4ZYZA

Human gar transformylase in complex with gar and (s)-2-(7-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)heptanamido)pentanedioic acid (agf145)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
b'ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trifunctional purine biosynthetic protein adenosine-3
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
total genus 65
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zyzA00
4YFVA 1JKXA 2YWRA 3DA8A 1FMTA 4TT8A 4QPCA 4DS3A 3N0VA 2BW0A 4TTSA 3GARA 4R8VA 3Q0IA 5J9FA 3TQQA 4ZYYA 1C3EA 1RBZA 1RC1A 2FMTA 1MEJA 1NJSA 4PZUA 5J63A 3P9XA 1RBYA 3NRBA 3R8XA 4ZYXA 4NV1A 4ZYUA 1C2TA 4YFYA 3O1LA 1YRWA 1CDDA 4S1NA 4EW3A 4ZYVA 2CFIA 4ZZ1A 1ZLXA 4ZYWA 1GRCA 3OBIA 4ZZ0A 3KCQA 1RBQA 4Q12A 1RBMA 2GARA 1ZGHA 3AV3A 4ZZ2A 4ZZ3A 3LOUA 5CJJA 4QPDA 1ZLYA 3DCJA 1GARA 1CDEA 1MEOA 1RC0A 1MENA 4TS4A 3TQRA 4EW1A 4EW2A 4ZYTA 3W7BA 4IQFA 3AUFA 4ZYZA 2BLNA 1S3IA
chains in the Genus database with same CATH superfamily
2G9NA 1EYZA 4CQJA 4RXTA 3QSYA 2NTVA 4UTXA 4H1UA 4B6SA 3A1DA 3L0OA 1OFIA 1D4FA 3KKLA 4V0QA 3WLFA 4NZ9A 4AUKA 3TNFA 1XRJA 1XFDA 2AV6A 1C1XA 2C83A 2H92A 5SYAA 5C1DA 1P4JA 4A1FA 4P5EA 5ERXA 4UUBA 2IS2A 2VRWA 5C5EA 4IMRA 4OGWA 4OAOA 1FP7A 2H51A 3CB2A 4PE5B 5K0JA 1F2VA 1M5UA 1NX9A 1LDEA 3P2IA 3QBVA 1E3LA 2VBIA 1UAYA 1SVMA 2Y1XA 3CNEA 1UBJS 3DAFA 2Y71A 4JT4A 4QATA 4GL2A 1MB9A 1QHYA 2KI5A 2XOKD 1YJQA 1P5RA 4MRMA 1X6VA 3NC4A 4TLDA 3WLAA 4EHBA 2PUGA 1M1NA 1I7SB 5I8WA 1EEXB 2ZW9A 1UMDB 2I2CA 2FZVA 1E1RD 5E4FA 1QH9A 2F62A 1CQIA 1GTZA 1M5TA 2C78A 2CDCA 1IYZA 2EW8A 6NULA 3VAYA 1RLOA 3JQGA 4M1WA 3WYNA 1W25A 2WJJA 3LFHA 3H2IA 3UIEA 1MRSA 2I6GA 3ANLA 3GY0A 3E9YA 4KRXA 5KVAA 3HNRA 1U0JA 2A84A 1GNQA 4FCTA 4WLUA 1AG9A 1EK6A 2ATEA 2YASA 3C7DB 4UQPA 3OF2A 2FPGA 3M6LA 4HPJB 2YTZA 4MW0A 2NZUG 4QEZA 3QJYA 4XB2A 1QVZA 3QFHA 4MGEA 3CSSA 4FDLA 3O7MA 3QG1A 3OZIA 2JAXA 3DE1X 3E22A 3RHTA 3ZNQA 3ROTA 1THTA 5EMMA 2GX6A 1D4ZA 3AKCA 1PT5A 2ALJA 2OLEA 1R4ZA 1SWWA 4NBKA 2NUPA 3OOJA 3QNUA 4ZO9A 2FNAA 3UMFA 3JSXA 4G5YA 1SXGA 1VRCA 2ZKLA 3K2QA 1U4OA 3R5SA 3KQLA 3R3YA 4QOSA 3VR4D 1P75A 1XHEA 4ZOQI 3A3KA 4D5EA 1W0CA 1WA5A 4UVEA 4FSXA 1O0BA 4B80A 2O8FA 3SJZA 2C20A 5ERGB 2DQKA 4MQFA 4XTRA 3ETGA 1MP0A 2QMZA 2ZIUB 1PGQA 4JBIA 2NO1A 3DP7A 3I28A 1KPIA 2ZG6A 4ASUD 1C7EA 4ZHQF 2V4ZA 3R6GA 3AFHA 4NU5A 3JALB 1D4AA 1XX6A 2X7XA 2IHNA 1GUAA 2DR2A 1CR6A 4J0GA 4UW9A 3U49A 2IYOA 5BR7A 4OY3A 1NSTA 4US0R 4PGGA 5A4IS 5BUCA 4H35A 1IXKA 1TKRA 1YZVA 4F11A 2HUNA 1YV9A 2HM7A 2OK7A 3EG9A 1PSZA 3CG4A 1FYDA 3KEQA 4HQFA 4JIGA 4Q05A 5IVPA 1WX1A 1YVDA 5IJ0B 5G41A 1JAZA 5FT9A 3ZXIA 1NLZA 3U3XA 4ERNA 3H5VA 3SBOA 2I54A 4UAVA 1UT8A 5BV8A 1U0GA 2CKMA 3EARA 3AINA 1LPSA 4PPQA 1I01A 1XEAA 1LI7A 2C97A 2M1XA 5CYGA 3RSHA 1CUBA 3TW6A 1GN9A 3QX8A 2BMEA 3DXFA 2ZRCA 5U4XA 1R5OA 4O8ZA 2VSXA 3UK7A 4IQ4A 3ASVA 4HGOA 1E2DA 5G0VA 3DVSX 4PNZA 4PN7A 4KL8S 4EYEA 2QBYB 1A76A 4MR7A 2XTMA 2OHHA 5DP2A 2XD9A 3HU1A 1SQSA 2RGWA 2XUFA 4XWAA 3RF6A 1OYVA 1YQEA 1VZ2A 2VSNA 4FCCA 1SXJA 1TU3A 2EKZA 4EG3A 2HMWA 2ZYUX 4JLBA 4KITB 1U4NA 4BFXA 3CFYA 3GIDA 3WS7A 4BMZA 4B44A 4ODIA 4YDSA 5JRZA 1DT5A 4BO1A 2XRYA 4PVCA 4YGYA 1V8DA 3AR6A 4DREA 1QGDA 2O2GA 3MTBA 4B45A 1DINA 2DGDA 1HMYA 1DQRA 1E1CB 1I4WA 4M99A 4UHHA 3JWEA 1H9AA 1G3MA 3AVOA 5DSXA 1LI5A 3AOEA 1LPBB 3OWXA 2FP4A 3GQVA 1KBOA 3I2GA 5FF9A 3K20A 5L4SA 4GF5A 2FWMX 2P4QA 4MW5A 4TVKA 2P9QA 4NS1A 2O14A 3TTUA 5K3FB 3TB4A 3FTNA 2X3UA 4TRNA 4CCAA 3UUWA 4CM8A 3OOHA 1KRHA 4ARCA 2YYAA 3Q1KA 1CERA 3CURA 4O2BF 4CLRB 3FSJX 1RS0A 1WTCA 4FUTA 2DY1A 4EUEA 5ADHA 3C3XA 2FUG1 4LZPA 3GLHE 2RAUA 1XEWX 1E64A 1FX0B 3WZLA 4ALJA 1Q0LA 2ZUEA 3HSSA 4J1TC 4OKSA 1YMUA 4ZT7A 4F4UA 4HN4B 1DWUA 3GGDA 2NU9B 5AUPB 1A8SA 4IXWA 3SZRA 1NV9A 1E9FA 4CLOA 2HREA 2RFLA 4X24A 3MYRA 4O4JB 3FROA 5FI0B 2JIZA 2BLLA 4LSWA 4J2OA 5TQJA 1S5PA 4AKTA 2HLDD 3H86A 5BWOA 5KVVA 3F74A 4K1XA 1P6XA 3O8NA 9ABPA 2F7SA 3BIFA 1H22A 4KPFC 7MHTA 1AM4D 3I64A 1ICEA 1YULA 5J5CA 5LP6A 3U60B 3R09A 1T3HA 5L6MB 5BWNA 1Y7TA 5EWLA 3KVNA 4QREA 4KO4S 3DOOA 4C20A 1XRSB 3EPKA 1ZJWA 5I47A 1TVCA 3HM9A 4DA9A 3N6RA 4N3GA 5MGBA 1GCAA 3QOYA 1HLGA 1R8QA 1YE8A 1LV7A 1J0AA 5AD1A 2BMAA 4RK6A 1RCUA 3PYMA 1YTLA 2BZ1A 2WB4A 1SA0B 3DXXA 3MCVA 3DUFA 4EVSA 3DAHA 4PQYA 2J9RA 3HZOA 4U9HS 4X1IA 4IR7A 4N39A 4UMDA 3DXZA 5TB5A 3ND7A 1G8HA 5KYUA 2I4RA 3MD9A 1JRLA 3C1OA 4QOIA 4TKUA 5ALZA 3VOAA 3T4XA 3NBYC 3LZCA 4BO7A 1JKFA 3FXAA 5C8YA 3ENVA 3OQNA 3EXEB 3GD5A 3Q3CA 1VGVA 4Y1RB 5ALOA 4FHEA 1G2IA 3ASZA 3WQRA 1ZD5A 2WNHA 3OT1B 3G5LA 4YJDA 2XKJE 1NR1A 4BJ3A 1NRWA 2HZBA 1C0EA 3KSMA 4LISA 5DE3A 3ZWYA 4DAOA 3MMNA 1L5HB 1DBQA 1NTRA 2XXBA 3ABQB 3I0ZA 4HTFB 1T4DA 2OD7A 1I4DD 1NSYA 1O95A 4ND3A 2JEYA 5E1MA 5FKJA 5BT9A 3IB3A 4L28A 2QTRA 3WBJA 1SVWA 1QVRA 4I9FA 1U1DA 1G64A 3EXG1 2WSYB 4BNFA 3EOZA 2BKVA 3KC2A 3GAAA 1Q1QA 1Z6AA 2J9GA 2FPLA 1J70A 5JECA 3I01A 3JZFA 1N2EA 5G0UA 4Y7CA 4AO8A 4DWJA 3K8OE 1D9XA 5AUQA 4NIMA 3UM9A 1NQOA 2XOEA 1QHSA 3SK0A 2O3TA 1FFGA 4NQZA 4A3SA 2EP7A 1X19A 1T8SA 3V7UA 3ZDAA 3GUZA 2ZVPX 3PNYA 1IPHA 3H11B 3GFSA 3DWGA 4IEFB 1RXUA 