4H77A

Crystal structure of haloalkane dehalogenase linb from sphingobium sp. mi1205
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 114
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h77A00
1EXWA 2WJ3A 2LIPA 3HSSA 1G4HA 1PFQA 4RE5A 4Y2RA 5D7BA 2HRRA 1SCQA 4D9JA 4H35A 1BEEA 5K3EA 4TVKA 4W1RA 5IVDA 4X6XA 5D6OA 3DKKA 4HXEB 4J7AA 1C7JA 3ESAA 3FCYA 3FLBA 2VT6A 3C87A 2GYWA 3I2KA 4JEIA 4A5SA 4U2GA 3DNMA 5DNVA 4BC0A 3L1HA 4Q3KA 4UFOA 2HA6A 4G1FA 2O2HA 1ZIYA 1UK7A 1YSCA 3V48A 3Q8WA 3WYNA 5JADA 4OB6A 3BJMA 2G5TA 4H7IA 1D07A 2WM2A 4CFSA 1CQWA 4F21A 3M3DA 3PUIA 3EBLA 4Y7DA 2JEYA 3KXPA 3DL7A 4C88A 1TQHA 4OU4A 1LPPA 2WHPB 4HXGA 4UHFA 3V1NA 4W1PA 1XLVA 4FOLA 3WKEA 1H2XA 3R3VA 5C81A 2WUDA 2PU7A 4GBGA 2PUHA 3GUUA 5ALXA 4C89A 3STYA 3O9VA 2JEZA 1CEXA 3H2JA 1DT3A 2D5LA 3HYSA 3G9UA 5AKZA 4PV7A 3FVRA 3QZUA 1X2BA 2RHTA 3ESDA 4YK7A 1C4XA 2H7CA 1XQXA 4BBZA 1YB7A 1Q0RA 4AMZA 2HA3A 1CRLA 1XFDA 1A8QA 2GBIA 1ZOIA 2Q0XA 2Z8XA 5I7UA 2OQVA 1THTA 2VJAA 2BAGA 2PVSA 1FSSA 2X76A 4OYLA 4Y2VA 1B41A 5AKHA 2JF0A 5ALSA 1LNSA 3LIPA 1QIDA 4QDUA 5J3JA 3BJRA 2PUJA 4G9EA 5AHXA 5ALZA 4FLFA 2GZRA 3IIIA 4X93A 2PU5A 3WK4A 2VATA 3ZLUA 4BTLA 1ZGCA 5A6VA 1QO7A 1DX6A 2JGLA 4AO8A 4B85A 1ORVA 5CT5A 3BIXA 3SX4A 5AIAA 1XZHA 4FBLA 2WSLA 3KWJA 3W04A 5CMLA 1P0IA 4X7BA 3IUMA 4ARAA 3WKDA 1AURA 1ZI8A 2PSDA 2X5XA 5K3CA 1GZ7A 2O2GA 3IDAA 1YS1X 4G5XA 5ISMA 3VVMA 3QMMA 5AK3A 4DTCA 1DWOA 5JZBA 2H7YA 3N2ZB 3FNBA 1QGED 3HABA 4EY7A 5SYNA 3WA6A 3A2LA 2PSEA 3BDIA 4RNCA 3WKBA 2HU7A 1LZLA 4F0JA 3L1IA 5ALDA 3H17A 2O7VA 3QMWA 2HL6A 4B9AA 1NU8A 1YA4A 1EVQA 5BWBA 3V1MA 1UOPA 2CMFA 4MJ3A 3BF7A 1XRMA 3WL6A 1E8NA 4P93A 4YPVA 2BGRA 3SK0A 5CURA 4RGYA 1ZGBA 5ALGA 3NUZA 3R3YA 1MO2A 4LXIA 5AO9A 4J03A 5LZ2A 5IH7A 4MYSA 3KSRA 1UT6A 2DHEA 1CUYA 5AK4A 4KE8A 4QWMA 3WI7A 1YB6A 1HBJA 