4ZYZA

Human gar transformylase in complex with gar and (s)-2-(7-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)heptanamido)pentanedioic acid (agf145)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
total genus 65
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zyzA00
1ZLXA 3R8XA 5J9FA 1RBMA 4EW2A 4NV1A 4YFYA 1YRWA 3TQRA 3GARA 4EW3A 4ZZ1A 1MENA 3DA8A 3DCJA 1RC1A 1C3EA 3AUFA 4TTSA 4ZYVA 1CDEA 3O1LA 4YFVA 4Q12A 1CDDA 5J63A 1RBZA 4ZYTA 4ZYZA 4ZYWA 4ZYXA 1MEOA 3W7BA 2YWRA 3KCQA 3P9XA 4EW1A 4QPCA 4R8VA 1GRCA 3AV3A 1RC0A 5CJJA 3NRBA 2BW0A 1FMTA 1RBQA 1S3IA 3LOUA 2GARA 3N0VA 4QPDA 4ZZ2A 3TQQA 3OBIA 4ZZ0A 4ZZ3A 1GARA 4S1NA 4DS3A 4ZYYA 4TT8A 4TS4A 4ZYUA 1C2TA 2FMTA 1NJSA 4PZUA 1MEJA 2CFIA 4IQFA 1JKXA 2BLNA 1RBYA 3Q0IA 1ZLYA 1ZGHA
chains in the Genus database with same CATH superfamily
3MIZA 5SYNA 1BX0A 4O4HF 1K2VN 2A33A 3TLMA 1VKZA 5EEHA 3HCWA 3KEMA 1J42A 1FCJA 2H7VA 3H3FA 4GBJA 3H4TA 4GPD1 2VK8A 4HGQA 4NECA 3G02A 4Q1EA 2YJ4A 3UJPA 3PC2A 1T1IA 5LCXA 2H48A 2A0UA 2VTVA 3ZTTA 1KP3A 4A4DA 2J87A 2X2OA 1YQEA 4KK4A 1QG0A 4RKFA 4IOJA 5TDHA 4DHEA 1KQOA 1QVVA 2Z9CA 2MOKA 2IS1A 3R3UA 1PEYA 1QYVA 2JLAA 3IAEA 4FSDA 4HZIA 4HWOA 4DCPA 5K6RA 2O1XA 4PQGA 3WIEA 2BHNA 3MWJA 3ZLUA 4ZMSA 3ODGA 2WFZA 1QHNA 2DKFA 2I4MA 3KEFA 1A9TA 4PQRA 4YR9A 2OBYA 2HRDA 2GM3A 2I4TA 3E22A 3HVKA 1B0AA 2X7JA 4IZ6A 2PGXA 4JBGA 5ALWA 4UDYX 1UPCA 5K01A 1AH2A 2G67A 1EWYA 1ONBA 1AHHA 2MINA 4PZ9A 3STWA 3HJAA 3WTBA 4EHLA 2PBFA 3N70A 2CYCA 4MLCA 2OSVA 5IXJA 1P44A 5CDTA 4GL2A 3O4IA 4US1R 1RZ3A 4LGYA 5D3MA 3V34A 2HMUA 3V5NA 3FJYA 3LDUA 3SDZA 3V6LA 2FWNA 3WLOA 3DT8A 3K70D 2BKLA 1SVKA 2JCGA 1OXKB 3HBNA 1A76A 1PV2A 2DPXA 3ABZA 4PFSA 3SAJA 3HJBA 4M46A 3ID6C 1ZS9A 2J09A 3ZWYA 3Q15C 3JWJA 3URKA 4FNAA 2B7LA 3ILYA 2ST1A 3WWCA 1XZJA 3VHLB 4BLQA 4XVCA 3K5WA 3O90A 4Z7QB 5K99A 2AOUA 5GM1A 5FPHA 4OBEA 2Z1DA 4BB6A 2B9EA 1O4WA 4P08A 4DEYA 1NLFA 2PGNA 4YO8A 2KWIA 2WT9A 5EWJA 1T0PA 3K0KA 4TMFA 1JFSA 2KYRA 2X0NA 1E2KA 4IYRA 4JK3A 3OLWA 5EINA 3VYRB 3BMXA 3R9WA 3D1JA 3FRHA 4KYTA 4EG4A 4QRDA 2ZYHA 3MRXA 2TMDA 2IWRA 3E35A 3FPAA 2QAGB 3A25A 3D4BA 5AO9A 1AO0A 3A1UA 3QU5A 3CT6A 3U48A 3UJ8A 3HH8A 3PHCA 5EMJA 2RKBA 2JJ1A 1BJKA 5CLHA 1XQXA 1UJMA 1WMEA 1GTSA 1GTZA 3SFZA 3IAM1 5FFMA 4M8SA 1W0KD 1C7JA 2VG8A 2XHEA 4WEOA 2H17A 1B6SA 4OVKA 3ADCA 1VXOA 5FOUA 4B3HA 1MC5A 3Q3EA 1ZY2A 4L9SA 4YP9A 4X60A 3JARA 3HCDA 5JD5A 1XRJA 1OLXA 1ZA1A 3T3EA 4CKCB 1JKJA 1V7ZA 2DWUA 2RG1A 4FR2A 1SAYA 2AHOA 3KEQA 4NJOA 1XMIA 4HR7A 2VRNA 2QQGA 1WSAA 2HB6A 1N2JA 4C0SA 3KAQA 4QXOA 1SZDA 2V97A 1FTGA 2AJ8A 2P2NA 1I1HA 1FRVA 1LBIA 5D3QA 3WLKX 1XYGA 4B8ZA 1LPBB 3U4HA 5KU1A 1QQAA 5ALGA 1NN0A 2FWBA 4KFRA 3AK4A 3PPYA 4F4FA 2UYCA 1TQ2A 5JLJA 1YRLA 3CF6R 2ONYA 4XARA 1XNJA 5LPNA 4FQ5A 4D4MA 2C8LA 2QTWB 2XA9A 3H9JA 2QX9A 5JTUA 2WKSA 3WRXC 3Q4GA 3BFKA 3FCAA 3MM4A 3OP1A 3JZAA 1KRWA 2UKDA 1IM8A 2OD9A 4Z4EA 4RDXA 1EU1A 2WPNA 1GY8A 4MW6A 3KUXA 3UUGA 3OE1A 4PHTA 5JD4A 1IXRC 1OASA 5CURA 1IM5A 1DEKA 3PGMA 3RSCA 2QVXX 1JX6A 3RV4A 5ELMA 1RJ9B 4ACAA 1US8A 2WT4A 1E1KA 1S0UA 1FFCA 3ENVA 2V1UA 5LQSA 4KMOA 4L73A 4LHWA 4U8GA 3PFNA 1YMVA 1UJ5A 1OSNA 2HNKA 2X8AA 4WOBA 3IUMA 5ERYA 3NHUA 1D1QA 2P5TB 4YASA 2ZIEA 5F12A 3GNLA 2VZ8A 3GIWA 4IZOA 4CCWA 3HXKA 2OVBA 5CK4A 2UDPA 5C81A 1QH0A 2E3JA 2VPYA 1Z8NA 3OY2A 4HDMA 4YAJA 3RH0A 1T0IA 4UZEA 4D41A 2ES4A 3HU2A 4TXHA 2ZRAA 1SUCA 3ZQJA 1SQ5A 3I6BA 2BFEB 3HMQA 3TJZA 1FMFA 3ICOA 3QEJA 4FNGA 4Q3EA 2J67A 1UXHA 2ZJFA 3NHAA 3A32A 3IQZA 2EKDA 1JHAA 1NT2A 3LBAA 1KZ9A 4P0TA 4HADA 4R7GA 1RXYA 2EBWA 4RJTA 1I9GA 5JDCC 4DABA 3MB8A 1KZHA 4DADA 4AWBA 3IOMA 1SZCA 2ZRNA 1J21A 4MEJA 5A05A 3U7QB 5BMVB 3HEMA 4IRUB 3TIVA 4M1TA 9LDBA 2XCUA 3HWX1 5GVSA 1DBIA 1MUUA 3O38A 1VHWA 1ZP6A 4ZQHA 5JYEA 3SCZA 1KYXA 3PNPA 1E2QA 2G8NA 5AM3A 1X3SA 2AMJA 2GD6A 3FKSD 3D7KA 2HU2A 4NMHA 3ISTA 2LV8A 4X24A 5EE9A 1YRQA 4G36A 5ADWA 3MJCA 3NEPX 1EDDA 4RK5A 4YMSA 1LLCA 1QO7A 1QWOA 3ZZUA 1QRSA 4HSEA 2C1XA 2FPGA 1IXKA 1MB2A 4IFBA 3LBHA 5F2EA 5JSHA 1QZTA 2ZS7A 1DHRA 4QXRA 4ZTZB 4NIMA 2DKNA 5TMBA 3CCFA 1H2EA 3K1ZA 3O82A 3NBAA 2HUNA 3OQIB 4UBNA 4KITB 2PD6A 2F1OA 2IZZA 3FNIA 5IFLA 1II8B 1W0JA 2H65A 4L07A 5KYNA 4N5IX 3NV9A 3TAUA 1KI6A 3WK6A 5EIBD 4M37A 2A9JA 2PANA 5JRDS 3PGLA 1Y5RA 4FLMA 4FC7A 3V55A 1BG6A 3RLFA 2VDWA 4N3GA 4GM0A 5DBFA 4DYVA 2RDMA 2ZUCA 2FFQA 2BTQA 1SC1A 3K5PA 2GAOA 3LAWA 4KLNA 4C3OB 5CFLA 5HE9A 3STHA 5IVPA 4A73A 2QROA 4DIDA 2AK2A 3G8YA 3GJ7A 4BAUA 1BN6A 2F8MA 1GJRA 4KXYA 2I76A 5D2CA 1C8BA 5HRAA 3EOBI 2N9UA 1YOBA 4R3UC 4YJ2F 1QK3A 5EQFA 4E88A 3EF3A 1ZW1A 2I8AA 2VUSA 3QG1A 4U7HA 5TPWB 4IVNA 2XDYA 2HYIC 4GOLD 5HA5A 1E32A 3V9AA 2OTCA 1OI7A 2GVDC 2J9ZB 1PYDA 2XAUA 4FFLA 1MG5A 1UAGA 4WKCA 4X94A 3GBVA 1PU2A 3FKJA 1G3MA 4O25A 4RVNA 4BYMA 3FUWA 3BAZA 4BL5A 2I7VA 1MOQA 2O23A 1SHKA 4NV0A 4H7JA 4OB8A 3AVUA 4I5EA 1IY8A 3OT5A 4BEWA 2WLSA 4JDUA 3ZHQA 1JQ3A 4RIHA 4CTKA 2JGAA 3DEHA 4JLDA 3DFZA 3S2YA 5EHXA 1VYUA 5HF5A 2R84A 1NR1A 2LP4Y 2VXBA 1D5CA 2JL1A 1E2FA 3U44A 4QDXA 1OT5A 1JHRA 2POCA 1XD8A 2ONCA 1DC3A 3L0ZA 4UJ3A 4PN3A 2F6RA 2G1PA 1YB1A 1IZ7A 