2PWBA

Crystal structure of the complex of proteinase k with coumarin at 1.9 a resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of proteinase K with coumarin at 1.9A resolution
rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2007-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2pwbA00
5B1EA 3BX1A 2Z30A 3UNXA 1WMEA 1T1GA 5JMOA 5SICE 1KDYA 4RYDA 3DDZX 1T1EA 3GCWA 1SBIA 3I2YX 1EGQA 4H6XA 1Y33E 2ID8A 3I30X 3WQBA 1R64A 2ZWPA 4DZTA 2XTJA 1Y34E 3LPDA 4WOCA 5FFNA 1GTG1 4ZOQI 3GT4A 1SELA 2SECE 1MEEA 1YJBA 3QMPA 1SVNA 3CNQS 3DE4X 3I34X 3LXUX 4BWGA 1C9MA 2W2PA 2Z2YA 1KE1A 3ZXXA 3VSBA 1BH6A 1TK2A 4KG7A 1AK9A 1SUCA 3DE5X 4I0WB 3F7OA 3SQOA 3ZXYA 1P7VA 1TO1E 1LW6E 1R0RE 4Z2AA 1PFGA 3AJ9A 1KE2A 1WSDA 3CO0S 2PKCA 1S01A 1Y1KE 3PRKE 4MZDA 1PEKE 1IC6A 1BE8A 1SUPA 2G4VA 2SNIE 3BGOS 1TM7E 2W2OA 1SBTA 2ID4A 5ARDA 1IAVA 1DBIA 1SIBE 1GCIA 3DE7X 3F7MA 2DQKA 3EIFA 3VHQA 2P4EA 4C3VA 4KB5A 1TECE 3H42B 3AJ8A 1WMDA 3DVSX 4CG0A 1Y4DE 1OT5A 1SCJA 1TM3E 2PMWB 1GTL1 1NDUA 4NMXB 1S2NA 2W2MA 1TM1E 1V5IA 1V6CA 1SCBA 2SICE 2W2QA 4K8RB 2WV7A 1SUAA 1GA1A 1OYVA 2XRMA 4KPGA 3L1KA 3A3OA 2PWBA 3VV2A 3WIUA 3DVRX 3DWEX 1GNVA 3LPAA 3HJRA 1Y9ZA 4LVNA 1DUIA 2ZRQA 4H6VA 3I37X 3GT3A 3GCXA 1SPBS 3PTLA 3OSZA 1EA7A 1AV7A 1Q5PA 3D9QX 2HD4A 4FONA 1PJ8A 1SBNE 1TM5E 1NDQA 1BJRE 4YN3A 3WHIA 3DE0X 3WIVA 4M1ZA 2ZWOA 2GKOA 4JP8A 1AH2A 5I9SA 1OYOA 3TI9A 3BPSA 1YU6A 1R6VA 3Q5GA 5FBZA 2X8JB 5JXGA 2PWAA 1ST2A 4AKTA 2ST1A 3DE2X 4AKSA 1HT3A 3P5BA 1GA6A 1SH7A 1GA4A 1WMFA 4HX2A 1VSBA 1T1IA 1YJAA 2Z2XA 5ARBA 1C9NA 1Y3BE 1SUDA 1KDVA 1S02A 1A2QA 5AMXA 5AQEA 1Y4AE 4J94A 4C3UA 2WUVA 1GTJ1 3SICE 4CFYA 5JXHA 2QTWB 4OMDA 1AQNA 3QTLA 1SCNE 2IXTA 1CSEE 1TO2E 2X8JA 2Z57A 3DE3X 5FAXA 1Y3CE 2PYZA 2IY9A 3A3NA 1C3LA 2SBTA 3T41A 1XF1A 1SCAA 4OMCA 1BFKA 5AVJA 3TECE 1GT91 1SIOA 4GI3A 5JXJA 1MPTA 1Y3FE 4DWWA 1ZVJA 3Q40A 1GNSA 2Z58A 2DP4E 2PRKA 3DE6X 3EDYA 1SUBA 1AF4A 3DYBA 1ST3A 1TM4E 3F49S 4B5LA 1SN7A 1PTKA 2Z56A 5ARCA 4H6WA 1KDZA 2DUJA 2E1PA 4LVOA 1SBCA 3DW1X 4HVLA 4WOBA 5B1DA 3D43A 1Y3DE 1TMGE 2W2NA 2B6NA 3DVQX 3EE6A 3QFHA 5K7SA 1P8JA 2PQ2A 1C9JA 2Z2ZA 3AFGA 3VTAA 4ZARA 1SCDA 1YJCA 1Y48E 1BFUA 1BE6A 1WVMA 2TECE 4CFZA 3VV3A 1SUEA 1SIUA 1CNMA 5CW1A 4DJ5X 4NE9A 2V8BA 1AU9A 1P7WA 1ZVKA 5JXIA 3DW3X 3DE1X 1NLUA 3VYVA 4OV6B 2HPZA 5AVKA 2WWTA 2WUWE 3LPCA 1SBHA 1JEAA 4NE7A 1UBNA 3TI7A 1THMA 1AVTA 3A3PA
chains in the Genus database with same CATH superfamily
3SDSA 4GGMX 3RVOA 1TW2A 2P4SA 3L8ZA 3A6DA 3UJ7A 1QFSA 1TFRA 2ATIA 3P2KA 4FYPA 2BSAA 4HQFA 3LYHA 3NHBA 3NB0A 3I2YX 3EIHA 2IGBA 2DTDA 2F3PA 5CB4A 3EOAI 2BN4A 5K4AA 3DGEC 2VLIA 3DOHA 1ZR4A 1H4TA 4EM6A 2R6CA 4LWZA 4PC1A 3TKYA 3DAHA 1XRJA 2VKTA 2VP0A 4L76A 3TIFA 3UJAA 5BV7A 1YF3A 4G0UA 3A4YA 4Y2YA 2RHWA 3AGPA 3ZCRA 3NBXX 2XSZD 1LW6E 1XR3A 1OHHD 1P9OA 1KE2A 2NUTB 2RAUA 1VLJA 4MZDA 1R2QA 1TLFA 1R0SA 3PTZA 2YIDA 2JJ8A 1JNYA 3PJRA 2HMYB 3IV7A 1JZQA 2N75A 1MVLA 2ZSJA 4GYJA 4PR0A 1VC2A 4UUNA 4AMVA 1WDMA 3I76A 4AZVA 4RGQA 5SZIA 3GJQA 3DVSX 4N8EA 3NUGA 3VVCA 2A57A 1MFZA 3PGLA 3TD2A 4URHA 4W5HA 4CR7A 1UQTA 1S2NA 1Q16A 3JQFC 3ZLUA 2YHIA 4BEJA 3V8MA 3RUFA 5LDDC 2EYUA 1KZ1A 2ANBA 4ZMRA 1RSZA 4RGVA 1JT2A 3WGUA 2WMOB 5IP5A 5JG7A 5DI9A 3DLCA 4PAOA 2EX1A 4GFDA 4LVNA 4LNUA 1EFRD 1FTWA 2HN9A 4QWWA 3P2JA 2AI1A 3TLCA 2HHCA 2YYSA 3F3SA 3FA2A 5BMVB 1B6RA 1CJCA 1G21A 1SOWA 2ZANA 1JB1A 2AFRA 4L75A 3KP1A 2BGGA 4GE0A 4R40A 3UMGA 1JVSA 5BN1A 5KPDA 3ZY3A 2YJZA 2AMVA 3QY0A 1E9SA 3AWIA 4TLAA 1KGSA 2FSVA 3L7IA 2RK6A 4G0XA 3ILHA 3FTDA 4UHKA 3UCFA 4QPCA 4D9NA 1VZ2A 2CNKA 2VYVA 2XOKD 4CKYA 4GL2A 2Y0DA 4HX2A 1LWOA 1MO6A 2IIVA 2KBFA 2A5JA 4AICA 3ZZTA 4X97A 3LY5A 3UAGA 5CLHA 2AG8A 4NDNE 4W7SA 3SFVA 1WB5A 3BORA 3ZDBA 1DG3A 1TQ2A 1Q1EA 4U7JA 2J0EA 1JPJA 5EMJA 3SDBA 5HVNA 3PEWA 4KJZA 5KUTA 4ENVA 1CK4A 4TWAA 3V2UA 2EIHA 1RZRD 3B9RA 2X8JA 4TZ6A 1ZMBA 3STHA 3U0VA 3NKLA 3FF4A 1JJVA 2Y6UA 4GYYA 3VHLB 5IDVA 1FMCA 2G7ZA 2BZ1A 3OBBA 4TV8A 2I8AA 3T34A 2XTNA 3BIWA 3F4KA 3NJRA 1I2BA 1XJ5A 4ZAXA 2XB9A 3GMIA 3UXYA 1T1RA 4TS4A 5BSHA 1YRQA 2OZLA 1A27A 3CPSA 1L4BA 1UDCA 4NZPA 4YI3A 3PUVA 1OA0A 3WGIA 5GJVC 2D6FA 4TVOA 2RI0A 5KDDA 1YGYA 1RHMA 3QUQA 1FBTA 5DM70 1EIZA 4HMQA 2VCYA 4KXVA 3JTEA 4QUEA 4X84A 4DUYB 2JFYA 3MSCA 4D9FA 2TS1A 4M22A 4YIHA 2XGSA 3AF5A 5BPHA 1HM5A 1H8ED 1IH8A 2H2GA 2R6R1 4GR4A 2GM4A 3TFQA 4UNQA 1PE0A 2R4QA 3MBOA 3IIKA 2HDWA 4NL4H 1I1QB 4DAOA 2FQ1A 2GOYA 2Z8XA 2I2WA 1B16A 3WIBA 5DNYB 5JZOA 3IQWA 3W3AA 4D9GA 2NP7A 2W00A 3TYXA 3G0OA 1EAMA 5GZ3A 2WJPA 3CUVA 1OT3A 2P9GA 3K73O 2B9EA 1OLUB 4DSOA 4PLWA 1XTRA 5B7PA 1IXRC 1NI4A 3O2JA 3QHQA 4KN8A 1Z4NA 2CB0A 1OKKD 2XT6A 1TU3A 3HSSA 4QLOA 4G0MA 5IHPA 3LQQA 3NONA 1LCIA 3U7JA 2BGJA 2CZQA 2VDVE 4NECA 1X6VA 4D81A 1RXWA 4K6FA 3KKNA 1GRVA 1IJBA 1KXJA 2I55A 3CH6A 2A0FA 2ACEA 5BSRA 1OLSA 1CJSA 2PU5A 4GI5A 4N39A 5JNLA 4OEHA 3L0ZA 4OO3A 3SG0A 1Y37A 2GYVA 4JI6B 3PPWA 2RHTA 4RABA 1GPBA 5I7FA 1G9SA 1Q44A 1EFDN 3FFBA 3QVWA 2XAAA 3HRKA 2V54A 1I80A 4GPD1 4KBGA 1A4XA 3EYWA 2M6RA 4HFNA 1Z0IA 3SYRA 4E7PA 1T4MA 4YJKA 4LDNA 4ZQCB 1DO0A 1Y9DA 4AY3A 5KTYA 