3NBAA

Phosphopantetheine adenylyltranferase from mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (ampcpp)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
156
Chain Sequence
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Kinetic, thermodynamic, and structural insight into the mechanism of phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 52
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nbaA00
2A84A 1MC1A 1O6BA 1K4MA 2PIDA 1PFVA 2JAXA 5TGTA 3I05A 4MUKA 2D13A 1N2GA 5FO0A 3CLRC 1JEEA 1I6KA 3CA8A 2CV1A 5BNZA 1MB9A 2PG3A 4RUKA 1T9GS 1EFPA 1JZSA 4MUEA 3CVUA 3PNVA 1KH3A 4MVWA 1QRSA 3AL0C 1T6YA 4XFDA 5J5AA 3K9WA 1M8KA 4DDHA 4GRIA 4MW9A 2TS1A 3ZXSA 5IHXA 2A1TS 2H2AA 3G6KA 4QRDA 1KORA 2V0GA 1QU3A 3P0HA 2A1TR 2XRYA 2J09A 3COVA 3Q10A 1OD6A 4EG5A 4ZCSA 3CVVA 3NV7A 4G6ZA 1N2OA 2VXOA 1A8HA 1QTQA 2PXHA 4EFKA 1O94D 2O8VA 3ZUGA 2DXIA 3NBKA 5FO1A 5DK4A 4KPUB 4MULA 2J5BA 1JGTA 2V0CA 3DPIA 3IMEA 1U7XA 1NSYA 4HPWA 3GLVA 3AG5A 4CDMA 3A05A 3ZIUA 4OUDB 1N2IA 3CVYA 2HZ7A 3UK2A 5AHWA 4QBTA 1IH8A 3DO8A 3MXTA 5J58A 1NP7A 2GOYA 2PZBA 3A2KA 4PBSA 1WXIA 2CYCA 3ND5A 2EL7A 1IQUA 4KPUA 4R0NA 4J76A 1OWNA 4KR6A 1KH1A 1ILEA 1IRXA 3CLRD 3KFLA 1NUTA 4AQ7A 3TS1A 4ZCRA 1QRTA 3D6VA 1S4MA 3COWA 2NZ2A 1Q11A 1O95C 3H9CA 4CQNA 2O5RA 3IOEA 3ZJVA 4MWCA 1U3CA 1JZQA 3N05A 1O5TA 1TYDE 3AG6A 1BS2A 4PY2A 2C5SA 4MLPA 4H3SA 3BL5A 3LOQA 1VL2A 3K32A 2IJGX 3IVGA 5EKDA 2J07A 1G59A 1IFXA 1QJCA 4DE5A 2WQ6A 2DERA 1U7DA 1YIDA 3G59A 2OQ2A 3QTBA 1SURA 4MWDA 1TQ8A 2Z08A 2YXNA 1OWLA 1KP2A 2XRZA 2CV0A 4MUJA 1GLNA 2QUJA 1Q19A 3SP1A 3HFJA 1H3EA 3IOCA 1EXDA 1O0BA 2IP1A 1NI5A 2YY5A 3KT8A 5LLTA 3INNA 1MRZA 1JIKA 4MUIA 1OBCA 5HG0A 4UZEA 2A1UB 4YP6A 1JEDA 4Q16A 3TNJA 1YIAA 4G5FA 5H7XA 5LM3A 5JBNA 1U0BB 4MUNA 2EJCA 2X0KA 3COZA 5KCMA 1WQ3A 2E89A 2HGZA 1OWOA 4MAFA 3TZLA 4EG7A 3QE4A 2J08A 3IUEA 3X1JA 1H1TA 1K92A 4WNYA 2E0IA 3SEZA 1O95D 1KAMA 2E18A 1TYBE 4GU5A 4I6GA 1WXFA 3HV0A 2A1UA 2YWBA 4U8HA 1TYAE 1EUQA 3CLSC 2I1LA 4JYZA 1KH2A 4XFJA 3IMCA 3P52A 1N3LA 3SZ3A 4NATA 4KKVA 5K0SA 2A88A 2X3FA 1GPMA 1KQNA 3ILVA 1G8FA 1VBMA 1XNGA 4MW6A 1UFVA 3DLAA 2WQ7A 4I6JA 4XSVA 4JXXA 1GTSA 2ZUFA 4MVYA 2RE8A 3AKZA 1VBNA 1XNHA 2OV4A 3PRHA 2QTMA 2Z3VA 1V8FA 3PNYA 1N2HA 3MLBA 2ZP1A 3SEQA 4BWVA 1KAQA 2CFOA 2QUHA 2QTRA 3ISJA 4HJRA 3IMGA 4MUFA 2D54A 2E21A 3UC5A 1JILA 4MVCA 1N2JA 1WJGA 5H16A 1YULA 1YUNA 2PFSA 1GTRA 1O96B 1X8XA 2DEUA 3TQIA 1ULHA 3CR8A 3PXUA 1T6XA 3IH5A 1O0CA 3MMXA 1NUUA 3RJZA 4KR7A 2DETA 3FY4A 4P2BA 5TEVA 3DV2A 1F4LA 4EG4A 1PG2A 2DUMA 3GMIA 3RK0A 1LI7A 3ZJUA 4U7JA 1J21A 3Q4GA 2AKEA 3MUEA 2VTBB 3L92A 5DASA 4OUDA 3H97A 4MWEA 3CLSD 4U63A 1P7PA 1ZH0A 3FHJA 1M8PA 5HUHA 3OP1A 3HGMA 3X1KA 3FI0A 1ZH6A 3ZXIA 4MQ6A 3ELBA 2BTEA 1EFVB 4Q93A 1LW7A 1HYBA 3VU8A 3X1MA 2VTBA 1VLHA 3FETA 2H29A 1PG0A 4ZCTA 2QJOA 3CLTC 4ZCQA 4NAHA 1R6TA 1WOYA 2JA2A 4MW1A 2BYTA 2QJFA 4S1OA 5TS2A 4DDMA 3SDBA 3H05A 4YP5A 1NUQA 1J70A 1RQGA 3S3TA 4ARCA 3KT3A 3NBAA 1R6XA 1KQPA 3IUBA 5HUJA 3P0IA 1NZJA 3RBAA 2CT8A 3HZRA 2ZUEA 3CLUC 3TZEA 1Y42X 4G5YA 5DB4A 3CVWA 4AS1A 4JXZA 3F3MA 2DPLA 4NZPA 2AZXA 2B7LA 1H3FA 1FYDA 3UMVA 3LCJA 3N2YA 3HMQA 1XJQA 4ND7A 1N1DA 1GZUA 2WSIA 3G5AA 2CUZA 1K4KA 4HK4A 3FDXA 4KR9A 5KHAA 3FG9A 5FNZA 3FOCA 1PFUA 1MAWA 1MJHA 2HMAA 3IDFA 2QJTA 4ZT7A 4ZCPA 1T6ZA 4I6EA 1TFUA 3IODA 4FZJA 4R2MA 3RHSA 1JHDA 1DNPA 3Q12A 3TQOA 3CVXA 1CT9A 1G8GA 1IHOA 4CT0A 1V47A 4TS1A 4YMIA 1OWMA 2PZAA 1M8FA 1JIJA 1IQRA 2YWCA 3AIIA 3CLTD 5KWVA 3HL4A 3ZJTA 1FFYA 4R2LA 4EG1A 3H99A 4PBRA 1J1UA 4J75A 1GAXA 3FWKA 1M8GA 1O97D 1EUYA 2J4DA 2QUIA 2GKSA 4MUGA 1WXGA 1F7VA 4MW5A 1N75A 1QU2A 2DLCX 4MW7A 5IJXA 1MBZA 3CLUD 1NURA 3KT6A 4MUHA 3E27A 1GN8A 2AG6A 4NDAA 4ZT6A 1T9GR 4NX2A 5F23A 2A4MA 1COZA 1WXEA 1YI8A 1MB2A 1XNJA 3C8ZA 1K97A 4MVXA 2NSYA 1WKBA 1OWPA 4MW4A 1PFWA 1Q15A 2X1LA 4ZT2A 4MW2A 1QNFA 5J59A 3H9BA 4DDKA 4JZYA 1R6UA 2DR2A 2X1MA 3COYA 2CSXA 1ZUNA 4ZT4A 4EG6A 1B6TA 4X0EA 1TYCA 1KQOA 1YUMA 3N9IA 1O96A 3JXEA 4K03A 2R5WA 4ZT3A 4HJXA 2GM3A 1N78A 3OTWA 1J09A 1F7UA 3UOWA 3UY4A 4JFAA 3IVXA 4ND6A 1NUSA 2RD2A 3IVCA 3SYTA 2QUKA 4QREA 1JMVA 1N2BA 4RPIA 2JANA 1MAUA 4F3RA 1M1ZA 1ZJWA 4DNXA 4DJAA 1M83A 1IQ0A 1WZ2A 1I6LA 1J20A 4CDNA 3VGJA 4EF6A 2IELA 3AFHA 3ND6A 1EJ2A 1VBKA 1O97C 4NAUA 4PBTA 2CYAA 3P0JA 1F9AA 3RK1A 1J1ZA 3VRHA 2PZ8A 5LFAA 1NUPA 1EFVA 1KR2A 1TEZA 1U3DA 3MLAA 5DEOA 2A86A 1I6MA 1MOPA 3A04A 3ZGZA 1PFYA 3M5WA 4ZT5A 4EG8A 1IVSA 3FH0A 1LI5A 1OBHA 4DLPA 2CV2A 1KKUA 3A4IA 1Q77A 4WSOA 3KT0A 3IOBA 4L2IB 1WY5A 3FNRA 4F4HA 1N77A 3ND7A 1WXHA 4MWBA 1G8HA 4A91A 1JIIA 1QQTA 3RFFA 3LE8A 3L93A 1EE1A 4ARIA 2D5BA 1O94C 1JECA 4UZFA 4EGAA 4OJMX 3N8HA 3GUZA 4EG3A 4L2IA 3QTTA 5TEWA 4MW0A 1M8JA 4YBRA 1WQ4A 5K0TA 2G36A 1QRUA 3PNBA 2CYBA 3U1VA 1KP3A 3FIUA 4K0RA 1H3NA 2A7XA 2WB2A 1EFPB 2Z09A 1X6VA 3SZGA 1D2RA 1I2DA 2QTNA 4E1AA 1N2EA 1NYLA 3D6UA 4YP7A
chains in the Genus database with same CATH superfamily
