2PWBA

Crystal structure of the complex of proteinase k with coumarin at 1.9 a resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Crystal structure of the complex of proteinase K with coumarin at 1.9A resolution
rcsb
molecule tags Hydrolase
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2007-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2pwbA00
4H6XA 3WIVA 1R64A 2IXTA 3VHQA 2PQ2A 2IY9A 1IAVA 5AVKA 2Z58A 3DE3X 1TM5E 1Q5PA 2SNIE 2ZWPA 5B1DA 3CO0S 3QMPA 3A3NA 3P5BA 4CG0A 3LPAA 1VSBA 1C9JA 3EIFA 2Z2ZA 3H42B 4OMCA 1SELA 3EE6A 3WQBA 1S2NA 2SICE 3WIUA 2GKOA 4RYDA 3WHIA 1SCBA 1Y4DE 1NDQA 1SPBS 2QTWB 1Y3CE 1AV7A 4AKTA 4NMXB 3DE0X 4YN3A 3I2YX 1Y33E 1T1EA 5JXJA 5JXHA 2W2NA 1GNSA 1ZVKA 3F49S 4GI3A 3A3OA 3F7MA 1DBIA 1EA7A 2WUVA 3QFHA 3F7OA 1SCJA 2X8JB 3DVRX 1WMFA 2G4VA 1YJBA 2W2MA 1KDZA 3LPCA 1TMGE 1WSDA 1Y9ZA 3SQOA 3L1KA 2DQKA 2SBTA 2HPZA 1MPTA 3DW1X 3SICE 2W2PA 1SCDA 3GCWA 3VSBA 1NLUA 3DDZX 3AFGA 5JXGA 2Z2YA 1SCNE 2Z30A 3I37X 3GT4A 3GT3A 2W2QA 5SICE 3DWEX 4DZTA 4NE9A 1TM1E 1ZVJA 4HVLA 5FBZA 1AQNA 2WUWE 2TECE 4OMDA 3DE6X 1PTKA 1EGQA 1YJCA 1GA1A 2WV7A 4ZARA 1SUCA 4KPGA 4WOBA 2ID8A 1GTL1 1GTG1 1TO1E 1V6CA 3DE1X 4DJ5X 3ZXYA 4M1ZA 1AH2A 1KE2A 1WVMA 1P7VA 2HD4A 4JP8A 2W2OA 1SBIA 3DE4X 1GTJ1 2P4EA 2V8BA 2WWTA 2Z56A 2B6NA 1CSEE 1AF4A 3TECE 4KG7A 1OYOA 2PRKA 4BWGA 1YU6A 1R6VA 2PMWB 5I9SA 1C9NA 1CNMA 1TM4E 1GNVA 1LW6E 3I30X 1Y34E 1WMEA 3VYVA 1S02A 3QTLA 4LVNA 2ID4A 4B5LA 1TECE 2PWAA 1V5IA 5CW1A 2PWBA 1P8JA 1AVTA 4DWWA 2DUJA 3TI9A 5ARDA 1SUPA 1Y3BE 2XTJA 1S01A 1SN7A 3DE2X 2ZRQA 4H6WA 3EDYA 2ST1A 1SIBE 1SIOA 4LVOA 1KDYA 1OT5A 5AVJA 1SUDA 1SBTA 2PYZA 1ST3A 1THMA 1SH7A 1Y1KE 1KDVA 5ARBA 5AMXA 2XRMA 1Y4AE 4C3VA 3DE5X 4I0WB 1R0RE 3DYBA 3I34X 2X8JA 1Y48E 1SBCA 2ZWOA 1SIUA 3AJ8A 3LXUX 5FFNA 1Y3FE 3PRKE 5FAXA 3DVQX 3VV3A 1GA6A 1BE6A 3Q40A 1YJAA 1TO2E 1BH6A 4K8RB 4MZDA 3VTAA 1SUBA 3LPDA 4OV6B 3UNXA 1AU9A 4Z2AA 1UBNA 2Z2XA 4C3UA 1BFUA 1PEKE 1MEEA 4CFYA 3T41A 1TM7E 3OSZA 1GA4A 3BPSA 1C3LA 4KB5A 2SECE 3AJ9A 4FONA 1SUEA 1BE8A 4ZOQI 1HT3A 1SVNA 4CFZA 1SBHA 1T1GA 5JXIA 3D9QX 2DP4E 3GCXA 1TK2A 1P7WA 1Y3DE 5ARCA 3PTLA 4HX2A 1SCAA 3DVSX 4AKSA 2E1PA 1DUIA 1PJ8A 3DE7X 1BFKA 2PKCA 1ST2A 1SBNE 3HJRA 1KE1A 1JEAA 3BX1A 1GCIA 1GT91 1NDUA 1OYVA 3DW3X 1T1IA 1XF1A 1PFGA 4J94A 5AQEA 4NE7A 3CNQS 4H6VA 3D43A 3BGOS 2Z57A 1BJRE 1SUAA 5B1EA 3TI7A 5K7SA 1WMDA 1C9MA 3Q5GA 3VV2A 1A2QA 1TM3E 4WOCA 5JMOA 3ZXXA 1IC6A 1AK9A 3A3PA
chains in the Genus database with same CATH superfamily
3OZTA 2VDUE 5LN1A 3ZYCA 2YV4A 4YJHB 1E1CB 3VJKA 2H17A 4K9KA 2PIAA 3E22A 2OXFA 3DULA 2XV1A 3X1JA 4IH9A 3ZXUB 5JYCA 3Q8LA 2EF0A 4HEA6 3W7VA 3B6KA 2XUZA 3V8NA 3H4IA 4DIUA 5C8DA 3VUEA 4CR8A 4RQUA 4R83A 1TM5E 1LV7A 4FZJA 5A3QA 1A27A 2I1LA 4G67A 2ZAYA 4IG9A 3MHPA 1NXXA 1NU6A 2WINI 2GERA 4KYUA 2JHPA 2Z8ZA 1AG9A 3A1VA 3O1JC 1JEYA 3HJAA 2GWRA 4GNRA 2O06A 1DRVA 1YR1A 3JRNA 5DEIA 3CFYA 3UM9A 1KR2A 4ZJYA 1R74A 3KXDA 3DBRB 2C7BA 3MS4A 3MWLA 2ZIZA 4ZAVA 1OZ0A 4CKEB 4GDMA 1MR3F 1FFHA 2OHHA 4QLAA 2QB5A 2RAPA 3D4IA 4AUNA 4A36A 2IUFA 2JIQA 2OAGA 3CBGA 3JVEA 1YVUA 3R0IA 4N47A 5KBYA 3WZ2A 1N2JA 1V5FA 4B45A 4BMXA 2OAP1 3ZBTA 2QX8A 5E3IA 1AY0A 2VJMB 3A0RB 3BZUA 3F98A 4BX9A 5DTMA 1BA3A 1T5DX 1VPVA 1YWGO 3K6KA 4P53A 4PYMA 3GJ4A 2YVQA 3FMVA 1NVVR 3UT5B 3GH3A 4JY7A 3WQBA 1PAUA 1I01A 3E9RA 5F1KA 3ZWPA 3OE5A 4YJ3F 2PX4A 1RZUA 4M9CA 4TRJA 1RAEA 3H8SA 2IIPA 2NAFA 2VUIB 1DDOA 1EK5A 1TZJA 2L17A 2BHTA 3Q3EA 4RW0A 5C31A 1T1RA 5FPYA 3K8YA 3MOIA 4KSYA 1KGSA 1Z63A 3AVYA 1P6XA 1TJ5A 4G5FA 4ZJPA 2NMVA 2GLXA 5L3SA 1YVEI 2PUCA 1M8JA 1GNTA 5D7NA 3EXFB 3D7NA 1FPMA 3L5OA 3WGMA 3V4OA 2DE0X 1ARZA 1P2FA 4J0QA 1ULAA 1GFSA 5THQA 1MJNA 3SZRA 2I03A 3FJ1A 4HWTA 1S2IA 2W2NA 4ZC8A 4CIWA 3LC2O 5MN6A 3N74A 3PUXA 1ZH2A 1A8HA 5CFZA 2QJTA 2I1VB 2FZKA 2PBRA 2X5KO 1GKIA 4JLOA 4JX9A 4M89A 1A9RA 4UOQA 5JLAA 4F93B 4L8VA 1CUXA 4ND8A 1X1AA 1J2YA 1QUEA 1T36B 2YNMC 1GPUA 3F3MA 5BVHB 3DP9A 4U6SA 4BKQA 1N0VC 1Y1QA 4PYIA 5AXDA 5M04A 2XZPA 5HRUA 5BN3A 3C8HA 3U61B 3QG5A 4JXZA 3HJNA 4ZEXA 5CX1A 1G7SA 3I73A 1W87A 2G9VA 2W2MA 4IGAA 4YO7A 3WL7A 1TYDE 1V6AA 1PQ4A 1VHJA 2F9LA 4EI2A 2WM9B 4D99A 1M0TA 2TMDA 4C3OB 4FILA 2H54A 3COSA 1FMTA 3BK7A 1FW8A 3ANTA 2QD3A 3ANNA 3DHNA 4HFRA 4FI3F 3LK7A 4RDIA 4WVLA 1ZRMA 5EESA 2Z3VA 3T1NA 3VOSA 4C6HA 2XXJA 1FFYA 1SUWA 3IAS6 1KH1A 3CEMA 4TQ9A 1EGVB 1TA0A 3ASVA 3LF2A 3IQWA 4JYCA 3UV3A 3AUJB 2RCNA 2CV0A 1ZNYA 4B6GA 3L1VA 2WSIA 1C80A 5D5HA 2WW8A 1XZEA 4L2IA 2WJ6A 3NB0A 2XCSB 1FX0B 3AQIA 3QE2A 3KAKA 1XP5A 1W9MA 2V7UA 4QOEA 1EFHA 1NQ5A 2H4YA 2HIAA 4UJ5A 4UNPA 3L40A 1RMYA 4WNYA 3T0GA 4AWAA 4LJSA 3EOZA 4YP5A 4BP3A 2ZI6A 3FZYA 3PC8C 4LXUA 2XB2A 2J31A 4G1VA 10MHA 2X58A 2YVAA 4J2HA 4F91B 4DZTA 3TE7A 2IOQA 1VYHA 4WGFA 2QL5A 5K0GA 4M7OA 2R60A 3I0NA 5KNCD 1J2RA 2E82A 2QN3A 1AQ6A 4TLAA 5A3SA 1GXSB 1TAQA 3IUQA 4UFNA 3WA6A 4Z4GA 4YAOA 2HWXA 4RLSA 3IC5A 1O95C 3LZ6A 3EPPA 3WLNA 3JYHA 3W8NA 3IEMA 1OIWA 1KAOA 1QM5A 2OV1A 4GYYA 1D9ZA 3BYZA 1OE0A 3FOAA 3IRUA 1LI7A 4INJA 2FPGB 1X9GA 1R4NB 4G86A 1EUYA 4ZTZB 3M3HA 2B4KA 2DCMA 1VE9A 2WLTA 1QGDA 