4ABYA 4OO3A 1OY1A 2IEGA 4BECA 3GRAA 3SD7A 5TQ0A 1A2BA 3EXG1 3G49A 3E9EA 4NTZA 3ZGNA 1Y9DA 3PCRB 4OMUA 4WZBB 4F3RA 3G85A 1B8UA 4Y1RB 1SG9A 3FOBA 1BS2A 1Z08A 4JLSA 2I1WA 4REQB 2WP0A 1SXIA 1BVYF 1KYWA 3MFYA 3GGJA 2QUBA 5BMVA 5HZHA 1CQIB 2G77B 1NZDA 3E9MA 5L51A 1Y4DE 3N0TA 1WXEA 3H8WA 4HB0A 5CVJA 3WJ7A 3FVVA 3WLQA 2J3QA 3O3OB 4ROSA 3C8HA 4RMNA 1N9GB 2Z56A 3BF7A 1XZBA 3AETA 4HQRA 1MGOA 5L6MB 5B4TA 2BSQA 1F38A 5TT1A 4Q37A 4Q02A 4UVGA 2D7CA 3IR5A 1Z6ZA 1OU0A 4N12A 4CN8A 4WLOA 1FNBA 3VOTA 5TGZA 4ZK6A 1H2RS 1BMFD 1XQ6A 4RIEA 1JR6A 4KDCA 3HRIA 3R3VA 3F5SA 3KWJA 1DAHA 3W5AA 5B7PA 5A4KA 2FKNA 5EIBC 2Q27A 5B4VA 4YJ3F 1PAUA 4BFZA 4KQ6A 4C0BA 2IPAB 2C2ZA 2APJA 2ZSEA 4JJ6A 4N3CA 5AHKA 4YRKA 4NOMA 3QBVA 4PGHA 1CQIA 3CNEA 3F6CA 3AC0A 1WABA 2PCLA 2PHZA 3M9LA 1DAGA 1F06A 4UARA 1SA0A 3DFIA 5TQVA 3WLIA 4ZQEA 4BMSA 1N7GA 1HZZA 2AV6A 2FWRA 4HRYA 3K1AA 3VR6A 3V8VA 2Q5OA 4DLPA 4HDRA 1JDUA 3QMVA 5CVEA 1AMNA 2H31A 4M7RA 1MW8X 1DAIA 3GAAA 3ZE0B 2IZ6A 4CM8A 2JFPA 4NNJA 2Q6IA 3ME5A 5EJ9A 1VFPA 2H85A 3NKVA 3NCHA 3RU7A 4RAQA 2BLLA 2V0NA 1QHXA 1JAIA 2BFWA 3IXLA 4MJ7A 4D0NA 5TMEA 2XGJA 1KJWA 3CR8A 4D3DA 2AG0A 5A4AA 2BFBA 1NONA 3LUFA 1ORIA 2O57A 2HYDA 2P2GA 2DHQA 3ISJA 5IK2D 2ZSFA 4LXIA 4XAQA 2XMZA 2M6KA 4D79A 1ZUWA 2HPZA 2JCBA 2VZEA 3H16A 1Y7LA 1WE2A 3E3AA 1RPAA 2FJPA 2A78A 2PIAA 1GITA 4LDZA 5TS3A 3D4OA 2EFHB 2P0EA 4D57A 4YRNA 2VF7A 3MGBA 1E8MA 3O73A 3GVIA 5SY4A 3CX8A 3T0GA 4EPWA 5FHQA 5HP4A 2QSYA 3R5KA 3L8EA 4KFTA 2JFXA 2DPHA 3GRPA 4DIOA 3CX7A 3TOSA 2ZS9A 1EQUA 1KEVA 4OHRA 4QO8A 5F1YA 5KNDA 2NN3C 3HSSA 1ESEA 3X43A 2XBMA 1X15A 2PD3A 1K7YA 1SIBE 1EP2B 4BO1A 3KNZA 3PTLA 2YJ3A 2L19A 4EJFA 1CE8B 3H42B 1Z6YA 1QVAA 2FH5B 2REOA 2XMQA 5CA1A 3OIVA 2P65A 4Q05A 2C3PA 1WB4A 1YQXA 2WIAA 2BHRA 2ESRA 5TRTA 4ZV4A 3RYCB 3ZCPA 4XGRA 2O8BB 2VYVA 1BGWA 2GO1A 3B70A 2C42A 5I7UA 5GADl 3HUDA 2GJ9A 2OHHA 4WOPA 2V59A 1CU1A 3DEAA 1S4QA 2J41A 5KTTA 1VJ5A 2ZBEA 3V7WA 5JBQA 2VDOB 4K1XA 3G7SA 3RSZA 3NBMA 3GG2A 3C3BA 1TF7A 4KQIA 4X91A 3SSMA 1KJYA 1U5AA 3FFXA 3WP0A 5DNUA 1M73E 2QJRA 3E3MA 3O8QA 4AP9A 4DCGA 3S29A 4WKBA 2J0EA 1RW4A 2I2XB 3DWFA 4ZC8A 4B7UA 4CFYA 4DEXA 2LVBA 3DZHA 1DKRA 1KGDA 1Y1KE 2C0CA 1XZMA 2QRZA 3COWA 1F6WA 4IMJB 4UPDA 1C30A 1OAOC 3BERA 5LA6F 3VZBA 2F4VB 3ECCA 3Q2OA 2CVFA 1UODA 1MLDA 2Y71A 3MS2A 3FNBA 2BF7A 5HMMA 1O6FA 5L9AA 4CMAA 3AHFA 3DHNA 1SHJA 2XHZA 3CNBA 3I2YX 1CUSA 2G9VA 2XRYA 3QKWA 3R1IA 1M33A 4KQ2A 1ORHA 2WHEA 1PGJA 4NMLA 1D0SA 3LFTA 4CG3A 1F8XA 5CCDA 4UAUA 1RWKA 3O4JA 1BH6A 3EFEA 1M6NA 1URPA 2A5JA 1OIWA 3G9QA 3INYA 3L0YA 1S2MA 4G1VA 2INGX 3PJFA 4QPDA 2BGJA 1T5DX 4YPFA 4PXYA 3EUAA 4IIYA 2F43A 3SYLA 2G8LA 4QGBA 4EGSA 2QY9A 2MINB 3PDUA 3KKEA 3C8MA 1KMCA 2EOAA 3PXDA 4LJ7A 3RC1A 4BBAA 5I4CA 4O2RA 2R0QC 3TBFA 3I6MA 3SJUA 4GQIA 4H77A 3QXHA 4QA9A 5T7BA 4FJ0A 3TO5A 4MV1A 1QHHA 1CG6A 1RWXA 1WUTA 3V4PB 1YMQA 4JYAB 1F9AA 2GZAA 1O6BA 1WCIB 5IG2A 5IH3A 2BIFA 3LZDA 1BU5A 3LM8A 1C1HA 2PNFA 3SHWA 4ZT3A 2NO4A 5I01A 5IJ0B 1P17A 2QIOA 3M6UA 4RU1A 2VK4A 3CO5A 1P81A 1XK6A 4MRNA 3WYEA 1P4GA 1S1CA 2X4GA 2C2BA 4MSUA 1NG1A 4DHWA 3M49A 1RPJA 4UNRA 2BC9A 5DRYA 3JZFA 1HE8B 2RGWA 1BIFA 4CI0B 4DUYB 1OAOA 2JZNA 1W85A 2VPZA 1XELA 3I9FA 3FCYA 5CGQB 5FBQB 1KJNA 1VLVA 3UK2A 2O2SA 3CF0A 4LG1A 5COBA 7GPBA 3TVTA 4DLLA 3D6AA 4KR6A 3QX3A 2X3FA 5TS2A 3K1JA 3KAKA 1DIAA 1LU9A 4ARZA 4B6QA 3G0OA 5ICCA 5KDDA 2CE2X 2D5CA 3F47A 3CXRA 2R6R1 4YP1A 3O75A 3JSXA 2I55A 4IDDA 1QUFA 3WJ2A 2GRAA 3NM5A 5EIFA 1CS0A 4N18A 2R9VA 4GI2A 2ID8A 4HMPA 5JFTA 4WCDA 1HDXA 4JL5A 4B46A 1NRIA 1BX3A 3ACDA 3KLNA 4GU5A 4G25A 4U02A 4UHJA 1MG0A 1VMEA 1KE1A 1VL1A 3K05A 1W7AA 1LRLA 2QF7A 1JBQA 2LCQA 3IPXA 4KODA 2G82A 3IC5A 2ONJA 2G83A 4M7OA 2RIRA 2HU7A 3B1FA 3HPRA 1HLGA 2D54A 1X7WB 2IXBA 4P3XA 3RABA 3UWSA 5CLFA 1WHSB 2AFVA 3A4LA 5J2TA 3HC7A 2NAFA 1QCYA 4P3NA 4ASUD 3T3OA 1D4AA 1PGOA 5T6MA 4X61A 1SKQA 2QMHA 1IULA 1UMCA 2XADA 5D86A 2Q9AA 2E18A 1L8XA 3B3JA 3E9NA 4JSTA 4BN4A 4BV8A 1UDRA 4WBNA 4G2NA 1O1YA 1V48A 2WHXA 4HNTA 3DV0A 1O08A 3NC1C 4PRZA 4Q4JB 4I4NA 1M1UA 1XD2B 2CNNA 4TLEA 4LNUB 5BSMA 2XZLA 2Q2VA 5EHNA 1V25A 2ASVA 1ACJA 1VE5A 3QY9A 2OFXA 3DTVB 3A1SA 1H8EA 1UDXA 3N1UA 4CW7A 4F6CA 3B6MA 3IPLA 1NBMA 2QUJA 2I6UA 4FMCB 3W5DA 4CMGA 1LW6E 2VH1A 1GIAA 4A10A 4QE3A 4OQDA 1X7GA 3GJ3A 4HWTA 1YBVA 3V1YA 3WQBA 3ZDRA 1FRFS 1GNRA 3F90A 1TCCA 2C9OA 4IILA 4KR0A 2RBEA 4TT3A 1IHUA 4E7OA 1AQ6A 3I9NA 5JI3E 1DAKA 1VRCA 2GTHA 1TU0A 2OO5C 3R23A 1ZSVA 4L74A 3IQWA 5JZVA 5GZ6A 4QG3A 2C0PA 2QTLA 4LTNA 2VJMA 3HDHA 4HYYA 1E9FA 2ZYDA 2G04A 2HBYA 1IN1A 1DDIA 3CYFA 3OM1A 1JIKA 4Y0VA 3GDOA 1ZD3A 4QXPA 5EZ6B 5A62A 3P71T 4CLRB 3COPA 4DR2B 5AW4A 1SUBA 4BO3A 4M0FA 3DF9A 5DW0A 5EWLA 1ECBA 1VPWA 5JJLA 1Y9JA 5HVNA 2DBYA 4IGEA 4O4JB 3NXSA 3ZDXB 1S6YA 4MYRA 3IL2A 3GMTA 1C30B 1TW3A 4CT4B 4FXPA 2ODEA 3A2LA 3GEMA 1C9JA 1EGMB 2AQ8A 3O8DA 4I50B 5EGSA 1ZMXA 5IABA 1XAIA 1U3CA 3KQOA 5LUAA 4MS3B 3TWOA 1W5BA 4ETIA 3LZCA 1CRWG 2I4IA 1RJ9A 4IEIA 4R16A 1R8QA 1N5LA 5KSOA 3TE7A 3R8FA 5KTSA 2AOXA 2RKOA 4C6TB 1QK4A 1WDLA 1EA7A 4PS1A 2QWXA 2P68A 4QNMA 3PDJA 3TQQA 3UOGA 1GD1O 3NUQA 5DASA 