3V46A 4GOJA 4A2PA 4DDMA 5LWQA 3KR0A 1TL7C 3FVTA 4HWPA 4W5NA 1X9IA 3Q40A 3F46A 2GO1A 4RJLA 5IAEA 3C4QA 3NV7A 2VZ9A 1CY0A 1YZGA 2XVYA 1FXUA 3DTYA 3K4PA 2NYVA 3QKRA 1ZH2A 3CLVA 4RY2A 2ECOA 5AKHA 5EXSA 1PUIA 3AHDA 1C1YA 1E2FA 3GARA 4GMDA 4AS3A 4EW6A 3FNFA 1JDUA 1GKIA 4WEQA 2Q9CA 1QIEA 3UK0A 1KXZA 3VHXA 2FPWA 3TK1A 4F1KA 4INOA 5BSFA 1M73E 4IVNA 3EIOA 2JARA 5DCUA 3LU1A 4GLLA 4K2HA 5CB0A 5AKIA 1EFPB 1C9JA 2D1YA 3I01M 1NN5A 5CD1A 2JFZA 3OURA 3OVMA 1EFHA 2PH7A 4NNOA 5DTQA 4X20A 1TXGA 1R6AA 3T7IA 4EABA 2CJXA 1P7YA 2BFAA 1P1FA 1S9DA 4URUR 1IPEA 1DIHA 2LVBA 2A0UA 3DBLA 1T5IA 3GG9A 3ZY2A 1H85A 1GGNA 2FR8C 4GI7A 1A2KC 1M8GA 2F1OA 1C4XA 2EDAA 2WWTA 3AF4A 3FNRA 4N7RA 3TEFA 1TLFA 3I76A 3IIKA 4H7JA 5KU1A 1FMTA 3P32A 3R1IA 2YKGA 3NP9A 4URWR 2IWHA 4A8HA 1GDHA 1K06A 1CUYA 2LXNA 2X4IA 4BRSA 1R37A 2NVUA 2NVBA 3T9BA 2YJNA 2IHBA 1NUHA 2G1KA 2D5IA 1KJ9A 4OHPA 2C2ZA 2CNNA 5KTNA 1MQ8B 4OQYA 2VP5A 2H7CA 2VDOB 2XQKA 4MQMA 1ZIYA 3JTEA 1ZRMA 4XGKA 4Y8VA 1TM5E 4GGMX 1J90A 1EUDA 1VCOA 2P65A 4PNHA 3J7AC 4N47A 5A9TA 1CUWA 2CLIB 1FU8A 4UM7A 4UHEA 2XYRA 4HWRA 4QUJA 4DIOA 1XMPA 1NFQA 1WCXA 5JAIA 3ICOA 1P80A 1WUKS 1ILWA 1W48A 3P9YA 1RC8A 2MSDB 4FC6A 2QU7A 4CUJA 4UEWA 2XYVA 5AW8A 2WV7A 4Z9FA 2WHPB 3M6IA 3COSA 2OBLA 4OBEA 3G68A 4RZUA 4XQ0A 3HGTA 1S6YA 4OOFA 5FTKA 2NZWA 4O1HA 3B8EA 4PLWA 3R76A 3TE7A 2FH5B 3URKA 1KERA 2C92A 4IWNA 2FRDA 1AN0A 1EVQA 1A77A 2YS6A 3PHJA 2IFTA 5D6OA 3UUEA 4MPDA 3TUZC 4DV3B 3T52A 3X1YA 5JJLA 5KTKA 3PNMA 5FPQA 5JMTA 1QVAA 4NDAA 4JN6B 4FDVA 5IAJA 2NSHA 2ZYSA 1E2JA 4B7AA 2EZ9A 2ZPUA 5G1NA 4DUGA 1U7UA 1BHO1 2VQDA 4MQBA 3KWJA 3QI2A 3F8SA 2KYRA 3QBJA 5BURA 3B7WA 2YXEA 3EXHA 1Z4LA 4FWBA 1ULBA 2JEOA 3UANA 4BLTA 2N46A 2D00A 1F4VA 3DKIA 2F3QA 3DMTC 1J33A 2VQEB 1KZYC 4WCDA 1YGYA 4X8OA 4QRIA 4RTKA 3HXQA 2N9UA 2QP3A 1LPOA 4MEJA 4HXYA 3X2FA 4B6RA 2FGJA 4EX6A 1UFKA 4D8VA 1Z6PA 4MW6A 2VI5A 4HX5A 3ZVNA 2AN5A 3BRSA 1QV7A 3ZQUA 1ZCBA 3GPDG 4FDMA 4AIRA 5JYDA 4NJMB 2AKEA 5A2QA 4P81A 3B78A 4F9EA 1O5TA 1RI2A 3OPYB 1C9NA 2FLVA 3N70A 4QGHA 3W2FA 4NULA 3INGA 2IS1A 2FOIA 3ZNNA 2Q3MA 4BLQA 4FHDA 2J3MA 5IH7A 2EX4A 4CM6A 2W4QA 4JENA 1TZMA 4BLVA 4UTNA 1QRRA 2C3UA 4AI6A 3JV7A 2IYVA 3E48A 4CLEA 5E9JA 2LIPA 1OUMA 2Z56A 3G5TA 4JS0A 3TR6A 1A5TA 1M6WA 2AOUA 2I1WA 1YJCA 2DQSA 4NDNE 4ZVTA 3UG6A 3VZBA 3ZHZA 4G0UA 4DANA 1XTBA 4G8CA 4HMPA 1U3DA 3FJYA 1Z34A 2BR4A 3A9CA 1BYUA 2C9MA 3OIDA 3QF7A 4IIEA 4ND4A 5DKFA 4D9GA 3FHTA 2O54A 5FOQA 1FJGB 3LSTA 2I71A 1E60A 3OJOA 3A3YA 2PV7A 4C4ZA 2IE8A 2IOFA 3ENNA 2ZVJA 3MTQA 3OE5A 5TQ0A 5B3JC 1WUTA 5FH9A 3CUSA 3U4IA 2R60A 3PP8A 3AY6A 1MN6A 5CCDA 4Y1RA 3CRNA 3JQAB 1MX5A 3GMSA 3OZGA 1C7QA 2CFSA 4UD2A 1ZSVA 3BF8A 3DO6A 2LIVA 3CLUC 2ZYHA 4KODA 2XE8A 2B2NA 3GRKA 3JR7A 4X3CA 1KE2A 1I1OA 4CHTA 4PG7A 7ABPA 3VU0A 3BHIA 1WZUA 4GBGA 4Y2UA 1YFKA 5TT0A 2P9CA 1XTZA 1IRXA 2VRCD 1DIGA 1WKVA 1T3LA 2GRAA 1MIHA 4HXEB 4Q4LA 1ZO8A 3QVGA 3A7DA 3ISVA 5THQA 3VJMA 3BQ9A 3D0RA 1D7OA 1NDHA 3UMSA 4LDPA 3ESBA 4UXIA 1LXCA 4A03A 1C50A 3I8OA 3LQRA 4YQEA 3KQUA 3PJDA 3RAFC 5EMLA 1B15A 2WJ6A 4CCYB 1U8XX 2FMUA 1QAQA 3NS7A 1P1JA 1K4KA 1VKJA 3HJGA 3LSYA 1U7OA 3ICPA 4HWOA 5EUBA 1J2TA 1J8FA 1H2EA 2OXEA 4JXJA 1MFPA 1XK7A 3VVMA 2P9EA 4OJTA 1B3BA 3ZQKA 1BJTA 4ZARA 4WBNF 1V7PC 2D06A 3MMSA 4ZODA 1ETUA 4ER7A 3E82A 2CV2A 2FEAA 1R0LA 1R8JA 1RLTA 4QAQA 1TEZA 2WLSA 4YAEA 4JLAA 1E0DA 2FF7A 2AX4A 2D1RA 1CUCA 2YBDA 3BIJA 1Q3KA 5CJJA 4YP9A 3DTVD 1KI1A 5AO9A 1IAVA 1IN7A 1JSCA 2FOLA 4XPZA 3PC7A 2O8CA 4TROA 1WMFA 4Z2AA 5FLEX 3O3OB 2Q0XA 1ODSA 3COPA 3H3XA 3HACA 3IB6A 3QUSA 4F46A 4Z1MD 1A9ZA 5BQFA 5HX7A 2CVHA 2HKIA 2QAIA 1U5BB 2JIDA 5I51A 4YPFA 4DYHA 3GQBA 1QRAA 1SXQA 2PFKA 2W6ZA 1Z4OA 5AK5A 5E2AA 1OY1A 3M81A 5CG1A 3HN2A 2BFFB 4Z53A 1DS6A 5BRAA 1MJ5A 1OXXK 2C9YA 2C9CA 3MPUA 2G9UA 1NPDA 1XXHB 1ZIOA 1DMRA 3LCCA 4HB4A 5GONF 2F00A 2BH2A 2F3RA 1JU3A 1NW3A 2HU2A 1GOTA 4ZOLF 2VHQA 1XCPA 3SMVA 4ZOBA 4BMYA 3S8MA 1UC5B 3G9QA 2ZYRA 3NYWA 2C7GA 3DW3X 4RY8A 3JYNA 2FRXA 4CMEC 1XMQB 4DG5A 2AX3A 5FPSA 4AY2A 1H0SA 2ONYA 3A1UA 3SBEA 2BJWA 4I1VA 3MJFA 5KDLA 821PA 2TECE 3ONNA 4HDKB 1K5GA 3ZUPA 4RJ2A 4WW0A 1ZMRA 2BFCA 3B1VA 4TV9F 1ODJA 1Y6ZA 2R8ZA 3A3PA 2Q50A 4U7TB 5AH0A 3QU4A 3RCBA 1E1NA 1U3UA 1M0EA 4CEHB 1RJDA 2VT2A 2AMVA 2CV1A 1PRYA 2XQVA 5E8JA 2X40A 5EKXA 1UPFA 3UJ8A 2D3WA 5CFMA 2NU6A 2PN1A 4C22A 1I14A 4LYAA 4F3CA 3OWOA 1CP2A 1SBHA 1VCIA 1LV8A 2UKDA 4KR3A 3GUVA 2BM0A 1AHHA 4YRCA 4QBFA 4WKNA 2E48A 1ZMOA 4NYJR 5DWVA 1QP7A 4Z0PA 5A4DA 3LC2O 1RYYA 4BC0A 2NNWB 3IUMA 4CNBA 4HNRA 4OAQA 3TUIC 2ESRA 4RZ2A 3R8XA 1U99A 1T0JB 1YRQA 4DIKA 3ZD6A 1Q6ZA 2G6TA 5AHOA 5T4EA 4YT4A 5JZ9A 3CVXA 1SXPA 1T3TA 1TKAA 3KOXA 4IHJF 3ZBPA 5CFLA 2FJUA 1ISGA 3F5QA 1RJ9A 5DGDA 1RZRA 2FW8A 1TJ4A 4CMHA 1QLWA 3WQBA 3T0GA 1NYQA 2X9GA 3RC3A 3VHLB 4E88A 2O5CA 1M7HA 4Y6QA 1W6UA 2AK3A 4P4UA 5BN5A 5KYGA 3UWSA 3ROPA 1F0PA 4I5FA 2JBAA 3ZIAD 4TV9B 1EFKA 5LQDA 5EJ5A 3I61A 3F96A 4FGWA 1FJHA 1U6IA 2G9VA 3LGXA 1UWCA 4JLNA 3H9QA 5B2EA 1TYCA 3AEKB 1SIWA 1ULTA 3AUUA 4YRJA 2J3JA 3TW8B 3ZIUA 3DZGA 1ZNXA 1AY0A 3VR2D 4F3RA 3TX6A 2PBFA 5MN5A 1Z18A 3THSA 2IZZA 4U5XA 3TG2A 2HPAA 3R3VA 