3NBAA

Phosphopantetheine adenylyltranferase from mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (ampcpp)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
156
Chain Sequence
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic, thermodynamic, and structural insight into the mechanism of phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 52
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nbaA00
3N2YA 3ZXIA 5TS2A 2A84A 4YP5A 3GLVA 3FETA 1JIIA 1WXHA 2B7LA 3KT3A 2CYAA 3PNVA 4ZT5A 1IH8A 3G6KA 1XNHA 3H9CA 2QJTA 3ELBA 5HUJA 1O96B 3SZGA 1QTQA 2E0IA 1OWOA 3ZJVA 3CLRD 4FZJA 1R6UA 3TZLA 1BS2A 1EXDA 3AG5A 1J21A 3SEZA 3LE8A 1IVSA 5LM3A 1YUNA 3IH5A 1M8KA 3CLUD 4KR6A 1WXIA 2R5WA 2WSIA 1KP2A 2E21A 2IJGX 5HG0A 3F3MA 3IVCA 4HJRA 1N3LA 2YY5A 3G59A 2J08A 4MLPA 1J09A 4MW7A 4NDAA 3N8HA 1NUTA 2I1LA 4YP6A 5J59A 4MVYA 2X1LA 4ND6A 1KORA 3G5AA 3ZXSA 4EFKA 2NZ2A 2YWCA 1OWPA 2O8VA 4MUGA 2YWBA 3TS1A 4NZPA 1OWNA 2DPLA 4ZCQA 1O95C 3D6VA 4PY2A 1NZJA 1QU2A 1NYLA 2GKSA 4MUNA 1F7VA 3QTTA 1EUQA 4MW0A 3RK1A 3FWKA 4EG8A 1M1ZA 1KQOA 1U3DA 1G59A 1Q11A 1M8JA 4Q16A 4S1OA 3RBAA 3A05A 1F4LA 2OV4A 2RD2A 3CLRC 3RK0A 1QJCA 1J20A 4EG3A 3FIUA 4L2IB 1ZJWA 2A1TR 4F4HA 3COVA 1WJGA 3SDBA 4U8HA 3CVUA 1ILEA 3JXEA 4HPWA 4KPUA 4G5YA 4KKVA 4DJAA 4GU5A 2TS1A 1QRTA 1QRSA 1QNFA 3CVYA 3COWA 3DPIA 1D2RA 1ZUNA 5LLTA 2AKEA 3L92A 1TYBE 5TGTA 3FI0A 2ZUFA 1MOPA 4MULA 1SURA 1XNJA 3MXTA 1H1TA 3AIIA 4RPIA 1YUMA 4XFJA 3CVWA 1JEDA 1VL2A 4JYZA 3VGJA 4KPUB 1O95D 1V8FA 1JECA 2QTMA 4U7JA 2QUJA 4AQ7A 3A2KA 2J07A 3P0IA 3ZGZA 2PZAA 2CSXA 1KAMA 2G36A 1GZUA 3MLBA 2HGZA 4MW5A 4XSVA 3LCJA 4EG7A 4PBRA 1MC1A 4OUDA 2C5SA 3N05A 5KCMA 1T9GS 1ZH6A 4MQ6A 3H97A 3IVXA 1PG2A 3OTWA 2ZUEA 2AG6A 2JA2A 3FNRA 1X6VA 2YXNA 3IOBA 4DDKA 1KH1A 4I6EA 3HFJA 4YP7A 1JEEA 3AG6A 3KT8A 1GN8A 2A1UB 1OBHA 1J70A 3RFFA 1EJ2A 5IHXA 4GRIA 2J4DA 4MUEA 2QJOA 4G5FA 1N2JA 1JMVA 3C8ZA 3UC5A 1GTSA 4MWCA 2J5BA 3IDFA 1YI8A 1EUYA 3CVXA 1F7UA 4UZFA 3ZJUA 3X1MA 1T6ZA 3RHSA 3CA8A 3UOWA 3CLUC 4MAFA 3ND5A 1HYBA 3P0JA 1KP3A 1MB2A 5K0TA 2DLCX 4BWVA 3DO8A 2V0CA 3IMEA 1U0BB 3GMIA 3CLTD 4QREA 3QTBA 1PFUA 3N9IA 4R2LA 4E1AA 3DV2A 3IODA 3P52A 1K97A 1R6TA 2D13A 1G8GA 4ARCA 5H7XA 4KR7A 2Z09A 3CLSC 4F3RA 1QQTA 4EG4A 2DUMA 2QUIA 3PNYA 3INNA 3FHJA 3IOCA 2A7XA 1NI5A 5J5AA 3NV7A 3CVVA 2DR2A 2CYCA 1WQ4A 1NSYA 4J76A 3QE4A 4I6GA 5AHWA 2XRZA 2EL7A 1U7XA 4MW1A 4MWDA 4JFAA 3SZ3A 2GM3A 2PG3A 1N1DA 1GLNA 1NURA 2WB2A 1Q15A 3NBAA 4MUJA 1TYAE 3CLTC 3LOQA 1JIJA 1N2EA 4WSOA 4MWEA 4XFDA 4A91A 1TYCA 2PZ8A 1ZH0A 3H9BA 1P7PA 2PZBA 1FFYA 1KQPA 1KH3A 1KR2A 2NSYA 2EJCA 1K4MA 3HZRA 3FY4A 3CLSD 2A1UA 5DASA 3IVGA 3SP1A 4DLPA 4MUFA 1WXEA 3AL0C 5HUHA 4ZT6A 2QJFA 2A1TS 1YIAA 1MRZA 2D5BA 4UZEA 4OJMX 4WNYA 3MMXA 4JZYA 1JIKA 1MAUA 4MVWA 1OBCA 1EFPB 1M83A 2O5RA 1VBMA 4EGAA 5DEOA 1PG0A 3M5WA 4RUKA 3ZIUA 2A88A 3U1VA 5FO1A 5EKDA 1X8XA 1LW7A 4G6ZA 4NATA 4OUDB 2IELA 1Q19A 2PXHA 1NUQA 5TEWA 5IJXA 1OD6A 1B6TA 2H2AA 1JGTA 3OP1A 4MW2A 4AS1A 4HJXA 2XRYA 4HK4A 4DDHA 4CDMA 4TS1A 4EF6A 2X3FA 2Z3VA 4DE5A 1M8GA 2ZP1A 4QRDA 1IQUA 3PNBA 1KAQA 3Q4GA 2DXIA 3FOCA 1KH2A 3NBKA 2PFSA 4L2IA 4YBRA 3HGMA 3COYA 3VRHA 2PIDA 4JXZA 3TNJA 1OWMA 3TZEA 4QBTA 1K4KA 4K03A 1RQGA 1N2HA 5KWVA 2HZ7A 1MJHA 3Q12A 3X1KA 2CV2A 1IQ0A 1WXFA 1WZ2A 1YULA 1TQ8A 3ZUGA 1K92A 3MLAA 1O96A 5FO0A 4MW9A 2DERA 1J1UA 3HL4A 1UFVA 1O97C 4KR9A 1G8HA 3S3TA 3K32A 1VBNA 5J58A 1H3FA 2JAXA 3L93A 1JILA 1PFWA 2CFOA 1WY5A 4DNXA 1I6KA 1NUSA 4K0RA 4J75A 5FNZA 3P0HA 3X1JA 3D6UA 4ARIA 1TEZA 1U7DA 1FYDA 1NUUA 4EG1A 3ZJTA 4MVCA 4CDNA 1IQRA 4R0NA 1O94D 1XNGA 4U63A 1GPMA 2H29A 2AZXA 2X1MA 2GOYA 5TEVA 3AKZA 3DLAA 4ND7A 1F9AA 2IP1A 1LI7A 3IMCA 1U3CA 2RE8A 1N77A 1H3EA 4CQNA 4P2BA 1I6MA 2WQ6A 3IOEA 1O94C 3K9WA 1VBKA 4CT0A 2J09A 1XJQA 1WKBA 3MUEA 4EG5A 3I05A 2QTRA 1V47A 2QTNA 4YMIA 4MVXA 2VTBB 1EFVA 1R6XA 3HV0A 1O0BA 2CV0A 1T6YA 2Z08A 1O5TA 2OQ2A 1KQNA 1MAWA 4ZCTA 4PBTA 1O0CA 4ZT2A 2WQ7A 3AFHA 2E18A 3GUZA 3SEQA 1MBZA 1GTRA 3COZA 4R2MA 2A4MA 5F23A 1M8FA 1VLHA 1I6LA 4JXXA 4MUIA 3UMVA 1N2IA 3TQIA 4PBSA 2E89A 5K0SA 3KT6A 1EE1A 3UK2A 1JZQA 4MW4A 1OWLA 2D54A 1T6XA 3PXUA 1QU3A 5LFAA 3KFLA 1JHDA 4NX2A 4NAHA 1N75A 1Y42X 4MWBA 2CV1A 1ULHA 3ISJA 3IMGA 2DETA 1Q77A 3Q10A 5JBNA 2V0GA 5DK4A 3A04A 3SYTA 1IFXA 2CUZA 1N78A 1KKUA 4ZT7A 4MW6A 5DB4A 1TFUA 3BL5A 3UY4A 1A8HA 1EFVB 1MB9A 2CYBA 4X0EA 4ZCRA 3H99A 3ILVA 1I2DA 4I6JA 2X0KA 3CR8A 3RJZA 3IUBA 3ND6A 1NUPA 5BNZA 3FDXA 4DDMA 1CT9A 3KT0A 4EG6A 2CT8A 3H05A 1S4MA 2QUHA 3VU8A 1T9GR 1H3NA 1PFYA 3ND7A 3PRHA 4MUHA 4ZT3A 4NAUA 2VTBA 2QUKA 1N2GA 1COZA 1GAXA 1IHOA 4MUKA 2DEUA 2A86A 1EFPA 1O97D 3FG9A 1TYDE 3A4IA 1QRUA 3E27A 3FH0A 1O6BA 2JANA 1J1ZA 5H16A 1YIDA 1M8PA 3IUEA 1IRXA 4ZCPA 4ZCSA 1NP7A 1WOYA 4H3SA 4ZT4A 4Q93A 1N2OA 3TQOA 1WQ3A 1N2BA 5KHAA 3HMQA 1G8FA 1PFVA 1JZSA 1DNPA 2BTEA 2HMAA 1WXGA 2VXOA 1LI5A 2BYTA
chains in the Genus database with same CATH superfamily
