3NBAA

Phosphopantetheine adenylyltranferase from mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (ampcpp)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
156
Chain Sequence
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Kinetic, thermodynamic, and structural insight into the mechanism of phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 52
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nbaA00
4RPIA 2PFSA 3IMEA 3QTBA 4HPWA 2CT8A 3X1MA 4MUNA 5AHWA 4XFJA 1WY5A 3G5AA 3QE4A 4MWBA 1WQ3A 3PNYA 4X0EA 4HJXA 1X6VA 4HJRA 4ZCTA 2DLCX 3ILVA 3CLSD 3A05A 1U7XA 3RFFA 2Z08A 4ZCSA 4MW9A 4QRDA 1NUUA 3ZJUA 1NUPA 3CLRD 1K4KA 4UZFA 4TS1A 3PXUA 3U1VA 2TS1A 3CVWA 2QTRA 4NX2A 1QRTA 4ARCA 1KQNA 3Q10A 2IJGX 3IMCA 1EXDA 2PZAA 2R5WA 4Q93A 1Q19A 3ND5A 2ZP1A 1ULHA 1TQ8A 1K97A 3KT6A 4YP7A 2A1UB 1G59A 1H3FA 2AKEA 3AFHA 1JHDA 3VRHA 3DPIA 1LI5A 1MRZA 2WSIA 2OQ2A 5F23A 1TYAE 1O95D 1COZA 3VU8A 1MC1A 1TYCA 1A8HA 1N2EA 2HGZA 3G59A 3MLBA 1I6MA 4QBTA 3UC5A 1T6YA 4RUKA 4EG5A 4G6ZA 1JIKA 1XNJA 1ZH6A 2PIDA 3IUBA 1WJGA 3A2KA 4MWDA 3ISJA 2JA2A 4P2BA 2A1TS 5DK4A 1PFUA 5J58A 2E18A 4BWVA 1O95C 4JZYA 4ZT7A 1PFWA 3UOWA 2QJOA 1NZJA 1WXIA 4MW7A 1IQRA 3ZGZA 1JMVA 1BS2A 3TZLA 4PBSA 1TFUA 4MULA 1M8GA 3ND6A 1YIDA 2VXOA 4R2MA 3PNVA 1N2HA 1ZH0A 1MB9A 1YUMA 1WKBA 1MJHA 1WZ2A 1D2RA 1GPMA 3IDFA 2D13A 4EG8A 3ELBA 3SZGA 2H29A 4MVCA 4MW4A 1ILEA 1Q15A 2J5BA 3IOBA 1O97C 4MUEA 4UZEA 5TEVA 4F4HA 2QUHA 1N78A 3H97A 1KQOA 2PXHA 3H9CA 1NP7A 1VBKA 5EKDA 1B6TA 3RBAA 1F9AA 1IVSA 1U7DA 5LFAA 2JAXA 3HV0A 4I6JA 3N05A 1GZUA 1PG2A 2PZ8A 5K0TA 2NZ2A 3MMXA 2DPLA 4QREA 1VBNA 4MUHA 4XSVA 4YBRA 1JZQA 2O5RA 3FWKA 3IVXA 4NZPA 2E89A 4L2IA 2A88A 3TS1A 3TQIA 3CLUD 3C8ZA 1KR2A 3CVXA 2A4MA 4K0RA 4KKVA 1GAXA 1N2OA 1T9GS 3K9WA 1X8XA 2X3FA 3RK1A 4CDNA 1OWNA 1EUQA 1FFYA 3CLTC 2ZUFA 1WOYA 1JEDA 1XNGA 1NYLA 1K92A 4MUJA 2JANA 2D5BA 4GU5A 3M5WA 1N2GA 3RHSA 4CDMA 1TYBE 3F3MA 3IH5A 4WNYA 5FO1A 4NATA 1NUTA 2I1LA 3GMIA 1R6XA 2YXNA 2RE8A 1DNPA 1MAWA 2QTMA 2A7XA 5DASA 4EFKA 1R6TA 2DUMA 3BL5A 1KP2A 1O94D 2CUZA 4JXXA 1G8HA 5HUJA 5LLTA 4DE5A 1N1DA 1OWLA 2BTEA 2PZBA 3IOEA 4KR7A 5KCMA 3H9BA 5J5AA 3I05A 3G6KA 1PFVA 1GTSA 3AKZA 1U3CA 1YULA 4AQ7A 3S3TA 1IH8A 3GUZA 4MW0A 2A1UA 5FO0A 1GN8A 4MWEA 2X0KA 3CLSC 1J1ZA 2QUIA 4MAFA 5H7XA 4MW2A 3GLVA 2IP1A 1N3LA 2J09A 3HFJA 1RQGA 3CLRC 3LCJA 4KPUA 2X1MA 4KPUB 3H99A 2CYBA 2YWBA 1I6LA 3INNA 5TGTA 2QJFA 3N8HA 3H05A 1IFXA 1Y42X 4DNXA 1ZJWA 3FI0A 2CSXA 3KT3A 1M1ZA 2BYTA 1JGTA 3P0JA 1VLHA 2H2AA 2G36A 4ZCQA 3X1JA 3NBAA 3FH0A 4R0NA 1VL2A 3PRHA 3IOCA 1P7PA 3RJZA 2E21A 2O8VA 3L93A 1QTQA 1QJCA 3PNBA 3ZJVA 1PFYA 1V47A 4ZT3A 4U7JA 4JYZA 1IQ0A 1MB2A 1TYDE 3A4IA 3X1KA 4Q16A 3SP1A 1EFVA 3CVVA 3CVYA 4ZT6A 3P0HA 1OBHA 1EFVB 1NSYA 4H3SA 3ZIUA 2A1TR 1O5TA 2CYCA 4R2LA 5H16A 3KFLA 2PG3A 4E1AA 1KH2A 2AG6A 1R6UA 1M8FA 4YP6A 3K32A 1N2IA 4U8HA 3DV2A 1XJQA 1JEEA 5DEOA 3P0IA 1K4MA 1KKUA 2CYAA 1JIIA 1J09A 1NURA 1Q11A 3N2YA 1NUQA 1EE1A 2X1LA 2DXIA 1MBZA 5TEWA 2DETA 3ZJTA 4MWCA 4I6GA 2GM3A 1H3EA 5K0SA 4GRIA 1U3DA 3IVGA 3SYTA 4CT0A 1OWPA 1PG0A 2A86A 1M8JA 3OP1A 4EF6A 2ZUEA 2WQ7A 3FG9A 1EUYA 1Q77A 2VTBA 3FIUA 3MXTA 3QTTA 2VTBB 2Z09A 5DB4A 5BNZA 1O0CA 1EJ2A 3CA8A 1KORA 3KT8A 3UK2A 1KH3A 4MLPA 1OD6A 3CLUC 3FY4A 4ZT4A 3FETA 3ZXIA 5HUHA 4FZJA 3SEQA 1JECA 2CFOA 3FNRA 1QRSA 5KHAA 1T6ZA 4CQNA 1QQTA 1F4LA 1MAUA 4MW1A 1M8PA 1O96B 1NUSA 3NV7A 2WQ6A 3TZEA 1J70A 1VBMA 5IHXA 1WQ4A 3FDXA 1T9GR 1T6XA 4MUFA 1M83A 4U63A 1YUNA 4KR9A 2DERA 3MUEA 1N2JA 1V8FA 4MUGA 4WSOA 2DR2A 1YIAA 3TQOA 5LM3A 2J4DA 3KT0A 4EG4A 3FHJA 2B7LA 1KP3A 4DLPA 2CV0A 1JILA 3COYA 2CV1A 3L92A 1KH1A 1O94C 3MLAA 4K03A 3Q12A 1IHOA 3ND7A 3IMGA 4S1OA 1N77A 4DDHA 3AG6A 2XRYA 4ZT2A 2YWCA 4EGAA 1QU2A 4EG7A 3COZA 2E0IA 1M8KA 4NAUA 2WB2A 3D6UA 5FNZA 5TS2A 1JIJA 1O6BA 3DO8A 3FOCA 1WXGA 3HGMA 1H1TA 1H3NA 2QJTA 4ZCPA 5KWVA 1F7VA 3AIIA 1HYBA 1J1UA 1OWOA 4PY2A 4JXZA 3IODA 4MQ6A 3SDBA 2V0GA 4ZCRA 1YI8A 3TNJA 2XRZA 1I6KA 4EG1A 4NDAA 3N9IA 1GLNA 4YP5A 1EFPA 3COVA 1NI5A 1EFPB 1KAQA 1QNFA 3LE8A 1CT9A 4MW6A 2GOYA 4XFDA 5IJXA 4G5FA 1WXFA 2CV2A 4HK4A 4JFAA 1IQUA 1OBCA 1UFVA 2QUJA 1G8FA 1N2BA 2EL7A 1J21A 4PBRA 4YMIA 2HZ7A 4OJMX 2GKSA 1O97D 4PBTA 3VGJA 1TEZA 3IUEA 3E27A 2J08A 4I6EA 1XNHA 2YY5A 2A84A 4G5YA 4J76A 3HMQA 2DEUA 2J07A 1N75A 3ZXSA 4AS1A 4MUIA 3SZ3A 1IRXA 4ARIA 2NSYA 3LOQA 3RK0A 1MOPA 4J75A 4ND7A 2HMAA 3AG5A 1QRUA 1KQPA 3HL4A 4MVYA 3NBKA 1GTRA 2QTNA 4MW5A 1ZUNA 1WXEA 3UMVA 1G8GA 1OWMA 4NAHA 1O0BA 4DDKA 5HG0A 4MVXA 2C5SA 1I2DA 3AL0C 4MVWA 3UY4A 4ND6A 3Q4GA 1KAMA 1S4MA 4MUKA 3D6VA 4A91A 3JXEA 3CVUA 2RD2A 4KR6A 3CR8A 3CLTD 2AZXA 3IVCA 3OTWA 5JBNA 2EJCA 1SURA 1LW7A 2QUKA 5J59A 4F3RA 4EG3A 1J20A 1LI7A 4L2IB 1QU3A 2D54A 2IELA 2OV4A 1FYDA 1O96A 3COWA 3A04A 1WXHA 3HZRA 4ZT5A 3P52A 1F7UA 4EG6A 4OUDA 3SEZA 4DDMA 3DLAA 4DJAA 4OUDB 3ZUGA 2V0CA 2Z3VA 1U0BB 1JZSA
chains in the Genus database with same CATH superfamily