1GTL1 3HDJA 4LHVA 3S6JA 2ZJBA 4A0GA 3T5PA 2NVBA 3GXOA 3OLVA 3ZXYA 5D3ZA 3WLIA 1K6MA 2XDAA 1UPAA 2W2KA 4KRGA 4M6WA 4NYJR 3RJ9A 3STTA 3UW1A 3UK1A 3ZHQA 5JNWA 1GRRA 5M3BA 2E4UA 5JSZA 3WLKX 2HD4A 4AYXA 3P9QA 3P9YA 3B9BA 4EG5A 4OU4A 3M6XA 5K6TA 4AMBA 2B2NA 4TMYA 1S8FA 2XMBA 3K9CA 5HDBB 1A77A 2H2IA 4Z3DA 2PXCA 5A03A 3T4PA 1GD1O 1Z5ZA 3IJPA 4UNSA 2B6NA 2P9YA 1EFRD 5A71A 2GQ0A 1HE5A 1SVKA 1USKA 3G49A 4US0R 5I6DA 2ZM5A 4KR7A 2UUPA 2WD8A 3BTOA 3EA4A 4TVSA 2GN9A 2Q0SA 3VZSA 2GLTA 2Z3WA 4WNAB 4CM3A 1DAEA 1O5IA 1P9NA 3IP5A 5TGDA 2VJOA 3Q7SA 1XXLA 1UZNA 4HY3A 3AW9A 1UAGA 4HRYA 4UC0A 3K1YA 3O74A 4J0KA 4H0CA 2O3TA 3KWLA 3FLMA 1UFOA 1R6DA 4XX1A 5DN6A 2WSLA 3WMFA 1Q0TA 2XE4A 3HHEA 4XFJA 4F3RA 1NU8A 2YH2A 3NHUA 1VE7A 4WXRA 1UR5A 3NASA 3I5YA 2OOSA 1F8GA 2C3OA 4U9UA 1SQ0A 3G7NA 4URZR 2B4QA 3OWHA 4QO7A 5JSFA 1NXVA 4LV5B 3RS4A 1N2XA 2DFVA 3F5DA 5IAEA 2M98A 4N9WA 1E62A 2OXCA 3A2MA 2ZPTX 3KC2A 3FYSA 4I3GA 2J8ZA 1GPKA 3LBIA 1AA9A 2JFVA 1WMEA 1GQRA 2AIRA 4KZPA 4ZU6X 4U2CA 3UT6A 4CDNA 1HXHA 5IKXA 1QG6A 1C3JA 1LBHA 1LSOA 4MVWA 2PU5A 4ZAWA 5SZIA 1ZW1A 4BATA 4UMVA 2BFNA 2KW5A 5FQOA 4L15A 3M49A 3VQTA 3UMMA 3BMNB 5TVKA 3IURA 1WQ3A 3HB7A 2P11A 3OPYI 4AJEA 4AX8A 1P1FA 4OM7A 1GILA 5CEFA 2OKCA 4L07A 4HVCA 4KQJA 4L08A 5A5FA 4FLFA 2C97A 1J97A 3EWAA 2V0GA 3PQ7A 3DHVA 1JVNA 3DQZA 1X6VA 1J5XA 1OCEA 1EDBA 2R84A 5HTOA 1XJWA 2I6TA 1G8YA 2NV2B 4TL9A 4E46A 2PU7A 4Q6WA 2BR3A 1YMUA 3INRA 4TSKA 6LDHA 5CVCA 5ARDA 1MIHA 5IUJC 1QVZA 1RCFA 2WF5A 4UNNA 4MGYR 3VJMA 4MKXA 2QXYA 3MCWA 1O54A 2BV3A 1H1LA 1PFWA 2C88A 2WG2A 2ODQA 3LY9A 1ZI6A 1Q2XA 3HY3A 2CE7A 2IODA 3M3DA 2CSUA 4BXOA 2Q5FA 3BK2A 4EKGA 4A15A 2A1TR 2ZUDA 3O73A 5B64A 4K46A 4OIMA 5HJEA 3ADBA 1U2DA 4O4LB 2GPAA 2WTEA 3F0TA 2V5VA 3I45A 3LNCA 5TQJA 3UHPA 3GLGE 3F74A 3S5UA 3BCHA 5IJWA 2N1MA 4XJVA 1K75A 5FYQA 1PTJA 2MOKA 4ZP1A 3PC7A 3R8FA 2QRMA 2RIRA 5AMXA 4YCJA 4PZUA 3KTAB 1EQ2A 5FPQA 4LN1A 4GQIA 3SIWA 4UEJA 3SQNA 4DNFA 1OH8A 4OHUA 2PWPA 1BWQA 1QH1B 1EU1A 1Z56C 1H85A 3C74A 1H0KA 1JPUA 1XDSA 3NBUA 3WBBA 4F4JA 4EY7A 3C6XA 3FBGA 4XCVA 5KWVA 4O59O 4N12A 1JLMA 2JVIA 1KOFA 4PZLA 4BKRA 2CK3D 2OCDA 2RB5A 1A4UA 1JKXA 5C18A 3DNFA 4G09A 5D5PA 3HR4A 5BNFA 3AJ8A 3LECA 1Z5VA 4G63A 2IT1A 4HRAA 3GQBA 5AVXA 2WJZB 4HV4A 1YS7A 3HVUA 2JCBA 2WPDD 3WZMA 4QPJC 4ASUD 4BNMA 1ETUA 4IEFB 5BPFA 5FAXA 4EKEA 3R5FA 1RKXA 1Z6XA 2LUOA 1IUNA 1UXHA 2ODWA 1R88A 3HNPA 4MWZA 4XJTA 2P65A 3OZVA 5IW8A 4Z3OA 1KORA 2FR1A 3RM3A 2OPHA 2OYCA 3OIVA 1BH6A 2OY0A 4O33A 4ETNA 2C04A 5JAOA 4G4SP 2F17A 3KB6A 1H6AA 1VLLA 3ADPA 3P20A 2WWXA 1Q0RA 2XI4A 2WAXA 1JHDA 1UZAA 3IV7A 3M9LA 4GX2A 4MV3A 3TL6A 2Z04A 3KX2A 3CB4A 2EZ9A 1EXMA 3ST7A 1U0RA 1EMDA 3EZNA 4ZVQA 4Z2AA 1K63A 3WY9A 2H48A 4F72A 5CDUA 4W4TA 2Q50A 4RWZA 3S0JA 3U17A 5CBPB 3LQYA 2H9YA 1I3MA 4GGPA 2J41A 4JIMA 2NV6A 2V7VA 3HNRA 2X0IA 1KERA 1ZFNA 3A2NA 3G5MA 3Q9SA 3PTAA 3B20A 3M7IA 3UBTA 3SHVA 2F43B 3W90A 3HNOA 1BE0A 5DM0A 1G9SA 3FFXA 4X7MA 3WK4A 3EZ2A 4TL7A 2P2CA 1PCXA 1KTVA 2ZWMA 2FWPA 3R0ZA 2PMEA 2KB0A 4Q4AA 4BFXA 1DADA 4OJTA 3GZNA 1LRKA 1SKUA 4JP1A 4QG7A 1O94A 3PQ4A 2JJMA 4E31A 5TIIA 2JLZA 1AF7A 5JISA 5CXSA 2QF7A 4V0MA 3UAYA 3R74A 3KRTA 4REOA 1MMFB 4EG1A 1IJFA 3LRPA 1SUSA 3SDBA 1N0IA 4HDNA 4NPCA 4B3HA 5IXSA 1NJFA 5FPSA 1FDIA 1FP2A 2EZTA 2QXTA 4M9ZA 4Z8YA 1QNLA 2A0YA 1R0LA 2FSUA 4C0SA 2IYYA 1T1GA 2F3QA 4U3JB 4X1YB 2NU8A 1CLUA 1D0SA 1P7PA 1W2WB 1JFFB 1ZM3A 2RG7A 1JJBA 3B9RA 2C4VA 5LZ8A 3K9NA 4EVRA 2YWXA 1RJ9B 4KN8A 2GJSA 4MR7A 3HCNA 4CKWA 3WKAA 4MWDA 3KSDO 1SXQA 3PQ6A 2YFQA 1JE0A 4R01A 4AURA 3HMKA 5DM60 4I8IA 1RXWA 1NKVA 3C5VA 4UXHA 1ZKMA 3OG9A 3NMUF 2V4ZA 1E96A 1BXZA 2FETA 1KKMA 2J4DA 4GXQA 3SXJA 4K7JA 1PS8A 2AG8A 1P2DA 2DGDA 4UE3S 4XLLA 5HIMA 1M74A 4HX2A 3P0HA 3VHLB 3WLLA 3X1KA 1U6KA 4LPSA 3DVSX 3LLMA 4DLUA 1ZSNA 3HV2A 2WHEA 2VSXA 2JS7A 4D5EA 4YJGB 3UHJA 4UBOA 1PIWA 3EPHA 3N8KA 2GD1O 3OZWA 4GI7A 3BN3A 4XYMA 4HZIA 1GG2A 4H4DA 1SBNE 4IICA 1R9MA 4EDHA 4B43A 4E30A 1KVQA 5HOEA 4MQ5A 5JXWA 2JVJA 4MPRA 1WNFA 3W06A 2Y6UA 5K0TA 1E32A 3IR6A 4ZYZA 3UENA 1B8PA 5KINB 1ZM9A 3HKBB 1FQKA 7MDHA 2RKOA 4J9UE 1MJHA 1X86B 2OFWA 4GPEA 4L1KA 4ZQFA 2ESRA 1HBJA 1DFGA 1RFLA 4JB0A 1L7AA 3TPFA 4D80A 4Z5XA 2QX7A 5IHXA 3TUIC 3EHDA 2ZIAA 4CL0A 1JDNA 3A4LA 5LB4A 1CUEA 3FSJX 1CFJA 2ZB7A 4JOCA 3R7BA 3TLMA 2Z9BA 1ZA2A 2QKYA 1W35A 4WESA 3B5IA 3WWEA 3QVLA 1W5AA 4H6VA 1GV1A 2XA9A 4LSMA 4M8IA 2P62A 1QC5A 1VI6A 2RGNA 2Y3IA 1ZGCA 1W581 1NQWA 2H00A 3OE7D 4POOA 4KGDA 1DX6A 3CPJB 3OPNA 2I54A 4MW2A 3C3JA 3OETA 1T4MA 3WRYA 1N33B 1L7DA 3EISA 3G6WA 4X1IB 4MJLA 3ZTWA 3H6KA 4B0OA 2QIOA 4X85A 2JASA 5KNCA 4Z86A 4UD6A 4DNPA 2Y0PA 1PSZA 1NN0A 5C8VA 3OJEA 4TS3A 3SC6A 1NJ5A 3D5TA 1UBLS 1SCUB 2YC4C 3R3UA 4MAAA 2W93A 3P96A 4FEAA 2I7VA 4JMPA 2AFIB 2GHRA 3WIVA 1XDZA 3I2FA 4EBBA 1CUSA 3DUFA 3ON5A 4K9DA 4KNWA 1P0CA 3FCOA 1TTHA 1W94A 4O6VA 4RKQA 1CR6A 2IHTA 4H27A 5HF5A 3RBXA 4NNOA 4CVNA 1U0BB 3PKZA 1YKFA 1A88A 2X13A 1G6OA 1C9YA 3FMIA 4A6EA 3F1KA 4ACBA 5IVPA 4JI3B 3N75A 4QBKA 2YZ7A 5A7FA 1E3QA 1Q5PA 2FSIA 4G9BA 5LMZA 5KMGA 2JDIA 1E58A 1HDCA 3DO5A 3PQ8A 5BWBA 2F3TA 4V0LA 3OP4A 