1CUAA 3G0CA 3C5VA 3DYVA 3H18A 1WHTA 2O2IA 1DTEA 2ROQA 4WFJA 3QYJA 2VSQA 4I19A 1UK6A 3ICWA 3KOOA 4BP8A 1LPAB 4LYDA 3AZPA 3IBTA 2WFMA 3GBSA 3C45A 5AI8A 4CI9A 1GGVA 5AM1A 4EUSA 2FUKA 3DL4A 5F4ZA 5JATA 4H7HA 4LXGA 4IQ4A 5JARA 5K3BA 2WU3A 1C7IA 4KRXA 3VISA 4UBMA 5CW2A 1UWCA 4U2CA 4LIPD 2WUEA 1ODCA 1WB5A 3IURA 2DHCA 4ZXFA 4QNNA 4GHWA 5KBYA 4AXBA 3K2IA 4QA9A 5CT4A 3H2GA 2XQFA 1EB8A 1DX4A 1NU6A 4X97A 1H23A 1AKNA 4JYMA 3WIBA 1QTIA 1QIHA 4TPKA 2WTNA 3RK4A 4KRYA 5EHXA 5HF8A 3IUNA 2HU8A 3V1KA 3UUEA 3A70A 3R0VA 5LZ5A 3P2MA 3I28A 5ALOA 4MEAA 1LPOA 1XZKA 3T52A 4Y2PA 5HKAA 4BE4A 3DLTA 2BKLA 1UKBA 5ALEA 3CN7A 3WWEA 1CPYA 2YH2A 4GI1A 4X90A 4JUIA 2QUBA 2XMBA 3M81A 2WG0A 5DLPA 3TJMA 3O4HA 4Q82A 2WTMA 4QDZA 2FJ0A 2VAXA 4RPCA 1IZ8A 3I2JA 4RE6A 1XLUA 3DJYA 3O4GA 4BE9A 3VJKA 1P0MA 1BCRA 3KD2A 2HA0A 5ALMA 1TRHA 1U4NA 4LHEA 2OGTA 3R3WA 3FSGA 2WUFA 1WM1A 5FUMA 1EB9A 3RM3A 3BDVA 3EQ7A 3D2CA 1FFAA 4KE7A 1TAHA 4BVJA 1DQYA 3UUFA 1WB6A 1DT5A 3W9BA 1CUJA 1DINA 2WIFA 4NMWA 1E89A 3WWOA 1YCDA 1ODSA 2WIGA 3R3UA 5EHNA 3LS2A 4LKOA 4G8DA 2BGNA 3M82A 1WB4A 5D3ZA 5JD5A 5DYTA 1CUXA 1EDBA 3FOBA 5ALKA 3I2GA 3QBJA 4C01A 1CFJA 4Y9SA 5CT9A 5AKKA 2DQZA 2ONCA 5T4HA 4F5ZA 2PBLA 5T4BA 4H0CA 1E5TA 1YAHA 1UXOA 2Z5GA 1Q84A 3AZOA 3FWHA 1H2ZA 4KR0A 1H22A 1QONA 5AOBA 4Y2SA 2IIVA 1ZJ5A 4DNPA 3GROA 4INZA 5LZ9A 4HRXA 1W6RA 4PF1A 3ANTA 1L7RA 2BCEA 4FFVA 3H2KA 2OQIA 3NOXA 2Y1KA 3WWPA 1TK3A 1UK9A 2HFJA 4Z49A 3UMJA 3VJLA 5K3FA 4MWTA 4HS9A 1YR2A 4U2FA 3JYHA 1P0PA 5AI0A 3F97A 3KWFA 1HDEA 1R9NA 5FXMA 3WIOA 1JKMA 3TRDA 4FHZA 3G02A 1ISPA 1Y7HA 2C5GA 2J4FA 2EEPA 2Z8ZA 2ZYSA 5DNUA 2B4KA 3HEAA 1MX1A 2CEKA 3D5EA 4CCYA 4OB8A 3QVMA 5IVHA 2WHRA 3AIMA 4BAUA 1MN6A 4C4ZA 2BFNA 1KU6A 2J4CA 5LIPA 5KREA 2ORYA 2XUAA 3OPMA 3CXUA 5CXXA 4EY4A 5ESRA 4HZGA 2G4LA 1J07A 1T4MA 4IH1A 4FNMA 