3DQPA 1NW8A 1SU8A 3KC2A 3Q7EA 2CNLA 3AR5A 3VQTA 2QP4A 4BLUA 1IN4A 1TVMA 1C1XB 2GF2A 2XOXA 2FLVA 3L5OA 2VNJA 4BB9A 1WZUA 1OFGA 1QS0B 1HUQA 3LXUX 3W79A 5DYWA 3RFVA 2DG2A 3RF6A 2FGKA 4PLPA 5EWJA 5KSPA 4JBIA 3U1TA 3LNTA 4KFUA 5KWIA 4F2DA 3TB4A 4WZZA 5BSMA 1LF0A 4HJXA 3N74A 3UHFA 3T12A 1WCWA 1E4VA 3DHVA 2FSGA 1VCIA 1ZDMA 2CKDA 2ZBGA 3VHLB 1P4HA 4WMLA 2JG3A 2WE8A 3R0IA 1FE8A 5AVZA 2XR1A 4OP1A 1VCOA 1NSTA 3CLRD 2X8AA 5TLSA 1ZJ4A 1IPEA 1KC3A 2XRMA 4YJ3A 1L5LA 1ZHFA 4Z2AA 2G1JA 3CVWA 4GBGA 2ZWOA 3IAXA 1NATA 4Y2QA 3LPNA 3F7OA 3FUTA 1U63A 4F56A 3PFBA 4ZEXA 3KK0A 5ES4B 5ALNA 2Z5LA 3I5XA 4RELA 2OAQ1 3HSKA 4CN9A 5DT9A 4FBLA 5EZ5A 2PUAA 1EVEA 3HCCA 1C3OA 2YRFA 3D8RA 1OX6A 4JB8A 2CEKA 1MRZA 4IQ8A 4OKSA 1V26A 1ZICA 3JZDA 3ANMA 5IM4F 3IIIA 4AJOA 1O4VA 4MIKA 3RIYA 4YWHA 5JAMA 1KFKB 2FUG6 4JYCA 4M60A 2ZREA 2HA7A 3DLCA 1U9YA 1YKFA 1C3LA 4RW0A 3WIVA 1JP7A 2ZZNA 1XNJA 3DTVB 4KO2S 1KTIA 3MCTA 3N70A 4P81A 3MTAA 4C3UA 1A5ZA 1YZTA 2ZU6A 4U9HS 4EAAA 2ZWMA 3TM5A 3AF0A 5KOJA 1XQ9A 3DW1X 1WE2A 3SD7A 2PD4A 2GJ8A 3OEHD 2YV4A 4UHKA 5CNMA 4BAZA 5JSHA 1WUIS 5JYEA 3ZE9A 1IAQA 2JI4A 4AY6A 4F6CA 5B1IA 5JQWA 3ET5A 4M9UA 4Q15A 3MJTA 1GRNA 3A2NA 2E37A 3QI7A 4TWIA 3ANXA 3FTCA 5FL3A 2RGEA 5DV9A 4F3KA 3JQQA 3TZHA 3NTLA 4GZ5A 4A8PA 3VDQA 3DA8A 2KBEA 4RFSB 2CZGA 3L4BC 1F8UA 3B3FA 2FV8A 2FEPA 4KMMA 3SF8B 1CJMA 1NKSA 3H1EA 4IDAA 3NBMA 3JD0A 4LNHA 4U5XA 3EGOA 2OZKA 1E0JA 3MAJA 3H16A 3N2LA 3QOXA 4RC9A 3WI7A 4RSMA 1N0HA 4BAGA 5KVSA 1J8VA 4R40A 2H7XA 3FGNA 3T4UA 3KSBC 1X7YB 1WKBA 1YZQA 2LCFA 4BGDA 3OA0A 3IDFA 1ZBQA 3KR0A 3FUVA 3QKIA 5I8ZA 4MW4A 2J5BA 3LKZA 3KXDA 3Q6IA 1EFRD 3NHFA 3LUJA 3QKTA 3IKLA 1G20A 1C81A 5DIZA 5ARBA 3GQBA 4U6NA 1YCFA 2I4LA 1DWUA 2RJ3A 4GUDA 3D7LA 4B31A 3DBHB 4LEIA 3RSHA 1PVOA 3MRVA 3G0CA 1BA2A 2I66A 2E55A 1S1MA 3DAHA 3MYRA 4CMIB 2OHIA 3GUHA 3S27A 3FR7A 2QDKA 1IZ7A 3K92A 1F12A 5FJJA 2NZ2A 1SULA 3L1HA 3VZQA 2DPLA 3S2IA 5B7NA 1JG1A 2ARKA 2A4KA 2JIOA 1LSOA 1Z4IA 3KAQA 1YZNA 4PHCA 1BMFD 1JLRA 5EMHA 4EO4A 4TTSA 1TDJA 4EGQA 4IXMA 1HXHA 2XEXA 1RQNA 4P34A 3GRRA 4ZYZA 1DEAA 1R2QA 1Q1AA 1PKEA 4ZDIA 2JIBA 1CUHA 1RKXA 4X7PA 3Q3HA 2YFKA 1U0NA 1FFYA 3OFSA 4MS1A 5LQNA 4CDGA 4IFTA 2H3HA 1XNGA 5DBFA 3MWYW 2YWGA 1JJBA 3CT4A 5ICFA 4YRZA 3R3WA 1YQTA 3V4LA 2JANA 4YAFA 3FGZA 5JCJA 1EXNA 2KB0A 1GPJA 4ZCLA 3UMCA 1TD1A 4CLOB 1E1KA 1ZVJA 2BRUC 4W9NC 1F6BA 4CDMA 3BZBA 3F3MA 4KR0A 1M66A 2RHGB 2HI0A 4GI3A 3E7PA 1NUTA 4I14A 1VJDA 2RE8A 2IOYA 5DBEX 1RXIA 1J97A 2WM8A 1W4RA 1FLDA 1ZIXA 4AZTA 4D25A 2R8RA 1P75A 1XPUA 2CUZA 3VR4A 2P9JA 2PO7A 3D5QA 1T1JA 3UF0A 3L7NA 3CNOA 2CFSA 1M34E 4EYKA 2FPKA 2W37A 2F59A 3I9KA 4FI3F 3BWXA 3CSUA 1S7CA 4BNLA 4ZAFA 4QJ3A 3LBFA 4JL6A 1G3RA 3C5CA 2P8JA 5CVJA 5CA0B 2QRPA 5LXTA 1ECJA 4C2UA 2HW8A 3RVNA 1UBOS 1H0KA 3BXFA 1V37A 4KQ1A 3HR8A 2FPGB 5EYPB 4HTFB 1HQYE 5FO0A 5H3HA 4YB8A 5IF9A 4R7TA 4CEJA 4L0MA 2C57A 2RJNA 3E6AA 4DIEA 3HGTA 2AB0A 4IZOA 5B64A 2MYPA 2HF9A 4CR8A 5E6UA 2N1MA 4JVNA 4WY5A 2B2CA 2CHGA 2VHXA 1K7CA 2FOXA 4FDAA 3S1AA 3V7YA 3OZUA 4BZPA 3E61A 1Q0UA 4U7DA 3VSBA 4MHTA 3QKWA 3INNA 2NVBA 3WKDA 3ZDBA 3L0YA 5EWLB 4BUJA 3FPCA 1NX9A 1WD7A 2SKEA 3AP2A 3LWDA 2CGEA 3I4FA 2NTYC 4IDDA 2W2KB 3I9NA 1KJNA 4ZCQA 5EMLA 3U81A 2GEFA 3M1LA 2JAOA 1T1RA 4QBGB 2J0SA 4ZOLF 3WQSB 3QX3A 1KI6B 2CBGA 2PHZA 4XM0A 4RA9B 2GS9A 4PPNA 2V4UA 2EHDA 4BFVA 3ZI0A 2GRJA 5I7SA 4NBKA 2NO5A 2IZOA 4DBZA 3NQ41 2DKNA 1EM6A 4O0LA 1IYZA 2HU2A 3FF1A 1KP9A 3L49A 4AZVA 1IQ0A 4AZWA 2XQIA 4EPWA 2H59A 3B53X 3GVCA 4Z7QB 3W3ZB 2IZZA 5KAPA 4RKRA 3SP1A 1VSUA 2B4YA 3I01M 1OBHA 2K87A 4LXHA 4OQMA 3RAGA 4B2IA 1F8GA 5DE3A 4IQGA 1XZJA 2OCAA 2JJ1A 5EEGA 4DLSA 3ZNPA 3IHKA 1E9RA 2B0JA 4D9BA 4F4IA 4PCVA 5BRNA 3H3XA 4GMGA 3C4QA 5IH7A 1ST2A 4Y2TA 3TF5A 2GCGA 2EKLA 1BS1A 2ENWA 1UZUA 1O58A 3CLHA 1NWHA 4AY3A 2UZ3A 3AV3A 2GEJA 3GH1A 4LOKA 3PFFA 1BHQ1 1V5EA 1KMIY 1Z4MA 2P9TA 2XNSA 2Y0EA 4P80A 3LU1A 4L57A 4BFSA 4BFUA 2D4AA 3RSGA 4NOMA 1YO6A 1XMIA 1ZJ5A 4KL8S 5FYDA 5SY9A 1JAHA 1L5HA 5DVZA 5HIAA 2ZSAA 4MUXA 4CF6A 2AYZA 4D3SA 3EW9A 5FNVF 2H17A 4KCGA 1A04A 2GN1A 2YUTA 1MT0A 3WLKX 3VNVA 2X0NA 3G7NA 4JEHA 2IHJA 3G85A 4KX3A 4NESA 2FZVA 4WKOA 5KCZA 2NO0A 4KVAA 3S81A 4NPCA 4OJQA 4M8NE 1PEKE 5JO0A 4X5OA 3SYTA 2WLSA 2YMPA 3TMKA 5JY1A 1UOOA 3L7JA 3OIUA 1E3LA 2CC2A 5AJHA 1QZ3A 2ZJFA 3SZMA 4DCJA 2VTEA 3CW2A 4FMCB 1RAIA 3KXIA 2P2YA 4C6RA 4YWJA 3SYRA 5LNK6 5CB6A 4N18A 4YIHA 1CD5A 1NRWA 1MGOA 1DJQA 3ROGA 1TPZA 1UDCA 1RM0A 3LH5A 3QTTA 2VTBB 3HDYA 4C0XA 1NXWA 3L05A 4OL9A 4LC0A 2Z2XA 4LC1A 3OOYA 1DEXA 1CQJB 1V8OA 1TCBA 3L6BA 2YXLA 1O9BA 4LZZA 4US0R 3E4CA 1T0UA 1YS9A 2WA1A 4O63O 5ISMA 2PXCA 5FPYA 4XIFA 3T1HB 1J42A 1J8YF 1MPTA 2FB9A 3OLXA 2PUVA 3N2GA 2NSJA 4MRSA 1NXXA 3IYLW 4O2LA 4RHFA 4DZTA 3ED1A 2I99A 3HDJA 2YC4C 2Z83A 3OC0A 4EYOA 1UPFA 1VBMA 1XF1A 2ZRPA 3QBVA 4M1QA 3SC6A 1EJ0A 4MRPA 3O4RA 5HF5A 1ACMA 3HJBA 1D09A 1SCNE 1BN7A 3WHPA 3HL0A 4CHTA 4G86A 2IDJA 2YDYA 1LK7A 4DCPA 1Z36A 1U0RA 1KI7A 4N3BA 4DWOA 1DHRA 2OTCA 3KQNA 4WKCA 3TIGA 3KSMA 2SCUB 4U7HA 2J5KA 3CW9A 4MUGA 1PL6A 3I9V6 3DZDA 4J3JA 3SJBA 1EJBA 3ZZMA 5KTSA 1P9OA 3MCUA 3I9OA 4E09A 2GNOA 1JEQB 3FOEC 4Y2SA 1FMLA 2V7BA 2BZSA 2QPOA 1XHLA 2CV0A 2R1TA 3G5MA 4KKXB 2JIZD 1O94C 3EMBA 4EY6A 2PN1A 4K9MA 4OHYA 2IU6A 2W6ZA 4P4NA 4W7IA 