YKSA 5JJLA 2PZEA 4FMDF 3LA6A 2ZANA 3GCGA 1NLZA 2I1VB 4DLTA 1ZNWA 2O8CB 2D7CA 1R6BX 3W8NA 3O8BA 1G1MA 2XJ9A 4PO9A 2QEQA 2PLRA 2ZRMA 4TSFA 4DUGD 3I5XA 2PH1A 3L2OB 3IIJA 3X1XA 5AUOB 2F1IA 2CHGA 4A0RA 2X8AA 1R0XA 2V6JA 4OKSA 1CR0A 1SHZA 3LLUA 3WHKA 1D9XA 1XTIA 1BIFA 3AKYA 3C7KA 2DFNA 3IPYA 4M9ZA 4OYHA 4ON9A 4DT1A 4PC6A 4R7ZA 1UADA 4HAUA 3EW9A 4D4KA 1E2JA 4GBMA 3NBFA 1IM2A 1UPTA 3KJEA 2GTPA 3TVTA 2P2LA 4L9WA 1BH2A 1D2MA 4ZO4A 1E2PA 3DMNA 1WBDA 1C4OA 2ZUDA 1GM5A 4GOKA 3ZIAA 2ZS8A 5GADl 1WDTA 3KQHA 4TZ6A 4BASA 4OHVA 1H65A 5HPYB 2EW1A 5CYOA 2FG5A 2IYTA 2GJ8A 1EFCA 4PSVA 5FPSA 2IYQA 3I5YA 4MYTA 4LWZA 2XJ4A 2VO1A 3BS4A 4HZUA 1ZNXA 2VA8A 5TMPA 2CK3D 2YINC 1S2MA 2B6HA 1EFRA 2GK7A 4BZPA 2QN6A 1OXVA 3AP3A 4OL0A 1DPFA 3RS0A 2ZI6A 3IO5A 3BXZA 1EG7A 4XWKA 3SYNA 4JSYA 2XSZD 1N5KA 2GBLA 2WJGA 3B9PA 3UANA 3LLMA 1JR3E 3A6PC 3EXAA 1FX0A 4FMBB 3AH8A 1UBGA 3GFPA 2CLCX 3EX7C 3DM5A 4PO8A 5JHHB 5JSZA 3QKSA 1TU3A 4LY6A 1VECA 3EZ2A 4URZR 4BECA 3FE2A 2QT0A 2ORIA 4POAA 4OK3A 4OJQA 2FF7A 4MRSA 2CVHA 3QPVA 1GVNB 4KO8A 1D2EA 1SXJB 2FU5C 3IHWA 1YZKA 4EPTA 2EFGA 2GXQA 4TSFD 1ZM7A 1KHTA 2QSZA 4DUGA 1NF3A 3BIFA 2WJVA 3FKSA 4MRPA 1JXOA 1P60A 4L16A 3CWZA 2GAAA 1OSNA 1T8UA 1D6JA 1MKYA 4M1WA 3C5HA 3K8YA 5KNBA 1JAIA 2QRNA 3QPWA 2ZVQX 4FMCF 4HLDA 4PX9A 2O8FB 2ZR0A 2X1VA 2ZAOA 4CF7A 2VBCA 1KI8A 2C2HA 2B21A 2ZI3A 3UG6A 1QHXA 5A4JA 2GZHA 1J2JA 4II7A 2HV8A 3VR6A 4C0HA 3KXLA 2Z83A 3PV0A 2BBWA 1E2LA 1SVKA 3PUWA 3SFZA 3SOPA 3DM9B 1E2FA 3PUXA 1XTQA 1KKLA 4EAQA 1Z6TA 2PT5A 3GEHA 1G8FA 2ZU6A 2C03A 3TJZA 3SBDA 1HY3A 2FEOA 1ZCBA 5KDLA 4LJ4A 2ZYVX 2WZQA 2V3CC 4ARZB 3PUZA 3U3JA 2EFEB 2IYYA 2RMKA 4AKEA 1NMXA 2RGDA 2X2EA 1E0KA 5AJZA 1D2NA 2AXPA 3NXSA 3T15A 4C30A 4JJZA 2BCJQ 1CLUA 1H8HA 4M1KA 3WNDA 2IXGA 3ZVLA 2DCUA 2ERYA 1KIMA 1MRNA 4M4SA 3T5GA 3THYB 3SQXA 1AGRA 1XJCA 5CYPA 3IDQA 2PMDA 4Z1MD 2PZGA 2GBLC 3GLFE 5KSPA 1N6IA 3OHMA 1PLJA 4B3CA 4FMCB 4PQYA 2I4IA 2IWRA 1N6KA 4Q9LA 2NMVA 1RE0A 3TGPA 2XZLA 2REXB 1KI9A 2AN9A 4IOMA 4BZQA 5EXTA 1N6LA 4NHOA 1EFUA 4NONA 3K0CC 2QAGA 3GP8A 3FMFA 1G18A 3I1FA 4PSAA 2BEJA 4M1TA 3CO5A 1N5JA 1KYIA 1E2HA 4DDWA 2W83A 3QPUA 2AX4A 1E9CA 2PCLA 4M21A 2PMKA 3NC0C 2O0KA 4LPSA 1S9DA 2ZITA 2YYZA 4TLAA 3FFBA 3TBKA 1QHNA 2ZRGA 4RVCA 2IF2A 1QRAA 1KSHA 4Q9IA 4TYNA 3VR5A 4D26A 1OV4A 4KU4A 4TLCA 2G0TA 1FZQA 721PA 3RAPR 1MT0A 4DRZA 2VF8A 1F5NA 3ASZA 2Q3HA 4TYYA 1F60A 5J47A 1FP7A 3REFA 3ZVMA 3QXXA 3GFTA 1A4RA 1UBCA 1KMHB 1S9HA 1DE0A 1OF1A 4P31A 2REOA 3DVLA 4RFVA 1Z5ZA 4B35A 2QUZA 3KUCA 4E09A 1COWD 1J8YF 3EIQA 2VH5R 4D4JA 3RLFA 1NJFA 1CTQA 2RAPA 4I4LA 5DIFA 2WAXA 3AUXA 1C9KA 1OYYA 4TN1A 2GEVA 3U6KA 3NEJA 2FDCA 4OQXA 5DI3B 2ZRNA 2GZDA 4BFSA 5K8UA 4DBLC 1P62B 1VG8A 3LW7A 1II9A 4HAWA 3R8FA 4QJ5A 2J0QA 3WBKA 5JEEA 4Z54A 3ZJYA 2AXNA 3KXIA 4H1VA 3NEYA 3CWQA 1N6OA 2VP6A 1G3RA 1QF9A 3IHLA 3KKPA 5EP1A 2GK6A 4B43A 4DT1B 4BLOA 4EQ6B 1KZ7B 3TK1A 3N5CA 2K5UA 1P6XA 3GMTA 2CL7X 1YZNA 2ZYWX 2BMDA 4ZI3A 3M4YA 1IHUA 2NOAA 4OI1A 3ZD7A 2ZJAA 2GNOA 1GUAA 1OLOA 4UNNA 4B33A 3MGCA 4QNRA 2JLRA 5EP2A 1CJVC 3X1WA 4TLDA 4D4MA 1JNYA 1EGAA 1RVDA 4GOXA 1SVLA 2R65A 4AD8A 1AS0A 1W49A 3FMOB 2ECKA 1W46A 1KJZA 2OZEA 2IUTA 2WSMA 1QHIA 1X1SA 3MCAA 4WOPA 2W0SA 3P4XA 1UKEA 2NO7A 3PXGA 2ZRFA 3Q72A 4B3BA 1E2EA 1Z6XA 2JDIA 5K8TA 2FMXA 1XEFA 2R2AA 4Q66C 3VNVA 3GJ6A 4TL7A 1CULC 4JVNA 4EFNA 3L43A 2CCJA 3QUSA 2HXSA 3C14C 1OFUX 2QTVB 2ZYTX 1NMZA 2G1JA 3W3ZB 4A92A 1GNRA 4Q1FA 4DIDA 4B3GA 2O8BB 3PEUA 1R0ZA 1GOTA 1RW4A 4M9SA 4BRUA 2YV5A 3UATA 1OFHA 4B75A 3WP1B 2BKEA 2WBLC 4DJTA 2ZRPA 3CNLA 5KDDA 4JZKA 1NSFA 1NLFA 2CK3A 3IIKA 5FOXA 4DCUA 1P9WA 3VKHA 1E2IA 