1NMSA 1E61A 1WLYA 2WSIA 4M0MA 2HEIA 4RSHA 5CDYA 2VDKB 1NW3A 4OATA 2GCPA 3R7BA 2EYQA 3D5QA 3R7NA 3QKSA 4K2AA 3VM6A 5LKAA 2SICE 4B35A 1ORDA 2WKPA 2YY7A 1N6IA 1G17A 3T5MA 2DHEA 1Y42X 3FNRA 4GZ3A 2V3CC 2WWFA 3CRRA 1I8TA 5JE8A 1A9TA 4LVCA 1GNVA 4C6HA 1X1QA 4WCFC 1ZD8A 3JS5A 1CIPA 3IV6A 2FX5A 2Q5OA 3VPFA 3RAEC 4PCLA 3F6YA 3HCEA 3H87A 4MTLA 1EP3B 3RHTA 5DI3A 2PV0A 3KKOA 4YQEA 4LMAA 4BAGA 2KX7A 3V8BA 1YBHA 3WYDA 2OV1A 2WU1A 4CTMA 1LLFA 3DV2A 3VOTA 1CDDA 2Z5GA 3IMFA 4MCIA 2VCEA 4LPSA 2CNWA 4Q7JB 4S1OA 2HHJA 1O54A 1XQ9A 1YQDA 4KGDA 4WXEA 4MHSA 4X91A 1ULTA 3T1HB 1HE4A 5AW2A 1JMVA 1BWPA 3OM0A 1JEYB 1KJQA 1PJ3A 2GPBA 4JLSA 4NJEA 3DOFA 2OHJA 4E14A 3M1AA 4YR7A 3EA5A 3ESYA 4Y9TA 4RTQA 3PE4A 3HE3A 5K0CA 8AT1A 4BV3A 1HQYE 3T61A 3LCRA 3A6PC 1CUUA 1WHTB 3HCWA 4Z0PA 3HZHA 2P75A 1IN6A 5HRCA 5IAJA 2VEOA 4B4OA 1JAHA 2A5LA 1NXPA 1TADA 3EIOA 3R7SA 1LV8A 1P61B 3TWOA 1EXDA 4DMGA 3ZNOA 1AA9A 2AZDA 5ARCA 5EYPB 4ZYUA 1GQRA 5LNK6 2DFLA 4PHFA 1QXSA 4E5PA 5K0JA 2Q1UA 5ECWA 2OAEA 2ILTA 2LTAA 2VJKA 1V1MA 2OUKA 2WIAA 1ISRA 4MUAA 1RI2A 5JYCA 1L5VA 2CJPA 1VA4A 5GY7A 4Q1BA 4UMEA 4F9EA 5LP6F 5KVVA 3PICA 4HGYA 3ZEIA 5AVSA 4UBOA 1IQUA 5J59A 1LFDB 1GG5A 5JFTA 2N3ZA 3ECAA 5GWXA 4FB5A 3II6X 1OFUX 3PNYA 4H77A 3PKIA 4NCBA 3K2IA 1XHLA 2XUQA 4TKUB 3SC4A 4QO8A 3RYIB 4FFBA 1NOIA 4IZIA 3K6KA 1OLXA 1OFGA 4Y2HA 2X9QA 4NZYA 4UARA 1NNLA 1R64A 4GOLD 1VE3A 2IYYA 1H1LB 3ABIA 5GQSA 4BBJA 2W8BB 2O8BB 3EW9A 3VJRA 1SELA 3DCNA 1H6AA 3QMPA 4O8CA 4FDLA 3W7AA 1SRQA 3LDAA 1Q83A 4R81A 2VP9A 3ENVA 4LYEA 1T24A 3PUZA 4CTNA 3AR2A 1L5MA 4GX5A 3FVVA 5T6BA 4KXQA 5ALOA 3ROTA 3WLKX 4LMPA 5TPWA 1UJCA 3DUWA 4KXLA 4N5NA 1HXHA 3LFHA 1HEYA 4V24A 3GGJA 4UKDA 1BCSB 3DQZA 4OXXA 5IDXA 5KNDA 4E07A 4RTLA 2C4UA 4H1VA 3IVMA 1PSZA 1VL0A 1GN8A 3I6BA 2Q7OE 2CBZA 3R3HA 4FX5A 4YS6A 2FUG1 4XWKA 2BSQA 1QHXA 1FYDA 1OX5A 3GZNA 1M8KA 3RWBA 1CY0A 2CFSA 3EOZA 1GSIA 2H5IA 1ECLA 1CQIB 4M0DA 4P82A 5EZSA 2YY6A 3A6FA 3DDUA 2GCOA 2IPXA 1RM0A 1VG0B 3OSUA 2ZRPA 2HLPA 4HGQA 4TN1A 5KQGA 3S2EA 3U3XA 2PGIA 3L7MA 4UE6A 4Y98A 4YH1A 4CR6A 4DA0A 1EBUA 1GHTA 2JIRA 2PUVA 1GV1A 1MH1A 1ETHA 2R7MA 3Q1KA 3O7MA 3K5IA 4N9WA 2LR0A 1N7IA 4K86A 4KIJA 2QU8A 3BPSA 2Q6LA 4MW7A 3ZH2A 4ZYXA 5AKJA 3CCBA 3CBQA 3G2IA 1V5WA 1U7PA 3IEUA 3V8VA 1IZ8A 4ZVRA 3CONA 3C4QA 4KXFB 4C7XA 1CPYA 3SHVA 5CVUA 2P6OA 5KJFA 1CUCA 1VSBA 3LC7O 5KSYA 2BCGY 4AT1A 4UMFA 1SUDA 2JRLA 1FP7A 2H92A 4KIUA 3V8EA 2F00A 1U0TA 1LC3A 3O2NA 3P4UA 3HMKA 4B85A 1V4VA 1JIVA 5DK6A 5I5EA 2X4LA 5JZMA 3LLSA 1CY2A 4GGOA 3VZRA 3WRYC 3H9QA 1CR4A 1S7CA 4YP0A 4A1OA 4ZOLF 2CF6A 5BUCA 3MXTA 4A8HA 4CI0B 1YA8A 2VNIA 4ZVNA 1I0ZA 2NO1A 3LCCA 1TTPB 5IZCC 2JGFA 1ULZA 2O2DA 3PYLA 1TQ8A 4RESA 1XZFA 1H69A 2GPSA 3NRCA 2QTTA 4YRQA 2BEWA 2I7CA 1NR1A 4H27A 3A27A 4OXIA 3IC5A 3UV7A 4PPYA 4BTLA 1YA4A 3O8NA 3WMXA 2GK6A 3B6KA 4AKEA 4BYGA 3O95A 4D7AA 2IH2A 3ZQUA 5E6RB 1EHIA 4M1EA 4FQ8A 1H05A 4YIKA 3PWKA 1Z08A 4Q3DA 3WNVA 7GPBA 4P8RA 1VB5A 2IZ1A 1N77A 4MVJI 3M4XA 3R9XA 4Y0AA 1I36A 1MLDA 3NLLA 4HT3B 3OZAA 3N9IA 2HDHA 2A78A 1ZHOA 2FQQA 3W6PA 4DDHA 1QZZA 1W4ZA 1DAMA 5AI5A 3ZD9A 4OGLA 2P0AA 3IKJA 4IUCS 1ZNZA 2GD2A 2RSLA 3VFDA 3H9UA 2PLRA 3C1AA 2VHQA 1P2TA 4HBGA 3WBFA 4RVFA 3BZWA 5EXTA 4QL3A 2ISCA 4NRDA 3GH3A 5CB4F 1NVWQ 4CLRB 4DB4A 1WBBA 3CGWA 5DOZA 4BNDA 4OQMA 4ACAA 1DMRA 1XP5A 2W0SA 1A1SA 3AR7A 2XIQA 4N65A 2O8BA 1QKKA 1VE7A 1KK1A 3SBDA 4EYOA 3D5EA 4ZO7A 1P4JA 2CK3A 3E8XA 3M5DA 3AP2A 5A0TA 2FHSA 2XF2A 3OQBA 3RYIA 4UTPA 2VQEB 2Q07A 4RXUA 1SVSA 2X76A 3G89A 2AUTA 1LBEA 4XOIA 5TF4A 3UWPA 2P67A 2YNMC 3BHNA 3EWAA 5K09A 3QE3A 1JEQB 1Z0FA 1Z2AA 4PFKA 4XM2A 1E94E 1EGAA 4DUGA 2H9AA 1R8XA 2J3MA 4P31A 3IALA 3L79A 4C6RA 1OAKA 2W7TA 2WA2A 5ALQA 3F98A 2UYQA 3M6XA 3BWCA 4G56A 4NKRA 5SV2A 3VU9A 3RYCA 4KPYA 2Q4RA 1U8UA 3UW1A 4ZCQA 3V8RA 4PNPA 3H4VA 3DWEX 3OIWA 4C4YA 2HZ7A 5BSGA 3KR1A 3UJPA 3DG9A 3WL4A 1Y4UA 2E5WA 1ZICA 4BP3A 5IG2A 1VIAA 3GXBA 2BUBA 3GDFA 3HBFA 4ZZ3A 2Z2KA 1TAHA 2B9VA 3E84A 4PSUA 3Q3EA 2YIJA 3WK4A 3KT0A 3K0AA 1AZLA 1J23A 2M6SA 3LTEA 3P9NA 4YMTA 2UZ4A 3KXKA 1W5BA 2PGLA 4BVJA 1XL1A 2QTFA 1W30A 3ZV3A 5GOTA 5K3FA 3KQHA 1SWVA 1QIIA 4OY3A 1CRQA 2W6IA 1ABFA 3Q7IA 1QYCA 1FFDA 1O58A 1PW7A 5ESXA 5J4VA 2Z2XA 5D7BA 4L78A 4EYQA 4Z4FA 3O2SB 1FSPA 3G2PA 1AS0A 2HSGA 1CUIA 3VR6H 4AP9A 4KQHA 3W5IA 4L3WA 3NR2A 4G0NA 3QU2A 2D5CA 4UFNA 3OZVA 3UK1A 1EWVA 4F9GA 3WYGA 4EB6B 4DB2A 2QB5A 4UBLA 2QSYA 2EW8A 5EWLA 5L4NA 1E9AA 1HYQA 1OBFO 1VSUA 2GLXA 3O8OA 1Q20A 2GPNA 1U0GA 3I2IA 2QN9A 4G86A 2B5WA 3MRXA 4LXGA 1U8XX 3JQ9C 4OOFA 5E2IA 3ZY4A 1ZY2A 2FWPA 2R47A 1UPUA 2HMVA 1MJGM 3H99A 3VAYA 5IHXA 2B7LA 2CUZA 3LFUA 3CH5A 1M34A 3CLKA 3BJEA 2NZJA 3L0SA 2OZKA 3LQKA 4GDMA 5EJFA 5A5EA 4YUVA 5GTDA 1ZA1A 1EEHA 2WY2D 4KRFA 5BVHB 1O89A 1LF0A 4DM7A 1J0CA 2AHOA 5IC6A 2ZITA 1Z16A 1L9KA 2OQIA 3PC6A 1APBA 3MVEA 4KH0A 1QMPA 4G8CA 2WT9A 5LZ7A 2Q3JA 1Y48E 1YUNA 2FMFA 3MWEA 4CFZA 1ZL0A 2HU2A 4RS3A 4Q5IA 3PC4A 4ARUA 2F62A 1L1QA 3E9MA 1J39A 4ZOBA 1BRMA 1N9GA 3JQ7A 3JRNA 3ONEA 4JCCA 1Q7CA 1B6TA 2Q9CA 3EF1A 1PTJA 4AP6A 4UZEA 4EZEA 1Z4JA 1O96A 1SHKA 3BH0A 4CCWA 1JXAA 