1YC5A 1KI9A 2AL7A 3C6KA 2XEXA 2GPNA 4P22A 4LF9B 2VYVA 3AVVA 1CR0A 4ZOLB 2JG3A 2GERA 5FBQB 1TEHA 2CF5A 5CJPA 5CVDA 1XZ8A 4BIMA 4J4BA 3QE2A 2H1LA 1D6MA 1ZR2A 3LPAA 4HAWA 3EW7A 1RPNA 4LF4B 1HC7A 2PGXA 1TI7A 2CXXA 2O2CA 5BSGA 3BZWA 2YRXA 4B3SB 4GW3A 4YCCA 4YIKA 3CZ4A 3KUCA 3TWOA 3A6PC 1LK5A 1QZXA 3TW4A 1QKJA 3W9BA 5BMVB 2VAMA 3KKKA 1K5PA 3UB4A 5C9ZA 1ZJ6A 2D4AA 4H4CA 4CM9D 4LI0A 3UGKA 4UNQA 2ZM6B 3QFTA 4X0EA 3SGLA 3KJEA 5J2TA 1PR5A 3DMNA 3FMIA 5DGHA 5MHTA 4QHYA 3VSAA 3FAZA 5UKDA 3L0ZA 5CB4B 2EJBA 4PZPA 1T9DA 2ZDQA 3SBXA 3WGJA 5LQCA 1MMFB 2A6PA 1JEEA 3DHEA 2IXBA 2Z09A 1FFHA 1LSSA 1M1YA 4O2BA 1GT91 4BP3A 5FHRA 2ODBA 3RABA 5T5QA 1Q50A 1M2FA 2JCXA 2Y0PA 2FZLA 2ZBFA 4NE7A 4N5NA 4KQ2A 4MYCA 2DUWA 4BKUA 3GT4A 5FCDA 5FPTA 1E58A 3CPJB 2YUTA 5SY6A 1ZH6A 1U2DC 1VHQA 2OYCA 4V0OA 4D9FA 3IKVA 1BJRE 1E3EA 1Y5LA 2HY7A 5HOQA 3OPNA 2OHVA 5IWCA 4GD3Q 1ZESA 1R0SA 4RV4A 3UEOA 5CIWA 2QU8A 4HEA1 1U2SA 4J43A 4Y18A 4A36A 3Q6MA 3MN1A 3I0MA 1UMCB 1PVVA 3C98A 3FCXA 3DBIA 4H3SA 4N18A 2QRMA 5JQGA 5NLLA 1O95D 5FFFA 4GKKB 3Q7EA 3RWMB 3DYIA 3IP6A 5DHSA 2GCOA 5BSVA 4OXXA 3D5QA 4FMCF 5E0KB 4PCUA 3TQRA 2XVXA 2XLBA 1OPRA 1RM5A 2FWRA 4NCIA 1OX5A 5L3SB 1KR2A 4R2LA 3PUZA 1TCCA 2JJ2D 4KGXA 5ALIA 1M2NA 4EAAA 1R8XA 2YV2A 4CIDA 1DJMA 1R12A 2O2ZA 1O1YA 3UHOA 2YY6A 3GN1A 3SR4A 2ROQA 2X19A 2B9EA 5JR3A 2EF0A 2SICE 3L8DA 1DC8A 5CTAA 3TMYA 1R5BA 3ZU6A 4MGYR 4TTPA 4RZHA 4GPD1 1SQGA 3FUWA 4CG3A 2D2VA 3QLUA 2R7KA 5LD2C 1TTHA 3ZWCA 5E9AA 1WE2A 1LLUA 4GHWA 3TLGB 1G8PA 1REQA 1Z5ZA 2DXIA 2HJSA 2Z5LA 4IUBS 4HZGA 1ZIPA 2HA0A 2VL7A 3H83A 4U6NA 4A1OA 3UK2A 2AD5A 3DAOA 3W77A 3WWDA 1ESMA 1Z88A 2V55B 4FFMA 3K8ZA 3ZWQA 3RIHA 5HYVA 4RD1A 4BB5A 1CC1S 2ZWOA 2IL1A 2JGEA 3NJRA 3ESAA 4BVJA 5HUJA 3H3FA 2VQFB 3WHIA 3AB8A 3GLSA 3L0YA 4JHLA 3QLVC 3OD5A 3NT5A 2XDQA 4WJKB 3OM9A 1T2UA 4OUKX 5EIFA 5G3YA 2F1IA 3FD8A 1GUBA 1Q7RA 1TVEA 3VYSB 4C0XA 1BX1A 4WX2B 5SICE 3FF4A 4WBNA 2IPXA 3B85A 2JLQA 3KE9A 4WMLA 1M7GA 1SRRA 5DN9A 4TZ0A 5DO9A 2GWHA 1LC3A 4ADSG 5FUMA 3QSGA 4XR9A 2XIJA 1FRNA 4PYKA 5ER9A 1PLKA 2RBKA 4C0HA 5BXQC 1N25A 1HOTA 4LYDA 1QOQB 3P71T 1Y3BE 3H1FA 2JVJA 3NI2A 4KXYA 2J0EA 2RGBA 2D7CA 1QCDA 3ONDA 4K9DA 5CR9A 2HJVA 4DUGD 1XWWA 2JNWA 5MFPA 3WQHA 1V2GA 1EINA 1BU8A 2BEKA 2QX8A 1UEIA 3D2BA 2QRJA 1J49A 1QCCA 1S3FA 1FDIA 3KQOA 4PFQA 4D3YA 2X2PA 1VFPA 4FOOA 4IRUB 4TMXA 3W05A 2C82A 3WRWA 4C6TA 2VK2A 1HETA 4Z0TA 3G9UA 3KFVA 1K5HA 3UYLA 5HCIA 5EI5A 5IBPA 1MVOA 2BI7A 5MN6A 3PJRA 5CFNA 4YT2A 3LLCA 4OM8A 2ZRKA 3QVJA 3UH0A 2ZETA 5F3RA 2QRPA 3VR4A 2YHIB 5YASA 1KC1A 3GG2A 4FFRA 5G4KA 1KY5A 2BBOA 5BW8A 1C41A 4IIUA 1W4BA 2TYSB 3EIXA 5C8DA 4UEKA 2BDTA 3DE0X 3ECSA 1L4FA 1TK3A 3UHJA 1WM1A 2OO7A 5KB3A 4RPGA 5A06A 1O58A 1ZQ1A 4F04A 1RE1A 1KS9A 2GJSA 4G01B 3TVDA 4I6GA 4PX5A 4CT5A 1QFZA 1KI4A 3N75A 4Q3AA 1W36D 1ZD1A 4BMDA 4DXAA 3VAAA 2WRZA 3VX3A 2DFKB 3NMUF 4Y0VA 2WV9A 2DT8A 1U7XA 1Q7BA 2V6BA 2QLJA 1MB0A 2IV3A 3KLOA 4S1WA 2VHXA 5BOSB 1L8LA 2BM9A 1PJ8A 3GMTA 3HMKA 3Q3IA 1SBCA 4GMGA 1LC0A 1EFRA 5DPMA 4TV9A 2VTEA 4F8YA 3QVSA 4NBRA 3ZGVA 5K99A 3EK2A 3SKVA 2OHJA 3EF1A 3W5SA 1SUAA 1X7DA 4UU0A 4YXWA 3RJ5A 4EBFA 4QPCA 4E32A 2AOUB 2QX7A 1FYXA 4RTLA 3A2MA 5G0WA 4BJ5A 5LZ4A 4I55A 1VGQA 4PYRA 3ANYB 3L6DA 4TTAA 3ZDFA 4LBYA 4F56A 3UCXA 4I4NA 4YQZA 1R0CA 1GPJA 2ZDHA 3LW8A 2ZYAA 4HL6A 1U94A 3R5JA 4Q02A 1XDZA 3W1VA 3W5HA 4YMVA 2FEPA 3RRJA 1T0HB 4QASA 4ENPA 5D3MB 2H4WA 3AJRA 4GGPA 5EZSA 3GA7A 4Q15A 3IELA 1WOYA 3NWOA 4BX2A 1G6KA 3G6WA 3N2KA 4KI7A 3GBPA 5K3DA 5CD9A 1DWOA 1N7IA 2P75A 2MCFA 1QRDA 5EZYF 1P18A 3BGIA 3OMXA 4IGKA 3SDSA 2Q4BA 5DXAA 3EGCA 1HKHA 1TZBA 2ZJ4A 1V3QE 4U0KA 3P0EA 5J1SB 1SUEA 3KX2A 1HT3A 2R00C 3FB4A 2C8KA 3HY3A 3OJLA 4BVHA 2QPOA 1EM8A 1KO4A 1MZVA 2C5EA 2ZAGA 1M1NB 2FFHA 3E5MA 4RJJA 4EJ6A 4GYKA 3PX2A 2OCAA 4JYCA 1EJBA 3A32A 1DWQA 4NU6A 1GLGA 1M2GA 1UMDA 1Z16A 1SOWA 4KNWA 1T0BA 3HO1A 5K5EA 1YCHA 1TM3E 2NYAA 3CW2A 3LYAA 1J56A 4B40A 1SHJA 3CA8A 5LDHA 2UVPA 3PLNA 2RGGA 4GPZA 1I2MA 1EDBA 2DQ4A 2GYYA 1QH0A 4KJXA 1R6DA 1XPOA 2I7CA 5KJEA 4BQIA 1JEQA 1H6AA 1JX6A 1NVEA 3L92A 1L5RA 4TKVB 2HA2A 2QVZX 1IDOA 5I4BA 4MTLA 4J0CA 4R8LA 4RVSA 1GKUB 4DMKA 3THRA 4QNNA 1OAOA 4N5IX 4G6ZA 4GC5A 3FWKA 4D8TA 2BFMA 2V9PA 3UAVA 1XR3A 3EXG2 3BXXA 3V2UA 3ZY4A 2ZCVA 9LDTA 3DBRA 3ZHCA 2NUAB 2Y1EA 4Y9SA 1HDOA 3G0BA 3OEHA 3DOJA 5A6SB 3IDOA 3PHIA 1KEZA 4CF5A 2QVYX 5IKXA 4DTCA 3WMFA 2FN9A 5AM2A 3WNCA 5JZMA 3CLTC 3KTAA 2CFOA 4LE0A 4YCBA 5TQ2B 3JAKB 4P7BA 5REQA 1U11A 4ZCLA 2DUMA 3WDSA 3MRVA 1GRRA 2ZRJA 4ZYTA 1Q16A 1VLJA 1PP4A 4ENSA 1I6WA 2NAPA 4DCMA 1XJ0A 1FBNA 3NUZA 4P6VF 3PE3A 4YREA 5EIEA 4LG1A 1E3JA 2ODEA 1ARZA 3M4ZA 3LYUA 3U9SA 1YD7A 4P80A 4PHGA 5JQGB 3NATA 4NJEA 4P3KA 1GPMA 1WIWA 1XRPA 3ZQ6A 1QAMA 4R2IA 1UBTS 4V24A 4L0CA 1B1AA 1SBNE 3DFIA 3EG9B 4EI2A 1U1IA 2XODA 2MSCB 3GELA 2IX3A 1P3DA 2GKSA 2YNMC 2FSVC 4DC0A 3OFNA 2XW6A 1LFDB 3LPLA 1XYVA 4I4IA 4G26A 2AE1A 3L9XA 4EVIA 1L8AA 1C1HA 3DTVA 3FCAA 4NBUA 1VCMA 1KQNA 1XRMA 2O7SA 2WJAA 3O95A 2Q45A 4B3FX 4E4YA 1U9JA 1GITA 4NDZA 3UJ7A 4DSUA 4X1KB 2CKDA 2O1EA 4YFVA 3SI7A 1E1MA 2PKQP 4FEYA 4DLAA 5IJWA 3DW1X 1TCBA 3U7RA 3TZBA 