2CBGA 2BJHA 1QIGA 4JYPA 1MT3A 4C4YA 1CUCA 1WPXA 4QWWA 1QZ3A 2C0PA 2ZVDA 5JASA 4J0KA 2XUDA 4GW3A 4PNZA 4G8BA 3CCCA 1A7UA 3MUOA 4A23A 3HI4A 1CIJA 1GKLA 2VA9A 4BATA 5C7YA 4CIBA 1J2EA 4QLOA 1HKHA 4LXHA 1XRLA 5EHQA 4EA6A 2OAEA 1L7AA 1DQZA 1X2EA 2XUFA 5C8VA 3FVTA 3X3HA 5JALA 2XMGA 1XZJA 1BN7A 4FNGA 4EHBA 3ZLVA 3WZMA 4JNCA 2QJWA 3OOSA 5CT6A 4ZGBA 4AO7A 4AN0A 1MPXA 4W1QA 1CR6A 1QLWA 1USWA 2H7XA 4A16A 1RWQA 2NW6A 5DWDA 4XX1A 4AN1A 2C7BA 1ETHA 4QLAA 1XZBA 3S2ZA 5HK8A 5JAPA 1CUZA 4W1SA 5JD4A 2XE4A 2AJBA 4KAAA 1XKTA 3PFBA 4AZ0A 1F6WA 3IUQA 3ZI7A 3IB3A 4P92A 5HFAA 4F60A 3PF8A 1R9MA 4XJVA 1RYYA 4J3JA 3DOIA 1MTZA 3F8SA 5LZ8A 3MGAA 3C43A 4H77A 2VTVA 2B9VA 2HIHA 5AOAA 2PX6A 4H7KA 5BOVA 4FMPA 3M83A 1K63A 3GA7A 4UBKA 5AICA 1BN6A 2AJLI 3D2BA 5BWCA 4N5HX 2I3ZA 3EQ8A 5D3KA 1CQZA 5T4EA 5DYYA 5HF6A 2AJ8A 2GZSA 3PF9A 2C4HA 1JFRA 2Y6VA 4BCCA 3E1GA 1A88A 3H1BA 1J1IA 5HQ3B 5K3FB 2GBFA 4EY6A 5CRIA 1UOOA 4O08A 3OURA 3ZPXA 1W1IA 2QXUA 4DIUA 4OYYA 3EQ9A 3G9TA 5K3AA 3C8HA 1R4ZA 4B7ZA 3V1LA 4NS4A 1TCAA 1X70A 1XROA 2XMZA 1IVYA 3E3AA 4UBJA 4E46A 1XZIA 3F67A 5ALYA 4HXFB 3STVA 1RP1A 4GEGA 2WQZA 1MX5A 5HF9A 4BCBA 1HL7A 2XUOA 3N0TA 4CG1A 3WWDA 4H7FA 2ECFA 1OCEA 3H1AA 1G42A 1ORWA 3QH4A 2WIJA 5IVIA 2QUAA 3C70A 5HCUA 4QEKA 1W52X 4X92A 5T4FA 2HM7A 4OCZA 4CIAA 1M33A 1EDDA 2BUBA 4MQLA 2XQJA 5ALIA 4H18A 5FPPA 4AZ3A 4H7DA 1UKCA 3HZOA 4XWGA 2AJCA 2CKMA 1Q0ZA 2QJRA 1UFOA 4MWSA 4S0XA 5JZSA 2PSHA 1XZMA 5CH8A 1VA4A 2GYUA 3GFFA 5ALTA 2JGKA 3DD5A 1E66A 3W9UA 1LBSA 4B81A 4CCYB 1VOTA 1JU4A 1QJ4A 3WKCA 2RGUA 2JGJA 5ALFA 3D4LA 1GQRA 4FWBA 4EB0A 3NWOA 2FX5A 3Q0TA 4ZV7A 5IKXA 2Z3WA 4IHAA 1VE6A 1BU8A 4Q34A 1K5PA 1XRQA 2I3DA 2XMQA 2DHDA 4DYHA 2G5PA 5AKGA 5AKIA 1N1MA 2WUGA 4BZWA 1ACJA 3WJ1A 3QM1A 3I1IA 1FJ2A 1EHYA 3L1JA 1XZCA 2OCIA 4OB7A 1QFMA 3DCNA 1XKLA 2ACEA 