1CY8A 7MDHA 2E48A 4YWHA 1Y98A 3IT0A 3HNOA 3M6FA 3P4UA 4G09A 3TLAA 3VR0A 3WLNA 3RG2A 1B0PA 4HNAA 2A5YB 3IQFA 5F7ZA 3BSYA 1QTIA 4URXR 2HZBA 3ADPA 2O59A 4WFJA 1HEIA 2QTGA 3AHJA 4P4GA 2OHFA 1EDOA 3G9ZA 2PAAA 3RQIA 4TRMA 3U3OA 1ZPDA 2FOXA 4LC0A 1AB6A 4C03A 4F8JA 3THOA 3PNBA 3I01M 4LC9A 4O5AA 1GGEA 1MAWA 3A27A 1C81A 1RWBA 4DG8A 1IBKB 5M2QA 3N5KA 1Z35A 2B4TO 3V46A 3AHHA 4RABA 5AIBA 4M36A 3PXEA 3JRWA 4FP9A 3THYB 1NE2A 4W5OA 2R4QA 4WLEA 2C9YA 4MR7B 5GJCA 1DXQA 2P5UA 4IVPA 4D9MA 4Z1OA 1NY5A 3NIBA 4F1JA 1I30A 4PG8A 4YMGA 1XZEA 3SIPA 2ZSBA 5EXXA 4RTQA 3HB5X 1JHMA 3QV1A 5HKAA 1KJ9A 3WKDA 4BZZA 1RCUA 3EVTA 3IS3A 1OBHA 3U1BA 1MV8A 2A1TS 1ONNA 2XDQB 3AEZA 5DNCA 1RRGA 3NHRA 5IUKC 1DKUA 4F3CA 1R0KA 5FTMA 5AP9A 4OLJA 1CC1S 4QYMA 3L8HA 5ECDA 2DHDA 1BEUB 2C2MA 5THKA 3FJOA 2X86A 2GVNA 3OJOA 3BXZA 4NI5A 5U1PA 3USCS 4QNNA 4AURA 4RGVA 3C4QA 4C3ZA 2QTHA 1CBUA 4GMGA 2PAFA 4RMJA 1P72A 3IBCA 1PLKA 3MRSA 4I1OA 4BXOA 1SC4A 2QD5A 5BPHA 1WCWA 1WSBA 2HPHA 2O2IA 4MZXA 3R3ZA 2Y0BA 3EGCA 1L5KA 1J9GA 3UH1A 1JTFA 4DUPA 1BH2A 3ZD9A 4ZO9A 3CJQA 4HDSB 4DT1B 4K5QA 2BGRA 1BQ4A 1JHQA 2YFKA 3OJCA 4TWBA 4BNDA 2D1YA 1NT4A 1UXGA 3DMDA 1Q6ZA 4DW8A 4C07A 3HYRA 1BMDA 1KY5A 4TXNA 3I32A 1KH2A 1U0TA 4ZV9A 2QVLA 1UR5A 3SKYA 5P21A 3LX4A 3GPDG 5IKOA 5LFAA 1E61A 2BTEA 2H7XA 4DUGD 3LGXA 4I1SA 3H2YA 1KSHA 5KAPA 4BY9E 4MA0A 1ENPA 2OBBA 2PZAA 3IUYA 1GTL1 4JXXA 2ZYRA 4DR1B 3BHMA 3ECAA 1EI9A 2FMKA 5C51B 1CZNA 1EA5A 1Y3FE 3BRWA 3CNOA 3FYSA 3KQYA 3QLUC 3L8ZA 8ABPA 1FFGA 2DT8A 3B8EA 4YP7A 3WDKA 2IJGX 3IQEA 3ZCUA 3L41A 3E9RA 2WOOA 2PUHA 3EVEA 1DZIA 4XJSA 1Y8ZA 4DR4B 4HATA 1JLKA 5IWAB 1WBBA 1MX5A 4OUDA 4EMUA 4NXNB 2E37A 2RK6A 4D56A 1UT8A 3DWGA 1TE2A 1MABA 3QA9A 4QDOA 4U9IS 4XWGA 3DDCA 1PQYA 1E3TA 1LPAB 3NDIA 4M60A 1HTTA 1YFKA 5LKRA 4GLOA 4H59A 2GXSA 3ESZA 1IDN1 5AW2A 1HYEA 1Y1QA 1YA8A 4BMZA 4KH0A 2IYRA 1GG2A 3VSEA 2H0AA 4ND4A 3LKDA 3M4ZA 1N0WA 4C0KA 2X6TA 2GYYA 3ED5A 5B7NA 5BR8B 1EVKA 2QN2A 2WWRA 3EE6A 4J7UA 4WEQA 4AJJA 2F3UA 1H9CA 1VG1A 3WNDA 1YF3A 4Q5IA 2CMGA 2NU6A 1H5NA 1N5RA 4GECA 3NJ8A 2LKDA 1ZLYA 1UBLS 3AH8A 2FVXA 3AHCA 3CLTD 3KKQA 5DPMA 4Q7QA 2I87A 3VV3A 1P73A 5CT6A 4Q4HA 1ULZA 4IFTA 2O7RA 4FOLA 1Z4PX 1BXRB 2VAMA 4M53A 1YR1A 4O59O 5SY9A 2BOVA 4OBXA 1KBQA 2I78A 4Z9YA 4JB2A 3D3WA 3UB4A 4ZGWA 3E22B 821PA 3SKXA 2QAGC 4H35A 4INZA 1Y6QA 4J1QA 3WGJA 4IFIA 3G0IA 3TCXB 3WYCA 2PSEA 4L8WB 3AF5A 4QOHA 4BMXA 1F5SA 1DB3A 1K06A 2Q6OA 2R60A 2REBA 3DMYA 5ALTA 3VMMA 3ZIUA 8GPBA 2GZRA 3CN9A 3LXXA 3QVOA 2JAWA 4ZVRA 1W8DA 1CUUA 2X41A 1CV2A 4ZDIA 4RC9A 3A6ZA 4ZAVA 4ZVSA 2KS6A 2O9JA 2BMEA 1J56A 1JHUA 3F74A 1JJAA 3QU7A 5FA5A 4A16A 5C8YB 1CCWA 1E6LA 2JD0A 4LI3X 3REOA 2R6FA 2ZJ8A 1NSYA 3A11A 4RPCA 4EO7A 2WTUA 1CLEA 4XM2A 3MNFA 4DA8A 1UFKA 2FEXA 3B51X 4F2WA 1F8GA 2VTEA 1I24A 2CVQA 1N8SA 1IQ0A 3QWBA 2VP0A 2YVAA 4L5JA 3ZIDA 4BRSA 2JEZA 1DCFA 5TR9A 4CF6A 1M1ZA 2VAXA 3KZNA 4K81B 3B12A 2I4OA 2HHJA 2G36A 1Y7TA 2GPNA 1SUSA 4JI5B 4D43A 3HJTA 4IWNA 4E51A 1P2FA 2W7TA 3RVRA 1IC6A 2REXB 3W2HA 3VYVA 2G63A 1GTVA 1ENZA 1MDBA 4MYCA 4Y98A 2D7JA 1I36A 1N5DA 4LCBA 5CCBA 2O5RA 3FAKA 2XRFA 1ZR4A 4RHEA 5I51A 2IZ5A 3AIKA 2DLCX 4RLQA 2HWXA 1HQKA 1RQRA 4BVJA 3LCVB 2EHJA 1U98A 5TF0A 1E7QA 3ASYA 4RQTA 2GCEA 2ZUEA 4U2FA 1H3FA 4EDFA 4KOEC 5FUQA 1R74A 4JBIA 5F3RA 1J0BA 3OH8A 2RHRA 2JIZA 4MR8B 1CFZA 2FHSA 1GQOA 3BWDD 3QKRB 4MQUA 3ESBA 1OGIA 3L7CA 2YJGA 3Q6MA 3OTQA 5TJHA 1VPVA 2OD7A 3R7WA 4GMXA 2Q1TA 3EEBA 4HAVA 3H7AA 5KHLB 3VR4A 1IUNA 2QZ4A 3PPIA 1K75A 1KYQA 3ORFA 3P7MA 2DFNA 4BDSA 4EGCB 2J31A 4JC0A 4NU0A 4TRNA 1K98A 5FF9A 1X7YA 1U81A 3T1OA 1M5RA 3OBIA 1XVVA 4HB4A 1GYRA 1CUDA 2DPMA 3SEFA 3OIFA 1EXMA 3PJRA 1RLOA 2I3GA 4BFCA 3TTSA 3MT9A 1GILA 1JT2A 4W8GA 1ISJA 4G1UC 1J7KA 1UZMA 3L40A 1JU3A 2OMKA 3VSBA 3ZE2B 1R6BX 2QRJA 2ZIGA 3N74A 2R79A 4QJ3A 4CV0A 1TJ3A 2OXRA 3C3KA 4Z0PA 3TCKA 3TZQA 1KO7A 1N2IA 1YHZA 1TNDA 1UZNA 1EBBA 1VYVA 2G7MC 2HIHA 2OESA 2PA3A 3LBFA 4GT1A 2QGFA 3ZPXA 5FYDA 4UHFA 1N57A 1M1XB 3DW3X 3M33A 5E2AA 1IJEA 1E6KA 3BGIA 3HQ4O 1K08A 1NLMA 1H0HA 2QHXA 2ZIUB 3D7SA 1J5PA 1SURA 4MVJH 4ZO6A 4ZOEA 5JY6A 3ZTWA 2QVGA 3H6KA 4AJNA 3FNRA 1I8TA 2HR1A 3AX6A 2DKOA 3JVUA 3NV7A 3W90A 3ZCRA 2VN8A 1TMYA 3RTCA 1QG2A 4HLNA 4ZU6X 5G4KB 3AHEA 5B58T 3TZHA 1NP6A 1L4KA 5G0UA 1B6TA 1DFIA 1I4DD 4NBVA 4MUAA 4PIMA 1K8QA 4BBPA 3ZVNA 3F8WA 4BYGA 1EFTA 3DAHA 1ZJ6A 4Q21A 3PFHA 4WXEA 3TEJA 5KS2A 3GEDA 4ILEA 1Q0LA 1UZUA 2EWWA 1XL0A 3C41J 4FFMA 1H8ED 2HSDA 4IHJA 1PEDA 5DE3A 1CETA 5HFAA 2OQVA 5JARA 4ZA2A 3T3NA 4C78A 1E9BA 1Q3HA 3O8QB 5B37A 1E60A 2HF7A 4EG0A 1A9RA 2AI2A 2XLCA 2Z83A 4IV5A 3JQGB 3WVNA 4E14A 1ZMTA 3BMCA 4QQFA 4YJGB 1FYFA 4RTPA 5FWXB 5JDIA 4HZUA 1Y9AA 4R6WA 1K1EA 2NU6B 1EVYA 3AJ8A 3AVQA 2OGWA 1DCKA 1GPDG 3R0JA 5FPYA 2QZZA 1TVMA 2QX7A 1PJCA 3LWNA 3TJMA 2ZWVA 3UM9A 4WXHA 5DT2A 2ZUBA 4KGXA 2WSIA 5EZ5A 1DOAA 1FVHA 1KJIA 4BE9A 3K09C 3PXBA 1IRIA 3HMKA 3RS5A 3BDIA 1DUIA 1E1YA 2ZTMA 3C16C 2HF8A 1J49A 4V38A 1DRWA 1G7CA 2QLLA 1N8TA 2Z57A 3L1VA 4ZVUA 1E3EA 5B7QA 3TUIC 1F2TA 2NW6A 4XGIA 1BKDR 1E3SA 1GKYA 1LCIA 1ORTA 1IG0A 3DAGA 3V42A 1VSBA 2ZITA 3KPUA 