4S35A 4WZBE 1IXSB 1R0WA 5SZHB 2ERXA 4AY2A 1G19A 1XZQA 2WJJA 1M1YE 1XU4A 4DC9A 1TMKA 5BYJA 2GHIA 1GKYA 1OIVA 3A8TA 1P7CA 3A1WA 1MO4A 2RGNC 4PTLA 2C9CA 2RB4A 2RGXA 3HP1A 2IL1A 4Q7MB 3IO3A 5JZVA 2XZOA 1NG1A 3QBTA 1E94E 4HUTA 4WVFA 5JFGA 1YR8A 4EFMA 1DTSA 4YDSA 1F3OA 2ZIAA 3OESA 4QNMA 4QKQA 4ZDJA 1DO2A 4QM6A 1II0A 2OFXA 3ZDQA 4BLQA 4AYWA 2YWGA 1XF9A 4CW7A 1D5CA 1JALA 3AP2A 3EG5A 1GRNA 1N5LA 4DDTA 2P67A 2BVNA 3AF2A 1T91A 3FKSD 5IF9A 4YMVA 3OF5A 3GFOA 4Q4LA 5P21A 2O8DA 2XTNA 1QG2A 2ZSFA 3B7GA 1UFQA 1KAGA 3GJ0A 1E32A 1Z28A 4NYIR 4TMWA 2CMKA 4C0BA 2VL7A 4DIEA 5TARA 2RGGA 4C2UA 1E4VA 4L9SA 1CRPA 4D82A 1W0KA 3X2SA 1L2TA 2CJWB 4DCSA 3WRXC 2AR7A 1N3BA 5JI2E 1UJ2A 2WJHA 2ZRJA 1X8LA 1FL9A 4JT2A 4MKHA 1P73A 4NU0A 3VR3A 5FH9A 1ELOA 1P9NA 3SJAA 3VQTA 4AK9A 3IEVA 4Q01A 5FI0B 4F4CA 4ZDWA 2P3SA 3FDIA 4D0NA 2FZLA 2XTMA 4CEJA 3ETLA 1OIXA 4D81A 4Y0VA 4LUCA 4P0TA 3VHXA 4ZIRB 2HYDA 5KSYA 3H1TA 1NIJA 2RCNA 2BOVA 4PHGA 5IDVA 3RC8A 2GCNA 2IW3A 1GP2A 4MKFA 3NH9A 3UG7A 3IUYA 5CITA 5AUNB 3MJRA 1JQLB 4BFZA 1RYHA 2Q3MA 3ADKA 4FWIB 2IWHA 4DSTA 2F1HA 2WVJA 2J0VA 1IOZA 4KXFB 5EZ6B 3O8DA 1SKQA 3B5JA 2IK8A 4NCIA 1VIAA 1CJUC 2Q3FA 4HDCA 4K81B 3K0SA 1OKKA 5FPKA 4UNQA 2JASA 3CF6R 4Q4AB 1YRAA 1TQ4A 2ZRIA 4NZYA 3FHCB 1YE8A 4JLMA 4ZV4A 2V6IA 3TUZC 1W4RA 4EPVA 2J41A 3BK7A 4IVQA 4NYIQ 3RWOA 1XEXB 2HEIA 3RVBA 5BYKA 1AQYA 2VHQA 3HPQA 2A2ZA 4KFUA 5JMTA 1AA9A 2Q9CA 1QVAA 4JLKA 1DELA 1PUIA 4JIMA 4UJ3A 2NPFA 1IXZA 1G17A 3QOFA 5BXQC 2WSSD 2XNDD 2ZUCA 1VTKA 3DPUA 3MSXA 4Q1EA 1KGDA 1M6NA 1XCMA 3SQWA 1MABB 4Q1BA 2BKUA 5E4FA 1BMFA 4X8LA 2IYLD 5GVRA 4Z51A 4V0OA 4FCTA 1KNXA 1E2KA 1UM8A 1NBMD 2ZE8A 2D62A 3QE0A 1SGWA 1WBBA 5HZHA 1CJTC 1F6BA 2X77A 4J0QA 4Y0AA 3SHWA 3OEEA 5DO9A 5JJIA 1QG4A 4IDHA 3CRMA 4LJ5A 5FOUA 2QAGC 4G1UC 1OPXA 1Z8FA 3NKVA 2CLDX 3KXKA 3UWKA 3PVSA 4YMWA 3RSOA 5DN6A 3GD7A 4UKDA 2IS2A 4Q9KA 4KSBA 1DARA 4OBEA 5SZKB 2IA5A 3L0SA 2QGZA 3IEUA 3QJYA 1DADA 2QE7D 1Q3TA 5J40A 1VMAA 1IXRC 1FMLA 1SHKA 2P6UA 3CB4A 3VFDA 2J59A 2DFTA 1T8TA 3B2EA 3Q85A 3T1QA 2EWWA 2W2VA 3MWKA 3UKDA 1A5TA 3MWLA 3TMKA 5A0FA 2OILA 2O8BA 5L3QA 3CIOA 1HE1C 1OH8A 2O8EB 3K0FB 4H9GA 1VHTA 5E7IA 1Z22A 2VLIA 2VP4A 2BM1A 2ZJ2A 4IVRA 4M22A 3W9YA 1OXXK 3RNLA 1T9HA 3PEWA 2AWNA 1E2NA 3TVDA 3VR2A 1TEVA 1PZNA 3FTQA 1Z29A 3IIMA 1RPZA 2XX3A 4HAYA 4EJSC 4LI0A 2QA5A 1XD2B 3WRYC 1R8SA 1L4YA 2W6IA 2NZ8A 5AWFC 5BWMA 4QXAA 4WBSA 1AN0A 1FFHA 1YRBA 3LX8A 2WKPA 2UZ3A 2BDTA 1XEWY 3U44B 1R5OA 1N6NA 3ZZTA 5EP4A 3R8CA 4CIDA 1XBTA 2GVZC 4DCTA 2R62A 3U60B 2F1RA 2YOFA 2YWFA 4TL8A 3MWJA 2BCGY 3KFXA 1ZD9A 4JLBA 1E9RA 5C18A 4BPBA 3SBEA 4LC0A 3KUDA 4P4SB 5IHPA 3PIRA 2YNMA 4GSYA 3T1TA 5C4GB 1Q20A 5K8IA 1E1RD 1A2BA 4LJ9A 1JR6A 4OHXA 1GL9B 4F38A 1S0UA 1Z63A 1EFTA 2Q21A 4PSKA 4A36A 4Q03A 3K9HA 1Z08A 1X6VA 3QXSA 4NCNA 1YZGA 2ZQ5A 1NMYA 3LFUA 2BBTA 2FA9A 3K70C 2IYZA 1NVVQ 4Q4HB 1VG1A 2FE4A 2YVUA 4FD2A 1II8B 5AJXA 1TAGA 1KI2A 4I99A 4TMKA 3W34A 3LBNA 1R5NA 4JKYA 2AK3A 3G5UA 3RS2A 3CR7A 3TKLA 5IK2D 4Q7JB 4CT5A 4ILEA 4RD1A 4WIAA 4I1VA 3ONWA 2NIPA 2WWYA 3WYAA 4NCHA 2O8FA 4DSUA 3ADCA 4XD7A 3FMPB 3AVYA 1S8FA 1DAIA 5AUQA 4EUNA 2N46A 4V0KA 2KB0A 3ND8A 3REGA 3D3QA 1P5ZB 5FL7A 2MMCA 5B58C 5EXPA 4NCKA 2DWPA 4ZI2A 5JI3E 4RD0A 3W6NA 2PX0A 5GVSA 1I4TD 3TLXA 2XB4A 1ZMXA 5FUYA 2IT1A 4CEIB 1XZPA 5GJBA 4DSOA 3B6EA 5FTMA 4GMXA 4IW3B 2NTYC 2ZS7A 2G3YA 4BFTA 2ODNA 1XP8A 1DG1G 1R8QA 1YR7A 1N6HA 3B85A 5DYGA 2CHQA 4O2RA 2FSFA 4IXMA 2C9OA 5TDHA 3QNUA 3EWAA 4JKIA 2DY1A 2A5GA 3EA5A 1TQDA 4IOLA 4I1UA 5B2ZA 5J4YA 3J81k 3SNHA 5KYKA 1KI3A 5L3VA 2QT1A 3NBXX 4EJSA 2WKQA 2JJ1D 4Q9HA 4M0LA 2Q9BA 1KK3A 2AKYA 2ZJBA 