1OCEA 2Y67A 4W82A 4DXAA 5HWSA 3L6DA 4YMLA 1Y1QA 3IUBA 1F2UA 1QG2A 3BTVA 5T64A 4P9NA 3IP6A 4RF5A 5JI2E 3LDUA 2EATA 1LDYA 4IICA 4MUGA 1BS1A 2GCGA 2HGZA 4CMIA 4HVCA 5D5QA 3GCGA 2FEPA 2ZSKA 1CZRA 2JFVA 3K05A 4BLSA 5CA0A 2VAPA 4PHGA 5HP4A 1E2PA 4E5SA 4CNQA 4WLFA 3A26A 1JTEA 3QKTA 5EXPA 1V7CA 1Z82A 4P0TA 1XDWA 5CDTA 1OB5A 4RHEA 3PR2B 4B34A 2DH6A 1QIEA 3HVJA 1B8OA 2WJHA 3QFTA 4KO3S 2QRQA 3KD2A 3QMWA 5BN4B 4KAJA 4B7UA 4J7AA 1RJWA 2QYTA 2W2OA 5EWJB 1OXKB 3FPBA 4PRKA 5I4IA 2ZR7A 2VF7A 4ALNA 4YT5A 3L6BA 3C16C 1IIBA 2QR3A 3W79A 2JZOA 5IM4A 1S8FA 4UAVA 1IY8A 1A3CA 3IVAA 1T8YA 3JQAD 4N8SA 3FWZA 5FA6A 4Q18A 1GLGA 1QHFA 5AUOB 3FLEA 1Y6QA 4M8LA 3EDOA 1ZNXA 2FE4A 4XIJA 4Q6BA 3UJNA 1FYVA 2YWJA 4X8MA 4QPJC 3SZUA 1FZTA 4ACBA 3HI4A 3C24A 1SPBS 3WGZA 1CS0A 4PZYA 4UASA 4YLEA 3FIJA 1LZKA 5E7JA 3B13B 1N2BA 1PZGA 1Q91A 3ST7A 4O4IF 4MROA 1XQWA 3UMMA 1IZ9A 3FGNA 1T0UA 1Z2CA 1BMDA 2GN8A 1G19A 3NT4A 4HSGA 2BMJA 4P22A 5DISB 4EMBA 4NCIA 2HQOA 4MVJF 1H1DA 4N03A 2HLDA 5E6UB 4UTZA 1IZYA 4ZJZA 2RB4A 4PAMA 1FXWA 4XQCA 3H1GA 5F35A 1GGMA 3RADC 2YMLA 2EW2A 2BHRA 4LISA 4P2BA 2JJYA 5JCJD 4HLDA 2C2YA 1ADFA 4JOSA 5JO0A 1EK1A 1YS2X 2EZ8A 2BI8A 3D64A 1ESMA 5IKMA 2FEWB 3NHUA 3VR5A 4DT1A 5KQPA 3L6RA 2XQJA 4JA0A 2ODPA 1GPMA 4N01A 1AZTA 3RREA 1DV1A 2J9YB 4YJ3F 2J0QA 3VC7A 4CG2A 3LPLA 1SCAA 4EG3A 3WSWA 3QENA 3FPAA 3WB9A 4I9HA 1DI0A 2B78A 1E2DA 2Y4OA 3P5SA 3U13A 4K46A 1Q84A 1EX7A 3QVUA 4Y8VA 4N8DA 4EBFA 1NVUQ 1T4DA 3FW1A 4OYLA 1UINA 2O2GA 1UXIA 1UWLA 4ABYA 5A6SB 4K1LA 3EXAA 1K4MA 3H4TA 4LGMA 4WINA 7ABPA 3D43A 4CXMA 3RIYA 1ZU5A 1NATA 2QW0X 3T7AA 2ZVQX 3I64A 1DC8A 3T12A 3C5CA 2AXQA 2V8OA 2GO7A 1PDWA 3ORYA 3V6LA 2NMVA 2OP1A 3EFHA 4PCAA 5DBHX 2WIJA 5JEDA 3DC7A 5JRDS 3L8YA 5LMCA 3ZHVA 2LKCA 3DJFA 1RWQA 2E4VA 3P9ZA 3OJCA 4A4DA 1RWMA 5HJ2A 2WTMA 2RGYA 5KAPA 3A3PA 2FMHA 4D57A 4MRRA 1FLNA 4OQFA 2C2GA 1W4BA 1BXZA 2REQA 3HVUA 2CMKA 4WXRA 4EHDA 3LI2A 1L5LA 4D3SA 2DETA 1F06A 1GT6A 2C2BA 4MPPA 1T3ZA 3QOFA 3MB8A 2G80A 4XTRA 3GT4A 4BV8A 1WQ3A 2QTVA 5HBGA 3VBCA 4ZQIA 1YRAA 2OT3B 1LBHA 5EMKA 5E2AA 1NNEA 1JJFA 2HOQA 1JDTA 4C30A 1G6HA 2W6PA 5TEVA 5E0OA 3DMDA 3KAKA 3VUFA 1Y1KE 3IQHX 3TR0A 3K8ZA 2OEPA 5CTJA 5KVCA 3NDBB 1N2GA 2IBTA 5IAAA 2IY7A 4F56A 1PR9A 4DYHA 4PHHA 4B44A 4CF7A 2BTQB 4D0LB 1FMJA 3R3UA 1E0DA 3P4YA 1P7YA 3IUNA 1HDXA 1J97A 2FZLA 3ZBUA 5C8ZA 2QX8A 3VZBA 4R41A 1ONNA 4PYQA 2Q2VA 3ROGA 3TK1A 1WA5A 2AJCA 5EVJA 4J2OA 4GC9A 3TEMA 2QVLA 5B12A 4ERNA 4PS0A 2NO4A 1M2EA 3LPAA 3OTQA 3VMMA 4EKIA 1UK9A 4WXYB 3QOYA 5CXXA 5C37A 5KOHB 2QHXA 1N3LA 1Q0QA 1ZOSA 5CP8A 1KOLA 5GOZA 1PW5A 3PTLA 3TSYA 2IOQA 3H7AA 3BB4A 1SVUA 2J45A 5F2EA 4XYLA 5LJIA 1MGPA 5JMPA 3H7IA 3TDKA 3PCTA 1T4CB 2WUGA 1T0BA 5I9BA 1ILEA 1C2TA 1S3IA 5TVGA 3KAPA 2AH5A 2PFKA 3HADA 4BJHB 2XD4A 3H5AA 4MR7B 3RSOA 3WNCA 4OIFA 1DJQA 4TWZA 3JYOA 2ZIXB 4LXHA 4V02A 2SCUA 4ND8A 4PINA 2B99A 3H86A 1L3BA 4UUQA 3IQGX 4U7TB 4IF6A 2PGNA 1CUXA 2VP4A 1EU1A 4HNAB 3A10A 4ZP1A 5EZYB 3S1AB 5FUVA 4EI9A 1N78A 2VPQA 3ME5A 2IV3A 1FUUA 1PJSA 2PVPA 3LQRA 4PNEA 1MB9A 2R5NA 3A1DA 3ZHBA 5TMPA 1T6ZA 1BC5A 1C1XB 1P2GA 2REOA 3TW4A 3ZI7A 2PDAA 4JZKA 3ZTTA 2BE9A 5DYNA 2YL2A 2Z8YA 5K6RA 2WSLA 5GJCA 2IK8A 1AX9A 1DAPA 1KK0A 2AI2A 4IGKA 2IXAA 4W99A 2DR3A 2YKGA 1C4XA 2CL7X 3M9LA 5DTIA 4REQB 3WL5A 1S7GA 3EIEA 2AXEA 4Z9FA 3Q8XB 4GOJA 3C3YA 2HCFA 1DBWA 2DFKB 3KCNA 2Q0HA 4FXOA 4KUGA 4GMKA 1I7QB 2YV2A 2BHLA 1FLDA 1P2VA 1ATZA 2R65A 1WW3A 2ECKA 3F7TA 3OZ7A 3M83A 4F11A 1K8QA 2WFLA 3P9RA 2QPAA 3K72B 2JD0A 4BO3A 2IKSA 3FNHA 2VH1A 3EFBA 3QEMB 4ZYZA 3QMMA 3UA3A 1UMKA 3H5WA 4ZAGA 3ZGZA 3VJKA 3I9KA 1TLLA 121PA 4OUDB 5DYIA 1J5XA 2JHFA 1RAFA 4F3YA 3RE1A 4E51A 3NHRA 221PA 5BY2A 4JIMA 3T9DA 3LT5A 3HGQA 4QYMA 2V4ZA 4WUTA 3UNXA 1RLMA 1J0XO 3JQ8A 5BQFA 5AI4A 1D2HA 1EJ0A 4NWIA 4HYYA 1AKTA 1DS6A 4D8WA 5BSUA 3U56A 1G4UR 1UKYA 2UV8A 1ZSVA 4X92A 2A9OA 3SYTA 1K5GA 3U1BA 3WLNA 3RTAA 1BGVA 4MV5A 1ZCZA 1NMYA 1PD1A 1H6DA 4MUBA 3AVVA 3BUSA 2JLWA 3LHSA 4LXUA 1CRWG 2DQSA 2WZQA 1TEHA 2OBBA 4N5HX 4R83A 3HB0A 2Y1DA 4FE3A 4HEHA 4BGVA 4DIDA 3INTA 2WWYA 1TA9A 1XQ6A 1ZUWA 5SZHB 4R0MA 2ZBQA 5JOQA 4HRYA 1ZM3A 2ARKA 4WLOA 4B47A 3T1QA 3LUJA 3T5BA 4HLQB 1GQOA 1ACJA 1U8FO 2IWHA 4FHGA 3TLAA 2A4MA 1ZESA 3BD9A 5L7WA 1ZRHA 1GTL1 3QUSA 1SHLA 3DKVA 2QM3A 3FHOA 1YFKA 4AN4A 3EQZA 1YJ8A 1CEXA 2GN9A 3BSFA 3H18A 4QBFA 3MJRA 1BVYF 2Y1EA 1H5QA 2J3DA 4H3VA 2QRVB 1USUA 1YQ9A 4IWXA 4O2AF 3R7FA 5FJJA 2FOXA 2ORIA 1L6IA 3AFOA 4ZANA 5LA6A 3IVRA 3T3EA 4E3ZA 5F3DA 3KUUA 3QGMA 1GTVA 4YT2A 1R10A 3FCAA 5C5CA 3ICOA 3LYAA 3S8MA 5AVYA 3TCXB 1Y6ZA 4HLUC 3PGA1 1M10A 2DRIA 2W2TA 1N2OA 1OFHA 4U2BA 4R54A 1NA5A 3TI9A 4BL5A 4MQUA 2DG2A 1DRUA 2YWFA 1A9OA 4YMGA 1M0TA 4IOMA 1GG9A 3LCUA 3AOEA 4U2DA 3EVEA 4UM7A 4WFIA 5KYGA 2W2XA 1GPAA 1POXA 1U2TA 1UPAA 2HHAA 1ZK1A 2K6GA 2UVPB 4WE3A 4YCJA 4JI5B 4G1VA 3ED1A 4Y2RA 4ZOCA 2X13A 3C39A 2Y2VA 5AOVA 5KOJA 3N2GB 1NP7A 3VA7A 4X20B 4UHEA 3PEFA 4OI1A 1R9MA 1V2HE 3O94A 3PLRA 3UT0A 5C5IA 1F4VA 2Z57A 4W9NC 4XWYA 3VDXA 3B1FA 3ANTA 4B31A 3CEAA 5KYVA 5DTEA 1I4LD 4Z4CA 3TM4A 4EF5A 1ZIPA 3LP8A 1UOQA 4S2UA 2ECFA 6REQB 