1N77A 1SZPA 4H0NA 3L02A 3Q7IA 1W4ZA 4WCFB 3C74A 4CKCB 2Q4OA 3CEHA 4X94A 3R41A 4D5EA 2Y1KA 5I7AA 3PHCA 4Q3EA 4JLOA 5B3JA 1ZAKA 2QJRA 3PQ3A 4BCBA 4NV1A 5LYJA 3AVWA 1SQSA 4NYJR 3ZDRA 4DJ5X 3IELA 4HX2A 4NVRA 3GVXA 4JY7A 2C07A 2NUBA 3AIIA 4N5DA 1OWOA 1NPDA 2FHPA 4OXRA 5G3YA 4HFRA 1NBMD 3I1JA 4US1R 1H1LB 4CM8A 3QWAA 1RLTA 2HCRA 2I4MA 4H3KB 5KEIA 4DUYB 4M1MA 1G9TA 5EZYA 4GX2A 2XWQA 1NF2A 3T5DA 4DG9A 4DR7B 3D2CA 2Q1WA 4KR3A 1Q20A 3NRBA 4CM1A 5LP6A 1IN1A 4FEYA 4L78A 4IGKA 4GL4A 1RXSA 4XCXA 3WRWA 4DXAA 5IZ4A 9MHTA 4MW6A 1COWD 2PEYA 3IQDB 2OA0A 1YHYA 4A5SA 1NVBA 4GQIA 2WTUA 5HOQA 2VDKB 5DW0A 3HA5A 2CNBA 3HP7A 3OCWA 3UJCA 4BYGA 2PX6A 2PQ0A 2O1SA 2P27A 5GM1A 5A06A 1D8TA 1XMQB 3EARA 1RAFA 1UFVA 1KVQA 4HWRA 1T43A 4IQ0A 1E3IA 2A67A 4NYJQ 3DOFA 3WK8A 4JEUA 3OIYA 5F52A 1M5TA 2EJTA 3R5XA 4MEBA 5E4TA 6ADHA 3CUVA 1G17A 1WMEA 1XXLA 3KUXA 3QY0A 4NFYA 3WMXA 3RI3A 3QK7A 4KVGA 6CHYA 1BEUB 1X8LA 2WQZA 2RAUA 2XI4A 3NDJA 4CIVA 5KYWA 4L3OA 3R3SA 4UTZA 4Q9JA 2O0MA 1QDUA 3WISA 3IB6A 4TSRA 2F1HA 2QPTA 2WUDA 2R6DA 2I6GA 3LZ6A 4CCYB 5LZ4A 4XLLA 4JJ6A 2RIRA 5DGTA 1HLFA 3S70A 3ZY2A 3V6LA 5CTJA 5ADWA 1Z8FA 1VB3A 1VI6A 1DE0A 1YR1A 4KDCA 3TBFA 4CM5A 5IT5A 4O1MA 1GTRA 4CGZA 1YTUA 5I3CA 1LWNA 1DV2A 4URVR 4FFMA 2X9VA 3S2SA 4RTQA 3DPUA 3H9GA 1OWMA 1QOZA 3CF6R 3KHKA 2C29D 1JG4A 3CRVA 2XTNA 2PH1A 1LBIA 4QBKA 3WA6A 4DQUA 4BNVA 2H65A 5ALUA 2NYVA 1XZIA 3B2EA 4L7QA 2VAWA 3U19A 4AY5A 4I4TF 4ZVRA 2TMYA 3OWHA 1BDIA 1FX0B 1I36A 4QJBA 2M2IA 3DE1X 3PQDA 3U5TA 3N2KA 3N5CA 2QZ9A 4FGKA 5BP7A 3GLKA 2HT6A 4RTJA 2AZXA 1RJEA 4JKYA 5JBNA 3IP1A 3UGJA 1M1NA 4TLLB 2G28A 4Y9UA 2FR0A 2Q4TA 1IBSA 1BCRB 3U9LA 4MAAA 3FOFC 4WHMA 2QUKA 4US2R 2B1IA 5HEKA 2CE7A 4MS4A 3IPXA 3ZW8A 3NHKA 1MC4A 1TF7A 1O96A 2G9QA 3R7NA 1BE8A 4N03A 1X1CA 5JVDF 5C4MA 1XVUA 3DSRA 3HEAA 4RMJA 2UZ4A 1B2LA 3LUCA 1FU7A 3MGAA 4OSPA 4EG6A 3RYFA 4F7WA 1TJPB 2AJBA 4I46A 4P3KA 3CN9A 1LLFA 2H9AA 5BY2A 4DNPA 3VR5A 1ZIDA 2XGOA 1G291 5CAEA 3OF5A 1XQ6A 1U4OA 2X19A 4HB2A 2BE7A 1L5ZA 4N3NA 4E5YA 1NXSA 1EZ4A 3U3ZA 1XKLA 1QQ6A 1RRVA 1D9XA 1XHEA 3IC5A 4LY0A 5TMEA 1SRRA 2QGZA 4DLWA 1W4AA 4DB2A 2HDNB 1TYEB 1ZL0A 1SVUA 4FMDB 3C3DA 4NU6A 4TL8A 2I91A 3R3YA 1UMCA 4IIYA 1FEZA 1DTWA 1DC3A 4V2UA 1QOQB 1AQ6A 3GJZA 3OZ7A 4WXPA 1EJ6A 2WWTA 1PI3A 1Z37A 1G64A 3RNOA 3NALA 2DPHA 3BM5A 4MUMA 1TCVA 5BN5A 1E3EA 5EIOA 1YRBA 2CVPA 4CFZA 2A9RA 5KJ1A 1CNEA 4LVUA 2W2OA 2BT4A 3IPYA 3MILA 1NVDA 4IJ5A 4M1EA 4C04A 4EHBA 5KNCH 1M6YA 2VRNA 3FHCB 3ZWQA 3NBQA 3H9UA 4M8SA 3KKEA 4GBED 4BX2A 4K40A 5AVYA 3PUXA 4ES6A 4EX7A 1QIEA 1AG9A 4YJ3B 4ONEA 2EW2A 4ZYTA 4R51A 3WGHA 1TJ3A 4JN6B 3PEEA 3Q88A 5CDTA 3EZNA 3V2GA 3T9DA 1YS2X 1FDSA 2DBQA 2JGDA 4IDOA 5CA1A 4NSNA 1TQ8A 2G06A 4ND5A 3GOHA 4D98A 2A1UB 3GXOA 1AU9A 1ZA2A 4GL2A 4QDKA 4OB7A 1NI4A 1V7QA 2AEJA 3EWNA 1Y3HA 2BFBB 3GRKA 4Z9XA 4P5EA 1C3OB 3DPIA 5DU2A 3TIVA 4B45A 1C3EA 2GCOB 2YS7A 2FPLA 2JDID 4M46A 3JAWB 2WSSD 3ZV6A 1W48A 3K9NA 1CRLA 5ITVA 1RYDA 3EOAI 3OX4A 2PGJA 4HLNA 4HXGA 4MYRA 1Z73A 5DNEA 1I6MA 1ZVKA 4ASUA 3VR4H 2NSDA 2FPXA 1L2TA 1TUIA 2P90A 1WB4A 3LMKA 1G3UA 5TV2A 5AQ1A 1VXOA 2YCBA 1EE2A 3TNFA 3ZDDA 1E69A 4YRDA 1TZMA 3PFGA 4DA6A 2NQ2C 2J7PD 3G2OA 4IQ4A 5CBKA 4RPLA 4HRAA 1IL0A 1SCKA 2BGLA 2XKBA 1N2XA 4C29A 5KOJB 4RPKA 2E5LB 1MIOA 1DAMA 1PFUA 2O2XA 4L3WA 4H1HA 2H1RA 2JPDA 3HACA 2VSNA 1FMTA 3S2EA 5J58A 3O8RA 3EVFA 3AB8A 1UBSB 2JHFA 3CN7A 3WLRA 1G2OA 3BJMA 3R3ZA 3SQLA 4CNQA 1XQXA 1N7GA 1FQWA 3NORA 4I1SA 3K5PA 3UHJA 1M5UA 3EISA 2HF2A 4PLVA 1XEWY 3Q3EA 1LPSA 5EGNA 4FC7A 5ALDA 5HNKA 4C0WA 2WAAA 3QGMA 1YIDA 4Z4CA 4RLFA 1K8XB 1UFRA 2E4VA 2Q3MA 1ZH0A 4M54A 1QG6A 2G72A 3PJEA 4DCUA 1DINA 2NTVA 1CQPA 2BZ0A 5JADA 3LRTA 4CTKA 3O8NA 1WZ2A 3UA4A 3K1JA 4BAUA 3IEPA 4LY6A 1SXJD 2ZRCA 2EQAA 4QE3A 3CXRA 4JQOA 1KJWA 5B2ZA 1FYEA 3EZ7A 2NQTA 3HYTA 3PICA 4BHTA 4G0UA 2ONYA 1BYUA 5EKDA 1NP7A 2J5RA 3FJOA 3JQGB 3MF4A 2RGCA 3GQBB 2OFFA 1VMEA 4L9AA 3C6YA 1N6PA 1U7DA 1ZY2A 4PWYA 2FUNB 5FHQA 1CY8A 2L69A 2G4LA 3TB6A 1QE0A 3KG2A 4XWOA 2PZ8A 1RM5A 4AO8A 1YOVA 2NVWA 2BH9A 5EJGA 4TTPA 4G01B 3U9TA 5F77A 3WK7A 3P96A 2MU1A 1CC1S 3H5TA 4HN9A 4ENQA 1X1TA 3HJAA 4B74A 3ONNA 4JLDA 5DDIP 2W48A 2R2AA 4KO4S 2ZAYA 1F8YA 1CXZA 2NSHA 3ADDA 1E3JA 3QMMA 1B4DA 1MJFA 2G1KA 4NNJA 5KKAA 5CLHA 4NZPA 1UDAA 4J29A 5BNFA 3KU1A 4F9GA 3MJFA 4TV9A 3EF1A 1PW7A 4RKFA 1GV0A 5CEJA 1DJOA 1VOTA 5EXXA 4AP9A 1HT2E 3URMA 2EF1A 3A11A 3K9WA 5HGXA 2RARA 1Y3CE 2DGDA 3L8MA 1VM6A 5GY7A 5J1TB 4DSZA 2MSWA 1XLVA 3Q3IA 3CLTC 1N34B 4EO9A 4QBIA 4DABA 5AP9A 1CZOA 4HFMA 4CUKA 3P20A 2M6SA 2VYVD 2DBZA 4MV3A 4PX5A 2IHVA 3DV9A 3NYRA 5I9MA 5I7HA 4G97A 2P4QA 4MQEA 4D4HA 2P9GA 3I5AA 3F6RA 3PRYA 1Y7IA 1Y98A 3VA7A 2CCGA 1JBKA 3EAGA 1G1MA 4GUAA 2PSSA 4NQZA 1DVRA 3RLFA 1MV8A 1L4YA 3ON5A 3TEMA 2EQBA 3NUGA 3UW3A 4EJ6A 3A27A 3OI7A 5A2QA 4LOAA 3WAGA 2QSJA 3DHNA 1N2CA 2FWPA 5B57C 4XI9A 5EE0A 4RZHA 4X7MA 5JV5A 1F20A 4IICA 2PD3A 1Y3AA 4K6KA 4NYIR 2I4IA 1DKOA 4K28A 1MVLA 4KTVE 2APJA 2OMEA 3FPLA 5IABA 2H9IA 1UBEA 2FUEA 3AEUB 4C7VA 2AG0A 1V1JA 2B6HA 2QUZA 1WS6A 2XWSA 2X9LA 2HU5A 3O2QB 4RK1A 4EFDA 3IRUA 2Q0SA 1RRMA 1E58A 