3A1SA 4C0JA 1OJLA 3THYA 2V4ZA 2O8DB 3GJXC 1E96A 3CX8A 1OH5A 3OZXA 2ZE7A 2FFHA 3QENA 3KQNA 521PA 5JBQA 1NKSA 1XTRA 5H8WA 5CDFE 3E2IA 4EQ6A 4LC1A 4G3XA 4HB3A 3B1VA 3CUEF 5AJYA 1TQ2A 5CB6A 3THXA 3LVQE 3LBHA 3B1XA 4OI0A 1NG9A 4N1AA 1T4GA 2R6DA 1U90A 5CLQA 5GJCA 3W6PA 2BBSA 1QHHB 4MGYR 4BFUA 1EFHA 4R9UC 1LF5A 2R8RA 2QMUA 4I81A 4KFTA 221PA 2GVDC 3KJIA 2OXRA 4TQUS 1EESA 2VSOA 3OE7A 2HDNB 3NHAA 2XITA 2VP0A 2JJ2A 2OBLA 1XTKA 3LX5A 5FUWA 3PCRB 4MGKR 2WPDD 4TQ9A 3SC3A 5G3YA 1KSGA 1CRQA 2O5VA 3OFNA 3LO5A 5BN4A 3WXMA 2JAQA 4LK2A 3GLIE 2JLVA 4B73A 2CE7A 1Y3AA 1MO3A 3BC1A 3Q8XB 2FPKA 3M0EA 1DO0A 4B2IA 3KJGA 4OI4A 5HZKA 5EUQB 4TT3D 1E2DA 3UMFA 1XPRA 4LHVA 1AGPA 3DHWC 4Q1DA 4V0ME 3TUIC 2FNAA 1CJKC 3CR8A 5KOYA 2HJGA 4KCGA 3SDZA 1G4UR 1DOAA 1Q12A 3AGPA 1LVGA 4KYIB 4RSGA 3NG1A 2ZRHA 4CZ2A 5AUPB 5JWHA 2XXAB 2O8EA 5HKKA 1XFAA 4Z8YA 4B3XA 3GLGE 2WIBA 2BJWA 1E9DA 2W6JD 1OB5A 1W1WA 3CBQA 4AYTA 3P27A 1ZIPA 3WMEA 2QP4A 1IQPA 3BOSA 4KYUA 3G0HA 1EFRD 3QY0A 5CK4A 3PENA 2O0HA 3RRNA 3ND9A 4V0NA 2J46A 3N2EA 5HCIA 1ZINA 5DNYB 5CM8B 1XX6A 2IF0A 4IOKA 1I4DD 4QL3A 3HYTA 5DHAA 5G53C 4G5QA 3SI7A 4EPYA 4PZZA 3L0PA 3IQWA 2XXAA 4WXPA 2XZPA 2VPPA 3I72A 1SXJA 1OYWA 421PA 4RCZA 2L0XA 3VHLB 2IHBA 3BBPA 3NIBA 4C0QC 2CCKA 4OJKA 1UBFA 3EPKA 1BO6A 4DZZA 1TEXA 2ATVA 4QBIA 2JJ2D 1KDTA 1NSTA 4B2LA 2ZJ5A 4OI2A 4UNRA 1G291 4HUQA 1ZYUA 3SJCA 1QVRA 5D3MA 1JR3A 4W5WA 1EWQA 1PJRA 2ZR7A 3OFND 4WW0A 1ZUNB 4YQFA 3X1DA 4QHTA 4B44A 4ERNA 3HJNA 4AC9A 2HT6A 4B76A 3RSLA 4ASUA 3LVRE 2EFHB 2IUUA 4QGHA 4URYR 5C46F 4DEYA 1LNZA 2GA8A 3Q9LA 3LAWA 4QJ3A 1YQTA 2WHXA 2ZPTX 5KO2A 4NYMR 4UJ5A 2IS1A 2D06A 1IN6A 2IEYA 2V7QA 3Q3JB 1XTSA 3LH5A 1G3QA 2BWJA 2OCBA 4FWTA 4XOIA 5TB5A 1WF3A 1RIFA 3A1TA 2OCPA 4B3DA 2HLDA 2EYUA 3MJHA 5DGXA 3CW2A 1ZM9A 2CHVA 5HKKD 3MRSA 2JJ1A 1FX0B 4Q7LA 1W47A 4E07A 1G7CA 3GJ4A 4BZXA 2ZM5A 1PUJA 4PZLA 3T12A 5IK2A 4A15A 4KFSA 4RKFA 2EQBA 2RGAA 3C8UA 4TLBA 2J9RA 4B47A 2PL3A 4MYHA 4R98A 1WCV1 4M1SA 1Z0AA 4HSEA 5JLJA 1P2UA 2ZRAA 4NKRA 2IXFA 4FCWA 5EE1A 1U94A 4A6PA 4B32A 1MH1A 1UDWA 5BW8A 3A37A 2QBYA 1IN7A 3VNUA 1G6OA 4HZUB 4QBFA 3K0AB 3R9IA 1NN0A 3A4MA 3HPRA 3K9GA 3U61B 1DBSA 3E1SA 3PQCA 3U3KA 3M6AA 5B30A 3FB4A 4NL4H 2YWHA 2QG6A 4M53A 1W44A 3MLEA 5SZIA 3LQQA 4IDQA 1W4AA 1G41A 3CX7A 4A1FA 4B74A 1OFTA 2V55B 4V0MA 1AK2A 2IHYA 821PA 3QKUA 1QHYA 3OE7D 1PVOA 4LZZA 1Q22A 1KZGB 3NBZC 3AF3A 4BQSA 3H2YA 3EASA 1SXJE 1R10A 4IKEA 4JMPA 2PT7A 1SVWA 3B78A 3UXMA 4EDHA 3TAHA 3CPHA 2C96A 2JLWA 1ANKA 2WWWA 5G40A 3S1AA 2WTUA 3CZQA 4AIIA 3F5FA 3U3RA 5AJWA 1NIPA 2QU8A 4ASUD 1WXQA 3I61A 1G3MA 3JVVA 5H1YA 4BWYA 1MO5A 2QQEA 3TQFA 5FTLA 3M1IA 1P2VA 3CNOA 5DI9A 2PLFA 1T5LA 5ANRB 5GJVC 3CM0A 4ABYA 1WA5A 3WNBA 3BWDD 3I4LA 3OIUA 1XEWX 1G7SA 1HE8B 1MO6A 2ZRCA 5J5CA 1G3UA 2HLDD 2OUKA 5CJ2A 4ZKEA 1FPMA 3WY9A 3OAAD 4Q21A 1LF0A 4TMZA 5JS8A 5G41A 2OFWA 4OQMA 4IDNA 1ZNYA 1JJVA 5L3SA 3DEFA 5L3RA 3HDTA 1KNQA 1U0JA 4L5BA 5EXXA 4ZCIA 1F2TB 4Q4HA 4XSGA 2Q0HA 5KNDA 3BH0A 5B64A 4XVUA 2WWGA 3BGWA 4JBXA 2GF0A 2QL6A 4PHHA 3SYKA 2FH5B 1FP6A 4KVAA 3UWOA 2F7SA 3FFAA 4HDOB 4ZPXA 2ORVA 1G9XA 1XPOA 4FN5A 2DPXA 3QKRA 3TW4A 2VRWA 3TNFA 4YDHB 4IFBA 2XAUA 5FL7D 3A1VA 4GP7A 1XMSA 1GRRA 2WWIA 1GSIA 1P3JA 4TYPA 2VSXA 3QF4B 2QAJA 2NZJA 4HAXA 4Q9JA 3AVWA 4NYMQ 1HT1E 5JEDA 4MRVA 3N2IA 1YHNA 1T0JB 4MDFA 1G16A 1P72A 2C9YA 4YXWD 4ACAA 1R0YA 5FTNA 4CEIA 3U44A 4HYYA 2GJAA 1W5SA 1JQJC 5TV2A 4DB4A 1Z83A 3THOA 1VG0B 4QHSA 1FUKA 4IHQA 3W3AA 2ZYUX 3GJ8A 4LV6A 3TE6A 5F98A 4US2R 3MFYA 2ZI7A 1CS4C 3HR7A 2GF9A 2ZROA 4C7OB 4QBHA 3IGFA 1KI1A 3K0EA 4ZDIA 4UXIA 4A8JA 4XJXA 3CRVA 4D25A 1TUIA 4LBZA 3WYGA 3AVTA 1XWIA 3GJ5A 4V02A 1US8B 3QF4A 3GPLA 3H4MA 4MUAA 2CCGA 3NH6A 4LRWA 3EPJA 1AZSC 5CLLA 3T1VA 1N6RA 3V00A 5C2JB 1ZUIA 4KHZA 4UXJA 5DYIA 4UXHA 3ICEA 1N5IA 3NC1C 2WWHA 3A36A 2ORWA 3RHFA 2IEZA 4PAMA