4LZOA 4NVRA 4DDVA 3ZK9A 1T4GA 2IGTA 5JAMA 1YMQA 2C5EA 3T52A 1QFXA 1RACA 3PPXA 1DG3A 3T7EA 2CDNA 4DGSA 4EM6A 1WXFA 2ZBUA 4XSHA 3RRBA 3VPSA 4ER0A 4JV5B 5K5EA 5LP6A 5K8JB 1JI3A 2Z5LA 1DDIA 1KZ9A 3M9WA 5HS6A 4JFRA 1IHPA 1UJBA 3TB4A 2GASA 2VP4A 2FPMA 3UG7A 4M49A 2AOUB 3ZU3A 3VNUA 2MU1A 3QHPA 1QJCA 1OGJA 4RV4A 4LJLA 4F8JA 2VSFA 3R8CA 4MVJF 3KSBC 2IDKA 3GIWA 2HA6A 1IXKA 1WD5A 3RIMA 2IP4A 2OGWA 1T5SA 3EE6A 3FCEA 3UUEA 1SVWA 3BHIA 4XQ0A 4EB6B 1E1KA 1XF9A 4KLNA 1BMDA 3WHKA 1ZIDA 221PA 3ZBPA 3G2KA 3LX5A 4BUJA 3MYYA 4UXIA 3VYSB 4C4SA 1FFEA 4LFBB 4YJHA 1U2DC 3TXAA 3TTXA 2FPPB 2HQOA 4QECA 1SCBA 4PINA 3TTSA 4KU4A 2J0UB 1C0EA 3WP0A 4YCLA 1Y4DE 1V8PA 5ALXA 2YY7A 4GI2A 4DDUA 4PLPA 5B4TA 1PTJC 4QJ5A 4HNGA 5GONF 4CDMA 3GWZA 5F21A 4PTLA 3S27A 5IEBA 1KDRA 1OXTA 1ZL2A 3BS4A 3IUNA 3RSCA 4YN3A 1L7OA 3FPJA 1T1EA 5HBRA 1P17A 2AEJA 3G2JA 4JI1B 4CJXA 1C3EA 2B9VA 1IIBA 4OHCA 5EEHA 2H8KA 2ONCA 3DR5A 3EB9A 2IQ5A 3P0EA 4IXTA 4WADA 5SZJA 3NX4A 3EW9A 4UHCA 2JEYA 3TZKA 3RYTC 3JZAA 1B42A 3MF4A 3FKSD 3AOEC 1AQIA 3SZOA 5CDFE 4CKEA 1PK9A 2BFAA 2BFOA 2D74A 3GOHA 4K6FA 1HMPA 1JIIA 1SC1A 2GJ9A 3EARA 4O2AA 4OI1A 3W5AA 3UJHA 1R8JA 4CLEA 3HCEA 4G0WA 3VO9A 3ZHRA 1BEUB 3DMDA 4GW3A 2IP2A 1U5AA 4ZGWA 2Y1KA 4X92A 3UJAA 3I9MA 1SRRA 4OHKA 5D7BA 5CCXA 5CHEA 1ZGGA 2NXNA 3S4YA 4DXHA 3UT5A 4H7HA 5JFOA 3WHLA 2PPLA 1NBMD 1EDEA 2ZS7A 5HF8A 4DIEA 2HPZA 1U4SA 1MPTA 1NT4A 1PJRA 2E89A 4W5JA 5EE9A 3VOTA 4D9IA 1DC3A 4E2WA 1VPWA 3GCWA 4UM7A 3ORYA 2PJDA 4DSAA 4M99A 1Z06A 5DXFA 4FR0A 3TXYA 5I7UA 5LMCA 3BWYA 2O8CB 1KXJA 3N6RA 2H4XA 1KO7A 1WTCA 2EZ4A 1RQRA 5ESRA 3O6VA 2H4FA 1KZYC 3IIKA 3DVAB 3KQSA 3NHMA 4OHFA 3VUFA 3MMZA 4IIHA 4ND6A 2D3TA 4TQGA 2Z2YA 2Q3HA 1DFIA 1UXJA 3E3LA 3GPBA 5EPEA 1P9WA 1WZUA 4C0KA 3W34A 3E8SA 3EX7C 4YDHB 5JQGF 4LA4A 3FUTA 2IWHA 2X1LA 5J47A 1PZGA 2WJIA 2YYZA 2W8ZA 2BZ1A 3PIIA 3USCS 4GD3Q 4NH4A 1T36A 3DLBA 3PIRA 1CEYA 4KIWA 1N57A 4TPKA 1T13A 5KSOA 1YDGA 2G77B 2CZQA 2E48A 1KYWA 2HK9A 1L5VA 2VDQB 3S8EA 1WTAA 2AX3A 2QR2A 3F6PA 2ZCVA 1O94C 2M32A 2FI1A 2QRGA 4HVLA 2IU6A 3KJNA 3PGLA 3EVAA 1TTTA 1ZCBA 5KWIA 1F2DA 1AQNA 2HJSA 1XLTA 1W4LA 4LYEA 4MV7A 3THSA 5H81A 1ID1A 4NFLA 1RXSA 3K16A 3GFRA 4P3PA 4Z4CA 1OFGA 2W2LA 1E1MA 4WW0A 2CWWA 2B99A 3IT3A 3RKRA 4AY6A 2JAWA 1BVHA 1M2NA 2G71A 4BNFA 1DP4A 4XFKA 4OD0A 3L8CA 1W1WA 1W93A 3BXOA 4TVOA 2YBEA 4K9NA 5JJCA 4MUBA 4CWAA 2V54A 3DL4A 1PKEA 1KE2A 4CNQA 3CEJA 1E2EA 2CL6X 2R5NA 4MI9A 2FPXA 2J0SA 4E11A 3T35A 5D86A 1R5OA 2QA5A 3OH8A 4ZZ1A 4EUHA 1FX0A 1K0FA 1MG5A 2XMGA 3MJEA 2WIJA 4NMHA 4PC1A 1E4OA 2VHVA 1FYFA 3KAQA 4LVUA 4QU5A 3V6LA 4YRZA 5AVQA 2FSVC 5CYPA 4XYEA 3LG2A 5IKOA 2BF7A 4DY4A 1LBEA 5EIAA 5JAIA 4M0PA 2Q4TA 3Q7RA 3NUQA 2XAAA 1BIFA 5F5NA 2F4VB 3RNOA 4CT5A 2VDJA 2G1PA 2VQDA 3L43A 2RBGA 3SQWA 1S4MA 1DKNA 2BEUB 4HI0E 3SXUA 1B14A 1GXSA 4LW8A 1JR6A 1EVZA 3OTOB 2E55A 1R50A 1RYMA 3BWEA 1Q15A 3R0QA 5IBPA 3WWOA 2QTGA 1Z36A 4A1FA 4K81B 2R68A 3FRIA 4LUCA 2IP1A 2OUIA 5JBIA 2E4WA 3BF8A 3C1TA 4FFDA 4OLJA 1K27A 4YRFA 3ZGOA 5EEGA 2AEFA 1FMLA 1ODFA 1R4NA 2PD3A 3AK4A 3A05A 5T67A 1FNMA 1HFEL 3DJYA 2LPMA 2NUBA 3HCFA 5CD1A 4OA5A 4LG1A 4LWPA 1TM4E 3GUCA 1MB3A 5KYGA 4F8YA 2R87A 1VCIA 1QO0A 5A9RA 2HLNA 1YHYA 1DE0A 1ZD5A 2W6JD 5DEOA 3R7FA 4DJJA 1FTQA 5B6PA 3COWA 2MMGA 1V26A 1N2ZA 3NHPA 4QNMA 4JJ7A 2RGNC 5FQNA 1TA9A 4OI4A 4PLZA 3TAXA 2BEKA 3U44A 3IOMA 1TXGA 3QVSA 4Y2SA 4TV8F 1QKIA 5LWQA 4FC7A 1RYDA 3WRYC 1Z6AA 5GJVC 3OMXA 4UM8B 3RYCB 4KDCA 4Q4JA 3SNHA 3OPYA 2ZAGA 3I62A 1WJGA 2PAFA 2R66A 5KC9A 1HX7A 4Y1EA 2GYYA 1YMVA 4FQ7A 4JVNA 5DMXA 5J9FA 4R7ZA 4LYJA 1ZD9A 4F7DA 5JAPA 4P0PB 4FS8A 3BHMA 5C81A 3M83A 4N3GA 5AI9A 2AFHB 1THTA 4J0FA 4RHTA 1Q3KA 4H18A 5LD2C 3FNHA 4EYQA 5F4ZA 4P92A 1BROA 4QVIA 3H0KA 1XRQA 3ED1A 2QT1A 3HU1A 2AF3C 2QENA 3ZDBA 16PKA 1Z2AA 5JNLA 2X8WA 1PGPA 5AKGA 4JUDX 2PWZA 3KP1A 4EUEA 2CL7X 1TTPB 1MQAA 1R12A 5F3DA 5C35A 2C77A 1U3DA 2WYIA 4DRXA 5A2GA 3ZIUA 1JXQA 4EITA 1KS9A 4V0NA 1RADA 4IJMA 1HF3A 1E2IA 3NGXA 4D3FA 1HUQA 2ZIXB 4MTCA 3AILA 1J5EB 3T5AA 1PYOA 3TSWA 3BH7A 4JNCA 2VO1A 2FJPA 3AYZB 3OE4A 4KPYA 3IQZA 3V8PA 1QYXA 5ALHA 3CR8A 4W63A 4QDJA 4ARAA 1G5IA 1SBTA 3COVA 4B71A 5IT5A 5C51B 3DYVA 5DT9A 5EKDA 3WGIA 1H2WA 2GEJA 2Q41A 3FYCA 3LQ4A 3PQ2A 4M1TA 2W83A 4ZRMA 3C3AA 3RGGA 3UKOA 3UXEA 4EX7A 5COQA 1PZEA 1R66A 4LJYA 4C3VA 5KNDH 2HQBA 2QT9A 3BMNA 2PZMA 3FTPA 1I80A 3TYXA 2LDBA 4B4VA 1YZTA 1NW7A 4KVZA 1YACA 3DDSA 1EJ2A 3H4MA 4JCOA 4OIFA 3QP9A 4Y9DA 3UGKA 5FB3A 4JI8B 1Q1BA 1BXRB 1R2QA 2AKAB 4M22A 4PFSA 1LSUA 4O4HA 4HF7A 4ER3A 3U4HA 1Z6GA 5GJBA 3BD6A 3RUPA 1MBZA 2WJ4A 1XLUA 1YL6A 2HH9A 1GCUA 1LX7A 4YDRA 3R5SA 2C7RA 5JHGB 5B7GA 4ZVNA 3IB3A 4WN9A 2VUTA 1GKUB 3KT8A 2BUAA 1Q12A 4A03A 3K70C 4GOOD 4RKEA 3RVQA 1XE3A 2YYSA 4C0AC 2G9UA 4R1MA 4B2IA 1J00A 2IXEA 3ZDXB 2PL1A 2B69A 3ICCA 4F1WA 2W90A 3QE3A 4QOIA 4CDGA 2IV7A 3OECA 4BB0A 8GPBA 3KBBA 4JT9A 1U94A 3LHDA 4K6CA 5FEUA 2QQGA 5H02A 1NAIA 2UZAA 2VYND 4LDZA 1JF8A 1SAYA 5LBUA 1P4GA 5GADl 2F3PA 1XTTA 4CNBA 3IV6A 3PT9A 4AIRA 1S89A 2Q4RA 1FXSA 1ODCA 4JVMA 2CNLA 4LBZA 4OF4A 1Z9BA 3CEPB 5F35A 3ROEA 3WKEA 2PHZA 3AUSA 