2A9QA 3AQIA 1A50B 3L7AA 2COUA 3KD2A 4UAVA 2GUWA 5EJMA 1NXPA 3LIIA 2VHWA 2YJNA 1TZJA 3GK3A 2XB8A 2NYUA 1L0BA 2Y1EA 4W8HA 4MVXA 3ZOZA 1Z74A 3M8KA 1LVHA 1QE0A 3AFHA 4N65A 4NYIR 4EHDA 1CUAA 3SC6A 2N75A 2YMMA 4KBFA 3VKUA 3KWFA 3PIRA 4S3MA 4DSAA 3V32A 1E3QA 3L18A 2QGNA 4B2YA 5DGHA 2NTNA 1QGED 2RGYA 2XUGA 1K3TA 5HS4A 1L7MA 1U3VA 5EP1A 4I36A 2EWMA 1PZEA 5BW6B 3LVRE 2OY0A 4L1KA 4DBLE 3F6YA 5JDIC 2A9VA 1RYNA 3B13B 3IUNA 3RG8A 2VHYA 3PA8A 5AESA 5LM3A 1WNFA 1YRHA 2IKSA 3L7IA 4G8DA 4UTRA 3I53A 3R7LA 1ZKDA 5IKPA 2CDNA 4AJHA 3OQPA 4KSYA 2HJRA 4LXTA 4G1EB 2ZJ1A 4F8EA 1N2OA 5LZ9A 1FYEA 1FQWA 3U61B 4M2LA 1XK7A 3K1AB 1W36C 1KI3A 1R4MA 2ZROA 3WRYC 1CEEA 2DT5A 3HA3A 4RPJA 1JFLA 1JAYA 1BE6A 5FYQA 2RBKA 1L7VC 3ZDYB 3A1DA 1A5AB 1DMSA 2QDKA 3DF7A 3KX2A 3Q7EA 4HTAA 4QDTA 4RKRA 1O5TA 5DISB 5TB5A 3R6DA 1MAUA 5C1BA 4RGYA 4AZ3B 3TG2A 1H2WA 4RSGA 4GKVA 4I5IA 3IA2A 4MIEA 4UEKA 4XI9A 2ZYTX 4NDZA 1E9SA 4BVHA 2PMFA 1QFZA 2QLFA 4EGJA 3L6DA 2V54A 2QX8A 2XD4A 2V7EA 2WYHA 5TQ0B 2DUUA 5FPPA 1ISGA 2FK8A 4NPHA 4E13A 4DB4A 3O1IC 3MGKA 2WUDA 3UY4A 1Z75A 1UZAA 1H2AS 2CLSA 4FR0A 2IBSA 3Q7SA 4ENTA 1XTRA 3K35A 4ZKEA 4Q9DA 4AECA 2PUDA 1L3CA 1NQXA 3I4LA 4KWHA 3I2JA 1P62B 3C6BA 1IEWA 1ADGA 3E2PA 3OZCA 4JJ4A 3JQ9A 5CT5A 4A8JC 1PIWA 2JASA 5K51A 3OIUA 4B71A 4L6AA 4M0DA 4E15A 3N2KB 4CQMD 1QU3A 1X1QA 2W00A 1Y6RA 4HPJB 3V00A 1ANKA 3RFCA 1Z4KA 1QCDA 1G2QA 3RSQA 2WE7A 5AUQA 3MTQA 1J24A 2DQZA 3M4NA 4ARSA 3HZRA 2W2PA 4LE2A 4Z4CA 2QPAA 3GQBB 1IK4A 3O8LA 4EB0A 5LWHA 1KIMA 5JH7A 4RSHA 2PX5A 1XRSB 3BZWA 2JLZA 1LDBA 1R7RA 1NXOA 1YDGA 2HIMA 3T9AA 4CIWA 1Z0IA 3S40A 3N53A 3V2IA 4YRGA 3IVXA 3VQTA 4S04A 2J5XA 5J4LA 5A0VA 4AROA 4ZEVA 2C5HA 5JISA 3KSRA 1ITZA 3B7PA 4HFRA 3IP7A 1GLNA 2Q29A 1COWA 4HNUA 3PNVA 3L4KA 1NNEA 4QOSA 4II2A 3DMHA 3NI2A 3WLLA 4O6VA 1RJDA 1BCRB 1V35A 2I7XA 3MYRA 1WXGA 4BCBA 5AVTA 3MCVA 5F9HA 5FX2A 3IMGA 1I1NA 4FYYA 1M2EA 1O5OA 1VBNA 4MQ5A 1ND5A 1OE0A 4PLZA 3VOSA 1IAQA 2IUEA 3DZ8A 4P34A 2ZI6A 1R5OA 1RLTA 4BJ5A 1LTQA 3OOJA 2W6NA 3DE2X 4JX9A 2Q50A 1LFAA 3AM5A 2EZUA 3IQDB 4HYTA 2NUPA 4IOLA 1U6IA 2F4NA 4HP8A 1W2WB 5DH9A 2XYRA 3M89A 4DE5A 3I0NA 5PNTA 3DAOA 4QUAA 2GLTA 2BFFA 4O02B 1KK3A 2AN4A 3TRHA 2XWQA 4O08A 2F1KA 3RC2A 3R3HA 3UW3A 4FB5A 3WAJA 3RAPR 3BWEA 3FI9A 4HEJA 2JBHA 3CXUA 1E4VA 1SBZA 3P26A 1XEXA 4H3HB 5BVGB 1KWKA 4AQ7A 1GUZA 3T9FA 3K0SA 1AGRA 4KYUA 4M21A 3WADA 1BMTA 1U99A 4S1NA 1QM5A 5T3YA 1N4AA 3MPUA 1R3UA 4C7KA 5B7GA 5KNDH 4K6CA 2G1JA 4Q03A 2HWYA 4US2R 1KSJA 5FAKA 3OA2A 5DOZA 2H92A 2JIBA 2WFLA 3MQFA 4NCIA 4KHPB 1P8JA 2BKXA 1WUYA 4CQLB 1YRWA 5D5HA 3EZXA 3E8SA 5F23A 5FNVA 2FUG6 2HBRA 3OSUA 4RWEA 3ZDEA 3HYNA 2B4AA 3TNYA 1V1MB 3A70A 4KPUB 1Z47A 4DV6B 1NNUA 1BYIA 1DEOA 3KEGA 1J97A 4M8KA 2QRNA 3QMPA 5J5CA 3S1AA 4OQEA 3WMXA 1RZRD 4OBBA 5ICSA 1KEEA 2Q9CA 3NHMA 1EIZA 3FNHA 4QEKA 2GQ0A 2E5LB 3Q8LA 2I6GA 3FOCA 4HAIA 4IZIA 4IDEA 4RCYA 5FBZA 2X1VA 1F51E 2FQYA 1KMIY 2J4DA 2IGBA 4FMDB 2AN3A 2Z8ZA 3IQHX 1BTOA 3TSAA 1JNXX 4NBKA 4Y6LA 3WK7A 3GH3A 4DTIA 5IEBA 2ZAOA 1OFUX 1PYGA 2QTVB 4BEJA 4DTCA 1XKQA 2ZB2A 5DBIA 5CB4A 4ZU1X 1SVOA 1ZH4A 4K9MA 1EX6A 2IYOA 1JN0A 1QX3A 5DWDA 3WJ1A 1PJ4A 1M5UA 2XR1A 1EBUA 4LBZA 3DFFA 4XVHA 1T0HB 1ZGZA 5ALPA 2NQ8A 1YDWA 3GZ4A 3QHPA 3S1AB 3HFGA 1CJMA 1JFRA 3RC3A 3UJDA 4CETA 2YOGA 4KDFA 1XTJA 3AF0A 4Z9XA 1C0KA 1KH3A 1KMMA 5JALA 4B3JA 5B53A 2SKEA 3ZGOA 1Y9ZA 1OHHA 3HKDB 4JCCA 3NC0C 4TOIA 1LFDB 4L51A 4ARVA 2Q41A 3GFRA 1KK0A 1ZRMA 2CXXA 4JS0A 3OM9A 2V4ZA 2HBQA 5U4QA 1T26A 2WWIA 3IVAA 4NCXA 2ZAIA 3JWHA 4FEYA 3L79A 5ALDA 5I5GA 1D8TA 4ZAXA 2VJNA 1HNXB 2ZUVA 2EIHA 2OK7A 2FP4A 4P5DA 3LECA 1N4DA 1U02A 1I80A 1Y1RA 2QVZX 3MG9A 3N2IA 2R4UA 2Q5HA 4M86A 2H52A 1Y3IA 3EAGA 1IEVA 1L4GA 2NXWA 3HSKA 4GI3A 3IAUA 5DVZA 3AB3A 2WZCA 4MROA 2X3YA 4LZWA 3ADBA 3PJDA 4EB6B 3TKLA 2ICAA 4NYMR 3NS7A 3VO8A 4NARA 4L3VA 3AHGA 3HI4A 5CVTA 4R2JA 4GP7A 1HMYA 1Q7BA 1E2EA 1UBKS 3KJZA 2NPFA 1XRQA 2LD4A 1B8NA 4A26A 3CEPB 2HKIA 1ZOLA 2ZPAA 3PWSA 4P6VF 4Q7KA 2DG2A 4OKSA 3WFJA 4DRXA 4Q1DA 5L40A 1QHHB 2YXLA 2CNOA 4WKPA 2H51A 1KHTA 2Q3FA 1SXJD 5JJBA 1DCMA 2PL9A 5L3RA 3HM9A 1EHCA 2NU7A 2XNCA 2QXYA 4B4WA 4BOYA 4ER5A 4Q1FA 4YCDA 5DTJA 1DJMA 3SJAA 1KYTA 4ZTBA 2XWPA 4RW0A 3DOUA 1PTJA 5L53A 2ZEJA 4LOAA 4V3BA 2LR0A 2RCYA 4QGFA 2WMDA 1U0SY 1V5GA 2IHYA 3ZGLA 1K5GA 4UATA 2SKCA 1ZGCA 2XUIA 3P9CA 2JGDB 5EHZA 4MUMA 3EXAA 1XBTA 5IAEA 1GOTA 3U31A 2PRIA 3B1VA 2ADMA 1JECA 2RHBA 3FPLA 5F77A 5J4VA 3AUJB 4DR3B 4L16A 3CSUA 3OZWA 1GPWB 4P8RA 4L57A 4IIBA 1PO7A 1YJBA 3AZPA 2QRHA 5AVVA 4WNYA 1IFXA 3RS0A 3TSOA 2Q4OA 2WAOA 3RTBA 5B55A 1UPAA 2WTXA 4ZJZA 2IOQA 2PJUA 2QKYA 3PVCA 1Y1PA 4EFDA 3VI3B 2EJBA 2VUIB 1FJGB 3S3TA 3QFTA 1GP2A 3QXSA 4PWZA 4WA8A 1VJDA 3UEOA 2J7PA 1E0DA 1BD4A 1T3HA 3FB1A 3QPDA 3O0DA 3R5XA 2XCTB 2QX6A 4QASA 3RFFA 3DVRX 4MRMA 3SC2B 3NT4A 1RU3A 2MIIA 1CEQA 1T0BA 2X13A 2BM0A 2W93A 3SS8A 3DLAA 3W06A 1ID1A 4Y2JA 1PUXA 1CQJB 2JA2A 3GCWA 3H9BA 4PC6A 1Z34A 3QKSB 4MR7A 5AK5A 4DYDA 1DAPA 1U5BB 3EVZA 2GFQA 3DGEC 3EGXA 3GEHA 5I9TA 4KFCA 1ZGAA 3FMOB 3PF9A 4Q16A 3CNQS 3FM9A 1KKMA 3W4IA 3FPFA 3QXCA 4RACA 1Z9BA 4BQSA 