chains in the Genus database with same CATH superfamily
1V1RB 1M7HA 4UAUA 5FOVA 3A6DA 4P9NA 1XLWA 2VDQB 4HQKA 3K72B 3R7LA 3JALB 4Z5XA 4RTKA 4X1KA 3GLIB 4R2HA 1E4YA 1JMKC 4KAXA 3E6AA 4DIKA 3HU5A 2R1VA 4UQPA 1E9VA 3PC3A 3Q3CA 5A7FA 3RVKA 5CA0F 4M7PA 1CWUA 3DB1A 4RWZA 4EIWA 3G5AA 1Q1AA 3UYKA 2G83A 3ZDXB 4ZKDA 5BSUA 1NBAA 1T25A 3C3MA 4HEJA 4JL5A 2CFCA 4GZ5A 2XIJA 1U6KA 1Q3HA 4GUAA 1U8EA 4P4SA 4QUAA 3GVHA 5T4FA 2GEDA 4RC9A 2NUTA 1GG5A 4L6AA 1XYYA 3V8BA 4J7AA 3SIXA 3EUFA 3N8KA 3NETA 4LSGA 3ZV3A 3U16A 2X23A 4UDOA 4XM1A 3HM9A 2Q99A 3LUHA 4ZRMA 3R5KA 3W8RA 2BZ1A 3JASB 3HP7A 4S1VA 3EXIB 2YZ2A 1RWVA 3IAXA 1JDJA 1ZJ5A 5JHGB 4IXWA 1R18A 2AFHA 1EJ0A 1UJ5A 2V6GA 2D4HA 4CMEC 5JAUA 2VT6A 1VIYA 4Z4GA 1H3NA 2VYNA 4Y2RA 4KKVA 2Y0BA 5HG0A 3L05A 1FQJA 3F1KA 4LXQA 5A05A 4D8XA 1Z74A 3H5NA 2E89A 1V8ZA 2PZJA 1GHTA 3ZJTA 2H7VA 2XQKA 2I2DA 3ZTYA 2P11A 2Z2IA 4C03A 2C1ZA 2JDID 1W6UA 5AVXA 3TR5A 4PAQA 1BHSA 5J2UF 5KYNA 3NHKA 1E18A 5DCYA 4F4FA 1XPUA 3T5CA 2FPMA 4ARIA 2R86A 4HC4A 5BR4A 1FLVA 2IYRA 1CBUA 3THXB 1W5AA 5IEBA 5J2TB 1GYRA 2FZVA 2AL7A 5TRTA 3CX6A 5U1PA 1BDMA 2A8YA 3M33A 2QX7A 2ZTVA 3M1LA 4O8ZA 3T41A 1ZDMA 3OZBA 4AS2A 2WABA 3G2IA 3F3YA 2PWBA 1MH9A 1TJ3A 3LK6A 4O2AF 4QDKA 4O3FA 3RUAA 2CNWA 1E3LA 2BE9A 4MPTA 3KJXA 3SQMA 2B37A 4YQZA 3WNZA 3DNPA 1T9CA 4KR2A 2JPDA 1U0GA 4TQAA 4TVBA 2AKAB 2PRJA 3DNFA 3I3OA 1ZGAA 4JK3A 1BDHA 2YS6A 3WLQA 4IIXA 1CY6A 4HAOA 5A5VA 2EKLA 1HRDA 1TXGA 4OHKA 4CMHA 2JL1A 1RJDA 3CX4A 3WLNA 1M5RA 1VE7A 4OQFA 2RGNA 2ZAIA 1F6WA 3PQFA 4DANA 5KYGA 2XRFA 4F92B 1Y5LA 4JL8A 1GRQA 2M1ZA 1U0LA 5EKDA 1CU1A 2DT8A 2KLBA 3DA8A 1JG4A 4XR9A 5HIMA 4AZ0B 3DLCA 4YHHB 5AHRA 1U2SA 1CETA 2ZJ3A 1X1DA 3LNTA 1KJYA 1WDKA 3HDYA 4I4TF 4D4GA 3UMCA 4TKLA 4KUGA 4CCSA 3PHLA 4JVOA 3WB1A 4B7UA 3U7FB 4CFSA 3AEUB 2HTFA 1M3SA 2H4FA 2GBCA 4PPFA 1Z5GA 4UZFA 3JASA 1ZNZA 3I62A 4ITRC 1W75A 3EF0A 4L3VA 4NNPA 1RNLA 4R6XA 2EWMA 3FNHA 4UVHA 5EE5B 4B83A 2FEPA 1THGA 2PRKA 2VHJA 1CHDA 1RU3A 3DO8A 4AI6A 2NU7A 4E88A 2PH3A 2JLSA 4LOJA 5LWHA 4ND6A 4F4JA 1QGAA 1XKQA 2VP2A 4IHAA 5MFZA 3AIKA 2BM0A 2EJUA 3LXXA 1EG2A 1PD0A 4XCXA 4TV9F 2OXEA 1NF9A 2H5EA 1LJLA 2XTAA 1U3CA 3DMYA 1M8PA 2HB6A 4UVGA 3AV0B 5E95A 1GQQA 4MAMA 1OROA 1VE5A 2CLMB 2DKOA 3ETJA 3CH5A 3IOYA 3LBFA 2PFGA 3K6SB 2GLTA 5TMEA 1DLIA 3PB3A 4JLNA 2H1SA 1Y8QA 4EABA 4WKOA 5HMMA 2V3VA 2ZT8A 4X0EA 1R4AA 2C7VA 5DBIA 4CBVA 1IN1A 3VRHA 4JJFA 3OTWA 1YS2X 1H0KA 1NN3A 2BEUB 2E1PA 3UH1A 1MA3A 1BGVA 4TS4A 4ZI7F 4HUJA 1HL7A 2RGWA 2H4YA 1OA0A 3W77A 2X5OA 2A5DA 2HSDA 4QJBA 3CSDA 3Q6IA 3MAAC 2CLKB 4XQCA 2AMFA 7ADHA 1N0HA 1PV4A 1N7GA 3PDHA 1QHSA 4N40A 4C3OB 4NF2A 4OATA 2VT3A 3RSSA 3V2UA 4CEJB 3HCEA 4LDRA 5KTSA 2BN4A 2WWXA 3UMRA 4YLGA 1DWUA 3OCUA 5CVCA 4YP7A 1HORA 2I2WA 1DHRA 2A1TR 1YE3A 2RHWA 3DCNA 1U9IA 3DD1A 3H4VA 3Q9SA 3TI9A 4CKWB 5LPNA 4I7EA 2EGGA 4LAFA 3R7WA 3C4JA 4JVMA 5IZCC 3ANTA 4WCVA 1XDSA 3GT7A 1AB5A 1RI1A 1JKFA 4MYCA 2HU5A 3RHSA 4GZLA 1ND6A 3RROA 1BE1A 2BGNA 1DDIA 3K92A 4HLQB 2DQSA 2DT5A 3SICE 4ML3A 1UODA 1NXWA 1U2DA 2QX6A 4YXWA 2XQFA 5F1PA 5CPBA 4AZ0A 2BD0A 1U98A 3C8ZA 2WP0A 4IJKA 4LEIA 5EJ5A 1MT3A 2IEAA 1UZLA 4EPWA 2WIGA 4A0SA 4NK4A 2ZSBA 1IRIA 1GEGA 3BILA 1NVAA 3N2YA 2V74B 3GYBA 5DNDA 4O5OA 3NTXA 3TQTA 1JGTA 1KRHA 1T0HB 3ILXA 4DKXA 1MC8A 3DS8A 3SQOA 1U5BB 3L6CA 3OPMA 1XEXA 5ECWA 2Y9PB 3BJMA 3LGAA 2IY8A 4ALNA 2VKTA 4R2JA 3R0JA 1VM6A 5BQOA 4UTVA 3I53A 3HN6A 3R7WB 