3U1TA 3TVTA 1QHFA 3ZXSA 4F4IA 1PJSA 1JP7A 3NIFB 4O4LA 3O9ZA 3CZAA 3LPDA 3I9V1 4TGLA 3U7RA 1JDZA 2ZGVA 3LT5A 3MLBA 4H7IA 3ERCA 1L8LA 2I3GA 2IPMA 3OAAA 3Q7TA 4V0ME 1MC1A 4LNUB 4O3FA 4L73A 2XNKA 4HZUB 4Z7NB 4KR6A 3PWSA 4C3UA 1T5OA 3BVPA 3TVDA 3U7EB 1JHYA 4L9AA 1D1SA 3AVQA 5ALVA 4IIDA 3ZTYA 1EUCB 2GAFA 2ZI7A 5CB6A 1QH1A 4K9PA 2EX1A 4WK6A 3LUKA 4BVBA 1CF2O 3COYA 1RM4A 3ZQKA 4PZ9A 1EX9A 5A3RA 1PDVA 5F73A 5IKPA 2I1QA 1VA5A 1T91A 1O8CA 2FSHA 3JAKA 5J1TB 2EKPA 4BRWA 4EGQA 1PF7E 4X41A 4UBIA 1E0DA 2AKEA 2Y9PB 5KTMA 3C70A 5F7OA 1Z6TA 4J4BA 3CU5A 1FU7A 5K0LA 1S3FA 2BTQB 2GZ3A 4DM4A 5I7SA 1JQ5A 5J4HA 1PK8A 1ZO8A 1WZCA 1XCBA 2QG9A 4TT3D 1OV6A 2EG5A 3C6KA 3ILXA 4HTAA 5FYDA 4DQVA 1DZ3A 4H08A 4XASA 3T61A 2B94A 1RPTA 3OQHA 3DKIA 3N59A 1ULHA 4LE0A 3K6JA 1SK9A 3OEED 4P32A 3SVLA 2ZQYA 5IJAA 4EENA 2O2HA 1QQ7A 3NRJA 3RU9A 4KK4A 4OLBA 1F1BA 1KIAA 4FMCF 1WOMA 2EXXA 3UK7A 3VI3B 1Z33A 3K0SA 3OIYA 1T9GS 2GILA 4XQCA 1QZ3A 3EFHA 4CXMA 2YZKA 1KFCB 2QNIA 1X3LA 1J70A 1U28C 2Z5GA 5SY4A 1ZK4A 2K5UA 1QYIA 2GAAA 5HSGA 1NXOA 1Y3DE 3QIAA 2F8MA 4MPTA 2JRLA 4YR9A 4UBLA 3P1JA 4J7XA 3I72A 4JX8A 4YI3A 3NDBB 5IDVA 1DXOA 3JVVA 3OWXA 4ZWNA 2Q3CA 3MYRA 1XLTC 4LRXA 3IPAA 1UJMA 5CBPA 4LDRA 2ZSAA 3G82C 5FI5A 5JASA 1A97A 3ZJVA 3GG9A 4N6GA 4DQUA 4IVQA 3L6OO 2XA1A 3E4CA 4MQLA 2ORVA 2VNHA 3K71B 1AC5A 1FSFA 1RKVA 2GCEA 1HDOA 3OICA 1KEUA 4L5IA 4RVNA 3WK6A 2WWGA 1OXKB 4YRIA 1EG7A 3BKWA 3VKWA 2GKGA 5EUMA 4ESOA 4R1TA 4GPD1 1CD5A 1NDUA 3CB2A 4ECAA 3UY4A 1Y9JA 2QZJA 3B1YA 2WWYA 2WZCA 3A26A 4HGYA 3Q7EA 3IEKA 2QNRA 4D6YA 1YF3A 2VPYA 3K0AA 3PNPA 4EL5A 3TMYA 2FUNB 4UAJA 5K3EA 1JR2A 2JD0A 1X9IA 1W4BA 2GGSA 4HS9A 3V4SA 3VTZA 4HDCA 3RIXA 2FZ5A 2KSQA 3JD1A 4IO0A 1BO6A 4PPYA 4X1YA 3RIHA 1YC2A 4PRYA 1BVYF 3KZXA 3AEQB 3EMKA 1RJ9A 4LRUA 4WOKA 1U7OA 3UIEA 3KQWA 1E6WA 1FDTA 4JXKA 1K1EA 4I50B 3BGOS 3L0ZA 3BTVA 4M8LA 1VJ5A 4EPVA 1ZOLA 2ECOA 4NKRA 3K05A 2ETXA 4JBNA 2COUA 3H7IA 3B89A 5ADWA 2YCLA 3L82B 5EUQB 2POQX 2VRCD 4HPJB 2R47A 4B2LA 4BNLA 3P2JA 3G0CA 4ND4A 5LCXA 4PIMA 1ODJA 2CVOA 1TF5A 4Q5IA 3B6MA 2J1LA 1EFDN 2REBA 2FFQA 3ETCA 1Z82A 3DPIA 5BSKA 1CUBA 1DWOA 1XRRA 4Z0NA 5EIXA 4IMRA 3TLCA 4KQKA 4ER5A 3SS8A 1KYZA 5EGNA 1Q1NA 3C3PA 3L9WA 1PJ4A 1NMSA 4MW7A 2X5JO 1JHZA 1FXWA 1KR5A 4PC3A 5IEJA 1NNI1 3HL0A 3I09A 4RGBA 1BA2A 1QZTA 3TL3A 4YPVA 1GUZA 4X1KA 2PQ2A 3OT5A 3Q10A 2WI8A 2FN9A 5K3CA 1LVUA 4F9TA 1E77A 2Z58A 4C22A 4NCBA 2WOJA 4PE5B 3HLTA 3TOZA 1D4OA 5F3RA 4ZVVA 1R6AA 4IJ5A 1ESCA 1A5TA 1KY3A 3BRCA 2VZ0A 4F12A 1ND6A 3M8KA 2R48A 2AE2A 2EW1A 1KKUA 1AKYA 1A76A 1RZVA 5DASA 5C52B 4CG0A 3EOBI 1T5HX 5BNTA 3SSNA 5C1IA 5FUYA 2BFWA 2E7ZA 1Q0UA 1DI0A 2Q3FA 4MB0A 3VMMA 5JEEA 4RULA 3D2LA 4RK1A 2N3ZA 1ACMA 1BS2A 1GZ5A 1PNQA 2IUTA 3A3YA 1Y4ZA 4FNAA 3L8GA 1C9JA 3NAMA 2CNWD 3K1AB 3EY9A 1S3IA 4KIFA 4YUAA 4K6GA 2XF8A 1Y1RA 5CLLA 4F3CA 1TTQB 3HO1A 4U9HS 3NWEA 4JA0A 2X5XA 4EHDA 4TYWA 2P3OA 2D8MA 2O0LA 3LM8A 3PICA 4X1IA 2XUGA 5DN9A 5BQFA 3RF6A 5LQUA 2JPDA 3CSSA 3OQ1A 2AW3A 2VHXA 5A9SB 1P18A 1OXUA 1DXYA 4CKZA 1OBVA 1G3RA 2EHDA 4Y7DA 4YAFA 2H8GA 2WT9A 4MYUA 1L4KA 3TBHA 4DWJA 2AFIA 3QWAA 3ZCUA 1GSHA 3WVNA 5BW4A 1YUBA 3SX0A 4H7JA 5CJJA 4MKRA 3A04A 5DBEX 3ZJ5A 1XDBA 2OFFA 1XZMA 2V4UA 3GNQA 5EKTA 4D4JA 1K06A 3IPLA 3R7SA 2F1OA 4CF6A 3TW6A 1ZHOA 4JBYA 4XH9B 3U26A 1AB5A 2WU1A 3RCBA 3VC1A 3OZEA 2H1SA 2QRZA 2CVQA 1I2ZA 2ZVJA 2HRQA 3R3VA 2QP4A 3ILHA 4M36A 1YJ8A 4BHTA 2YRFA 3TQOA 4GC5A 4FMDB 4X6UA 1N5MA 4PSKA 4K86A 3KPYA 4HH1A 4RXTA 1M72A 3LSYA 2BKUA 5G1OA 3T4XA 4RF2A 2JH8A 1L4UA 3MJTA 3QELA 4E1AA 3A3OA 1Q83A 1YAJA 3SYMA 4LYFA 3RBVA 2HBZA 4FCCA 4OGKA 4AAYA 2P6OA 5HTKA 1MORA 4N0DA 1A7UA 1PWZA 2HJGA 2B7LA 2KBEA 1COWD 2DYKA 3VXKA 2J9GA 2LGJA 5AJHA 4WH0A 5HDQA 2QSZA 1SJ9A 4COOA 1XP8A 2CW5A 5H4HA 4EEKA 5INTA 1KDZA 4HNSA 1P7YA 4BFSA 3SU8A 3V48A 1AS3A 2I4RA 4P84A 4YFYA 2CLOB 1JIUA 3BUSA 3JS5A 4UEKA 2QLBA 1TZ2A 3SICE 3D2BA 3VYWA 3IALA 3S2UA 3QX3A 2XTNA 2A5FA 4LC0A 1CUZA 2JIZD 4QGBA 3CEHA 3TFQA 1N32B 4B2YA 3QVGA 1Q74A 2NW6A 4YP9A 5ILOA 2ONKA 2B0JA 4RTSA 3KUDA 2P6MA 1QRTA 4YJ3A 4C87A 1VYUA 2FV8A 1JIXA 5ESWA 1XXHA 1DS6A 4QXQA 4DS3A 4E22A 2VK2A 3R5KA 4RZUA 3O92A 5TDHA 3UJNA 3D59A 3GT3A 3DT8A 1QG2A 3KKKA 3UJBA 4B6RA 1AMNA 1Y82A 2V98A 5IAGA 3VR4A 1GAXA 1H2HA 1DXHA 4CM8A 2JW5A 4KCGA 2GZHA 2O6HA 4N0MA 3R77A 4P3NA 3A6ZA 3QI2A 1QHYA 2X3UA 3FDIA 1JDTA 1NKTA 2C5FA 3LRTA 4FLMA 2ROQA 4JQYA 3SSAA 1SVSA 2HV8A 3QPDA 2XCIA 3T94A 5AW2A 1AQJA 3M6UA 3NAQA 3NV7A 1CTQA 4IJVA 4BVEA 5B3JC 3U4QB 4HB4A 2R751 2ZBQA 3ZIAD 3AZOA 4DTIA 1KHTA 1K97A 3S2ZA 4XVQA 1WXWA 2H1FA 1GYRA 3BGIA 3E6AA 3GFPA 3GFSA 5K0FA 4N7MA 4DLBA 2PUFA 5JAZA 2QQ0A 3N2EA 1F06A 4LIPD 1JDBB 1YU9A 4O3MA 2NYUA 4IKPA 1A8PA 3NO4A 4OMDA 4UBNA 5AKXA 3S40A 4KO3S 4R0MA 1LNSA 2CCKA 2C3MA 1YD7A 3EVFA 3L7KA 3ILSA 2Q62A 2Y27A 4R9VA 1YJCA 2BMEA 3EK2A 4JI6B 4MB2A 3BRWA 5IVDA 3PNYA 4CI9A 5BSFA 3V8MA 1Z5WA 2CXQA 1OMOA 1ONNA 2HO4A 1PR0A 4PSAA 3GOQA 4UXJA 1T4DA 5AXCA 3SG0A 5IDWA 4YY3B 2B8EA 1E9EA 4H16A 1I7QB 2QOEA 4ZDWA 1VGQA 4CMHA 2IHVA 4MQFB 5DHUA 3V2UA 5JR3A 2VYNA 4XR4A 1QIFA 3FI0A 1C3OB 1D8AA 5IH7A 2N1BA 4PN3A 