3NBAA

Phosphopantetheine adenylyltranferase from mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (ampcpp)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
156
Chain Sequence
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Kinetic, thermodynamic, and structural insight into the mechanism of phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 52
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nbaA00
4ZT7A 3MXTA 1B6TA 5HG0A 1OD6A 2OV4A 4DE5A 1QRSA 1JZQA 2NSYA 3UY4A 4ARCA 1ULHA 3IOEA 2DXIA 1PG0A 2GOYA 1WQ3A 3ZGZA 1QRUA 4QRDA 4ZCRA 1NUTA 1U7XA 4MUGA 1O97D 2JANA 2VTBB 1U3DA 4OJMX 2PFSA 5AHWA 4F4HA 4NZPA 1J1ZA 2DERA 1WQ4A 4NATA 3N9IA 4ZCTA 1ZJWA 3HL4A 4MW5A 1T9GR 3L93A 3DO8A 3FOCA 5KHAA 4AQ7A 1G8FA 1M8JA 5HUHA 1JMVA 3G6KA 3L92A 5FNZA 1KP2A 1N3LA 1K4KA 3M5WA 4MWDA 1NSYA 4EF6A 2EL7A 1N2OA 3MLAA 3C8ZA 1V8FA 4MWBA 2QTRA 1PFYA 1X8XA 1JEDA 1U7DA 3FG9A 1OWNA 5HUJA 4MQ6A 2GM3A 3RBAA 3N05A 3OP1A 3UC5A 3I05A 2ZUEA 1N78A 2A1UB 2Z09A 3GMIA 2AZXA 3SZ3A 1O97C 1YUMA 1I6KA 3CLUD 1Y42X 2DETA 3FH0A 3IODA 4CT0A 2CUZA 2DLCX 3PNYA 4HK4A 2WQ7A 4KR7A 5J58A 1OWOA 4ARIA 1TQ8A 2IP1A 5KCMA 1XNJA 2CV1A 3P0HA 4JXXA 3DLAA 1JIIA 3FI0A 5IJXA 5TS2A 1NZJA 3G5AA 3CLTC 1O96B 5DEOA 4GRIA 3IDFA 1J70A 2J09A 3QTBA 2CT8A 2PZAA 3SDBA 1NURA 4E1AA 1NUQA 3COVA 4F3RA 1NUUA 2PZBA 5BNZA 3ZJUA 5FO0A 3TQIA 3NBAA 1VBNA 1NP7A 3VU8A 3D6VA 3IOBA 5KWVA 3A04A 1X6VA 3PXUA 2A1UA 1IQRA 3ILVA 1WXEA 1O0BA 3P0JA 3G59A 4R2LA 4X0EA 1MAWA 2WB2A 3ZXSA 4UZFA 1TYBE 1IFXA 3ISJA 2RD2A 1I6LA 1EFPA 1TYCA 2V0GA 2CSXA 5K0SA 4R0NA 4MVYA 1A8HA 3ND6A 1Q19A 2CYBA 4WNYA 1FFYA 2Z08A 1O96A 3AIIA 3CR8A 4DDMA 1H3EA 4MW1A 2WQ6A 3CVVA 3U1VA 2J08A 4JFAA 4ZT6A 3DV2A 3KT8A 2A7XA 1O95D 1KQPA 1WOYA 3A05A 3ND5A 4YBRA 1NUPA 2X3FA 4ZCSA 4JZYA 4KPUA 1KH1A 1QRTA 4MUJA 4DNXA 4GU5A 1KQNA 5TGTA 1T9GS 2EJCA 4EG4A 4EGAA 3CVUA 2PZ8A 4KR9A 3MLBA 3TS1A 3F3MA 2Z3VA 1GN8A 3H9BA 4EG7A 1EJ2A 3QE4A 4RPIA 4XFJA 2DEUA 5FO1A 1G8HA 4K03A 2J5BA 2NZ2A 4MUEA 4YP5A 3VRHA 1PG2A 4FZJA 3K9WA 1R6XA 1XNHA 5F23A 2PG3A 2RE8A 1S4MA 2J07A 3AG6A 1XNGA 3IUBA 1WKBA 4Q16A 1Q11A 1N2EA 1F7UA 4MUFA 3TZEA 1O95C 3HZRA 2A1TS 5IHXA 4PBRA 4MULA 1QNFA 1R6UA 4MUIA 1F4LA 4PBSA 2AG6A 3N2YA 3SYTA 1CT9A 1O6BA 1VBKA 2B7LA 4XFDA 4MW9A 2IJGX 2QTMA 5TEWA 3AL0C 3IMCA 1OWPA 1EUYA 4CDNA 4MUKA 4I6EA 4MUNA 5TEVA 1MC1A 3KT6A 3RJZA 3RK0A 2A1TR 1ILEA 4UZEA 3ZUGA 3PRHA 3UOWA 3FWKA 4CQNA 2I1LA 3ELBA 3SP1A 1O0CA 2OQ2A 1QTQA 1EFPB 4OUDA 4JXZA 3TQOA 2D54A 1M8PA 3OTWA 4EG5A 1R6TA 2E21A 5H16A 1KP3A 1N2BA 2YWCA 4I6GA 2WSIA 4J76A 2IELA 2E18A 4ZCQA 2C5SA 1SURA 1YI8A 3S3TA 1WY5A 3ZIUA 3FHJA 1JGTA 3IMGA 4Q93A 5JBNA 4P2BA 3MUEA 4ZT5A 2BYTA 1PFUA 2CYCA 1WXFA 1TEZA 3KT3A 2V0CA 3Q4GA 4AS1A 1MOPA 2R5WA 2JAXA 2CFOA 2QUJA 5J5AA 3IUEA 3FY4A 1Q77A 1ZH0A 4G6ZA 4KPUB 2O8VA 2E89A 1U3CA 4JYZA 1IQ0A 3FNRA 4ND7A 4CDMA 3UMVA 1JECA 3LE8A 1H1TA 1M8KA 3IH5A 5H7XA 3CLUC 4NX2A 3INNA 2HZ7A 4U7JA 4EG8A 1MJHA 3NV7A 1GPMA 3VGJA 4ZT4A 1F7VA 4U8HA 4QREA 4TS1A 1M83A 1K97A 3GUZA 1T6ZA 2VXOA 3RFFA 4U63A 2DPLA 4MLPA 3TZLA 1LW7A 2QUIA 4ZCPA 1U0BB 2X0KA 1JHDA 3A2KA 3HGMA 5K0TA 3X1JA 1WZ2A 1NI5A 3X1MA 2QJFA 4RUKA 3IVCA 1GLNA 1YUNA 1J1UA 2CYAA 2CV2A 4L2IB 2YY5A 1UFVA 1OWMA 3X1KA 1QU3A 1KORA 2DR2A 1N75A 4NDAA 4MVWA 3COYA 4J75A 5LM3A 1RQGA 1JIKA 1OBHA 1JZSA 4MW6A 2D5BA 2XRZA 1EXDA 1GTSA 3DPIA 1M8FA 2HGZA 3KFLA 2E0IA 3IOCA 1EE1A 4PBTA 1M8GA 5DK4A 4ZT2A 1IRXA 3H99A 4I6JA 5LFAA 1NUSA 2QJTA 4OUDB 4MAFA 3RHSA 4R2MA 2G36A 1IQUA 1H3NA 3FIUA 3LCJA 1TFUA 1T6XA 1JIJA 5EKDA 1NYLA 2QJOA 1GZUA 2XRYA 2PIDA 2D13A 2DUMA 4L2IA 3ZJVA 3PNBA 3ZXIA 1MB9A 4HPWA 1M1ZA 1KR2A 4NAHA 3N8HA 3SEZA 2ZUFA 1EFVB 3H05A 1FYDA 1VL2A 4DDHA 1KH2A 1KH3A 1MB2A 4NAUA 3CLTD 2X1MA 3Q10A 1K4MA 4K0RA 4MVCA 1KAQA 1OWLA 2QUKA 4MW4A 4DLPA 5LLTA 2GKSA 3H9CA 3CVXA 3UK2A 1EUQA 1QU2A 4KR6A 1OBCA 1I2DA 1JEEA 2J4DA 4EG3A 1GAXA 2O5RA 4HJRA 3CLRD 2A86A 4KKVA 1PFVA 4MWCA 1ZUNA 1F9AA 3H97A 1T6YA 2CV0A 1IH8A 3ZJTA 1HYBA 1G59A 1P7PA 3P52A 2A4MA 3AKZA 3COWA 2VTBA 2JA2A 1N2JA 2A84A 3LOQA 3CA8A 1QJCA 3JXEA 3KT0A 4YP7A 4G5YA 1IHOA 4MW2A 5DB4A 1TYDE 1YIAA 1WXHA 2QUHA 3CLSD 3A4IA 1BS2A 1LI5A 4HJXA 1EFVA 1LI7A 3TNJA 2PXHA 1N77A 3D6UA 1G8GA 1O94D 4WSOA 2ZP1A 4QBTA 3ND7A 1COZA 1N2IA 5J59A 3CVYA 1YULA 3CVWA 2A88A 3RK1A 3E27A 1N2GA 4YP6A 1YIDA 1KKUA 2YXNA 3BL5A 3AFHA 1KQOA 4MVXA 1DNPA 3SZGA 4YMIA 3GLVA 3CLRC 4DDKA 1KAMA 1WJGA 3QTTA 1WXIA 3COZA 3FDXA 4MW0A 4BWVA 1VLHA 2YWBA 1IVSA 1GTRA 1ZH6A 1XJQA 3K32A 1K92A 1VBMA 1MAUA 3FETA 3IMEA 1V47A 4S1OA 1Q15A 4ZT3A 4G5FA 1N1DA 1PFWA 2H2AA 4EFKA 2AKEA 2HMAA 3Q12A 1I6MA 3P0IA 3MMXA 1JILA 3CLSC 2QTNA 1TYAE 5DASA 3IVGA 2H29A 4H3SA 3SEQA 1MRZA 4MW7A 1O94C 1J09A 1H3FA 4PY2A 4MUHA 1J21A 3AG5A 4ND6A 3HFJA 1O5TA 4MWEA 3HV0A 4EG1A 3IVXA 2BTEA 4EG6A 2TS1A 4A91A 4XSVA 1WXGA 3PNVA 1N2HA 3NBKA 3HMQA 1MBZA 1J20A 2X1LA 4DJAA 1QQTA 1D2RA
chains in the Genus database with same CATH superfamily