2GHRA 1C4OA 3JQRA 2HMTA 4H16A 4RZQA 4C2BA 3Q2OA 2VHYA 4H3HB 4R1NA 3MCVA 2QEQA 2H17A 4FXPA 4I5DA 2CLLB 1XN1A 4PAGA 5DKFA 2QRVA 4FGUA 4RK1A 4ZVSA 1P2SA 2FPPB 3G6WA 1BCRA 1JIJA 3HLKA 3O91A 4HVLA 4TMKA 5CJJA 5F4ZA 2IQIA 2G67A 3LHIA 1SQGA 2Q5IA 4CDGA 2GAAA 4JU9A 2CXNA 1BE6A 1FA9A 2IW1A 4WFJA 5LYYA 6Q21A 1FFCA 3IB3A 1FY2A 3OP1A 3KOXA 1Q7EA 1H2WA 3KAQA 3Q6IA 1JWAB 3L7AA 2BISA 1KJNA 4W9NA 2DMRA 3MUOA 3UJCA 4KI0A 3ICCA 4FT4A 5AO9A 1O87A 4KQEA 1P81A 1M5UA 2FZKA 2X3FA 3PX2A 5LP6B 3AF0A 1CY1A 3NBYC 4GNRA 2MT9A 2HF9A 2FNAA 2QLTA 3I73A 5G1OA 4UU1A 1N5MA 2WV9A 3WQSB 4CL0A 1ZN8A 5BV8A 2DR2A 5GONF 4F85A 1E5DA 5AUNB 1V16A 3MXOA 2AOUB 3KSDO 4BIMA 3B6IA 3RSGA 2G5GX 3KYBA 2FN3A 2QTCA 2XTMA 2ZBFA 1EFAA 1MRSA 3QBVA 3TE7A 2X5JO 4KXXA 4CMHA 5IBRA 2BFFA 3MAGA 4KQJA 3K4QA 3WKEA 4URXR 1B2LA 2JFBA 2P69A 2YUIA 2RHGB 2QUKA 1I30A 5DTQA 3UJBA 2CT8A 3T0GA 1F5SA 4FWBA 3TSZA 4ZDKA 2VDMB 3PC2A 4NDZA 4KK4A 5KWSA 2XBMA 1ILWA 3CEJA 3CLSD 4RL4A 1S89A 1W59A 2W2KA 3ZLBA 1GL3A 5CBKA 1UBLS 1QIJA 2ASEA 4DZRA 1ZR2A 3EIFA 3JVEA 4ES6A 3ZWKA 4NEQA 5BR8B 3O8DA 1EWRA 5TSDA 1XAJA 1JHXA 1C4KA 1AZSC 1QQTA 4UDOA 4CUJA 1HDIA 1HDZA 3PRJA 3TLMA 5IANA 5A5VA 5LZ9A 2JBAB 3FYHA 1F14A 3FCXA 4K28A 2CF5A 5CA1F 3F3MA 4GXTA 1QHEA 1YACA 5CDHA 1I32A 3L46A 3I5MA 1I3MA 4PWYA 4EJMA 2ORWA 3QU4A 3G0HA 1I13A 1TT5B 3CRNA 1UJMA 3UTDA 4X66B 5T3UA 5COQA 2BZ0A 4ZODA 4BUCA 4GMHA 2XXAB 1W87A 2BELA 4LVUA 4Y0VA 5FNVA 5FXMA 3BQ9A 1II9A 5TPZA 1DAIA 3NUQA 4OI4A 4ZU3A 1UC4B 4H4CA 4I50F 4EPWA 2HNKA 1VM6A 1ZLXA 2D1YA 3X1YA 3OEYA 1AUOA 3MNFA 4I4IA 1RBYA 1KR5A 3NW9A 4RPCA 2GYWA 4OK5A 4JUDX 3CX7A 4Y6QA 1LSOA 1DTWA 5FOXA 1RPAA 1W34A 4FHDA 1BOFA 3DDHA 4RWEA 1G291 1P1JA 4UCXA 2BJWA 3AU8A 1FQWA 4FYYA 4V2UA 3UMVA 4BEVA 4MKRA 1F4LA 5E0KB 1VPDA 5K3OA 4KP7A 2DPMA 4MR7A 5J5VA 1J90A 2GZHA 3CTPA 3MPOA 4G01B 4EO9A 1NAIA 1QE0A 2VTEA 4MV8A 5G4KB 2X15A 1FYFA 2DKOA 2FG6C 4M7PA 4DQDA 2OMEA 4KBYA 1DEAA 3FTEA 3H4MA 3KYIB 3W9YA 3ESXA 1UFRA 3DWIA 3OQIB 4GI3A 5CRIA 3RRXA 3WYAA 4XFDA 3CX8A 2IU0A 4R0NA 3ZK8A 2O59A 1CRLA 1Y5RA 3GEGA 1KF0A 3UJ6A 2GEJA 4OSOA 4BQOA 5KDOA 3ICQB 1U9IC 1XP8A 2A0KA 4KREA 3EEOA 5CXSA 2JVJA 3L0YA 1HNZB 4JOBA 2ODAA 5LMNB 2Q5HA 4LZWA 1N4AA 3AR8A 3T7TA 4RHCA 1X1EA 2ZI6A 2BBSA 2N0SA 4FWIB 1NVEA 3I2FA 1DWQA 3GRPA 3AV0B 1CZLA 3JQCA 5HIMA 4RH0A 2R6AA 4BP8A 1PLKA 3TTYA 1IZ7A 5A1TA 1SVIA 2YNMA 4L4ZA 2BTQA 1NW6A 4OQZA 1KQGA 1E6EA 3ZE0B 3RKRA 3FDJA 3ZE9A 4M0CA 1TQ6A 3AB3A 5C32A 5HBRA 2ZI4A 3ZY6A 1E2GA 2G25A 3D81A 1J9EA 3C8DA 1TJ5A 4JCOA 4RDXA 5AVQA 2X8WA 5AVXA 2JEYA 1T34A 1T15A 1T5SA 4HLNA 1KGDA 2FH5B 2XLBA 1BG6A 3DT6A 4IXWA 3TVYA 4A0QA 521PA 3GZJA 4QASA 1Y34E 4TWIA 4CUZA 1ZNWA 3ANSA 3THOA 1P4HA 1ZUHA 2KE5A 4ZU1X 3WLHA 1FQKA 4YRJA 2R6FA 5GPBA 2E48A 4BNDB 5FBKA 1UC5B 4LXTA 1PT6A 4C87A 4QPDA 2IOHA 5ED0A 5HDQA 3IV9A 4ZKEA 4Z2AA 1B1CA 3AHEA 4YRPA 1UMBB 1S01A 3COJA 2HJHA 1REQA 3FROA 1R0ZA 3KHKA 2QAGA 3K0FA 4ARZA 1II8B 4RIHA 1T5IA 2NVUB 1YH3A 4QUBA 3HN7A 5E3JA 1JJBA 2LDBA 3PHLA 4RXTA 2AG1A 4C5CA 3UXHA 1U8EA 1T9KA 3BXXA 4M8SA 3ZC3A 2MINB 2NO9A 4MKGA 4D0GA 4ZI3A 1Z15A 3NEYA 1KKMA 2YRWA 3GLIE 2LW7A 1S1MA 3ONFA 5ALNA 1MO2A 5JD3A 4EF4A 1GUBA 1DKNA 1Z88A 3V7UA 2PKWA 1F48A 3KTFA 4JB3A 4TS9A 3IAS6 3GGOA 1PQYA 5AKIA 2PGDA 3RODA 3OOWA 4NFLA 2WWGA 3ML1A 2X4GA 5AI0A 3G2OA 1J1UA 1TJNA 2PCJA 4MS3B 2JI8A 3EWIA 4DF3A 4Q66C 3NYIA 3UUFA 1OZHA 2QX9A 4J4HA 4ZRNA 1ZM4A 1CRZA 2R00C 4H7JA 5JMWA 3KWJA 1CUGA 1XNRB 1KI4A 3OPYB 1KI9A 4P0PB 3LOUA 2UUCB 1C9EA 4F46A 3ENWA 1M33A 2DECA 3TQCA 4QRHA 1THZA 5CGQB 3MAJA 3IAXA 1HT3A 1VQ1A 1JPNA 4MQBA 2XDYA 3PVZA 4NS1A 1SUSA 3EF0A 1MX5A 4UHDA 5K6TA 1NVTA 1WKVA 1G5TA 2IHBA 3LDGA 1ZD5A 5K9ZA 1XMXA 2E4YA 2XNDD 1RQNA 1MNQA 3MTBA 4HVAA 3FPSA 3G1TA 4ETMA 2X1VA 3GLFA 4G4SP 4NK4A 3BE8A 3DVAA 4OHPA 2PIDA 1GUZA 3RCBA 1GTMA 3PF8A 5H0IA 4Q9IA 2WQ6A 2LUOA 3UG6A 4AQYB 3CWZA 1GGNA 3D4NA 3K31A 3C5HA 4OTZA 1NKSA 1SKBA 2XE7A 3JX9A 3E70C 1PK7A 2M32A 4J90A 4MIYA 4HDMA 3ITNA 3JQQA 5I7RA 1GR0A 1G8SA 2W58A 2ZWIA 3VJLA 4KR2A 3OUTA 4S12A 3O8QB 4GDFA 4HAZA 2J31A 2I2CA 1F8UA 4JBXA 2HNAA 1AUXA 2VAWA 5FL7A 2AT1A 2D2FA 3NRJA 1SCUB 2PD3A 4FJ0A 4UPVA 5CW1A 4Y1RA 3RC2A 2RKBA 3NVAA 4YEDA 1AQLA 2GFHA 2G1PA 1HORA 3N59A 3F6PA 1NM5A 4FEAA 1NMXA 3UAXA 4MKIA 5DHRA 1GNLA 3VOBA 1Z2PX 4UEKA 1L7NA 2TYSB 3CJQA 4KK3A 4NCXA 2VJLA 4GVXA 4MP8A 2HRBA 2VF5X 2VSOA 3IPAA 2DX7A 4L1KA 3QXSA 4PXAA 1PNRA 5CITA 3AR6A 4FE4A 1STOA 4YPFA 1GTG1 1KDOA 3ABRB 4TL9A 2W8BA 2VTDA 5HMLA 1W73A 3G2MA 2XCTB 2C8VA 2WF9A 5FUWA 2ZI7A 3E0QA 1JQ5A 3IXLA 4HH3C 3ROMA 1G5PA 1ORIA 2CHQA 1PT9A 1U4SA 1IEVA 2RC6A 2WKSA 4ZQHA 4YPOA 1I7NA 2Z2JA 3CT4A 4QZVA 1CFZA 4UMDA 1D0VA 4MW2A 3I5XA 4LYYA 5JJ5A 3C6ZA 3PL5A 3L1IA 2F1HA 1W94A 3SCZA 1JE1A 1D2CA 1RQRA 4Y1RB 4KWCA 3I9OA 2PMWB 3RO7A 4JKIA 3IEPA 1WUTA 2QYSA 2W8ZA 3K4HA 3P2MA 4BKRA 3ZIUA 1OA1A 2Y4NA 4JLDA 2ENUA 2X23A 1EE9A 1ES9A 4M6WA 2CXXA 5J2TF 3JYPA 4PZZA 2NVWA 2O19A 4O02B 2XNKA 4D8VA 1QK4A 3EZGA 4II7A 1TAQA 4OB8A 4E2FA 5INTA 3GHYA 2VJAA 1GGEA 1VXRA 1BH2A 1WD7A 2ZUVA 3EC1A 3Q9LA 4WPGA 4NMLA 4E31A 3DM5A 4EATA 1TU0A 4DMKA 2JZCA 4CZ2A 4E5VA 