2PGNA 2IHNA 2VPXA 4JMLA 4ZOEA 1JEDA 4K6KA 4KACA 1P19A 1P7VA 4MQBA 3M3PA 5BR8B 1EQUA 3O3CA 2VRWA 4JP8A 3ZDRA 1CDDA 2A1UA 4RENA 2BKXA 1E2NA 2WOOA 2XTMA 3FI9A 3WYFA 1H2ZA 4BBZA 1JIVA 4RJTA 3FUCA 1KJNA 4C04A 4P22A 2PLFA 3OF3A 2HCRA 4RDHA 3RS0A 2PS9A 1OLOA 2YIVX 4K1LA 6PFKA 2HX1A 2IYPA 2AFRA 2WIKA 1S2MA 4O25A 4WFJA 2MCFA 2BHLA 3CVWA 4C5BA 3QKRB 4JSYA 4ND3A 1NPYA 2EJUA 2EKLA 2JFYA 2KX7A 1R5JA 4IQ4A 4QQRA 4S35A 3W8FA 3RUDA 3TECE 1YTUA 5CLIA 3U9LA 2O6LA 4K1XA 1TUBB 4TYNA 4B73A 2CYCA 4QO8A 3HUUA 4F86A 2XB4A 3CG4A 5JSYA 4F6RA 2JBWA 5C80A 5BN4B 4JYPA 3CJTA 4QRIA 2PXXA 5K6RA 3CZ9A 2IYAA 1SFRA 3D5QA 2JD2A 3GEPA 3IIJA 3DV2A 2AQ8A 5TQ0B 2J6IA 1DTWA 1XTUA 3QFRA 4TVKA 3WMRA 3ID6C 3Q9LA 5T4FA 1M73E 2B1RA 4I9FA 3AHIA 3OJCA 4OMUA 5CFQA 5KQRA 4FFBA 5L3RA 4L7VA 4QGFA 1IY8A 3T9BA 4ZK6A 3LF1A 4C4XA 3ZQ6A 3VR5A 4QA9A 3IAAA 1KWKA 2IW1A 4TYMA 4IJUA 3T3IA 5EXPA 3SLGA 2O7RA 2ZI5A 3H6HA 1OB2A 2JIOA 2HUPA 2O4UX 1L1RA 2B35A 5KVSA 1SU7A 5EJAA 3KKQA 4JLBA 1JAHA 2ZI9A 4OLAA 3OI7A 2UZ0A 2Q99A 3WQQA 3RTEA 4C5AA 2AYZA 2FHPA 4B5LA 3PGMA 4ZT7A 2PX3A 4FHGA 4E5VA 3DH0A 3RBAA 2BBWA 3I9LA 1TZCA 4J0CA 2QM7A 3VH1A 1HMYA 1MZPA 1GL3A 2JGDB 3DTNA 3MMPA 5AVRA 1DJMA 1RAIA 5G0SA 1JECA 2IELA 4M9RA 5IDYA 3V9PA 3CNBA 1HYGA 3C87A 4PX3A 2WSSD 1E1NA 3IEIA 1V48A 3N2KA 2WWIA 2R6GA 1Z2PX 1QR2A 2XKJE 3FWHA 3JXEA 2WZBA 3N6XA 2V6GA 4M0FA 2YQZA 4QPNA 2DQZA 2OQVA 3TFWA 4DGQA 1JWLA 1TK9A 3M0EA 4D9HA 3KWMA 4RK5A 2JGNA 2YQ5A 2AN5A 2MINB 3GGPA 1J0BA 2CFSA 2UZ4A 3BT7A 4QHSA 1KVSA 3HA2A 3T3GA 2CB9A 5M7EA 1KZ1A 4CDRA 2QE7D 4BFZA 4OFWA 4EELA 2DWCA 3HJFA 1J06A 2RG1A 2ZRQA 4Y9SA 3WDSA 3EXAA 3PNOA 1ZMTA 5K2MA 1G6Q1 2MSDB 2HM7A 2QTRA 5FFMA 3UTCA 3PRHA 2QDXA 4UEQA 3C3CA 5LXTB 3A9SA 3BK1A 4MWOA 1Y8ZA 1PJZA 2Z6AA 1PS0A 4JJ4A 1SHUX 5FXMA 4IMPA 1D0IA 1SUDA 3GFGA 1N6IA 3G1UA 2O5EA 1Z68A 1WU7A 4KODA 1G21B 1JQ3A 1EVIA 1G1AA 1QMGA 2AMJA 4LISA 1J5PA 1W4ZA 3VAZA 5CNJA 4BMSA 4OUDA 4DMHA 5EFOA 1FLVA 2HMUA 2SKCA 1QRDA 3BIXA 4I1OA 3L07A 3PSAA 1KMQA 5CA1F 1GG9A 1PGQA 2FW6A 5EZQA 5CB4B 2CCJA 4KE9A 3C6ZA 3LZDA 3Q9UA 5IS2A 3NVKI 3HKDA 4DAEA 1Z4LA 2GBCA 2ODNA 1AIPA 3TW4A 3H84A 3ZD8A 4KRFA 4RD0A 1CZRA 4HGOA 2BP7B 4U2GA 4M4SA 5BW5A 1FQOA 3THYB 4QFMA 3NHYA 2J07A 1XPJA 2XEDA 3SY8A 1KQPA 4ZCLA 3KOOA 2GSDA 4PQGA 1GCAA 1X1EA 1DAGA 1ZY2A 4FE3A 1BMQA 4IFEA 3PD0A 4O08A 4B0PA 1EZZA 1GRCA 1U04A 2HXYA 1FU8A 4HLDA 6ABPA 2JGAA 4PC2A 2OZLA 2AF4C 2JI4A 2OCBA 5BQ5A 1UBEA 2QP3A 4QSHA 1GZDA 2NYRA 2DM6A 4XUCA 3DEAA 1WE2A 4JOQA 2VRBA 1G63A 2RONA 3LPNA 2CDAA 4LMPA 2ZIXA 4BYGA 5DNEA 1ZSYA 5E6SA 4DYDA 3I1IA 2IS6A 1EFVB 2XVXA 3G5TA 2WWVD 4NOMA 2QRHA 4BPRA 2ZT7A 2NPOA 2Z09A 1GPLA 2ONYA 2JFWA 1IMOA 4HMOA 4I4TB 1G59A 4RVSA 1JTVA 1UT8A 4KQMA 5J5VA 1FFWA 1CV2A 1ZUNB 1PQUA 3R41A 1NXPA 3NOVA 4LI3X 2OBFA 3OZXA 2FDCA 5ELXA 2D0OB 2X22A 3G2LA 3FVTA 4JWKA 3ZDYB 1Z4MA 1P7ZA 4LZNA 4IQGA 1ZK1A 2ZI3A 3HU2A 4MUEA 5KQPA 1V25A 1NATA 4WA8A 3KZOA 2JLCA 3UPUA 3DD5A 3E2MA 3FBWA 2UYCA 1AM4D 4G8CA 4EHJA 1VL2A 3L4JA 2O05A 1OFUA 1O97C 3EUWA 4LJ7A 2X76A 3GIDA 4H1VA 4Q01A 1W0CA 3WFIA 3L6BA 2I4LA 2VS1A 4HC4A 1FVXA 1DNPA 5KTNA 1E3EA 1W36C 1V8OA 4RMIA 2UXDB 2AZ4A 3EA5A 3G1WA 4FOLA 2Y1CA 3MCZA 2BZ0A 1R27A 1VKZA 3EIWA 5CVEA 4JT2A 1YASA 4M0KA 1P5JA 1IOVA 1SHJA 1E7QA 1H2RS 2YXEA 4K9RA 2FEXA 4LJ5A 4E5SA 1M67A 1CEXA 1L7MA 3MIZA 4PANA 2HU2A 2QZPA 3UTDA 2QRPA 4LC1A 3OC0A 5CB0A 1IIRA 3A9RA 2GM4A 4ECEA 4C9BA 1I1HA 1ZZEA 2QJFA 2VC2B 2X77A 4HDKB 3OZSA 3V80A 3P9ZA 1Z22A 3B6IA 3B82A 3Q6NA 4J8PA 3VPHA 2F64A 3T1HB 3JQ8B 4FW9A 1ADFA 4ZI7B 4LNUA 3PEYA 1UMBA 4UREA 4HZUA 1RZRD 2NTJA 5CT4A 3DFFA 3W3AH 3PTLA 2G82A 1NZFA 3IVCA 1S7GA 3ZHZA 3ZJTA 5TQ2B 2O9JA 1PEAA 3M6IA 5FL7A 3W6OA 2V74B 4TRRA 2IC5A 2ICAA 2NVUA 2ZITA 4NG4A 2BYTA 3RAGA 1X1SA 3CLTD 4HGRA 2A5DA 4JAVC 1VBMA 4XLZA 4REMA 2FPKA 3ZX4A 2JJ2A 1ZZGA 3FUXA 1CC1S 1QWSA 2YR0A 4OP3A 3IP6A 5FULA 1SD1A 4BE9A 2G0AA 4HEQA 5DYTA 4B32A 4ZFNA 1YCDA 2BTQA 4IUBS 4MLDA 1YUNA 4TV9F 3HDQA 1GU1A 2O8DB 1RKBA 3CKYA 2D2XA 4QXMA 2OBYA 1IN7A 1C3XA 1E94E 3PJFA 2A0WA 3VC2A 4G23A 3V8EA 3HWSA 4FI3C 5COBA 4YQEA 5EJ8A 1QG0A 1WUYA 4Q0MA 1EI9A 1L9KA 2Z2JA 1RKUA 1RRFA 1Y8CA 1YIAA 1XPOA 4QUKA 2VT2A 3EIEA 2FPSA 5G4LA 2FQYA 2J9FB 3JPYA 4HD8A 3K4HA 3RGWS 1KJZA 1GQOA 3TINA 5LMUB 5AUPB 4CIXA 2FW1A 4RMNA 1ZI9A 2QEQA 4N6NA 3ND9A 2QV7A 2HLDA 2ZJ1A 4PLVA 4ABYA 1BEZA 2VTVA 3HBAA 5E9WA 1PX0A 4DLXA 3TI7A 3NT2A 3RUAA 5JYEA 4BS9A 4QJ3A 2C4WA 1WMDA 5KZMB 2CUTA 3VDRA 5CA0F 3ESQA 2O54A 2WE7A 5IC5A 5EE5B 2BM8A 1UBMS 2QNBA 3R6TA 2IPLA 3NALA 4ZEOA 5AKJA 1BNCA 3CPEA 5THKA 5KDDA 1EDOA 2X6TA 4ZOAA 2I2DA 2C4TA 1CEQA 4WKNA 1W0JA 2XCUA 3C3DA 3JWGA 3K32A 4KWEA 5HFNA 1SKAA 3F4LA 1XU4A 3ZXXA 1JFLA 1AQLA 1SOWA 1XRMA 2VWPA 5ALDA 3Q12A 3W8EA 2IU3A 1MX1A 3L8HA 4US1R 4QHTA 4E4YA 4Q16A 3BRQA 5NLLA 3TQSA 3PJGA 4KIJA 3ZS8A 5CXUA 1VDZA 1WABA 5KNBH 1PP4A 1VL8A 2DAPA 4JASB 3UWOA 3S8YA 4FNOA 1JU3A 4HYEA 3QEKA 1X1TA 4G5OA 4XQEA 1QO7A 5D6NA 5CHYA 1NKSA 2G80A 2ZSUA 5B1DA 3EQ9A 1A9QA 3T06B 3KEOA 1O5TA 1LQUA 4KR2A 2B8WA 1YQTA 5EERA 3ZOZA 1AX9A 1HOTA 2ZTLA 3SOPA 3IE0A 3E9QA 3FGZA 4HAWA 1SGWA 3MFQA 5HUHA 5JMPA 