1E8DA 2WHQA 4B0OA 3LP5A 2B20A 3D59A 1AC5A 1CUDA 4WFKA 4OSEA 2I78A 1THGA 3D2AA 2W22A 3AZQA 5AI4A 5AM5A 5H3HA 1JU3A 1XZEA 5DYWA 4KYVA 1MJ5A 4X85A 3VXKA 1BEZA 3U1TA 4L9AA 4K5QA 4GECA 2VEOA 5A7GA 5HQ3A 1HQDA 3G9ZA 3AILA 5ALNA 1XZFA 1QFSA 4BAZA 1N5MA 2HFKA 3O9MA 3C5WP 2ZYRA 2ACKA 3ILSA 5FP0A 2ZYHA 2QKYA 1TCBA 4DMKA 4MXDA 5HFNA 4OUKX 2QZPA 4QDOA 5LP1A 1DU4A 2JIDA 3O4IA 4ITVA 5ALLA 1G5FA 1HLGA 3BL8A 4B9EA 4Y2YA 1A8SA 2W6CX 5DTJA 4ZRDA 2Y2UA 2XI4A 2WFLA 4P08A 4GLBA 3G7NA 2OPHA 4KJXA 2K2QB 4B6GA 2H1IA 4UPDA 2XQKA 3FLEA 1GPKA 1IUPA 5ALVA 3STWA 3WYDA 4WY5A 2I03A 1NX9A 3WJ2A 4PO3X 2VAVA 4CCWA 2OGSA 5AM0A 3PE6A 5FPQA 1JI3A 1SCKA 2JGEA 2JGFA 1Z68A 1ZJ4A 1YA8A 1CUSA 2RHWA 4Y2XA 4FLMA 3GZJA 3W06A 2JGIA 3C6XA 2AJDA 2CUTA 1XZGA 2WG1A 2DR0A 1CUFA 3ZWQA 5ALPA 2OAGA 2XQIA 2HADA 4M0EA 1W75A 4N8DA 2O7RA 3A2NA 3STUA 4PSCA 4G4IA 5CH3A 4FDMA 4KAJA 1QOZA 2B61A 4CG2A 5AIBA 3WK8A 5A71A 2VT7A 4AMYA 2VJCA 1GT6A 2IITA 2PL5A 3I6YA 4H7EA 5AK5A 4FTWA 4DMFA 4BVLA 3RKSA 1FFEA 1GKKA 4DMCA 5C8ZA 3ESBA 1LGYA 3F98A 1VLQA 4X71A 1QE3A 2OGZA 3DYIA 1SFRA 1N8SA 2XB6A 2FJPA 2OXEA 5FV4A 4J0DA 5SYMA 2VJBA 2PKYX 1EA5A 2ZYIA 4M0MA 1JMYA 3H2IA 3SC2A 5HF5A 1CUGA 2QS9A 1W4LA 2XUKA 5CBKA 4EZIA 4XVCA 3ANSA 1CUIA 5AH0A 2VJDA 2ZJ6A 5EIEA 1J06A 4C87A 1K6EA 4UBNA 3WK7A 4N5IX 1EDEA 5LZ7A 4E14A 5LKAA 4DSAA 4AQDA 4GDMA 1OXMA 1VJ5A 1L7QA 3T4UA 1XRNA 4TGLA 1W76A 1P0QA 2BUCA 2HRQA 5DNWA 2XUGA 2XUQA 2HA5A 3FBWA 5IVKA 3O0DA 4YX9A 2QMQA 4WJLA 1O6GA 3K6KA 4EY8A 4MQMA 4AB1A 1MNAA 1MNQA 5EIHA 2CB9A 1A8UA 3QPDA 5E2IA 4W63A 5LYYA 2PSJA 4C4XA 2X8BA 3VDXA 2RIPA 5A7FA 4ZI5A 2Z3ZA 1HPLA 2OLEA 4K2AA 4N8SA 3HC7A 3C6YA 2EDCA 2C58A 2GBGA 1EK2A 3H0CA 3OM8A 4BP9A 5JAHA 2ES4A 4IH4A 3QMVA 1BRTA 3C6BA 5ALUA 5AI6A 2QR5A 2XQGA 3MVEA 1AX9A 2R11A 4U2DA 3FAKA 3STXA 3EIOA 4L0CA 2ZSIA 1KU0A 3DS8A 