3VTFA 2HF7A 1E61A 3GLHB 3D7MA 4EBBA 3FR7A 1X1TA 1E1NA 1WCWA 3RUHA 2P4UA 4LOHA 4AUNA 4BJ1A 3KL2A 1SAYA 2HWYA 2H17A 3PNOA 4XLLA 4XUDA 5LXTB 4NMWA 5ALDA 2J87A 2VEDA 3HP4A 3OC6A 4L0DA 2VJOA 5GTDA 4CYMA 2DHQA 3GRUA 4MKGA 3U19A 2Q2NA 3ORYA 1JR2A 1W48A 2QUIA 1JHQA 2G7MC 1Y8RB 4YAEA 5KWIA 2FRXA 5FR2A 3TZQA 2JKYA 3NVMB 3ZWWA 2EBWA 4U2CA 5DX0A 4D45A 3WWEA 3SGLA 1OKKD 3OUTA 5EUMA 4A8PA 1UM9A 3PR1A 4MH0R 2QE7A 1C7QA 1QZUA 5JTUA 3GLHA 2ZTLA 4R1TA 3L4EA 3KIPA 4L5IA 4EMTA 1HNNA 1A8SA 3CR3C 2PX2A 4JLSA 3TZEA 3W5BA 2ZYHA 3OM0A 1NPTO 1T5OA 3HKEB 5EPEA 3P71T 4LSZA 5GONA 3MRXA 1C8KA 1JFVA 1HFEL 1IUKA 1P5RA 1S7CA 1U7HA 3RWBA 4CM9A 5CEJA 3KLNA 3BZWA 3V1LA 2WUGA 3H99A 4AMVA 1Z4OA 2ZXFA 1QOQB 3PS9A 2I1LA 2Q8QA 3HEAA 4ES6A 5L95A 4G0MA 1I36A 4TTTS 1U7XA 1Z0KA 5KTMA 4MW0A 2HOQA 4ZHQF 3R6LA 1Z3IX 1LK0A 4R9VA 1NT4A 3QP9A 2WFAA 5EQTA 1RRGA 2A0YA 4I9UA 2GERA 4IOJA 5CFMA 1AMOA 3F49S 4H7EA 4DWJA 1E8DA 2ODBA 3BB3A 1VJTA 1L8QA 3OQPA 1Y4AE 3ZVRA 3LNCA 3IBGA 3ZIAD 2GN4A 3B5EA 3PX2A 4LNUA 5EKTA 5JZBA 1CR6A 4IILA 2ESRA 4KJZA 3X44A 1X19A 1YGPA 4WNAB 1CUHA 1P3Y1 4IDGA 3TLCA 2XYPA 4B6PA 5IWCA 8MHTA 2Y1OA 2VPYA 2ZBUA 2CHEA 2FWBA 2W58A 1UC4B 2HT1A 2UKDA 2HYIC 3IURA 1WSWA 4JB0A 3ZDRA 3OUUA 3M4NA 3FVQA 3GDHA 1SKYB 3NYIA 4MKIA 5BNFA 2H9IA 4LHXA 1ZJWA 4D9BA 3K9CA 3KKQA 4DF3A 2OFOA 2PUJA 1ULHA 1XAGA 1KZYC 4I55A 1E98A 2G1KA 2GAOA 1AJEA 4NARA 3RFFA 1VYTA 3TQIA 4BNYA 1KJNA 3EGIA 1ZL2A 4BCDA 1KYZA 1WBJB 2QD2A 1L7EA 4KOAA 1T9GS 2F43A 3WK5A 5C80A 1FW6A 1K4MA 7REQA 1ZH4A 3T38A 2FR1A 2MJLA 3ROTA 3RC9A 3INRA 4P32A 2IDZA 2PZMA 3LZCA 4BLUA 1XQYA 4NFLA 2WNSA 1HYBA 1PKXA 3VR6H 1NXTA 2YFYA 3C3KA 5EQDA 4DYDA 1JAZA 4V0QA 2CLSA 1ML3A 4EUEA 2BH2A 1H1LB 3ESBA 1LK5A 4MJ7A 5AVVA 2JCBA 4J1TA 3SR0A 3ZV4A 5T4EA 2P6NA 2RH4A 2QGFA 4HAVA 5KNLA 1Z0ZA 2HWUA 2EP5A 3LPDA 4N5NA 1M73E 4B45A 5FUMA 4KH0A 1Z9BA 1UBEA 2HPZA 4IV5A 4J29A 5ICFA 1OXBB 2P7HA 2Z2ZA 2ZS9A 4J49A 3LDAA 1JU9A 1H2FA 4OPMA 4OQZA 4RM2A 3H9UA 3MCWA 3IUSA 2QNRA 5JS1A 4WOCA 4QRIA 1O94D 4TTQA 4NG4A 4OIMA 3A1NA 4XYGA 1Q15A 2Q5EA 3CT6A 3SY8A 4F06A 2H85A 1DG3A 3AG5A 1RPAA 2B1JA 3AYXB 4PZ9A 4PZPA 1P80A 4XYMA 2O3SA 4G5OA 3CZPA 4D0SA 3HDGA 3ZTWA 4BVLA 1Q0TA 2AD5A 2J67A 2A6PA 2A0FA 5IKMA 4XIGS 4A10A 1NR7A 5MN5A 1GTSA 3GELA 4O25A 5MGBA 3PQ7A 5IYZB 3Q7TA 2DLDA 2PUCA 4RK7A 3SYMA 3WQRA 3DDCA 2HDOA 2EC5A 2JA1A 2VJAA 1UK9A 1JHOA 3B38A 1OLSB 4JODA 3FCCA 1JLKA 1W76A 3CEHA 3WLOA 4WZAA 4P7KA 3FROA 5CVJA 2RGUA 4QO7A 1BCSB 2IITA 5A4IS 1JHPA 2X19A 3BHJA 1B6GA 1P6UA 2J3MA 1FC0A 2W6JA 3IT3A 3KOMA 4UUBA 1OT3A 5F7XA 1T4DA 4B84A 1J21A 1KH2A 2J3HA 5JYCA 4WKPA 3ADOA 3OH8A 1N8TA 4TMXA 3ZR4B 3GL9A 4OQNA 3ZI0A 2NTVA 3AKDA 4M83A 3VOAA 5KSWB 3BAFA 5LMZA 2JRLA 2J3EA 3MPUA 4Z9XA 4DUYB 3RABA 4ZVPA 3OWHA 4YAOA 3T61A 5E8JA 1OA1A 3X1ZA 3O7MA 3FTNA 2WV9A 3FNQA 3KSBC 3J7AC 4JLOA 1MJGA 1NNI1 1JHAA 1P0FA 4WAUA 3WGIA 5J2TF 1XSEA 2PS0A 1RDFA 3HCNA 5EQJB 3ZDBA 1N36B 3E70C 4CIBA 3QK7A 3AQIA 1P7ZA 3HY4A 4CLOB 2QL5A 5CP8A 2CYAA 3E84A 4PGFA 2QMHA 3ZJ4A 2IOQA 5AM2A 5C7OO 2H16A 2NU8B 2AOTA 4HV4A 4WV3A 3I45A 1I3MA 2GPAA 3I73A 3ER8A 1YVRA 3HNRA 1JL3A 2I99A 1PWYE 1VIDA 1XMIA 2IE8A 5K8LA 1WX1A 3MSCA 4HZIA 1E3SA 3F71A 4RUKA 3EXIA 4XGNA 1Q1NA 3E81A 3HABA 3K96A 4JI0B 1P45A 3LS2A 3BZUA 1K6JA 1AZLA 1R4ZA 1CS0B 2P5YA 1RJ9B 2Z4SA 3FBGA 3G2MA 3NZEA 3TSZA 5HQJA 2PZFA 5KS2A 5IVIA 1J7KA 2HC9A 2CFRA 1LTQA 2YWCA 1PEDA 3HCAA 1XA4A 4XI9A 4AXBA 1SCIA 2QMQA 4UMFA 4Z9YA 3AU8A 1A76A 1B3RA 3KR2A 1C3OB 3O38A 3Q98A 4UU1A 3TBFA 3MINA 3BFXA 5A6SB 1TO2E 2PX6A 1E3DA 1FMFA 1H5UA 2C2OA 1K88A 4UARA 4XIYA 1TKAA 1KEWA 1WDLA 2QTHA 2OA0A 4OBXA 3KB8A 1WKCA 5E6UA 