3MERA 1IK4A 1WF6A 1UXJA 2C96A 2MCFA 1CUZA 5KDOA 4GVXA 5AVKA 2B7LA 1V5FA 4BO6A 3ADDA 3GJ0A 2FWIA 3AVWA 1RQPA 1ZM4A 1U2SA 4Y67A 4C4YA 2QJTA 2BUCA 3E9NA 2DBQA 1XVLA 5CB0A 2OXRA 5DWQA 4JXJA 4DIUA 2YYAA 3HXPA 4I1PA 4YR9A 2BFMA 3DXXA 1KVUA 4LVCA 1MQ8B 1GPBA 4OMUA 4BQIA 4AJKA 2Z3ZA 3IAAA 3LXRA 2IHBA 3WDKA 3L6CA 4XB6B 1YUNA 5G1PA 2V97A 3SZMA 4RVOA 3BG5A 4EJ2A 1QO0A 3A6GA 5EJ2A 4B82A 4KR6A 4WNAB 2C9BA 1UZMA 4H7PA 1RYNA 3FAZA 3ORRA 5A1TA 5B4VA 4PG7A 1CJUC 2EX0A 2WIAA 1WPRA 3A4VA 3G5TA 3OSUA 3RU7A 4HGYA 3HB9A 1N5MA 1E1RD 1RHKA 3UK6A 5B2FA 5JZMA 2Q4EA 5K4HA 2I1LA 2PFGA 3N07A 4OHBA 1YBFA 4TZ6A 3I9V6 4WACA 4MVJG 1RWMA 4AYTA 1Y8RB 3TLBA 2WTEA 3ET5A 3ZH2A 4ENRA 2LIPA 3BF7A 2RGYA 2G0AA 3IP5A 1WEHA 4MUGA 4XSGA 1BOFA 2A7QA 2UUCB 3C1UA 4DR2B 4ZDWA 3A7EA 1UDWA 4DMCA 2VSYA 4C6RA 1AQJA 3K5IA 2W6JD 3G82C 4YJ2B 5AK3A 5C7LO 4A4DA 3KCQA 3E5HA 1VJ5A 4JLBA 3SYRA 4OYLA 5E2BA 3A0RB 2O52A 3BB4A 1CKEA 5LWQA 4EG0A 3A10A 3KO8A 2AVDA 4JNKA 1ULBA 4PIMA 3IBSA 1U7TA 4P54A 1EWRA 3OPNA 4XQEA 3ZJ5A 1M1ZA 1Q1NA 2MSDB 3MT9A 4YWHA 3U37A 3TVDA 1LJUA 3ZE8A 5LP6C 3UIEA 3TL6A 2H2HA 2ZJ0A 4RLSA 1Q44A 3VH2A 3HH8A 1KRXA 1EQAA 2WU8A 3RFXA 1WHSA 3BULA 4ZKEA 1TW3A 4KIWA 4M0FA 1PZXA 4DAOA 2P6PA 2YVUA 4OTZA 3HVHA 1S8FA 3C3CA 1F8UA 1D04A 4XIYA 4YIHA 4KR2A 4D4IA 1GZ3A 1M6VB 2JFVA 5BVHB 4ZEVA 2O8BA 3QY9A 1YJ8A 1BA2A 4URXR 3AEZA 3KM0A 2R751 5ECWA 2FGKA 2NNWB 1ZVMA 4LFAB 5CHEA 1H9CA 2IDJA 2IDMA 1E2GA 3M2PA 4UTNA 4MOWA 1KFBB 3G9XA 4YCNA 1LB1B 5DBIA 4HUJA 3V1KA 2GXUA 3DOJA 3MT7A 2AHOA 2QTVA 3MT8A 4WW0A 4CM8B 2X8JA 4QATA 4K9LA 4PYJA 2HK8A 1I5RA 4HEQA 4TTSA 4HNGA 3OM8A 2D2EA 3U31A 3ZW8A 3ELYA 3OOYA 1ITZA 1O6CA 4KPUB 2J0SA 3AVXA 1KZHA 5I3CA 4OHUA 3R7WB 3PXCX 4XJTA 1KO4A 2I4LA 1A9YA 1C41A 1OFGA 4WOBA 3DUFB 3MLBA 4Y2VA 2CSXA 4CDRA 1HDEA 1X7ZB 2J4FA 3LCJA 3OPQA 3P9ZA 3IV9A 3WB1A 3OT4A 4LJYA 1BIFA 1T36A 3N6VA 1NAIA 1CQZA 1R9MA 1S2LA 3C70A 5CB6A 3QVGA 3EMKA 3O9ZA 2VS1A 3OEHA 3AEXA 2WWXA 3LC2O 2RIPA 5FB3A 4AN1A 4C6HA 2QL6A 4L4ZA 3AI2A 1JQ3A 4IRXA 2UXCB 1EWKA 4FK8A 2ZZKA 4YJGA 3RIHA 4JYBA 2IHZA 1G38A 4YPFA 2ZM6B 3H4MA 4U7WA 2UYOA 2ILTA 3ITNA 1H4VB 1HTBA 2IUEA 3WLKX 2LUOA 2H1CA 9LDTA 4O63O 1EVKA 1C4KA 2HRBA 4PNZA 2HHLA 4RHEA 1Z0AA 1KGSA 5JQGF 5A0TA 2J48A 3CWZA 2Q5JA 3SNKA 2GZDA 4EY4A 2O4UX 2VQ3A 1LGYA 1BWRA 4C7OA 1H66A 4JUAA 4E21A 3C3XA 3ZDCA 1DBRA 3BSYA 4RX1A 2FR0A 4D97A 1DQNA 3BICA 3GRFA 1ZM3A 2FZ5A 5GJVC 3VMFA 1NE7A 2Z8YA 5D3MA 1N5IA 1KZ6A 1WB4A 2ORVA 2EQBA 4ZDJA 3V4LA 1MB2A 1PD1A 3D3KA 2BDUA 1L5YA 4KEAA 3BD8A 4MQ5A 4C0KA 1FMJA 3L1UA 3WB9A 3CG4A 4JB8A 5FHQA 2NSHA 2Y0CA 5BN1A 2RG7A 1S3GA 5A02A 4JT8A 1P4RA 5FTNA 3QEBZ 1RQXA 3JTEA 4MKFA 4D56A 3BS4A 3GMIA 2X7JA 1ES9A 4YDQA 5AW4A 4DR5B 2X2FA 3BGWA 5FBWB 4B3FX 1EH5A 2GD2A 4KSYA 4WZBA 4DXAA 2B98A 4DGQA 1TECE 4MWGA 2VTVA 4MP8A 1VCMA 1ZH2A 1QR2A 2HQSA 4DM4A 4ARCA 3MJHA 3VPXA 4FCVA 3G17A 3B9BA 3LLVA 3QF4B 5DBFA 3SHWA 1E3WA 5J47A 3BXPA 1D4ZA 3HXTA 3PNYA 3SJAA 4BMDA 3R6TA 3HVRA 1KVRA 1ATIA 1Z7EA 2J9YB 3K0CC 4JLMA 3IOCA 4XPZA 5LNK6 3V1YA 1PDVA 1RPAA 3RYHA 3DF9A 1Y98A 1W34A 1MOZA 3K72B 1AF4A 1KZ9A 2WUEA 3NH6A 5IAEA 2UZ1A 3W5CA 3IKTA 4PEVA 1W29A 4NU6A 1BQ3A 4HNVA 3ENWA 3DEAA 4C76A 5I4KA 1KJZA 1YCGA 3TXXA 1VDMA 4IZ6A 5KVQA 9ABPA 5K6AA 2XZLA 2PAAA 4A8JC 4HDCA 1U8FO 1UC8A 4FMBB 1KK0A 2ID4A 3I2FA 4ZVNA 4BVJA 1KU6A 2EFEB 1TZJA 5AESA 1WKCA 4HSEA 1NR5A 2M1XA 2Z1DA 1IBMB 1HDIA 2XITA 3OA2A 2IPXA 4NFHA 2ZU6A 1NMXA 2FMTA 3N86A 4NZMA 4OHWA 3V8VA 3FTQA 5HR5A 2XMBA 1TJ5A 1W76A 3BGVA 4MWEA 5KQLA 9MHTA 1QPGA 3KU1A 2OV2A 2ZRPA 4ZQEA 5MGNA 3GLFB 1QX3A 3KJGA 3T1QA 2BLNA 1QOPB 5DN9A 3P5SA 5CM8B 1T9HA 3JR3A 1MNAA 5T5QA 2VN8A 3FY4A 3NHAA 5GWXA 4EI2A 5AVYA 1Y37A 5JNLA 1AKWA 3O0TA 3CFYA 4R9NA 3AKDA 1IK6A 3ZWYA 3ETLA 2JHGA 3H2GA 1KI3A 5C37A 1U8XX 4EB6B 5EVJA 1MJFA 3VKHA 2A1TS 3FWZA 4PPQA 1L4MA 1SXJC 4CEJB 1WMEA 2I2WA 3CRMA 3L0PA 3TLEA 3OEYA 4ESEA 5JZBA 1M2VB 3ZPXA 4ITVA 1H8HA 3BFPA 4MVWA 3EXIB 3LCRA 3LXXA 1NYRA 4JT2A 1KPHA 1ESDA 1OV6A 3SLGA 4BXOB 4YV2A 1US8B 2QQ0A 2QORA 2W2MA 3AUFA 3VHQA 2G9UA 4WXPA 1TMKA 4FDMA 4GPEA 3PQ5A 2Z5VA 4UFPA 1ZJZA 2AOVA 3Q9SA 4PLTA 1Z63A 3G5LA 4I5EA 5EEHA 5TEWA 4L9WA 1OD6A 2D7DA 5FLYA 2ZR7A 4LYAA 3C39A 3LYUA 3SCZA 2ZVPX 4TS1A 2P2LA 1YTLA 1NVGA 4XPIB 2PD4A 1ESEA 1QYIA 1IPHA 5CMLA 4R9VA 1R9GA 1UINA 4DPKA 2VTDA 3ZDDA 1P7VA 1U0SY 1U0TA 1ZHOA 2QW8A 1R0KA 3Q4GA 4R8VA 5AI9A 4O3FA 2DXIA 4CM9A 2DTEA 3CUSA 1ESZA 1G3MA 3SQOA 3MS2A 5P21A 4F93B 1BGWA 1EG2A 2PIDA 3OQIA 10MHA 1E6MA 3DTTA 3JQAA 3IXMA 3R3YA 1TEVA 2NU9B 4WN3A 3RNLA 1F0YA 7GPBA 2VJPA 4Y2HA 1LJ8A 3I2KA 4K03A 3S5JA 4MHSA 3V42A 1XZLA 3ZLJA 5LQJA 5KWVA 2AFVA 2CZGA 1SCDA 3FVRA 1JU3A 3UHAA 3BK2A 2B99A 2VPQA 2VEOA 4M9RA 4OL9A 4LBVA 4QDUA 2E55A 4Z9XA 3ZWKA 3ZZTA 4QWWA 5KYWA 1I1QB 1ZOPA 4FMDF 5M04A 5JPDA 4KPEC 1JI0A 1PEKE 3KLBA 4N82A 2FFJA 2HCTA 2OR3A 2VBIA 3TIVA 5JVDA 4MRNA 2DERA 3HL4A 2J33A 3KTDA 3OZCA 2Q1TA 3ER9A 4OHOA 4EB3A 3BFJA 1HA3A 4J0EA 5T4HA 1BZYA 1QFYA 2FRVA 2P27A 4KIGA 3LYAA 4HGZA 2OHGA 4RD1A 1E5QA 1RIIA 1X1RA 2V7GA 1GNSA 1UADA 2RHCA 4FYJA 4YYZA 3IAHA 4WNCA 5P8WA 1QOZA 3BD9A 4FR2A 1VHJA 1QDUA 1Z38A 1XZDA 2IY7A 2OM6A 2J3IA 4XCQA 4JWTA 3WLAA 3I9FA 3BSSA 3OIDA 2X5KO 2Q6KA 3VKVA 5EJ6A 3VR2D 3UFXA 1H2BA 2WHXA 1UT5A 2EARA 5AP9A 2HMWA 3UWMA 3MWDB 3KQKA 