3GF4A 2UUBB 4Q39A 3B1JA 4LIPD 1W75A 1OBVA 3KLPX 4UREA 3ZZMA 2GHQA 3W2FA 2QL7A 4AUEA 3ADKA 4JU9A 4KX5A 2B34A 4XW2A 1UXKA 4DXHA 1TJYA 4DSUA 5IVKA 2I2DA 1POXA 3HP1A 3WYAA 3FUXA 2BYTA 3ANTA 4X6UA 3UIEA 3JYQA 1KKLA 2C04A 1Z36A 2V58A 4H7FA 4Z9FA 3DVLA 2RJOA 3KZ1E 5FD8A 1C0IA 1KI7A 1ZWLA 3MJDA 3GU3A 1NVFA 5D00A 4BWGA 4NCBA 4QLBA 1SBHA 4EJ2A 2W70A 1HMPA 2R00A 1PQUA 3ACBA 2W6JD 4OB6A 1G9XA 2Q1SA 1KL7A 4EI9A 2WZQA 3OEHA 1TC1A 5DF1A 2YMQA 3QXJA 5DK6A 1BO6A 5ALYA 5EE1A 1RM5A 5D3ZA 3EC1A 3SYRA 3R7DA 4OHVA 3G9TA 2GZMA 4OQYA 1YB5A 2YFQA 4NCJA 1GR1A 3HG7A 4EX7A 1DLIA 2W2MA 1LDGA 2Q1YA 2W6ID 3KQMA 4LZLA 4R8RA 2D5BA 2QW8A 1C1DA 4PC3A 1G8JA 1NJGA 3H9CA 3JVIA 3AYXB 1L5FA 4BMDA 3WAGA 1C3EA 5CCXA 1HLFA 1M2WA 3LFUA 3M2PA 1ML4A 4TTRA 3TTXA 2XSZA 4EKYA 2IY7A 5SV2A 1ZK3A 4UZSA 3CE9A 1C9DB 3QU4A 4EJSC 1E79A 5H8WA 3FSGA 2ZPTX 4YRBA 1KZYC 1PVVA 3PICA 4J2OA 1S2DA 2YRFA 1Z5GA 5C5CA 1V8ZA 2CNWA 2EJTA 2W8ZA 1WUJS 2ORYA 2TECE 4DILA 3T5AA 1MQSA 3FTEA 4E5YA 3PIIA 1E3WB 4JI6B 1RXEA 1QH9A 4DSZA 1U11A 3LHFA 2GZ3A 5KX5B 4RM3A 2AT1A 3P2YA 1T2FA 3AR2A 1YVRA 3GEPA 4IJUA 3PKJA 3JU3A 3PNQA 1D5WA 3CCBA 1QRAA 3V4ZA 2J5QA 1W5AA 4TWZA 3GDFA 3QLUA 1RR6A 2NU9B 4BVLA 3IP3A 2Q6VA 1NLUA 3CRVA 4EPXA 2I66A 2ZYAA 3OI7A 4WUVA 5IDQA 2C94A 2MJLA 3N59A 4I5GA 2QYTA 4A0SA 2JAHA 4FYIA 1WKVA 5FA6A 4DFDA 3T5GA 4D1YA 3JD4A 4Z4FA 1FX1A 2XNDA 3PKIA 4V0LA 4TV8A 4V0ME 5TLSA 4MNTA 1JKXA 2GO7A 4LY3A 4MRMB 1JAXA 3CWQA 1U3TA 1JB1A 4FJ1A 2PUEA 3UNXA 3TL2A 2EL7A 4LSMA 5T4FA 5EP4A 2P3OA 3BF8A 4Y6GB 5DBOA 4G24A 1L5HA 4XB2A 3K2IA 2QB5A 5CXSA 4AU1A 1JDBC 1XMXA 2Q9BA 1CDZA 2HHAA 2VJPA 5EVCA 1WLYA 5AJVB 4C5AA 3I73A 1QP7A 3QMWA 5K8VA 1QLJA 1QHYA 3SYMA 3J81k 4CMKA 2J9YB 1HYBA 2PH3A 3OJXA 4YPVA 4MS4B 1IN4A 4P35A 3F78A 2HJVA 3EY9A 4EW1A 1HURA 5KBYA 1NFFA 2X9NA 2CCGA 2E55A 4L4RA 1FDSA 3I5MA 5EUMA 2WR8A 4FDVA 2G0NA 3H18A 3LPAA 2ZGVA 2OT3B 3JY6A 3L4BC 4BLOA 2ZB3A 4RJ2A 5K8TA 5JO9A 5T3UA 4A2CA 2JH3A 2RH4A 3EC7A 2DWPA 4WZAE 5DHFA 4DC0A 1L4BA 2I2BA 4CKBB 3A9UA 3X3HA 1I2AA 1K66A 1YTLA 4ZIRA 2DBQA 2FPUA 1QGAA 3B9BA 2F3QA 4ZEWA 1XZKA 2JEYA 1FPQA 1Q2XA 2Q3HA 2QQEA 2V6IA 2YXPX 4TQUS 4JIMA 1JI0A 4LQLA 5CFMA 3TECE 4RLFA 5EFZA 4H60A 1P77A 1ZGJA 1G8FA 2P4QA 3RVDA 4ZI7A 3IT2A 4BFUA 1A04A 3FR7A 4MA4A 3BKWA 1VIDA 4WZAB 1DT3A 1RJEA 5DTEA 3PWTA 4PU0A 5LOVA 4EJSB 5IP5A 2VAVA 1W4AA 1W30A 3C6MA 2QZPA 1MC8A 1RI1A 1BQEA 1YFZA 2AI1A 2Z58A 2W8BB 2FYTA 4X00A 1AS0A 1PR5A 3CMCO 4AYXA 2ZANA 4DQVA 1EX7A 1YVDA 1BC5A 2EWVA 1NVDA 5JCOC 3H7IA 3EEQA 1Z82A 1R4NB 3U4GA 2PYIA 3WRVA 4CL3A 3EBLA 5HJEA 4IBOA 5AVWA 2J9GA 2AX4A 4NY1A 4TKMA 3TNLA 4Y6RA 5ALLA 4HNQA 1W4BA 1M2OB 4Z7JA 3MUOA 4Z8XA 1PN3A 5FBKA 1C3OA 4CLHA 3BL6A 4RD3A 3RSGA 5J58A 2AK3A 2ZI9A 3T4UA 3H1EA 2B9VA 2JGMA 1TM5E 3LJKA 3NT5A 3QPUA 3VDRA 4YWJA 4JI0B 1E5QA 2X2EA 3R7NA 3O94A 4IIJA 1PQWA 3G7UA 1HE2A 1MOZA 3OE7D 4JR0A 4LJAA 1F17A 1T0UA 3CKYA 1LBQA 3ZWAA 2YIJA 5DNYB 1U7WA 5ALKA 4D7AA 4F9FA 3GUHA 3Q3CA 4IWYA 4JHLA 1TXGA 1EWTA 1NDQA 5AJXA 1V8OA 2AOTB 3KYJB 5EKUA 3AOEA 1X7DA 2BM9A 2LW7A 2PSFA 3TGWA 1PLLA 3HDVA 1TGYA 4I9UA 3B5IA 1KO8A 2VJQA 2WM9B 3ILSA 2ZJYA 4RV4A 3W9UA 3WHKA 1PNQA 3D6UA 4BLVA 1Z2DA 3AILA 4TUYF 3TZBA 3PUYA 4D0GA 3VTFA 1CJSA 3U7EB 2NT3A 1BWQA 4W4TA 3VO9A 2Y6VA 2GYWA 1E7SA 1OD6A 1GPAA 4RK6A 3TUJC 3T0FA 5DO9A 3EPHA 5FNZA 8AT1A 1P0CA 3QOFA 2YUTA 3BILA 4W1SA 4G1BA 3DLTA 1X80A 3AW9A 3IB3A 3C7AA 3T1TA 3ILXA 4WLNA 3G59A 5HILA 3CU5A 1KDVA 1SIOA 4B47A 1D1PA 2B82A 2CN1A 2QTRA 2R6JA 3I64A 2PCJA 4MRPA 2TMGA 2W6JA 4NBWA 4BNXA 2AQIA 4W82A 3ZVMA 4A36A 5M5BA 1XRRA 1KDZA 1QO9A 3FF4A 5IBQA 3UCEA 5TVGA 3RGWS 2GH1A 2UUOA 1HZZC 2FGKA 2WV7A 3TLCA 1QYDA 2BP7A 5J47A 3OQIA 3ECSA 1Z88A 3TL6A 3AESA 1H1DA 2HA0A 2ZR0A 5FNVF 3R8XA 2P0YA 3QUTA 4AYWA 3WGVA 3B1YA 1A8HA 4RLSA 2YHIB 1MOPA 1FSZA 3WLEA 2O8DA 1LQTA 5C31A 4YALA 3ND9A 3EIFA 4B80A 3AY0A 4AG5A 2ZAYA 4L0CA 2ZRJA 1G8YA 3CZCA 3W5CA 3EMDA 3O31A 1BQ3A 3CF2A 2UXCB 5SY6A 3QEKA 3H3JA 4EA8A 4QT4A 2D06A 4IGFA 1N3LA 4YP0A 5E1MA 2JGLA 3X1JA 4JP5A 1GAWA 4D82A 4TM7A 5ILGA 2W37A 5LL6P 8LDHA 5ECWA 2EEPA 1AKEA 1FZQA 1PG5A 3IEKA 1NOKA 1YVUA 2P40A 4P81A 5COAA 2YJTD 3DPSA 1CUWA 1Q1NA 2FSPA 3D2LA 3PXCX 3GJQA 4K2AA 2ZT8A 4QVKA 3S5JA 1K6IA 3QWHA 5EESA 4DBLC 1PJAA 1Z83A 3B6KA 3KKKA 4QJ5A 4RMGA 3TKYA 3UN1A 3K15A 4Y9SA 4X66B 3NIFB 2ZATA 4QFMA 3T1QA 3FTDA 1AXEA 3OZRA 2C5FA 1G20A 2VSYA 2XMBA 1K8RA 3CW2A 3OZUA 5IC4A 1JQEA 2O2GA 2WUWE 3GHHA 4YV7A 4C6SA 4WZAA 4L8GA 1G291 4A3SA 1R4MB 1XAGA 2W6CX 2BMVA 4PLVA 5HRCA 5J1SB 3T6KA 1L5SA 2QDXA 1N5OX 1NXWA 2WM3A 2WYWA 2YYSA 2W2KA 1LK5A 3Q8XB 4XLZA 4CIVA 1ORDA 2QRUA 4INOA 4QICA 5D6NA 5FI3A 3LV8A 3DDUA 1WW8A 3RKUA 2YASA 3HJGA 2BR3A 3K8OE 4Q7JB 3VOAA 3NWEA 4G26A 1AKYA 4D02A 1W44A 4RL4A 4Y6OA 3EX7C 1TYBE 2GF9A 4UBJA 4LC1A 2AEJA 4JYBA 3DZDA 4JFRA 2ZVDA 4CV2A 3GT3A 2F55A 3AW8A 4XFDA 4L7VA 2C7RA 5EMHA 5B36A 1X0XA 1JIUA 3ROKA 1Z6AA 4AZSA 2Y67A 4CF3A 3F6EX 3QE0A 3JTMA 4FC6A 9LDTA 2D59A 2KMLA 1AURA 2PZGA 4P84A 2CK3A 3ENZA 4ESHA 4GR5A 3E9YA 4LYFA 4TXMA 4V0OA 4L4XA 4UNSA 1W47A 2P79A 1H4TA 3P9QA 1EK5A 1XJ5A 3B3FA 4J4BA 4KFUA 2HHCA 4U63A 