2AFIE 5JH7B 2A3NA 2YXLA 1FNDA 3AF2A 1U8CB 5DTIA 3WRVA 1ISPA 2IUYA 1JT9A 5L3QB 3CRVA 5EMKA 3RHZA 2PLWA 3GDWA 3W5CA 4RANA 3IDOA 2YVLA 3FKQA 4RPGA 3TSCA 2GJ8A 4NOKA 3NP7A 5FDFA 4S1PA 2ZUUA 3AEKB 1G3MA 1H2BA 2AV6A 1ZJ6A 2PKWA 3OKAA 1YZHA 3JR3A 4OMCA 4PSCA 5KKAA 2DR2A 1XNHA 1AZSC 3IEUA 5JCZA 4FR5A 3G7UA 4RE6A 5DMHA 1Y7IA 3RQSA 1T3GA 5C8XA 4DA0A 2IYWA 5KJFA 1SEPA 4UCFA 3W5BA 2V7GA 1X8KA 1M6VA 3KVYA 4JN6B 2IH2A 4QWMA 2G17A 1XI2A 3D8TA 3GP3A 4RXUA 5J59A 1PR1A 1ZUWA 1NJ8A 5D1NA 4P4LA 1RAAA 3CF4G 2W6PA 3MTIA 2G07A 1R37A 2O2XA 3BGVA 3I8SA 4LDQA 1KJQA 3OX1A 4I1VA 2DH5A 5DLQC 3V4RA 3K9WA 3NAZA 4G5QA 1E3JA 1EUQA 1P2TA 1Q17A 2X41A 2QPLA 3QM1A 4BPBA 5GZ3A 5LA6F 1SG9A 3L84A 1D9XA 2BR4A 1JJVA 1DX9A 3IKJA 3H4TA 1HEIA 4EGSA 1NXSA 1UXIA 3MK31 4HR7A 4C0JA 3B52X 1RCUA 1NF3A 2DHDA 2AYXA 2COKA 1E4VA 3DBLB 3KHKA 1V7CA 4P6VF 3V4VB 4D96A 2EFHB 4MP3A 4TKMA 4KJZA 4WKCA 3FUWA 5HVNA 1L4HA 1SHKA 1U8XX 1UKZA 3FJOA 3BSYA 2EWVA 4W1PA 5BV1A 5LOVF 2IXBA 4PHTA 3DZGA 3F7MA 3SSMA 2C20A 2D8AA 3K1AA 4H3VA 4HJXA 4M53A 3AHGA 4KN6A 4ZKDA 4GX1A 4ITVA 4KXWA 1QRSA 2PUGA 3CSDA 1I1NA 3I1YA 2QX6A 5LU8A 1DAMA 3UGJA 1ESNA 3R5XA 2GHIA 2H4JA 1HLFA 2F8LA 4MCJA 3SE7A 3DA8A 3O8RA 1X7XA 4DLSA 5K20A 2XUFA 1WXIA 2DWPA 3DZFA 4MYDA 2Z3ZA 3HKEB 5TMPA 4L5AA 5A9SA 1M2HA 3B1WA 1V37A 4HAVA 1G3QA 2C84A 2GAIA 3Q3HA 4HFNA 2HRZA 3L7DA 4MRAA 2NXWA 3VSBA 3KJFA 3ABRB 1P2VA 1F1JA 4P3KA 4S05A 2G9ZA 1B43A 4K2AA 4EIWA 2D54A 5KYXB 4EHFA 5FL3A 1JB1A 4DM3A 1H23A 1HWYA 3O93A 1IUOA 2GZMA 4OJMX 1I3OA 1U9JA 4FXPA 4IX1A 1JEQA 4TTQA 1NX6A 4WACA 1VG8A 4YC7A 3ZBQA 1KTIA 1W85B 4N01A 2QBYA 4UQOA 3P0IA 3I37X 2HXGA 1HDGO 4HL6A 3GEEA 1JQLB 3PWTA 3N0TA 4IYRA 5AHRA 4EATA 5A4IS 3ZV5A 4U2EA 3QLVA 4ZDKA 1JAXA 4GSYA 4OLFA 1A3CA 1X19A 2KHZA 2Z4TA 2O0MA 5GONA 3NYRA 3DWEX 2YXBA 3HS3A 4ML3A 3VPCA 2G0TA 4PCAA 4F56A 4A3SA 5FV4A 2OSBA 3NBXX 3HGMA 2IS4A 1DFHA 1XQWA 4PZPA 5JV5A 3EDOA 4YIHA 3DTVD 5LUAA 3N8NA 1CERA 4RAOA 5ELLA 2VHEA 4Q7KA 4ESVA 4JHXA 3EEYA 2JK0A 5ECWA 3RU2A 4TN1A 1GQSA 3LFUA 5LQCA 4ANFA 1YGYA 4UOZA 1RI1A 5GQSA 2DH6A 1TUIA 1JXAA 4M1KA 5DNYB 5D1HA 5BV2P 3BB3A 3GGJA 4EG7A 4AZVA 4E5DA 1E3DA 2DWQA 4A8JC 3TGPA 4RGYA 4K6HA 4TKUB 1N34B 1P1KA 3CM0A 3ILYA 4X60A 4JC5A 3NEJA 4DZZA 5JC8A 2DQ4A 3K9LA 1HDIA 1DMSA 4J0IA 3W78A 2X0NA 3CO5A 3T0IA 5FI3A 1HTWA 4DJ5X 2FK8A 5KS2A 1NF2A 1E2JA 2EGGA 4P4NA 1YL7A 5FV7A 2BSXA 1CK4A 4KLCA 4BN5A 2VA9A 5H3CA 1ZN8A 2PSFA 4YB8A 1GPJA 5LQDA 2C83A 1WVMA 5EL0A 1W44A 4MDYA 3K0EA 1HE1C 1BOOA 1EFUA 1RQXA 3DL7A 3AVOA 3ND6A 1NUQA 3GHHA 4MW9A 1RCTE 3WICA 1OAOC 2JIBA 2NAPA 3ADCA 3Q8KA 4MJXA 4HH0A 4ALMA 4EVSA 1YB2A 1RPAA 3TRJA 3MWKA 3VTFA 5AM1A 2BGUA 1BOFA 3ISJA 3WLRA 4R9UC 3WB2A 2J7PD 1NG9A 3F71A 4M9UA 4AROA 5C46F 3AI7A 3I28A 2CSXA 5DYWA 1DWPA 4GSLA 1V4BA 1S5PA 4PC7A 4FDAA 2RFLA 4HB0A 2YXNA 3D4BA 4G1EB 4I66A 4KX3A 2WTMA 4LHYA 5JQGA 1P2BA 1QHSA 2XT9A 4WOPA 2WQ6A 4PM4A 5CX4A 1OYOA 2HRCA 3FPGA 5BWOA 1BVUA 1DCMA 3FTCA 3LNTA 4PWZA 3ZQ4A 1D5CA 1YU6A 1M10A 3CRRA 5B1HA 2A33A 1IUKA 2XVYA 1MO4A 4IIJF 4IOMA 5AOCA 3W2EA 1V7QA 1XDGA 1QU2A 1YHZA 2LD4A 3H11B 1T3HA 1LB1B 3A6HA 1PUJA 2FZGA 4MW6A 4PX2A 1F0NA 4S2UA 4X5OA 5IG2A 3L0CA 3V4ZA 3E35A 1F2UA 5KU1A 1N5RA 3WGVA 5ICFA 3UZUA 3SJUA 4DLWA 1C9NA 1L8AA 3KDPA 2A2ZA 2XGMA 3EH2A 2QD2A 3PVSA 4YV2A 3FUUA 5IVKA 3N2LA 3UAGA 1M7BA 1J25A 1GGNA 2P41A 3VSAA 1JA9A 4MIKA 3ZZMA 1W1IA 3CUTA 4V0QA 3SX4A 3W5SA 4MQFA 3E1GA 1X8JA 2XYVA 4J7UA 4QPCA 5B1YA 4R1SA 3S5JA 5L8VA 2FZLA 1I2CA 3N7UA 5IJZA 1REQB 4EBFA 1V9SA 3EXG2 1DQPA 3LO5A 3UAVA 1RYFA 3ZE7A 4CMKA 1IQPA 1TKCA 2DCUA 4OAPA 1WY5A 3WLHA 2QVZX 3VR3D 2FH5B 3SEAA 2EJCA 3N6VA 3HUDA 4OXNA 1D2AA 3HEAA 4DLRA 2G8LA 1YFZA 2D62A 2XUQA 1EX6A 4AECA 2I3ZA 2DTEA 3BJRA 4JLSA 3RANA 1AVTA 4IR7A 4R2XA 4N8SA 4WEOA 3QKRA 4EPWA 3P27A 2JZCA 2C82A 4PG7A 5BT9A 4J29A 5LM3A 3U7GA 3NTQA 2OB1A 4JLVA 1ODTC 5ENDA 1CY2A 5BV7A 4AZ3A 3CWQA 1XMXA 4EEZA 5ITVA 2G5TA 1EK0A 1KETA 3GELA 5A9TA 3SS9X 4GVLA 1XB2A 3DE2X 1L4BA 2QTZA 4A6PA 1C3VA 2V6IA 5EAIA 3UF0A 5ER6A 4RPCA 4W6ZA 1F9AA 2LCQA 5JMWA 4RLQA 4M98A 1ZCZA 4X66B 4LOHA 2P7HA 5AJZA 4C20A 2OV2A 3WG9A 4Z4HA 4LVOA 2AFHE 2D4AA 2AQIA 2GPYA 3FOCA 4OQXA 2UXCB 4GKJB 2KPOA 4PXYA 1L5NA 1CY1A 1BMFD 2ZBPA 4I8XA 1TU3A 4MDFA 1W8DA 2I6UA 1V41E 1S4QA 4QVKA 3R7WB 3A9UA 3CLVA 5C4IA 1IVYA 1LPBB 1HH4A 1ZEJA 2YHIB 1QCDA 1EUDB 2X8AA 4N48A 5JZMA 4POAA 1BW9B 1VG9B 1Q3HA 1QYDA 2HDNB 2XODA 1O08A 3CXUA 1J8FA 3C2QA 3N5KA 4UZFA 4ZJUA 5JBNA 1B6RA 4YPFA 3TZQA 2R8EA 2YTZA 3T3OA 3DZHA 1RSZA 4TTVA 2JGDA 2DFPA 1G5HA 4XGNA 5ICCA 3AEZA 1QFYA 5B53A 5KVAA 1F4VA 3IBYA 3P0JA 1I2BA 1E6MA 1P4AA 1JRLA 4Y6GB 1B3BA 1QH8A 3TLKA 3TLAA 3F6RA 4NZNA 1Q19A 1T2AA 3LDUA 3R20A 1V47A 2JLYA 3L1JA 2O2EA 1EPUA 4WCFB 3B7WA 4DBLC 4KR0A 1KFKB 1P81A 3TRFA 4HT3B 2ORYA 2YFYA 3T1QA 3SVTA 2MINA 2J48A 4JOSA 4R9RA 1ETHA 4DMCA 4EEXA 2P3SA 4E7OA 4UPDA 4EAQA 1NUAA 3KDSE 4B75A 3N05A 2VCHA 1R0SA 3PHLA 4YI5A 4AFNA 5KYUA 2EEPA 2XKKA 3UHAA 3PQDA 3RRYA 5JCXA 3LCRA 4BLUA 4CF7A 3VGJA 1A50B 3IGFA 5E2AA 2GF2A 4ZANA 1W0KA 1YRQA 3OZFA 4R2WA 1NRWA 1Z0UA 1AKWA 3RWMB 5JOQA 5JPDA 4KQFA 2OWEA 3WR5A 3PVZA 