1RMQA 4UPDA 4G85A 2ZU6A 4HGPA 2IIBA 2OV4A 2Q7XA 3K9BA 5HFJA 1M2NA 2F62A 3O4RA 2NSYA 1SXQA 2O8CB 1DXQA 3HLTA 4GPTA 1SAYA 1U80A 4ZANA 4BCBA 2MIIA 2O2GA 4O1IA 3SICE 4B7UA 1X87A 1PCXA 3FM9A 3VTKA 5FBKA 3QM1A 1GCUA 2XT0A 5B7NA 3MJRA 2KSQA 3L7KA 3O83A 3QPBA 4RJIA 2X6QA 1DO0A 5CTAA 3FSRA 5C1OA 4UULA 3M4YA 2FETA 1U3DA 3C1UA 1M6YA 1VPEA 5C52B 1J25A 4KPYA 1P1FA 3OBBA 4OLFA 1E61A 3GD7A 4Q9LA 5A5EA 4CLRA 4HSGA 2IBMA 3FCUB 1SUEA 1JP7A 4LHXA 4QLBA 3OAAA 3Q3HA 3W5JA 4X92A 4W5TA 2LCIA 3N3BC 1PIWA 1N8NA 4CLHA 3JD1A 3F78A 3TN7A 1KZ1A 1DKQA 2WSBA 1M2EA 1AQYA 1Q84A 1T9GR 4RWZA 3AVVA 2Y1WA 3G0CA 2C57A 2H1VA 3P9XA 5HKKD 2GN0A 1JEOA 4L75A 2JI6A 3IP6A 4CV2A 2JW5A 1AU9A 1K66A 1PJQA 1Q5PA 4DTIA 4I8IA 1Y80A 2WAXA 3LHFA 2YJZA 3RM3A 3M5WA 1GEGA 3AEUA 4TQ9A 3EPKA 1RJEA 1X1BA 2EL7A 3EXFA 1CZUA 3I0ZA 5CFLA 4Q1BA 2SKEA 3HKCA 1NI4B 3SR3A 1Q12A 2ZRIA 3B5EA 2BV3A 2QTAA 4MVJM 3U62A 1ESMA 2PV7A 4K6GA 2ZVQX 5KYWA 3D1LA 1RBYA 3LGXA 4TUYF 3P2IA 2BDEA 4YWJA 4YV1A 3GCWA 4UHDA 2QA5A 3QJ5A 1XP8A 1LBEA 3CXUA 4HRAA 3DJYA 4BEBA 2W2KA 1MAAA 3WSVA 3F8SA 1GUZA 4RV4A 4RVCA 4RYLA 3HXLA 3RIHA 4EYOA 5TPZA 1O03A 1U3WA 3EXHA 3JRNA 4CT0A 1UPXA 2DLCX 2ATVA 4UU0A 5T41A 5EMMA 5JQGF 5JYBA 4L8WB 1UL1X 2HY7A 3KDAA 1ZHHA 1XZAA 2BKVA 4LI3X 4TXLA 5KCMA 4MAMA 2DPXA 4I9GA 3F6CA 1A72A 2EWVA 3Q87B 2HA2A 5AJWA 1V95A 3FOFC 3KEFA 3I9OA 1NZJA 3A11A 4AI6A 2BCGY 4LXIA 4NG5A 5FDFA 3OQ1A 3AF4A 3SDBA 3FMIA 2PK3A 3OU2A 1T26A 4WBNA 1U8EA 1NUQA 1P4JA 2GZAA 3L7JA 3AEZA 3NKVA 4Y2PA 4XOUA 1JA1A 3UAXA 1FLNA 2PZMA 4G0MA 3RRJA 4E5UA 1ULTA 4EYQA 1XMOB 1NP7A 5E3HA 2DQZA 2YHUA 1B00A 1PTJC 2AJCA 3A04A 3L0YA 3AKDA 1PEDA 1E6LA 1AHIA 3FVRA 2FZVA 3K9GA 3OUZA 4BLUA 5BUQA 1DC8A 2OCXA 4CI0B 4GKJB 3I34X 1LWNA 3DBOB 1KETA 2B4RO 2ISCA 2L42A 2FPGB 3GFSA 3LXUX 4ZU6X 4H3KB 1THZA 4FHFA 4MKXA 1RTTA 3U80A 3Q1KA 3Q8XB 4O3MA 2BRUA 1OLSB 3PU6A 3HZHA 1JW9B 3E6AA 2LIVA 3IUNA 4GP7A 5CYFA 4YRSA 2IY9A 5ADVA 4AN0A 4B7AA 4JNCA 2XMZA 2XMRA 1KO5A 3BHJA 2F48A 3HM9A 2CYBA 1Z9BA 3BJEA 3I58A 4XWOA 1F1JA 3HWWA 1KBOA 4BX9A 1FFYA 1PEAA 2G7MC 1O96A 3I0MA 5AOVA 3JWPA 4ETWA 3S27A 1K8RA 5JXGA 4DVJA 3S8EA 1R16A 1U0OC 2XUPA 4PZYA 1K0FA 3B6EA 1NR5A 4PONA 5JNVA 1GUAA 3QQPA 4CM7A 3B6ZA 1XYYA 3DV2A 5AP9A 1ZGGA 3KHTA 1U2GA 2Y92A 3KEGA 1BHQ1 1G8YA 4P93A 2H4ZA 3RAJA 3WL7A 5LU9A 1UXGA 4J1NA 3OQBA 2FWIA 4BMSA 1UEXC 2UVDA 2HHHB 1N7GA 2RCNA 4RJKA 5CB8A 3EVAA 1BQ3A 1MAVA 4UHCA 3JQ9C 2BGUA 4R54A 2OO7A 1C2TA 2P7IA 3BGWA 1XXHE 1ISMA 4Q7KA 4KGZA 1HE1C 5CM2Z 4D9EA 1U8TA 3WDMA 3G0IA 2IV2X 3WLHA 1V9CA 3FIJA 2J3HA 3C87A 2AOTB 1T9GS 3IR5A 4OAPA 2IEGA 4DIUA 1ZZEA 1EP2B 1TAHA 1M34A 2Z3VA 3DBIA 4QGAA 1MB4A 2BFMA 4EG7A 2CY0A 2PVSA 3O4VA 3QVWA 2WUVA 5K7SA 3GLGA 3IAFA 4P0TA 5EHIA 2Q0QA 4AO8A 2AFIA 3KOYA 1FE8A 2WT9A 4IHAA 5DNAA 3AFGA 4AQYB 3RRZA 2C9OA 3GA5A 5JXHA 2FLKA 1WUIS 2OHOA 3P97A 1A9RA 5DIZA 1E6CA 1ESDA 4EJSC 1R6XA 1C1HA 4FYIA 4MRRA 2C3OA 3R0VA 3RREA 3ROGA 2RE8A 3FMOB 4HDKA 2F90A 4PZDA 4DIEA 3IUBA 3W5CA 2AVNA 2BSXA 2MYPA 5JEDA 4CLDA 3K05A 2C2XA 4NQZA 3T4UA 3OE7D 3TZEA 4QICA 4QATA 4WOPA 3FPLA 4PBRA 4KYUA 4MULA 2C54A 3EG9B 3V1NA 5CVJA 4GI2A 1SG6A 4M8LA 3QP9A 1F2UA 4DMHA 2PX5A 2RGYA 1IZYA 1VBKA 4XR4A 2BT4A 3WLTA 2QE6A 2QK4A 5TDHA 2IJGX 2YWEA 1CRZA 1A9SA 3CV3A 3WYBA 4BVLA 1Y6FA 4TKLA 1CZLA 5CNIA 2ZCUA 3H9QA 4UAJA 3O8QB 1CQPA 4CMAA 2VRWA 1GO2A 4KWCA 1USWA 1UQRA 3K53A 2KI5A 1K63A 3E8MA 1EK6A 4IDDA 2QQEA 4CM5A 3HDGA 1PAUA 5DBGA 5CA0B 5LA6A 1WMSA 2WTAA 2C0CA 1SELA 3GLSA 4EUKA 1XZQA 5IULC 4BQNA 1T8WA 3AKYA 1EVYA 2OFPA 3MCVA 4OUDA 4K26A 4YCJA 3ZY4A 1XCGB 2O9JA 4BO8A 1M8PA 2HSEA 4EG5A 1NM5C 1D07A 1TLLA 2VJKA 3M81A 5H3LA 1T3HA 5T57A 2NU8A 2EP8A 2XYGA 2XCQA 2YHIA 5E38A 3H3FA 3IDZA 1HE8B 3M6IA 2HDHA 2GVDC 4J76A 3TL3A 3WBKA 4TVOA 4DA8A 2CVFA 3OCCA 3WRYA 1NNEA 3VYSB 5IAKA 1CEEA 1OYWA 2P2LA 1DCFA 1E20A 1GPYA 1QFYA 2O5VA 4PLFA 3CEMA 5IUKC 1PR5A 3U56A 2QD1A 3G2IA 5LN1A 3EZ2A 2QMYA 1ZIPA 4B3RB 2JJMA 1Q1BA 3HB5X 3RNLA 4NECA 4CM6A 2ALJA 4UREA 1SPBS 4RLQA 1T29A 3N70A 1QH8B 3FF1A 3Q4GA 1DQYA 1R3DA 2WSLA 2XVYA 1K7YA 1M7GA 1YHZA 2G9RA 2OY0A 2WAOA 4IDCA 3M89A 3SJZA 4RY0A 5REQA 4G0ZA 1N57A 1SHKA 2FMHA 4OXXA 3T9EA 4LXUA 3VDMA 4L5YA 5INTA 2NVWA 2AEFA 4YWHA 4AY2A 4KPUB 1QE3A 4AZTA 2FMXA 1Y1PA 3H8SA 1Q3KA 2AS0A 3O4FA 4XX0A 4Z54A 4PIPA 3PCXA 3TOVA 2P6PA 1CUGA 1H1TA 4HO1X 1M8KA 3LKBA 4RJLA 2OBNA 5H7XA 4KWEA 2WJPA 2X8WA 2Z57A 3BHNA 4P8RA 1XTQA 3VKWA 1FFDA 1POXA 4KI0A 1BWPA 3WFZA 3IEUA 3L7BA 3LUGA 1C8KA 2B61A 5EAIA 1WULS 1W8IA 1X9IA 2OEPA 4HMQA 4JQSA 3C4QA 5FI3A 1T9DA 2D7CA 2W6JD 4S24A 3GUZA 1I2CA 5CIQA 1WVMA 5ICEA 2VYVD 5JXJA 3UJ7A 2EJTA 4BV3A 4BP8A 1XO1A 2I22A 4V0NA 3T0FA 3ZCPA 2O3TA 1A2OA 3L1JA 4L74A 4Q21A 4X9XA 4E5PA 1Q91A 3ZK8A 3FZNA 1U2QA 2YJTD 1HQCA 2OCBA 2W2LD 2QROA 2ZSKA 5JTUA 4M86A 1SPXA 5KQPA 1I24A 2R6HA 5LUBA 1D9ZA 4QNRA 2Q2QA 1KYIA 3LL4A 3PDCA 5LBUA 3JVUA 1AQIA 5CLIA 5BRAA 2R3SA 5C7YA 4G0VA 4Y2RA 4E07A 2E4ZA 2XOXA 3NI2A 3PX2A 1PQUA 2EJBA 1EK5A 1KVTA 1Y37A 2VP9A 3FE2A 3GPBA 3F6BX 5KOIA 2RG1A 4YONB 4TYWA 1U2GC 2LGJA 4ZO8A 4IEIA 1NVXQ 1WDLA 4YMHA 2YN0A 3KQSA 3KLOA 3KKZA 4KR3A 4IKEA 3GVXA 4BVBA 5CW2A 1YVDA 1E1LA 2J6HA 2CHQA 1OBHA 1JXAA 3EBPA 4WCFB 3I45A 4AX4A 4C6RA 4HEHA 1EE1A 1X7WA 4D3DA 5AVYA 1Y3IA 2IH5A 1GKKA 1EUDA 2NUPA 2QZ4A 3OZSA 