1O6BA 3RRNA 3P9ZA 1J7JA 4KIGA 4X94A 3HVIA 1DARA 5G40A 2VPTA 3FCEA 1M33A 3LC7O 4J6EA 4LWOA 4ZP1A 1A50B 5ALOA 3I9V1 3EC2A 1HE5A 1U81A 2CF6A 5BN5B 4EY4A 4EJ0A 4NS4A 3VYWA 1L4LA 4CZ2A 3EEBA 3D7SA 4TLLB 4D9GA 2AN3A 3S40A 3UJ7A 3A6JA 1BHSA 2PZFA 3OAAA 4Q34A 2ZKIA 1ZNZA 3A1DA 3HRIA 4X20B 1DWUA 5FTKA 4DM4A 4R69A 1C3VA 4C0KA 1VE3A 2Y4OA 3OTHA 4DJTA 1M8KA 3ILHA 3KJFA 4K8RB 4RZ3A 3PJFA 2P3LA 5CM9C 5LXTF 1PK7A 4KDFA 4DANA 1OUMA 1A5ZA 1WLYA 1YU6A 4OL0A 3LX5A 2ZI6A 3HSKA 1R12A 3QUTA 4QRDA 1ISJA 1I8TA 2IODA 5TS3A 4QFBA 3P7MA 4PSCA 1Q3KA 3WWEA 2HA5A 5JJLA 4K2AA 5ARCA 3BJEA 4A8JB 4YAIA 3K1TA 4L02A 4N5MA 4RLHA 2N46A 3WMWA 1DRKA 2ZRHA 3CN9A 4CJXA 2PQ0A 1ZJWA 3B6JA 2B4KA 3R7DA 1WBDA 1FIUA 2C1EA 1PS8A 3F7NA 1DRVA 1FTQA 3PEWA 1SXGA 1RP1A 1X0XA 2IYOA 4JL6A 2NUTA 4OXQA 4EJSA 2VIIA 1D0SA 1OI7A 3GLQA 3DPIA 3MELA 3NR2A 4YVFA 4YRJA 4AUMA 4DA6A 4D9CA 2YHIB 5A5VA 3EA4A 4HDNA 2EX1A 5JLAA 4YMVA 1RHUA 1V11B 2PJUA 3EVEA 3OZVA 5EJGA 5MGBA 4RTPA 5GONB 1O54A 5EJIA 3WTBA 4HQOA 3RDPA 1FZTA 4E14A 3GRAA 4EGJA 2H1CA 2XOKA 3DO8A 3AEUA 3W2GA 4RY8A 2WUVA 2ZIVB 3B89A 3ZVNA 2ZAIA 5BN3A 5JZMA 2ACKA 1QQ5A 3D02A 4Q03A 5CP8A 7ADHA 4NV1A 4V1CB 4HRVA 3U09A 4KPUA 3OP4A 1I51A 1OIVA 4R0NA 5EWLB 2JI8A 4TVKA 4IICA 3GDOA 1SCNE 3PTAA 1JKMA 3HBJA 1P8JA 1SIWA 3SN6A 3REFA 2TMKA 3FZQA 1K6EA 1HWYA 3GLHE 4GHWA 2IPXA 3GJ8A 3SIXA 5C5EA 1AHNA 2VH1A 4JY7A 1RKVA 3W8DA 4FQ8A 3D6VA 4KR2A 2NMVA 4B46A 5AOCA 2V6FA 5PGMA 2R4QA 2HPHA 3BAZA 5FORA 2EG9A 4GI3A 1M0TA 1Z4OA 1S2OA 2Y1CA 2J3EA 2X4GA 3CUEF 3MJFA 1KI2A 4ACAA 3OO1A 5A71A 4R8VA 4LRUA 4BNYA 1GV1A 1P75A 2OGSA 2WT9A 4G85A 1ZGAA 3L0BA 1HFEL 4TMVA 1S6YA 1BS2A 1ZA2A 4I1YA 4HUTA 1E2IA 4JYAB 1E6WA 2QLNA 1LRKA 3KAQA 1X1RA 2FPGB 1GQRA 3CN7A 3MT9A 2P30A 4MLPA 3TR0A 4BXOA 3HP7A 1QDEA 5FTMA 3PQ4A 3T7RA 1B8VA 3OX3A 2IJGX 4TYMA 4RLSA 3F3KA 4OM8A 1W87A 5GZ1A 5LMNB 3L04A 2LIPA 2XVXA 1W25A 3W04A 4ADSG 1MO5A 2GUGA 1HGXA 1R0CA 2W2KA 1SURA 3O9ZA 3IDSA 3C85A 3OJWA 4ECAA 3SHOA 2AFIA 4RANA 3U0BA 3O8NA 3L7IA 1WULS 3TUJC 3QA3E 3LKBA 4M7PA 5DHFA 3PIRA 1UKAA 2BKAA 4OLJA 1M6WA 4JR0A 3ZW7A 2FUCA 2NXNA 7REQA 3LYLA 4W7IA 2AUMA 3FBTA 4B3TB 4INPA 4N7RA 1JB1A 1N5RA 1DV2A 3H4IA 3KS9A 5E7QA 3JQ9C 4DV6B 1G7TA 2YV1A 3INNA 2G0TA 4Y6PA 4FS3A 3W5UA 4FK8A 4CM8B 2PO7A 1KP9A 3MUNA 3QG1A 3KSUA 4L8WB 3QX3A 4P84A 2R97A 4HBZA 2X76A 3WR5A 2EKZA 1LUAA 2NYUA 3PLNA 3R76A 3RU3A 2WJWA 4OYHA 3A4TA 3DOOA 1SUCA 2VOJA 5P21A 1CYEA 1K2WA 1NW9B 2EHJA 5CVCA 1JTEA 1EM6A 5FBRB 3GX1A 4W5NA 1NVGA 1T0HB 2ZXUA 3T9BA 1D9XA 1IXRC 2YCLA 3IUEA 1K92A 3OCVA 5LUBA 3RM3A 3EGEA 3ZCSA 4DG5A 5FI0B 2Q21A 2ZBEA 1O95D 3LGSA 2C58A 1A9YA 2VO1A 2PL9A 2QT0A 2QAJA 3P9RA 1E2LA 4XIYA 5FR1A 1TYBE 4GU5A 4I6GA 3SYLA 3H5LA 1O2DA 5JAMA 3OCUA 2OO5C 2QX6A 3B1WA 3PEFA 4G9EA 3UT0A 4C5BA 4CLOA 4NENB 4JYZA 4QHSA 1VI5A 1XMXA 1VYHA 2V7PA 3GNTA 1KAGA 4A2CA 3G0IA 4XGRA 1ZK2A 2HRCA 4N39A 4RZ2A 1SRQA 1JHPA 2REXB 1P74A 3DNPA 1N0UA 4W6ZA 8GPBA 3BCUA 1B41A 1YVUA 1VKRA 1M1YA 2I22A 3EJ6A 2A0FA 3ILVA 2H18A 4G25A 4FVTA 4OQDA 1JIXA 5CLIA 3USES 2R6CA 3I37X 3NT4A 4U9HS 1K6IA 1P2UA 1GY8A 4K8OA 3T1YB 1LBTA 2NACA 2E82A 2PUEA 4DL9A 1VBNA 3LPNA 4DIOA 2J9GA 2O8BA 2P6UA 5TSDA 2O8FA 2MYUA 1PO7A 4WXYB 2UYCA 4M8LA 3PC2A 3AF1A 3UWOA 5A04A 4YP0A 1E6MA 1QVWA 2WD9A 3WSTA 2GK3A 3ZQ6A 5EPOA 2V1UA 3UW1A 4OEHA 2PU5A 3VUFA 2RGYA 2B83A 2P68A 3AKCA 4BDSA 1TVMA 4N8EA 4C0XA 1SXJA 2PLWA 1DBQA 1PD1A 1YJCA 3PX2A 5IT9A 1XQXA 3K96A 4A6PA 4PZYA 1QCYA 3MAGA 5BWBA 2IW1A 3AF6A 4EWLA 1YD7A 2O2GA 3E23A 5KYYB 4DSTA 2ONZA 3JVEA 4ENRA 3GRYA 1L1FA 4CM3A 4QTTB 4TTRA 2HHHB 4YMLA 4BNLA 3RJ5A 3NX4A 1C9DB 1P3Y1 2RAPA 3O8OB 5KQMA 2C7GA 1I7DA 2G7ZA 1T3ZA 3BULA 3DBRB 3DV2A 1MN6A 1OXMA 4EG4A 2Q9CA 3U39A 3ITNA 1NXQA 2P4SA 3RGGA 5BSWA 1QKKA 2BEWB 1P2VA 3UJNA 3CF4G 2VLBA 2YDYA 2J5RA 4UUQA 1DJNA 3QF7A 4UQLA 4RQTA 2JJMA 1PU2A 1TOAA 2ZTUA 5ALPA 1MX5A 3HKCB 3D4OA 2OV1A 1DVRA 2EF0A 3T7TA 2XMPA 4IZ6A 3I28A 4A4DA 4AJJA 5JCJD 4RY0A 3I9KA 2QIPA 1G66A 2GN9A 3NETA 4BNVA 4HATA 2O3QA 4V0KA 1NNEA 2JF0A 3RYIB 1XU4A 2ZIZA 1RKBA 4LWZA 1CB0A 4DS3A 2PEZA 3FI0A 1YJ5A 4OXRA 1ELOA 2WABA 1J23A 1Z62A 4EI2A 3S8YA 3QI7A 4M1QA 3DAFA 3L07A 4RF2A 1YB7A 1T1SA 5IU6A 2WG2A 5FB3A 3FETA 3H6HA 4HB3A 1VIDA 3EDOA 4PC2A 1VE5A 4UNRA 4FQ7A 5A0VA 1Y80A 1ZMXA 2EL9A 2R6HA 2JBAB 3BJMA 4IHAA 2EDAA 2QJFA 3U3MA 3ZS9A 3L6EA 3LDGA 3ROKA 1KSJA 1DUVG 2NTNA 5I5GA 4JMLA 5BOSB 5LYJB 1MFZA 2ZJ3A 4HAZA 3WLNA 1SHUX 1V3VA 5TQ2A 4EHHA 1TAHA 4XM0A 2J7PA 3IUBA 1G5IA 5DLDA 4CMHA 4LYYA 3FI9A 3L02A 4L22A 4RHTA 2B4QA 1XDWA 4MQUA 4TLCA 4TMKA 5DB4A 4A0GA 5AW3A 5IHPA 1E69A 1P3DA 2DLNA 2X23A 4X6YA 4NZPA 3W7AA 1G16A 2AZXA 3HYLA 1D5WA 4MP6A 4GOMD 4HBGA 5JHGB 3EPLA 1HQKA 2PPLA 4I9GA 3K92A 1DAMA 3D0RA 3URMA 1S2LA 3RIHA 4UBLA 2W58A 3BUSA 4DCTA 3VVMA 1JFFA 3EUEA 2XYGA 4R40A 1X3SA 3TSZA 3VZSA 1AK9A 3T9DA 2P4QA 2Z2XA 3CLHA 4C0BA 1U9IA 3PD1A 5EHXA 1ZVMA 2IZ7A 1VFPA 3BG5A 4AG6A 4K28A 2Q9UA 4WA7A 2V45A 3UT6A 1APBA 2OAQ1 3K5PA 1T4BA 3DAHA 4AKIA 2B21A 1UADA 2B69A 4X41A 2FZWA 1E9VA 1XZCA 1WBBA 2GBLC 1T6ZA 4I1IA 1FS5A 1KZ7B 5E38A 1SZPA 4C3VA 3EXFB 4GYYA 1ZIYA 1BCSB 4OJYA 4OIFA 2YFYA 3DCNA 5JH7B 3KQYA 1XXLA 4X84A 4Y8VA 2Q3MA 2UYOA 3CVXA 2ZYVX 3IBCA 4DCMA 1FFXB 2CLEB 1G9TA 4KTVE 4ETNA 5KYKA 3NFRA 1Z0ZA 4KE9A 3S5UA 2GDJA 5JHHB 