2FY8A 3GDGA 4M87A 4B4OA 4CTMA 5J4KA 1SKBA 2IHJA 2PKYX 4XARA 2O4UX 1U9YA 1S8OA 3PC4A 3UJHA 2I4NA 4ER0A 1T4CB 3LCJA 4AJLA 3CKKA 4I1OA 1ODKA 1Z82A 2H5LA 3ZHUA 1U28C 1KTVA 2HSEA 4EKDA 1HPLA 3W8FA 3VYVA 4HNAB 3T1OA 4B7XA 1Q0RA 2HAEA 2OLJA 1B76A 5L45A 2Z1NA 4X8HA 4MRRA 5JOQA 3LY5A 5CCDA 1QCDA 3EZ6A 5IRCD 1D0VA 1ZI6A 3PRHA 5BSVA 2E4YA 2HM7A 4QBTA 3A6HA 1ZCZA 4P3KA 2XMSA 3JQ9C 1ULTA 3FYUA 4KO1S 4NDNE 5JD3A 3W05A 3OT4A 1RXUA 2DBQA 2DUNA 1DFIA 3RS5A 5ENVA 4RWEA 4KQGA 2I03A 2QP3A 2VSFA 2YV2A 4HB4A 5HIAA 3FDFA 2FWPA 1H8HD 5JAQA 2MINA 3MGAA 4D02A 4AY6A 4BU0A 4TS1A 2AF3C 5JAPA 3ACBA 3CPSA 3VJLA 1YMUA 4ZRNA 3TRFA 3NM6B 3ICWA 5LQMA 4W5QA 5EP3A 4L15A 2ZRBA 1QIIA 4P33A 1L7MA 1WCYA 1UK8A 3DWGA 3H9GA 2ATIA 4GXNA 3MMPA 4JNKA 3TZHA 1EK0A 1IUOA 3E3MA 3GBPA 3RS8A 2JFFA 4M1QA 1J5PA 1QUFA 5HDQA 1KJIA 4NZ9A 2QAIA 4A4DA 2IVFA 3L8HA 2Y1XA 3RQIA 4YJ3F 2GPTA 2Y1CA 2I6GA 3IP1A 1JTFA 2JGAA 5AT1A 1RSZA 5I5EA 1OXTA 1Z8HA 2IYWA 5J43A 1YIDA 3PX7A 2OO3A 2MOKA 4R81A 3HCWA 4YJDA 1PQUA 1QO7A 1VYUA 3GZTB 3QE2A 3AVQA 4FSXA 1SD1A 3SLRA 2QRKA 1PJSA 1HSZA 1BS1A 1MEOA 1N75A 1XZEA 3ET4A 4HAIA 4XVQA 4YP5A 2BTQB 3WLHA 2PE5A 5B1YA 3ZEIA 3DFFA 5LLTA 2NXJA 3PDUA 2QTNA 1D7OA 2PGXA 4XA8A 1TZKA 4RKEA 2DX7A 3KYCB 4W5OA 3CVJA 1NVKA 2IEBA 5JQGF 3S2YA 2X4LA 3EGEA 1YS6A 1MN6A 3L5KA 3QYPA 1IN5A 4DA9A 3OZRA 3MD9A 1W29A 3RBAA 3UHAA 4RZSA 4ZEMA 1VRCA 2PAAA 5JXGA 4EKIA 1NNEA 3DW3X 1UK7A 1NT2A 3GP5A 4AJEA 3TIFA 5IEJA 1J1IA 4RPGA 1HE3A 1I4OA 1DRKA 1EHIA 1QP0A 1QH9A 3ZLVA 3OTIA 1J4AA 4CRWB 1E6LA 4V38A 3CW8X 4G0XA 2OFFA 5E1OA 3ZGYA 3K35A 4FZ5A 3SK0A 4ZZIA 1XR3A 2IU3A 4RFSB 4BLTA 1THMA 1ONBA 4O8CA 1W25A 3THWA 3B1KA 5AIAA 1KOFA 3SJZA 5IXYA 5M04A 4MYUA 3L06A 2PMBA 3BE8A 2Z3VA 2WAYA 4IIHA 3B8HA 4JC0A 4TLMB 1D1QA 1IC6A 1QWSA 1H9BA 2GHRA 4GM0A 1TA0A 2JGLA 5FPPA 5TQVA 3G8CA 3WTBA 3FYUC 2HU2A 4OM8A 1H1TA 1XJ0A 2P3LA 3SE0A 2ZUVA 3RRYA 5JO0A 4IYRA 2VK4A 2FPXA 3OF2A 3L0OA 1GTMA 1ZVQA 3P9RA 3K2QA 1W85B 4NPHA 3PHBE 5DZSA 5I8PA 1J5XA 1LLFA 3NBUA 1EUQA 3MUFA 2FE1A 5EGNA 3QLEA 2Z1DA 1SVMA 1YJAA 3SKVA 1HZZC 1FLDA 2WVHA 4HADA 3R0XA 2JFGA 1ITZA 4IRUB 4PZYA 2O2ZA 5LC1A 5BUSA 4PW0A 5CA0A 2XB6A 3D5QA 1FSZA 1X38A 2A58A 1E6MA 2FWNA 2OBMA 2VEOA 1K75A 4YWHA 5IARA 1Q21A 1VCHA 2I7TA 2W2XA 2KJQA 4HL6A 4QODA 3TFWA 4BWGA 1OFVA 1NOKA 2HQRA 4PPQA 1T13A 1TT7A 1Z07A 1ISHA 2XA2A 5EYPB 2Q5QA 3HKEA 3UBMA 4RNDB 5CW1A 4B17A 4Q4JB 1A71A 5EJ2A 4LXIA 8GPBA 1AQUA 1ZUHA 1XZKA 3A4LA 3BGVA 1GTG1 3DR5A 1L5NA 1UXIA 1V39A 1CQJB 2EFDB 2ZR9A 1BWSA 1VIVA 4O4IF 2XVZA 4YPOA 2RKOA 4QX6A 2W2TA 5A9TA 1BEZA 3JD2A 4YP9A 3V97A 1H4TA 4AJKA 2ANCA 3LX6A 1RHQA 5HOQA 1ZU5A 2H31A 2Q27A 4K3UA 1RWXA 1B0UA 1ODFA 3I3SR 3MWDB 5E7JA 1YU9A 2FLVA 1J00A 4FHCA 2PQ2A 3ZJ5A 1DCTA 3N70A 3W0LB 3N2ZB 1F6DA 1BMFD 1VBKA 2QRVA 4RPHA 2BRUA 1W36C 3E9ZA 1R3UA 2RJ3A 3UMSA 2GXAA 1QIGA 2VNIA 3SOZA 4XQ0A 4A8HA 3OCZA 5CFOA 2FV8A 3SG0A 3CRQA 1AGXA 4UBOA 3T9DA 3AEQB 3ZZNA 3LQRA 3WGLA 4AO8A 3QVGA 4BE9A 1RYFA 4MUEA 1E1CB 2J0UA 4FMDB 4KN5A 1XKLA 5GY7A 1AX9A 1V3UA 2F1JA 2KI5A 3QLUA 5PGMA 3ZNOA 2IODA 5AXAA 5DLEA 2NYAA 4CM7A 1II8A 2H07A 1U8ZA 3C16C 4UOEA 4UZSA 5IYZA 1Z88A 4QU8A 1G5TA 4YS6A 4HGYA 5JD5A 1ES9A 4IKOA 2D8AA 4PHFA 1DAPA 3S2SA 4IDAA 3ZWVA 3DDNA 5CT4A 1IY0A 3IEPA 4A3SA 2Q45A 3CUVA 2QM7A 4CDMA 2ZIUB 4BN4A 2YJNA 3DO5A 2I9KA 4LF9B 3CNNA 5G0WA 4KQHA 3S29A 5HKAA 2GBIA 3PFIA 4EHHA 2CXXA 2WHEA 4NCBA 4TT8A 5AXBA 1XT6A 4OGWA 1AT1A 2EJVA 3BSYA 1GZ5A 5F2EA 1GDDA 1CQZA 4FHGA 3ZH9B 1K7CA 1YT5A 1VJCA 2GSWA 2YWXA 1V1JA 4YRNA 5EEHA 5HTKA 3RE1A 1Z06A 4JVSB 1T36A 5KPDA 4KVGA 4N0QA 2UUPA 1Z56C 2WILA 4I2NA 2AFRA 3FMVA 3UENA 4ZYYA 