3DVLA 4F72A 2CLIB 5HIMA 1ODJA 4ZI5A 5KQGA 4LW8A 3J81k 3CUVA 2XADA 3BB1A 1X15A 3KSRA 3M5CA 4L73A 5GINE 3NHYA 1QHGA 1JHPA 1NLFA 1QRRA 2F3PA 3D0QA 3FYDA 4PZ0A 4C08A 3KQHA 1TVKA 3CIOA 5E3IA 1UJ4A 1F8FA 1NYLA 3CNBA 4PAOA 3ANTA 3GEGA 1B42A 2XUDA 2W4IA 1G16A 4WCVA 4C7JA 2R4QA 5IM4A 4A2PA 1PR3A 2IPMA 5CFZA 1BX0A 3IPAA 4R2JA 4B3HA 4WXMA 2PXXA 4AUNA 1L1EA 2D3WA 2YVLA 1HEUA 1LA2A 5G3YA 5C35A 3C3DA 5E0KB 4Z4GA 1I7PA 4OQ4A 1JJVA 1Z8HA 2RK6A 2YY6A 3OOHA 1VL2A 4WLNA 3ROKA 1M74A 4J29A 5IG2A 2IYWA 1XMJA 3QOXA 1VMKA 3D3NA 2J3JA 3F47A 1K4MA 1GCGA 1VGVA 2QUKA 3REQA 5JI3E 5KX5F 4FNGA 2HMSA 1GQOA 5FKJA 3NH6A 2OECA 4UDYX 1BXRB 1MH1A 1P17A 4EHKA 4KR6A 1OBCA 2VCHA 1WZEA 1ZH2A 1LX6A 1B1AA 1OREA 4LWZA 1DBVO 4HWGA 3F2IA 4JBGA 1XNQB 1GAXA 4YMUA 1FW8A 4DM7A 4IXDA 4DHEA 5MHTA 3D7MA 3K16A 4RA9B 4NFSA 5C8YF 3PWSA 2CV0A 2IUUA 5CEEA 2OA0A 4K6HA 3EZ6A 1C30B 1PQ4A 2BGMA 1IUOA 2XX3A 3HN6A 3M9XA 4L4SA 4LZJA 4QRHA 5D6NA 5DHAA 2WM3A 3O8RA 5DMXA 4GM0A 3LO8A 1W87A 4C6TA 1B23P 3DBHA 1E9VA 3JXEA 1NF9A 5FTKA 3T7AA 5DM60 1ZBQA 1MCZA 3DT6A 5EWJB 3K70D 4GL2A 2Q0HA 1YIAA 2H1FA 3MILA 6Q21A 8ATCA 4B79A 1GNTA 4IRUB 3F6SA 4N54A 3A4IA 4DBVO 1EFVA 3RWMB 4OFBA 2A59A 5DHPA 2P6MA 4PXSA 2WYVA 4NBLA 1F06A 3P9IA 4D4LA 1O94D 4ZFNA 5I4IA 2XCIA 4FGSA 2PTGA 3VX4A 4FXPA 2FMFA 4EQ6B 4X6XA 3O8LA 1NG9A 3WIEA 3W04A 5IYZA 4RXTA 3T4XA 5CMLA 2D5LA 5M29A 1TUIA 2CCKA 5F2OA 4ZI7F 3IUQA 3NS7A 1YULA 3AUYA 5BRJA 3ZK9A 1KMHA 1N2GA 4BB6A 2ABWA 4JEHA 1RQXA 2H2HA 3KQVA 3MZ0A 4PPYA 3BL5A 4I9FA 1P5RA 2OZPA 3ADCA 3IDQA 3ZXUB 4FEEA 2BE7A 2EDAA 1SVWA 2V6FA 5DH9A 2ZUBA 1CUYA 1PX0A 2GDZA 4JYMA 4CIDA 2IOYA 4FE4A 5AQ1A 2JFOA 2Q5LA 3GVHA 4M1MA 1UAAA 2QN3A 1DDIA 1ELOA 4WY2A 4MSUA 3T1YB 5KO2A 3L4SO 3IMEA 1K1EA 4F4JA 2WIGA 3S28A 2LNDA 5D3QA 2B69A 2ODTX 2XLCA 2W8ZA 4JX9A 1RXVA 1SH7A 2FRDC 1T5TA 2H2AA 4RMJA 4Y2XA 5H5JA 8OHMA 4QC2A 4BIIA 2AKEA 2V59A 2BFBA 3GHYA 1QHHB 4J0QA 3VBEA 4IKPA 1TQ6A 4JUIA 1BMFD 4HUQA 4TV8F 4E32A 5HYVA 2JJ2A 2JHPA 2C5EA 3I9KA 2BMDA 2H29A 1TECE 1JYSA 2P6UA 4UNQA 4XUEA 4EO9A 3AXTA 4FDAA 5CEFA 5KIAA 1Z45A 4X61A 1F48A 1LDBA 3L77A 2GPBA 4I1OA 1MEOA 2DUUA 4MUHA 4Q7EA 3FKSA 1HC7A 4TMVA 4K88A 1L7XA 4ZC8A 1BU5A 5THKA 3R5XA 2H59A 2YV4A 1L1RA 2ZBQA 1ID1A 3A3NA 3ENQA 3HXTA 3O1LA 1CQIA 3QJGA 3KYBA 3DTVA 4R68A 3ZS9A 1V3TA 1E32A 2CDRA 3BTSA 4X63A 1BIFA 2BF7A 5EMNA 5FNVA 4ND8A 3WIUA 4J6EA 4HNUA 1F8YA 2FN3A 1G6Q1 5K51A 2QAJA 3DFZA 1XVLA 1VJCA 4BV2A 4N5NA 2YV1A 3GJYA 4LOLA 4O3FA 2X1LA 5B2FA 3HDHA 1IBMB 4EW2A 1GDHA 2C96A 2AC4A 3GCXA 5DTRA 3WGMA 1P9LA 5HM8A 3F4KA 5ITWA 2ZRFA 1KFEB 1W581 1J6UA 4JI3B 1E2JA 2VH1A 4KK4A 4CWAA 2FSPA 1VLMA 5JALA 2FPPA 3L04A 1N5RA 3LNTA 5BN3B 4W5QA 3TB6A 4CLXA 3OMWA 3ZD7A 2EZ8A 4WWHA 4MJXA 3IKJA 1E0JA 1S02A 4KITB 3D6NB 1M0WA 4Q7LA 2ZLBA 1LTKA 1VE6A 1JEAA 4LIPD 1EHIA 2IDMA 4FD3A 1CR2A 1NMYA 1FFXA 1LFAA 2OKGA 2ZB8A 3QSGA 3VYUB 3JYQA 4JLMA 1G21A 1GA4A 2VTDA 4WN9B 4NBNA 4DNPA 1MH9A 3EFOA 1MQ8B 3SSOA 1AKMA 4M4SA 3NMUF 2W2QA 1QOZA 4QPJC 1QG2A 3WICA 2JLCA 1WQ4A 2VJOA 1S2DA 3VBCA 1VJ0A 1ZSVA 2ACEA 4B33A 4M1EA 3C8DA 3N2GB 4NATA 5AW3A 1P7VA 3LDFA 3I53A 4ID3A 1YJ8A 3D81A 3FNGA 1WUJS 2JLRA 3TNFA 4BBJA 5HOEA 1REQB 1L4LA 2EJUA 2QE7A 3MTEA 3G6KA 4M0LA 2OHFA 3RS8A 3OPYB 4CM4B 5FX2A 5HUHA 1PKEA 4LFBB 3KR0A 1J42A 2Z9DA 4YYZA 3DXYA 3ORYA 3SYKA 3ZWNA 2IS4A 1Z74A 3ND8A 4HADA 2GLTA 1YDWA 5JROA 1FNDA 2VHVA 2VDWA 2ADOA 3QVSA 4TTJA 1P5JA 1WUHS 1SXJD 2LKDA 3JV7A 5JNRA 1M9NA 1WD5A 2NIPA 2BDUA 2CL7X 3EBLA 4LZNA 4TMZA 1YCHA 1BXGA 2H18A 4IMJB 1XELA 4KHZA 4M99A 4XX1A 1NVAA 2QMQA 2GM3A 2X5XA 4KTTE 4BFYA 1PJLA 2YZKA 2EQBA 1R4MB 4D8UA 1X7GA 3QFHA 1AQNA 3CF2A 3DVRX 2OAP1 4I4CA 3M0EA 2CLHB 4NYIR 5KPJA 3GAMA 5TMDA 3OJEA 1E89A 2IV7A 1J56A 4IJVA 1J33A 4H0CA 3EEYA 4KR7A 1L9XA 1Z5OA 2Q1YA 3UNXA 2JCVA 2A78A 4HF7A 5JZBA 2Y1XA 3QVJA 1QP7A 3OMLA 1RAGA 5FF9A 4NU5A 3FMPB 1XNJA 3DS8A 2OV2A 4X1IA 3RTGA 3WHPA 4BXOA 2WW8A 2CB9A 3LKVA 3TW4A 3MJSA 4J0JA 4DM4A 1IQPA 2C2ZA 1F6WA 2KPOA 3EXG2 3OD1A 2J09A 4FWBA 4ZIRA 3ZLBA 2PZAA 4JI0B 2X8JB 3UFXB 4B6EA 1TAUA 4D42A 3DKVA 2AF3C 4PHTA 4IQ0A 4PQRA 2G3YA 1NX6A 1N25A 1WW3A 2AN9A 3HCCA 4A8JC 2R6GA 3RD5A 2VF2A 2YX1A 1Y1RA 1VG0B 4LY3A 2Z43A 3RSZA 1DUIA 5FORA 1F2DA 2Y05A 3JWHA 4W9RA 1I14A 1SQ6A 1Z4IA 5H9WA 3KD3A 5CK4A 2Q2VA 4MR7B 4LMAA 4K6KA 5C4GB 1YDGA 3OC0A 3L1VA 4YPVA 1Q95A 1KXZA 2ZRBA 2QUZA 4WOCA 3CCBA 4L6CA 4RWEA 1OW3B 3BD7A 4KFSA 2HFJA 3L79A 2EBWA 2RD2A 3DDNA 3IP7A 4EHJA 4ZMBA 4CEJA 3HWRA 1XTRA 3L8EA 3QVGB 1VKNA 4JASB 1IEVA 2O23A 4NMWA 1A2QA 1G6HA 4M0UA 4Q4AB 3ULKA 5KREA 3BFKA 2OZVA 1VXRA 3QVVA 3JD2A 4KRYA 3UH0A 3UV6A 5KJCA 4BC1A 3IURA 2ZJ2A 2BHNA 3ZWPA 1D5CA 1PS9A 2ZWOA 4RC9A 4N01A 3ZWYA 1HV8A 2X13A 3AUAA 4GMDA 1TC2A 4LK3A 5KJ1A 1IIBA 4E2FA 5ALQA 2DH5A 3M49A 1OTXA 2R4UA 1YRBA 4G3XA 4KNYA 7ADHA 3N2LA 3ISTA 3TL2A 3AUFA 1ZMOA 2RBKA 4QYWA 2PIAA 4NYJR 4UQLA 4XVQA 1XHFA 4GXQA 1ISGA 5FPTA 1BZYA 4JKOA 3OF3A 4NLLA 4WUVA 4CMKA 2QN8A 4KTVE 5B7PA 2H4HA 4P0QB 3D2LA 3VSEA 1JB9A 3FNQA 3V9AA 1NUPA 4FHGA 2WQZA 1UBHS 2W7TA 2XQGA 4R8LA 1EDBA 1H69A 1UMDB 5ICMA 1KH1A 3GFTA 4NEGA 3RHZA 4OP2A 1DMRA 1JQ5A 4NIMA 