4HLUC 1OWMA 3MHTA 3TNLA 1G9TA 1KEWA 2PT7A 3M6VA 4L50A 1CNEA 3MIIA 2BISA 2JLVA 2AVNA 5BPHA 3O8LA 4Z4IA 3ZNQA 4HNUA 3HUEA 1P3Y1 2ZT8A 3WRWA 2H92A 3IAHA 4W9MC 2QG4A 5H1YA 2OXRA 5FOXA 2I62A 2XHZA 4RJLA 3TFOA 2P6NA 1I5OA 1QB8A 1YBAA 5EFZA 1JKJB 4TYYA 3NXSA 2YN2A 2PZLA 1FJ2A 2Z95A 1ZN7A 2GTPA 1I4LD 3JASB 4ND1A 4BO4A 2BP7A 2I4NA 1TIPA 2FF5A 3OFJA 3THYA 1R16A 1C1HA 3W9BA 3FLAA 2UV8A 3ZUPA 3BMOA 2ZATA 4ZOQI 2YMLA 1T9BA 4QPDA 3WOHA 4XVCA 4D4IA 3U4GA 3WMXA 2JHGA 5C8ZA 3L93A 3PL1A 1I2DA 1PVDA 2R96A 2JJ1D 1O87A 2ZU6A 4GYJA 4UUPA 1RIIA 4AJJA 4YPOA 5DNUA 4R81A 5HE8A 3LUAA 2AUMA 4M9XA 4LXQA 3EUEA 4BNHA 2P2NA 3AYXB 1HZJA 1XKQA 2WEKA 1QOZA 1ZK0A 3RS7A 1AKVA 3W5UA 3PUHA 1MC4A 3I1JA 1EFVA 3KZMA 4FHDA 4YECA 4L22A 4O4IF 2C7OA 3BQNB 4ND5A 4I4TA 4JJKA 3TDMA 3AIIA 3O2SB 1IZ0A 5IHPA 1PG2A 2CB0A 2EV9A 1JWBB 5IT9A 1R0KA 1E63A 1ZUNA 4JEIA 4Q12A 2MT9A 4NK5A 3ND7A 2PD6A 4NONA 3ZV7A 2IY8A 3GEBA 1XD2B 3PZRA 1A1SA 1MDFA 2C3YA 3GN1A 3PPYA 4EY5A 3EVZA 4HGZA 4DIBA 1MRNA 2OESA 4ENSA 1H6DA 2ATEA 3V1LA 3W3ZB 3KEQA 1CLEA 2DFNA 4WBNF 3REOA 2BLNA 3AUKA 1BC5A 5FI0B 3EFBA 4GMFA 1VI5A 1Y37A 1YS4A 2W58A 5U1PA 4GBGA 4TUYF 2WIGA 1UH5A 5D3MB 1X7ZA 3TGLA 3MGGA 1H1TA 3DOUA 4HAZA 1GCIA 1TJ3A 5G53C 1FDVA 4PG4A 4JJGA 5AM4A 3ENNA 3KNZA 4C7MA 1ZRSA 4WXYB 2O5RA 5B30A 4OL0A 3ADOA 4LSZA 4AU1A 2GK6A 3QNUA 4P0TA 4ZQHA 1BZYA 3R5HA 3BB4A 4I2NA 1EVQA 5DWVA 3UH0A 4EZBA 4Q19A 2OC9A 1M1ZA 2YN4A 5I7AA 4D9JA 4Y1FA 2R6CA 5A1JA 4CN9A 2JBAB 3WIBA 2WC1A 3FVWA 3KSRA 4MI3A 2HHHB 4FQ8A 1PJ2A 1M2KA 1RLIA 2C2BA 4G8BA 1JVBA 4IUYA 1R15A 3ZWNA 3P4YA 3WIDA 3ESYA 5U4XA 5A4AA 3WS7A 3JYLA 4EZEA 5A6VA 4TRNA 1H4VB 3JQ8A 1UL1X 1L3IA 3HHPA 4GQBA 4Q02A 4ZI7A 1UBTS 3HKCB 1ZHFA 2YFKA 2WHRA 4UD2A 5CIQA 4ZHQB 2O5CA 1JDBC 1L4EA 4MRVA 2QR3A 2HADA 3DZDA 1GZHB 5TQ2A 2C5LA 4Y1GA 5HEKA 3F73A 2WAYA 3LC1O 4DUZB 3OX4A 5WRFA 2A78A 5JCOA 4D56A 1LPOA 2IK8A 1J8DA 1JN0A 3KV1A 3WDLA 4H6XA 3I04M 2I2BA 1U4OA 1OX4B 1J07A 3EIXA 2Q5OA 1MO5A 5EWMB 2KYRA 3CZRA 3OZUA 4D81A 4EKNB 4YRNA 1IAVA 1ZYUA 4G5RA 5AVKA 2O8DA 1XAIA 4J49A 2EHJA 5B3AA 1LLFA 1B00A 1VI2A 3HUTA 2C2HA 2LWIA 4QDZA 4F1JA 3LUBA 4BO3A 5J58A 3Q0TA 2ZE7A 1MENA 5JYDA 2XHEA 1ISFA 3LPAA 2J9FA 3RIEA 2IH5A 4HQNA 5DHPA 4BFCA 4B3IA 3D54D 4CV1A 1XK6A 2GYUA 2OGTA 3AF1A 3NWPA 5MFZA 1Z12A 2IEAA 2QORA 1DKLA 2ZAOA 2ZT6A 2PKRA 1RBYA 3KR9A 4LRSB 1Q44A 2J0QA 4HDAA 4BO9A 2WF7A 3PENA 4DBLE 2W71A 2KE5A 3CLTC 1JKMA 1IB6A 2VK4A 4D8VA 2QSJA 4WLUA 1XA4A 2IHJA 5EN4A 3SEFA 3EPKA 1ENOA 1G4UR 1NBWB 3HZRA 1M6HA 1YXMA 3BFKA 3AVPA 3CINA 3EBLA 3T7JA 4H3KB 5K0JA 4RPLA 1B76A 2P77A 1V2HE 2PO7A 3GX1A 3LHFA 5C7OO 4AB1A 1O57A 2BHNA 3A6GA 2BFPA 4RD4A 5CYFA 1QSGA 5KNDA 2ZRNA 2EP5A 3BQMB 3BWVA 3GLHB 1RAHA 2OE2A 1NUTA 5I3ZA 5BSGA 1H6CA 1BYUA 2ZRBA 3RC2A 4Y2JA 4NYMQ 3V4LA 1E6EA 5KOJB 3UKDA 4JBLA 1ISHA 1BQ4A 5ANRB 4ADSG 3QBVA 1GRVA 1GRNA 1GUYA 2R79A 3KJHA 1A9XB 1BXKA 2QTWB 4MUYA 1YDWA 2OL4A 4GMGA 5EJGA 5BORA 2GBGA 2OQ2A 4KAAA 1LKZA 2NQ2C 2H0QA 4IHQA 4QM7A 3A6KA 2R6R1 4FGLA 3IL2A 1C8BA 4D2IA 4DA9A 3N8HA 3TZHA 4Q7LA 2CHGA 1Z7BA 4R9SA 4OX9B 1QE0A 1QDLB 3GJ6A 1PWXA 4NE2A 3ZCVA 1JHAA 2NO0A 2VQ6A 2I65A 3KG2A 2PL5A 4GI3A 4GP7A 3UATA 4F85A 3A11A 2FPIB 4RQAA 3EPRA 2DPLA 3SLKA 3VNSA 4DR4B 3JRXA 4A82A 4UQPA 3ZLTA 3U4QA 1GFWA 3LCJA 4Y0NA 3KKOA 4Y2HA 1HQCA 1LPAB 1Q7TA 3EGCA 3LT4A 3TLBA 4BVAA 3OKCA 5K0EA 1EGMB 1WB4A 4W7SA 1DQNA 3LPCA 4I19A 5CPFA 5CRIA 1K88A 3VM6A 4FYIA 2C9MA 1DHRA 4BLWA 2FEMA 3CQ9A 5LQRA 3CUUA 1C1DB 5HCUA 3SQOA 1M5TA 3TAHA 5I01A 1NW9B 3L6CA 3ZV4A 2I6XA 1U0OC 4O1MA 5C37A 4X65B 2F3UA 2Q6OA 4YJFB 3WHPA 3AEXA 2RJOA 2ONJA 3W7AA 1DB3A 3N3BC 5EIBC 3PQCA 1QYCA 1B0ZA 3IDQA 5HXAA 3E8MA 1QORA 3NNSA 3O8QB 4C3ZA 3ZK8A 4Y2RA 4MS3B 4ETIA 2OZEA 3PDHA 4R8MA 4NY1A 1BE1A 3QYJA 2RJNA 1O9HA 2Z43A 3L77A 2XQFA 3VBEA 3WL6A 2HR1A 5GZ1A 1N36B 2HA0A 1RXVA 3O0TA 4REQB 3EGXB 3IJ5A 5BWLA 3AJDA 3DBLA 3JRWA 3ENKA 3AEUB 3DCYA 1KL7A 4LJAA 4CM7A 1Z13A 2BEVA 1NRXA 1UJ6A 3IA2A 1T4CB 4OHMA 4YMIA 3SJBA 4FM9A 4N4AA 3ROXA 4ZMSA 3JX9A 5I4BA 3NQ41 3ZHUA 2N42A 2PJRA 1SVIA 1WUIS 3T3EA 1RWWA 3NIDB 2XW6A 2VT3A 2DERA 2PLRA 3PFWO 2H2AA 4GAEA 4RETA 1DUVG 1TC2A 3UWSA 4QQNA 4W8GA 4JXXA 1NVVQ 3DDHA 3OX3A 3N28A 2Z1DA 2BMVA 4QOFA 2MWMA 3SF8B 2RARA 1YIDA 4EARA 3HKEA 2WV7A 2JH9A 3GRPA 2OBBA 2ZYHA 4MWEA 2V55B 1VB3A 2VR1A 4PPNA 5ELMA 5AK5A 3LYHA 5EE0A 5U4QA 4L85A 1IRXA 4CFSA 2CV2A 3KXLA 2L42A 4HCJA 4OA8A 1GTG1 4BASA 3PXBA 2O3QA 5IK2D 5JD5A 2E4AA 3KYBA 5AKEA 3LAWA 4TZKA 5JQWA 2EBFX 2EOAA 5HZKA 4PPFA 2G28A 1H3FA 2VJDA 2ZQZA 1R0CA 5AM3A 4WK4B 3EZ9A 4KGXA 1ZIOA 1KJIA 1VE5A 2IYTA 3KQKA 1QGOA 1RAFA 1W85A 3IIIA 3DMNA 3QXHA 4NENA 2KBFA 1NTOA 4NYIR 1NMYA 5DT2A 2Y68A 2YJ6A 4D25A 1IL0A 1PGJA 2HJRA 4CR7A 1NXWA 2P30A 1CHNA 2VDPB 4YLYA 1XDDA 1KOJA 2CNNA 4RWEA 4F97A 5AVTA 1NVXQ 2FW8A 2JGJA 1EIZA 3EXG1 1CSEE 1ATIA 1NPTO 1AF4A 3Q98A 4NEQA 4EY4A 4DDTA 1Y6FA 3Q0IA 1IYZA 3F3SA 2RGAA 5BQOA 4PLCA 4P0QB 4G65A 1RPJA 1DGQA 4Q7EA 3KJQA 5KCMA 3AINA 1MW9X 5E1BA 2PH5A 3LY8A 3OEHD 1V11A 5ISMA 3FZGA 4BJ3A 3UMCA 5BWNA 4KE8A 1I3KA 2VWHA 3IBCA 3OZ7A 3WA7A 3D8SA 1K6IA 5DW0A 2ETVA 1FQWA 3O8OA 3ZWVA 