5AKEA 1IZ7A 2OCGA 5FDFA 4UHDA 3W2TA 5A7HA 3CCBA 1XRRA 2WJ4A 4HRYA 3TEJA 1LPSA 1CLEA 1PJAA 1XZLA 2P8SA 3LLCA 1YS2X 1QIJA 1LBTA 1MAHA 4J0GA 3E4DA 4BRZA 4B82A 1ZI6A 3AFIA 3FYUB 1Q83A 2XDWA 4BRSA 4H7JA 2WJ6A 3B5EA 1AMNA 3CN9A 1WHSA 5E4YA 5ALWA 5AI5A 3WQHA 3S8YA 4UBLA 1UK8A 1XRPA 1I6WA 2XMSA 2ZJ7A 4K6KA 1H2YA 4XIIA 2XMCA 5JANA 4IO0A 1T2NA 1CUHA 2XUJA 3ED1A 3IVMA 4UHHA 3G8YA 3JWEA 5AJHA 2PSFA 2V97A 3FYTA 1QIFA 1XQYA 3IA2A 5YASA 1AQLA 4FKBA 3DKRA 1EX9A 2G63A 5E4JA 3FYUC 4B84A 4HTAA 3VKFA 1G66A 1FFCA 1IMJA 5AK6A 6YASA 4Y2TA 2HU5A 2GBCA 3R3XA 4EY5A 4M0FA 3HXKA 4UUQA 3WWCA 1QIKA 1S8OA 3EF3A 1H2WA 1EK1A 2XMRA 4X95A 3C6ZA 4DNOA 5I9IA 3WA7A 4JH0A 3E0XA 1B6GA 1CVLA 5HZGA 4GXNA 2Y2VA 2QOEA 5AKYA 1N5RA 3MUNA 5ALRA 4QDXA 2WLSA 5AM3A 3FYUA 4J0IA 2V9ZA 3V9AA 5CH5A 1ZI9A 4K6GA 2WFZA 4UHEA 1K4YA 4J0CA 3PDCA 4KAFA 3G0IA 1VZ2A 1AZWA 5E4TA 3WK9A 3BIWA 3H2HA 5ALQA 1DWQA 4HVTA 4UHCA 1BE0A 2RAUA 3IUJA 3WMRA 1LPNA 3F9CA 4IH9A 4X6YA 5DTIA 2H9YA 3BE8A 5DJ5A 1MAAA 1JT2A 4UFPA 3G0BA 3O4JA 3OC0A 3SWWA 1VKHA 4EBBA 2QM0A 3VVLA 3QPAA 5JIBA 5EI5A 1DWPA 1QTRA 4BVKA 1K8QA 1XLWA 1LPBB 1GXSA 5K3DA 2DQYA 5FRDA 1JMKC 2QRUA 2YASA 5EGNA 4MYDA 3DEAA 1ZD3A 3WLAA 4X00A 4GWLA 1XZAA 3ZV7A 4G4JA 2HHAA 1WPRA 2Y6UA 2BUAA 3ICVA 4NVRA 4OU5A 5EHZA 2E3JA 3PI6A 1TIBA 3B12A 3HLKA 3H04A 4J0HA 1CUBA 1ZICA 1QIEA 4KEAA 5AKLA 1LLFA 4PSDA 3D3NA 3YASA 2HA7A 4J0JA 1WOMA 4MEBA 4V2IA 1ZD4A 4DLNA 5JAUA 4L3WA 2V96A 2R8BA 1ZD2P 1QIIA 2WU4A 4QE3A 4B83A 1JJFA 1FFBA 4L72A 1GPLA 1QIMA 1FFDA 2RONA 2J3QA 4AO6A 4DGQA 3W05A 4QZVA 4BAGA 3FCXA 2JBWA 1AGYA 3FLAA 3I2HA 1F0PA 1UKAA 3R40A 1Y37A 5JZ9A 4YASA 2C5FA 1XZDA 3C8DA 4Q3LA 1JJBA 4W9RA 3IULA 1CUWA 5EIAA 2EDAA 3I2FA 1WCYA 1R1DA 4E11A 1F0NA 1U2EA 3KDAA 2DSNA 3WKAA 5C8XA 5AOCA 2XLBA 4E15A 5AM4A 4NZZA 1ACLA 2PPLA 1ZD5A 3WL5A 2C0QA 