5FUBA 4IQ8A 1TMKA 4A36A 1GHTA 2QN6A 4LJ4A 4U2DA 4EITA 1MABA 1FK8A 1PX0A 3SKYA 1M2EA 1CPYA 1YB1A 2VFAA 1KFKB 5I9SA 1RIFA 1W5SA 3BH0A 4PFKA 3ORRA 1KJIA 5EOVA 3CF0A 3OIUA 2R8PA 1RZUA 4EUKA 2IEYA 1GAXA 5LYYA 3AGQA 4KR0A 1ETHA 4EKGA 3ZWAA 1T1GA 4B7CA 4XIJA 2W6JD 4D4KA 3EXIB 4F6LA 2HHCA 1FW8A 2AG5A 1N75A 2EVWX 2ZG6A 4AN4A 3JZFA 4MW7A 3IIJA 2HK9A 4MUHA 1DB3A 3LV8A 2Y1LA 2PQ6A 2G7MC 4QUBA 3CPSA 1P1IA 1ECFA 2QPTA 1EIWA 1RSZA 1U0NA 1T9GR 1XEWY 2YIJA 3GV0A 3ETJA 4GI5A 1Q2XA 2O1EA 3CX7A 2ZT5A 5IAKA 5LCXA 3MTEA 3T4UA 3E5HA 1G17A 3ER8A 4FWBA 2NSYA 1GZ7A 3GC6A 1T9DA 3Q7EA 1PUJA 2WSSA 5ERGB 3RVLA 1USKA 3QJ5A 4QXAA 1N8NA 1NW8A 3R09A 1HDGO 4M89A 4NKRA 3SX2A 2O1XA 1NV9A 1H8EA 1KJJA 4L3WA 4Q4AA 2GD1O 2X1MA 3ABQB 5DULA 3SZLA 2N3ZA 3EG9A 3HB7A 4AYXA 4BFVA 5ECYA 1AHPA 3WKBA 3U16A 3FYUA 5J4YA 4X0EA 4MGYR 4AZ3A 1X39A 2QVCA 2GPBA 3HY6A 221PA 3ETEA 3UWSA 1DAPA 2P3SA 4PN7A 3QJGA 1MORA 1FYXA 3EOAI 2BE7A 3ZZ1A 1W4ZA 1N9GB 1F7UA 4N8DA 5FJIA 1D6MA 2C5FA 2M1XA 3KQVA 3NWOA 1EVLA 1YHZA 2OVBA 3ICCA 4YB8A 5CB6A 5F21A 3OQMA 3CNHA 1XVLA 2X5JO 4JJZA 2XZPA 1JSXA 1JEYA 1MAUA 4EARA 1M1ZA 3FGZA 2NSLA 4X63A 1SUEA 1K8XB 2DTXA 2GPSA 2ROQA 2N47A 4NPAA 3HI4A 4RHCA 4UC0A 4FBLA 5LQJA 2GEDA 3I2GA 1XALA 3U3OA 2IOQA 4IJUA 4IEEA 2R1VA 3ZZTA 3L0OA 3KUKA 1VBKA 3I0NA 2P4UA 3CKYA 4HN2A 4PG4A 2PUBA 5TVGA 5A4DA 2VF4X 3UIEA 3OC0A 3GDGA 3LIIA 3I9NA 3K2EA 5KHOC 1NR7A 5IM4A 2WZQA 1PJTA 4P32A 5EIBC 4E5KA 4YRKA 5A1JA 5J2UF 6NULA 5EINA 2ENUA 2B1IA 5KS2A 1LZKA 4KXWA 1BW9A 1V6AA 4NG4A 3TFQA 1CQPA 2Q2NA 3FH0A 3TNYA 2J0EA 5AW6A 1XZIA 4MV0A 1U4NA 3EC7A 4JT8A 5AKHA 3UG7A 3TW8B 3WQRA 3DM9B 4RA6B 2AG1A 3V8VA 1RYFA 2WF9A 3IUQA 3JR3A 4OMDA 1PVVA 5A3JA 3T12A 4FILA 3AHHA 1CVRA 1T2VA 1AOXA 5DW0A 5KYVA 3EE6A 4UKDA 1G8HA 1RFGE 4CV2A 3VA7A 2BHLA 4X93A 3OCYA 2D06A 4GBED 4XVCA 5ELXA 3DF9A 4PLWA 2MYNA 1GVHA 4MUYA 4BO1A 1NW5A 2P1DA 4CFZA 2PE5A 1VKHA 1ZEMA 3JQAA 1G20A 1SOWA 2ODBA 3L6CA 5ICMA 4WL0A 2RG1A 3M1YA 2H5JA 3BE5A 1R0BA 1U2RA 4XUCA 3VJKA 4YLYA 2XBMA 3G7UA 3E8XA 4H6XA 3PXBA 4KLCA 3W6UA 1DOAA 1DI0A 3GGOA 2YJTD 2IXGA 2ID4A 4NBTA 2HLHA 3WL3A 2FCAA 2WW8A 4DUGD 1MV8A 3RC7A 1XMOB 5FL7A 5F2KA 4WCDA 3VDQA 1KDVA 1FJ2A 3PNBA 3CPEA 3K9BA 3MUFA 3U1VA 3H11A 4NEGA 4ASUA 4EZBA 5TNXA 3ZWMA 2WKPA 5ITZB 1W5BA 1WCWA 1X6VA 4JT4A 1P9RA 2Z6AA 3NOQA 3CEAA 3NO4A 5CBPA 3A11A 1ORVA 3MTDA 2WICA 3N7AA 2N42A 3DW1X 1VKJA 4LZPA 3AZQA 4Q6WA 1A7KA 2ATXA 2X9LA 3OEHD 4F97A 1MJ5A 1R0YA 1E3DA 1PFVA 2HB6A 1XC7A 1J99A 3HU5A 3I4CA 3I52A 3PZRA 3PQ3A 5HTKA 4BP1A 4KAAA 7GPBA 2IOYA 2XNKA 5E9AA 4YN3A 1AV6A 2AX3A 2Z4RA 1HKHA 1PT7A 4LJLA 1EQ2A 1VHWA 2XNCA 4U7GA 5BNZA 1YASA 3HR8A 1KJZA 3RU7A 1DFGA 3LQYA 1QGED 3UMFA 4Q1DA 3CVUA 4ZWNA 5KTPA 3VR2A 3EQ8A 5LL6P 1N2SA 4B6EA 4M99A 4Q9KA 4G5SA 1FJHA 3STWA 3CIOA 3L7BA 5EJ8A 1GPBA 2A33A 3NH6A 3KZOA 2GUWA 3ABIA 4DR3B 2CMKA 3Q3CA 5DBIA 5B3LA 1DIAA 4JSYA 2NUTB 3I04A 4BIIA 4EJSB 1ABFA 2H2AA 3ON5A 3MWGA 1GNQA 4ZO7A 3IKLA 1VP9A 4HDNB 1D03A 3TVTA 3KK0A 3NVMB 3A6ZA 1U8EA 1HT1E 3PENA 1XK6A 3ICQB 1TM5E 1VGQA 2YOGA 3EHDA 3NV7A 4RXUA 2NO0A 1S7CA 1T0BA 4MHTA 4PSKA 4EFKA 1O94D 2BFCA 3LUJA 2GVZC 2GYWA 4Y0VA 1ZG3A 5CW1A 2JJ2D 4UBMA 4DTCA 3KR2A 5BN3B 1KZGB 2HYIC 1EP1B 1VJRA 4ZAZA 1CC1S 1KRHA 4KPUB 2MYPA 5CDSA 2I7TA 1G2QA 2VVTA 1YAJA 1CUUA 5GGXA 1RAEA 5IMBA 5L3SA 1BDHA 5ES4B 3KJIA 1E5TA 5F9MA 1IQPA 3KKNA 3SLRA 1F5SA 3CCCA 3UK2A 2J33A 2HMSA 3BZBA 3IMKA 4HYQA 4RVUA 4XWGA 1J2YA 4CKWA 4M76B 5A0TA 1TGYA 3GZJA 4WADA 5AVJA 1PSDA 1UKZA 1ESMA 5SYAA 4PBSA 1SEPA 4HAUA 2CYCA 5EEGA 5CAEA 4QHTA 3ZZNA 4G0WA 4C14A 5HKKA 1XP5A 3AHJA 3SHQA 4BECA 3LA6A 2P67A 4LOJA 2C3OA 4KODA 3RF6A 1ZW6A 2BLLA 2J9YB 5DBEX 5DP1A 1IRXA 1RWXA 2XR1A 1WW2A 3CLRD 1X7XB 1C9YA 2DZDA 4Z2YA 4OHRA 2HUNA 1QG0A 3TS1A 4OFZA 4YYEA 2NX2A 4IIJA 1AGNA 4LCJA 1G2IA 3UK1A 1P2FA 1E1LA 1NHWA 2VHYA 1E5DA 1DIHA 3LVQE 1ZD4A 2QU7A 2ICAA 4CQNA 3ORYA 3TW6A 3M6LA 5L3QA 3SHFA 4Y0NA 3VHLB 2HGSA 3L0IB 1HT0A 2VQDA 2W2KB 4IILA 4JKYA 4N7JA 4S1VA 4DIDA 1K7FB 2AFIB 3T1HB 2VJAA 2NSJA 1CK4A 1F8XA 3HO6A 1F12A 1G9XA 4QIHA 1PL7A 2C0PA 2QP4A 2ATVA 3ZLBA 3QPAA 4D8VA 1IY8A 2QQGA 1NAIA 2QSJA 3DUWA 1UQRA 2OCGA 3BTVA 3FPJA 4H3SA 4NWIA 1GGJA 7REQB 4B3RB 4WTOA 1WY7A 2AS0A 3Q7QA 3FSEA 4ZO4A 3RSQA 4QEDA 3AXSA 3ECSA 4DDVA 3S44A 4M0DA 4JL8A 1NY5A 3EBLA 4OHFA 1FS4A 1KXZA 3TE7A 3VKWA 1YXMA 3E35A 2CJWA 3I5AA 2BJWA 3KR9A 3QJYA 4C5CA 3L5OA 1YBVA 4Z1OA 2UVDA 3SPXA 1MB0A 2QZPA 4OU4A 3NALA 3FSGA 1WDKA 3PHBE 3SC3A 4QU0A 3FCYA 4M6WA 3IFSA 4QNMA 3PPVA 2YIVX 4N6OA 1RM0A 1Y4DE 3WHKA 3FGNA 3KOYA 3FLBA 4AS2A 3TI7A 5CEJA 3SF8A 1RXVA 3AJAA 3GR6A 4KN8A 4XQEA 1Y3HA 3NWPA 3HY3A 5AW5A 2O2HA 3LC0A 3N2ZB 5K3AA 5AW9A 4ZI7F 3BFJA 3OD1A 4NE7A 3VO1A 2YY5A 4KO1S 1QANA 3GMDA 1SWWA 1VE6A 3KJNA 9ATCA 3HO8A 5F4ZA 1T2EA 2NXEA 2GJ4A 3KJQA 4N1AA 1ESEA 2O0HA 3HU2A 4YP6A 4CLOB 2DB3A 4E5YA 3GUYA 1V5WA 2CFIA 4JYPA 3KBBA 3MD0A 4INZA 4Y6LA 1L7QA 3WC4A 3BEDA 2EQAA 1Z0SA 3VPBA 1TMOA 2YUTA 1E99A 2VP9A 3CXUA 1UBOS 2VYNA 3TKAA 3HKEB 4KX3A 4F2DA 4ZZIA 2YRFA 2X86A 2QY9A 5A2GA 1UK9A 5HDQA 4OA8A 3H1BA 4HGPA 2HJGA 4UM9D 3L0CA 2JLRA 4ZOBA 1GZ4A 1GA6A 1UPBA 