1FS6A 1O94D 3P27A 2WIKA 1N6PA 2IUUA 2NV0A 1Z6GA 1XK7A 2I6QA 4L22A 3HY4A 2PIAA 5KKAA 4DIDA 3AKZA 4URHA 2P90A 3LO5A 2H4ZA 4F3KA 1JSZA 1KSGA 2IUFA 3T3HA 3B82A 3VNVA 1OH7A 2VLBA 3EXHC 3ZK8A 1K7XB 1VBKA 1ND6A 1MOSA 1UT8A 2I71A 3EC1A 5IVPA 1N6NA 3CWQA 3I05A 1Y4DE 2QTRA 3R20A 4YK7A 4YMIA 5EGNA 1SC6A 2LRHA 1JBQA 4HWKA 1AO0A 5EKTA 1W0KD 4WLVA 2DWQA 5ICMA 1AUPA 2H9YA 2V4ZA 2FNAA 1ZGJA 1XXHB 3MQ2A 2OQ2A 1WZUA 3QSGA 3LUDA 1QZZA 1U8ZA 1ISHA 2X8LA 1Y3DE 2NO7A 2RH4A 4C01A 3TG8A 1G5HA 4IJKA 3EVAA 5HCUA 3STVA 4RKYA 4XDGA 2XRMA 3VPHA 1PEDA 2B21A 2A5DA 2VJMB 4O2AA 3ZR4B 4N3CA 3O8CA 3HN7A 1VLHA 1CWUA 4P1ZA 3DFFA 4WTOA 5JMOA 4ENUA 2LNDA 1YGYA 2PZMA 4O4HB 4HNRA 2MSLA 3P9CA 3GCDA 3A4MA 5I7EA 3L6BA 3VM6A 4LC0A 2ATCA 4GYJA 2ZT5A 2PX0A 4CF6A 2VPYA 1EGAA 5LIRA 3RBXA 2OV8A 2WG2A 2ZFUA 1NMYA 1V41E 4JA0A 3H11A 5KX5B 5KIAA 2P2DA 1UK8A 2YOFA 4P7GA 2OXTA 1HE8B 4EKYA 3BWEA 2FEAA 3V55A 4D99A 1Z7WA 1E20A 3FJYA 1P5RA 2GPWA 3O8OA 3DBHB 3Q10A 1ULTA 3ZV6A 3D02A 3E1KA 2PKWA 3UAXA 3GNQA 1Z7YA 3SHQA 4A16A 3H2HA 1JH8A 1YF3A 4P5DA 4BGIA 1G6KA 4HQFA 2G5CA 1FYVA 2C98A 5FPKA 7MHTA 3G7SA 1TFUA 1XFAA 4D0LB 4M1TA 1LRJA 2Z56A 4G1MB 4X6LA 3JYHA 1GUZA 2GPTA 3V00A 3DPSA 1O03A 5BP7A 4B3RB 4JOCA 1PL8A 3U3DA 4YAIA 1TL7C 4ZMBA 2GR9A 4GBMA 1KJJA 3FPAA 3OURA 1DTEA 3FDFA 4QDJA 4MIOA 2UXDB 4GVPA 1ZVKA 1K6EA 2PKRA 4G3XA 2DE0X 4QC2A 3TEJA 4N9WA 5KMGB 5KTSA 2FSSA 3BQMB 5IXSA 1JXQA 4LJ9A 4PAGA 3OE5A 5L3QA 3W6OA 3N8GA 3HCNA 1T0UA 5AVUA 2HB6A 3MVEA 2H0QA 2XOKD 2XKKA 1GPH1 1IATA 2WJZB 3I5MA 3W3ZB 3QW4B 4DLYA 1VP3A 3RRBA 4CIXA 4PPYA 4FOSA 3QVJA 7YASA 1FQKA 2I8LA 4PYOA 3DHEA 3K31A 1R6VA 1O97D 1AQIA 1ZUNB 5AXBA 5B2EA 3GARA 5AKJA 2NXNA 4KV7A 1O6BA 4TKUA 5EXPA 4OP3A 3F7OA 1E59A 4YT4A 4OHYA 1KJ9A 4LF7B 1Z34A 2PUWA 5DM0A 2PGNA 1UXKA 4C0LA 4XQ9A 4QOFA 5JZSA 1TC1A 4H1TA 1XLTC 2C4WA 2ZS9A 2HF8A 2ZBRA 3BJZA 2BFOA 3EQ9A 2ZXEA 3N5CA 4H3SA 4JWKA 1NP3A 1BCSB 4M1YA 5ALKA 3STTA 3IRUA 2BJWA 1U98A 3KUKA 3LY5A 2GD1O 4QJBA 3G0BA 1T2FA 5G02A 4V3CA 1V7PC 2V7UA 1AKQA 3U40A 1BXGB 1G8FA 1LBIA 4I5DA 2V3WA 4TMFA 3L1VA 1JQBA 2HR1A 1AXRA 2WINI 1W5BA 1JQDA 1TQ4A 3R0VA 4JSRA 4L02A 4S2EA 4ZU6X 3TLZA 4XVQA 3CUKA 2C7VA 3D6NB 5KQPA 2ID9A 2QAGC 5C3MA 4WOCA 1P45A 4G5HA 4KFSA 1FYEA 3W34A 1XELA 3ZV3A 3TECE 1HC7A 2A30A 2IQ5A 2WHYA 2EP5A 3FCCA 3IA2A 1B00A 5CVDA 3T3MB 1M0SA 3FMVA 3HM2A 1NVFA 3PR2B 2IEBA 3ZHUA 3R6GA 4Q7MB 4UCQA 4WINA 2XHZA 1DRVA 3EZFA 2GHQA 3LRTA 2PKQP 4K9NA 1JKXA 1LY1A 2NT3A 2P9TA 3DVLA 2BCJQ 3A37A 2YUIA 3UJBA 4BV3A 3PC8A 4FOPA 3OZ7A 3IT2A 5IN5A 1REQA 5AVZA 4DILA 3DHWC 1DO2A 4K1XA 4NY1A 5B1DA 1AHPA 2H9IA 4H1WA 4Q37A 2F3UA 1XP8A 3PTAA 4N7RA 2A94A 3CO5A 3UWOA 2XB2A 2R6JA 3G0OA 3ZCVA 3GVCA 2RCYA 4ALLA 1MTOA 1SD2A 3O2NA 2VHVA 4M98A 4L6AA 1NUTA 2R47A 3NFYA 3RYIB 3DDZX 3LDUA 4YP6A 3W5VA 4FBLA 3JD2A 2P4EA 4BLOA 1VKZA 4Y2SA 2A5LA 4ZEOA 4B3JA 2ZUBA 4D5EA 3HM9A 4OM7A 2QX9A 3NVAA 5I9LA 1Y4ZA 3K3PA 3PNLA 5L7TA 5FLKA 8ADHA 1NC1A 4YMGA 1JVSA 4X7RA 4Z4CA 3KR9A 2SECE 1U80A 2NWQA 3OWHA 3Q11A 4FXPA 3R4VA 4J07A 4Q1AA 4RF2A 3T0FA 4MV8A 1Z0UA 4Q82A 4PFJA 1HT1E 2C78A 2D1RA 2O06A 1YZFA 3GRVA 4GNKA 4JC8A 4MW0A 4MV5A 2ZG6A 4ZPJA 3UWSA 4ZYWA 5KOJB 3NLLA 4Z4IA 1XVTA 3T1TA 3NHWA 2HY7A 1T1EA 1NN5A 4C88A 1M73E 4EH1A 4MQFB 2YZ2A 4GLJA 2YW9A 3L4BC 4H6WA 4MDHA 4IVRA 2AZ4A 1J7JA 1F8FA 1DAEA 1QNLA 1RPTA 1RTTA 2NO0A 4UEKA 2RBGA 3QVKA 1EQUA 5BQXA 1PTKA 2BDTA 3BSWA 4U5QA 4UOQA 2WSYB 3T4XA 3GMTA 3IA7A 4G4IA 4CMHA 1J20A 4YAKA 1PR0A 1RLJA 1U31A 2O2HA 2AC2A 3CPEA 2YV5A 4MPPA 3T15A 5IDXA 1W2GA 3KVOA 4JIMA 1OLSA 5FL7D 3SDBA 3V4RA 3JXEA 3TQTA 2FSIA 5AHXA 4Q4DA 2RBEA 3Q72A 2HT6A 2FLVA 3HN2A 2INGX 4A7PA 3C6MA 5LP6A 4CNBA 1Z8NA 2YV2A 2ZCUA 1K2WA 1C2YA 4M0LA 5A62A 1QGYA 5K0EA 2O8EB 1MOPA 3MFYA 4MVJF 3MRSA 5HE8A 2W42A 5AW8A 2FKNA 3TL3A 4N0PA 5GJWC 1YS9A 5CB8A 2VDMB 4IFEA 1EK0A 3GDOA 2FXVA 1OU0A 3M4YA 1BE6A 2KS6A 3WGQA 3EMDA 3C4QA 3HP4A 3I09A 3A4YA 1O95D 4J3FA 3H5OA 4ZAZA 1RBZA 1GEGA 1YBAA 3A3OA 4NCHA 2VDLB 1QHEA 3DTVB 3E70C 3GLHB 5EPEA 3CF6R 5E0OA 2PLNA 5HP4A 1II8A 3ILHA 4XSVA 4RY9A 4OQZA 3S8MA 1IUKA 2HXGA 3H2ZA 3IKJA 5SY6A 2R66A 3ZU2A 2XNJA 5LDDC 2J9FB 1NXWA 2I62A 1WIWA 2HIHA 4WLEA 4AY4A 3LD9A 2G3YA 2G83A 3ZHCA 4G0WA 3BEDA 4CLOA 1YS2X 4I4NA 3EIWA 3AI1A 2VZ0A 3UBTA 1BMTA 5JWOA 3Q8MA 3LW8A 4XLLA 4MKGA 1U4OA 3SWWA 1XU7A 2O2YA 3PFFA 3UAOA 3A2NA 3OMLA 4YRLA 3BMOA 3JYPA 4AMGA 4P0PB 1CVRA 2G0NA 4UUMA 2RHWA 4LF5B 1VB5A 5EE9A 1YB5A 1XALA 2GZSA 2F9LA 3FUVA 2J9ZB 4QOJA 3RAFC 2QHXA 1UAYA 4R9RA 4XCXA 1JH9A 1TVCA 1CQPA 2D2IA 2ZJ4A 1HZJA 3DL4A 2C07A 4P3NA 3WKCA 3VU9B 2B8JA 5K3BA 2EVWX 1LBQA 3O8LA 4YONB 2XIJA 1C1DA 1F7UA 1C4WA 3HUTA 4UDNA 3GQBA 2FQWA 5DHFA 2IH2A 3ISVA 4K6HA 3RHSA 3R1IA 2BONA 3UOWA 4BDTA 5JQGB 2OHJA 3PUWA 4PAMA 4RDHA 4IXDA 3IPCA 4JODA 3ZY4A 5NLLA 2FDCA 4NICA 2RARA 1KETA 1U28A 3P1JA 3UMJA 1DX9A 4K8OA 3M6LA 1KNXA 3Q6IA 4QSMA 1FSGA 4G0NA 2D8MA 3W79A 4MIEA 3WK6A 5KHLB 1WDTA 4DRXA 4JMPA 1CNFA 1I1HA 4RVHA 4O4IF 5E2IA 4LYHA 2XCOA 5E9JA 5ER9A 2BELA 4LHWA 1CRWG 4CKYA 3GLGB 2ZJ2A 3CH5A 2X9LA 3P52A 3T95A 3E5RA 3TLMA 4C7JA 4KR7A 1H0SA 5IBPA 3S2EA 2P7IA 3WBKA 4DCUA 