5AJUA 1U04A 3WLJA 1ULSA 1GTMA 1SKBA 2GVZC 4QO7A 1KQNA 1PGPA 3SBDA 3UO8B 4R2WA 2XH8A 2J0QA 5EZYF 2XJ4A 1Q0PA 4D4HA 1X7XB 1OI4A 4KR9A 4LS3A 1VOTA 2O52A 2VNAA 3U40A 5IVHA 1GN8A 1HGXA 3ST7A 4B44A 4KN5A 3MUFA 5ICFA 1RQNA 3QE4A 2X86A 2FHSA 4JA0A 2Z2IA 1MJGA 3IJPA 3PR2B 4YRGA 4DGQA 5THQA 2R1VB 1OXKB 4QOEA 4WOBA 4QUDA 5EKSA 3OTOB 1QP4A 2DEUA 4P0PB 5T7BA 2ZWVA 3SD7A 4EAQA 2R7LA 2RHLA 1RM5A 4X8OA 3KPUA 4M0KA 1Z7WA 1MJNA 2BF4A 3ROZA 4CCYA 3ADBA 2XBLA 3L8HA 2AWNA 3O7MA 4KZPA 3TVTA 4A6EA 2M1ZA 3SK0A 3OFSA 4IV0A 3T38A 1S4MA 5EVJA 4B32A 1KYQA 2WF7A 4DEVA 4CF7A 1ZR4A 2BGGA 1WKBA 5E1MA 3KAKA 5K3FB 3W5VA 1K9VF 1T24A 2A35A 1FYEA 2A0UA 3L7LA 3C39A 2I3ZA 4D9MA 1KI6B 2NXCA 2VRCD 4FLEA 3IBGA 5E7IA 3Q9NA 4MUIA 2QBYA 2Q8QA 4O2AB 4C4RA 2ZXFA 2I80A 3N5CA 2B4YA 1O6CA 1R9MA 3BMQA 3DHEA 3DEHA 3EGDB 3CMMA 2GCIA 5K3BA 3RLFA 3SYTA 1ACJA 1PSDA 2PUDA 4NXNB 1U9ZA 3DMTC 4DDVA 2DBVO 5FLEX 2GYYA 4IHQA 4E21A 1LPBB 1P61B 4HOYA 4Z0TA 1DELA 4HD8A 2QRLA 3EVDA 1YJ5A 3HR7A 1R5BA 4UMEA 3SQNA 1AHHA 4ZHQB 5GZ6A 2AR7A 2NOAA 3OIGA 4PEVA 3KT6A 3GLKA 1WTCA 4KE9A 4MA5A 3D3WA 1RFGE 2AN3A 2A1TR 3RO7A 3A4VA 5BYBA 3UAGA 3S8YA 1T2NA 1N3IA 4NICA 3E1KA 2FP3A 1K3TA 1C7QA 4IQ8A 3WY9A 3ZUGA 4D9BA 1K75A 4YMVA 2OXTA 3GNTA 5KKAA 1EFPB 3F3SA 4WBSA 1BXZA 5AKKA 4EELA 1LX7A 1PZNA 1PBNA 2XB9A 3F98A 4TLLB 3WHLA 4ALNA 4E2WA 1ZW6A 5LZ9A 1QUEA 4LZPA 1N2BA 1XRJA 2XWBF 1OV6A 2EDCA 3IBCA 4A16A 1M6NA 3D4NA 4XTCS 1KAOA 2AI3A 1XDZA 2OB1A 4MIYA 521PA 4CHGA 2C8LA 2K2WA 3KELA 3E53A 4GVPA 4J43A 4L5AA 3DEYX 2I4TA 2VWPA 3H86A 3INYA 4ND4A 2HYIC 3NDBB 1HTWA 3JQ6A 3ONNA 3QBVA 1KDZA 3WK4A 2W0SA 4A0RA 5FOXA 5HQ3B 3TSZA 4ZRNA 5CG2A 1YJBA 1SVMA 3DE1X 4Y7CA 5FPHA 2G1AA 3MUEA 2ZSIA 2W42A 1CIJA 4FFNA 1OZAA 2FDCA 1TEZA 4K6CA 1IC6A 1XAJA 3SFTA 4Z7OB 1AURA 1NLYA 4Q47A 4M8KA 1RJDA 4RAQA 2OL4A 4ES6A 3AOGA 4KX3A 2AFRA 5LP6B 1KBZA 1YDHA 4HXFB 1QWOA 3NHJA 4IDQA 4HH0A 1XKTA 4PSCA 3OEHD 4XD2A 2O1XA 1JXQA 2HWKA 1MW9X 1YDEA 2PZGA 1PV1A 4L50A 1GQFA 2HU7A 2VN8A 4NP6A 4DSOA 3CYFA 4KV9A 5K0LA 5BQXA 1MPXA 4K8OA 5T3YA 3Q8KA 1DEXA 1R12A 4C0WA 4QQNA 3CTPA 3EH2A 4CKWA 2B30A 3A4MA 1RZRA 2DY0A 2JGMA 4AIRA 3UUGA 1JU4A 4Q7MB 3AFIA 4BECA 3I8OA 2RHMA 4U0KA 3RVNA 4BP1A 4V1CA 3KOXA 5CA1F 1SOMA 4LHYA 4E12A 5DN9A 3TLGA 5AKHA 4ZT4A 1XAHA 2HU5A 1Z33A 1YOBA 2O8FA 2JFUA 2GF2A 4AM8A 3AJEA 4EI9A 2P0EA 2P8JA 3AHEA 2W8BA 4RK4A 4MB6A 1W6UA 3K0EA 1LW7A 1OFUX 2JC3A 3F5QA 1BGVA 1APBA 1GP2A 2QAGA 4KIJA 3AFOA 5HF6A 1W59A 5AHXA 4DFDA 4Y2JA 5LD2C 3E0QA 4KH1A 1RNLA 2X5NA 2Q2WA 1Z06A 4L4UA 3TFQA 3WIVA 2ILVA 2P9BA 1BHJA 1KVRA 2YDYA 1P7WA 2BCJQ 4EW6A 5CFOA 4HTFA 2QJFA 1UPAA 3V1UA 5BO5A 1GGJA 3B89A 1M2GA 1BNCA 1EI9A 1G5FA 2CV2A 4G9EA 5C5IA 3BSWA 5ISMA 3I61A 4CQMB 1TVEA 5CH8A 3TXXA 3A9SA 4IWNA 2WLTA 4BO6A 2DFKB 2ZIWB 3DDHA 3QUCA 1ZNYA 4I1PA 2IYZA 2R0QC 2VP4A 4HFJA 4IOKA 1VDZA 4LCEA 4R0VA 4TZTA 5WRFA 2PNJA 3SVLA 1H2BA 5EJ6A 1MQ9A 3LX6A 4KP7A 4P4SB 1U9YA 3ZQKA 1A95A 3L84A 1N4DA 2YVUA 2LZ0A 5FUWA 1KS2A 2K4MA 1O2DA 4RPJA 4PBTA 1M8GA 1P2FA 1Z16A 2PU7A 5U1PA 1IRXA 3AVUA 1LLDA 1ZK2A 4ND3A 2EP7A 5KC9A 5LFAA 3LOPA 5TF4A 4PS1A 2WIBA 1QFZA 2G36A 3K9NA 4CF3A 4BNYA 1TO6A 2I67A 2J3DA 2QYHA 5KYUA 3ZVRA 2HN9A 2WJWA 1Y5NA 3UWOA 3HXQA 2ICAA 1L3CA 4N48A 4JP8A 4JWKA 1CETA 5JW6A 3U4QA 2P75A 3I01M 3DTTA 1CR4A 1SCUB 2C78A 4OATA 2XE8A 5EIXA 5HS4A 1UK8A 3GP8A 3A2NA 3OI7A 5GQSA 1EJ0A 3D3EA 5DM4A 1IN4A 4R5MA 2PZEA 3P96A 1L7OA 1XHLA 3PLAE 4MTLA 3P7MA 3IQZA 4PG5A 5G0VA 2X19A 5ALPA 1D4AA 2QR2A 2BJVA 1ACLA 4I2NA 4D44A 3CLTD 2BE9A 2OYRA 3TIVA 4C0HA 2WJ4A 4K0RA 1KAQA 1Q0LA 4FJ1A 1C1XB 2GN4A 4QLOA 4QU5A 4RJJA 2QX7A 1XTJA 5TMBA 5CT9A 1JQJC 4K9KA 3CUYA 1CY0A 4B09A 5IFLA 1WCXA 3LOUA 3CLRD 1LSSA 4MVJG 4MPTA 1PFVA 1JLLA 3ZCQA 3A9WA 1V6CA 5K0GA 1XU7A 2YFYA 3I2HA 4O4JA 4OM8A 2AI2A 4JI4B 1ZD4A 4H27A 4RQTA 1L7NA 4YJ2B 1J2UA 1NQTA 4II7A 4YCSA 2RB5A 1V43A 4RLSA 5A7HA 3CTMA 2Q7DA 2B25A 2VTBA 4HX5A 1LJUA 3LX4A 4G5XA 3EPHA 3V8MA 1QJCA 1D6SA 1P9WA 2GD0A 1QX3A 3KPYA 4PFJA 1QCYA 3S7ZA 1B8VA 3BFVA 4HFNA 4HHEA 4RKQA 5C7OO 2SECE 1A50B 1FY2A 2OCGA 3EY4A 2PH1A 4MGKR 1NXXA 3BAZA 5ICSA 3IT2A 4INOA 4KAFA 3BD6A 4JJFA 3UOGA 3VZCA 2J0EA 4BVHA 3ABIA 5JNTA 1E60A 5JUWA 1OHHD 4G25A 1N36B 3RT1A 1OAAA 5JSZB 1ZD5A 5LQUA 4X7MA 3TRDA 4LDQA 4QBTA 4JX8A 2PGNA 4URHA 5DGDA 1I5OA 1WB6A 2Q2OA 3PA8A 4E6PA 3UOAB 2ZYIA 4Y2UA 1JUDA 2NADA 3DKPA 1OI7A 2AOUA 4G63A 5E8RA 5EYPB 4ENRA 4AC9A 3T7SA 2OHXA 3GARA 5JYCA 1OI3A 3HGQA 2ACVA 4L57A 4YP6A 5FHRA 1GARA 3SMVA 3VR5D 2X8LA 6GPBA 1HURA 3VSDA 4EA9A 1XMQB 3ZI4A 5JY1A 4R98A 4DBZA 5T6MA 3H6GA 4QOHA 3IOMA 2VUTA 4NMHA 4YJ3F 3RTAA 2H5EA 4L0QA 4M9CA 1E1KA 1R8XA 2C9CA 2VYFA 2WYHA 4TXNA 4RYDA 1XZKA 1KK0A 2YXLA 3A9TA 3GFRA 4CG0A 5BV0A 1FC0A 1DPGA 2ZJ8A 3LLVA 1L4YA 3VJMA 4TMXA 1J8MF 2AQ8A 3VYTB 1E94E 5KWEA 3EISA 4QNMA 3TRIA 3AX6A 1T0BA 3UK7A 1S8AA 4BRZA 1SULA 1KOJA 3KZ1E 3AC0A 4Q9KA 5C1IA 4TQAA 2DPMA 3V1MA 4PO3X 1T8TA 4HPXB 4XYEA 2NO5A 1RS0A 5FL7D 3LGAA 1CR6A 5B58T 4BVAA 3IAUA 2IUEA 3MMXA 3HKDB 2FWAA 1RYBA 3AI7A 3CR3C 3LCUA 4PQEA 3D4BA 2GBFA 3QXXA 4J7AA 4MQBA 1GQ2A 4PAWA 3PYMA 1FTWA 4P36A 3VUEA 1L4EA 4CNBA 