2UYHA 3INRA 5JNWA 4LVUA 2Q5HA 1DKOA 3AZPA 1K6MA 1FYFA 4C07A 2RKWA 1EQ2A 3VFDA 4CTJA 4DUYB 1OIVA 3IIEA 4OXNA 3JQAD 3E7DA 1HH4A 1WCIA 5L7TA 2WWVD 1QTNA 2WMDA 3C8DA 3GGPA 3C5VA 4QWWA 4YMLA 4ZQBA 1XLTA 3U3RA 2H16A 4OSOA 1IY8A 1W49A 4MWSA 5KYXB 4B85A 4D4IA 1VHJA 3KQTA 4GLBA 3ZGZA 2I4MA 1TAGA 1J23A 5HWSA 2Q49A 1H2AS 1GAWA 5F2NA 3V1UA 2GF2A 3LHSA 3CNHA 3VKGA 4FX5A 4HNSA 4Y2HA 2P69A 1I7PA 1JSZA 3CEAA 2ZB7A 4JLDA 2QZ9A 1SUWA 2YN0A 1YS7A 2DJIA 5FFMA 2GXSA 3WB1A 1GTL1 4CQLA 3CBGA 1XRNA 4O3FA 2NZJA 4LVNA 1LTQA 4U7PB 5JAUA 2XY4A 4IV0A 2F6RA 1EK1A 4ZIRA 3BMXA 3ZTYA 4Z1OA 1TUEA 3L7AA 1KDPA 1ORRA 1C5KA 1J9GA 2QQEA 3CB4A 3ELUA 3GUHA 2PD3A 3KYCA 3PVCA 5BNFA 3RYFB 1I4LD 2C42A 1IQ0A 1BMFA 3N58A 3QEKA 5EJ4A 1G9TA 5KQGA 3ICQB 2GPSA 1G7RA 2QR3A 1XP8A 4FFBA 4MLCA 1T5LA 1J2UA 4LTMA 5L4NA 3DFFA 4DBVO 4ZJPA 4OQLA 3TGLA 2V7TA 2BJVA 5AKYA 5GIPE 5CT6A 2CDRA 3MCUA 4WOJA 3TZ6A 4IQ0A 5K3AA 2G72A 1E9BA 1K5DA 3TRFA 3ZDYB 3KB6A 3UKDA 4CF4A 4ZOLA 4U7WA 1WXGA 1Y3DE 4DM3A 1B00A 3AP2A 5G4KB 4URVR 1WZNA 1E0JA 3JQGB 1T29A 1GPWB 5ALUA 3HWWA 3LO8A 1V7CA 3O47A 4KGDA 2DEUA 2XB2A 5DISB 3QHPA 1KF0A 4P53A 3DM5A 3JQQA 3GLUA 1KWGA 2I6QA 2MYUA 3CO0S 4UAJA 4E12A 3UC5A 1CS4C 3P27A 4I6EA 3WDKA 4Y2RA 3GCXA 3TAUA 4XB6B 3WWOA 5J43A 3OWHA 4WBSA 4LF7B 1LJUA 2RC5A 5BMVF 3K4QA 4DT1B 1M75A 4UASA 1FUYB 2CJFA 2B37A 2C07A 4Y2GA 3WNDA 2QN8A 1RTKA 3G9ZA 5BSHA 4LAFA 4EPYA 5KTOA 3HNPA 1JHDA 3GXBA 1N3BA 4J0IA 4ZT4A 1W36C 1ZHOA 2VZEA 1RBQA 2WAYA 5KOHB 2HSWA 2QQ5A 3NVAA 4DR5B 1SCUB 3ZU4A 1IZZA 2XNKA 1MV8A 2XQFA 1NAHA 3I4LA 3JD3A 4Q4HA 1PG2A 4DMCA 5INTA 1BKYA 4M88A 3LD9A 5DNYB 2RD2A 1ODKA 3MWDB 3UUFA 1RWNA 2GESA 3RREA 1EA7A 3Q5DA 3S4YA 4N65A 4MGZR 2HA6A 1BRMA 5IM4A 3IEMA 2RE8A 1KIAA 2DFDA 3P4YA 1GSIA 1HNNA 2UVPB 1YE3A 3B82A 4TT3A 5TEWA 3TD9A 3AERA 4KRFA 3QVOA 1F6WA 1GYPA 3Q41A 4RVDA 1VG8A 1Y5MA 5IUNC 1Z68A 5JDIC 4E5KA 4KW7A 5HG0A 3ZVLA 4Z4CA 4LZLA 3TOSA 1N2IA 2WTUA 1XZJA 1Q21A 5ES4B 1L7PA 3QVVA 4K26A 1JFSA 2P5SA 5AVQA 3SC2B 3ESQA 1T1SA 3F6RA 3S2UA 1DC7A 2NP7A 1FP2A 5AESA 1FYWA 3D7RA 1NBME 2ZI7A 4IHJB 2DFLA 4M9SA 5C18A 3BWMA 3WGIA 5EZYA 1PQ4A 3N2NA 2QJOA 4LTNA 3KHUA 3PBKA 4ND2A 4AUMA 1OXSC 4F97A 1HR0B 3LCUA 3S5JA 4K9RA 1RWPA 3CVOA 4M8NE 2N0SA 4Q9IA 4B31A 3WZMA 4ZYUA 3F9RA 1PZNA 4MV1A 5IT9A 5HILA 2G88A 2ZWVA 3HDVA 4DHWA 2GEJA 4EDHA 5LNK1 4IOMA 3PXDA 4NK5A 2ZRQA 4ZEOA 4CLXA 2H5LA 5E1OA 1FBTA 3QFRA 2EHJA 1Z2PX 2OFXA 3L6BA 1F5SA 1XZGA 3R9XA 2HRZA 3KIPA 1JPNA 2R79A 4QQ8A 1IZ8A 5DGCA 3T7DA 4DR7B 1W0JA 2NU6B 2GH1A 1TJPB 1T5BA 3STTA 1M6YA 4P3NA 4IG4A 4EH1A 3D2CA 4IKEA 4RTRA 1DQSA 2YBEA 3GJTA 3L0PA 3AZQA 5CLGA 2Y67A 4TYMA 3UFXA 3NIWA 1QLJA 3O3CA 2QDXA 4N01A 2QM7A 1P7PA 5A05A 1PNQA 5F7OA 3AKYA 3RVPA 5IMBA 3SZOA 3U17A 3DP9A 2FUEA 1G2PA 2VHTA 1TIPA 5U4QA 4U2DA 3N07A 5BVGB 1BDHA 1WQ1R 4C5CA 2JH8A 1OHHA 4BNDA 3QENA 2B35A 4FHZA 1L5ZA 2AR0A 4X1KA 2WAOA 1LJLA 1XQ9A 2OV8A 3F3YA 1SZCA 3MILA 4V3BA 4ETIA 5C52B 1R7RA 4W1SA 1L0BA 3FTDA 2FDXA 2HDHA 2OOSA 1NMEA 4JP2A 4KUHA 1MJGA 2FPKA 4QNRA 3WR5A 3RT1A 3QHQA 3Q2KA 1ZK1A 4NECA 4FFVA 2YC2C 2ZS7A 4ON9A 5K0ZA 1KHHA 1E63A 4NOLA 4TL8A 3NWPA 4RACA 4X6XA 2XJ4A 3CUWA 5AVUA 2X1HA 3EEQA 4YO7A 1U02A 3AP1A 3I9MA 4R0VA 2FYTA 2PMCA 3IKJA 4V38A 2QVGA 5CDTA 2UZ1A 2WZBA 2JGDB 1CR4A 3HN7A 4OQDA 4XKJA 5BOSA 1XTJA 1YSCA 4S0XA 1N6HA 1NXXA 3Q9LA 3I04M 2E6UX 2W2NA 2WAXA 1YZTA 2C2MA 3ONEA 4KQHA 1XB2A 3PRHA 3K9FC 1Y3FE 2IYEA 2WVAA 3GZ4A 4HWKA 4PGFA 4U02A 5A7FA 5HZMA 1R66A 4RK5A 5CFOA 4KO1S 4YV0A 2FPSA 1YHYA 4Q3EA 1OWPA 1VJGA 2DLDA 3JS5A 1J8YF 4XJXA 4BEJA 1UC4B 1K6XA 1DCKA 3B89A 5DXJA 1RPAA 3ZWMA 1EWYA 2CFRA 1ECBA 4FCWA 4FMDF 1F7UA 4ZEXA 1P4GA 3TM5A 5CX1B 4Q01A 3S1LA 5LU8A 4PC3A 1MD9A 3G85A 3ODGA 1CUZA 4H4EA 4Q6WA 2JS7A 4L5CA 4G4SP 2QN3A 3MOGA 4RW0A 4O2AF 5LCXA 3U56A 2CHFA 1EZZA 5ESWA 4CL3A 3DLBA 5DW3A 1AKQA 1E3MA 2IZ1A 4WZBB 2HLHA 1JUDA 3TL3A 1SUBA 5EHZA 1ODIA 3KKQA 1FVXA 5D86A 3ZCVA 1M1ZA 5K0CA 3THWB 4I99A 4F9GA 1KDOA 4RORA 1L1FA 3WBBA 1IQUA 1JLMA 4MEAA 2RBGA 5HW0A 4TV8F 3CT6A 1HL3A 5JU6A 1PQWA 2J9FA 1ZIXA 1ZGHA 2B8EA 1CQPA 2QUBA 3AH8A 4I0WB 1SBIA 3AI2A 3WAJA 1GARA 1DI0A 3C14C 1RC0A 2C2OA 3LX6A 3MD0A 3HP7A 4H4DA 2WABA 3P9ZA 1EQUA 4LOLA 4DNFA 1CR1A 5FWXB 2V58A 3MWEA 3IDSA 1A2OA 4MWBA 5CB4F 3HMQA 4TWZA 1FFXA 3L8CA 3C85A 1P2FA 1NOKA 2E82A 1FUUA 2PJDA 3W5VA 4QBGB 3FLBA 2AC2A 4CUKA 4F3YA 1TA9A 3T4PA 1B8UA 5EJGA 2JBHA 5AI5A 1KOJA 2YMMA 3A3NA 5D84A 3TB6A 1AGPA 2C03A 1U8TA 3DOHA 1TF2A 4P32A 3I1FA 3SJCA 3UJ9A 3GP3A 4MUAA 4BZQA 4EATA 1PBTA 4AK9A 4B0OA 2ZJ3A 3R9IA 4I1PA 2PCLA 4QYMA 1GZ6A 1YDGA 4FFWA 1ODCA 4C76A 5DNUA 2I2XB 4AZ0B 2O0KA 3V97A 2PMFA 1SK9A 4NMLA 1M2OB 4J1TA 2A9VA 4OLHA 1YONA 4CMKA 2XECA 3RSGA 3BIWA 2GEDA 3OFND 2YV1A 4B33A 4KE8A 1JLLA 3CNOA 1C9YA 3VC2A 3K1JA 4NJEB 4OHUA 1UOPA 3ZEIA 2D54A 1H1TA 4IJKA 2A57A 4HYEA 4KN6A 3RTDA 2X8JB 3LL4A 2EP5A 4RUKA 4MR7B 5CX4A 5ICMA 2DT5A 4R9RA 3W5BA 3WGYA 1N5KA 3IAM6 1F0YA 4NPCA 2ZATA 3AJ8A 3QVWA 4OYRA 3ETLA 2OILA 2Y1FA 5LOVB 2HPZA 5ED0A 3V4LA 4LXYA 3ZHUA 2P9ZA 5DHQA 1H2YA 4ZMSA 1U8EA 1UP7A 2NVUB 1VE3A 1XZLA 2BELA 1CQWA 4Q66C 4RNCA 2Z95A 2AD1A 3B3QA 1GSOA 3CKMA 