1WXFA 4BTEA 3QXJA 2O8FB 2AOVA 4P35A 3QM1A 2H2IA 4FI3F 1KO4A 4HY3A 3NH9A 2W6OA 4M54A 2GWRA 3MT0A 4C43A 4UOZA 2NYRA 4NECA 4DWOA 4KEAA 1OFTA 2E6KA 2XKJE 5GMOA 4YEDA 2ZDHA 4LQCA 5FOUA 3N5CA 5GV7A 4D3ZA 4UQOA 4KLZA 1JZTA 1WF3A 1QP4A 3GFRA 3M1IA 1SXJB 4FGSA 1Z5WA 3GLKA 2HWKA 2IS1A 2H08A 5DN9A 2B78A 4MVJI 1U7TA 1S8OA 3WWCA 3UWKA 1EDEA 3MW8A 4BPRA 3T5CA 5JNVA 2FEWB 3IC5A 5JS1A 1YVRA 1R0WA 2CSUA 2Z3VA 1EGVB 4KITB 4D80A 1COWD 1C80A 3EPJA 2BCEA 2JLWA 4JENA 5DM0A 1YE5A 2J3DA 4H18A 5IAAA 3LTEA 4IJMA 5FWNA 2QTRA 3ADBA 3JQPA 3ESZA 2D54A 4XYMA 5AKZA 3RAPR 5GVSA 5MFPA 2R5FA 3O9MA 4F0JA 1QRRA 1PG5A 5SZKB 1V3UA 2HEGA 5KNCA 1Q0ZA 1YRYE 2C29D 4YT8A 1KS9A 4NICA 3DE7X 2BN4A 4MCHA 4PW0A 1I4DD 1KK2A 1DG9A 2YZ2A 3D8BA 3FJOA 4Y1FA 5ILOA 2EGHA 2WIGA 3BE8A 2PCLA 3BEOA 3CT6A 2NV0A 1XA0A 3ZV4A 3EF3A 4JBNA 1GG9A 3IH5A 3EZ9A 4MLCA 4FCCA 1FX0A 2XYHA 3UHOA 5BW5A 5GJBA 2JIOA 4L4ZA 3P2IA 5B1IA 2FSPA 1Y0BA 3P9SA 2VPWA 2JLQA 3F5MA 1X15A 2DWQA 1L5NA 2Z1MA 3ZDDA 1H1DA 1U02A 3CV3A 4JJ7A 2IXFA 1F0KA 2HJWA 3JTEA 5DNDA 5B4UA 2AXEA 3JAWA 3VDXA 5HKBA 3V6MA 1OJ7A 1E2EA 1I36A 2AKYA 2PL5A 3MS4A 4RSMA 1A5TA 1LS6A 3PVCA 4C6HA 3TPCA 4BWYA 5AIBA 4CM1A 4P3NA 3A4YA 5DIZA 4E5NA 3WV4A 3CUWA 4QYWA 2F3TA 2WOOA 1AZSC 4FHGA 3AR8A 4TKVA 3K6JA 4J6FA 1FPMA 3GEBA 1M0SA 4ETWA 1C2YA 1JPNA 1HE1C 1H5NA 4G41A 5CLJA 5EESA 1RJ9A 3K1YA 2JRLA 2QIOA 2ZRJA 3QIVA 4KCGA 4CEHA 5EQJB 1VLHA 3QWIA 2J6HA 1UK6A 3LO8A 2XXAA 1E8MA 3MINA 4BLOA 1RRKA 2LGJA 1YIOA 1Y3CE 1QKIA 1MC5A 3MTQA 1R74A 4FN5A 5HGJA 5LA6A 3ICPA 4HXYA 3GGSA 1TC2A 2IBTA 2Q6TA 4FXOA 4XSGA 1RTKA 1DZIA 2ZITA 3UMRA 5K2MA 1JFFB 1FVOA 4L1KA 2P2DA 4U2KA 4KQMA 1RLMA 3AVVA 3VNQA 1H2WA 2C8KA 5FLKA 5BYBA 4ZHSA 1YB6A 1HOTA 3RE1A 1CQXA 1RQXA 2GCOA 4C76A 3R7BA 5CMLA 3P0RA 3DEHA 4EHFA 1SC9A 4MICA 5F76A 4CUJA 1PQPA 1JJAA 1B8PA 5IC4A 2P9EA 4R5MA 2W6NA 4XWKA 2QRPA 2G1AA 1CIVA 4TS3A 4G1MB 1EI9A 1P1HA 1IOVA 4IWXA 5TPZA 3WLAA 4UPVA 1NTRA 5KUTA 5CRIA 2ZRIA 3RJTA 1TAGA 2P79A 3KOWA 2ZZNA 2C7RA 3PC7A 5DHRA 4WBXC 1XPRA 2V74B 2PH3A 3DZIA 2GJSA 1IULA 2EC5A 3ILXA 1XLTC 1KQ3A 1UT8A 2QAGC 5AKGA 3BREA 1IYZA 1MABB 5CIQA 2EW8A 2WTAA 4NOKA 4OFWA 4BB6A 2QVXX 4KWIA 3PG5A 1OXXK 2JC3A 1EVQA 1JHDA 3U7RA 3JQ8A 3WAJA 1QIGA 5DTEA 3MJCA 1KI1A 1WQ1R 1IEXA 1XKLA 1N1GA 1G8GA 2PZMA 3DT6A 4XDHA 1HDZA 1HPLA 3OLVA 1DE0A 1DTWA 4DRXA 5T7BA 3AWIA 1GZSA 3F4BA 5AH0A 3B38A 2AK3A 2GZAA 4E21A 2VAMA 2DBRA 3O3CA 4AIRA 3RROA 5CEFA 3L9WA 5DTIA 3ASYA 1T4GA 1GZ6A 2VC2B 4DF3A 4TVBA 1E7MA 3LQFA 5KWVA 4J2OA 4B83A 4AJKA 5IABA 3B5JA 4S35A 1BKDR 4QUIA 4AJLA 3MJTA 2WVGA 3AQ4A 2QTTA 3ET4A 5KVSA 3DXFA 5I4KA 2QUIA 1XLWA 1C4XA 4L75A 1O6CA 2XVAA 1RAAA 1DAGA 5BSGA 4BC1A 1Q5PA 4WY8A 4W7SA 1RM3A 3KT6A 3OOSA 2IXTA 3M9LA 5FYDA 4NSNA 4O63O 1XRMA 5JE8A 2NXCA 2WT8A 1WXXA 1THGA 2AG6A 2ORVA 2RG7A 4HWRA 4NDAA 4Q7JB 5DBFA 4JITA 4ENUA 2ZWIA 5KNDD 5KNBA 3EZGA 3V2UA 4Q4AB 2IY9A 4XWOA 2HLDD 1DV1A 2H4JA 1WZUA 4IHKA 3IBSA 1YZQA 3R40A 3FYUB 2DY0A 1T15A 3L0YA 4JUFA 1K97A 4X45A 4N0MA 3A4LA 2B34A 4I8IA 1C41A 3NGXA 1GWNA 2ZRMA 5EJMA 1ZGJA 2JCXA 1YL5A 3GAZA 1O0SA 1FDRA 4GM1A 4ABYA 1EFDN 1AMUA 5L40A 3TTXA 2RAVA 5J59A 3SYRA 1YZHA 2NZUG 2ZBQA 3H18A 1ZISA 3B48A 1F6BA 1W9MA 3FLMA 4URZR 3TDMA 3N8NA 1NPYA 2EKDA 1JEYB 1LSJA 1L8QA 1AXRA 3V42A 3K4HA 3PEVA 1W36C 2RKWA 4RPLA 1O89A 3VZBA 1YDGA 1H66A 3EJWA 2JEOA 3VISA 2R1VB 2B5WA 3OKPA 2DWUA 3QPCA 1JDBC 1L7DA 3W5JA 1BN7A 5F9FA 1SAYA 3H8WA 1DUSA 1ORWA 1QFMA 2PX8A 2IYPA 2G04A 2QW1A 2HN9A 2W9XA 2AEJA 2QL5A 3JQ7A 4FMCF 4TSRA 1CTQA 4X92A 2I55A 3F96A 5JVDA 2JANA 1XPUA 3CW2A 4DNXA 1USIA 4JOSA 2VDRB 4DMRA 5E0OA 1U7OA 2D59A 2AFVA 2BBWA 1TF7A 2XUIA 3IR6A 1UWVA 1I6LA 5THXA 1RZRD 4AZVA 4BNKA 4JQCA 3ODPA 3NHLA 3L0PA 1QIJA 3DS8A 4O4IA 3V3TA 4J91A 3RS7A 1QZXA 2C96A 5JYEA 1ZRMA 3AJDA 1J1ZA 2HU7A 3JV7A 4IXNA 4KYTA 4J43A 3B1JA 3B9RA 3Q88A 5KBYA 5AW2A 2PSEA 1A7AA 1ZS9A 3M4JA 3RFTA 1TTTA 1U1FA 2K6GA 5EGSA 5FEMA 1YOVA 4ZYYA 2JFYA 1VL8A 3I1YA 1UBLS 3WBJA 1MEEA 4QPDA 2QY6A 2WPDD 4OHZA 3ZXXA 4N6NA 1FFEA 1G20B 1LI5A 1MQ9A 3BAFA 5AM1A 1GFIA 5JNSA 1AA6A 3DPSA 3EC1A 4ECEA 1TCCA 2UVPA 5KJFA 1MOZA 4MGZR 4IOLA 1NDQA 1T2FA 1VCNA 3PCTA 3GL9A 3FTPA 3O74A 4ZVRA 1M0WA 2FW6A 3BWEA 3A9VA 2K2QB 1F3OA 1UFQA 3EBOA 2Q5CA 3QVUA 1QC5A 2C77A 4TM8A 5CYOA 4CHGA 4CF3A 2C9BA 3AEZA 1XJ0A 2IEIA 3VNBA 1BRMA 1WXHA 4BQQA 4DZZA 2JFFA 3F1LA 4ZOLA 1MJFA 5C7OO 3I9JA 1E2MA 2VQ3A 4NJMA 4Y6GB 1W8DA 1YA4A 2K87A 3HB0A 2QRKA 1QNLA 1QHXA 1E64A 1KERA 1G0OA 1QQTA 1TLTA 2NVWA 1XRPA 3GG2A 3GZNB 4JQZA 1SUPA 4X91A 4IXTA 5DT9A 5SY6A 4ZMSA 3VNAA 5CBPB 2NYVA 3L1HA 1Y1LA 2C1ZA 4EG3A 1L0BA 3GUZA 3AR9A 3HCOA 4LK2A 4OM7A 1ZHOA 1LJLA 2EIXA 1MZVA 1M3SA 1M8JA 2BEUA 2I6UA 3CJQA 2IUTA 2QD5A 3FLEA 3GQBB 2YJNA 2QWXA 1HOXA 5ICFA 2GRAA 3DL7A 2QS9A 1WCYA 3TDNA 5K0TA 4RS4A 2O4UX 3K1AA 4JT9A 4FONA 1U9JA 1NXSA 1H3NA 5JO0A 2WKSA 2ZSFA 3JCZA 3WGNA 2B99A 1P4AA 1XFDA 3DMTC 3ZHRA 2IYLD 2XDYA 4RELA 1JHUA 2EJVA 4TV9F 2V96A 3R3YA 5IVPA 1QVRA 1PJ2A 1X9HA 4YP7A 4MWTA 1K4MA 3U5TA 1FFHA 1T0PA 4RTKA 4F86A 1FBTA 3DMPA 4CR8A 2GCNA 3V4OA 1SBZA 5CGZA 3B3GA 4KYUA 1C1DB 4MVJF 1D2AA 4LYEA 3ZD6A 1HEUA 