1SBNE 5L3SA 3IE1A 4E03A 3QH4A 2D3WA 4KVGA 5AJXA 4DGSA 3E27A 3QKIA 3BZBA 1KVQA 3ZQJA 3MJSA 5K2OA 4K9RA 5DT2A 3ZKAA 8GPBA 1OWMA 1RMQA 4BMCA 5CYGA 1O8BA 4F4UA 2H0AA 1C0KA 4L9RA 4MYRA 2OQVA 4QDJA 1EDEA 4GR9A 2OFXA 3TW6A 2OE2A 3I01A 1RLOA 2OLJA 3WLMA 3ZU2A 5EXXA 1JEYA 4BNGA 3L0DA 2PUEA 1HZZC 2YOFA 1OILA 1VP3A 2P62A 4ND7A 2AUMA 3SICE 3RI3A 4Z0TA 1CD5A 3QWBA 3BRSA 3DONA 4ZYWA 1BD4A 1CSEE 2V74B 3SZ3A 4Y6SA 2GFIA 5K3AA 3CW9A 1KI6B 5L3ZA 5LBTA 1K08A 3PHGA 2BGIA 4YP1A 3ASZA 3TQFA 4US2R 1ESNA 1QIHA 2PTGA 1W5FA 3PNBA 2CDBA 3C6XA 4LY9A 3M4ZA 2OILA 5ALJA 3RS2A 5MGNA 1T8PA 2YFHA 1NJGA 2CNNA 1FFAA 2WI8A 2BFEA 2XA9A 3U44A 3O8RA 1MEOA 2VG8A 2C3UA 2WQ7A 4ZT3A 1WW8A 1X1CA 1JYFA 2X4IA 3TQQA 2QE7A 3QNUA 3GEEA 4CMGA 1ND6A 3KBOA 3K53A 1E6KA 2J09A 2PWYA 4MAAA 3SHOA 4D9JA 2CV0A 2C00A 1BHO1 1PL7A 2RC5A 2XTZA 1DWUA 5CIWA 3W3AD 1GQQA 3OTOB 1X7WA 1DWOA 2ZSUA 3P94A 1J8YF 4E33A 5KBYA 3HU1A 4HQ6A 1VG8A 4PLTA 1LBSA 1RXUA 1BW9A 5T4BA 4DNPA 2WBLC 2VDNB 2H1LA 2XIJA 1M6WA 3PQ5A 1O7JA 5DNWA 4I5GA 1M5TA 3OQMA 1JEQA 3KV1A 2W70A 3K5PA 4IDNA 5B57C 5CFRA 3CT6A 1I2DA 5JH7F 3UMCA 2HHHB 1UMBA 3BX1A 1ESEA 3IIMA 1M7BA 4MPRA 1XVVA 4HOYA 1Z25A 2R60A 1UBUS 4IVQA 3WADA 1H66A 3OLVA 4QBKA 5HIIA 4HUQA 1KYQA 4INOA 3BSSA 1ULUA 3C87A 4PG4A 3KUXA 4RX1A 4C05A 3DMPA 1W49A 4QFBA 3I34X 3WISA 2XZOA 3GCDA 5AOBA 1X94A 4KC0A 4QBGB 8LDHA 3RS5A 4R2JA 4RIIA 5F98A 2C4WA 1Z2DA 1WCIB 3DFZA 4ZCPA 2Q28A 3RU2A 3VR5H 4W5OA 3S8EA 2XCIA 3DZFA 3FPCA 4LQLA 2R1TB 2ZRCA 1G42A 4V0QA 1SXIA 5G02A 1PFKA 3VSCA 1RE0A 2Q4OA 3JZDA 2W6OA 5EMNA 1QAMA 3BXZA 2POCA 1DX4A 3L6EA 2AK2A 3VU8A 3DD1A 2WVJA 4FLEA 4HFMA 2W4MA 2J1LA 1N3IA 4H59A 4NAUA 4LI0A 1T10A 3RG2A 3TXAA 3WMGA 4C0HA 2R62A 4I4TA 4QX6A 4NBSA 1EXWA 2CNOA 3TTTA 2GMWA 2IE8A 2G5CA 5JBNA 1GG8A 5DIFA 1P1CA 1J0AA 1RM4A 4BFXA 3OOEA 4S05A 1LVGA 3PHIA 4GU5A 2ZKIA 4JLMA 3LKDA 4HDMB 3S2FA 1XLTA 5ITVA 2OV6A 5KOIA 3OIUA 2QT0A 5FDFA 2PSHA 1JIKA 4YASA 2WB2A 4R6XA 5JWHA 2VHZA 3JTMA 2VATA 5KB3A 2DAPA 4QXQA 5K3CA 2PH3A 2PUWA 4ND3A 2QM8A 4BJ1A 3AQIA 3S2YA 4I4TF 2HLNA 2Z3VA 5CNIA 2RHDA 3BQNB 3KALA 4M4SA 2JFHA 2Q0QA 1MXFA 4IGEA 4J07A 4K9DA 4ZHQF 1Y7HA 2PBFA 1KDVA 4HWPA 1TRHA 4G24A 4RNCA 2CLDX 5DP2A 2BH2A 1ZVVA 4R1MA 1JHOA 2IW3A 3P52A 4NAVA 2M6KA 4YMVA 2JFGA 5LWQA 1Q50A 4FGKA 3CVVA 2LBPA 5FO0A 4JD5A 1YIDA 2DLCX 3HYRA 4LC0A 4KFSA 1EP9A 3EIWA 4QYIA 3GUUA 3OY2A 3HUEA 3OPYA 4GKVA 5FWAA 4DG5A 5EN4A 4RTPA 2C84A 1JKMA 1RBMA 2OXCA 3TXXA 2RFLA 1DCTA 1GCAA 1PZHA 3H8WA 4Q48A 3AEZA 5EJGA 3GLKA 3WWYA 4QLAA 2JBWA 3SZOA 2IV2X 3O1IC 1DQPA 1YR6A 2EBWA 2SHKA 1QS0A 1Z6QA 3ENKA 1CDZA 3CXRA 2FMXA 1FRZA 4MUJA 1GSOA 2E1PA 1YKSA 3IS3A 1B00A 4NG5A 4BKUA 2FR1A 4ITVA 5K6AC 1HL7A 2WM9B 1D4OA 2AVNA 4RVDA 3P4XA 3K0SA 2IUEA 5HGXA 3LUPA 2BRUA 2AC7A 1G3MA 1QHIA 2FCRA 3AW9A 3GJ6A 2QN6A 3R5TA 3ENNA 4JEIA 4K6HA 3SN6A 4RZIA 1ZN9A 2CHEA 1JILA 4IBOA 4MW4A 3EMKA 1YOVA 2KYRA 4Y1FA 3B12A 1R0XA 2AG5A 2M2IA 4KQ2A 3UGKA 4KGVA 2Q8NA 1FW6A 3VNUA 3HBMA 3G8YA 1XRLA 1A7KA 3D59A 5TPWB 3ASYA 1EXVA 2H54A 4RFSA 2FGJA 1E8DA 4QFMA 4RVHA 3EQ2A 2F9FA 4LJ4A 1MA0A 2FHPA 3TL6A 3Q8KA 4Q1AA 3DBOB 3EG5A 2ZRFA 2I1LA 2EJVA 4PZPA 1RMYA 4KFTA 1NQWA 2V97A 4EUKA 1EVIA 2DHDA 3QBDA 2P91A 3G2LA 2FPIB 1BH6A 3QG1A 2XQIA 1KE1A 2O5RA 4RPIA 5J4KA 1JJAA 3CVYA 4PLFA 4KO4S 2HA0A 1YWGO 3HUUA 3PVSA 3Q15C 4JLWA 4HDSB 5FYQA 2ZM5A 3RUIA 5IFLA 1PX2A 3T5TA 3Q88A 4ZC1A 3U0BA 2I03A 3VPXA 1MQAA 1OBOA 2ZSIA 4N5LA 3V42A 1ZL2A 2ATEA 1I3LA 5FEUA 1XCPA 1JDJA 1QOZA 3KNZA 2FQWA 4H0NA 2IL1A 3AVOA 4AWBA 3JVIA 4ZYYA 5A4AA 1TQDA 3A0UA 2HUPA 3PNQA 3UKJA 4ZC8A 1SCJA 5LOVA 2GXAA 2GJSA 4ME6A 1UKCA 1DDOA 4QBTA 3LZCA 5LD2B 2PUAA 1SQSA 4Q39A 3ZDYB 5EGSA 4TYWA 2HA6A 4K9QA 4R1OA 5E9WA 2C7VA 1QVWA 1B4DA 2QZ9A 2H2DA 1F0NA 2P3LA 3B5IA 2FPPA 3NT5A 2PZAA 5KMGA 2J9GA 2CW5A 3SBXA 1Z28A 2QYHA 3C3PA 3IR7A 4UBIA 2BI4A 1W0JD 1BIFA 3DL0A 3QE2A 4MWGA 5L7TA 3OU2A 5FTNA 3DA8A 3U9LA 4TKMA 2FFQA 3QVMA 1GITA 3FDXA 4GX1A 3W2GA 1EJ2A 3QX9A 2DKNA 3ZHXA 2IVZA 2WKWA 1CR0A 2C5EA 1RP7A 1TF7A 1Y1SA 3GEPA 4DABA 5HOEA 1SG0A 2I6GA 5KOJB 1A9QA 1B0UA 1XDGA 3RVPA 4D8TA 5HCUA 4HV4A 5B2ZA 1AKQA 3EY4A 3RHZA 1U3FA 1WPGA 4NCKA 3DBRA 1PU2A 1AQNA 2CYBA 2QPOA 4WDRA 3ZV5A 1L9XA 1RYDA 3ETJA 5EZQA 3ZW8A 5HCNA 2WTAA 2VJYA 2O3QA 1JEDA 5TC4A 2CEAA 3BICA 5H1YA 5JJCA 4WLUA 2P7IA 3MEQA 1P6XA 3H0EA 1VPWA 1UBJS 2A5GA 5FP0A 4TYMA 1QPBA 4OAOA 4FYXA 4Z9BA 1JJ7A 2RJOA 3SLKA 1Z7EA 3TTXA 4XR4A 1PR2A 4OSEA 4CMEC 5C52B 4DC1A 2LXNA 3DR5A 4G65A 4JP1A 1X7XB 1VKZA 5ALYA 3TGPA 2W6JD 4WOBA 1NLYA 5C8XA 1U0RA 1Y3DE 3L1HA 3VU0A 4CV1A 2Z6QA 2XGMA 2QTNA 3QOWA 2PMKA 3EZ2A 3QVOA 3G8DA 5DHTA 4DQVA 3OOHA 3TZBA 3EZXA 3TGWA 4J0QA 2CYAA 5HIAA 1CNEA 4TLMB 4ZVVA 4WCFB 2V96A 3CF6R 5CT8A 3DFFA 3U40A 2CXTA 2OWDA 3EDRA 1XZIA 3QRWA 1MORA 4CM3A 4CMEA 1XEAA 1E3JA 2DWPA 5HHTA 4NMHA 5TB5A 1AB6A 2V7XA 4IVRA 4YVFA 1JFLA 5F1PA 3WQRA 2WZCA 2HQSA 2WM8A 2UAGA 4FFNA 3CNNA 4XI9A 5JNSA 1M2NA 1MBZA 4E46A 1VGVA 3FCUB 1KK3A 3JWGA 1Q19A 1BMFA 1N2CB 2IELA 4NH4A 3A4VA 3O26A 2NUBA 4RANA 1KRXA 1B74A 4MS4A 4OFBA 2NUAB 1AK9A 3SQDA 4ZDIA 2WUEA 1TIPA 2NTYC 3CMCO 4JBGA 5KYTA 1J7KA 