1E8DA 5EGSA 1SY7A 4CL8A 2JAQA 4XRGA 3U4HA 2GJAA 1JEAA 5DOZA 1M66A 1Y3AA 2HXGA 4DMLA 4PV7A 4UUMA 1D6SA 1XVAA 5HSGA 3JYPA 3MGBA 1VYUA 2J48A 4O4IB 1I2AA 3DBLB 1XDWA 1BA3A 4MW7A 1KJJA 3ICEA 3WK7A 2Q4TA 6REQA 1V71A 4DLLA 4LF6B 3MLAA 1I7NA 4E2XA 1JG3A 4K9KA 4D9NA 1HEUA 2AOTB 1G1MA 2OC9A 5DASA 4ZKDA 5FTWA 5IM4F 4YX9A 3THYA 4OQEA 1OXKB 2OG2A 4EHKA 2ONKA 4EZBA 3QVMA 4ZDWA 1GSHA 3PPVA 2W5UA 1VMIA 5F2KA 3QV2A 1TO2E 5F21A 1LRLA 5B37A 4RVOA 1MEEA 3RFFA 1UBOS 2ZT7A 2AC4A 3KBBA 1GQSA 3KYJB 3FGZA 4YDHB 1EH5A 1NYLA 1N4DA 1ISRA 3ED5A 3FUXA 4Z7OB 1ZQ9A 4QOHA 1EUDB 1BCRA 3NHLA 1R4NA 2VYQA 5JCOA 5K0SA 3AP3A 3M83A 2O7RA 1H2XA 3QJ5A 1NW5A 1LDBA 1X15A 4L5JA 4MS1B 2OCYC 4ARAA 1OLSB 1KYWA 2OAP1 1VZ3A 3WTBA 3WQQA 5LQUA 3U6KA 3G3EA 3R3WA 3NUGA 2ZT8A 4O4LB 3TKLA 1IPFA 3L7CA 3UENA 2J6BA 4UKDA 4Z4QA 1I7DA 2OENG 2BFBA 3P94A 4O2LA 3Q87B 4CQNA 2A7XA 3QA9A 1H3EA 3QXJA 1FDSA 4NENA 2H59A 1NUTA 2IOFK 3ZHQA 5E95A 5K3SA 1HDIA 3ZE8A 2AW5A 2CCGA 2DZDA 4BNUA 4HH1A 3HCDA 1CIPA 2O2EA 3JQEA 4CJXA 2XE7A 1Z28A 3LX8A 4D79A 1IBKB 1ZA2A 2BDUA 1XZNA 1DQZA 2I33A 4GUDA 4M1SA 5C5DA 3ZGXA 3AY0A 4Y3UA 4MA5A 1XYGA 3N8GA 1Z0IA 1KYTA 1ZD9A 4PX3A 4D3ZA 4PHTA 1A96A 3QUQA 2HIHA 3ZI0A 4D4GA 3EX7C 1E7RA 3NM6B 5EAIA 3COVA 1TW2A 3AG6A 3DVAA 1BMDA 1FTGA 3P2YA 4XH9B 3VZPA 4XVCA 2FUCA 1ZKMA 4TTJA 4H3VA 1I3LA 3K0CA 3HYLA 1D8AA 1P77A 3LRTA 4R8MA 4FYMA 5JXIA 4R51A 4RPLA 4TSFD 4A8TA 2AXEA 1MEOA 1N1MA 4Y2TA 5F33A 1V2HE 2B1GA 2BZSA 3P9IA 4LC0A 3BZBA 4RPCA 1NQ5A 4WFJA 3RVRA 3URMA 5F3DA 5BQ3A 5KTMA 2NXWA 4JLOA 4UUAA 2PUWA 4G0WA 2CHVA 1HOXA 1EFVB 1JEJA 3MMXA 5TGZA 4FYKA 2YV3A 1FLDA 1JP7A 3REQA 4G86A 3HL0A 1PV4A 3IQIX 3PSHA 1RZVA 3PIDA 4J29A 3VU9A 2HTEA 3MGGA 3NG1A 3UF0A 3EVGA 5HIAA 3GOQA 2RDMA 2ZWIA 5H59A 5ITZA 4Q1CA 1EP1B 1CZRA 2YL2A 1VE6A 1QORA 2GPAA 4JVMA 4P98A 4EX7A 5TRTA 1XJWA 1LQTA 3GLQA 4S0ZA 4EPTA 1XAGA 2IH5A 5LA6F 5DEOA 3C8MA 2Q9AA 4B6QA 3WIBA 2HX1A 3N2IA 5HIIA 2CBZA 2JRLA 3O94A 4X84A 3W8NA 1GDTA 3LOQA 3MJ4A 4BMXA 2GN9A 4CKEA 5DM0A 1QBGA 3DE4X 3EVAA 3F49S 2DU8A 4XIIA 3CEHA 4ZA2A 3M4JA 4KAAA 3BGDA 4OSPA 4Z8YA 1P0CA 2APJA 3OQIA 4WLNA 2GJ8A 3L8EA 3ZU2A 1KEKA 1Y82A 3K1AA 3A6JA 1MW9X 3WL3A 5FNVF 3FCOA 1OQAA 4C0AC 4AJLA 5D1HA 3KZKA 1DBRA 2PEYA 1VXOA 4G4SO 4UPVA 1XJCA 2CVOA 3E8MA 5LZ9A 2D1QA 4IIBA 2FZGA 1QZUA 3QVLA 3QMVA 3BFKA 4MLDA 4MA0A 5JBNA 4QVGA 4DOMA 2CXOA 3RC8A 4LJ6A 3ROKA 1ZISA 5H82A 4UMVA 4ARVA 4KRGA 3H5RA 1P17A 2O2HA 6YASA 2FZEA 4PLTA 3NAGA 3TAHA 5JEDA 5EQFA 5JZOA 3KLBA 4H2DA 4QXQA 4RDCA 1QIFA 4AN1A 1SVNA 2XGJA 2O8BB 1ZI8A 5EZ5A 1MO2A 4AO6A 1Y7LA 4CMCA 4K3UA 3M9LA 2O3RA 4HDOB 4JC0A 2FPXA 5M5BA 1ZAKA 1VL1A 5SY4A 4AL4A 1JKMA 1Z17A 1JJ7A 2NSLA 4I7EA 2OR3A 4NCAA 2VQSA 2HPHA 1ZCZA 1H6CA 4QECA 5AVWA 2Z9CA 1YRLA 5EWJA 2I8LA 4FGZA 4RZQA 2GPJA 4BL5A 3IXMA 1YBFA 3AQ4A 3MWEB 2FEMA 2WHYA 4QJ5A 4N1AA 4Z4FA 1HYGA 3UOWA 3DCJA 4QPPA 5P21A 3V8PA 2QLTA 1RMYA 3RRFA 1UP4A 1V8BA 2Z3WA 1L7XA 4TXNA 3OTIA 2HJHA 5D7BA 4AJIA 4JYAB 2I66A 4O1MA 4BU1A 3AONB 3OQ6A 1WHTA 5TSDA 1UQTA 2J33A 2I2BA 4OIMA 1L4EA 4QTXA 3MRXA 5HKAA 1AA9A 4ZV7A 4OX9B 2OZKA 5JXHA 2EOAA 3BE8A 3CCCA 5FYDA 1F8YA 3ROXA 1WW3A 3WIEA 5JYBA 2IZ5A 2PL3A 1QSGA 4NQRA 3AHFA 4F5DA 2JH3A 5KQSA 4GPTA 3SHTA 4D42A 3KUDA 4OGFA 2OD9A 4M7OA 4YMSA 1WCWA 3BREA 1AKEA 4L27A 4PX9A 3VR2A 5J4LA 4J75A 4QHSA 3GQBB 2F64A 2EQBA 1POWA 4LVCA 4ZRDA 1SQFA 4L95C 2GB4A 1K3TA 2C2YA 2WNSA 3AB3A 4FN4A 2QL9A 4JLSA 5A9SB 4V02A 1UXJA 4HP8A 1GV1A 2ANBA 2ZYVX 3BQMB 3WRYA 3OPMA 2Y1LA 1LB1B 1ST3A 3TLXA 4BAZA 3VOSA 1GPKA 3MCTA 3O0DA 3R0QA 1SKYE 3RK0A 4K5QA 4XFDA 1R50A 4OA8A 1T2AA 1VPDA 2FZKA 3P0FA 3VBEA 1HTBA 3VR5D 4XVUA 1G5TA 4E5DA 3LP5A 5EPOA 1JAXA 1QHEA 2PTGA 5BVGA 4ZQEA 1RHRA 3Q12A 4URYR 1T3SA 4NHEA 1CRWG 5D1NA 4HLQB 5FTLA 1W9MA 4OBBA 4PQEA 4BX0A 1GADO 3BGSA 4BNJA 2GM9A 1PR6A 2QG9A 3JPYA 2IYLD 2CJWB 2H08A 3F2IA 4C7OB 4ACBA 3A25A 3BCSA 3NPMA 1WPGA 2PL1A 2ZBPA 3EXFB 3IQXA 4NX2A 4UUOA 5BN3A 1NW8A 4QFMA 3P9CA 1WLYA 3VQTA 3GLKA 4I66A 4PFKA 4RKWA 3VJRA 1XEFA 1XROA 3QELB 2QP4A 3UNXA 5HZKA 3ZVKA 1JHUA 4Z0HO 1JI3A 5K6AA 5KVCA 2X0DA 3W78A 4BNKA 2DFNA 1U8AA 2R8OA 4MP8A 2RHGB 3B36A 4HF7A 3I32A 4E46A 3SAJA 2Y05A 3EQ6A 1Y8CA 1GG8A 1WBJB 2VJDA 5A4AA 1NWHA 1IEWA 2WIJA 3GFBA 1E6MA 4IM7A 3KZMA 3R6TA 1HZZA 4IDOA 1MUUA 1RW4A 1EWVA 2CLSA 4PZ0A 1E4VA 1RLJA 2VJLA 3ZE0B 3B7PA 4RPIA 1GRQA 1VXRA 3WL7A 1QJCA 4IJMA 4QBIA 1A5BB 5IDQA 1M6NA 4IIGA 1IUKA 3FCEA 5HJ2A 2HIMA 2VBCA 5IVDA 3T1NA 3WYEA 5A5VA 5K0EA 2WP8J 1YFJA 2ARKA 1WKCA 5JS2A 3U2QA 1N7HA 1U6KA 1KMIY 3K3PA 3T61A 2WJGA 621PA 5LIRA 2PE5A 1UFQA 1KGSA 1X1QA 3CNLA 3K0FA 3QWAA 4JA2A 3N7UA 2AHOA 2WDPA 4LFCB 3KVVA 3ZN2A 5I7HA 5CH3A 3VR4H 1DAHA 2DX7A 1RC1A 4CLRA 3EZFA 4PBTA 3E9DA 2ZXUA 3LDGA 4M54A 2VHVA 1JHVA 4BYGA 1GY8A 1GR0A 2Z0MA 4YY3B 2XDWA 3D7SA 5AK6A 4X66B 1PR3A 3TLAA 2FY8A 3FVRA 1DCFA 2HF7A 3LQ1A 2I3ZA 3R2JA 4J8PA 4Q03A 4Y1EA 5I9SA 3RTEA 2VLIA 5FO1A 1UL1X 3OX3A 2DHEA 4GH5A 3PFWO 4LZWA 2V8OA 4OHOA 4BDTA 4DA7A 1JG4A 3NBMA 4QGGA 3UPTA 2W2LD 3EIWA 5AKLA 3FBTA 1RHKA 3ZGOA 1XTKA 2QZSA 3GRUA 4JGBA 4ASUA 1QCYA 5KQMA 4JI7B 3FNBA 3MTGA 3KB1A 4CEIA 4KWEA 5AW4A 2N3ZA 2C7VA 1LPAB 