3VSDA 4A9AA 3EXHC 1MB9A 2PG3A 4GXQA 1CJVC 2WP8J 1GU0A 2AYXA 1X3LA 2IZ0A 3PXGA 3UKJA 3UQZA 4NMHA 3WWYA 3P9NA 4Q9DA 5LLDA 2YC4C 3IUMA 5IBRA 4I55A 2BFCB 2YH2A 1MX9A 2NUAA 1MIOA 3FWZA 3NAQA 1SHTX 1V6CA 1YS9A 3E5NA 1LF5A 3K30A 2O20A 3WMEA 2DRIA 2Q45A 3O9VA 5B4TA 1EGHA 4AZSA 3F3YA 5LKRA 2A1TS 3DMGA 3Q9LA 5KWJA 3WMXA 1I7LA 5EIEA 1BGVA 2OGWA 2VJKA 5L3SB 2FOXA 3BRCA 1US8B 3M6IA 3DDOA 4LHWA 5AVZA 3WTCA 3DE1X 4N41A 1O95A 5EE9A 5JFOA 3FHCB 5ALKA 5K99A 1Y3FE 2FKNA 2QPOA 2VXOA 3LMKA 2XB2A 4G1UC 5A4MS 3TOSA 4J16C 4CKWB 1QYIA 5HQ3A 2CNBA 5TF0A 3DOJA 4IFBA 3ZUGA 4W8HA 3ES9A 2ILVA 2XVMA 4KVZA 3R8CA 1T13A 3LBAA 2VJYA 1TKBA 3ZU5A 4J0IA 5CAEB 1XEFA 1ISHA 1DKUA 4MULA 5EHGA 1Z2NX 3U3RA 3DLHA 2D1TA 2FP4A 2K5UA 3RWBA 3DJYA 3AG5A 4I2NA 3ZIUA 2AF4C 4ZOAA 3BCSA 3IR7A 1CZKA 1WUIS 1GP2A 2W7TA 3M1AA 4L6IA 3ED5A 4B2IA 3PD7A 1ZMRA 1PR0A 1VG9B 2YVKA 4JLBA 4O2AF 4RPKA 4JI5B 1HE3A 3VKHA 1U6KA 4B3GA 1AX9A 2R4TA 1AF7A 2EWMA 3V1NA 1EP9A 3KWJA 4AC9A 3LX4A 5L3QB 2Z5VA 5KDLA 4RXMA 5KKCA 1XTUA 3LPCA 4TXLA 4J2TA 1YS7A 1D6NA 4H1VA 5E1BA 4E88A 1CUEA 1DTEA 1ECCA 4NBLA 4YASA 3AUTA 3U26A 2FUEA 1Z0JA 4G0OA 2VZLA 3QHQA 1ZD3A 3IAUA 4YFYA 2WAOA 2FWNA 2IUUA 2REQA 3RC1A 1P33A 3WBBA 4Y9SA 1VM6A 3QFSA 4LHYA 2YWHA 3RR2A 1QRTA 5EMLA 3JY6A 3TN7A 2WLTA 2IFTA 3L4EA 2GAJA 4UVDA 3T3EA 4EOGA 4F46A 1ZD5A 5JADA 4E5MA 3T99A 3A3YA 3VPDA 2FEPA 2GPAA 1Y1RA 4KFUA 5JY6A 2CJWB 4FFDA 2QAGA 4OI1A 3TAHA 4AF6A 1U3CA 2VWHA 3H83A 1G7SA 4RKEA 4C2TA 2Z8YM 4NV0A 1TYDE 1VJ5A 4M6WB 1RXIA 4D44A 3V2HA 4YACA 4IDFA 1HDIA 3GCDA 2XUQA 1J25A 4MHOA 4B7ZA 4QOIA 5FUQA 3H4VA 2FMTA 4P92A 5GJWC 1NNSA 2QRVA 2W6QA 3LX8A 2QN8A 5FYQA 4P5DA 3QE9Y 3HJBA 2CLHB 3BH6A 4M0CA 4N5IX 3TD2A 3R6LA 1AUXA 3HM2A 4REMA 5JCJA 3ZLTA 2OQ2A 3HDJA 4FD3A 4LXYA 4KAFA 2J9XB 2ATIA 3OKAA 2ACWA 5KQPA 2QVLA 1AT1A 2F90A 3FDZA 3U3XA 3VYVA 4R3NA 5TJHA 3SOPA 1NU6A 2XOEA 4UVHA 2GKOA 4NU6A 3K0SA 1O08A 3HH8A 4GP9A 1Z39A 3ISVA 3M6XA 3AX6A 4Q05A 1NW4A 2Y76A 3UCEA 1A76A 4KLAA 3GN2A 3KZVA 4BFYA 1T2UA 2V5VA 3RG8A 3E0QA 2IVFA 3AH8A 2MOKA 1QYCA 1CUXA 3ZUPA 4GUDA 4M7RA 1SZJG 2QPAA 3KHTA 1SUBA 1WU7A 2RB5A 1SHKA 4HN9A 5LM3A 1VJ0A 3BTUA 4QQFA 1ZH4A 1PWYE 1ZBDA 1SIUA 5EUBA 4JEIA 1GEEA 1R16A 4V39A 1WQ3A 3T35A 2C95A 3EN0A 3KB6A 3GH3A 1GGNA 1XTPA 1NT2A 1OFIA 2OZLA 4LOIA 3RVPA 5DTRA 2O7NA 2ZREA 4EG7A 1S2GA 5K05A 1P6QA 1Z18A 4JUIA 1GG2A 2MIIA 2CBGA 3OQHA 1WMDA 3UYKA 2XQGA 3Q41A 1HRDA 3HV0A 3OZAA 3ZWQA 4JP5A 3SS7X 3OZXA 1YWGO 1OXVA 2AEMA 3WLHA 1B16A 3E18A 5LBUA 3PFNA 3ZY4A 3WGZA 1FDIA 2BL4A 2OUIA 3AIOA 5IP5A 1RC8A 1VPWA 4IG9A 1U0OC 4BNMA 2CKDA 2Q6KA 3T9AA 8ABPA 1LC3A 2OO7A 1WCIA 3K6KA 1T34A 4UHEA 3T6KA 1G8FA 4LRTB 1O77A 4L50A 4PE5B 1HX7A 3TTWA 3IT0A 5K3FA 4QASA 2QG4A 1OB5A 3PSHA 3AKZA 5D86A 4BFSA 3IKJA 2IXAA 2P9TA 2QX7A 4L85A 4YRGA 4WKPA 1B1AA 3ZGLA 4BO5A 4DY6A 5BUQA 3HLYA 4GZ6A 1D4AA 2NO5A 3GGGA 2I2CA 4H0NA 2HXGA 3V2IA 3D6NB 1ZN2A 5ILGA 1A9PA 4BB5A 2R62A 3OI7A 3TRDA 4V03A 2VNSA 1F8UA 2GZHA 1EP3B 1OA0A 3ASZA 3C3MA 1ENPA 3IELA 4ZV7A 1FFDA 2AKAB 3B3JA 1NFRA 3DJFA 5AKKA 3FFBA 2RK3A 3UXEA 3O3MB 4ZYTA 3ICVA 3NEJA 5JTUA 4MVJE 4P7FA 1YULA 4QE3A 4EY6A 3OHMA 2Q5JA 1O96B 4E09A 3JAWB 4IZHA 3JWGA 4Q39A 4HS4A 1VRVA 2C1XA 4Z6KA 5HYVA 4EGCB 4GXRA 4LXGA 2IYWA 2ZR7A 4M21A 3I9LA 4GC5A 4QPNA 4RVNA 2DR0A 2JGEA 3MMXA 2Q5EA 2O2EA 2PN1A 2POCA 1KF0A 2W6JA 2NZ8A 2PA3A 3D2BA 3DE6X 3GVHA 3HCDA 4IYJA 4KR7A 1Y5RA 2FUNB 3AJRA 2P62A 1D1PA 3L46A 4TKVB 4CLXA 3S1AA 5BW4A 5EJEA 1WPGA 2C20A 2DUMA 3HWWA 1NR1A 4NULA 1AQ6A 1LI7A 1Y4SA 4XQ9A 3ZJUA 4KC0A 1RJ9B 1UR5A 2VAWA 1J21A 5JD3A 4K40A 4CEHB 4KVFA 2Q0QA 2P27A 3OE7D 4O08A 4G0XA 4MCAA 3H97A 2CHUA 2XXAB 1XA3A 4Y2QA 3MINB 4PLFA 4YAEA 4EABA 5HOEA 4PM4A 4F3KA 8OHMA 5LA6B 3IIEA 4B7XA 3KJHA 4P0TA 5C51B 1SQFA 3MIIA 2CEAA 3EEQA 1TX4B 4G1CA 3UJCA 4HNAB 2AIRA 2B0CA 1ENYA 1Z17A 2J8ZA 4JVLA 1T36A 1LQTA 4X3CA 5AM5A 1Z5UA 5GM2A 5JYBA 3TG2A 1NI3A 3TBKA 3FVTA 3L7KA 4RZQA 5EQFA 3P9KA 3DYBA 1EX6A 2QEQA 2GCOB 4G0YA 4A6DA 3LH5A 5J40A 1YFLA 2FVXA 1QX4A 3HMKA 4KXFB 1PWXA 3RVKA 5HPYB 1V2GA 2I2WA 3E48A 1R6TA 2CFTA 1NUHA 2HEIA 2JA2A 4FYKA 3OQBA 4QPZA 4F5YA 1RR6A 2X1VA 3WNZA 4HGQA 4XAQA 3WK6A 5AVUA 3FTFA 1U8AA 3M6UA 1JIUA 2BRUC 4QZVA 5AOBA 1B3BA 1GV0A 2W2OA 2R84A 3K7EA 3OIVA 1S2MA 2CNKA 3UV6A 4WK6A 2ET6A 3LWDA 5C4MA 3NBAA 3PGA1 2R5NA 1QTIA 1ZCAA 2AN9A 1UMDA 4ICIA 3DMTA 1PLKA 2ADMA 4KO2S 4UNPA 2BGLA 2FPSA 1M34A 1DRWA 3MA0A 1IEQA 4BFLA 5J2TF 3ZEAA 3V1LA 2BOVA 4D42A 2PH1A 4TMXA 3DOCA 1UBSB 3GJRA 4MAMA 3ROXA 3RSSA 3LU1A 1DWQA 2OCKA 2VF8A 3BK7A 2C2KA 3KDPA 1AZTA 3NOOA 4KN9S 3RFXA 1ZWKA 2YWXA 3WL7A 3ZWVA 1RPTA 2I65A 1XCGB 1MNQA 3ETCA 3JQ8B 2I6QA 2YBEA 3PX3A 4AY5A 1FX1A 1LBHA 4HK4A 4HYTA 2H2FA 3C7TA 5HJEA 4QDUA 2H1IA 1DTWB 4DRXB 3RADC 1XQVA 2NU7B 5KX5B 3CRRA 4LMBA 4LRSB 3IQDB 4LYGA 4YHBA 4MI9A 3K9FC 4HAVA 2O7RA 1EG2A 4ND8B 5MGNA 2HMVA 4O2BA 4ZT7A 4WLOA 1ZCJA 4Q3EA 1JAIA 1W5FA 5C7YA 1EB8A 1TFUA 1KU6A 5JC1A 3DFKA 1NP3A 1Q91A 4DAEA 1KNXA 1QB8A 1W94A 1KYTA 1XN1A 5DGIA 1KZ1A 1TT7A 4RZIA 4AY4A 3JQDA 3ZHTA 4OQFA 4DCCA 5HIIA 1WP4A 1CRZA 2R7MA 4N48A 4C4YA 1GYQA 2QV0A 4G37A 5ULLA 3EEOA 2IDJA 