3IX7A 4RF4A 3KJXA 4S0ZA 1P1RA 1UCFA 4M76B 5J2UB 4X95A 3QVXA 1M8FA 4P81A 1N6KA 1TD1A 2BSAA 4J16A 1A4XA 1EESA 1II0A 2CJYA 5LQAA 3NAGA 4HUTA 3PA6A 1PS9A 3EQ6A 4QBFA 2GYWA 4ZZIA 5JJ5A 1KYQA 1T6BY 2VP9A 4DT1B 2QWXA 1M2EA 3GW8A 2GCOB 5EQTA 4LE2A 1ILEA 1GJRA 2LRHA 1TQ4A 1B16A 2WR8A 4K03A 4EMSA 1N5DA 2QN7A 1ZGBA 2XE7A 1V96A 4NQRA 3UHFA 4DEYA 2Y1GA 3VC3A 1CP2A 1JHOA 1YQWA 4AF8A 1NUHA 1VXRA 2NU6A 3NFRA 1D4AA 3LVBA 3VU9B 5JCOC 2QMEA 1Q1AA 1WF6A 3TF5A 1FJHA 2A57A 1K8XB 2HZBA 5G0UA 2ZS8A 5FWDA 4XGIA 4CM9D 2H1HA 4B4UA 3W8RA 1TQ2A 2C95A 2RK3A 2Y0EA 1KI8A 1PR6A 1XKLA 3GLQA 1XTJA 3BSSA 4I99A 2BT4A 4CQMD 4DQXA 8ABPA 3F4KA 1FFAA 2HT1A 3OM1A 1V1RB 3MW8A 4DL9A 4MA4A 4QDXA 2M9MA 3TSYA 2CHUA 2YV1A 2JLWA 4PSDA 4C4TA 4KOAA 1L8QA 2XTJA 1ZU4A 3EOAI 2A8YA 5I47A 2BTEA 2JCSA 1OI3A 2AEEA 4MYTA 2EBWA 2WM2A 4OHVA 1VE1A 3H11A 3HABA 1PE0A 1MAVA 1SOMA 3NTVA 4GUDA 4M1EA 4UTOA 3WXMA 5B5SA 2GBPA 4YDSA 4MVCA 4NULA 3BGSA 3MQFA 4FYMA 4C21A 2REQB 2ST1A 4MYSA 3K0FB 4OYLA 5JAQA 2VDNB 2WG0A 4ILKA 1CDZA 1B0UA 1L4LA 1KDYA 3RE1A 4URVR 4WLOA 4KO8A 4NJMB 4FYWA 4NYJQ 5A0TA 4Z7OB 3FOWA 1VE6A 4R2IA 3RC3A 2I6SA 4KGVA 1LCIA 1ODSA 5G1NA 5BMVB 3SJAA 2EWMA 3AB3A 1OASA 1VIMA 1YB4A 3DEFA 3F7TA 1K86A 1D8TA 1G7CA 4ROTA 5AJXA 3F5SA 3PJRA 2I8AA 3L05A 2VG8A 2V3VA 2QW8A 1WS6A 4F45A 1FIUA 2X8JA 2WIFA 1SBCA 2WUDA 1OFUX 3HB9A 4E6PA 5AM2A 3ZLJA 3H5TA 3ZCSA 2EW8A 1CS0B 2PIDA 4F2DA 3T3MB 1IOLA 5JDCA 3Q3GE 1X77A 2DHEA 2Q1TA 3PUWA 5T4EA 2I7CA 1ZVVA 3LP5A 1YQQA 3JQPA 4HXFB 5FBVB 1ABFA 4QLOA 2DBRA 5AXAA 1G21E 3W3AD 3IUPA 5T4BA 4F2HA 4IPTA 3IQGX 5YASA 3RADC 1K7YA 4RAQA 4C2BA 4TVBA 4ZU1X 1UF9A 3V7NA 1Y5RA 4CEJA 1GITA 2JI8A 1JA1A 1SOVA 3DBVO 2OVBA 2D2IA 1UC5B 1RAGA 2UDPA 3FROA 1SU4A 2F4NA 4BQFA 4EW6A 4Z53A 1DCKA 3PXGA 5EPUA 1QIMA 1OAKA 1WVGA 1LLCA 4MZDA 2B4RO 3H5AA 5KYKA 2DKNA 3FCAA 3U3KA 1CE8A 3T1TA 1STOA 2NV0A 2QTBA 2X6RA 2BEWA 2ODTX 4FVTA 4TQAA 4PPQA 4B80A 5BQXA 3HEBA 3RS8A 1WEHA 4MGIR 4DDKA 4DOMA 1H8ED 1U2QA 4C7XA 4IKEA 1G8PA 2GN1A 2XUOA 3EGEA 3P45A 3R7WA 2FE1A 2CJXA 1P29A 3L6EA 2QG6A 4Z7QB 1P31A 4IXNA 2YHIA 1ZCJA 3I4FA 4JBXA 1EUDA 2NSDA 4OB6A 4OXRA 1Z3CA 1EHIA 3LQKA 1YQDA 1L7XA 4CM6A 4DARA 1Z34A 2P91A 4DA8A 3KHSA 3LCCA 3II6X 3LLSA 3PNKA 4U02A 1T8PA 4RY9A 2GTHA 1GGHA 3ASZA 1OXSC 5IARA 5DRYA 4K26A 4YX9A 3K2QA 2SECE 3K72B 4PZYA 4B46A 1E2DA 1QXSA 2W4QA 4ZO8A 1UBCA 2IYNA 1RWPA 3QWFA 1EP2B 3W8DA 4AJNA 2R4QA 1CJKC 4XW2A 4Z3KA 4UAGA 5JSKA 1SVOA 4WCFA 1T29A 5IAJA 1KSGA 3JQFC 3V7WA 1R6TA 4JD5A 1YK1A 2QMZA 3OUTA 5JO9A 3AXTA 1SNYA 1M75A 1WG8A 3P7MA 1M2JA 1G66A 4WKBA 2YZGA 5B1SA 5K2OA 4BNWA 3PUJA 2IEDA 3HJCA 2P0AA 1X74A 1GYPA 4TL6A 4C4RA 3VHXA 4PLTA 3KUUA 2OKGA 2P9QA 4KHZA 1HYBA 2CY0A 1GAEO 2EJWA 3CONA 4DWOA 3V8QA 5KNBD 1YC5A 4QICA 3K5HA 4QOJA 3VAAA 4MDHA 2B7CA 2V97A 2OQRA 3N7TA 4PHHA 3R75A 4F4HA 1Z5PA 4HAIA 2QVGA 2I3DA 4Y9UA 4IV8A 1PT5A 2XMQA 4NWIA 1IXRC 3SZUA 2QLNA 1CRLA 2AR7A 3HK2A 2UXBB 3HVKA 3EGOA 4ENQA 5LYJF 3UJDA 3ZD7A 3GRRA 4KDEA 1X3SA 3UK6A 1Z0IA 4KO2S 4OJYA 1X13A 1XQ9A 2YHUA 4G2TA 2DKFA 2C5GA 4ZV7A 5IYZF 1QQAA 3EVEA 3M4JA 4KNYA 2Y05A 3TJRA 4O8CA 1JKJA 1YR6A 4QAQA 2EJTA 4JL5A 4BNTA 5CM2Z 5HOQA 1DELA 4PXAA 1AKTA 1GZ6A 2PKQP 4NNPA 3QW4B 3BX1A 2EFGA 3M5WA 4JJ6A 4XTRA 2JKZA 5EHQA 4BWFB 3I3SR 2C00A 1IY0A 4QU0A 3LT0A 3A9TA 4KXYA 3LPLA 1OYVA 2C4KA 2JD1A 3D4PA 3VKGA 1E9SA 2QUAA 3K73O 5GJCA 3GU3A 2DB3A 4G8JA 1JXMA 1Y80A 1A1VA 5ILGA 1L2TA 1L5ZA 2C8KA 1KSJA 1VPLA 3C6YA 3NYIA 4N7RA 4HRXA 4NV0A 4ZCMA 4JEMA 5KKNB 2BBTA 2ABWA 4BNVA 2QK4A 3CURA 1ZNWA 2ZVPX 1TU4A 2A9JA 2X1HA 4DJTA 1J0AA 3HBNA 3M4YA 4MKGA 1ZONA 3MWDA 3ZDAA 4E09A 2BC9A 1LDNA 5EMMA 3RPEA 3LXXA 3NDRA 3O84A 3VU0A 2PMKA 3O1HB 4KK3A 3A0UA 1G8GA 1VL5A 1QGAA 1U2GA 1KYXA 4PYNA 2WJVA 5B58C 5IU6A 2C2XA 1M7HA 2ZUFA 2B6HA 3DBHB 4N5NA 1GGVA 1TMYA 2RBEA 2I99A 3HSKA 3HVRA 3SLRA 1VP9A 4R6WA 1MKYA 2INGX 3R24A 4ZRNA 1LC0A 3GNSA 1M6WA 3IMEA 2VKQA 2UU9B 3AETB 5FWYB 1XZIA 3ZLUA 1XD2A 3O1LA 4RUKA 3TW8B 4P38A 4B4DA 4BX2A 2BMDA 2VPZA 4EHIA 1PR2A 4M0DA 3QXSA 4E5MA 4YXWD 3ZDCA 5EPOA 1WVIA 4X7RA 3HVIA 3QKIA 1KI6B 5H8WA 3KXIA 2RGBA 3BH6A 2JLRA 4BQOA 1QONA 4EWLA 1IC6A 3ET4A 1JHPA 4YHBA 4BLRA 4D1YA 2OV6A 2TMYA 1JA0A 4J16C 5D3MA 2I9KA 2W11A 2VVTA 3JQGB 2IXTA 4QTTB 2I2XB 5TGZA 1TO6A 1A95A 1MW8X 5BYKA 2NT4A 3SKYA 3DAFA 3FFTA 2IY9A 1POXA 3QE0A 2W6MA 1O0CA 1QF9A 1J1IA 4WIAA 3U0BA 3QY9A 3U39A 4DMGA 1H69A 2A67A 3FCXA 2JFPA 3I58A 3KHTA 3PYXA 4JGBA 3E61A 5DI3A 2YIDA 3WGKA 4NZ9A 5ICEA 4DV2B 2WT8A 2FR8C 3FPBA 2JBAA 4HEJA 4TV9A 2HNKA 2JEZA 4LZLA 3WYBA 1XZQA 3HY6A 4PZCA 2AG5A 2O2DA 2PANA 4JKIA 4N0PA 5ALJA 4MXDA 4MRPA 3ME5A 2ZBEA 2V0NA 3W6PA 2DQYA 1TZKA 3IO3A 4KXQA 4PX5A 4FYVA 4PO9A 5DRTA 2QZ4A 2X4IA 4NFHA 2L0XA 5JNUA 1XQYA 1DLJA 2A0KA 3GFQA 3TEFA 4W5QA 3SZ3A 4QKQA 2FYTA 4KFCA 4J0DA 2IEZA 3BMQB 1Z38A 2OCLA 3LHSA 3DDWA 1YR8A 2SCUA 1JYSA 1YS9A 2CVHA 4GM1A 4WASA 5AW7A 5JADA 3JQAB 4FMPA 1BD4A 1Y98A 1USUA 1P4SA 1YDHA 3RLIA 3JQCA 6NULA 4HMQA 5JMTA 3B51X 1SELA 5AW4A 1ECLA 3OFVA 1GGFA 1LU9A 1JR3D 1QP4A 1UFKA 4RTLA 1F51E 3CH5A 3CX3A 2JCGA 4MYHA 4P9NA 5CA0A 1M1UA 3L7NA 3F90A 4KW7A 4XUDA 4KMSA