3KB6A 5A4IS 1J09A 2JIMA 3VPFA 5EJMA 3Q2KA 2QLMA 1PS0A 3SLGA 4RKWA 2QAGC 4F3NA 3E9DA 1X19A 1T1RA 2G5PA 2YQ5A 3HSKA 1JE1A 1VFNA 4D4JA 5EKTA 2L82A 2ZG6A 4I4NA 5IPFA 2PBLA 3LDGA 4Y1GA 5BVGA 1EWQA 4FUTA 1DP4A 1TVCA 1KTIA 2ZS7A 4QD3A 4RVNA 1RAAA 1H1LA 4TRNA 2WIFA 5E9QA 2C7VA 4R6WA 3N0TA 1NBHA 1FNBA 4L76A 1LVHA 2MSLA 3D02A 2GTPA 4ZGWA 4B1FA 3CE9A 4OHZA 3HVKA 5K09A 1RRCA 1T0PA 1XD9A 4HB3A 5HPYB 2H0QA 2A9JA 4HV4A 3EEBA 4LQCA 1AZSC 3G0GA 4HNAA 2J9RA 2OO5A 1EGMB 2EGUA 1ZN7A 3AJAA 1WE2A 2I7DA 2SKDA 3L6DA 1JDBB 3EK2A 1G9TA 3JATB 2GOYA 3U4GA 4BDTA 5PNTA 3EPLA 4DV1B 2CVPA 1P1CA 4OYYA 1K98A 2VHWA 1PDWA 3TB4A 1ODFA 2OBXA 3HB1A 3MWEB 1JE0A 4FBLA 2G07A 1NW6A 1YB5A 1Y7IA 2P2ZA 2VPTA 5CNMA 5ALTA 4LNUA 4HTAA 1G20A 2HRCA 3E4CA 4QJIA 2RHOA 2EWWA 3DFUA 4WLUA 3EVGA 4KO1S 1FX1A 1L5LA 3DOEA 5ALWA 3TLBA 2AG0A 1V25A 5K0FA 1GSOA 3Q88A 2Z0MA 3KKLA 2UUOA 5AW9A 4W1QA 3EUFA 3ICEA 3O4JA 4PYIA 2DM6A 3C3BA 1KEVA 2P9QA 2UZAA 3GRZA 4OO3A 4PG6A 4QDJA 3ERCA 8ADHA 1D6NA 2RHCA 1VI2A 2I54A 3HBMA 1MGPA 5H8WA 1NAHA 1TGYA 4JDUA 2JIQA 5E1DA 4H35A 1FRZA 3OSZA 3IHWA 1BA3A 2CXHA 2GZ3A 1BX3A 1V3VA 3H2KA 4M1QA 4OHWA 5ECDA 4D5GA 3NGLA 3VOAA 4R8RA 1VP9A 2O3SA 2IYAA 2RKOA 4NJMB 1VKJA 3UM9A 1GPWB 1EJ6A 5FV4A 1XQ1A 3NHLA 5DXFA 4PHFA 4RHYA 5SV2A 3I6BA 3RW9A 4ALJA 3C5VA 2ODQA 4EKEA 2PLRA 5DSZA 4C2AA 4D92A 1Y3FE 4OLAA 1ZESA 4R4JA 2HDWA 2YVQA 3A9RA 3DDOA 3I05A 3R0QA 2DMRA 4FXOA 2BFFB 4XUCA 5IN5A 1VIMA 1JPJA 2A1UB 3ZE7A 4ER7A 2Z09A 1VB5A 3WAGA 3WHKA 2X41A 4RTLA 1O97C 4G1VA 2O2DA 3U7RA 2PX6A 1D04A 4Q9IA 2JI8A 4BFTA 1VHWA 3IP5A 3MINB 1ZN8A 2OPBA 2GPTA 4Z1OA 4G5HA 4RQUA 1GFZA 3DH0A 1QIIA 4B3XA 2Q45A 2WIDA 1TQ8A 3UJAA 1SIBE 4C3UA 5JRZA 2DHEA 2VUIB 4LE1A 1OKKA 1U94A 1AKRA 5LQJA 3BXXA 1RRFA 4BWFB 1EFAA 1QCCA 1NVKA 1V11A 2O0JA 1T0JB 2XY4A 1TCVA 2YXBA 3DMHA 3PJDA 4M9SA 2AXEA 3CNEA 1U0RA 3FHCB 3AGPA 2IIPA 5FBWB 2QZ9A 1MP0A 4G4GA 4MIEA 4R1OA 3O47A 5G1OA 1L9KA 5HF8A 1NVVQ 3WDKA 3AH8A 1I4EB 1WKCA 4YC7A 3QPUA 4DN6A 2A6PA 2P7HA 4OB8A 1FTGA 3GRCA 3LT5A 3O2JA 1SBCA 2G09A 2YJ3A 4IWYA 5EP1A 5AUNB 3ECSA 3RS4A 4N6GA 1NT2A 1GGHA 2VUUA 1QKJA 2I6SA 3AB7A 1XFAA 3VZSA 3FUUA 1WKVA 3BQMB 3FTCA 2MT9A 5FFNA 3AW8A 4M89A 4HYYA 3BDAA 2ANCA 3MJTA 4HH3C 5C37A 1M6EX 3T61A 5IRCD 4XJVA 3X2SA 4N49A 4LAFA 3WK5A 3HB4X 4MB2A 1Z5ZA 1TYCA 3JZMA 5BN4B 3IP3A 4HQ6A 1H8EA 4DLRA 2VZEA 5BOSA 1PWHA 5IX8A 5AI9A 1LU9A 1MQAA 2HQRA 3FFAA 4OSPA 1DBIA 5ILOA 4G0WA 5J4KA 4C3OB 4WNYA 3ZQ6A 4ZJYA 4U9UA 4WKPA 2XA1A 4QJ5A 2BR4A 1Z62A 4FC7A 3G8DA 5I7UA 1NULA 2BZ1A 3KBBA 1E8NA 3T1OA 5KTPA 1WB4A 1QONA 5AJYA 1TDJA 1WM1A 4ZOBA 3V34A 2ZI3A 3NIGB 3QOYA 5DWDA 4Y6PA 1VL1A 3LO5A 1T0IA 3U9SA 2UUAB 3PUXA 1WOYA 4NMLA 1P1HA 4Z8YA 1RTKA 3A2LA 3KXKA 3M6UA 4C76A 5FL7A 1XCBA 1X92A 2WB4A 1JXOA 1ZW1A 2HF7A 3KB2A 3KVRA 2QGFA 3W6ZA 1ZOOA 4WY8A 1T1JA 1SUSA 1FLDA 4NABA 4H0FA 2HRDA 4CDGA 4EYEA 3TD9A 4M8SA 2W83A 5A5FA 7REQA 3VVLA 4HATA 5F3RA 1E5TA 1HFJA 3BWCA 3H9BA 1I13A 2IEZA 4RV5A 5EMHA 1OXXK 3FAZA 2CNLA 2Y1DA 3GJQA 3CUSA 2OPHA 1NZFA 4QQRA 5AW8A 3DDWA 1KZHA 1GT91 5JCXA 1DXHA 4Q4JA 4JOCA 1KSGA 3WLKX 4CEHA 3N53A 4JT8A 3A3YA 4K03A 3MA0A 5BYKA 1JR2A 1ID8A 3IDAA 3KTAB 4HX2A 3HABA 4YP9A 4RIFA 1R4AA 1PG2A 2JEOA 3IELA 4F38A 1HTBA 3WWZA 2JI4A 5BORA 1IB0A 1S3IA 3AG6A 4BX8A 3VZQA 1Y5MA 1FP4B 1K08A 3LPNA 1SN7A 1LPOA 1PBTA 1GLGA 2YJ5A 4R9RA 2VF8A 5CJJA 2PJUA 1Y8CA 3MBIA 5IVDA 2RK3A 2EP5A 5FWXB 2CB0A 2SNIE 3PJRA 3WK9A 3O2SB 3W6PA 1W2HA 4UBLA 4WH0A 3BWEA 5TEWA 4A26A 2GNAA 3JAWB 3U3ZA 3H0KA 1BXKA 4LF4B 1TJ5A 4NV0A 3NJ4A 5DNYB 1CIPA 2A5JA 4M8NE 2EFJA 2ZBEA 1C9YA 1FLAA 2X9GA 1Q1GA 3K0FB 2Y4OA 5IABA 3NEPX 1PO7A 1Y9JA 4NAVA 4I3HA 2A3RA 4B2YA 3CNQS 4HLUC 4LDRA 2DKFA 2JLAA 1M72A 2I6QA 5L6MB 2B1GA 2PT9A 1E63A 4WHMA 1R6DA 3STTA 3B9QA 3UICA 2D4HA 4Y1RA 4LNAA 4TTIA 1PNRA 1RRGA 1Y9EA 5A1TA 1E0AA 3F1LA 1CUCA 1I51A 1LRJA 3KXPA 2YOFA 5GZ3A 3JWGA 4DCPA 3UG6A 4CE6A 1CXZA 5GJVC 4ZYZA 2A8YA 4GEKA 4UAVA 4KCGA 2ZJBA 1NY5A 1T4CB 3O0TA 3O8OA 4MDYA 3U19A 3DLBA 1SU7A 1O4WA 4WE3A 4E11A 5B7QA 1E2BA 3L1KA 3KSMA 4U2CA 5ULLA 1FX0A 2QRQA 3NH9A 1D4OA 1JBKA 1K2VN 1SCAA 1U2PA 3C85A 3NM6B 4B7XA 4GR9A 4CKEA 2YFHA 1F51E 4OH7A 2VK8A 4MNTA 4YJKA 5K8IA 4QQ8A 1GQQA 1TM5E 3KQWA 1A5BB 4BMNA 2CJXA 5AXAA 2B8WA 3P9RA 1MOPA 4JJGA 2C99A 4RD4A 2GCOB 2H8KA 3I4FA 3THSA 1V5WA 1E66A 3N39C 5CDTA 2NO7A 2QI9C 2XOKD 3F9RA 2IPNA 5IJAA 4EABA 4KE7A 3EC1A 4RCZA 4KXLA 4W5OA 10MHA 4PG7A 3FNRA 1WBJB 4US0R 1J23A 3OOSA 1NOKA 2ZVJA 4LX0A 1QRAA 4KJXA 2UU9B 3UF0A 2NW6A 1KZYC 1NVMB 5ALEA 1S5PA 4DNOA 1DAOA 1UBCA 4PX9A 3KIPA 4S35A 4EG8A 4LFCB 1EGVB 3NHKA 4B8WA 2F3QA 2C61A 2HJ9A 5BSMA 3MCZA 5BRNA 4BFWA 4UBOA 3RSLA 3RG8A 2GXSA 3FUVA 3H1BA 2F8SA 5LYJA 5D7BA 2NZUG 5KNCH 3OC6A 4I4LA 5GOTA 1U7WA 2A9QA 4BU1A 8GPBA 5I7OA 2ACKA 4QDTA 2G77B 4EHHA 3PCTA 4CTKA 1XLUA 3AVOA 1DB3A 1R9NA 4KAJA 4N3NA 2IE8A 4QTUB 1CJCA 1RAIA 1YR7A 1KU0A 4RMHA 3EY9A 2C3YA 3HU2A 3PZBA 1DLIA 1MJ5A 5I7HA 1OY1A 2H4YA 2YQZA 3Q9LA 5JG7A 5U4XA 4BMXA 4FB5A 3AKEA 5LKRA 1L5ZA 1RU3A 1XTBA 4H16A 3OKPA 4LJRA 2G7ZA 4CN8A 4EH1A 3KUKA 2P41A 2ZBVA 4QX6A 5H0IA 1I4OA 3BIJA 4BP3A 2AK2A 2H4FA 4MVJD 