2XBUA 3BHMA 3M34A 3MZ0A 5F1OA 3AHIA 3SFVA 4F5EA 5JJ5A 1H9CA 3I05A 3KR9A 5EMKA 3ZOZA 1J0CA 1KU6A 3DHVA 1HDEA 3B1XA 1TZJA 4QM6A 1FNBA 4NL4H 2PH3A 4COOA 1X7GA 2IIPA 4QFBA 4CR7A 2ZP1A 2CXHA 2W6NA 1DAKA 2OLJA 4QYSA 4ZU1X 1GKKA 4ZOEA 2XH8A 2X9QA 1MBZA 2AFIE 2VCYA 2IUTA 2YN2A 3FPHA 4DBLE 4EARA 5JO0A 4NCJA 2FSFA 4Y7DA 5JWOA 4YAWA 3TLBA 2C0CA 2FA9A 3JVVA 4HZUA 3P7MA 3BKWA 4EJSC 3BORA 1AE1A 4LMBA 2UYOA 3DZHA 2YJZA 1XDSA 3HB0A 5BW6B 1KETA 1PJQA 3NTVA 3OEYA 1HMPA 3KPJA 5JBQA 3HFJA 5TY0A 3B3GA 4A2CA 2ZIXA 2BKEA 4DB2A 2HLPA 3E23A 2H5EA 2I2WA 3NIGB 1FFDA 5ITZB 2A1TS 2IPLA 4DE5A 4QG7A 2HHAA 2ZI3A 3T94A 1TQ6A 5IULC 3C5CA 1YZ3A 3F3MA 4NV1A 1O8BA 1U3TA 1HORA 5D3QA 3WFIA 2HBYA 2GM4A 4G81A 1E5XA 2CFIA 4ZREA 1KOLA 4QUHA 1T9CA 3M6WA 3Q5EA 3SDZA 1AKTA 3GGJA 3M7IA 1AXGA 4B3DA 4LI3X 3QVTA 1TKCA 3SF8A 4P93A 4GFDA 1W44A 1WEHA 2VF4X 3BXEA 4X5OA 1J20A 3W5UA 2J41A 4P31A 1MF7A 2EKBA 3JZIA 1ZH8A 4QBHA 4R41A 5JWHA 4RXUA 5T8KA 5KTPA 3KJIA 2EC5A 1F14A 4FDUA 4WXPA 3OQIB 4DCNA 3FSGD 2AN4A 4HH3C 2ZWAA 4U2CA 4D6PA 1B6GA 4R2MA 4INAA 2FG7C 5KHOC 3JZDA 1RKXA 2VWQA 2WTBA 3KAPA 4LJKA 4BWVA 4AQDA 2YVKA 4A5SA 4MMZB 3FNIA 5I7OA 3WMWA 4DNPA 1SU7A 4K81B 3K9WA 521PA 3LHDA 1KARA 2QX6A 3RRZA 1AXRA 5L3SA 4BZWA 3OPYI 4KRYA 5JNVA 3DE3X 2GILA 4HZUB 5CEJA 3EY4A 4X1OA 3HDYA 4KGVA 3WLSA 2QM8A 3FPEA 2QWXA 2YHBA 4LHEA 5A02A 4OBWA 4JCCA 3S0JA 3W6OA 1YS4A 4GZ5A 1WL8A 3ZXXA 3ZXSA 2V6IA 3HFGA 3FPSA 5FNVA 4LF8B 3EMDA 4KWTA 3CU5A 3IMEA 5LLSA 3E4DA 1G18A 1N0UA 2EEZA 1YCDA 4AG5A 1KQ3A 2CY0A 1WP9A 3KEMA 3N8DA 1JR6A 4KXWA 4EO9A 5JH7B 3JASA 2OTCA 3VISA 1WXFA 4JJKA 1Z0UA 4U00A 2H00A 1N75A 1Y98A 3LK7A 3ZGLA 5T64A 5ALVA 1N0HA 1UQUA 1ZOOA 1JTFA 4DDWA 1Z6XA 3TQSA 1VPWA 1AQYA 1SVSA 3OBIA 1ZPDA 2LTAA 5DXFA 2XMCA 1Y48E 1J1IA 3Q6IA 2VRBA 3IAXA 3FDFA 4MW2A 4YVFA 5FPYA 4ZTUB 1VDZA 2ZCJA 4TTQA 1I94B 5CDSA 1SXJC 2PMKA 3AIKA 1PZGA 3OUUA 4UCXA 3GLFE 1I8TA 1VJ5A 4QQKA 4QM7A 2G4CA 1V6CA 1ZC4A 1BW9A 5HQ3A 2JLVA 4NLLA 1C3VA 2HV8A 2Y4NA 2R48A 4JEIA 4D74A 1BROA 4D4LA 4UOQA 3EOBI 2XNDD 3W3AA 3KR1A 4GICA 4J1NA 4KI0A 5GV8A 4M0DA 4G07A 1NJSA 1OPXA 3WIUA 2BHTA 2JHCA 3EJ6A 5J40A 3UJBA 5AVXA 3KEGA 4Q7MB 4ZAVA 1H42A 2BFBB 1T1GA 1O4VA 4O0MA 2VK4A 4ZVKA 3Q2IA 5AVYA 2QENA 3IT3A 1W9HA 1MO3A 2Q29A 3D4OA 2C00A 2ID8A 4OL9A 2P4UA 2WILA 3TH5A 3TPZA 4YEDA 4EGSA 1E2UA 3N0XA 4ND6A 5E7JA 1SELA 1YZLA 2RGEA 2RG1A 5G1OA 4C4AA 3C6MA 2W6JA 2ZIFA 5KU7A 1BWPA 1Z36A 1G9SA 1MABA 1TOAA 2C88A 1T24A 1USKA 1X92A 2FZWA 2RJOA 1S3SA 2VF2A 2AJBA 1U8CB 3AETA 4IJUA 4X41A 4BE9A 5JSZB 3ISJA 1BS9A 1JWBB 1R10A 3SMQA 3K9CA 4CM4B 2RAFA 4I4CA 4TUYA 4U3JA 1M8FA 3O3MB 5TMBA 5FWNA 3SS7X 2DPHA 2I76A 3S81A 1E5QA 3ZK9A 4G0NA 1EXNA 4YP6A 2QQGA 3BAFA 5EWLB 2QNIA 3GFFA 2CWWA 2JHAA 3FJ1A 1QE3A 5C1BA 3W9SA 1WDTA 4JUBA 4OI4A 3D3JA 2QORA 3QELA 4BBZA 3NTRA 2GZSA 1PL0A 1AUVA 4LC1A 4NZYA 3VO8A 5EVCA 2BE9A 4DY4A 3WLPA 3E2MA 4RD2A 1ZD8A 5B1IA 4AP6A 3TRDA 1UPBA 1GEEA 4NPHA 5KINB 4KZKA 3W90A 2R1UA 2ZE8A 2A3NA 2NU8B 3KPUA 1LCIA 4CODB 3ANMA 2YFHA 1F8GA 2L2QA 2QIOA 4IOJA 1UP6A 2ZZKA 1Y9EA 3NHZA 1YC2A 3SYLA 2XUQA 4BKOA 5HNKA 1LW6E 2O8NA 3LUJA 2D5AA 3GRRA 4PHFA 1NI4A 3H9CA 3KQSA 4KXNA 4ZQCB 1I7QB 3T3EA 2GPYA 3QBEA 4HDSB 4G56A 3LDFA 2VAPA 3Q1LA 1D0SA 4TMWA 2WD7A 2AVNA 2PLNA 2Z5GA 3D4LA 2WMYA 4GSKA 1WQ4A 1YB6A 3F2VA 3IEUA 3E81A 1CY2A 1WB4A 5DN6A 4D9EA 4YMHA 2XUAA 2RKOA 3QKSA 4QRHA 4X7RA 4BQNA 1ML4A 4S12A 1GQ2A 3C43A 3MBIA 1E66A 4J2TA 4HJXA 4ZYYA 1H2WA 2ERXA 2GBLA 2DKNA 3ANSA 3Q88A 2VYND 2SECE 5IFLA 1XZHA 5I7UA 3WGHA 4Z7JA 4WKCA 5DTEA 3TFOA 4FLEA 2W2VA 3V4FA 1ATIA 3WHKA 1EVIA 1HE2A 2IXAA 1PTJC 1U0FA 1XGKA 1JE1A 2Y4OA 1VHWA 1XD2B 3CUVA 4DABA 5AIBA 3COJA 3LUPA 4LGYA 5KOYA 3F78A 2VYCA 4M9CA 2K4MA 3A6KA 2ZS9A 4B4WA 4BPRA 3FLMA 4QTZA 2GRJA 1VSVA 1H8EA 3EPLA 2RHJA 1TC1A 4W99A 4MUJA 2CZCA 2NXEA 1OKKA 4CG0A 1MOZA 3ETJA 1CDEA 3WICA 5CXQA 4E5YA 2JDID 3EF3A 4F4CA 2WIGA 1OA1A 3GJ7A 3AWIA 3HB4X 1IDN1 3NHPA 3IE1A 1VL2A 3PDIA 1RCFA 1P31A 4HSEA 3RNOA 1P7ZA 2FKAA 1CVRA 2OV6A 3B1JA 3KPVA 1KFCB 2BW0A 4Z99A 1R2QA 4AC9A 1S2DA 4WY2A 5ES3A 4LOAA 1PK8A 2KM1A 3OUZA 1QANA 1BNCA 5EP4A 1WY7A 3KJFA 2YICA 2DHRA 2OVBA 5H4GA 5GINE 2R00A 5K01A 3MJHA 2ZIZA 2OV1A 4TQAA 1V7ZA 4RS4A 1DSSG 4GI5A 4K7JA 4UBMA 5JC8A 4R68A 4HDCA 3JVUA 2PUFA 4C2UA 5DTIA 5IC4A 3UGQA 4KDRA 3VI3B 2MR5A 4ZHQA 4HQLA 2O0MA 3UPUA 1M34E 2R1TA 3E9MA 3FWZA 3MTIA 4K9QA 1U7WA 1UKAA 4PRLA 2W71A 2V9CA 5F52A 3ZD9A 4GZMA 3SWWA 1CRPA 4ZYZA 4CHGA 4HGNA 5HDBB 1GFWA 1SJ9A 4G5FA 5ALQA 2L0XA 3VPCA 5HKBA 4Z4IA 2GZRA 3SVZA 2RHHA 3QTLA 1IAQA 5LKAA 4N5DA 2IY8A 3VR6A 3H75A 1JHQA 2AZTA 4LZOA 3FOZA 2VSFA 4KDCA 5IYZB 5FAKA 1EFRD 4P54A 3VHXB 5C7IO 5TVGA 5E4TA 2EWMA 1IWOA 2W2QA 1YR3A 4LJSA 2UXDB 4QUKA 8ABPA 4EFMA 1V3VA 2ECPA 1O89A 2QD4A 2WVJA 3DJYA 3QPWA 2VT7A 3YASA 4A73A 1OYOA 3O7WA 4XWOA 1FC0A 2AA3A 1SVKA 4U9UA 4ZGGA 3KEFA 1RDFA 2B34A 1ZK3A 1G60A 2RHRA 3KDAA 4OMFG 4YPVA 2Q28A 1MXFA 1ZX1A 1UODA 1VC2A 4I9NA 4C0SA 2GTIA 4LOHA 4EW2A 4EYGA 1MVNA 4FB4A 4OXKA 4V2UA 1ZWKA 4MS4B 1L9XA 2ZJ7A 3ZW7A 2HSJA 1QTIA 1M6HA 1R74A 2FLKA 3IAS1 2GHRA 1UDXA 2I3AA 1VBNA 3KJHA 3QPDA 1KPGA 2Q3EA 2B7BA 5DU2A 