3K35A 4CI9A 1NZDA 1QX3A 2QZSA 4JGIA 5EQTA 4DYVA 1DC7A 2KLHA 4XFKA 2VIIA 1WNFA 4TSFD 2Z3ZA 2FFRA 2VYNA 2BKXA 5FBRB 2WJWA 5FQOA 4ZD6A 4TXHA 1XZ8A 5IKEA 3AG6A 1QGUB 3G13A 2OGUA 3ZOZA 1KYIA 2H8GA 4AKGA 1PYDA 1TZBA 3AJ8A 5G0SA 2OD7A 4Y2JA 4EGCB 1W48A 1JBQA 2IVFA 5C31A 1FXSA 2H9YA 2J5XA 4CIWA 4V0OA 4K40A 2K2QB 2JEZA 5C4MA 1N25A 3WJ7A 1Y1RA 3M6LA 2RHHA 2ZUDA 3E3MA 3R3SA 4LF9B 3M4JA 2QWXA 2PL1A 3K3PA 4XIIA 4IILA 3ZD6A 2ZDHA 3JV7A 1QOPB 3G5TA 1JU9A 4IEEA 2OZLB 4WK4B 3LFTA 2F1OA 4X6LA 4HWGA 3JQPA 5JQGF 1RYYA 1YSCA 2ZIGA 3COVA 3I9V6 4U1RA 1HLFA 3MJDA 3N8KA 6REQA 1X19A 2JAOA 4MEJA 2IU3A 4F4CA 4XA8A 5AM1A 4F6RB 4Z7JA 3JARB 2Y71A 3TLJA 2OCXA 3CH7A 4MSUA 1G7TA 1ST2A 3H1PA 4K0RA 1E9FA 5LQDA 3OA0A 4DCPA 3THWB 5FUYA 5ELMA 1LI5A 3OCZA 4CKEB 5EVCA 1HLDA 4Q4AB 1GEGA 4BLUA 1EVZA 1NUQA 2R97A 4U3JA 3F5DA 4BFWA 2YV3A 5BMOA 3HYTA 3THYB 2ZK7A 2BH9A 2J9XB 3FDZA 4DPKA 5JU6A 3ZWPA 2PZGA 5BN5B 3N1UA 4L02A 3E61A 2MR5A 3QUAA 3VTKA 4R69A 1UBKS 1L5FA 3OCJA 1JDUA 4CM7A 3GRAA 1EVKA 3QBJA 2P78A 1SPXA 4GOOD 1BRTA 2GN4A 2XA1A 1WF6A 4MXDA 4N0QA 4CM6A 3GYBA 3IEIA 4ZALA 3RK0A 2HSWA 2RI6A 4QGFA 3LF1A 4B17A 3V2HA 2P5UA 3ACCA 3WL7A 1K9SA 1NOJA 2IODA 4J6FA 1YQTA 1G98A 5LQKA 1KI8A 4RLSA 3OUUA 4RZHA 2EJCA 3VQTA 3ZDZB 3BFKA 4R1TA 4BBAA 4D3ZA 2PY6A 3H17A 1RAGA 4PPQA 4S24A 5DK4A 3EE6A 3GLHA 4UOZA 1EX6A 1M2FA 4I1OA 4C5BA 1CG6A 3DT8A 4FUTA 5K7SA 4HAIA 3I9FA 3LO8A 4PX2A 3WE7A 1V1RB 1WVMA 1OGIA 5EUBA 3K6SB 2QROA 4KXYA 2O48X 4N49A 1H2YA 2F59A 1ZJWA 2RBGA 3OZIA 3KJFA 1I33A 4DW8A 4PFQA 1XEWY 4YJ2A 1IB6A 3EHEA 4U4AA 4OQPA 1HI9A 1NLUA 3GGPA 3QPVA 4H3KB 4X3OA 4AQ7A 5ALDA 2VF8A 4BU1A 3HJFA 3ODGA 1EGHA 3MOIA 4JLPA 2HMAA 1Z0JA 2EJUA 2QY9A 1WABA 4XSGA 3RRFA 4FBLA 3OQJA 2JAUA 2R9VA 2V7PA 1KY5A 4BO2A 5I7VA 3D54D 3OZRA 3O47A 5K45A 1UXKA 1Z45A 2ID7A 2Q4EA 4QQKA 3O4JA 4Q7QA 3ANXA 1QHGA 1MO5A 1VJTA 3B82A 3M5WA 1QLHA 2FKNA 4HX5A 4KG7A 3ZY5A 4DNXA 3KU1A 4U2CA 4JWKA 2JB9A 3CSSA 3LKVA 4A6XA 3AM3A 1VPLA 3ONDA 1OPRA 4KACA 4RIGA 1F1BA 1YZFA 3L1JA 1TMOA 2G07A 3DEJA 3GK3A 1JPVA 3F6RA 4JLBA 4WZ6A 5AOCA 3SFZA 3VNSA 3P0HA 3D6UA 1JR3E 2NZYA 5TGTA 2QMOA 3U3MA 2XRZA 4J7UA 4C4PA 5B4UA 5HQ3B 1Y8RA 2FUEA 4KB5A 4D46A 1JHAA 3S29A 3MRSA 1LZLA 3LWZA 4G5YA 4DCOA 3CVOA 4TVKA 3TFOA 1KOGA 3L8HA 4MRAA 3JQFA 4CIYA 3ORHA 4ZIRA 5TMDA 4YFYA 4OM7A 1MHTA 4HYEA 4ATNA 2RH9B 3QUTA 4PG8A 3RFXA 3DULA 3PQ4A 1HDEA 1KS2A 1L1EA 3R5JA 4R4JA 1TDJA 2PGAA 4KR6A 4HQLA 4NE2A 5ALIA 4MUIA 1KEUA 2PPVA 5B53A 5A0FA 3AEUA 4C7VA 2IX3A 1MDFA 2XYGA 2W6ZA 2OBNA 1G8MA 2R48A 1QYWA 1LTQA 2PSEA 2QMYA 1OU0A 3DZBA 5A5FA 1RPTA 2C2ZA 3QLUA 2EAUA 4X41A 4J3FA 3UENA 2JASA 3GNQA 1LC0A 1Z4KA 3WLQA 1WVIA 4HTFB 5EJ7A 1Z33A 3L0CA 1LI7A 3P9IA 3OETA 1HWYA 5EZYA 4OQQA 3E4CA 5J47A 4ASUA 4Z5XA 1T1IA 3Q8WA 1NNSA 2GYYA 2C31A 2D7CA 4BOYA 2GK4A 1F6BA 1JRLA 3C7CB 4PBSA 1V1JA 3R2JA 1VIYA 3V7NA 1AKEA 4D97A 4XASA 4BZXA 5BVGB 2J6CA 1O0CA 1CR1A 2P8JA 3LT4A 1EDBA 1F51E 4PLHA 1C30B 4DDWA 4TGLA 2CK3D 2ZE6A 1LLQA 1WSAA 2YQ5A 5FAKA 4ND1A 3SZLA 1BXRA 4GPIB 5DE3A 2VJMB 1BFKA 3SKXA 3E9DA 4FDUA 5CFPA 5KTPA 2QP9X 5FD8A 4F5EA 1OJ7A 1Y89A 2AFHA 4IDAA 3NI2A 1JMYA 4BBZA 3N0XA 1TC1A 1TVEA 1TGYA 3C0KA 7AT1A 1SU7A 3CJTA 4HB2A 2W6CX 5KOHA 3JALB 4QEZA 1HT0A 3GQVA 1XO1A 2O7NA 3T3DA 3MUNA 2V6FA 1KC1A 1VMEA 1KYTA 2IXDA 1SOVA 2NACA 2PZLA 3N53A 3QVGB 4L5YA 4Y2GA 5GONA 2QQ0A 1XWFA 3PIIA 3AUAA 3IJ5A 2IUUA 2JK1A 3DEFA 4Z7OB 3UAVA 2AC4A 1V39A 3QJGA 4RVUA 1NMZA 3AI7A 4BN4A 1II0A 1NV8A 2IC5A 1A9ZA 5EZYF 5U4QA 2ERYA 1TX4B 2I1QA 3CA8A 4KQCA 4XX0A 3VI3B 5C18A 2O8DA 1JLLA 2HPZA 2X0FA 5DSZA 3WKDA 5KREA 3FVTA 4U00A 1U63A 4Q9HA 1YO6A 1E9CA 3OIVA 4P34A 2QM7A 2QYOA 1Z07A 2FFJA 4MPJA 4XJTA 5JMOA 2EC5A 4J7XA 3TDNA 4PZ0A 3N7AA 3WLPA 2IQ5A 1Z4LA 1YZTA 1NT2A 5AUPB 5MFPA 1ZONA 2OG1A 1OD6A 2H85A 4MK4A 1LPMA 2HJGA 3CM0A 3TIXB 1DSSG 5T8KC 3D4IA 1NYQA 1KXZA 4UPEA 3JD2A 1C9MA 3GC6A 2QA5A 3NHJA 3A32A 2XPCA 1F2UB 2HK9A 1TE2A 2X58A 1WR8A 4W5TA 2YMQA 2OHOA 3AJ9A 1ZH2A 1GRQA 1WOYA 3H1AA 1WULS 2PKQP 3K15A 4L8LA 4MDYA 4RL6A 4TKLA 4CLHA 5JANA 4YONB 1Z6ZA 3GRVA 1FB5A 3LKBA 5JMTA 4LFBB 4S0ZA 5ADUS 3AQ4A 2X42A 3I9JA 3FAKA 3PKZA 1WF3A 1RAAA 3B1ZA 2WAOA 3IAFA 4OXNA 2WSYB 4OMUA 1C0PA 3NHAA 4MQFB 3KEQA 1HZJA 1KC3A 3GA0A 2CY0A 4BQQA 5IU6A 1PNOA 2BKVA 4FT2A 2IDMA 1QYIA 1EK0A 1GDTA 4I4CA 1VLZA 2I3AA 2V6IA 1BFDA 3FWNA 2J4DA 3GFSA 2ET6A 2Q5FA 3IOMA 3K20A 2RG1A 3KR2A 3ZDDA 2Y0PA 2Z95A 4R7TA 3PJDA 1L4KA 3GDWA 5AW6A 3D7NA 1Y98A 3BBLA 1TO6A 2OAP1 3W1EA 1ISMA 1M34B 3GW8A 4WXHA 2FLKA 5DGTA 1KI7A 3ITKA 2IU6A 3H1TA 3A25A 1J5EB 3N8IA 2H7XA 5DGHA 3BREA 1JYEA 2UYYA 5DF1A 1E1DA 2FQYA 3LBFA 3SF0A 1NGSA 1FYWA 4Q9LA 1GNPA 3GGGA 2ZUTA 4X1IA 1XF9A 2PKEA 4Q01A 5EIHA 3ENQA 1C0LA 2F48A 2P1DA 4NR0A 3BMXA 3JSXA 3FMOB 1TW3A 4MZXA 1DWPA 4IFTA 4KQ6A 3UOWA 3GEBA 5DH9A 1AB5A 2KPOA 1K5HA 1X42A 2GD6A 3ZU3A 5H9VA 4OYHA 2YCBA 5BWOA 4DV0B 1GZ6A 3CUKA 1GFZA 4BB6A 1K97A 4FTWA 3TZLA 2BY4A 3RS7A 4MW6A 1VHDA 3EPHA 5H4GA 1QRTA 5EQFA 4L8FA 3ZBTA 1E69A 1U1GA 1USKA 2CMDA 1DKUA 4BPRA 5HK9A 4W5JA 3S2GA 2IEIA 3IT0A 3IBYA 1JH9A 3PI7A 3F1LA 1J8FA 4IHJB 1KNQA 4LHEA 2NUPB 