1JHZA 1QGUB 5CNJA 1A4IA 3VPFA 3IVAA 3FHJA 1XQYA 3IP9A 1N2CB 4GOXA 4P4UA 1ZXXA 1LBTA 1HH4A 2ORYA 2ZIGA 4NEHB 1XZEA 3CWCA 4KACA 1UKAA 3QVLA 2RK6A 2FFHA 3WNCA 4FE7A 5IDQA 2FFAA 2CUKA 1CUVA 3I73A 4N5MA 2MINA 4QPNA 5AICA 1NSYA 4RVNA 3I92A 1OFHA 1L5SA 4CWAA 1WR8A 1H2AS 1XZ8A 3VNBA 3FFXA 2XRZA 4F5YA 3PDUA 1WB5A 1KI8A 4RY8A 1ZHHA 3AP3A 3WTBA 1J8YF 3HFGA 4MH0R 4R6XA 2HA4A 2WMDA 4GO1A 2OHOA 2YWDA 2RBKA 4PCAA 3LL4A 1U8CB 1GLNA 1JR2A 3SE0A 5DNDA 2VTEA 3U16A 1ZZGA 4MQFA 1NQXA 4Q3KA 4DKXA 1V1MA 5EP4A 2X7HA 3AR6A 3GGDA 4HFJA 5KTOA 3EA0A 2QM8A 1DIGA 1ISPA 1D6MA 2DGDA 1LK0A 1S3FA 1G9XA 3RIMA 1X8KA 3MJDA 2EAUA 2PLWA 1N34B 5DSZA 1P29A 2NSYA 1JN0A 1EUCA 1K6MA 5J63A 1GZSA 1C1XA 5GGXA 4OKIA 2D59A 1AK1A 3EZLA 1BKSB 3IR6A 3VU1A 2OUKA 3H8WA 5EIFA 1R4MA 5CAEB 2IHVA 2GN1A 3GFTA 3FSGA 3WQHA 5I5EA 4O2BB 6REQA 3QPBA 4XEHA 2PUEA 4NCAA 4LHXA 3TIGA 1CUHA 4M83A 5H0IA 1GV0A 3F78A 4UZEA 1W49A 3L1KA 4AX4A 1EM8A 1XVAA 1T0BA 2LV8A 1I2ZA 1MAUA 4QUKA 1OBCA 2FV8A 4LQ4A 2R2AA 3MUOA 5C5CA 1Q50A 4D0NA 1RC1A 5A04A 4MJ3A 5DEOA 3WWZA 3U4GA 4L3VA 3OC6A 5JECA 3UENA 2IU4A 1V11A 4NBTA 4Q12A 4CMEC 1AD2A 1PWZA 1P0QA 3PHCA 3VO2A 3ZZUA 5JZ9A 2FGJA 4LBWA 2RB4A 4PNPA 3JZAA 4DA7A 4HK4A 2W8BB 3GUCA 1WPGA 4ME6A 1VL6A 5IAJA 5TPWA 2P3OA 3SEAA 1ZOIA 4BLVA 4BVLA 3LY9A 4YCMA 2GM4A 4GP6A 1SHKA 1E89A 5JJBA 4E31A 1CULC 1W5FA 1A9RA 4EF5A 4F6RA 2YFHA 1Q1QA 2PUHA 1KAQA 3SLKA 4A1OA 4ALMA 4NG4A 2BHSA 2F00A 4IJ6A 3HGMA 1F8XA 1IONA 1NXXA 2H7CA 3GEBA 4WZAE 1CDZA 3JTMA 3L7CA 2YHAA 4JXZA 2V6JA 2ZRIA 4P92A 4Q19A 4R81A 5C18A 3DUWA 2IHJA 4TWAA 4J16A 2W4IA 2BFWA 2ONJA 3PEYA 2VQSA 4MICA 3SHOA 2CHFA 1YJAA 3RC1A 3PENA 4BV2A 3C7AA 3Q7RA 2OBFA 3FUCA 4OFBA 3H9JA 4OA8A 4JITA 2JGDB 5BSGA 2Z4SA 4CM4A 1UC9A 1BCSA 1A9XB 1E6UA 3N3AC 3I6MA 1K92A 1N4AA 3R3WA 1QGOA 3PQ6A 4YC7A 5GP1A 1JNXX 4IGEA 1U3FA 2ADFA 1M2WA 1Q0QA 1YOBA 1K75A 1TADA 2DKFA 1ZN8A 2HOQA 4MGEA 3MTIA 5F1KA 2NUAB 3GF4A 3OAAD 5KS2A 3EGXA 4ZAVA 2CNKA 1A77A 3BRCA 4I1OA 2NAPA 521PA 2WDZA 1VJGA 3QELA 1RMYA 3M5CA 4FHDA 3FUTA 2H2WA 2QNIA 2WHRA 4V1CA 1KERA 5CM9C 1DZIA 3QLJA 5BWBA 3PZBA 5ALJA 1NUUA 2LGJA 3HLTA 1MX9A 4GX0A 4E1BA 4UOZA 3W8RA 4ZQBA 1KSJA 4OHFA 2H29A 2F17A 2RB5A 4POAA 4EMTA 3LF2A 1FNMA 4FKBA 3E9DA 3H5TA 2I1QA 2F4VB 2LP4Y 3DEKA 2CWDA 5MHTA 4I2NA 1F17A 3JQ6A 4O1MA 3RQSA 3D3WA 4M9QA 2K7FA 3EVDA 5ES4B 4QUBA 3RVDA 4YASA 1DARA 4WN9B 5A3RA 1OTYA 3DAOA 2QZ9A 4N12A 1OX4A 3EPRA 4CM4B 4DMMA 2Q3EA 4LXGA 2Y1GA 2DCUA 2C4MA 1F48A 1MXHA 4PQGA 3ZQ6A 3N0XA 4QECA 4KGXA 5FOWA 3NVKI 1D09A 5FOSA 4XLTA 1PYDA 2H5JA 2BN4A 4HEA1 2OLKA 3BB3A 4LE2A 1APBA 3ANSA 2HJHA 2P9BA 2ZU0C 1XT6A 1KE2A 2WB4A 2Y27A 4RD6A 2I29A 2X5XA 2UYQA 3D8TA 1VPDA 1KQNA 4E4YA 2F3QA 2FP3A 1BCRA 3D8HA 4GICA 1EAMA 1K27A 4URFA 4PLFA 1P1BA 4YCBA 4AY6A 4XOIA 2BFAA 2AJLI 3AU9A 4ZT2A 5FF9A 3TD2A 4O08A 3VI4B 3TUZC 4P36A 3SEQA 4V1CB 1WMAA 2OHIA 3LPNA 3M5PA 4EKEA 1OV4A 1Y7TA 2REQB 2HU7A 4WY2A 2HFKA 5B12A 5JNSA 4JXXA 4MUIA 5B6JA 3OTQA 4LHZA 4MXDA 5DW3A 3U17A 1JQAA 4RZ2A 2AN3A 3IJPA 3IDQA 2XTAA 1HQDA 3UK2A 1L7XA 3ELUA 1AO3A 2EKDA 3WTCA 1EESA 1FFHA 3PPIA 1H2HA 4E3WA 4Z7JA 1L7AA 3FPGA 3R2JA 3FYUB 3CRZA 3BRWD 3ZGVA 2GAIA 1UMBB 3CZ4A 1L4LA 3NCTA 1YB7A 1QONA 3NTVA 4RENA 2CV1A 5EHZA 1EBFA 5K6AC 4NZZA 1IHUA 1Q77A 4BNMA 2AQ8A 2YWFA 2AYYA 2Y4NA 1D4FA 1U7HA 4IZHA 1KZYC 5ADUS 1SELA 4KAXA 2XZPA 1EVZA 3LTNC 2W2LA 2Z5LA 1IEQA 1AKTA 3LXUX 3H0KA 3KOWA 3UJ9A 3V4ZA 1JFTA 2HA2A 4LXTA 1T3LA 3H8SA 3ILVA 4JI4B 4F6RB 4E30A 3HUEA 3GJ7A 3RJZA 2QE7A 1EA7A 3O8NA 2HMTA 5FCDA 5F3RA 2JHPA 3KJXA 3ONDA 3S28A 4AG3A 4DUGA 4OI2A 2PQMA 5GV7A 3KT0A 4LMPA 5ALHA 1C30A 2QUHA 3C43A 4L9RA 4TN5A 1DX6A 3ZHTA 4JV5B 4D3SA 1KOGA 3QF4A 4TMWA 5F9FA 3P96A 1ZCJA 3PE4A 5DRYA 2FJPA 2ZPAA 2BGWA 1SXHA 1V37A 3ZY6A 3EXG1 3TPCA 2WIBA 3KTOA 1BH2A 4U00A 2BMFA 3W7VA 4PINA 4JUIA 1PJLA 3HUFA 1GPLA 4O02B 3TUJC 1JFFB 1QC5A 1LTHR 1LEHA 3GVIA 4FGUA 4E5SA 4EGFA 2OFXA 1CS4C 4UFNA 2OHFA 1YKSA 3QGMA 1KP9A 6AT1A 1JTEA 1E0JA 1G5IA 1H9BA 1S89A 2BGLA 4FFOA 5E6RB 4NC9A 1S7CA 1NYTA 4OQYA 3O75A 1V8PA 1T3SA 3GA5A 1IZ7A 5EWLA 3ZCXA 2ZWIA 3HGQA 2FB9A 3HMQA 4KZKA 3HP1A 1QLWA 5HILA 1YJXA 1MW9X 2OENG 2CFTA 2Q9CA 4NBNA 3SJZA 4M3NA 4CCAA 2PT7A 5CCXA 5TQ0A 1CP3A 5K8VA 1AX9A 2QVGA 3RAPR 2AS0A 3RWMB 1JHRA 2RHLA 4MLZA 1I7QB 1ONBA 4ZREA 2A5GA 4PZPA 1TU4A 4AZWA 1FFXA 3DT8A 1YR8A 3KYIB 1WVIA 5LYJA 1ORHA 5EL0A 5JI2E 1UOEA 3FGOA 3UKOA 4AS2A 4GH5A 2IWRA 3FSGD 1HOXA 3A1CA 3O7MA 4C7VA 4YRQA 5LKRA 5KPDA 4X45A 4JI1B 2OCGA 5LQKA 4A8JA 1KO8A 2AMYA 2HV8A 4QODA 3AG5A 1NBHA 4V0ME 4FDLA 3FBTA 4OREX 3RSHA 2GSDA 4HG2A 4BNGA 4DLXA 4ZO7A 5EZYF 4ZCLA 3CLUD 4WLUA 1GL7A 2R5WA 4ESVA 4HXYA 3ZBPA 1NKVA 1OI2A 1L3IA 1KMMA 1E2IA 3DCIA 3NANA 4HAIA 3QWIA 1PNTA 2A6PA 1TIBA 1HE5A 1MZVA 4HFNA 4EYQA 1HZZA 2ADMA 1LPBB 3LA8A 4CTJA 4N40A 4C0AC 4NF2A 9GPBA 1VC2A 2WSSD 4BVBA 2HCFA 5AW6A 1EXMA 5JW6A 2I8CA 3MINA 2YOHA 2WTMA 2YBDA 2O8VA 3OM0A 4OXQA 2A5FA 4TWJA 1WV0A 3EEBA 4H7FA 5NULA 1BE0A 4FHZA 3U7QA 5CJ2A 3EGXB 2XUZA 1RRCA 5FPSA 3DFUA 1X7XB 4CTOA 2ZSEA 1T13A 3O1LA 1F20A 2HA6A 5JANA 4FNMA 3KOZA 1X14A 3MJTA 5HKKD 1IM8A 5DTMA 2ZJ3A 3I42A 