1Q74A 4ZCMA 2OR3A 1R8YA 3ZQ4A 4BHTA 1RQRA 3EASA 1KVRA 2GPWA 4GXNA 5I7WA 5BO5A 5HHTA 2FK8A 1DPGA 3PNMA 2OCAA 5IAOA 4RZXA 3KKQA 1NMXA 3OM8A 1NXOA 2FZKA 3CG0A 1CJTC 1I9GA 3MJ4A 4LBVA 4R2JA 4UTXA 2QTWB 3ABRB 3L06A 3AUXA 1KK3A 4DDUA 2CCJA 4M9UA 4MPDA 4MR9B 1NQXA 3WAKA 2AWNA 1SU4A 3PFBA 3A14A 1MAAA 1U65A 4EIWA 3PNQA 1SBIA 4YCCA 4WIAA 3JALB 3CLUD 3DHWC 4NBRA 1FJGB 1P4GA 2OHGA 1PZMA 2BBOA 3RS0A 1GGEA 1KKLA 4DUGA 2ENWA 2VHXA 4K9PA 2XCTB 1JH9A 3FDJA 1UZLA 1BFDA 2EKLA 2QGNA 3H5VA 4EUFA 3IQEA 3ZE2B 2A4MA 1I33A 1FZQA 1RRGA 2PYIA 1SK9A 4DM7A 3HEBA 4EW1A 3RU2A 3T52A 2CE7A 3BWVA 3SZUA 3CTMA 3K0CC 1ISGA 3R20A 1W75A 4KYVA 5A5GA 3IP5A 3KDAA 2D6FA 3LPAA 1R0RE 4G0NA 3TG8A 1NVDA 3A2MA 1MW8X 3TLGA 1ULTA 3PV0A 4G0PA 1PQYA 2C88A 3OEHA 2ZJ1A 5B55A 4B6GA 2RI0A 2FJPA 3AYXB 1CUHA 3PC6A 3N6XA 4PLZA 4YJKA 3UB3A 2LIVA 5LD2C 1N57A 2D5CA 4D98A 4WE3A 1ZM4A 4GMGA 1EFUA 4DDKA 1XZFA 2WEKA 1W88A 1MU0A 3OLZA 1R7RA 2IGBA 4Y1EA 1ZUNA 2IKQA 3C5CA 1L5GB 4CMAA 2EBUA 4XD2A 4IXDA 4JJAA 1N5LA 4UMEA 5JVDB 3M6FA 2RHCA 5HP4A 1X70A 4Q47A 1W2GA 4QAJA 2XHEA 1M67A 4MRVA 1ORDA 3NC0C 4RFSA 4CR7A 3GJ3A 5B30A 5TXGA 5A4KA 3AY7A 1Z5PA 1UC4B 5K3CA 1ZK1A 4I4TF 4A0FA 2X9GA 4CEIB 2G1JA 3AWDA 3C98A 4HRXA 4O4IB 3TMKA 3U37A 3VOTA 2EJBA 4QXMA 1Z29A 5BSTA 2AJDA 1WPXA 2DGDA 1ATIA 2J0VA 1KEUA 4GQBA 4KQ6A 2ZZKA 1ZL2A 1H5UA 1TE2A 2R68A 3SVZA 2F43B 3SX4A 4ETMA 4UVEA 4F3YA 1RACA 1N2CE 2J85A 4LKOA 2DJIA 4DJAA 1O94A 1IXKA 1YOVB 2V4UA 1RJGA 4DG8A 3WMGA 2JJ2A 2NVBA 4KDCA 5DHTA 5ALZA 3ZI7A 4UTOA 2YV5A 3WJAA 1YQ9A 2FGJA 4Y2SA 4CQLA 2IELA 2ALJA 4CKCA 4F6RA 1DINA 1CUWA 1PLLA 1PGQA 5AJTA 4F8EA 1RRFA 5AUOB 3ZBUA 2QW0X 1RWVA 4TV8B 1VSUA 3O83A 5KJEA 3OKFA 5GM1A 1QC5B 4U7TB 1NC1A 1FOEB 4UDXX 4ZOLB 1Z37A 1I9CA 4EA9A 3I0ZA 4RD1A 1P4HA 3IKMB 1S96A 1RPAA 2IW3A 2NU9A 2QMUA 3JAKA 4NJMB 5DEOA 1P44A 5EC8A 3FVQA 4R5HA 2YY7A 2JAPA 1P8AA 1Y3BE 1OTYA 5EIAA 4YP1A 3JVDA 5FADA 5GJVC 5F77A 3TOVA 1G42A 3UV7A 3KTAA 1PRYA 1E60A 3DAGA 3DKRA 4IFIA 5CIWA 4J3NA 5K03A 4BLTA 1G6OA 1YZUA 3AZPA 3KEQA 2BEUB 4RJTA 1R18A 4UOEA 5CX1A 1SC1A 3INTA 4LX8A 3OFSA 3QHPA 4GMDA 3TF5A 1E1CA 2J3IA 1H6AA 3HBFA 4UATA 1M75A 3AONB 3K1AB 4IMRA 1WAMA 1YR3A 4HTAA 5ALXA 3B36A 4Z0TA 1JFSA 4B48A 3LW7A 4L3VA 2P8JA 2WRZA 3P19A 3MTBA 4QJIA 1SA0A 3LBYA 3KKEA 3D2CA 5AI6A 1QM5A 1T4MA 2C9YA 5D3MA 1BJTA 1DQPA 1JHQA 2RB4A 1T4CA 3LT5A 3CNQS 3NJ8A 1WO8A 4I08A 1LNQA 1NJ6A 4BRZA 1B3RA 2BT4A 5C18A 1N25A 1NP6A 4RFLA 4V2IA 1A3CA 4Q37A 2YXLA 3WLRA 4TXMA 3G9ZA 4R1NA 1QTNA 3N70A 1Q12A 2VF2A 3W3AH 2LV8A 2QTHA 3AI2A 1NN0A 4OHPA 3IGFA 1E9DA 2H1VA 5C4GB 2CMHA 2E7ZA 3L0ZA 2OPBA 3V9PA 1DEKA 1K68A 5ICSA 4AJ9A 1P19A 3RC3A 4KZPA 2PR7A 4FUQA 1IZ7A 4G1FA 1KAOA 2Y93A 4I55B 4ZCSA 1W35A 3E15A 2A84A 1MIOB 2COEA 4KRYA 1U2EA 4Q48A 1AUOA 4MYDA 3RANA 4CLRA 3F6BX 1H2BA 2HQBA 3W7BA 2IYVA 2ZR0A 4N4AA 9LDTA 4ZO6A 1FE8A 1CSEE 3FGOA 1GEGA 3LCRA 3NNSA 1ZC4A 4L9RA 4B34A 4JX8A 5LU8A 4GM0A 1QH9A 2AK2A 3MTIA 3AL0C 1NOKA 5HQ3B 5CBKA 4FSXA 5C8ZA 3CNEA 1FFSA 3C1UA 5IF3A 3UA4A 1QUFA 2P9HA 3DBVO 1EH5A 2FP4B 2HNKA 3PQCA 4GZ5A 4KBGA 1YA6A 1PT6A 1QIIA 4LBWA 3M9XA 3WLOA 1IN1A 3ESRA 4QQNA 2C7VA 1P72A 3BBPA 1J90A 2D8MA 4YGYA 1MB3A 2B7BA 4GVLA 2W2MA 4K87A 5F3DA 5HJ7A 5IX8A 2PSHA 3KVNA 3PDCA 3TR6A 4U0JA 1Q0UA 3M5CA 2WWXA 2HJVA 3CZRA 3ETNA 3FZYA 4FFNA 4PTYA 2Q4RA 2Y0CA 5DISB 1K5DA 4DQUA 4H59A 1I5OA 1QGOA 5IC5A 2NXJA 2XIJA 1Y82A 3A6DA 2C2XA 4OVKA 1R5NA 3F2VA 2Q29A 4RZSA 5ALTA 2Z57A 2UU9B 3ZNOA 3C3JA 2CJFA 3FLAA 3IMEA 5JNTA 4ERNA 3ZI4A 5JSKA 5A5DA 1VE7A 2GXAA 5LB4A 1CDOA 2X40A 5KTMA 1PJQA 1VPLA 4PRZA 1GQSA 1H2ZA 3PI6A 3OLQA 3KUXA 3LNTA 3AVYA 4BEVA 3SIWA 3V00A 3VTAA 4I46A 3R9WA 4I0WB 3ZK7A 1E9BA 1ECPA 2L42A 3HCEA 4B40A 1VLLA 3WZ2A 4BZXA 4M0LA 1B74A 1COWA 1JWBB 3P20A 1IN4A 2QAGB 4D0SA 3BXGA 1R6DA 4JLKA 1EAYA 1H23A 3D8RA 2ZTSA 3AGPA 3P2OA 1PEKE 3S27A 1HTTA 1Z6YA 5FBVB 4DJ5X 1F51E 3QU4A 3L82B 4L73A 4EAAA 2C84A 2ID7A 4Q9JA 2JI4A 2YCBA 3T9FA 1MIHA 3A28A 3M4ZA 1HH4A 2C03A 4RS3A 2VZ9A 3QVOA 4P4TA 4HVTA 1A9XA 3WGOA 4C9BA 5ILQA 3JVVA 1RAIA 3NHKA 2WTNA 3ESCA 1Z88A 3I5MA 4EI8A 4I9FA 2BHTA 3IOEA 1XBTA 1I7QB 1I3OA 1QYRA 4A7PA 2R8BA 3IVAA 3EVCA 4FXPA 2J9FA 4JGBA 4YUVA 4QGGA 3MT7A 1WNTA 1HE4A 1TCVA 5EZ6B 4N76A 2XDWA 3PA6A 4YK7A 4YRNA 3R24A 4GBJA 3FDZB 3L8DA 4GVPA 2ZUTA 3D31A 2PWPA 4AG3A 5BMVF 2C5LA 3U4MA 3LSYA 2EW1A 1ONPA 3II6X 5REQA 4HH4A 4MQ5A 2W0MA 2X9NA 2ZYUX 1KS2A 3U31A 3WIEA 5EJ7A 5JWOA 1OT5A 5CTJA 4G0VA 4ZTZB 1P0MA 4K9SA 1NL3A 3DEIA 1XZAA 4OGGA 4UREA 1LWNA 1TIBA 5EKDA 2VJLA 1KPHA 2HWYA 4CUKA 4P34A 3QUAA 4E7PA 5KWIA 1JS1X 3R4CA 3RS4A 4KL8S 3ENKA 3DVRX 4DR7B 2DERA 3HJHA 2YXNA 4IGIA 3PJGA 1EK5A 2ZDQA 3PC8A 3AHGA 4AAYA 4IKEA 1GUFA 1I2MA 1YKSA 1SKUA 2HF9A 4M60A 4FLFA 4US1R 3E3NA 2LPMA 4XB2A 3QWBA 2QMYA 1LTHR 1D1TA 1U2ZA 3PJDA 3QF4A 4P98A 4TWRA 2JLVA 5DX0A 1LV7A 1WTCA 3VR4D 2IP1A 1KBOA 1K98A 3OJFA 1TYEB 3O2QB 4IDEA 4EO7A 3BXXA 2W8BA 1KVSA 2B6HA 1M0EA 2UZIR 5JANA 1MRZA 2G0AA 4P81A 4RK1A 3S8EA 2JLSA 4B3IA 1XZEA 1EVZA 1LI4A 5JT1A 4KQGA 5EUMA 1SULA 4GKKB 4XTRA 3DDHA 1GGMA 2IY8A 2P35A 3GF4A 4Z4CA 3DHNA 3DVQX 3IP9A 4IFTA 3HJAA 4KR3A 4KIFA 