1BVUA 1T8TA 4O4IB 4PHHA 1UMBB 5AHOA 5JNTA 2FE4A 4BNFA 2DERA 1ZH6A 1N7JA 3BIJA 4X7PA 2QV0A 5JNUA 3KU4A 3WB0A 1E5LA 1JQJC 2CKMA 2HM7A 2P7HA 5HK9A 5EWLB 4LJRA 1VA4A 2HT6A 1PJTA 5FADA 5ITSA 3QLTA 4LZPA 1IHXA 4UNQA 3CLSD 3ZV3A 1ZEJA 3PZRA 5LIRA 5LWQA 3EBOA 5KTYA 4XZ3A 5AKIA 2AVDA 1Q7GA 2WE8A 3KLOA 2B25A 3N2YA 4CLOB 4QPNA 3LKVA 3QVGB 3EEOA 4EKNB 4QSHA 4UC0A 4TLBA 3JAKA 1I10A 1MIOA 2IU6A 5JQGB 3HWSA 1W49A 1X86B 4PX5A 4BX2A 1E9RA 1P2SA 2E89A 2H2AA 4GNRA 3LX8A 4GE3A 3DOCA 3RM3A 4EHKA 1KEKA 3SOZA 3EZNA 3JQRA 3DNMA 4O5OA 4YCAA 1R50A 4HYQA 2OV6A 5DCYA 3S5UA 1ZI6A 3DB2A 1P18A 3WTCA 5DM60 1LI7A 4BVBA 4EJMA 2K87A 8MHTA 1RWQA 2H9IA 1XP8A 3FA2A 4JLAA 3IALA 3KTFA 2JLRA 1AKTA 5BQ5A 1QGYA 1NVMB 4E2FA 3A05A 2ETVA 2WEKA 1XD9A 4MYTA 1RE1A 1IH8A 2UU9B 1JXMA 1QXSA 5H02A 4LJSA 5EXTA 3IERA 4TWAA 1G98A 2AA3A 1PT6A 1QHEA 2GPTA 2JFHA 3BXPA 2PXXA 2HRCA 2HHLA 2ZBDA 2ASEA 3QYAA 3JZIA 2R6GA 3RRZA 4UFPA 3ENWA 1NURA 1R8XA 5B2FA 4JLJA 1YV9A 2AC2A 3RUPA 4HPXB 4F7DA 3N0VA 1DSSG 2PT5A 4IRMA 1F9EA 4URUR 1E9CA 3CUEF 4URFA 1E6WA 3ZHUA 1KTVA 3FWYA 3EXFA 1BCSB 1EJBA 1F0PA 3V7NA 1X77A 2GEUA 4TGLA 3RKSA 2QRVA 3R5SA 2Q99A 1FXUA 2I65A 2AVNA 5AIAA 3UOAB 3WA7A 2EAUA 4R31A 3WQQA 4LTMA 3SZ3A 3OPNA 3F7TA 4JUAA 1XC7A 1AZLA 5DLPA 4RZHA 4N7MA 2W2TA 3AR9A 3SP1A 1ORVA 5F1PA 1OMOA 1GHTA 4PYQA 4ZANA 2EGUA 2C8VA 4ENWA 3BCSA 2COKA 3WBKA 3GJTA 4OF4A 5CYGA 2M1ZA 3PRYA 3TVDA 2VZLA 3HKCB 3HA2A 3V3TA 1W35A 3WSVA 4BEVA 4CTMA 2FN7A 1RSZA 2IYWA 1CB7A 5CXXA 3OUTA 1DL5A 5FNVB 3QBDA 1NU8A 2RG7A 3N3BC 5AM1A 3HBJA 5CDYA 1F2UA 2OO7A 1JG1A 3G89A 4RZXA 1TIKA 3QUSA 4BV9A 2W4IA 3A9RA 1VJCA 5JS8A 2JI7A 5AVUA 2FLWA 3U37A 2IEZA 3DMPA 3E15A 5AW5A 1I0IA 4ACBA 4KQCA 3UAWA 3VI4B 2GK6A 1E2MA 1UDCA 3IBSA 4UULA 1U04A 2YWCA 2B7CA 4MVJP 4WZZA 3GWGA 4X63A 4UPVA 1XLTC 1HSOA 3NHBA 4M99A 5DBEX 4OXYA 3UK0A 4TYMA 2VJBA 4BBZA 1U0GA 2FGJA 3A8TA 1JEQA 4URWR 5EQTA 2JLSA 2BGWA 2BEUA 2VFAA 3W6UA 4B83A 5DHTA 1PS9A 1XOIA 4YMTA 4AS2A 1V37A 3V4VB 3WICA 5TC4A 1G9SA 4WERA 3TB4A 5HUQA 2G0AA 1W88B 3KS9A 4FEGA 4OGWA 1OFUA 4PHFA 1VDMA 2XQFA 4RHCA 4XOUA 4NAUA 2HGZA 3ZXYA 1P75A 3ASVA 1GGNA 2XIQA 3TPCA 1B2LA 4YT2A 3MT7A 3T9BA 5JQGA 5LB2A 2ISCA 1XCBA 2WKWA 2P27A 2G3YA 2GESA 4FYXA 2FSFA 2ZJZA 2HRZA 3EDMA 4JQZA 4GP9A 3AJDA 3K94A 5GJVC 2C7BA 2OAP1 3ER9A 2H4ZA 1QRTA 3UANA 1XTSA 1ZI8A 3PKZA 1JEOA 2HK9A 2HLDA 4U1RA 5IXYA 5ALIA 1ISHA 5JZMA 2CFTA 3OM0A 3PUVA 4GFDA 1QU2A 3K9FC 1OW3B 1QOZA 5LMZA 1YKSA 4BNZA 4KZKA 5JSKA 3AUKA 1WX1A 3IMKA 2B21A 1S2IA 2VT6A 4L9WA 4LRSB 4R9VA 1W88A 4PRYA 1M6EX 5KNCA 4UBMA 4B3IA 3IEUA 3HLYA 2OXTA 4FBGA 1IBCA 5EHGA 3PQ4A 1D2MA 2NXNA 2PLNA 4Q4HB 5EI5A 4D9NA 2C7VA 2R8EA 3A4MA 4BFVA 1JMVA 2FPIA 2XB4A 1KI1A 1EWVA 4EBBA 1KFBB 4DQXA 2B1QA 1NC3A 4E5VA 3WXMA 1Q0PA 5LMCA 4BS9A 2VSFA 1JQKA 4HWKA 1G1MA 4CU2A 3K9QO 4CM9D 1VMAA 4PYJA 3V4OA 2GAFA 1L4YA 5I7HA 3TUZC 5L4SA 4BLSA 4WACA 4ECAA 1ISFA 1LZKA 2GAAA 3H9UA 5G3ZA 3VNQA 3NEJA 1FYDA 2GWHA 3PTAA 4V1CB 2A0FA 2Z5VA 2AW3A 1FFBA 1IWPB 3DUFB 1FDRA 3T3GA 2FPPA 1DXOA 3S81A 2P9HA 4G63A 1IATA 2AZTA 1RRFA 1I7LA 4UU7A 5E6UB 3NTOA 5A06A 4S2EA 2VRWA 3IDSA 4IDCA 4NZZA 4WA7A 2OCKA 2Q5QA 3KTOA 4WFIA 4YQYA 2XXJA 4ZT2A 4ETNA 3SF0A 4C0XA 4ZJYA 1NMZA 4JI7B 2GSDA 2D5AA 2QX4A 3D0QA 3WO0A 1ZNZA 2O8NA 3O8RA 3M6XA 1N36B 1LLQA 4RGBA 2Y77A 1FLAA 3G1WA 2OV2A 4X1YA 3U7FB 3UK1A 1Q1BA 3UPUA 1P0PA 3K2BA 1FXSA 4KR9A 1XTBA 1AKVA 1NG9A 4ZOCA 5DEOA 2R85A 5FEMA 2P2DA 5A6SA 4F3YA 5KNDD 4OYHA 2XMCA 1UFVA 4OBWA 1Z4LA 3ML1A 1KU6A 3D1LA 5E9JA 1OX4B 3AXSA 5BYJA 4LOLA 3AEKA 4LMAA 1N2CB 3BQNB 4A2QA 4AJKA 5JFGA 5K0BA 3F3SA 4FOPA 4AVYA 2PBLA 1W93A 2JA1A 4XR9A 3C5CA 1RPNA 2PKRA 3KQPA 5CDGA 3ONNA 1NBOA 1PWZA 3ZQUA 2PSJA 2YBEA 1WDWB 3ESAA 2YKGA 1N1GA 3HR8A 4PYMA 1PZHA 4HAOA 1V8FA 3QLVA 3OCJA 2DY1A 3T52A 4FDUA 1XRLA 2C4VA 3MXTA 1Q7RA 1B42A 4ALMA 1RWVA 4RVSA 4WNCA 2XKJE 4KQWA 9ABPA 3KXIA 3TD6A 3ILVA 2Y1CA 4INAA 4TVKA 4CNQA 1R00A 1FYVA 4I55F 4UHBA 4DJAA 3EVAA 4FDLA 1G17A 3G88A 1S7GA 1QV6A 1V2GA 2GYUA 2VXYA 4F2DA 1SGWA 2PQMA 4QJ4A 3U4MA 2FSIA 3NIGB 5KDOA 1L5YA 3F9IA 5BN5B 1ARZA 1HT2E 1U5BA 4N0PA 1XHLA 3CRQA 2TMYA 3KG2A 3KOZA 3W5VA 3W3ZB 3QPAA 3K6JA 4MW1A 3WFZA 1FSGA 3JQCA 1LBSA 4YACA 5HWSA 2NZXA 3A4TA 3IJRA 1SC6A 1PFVA 2WJPA 3F6RA 4MI3A 1SHTX 3I72A 2CC2A 4M0UA 2P8JA 2BGLA 4MKZA 5BYAA 1AUQA 1JHZA 1NV8A 1R3DA 4R2HA 4I5DA 2ZUTA 4J75A 2NO9A 4OMDA 3F7OA 1ZWKA 3LLCA 1O4VA 4ZVKA 4KGVA 1TT5B 2QRQA 4BTLA 4GDFA 4AI6A 2RAVA 3QMMA 4NAHA 4U2KA 2Q5FA 5IM4F 3L82B 1MOSA 4PIPA 4A0HA 2IP1A 2O4UX 4JUFA 4DV4B 4MW0A 3P97A 2C59A 2ETXA 4ER7A 3NOQA 3H3XA 4L6IA 4KIFA 3AJAA 3CW9A 3W6NA 4ANFA 4NICA 4G1MB 3H9GA 4M1MA 4U7TB 4BE7B 2WRZA 1Q17A 1YACA 2P69A 2VDRB 3V8EA 4IM7A 3V7FA 1IEXA 1L5ZA 3VKWA 3W3AH 4HJRA 3LMKA 3OFJA 5BMVF 3IPAA 1X7WA 1QF9A 1LH0A 3C3XA 4MARA 3D8UA 1P5JA 2IHTA 2DHRA 1N6OA 1E2JA 2FRDC 4PGMA 5FXMA 1XTTA 1GNLA 4PLWA 4BVGA 3QBJA 5AKYA 5E4FA 2PFGA 4BC0A 1NULA 2BZSA 1WMSA 4KLRA 4J3FA 4X84A 4HHEA 2DLDA 5A3VA 4ZCRA 1U94A 3FGNA 1NI4A 3R7WB 5LQMA 4CMIA 2G9RA 1ULBA 4JP8A 3LXUX 4ZQIA 1A95A 4JNCA 4MV3A 3UWMA 4URVR 1S2GA 4I4TB 3N8NA 1UXIA 3BK1A 5JPCA 