2WWHA 2H2IA 5GZ6A 1PBNA 1WUJS 1WB6A 4GC5A 3IEKA 3PZRA 3DWEX 4MKXA 4UEQA 1K9SA 5FPQA 1ZD9A 2AFIB 4BLPA 2H00A 2WZCA 2Z2KA 4J0JA 2P4QA 4P84A 3TMAA 3ZDBA 3T5MA 4X20B 4GECA 3SIPA 5J4LA 4CGZA 2YDXA 3OPYB 4YUVA 3L8ZA 5L8VA 1X80B 3PD0A 5BQPA 3SC6A 4BKRA 4ZICA 1M6VA 4D8VA 1JR6A 1G4UR 5C80A 2IXFA 2VBFA 2PV7A 5ALTA 1XMPA 4CTNA 3RPEA 1SG0A 2DAPA 3DYVA 1S2GA 5IDYA 1K08A 4CTKA 2QN8A 1QMGA 1TKRA 3LC0A 4QPPA 1FDUA 4QU8A 4RLHA 1L5HA 4JKIA 2A1TR 1FU7A 4WK2B 3KC2A 4LXYA 4QOHA 2QVXX 1RQRA 4FD2A 5CVCA 4D9CA 1Q83A 3ETGA 2PNJA 4LDQA 3RVKA 5KO2A 3ZU4A 3ZY2A 4GYYA 4UTXA 4BLSA 2PUTA 1ADFA 1ZBDA 1TTQB 3QI7A 1CE8A 1KYIA 1V35A 2I1VB 3L0ZA 3QOYA 4QU0A 4ZC8A 4C2TA 1ZM7A 4IGFA 3FI0A 1L7VC 2NYRA 4FNOA 4R0VA 3RVPA 2FUEA 2CLLB 1A4XA 2QG6A 5AXCA 3FOFC 4TTJA 2ZSBA 4R40A 2PZEA 1R5NA 4BN0A 4BNKA 1E3DA 1TD1A 2WUVA 4DG8A 5DNCA 1EFTA 2QROA 1ZD1A 1B16A 4XFJA 1ACMA 3VNRA 1U0LA 3HPRA 4EKGA 4TSRA 1F2UA 4RYLA 4EITA 2V9ZA 1E32A 4I1UA 2HF9A 1DJQA 4PGMA 3SC2A 4RY0A 4IW3B 1KDRA 2ZRKA 5K3AA 4F4JA 1IHDA 3EISA 3E23A 4KNYA 2DUNA 3E7DA 1N2SA 2G6BA 5DCUA 1E5VA 2VRCD 4LQLA 2RHMA 1RTKA 3VDNB 4DT1B 3DD5A 2XKBA 2H1VA 1VLLA 2OD7A 5GMOA 1JL3A 4DS3A 3W6NA 1DWUA 4IV8A 1DZ3A 1NMZA 1E7MA 1VPTA 1NVVQ 2F59A 1P44A 1SWVA 2O8EA 2M98A 1P74A 1MNQA 4JBYA 3IAS6 4JMLA 3LUFA 4OI1A 4DT1A 1AM4D 4E14A 1Z3CA 4PTYA 3ROGA 3T5PA 4V0NA 2ZRLA 5GVRA 3EULA 4R5HA 1I36A 2PNFA 1A2OA 2YS7A 3BZWA 3C5CA 1KZ4A 3GRYA 4WH0A 5CTJA 4GQAA 5I3ZA 2XF8A 4RZIA 3WRVA 1OLSB 3L6EA 4HYQA 3MTGA 2XKJE 1Z12A 5AWFC 4FHEA 1X3LA 4JQYA 4QULA 1O5OA 1ZGGA 3EPLA 1VECA 3IUSA 4ODIA 3V4OA 3B3FA 4U2FA 5DIFA 1WAMA 3V5NA 3UCFA 2FQ1A 4DQVA 1PR9A 1HQYE 1JR3E 1M76A 3IBYA 4K26A 1RRFA 5FNVF 3AB7A 3C8ZA 4I50F 3NG1A 1DG3A 3KJQA 4LSWA 1Q6YA 1ZC3A 5D7BA 4B7ZA 4DXDA 2O9JA 4F91B 1IBKB 4R16A 5KYUB 1QFZA 1XMIA 1CSEE 1JLMA 2H31A 1RQ2A 2J87A 4X5OA 3I8XA 3MRVA 2Q4BA 1MV8A 3QIVA 1YQQA 2ZIEA 4K8RB 2ODPA 3HJHA 5ALNA 2XUQA 1EFAA 4DEXA 4NXMB 3CLUC 4MAFA 1U8AA 2DULA 3ETHA 1DKRA 1JEQB 4A0QA 1KAOA 4RCVA 1Z2OX 2YIVX 3RV4A 1R15A 1X7ZA 1V8BA 5KJFA 1UJMA 1RWQA 1RRMA 3MNFA 1QH1A 4L4XA 3PJFA 1AUXA 4F12A 2PN1A 2QVZX 4MVJH 3U3XA 4IJVA 4HNAB 1Q6ZA 4D9EA 1C3LA 1P9WA 3RRNA 1FTGA 3GDWA 3OM1A 1DAFA 2C0CA 5JDIC 4WBXC 2PX5A 2XMRA 4RBNA 2R44A 1C2TA 3S1AB 1FDSA 5H81A 3GH1A 2GXSA 1QH9A 3ZI7A 4L16A 4LWPA 3OIGA 1ZRSA 2W6QA 2Q5FA 5F3DA 1TZKA 1N1EA 2BI4A 2VXBA 2L2QA 1AKYA 4C4OA 4US2R 1Z4MA 2M2IA 1QQTA 1GPNA 5DRTA 5J1TB 1Q16A 1OHHA 4UNSA 3D6JA 4N18A 1Q1GA 4BTLA 4QG3A 1XQ1A 3DH0A 1SVIA 4MV1A 3D4OA 2ZIFA 5FPPA 1OTXA 2CL7X 3F5FA 2OAGA 3C8UA 2B4AA 5JNTA 5L4SA 1DOAA 4BFWA 3GP8A 3L0SA 2C92A 2IPOA 1LNZA 4UBNA 1EHYA 3H5RA 5JYBA 4ZZ1A 4QARA 4XX0A 1RKUA 4RC9A 1N0HA 2HRQA 1U7XA 1AIPA 1TIPA 2XMSA 3NOVA 4YQYA 4GDFA 3DMTA 2FPLA 2I87A 3ZBUA 3AVVA 5EZYA 2IE8A 4IDGA 4WE3A 3PNSA 3CUEF 4HWRA 3TCXB 1FMLA 2NVBA 4FW8A 2C9YA 5G0UA 2YJ6A 2Q50A 2OLEA 2PZ8A 4OGGA 1XU9A 2WJYA 3H9BA 1SN7A 3TIXB 4EW1A 4QYWA 5AOAA 1CJSA 4WDRA 3ZZ1A 1QCDA 1QIEA 2D1YA 3H13A 4BMNA 3KVVA 4R8RA 4ZJYA 3ADBA 1N0VC 3RW9A 1JXAA 2CVZA 4OQMA 5EIEA 2FSGA 2OXFA 3K5WA 4R84A 2O50A 2AUNA 5LQUA 2QENA 3LPDA 4JJ7A 2ECFA 1ECLA 1E7WA 4GIBA 1JEYB 4H1HA 3SP1A 1AV7A 2WM3A 4UD2A 1Q0HA 2FW6A 3DJYA 4BNWA 4PRYA 1OBFO 3DDCA 2R6ZA 3I9NA 4H4EA 4AJ1A 3UPTA 3UMYA 4KU4A 1SQ5A 3NWEA 5JPIA 2JAUA 4KQHA 3K0HA 2WJVA 1KZ1A 2WFAA 2IODA 4OAQA 4XGNA 4C1NA 2O1WA 5DTIA 2BCEA 4CYMA 2D6FA 1UBMS 3KZCA 1TJ3A 3BHJA 4P32A 1M2GA 1YS1X 4MARA 2BUAA 1LTQA 1FDRA 1MMFB 3WISA 5AMXA 3VJMA 1TOAA 2GPAA 1E3JA 1E9EA 2K4MA 4FONA 4RUKA 4XXHA 2JCBA 5EKDA 3U13A 3ZIUA 2IELA 1HEIA 3E8XA 3IDOA 3UXEA 2PXHA 4J8PA 4EFLA 1EXWA 2FU5C 5IDWA 4MW2A 2PBLA 2O5EA 4BRWA 4OX9Y 2BJHA 1PS0A 2VK4A 3OUZA 1X7WB 2O2SA 3HWX1 3T7TA 1PZFA 3RVJA 1NVKA 2XUJA 2GLUA 1YI1A 3OKPA 4RHXA 1DRWA 2W6NA 5BW8A 1XPOA 3AONB 4JFRA 5HW0A 1OB2A 1Z26A 4DV1B 4CLDA 3HDHA 3NBKA 2L18A 2PFSA 4BMXA 1WF3A 2RKOA 2QK4A 1EJ0A 4WK4B 5JBQA 1XJCA 3VRHA 4DLSA 4C7MA 3WL6A 3HYTA 3H84A 3I39X 3QFRA 4HMQA 4AJ9A 3RJMA 1OWMA 5LQAA 1QBKC 1XKTA 1G3QA 3IQGX 3C3YA 4LJ8A 5AKIA 3UZUA 3JQPA 1SFRA 2V5AA 2D74A 2VNSA 4TL6A 5LA6F 3RUFA 3WQBA 2F7SA 2O8FB 1Q92A 4LRTB 4MITA 1CZOA 1O1YA 1VJCA 4G81A 5F76A 1G7CA 3K4HA 1J2UA 1I3KA 2GD6A 2ACEA 1NQAO 2IEGA 3KD3A 3O3CA 4G4SO 4B1FA 1E5DA 5EINA 1YDEA 5A5VA 1UJNA 1Y82A 4JGBA 1A72A 4DBZA 1F1BA 3TW4A 1XCGB 4PIVA 5HOEA 2B1IA 1WL8A 4ISCA 1ADYA 1N4DA 5HJ2A 4AIRA 5KYGA 3NWBA 1GTL1 3GV0A 3F8TA 4Q3LA 1TU0A 1PYGA 1ZJ4A 1LC0A 2XE6A 3PR1A 4FSDA 4LBYA 3JALB 4WV3A 3K32A 1WSAA 5EI5A 4CFSA 3IPYA 5IJ9A 4D3FA 4D3ZA 2PEZA 1KJNA 4UHBA 5FTMA 5K09A 3T12A 1AN9A 3OAAA 3QUSA 1JEJA 2JLQA 2QMZA 1DIRA 1E2LA 1E62A 3JQDA 3ZWXA 3O6VA 1GGKA 3PQ8A 3TQCA 3UXMA 4R3WA 1AMUA 4V0OA 3PEWA 1AGYA 1DAGA 1EDEA 4HADA 4M9CA 4R0NA 3W9SA 2W48A 4YFYA 1OYWA 2ZI5A 1KOJA 1LQ2A 3USZA 4TXLA 1C0EA 4HUQA 3HEBA 2WJ4A 2Q9AA 4ER5A 3OSZA 3KSRA 3R7SA 4BU1A 1Y8ZA 5IT0A 1FW6A 2V1UA 4A3SA 3RH0A 4MRRA 1QGZA 3EVNA 3IDSA 1V3VA 4QQNA 3HHEA 1OX6A 2GJ9A 2P69A 2Y93A 1ABEA 2WQ6A 1ZD8A 2XVAA 3F2IA 3O4VA 3IQWA 4E5DA 3EYWA 2E4AA 5TB5A 2X6RA 1TDJA 1DBVO 2WOJA 1XAJA 2QRLA 1ZH4A 3BQNB 3PVCA 3T3GA 1N5RA 