2CFTA 5DT9A 1T9DA 4GSLA 3D0QA 3T4UA 4AJ2A 4E5UA 4DVJA 2J4CA 4I5EA 2EDCA 2XXBA 4Z2YA 1ST3A 2EGUA 1VKRA 2EKPA 2PSJA 4MYCA 4ZWNA 3A1WA 1GZHB 3IJEB 2J7PA 2XYPA 1J06A 1W4CA 3ZWOA 2VDRB 2IUYA 1S2IA 2G7MC 3E3OA 1NPYA 4NX2A 4U7DA 4JH0A 3QVVA 2B7BA 3QSYA 3R75A 3STXA 1XZLA 2PJDA 4BJ3A 2ZZMA 1DIRA 2VYQA 3AONB 3T7SA 5TS2A 3DBHA 2QR5A 3PFCA 4DA8A 4J91A 4AD8A 1KMHB 3SP1A 2A1UA 3V4ZA 2PKRA 2ZRLA 4PN3A 3WNQA 4PSAA 1UZMA 5SICE 2VSQA 3ZD8A 1RM3A 2I22A 1AXGA 3O03A 4K5QA 1DIOB 4MIEA 4F3RA 3HO8A 5JCZA 3QXGA 4OL9A 5FFNA 4CCSA 4Q02A 2BFMA 2GASA 3E1GA 3OTIA 1JE0A 5A06A 2PRYA 3NBMA 1DEXA 1F8FA 2XAUA 4F04A 5BQ5A 4PQRA 4BBPA 5BV0A 5EE3A 1VHWA 4LRUA 1E7YA 1KY3A 4AF7A 1ZJJA 1IBCA 2PIAA 3BE5A 1HE2A 1O96B 1YHYA 2JVKA 2O0KA 4NBUA 3S81A 3KWFA 3BL5A 3JR7A 4H35A 2PLWA 3N6VA 4Y6GB 4UZSA 3KPVA 2WWHA 5LA6F 3ZWXA 1E60A 2OCYC 4F3KA 4G9EA 1IDOA 3PA8A 5LXTF 3OHSX 1G5IA 3EQ7A 4HG2A 3LIPA 3GFQA 3BIFA 4DG9A 1FUKA 1ISHA 4GICA 5K8CA 1JXMA 5GONB 3L93A 4PBRA 3B9BA 1GVHA 1SCQA 2DLNA 1U2QA 1SVMA 3DAFA 4A2WA 5E6RA 4DN6A 2VSFA 2SKEA 4FLFA 1MX3A 2AXPA 2PRIA 1QRUA 4EUFA 2GLUA 2HEGA 4M1KA 5FTWA 3LQYA 2RAVA 4EL5A 4YMWA 3RS9A 2QJRA 3AUFA 1FUEA 1DNPA 3MRTA 3NIGB 3QWAA 3R5KA 3THXA 1JHRA 1AV7A 3AFMA 2ZUUA 2VJMA 2R44A 1D4ZA 5GVSA 5A02A 2CJWB 3OECA 3WQHA 3RUAA 5TRTA 4C7BA 4B8WA 4F2PA 5BMVF 4UU0A 5UKDA 3RVLA 1EINA 1FBNA 1GAQA 3K9NA 4DXHA 3RK4A 4J0IA 2IUFA 1Z7WA 4QU0A 3T15A 1B8PA 1XMPA 5JO9A 1IEXA 1HFEL 4NENB 3VJMA 1QHSA 2J3IA 4C0QC 3PFGA 4KMMA 3RH0A 3CZAA 4D1YA 4OUKX 1ZWLA 5KSZA 2CLMB 2JHPA 4MUHA 4UM9D 3UGTA 1CYEA 5E7MA 3OE7A 4ZVQA 3GA5A 3TGLA 1J99A 3UHOA 1CRPA 2FK8A 1VL2A 2JLVA 3IUMA 4XQEA 3JATA 4TTRA 2PV7A 3ZU6A 1DBPA 1WETA 2NU6B 2E82A 4P4GA 3VC1A 2O5EA 2ZIUB 3OF2A 1L5QA 1W29A 3WTCA 3ZI4A 2KMLA 3CR8A 5ALUA 2DQYA 4AMYA 1NIJA 5BN3B 1O94D 4DLBA 2GCOB 2Z56A 3LXMA 2WYVA 1U8AA 2QXYA 1CZOA 1L4HA 1YZQA 1Q0UA 3NOVA 2HSZA 3KM0A 2A4KA 4KUEA 3S40A 4E6PA 1VZ3A 2OQRA 5JVDF 1GPKA 1R6AA 2A2ZA 3IHTA 4OK3A 3VOAA 1Q95A 3DP9A 3SX4A 3VBEA 1N7JA 1GUDA 3OD5A 4DIBA 1W4LA 4ESVA 2O1WA 3VH1A 1VXOA 4ZK6A 1OIXA 1CNFA 3T7RA 2PWZA 1HLPA 2B7CA 4ZVLA 4RCZA 2RJNA 4QXAA 4H7DA 2JKZA 1PSDA 3BL8A 4BP9A 4WT7A 1M2VA 4DM3A 4PWZA 3GI1A 3WRWA 1BEEA 2QJOA 3IUPA 4M1ZA 2ZI3A 3EGXA 3TFWA 5TJHA 1B8UA 1UBHS 3DHNA 4DCUA 3O4IA 3C3MA 1A9RA 1PZFA 5KO2A 4IV5A 3I9LA 3ELWA 1PYOA 1YR1A 3T5CA 5BW6B 2AA3A 3ZDRA 2V6BA 2PS1A 2BGTA 2WICA 4QOFA 1H5NA 3SSOA 2E89A 3R6LA 1PQWA 2COEA 1WX1A 2P3SA 4AMUA 4D3YA 1DBSA 1YAJA 3CZRA 4CLOB 5J2TA 3PB3A 1OX6A 1RBZA 3PQCA 4HFJA 1NBWB 1OTXA 4DY4A 1J5PA 1FL9A 3NIFB 4IY1A 2O7QA 2O3UA 1KP9A 4M0PA 3LRTA 3PNMA 4TZKA 3MTAA 4B83A 2ZT6A 3IL2A 4J3JA 3O90A 4WJKB 1GCIA 4G2TA 5LCXA 3HKBB 4NH0A 3PNOA 3UK2A 4BX2A 1HEIA 4N47A 4K3UA 1JB9A 4TT3A 3U31A 4HXYA 4FMBB 2JGNA 4QNMA 1S3GA 4CM4B 2C94A 3V1UA 4NV1A 2Y99A 1YR8A 1EG2A 3F71A 4F2DA 4OJMX 1FXWF 2I2DA 1N6HA 3B1JA 3K09A 3CR3C 4P53A 4CQLB 4EYEA 3CX6A 3QKRB 4GO1A 2GD0A 4Y9UA 3ZNPA 4KMRA 4LZAA 1ONSA 3KE9A 1VI2A 2PNJA 1A1VA 1Z74A 2Q29A 3FDFA 5A71A 4M2LA 1R8SA 1YUMA 1NW9B 4LQDA 4Q4CA 3T0FA 2AN1A 1ZZGA 4GOXA 5CDGA 4FNAA 2XZLA 1KOFA 3BXFA 3FXAA 4NS4A 5K4GA 2XADA 1YONA 2GK3A 2PMDA 2R4TA 3MOSA 2X77A 1C4WA 3LY7A 1P0CA 3MBIA 2AD5A 3AC0A 4N0MA 3G0BA 3W78A 5BN5A 3B6JA 4QC2A 1D07A 4DCJA 3UIEA 1L4FA 4NZ9A 2I3GA 5CHYA 2JAXA 1QF9A 5F77A 1FC0A 3ISTA 3WAJA 1GD1O 3U3KA 1UUFA 1XTTA 1AM4D 1R0LA 1ZITA 2Q1YA 3DLPX 2H65A 3GFTA 4Q93A 4M3NA 5JYBA 4MYTA 4PBTA 2IXTA 2QZJA 2Y2UA 4N18A 4IMRA 2XJ4A 3ZTYA 3KLBA 3KHUA 5IEBA 2QD1A 2GKSA 2IWRA 3TZEA 5JADA 5IM5A 2QVXX 3SHFA 4RDCA 1CB7A 3A9UA 3CSDA 1TJYA 3IPYA 3SKVA 4EZBA 5M7EA 3EDYA 4L5BA 4K7JA 4LV5B 1QWOA 4YALA 1S2LA 3HR7A 3Q98A 4JJFA 1TYDE 2ZEJA 4KXMA 4LJYA 3V1KA 1LQ2A 4A3SA 4NVRA 4C22A 4ETNA 5JWOA 1PNVA 2RE8A 1XGKA 1VI5A 4HXFB 3I4CA 3HA7A 5A9SA 4O29A 5EXEA 4KFCA 2Q2WA 4MUEA 3MS7A 4BASA 1F38A 2OK7A 4PLZA 5TS3A 4ALMA 4PLVA 4YC7A 3H04A 5I51A 1L7PA 1P7WA 4A9AA 1UPXA 2VK1A 3U9TA 4AJ4A 2AJLI 2R6JA 2XCLA 3PQ6A 5F1OA 1EUDA 3EGWA 2R6DA 4G0PA 2QTHA 2D5IA 2P5SA 1D2EA 2B1QA 1KZGB 2VUIB 2Z5FA 4HS9A 2Z3WA 2EFEB 2IXBA 4DHEA 2IJGX 2O4CA 1RKXA 2OYSA 3WBKA 2C54A 4JK3A 4JYMA 1G55A 1W5SA 2VH2A 5E6SB 3RIXA 4IUYA 4MV6A 5HF6A 3MJFA 2GF0A 4JP5A 5FR1A 3FJYA 1ZOPA 4GEKA 3I5AA 3CMMA 2VPIA 2I4TA 3QLTA 1W2WB 3U3DA 2AI3A 4X85A 5IAKA 4WEQA 4DSZA 4EVIA 5BURA 1AJEA 3PR3A 1X80A 3A31A 3PWZA 3NUZA 4G1MB 2XBLA 1OR8A 4UEQA 4RBNA 3MT9A 4FFBB 4YAIA 2NGRA 1WXWA 2HWKA 1YFJA 1XQ1A 3T7EA 1P5RA 2BFOA 2ZJ7A 4KZKA 5LN1A 1QP4A 2ODWA 1ZJZA 1CWUA 3VXKA 3PD1A 4U02A 2ESRA 2VHXA 3EXHC 3K9WA 4KAXA 2ZAOA 3QVJA 4GQIA 3VHQA 4YX9A 2AR9A 1TJ3A 1C1HA 3B3JA 4OLBA 3HGMA 1H2XA 2BFCA 3NNNA 4ZPJA 4CKWA 4BN5A 3IMEA 5JAOA 1CP2A 4GSKA 5CCBA 3FDIA 2H4FA 4G1FA 4JL5A 5D00A 3V3KA 1FFBA 4KQMA 4LC1A 4ENPA 1RADA 3RT9A 5JAHA 2ZYRA 1Z7BA 4GBGA 1Y9ZA 3KOMA 2C8KA 3OFSA 4UBJA 3H2HA 1KDRA 1C1YA 3AVUA 1BOOA 4JT2A 4RHUA 4NSNA 2ZE7A 4UVEA 3UEOA 4OFZA 1U8ZA 4WRRA 4I1IA 4U2FA 2EFCB 4XE5A 2CCKA 2JFOA 4L0QA 3D6HA 6ADHA 2I78A 4DKXA 1IM5A 3HXOA 2G4LA 3B2QA 1W7AA 3RSCA 1WUKS 2Z9BA 4WL0A 1F8YA 4IJQA 5KCZA 2WD7A 5K8LA 2X8JB 3FYTA 2G9NA 