1E3LA 4LXQA 1J0CA 4MGZR 4QYTA 3FPEA 1TJ4A 1OTXA 2OBLA 4KN5A 4AX8A 4PNZA 5IYZF 4L4ZA 3CGGA 3GVHA 3DZBA 1D4OA 1JR4A 1YGYA 4K0KB 5TF4A 3JAWA 1D1TA 1W34A 3CGWA 2C57A 3MELA 1MX1A 3E3LA 1YZKA 4LCJA 4TSRA 3UMVA 3JSAA 4N5MA 3WLFA 4DIEA 1XTVA 5JW6A 4EJSA 2Q3JA 1W5SA 2IEDA 5K3BA 3FSRA 4BO7A 5BN4A 4RADA 1RVV1 2GEJA 2QE7D 2VRBA 2XVYA 4OQXA 4IDBA 1Y3AA 2BFPA 4JXJA 1AGXA 1YXMA 4BZXA 1JU9A 2FG5A 2WQZA 1IIBA 1YH3A 1O94A 3R6TA 1CZHA 2BH2A 2ZWIA 1UM8A 1KHHA 4RA6B 3T8YA 4OH1A 3GP8A 1XDZA 4BEBA 1GAQA 1XJ0A 4KXNA 1SKYB 4V0RA 1WUHS 3B52X 3AVPA 3HB9A 1KAOA 4XCQA 1C9YA 1SY7A 3SLGA 3KQTA 4AUKA 4CIAA 4LHXA 3GUUA 4X8LA 2FFAA 3RTDA 3GXBA 2VDQB 4DCCA 4MUKA 5EN4A 4O4HB 1US8B 4XPIA 5J5VA 1DG9A 1HE4A 1HTWA 2H8GA 2WWXA 4ZRDA 3RSFA 1KP9A 2WICA 2VJOA 2O52A 3E9CA 1QAOA 4GPTA 4G4GA 3PQ8A 4ZQFA 2W2NA 3C3MA 2NYRA 4NLLA 1G8PA 1HFKA 3ZR4B 3A6FA 5KNCH 1G63A 3H6HA 1U6KA 2B37A 3I9V6 3P8ZA 4TMZA 2Q4DA 3GT0A 3D4LA 4C05A 2VYVD 4PINA 2YWXA 3AFGA 2CEKA 1LQUA 3E4CA 3L7JA 1A4RA 4KO3S 2WHRA 3HNRA 1LDEA 2Z2IA 1KKUA 4KDRA 5HS6A 5T6BA 5MN6A 3GJZA 3EZGA 3G0BA 4HQLA 1XJQA 5CDSA 4FYWA 5ED4A 3ABOB 2E5WA 1W59A 5EC8A 1V0JA 2GEFA 4A82A 1A8PA 3D0RA 5E0OA 1HR0B 1U8CB 3R0QA 3U3DA 2UZ1B 3OJWA 3E7PA 3I5XA 2I0FA 1T5LA 1W6UA 4BTVA 4QBGB 4RVHA 4EW2A 2JJ2A 4BPBA 5KX5A 1MVOA 1STOA 4MW9A 1DO0A 5FOWA 1EZ4A 2Z8YM 4G1FA 1T4CA 3RLIA 4X62B 1BOFA 1R10A 3DEKA 5KVQA 5J2UA 3DGFC 2JGIA 4P7BA 2G5GX 3PJGA 4R2XA 1E62A 3OZIA 2V7BA 2HDWA 2V7QD 4O8CA 3VX4A 5IT4A 2Y6UA 3C1TA 2ATVA 3VKFA 4MKHA 4MUIA 1KBZA 1EP1B 1JDVA 3OE5A 1O0BA 3FOEC 3RV3A 3DSRA 4WW0A 1MH1A 3ZD8A 2WF8A 9ATCA 3P1JA 2MSCB 3PLRA 4E09A 2C07A 3IJPA 3FWPA 3WHLA 4C7OB 4NJEB 2R47A 2RC6A 4P98A 4WGGA 5A04A 2W5UA 1V5FA 2XE8A 1FTSA 2E4WA 2YS7A 3GBPA 3R5HA 3ER6A 4W5RA 2FZEA 1OLSB 5EYPA 1XEFA 3B6JA 3JV7A 4N40A 3T3MB 4BN5A 1PT7A 2Y1FA 4EBFA 1FJ2A 2Q3MA 3BXXA 3ZV5A 3J81A 2BEVB 2AG1A 2HGSA 1PZNA 3AUYA 4HEA1 4Y2PA 5JBIA 2L18A 3ZIAD 2PH5A 4GZ6A 5BT9A 1FK8A 4Z9AA 1QX4A 1UANA 1HE5A 4JOQA 3G68A 3VC2A 4E5PA 2BZ1A 2PLFA 3F5MA 2VP9A 1U4OA 3GPIA 4D8YA 3AEQA 1ZZGA 3MJHA 3D3EA 5LQJA 2HCRA 1NHWA 4L08A 2AS0A 4AD8A 1KDRA 4JP3A 1X1EA 1OT3A 5YASA 1VIYA 4I14A 2IELA 1RC1A 3NAZA 3VSAA 2Y0CA 4X20B 3EVFA 4FCVA 1XLVA 3NP7A 2QYOA 3DO5A 2C4WA 2ZB7A 3PPWA 2IV7A 5F3DA 4L9AA 4J03A 5FAXA 2X42A 4TMWA 1WV1A 3KZOA 3Q0EA 2X8WA 2CMHA 2XMRA 3BE8A 4FYKA 2JDIA 2G9QA 1NN5A 1RYYA 4UU8A 5LBTA 4EY8A 5JU6A 1D4ZA 4JB8A 3G2JA 3GJSA 3IHLA 1G55A 5LZ8A 4HD8A 1MNAA 3TRFA 2LCIA 1TLTA 4M9QA 5F7XA 3K9NA 2WJIA 1B00A 1QS0B 4KWCA 4CT5A 4ZZ1A 2B7BA 2Q2WA 4X8HA 5AI5A 3ZHTA 5BQFA 3RK1A 1C14A 2VAWA 4GXNA 3FIUA 1G41A 1NC1A 2QZJA 4Y9TA 1ZN8A 4FN4A 1NBWB 4NCKA 1WB9A 1R0BA 1SD2A 4OLHA 1FNDA 4ISCA 1RHUA 3NALA 4PTZA 1ZK0A 3J7TA 5CM2Z 3RWOA 3S7ZA 1APBA 4CKEB 2XSZD 4MJLA 4YCBA 3JQ9C 2ZTUA 3QK7A 1T1EA 2VF5X 4JC8A 2K4MA 3JATA 3QH4A 4IZHA 1CLUA 1QANA 1AX9A 2PH1A 3H83A 2LXNA 3TDKA 3WQHA 4CM3A 2J0UA 1WL8A 1NLYA 1SG6A 1UC4B 1USVA 1VTKA 4QDUA 4YQZA 1JI3A 2YL2A 3MUNA 3NAQA 4RHXA 3W5HA 2CV1A 4N5NA 5L6LB 2XZOA 4GP6A 4QQRA 4EFKA 3N58A 4KQ1A 3UUFA 4FE3A 3NG1A 1NUHA 4FFDA 1DXYA 4YA6A 1IY9A 3EULA 3ZC3A 4CWAA 5FKJA 5JSUA 2NUAB 1MXHA 1DIBA 4ZYVA 2QENA 2WTAA 3H04A 3ZWNA 1P0QA 3HN6A 3IHKA 1QYXA 1EFVB 3AZOA 2CDCA 3OX3A 1ZJJA 2VJDA 1WD7A 1GQFA 1T2VA 1RHRA 3HYCA 3UWKA 4CQJA 1MH9A 1PJZA 4CLOA 2FWAA 1U63A 5KTMA 1FL9A 3GNQA 4GSLA 2VRCA 2YINC 2ORED 4LX8A 2CFRA 2Y0DA 4MYSA 4NONA 5LR6A 1ETUA 1NW3A 4AJEA 2NP6A 2X5XA 1T5HX 4FVTA 4JASB 4GLFA 3S6JA 2NXCA 1HSZA 1X8LA 5FTNA 1P80A 2B78A 1ZVJA 3Q3GE 2FCAA 4DN6A 2J85A 3H0CA 1GNVA 4RJJA 1L7DA 1SUFA 3VJRA 1VMKA 1SKMA 3EYWA 4AMZA 2Z6AA 4I4CA 5BV1A 4ZO4A 2IEYA 1JXAA 3Q7QA 1T9BA 3E1SA 3W8DA 4OHBA 1NYQA 1X7ZA 2PUAA 3ESQA 1ZQ1A 4NOKA 3VX3A 1NF2A 3GPLA 2Q2QA 3TXYA 4J9UE 4EWLA 1N78A 4OSOA 4ARUA 1LVUA 4LXGA 1OI3A 1BMQA 3ASZA 1AKUA 2N46A 3K9BA 4REOA 3FNGA 5FI0B 4D9JA 4E94A 4EYGA 5A4JA 3E9ZA 1GUDA 1GPJA 2NZYA 2Z3VA 3K72B 1U2SA 2AHRA 1TRKA 5FLXA 2Y1KA 1ENYA 3GNSA 3OTWA 1JV2B 4NMMA 1AK9A 2WFAA 1Z0AA 1GV1A 2PV7A 1RP7A 3NYIA 5HEKA 1UJ4A 1ORRA 1W94A 2VR1A 4K7JA 1PX2A 3C1OA 3ICVA 3QVLA 4NE7A 2DH6A 2H2IA 1K9VF 5SYMA 1JSZA 4WK0B 2XTAA 5DX0A 4YFVA 1COZA 4QHSA 3T4XA 1ZH8A 1CIVA 3LL7A 5L4NA 4LJLA 3OAAA 1SVUA 4MA5A 4LNUA 2ZYIA 4IICA 1U1CA 2OHVA 3GUVA 1VKJA 2GBFA 4FYPA 1U8XX 3NHPA 3MWFA 2EBFX 3G2OA 1A96A 4GYYA 4QODA 4JEMA 3DAYA 3TFOA 5ICMA 3E3NA 3V2UA 4QFDA 3EEFA 3AUFA 2EX4A 3CEHA 3PTZA 4UBOA 3QEBZ 3MJFA 1SOAA 5T4HA 3JD0A 3OQ6A 4YV2A 4YV0A 3P0HA 3ANSA 4MTLA 5I7FA 4KVAA 2OWEA 1PVOA 3DMTC 2GJKA 5EJGA 3AFIA 4RCZA 3U3XA 1KSFX 1RADA 2G1UA 2XMSA 3E7XA 4UNNA 4BLTA 1TU4A 1BDIA 1JA9A 1BHJA 1HQCA 3JATB 1M83A 5KC9A 4NBTA 1I3NA 4IG9A 1E7MA 1FU7A 3KC2A 2ECKA 2J0UB 4W6ZA 2ZRDA 1JDZA 2AUTA 1OTHA 1K6XA 3BWVA 1Q0SA 4MMXB 4K9NA 1W73A 3OEWA 5E6UA 1DAFA 1H8HA 2BMFA 2GN6A 3KFVA 2YIDA 4JUCA 4AJOA 2NOAA 4NE9A 4OI1A 5AOCA 2PZLA 3I76A 1PFQA 1SEPA 5DSZA 1AGYA 4D8WA 3DE1X 4JBYA 1WB5A 4J4TA 3SX4A 1WZCA 2HCFA 4DDVA 2D2IA 3GCDA 4GXQA 3SE7A 2AUMA 4F11A 3FFBA 4IXTA 1IY0A 1DBRA 3S7TA 3VR6H 4ALKA 4YRIA 4KC0A 2WB4A 1FU4A 3QRWA 2AOWA 4O4LA 4D45A 3ZGVA 