1WZIA 3OE1A 1QYIA 3D7NA 4YGXB 5IAGA 3EFEA 3PXAA 5C7OO 5JZSA 3ZWVA 1BTOA 3E4CA 4G0QA 3V3KA 1ACMA 4G1FA 5FI3A 2C98A 2FE1A 1X14A 4Q4DA 2H85A 1UJ5A 3TTSA 3DFUA 4XVQA 2UZ3A 4DCPA 4J1QA 4ER5A 4X93A 3PQ8A 1D2EA 2ZOSA 5HZGA 2AMFA 1QRSA 1A2BA 1KZGB 3LDUA 4HCJA 3CH6A 1Z39A 1U7TA 5HCUA 1UPAA 4RK0A 3LNCA 4JLVA 5TGTA 3FOFC 1LS6A 2G04A 3F5SA 3GV0A 5K3CA 4G85A 4U7DA 1LWNA 3FVQA 4FBGA 3I30X 4OGGA 1WHSA 4XPIA 4FONA 3LTNC 3IP8A 2EZUA 4MVJI 4A0GA 2VUHB 1GZ7A 1F6DA 4OB6A 2QRVB 4ONEA 4UVIA 1OMOA 5DF1A 4A0HA 1B8NA 3W3AH 4F84A 3GO4A 3NOQA 2ZYTX 1R3UA 2BFPA 1PAUA 1YDHA 1ONPA 1IM2A 4MVCA 3EA0A 4NV0A 4QUDA 3A6HA 4ZC8A 2VT6A 2CLDX 2D2FA 3DL2A 2CUKA 3ONVA 3WRVA 3RU7A 1B74A 3WWZA 3HCAA 2ACEA 2Q5OA 4BYMA 5KC8A 4TTRA 4M0LA 5KDDA 1O87A 3HI6A 2WIDA 4A0RA 3E6AA 2TRSB 2B8JA 1BE1A 3JQRA 3H1EA 4J7XA 1ZJZA 3FW1A 4ND5A 4O3MA 2BBWA 2P1RA 4GNRA 4AG3A 1R4MA 2VDMB 3AR4A 4HGQA 1BXGB 2N47A 4RHCA 1HQKA 4CM1A 1KJNA 1V39A 2O8EA 1RABA 1JR3E 4OP3A 5JALA 1WXWA 2C2BA 3I9FA 4KN5A 2FSPA 5ALEA 5HIKA 5DWQA 5I7VA 1WMBA 3IQEA 2V3VA 2CVZA 5FR2A 2AG8A 4HSGA 3DLHA 4L08A 3OCZA 2BBSA 1MRNA 4KLRA 2TMYA 2VCEA 1CNFA 1D09A 1FMLA 5EE9A 4RENA 3OETA 1PJSA 3LQQA 4EWLA 3EFOA 3NT2A 3RS8A 3FM9A 3PEEA 4IUCS 1L4YA 4NICA 1C30A 5JCOC 2YJTD 1DX6A 1RQGA 4DV7B 2Q3JA 2R7AA 1U2EA 5CLQA 4AN0A 5LP1A 4TKVA 3WWCA 2X5XA 2GCPA 3SEAA 1QYCA 4Q93A 4GYYA 3HEAA 4CW7A 3TJRA 2JGAA 1WXIA 1EHIA 1X1DA 2ZVDA 3IKLA 4MAMA 4MOWA 3GPIA 4RM2A 4U7JA 4F4FA 2E4AA 4OREX 3S55A 5BUSA 5IJ9A 1PD0A 1YL6A 5FLKA 5A5EA 2R96A 4TKLA 3A2KA 2WYHA 5FIUA 1DBWA 4JU8A 4AZVA 4TYNA 2HZ7A 6CHYA 3DV0A 1T91A 2X4GA 3FHOA 3O8OB 4L1KA 3ITEA 1GZ5A 4IGEA 4UBOA 2FRVA 1BO6A 5A5DA 3PX3A 3KVYA 1NLUA 3D3EA 3LXUX 4NAUA 4NG4A 3C8ZA 3C3EA 1X86B 3HVHA 4G23A 4L8WB 4UATA 4KXXA 3VHQA 1NZDA 2VP4A 1M0SA 1ADGA 1A4UA 1UFOA 3E9ZA 3RJ9A 5FLYA 2FX5A 3TW0A 5EY5B 3BJRA 3ZW9A 4WWHA 3LKVA 3EG5A 2PT5A 1DEXA 1DDOA 3QXSA 2PA0A 1E3IA 1HT1E 3MT0A 3OPQA 2PR7A 4KB5A 2DR0A 3D8BA 3FPLA 4IV5A 3W04A 1URPA 3B38A 2VA9A 2RGCA 4Q7QA 2ZR9A 4KG7A 5BMOA 3JYHA 1NURA 2PNJA 2ORWA 4C0JA 5KTYA 2Z1DA 1JT2A 4JLJA 4RMGA 1HV8A 1XJQA 3B60A 4JI2B 4R05A 1RJFA 5IBRA 1IHXA 4IS2A 1NJ5A 4M1YA 4RULA 3DDUA 4OYLA 2NT3A 1E1RA 2ZSEA 2O05A 4H17A 4KKXB 3ZKWB 2J87A 4MVJH 5I7AA 5BR4A 3KV1A 3HB5X 2LCFA 4QUBA 3QA3E 4C29A 4AURA 5I9IA 1JIJA 2Q6IA 3D8UA 4C7VA 3IUPA 4GEGA 1ZSNA 2FI1A 2WU3A 5FHQA 3A0RB 5FI5A 2FEKA 1NP6A 4LDRA 4F6LA 1T25A 3ED1A 3MWFA 3ZCRA 3KAJA 4W8GA 3PGJA 3PC8A 4WZBE 3DB2A 4BMPB 4X61A 3VPDA 4NBVA 1VMAA 3IVAA 1JVNA 2XDAA 3HJTA 5FQNA 4HDNA 3FTEA 1NA5A 1PLJA 5KNDD 2EX0A 1D04A 4IINA 3EPHA 1K9VF 1VLZA 4NAVA 3KK0A 4P58A 1TUGA 3O9ZA 2ZBUA 3VH4A 3HL4A 4LNUB 4V1CI 2CE7A 4TL6A 2ZJOA 4DLPA 3C1AA 1J2RA 3OLQA 4U2EA 5F64A 4EGAA 1TM7E 5CHYA 1SOVA 1NRXA 4G9EA 1VE9A 1NJ1A 2FU5C 1YDMA 2P77A 4ZHSA 1COZA 2UZIR 2FFJA 4DA4A 2GUGA 1TUBB 2OY0A 2YIMA 4JYPA 1IXYA 1W36B 3M6XA 4DHEA 1RAIA 4W7IA 1L8XA 2F9LA 1WF6A 3EYAA 4L9AA 2HJ9A 1J8DA 3NBXX 2PUTA 5LMNB 2PJRA 3IJ5A 4MWGA 1N36B 1MPTA 2X4LA 2XEDA 3B6ZA 3VOBA 5AM3A 3NO4A 5C80A 2O7VA 2BKAA 2GZDA 1L4NA 3DM9B 1HFJA 1PWHA 3CWZA 1F8XA 5E4JA 4MB2A 4Z54A 1SBYA 2OOKA 2JK0A 4MUFA 4BNDB 1BWRA 3ITKA 2XIQA 3V55A 4B6FA 2AFHE 1SC6A 3CGGA 1VBFA 3AHGA 1OB2A 2CUZA 2C1ZA 1V6AA 3ZHVA 4EITA 4ZYXA 1NRJB 9GPBA 1C2TA 2BRUA 1XC7A 4BVEA 3S8YA 3IP3A 2YYSA 1ML3A 3DKVA 4LFBB 3M0EA 1V0JA 2DHQA 3IMKA 2CYCA 4TS9A 3OSUA 2IUSA 3ZK7A 2BAGA 4MS1A 1JU4A 1YQDA 4YRZA 2CEKA 1Z75A 5JJCA 3BXGA 1VKRA 2IT1A 3GNSA 5B6IA 4UXJA 2BYTA 2CHQA 3Q8WA 2VJQA 4BLSA 2EGUA 2PLRA 2X8BA 2VJAA 3BDIA 4CEJA 3I6MA 4XAQA 2YWRA 1C7JA 1ZM7A 4I3FA 2O20A 3WMEA 2VJCA 3CEPB 3QVXA 3KV3O 3L5OA 4BVAA 1PX2A 1A4IA 3H8SA 4DMHA 2W42A 2JAUA 3E7PA 1QIMA 5FWDA 3W2TA 1BXRA 4RFSB 4TMVA 4MAFA 2N42A 1JGTA 2VHCA 3LHKA 4GVPA 4KN9S 2AQ8A 4QDTA 2DVMA 2HFJA 3GJXC 3H5NA 3MG9A 2AN1A 3MNFA 4JOQA 4MV9A 3TEJA 3VM6A 4UTOA 4AJ4A 1MOQA 2OXFA 3OJXA 1ZZGA 1GEGA 2JW5A 1G21B 3ENKA 4KQKA 2QI9C 1CQJB 1Q1GA 5C8YF 4FGUA 4WN9B 1DBVO 2JFYA 2YHAA 3P9PA 1AGRA 3PFCA 3SQMA 1E5VA 2XSZA 4MS3A 1JKXA 3DKRA 3GJ6A 2DBYA 4OD0A 3JQFC 5FOSA 1N9GA 3UJPA 3PHLA 4J9VA 3T95A 5K4AA 3PCTA 2Y92A 4G09A 4MV5A 1CYDA 1GL7A 5KHLB 1IHPA 2XZTA 1S9HA 1KO1A 4JK3A 3EGIA 3L8FA 5LYYA 2UU9B 1Q15A 2XWPA 3MWDA 4WNYA 1GZDA 1KRWA 4ZZ0A 3ZH9B 1LRKA 2DP4E 4FZ3A 4L8LA 5ETJA 4D9BA 3GDOA 1VJTA 3QH4A 1UBCA 1ZN7A 2J7PA 4NTZA 4HYTA 2PS3A 2M6LA 4Z3DA 1P8AA 1AHIA 2QLBA 1HT2E 2IOQA 4Q3KA 1PR9A 3GH3A 3PXEA 3UWKA 2V97A 1FEZA 1C1XB 1P8JA 1TK2A 2LWIA 4M9UA 3MJSA 4X1YA 2RGNA 4AFNA 2I91A 1C9DB 2XPCA 4YQYA 1BXRB 2CBGA 3A9SA 4RFSA 3H97A 2A5GA 2NLOA 2WW8A 2VEDA 2YWJA 2WEKA 5JVDA 5DHAA 3EQ2A 1GGEA 4MV6A 3SS9X 5KQLA 3OJEA 1XOIA 2AR9A 3ODPA 4UHJA 1QG4A 2E4UA 4RANA 5KHAA 1PT6A 4EYSA 4AUEA 2CMKA 4IYJA 4B2IA 5LSAA 4TSKA 4OOEA 1QYRA 4E30A 1M72A 4RS3A 1X7ZA 3SP1A 1PSWA 3H1AA 2WFLA 2RGYA 4NRDA 4M55A 3WAKA 4ESOA 1W94A 4JYZA 2FFQA 3PGXA 3ZY5A 1JEDA 3DJFA 3C16C 2G9ZA 1ICIA 2CW5A 3K0AB 4RHEA 5FO0A 4BO5A 1E9CA 4OK5A 4D9CA 2G80A 5JPIA 2L17A 3FGOA 3G2HA 4PNEA 3OT1A 4U8HA 1OBVA 2J7PD 1JB9A 2DECA 4TTSA 3UAXA 4B43A 4HVCA 2QD2A 3RIYA 5AI4A 5ECGC 1T6NA 3GRCA 3HJFA 2FWIA 