3RS9A 3T5AA 1EP1B 4JOSA 4EEKA 1SXQA 4KP7A 3LV8A 3L6CA 4ENVA 5J4LA 3ID6C 2VH5R 4C06A 5A4FS 4YV0A 2HMUA 3R4CA 3EPHA 2Z3ZA 3LYLA 5L3VA 3AVOA 5LXTB 2LKCA 2R79A 3DH0A 3EDRA 3KVNA 4XTRA 3U4QB 1VIYA 4TMVA 1AK1A 4HAWA 3GUZA 1HDIA 1X8JA 1JHUA 1NJFA 3EB9A 5J2TB 4CEJB 3B6MA 2H7CA 3CLSC 1R37A 3HYRA 3W34A 3NVKI 1T5SA 2QG4A 2IP1A 4IGEA 2X5NA 2FWJA 4LJ8A 4OHMA 4Z9AA 1OLOA 1V16A 2UYQA 4MVJI 3AK4A 5AVXA 1Z83A 3H1AA 4MHSA 4V38A 2AOUA 2ZTMA 4NAVA 5JZSA 3Q9UA 3EEIA 2DX7A 2RB5A 1EUDB 2HDHA 2VQDA 1EPUA 2HCBA 3EY9A 3MRXA 3QPBA 4QUBA 2CYBA 5AOAA 1UQTA 2FQQA 2QZJA 2XDQA 2ZR8A 2QLLA 1B0AA 3N8HA 3L6EA 1IFXA 4ZD6A 2AEEA 1MP0A 3QVXA 3FYHA 2AR7A 2ZR9A 3VVMA 2WTXA 4L4ZA 1E0SA 1N6NA 2C4UA 2V58A 3OJWA 3ZWPA 4BNIA 1MH1A 4G8DA 5B3JC 1CIPA 1WPRA 4HRXA 3TK1A 1VL2A 2R62A 3OEHA 1G1AA 4HR7A 4C07A 4IS3A 1NI3A 4HN2A 4MP6A 3L7YA 4MEJA 5T8KA 3JYPA 1X14A 2GT1A 1KRHA 5JE8A 3A6EA 3H9JA 2FFJA 1Z0ZA 1CDDA 3L40A 1GR1A 4ALLA 3TTTA 2R84A 3MNFA 3RRYA 2VDWA 2W2VA 1Y8QA 1EE9A 3IMFA 4U7JA 3ZBQA 4I4IA 4EHHA 5AI4A 2EFJA 1EDBA 4JU8A 3P19A 1NR7A 1RWPA 4RIHA 2JB9A 3ZKAA 3VNQA 2FTKE 4LF6B 2NPIA 4MGKR 1M1YB 5LP6C 3H0KA 1JDUA 3IESA 1NG9A 4X1KB 1JTFA 5H16A 1TAQA 1POWA 1YNSA 1ZMTA 2V65A 3LY5A 4KIGA 1ONOA 2CE2X 4DC1A 2H2HA 4D41A 1EFRA 4OGFA 1MQ9A 1JMYA 1U7OA 4QRIA 3K9LA 5CX1A 5EXSA 1YZKA 2F9FA 5CG2A 1Z5PA 4NZOA 1FTWA 2Z9BA 2ZB4A 4G1MB 1IK4A 1GTJ1 2BM8A 4TLDA 3NVAA 4N41A 2KHZA 4HLUA 2RGDA 2GK4A 4FFOA 2DTDA 2V6BA 1KKUA 4AXXA 4YAIA 3SGLA 2LUOA 4TWBA 1L5HB 1G7CA 3AONB 1TMKA 3RRNA 2ZYAA 3ZC3A 1GKIA 1EE1A 3IQIX 3NHSA 3DMGA 3RARA 2C59A 3HO1A 1NY5A 5U1PA 5BWBA 5IVHA 2XE7A 3G8BA 3KKZA 2NW6A 4QTUB 3JVEA 1HFWA 4QYTA 1PZHA 4RGQA 1GT6A 3U7JA 1YDFA 4DRXA 5AVTA 2JKYA 1E77A 1KK0A 1TW3A 1TIBA 1OWPA 4CMBA 2R9VA 1ORIA 1OZFA 5K6RA 1BMFA 1BMTA 2XMPA 1IB6A 2AOVA 1ONNA 3CKYA 3JWGA 5I8PA 2YNMD 4R8MA 4TZ6A 1K1EA 1TQ2A 2PLAA 2WFZA 4UVGA 2OXRA 2O2EA 2X0RA 2YQ5A 1Y3IA 3CRMA 4IMPA 2WQ7A 1JDVA 1B16A 1OAKA 3S5UA 1CQZA 2GWHA 4G5QA 4K9OA 1J2JA 2FCAA 5CJPA 1DAFA 4YO8A 3CKKA 2YMMA 1QHXA 4ZZIA 2BI8A 4PU0A 4OQDA 3TKAA 3VJRA 1GGMA 3ZNQA 2IGTA 3UK2A 4R8KA 5FBLB 2JGIA 1KH3A 2FWRA 2HJRA 4KQKA 2E4YA 2Q5LA 5CB0A 4IILA 4PX2A 4ZAYA 5G0UA 4X60A 1Z12A 5HUHA 1KI8A 2AFHE 2VCHA 3PJGA 2XUGA 2M6KA 1AH2A 1BDMA 1T36B 3AR6A 4HQFA 4HAUA 3UOAB 4UXIA 3N2GB 10MHA 2JLVA 1DQZA 1LBTA 5IF3A 2P9YA 4D6YA 1Q21A 3BMQA 1VRCA 1Z2AA 2QLBA 4Q7LA 4E3WA 2X5JO 3NXKA 3AQ4A 1JVNA 1OA0A 3GIDA 4PO3X 3LIPA 3RC9A 3CRZA 3E9YA 2KW5A 4JBNA 4O2BF 3X44A 1T15A 2H5LA 2HYIC 4PHTA 2C8KA 2VP0A 1OHHA 1L7AA 3KOWA 4BLOA 4NOKA 4F6RA 3PQ4A 2W6CX 2DR2A 4DCMA 3GPDG 2GO1A 1OZHA 4YRLA 1YBFA 5SYNA 3B8EA 3V7WA 3U60B 1NJ2A 4UCWA 5E0KB 1IN8A 4DAEA 4UZSA 1KP3A 3ZCXA 4D8UA 3VZPA 4DA0A 4HI0E 1J24A 1UPTA 2DTXA 2R1TB 4K03A 4ZQFA 1FQKA 2GN9A 3G2KA 1U2QA 1U8AA 4EGSA 1KF0A 1LZLA 3R7WA 3IKJA 2FZLA 1G5PA 1Z13A 3I37X 1K8QA 1ND6A 1H05A 5C8DA 1MAVA 4PO1A 1PJTA 1MKYA 4HN4B 2YIJA 3GC6A 1E4EA 5A7HA 3FYSA 5JSFA 1M8KA 3THXA 2CL6X 3VR5H 4K2HA 4Q05A 2X86A 3E70C 4IOMA 5LYJB 4AWAA 2Z2YA 4MO9A 2WB2A 1O03A 1P29A 4UM8B 2I2WA 1JTVA 3HY3A 2YTZA 3R6DA 4J6EA 4QUEA 2NZ8A 1G6Q1 4M0KA 1UL1X 3GYGA 3KLNA 3R7FA 4IYRA 5ARDA 4ARZA 1QZUA 4ER5A 4Q6WA 3JWPA 2J85A 2ZRMA 2O8BA 1YI8A 4WLFA 3DDWA 3ESAA 5JD6A 3JQAD 1GARA 3ORSA 3WLSA 1BWQA 5IW8A 2IYOA 4WK2B 3OQJA 5EZYB 3GU3A 1Q16A 1N2ZA 1E79A 2IHKA 1KSHA 5AK5A 5FBWB 4EKDA 1DDIA 4YJ2A 4OHVA 1WABA 3NT4A 4OXIA 3AVVA 5BW6B 3VR6D 1CQIA 3QFSA 1NBEA 2HHLA 5BNWA 1R1DA 2VI5A 4JFAA 4DLUA 3SKVA 4BBZA 1FBTA 5IDQA 3E9ZA 1QTIA 1NW6A 3G88A 3QUAA 2B8WA 5SYMA 5IN4A 1QP7A 1QF6A 1KYQA 1JLMA 3G9UA 3W4JA 1M0WA 4UNIA 5C4IA 2ZJOA 1SXHA 4O4IA 1OBCA 2VEDA 3S5JA 3ZHBA 1G8FA 3R5TA 3WFIA 1BWPA 1KQGA 3JVIA 5EJMA 4PBRA 5TT1A 1NVFA 2HZ7A 5A0FA 4O33A 2XDYA 4C6SA 2LCQA 4CBVA 2Q3LA 3LFHA 4I4NA 7ADHA 4OV6B 4J6FA 4JI4B 4P4SA 1OUMA 2Z5VA 4DBLC 2Z95A 1XZFA 5CT6A 3OT4A 4V0SA 4YRSA 2VJKA 3ONDA 2HRQA 3T5TA 2WEKA 5ULLA 2XEDA 3PDJA 4ARIA 4PGHA 1VIVA 4G56A 2IYZA 4MDYA 4UOZA 4J75A 2OPBA 1A96A 2GHQA 2JFFA 5TF4A 5MGNA 2HTEA 1W75A 1N5DA 2V5VA 2RI1A 5BV1A 1GPYA 3BVPA 2JJMA 2Q5IA 3BDAA 1N6KA 2MYNA 5EP4A 3TI9A 3D3NA 4ZYUA 5HGJA 2VN8A 4UEOA 2VJOA 1SKUA 1NLMA 1PLKA 4JGBA 3O8OA 4DMFA 3HNOA 1P4JA 3E7WA 2H08A 4R1QA 3VI4B 2EATA 3BE5A 3GEDA 1UEIA 1GL6A 1ATZA 1OI4A 2IXEA 3LIIA 4K81B 5ALXA 3O83A 4FX2A 4ZRNA 4DZZA 1CRPA 1G8YA 3N87A 4AJ4A 4CVNA 5K03A 2DWOA 2Q6LA 2GASA 1NFFA 4S2UA 3T1YB 3MJRA 2YFHA 4KE8A 3I42A 4CT5A 2AG8A 3A32A 2NO6A 1J20A 4H1TA 1IZYA 1RKVA 5DN9A 2W42A 3QITA 4EHLA 1QQ7A 4MS4B 2ORYA 2R6FA 1KHTA 4CGYA 3MMPA 2AOXA 1KGSA 3WLMA 1DDOA 4RESA 2AI3A 2MYUA 1ULZA 4RM2A 1HRDA 2UUOA 4R1SA 3P2YA 2HRRA 4DSNA 3G5TA 1EFDN 2AUNA 3V1MA 4EVSA 1ZGJA 2O48X 5K3DA 1U0BB 2OC4A 1I5EA 2W71A 2I34A 2Z3VA 5CAEB 4NJEA 2DJIA 1X87A 1UODA 2SKDA 3UG7A 3MCAA 3A14A 4A2PA 5FTLA 2D3WA 1X9IA 1FRNA 1V5FA 2EOAA 3JQEA 3ER9A 4KN6A 2VKTA 2Y1WA 4JP3A 3JVUA 4QARA 1CLEA 4CM6A 4ZOQI 4FR2A 3UHAA 5BNTA 4CUJA 1DTWB 2G3YA 3U1BA 4X0EA 3KQLA 3O74A 1P7VA 2TRSB 2JIZA 5LZ5A 4LKOA 2G8NA 3ILSA 4YA6A 3SXJA 1U0OC 1ZMRA 3QHAA 1D2EA 2EP5A 1X86B 2YVAA 3G2LA 2NYAA 1PIWA 3BQ9A 1KDYA 