2HQRA 3CA8A 4M1ZA 3NBYC 4A7PA 1AHPA 2BGGA 4W1QA 1HPLA 1RRMA 5IVHA 1RAIA 3GUZA 3WZ2A 3DNPA 5DU2A 1ZD1A 4C4AA 4JENA 2PTHA 5DNEA 2FQWA 1SR8A 1V8BA 4UUOA 2GM4A 3G5LA 4IXDA 3TX2A 1SRQA 3QUCA 3IDZA 4CIXA 1E7RA 5C5EA 1RZVA 2ZW9A 3FMGA 1C29B 4YH1A 4AW9A 3GP3A 3NYWA 5BV8A 3TZCA 5KYTA 1IY2A 5JYCA 4RULA 1QVZA 1ZLXA 3ELBA 1ZOSA 2EERA 5B12A 1Y0BA 2XGMA 4JBNA 1E2GA 1ZUHA 5CBKA 2ZDHA 4OCZA 2C99A 3PPXA 4PPNA 1KI4A 3WR5A 3VH1A 2PLRA 3C6QA 2IV3A 3BDAA 2ZRFA 3WMWA 1NP3A 4JLWA 2BFDB 2Q6LA 3KJEA 5AM4A 1XFAA 3PL5A 4KGZA 3QFCA 1CULC 2B2CA 2PM8A 1II0A 2GN8A 3K6SA 4FNMA 4MWCA 3SVZA 1L5QA 2FPIB 3DFKA 3PDIA 4KQJA 2Z0MA 4EGAA 3KR9A 1XZNA 1R8YA 3LF2A 2E4AA 2P6RA 2HO4A 4Y1GA 1EGQA 3ELYA 3MCUA 4LYDA 4QDKA 4MUGA 4RK4A 4Z0NA 5K4AA 1M7GA 1UMDB 3BIXA 3E23A 1Z5VA 1O8BA 2WJZB 2XVZA 3BXEA 4KAFA 1YHYA 2OLJA 3OEEA 5EQJB 5GONF 2OA0A 3D5QA 3ZU4A 4P58A 5L3ZA 2FEOA 4EY6A 5BVGA 1JEQB 4OA8A 2HXYA 1TOAA 5I6DA 2IGTA 4YRFA 4JZKA 5G1PA 3LS2A 1HL3A 1I2BA 2P5YA 3G1UA 3A31A 2YHAA 4C4SA 1DS6A 4KNWA 4K6MA 3L8YA 2Z2XA 3R4VA 4R2IA 4X6LA 4XWKA 1RYFA 3TCNA 4ZYUA 1K3FA 2V6FA 4CLEA 4DBZA 2J33A 4IQFA 3CZQA 1YI8A 2X9LA 3P9RA 2YMLA 5K3AA 3AVWA 3GA5A 2YV3A 3EXEB 2I54A 2P2YA 3GOHA 3LQFA 4JOSA 1YA6A 3V1LA 2EX0A 4FFNA 3RJ5A 2CYBA 1AUVA 4AP6A 5B1IA 2IODA 5DIFA 1P2BA 4JI2B 1WXXA 1PEAA 1L7BA 2HPAA 2XA1A 5D1NA 4QZVA 3QEMA 3MLBA 1P2TA 1A5BB 3D1VA 1P7VA 1VE1A 2GBGA 2PUWA 1FFDA 5DYWA 1GT91 1JJVA 1D8AA 2WF5A 1PCXA 3SDBA 1XQVA 3WK8A 2DUWA 1AK2A 2J6HA 2EJCA 2I7DA 4C43A 4R9RA 3A6KA 5CGZA 1D0VA 1PT5A 1EWRA 1NVWQ 3CKMA 5BR1A 3Q6NA 2QJOA 1XVIA 2WF9A 4N8SA 5LYJA 3VNBA 3AQ4A 3JQAD 1GGKA 1Q1ZA 2CGEA 2PMBA 2JGKA 3A9TA 4GOOD 2HD4A 3LX5A 1S5PA 1FBNA 3I2KA 1BCSA 2FN8A 1FXWF 3LUHA 2GGSA 4RH0A 3FTNA 3M5WA 3NUGA 3CVOA 3PUHA 2WJ6A 4WCFC 2M1XA 3W9SA 4J6FA 3MTDA 2A1UB 3ZV6A 2F8LA 3LA8A 1F0KA 4F2PA 2AGVA 4G5QA 3SS7X 3D4PA 1EXDA 2IA5A 3USZA 2A58A 2EJVA 2O5VA 1I4LD 3L1UA 3MIIA 4YCNA 1E69A 4YAIA 1XSEA 5AXAA 4BNUA 3E53A 3HCCA 5DI9A 2R00C 1IN7A 1Z18A 2CE7A 3AF3A 2GF2A 4ITVA 3NVAA 2QN1A 4HDOB 1XALA 5CH3A 2ORWA 3LHIA 4R0MA 1GKUB 2V03A 4FCWA 2YXEA 4XVQA 4TM8A 1RAEA 1I5OA 4FMDF 3WKCA 4V0NA 3MMNA 2JAPA 1SQSA 2QEQA 2XE4A 1RWPA 4KUGA 2E2WA 3FWZA 4CKBA 4OGLA 2QRGA 3NJRA 1NNI1 1IZZA 1T91A 1CX9B 2ON6A 1XMPA 2H2WA 4RD1A 1IB6A 3AZQA 2NZ2A 5ALQA 1DTWA 4RUKA 5I48A 4XDGA 1DRKA 5CNJA 3DR3A 3V4RA 1JQLB 3JTEA 3PDIB 2WWVD 3EZFA 3C7DB 4G4SO 2XBLA 2F59A 3PNSA 3ETNA 4A0RA 2HRRA 2VP2A 2VSQA 3K32A 4OHCA 1W85B 4N7RA 2EZ4A 4C7OA 1TO2E 1WVIA 5CHEA 1G8GA 2O1SA 5IMSA 3Q0IA 3RS7A 3G3EA 4DV7B 4YP6A 7MHTA 1U0RA 4BVAA 1YL6A 5CX1B 4DDHA 4DRXB 3AIIA 1PT9A 1GPKA 1VLMA 2AOVA 1OR8A 4IQGA 4Q3BA 3RVPA 3UJHA 3WLAA 5FWYA 1NJ2A 1UP6A 1J20A 4P3KA 3LA6A 5B58C 1H05A 2YY6A 2EL9A 2PWZA 3C1UA 5DFAA 3CVXA 4DY6A 3I2GA 1W5EA 4ZICA 1P2DA 4N0MA 3G7NA 4GD3Q 4LOKA 1TQHA 4WESA 1E0JA 4MW2A 2BWJA 3BSFA 4MK4A 3QNUA 4OHUA 3OUUA 3GFOA 2BEJA 3OIDA 2YZNA 4I66A 1GVNB 4ZHQA 3NFYA 4ZZ3A 2C88A 5JNWA 2MYNA 3K9HA 5LQCA 1THMA 2BE7A 3GGGA 4NX2A 3ZU5A 3QEAZ 2GXAA 4ZAWA 5HFJA 5IC6A 2RI1A 4KXMA 4MI6A 5CPBA 1QGDA 2RHHA 1PR4A 1UH5A 3S2EA 5HE8A 4P5EA 3UV3A 1RI3A 1N75A 4WFKA 1Z5ZA 3I09A 6ADHA 1MRNA 3BWCA 1J70A 5B1SA 1VJTA 1J33A 4G0ZA 1UXJA 3E3OA 4W9NC 4RS4A 2K5UA 3PNMA 2YNMC 2W22A 4FQ7A 2I80A 3THXB 1UM9A 2QR2A 3ZDDA 3R0ZA 5KYXA 4IEEA 4TUYA 5HF6A 2PS3A 2I3DA 2QVCA 3GJ4A 1L7QA 1O6CA 3RAEC 3QU2A 2PWAA 1L7PA 4J76A 1DRVA 4G8JA 3KAJA 5HKBA 4UNPA 1YGPA 4C4OA 3F3YA 3KDSE 3CWZA 2LNDA 2DULA 3QJ5A 3PBKA 2NU8B 3H1GA 3MA0A 3OT1B 5F76A 4YRRA 1CFJA 3ANMA 2HMSA 3RBVA 4E21A 1QYWA 3L4BA 3O8CA 4WL0A 3WV4A 2GHTA 5EJ6A 2V9CA 1R16A 2IHKA 3AKEA 1W96A 3AWDA 4DZRA 5EKDA 3OU7A 1UAAA 4N0EA 2C78A 3LO5A 5HQTA 1M1NA 3FCUB 3NHJA 4G0PA 3KELA 4LFBB 1U3WA 4QIHA 9GPBA 4FM9A 1OILA 2X9QA 1XQWA 3HZHA 3M7IA 4HL6A 4O4JA 3PDWA 3OPYA 2OMEA 3BREA 4OXNA 3UBMA 2W8BA 5EJEA 1XWFA 4E7PA 2EZ9A 2VQDA 4UQLA 3CZAA 2IIQA 2IU0A 1VJRA 3H5TA 1RMYA 4DLTA 4A15A 1R4NA 3TRDA 3GLIA 1EUDB 2FSSA 4CTOA 1CJUC 4TTIA 2KLHA 1DLJA 1YNOA 1M2FA 4BKQA 3FCEA 2EKBA 1I14A 2XEDA 1E18A 4Y2UA 4Y1RA 1ZRNA 4FUTA 2F90A 4NF2A 3Q7TA 4QQ8A 5AVOA 2PEZA 1TT7A 1BAPA 3GGOA 3GLUA 3UGJA 5KINB 3DTVD 3U5ZB 4C6TA 4L76A 3STUA 1L9XA 3MF4A 5JD3A 1AE1A 3B7GA 4ED9A 3ZNOA 1B76A 2NQTA 2A0KA 1C8VB 3BL5A 2IXGA 3JQGA 3DOJA 3IJ5A 1R0ZA 3CB4A 3NEAA 3IULA 4MUFA 4E5SA 3QVSA 5K3DA 5LZ7A 4XVRA 4KGDA 2CHUA 1T6XA 1BE8A 2XECA 4HYEA 4LRXA 4RFSB 1NUAA 4JHXA 4Y2TA 3BE5A 2IWHA 3SU8A 1MENA 1QR6A 1T43A 4HFMA 5AKLA 1V3VA 1DKNA 1GFSA 3BGOS 4BQNA 1Y6ZA 2X15A 3HXTA 4TMYA 3RADC 3H11A 1X13A 1TM4E 2HUPA 1TVKB 4NXMB 1Z39A 3OCCA 1Z13A 2XB6A 3STTA 4DSOA 1QYIA 2OV8A 4MUBA 4KSCA 5BSGA 4EG5A 2K2QB 2DR0A 3GFQA 1L3IA 2EG5A 2V6MA 2DUMA 2WM8A 4BKPA 2NXEA 1W2GA 4KQXA 4RXUA 1DTSA 4C2AA 3WZMA 1RFLA 5CLIA 3H5WA 1KH1A 1QR2A 1IOVA 2B1GA 2FMXA 3TPZA 4DWOA 4L0QA 3GB9A 4LGCA 4YRJA 1O9GA 4D6XA 4IV8A 4Q1CA 4AF6A 1HEYA 4ALNA 2CUNA 4G23A 5C35A 1RABA 1Y8RB 4MV4A 3GHYA 3C7TA 3ZCQA 1QP4A 1T1JA 3EUFA 1L7EA 3H97A 2R8BA 4HGNA 3NDPA 4U8HA 2E85A 4IIJF 1SG0A 3B5JA 1AZWA 4V0SA 5JJIA 3PJEA 3U1TA 3KQUA 5KEIA 4FKZA 1PSZA 3KOMA 4L85A 2WIJA </