2AE2A 4OFBA 1I6KA 1VLLA 4DQ0A 4CFYA 4EPWA 3ZHTA 3ILXA 3H1BA 3HDQA 4HRYA 7AT1A 4H7EA 3RO7A 3RYTC 1JQ5A 3AX6A 4EPRA 1ENOA 3HABA 1PSDA 2G09A 3ZWWA 2QLFA 3RUCA 3V4SA 4XWKA 3VU8A 4TS4A 1OIWA 2YRWA 4TYYA 3GA5A 1UOQA 3ZKWA 5JNSA 2IF2A 2CMGA 2FQYA 1UDRA 2FQQA 3IULA 3F4KA 4UZSA 5AKGA 3VDNB 4AX4A 1QHXA 4HKTA 1KRXA 3RJZA 13PKA 1KKUA 2OPBA 4D81A 1ZH0A 3A27A 1VMEA 4L9SA 3SICE 1EBBA 2CNWD 3DZFA 4RVHA 1VB5A 1ZVJA 1NF2A 1SUIA 2ES4A 1KDZA 2QTVB 4GI1A 1P72A 5E0OA 4GRIA 1RQNA 2R68A 3RS7A 4AMGA 3H1GA 3I6YA 2ZUBA 5DYIA 4DEXA 2VYFA 2JJ1A 4TSRA 1AUQA 3N2EA 5IK2A 5B7GA 1RT9A 4P92A 2GDJA 1VDMA 3TKAA 4C30A 1IEXA 3WKEA 1IIRA 1ZN8A 1DXHA 1LPNA 4H60A 1EXVA 3WNZA 1CKEA 2IU3A 1TPZA 1FJ2A 1E98A 2ZJBA 4D57A 2Z6QA 4ZO7A 5C4IA 4HBGA 3LVQE 2P30A 1GAEO 1H9BA 1Y37A 5ELLA 1UCFA 1XALA 3DDWA 4JP3A 3NEJA 4L76A 4MH0R 2JGFA 4OHRA 4W1RA 3WJAA 1UDBA 4A0QA 1Y0BA 4F3NA 5JIBA 3IR6A 2I22A 5A9SA 2VJPA 1V9CA 4WA7A 3AYXB 1MHPA 1W1UA 3JPWA 4H6VA 1JJVA 1PJAA 3MUNA 4IF6A 1R4NB 3AF2A 2Q2WA 2QTHA 4I4TB 1RYFA 2V8BA 3ABIA 3NHJA 4GX0A 4C4PA 4WACA 5K0NA 2PUJA 1GR1A 3T7KA 1MIOA 5D3ZA 5KEIA 1D6JA 1PW7A 2E89A 5EE0A 2XNHA 3N0VA 4PSVA 3R4CA 4HWSA 4YRGA 3WYAA 5HPYB 1R27A 2X13A 3VNAA 1OB5A 2JLSA 5TPWA 1MEJA 1WVMA 4ARUA 2NPIA 2NV2B 2NU9A 3V8QA 1QFYA 3QU9A 5I5GA 2BEJA 4FE7A 4C06A 5ITWA 5JXJA 4WFQA 1QQBA 1XJ5A 3VC7A 1YASA 4O2AB 2PMEA 3Q85A 3TEMA 5SV2A 4QTYA 2G5GX 2XUIA 4URFA 4FGLA 3DLTA 3A6FA 3P0HA 2CZGA 3AU9A 1GZUA 1LSJA 2CVFA 3MWGA 5EWMB 4AAYA 1ZJ4A 2B5WA 3OG9A 1EK5A 3LY8A 3MWLA 1I7LA 3I9OA 3ND6A 5L3RA 4ER0A 1JL3A 2GPBA 4GG1A 4RSHA 5CU7A 5DNVA 4CGYA 4BEBA 1BOFA 1GM5A 1YOVB 1M2EA 2PKXA 4GR9A 2X0RA 4KTTE 4UHCA 1X3SA 1U7HA 1UKYA 4MITA 3ZJUA 4WJZA 2BUAA 2GBGA 2Q1XA 1P1KA 4MQ5A 4F85A 5K8IA 1XDGA 1GGVA 3CG0A 5A1JA 1O6FA 1ZI6A 2HIGA 5AJWA 3FCYA 1XZCA 2YJGA 2WAMA 3QPAA 3ZE7A 3E8SA 5MFZA 3M70A 4EVRA 1KXJA 4RA6A 4LY6A 2ONZA 5GY7A 1SKYB 3V4PB 1BKSB 4I1OA 5AI9A 4ZQIA 3KTFA 3U7EB 4L74A 3AHJA 2UAGA 1OXBB 2Y9MB 3BJIC 4G1UC 1J1ZA 1B6TA 3LVRE 2PPLA 1ISJA 3O91A 4ZVVA 2W6ID 5FBRB 3ADKA 4PO1A 3RGGA 2WHXA 2FZ4A 1DXQA 4N40A 1LNSA 1ZN9A 2M9MA 2R85A 4HXFB 4R8SA 2PUCA 5KNBA 1U2GA 3RK1A 4EYQA 1DV2A 2YQZA 3OOSA 5ENDA 2W70A 3VKWA 4AKSA 1JWAB 1EM8B 2I55A 4H7DA 1FK8A 1L5QA 2X15A 4NF2A 2WUDA 1AQLA 4Q4JA 3LPNA 1W4CA 5CMLA 3STXA 5I9NA 2XTNA 2VA8A 4F3TA 2FPIB 3PKZA 4TGLA 1PBNA 3TPFA 1F0KA 1MTOA 4GT1A 1IN4A 4E22A 2RHOA 4C6RA 3I1IA 4RZSA 4KR6A 2WMOB 3BX1A 4HNGA 2V4MA 3CNNA 3G88A 3OQJA 1RZ3A 2QJWA 4FDAA 5K0BA 1ZZEA 1AJEA 3CLTD 5I4IA 1C7ZA 3CSUA 1INLA 1JA1A 4TQUS 3ILHA 4M1TA 3WV4A 2PSFA 2XGMA 2V6FA 1TQDA 3FOCA 1CEQA 2ZBEA 1PFYA 3KG2A 2H11A 4MQFB 1BFDA 4HDMA 1IQPA 3T15A 3T35A 4RA6B 3WGNA 4ITRC 5B7PA 1WTAA 1PDOA 3BWXA 3U31A 5BR1A 2EKPA 5KWVA 1WXDA 2R751 3WLRA 4PAWA 3NHSA 3MSCA 2QXUA 1RI5A 4TLEA 5B64A 1S2NA 2C9DA 4R40A 2ZBQA 3ET4A 4MMYB 1Y6GA 3V4OA 3BUSA 2WJHA 5T6BA 4WSOA 2BFEB 5KVQA 3HADA 1G41A 1Z4QA 3S6JA 1E9VA 1K7XB 1TMGE 5SY9A 4D9KA 4ZMRA 1ILEA 4F1JA 5LA6A 3RUFA 3WZ2A 2JI9A 1UM8A 3I2FA 2P1DA 3L7OA 3TF5A 2XMQA 4DS3A 2PUDA 4PZAA 4HFJA 4G1MB 5B4VA 4LS3A 4LWOA 5U9CA 5F98A 3DOIA 3DEJA 3EZ2A 4V0KA 2R87A 1G1AA 1ZRNA 5J63A 1A4RA 1LZKA 1JV2B 2N1BA 4LV5B 1MC1A 5JRDS 1M33A 4D56A 5JVDF 4H3KB 3HU3A 4ZCMA 4CE6A 2O59A 1JJBA 3H4IA 2OO5C 1E0SA 1X1CA 3TCKA 4RYLA 3TVYA 4EPXA 3U44A 4WADA 1IN1A 1CIJA 1P5HA 3NGXA 1RYMA 5LBTA 2OBNA 1RACA 2GPWA 4C43A 1E6LA 3AUTA 1SVIA 2ORYA 1TVKA 2W4MA 3DFKA 1LK0A 3R0IA 4PC7A 3T41A 3HJCA 2YJ3A 2QS9A 4LHZA 4WGGA 3F6BX 1ZNZA 2HGZA 3GRYA 2AFIB 1SQ0A 1XL1A 2B30A 4X00A 3N0RA 2VXOA 3PK0A 4Q7EA 1CFZA 3ORFA 4TVSA 3WSTA 1BMFD 1H8HA 2JFVA 2Z2IA 5PNTA 1WZEA 2JBAB 1T8YA 3LLUA 1AC5A 2V7UA 2IK8A 3P45A 2J09A 3NVMB 5BN3B 1G20E 2Z08A 2ZTVA 1UT5A 2VAWA 3WADA 1G7SA 1KO5A 1WY5A 1E3WA 1ZUD1 1OILA 2B69A 1SPBS 2LNDA 4C3OB 2NXJA 1JXMA 3TRHA 4IDGA 2WMNB 4PICA 4LZAA 1YS2X 3JQDA 4P9NA 3TSYA 2DWCA 1IBSA 1K75A 2WAAA 3HSYA 4B2PA 1GDDA 1NUQA 4IUYA 1RQRA 3JD4A 3QE9Y 3ZX4A 4CUZA 1IJFA 2Q8NA 1NT4A 3IEIA 5DYWA 5AR1A 1W5TA 3C24A 3IEXA 4FVTA 3MWJA 2H1OA 2YFKA 4HGZA 1KYYA 1KI6A 4LJYA 1JR3A 4CIXA 5JNTA 3K9GA 1WW2A 1W5EA 1BW9B 5HQ3B 2XBLA 1Q2XA 2H2GA 1A2QA 3CH5A 4GOXA 2VKTA 2PZFA 1VHDA 2QIPA 5HKKA 1VIDA 3OC6A 1SG0A 3AV3A 3KVOA 3L01A 3LFUA 2NPFA 2V7PA 1U3VA 1K4MA 2H18A 2PXHA 1R9NA 1DFIA 3FTPA 2AR7A 2EGGA 3GK3A 3G5AA 1JZSA 1QNFA 1U2QA 5CEFA 2PWZA 4ZQFA 5EESA 2ETXA 2EIHA 5JLJA 3OLYA 2WU1A 1D5WA 2I4LA 2X1LA 1Q12A 3PFKA 4FEEA 4RC9A 3TNJA 2GNOA 4F2PA 4BGDA 2GCEA 4CMGA 1QPZA 3RBVA 2JFBA 1MXHA 3E9EA 2X2OA 2VXCA 1IVNA 4YUYA 4NU0A 2NQ8A 3HFRA 2GXUA 4FLFA 4M53A 3LVFO 3EDQA 4XVHA 4JR2A 3U3OA 5JMWA 4FEGA 3NAMA 3GFVA 1PHRA 2HOQA 4XUDA 3SJBA 5JI3E 3BXHA 4PSUA 5L95A 4QPDA 4H16A 1VBKA 4AZTA 4LRQA 5LVAA 2ID7A 4FIDA 4ZKEA 1NU6A 4I4LA 4NVRA 3EIHA 3WJ7A 1HTTA 1PNTA 1TX4B 2Y0BA 3MA0A 2OV3A 3MW8A 4K40A 1OGIA 2YUIA 3I6ZA 1RKUA 1LW7A 2ADFA 1R64A 1LTHR 2L42A 4LC9A 3VI4B 3L4JA 3KXIA 2IS6A 4P33A 2P67A 5HXAA 5JATA 3G0IA 4ZU3A 4WDRA 2B4AA 1NNLA 3AXSA 3B53X 2CWDA 3AR8A 2A1UB 2YJ5A 3CPHA 3OZFA 4J0EA 5FPKA 2BEVB 3G9TA 3OCJA 5DB4A 4BKRA 3J81k 4MICA 1ZUWA 1R0RE 4YAOA 1T2DA 3B6KA 3X2EA 3O73A 2CJPA