3NRJA 2XGGA 2HIAA 5L6LB 1WCIB 4R6XA 4HXGA 3P97A 5M7EA 3JPYA 2VP4A 3Q7RA 4P80A 5ALJA 5KOYA 3N87A 3LBHA 3WA7A 1JJIA 1QBGA 2BFMA 2C0QA 4O5AA 1KYWA 1AD2A 5K3FB 1W36B 1FYVA 4L27A 3VAZA 5HW0A 2B8TA 4M55A 2GAIA 2A1UA 1ZM3A 2ZULA 3FTEA 2WTEA 2ZATA 3MZ0A 2FWMX 3JWEA 3NBZC 2FQYA 3S99A 1JDBB 3IMCA 2MWMA 2R66A 5EP1A 2VNHA 1HXHA 4NATA 5G0SA 4DV1B 2OEPA 4JROA 2GPYA 4WFIA 4BASA 4CQMD 5K0SA 2A88A 1SUDA 2E49A 4W6QA 1SXHA 1DG1G 1NQ5A 1CHNA 1ZUD1 3IHWA 3P27A 4YMWA 2B8JA 3DTTA 1MOQA 4DPLA 1DIRA 4X1OA 4ISCA 2GB4A 5F2EA 4X64B 5JD6A 1Q0QA 2G17A 2XDQA 2AGVA 2GJKA 1M2HA 2X7JA 3UK6A 2O2DA 5B3AA 4HH1A 4DEXA 5C32A 1XD2A 2XCQA 1BA2A 4IIGA 1SC3A 1XNHA 3ZWXA 3ZDCA 4PR0A 4E5SA 2YZNA 3IQXA 4BFUA 1N9ZA 2NAFA 2WM8A 4DR1B 2RAUA 3QUCA 2K2WA 1L1RA 2QUHA 5KSWB 4V0RA 1JYEA 1GPDG 4CN8A 4L9SA 1M1YE 3S1AB 3CGWA 4I1OA 4NJEB 2NZJA 1H9BA 2ZVJA 1WJGA 4DIKA 3W06A 3W9YA 4QC2A 4C88A 2O54A 1CJCA 2GZ1A 3P9YA 4NBKA 5ESRA 1R9MA 3JQFA 4OGLA 5AHXA 1CEEA 3KQSA 3QQPA 2QYHA 3W5SA 4JI2B 3FCAA 1T6XA 2MINB 1SD1A 3AFMA 4E51A 2VNAA 3RJZA 2UDPA 4DHWA 4LY6A 3BQMB 1JU3A 3PWKA 5TEVA 4AXBA 1I2BA 1BVRA 4DAOA 3NHWA 2AYZA 4CI0B 5FOQA 4KGVA 1W5EA 2NQ8A 4NE9A 4ZDIA 1T36B 2AN4A 2X4DA 2UKDA 2ZIGA 3GHYA 3H5IA 3HYRA 3NCHA 3OEYA 4FC7A 4ZI5A 4BJHB 1K7YA 2PRSA 1BVHA 2VS1A 2LDXA 3MK31 4BMPB 3SSMA 5KNDA 2AKEA 1K6MA 2RBGA 3HCPA 2JFHA 1U1CA 3ODGA 3NIGB 2J0UA 2HLDA 2O1SA 3HCAA 1YQQA 4U63A 1IZ9A 3I4LA 5I7OA 4MO2A 5HF6A 1NQOA 1KL7A 5FLXA 1PW7A 3GJ4A 1Y9AA 5FPSA 2BAGA 3ADPA 1TZMA 3JQGA 4P36A 1IAQA 4LV5B 3X1KA 3SHVA 3EGVA 4W1SA 3ZXIA 4DR2B 3EEIA 4G89A 4J0CA 4U00A 3P5BA 2QR3A 4L8FA 1QK3A 4O8CA 4MB2A 2HDOA 4LBZA 4PSAA 3DHYA 4B3SB 4WUVA 1XZQA 4NCNA 1M34B 2PM8A 1UODA 3TM5A 4N65A 1OXKB 2PAAA 2OBMA 5E7IA 5AXBA 3CLTC 3NOXA 4CM9D 1FDVA 3WL8A 2LKCA 1NI4A 3OETA 3CT4A 2OMKA 3PHCA 1WOYA 2V7UA 4WVLA 2NO7A 3DMHA 4JC5A 3NP9A 3CRNA 4D81A 5DYTA 3ROQA 1HDXA 3THXA 3AIKA 4RWZA 2PJRA 4RD3A 3SJBA 4Q9AA 3NBQA 2DQZA 1ZINA 4L8LA 2H2HA 2X9QA 4Y2GA 3RVRA 3EXHB 4EMUA 4AWAA 1G4AE 3TQTA 4OXKA 4H35A 1Y8QA 2CT8A 4JI1B 2ATEA 1KGSA 1Y42X 3KE9A 1WF6A 3HUFA 4N6GA 4Q82A 1L4KA 2QHXA 1E5VA 3PT9A 1BAPA 4O2BB 1SVOA 5I7VA 1H3FA 3P2YA 3BHIA 3JYQA 4K9OA 5C8DA 1RJEA 4YAFA 1LD3A 3LCJA 4JSRA 3WVNA 3HB9A 1EFKA 1U4OA 5B57C 4YJFA 2HSGA 4YQZA 1Y5LA 3ITEA 4MIOA 1ZRSA 4BMZA 5HQTA 1DCTA 3I2YX 4S1NA 4UJ3A 1RZRA 2PBRA 2FMUA 4MS1B 3ELUA 4HNSA 1FP4A 4YJ2F 2ZSBA 4ODIA 3UHFA 1Z2DA 5HSGA 2QZSA 2EFHB 1GCUA 4PHFA 5COBA 4HQRA 4PPGA 5B3JC 2G1PA 1UFRA 2PKWA 4M8IA 5LP6A 4NYMR 2ZUSA 3PTZA 3BGOS 3ZVMA 1ZD8A 2FJUA 3FE2A 3I8OA 2W37A 3KSMA 2B8EA 4DSOA 1QOQB 4ZI3A 2P9CA 2GM5A 3HYTA 4KFRA 5A9RA 3T3IA 3NJ4A 4MDFA 3TL6A 3G0BA 1YR2A 3N2NA 2AMLA 3PTLA 4DIBA 2WPDA 4RFVA 4ER3A 4GKAA 4NOLA 3T4XA 2IV3A 1RQ2A 4JVNA 2PWAA 2Q3DA 5EMMA 3W2HA 3DLPX 2J0QA 4D8YA 1V47A 3BA1A 3GBVA 3RVMA 1W1WA 4AI6A 3GXBA 2WVAA 1X1SA 4IUCS 4PHHA 4WY2A 2I66A 4JI6B 5HS4A 1JL3A 2ZXEA 1FW6A 3AIMA 4EG1A 3T0FA 4BZZA 3OUTA 1CP2A 1EE2A 1TCBA 4XLZA 5K0GA 4D0RA 1L3IA 4WOBA 2A92A 3L8FA 3WSVA 3FOFC 2J4DA 3E9QA 3QVXA 5F7XA 1MX3A 5IPFA 1YFZA 1O57A 4K3VA 3TLGB 3I6YA 4M9RA 1KSHA 3MGBA 5AJHA 2Z3ZA 4UOQA 5IJXA 4JJKA 1CRWG 3R2JA 4RTNA 4ENVA 3BJRA 4YCJA 1Z26A 4ZD6A 2Z5FA 2CL7X 5ESXA 1YO6A 2WUEA 3D3JA 3QXGA 1WUTA 1BROA 1W88B 3Q9UA 5KHLB 1KWKA 1CUJA 3NKFA 2W0SA 4DCJA 1ZUNB 4OHWA 4DXHA 1SQ5A 2YV2A 3MGKA 3EYAA 5IVHA 5K0NA 4L5IA 4CM6A 5BSFA 2D3WA 1CLUA 2CDBA 4AP5A 2OOKA 2W2PA 2WYOA 4RFSB 4XYEA 5JAQA 1KOLA 2YBDA 4N5HX 5FULA 3PD0A 1PV4A 1R50A 1M5RA 2HWWA 1T6NA 4TRNA 2E4VA 2CXOA 1LNZA 4ZO9A 3BQ9A 3ZWDA 1R6UA 2I99A 4HQ6A 2WU4A 4ALJA 1XRJA 3GT0A 2VATA 5HUQA 2CSXA 1LTQA 1VKZA 3QWFA 8AT1A 1UIMA 2HCBA 2CLKB 5DEIA 2BM8A 4FBGA 3L6BA 4I1UA 1CY7A 4CIDA 5IYZA 1JQJC 4NFLA 4TGLA 3LL4A 4E31A 1SOUA 4S2EA 1ODSA 1TZCA 2IITA 1OXBB 3W8FA 2UUBB 3OTWA 1U3FA 1CVLA 1T9HA 1UKEA 3C74A 3ZWWA 1Q7GA 4CQLB 4RQAA 4CKCB 3RB8A 1XDSA 2UAGA 4YH1A 4M1KA 3N0RA 3SBDA 3V7NA 4F6RB 1P0IA 3IEIA 5KTRA 1BG6A 1G1MA 5JR3A 4PC3A 4FNOA 5K3DA 4ZVNA 1ZY2A 1TJNA 3CX4A 3WQSB 3TOXA 2QL6A 4RMIA 1D07A 1JE1A 3AR5A 4PG6A 1K6JA 2ORED 5AOVA 5SYNA 1V71A 1X1BA 3KVRA 3FKSD 2NU9B 4OI2A 3JAKB 2JCYA 1U2DC 1XU9A 4NP6A 5P8WA 2PNFA 3IP3A 3LDHA 4C4OA 4ZREA 5AJZA 1EZ1A 2PKRA 2SCUA 2GXSA 2EWVA 4H16A 4BMDA 1KSGA 3KTAB 4O8ZA 4R4JA 4X5OA 4AWBA 2E5WA 2YQZA 2RKOA 4I5EA 3QVKA 2DM6A 3F1KA 3KSDO 1QO0D 1FU7A 3F2IA 1QHSA 2XCOA 3OWXA 5CX1B 1NQTA 4DQKA 1OXUA 1E1CB 2DP4E 4JZKA 3I3SR 3ZZUA 1CBUA 3F49S 4LZLA 1CR2A 1PFYA 3FB4A 1XQYA 1G9SA 5D3MB 5C7IO 1T4CB 2JCVA 4XCQA 5CVJA 5FFFA 2Q5FA 5J9FA 1TU4A 3KTFA 4PZDA 3NDJA 4NQZA 2P2YA 1VA5A 4IEIA 2ONKA 4DLRA 4YUAA 2QRZA 5CNJA 3HA7A 3S55A 5F33A 3CZ4A 5DV9A 4ZVVA 1PGPA 3HR7A 3O82A 4OHBA 2C5HA 4PNZA 2OG2A 1IOWA 3GJ5A 3G5LA 4I5GA 3S2UA 4C7OA 1SD5A 4W5TA 1C9KA 4D6XA 3PR3A 3AVWA 1BJRE 4QSMA 4REOA 4Y18A 2XYVA 3OCJA 4RABA 4UZFA 3BTOA 1SCKA 2CLDX 1TRHA 3QBJA 3WLJA 3O94A 4CF7A 4FYWA 5TEWA 4MW0A 4HP8A 3MNFA 1JWLA 1IVNA 2F1HA 1A5SB 4QGHA 4REQA 5BR1A 1RYHA 1T0JB 2UYGA 1EKXA 2QTGA 5E6RA 4K9MA 4W5QA 5LU9A 3K70B 1VP3A 3DFIA 2AA3A 2X6QA 1HDRA 2VRBA 1H22A 1YS1X 4BU1A 4OJNA 3LPDA 1Z5VA 3ZWKA 