4X90A 3TTTA 4RHCA 1EFVA 1R6XA 2DWPA 3TKYA 4GL4A 1P4HA 5AQ1A 3HV0A 2VK1A 5F2KA 1SHJA 1XTPA 3WLQA 4FEYA 2DUWA 4M1WA 1T6YA 4WLNA 5IJ0A 5T7BA 1YK0A 2I54A 4FGLA 1BD4A 3VNAA 2QTAA 3WYAA 2XJ4A 1VI6A 1KO5A 3OQIB 4M7WA 1W0KA 4ZCTA 4LKOA 4W5JA 3UXYA 2A14A 1CUWA 5I45A 1GJRA 2B92A 3M3HA 3EBOA 2PLRA 3GUHA 3KDAA 4KLZA 1RKBA 3IP1A 4RQAA 3KZXA 4QYIB 4TYQA 1H8ED 1WQ1R 2RAVA 4GE3A 2CW5A 4KXXA 4LYYA 4RWEA 3KUCA 5HKBA 3W4IA 4DIFA 4A2QA 4FLFA 2IS1A 3TQIA 4HWGA 4BZZA 3OEEA 4W9NA 4NESA 4XSHA 3ZU3A 3PFBA 3Q8KA 1JKMA 2QY9A 3HU2A 1E9RA 1E5XA 3KTAB 5KNBD 2QLFA 3PEUA 2Z1MA 4HB4A 5B3AA 3VUEA 4GYWA 5IXJA 3DOIA 2GBIA 3LGSA 4OU5A 2CCGA 4RTKA 5KNDH 3LBAA 4CI9A 4KUGA 2Y2UA 2VDQB 4KWIA 4Q7KA 4F72A 4B40A 1GM5A 3FFBA 1M2KA 2QM0A 4UNNA 3IMGA 2C31A 2XA9A 5LL6P 3KE9A 2GN6A 1W5SA 3KRTA 2NPOA 5B36A 5L53A 5KNLA 3A3PA 2NADA 2NU9A 4L8WB 1YZUA 4TQGA 1GDTA 1W1UA 4I55A 4ZU1X 3LUJA 4DCTA 4EIWA 1CV2A 5JDIA 4JR1A 3K5PA 5IAKA 1I3OA 1PWHA 1SXGA 2OCXA 1WOMA 3KQMA 4N5NA 3V7NA 4XWOA 2QGZA 2PVPA 2HCRA 1I2DA 1OFIA 1Y7IA 2C4UA 4JVOA 5JYCA 1Y33E 4A03A 3W06A 2EKZA 3DE0X 1A9XA 5JSUA 3PDHA 5KOHB 4LOAA 2X9QA 4DDMA 1UMDB 1C0PA 3HU1A 4OBBA 4RHTA 3SD7A 3U1TA 1P9LA 5F7ZA 2R9VA 3NGXA 3NIWA 5SYAA 2BEVA 1FUEA 1MPTA 4GPBA 1XNQB 2QX7A 4ZVRA 3IPXA 1THZA 4NZNA 1G64A 4F21A 4YDSA 4FEAA 1IHOA 5D6NA 1LDNA 4KSCA 3SFTA 5DGHA 5AW9A 2FWRA 1VMIA 3N2EA 1U0FA 3LWZA 5FEMA 1ZI9A 2A35A 4HR7A 3QE9Y 3EWAA 4M53A 2XNKA 4U9UA 1FOEB 3AFNA 2AJBA 3E27A 1QUEA 2EP8A 3P9YA 5FI0B 1JHOA 1OXBB 4C08A 3M34A 3DKIA 1SUAA 1EK1A 4LWZA 4TMYA 2SKEA 4YRZA 3FMFA 2IYTA 3L06A 2HQOA 2VDKB 2ATEA 2Z95A 1KI6A 3UJAA 4HX5A 3B3JA 1ZGZA 5C1PA 1C7IA 5JO9A 1I51A 1QS0B 4KQIA 1WMSA 4K6KA 1WSBA 3IPAA 5HIIA 1W8DA 3KZ1E 3CLVA 4GBGA 3VZSA 4L51A 2DFKB 2P4SA 2EF1A 1EMDA 4LBZA 3MMSA 1KTIA 1WHTA 1GN9A 3GLFA 4PU0A 4EO9A 3RK4A 2YCLA 3IAM1 4WRRA 5EXDA 3UWPA 1EM8B 4HATA 5IM4A 3FSJX 3SX2A 4OX9B 3VSBA 4CNQA 2BGGA 3L0CA 1MIHA 2O8NA 3BIFA 1FVXA 3IXLA 2BE7A 2EKLA 1X94A 3ELBA 2QQGA 5DULA 2JZNA 5JPCA 3DLCA 2XTMA 4MDEA 2QR3A 2DY1A 1KY5A 2FUNB 3EFOA 4AJLA 2ZXUA 3A1EA 4FFRA 1JNYA 3UPDA 3KJEA 3AK4A 1BS2A 1XTBA 4HQNA 4PLVA 1O77A 3SEZA 5EHIA 3VYTB 721PA 3OCUA 2BOVA 1EUCB 2C29D 2EHJA 2VBGA 3PYXA 3E9CA 1XSEA 3JW8A 3ZD7A 1KFEB 2Q2WA 3DMHA 2QW1A 3MUNA 3MILA 3MJCA 1AS0A 3M2TA 2IJGX 1S96A 1CQJA 1ZM9A 4QQRA 4D41A 1YUBA 3N1UA 3ERCA 3LC1O 1YAJA 3EGOA 2QS9A 3ULKA 2XBMA 3HEMA 1YDHA 4HMPA 1RKXA 4MVYA 5FWXB 2YWXA 1IWBB 1NR1A 1W25A 3O4HA 3K1ZA 4PAQA 2WRZA 4EA7A 3OZRA 5K0GA 3K0AA 1RYZA 2RHJA 5H80A 5KMGA 1GFWA 4HN2A 1DQPA 5JS8A 3PQCA 3IC5A 3GN1A 3OOSA 3OY2A 1NFRA 2Z2JA 2W6MA 2XRFA 3UA3A 1VE9A 4PLYA 3OEWA 4DIMA 1RPZA 3HJRA 4D5GA 1P0FA 4DSNA 1BXRA 2IYUA 4BKMA 2FSFA 2OO7A 5TQVA 3TRHA 3TW8B 1F2DA 4V0SA 4RKEA 3M33A 3E53A 4FLMA 4JD5A 5KYYA 2UUBB 2V45A 3KBBA 1P61B 2BWJA 2VRNA 3A3KA 3WDLA 2A0UA 1T9AA 2IPLA 1AGRA 3IP3A 5EIXA 2BSQA 3HB7A 1PN3A 1X2BA 2X76A 3CJQA 4ATNA 4DCJA 4DAEA 2XQIA 4CIBA 2Q0QA 1U1EA 1AQ6A 2AHRA 1RHJA 2AKYA 2XUIA 3DOUA 4S1OA 5K1ZA 1FQJA 3HCFA 3E2MA 1DEKA 3IAFA 1GZ6A 4NYJQ 3RBAA 3VZPA 2XQFA 3KUXA 2K6GA 2O5CA 4MPDA 2KMLA 2V7XA 1RACA 3LL7A 2G5PA 3QHQA 3RK0A 1QJCA 3DHNA 5GM2A 5KWEA 1YZKA 1EK2A 1YQTA 1N9GB 5M3BA 2FN7A 1U2PA 1ZOOA 3D4BA 4G5OA 4A9AA 2IZ1A 2W2LD 5K45A 4RZQA 1MJGM 3TN7A 5M5BA 2YOGA 4OXYA 4HPWA 1BC5A 2R25B 4CCWA 4W99A 4EWLA 4WVLA 4YEDA 1ZWKA 2G8NA 1BNCA 1K7CA 2VNHA 2ZJBA 3KQOA 1G21A 3PGLA 1EFDN 1SWWA 4I9UA 3KG2A 4II3A 4POOA 4AZ3B 1GGVA 2XUDA 4ZOBA 3SE7A 3WWDA 4R01A 2D7JA 4L76A 1D2MA 1UOQA 3D0KA 4FGSA 4TV9B 5HPYB 1C9YA 3AJEA 4A92A 1QIMA 1XVVA 1C0IA 1ZQ9A 4IHJA 2BGUA 2EG5A 2NU6B 3CF4A 4BYGA 1FVOA 3B1FA 1A97A 2F1HA 2ZYUX 4NQZA 2F8SA 3U3MA 5L3ZA 5BQFA 2PCLA 2OMEA 4X54A 2AF3C 1ESCA 2JGNA 2PHZA 3BFKA 1JG3A 3CBGA 3F6YA 3PB3A 5EESA 4ABYA 4IVQA 1U8EA 1BRTA 1JECA 3ZTWA 3HVIA 3K9QO 3JAKB 3AMVA 2XYVA 5FPTA 1Z2NX 2H7XA 1U1CA 4Y2RA 3H5WA 1WUHS 5HKLA 4WLFA 5IPFA 3EZ2A 3KQVA 1M34B 1ADCA 3AR7A 3NB0A 4FE4A 2VWQA 5JNUA 1G16A 2BH9A 2YL2A 3I2GA 3JR7A 4CL3A 5KCMA 3PVZA 4GKAA 4OD0A 5JT1A 2B2XA 1RU3A 1RYBA 1YMQA 4J49A 2QKYA 5K9ZA 2V1XA 4YJ2A 4UMVA 4ZVTA 1X6VA 5EXXA 3GLGA 2X0NA 1JTFA 4BO2A 3RWBA 3DEYX 3RARA 2Q1YA 2HFJA 1PEYA 3IOBA 2JI7A 5D85A 5HOQA 3PUZA 3U5ZB 1MGPA 4AZ0A 3KEMA 2YQ5A 3DMFA 3G49A 4HDKB 3SZLA 2HBRA 3W9UA 3REQB 1FTWA 2NO6A 4MUAA 2V7EA 1I30A 2AFIE 3QE3A 5ETJA 3SKVA 4X97A 2QX4A 4MYDA 2YFKA 3OCXA 3A7DA 2GCOB 5AVJA 2QJOA 1NTOA 1EDOA 3QYJA 3E1GA 1KWGA 2X3YA 1RM4A 1WHSB 3HZOA 3KP1A 4IDBA 1N8NA 3W04A 4ER0A 5IAOA 1W93A 4BKOA 1GTSA 3L41A 4MI1A 4MQLA 2EEZA 4MYRA 4E3ZA 3GD5A 1BMFA 2OXEA 2W0SA 3E81A 3JAWA 3UAGA 3WYCA 5JXJA 1ST2A 1FXWA 2BI8A 2B4TO 5DN6A 1DEHA 4G41A 1FMCA 4Y7DA 4B7UA 2G7ZA 3WGZA 2P65A 1LF5A 2H7VA 4R4JA 1C0KA 1S7GA 2OGUA 2I3GA 2VJBA 2ZTVA 4ISBA 4RLFA 2FZLA 4B35A 4BYMA 2NU7B 1PBTA 2GJAA 3H17A 2DLCX 5FYQA 1NLUA 2J6IA 4YN3A 1C7ZA 2AN5A 2UKDA 3BMOB 3PTLA 4WESA 4QICA 3OQMA 2C7OA 3AYZB 3R7BA 2I7CA 5J2TA 5EKUA 1QHNA 4PW0A 3PUYA 4OFXA 4Q9LA 1YA6A 3QBTA 1X9GA 2Q1UA 2IYRA 3DV2A 2JFPA 3QKSA 4IKEA 1KMQA 2YINC 2QUBA 2WOOA 1X7DA 2ZKIA 4R51A 4E70A 2AFRA 3LSYA 2ODNA 2YZNA 5SZHB 4S3MA 