1BVHA 2I6FA 4JFRA 4G8CA 1L5FA 2BFDA 4JLVA 4QQKA 1N6RA 4BMXA 4XJVA 2QMQA 3CX3A 1Z0IA 2C61A 1CCWA 1R50A 2FPIA 2I2CA 1XVLA 1RCTE 2HSDA 1DO0A 4RTMA 1CZNA 2WM2A 4HDKA 1OH7A 3D4NA 3O4FA 3LVFO 4HNUA 1C7QA 2O2CA 2QXUA 3W5VA 5JSUA 1K7EB 2IJGX 5JSZB 1VDZA 1MUUA 1PNVA 3LW8A 1NBHA 4FHCA 4DQ0A 2JGDB 1C7JA 2X4GA 1G3QA 3O03A 3EFOB 5CA1B 2YIVX 3OHMA 4PGMA 4FB4A 3EWIA 2YH2A 2O0JA 4I2VA 2UV8A 1NBMA 1QMPA 3A25A 2H1IA 3I0ZA 3PHIA 1NI4B 3QXJA 4FHFA 4A8JA 3DV0A 4UMFA 4R8RA 3QA9A 3GZNA 3K8YA 2ATIA 3BF8A 3IAS6 4FYKA 1COZA 1Z5UA 5D3MA 5HIMA 1TYCA 4GHWA 3BMCA 1L1FA 1VHQA 4L8YA 1VPVA 2BDEA 5M3BA 1YRLA 1UKZA 3B2QA 5ENZA 1VXRA 3GRZA 1CULC 3I28A 4IIJA 3T1NA 1COWA 3B6EA 4C03A 4D8YA 1UMBA 4N76A 2SNIE 3WFJA 5EGSA 5BVHA 1UPBA 3HJHA 1DC8A 1CUYA 5IAKA 1EX6A 4FFBA 3H83A 3TINA 1HM5A 1MIOB 3EVZA 2BKVA 4NG4A 2AC4A 3A3OA 1RI3A 3NW9A 3AFMA 4XA8A 5GGXA 4PNPA 3TTUA 2EEZA 4BGEA 1N0UA 2OUIA 2WAOA 3ANTA 4RY0A 5AI8A 2AI1A 4BE4A 1JMVA 5BOSB 2VTKA 4ID9A 3C15C 3VHRA 4PBSA 2PS0A 1RI2A 2ODPA 3M6IA 3TLGA 2E49A 4P38A 4IEEA 2WFMA 3SZLA 4NCJA 3HJNA 2HHHB 2QUBA 2XE8A 4JP5A 3UZUA 2H4WA 1QPBA 4MKXA 3R5KA 1TK9A 5T8KC 1D2RA 3EWAA 4DANA 4F4JA 4TSFD 3WXBA 4WXHA 4YDRA 2MIIA 4A6EA 4DRYA 3OVMA 4ZC8A 1SJ9A 3M4NA 4A27A 3OKCA 1CY7A 1MC8A 1VECA 2Q3EA 4L07A 1OT3A 5JAPA 5K51A 2UXCB 4OAQA 1I7SB 1UXGA 3OTHA 3PIIA 1UF9A 1SQ0A 5LPNA 1B8NA 2PKQO 3HO8A 1TUGA 5ALRA 4LJKA 3ZV4A 3C87A 2OAEA 2WD7A 1SB9A 1U28A 3IUYA 4JD5A 4KXLA 5EQJB 5LBIA 2ID8A 1ZX1A 1Q91A 2G1AA 3L8CA 1H93A 2XGMA 3R8XA 1JPJA 3NEJA 2YY7A 1WB9A 1C30A 1EFAA 3PSHA 1Z06A 2RGAA 1ZHHA 4L4UA 4RH1A 5G0SA 2XWPA 2C7VA 4RWEA 1V5WA 3ZJYA 1YOVB 4D42A 5K09A 2C7RA 1YAHA 4JVMA 2AYXA 4QREA 3PEWA 3TECE 4FXOA 3VH4A 3GJQA 2HIAA 4YI3A 1SIOA 3EG5A 2PPVA 3KVRA 1M1XB 4KREA 4HFNA 3GZ4A 3NTQA 4BMZA 4HLUC 3KVVA 1KR2A 3IHTA 3FCSB 4QPPA 5CD9A 1KOLA 2WUFA 4TV9B 2BEUA 5KYGA 1X1AA 2F3SA 5E2IA 2A5FA 5EOVA 1BKYA 3QKRA 2Q62A 4M9XA 4P82A 5TNXA 4OGGA 4CDNA 6ABPA 3IPCA 4XRRA 1PJRA 3H04A 2C8LA 3ROFA 3AZOA 2DH6A 1O4WA 3C3WA 3M3PA 4H4CA 1SC9A 4QDOA 5TE9A 3VYVA 3VVCA 2BPOA 4M88A 1I2MA 4N6NA 5T5QA 3ZCRA 4DLYA 1XJCA 4UTNA 1KQ3A 1N2GA 1MNAA 1YR7A 3KYIB 4BO0A 4C08A 2ECKA 3RSOA 1QE5A 4MMXB 4KPYA 1M5RA 4LJLA 4G37A 4PRZA 1N2CB 1APBA 2PRSA 2WKWA 1DNPA 1EUCB 4KMSA 4QPCA 5REQB 1CPYA 2XJ4A 5A7GA 1UK7A 3UWPA 3H13A 3BCRA 5JIBA 3KTDA 1C7FA 1JLLA 1CVRA 1ZU5A 2H54A 5AKYA 2EW1A 2RHMA 4DHWA 4TN5A 5HUJA 2O1XA 3QVTA 3W9SA 4ZYXA 1KC1A 3LRXA 4PICA 4MOWA 2E48A 1P17A 4OK5A 4Q3AA 1IQPA 2BISA 1O87A 3LBHA 1YZVA 1DX4A 1NP6A 4KEAA 4F38A 3IEMA 1YONA 2HUPA 3ZGVA 3P2IA 3LNCA 1DEKA 1G4HA 4J4HA 2ZYDA 3C8MA 4OJYA 1V4NA 1FS6A 3C39A 3CURA 1A27A 1JR3E 1ZRMA 3LP8A 3BYZA 3HBAA 3FPKA 3KUUA 4ZANA 1FZTA 4WFJA 3PXGA 4EA8A 2DHEA 3GLQA 3LO8A 2HNBA 3MD0A 1RM4A 2G76A 3WBFA 1NRXA 3MIZA 5HSGA 1RXCA 2E5WA 2JGFA 3EZ2A 3RGGA 1V16B 4I81A 1PE0A 1YJAA 4KPUA 4ZFNA 3VR2A 1GSHA 2JDIA 1U3VA 2YFQA 4RPHA 4ZMSA 1EVJA 3B1FA 3NH9A 4CLEA 5JRJA 3DR3A 1NRJB 1SQGA 3AM3A 3C7CB 1CJCA 4PNHA 1FXWA 3B13B 3L0BA 4EY7A 4B4OA 3HH8A 1LUAA 1MX5A 2VK8A 4GXQA 4XB6B 1GGEA 1HG0A 2ZTLA 3K6SA 5FOTA 3VSDA 2R7NA 2P6MA 1UDXA 3PFNA 4WGFA 1KDVA 4D46A 5FCDA 3CCFA 3TQCA 1PWZA 1HYGA 3GXBA 4N82A 4DTCA 2XXAA 3N58A 3TNLA 1BGVA 2G67A 4S1TA 5LQCA 2B21A 4YV7A 4I36A 4AECA 2J4FA 4QPNA 4ZTBA 2FW6A 2AJLI 1JBEA 2N0SA 1GNPA 1QJCA 4MROA 3M9WA 3U4DA 4AMBA 1ZKMA 1FOEB 1V47A 2R3SA 3DHYA 4WLUA 4H1WA 4QUJA 1J0XO 2GDJA 2VDWB 3K1AB 1Y8QB 4TQAA 4E5MA 3K70D 4I9UA 9GPBA 4R5HA 3I39X 4QL3A 1A7AA 3K4HA 2BCEA 1A4IA 3NTXA 4P5PA 2Y1XA 2KQUA 1GUAA 5H9WA 1GNRA 5JI2E 4HPJB 4MCIA 5J2UF 1NLFA 4XRGA 5E4JA 5AKEA 2VZLA 5K1ZA 2A2ZA 2XUDA 2HPAA 2HWKA 1RPNA 1SXJA 2PKWA 5KVQA 4OG2A 1A88A 1G98A 1R6UA 4FGJA 4UCFA 5JAQA 4D82A 5C1BA 2FN9A 1DAOA 3VSCA 4TZTA 2I7VA 1AQYA 2FX3A 3AKDA 3DZGA 3VC3A 4I1PA 5EZ6B 4U8HA 3OX3A 2EVWX 3BE6A 5KNBD 1MCZA 3SOZA 2CVQA 5D6NA 2P75A 2VOEA 1Q1QA 2AXPA 2YVLA 1PQPA 3IKTA 2J6IA 5DSTA 1GZ3A 1L7MA 4IO1A 4WASA 3KWJA 2J3LA 3CGGA 4FKMA 4IKEA 2IYVA 4TWZA 5F78A 3TPFA 2DXIA 1I1QB 4XQEA 1KFBB 1FDUA 1AXRA 1SG9A 2V8OA 3W5DA 2VZ9A 3WO0A 3WV5A 4LXIA 2WMOB 4MZDA 2C9DA 3KZ1E 3HXQA 1J2YA 5H68A 2V6MA 4UATA 1L3IA 2F4VB 3VTKA 4DRXB 2PUEA 3M2PA 1M2WA 4QICA 1J4AA 1RYMA 3FGOA 1XZKA 2VNIA 1G8JA 4OYYA 3WR5A 3IP9A 4J1SA 2EKBA 3RHSA 4HLCA 4FFNA 3FOZA 3GGGA 4K88A 3R23A 2I3ZA 2XADA 3BCUA 4JOBA 1NULA 1WMFA 1Y8RA 3DE3X 2HCTA 3WP0A 3STHA 4HZUA 4M7OA 1ZINA 2G9UA 2QVZX 3BMNB 3JQFA 1SCBA 4EYQA 4B8YA 3U0VA 4BWGA 3BK1A 2ORVA 5C32A 2CXHA 4W8HA 5DB4A 4YMWA 5DEIA 1KORA 2EZTA 1ZOLA 5DWQA 2FMXA 2HK8A 2VYVA 2OFXA 5K0ZA 5BN1A 4MLPA 3FDFA 4RL6A 5TT0A 1ZNXA 4NABA 3GJ0A 4RBNA 4ER3A 4XKJA 4GPAA 3WWZA 3ITEA 1UT5A 2JBWA 3KS9A 1SO8A 4EFMA 1PL0A 2WF7A 1F4LA 5IP5A 5JMTA 1L0BA 3S7TA 1EP2B 2VYQA 3IAUA 2ROQA 3I2YX 5CDHA 4NBSA 1QGOA 1XEXB 5TPWB 3BMQB 1WQ4A 3IBTA 2P9FA 4WADA 4DCCA 1GZHB 1NTOA 1S3GA 2GEKA 2ZBFA 4GGPA 3IXLA 1GD1O 4WKNA 4YMTA 1JV2B 2H3EA 3GLUA 5H80A 3U2QA 3GX1A 1Q12A 3S1AB 1Z07A 3DKVA 3N8IA 1V8FA 2RDMA 4GMHA 4F6RB 1YIAA 2PNJA 5CIYA 1YB1A 1ENYA 1SRQA 3M3HA 4YRKA 1U8CB 3LQ2A 3F5SA 5KOHA 3ROXA 2HM7A 2IYNA 3DF7A 4IG4A 4KRXA 