3UCEA 1JL3A 1P2UA 4HAVA 4PVDA 1BE1A 4F5YA 2PBRA 2CHEA 1N75A 3Q98A 3E7FA 1CY8A 1Z63A 2G8LA 3LWZA 4C20A 5IVKA 1G7SA 3CNLA 3HEAA 1IXKA 1SCJA 4EYKA 2R60A 4UNNA 3JY6A 2IP4A 1N0UA 1YSCA 2QRGA 2D2IA 1JYEA 2ZI6A 3RAPR 5M7EA 3ZJ4A 1NW4A 2GGSA 2ZJ6A 2CXXA 3B60A 4GZMA 5ECYA 5I45A 3A36A 3K9CA 3I64A 2MMCA 2WHRA 2WFMA 2PX8A 3JQRA 2JGIA 4UBMA 4U3JA 5ALYA 1K6MA 3P4UA 3MWFA 1IEXA 4JLVA 5B1YA 3NHWA 2XCLA 4RMIA 3QJYA 1G6KA 3EVTA 4RABA 3KVVA 3QKSA 1AF7A 1IVYA 2WIAA 4P58A 4BEVA 5D00A 1SVNA 1E1MA 1T2UA 3AHCA 2M6KA 4EL5A 2HBZA 3K0KA 1XOIA 2PIDA 2CLOB 1CZHA 1TNDA 5CIYA 1Q16A 2XWJI 5AJHA 1JDPA 2UYGA 2NSLA 2ZUFA 1MO5A 3HS3A 1YR6A 2V7TA 4GYWA 2WNIA 1N34B 2C9BA 2IL1A 2PGJA 5M04A 4Q3AA 4BNZA 4FFMA 2ECPA 2JB9A 2X1MA 3Q10A 4ARUA 3SKVA 2A5FA 1XRQA 1G7RA 3CKKA 3DMFA 4JJEA 3ZW9A 5IKEA 1H0RA 3CVXA 2ZE6A 4EI8A 1LGYA 5LQRA 5JATA 3QOFA 4B2PA 1KDRA 1PNOA 3ZQ4A 4BB0A 1M34E 4GM1A 3K6RA 1WB9A 4X00A 2BWJA 3ACBA 1ZX1A 4MA0A 3R3VA 5EA2A 4Y67A 3GLGE 2XHEA 1GKYA 3AW9A 1J49A 2YIJA 1NYRA 5K3DA 3UMCA 3J7AC 1FFSA 3PFHA 4L51A 4HT3B 3HDVA 4IIGA 1DC7A 3COWA 3AKZA 4YRRA 1HFEL 1NDUA 3BD8A 5BN1A 2ZJZA 3OFVA 3KT0A 4QBKA 1S4QA 1UDRA 2XDYA 1B76A 3MT8A 5E95A 3WR5A 2WILA 2XIJA 4OQYA 4PLZA 4FOPA 3N07A 2IH4A 2ZIZA 2ZIVB 4X64B 4QTTB 2JAHA 1M5TA 3C7KA 1JQLB 1QFMA 1VBFA 2PXHA 4GM4A 4PZ9A 1CC1S 4UBKA 3VR2A 1K0UA 3UUEA 4S0ZA 1WRBA 2P9YA 3MS4A 1SUPA 4FYYA 4KUGA 4PE5B 1MVLA 4XPIA 3DVQX 1K89A 1CUDA 3T52A 2RGRA 1QGDA 3C41J 1WD7A 1Z35A 1ZNWA 2AJTA 3JQBA 4Y6SA 5LU8A 4N82A 3IP1A 1LNZA 5K0NA 1YCDA 2OXIA 3E27A 2ZR8A 1SUFA 1NF3A 1KKUA 1AM4D 3LLUA 1D2EA 3AFHA 1KQOA 1CF9A 3FBTA 1DNPA 1T36B 3AR7A 1UWLA 3LV8A 4OQNA 3GLVA 5EXPA 3T94A 2PUCA 4XJTA 4PLTA 2E6UX 2IPAB 5HSGA 4JP5A 5JANA 2Z5GA 1II8A 2P9FA 2Q6KA 1DO2A 3LXMA 3PHGA 1CYEA 3DMDA 2R47A 3SHOA 2GB4A 3LC2O 5BWCA 3O8CA 1CCWA 3EG5A 3RVBA 4N12A 3KQUA 1ZH6A 1Q6ZA 1P73A 2AKAB 2W6QA 5T6BA 3HE3A 2BEUA 1XSEA 4FCCA 4OVKA 3UMJA 4XWAA 2EF1A 4ASUA 2XIQA 1IBCA 2XNDD 4OKSA 5AJXA 3PQCA 2IVZA 4RGBA 3EC2A 5ER9A 1BAPA 3CLSC 1VL8A 3OPYI 2L19A 3JZFA 5DASA 1UZLA 1N3YA 2PYZA 2ZIFA 4CUZA 1C9JA 1TC1A 2ZJFA 1W46A 1T4DA 1EK0A 1N6KA 1PT9A 1Z6GA 3U1TA 1P62B 3OTIA 4G89A 5BP7A 1LRLA 2ZRJA 4D0GA 3SQDA 4MHTA 1EXNA 3TL6A 2XYRA 2AX4A 3A1WA 3HV0A 1IONA 5LMUB 2H7VA 1OB2A 1QG6A 3ZGYA 2KM1A 2HI0A 3FTNA 3PEEA 4KPEC 2GFIA 3C16C 2ATXA 2E37A 3HSYA 4XZ3A 4C4XA 2QRVB 3B3FA 3P0EA 2JIOA 3MQFA 3M4ZA 5EUMA 4TWIA 4NZNA 3QH4A 4UASA 3RYTC 3PC8C 4GI1A 2IIQA 2XW6A 4FFPA 5JCOC 4BE4A 4MQFB 3SZRA 1YA6A 4CKXA 1WS6A 3W9SA 1JPVA 4PW0A 2Q9AA 3CEHA 2P5UA 3LZCA 4WL0A 4IX9A 5BWLA 5JPDA 3RADC 3MC1A 4WZ6A 4YQEA 3PPWA 1NBAA 5BWMA 1W1UA 2R66A 1S7CA 2IYQA 2REQA 2Y2UA 1BH2A 3DO5A 3N6RA 1HUQA 2GETA 3AUXA 1VYTA 3N74A 1UJCA 1ABFA 4M55A 2XTMA 2G9QA 4Y3UA 5IH3A 4E03A 1DV1A 2RFLA 4EBBA 1H8HD 1ZY2A 2NGRA 2O2IA 4IP0A 3ZY3A 1S7GA 1URPA 1KEZA 1L0BA 2O6LA 2ZSUA 3BEDA 3PXXA 2BFEA 2HA3A 3AO0B 3QW4B 4OFZA 5L7WA 3HU3A 4QODA 2RDMA 1I7SB 1RJGA 1G6OA 5FOWA 3IKVA 2ZPAA 4XIFA 1Z4LA 2P1DA 3QXSA 1TQHA 2VBFA 4AJIA 1KYWA 2KYRA 3DP7A 5T8KA 3V7WA 3WB1A 1J0BA 2QSUA 2H9AA 1NIJA 4P54A 3TRJA 4INJA 1P45A 4QU8A 3TBKA 1UQTA 3L93A 4QYTA 1TPYA 3DO8A 2GZSA 3FOCA 2XGMA 3GL9A 4DTCA 2RHHA 1NT4A 3O74A 2AD5A 4I5FA 5EJ9A 4MS1A 3THYB 3HB7A 1R8YA 4PLCA 3WNCA 5K0EA 1HRKA 2NO6A 3L8YA 2C7GA 1BS1A 2WKSA 4EF6A 5H83A 2D6FA 1QR6A 3SFVA 2E48A 3OJLA 2NZ8A 4MYDA 4RZSA 1UOQA 5F7ZA 2IYUA 2GQ0A 1R6VA 3GJ7A 4N5DA 2O05A 2VK2A 4PRZA 5EQTA 4ZHQF 1NASA 2I7XA 1ONSA 2BKEA 3FG9A 1RLTA 1OWNA 4K87A 4UHEA 1ENPA 2HSJA 2BP7A 1V4BA 1JFVA 2OV1A 3H2GA 2KMLA 4H2DA 2FKAA 1ZKMA 1N78A 3RTEA 1ZI8A 4F4DA 3HO6A 3JQAA 1D1TA 1GIAA 3EDOA 1NJ8A 3K8QA 3A7DA 4FNMA 2TMGA 3NQ41 4HQFA 5SYNA 3SZ3A 4BJ6A 3DBLA 4D9CA 3HNOA 1VJGA 1GV1A 2Y2VA 1FU4A 1XD8A 3QKUA 4OIMA 4G5QA 4CM9D 3GNQA 3AYZB 3IODA 1YTLA 4V03A 3QENA 5CYPA 1DLJA 2FF5A 2Y1OA 2J6BA 1TU4A 4RSRA 3AESA 4GEGA 4J03A 4BQQA 5J58A 4C1BA 3F7TA 2VYND 3BGIA 5KI6A 4DJFC 3MWDB 1B0PA 1WHTA 4FILA 1O57A 3PWKA 4JROA 2Q6OA 1RZVA 2QG6A 4RCVA 4Z4EA 1AKTA 3ZLTA 3E5HA 4JEMA 4QQKA 5AVQA 1IK4A 3W4JA 4XI9A 1I0IA 4URWR 3U9TA 2VAWA 4A5SA 1DDOA 2HCRA 5CCDA 3I8XA 3CU5A 1TA4A 5D6OA 2EF0A 1JMKC 4E1AA 2C2HA 2XTNA 2RAUA 4UHJA 2WHPA 2W6CX 5K2OA 2O8EA 2PX4A 1Y8QA 4TS4A 1CJBA 1W0KD 2XUFA 3AT1A 3MF4A 5LP6F 3NHSA 3ZR4B 3TM4A 2BI8A 1USIA 3HM2A 3RVDA 1X3LA 3D54D 1RIIA 1IG0A 2C8VA 2L17A 1IZZA 1Q7TA 1Y1TA 3H2HA 3SXJA 2FB9A 3MTJA 1JHXA 4H4CA 4HAXA 1G17A 4LOJA 5FBLB 1WU8A 3PTLA 1IOWA 2J7PA 3AF3A 4FFRA 2ZRLA 2SCUA 1W1WA 1OZFA 1E2GA 1QF6A 1D2MA 1YQWA 1NUAA 3RFCA 2PR2A 1WCWA 3A1FA 5HCIA 5FL3A 1Z4JA 1A97A 4KUEA 1CUSA 2GCGA 3PVZA 4FM9A 1D3AA 1QHFA 4I66A 3UWSA 1B26A 4BV8A 4ZZ0A 2ANBA 2NV6A 1OMOA 3KL4A 3AHHA 1HSOA 1XX6A 3CJQA 3NWEA 2CWWA 2PWBA 1KVUA 4UHBA 3WKBA 4C21A 1TB4A 4MRNA 4HSEA 1MO2A 3OU7A 2VRNA 3SHFA 2Z8YM 4ZJPA 5L3QA 1V4NA 3AM4A 4EUHA 1RM0A 4WKNA 5KVSA 3LLMA 3BH0A 3SN6A 4KH0A 4DC1A 4X8MA 1AXRA 2NYAA 1YS6A 1AZLA 3GLFA 4YASA 4FKBA 3T7KA 3AWDA 4BAZA 1I7LA 1PYGA 2E4XA 2FFAA 2J3KA 3GJ0A 3H9JA 3UUWA 4QGGA 1NVFA 4JELA 1YXMA 1D1QA 4HMPA 4MARA 3W8NA 5HRUA 2IBTA 4FSXA 2XDQA 5AXCA 1OXTA 4M0CA 1DADA 