5TC4A 4MPTA 5I48A 1W5AA 2DP4E 3CX7A 3EVZA 2E4VA 4ZVQA 3A70A 1Q7GA 4NYMR 1CJVC 3SIXA 3HZHA 2B2CA 3KR0A 4CM7A 2OK8A 3GVXA 3D5TA 1BFUA 1EVQA 1VSTA 2XSZA 3WGVA 1XHFA 2XA1A 4JBGA 3NC4A 2B0CA 1XD2A 4BNYA 4DB2A 1PZGA 4FKMA 1KEKA 3AKCA 1RC0A 1CNEA 2V7QD 1CUSA 4CKEA 3WLHA 1H2YA 2IOFK 2JDIA 4UDXX 5IC5A 5BW5A 3LY7A 2FSVC 5DI9A 5JNRA 3R7LA 2ZB7A 3MJEA 4BO8A 5IXYA 5IZ4A 4CG2A 3ETEA 1E3IA 1LCIA 4WUVA 4C78A 2ATXA 1ZA2A 4KX3A 1K6XA 2G88A 5TMPA 1ICIA 2IPNA 3GJYA 1NU8A 3DWFA 3EGWA 3JATB 3NALA 2QRGA 1E3QA 3BVPA 2C00A 1RCFA 3F7NA 4FCTA 5D3ZA 1QP8A 5JSKA 4ALJA 2PMCA 3SR0A 4BFYA 1RWWA 5J4KA 4O4LF 3QW2A 1TKAA 2GKGA 3EH1A 1EB8A 4EQZA 3D2AA 1K5HA 1RAEA 5CLGA 4UTVA 1I7PA 1EE2A 1XZNA 1XLUA 3CZQA 4G67A 2WUFA 2CXUA 2P2ZA 4KRXA 1B6GA 4YBZA 2RGAA 2A1UA 3P94A 1YC5A 4LE1A 2Y3IA 2W6PA 2IKQA 2OPBA 1GT6A 1O4VA 2CUTA 1WXEA 2AI3A 2OO5A 1R16A 3PDIA 1JFLA 4DLZA 5E1DA 2BAGA 3MAGA 5JJCA 3TSAA 4K0KB 4JN6B 1QIGA 4L4SA 4L9AA 3SXUA 1ONOA 1BE8A 3U80A 4UW9A 5E9WA 1EGMB 5JBIA 3D3NA 1JSRA 4MMXB 3R9IA 2UUPA 1R0YA 4AY5A 2BMJA 4ARZA 1H2EA 2IXTA 4NCKA 5C8YB 4V2UA 3CISA 4QEZA 3RO7A 1C9MA 3O1JC 4QYTA 5CIQA 1FLVA 2Q3BA 4DBLE 4IY1A 4F3CA 3KVYA 4UTPA 5ESXA 4GAEA 1UKCA 4D4HA 1AGNA 1T26A 3BAFA 3HVKA 4CDMA 1MZPA 1X1AA 2RGDA 1QB8A 1JYSA 3ZWOA 1NW3A 2GZAA 3STHA 3T4PA 1GADO 4CG0A 3UMMA 1TMOA 3WMGA 5CEFA 4L8VA 3TO5A 2Y99A 1Y5LA 1BO6A 1EX6A 2CDBA 3H42B 1X1SA 2Z1NA 3KJIA 1G7SA 4LK2A 3VVMA 5ARCA 1KPGA 3EHDA 4EHDA 3D6AA 2VP3A 1CY0A 1NGSA 3X1YA 1JEYA 1TQ2A 1G9SA 4BO1A 1VFNA 3KL4A 3T99A 4CV0A 5JD6A 4NIMA 3LP6A 3RC2A 5K20A 2BFCB 2O05A 2ZLBA 2XB9A 4NYIQ 5HJEA 3KQTA 4MUMA 4IR7A 3TS1A 1I0IA 1P7YA 4PX9A 4F86A 3JQAD 4R1MA 5SZIA 4AD8A 3FGPA 2G9QA 3SMVA 2XMPA 4G89A 2HZ7A 2WA2A 3PYLA 4OOEA 1Y4UA 4XDYA 1JLSA 2O6HA 1TYEB 2P8SA 3PG5A 2NVUB 1WXFA 4KDFA 4B8ZA 2M6SA 4YAFA 3RKSA 2JBHA 3PDCA 2XOXA 4HB2A 1O96A 1Q1BA 4GNRA 3M8KA 4C2BA 1OJLA 2C0QA 3BWCA 5LJLA 3DOHA 1E66A 4GGPA 2QAGA 1XRJA 4LMRA 1YR6A 4QJ5A 1GQOA 1E2KA 1Z22A 1KRHA 1V16A 2CFOA 2ZM5A 1I8TA 3QPUA 2EJTA 1ZK4A 1YDFA 3UMRA 1QDEA 3SQNA 3J7AC 3WYGA 1JPUA 1P17A 1IOWA 2AG5A 2Q0HA 1YU6A 3M7IA 3TIFA 2ZJ7A 5IWCA 4W5OA 3T3OA 3ORSA 2QD3A 4E46A 4EG1A 4CPDA 4O33A 5E8RA 3RFUA 5L51A 4K9SA 4CDNA 2G1JA 1F12A 4L7QA 3Q7IA 1WUTA 2M6RA 1KEEB 4MCAA 3M9WA 1NUHA 1DC4A 3TNFA 2JLBA 3HSKA 5HJ5A 1CLUA 1E61A 3IMCA 5U1PA 4L5JA 4JQZA 3TFQA 4HB0A 4CKZA 2HQ1A 2B1JA 1O94C 2ZAIA 1A82A 1YCDA 3BCHA 4U2GA 1FNSA 2GD0A 4O1HA 5LBIA 3ROZA 2R1VB 4EI9A 2P75A 3U6BA 2A67A 1W4BA 4C04A 3Q3JB 1FU8A 4YGXB 2BGTA 4B4WA 5EJ4A 5TJHA 2XZTA 4FCCA 2VJYA 2VTBB 1EVJA 4F2HA 3HK2A 3I5AA 2DZDA 4DLTA 2ZBUA 4AMZA 3LP8A 3G7NA 3K4QA 1WZIA 1O0BA 2FI1A 2GYWA 2HZBA 4RFVA 2HSZA 3P97A 4B3GA 2IXEA 1ZN2A 2WSSA 4MYHA 3FHTA 2QRKA 5KYUA 1HNNA 3P9RA 1A7UA 4GZ6A 3ZHZA 3AFHA 2ARKA 3I0ZA 4KK4A 1AC5A 3PK0A 5FA5A 5I9MA 3ZDYB 1EHIA 3M6FA 2Z43A 5ENVA 2HJGA 2E4XA 2NT4A 3EDRA 3B2QA 2A4MA 3GRAA 3ORYA 4L07A 2R86A 2HRZA 3EF3A 3L5OA 3UK7A 1E96A 4A2WA 3GRUA 5CP8A 4B8WA 2PANA 4QLBA 2HYIC 3WJAA 3KB1A 3N0WA 1NPDA 4DLUA 1G3RA 2BZ1A 1SRQA 4QGAA 1B2LA 4B32A 2FEWB 2ZI6A 1XVIA 3DDUA 3OJ0A 3ROPA 1SKYB 5HCIA 3CPJB 3WB0A 3M9LA 3VC3A 2W6OA 1EFLA 1YC2A 3OD1A 4GOKA 1O57A 4HAZA 5BT9A 2HA5A 3KFLA 5KOJA 3ZH9B 1QAMA 5HQJA 4B5KA 2LKCA 2LCQA 1SHLA 2Z4TA 3GPDG 3WNQA 2VNIA 3FM9A 2BFBB 3H6KA 3FWPA 4JX8A 4NULA 1ZYUA 4EPYA 621PA 1I3MA 1LKZA 1V9LA 4FR5A 4OJKA 4D4MA 2YC2C 5B53A 4HTAA 2QLLA 3VBEA 1RZRA 1J2EA 2W5UA 3DMTC 3DW3X 1EVYA 3RT9A 3IUMA 4U2CA 2E4WA 3AF0A 3EDMA 2WPDD 4PTLA 4V39A 1KJYA 3I4CA 2W2NA 5E4TA 4D79A 2DFVA 2BF7A 2GF2A 4GXQA 4YI5A 5BVGA 4X0EA 3WV4A 3C5WP 2RHTA 4FQ8A 4DLBA 4MQ4A 3L0OA 4LZLA 1UBSB 3A4TA 3I04M 4TRJA 2DY0A 4BNHA 4EX7A 1SD1A 2IYSA 2X0KA 2JGEA 4C87A 4NE2A 2CNDA 4KI7A 5JAZA 2CLIB 1RWOA 4YMVA 4KXMA 3UF0A 3ZWDA 2R4TA 1E9CA 2HJ9A 4UU0A 3H05A 4B84A 1WABA 4WZ6A 1MO2A 1T9GR 2RGUA 4D0SA 3FFTA 1N57A 4NAUA 1S01A 2QUKA 2VF5X 4BMZA 5FX2A 4GZ5A 3M4ZA 4UEOA 1KS9A 1NG9A 4S05A 2GDZA 5C53B 1T24A 5T8KC 2BM1A 1E5LA 3H2YA 4RY2A 1QIIA 4I36A 1XF1A 4YTEA 1R18A 5ALMA 2FPWA 1L4EA 4CFYA 3G8YA 3HXQA 1DXYA 3HDYA 3HDJA 4JLSA 2C7PA 1L8QA 5ALOA 1NVDA 3ZVMA 1BHSA 1ECBA 1KWKA 1DUVG 4FC6A 3S5UA 3HWWA 1VIYA 4TTVA 1KVSA 2CCKA 4OHZA 1IOZA 1VZ3A 3L8DA 4KYTA 2GT1A 5DHAA 3NHYA 4KAJA 3UGQA 2IW1A 3F6BX 3OCVA 1H6BA 3PFGA 4OHRA 4TLEA 5FWNA 4CKBA 1NQ5A 1UBNA 2JJ1D 2P2CA 2QLBA 3P0FA 4ZN6A 4Y0NA 1DBWA 1X1BA 3O8QB 4JSTA 5D51S 3PUJA 4PC2A 4BXOA 2QP4A 3HCAA 4M22A 5KYNA 1N6KA 2HGSA 5F73A 3ROEA 4AYWA 5GIPE 1XMOB 1G8KA 4JBNA 3ZQUA 2J3EA 3R5HA 4NS1A 1XTSA 1ORIA 4FFNA 4FIZA 4G23A 5AVSA 1RLTA 1GKKA 1DCTA 4YRPA 2R8PA 4BVKA 4KO3S 4KE8A 4HMOA 1KI4A 1CDDA 3H9CA 4YS6A 2EJVA 2FEMA 2VP9A 3HCRA 4ND8A 4KK3A 4PYKA 1K7YA 3DHYA 4HS9A 1Z0SA 4QBKA 4FZJA 3PQ4A 5EXSA 4Z7QB 5KVSA 2QLTA 3CM0A 3L8EA 4HZUA 2HU8A 1R6UA 3TZLA 4Z5XA 4JI2B 5CFNA 1T9KA 2FHPA 3LY8A 4LYFA 3SM3A 3HMKA 2C3YA 2GB4A 4TTRA 4Y9SA 1XTKA 2PL3A 3LQKA 4BNJA 4QXPA 4PG8A 1N7HA 4R7TA 4B46A 4AJNA 5K3OA 2WSIA 5IJZA 1Y9AA 3JQRA 4RESA 4ALIA 1N3LA 3HUDA 5ILQA 2BKEA 4TT8A 3ZVRA 4AAYA 4O4LA 4TN1A 5B6IA 4BLUA 5J59A 3TPZA 2UYYA 5U4XA 4MYUA 1YE3A 2QV0A 1GVNB 