4Y1RB 1MDBA 1T2DA 2CLEB 1SQ5A 1LBHA 5FX2A 3O3MB 2IYFA 3KKQA 2EZ9A 4JP1A 1ZGAA 2C20A 5MF6A 3T7TA 1N6LA 2OFPA 3MWFA 3LLCA 2HSZA 4IKOA 3M1YA 4ARBA 1R7RA 5KSWB 2IRWA 4V3BA 2YOFA 5CDFE 1M2VA 1XROA 1M9NA 2GN0A 2C8JA 5AVQA 3A4YA 4L7VA 4R9VA 4B6QA 4EG7A 3PR1A 4BEWA 2EJWA 3RVLA 2DQZA 1E4EB 2PWAA 4D3XA 1AKYA 1M1UA 1ML4A 2GXSA 4KHZA 2XAAA 4V03A 1MJNA 3D6UA 4BRWA 1QK3A 1FP2A 3SS7X 1W4CA 1SD2A 3CHYA 1N1EA 2PT7A 4KB5A 4HUTA 1CY0A 1KSGA 3AKCA 3DNPA 3SQNA 1D03A 2G5TA 5AM2A 3P2MA 4LTNA 4Y8VA 5C8YA 2NZUG 3PHBE 4AUEA 2P9ZA 3VKFA 1CETA 3BJEA 2HHCA 1KO7A 2O8BB 2BBOA 1YVRA 1UPUA 3IAFA 4M86A 5CH8A 5KC8A 1W2GA 3GG2A 1U8FO 3PQCA 5K3FA 1NI5A 3R09A 3E9NA 3KD2A 4X6LA 4MYCA 4ID3A 3ZWAA 3KQPA 3C1TA 3S4YA 3WDMA 4F3CA 2OXEA 3I83A 3LC1O 4QYMA 3ZBPA 2O20A 3W1EA 3T9AA 3WQRA 3QP9A 1W88B 1DT5A 4G41A 1N5KA 5F3WB 3PRKE 1LU9A 4BUZA 3AF3A 4ZVUA 4A8JC 4MRMB 2E87A 4KFTA 3DDSA 1J8DA 3JQBA 2EHJA 4X20A 2QLNA 1PS8A 1YB4A 2Q4BA 3E9QA 5AI6A 5LZ7A 4O4IB 3RO7A 2AQIA 2VWHA 3HEMA 3AIMA 1X9GA 1T0HB 4LPSA 4WZAB 4C14A 2XKJE 4V2IA 3ZW7A 1Q3TA 1IHDA 1QH8A 3EMDA 3T9BA 4IG9A 2P68A 3VGJA 2SKCA 3LF2A 2QXTA 3AYXB 5KTOA 1TEZA 3W90A 5ICGA 2DUJA 2J08A 1CUFA 1JQJC 5AKJA 5A03A 2IE8A 4RA6B 3HDHA 2CFRA 3RTGA 3KJIA 4GC5A 1HL3A 3TBKA 3ANNA 2QTHA 4MUIA 1YI0A 4ROTA 1MB0A 5DX8A 3THRA 3AWIA 3UJHA 1LVHA 1IBMB 3ZYCA 1YL6A 2IBSA 2W58A 2QW1A 4EKNB 4RL4A 3QE3A 4TQGA 1FNBA 2P9EA 3R7BA 1ZZEA 1Q17A 2WT9A 2O6LA 2IUYA 5JALA 1RMYA 3ILHA 3M89A 3G9QA 4Q6BA 4QDXA 1G8GA 3UMVA 2OCIA 3PE6A 1SHJA 2C0CA 4G89A 4WZBA 1QP0A 4Q3BA 5D87A 4TVKA 3ITKA 5G4LA 1DEOA 1UJCA 4GOOD 1DRJA 1VCNA 1VSQA 3O8OB 4JA0A 2R5NA 1UK6A 2YNMA 4RZ2A 5EUBA 2BEKA 2JD1A 3VPSA 3ZU6A 5HUQA 2JFPA 1VKRA 5F73A 4NTZA 4TTJA 2OUKA 5KPDA 3W78A 3GLHE 3DBVO 3EXG1 1EAMA 6NULA 2WSLA 1HO3A 2Y2VA 1R5OA 3IVCA 4NEHB 4PEVA 3ZHVA 1D0SA 4FZ3A 4I50F 3BXGA 3SIXA 4F5EA 2AE1A 2PZKA 1L5KA 1T29A 1PRYA 1U28C 1GVHA 2FKNA 4M9CA 4QVKA 3ADCA 4AUNA 3EVDA 3M82A 3OU2A 4U7TB 4CKEA 4YMLA 4N0EA 1GTVA 1JAZA 1ODKA 4YPVA 1WMDA 1XD8A 1XZBA 4CG1A 1DPFA 3VZSA 4QGGA 3DEHA 4R83A 3GCZA 4DQKA 4LMBA 5KWJA 2RBGA 4CKBA 1P3Y1 1T5TA 3C7TA 3QA3E 1EHCA 4OI1A 1AQUA 2AMVA 1NNSA 4MPTA 3W7VA 3AFOA 4YCSA 3BIWA 5AXBA 2VHZA 4MLDA 1E9VA 3NHRA 1T4MA 2GVNA 4I1OA 5EWMA 1LNZA 3IEXA 3RGWS 1YRWA 3V34A 3PIRA 1KS2A 3R8FA 1E3MA 1E4OA 3ZR4B 1U7ZA 5BSWA 2B94A 4JEMA 3TLKA 3KUCA 4NJEB 1GIAA 4FGLA 1UDRA 4R3UC 3H1GA 3FOAA 2A57A 1CUWA 2WIDA 4UBIA 5LLSA 2CT8A 3LBIA 3UB4A 4XFJA 2ZITA 4Q9IA 5K0LA 1Y9DA 3BA6A 1KKLA 2B20A 3BSSA 3LLUA 4ROSA 4B4KA 1V96A 4PW0A 1NSFA 1H4TA 4QHYA 4AJEA 4YMGA 1JKMA 1L5NA 4E12A 2GZDA 3DMNA 1FFXB 3QBTA 2CLDX 3B9PA 4PSDA 2ZIGA 4ZXFA 2XPCA 1YNOA 2QL9A 5TIIA 1NW3A 1UIRA 4H60A 1TC1A 2QTWB 3AVXA 1N5JA 4Y2PA 4UFPA 1CF4A 3WNQA 1O08A 2JEYA 1QSGA 1UJ4A 1TC2A 4YRMA 2CVOA 1WBJB 2V6IA 3AUFA 1F3OA 2HA3A 4FMCF 5EUCA 2YY6A 2XB8A 3OZGA 1WB5A 1GQFA 3FVWA 4MWTA 3UATA 1QJ4A 5EE3A 3QBEA 3F6BX 4WV3A 1VSTA 1W1UA 4FSHA 3P2OA 4WJZA 2IX3A 1XAGA 2VF8A 4YAGA 2P91A 2RH5A 4R7ZA 3AHFA 2HXSA 4JVOA 1ZCFA 1N6IA 5JR3A 4MXDA 5A0VA 2H2WA 2EZUA 2CJYA 2VZEA 1JQEA 1G0NA 4B0OA 5JUWA 2PGOA 2WWYA 5F12A 3N3AC 5D86A 1RYZA 5DM4A 3ZVMA 4U1RA 4MHOA 5A4KA 2UXDB 1KZGB 3IR5A 2W6NA 3DV0B 5F23A 5IK2A 1V6SA 1Y34E 3EIWA 3PUZA 4O59O 1BD4A 2HR1A 3MWDA 3GZNB 4M83A 4NG5A 5FQOA 4ECAA 5AESA 3BMCB 4AY2A 3ETGA 3QUSA 4OYRA 4YRJA 3SM9A 4RLHA 3U3OA 3GL9A 4DM7A 3W5IA 4M76B 2XT9A 1PFGA 2FVXA 1ZIOA 3VDXA 4HB0A 4IIJB 4CEIB 1IHUA 1AKTA 3L01A 1UMBB 2FMIA 4RIFA 3A2KA 1ZRSA 2OSVA 4NV0A 4KWHA 4IBOA 1AA9A 2JJ8A 3BHNA 4H35A 2Z58A 4BWVA 2IX9A 1EWTA 4HDCA 2WYOA 1PZEA 3UOWA 3A1UA 4MB2A 3DCJA 3BBPA 4KN5A 1IDN1 1L7NA 4ZYVA 4OHFA 1JFSA 1ZVVA 1PR9A 2FPPA 3BN3A 3NONA 3BFPA 2I29A 2CWDA 2GN2A 4X54A 5BV7A 2G08A 4XQCA 2ZIFA 2ZCUA 3SHWA 5LYJF 2CLSA 2P9BA 3F9IA 4P2GA 4R2MA 3TLGB 1GQ2A 1QGUB 1UKBA 4IOKA 3HA3A 4H31A 4LZNA 3DEYX 3RUEA 4AF8A 1XA3A 5E8RA 1GITA 4FFVA 1DS6A 1BX1A 1C2YA 1DO2A 5ECDA 3G2IA 1CEQA 2ZUWA 4ZRMA 4PYJA 1R15A 1VLQA 4R3WA 4S04A 1BRTA 2DC1A 4G4SO 4XM1A 4PNZA 1HQKA 2YJ6A 1XRRA 4HQ6A 2WWFA 5ALOA 3WLNA 1IZZA 2OEPA 2PU5A 5BORA 2VUTA 8MHTA 2C98A 3KQWA 1KQOA 3I8SA 2P7HA 3PYXA 5DMHA 1RWXA 5LMUB 2Q1UA 1SBIA 2PUWA 4RPIA 1AVTA 5E4FA 4IAOA 1YA8A 3OE1A 4GZMA 1Z0UA 2WD7B 4IIDA 4I6JA 4QYSA 1VL0A 3A4TA 4TKUB 1PQ4A 1RW4A 1VIDA 3R0QA 4QOIA 3G5UA 1ZI9A 1DRVA 1C30B 1SXJC 2WMNB 3RVDA 5G0TA 2IEZA 4B82A 5HA5A 2WSMA 5DIFA 3WHLA 2FXIA 3EPJA 3RAEC 5YASA 1D8AA 5JARA 5C0OE 1WR8A 2XZOA 4BYMA 5HQTA 4C30A 1LF5A 2LRHA 3ZHSA 5JRZA 3KQKA 2GILA 2FP4B 3CLUD 4CLXA 1KGDA 5FWAA 1LSSA 4ITRC 1HKHA 1IHPA 4DC9A 3D2AA 4OKNA 2VWQA 2JFVA 3QUQA 4GM1A 5F9HA 4Q12A 2ZJ4A 2BM1A 2OHJA 4IH9A 1G5FA 3EZYA 3Q3CA 2GJKA 3NJ8A 5T7BA 3ESQA 4DMMA 1L9KA 4E5NA 5H82A 2G88A 1C7IA 4UTVA 3AEQA 2BTQB 2D5BA 4IVRA 4HHEA 3AIOA 4RANA 4XLZA 3H1BA 3PFCA 4KXXA 4U7FA 5T57A 3ZOZA 1ZM9A 4A2QA 4EUHA 1H22A 1LJ8A 3GCWA 5FOXA 1U7WA 5H4GA 1SQ6A 2WJ6A 4FOOA 5H81A 3S2FA 5K20A 3JQFC 2IXTA 1QLWA 1XKTA 1W29A 2OCDA 3DBRA 1K6XA 1NHGA 3CCCA 1MAWA 3OOEA 4EP1A 3E5RA 4EB0A 1B8OA 3FE2A 1E66A 3JU3A 3L43A 4RTNA 3BH0A 4QODA 2WYVA 4XQ9A 2BP7B 1XHFA 2RHWA 1RE0A 2VHCA 