2HV9A 3BE4A 1K86A 1XDUA 3LVQE 5MGBA 1LZLA 4CIXA 2Y71A 4NCIA 1VCMA 2ONCA 1XVVA 4JZYA 4U2FA 4ZCSA 1S6YA 4UARA 5JAOA 1TUEA 2EFYA 5KU1A 2R9VA 2R6CA 4B3MB 2CNBA 4CQLB 4EY3A 4YUYA 5CUQA 3C15C 3BWVA 3WO1A 2R8OA 2HD4A 2YASA 3IV9A 5LQDA 1Z4KA 2QYTA 1TTQB 3GFBA 3HACA 4UXHA 5AKIA 4JA2A 4A0FA 2F00A 1BMDA 5H3CA 2IWHA 5CX1B 3KUCA 3NNDA 4GOJA 1RAHA 4B3JA 5IKMA 3EGCA 4WJZA 4AZ0B 1IPFA 1PTKA 4JLUA 1ZVVA 1P1IA 1H1DA 8AT1A 1SC6A 4CIYA 1UIMA 4IR7A 5KYXB 3TM5A 2O8BA 2B0CA 4WZBB 2ILTA 2VSQA 4C0LA 4FYKA 3MJCA 5KTTA 4XVHA 2WWYA 1TCBA 1UZNA 2XTZA 2LP4Y 1O95C 1ODCA 4NV1A 4X62B 2BGWA 4GKKB 3RIMA 1ZFNA 4Z49A 2HHJA 3CN7A 4UXJA 3S2UA 4CN9A 4ZALA 2HADA 1QDUA 3TMYA 1A9XB 1UBMS 1QH1A 1F4LA 4YB8A 1TIKA 1Z7EA 1VLJA 3GBPA 3UBTA 2QW0X 1ETUA 1KEEB 3GFFA 3OOJA 1T9BA 3W2EA 4BNWA 4LF9B 1KSJA 1H8HA 1SKYE 3UTDA 2Y0DA 4HQNA 2FOLA 3F4BA 4TMTA 3IIJA 4K81B 3OO0A 5AI4A 5EXXA 3FCCA 2PLFA 1T8SA 4QPNA 1XTZA 4CDNA 1KEPA 1EZZA 4GGMX 1OAOA 1P5HA 1YMQA 2VT6A 3ABSB 3PYLA 3HYNA 4KYVA 1W85A 2DTEA 3EAFA 3H5WA 3RYFB 3SS7X 4HCJA 5KVAA 3ZC3A 2PVCA 2V45A 4WBNF 4XQCA 1YJXA 5F73A 4IGKA 2R8PA 3R9IA 1GNLA 5JCZA 3HXPA 1JFFB 2QQ5A 4RD1A 4LOAA 3WL6A 1NOJA 1RWPA 1VQ1A 2BLLA 2VPXA 3U26A 3DNFA 4JXZA 2XNCA 1A8UA 1G21E 4CCAA 4QM6A 1OE0A 4ZVMA 5H16A 5SZHB 4GVLA 4WGGA 4I6GA 4XCXA 5DX8A 4FD2A 1HYGA 4S1PA 3OQMA 2E18A 5L3RA 4EA7A 4DNFA 1YZYA 5HW0A 3ZIUA 2MU1A 1UANA 1CHDA 1QWSA 3L0IB 3PGXA 3ZTTA 3RS9A 4HX9A 1I2MA 4U5XA 4B4VA 5BOSB 1M76A 3H7IA 3K2BA 4Q93A 2MINA 4XW2A 4MUXA 5CDHA 4J90A 5K8VA 5BQOA 4E4RA 1PGNA 2Z58A 3NZEA 5C7LO 2CYCA 3PUVA 4G5OA 5KEIA 3WQSB 2JCSA 4R9NA 4AKEA 1U65A 2GT1A 5I9SA 3RJ9A 5GM1A 4EEZA 1M2FA 4EB8A 2NP6A 3IUEA 4YQFA 2PMEA 2HTEA 3HP1A 2QNRA 3M1YA 4YGXB 1ZUIA 3HB0A 4UEQA 4ABTA 2VYNA 4TUYA 5EE5B 3VV3A 5CW1A 2GA9A 3GRPA 3W6OA 4DRXA 6ADHA 1EK2A 1MX5A 1BCRB 4RA6B 4ZV9A 3S1SA 2O2SA 3C3JA 3PEVA 3WRWA 3LG2A 1KRWA 1FMJA 4OB6A 4QWWA 4V2IA 1N2CA 2IYEA 2J59A 3TOXA 3TTXA 4FCTA 4AJ1A 1BDIA 2Q4DA 3CCFA 2XZLA 2HZ7A 2O5CA 1VKZA 2IHKA 4JJ7A 5JQGA 3QFFA 4M1TA 2P4SA 1PJCA 1QJ4A 2Q5JA 4AS3A 1SQFA 3VGJA 3CX3A 5EHXA 2H2WA 4F3CA 1CIVA 1EFHA 3BGDA 5HFAA 4EVQA 5KNBH 1GV0A 4TL7A 2W4QA 5DTIA 5K6AA 1SHTX 2WG1A 4TROA 4NOLA 2DFNA 2WOOA 1EA5A 3OKAA 3RPEA 3U81A 4ZVQA 4ATNA 1LV8A 2FV8A 4GKVA 3K4QA 3QELA 4UJ5A 3U48A 4PYMA 4KQCA 1ZZGA 4W1RA 3A27A 2JGDA 4HWOA 4OMFG 3N8KA 2KJQA 3E22B 4CIWA 4P53A 3MGBA 3GJTA 3SBEA 4A2CA 5I48A 5JZOA 1I9GA 5JJIA 4PSDA 3WLMA 2C8JA 2NWQA 4E09A 3DUWA 3QEOA 3R6WA 1QIJA 4I50F 2EATA 2RGEA 2EW2A 3SM9A 4WCDA 3VAYA 4RXUA 2F8TA 5EP3A 1Z2NX 3R0XA 1U2RA 1P4SA 3BX1A 4DLAA 2YS7A 1V7CA 2ZS8A 1BDJA 3DBVO 3QFTA 1YQDA 1XZGA 1HDCA 4X7RA 1CRWG 4AWXA 2JBAA 1KORA 1V1RB 5K0ZA 1VLQA 4WLOA 4QO8A 3H5AA 3TSWA 4OM7A 1ZCBA 2YBEA 5BXQC 1BKSB 3GLIB 3OKCA 2D0OB 4PNPA 1ILWA 1JKFA 3HCDA 1Z6YA 5F78A 4Y9RA 1TADA 4WNAB 1Y3BE 3BJZA 4RTMA 1DG3A 2OFXA 3KFLA 3VHXA 1N3BA 1VDMA 3TQHA 1V8PA 2Q21A 4IIJB 4BUCA 4EMBA 3B5IA 3DMGA 1CJUC 3KLMX 3K0AA 3W78A 1VIVA 5F7XA 3H99A 4QSMA 3RH0A 1EFLA 5JMTA 2A33A 1KZGB 1OYYA 1Q1AA 3P26A 4I6JA 5FPSA 2QJTA 3RHSA 3OQOA 3PNSA 3ECAA 2IYXA 3B9RA 3BB3A 4HDCA 1H3NA 4IW3B 3LCJA 2E4VA 3R0ZA 2RHTA 4UAGA 1X70A 2C7PA 5A3SA 4IMRA 4KZKA 4A4DA 1JIJA 4N8DA 3SYNA 2LWIA 4JLOA 4KHPB 2JFFA 3RC1A 4J94A 1A7AA 2XRYA 2HCJB 4MLZA 3GLUA 4M9QA 1XZBA 4IDNA 5IKPA 4IKOA 5KSPA 1GGEA 3TK1A 3SEZA 5DX0A 4QEZA 1WPGA 3DM9B 2B0JA 3BWYA 1EHCA 4O5OA 1NRXA 1V5GA 1ZL0A 3IPYA 1RBZA 1MLDA 2WF8A 3ELWA 1KDVA 3U4CA 1TLFA 1F14A 1QF7A 3R5FA 4M1KA 4O2LA 1MB2A 4GECA 4NZMA 4N8EA 3GT3A 1GOTA 1KIFA 4OAQA 4TV9B 2ZTVA 3TH5A 3RUPA 2OZLB 4G97A 5G3ZA 4OGKA 4DV7B 2X2PA 3FPCA 2VXCA 2YWFA 3N2ZB 1PNTA 1AKVA 3OZRA 4JL6A 4RHEA 2GESA 4U6NA 3TNLA 3SKXA 4HDRB 3ZY5A 4C2UA 2CNWA 2JA1A 2EQ5A 1USVA 1TT5A 5AK3A 2VOJA 3BULA 1SUWA 4MS4B 5KJEA 3T3PB 3DV0A 1F0KA 1OVGA 3BMNB 2MSCB 3H97A 4P4UA 2XECA 2QVBA 3GELA 3IBFA 3P2YA 4R81A 4UTVA 5FBQB 2CMHA 2D3TA 3I5UA 2O2ZA 2Q3CA 4X6LA 4JC4A 4YMLA 4M1YA 1OAOC 4JYBA 2BCEA 3WZ2A 1JLRA 3GPLA 1WV0A 3ZCRA 4N40A 5CYOA 3L6BA 1SNYA 4YRFA 1AK9A 4D4MA 3FOZA 4C7MA 5HP4A 3RIEA 3EGEA 2W71A 1DFHA 5G1NA 2MSEB 1TYDE 3LQFA 2ZANA 3OLQA 4Q6BA 5EQJB 4C2TA 4FI3C 4NG4A 5I47A 1AB6A 4K9SA 2HDNB 3DDUA 1MIOA 1CQWA 3QX8A 1RXWA 4K1XA 3R77A 3GGDA 4BGVA 1R5JA 3TKYA 1DIOB 2B98A 3PUKA 1Y1QA 2PWYA 5CGZA 3R09A 3EJ6A 3IUPA 5A9SA 1O7JA 4XWWA 3L43A 3ZZ0A 3HXMA 5BN5B 1HWYA 2GVNA 3N8GA 1X80B 1G2PA 2J3IA 4OHBA 2OXFA 2ODNA 4GMXA 4W6QA 1OB5A 1LPMA 4Z2AA 3H04A 3HR4A 1R88A 4JC5A 3SQOA 4IJ6A 4UVHA 3G23A 4LYHA 4G2TA 1WEKA 3L1HA 2BR3A 4HNGA 1BOFA 4YMWA 1KAMA 2FVXA 1DQNA 2JFVA 4NBUA 4ENWA 1QS0B 1SZJG 2JF0A 4QG7A 1FSFA 1JALA 3D5EA 5DX1A 3SDSA 3AVXA 3J81A 1HX7A 2XAUA 1SQGA 3MWKA 4BX3A 1IVSA 1OYOA 1PJSA 2P4UA 4GOLD 4JN6B 3FETA 1MAUA 4TS9A 5TT0A 1CERA 5DNEA 1BVRA 5IAAA 1CP3A 3TLEA 5LOVF 4Q39A 3LQKA 5IBQA 3ZZUA 4RTSA 4OU4A 3KV1A 1D7AA 1W34A 1P0MA 2FWJA 3AJ9A 1SXJE 4D6YA 1Z26A 2GD1O 3UK0A 1NFRA 3FPEA 5K6AC 3QKWA 3N8DA 1JH8A 3AF1A 2DETA 3HU1A 5ITSA 3W0LB 3A3OA 1JSCA 1KQGA 2CBZA 2K2QB 3EXAA 3K20A 4XOIA 5HBRA 4AJJA 2BMJA 3VJLA 2D1TA 1EVQA 2QJRA 1W5TA 3BICA 4MWEA 4PC2A 5YASA 3QF4A 