3KQNA 3PFCA 3R5SA 5BSRA 3SXUA 3EZYA 5JMTA 2Y3IA 1ZXXA 5BNFA 3LUGA 2HMWA 1SCJA 1PZGA 2QG9A 2H4FA 4EFLA 1H2HA 2D5AA 3EQ7A 1S8AA 1HL3A 1DX9A 1EWTA 4KQHA 4K0KB 1F8YA 2W71A 3DBLA 1QRAA 4B79A 1K8QA 2ZE7A 4LA4A 4MCIA 1HNWB 4PHTA 3A8TA 4TZ0A 2QN9A 1QH8A 5K5EA 5C8VA 4EI9A 3DULA 4UM9B 3DA8A 1KH3A 4MITA 5LWQA 3CONA 4TTJA 4HVAA 4YRCA 1O5IA 2JGJA 3KUCA 3K9WA 4P2GA 1VTKA 2VHTA 1NMZA 2XTAA 1UP6A 2WE8A 2EATA 3SBEA 2DOKA 4FNMA 3VKFA 1ICIA 2HIHA 3DZHA 1M73E 2NWQA 3AY6A 1SBNE 3HVJA 4YJGA 2A1TR 1KBZA 4X65B 2PFKA 4NL4H 4P22A 3D3EA 1XDBA 1E94E 1OX5A 3D4IA 2ZRBA 1K63A 4G5OA 4KPEC 4INOA 1CR0A 1TT5A 2B1RA 3CPHA 4ZXPA 1ESDA 3S4YA 3SCZA 4WKNA 2O8VA 5NLLA 4IGAA 3T15A 4F84A 5JZ9A 5K3EA 5LXTA 4Z51A 4LZZA 3K0EA 1RLOA 4TL8A 4WLUA 3KQTA 13PKA 4GOXA 5B1DA 4DIUA 1YFJA 1OC4A 2QUBA 3EK2A 4YIKA 3HLKA 3W4JA 4RK6A 1VZ3A 1Z28A 3JZIA 2C4VA 3M33A 2PX6A 3HDVA 2WYVA 1N2IA 1VHDA 1GYRA 2PTHA 5AD1A 5BNTA 1K2VN 1Q1GA 1S3FA 4FR2A 3W9UA 4BZWA 2J6IA 1A9XB 4IRXA 5AHWA 1XT6A 4UUPA 4D1YA 3OOYA 5HXAA 1WB5A 4W82A 1W4RA 2WJZB 5SICE 1NP7A 2JVKA 3IOMA 2CJPA 2D7DA 1HLDA 4UBNA 1T9BA 3ASVA 5LBIA 3WDLA 1Z35A 4CL0A 1ZDMA 2VWGA 5H8WA 1IQUA 1OU0A 3KUDA 3TGLA 4WZZA 3F46A 2UYHA 2DUJA 5LOVF 4J8PA 1E9RA 3NIFB 1S2DA 5IVDA 4FU0A 1SMKA 1DAHA 2XIQA 1YRLA 3DCYA 4FCVA 1GXSA 4LIPD 3ZDEA 1I30A 3AKDA 4D97A 4AQ7A 4ZCRA 5GZ6A 1URPA 1EDBA 1L8OA 1ORRA 1KIFA 2EFGA 1POWA 5EHZA 2ZRLA 3PRYA 3M89A 1FLDA 4MWCA 2FSHA 2PSJA 3BC1A 3EDMA 1IBRA 2DFVA 1JZQA 1OYVA 2D1SA 1CF9A 2I33A 5H5JA 4A3SA 1G6HA 2AR0A 1AB6A 4MEAA 3T0IA 3OFND 4P3OA 1GSIA 2FSUA 4AF7A 4BFCA 4CGZA 2AL7A 5KTYA 1UAAA 3R0JA 2C5SA 3PR1A 1I24A 2UYQA 2XRFA 3PUXA 1E9AA 1Z5GA 2XF8A 2D0DA 3LOQA 3SR0A 4B85A 4F21A 3W5VA 3OE7A 2O5VA 1ECGA 3IVGA 1AO3A 2JG3A 3UVEA 4HHEA 4UTRA 1A9SA 1J8MF 1JFRA 5AMXA 4DE5A 3TIGA 1YIDA 4BX3A 3VPXA 1L5OA 2GF2A 2O59A 5I45A 1Y1TA 1WB6A 2YNMC 2O7SA 3Q5EA 5LDHA 3UWPA 1H9AA 2LCFA 3EARA 2R9VA 3JZAA 1CD5A 3B1XA 3BK2A 3GAAA 1WPQA 1LLCA 3G9XA 2VHUA 3KCQA 3LP8A 3FUTA 4M9SA 4MVJP 1S89A 1XTKA 1BCRA 3L7AA 4JJ4A 1FXWA 2VF5X 4ZQFA 3VO8A 1O0BA 3B2QA 1I4WA 2BR4A 2XX3A 3KT8A 3MSXA 4XARA 2JGMA 3D3QA 1QVVA 1KMQA 1VL1A 3GB9A 1BXKA 1R4NA 2AR9A 1F6WA 3QNWA 2A1UB 4WKBA 2GM4A 3OPYA 5LD2B 4FEGA 2PSSA 2YL2A 1R8JA 3M6VA 4HYEA 3WS7A 1Z08A 5KOJA 1E0SA 3EWAA 1EGAA 3NT2A 2OSBA 5EE3A 1ANKA 4EYKA 5BORA 1B23P 4MVJD 3E61A 2PZLA 1Y7LA 2FUKA 4QDZA 5EPUA 3V55A 4ER5A 4ZEVA 5L53A 2O14A 4TTAA 5FUVA 2DY1A 2W2QA 4TROA 4CR6A 4YCLA 2D3TA 4MTLA 1G4UR 1G8KA 1AZWA 2AJBA 1RHRA 4MRAA 3WXMA 4X7RA 5EJ2A 1W96A 1T2AA 2IK8A 4DC1A 1XHLA 2XDQB 3P1JA 4WASA 4XLTA 2WWYA 2VCEA 2XE8A 1XD2B 1PP4A 1SVIA 1XTJA 1PNTA 2EJTA 3DGFC 4U8HA 4B17A 5JEEA 3CLSC 1EUQA 2FGKA 3GFGA 4JKIA 4KYIB 2A67A 3HABA 3M0EA 4PRYA 4OJTA 4E5UA 5H9WA 4YDRA 1J00A 1KK0A 4Z4EA 4BIMA 3AU8A 3V1TC 3IAXA 4DY4A 1BE8A 1GPMA 1KQNA 3UAXA 1N6RA 3Q6NA 3LC2O 3WNDA 1XVIA 4DLXA 4HAWA 5DM60 2Q7XA 2EBWA 2ZWVA 1O7JA 1QQBA 2BSAA 1GAWA 3Q85A 3BGDA 5LQCA 2WQ7A 1GTL1 2NU8A 3OMXA 3S28A 2JB9A 4FFBA 1U6IA 1UXGA 3FPGA 4LXIA 3QBVA 2ONJA 1C7IA 1K7SN 2ZJ8A 2QLFA 3PRHA 2AVDA 2VK4A 3AUFA 4LVOA 1IY2A 1PJZA 1J0DA 3QU9A 3ESYA 4Q66C 1KAQA 3D64A 3WLTA 5IULC 1TLFA 1VGRA 4JB3A 4JP1A 1G21E 2BH9A 1QG4A 1VKOA 3R0QA 5EVJA 3UK0A 5JXWA 3UC5A 4CF4A 4TMTA 3Q0TA 4TMFA 3LUCA 5G1NA 1OY1A 4RHYA 3T7SA 4DT1A 1N6NA 2VJBA 1AVTA 4U7FA 2GAFA 5CYGA 3GMSA 4E94A 5AKYA 2DEUA 3B8HA 1LK0A 4IM7A 3ZD8A 4C4PA 3T7DA 3FROA 3IAAA 4D4IA 2J0UB 4IWYA 3TLEA 4G3XA 3BS4A 5IF9A 3L84A 4P82A 2H4YA 3QLVC 2FUG1 4JA2A 5GONF 3ZHQA 3ND9A 3P94A 3ANXA 5M04A 2VK1A 4GYWA 3FRJA 2AOUA 2WJHA 1OILA 3JQGB 4DLBA 3M3PA 3EPKA 4IV5A 3TAXA 4PVDA 3H65A 1EXVA 3C16C 3C3AA 3GLTA 1NR5A 2FPIA 3DGEC 4LJ6A 2ZKLA 1ZMBA 5U4XA 3TLXA 5BN1A 5DHPA 1XTBA 4EUHA 4LQDA 3JATA 4MROA 4YJFB 4R83A 5B7PA 2UZ1B 6GPBA 4OUDA 5G0VA 2ASVA 1EVEA 1NI4B 4OQYA 5CNMA 1XKXA 4FB5A 2HF2A 2FQ1A 1T2DA 1UPFA 3IEVA 3Q5DA 4URUR 1T5OA 3FYSA 3THXB 3QZUA 2WG1A 1A72A 1T1JA 4GDMA 2LW7A 4NFHA 3HGMA 1YVEI 4OPMA 4F4UA 1AKQA 2V59A 4B3XA 3QI2A 4BVFA 1DQYA 2J3KA 2G63A 4DWJA 3ZHXA 1Y8QB 4KQXA 1W85B 5A1TA 1YQDA 3BXHA 1GPLA 3OZFA 4Y2YA 5H4GA 2FU5C 5JC8A 1CS0A 4HGNA 3E8MA 3I1JA 1U7UA 2V9PA 4XKJA 4B32A 3TIIA 4QDOA 1JFTA 4BATA 4D9BA 5JFTA 1E2FA 3NYWA 5KWSA 3TKYA 4XRGA 2MSEB 1NUQA 5EZYB 2OV3A 1TUBB 5TQVA 3NTQA 3U9TA 1RYNA 2Q99A 4WPGA 2VSYA 1ZM7A 2P6NA 1Q83A 3DE2X 4NK5A 1FP4B 3G5TA 3QMWA 2QXYA 1HSZA 2Z2IA 2WR8A 3O47A 2ORIA 3HZRA 4IOMA 5T4HA 3TZEA 4YAWA 3NW9A 4YRPA 3NBYC 1U94A 5LP6B 4U2FA 4R8SA 1E8NA 2PH5A 4H60A 4TYQA 3KG2A 4GIBA 3G2OA 4S0XA 3GUUA 1QYVA 2A0WA 3TH5A 2F4VB 1FDOA 3U7JA 1VE1A 1BWRA 3MQ4A 5ICGA 5K4HA 3BGVA 4KMOA 1B00A 1IBCA 5JQWA 1T24A 4EKIA 3WA6A 1KJYA 1PFKA 2J46A 5T3UA 3CC8A 4A1OA 4BCBA 4QQRA 5CDFE 3VR5D 3L43A 5JJKA 1XZLA 2EAUA 3N2IA 4UFOA 4EB0A 1E77A 3FUCA 4GVXA 3THRA 2HQRA 3WOVA 4DUPA 2FX3A 2P9QA 2OCIA 2RONA 3FCUB 3FOCA 3GEEA 5MN4A 1SHZA 2JGDA 4UHBA 4MQMA 1JBKA 4A0HA 5AVSA 3NHBA 2BFDA 1QR2A 4ZRMA 1U6JA 1X7GA 5KTSA 5AWFC 4F5WA 3WIVA 1D2MA 3JARA 1N4AA 1I2AA 4QG3A 1FNDA 2OKGA 1XMIA 1RXEA 1T3SA 2Q1SA 4DIFA 2HZBA 2Y71A 4LZWA 3JRWA 2AHRA 3TQOA 1IMJA 4XEUA 2G0NA