2NUTA 1JLLB 4AJLA 4BQIA 1JG7A 4J1NA 3KDAA 1OH8A 5LLTA 4ZI2A 3AVPA 3RQSA 2WD8A 2PR7A 2XNHA 2X3YA 1D1QA 1KI3A 1LK0A 2ZRHA 1H85A 1RKQA 4F9FA 1NVWQ 2B8JA 1NZDA 2VSOA 1DKPA 5CH3A 5J23A 2QP3A 4PZEA 3L07A 4UVIA 1Z8DA 2JFYA 3KCNA 3R44A 1Z0AA 2BR5A 3TNYA 1D6NA 4BRUA 3CY6A 5CYOA 4JR0A 3SAJA 1SG0A 2OMKA 1EBFA 1SHLA 1YCDA 2ATCA 3ZE8A 4F9EA 4D6XA 4MAFA 3C3PA 1CR0A 4ZGWA 1JKXA 1O9HA 3DC7A 3QU9A 3LXMA 1CIJA 1I4EB 1JWLA 4LZWA 3LCJA 4R3NA 1QVVA 1R6AA 5EIHA 3RVSA 3VKHA 2HBZA 1Y33E 4KPUB 1RLUA 3RKSA 1XAHA 1O2DA 1GAJA 2FLKA 3MOSA 5HKAA 4D02A 3ZQ4A 2FW8A 5EHXA 4NOLA 4LF8B 1HK7A 4DEXA 2QYSA 1LEHA 4DARA 1XVIA 3A0RB 4ED9A 3KVYA 5AICA 3P0JA 1PV2A 1Z5ZA 2GETA 5H70A 5J4KA 2IUUA 3NIBA 3OCVA 4K6FA 2A35A 3W2EA 3C6MA 1R8JA 3FTQA 3AC0A 4COOA 2QK4A 1H65A 3PCTA 4PPGA 5AHKA 2O05A 3D2BA 2FMHA 3F6SA 1XFDA 3IOCA 5CW2A 2WJYA 2J3KA 1P9WA 3D0KA 2FW7A 1WY7A 4FFDA 4FMDF 3ZCPA 5EIFA 3BWDD 1TJ4A 5F5XA 2QM8A 3R20A 3PNBA 2JAWA 3PWKA 1QYRA 3TVDA 1UBMS 4DDUA 1TUBA 3P4UA 5JFTA 4M8KA 2ZIXA 3WY9A 2DPXA 4HZIA 4QWWA 3ZDQA 1TRHA 4EQZA 1P6XA 1ODIA 1TYDE 2V74B 4B6GA 2UVQA 3T61A 3N7AA 3LPDA 2IEAA 3I5MA 3F5FA 1XMXA 4EW2A 1EFVA 1PJQA 2JFHA 1A69A 2JL1A 3P0HA 4UUMA 2J9XB 4ZT6A 4JJZA 2HWUA 1G9SA 1XRPA 2G4VA 2PL1A 2W2PA 4IJ6A 4KQ2A 3Q8KA 3WRXA 3A9SA 1Z28A 4PV7A 1I3MA 4YJ3F 4G0PA 4O3FA 1P4AA 4TS9A 2PUCA 1SXJB 1VQ1A 1X7ZA 4HAXA 3WIEA 4LF4B 1VL5A 3TGWA 2PMDA 2IEDA 3KUKA 5B36A 4RD2A 3GEBA 4RIGA 5FF9A 3JQBC 2IE0A 3B6JA 1EESA 2L18A 1JU4A 3VOAA 2JHPA 2X1LA 3EIHA 4U0KA 1STOA 4G5OA 2XUIA 4Z2YA 4CMAA 5U9CA 1OXBB 1FXUA 1YHZA 1FMFA 2X22A 5A4DA 2XMCA 3VKGA 1W6UA 2XNKA 5CNJA 5ESWA 5C37A 4N3CA 1BGWA 4YUXA 1D1TA 2RGXA 4CN8A 2HN9A 3CUYA 3GDFA 2VHEA 4PQFA 4X64B 2HIHA 2DHRA 3UFBA 4V39A 1ZUWA 2JGLA 3PFWO 1Z0KA 3OF3A 2R6JA 2M9MA 1BQ3A 4JJKA 4P54A 1LNSA 2QI9C 3K53A 3CTMA 1Y8RB 4D79A 4DQXA 1EB9A 1GYQA 5AMXA 1T24A 4OLBA 1NASA 1DCKA 1Z4KA 2R25B 4EI9A 4UARA 2DQ4A 3P9KA 4IJQA 3CA8A 2XBUA 4BPBA 1HYEA 1M2JA 1OX5A 3ZDCA 3GGJA 4Q3OA 4LE2A 1QGDA 5LWHA 3A4VA 2A59A 3VR0A 2P2ZA 1PWEA 5HQJA 1P8AA 2W8BA 1RWBA 4ZGBA 2YNMC 3DM9B 2JGAA 3K94A 3H6KA 4J0EA 1YE5A 5IH3A 1Z0DA 2QQFA 3PWTA 5BN4A 4HC4A 4M8LA 5CFRA 4CQNA 2FN3A 3BT7A 1BS9A 1OXTA 4S3MA 5K0FA 2GBFA 1JYEA 2XXBA 3UGQA 1GZ4A 4D81A 2JAHA 5AW2A 1J70A 3BHMA 4O4JA 2FFRA 3G8CA 3IAM1 5FLYA 3MMSA 3PL1A 3ZKWA 3KQOA 1AUQA 3DT6A 3OOJA 2OWEA 3KVOA 1YVPA 1QVZA 4YNBA 5IAGA 2Q21A 4MCAA 2ZVPX 3HO6A 4KG7A 1ECCA 2NZWA 1NOIA 1E7SA 4B4VA 1F14A 2HF8A 4N9WA 3P9QA 3FPHA 3GRCA 4UJ5A 2D1QA 2YWEA 2DUNA 3PGKA 3VUFA 5F7OA 5KOHB 3GLFE 4BNGA 1N0IA 1WXXA 1ZD5A 3Q5GA 4R8SA 3VOTA 4P58A 4MWGA 4KIUA 2PMEA 4C4TA 2F7SA 4Q3NA 3GRFA 4J7AA 5KWSA 1NQXA 1E32A 1Q1NA 4PWZA 1CF9A 5K0EA 4O5AA 4LFBB 4QVIA 2JLAA 2PX0A 2DLDA 1K3TA 1XYYA 3K0EA 3V33A 1DRUA 4JUCA 2ZRLA 2VF5X 2ZSUA 4KYUA 3HCWA 2CL7X 2WJVA 1Z56C 2CWWA 4EPTA 1GPH1 4PRYA 3H19A 5EXDA 4CTMA 4UAJA 5KVAA 4PNEA 2XD4A 4P84A 7GPBA 3T3HA 3L6UA 1NVXQ 1LV7A 4FWIB 4M9RA 1JIJA 2B34A 5H3CA 3FOCA 3AFNA 1YQXA 1WHTA 3RHFA 2UZAA 2NV2B 1J1UA 3M1AA 4V24A 3UGTA 1YJ8A 3KAPA 3ZHYA 3UV7A 4DDTA 1CVIA 3UJNA 1FP4B 1HDZA 1E3SA 4NNPA 4XYEA 4NXMB 3V1TC 4KOAA 1L4UA 3O26A 3PPIA 1A5BB 3ONWA 2NVOA 4OJKA 3N9IA 1CS0B 1GLNA 4UNQA 4D80A 1KYZA 4ZQGA 5K3FB 2V7WA 4FWBA 4XX1A 2BR4A 4QU9A 1FDRA 1FRQA 1EFTA 4FZ5A 1KAQA 2BKXA 2G0TA 2G5PA 4BBAA 1IVNA 1CT9A 1F2UB 2OCGA 2N47A 1K6IA 2WLTA 1F1BA 3A10A 1R9GA 3ZBUA 3ELWA 1QR6A 3PF9A 1P60A 1M34A 3G6WA 3PNKA 1SGWA 5AK4A 1F2TB 4A0HA 2XB9A 4QTZA 1L8AA 3ZI4A 4BMPB 2W2TA 4D26A 3QSGA 2WHXA 3HXKA 4KQWA 4RDHA 5EKSA 4D9IA 5KYTA 4CLHA 3AX6A 4BZXA 2V45A 3G7UA 4MPRA 1MC5A 4GYKA 3WMWA 1B1CA 2XT6A 1ADYA 4R1PA 1GKYA 3MWJA 5LXTF 3GAZA 4GPD1 1SVMA 1YBHA 3JD1A 3Q6MA 4OFXA 3M6WA 1X80B 3TR6A 1E2MA 3J7AC 2CHUA 1UOPA 3TUIC 4M1KA 4XE5A 3QQ5A 4IDQA 1A9QA 2QRKA 2QBYA 3FYTA 4HNQA 3TD6A 1JXQA 2JZCA 3B3GA 1QH9A 4LRSB 1T13A 4RZUA 3RU2A 2ZW9A 2Q1SA 3WS7A 3ZQJA 4PCLA 4E2FA 1EK6A 3NIGB 3ZD9A 1XZHA 1MR3F 1E1LA 1B6RA 4TRNA 5FTJA 1WA5A 5EESA 5K3BA 3W2FA 3FUCA 4LXYA 4B8WA 3F47A 1H8HD 2ZVDA 5DYNA 4E11A 4FDVA 3SXUA 1THMA 5HKLA 1XE3A 4FJ1A 4L5JA 3VR6H 2OHOA 2UUCB 5BURA 4HBZA 3L0PA 3IIEA 3RRZA 1S89A 4G0WA 2Z30A 4NLLA 2WD9A 5EE9A 5JROA 2PMWB 4YR7A 1NMZA 2P78A 3VOSA 5CB8A 2ODWA 1A7KA 1XPOA 3WKBA 1EBUA 2B98A 1NVVR 2CBXA 2C5SA 2GVDC 3DE2X 4E30A 5TQVA 2LDBA 2C83A 5ALJA 3EQ8A 2REXB 3A1SA 1BEEA 1KAMA 4IIBA 5CDYA 1FW6A 4D9CA 4K0KB 2JJQA 2V7QA 3D6VA 3OKAA 1BTOA 2FG6C 3ENZA 1EBBA 4WBNB 3G7SA 1GAEO 4IZ6A 5DMXA 2C4MA 4AT1A 3CF0A 1E9CA 3OTWA 3B20A 4KXWA 5F9MA 1BDJA 2IZ7A 3VC2A 4XGNA 2Q45A 3P4YA 4YCAA 5H02A 1DC7A 3V1KA 2ZYIA 3P9XA 1RXEA 1U8TA 2H0AA 4X44A 4DMGA 1B0UA 2F1OA 1LI7A 3MYYA 4L2IB 4QBHA 3TNDA 1A72A 4P7JA 1GCOA 4Z4FA 3UW1A 4L6IA 4OBXA 1C41A 4CKEB 4D2IA 3HCAA 3K9GA 1YWGO 1P91A 1QB7A 5CM8B 1ONSA 1ZOPA 1SVNA 4B43A 5HF9A 2JCBA 3TQFA 2VHJA 1KWKA 3EYAA 3TYXA 4ZQHA 3QFHA 4IKPA 4CKBB 3GVHA 4QGFA 4EHFA 1QCCA 2HOQA 2AZ4A 4DJAA 1JHQA 3EGIA 1IJBA 2QRMA 3AUJB 3A9RA 3U44B 1NVVQ 3HN2A 1QZXA 3NOXA 2IPLA 4MQFB 4Y0AA 2IC5A 5EWMB 3TQRA 2RBKA 4B44A 1V7ZA 3VSEA 2H7YA 1OX4A 3CUTA 5IVKA 4H6WA 4MI6A 1CEEA 3RWMB 1NIJA 