4QTXA 1R4ZA 4NENA 4BECA 4QQKA 3PX3A 1QRRA 3K70C 4JI7B 1Y9JA 2YW2A 5AJHA 1XZGA 1E2BA 1JHQA 4GOJA 4QOEA 4C4PA 2EWWA 1OWNA 4PLZA 7ABPA 5U4QA 4TRMA 2H2GA 1SOVA 3BCUA 1LA2A 3DBHA 3EUAA 4KQCA 4P58A 4X24A 3UV7A 5LQCA 5M7EA 1A8IA 4PHGA 1D5CA 4DUYB 1WXDA 4RIEA 1UXIA 4JQSA 1JX6A 1C7FA 1FUKA 1PV1A 3MPUA 1VKOA 2QIPA 3FKQA 3O03A 3Q3HA 1HQCA 1QU2A 7ADHA 2XOKA 2QMHA 2SCUB 3LWNA 3K09C 3CE6A 5DE3A 3ZY5A 2ZT7A 5EMKA 4MWZA 1U0RA 2GCEA 3LOPA 1TCCA 4UREA 1G4HA 5CLIA 3B6EA 5D3KA 5EC8A 1EG7A 4ZZ2A 1EFHA 1HFWA 4E03A 5KNCH 3IESA 2CY0A 3KKEA 4YRDA 5BSVA 1KFKB 1HFEL 1CR4A 2AEFA 1U81A 2GUWA 4QPDA 1CYDA 5L4LA 5FOVA 2H4XA 2QRJA 1MUUA 4TSFA 3PUIA 2CHGA 4LNUA 4OQFA 1YNOA 4X8MA 4ZDIA 2NZWA 4ZJZA 3DTNA 3UAZA 1XLTA 5AVXA 1MABB 4XWWA 3IUQA 1E8MA 1JAHA 2J1LA 5FTLA 1LPNA 1MT0A 3GLKA 3R3XA 4DNOA 1ADJA 4QWMA 3TQQA 3KXIA 1RWKA 3RU2A 2ZCVA 4U9IS 4G0XA 4YUXA 3QLUC 3WLRA 2C4KA 5K51A 3C41J 3I34X 4C29A 1ZUIA 5AK6A 1TF7A 4MVJP 4X84A 1TO2E 2ZB2A 2VSFA 2FMFA 4HB3A 4YH1A 4AF6A 1HG0A 3QNMA 3VSEA 4CIWA 4OLAA 2TMGA 2P35A 4KFTA 3OJLA 3T5TA 2YWEA 2XB4A 3IQDB 4RK0A 1ZP6A 5EZSA 2I3DA 1M67A 1Q84A 3OD5A 3DQZA 3OTOB 3ZS9A 3ADPA 3IVRA 2OUIA 4U02A 3IVMA 1YZQA 4I3FA 1W581 1R0CA 3FVQA 1I4TD 1OZHA 1V96A 4HCJA 3ZGNA 4AQ7A 4NPCA 1XG5A 3OMXA 1P2TA 1FFWA 3GAAA 3U2QA 3VR5A 1N9ZA 4KUHA 1C7RA 1GZUA 2ZPUA 4IV0A 5DJ5A 3U7IA 4BN5A 5HUQA 1BMQA 2HLPA 5DNUA 1NC3A 4IMRA 2JJ8A 2BEWB 5AW3A 4MYCA 1AA9A 1U0EA 1G20B 2ZIUB 4HN9A 4LY9A 3L05A 4UM7A 4WKGA 4E2YA 1IXYA 1AN0A 3IVXA 3GJQA 3OTWA 4M1EA 3WGTA 2JFUA 2AG6A 2B30A 2G6TA 1M7HA 2GXQA 2VDNB 2YIDA 4ZMSA 1I4EB 4REQB 5DBHX 4CKWA 1Y6GA 3HYNA 1DX4A 3DM5A 1PW5A 3DZGA 3EIUA 2O8CA 3GCXA 4KRFA 1NVBA 3PFIA 4YV7A 1WDLA 4Q4JA 1P1RA 2BFNA 3KAJA 5DNWA 1UUFA 2GUGA 1SUBA 3UYLA 4Q7EA 4YLGA 5C5DA 1GNVA 1U0NA 4GM1A 4MUEA 4OQQA 3UHFA 2QYSA 5LR6A 2QT1A 5LN1A 3OPMA 2DLDA 4WD3A 2GILA 5IULC 1JMVA 1OSNA 3MK31 3TLGA 1NXSA 1ZR4A 4PQRA 2C2YA 3QPDA 1EINA 3QKRA 3SS9X 4A23A 3L0BA 1VHTA 2CXHA 4ND7A 5GONB 4C1BA 1JR3A 2H1OA 2OFFA 1O7JA 3PDJA 4I8XA 4PZYA 2YZ7A 4YRNA 1CLEA 2PBZA 1NASA 3B3QA 3P0JA 4ND8B 3B48A 3HQ4O 1Y81A 1VMKA 2EDCA 2QTGA 3NHLA 4H18A 4TQAA 4TV8A 4PO3X 3D64A 4TKLA 2FPMA 4YA6A 3R76A 1P73A 2J0VA 2YMPA 3DCYA 1KGDA 1IJKA 3L77A 3RU3A 3GUYA 1KIAA 1ECFA 4M38A 2QP9X 3JQ8B 4D98A 2G9NA 2GEKA 1BSVA 3H1PA 4CRWB 2HI0A 2BM9A 3L49A 3LNTA 4M60A 3AOEC 4BJ5A 3T8YA 4BE7B 4F0JA 1TYZA 3A1NA 1JFRA 1SVMA 3GLTA 3BT7A 4W63A 1K3UB 2CHQA 3CLSC 1OXUA 1T9ZA 2JI4A 3DB2A 3O83A 5CW2A 3VVBA 5C1DA 3PLAE 2QUIA 2QUAA 3M4JA 5CLHA 2Z9CA 3ZWQA 4FGWA 2WWVD 4F3YA 5CDGA 4ZEWA 1ZINA 2V0NA 1MAAA 3MOIA 1KHHA 1JJFA 3PFNA 5B7NA 5IYZB 3UJHA 2MSEB 1QYCA 2B7CA 3N0TA 3JQ7A 1M6YA 1NJSA 3V2UA 3O8RA 3ORFA 4W5RA 4MHTA 3EOBI 1IM5A 5DCYA 2NYUA 3T1OA 2ZIZA 3R8FA 3I52A 3OFSA 1VYVA 3IQXA 4QT4A 3I2YX 3GQVA 3MWLA 3Q5EA 5DWDA 1E4EA 2IIBA 2NSJA 4R2KA 1KDPA 5JRJA 2Y0BA 1S0UA 2KW5A 1GCUA 2JFXA 3OCYA 5GONA 5J2UB 3ZTTA 4JUDX 4DWOA 3HXOA 2FPGB 2Z4RA 4KC0A 1DBPA 4DTCA 3HCWA 3ZDZB 4XTCS 1ZRHA 2C8JA 3BX1A 1V7CA 4Z4HA 3FMGA 3LGAA 3K6SB 5ISMA 1D9XA 2ZBGA 3CKLA 2R96A 3CY6A 3PHIA 1G7RA 1I2AA 1IHPA 1SZCA 4EUKA 1U2ZA 3OKCA 2YHIB 2EJBA 1STOA 3WMFA 2GZ2A 3WLIA 3I5YA 3NUGA 4OCZA 1J4AA 2QD1A 4FZVA 4R3UC 4NZ9A 3KQQA 4HNUA 4MR9B 1B8VA 3MBKA 1JALA 2E49A 2D5LA 4DN6A 2XDQB 2FR1A 3ANXA 4KYVA 4DIEA 4Q48A 4X9XA 3AL0C 3LAWA 2H3HA 3I1YA 1FP4A 3FTPA 3WLEA 1XN4A 1VHDA 3PHJA 4WA7A 1SUDA 4CEIA 1P9NA 2UVDA 4MCHA 1DIAA 2CLFB 3R5TA 4GXNA 4A0GA 5JFTA 2QI9F 4ZVVA 3ZE6A 1JIKA 1PQUA 2OCAA 2PWBA 1U3UA 1E1DA 1R9JA 2AK3A 3AUKA 3CH4B 4H77A 3U0BA 1ZIYA 1OZAA 2K87A 1T43A 1TXGA 2COUA 3JPYA 3D0OA 3O4GA 1WW2A 5B58T 2QBYA 4EL0A 1CUXA 3G23A 3RS3A 1PVOA 2HWXA 4AS3A 2KX7A 3WLLA 4BJ6A 4E2FA 3HP7A 3STWA 1YR2A 5AI5A 5K3EA 3BC1A 3JRWA 3VKWA 4AS1A 3KB2A 4GQBA 4TL9A 3CH7A 4RJLA 3GLHA 5ALRA 4WKPA 4IILA 1D0IA 3M1AA 3QVUA 4BUJA 5C1IA 4WT7A 4WFKA 2R8OA 1HBJA 2FXIA 3PT5A 3DAGA 3IEPA 4QRDA 1RP1A 4GEKA 2M6LA 1SIOA 3EXHA 1LH0A 5D6OA 3KQWA 1FJHA 4DV0B 1NOIA 4PYMA 2QUZA 3JRXA 2SBTA 3FXAA 3HFRA 4BQFA 5A2QA 3E48A 2FOXA 4C5CA 3QWHA 4IWXA 1LLUA 3UB4A 5AIBA 4E6PA 1VA4A 2P5SA 3AUAA 2CLCX 3K1TA 4FUTA 1P2DA 4Q9DA 4RPKA 4RSGA 4XR4A 4ARBA 3ACDA 5LP1A 1Z2CA 3EEQA 4P4TA 3E7WA 3R5SA 4C0SA 1G8JA 1XDWA 4ZEXA 1U63A 2OGWA 3LCUA 5I7HA 1CB0A 1RJ9B 4IUBS 5FI5A 2QTBA 3X1KA 4FB5A 1IQ0A 4LNUB 2LD4A 3ESDA 1URPA 5EXTA 1Y6JA 1TQ8A 5AFSA 1GQSA 2BFDB 3A1VA 5FWYB 2I4NA 4D9KA 3ER8A 3IQZA 3QV1A 3TRIA 2L42A 1TCAA 3SYMA 5BWMA 5CUQA 2QRQA 3TB4A 2W22A 5A7FA 1PJCA 3F8WA 2M32A 2Q6TA 4NDNE 1ZZEA 3OTHA 4MUXA 8GPBA 3S3TA 4IV5A 1J2JA 4RQUA 1RCUA 4YCDA 1H3FA 1O9HA 4DHEA 2ZR0A 4CT5A 3BXHA 5JJKA 2PX6A 3B20A 4K0RA 2QAIA 2BZGA 3BKWA 2MINB 3R6WA 2OB2A 2HPZA 2R84A 3HJNA 2BGRA 2H5IA 3AVQA 3OCJA 2XCLA 2PH3A 3F5MA 1IZ9A 3NM5A 4GR9A 4GKJB 5CBKA 1L6IA 2FW1A 4XZ3A 1L5KA 4IUDS 4L3WA 2IIQA 4RJJA 2BGJA 2P1ZA 3NBMA 1HYEA 2D2FA 3U60B 2OGZA 4GSLA 1ORRA 1R5JA 2CZCA 4RKWA 3PYMA 5BYJA 5D00A 3I30X 3PGA1 4ND2A 3TXAA 1JSCA 4HWSA 4Q4HB 3A32A 3L8YA 5CU7A 1M33A 2DSTA 1FBNA 2C97A 5HZGA 3GJ3A 4D25A 2NN3C 3PC6A 3B52X 4A6XA 4KLNA 4YB8A 2JA1A 5LLDA 1ETHA 3EMVA 3LT1A