1JHRA 2R6HA 3RREA 1NAIA 2NPOA 3P7MA 1QH8B 2BMEA 1T9DA 3TQSA 4A2QA 3QX3A 1BEUB 1GDHA 4ZZ3A 3K1JA 3G9ZA 2AD1A 1VMIA 1VE6A 1KERA 2JFNA 3IAHA 3JQ7A 2MR6A 2KM1A 4BYMA 3ZW8A 3QLVA 1MNQA 2OM6A 2PWYA 4PIPA 2EG5A 1O0CA 3SIWA 1NJ2A 5JAIA 2A0UA 3K4PA 5LLSA 4EHBA 2Q1WA 4PGHA 4IIEA 4DLZA 2JAPA 4AFNA 3KQKA 3UVEA 5K3AA 4TKMA 1LB1B 1DOZA 1FMTA 2VDLB 2I2CA 4R16A 5JQGB 1FU7A 1I10A 4MRMB 5ALRA 1DXHA 1F8XA 1TM4E 1WMSA 2UZ1A 1QB8A 2WJYA 2EZUA 3F8WA 3FVRA 4GMGA 5C8VA 2VPQA 1T5IA 2QMYA 2JVJA 2FX2A 4YJFB 5I4KA 1T3GA 3WMFA 2ZRDA 3HY3A 4IGEA 1OE0A 2G4VA 4LYGA 3VKVA 2WV7A 1F2UB 3PZBA 4IFEA 4U9IS 3TTTA 2GPYA 2HEGA 4Z8XA 3H17A 4U4AA 1VLQA 3ETCA 2XWJI 1MPTA 3QBVA 3UK7A 3WK9A 4PQFA 4RVSA 2FX3A 1LJUA 2ZIWB 3L82B 2FFBA 3ANNA 2F3PA 3BRCA 3Q7SA 2KQUA 4TV8F 5LZ8A 1PKEA 1Y6FA 3OMWA 1UAAA 5JTTA 3QVXA 3EXHA 3GAZA 4RF2A 4DXAA 1JPNA 4TYWA 3BMNA 2MIIA 2R1TB 4BJ6A 1XRPA 4YUAA 1D03A 4G0PA 3PPXA 4AY4A 4YMLA 4OSEA 3FWHA 1G3IA 3NTRA 3P5SA 1IJBA 3DTVB 4FGSA 4O4IB 4NAHA 3C5CA 4NENA 4TTAA 1HXHA 1GUZA 3HA5A 3IILA 4W5HA 1EFPB 1YQWA 3PXCX 3RRMA 3GVCA 5G3ZA 1IVSA 4DDUA 3G7NA 1LZLA 1UMBA 1DTWB 4PG7A 4S2UA 5A3JA 2PU5A 5DBGA 5HKBA 2Y1DA 5JH7B 1W1UA 3DXXA 4URXR 1KWGA 2FPWA 3KVRA 3OZTA 1SOMA 4WUVA 3ZH2A 1BYIA 3LP5A 4PIMA 2I3ZA 1E3QA 1E9SA 1DQRA 5ES4B 1Y82A 2WDZA 1I1QB 5YASA 2G28A 4KFRA 1MRSA 3C4VA 3LRTA 1BSVA 4PN3A 1H2BA 2H4ZA 3GMIA 4B3JA 4RVOA 3PCTA 3WNQA 1XXHB 1O03A 1YOVB 4CI9A 1H2HA 1X1RA 1NZJA 1Y6RA 1YASA 4DWVA 4PY2A 3C15C 2QRGA 2G6BA 1IZ0A 3GPIA 4OOFA 4B6FA 1E62A 4DL9A 2D3TA 5A5GA 3HYNA 5JSZA 2GKGA 4X64B 3RD5A 4ZJPA 1IJEA 2MHCA 3HJAA 1NHGA 4EG7A 1OZAA 2M6RA 3RARA 5EWJB 2V0CA 4J8PA 1IXKA 2BF7A 4FBLA 4K46A 4N49A 3V9PA 4EY5A 4PLWA 2DBVO 1RYBA 1XD2A 3MBOA 1XRJA 2YHUA 4L8GA 1J49A 1NM5A 2POCA 4C04A 5A4FS 1F1BA 1OJ7A 4D57A 2WZBA 1C1YA 1J70A 5JDCA 4E22A 2ALJA 4YR9A 1GXSA 1B4DA 2ZRKA 2AYXA 1PK8A 3NLLA 4NVRA 1SUDA 2XEXA 2XUGA 3E15A 1H9AA 2QRMA 2HF8A 3EEBA 4TXLA 1UXKA 1E2BA 4K9SA 4DS3A 4QLAA 1Q7RA 3AUKA 4AZ3B 5LZ5A 1SULA 3OQHA 2XKKA 1LNSA 2YY5A 4ID3A 2I5PO 5BOSB 5LJLA 1SXPA 2NUAA 5EXSA 2B1IA 3QVSA 4LHYA 3MD0A 5JPDA 2BFOA 4QU5A 1T15A 3NU1A 4I3FA 2RKWA 2QV7A 3L7AA 4EW6A 2J9FA 3WKCA 1U9IC 4G2TA 5JADA 2KWIA 1HA3A 3A32A 1IM5A 2C8JA 1P75A 1SUFA 3BERA 4OP2A 1HNZB 3FKJA 3GMDA 1JTEA 1QU2A 4ZQBA 4RMNA 2ZZMA 3WLLA 4AKHA 4RJIA 1EUDB 3B20A 2PAFA 2WRZA 3OBBA 5EIWA 1O58A 1WUJS 2CUTA 2OHIA 2ZKLA 4LVUA 3K0BA 2OV2A 1A9RA 1HOTA 2EW8A 4GPEA 4JT4A 3BH7A 3CH4B 3JW8A 4K2AA 4KSCA 3BRWA 3WQHA 2FPGB 3KE8A 4EGFA 4J03A 2NUBA 5GONF 2HNAA 4WBNA 3JQBA 5KOJB 4GDMA 1KY5A 1QF7A 4FNAA 3SDBA 2W2KA 2VAPA 2D2EA 3NFRA 1J25A 1MVNA 5CX4A 5BP7A 1C7FA 1UT6A 3GT4A 2C2MA 3PNVA 4UHEA 1N1EA 1IU9A 5FOSA 1Z12A 1NYTA 2QNIA 3E3NA 1S3GA 1O9BA 2Z5VA 1ODSA 3VVMA 2O2GA 2PEYA 4CUKA 4HGZA 1MGPA 2PL5A 4RENA 1SKYE 2WD7A 1IE3A 3RC1A 3TSYA 5HJ5A 3ERCA 3JVDA 1R0LA 1V2HE 2Z2XA 5FPHA 4FS8A 1UJ4A 2J5QA 2G0AA 1D4FA 2BKAA 4MUBA 1U8AA 1VCIA 4MUXA 4TT3A 4W1PA 4FYKA 3V8NA 4W5RA 2C8VA 3DOEA 3AHCA 5L53A 1UBOS 2JZCA 4P92A 3O91A 3NIFB 1PV2A 2RFLA 1ESZA 3QU9A 4IIJA 1ECJA 1YL7A 2Z2JA 2RGCA 1WXEA 1E2QA 2YZKA 4JC4A 3L07A 2WJIA 4ZAGA 1JECA 3VU1A 3DF7A 5ERGB 2WEKA 4O1MA 1R27A 3O3NB 3ZDDA 1I7PA 5FCDA 4BMDA 1J9EA 3CT4A 3ZUGA 1M8KA 1C1XA 1L5ZA 1Z0DA 4MV9A 4U8GA 1F3LA 5IANA 2AN1A 1BS2A 1J99A 2QRPA 1RZ3A 2V5AA 4Z7QB 4X62B 3D8NA 4HAZA 3LCVB 5LCXA 2F1KA 1ZHFA 1Z6AA 3EZ9A 1U80A 2FPIB 1YS1X 2FSHA 3D0QA 3NXKA 2VJDA 2HMYB 1BFUA 3FGZA 4P4TA 5KSZA 4L0MA 2X8JB 1WB9A 4ZXFA 1ECBA 2XDQA 1GZ3A 3SMQA 4H2DA 4BDSA 2AI2A 2QZ4A 1PYGA 3DKRA 5AVRA 1C3VA 1LI4A 3CE6A 3OM9A 1DGQA 2GZSA 2DQZA 1CR2A 5JVDA 1J8QA 3H9BA 5EHNA 5DHFA 