3ADBA 1K92A 2GBIA 1PS9A 2Q45A 5ABPA 1GAWA 1OXMA 1W8DA 1FYXA 4NJMB 1X0VA 2I4RA 2PR2A 5KSWB 3L4KA 1U6IA 4P58A 1YQWA 3RKSA 3KTAA 3ZYCA 5HOQA 4DLRA 1F0PA 3KOOA 1GDHA 4AIRA 2RH4A 3GJYA 1AHNA 1Q1ZA 1PWEA 3CEPB 3ETDA 3OLYA 4HEA1 4N0PA 4QTTB 4NV0A 3LUFA 5JAPA 5EJIA 2DE0X 2PLAA 4A03A 3OJ0A 4WECA 3GXOA 2C61A 2Q6TA 4MV1A 5JDIA 4UHJA 1YDHA 2H1HA 5KTRA 5CAEA 3SSNA 1SQ6A 1PR5A 1RRMA 4QAJA 4R8VA 4AB1A 3FFAA 3FMGA 2WYIA 2OGZA 2AJTA 3DYBA 4LQCA 1I2CA 3ZWAA 1V48A 1IN8A 2AOWA 4YRGA 1G6KA 5JS7A 3NYRA 2NV6A 3EARA 4TS3A 3H84A 3KKQA 1ZKDA 3LBNA 3M0EA 4EPYA 3EH1A 1V5FA 3I2HA 1WUYA 1TMGE 4RQUA 4IIHA 3W6ZA 2IS4A 3AI3A 2RCNA 4I3HA 5IBCA 4G1BA 2QRZA 2ZJBA 4CM4A 4ZCRA 2XUKA 5CYOA 2YN2A 4DA9A 1ECJA 1AQ6A 5ALXA 3G9XA 1ADGA 2IOFK 2JIQA 5B3KA 1L5ZA 3ESAA 1ULAA 3DXZA 3F3YA 4D41A 1OW3B 4E4RA 1EI9A 1K6MA 2HA5A 4Y3UA 4Z49A 2W6JA 2ZTHA 5T6MA 4MR9B 3TQSA 4IIBA 4PCVA 1WKCA 1Z68A 2GH1A 3K7EA 3O7WA 3TN7A 1BE1A 2R1ZA 1MRNA 4BDTA 1VLVA 3GG2A 1P1IA 1ZXXA 2QK4A 3KLPX 5EERA 1ZU4A 1L4YA 4BB5A 2GBCA 1DO2A 4H7EA 4CLOA 4ZVUA 3KFVA 4NBKA 4A92A 4ZJYA 4D9KA 4IKEA 3T95A 3F6CA 3KJGA 4Y6PA 3AHIA 2E4WA 1CP3A 3BCSA 2BR5A 4TV9F 4DMRA 2W71A 2ATXA 3WHPA 3UHPA 4CRWB 3PXCX 1T36A 1PFGA 3NHWA 3DEKA 4O33A 4QUJA 3ZJ5A 3UPUA 3PLAE 3UANA 3UATA 4OJKA 1N6LA 4MAMA 1L7QA 1UAAA 2KM1A 4Y67A 2YV5A 1L5RA 4HDNB 4PGGA 3BTOA 3L05A 3LT1A 3RHSA 5LXTA 1JTFA 4JJAA 3G17A 1YRYE 1T91A 3T4EA 2DH5A 4YTEA 3EAQA 3IAAA 1L7OA 1NDUA 2ZQ5A 5CD1A 1WVGA 2HCRA 3KBBA 5MFZA 1HE5A 1NX6A 2EP5A 4GKBA 1I3NA 5HRUA 4RTKA 4JN6B 3NNDA 1KH2A 3F5SA 3R0XA 3FNGA 2WSMA 4OHXA 1QS0B 5CA0F 2QLJA 1L7AA 1KBZA 1OXTA 1PJ4A 1SAYA 1C81A 2QMZA 1YJ5A 1E96A 2VP6A 2ZSBA 3JXEA 1WXQA 2HNBA 1V3QE 1NP6A 2NU8B 3CKLA 1WV1A 1N1EA 1NVKA 2BEUA 1BO6A 5LMZA 2YW9A 3OLXA 2WILA 1L8QA 5BNTA 1HTTA 2Y1KA 4NOMA 4B3SB 3DE2X 5CM2Z 3UM9A 1ISIA 4NMMA 5CH5A 2XV1A 4KN6A 4WHMA 1CY7A 1P9RA 1Z36A 4WWHA 3SPXA 2VDWB 3TZ6A 4KOEC 4W8HA 4RKQA 4AJPA 3AVWA 2BTEA 4YQFA 1P8AA 1M74A 2OVFA 5AVVA 4JC4A 7REQA 4D9IA 2FW1A 2FSVC 3EASA 3KOYA 4FYKA 4IM7A 1SCNE 3K6JA 5EFZA 5C35A 2YUTA 4PZDA 4NYJQ 3MWDA 2YRFA 3FM9A 2XYQA 2NLOA 4NTZA 3ICVA 3IEXA 3EGVA 1JXOA 1FRFS 2LIPA 5C34B 3V55A 1PR0A 1TYZA 4RQAA 1YI1A 3GL9A 4YXWA 3WGGA 3JQBC 1BMFD 2C20A 4ITUA 2K2WA 4PVDA 4NU8X 4BNMA 1W19A 1FQOA 4NZOA 3RT1A 3T3NA 1KIFA 1WQ4A 3G79A 5ICEA 1NFFA 1KHTA 2J5RA 2P2ZA 2JH8A 1U9YA 4JWTA 2ZIFA 3HA5A 4KPUA 4I4TB 1YS1X 2CLFB 3BJIC 2OG2A 1U1FA 1PD0A 3OKPA 3OMWA 3BXOA 4B8ZA 4XIYA 1Z8FA 3AVXA 2VK2A 5L45A 3HXTA 5C1BA 1B8NA 5C5EA 1ZRSA 4I55A 5KJEA 1UFVA 2ZRMA 5B6JA 2Z1MA 2ZRGA 5EPOA 2HM7A 1O6CA 1FNCA 4FNGA 3U3RA 3RYCB 1MAVA 3PPIA 2ASVA 1DQNA 4W5RA 5AVKA 4LWQA 2QTRA 2CHUA 2R1TA 3Q9NA 4PYMA 4I9UA 3MJCA 3AHHA 3GBVA 4G8JA 2Y66A 3R9KA 4A6PA 4P3XA 2QGFA 1AQUA 4BX0A 4F96A 2BHTA 2C88A 3ETHA 4G09A 3FLMA 4M37A 4FFWA 2RH5A 2Q9AA 2FV8A 4Z0NA 2P5YA 2B5VA 5AHKA 4DDVA 5FOWA 4FW9A 2BM1A 3AHJA 2X3YA 1U8YA 3ZGNA 4ER5A 2PUFA 4KW7A 3A1FA 3D8NA 1X9GA 5BORA 1J2TA 2AS0A 2C5BA 4M46A 2PEYA 4QULA 3S7ZA 4EYGA 3EGXB 4LDJA 3H9EO 3HFRA 2A1UB 3EEBA 4QOJA 5LIPA 3UGJA 5JDCA 2HWWA 3WLFA 4H15A 3RS4A 3PE6A 4IMJB 2J46A 1T9GR 4ALKA 3C5WP 4N3BA 2HQRA 1H9CA 2FMTA 2VHEA 2DQKA 3ICPA 2BD0A 3ZX4A 1CJKC 4K0KB 3WP1B 3FJ1A 3OESA 4NU0A 3CH4B 2PH5A 2N1BA 5EP1A 5JCPA 3RVRA 2YDXA 4EA6A 4UBMA 5K0LA 1CUSA 4MKZA 4Z4HA 2DTXA 2CSXA 2B34A 1RJ9A 3OO0A 4B6GA 1G0NA 1T8UA 3IP7A 1NUPA 2CB9A 1A97A 1XLWA 2A30A 3FZYA 5LU8A 1AMNA 4O3FA 4E2XA 1XQYA 4POOA 4QVGA 4FM9A 4KRYA 4O3MA 1MABB 2CKMA 3AP1A 4G5RA 5M5BA 2Q1WA 4BO6A 3D3JA 1AKMA 2QTLA 3WIVA 3UZUA 2ZSFA 2HA4A 1P7PA 3MLEA 4EEZA 2QG6A 1PR1A 1YQUA 3JD3A 3Q6NA 4MCAA 1DXQA 5JVDB 2Z6VA 4YUZA 4GVLA 1UP7A 2YJ6A 5L51A 4FHFA 1EGMB 2H1VA 5I7AA 2I6FA 2X6QA 1A04A 1W96A 4HCJA 1KKLA 2H2IA 2QL9A 2R8BA 1EQUA 4FFPA 4ZT2A 2Y0CA 3SY8A 2WG0A 1VHLA 5C1IA 2JDID 2R86A 4QQNA 3IT2A 3W2TA 2IY9A 1R6UA 2BLNA 2MSDB 1G0OA 3A9SA 1KYYA 3SR0A 4DEVA 3DL7A 5LM3A 4BPBA 5F21A 3D0RA 2I9PA 3NBAA 5TARA 8ABPA 1JAZA 1UZUA 2RGEA 5KU7A 2QD5A 1VIDA 1P4SA 1PEDA 3KX2A 3Q5DA 4YJ3B 1N0UA 3R7WA 3V8PA 1M0WA 3IBGA 4A8JA 4JR0A 5ILOA 1MW8X 1GKIA 3GLGE 3QF4B 2KSQA 3LC1O 4EHHA 3UMYA 3BGDA 1PJQA 1I2ZA 4FFLA 1GUYA 4L6AA 4G41A 2SKDA 1CUWA 3GIDA 3IGFA 2YHSA 3M9XA 4IRXA 4F6CA 4ANFA 3TLZA 3TX2A 4OQXA 3I23A 4AF6A 4NZNA 5HJEA 4FK8A 4C08A 1ITZA 3VSAA 1J0DA 3X1WA 5CDFE 1MP0A 3WWZA 4PAQA 2NU9A 4GBED 1VLLA 1GM5A 2F1KA 1I01A 3R6GA 1NSFA 1YMQA 1A4IA 1GTSA 4TV9A 2PUCA 1XE3A 3GQBB 5I3CA 3ILVA 2XVXA 4WKBA 5HA5A 1MB3A 2V6MA 5A3QA 3EXFB 4A23A 4JJZA 3RW9A 3QJYA 4WBSA 1NVVQ 1RQ2A 1FLAA 2DHQA 5HQTA 2VDUE 2WIGA 4NG4A 3RANA 1E2IA 2WQZA 1P5HA 3OIFA 1JG4A 4PE5B 5F7ZA 1QZXA 3R4CA 1VTKA 4BWGA 4FD2A 2VZ0A 1E3MA 1BVHA 3FOEC 1S8NA 3QVSA 4KXNA 2C3MA 2PK3A 1ML3A 4R9NA 3QVTA 1NXQA 3T3HA 1UJ4A 1Z37A 4B6OA 2H5EA 1W581 2JLBA 3ZW7A 1SOAA 5IJZA 4KYUA 1AKNA 1O97D 2VRCA 3DL4A 3NTVA 5YASA 1RQXA 1VYHA 1Q22A 4HH4A 4Q1FA 4GWKA 4AUNA 4FNMA 3VPBA 3OFVA 2FPMA 1ZC3A 3SAJA 4YRNA 2BF7A 5K0GA 3IKVA 3F5QA 3EPPA 5DSXA 3UQYS 4C89A 3SIPA 4OAQA 3RC8A 4O1MA 3UHAA 3ZK7A 2X7HA 4PQFA 5AKKA 3V32A 3HWSA 4C4XA 5A03A 1E9RA 2YQ4A 2FPKA 5BVHA