1KYTA 4GX5A 2I2AA 5B1YA 5FFFA 4LAFA 3QE4A 2RHBA 5HFNA 2IYTA 3A8TA 3EGVA 3AEZA 2QM3A 1R4ZA 1ISGA 1MFPA 2O0LA 1U3TA 3PE4A 5GOZA 4HUQA 5ECWA 3LG2A 5ALYA 3TLXA 4ZJZA 3KOMA 2DLCX 3S40A 3LKDA 3ECAA 2AFRA 3A05A 3N86A 1JB1A 1U7XA 1R4NB 1X3SA 1PV1A 1ADFA 5DNAA 3ANYB 2CHEA 3ZJUA 1XOIA 5KJFA 4YEDA 2PMKA 1OTYA 2VHUA 5KSYA 1SNYA 4ARCA 1D9ZA 3VPGA 3UUEA 4HF7A 1LLQA 3NWJA 1W36C 1DG3A 2H8GA 1NDHA 1RZ3A 2W9XA 4IEFB 4MJ7A 3K0FB 2Q50A 4Q4DA 5BUZA 1NVTA 1ULHA 1K97A 2HSWA 3PNOA 1MW9X 1P74A 3IO3A 2F8SA 2COEA 1H3FA 4N7MA 2ZAIA 2ZSIA 3AI3A 4LGMA 2YQ4A 1G5IA 2WSIA 3HWWA 1D7OA 3OY2A 1B6GA 4Q03A 5KX5A 5MFPA 3HXMA 3JQAB 3QENA 4AQYB 1JNXX 1YDEA 4AO7A 3O90A 1EZ1A 2R7KA 2HRDA 4PGGA 4EB6B 4BNWA 1U0FA 3L41A 3PC3A 5I9SA 3QVVA 4JOQA 1I2BA 2XF8A 4BMNA 4UTRA 2AX3A 2YHAA 3O3NB 1L4HA 3RKUA 1KZ7B 1M2NA 2J9FB 4OX9Y 3UM9A 1OIVA 1WX1A 1UDBA 1ICEA 1MRNA 2FCRA 2R6R1 4PYOA 5IEJA 1H94A 5A0TA 5JNUA 2CLOB 3C4VA 2DKFA 4Q3CA 4U2GA 1Q44A 1PFWA 4KV9A 4A03A 1WDWB 4YRFA 1U1CA 4G4GA 3BK7A 2C3PA 4M38A 4B75A 4RM3A 4DIBA 1ZK0A 2G7MC 2ZZKA 3OX2A 2AW3A 4MIEA 4A6XA 1K66A 2ZIAA 3UXHA 1XZEA 3DT8A 1YBAA 3JYHA 4Q4AA 1IWOA 3BRCA 2VPWA 1Y7LA 2GA8A 4GS5A 1F2VA 3O1JC 3GBPA 1LVUA 2N46A 2W2MA 5L53A 1EGAA 1C0KA 2X8JA 5MDHA 4EJSA 4EMBA 4YAEA 2ZRAA 1ULTA 2AV6A 5K0GA 4QASA 5L9AA 3OJXA 3EGCA 4NOJA 1VYTA 2R66A 1G6OA 4MVCA 1EHIA 1PX2A 3V8PA 3KLMX 1ODSA 3K2IA 4IRUB 5L3QA 1N25A 3HRHA 2J9ZB 5FPSA 1FMCA 5DM0A 3WNCA 5I01A 4KAJA 3NU1A 5C1OA 3A3PA 2PKEA 2W6JD 4EK9A 4ZHQA 4D9NA 4H7IA 4WZ6A 2X7JA 4RGVA 1F9AA 2WZDA 4G0MA 3LOPA 3ZWBA 2DQYA 2B5VA 1AKMA 2DE0X 3OM9A 3NHYA 4TKLA 3MG9A 5LLDA 5LFAA 4XWTA 3OLVA 1OREA 3QVKA 4EMUA 2UXBB 3WRXC 1JDSA 2C5EA 5ICEA 2QX6A 3SPXA 3SYKA 2GDZA 4R9RA 5EZYF 2EBWA 3OFVA 1LFDB 1N8TA 4QM7A 4XUCA 1L4NA 4M9QA 3RFUA 2P3OA 1E1QD 5LP6F 5EHGA 3FWKA 1PJ4A 4KBYA 2GLTA 3CVOA 4W5QA 4FB5A 4KC0A 1JHAA 3TRHA 2H1WA 4KSCA 1WLSA 1MNQA 1Q1BA 2I2BA 4HAZA 1ZOOA 4HGZA 3GA0A 4AFNA 2F3TA 3RTCA 4P3YA 1AS3A 4QOEA 2P40A 2J41A 3KAKA 3JPWA 1E92A 2MYTA 2QTFA 3WIUA 1U1GA 1X77A 4JLPA 2EAUA 1JR4A 2GHRA 2GUGA 3WTCA 1VE7A 1GJRA 4R6WA 3SHOA 1VP3A 5DCUA 3AF1A 3SC4A 1DKLA 1TW2A 3O1LA 3TTXA 2IEIA 4LFAB 4WL0A 4WN9A 5T6BA 3BGSA 1R4MA 1FC0A 2Y9PB 3K30A 3RS0A 2Z2JA 1X3LA 1CX9B 3AEQB 1UBGA 2GVZC 4HH1A 4MRNA 4OMCA 4AJPA 3E03A 4AYXA 1ZR4A 3STXA 4MKRA 1ECGA 1Z38A 2F62A 3OJLA 2AEFA 2IOHA 1RS0A 2W6ID 3CNLA 3B36A 4KIWA 4LWZA 5B58T 2NMVA 3RAJA 3GMIA 1ZIPA 1HE5A 2YZKA 3JAKA 3DBRB 1RBMA 2PLWA 1C1DA 4FZRA 4XQ0A 4YJDA 4NE2A 3V46A 3FUUA 3VBEA 1UPCA 2VG8A 1S8FA 1R6TA 2PUJA 3DEZA 3VR1A 1ZOSA 2E5FA 4D3DA 1JEAA 1Z5VA 3PC6A 1RWQA 1UAGA 2NUTB 3EGEA 5FPHA 1OFUA 3BTOA 3W3AD 3WKEA 4BRZA 4GYWA 1T5IA 1R27A 1N3IA 1Y1KE 2WRZA 5HP4A 2CVHA 3ENVA 1RLJA 3ETLA 5IBRA 4KUHA 1A76A 4KO8A 5D1HA 1MH9A 1OBOA 1WMBA 1T5DX 4UUNA 2ZBPA 4Q9LA 4PZPA 3KSAC 4E5SA 3I52A 4Z3DA 4C89A 4CLRB 4JC4A 4B84A 1H6CA 2EFYA 3U80A 5IJWA 4PIMA 4HGOA 2VATA 1C4XA 3NASA 5KSZA 4HEA1 3R3XA 1QV7A 3OZRA 2PWZA 2WHRA 4R41A 1BXGA 2UYYA 4DEVA 1XTJA 2K7FA 4IXWA 3VZCA 2ISSD 4H7DA 1CHDA 4L16A 3RC1A 5FH9A 4BMVA 1BKSB 1AM4D 2NXNA 1N6HA 3HJRA 4L8WB 4GM4A 4MVJP 2X5XA 4XDGA 3UT0A 2RHTA 4PR0A 5AO9A 3BGVA 3R5HA 3SSAA 2WZBA 4P86A 1SBYA 1WV0A 3QLVA 5HE8A 3OSUA 4CL8A 2ZJ1A 1GKUB 3V42A 1V0JA 3WLEA 4CEHA 1GO2A 4Q4HB 3GPCA 3KL2A 4KGVA 5EVJA 4DNXA 2FYTA 4XDZA 4B35A 4V0NA 3WWCA 2AK3A 4PRKA 3FMIA 3LVQE 1E9AA 2REQA 1Z4NA 1GFIA 2GKGA 5TJHA 1R5BA 4KH1A 1ISRA 3EZ9A 1PG5A 2A6PA 5TMDA 3HKCA 2CD9A 2D2XA 3PRHA 1RPJA 4LGVA 1K0FA 1NMSA 3KLPX 1IY0A 3FNFA 4TL7A 4B48A 4YY3B 2X9NA 3GMDA 3OZWA 5ABPA 3EOBI 2H07A 4W1QA 2R1VA 4WIAA 4HNTA 2ECOA 1QFZA 3OPYA 3LY8A 2OAGA 4HNGA 1AN9A 3UPUA 4JDUA 3DWGA 3OIVA 4F97A 1UCFA 3QJYA 3KKLA 3ZCVA 3W5BA 2KLBA 3N5KA 3CZPA 2C3YA 1R64A 1EFVB 1PL8A 1VYVA 3EHDA 3IT3A 4A4DA 3P9ZA 1P2SA 5D7NA 1X39A 4OLFA 3EGDB 5LUBA 2UYCA 4MI1A 4OFZA 2CYCA 3DMRA 4WERA 1ISIA 4CR6A 3P32A 1PR2A 3KFLA 2FEKA 4GR5A 4DLRA 5K3SA 4YV1A 5E38A 1OIXA 4B6FA 4LVNA 4ZVKA 3GJ5A 4TT8A 3RUIA 2F55A 4PONA 1DADA 2CK3A 4JHXA 1ISMA 1ZGBA 3U7FB 5LL6P 2FX5A 4M0EA 1N36B 1ZCBA 1G4AE 3GEIA 5CA1F 2HDWA 1TYZA 4E7OA 1KMCA 1W9MA 3EXHA 3KZXA 1V9SA 1LD3A 1Q11A 2CN1A 3JALB 2E4AA 3H5LA 5G0VA 4EB3A 1YHNA 4X8LA 2FRVA 4DFDA 2MSEB 4ZVVA 2HC9A 3ECSA 3M9LA 3NHWA 4MRAA 1A1SA 1AZSC 2PL9A 2Z5FA 1K08A 3NJ4A 1Z29A 3P0EA 2MDTA 5AKGA 2AUMA 1DBIA 2IT1A 4DS3A 2GPBA 5J47A 3HB4X 1G3IA 2BGMA 2YRXA 4DF3A 1KEEA 2WZQA 1QKKA 5AVUA 1RZRA 2O3UA 3SJCA 4DBVO 5EIBD 3TJMA 4RLSA 3A2LA 5F7XA 3HZOA 4FBMA 4UNNA 1LRJA 5BN3A 3WRVA 3FFXA 4MJLA 1WW8A 3MXTA 1M7BA 1IIRA 3HXPA 4BLSA 1GZDA 5JTUA 5K0BA 3ZLUA 4B80A 2X1VA 5IM5A 2CJWA 2ZRNA 5SZJA 3GAMA 1D0VA 3FSGD 1U6KA 2ZSJA 1CYEA 1DWQA 3FY4A 3DDZX 2GUWA 1XZ8A 1H6DA 3KIPA 3LO5A 3O3CA 1M33A 1C8VB 1TU4A 1IHXA 1L5SA 5BN4B 5SZHB 1XTZA 4D0NA 5BQPA 3BQMB 1IBKB 3ICEA 1W47A 3J81A 3GN2A 4CEIA 4EUSA 2JH8A 3WX0A 1JDBC 4ZYYA 1MX1A 2ZAGA 4IMJB 1AMUA 2LV8A 4TTRA 1ENZA 1OFUX 1W0JD 3COSA 4B17A 1KDTA 4WVFA 3UJ6A 2XWJI 3EXFB 4JSRA 5DGCA 1PT6A 4D4IA 4EA7A 2Y6UA 2H1LA 1E1CA 3DULA 4TYQA 2PH3A 3PRJA 3ERCA 2J4DA 2ZIZA 1DWPA 4C7OB 3I12A 3WJ2A 4J2OA 3NUQA 4MUBA