4P22A 1XYVA 1UL1X 2Q9UA 3VH4A 5BN5A 1G5QA 2HJRA 2Z4RA 5I51A 1B3BA 5J5AA 3UFXB 1Z0SA 1G66A 4NMXB 1YE5A 1BCRA 1C1DA 2WNHA 1QDLB 3EC2A 1TJ5A 4MZXA 4TWZA 2DP4E 2DRIA 4FOPA 1M1NA 2DPGA 3KKOA 3P1JA 3L41A 1N2CE 4GI7A 4CG2A 4LGMA 3G8AA 3VYRB 2EXXA 2C4WA 1E2UA 1DT5A 4TL9A 4Q0MA 5CPFA 1MAVA 1M1ZA 4UCWA 3R3ZA 2O8VA 5AK6A 2W22A 1UBKS 5KINB 2M98A 2AZDA 1VL2A 3L0CA 2LKCA 4GMHA 1H0HA 3BTUA 5IDYA 5IPFA 1CQJA 3GGSA 2DFLA 1TD9A 2QUJA 3KB1A 3OHPA 5JYDA 1ECCA 2ODAA 3MGGA 3PUVA 1Z4LA 5DGDA 4PN7A 3HV2A 4GI2A 5EE0A 4K9LA 1GQYA 2QVGA 3K2IA 4P38A 5TEVA 1M7BA 1YVUA 1EEXB 2WNIA 2C4HA 3C7AA 2AIRA 2BSXA 2AVDA 3CISA 1PEYA 1FMCA 1QLWA 2JCVA 2OESA 3L6RA 1KI4A 1YS4A 2B4QA 2BW0A 2HBYA 3A58B 3DYBA 3H8SA 3KKLA 3KT3A 2C5EA 2F64A 4L5YA 1JFFA 3VI3B 1TF5A 1R6DA 2R1UA 4MB2A 3AJAA 2XADA 5H16A 2J9ZB 3SM9A 4C08A 4JU8A 1IFXA 1E2GA 1N77A 3NRJA 3TQOA 4IJMA 4K8RB 2X6TA 5DMHA 3KZXA 3M3DA 1NC3A 1VA5A 1NVUQ 3GO4A 4AF6A 1PJLA 3UA3A 3RU2A 5DNUA 1LS6A 3DDWA 4RFLA 3DOFA 5K0BA 1OVMA 2H2IA 3Q8KA 3H6KA 2V1UA 2J5BA 3F73A 3HUEA 2XF2A 1C9NA 1SKAA 2G0NA 4HRAA 1O89A 2ENUA 2VRBA 2VWHA 3GCXA 2OO5C 4XM0A 4CT0A 2C4VA 2LKDA 5AIBA 1YOBA 1ZA2A 3DL0A 1L7OA 1NX9A 4I66A 3Q9UA 1W5FA 1ZZGA 2O2HA 2QD1A 2O4CA 2A7QA 4M0PA 2W6MA 5EE9A 5B3AA 1U7PA 4DBVO 1MP0A 1NXOA 4YP0A 4N65A 4EPXA 3UGJA 5KVAA 4BYGA 1YKSA 1YL5A 2Y9MB 2O3UA 2R7MA 3PNKA 4O33A 5TE9A 3VSDA 1NLZA 5A6VA 3O7WA 2BTEA 3NDIA 2O8CB 4JWTA 2D7CA 3HKBB 1JFTA 2VLBA 4O4JF 1R6BX 2PV7A 4X1YB 5H3HA 3LBYA 1U7DA 2PR2A 2XJ9A 3U56A 1HDYA 1DEHA 1V48A 2N3ZA 5HYVA 4RA9A 4ZT7A 4MO9A 2OK8A 3DAYA 4QPJC 3O4VA 1IXYA 1XQVA 5AUOB 1E3WA 2Q4TA 1LBTA 3AEKB 4A0RA 2X8AA 1R0XA 4X3OA 1XWWA 3L7KA 1CF9A 1R50A 3ITEA 2X0KA 3QUBA 5K3EA 1SHZA 1KOJA 3LLUA 4CEHA 1TCAA 2HXGA 2O3QA 2EKBA 2XDYA 3AKYA 3C7KA 3D0OA 3IPYA 4ON9A 4PC6A 4U8HA 4Z4QA 1E2JA 2Z6AA 3NTQA 1PT6A 3IAM1 3PXEA 4FLMA 1QGOA 2R1VB 2GTPA 1Z25A 5IT9A 5K2MA 2P2LA 1ACLA 1FXWA 1BH2A 1D2MA 1J2TA 2YY6A 4ZO4A 2XGSA 2VRCA 3BFJA 3E8SA 4Z0PA 4WINA 1GM5A 3GCDA 2QRUA 4DSZA 3BXPA 4H7JA 1S89A 3T8YA 1V8BA 2Z8YM 1UP4A 3E53A 1NR5A 3QPAA 4I1RA 1ADGA 1H65A 2I71A 1QH1A 3HDQA 2QNBA 1MW8X 5CYOA 2FG5A 4RW0A 1WCIA 4MKRA 5EHGA 5FPSA 4N47A 4L5JA 1JDSA 3WFJA 5C53B 1EUDA 1Q1GA 3DMFA 5B12A 4GYJA 2O2IA 2VA8A 4G5HA 2WTNA 4HGOA 5CD1A 5HW0A 4N82A 3UFBA 1F8FA 2C7BA 1AKVA 1XLUA 3PI7A 2OG1A 1S2MA 1BN6A 2DLNA 3UJDA 1OXVA 1O5IA 1LPNA 2O2YA 2ZI6A 4MMXB 5EJIA 3BXZA 1KVRA 4JSYA 4LZNA 3BJZA 4YECA 2WJGA 4FI3F 3UANA 3LLMA 1JR3E 2B4AA 4Q9AA 4BIMA 3EXAA 4G8CA 1B93A 2UAGA 3HY6A 4JITA 4DBZA 2CLCX 4JT8A 3EX7C 3CS3A 1I7SB 4PO8A 1M1YA 1U2ZA 1UJCA 1FW8A 2XNHA 5JHHB 3A3OA 4UHCA 4XGIA 4QIHA 3TL3A 1F7UA 2X7JA 5ISMA 3F46A 4ZCPA 4LY6A 4GEGA 1H66A 3MNFA 4MRSA 2CVHA 3QPVA 2DFVA 1GVNB 1EVJA 4JJ8A 2WINI 1D2EA 1SXJB 2FU5C 3IHWA 4ALIA 1U6IA 1YZKA 3B3JA 1KHHA 3F4BA 3D4NA 4MAFA 1DNPA 1WXWA 1YBMA 2I2BA 1C1HA 1NF3A 2J85A 2QSZA 3FKSA 4MRPA 4BDTA 4PXSA 4RVDA 1Z39A 2UZ0A 4FDUA 1P60A 1VL6A 2COUA 2IUFA 3LLSA 1CSEE 1NLUA 4QTTB 1JR4A 2FWIA 3DOCA 3DT8A 5JSUA 4M1WA 3OZCA 3QLJA 1BVUA 1JIIA 1N7IA 2CXHA 1QK3A 4EA7A 3II6X 4DMFA 4PX9A 1U3GA 3ZYZA 4FX2A 2Q6KA 2R8EA 3PJEA 4E12A 1BWQA 2ZAOA 2VBCA 2B21A 1NUAA 3IR5A 4RIEA 1QHXA 2OORA 2QXTA 2SBTA 4FNMA 1J2JA 4II7A 1GQRA 2HV8A 2VTVA 4C0HA 4YP6A 1WSAA 1E2LA 3PUWA 4HQ0A 1LEHA 3SFZA 3WGKA 3AUAA 1WLSA 3MBKA 3VBCA 3PUKA 4EUFA 1EWVA 3FN4A 3PUXA 3UJ6A 3W3AD 4IFTA 3G02A 3KD2A 5ESWA 2RG7A 2P2CA 3PE3A 5KKAA 3SBXA 5A9SB 1U3FA 2RAFA 1V2GA 3TJZA 1R4MA 2CNOA 2Q1TA 2H7XA 5AXDA 3WR5A 1A9PA 4D9CA 4EB6B 2OLEA 4ZZ0A 4RYDA 5E1DA 3FZNA 5CFRA 2B3DA 3D6MA 3JPYA 2HX1A 2DH5A 2W11A 3WQQA 4JYAB 2V3CC 3ZZMA 3U3JA 2BGUA