4TWBA 4EG6A 3NVKI 4XRRA 1Y8RB 3QNMA 1PLLA 4DCJA 3CSSA 4POAA 4YCMA 3DE6X 5EKXA 2PX2A 3T9BA 3SXUA 3QYJA 1L5HB 1Z6TA 1VKOA 2VKQA 1P2BA 1XFDA 5ARCA 3CPEA 1W52X 3TLJA 3WE7A 4TYYA 1RMTA 5IM5A 5BSGA 3AONB 2WUWE 2R5NA 3LXXA 2D4AA 3MXTA 1B6TA 3QW2A 2BLNA 2ZEJA 3H8JA 4R2KA 3AEYA 4V3BA 5SYAA 3S2SA 1QRSA 1J0XO 2I33A 1P44A 3DDCA 3GEEA 3CN9A 4JCCA 3ZDEA 1MUUA 4A82A 1FP6A 4NV3A 3QK7A 4GYKA 1T2AA 1QYIA 1G63A 1AA6A 3WS7A 1O97D 1P33A 2BGLA 2EFEB 4B45A 3JTEA 3B9PA 4K7JA 3PS9A 4OBBA 4UCWA 4X20B 5AHWA 4B3BA 4J6FA 3G2NA 2Y77A 1E2QA 2JK1A 2R2GA 1GFWA 1ULUA 1T1EA 2QTTA 3IAS6 4FT2A 4OY3A 2ZK7A 5FPYA 4YY3B 2Z6QA 2VLIA 4QXAA 4M7PA 1Z68A 2XA9A 3JQDA 2FWMX 1U0EA 2GK4A 2Y1CA 3OCWA 1SFRA 4YAKA 1DKUA 2NTEA 5JS8A 1UBLS 1QQAA 2DWPA 5KTYA 1ZUHA 4GOXA 5JSFA 4Z4FA 1CVIA 2O2JA 2RC6A 3EW7A 3IXQA 3ODGA 3IJEB 3AIOA 4MW5A 5ED0A 5IZCC 2UXDB 3F5SA 1QBKC 1OLUB 1DBSA 3DD1A 3RRNA 3HI4A 2WFLA 3S1AA 1XEXA 2RHWA 2JRCA 3EFEA 3UAVA 5J40A 2IHUA 3PFNA 2ATIA 5KNCA 3LSTA 2WJAA 1E2IA 3A0RB 3GRAA 2CXTA 3GROA 3P9PA 4OQLA 2GJ4A 4NF2A 3RANA 1HE5A 3ZWQA 2W58A 3VDXA 3TKLA 3MLAA 3VTFA 2M1XA 4ZAXA 3AR6A 2F9LA 4N7JA 3WADA 2QTRA 4TQUS 1T5OA 3DQZA 1BO6A 4YJFA 2VUHB 4GNRA 4Y18A 3KE8A 2QS9A 4TYMA 3UXMA 1FDWA 1VA5A 2NPFA 3T0IA 3IHLA 5C2JB 3OZWA 3K9HA 2Q3DA 2QLFA 3AU8A 3ORSA 5AVOA 2ADMA 4UU7A 1RCUA 3KKEA 4OHFA 5CK5A 5KTMA 3N2NA 4JC8A 1CRPA 3BFPA 3Q11A 3TGWA 2Q29A 1UOEA 1E3MA 5DU2A 1BGWA 3LM8A 4JUCA 5KTNA 3ZY2A 3TRHA 1WNTA 2QDXA 2E4AA 4RHCA 1LDEA 3D6AA 5EJFA 1U3GA 3CINA 4LEIA 2XI4A 2HMYB 2CN1A 2FTKE 4ND8B 2WPDD 4IS2A 4Q4LA 2F17A 2GJAA 4UCXA 3EW9A 1RE0A 2O3QA 3FFBA 3P0HA 4UUOA 5ALJA 4XVCA 2G6TA 1U4SA 5JO0A 4H1TA 5CXQA 3BK2A 5IJXA 3G5AA 5KX5A 1D09A 1Z38A 2E3JA 1UF9A 4EJFA 2ZM6B 2C4MA 4GRIA 2H4WA 6REQA 2VK4A 5CDUA 5FPQA 3HVIA 3UPUA 1ADCA 2BZSA 1TL7C 2VQ3A 2CF6A 5U9CA 4HDMB 3NTRA 5I3CA 2H52A 4PRKA 2XE6A 1ZKDA 1AC5A 2FA9A 5C8YA 5LIPA 1G2QA 5DM1A 4EO7A 4QKQA 3LT1A 3TZKA 3EQZA 1UFKA 1FFHA 4XVUA 1KE2A 5J4VA 1WWKA 3A6FA 2FSGA 3V4FA 4ENPA 3KLPX 3QU5A 5ER6A 3ZH9B 3I92A 1EG7A 3VMFA 1PNVA 2VQSA 1ZVJA 4FQ7A 1EBBA 4R2LA 2GK6A 3AQIA 2AFHE 2VHXA 5FNVF 1P1JA 5DCLA 3CMCO 1C9MA 1J90A 1GPDG 1JTVA 1UC5B 2I8AA 2PSSA 4EJSB 5FH9A 5BMVF 1YZFA 4O1HA 3AEKA 5DVZA 5JTTA 2JLYA 2Z04A 4LXQA 3ND6A 2VNKA 3DE5X 3KKKA 1NQAO 3AUJB 4YRIA 5I3ZA 3ESZA 4GWLA 1Q2UA 4JL8A 4QYSA 4CLRB 2DQKA 1RM3A 5J4YA 4QFBA 4JENA 4R0MA 2OMEA 4ISBA 4BYGA 3RVRA 4HZUA 3UWPA 2WU4A 4IS3A 4U8GA 2JGAA 3NYRA 4KWIA 3TJMA 2NQ8A 1T5BA 3NGMA 4NH4A 4MMZB 4PCAA 4URVR 3L8GA 1ORWA 1Z12A 1MABA 4OSOA 1FDOA 3OHMA 2F1JA 1UJMA 3KSZO 3EGXA 3TDNA 4F8YA 5T4FA 3EZYA 2OGZA 3VPHA 2XYPA 4JQOA 3ZWXA 1Z7BA 2GK3A 1VZ3A 2DX7A 1BFDA 3HGTA 3HP4A 1W0JD 2C9ZA 1GFSA 4HDNA 1CUVA 4RD6A 5T4EA 1C8VB 5KHLB 4R2XA 5E2IA 4D57A 3TXYA 1JKMA 4DNXA 3GT4A 1AUQA 2CLKB 3EXFB 3QKTA 4IHJB 1EXMA 1PFQA 1GPH1 2YMPA 4MYTA 3G8BA 3PIDA 1KJQA 3HKCB 1JHOA 2PT5A 3NDIA 4K9RA 4N7MA 3UATA 3VR3A 1N32B 1YZUA 3DWIA 3RCBA 4F6RB 5KYWB 1TYZA 3ANNA 2XGJA 1X9GA 4U00A 5IFKA 2YIDA 2DKNA 1V39A 2VJCA 3I37X 3M1LA 4TV8A 3JARA 4XFJA 3MPOA 3NAMA 1DRWA 2W2KB 4X91A 5JS1A 3TMAA 1WDTA 1MDFA 3A37A 5L3ZA 3K9FC 1GRRA 4D6PA 1E1RD 2A9OA 1XEWY 3EXHB 5KSOA 5AI6A 3G2HA 3CW9A 1CTQA 4FZJA 4LJ9A 1XNHA 2UZ1A 2GN6A 1ZCAA 2Q8PA 1GGVA 1P7ZA 1W94A 2OXCA 4KO8A 3LYAA 2NX2A 4FKMA 3B9BA 3V4LA 4YT2A 4ROTA 2WWFA 2XQJA 3L0OA 4TL8A 1RC0A 4CM1A 3SQWA 2PPLA 2WG2A 3NDJA 2ZR0A 2ZBUA 3CEAA 3PUZA 2R751 3C3MA 3F71A 2P9HA 3Q7TA 1R6UA 4XWKA 3HYCA 3RC3A 4H6PA 4TT3A 4Y6QA 2VDPB 3UB3A 1JFLA 4Z9XA 3VNBA 1ZYUA 2CDCA 3I5MA 1YO6A 5DRYA 1JLHA 1NQOA 2G4CA 4N76A 1TF2A 5IUJC 4BMCA 4MEAA 1M5UA 1DVRA 1UXJA 3K09A 4LE0A 4CGZA 1BDBA 8MHTA 4GZ3A 3EB9A 4N0DA 4DA7A 4ZYWA 2QNBA 3DONA 3IR6A 1JR3D 5B3KA 3C7CB 4Q4HA 1Z6XA 3H9UA 1G3MA 5HF9A 1TIPA 4P84A 3UHAA 1ZGHA 3RTDA 1FNMA 1X3SA 2GRAA 4BQRA 4HLQB 2BKAA 5G4LA 3P0FA 3PB3A 2AG8A 1N6HA 3D6JA 4V0MA 5CVCA 5DGCA 4DREA 5SZJA 1Y1KE 2CUNA 4D02A 1EFRA 2MMGA 3N7TA 4OHMA 3B3AA 3J7TA 3R3UA 2FLWA 3GGCA 4OREX 4TKVA 1FS4A 2IODA 2RGCA 3GJSA 1K6EA 3L0PA 4F0JA 4F7DA 1USGA 3R6DA 4AUKA 1G20E 1J0CA 3B1ZA 4HVCA 1Q44A 4KXQA 3VX3A 2RGWA 3I5XA 3WQRA 2WTBA 1CEXA 2X22A 4WZAA 4CUKA 4HMOA 3R8FA 3FJYA 2A58A 1P75A 1JF8A 4UBNA 3NBZC 5IWAB 2B7CA 1IZ0A 4WNCA 3W9YA 3PNPA 4LF6B 2CNOA 1MV8A 1SIOA 1NPTO 1UT8A 1YU9A 3E23A 5BNFA 4BPBA 4OA5A 2GN8A 2NU9A 1TW2A 5FLYA 4BRUA 4BWYA 3DNMA 3ICVA 4Z8XA 3WB2A 2X14A 4L8GA 4RF5A 5CB4F 5AVXA 1A0OA 1QHSA 1Z0ZA 3EA5A 1PGOA 2HJSA 2PT6A 1GTG1 2PTHA 4FS3A 4WKCA 2NU7A 5JV5A 4JYZA 1JFSA 4Z7JA 2FE1A 4F12A 3KXDA 4ZD6A 2QGNA 4DGSA 1RWWA 4EPVA 5JNWA 1IY1A 4EYGA 2P1ZA 3JR7A 3L7OA 2V98A 2PLAA 3LKDA 4R5HA 5AYVA 4JU9A 1TQ4A 2R84A 3RRBA 5DNUA 3BTVA 3ML1A 4M9ZA 1PJZA 1D2HA 4DKJA 2N75A 4ZU1X 2AFIB 3NRBA 3FNFA 4JI5B 4KIWA 4AKSA 2OCIA 3QLEA 1AUVA 2ODBA 1YR2A 1MX1A 3FB1A 1PJ3A 3GJRA 1BD3A 4FBMA 1SEPA 2JNWA 4UTXA 2PUHA 3L6CA 2MTBA 3LHSA 4XB1A 4MR8A 5C4MA 4DA4A 2GJKA 4KQXA 1I33A 1KYTA 3HJHA 4YJHA 2RHGB 4LYFA 3LJKA 4DB4A 2HPHA 4FLFA 4QUEA 1TE2A 5E2AA 3O03A 3THWA 1UBKS 3CONA 5DGIA 2WC1A 3TFWA 3KEMA 1DDGA 4ETNA 4N5HX 5JMOA 2IDZA 1OX4A 1C9KA 3WGQA 3LUFA 4CMEA