1O6FA 1EINA 4UHBA 4G8CA 5FKJA 1E8MA 4ARBA 5CXUA 3A6ZA 2XMDA 4BDSA 4I3FA 4UBOA 4PW0A 2DCMA 3G0GA 3WL7A 4N8EA 5BV7A 3LCRA 2J3DA 4ROTA 3AUKA 1EVEA 3ESCA 2XT0A 2XUIA 1UZAA 1QO9A 4ZWNA 4BDTA 3OG9A 1BS9A 2OG1A 2WIDA 2V98A 4C6HA 2PM8A 3DOHA 3DDUA 2ZJFA 4QDTA 5JAOA 1SOMA 1AUOA 4BC1A 2UZ0A 4FBMA 4B0PA 3K9BA 2QXTA 1F8UA 2WG2A 1GQSA 1SC9A 3I6MA 3NGMA 1U65A 1VE7A 1R50A 1TKRA 3D0KA 3QPCA 2AXEA 3G0DA 4WY8A 4ZREA 5LZ4A 1MX9A 1R88A 4Q1VA 2IX9A 4DNFA 4BTVA 1XQVA 2JGMA 2RI6A 5KWIA 2DFPA 4K6HA 3G9XA 5A62A 3AIKA 4DSZA 1BROA 2VQ6A 2HA2A 1YAJA 2HDWA 4X91A 1JJIA 3RARA 3VJMA 5FOQA 3GELA 2OCLA 1VA5A 4U2EA 4X3CA 4DM7A 2HA4A 4FLEA 5JD6A 1IUOA 4KE6A 5ALJA 2D0DA 4UBIA 5LKRA 4DNQA 1ODTC 1SCIA 3WL8A 3RLIA 1CUVA 3I2IA 5CTAA 1OILA 4G9GA 3WK6A 1LPMA 3DQZA 2OCKA 2XLCA 1VZ3A 1U8EA 5AP9A 4FFWA 5HK9A 5FLKA 1YASA 5AKXA 2VF2A 4HAIA 3F96A 4LYEA 4Y2QA 3AINA 5I8PA 4B80A 2GYVA 1VXOA 7YASA 4BZZA 3AIOA 1CV2A 5ALHA 3OTQA 4WDQA 4P9NA 4WDRA 2WHPA 1PV1A 5JYCA 2XUHA 5AI9A 4WFIA 3HACA 3STTA 1EI9A 4OD0A 3BXPA 4ETWA 2YYSA 3WK5A 1KEZA 4CG3A 2YXPX 4Q3OA 1IUNA 3LIIA 3BWXA 1EH5A 4X94A 1CUEA 3PUHA 4I4CA 4AX4A 4WCVA 4Q05A 3BF8A 1ZIXA 4X6UA 5HKBA 3B3QA 3HJUA 1CUUA 4BYMA 3I1YA 4KE9A 4U2BA 1MU0A 2ZSHA 5K5EA 5A2GA 4PSUA 3ZLTA 3WZLA 3HRHA 3AJAA 3I6ZA 2QT9A 4UFNA 1LZKA 1BCSA 2WILA 1R3DA 1GPNA 2CJPA 4OPMA 1TCCA 2QTBA 2CZQA 2QVBA 4Y2UA 3O95A 3D7RA 3PICA 3R3ZA 2WIKA 3FSGD 2XUPA 1XQWA 4ZV9A 4PQEA 2WFLB 5EFZA 3A2MA 3U0VA 4BB0A 4DMHA 1UOQA 1VXRA 3TGLA 3R41A 3PFCA 5KWJA 5AKJA 4Y2JA 4BCDA 5LLSA 2WKWA 4G4GA 5CT8A 3JW8A 5AM2A 4KACA 3H19A 1E3QA 1Y7IA 3QITA
chains in the Genus database with same CATH superfamily
1FX0A 1NWHA 2QMUA 4Q02A 4A5OA 3G2IA 4QXPA 4B6EA 2FUG1 2UV8A 3KPYA 4GX0A 1U0GA 3KB6A 4F5WA 1YVUA 3VU9B 4AJ2A 1SCDA 2ZAMA 4E4YA 2O3UA 2QG4A 2EGUA 5FCDA 1TUIA 1L1EA 4NENB 4DG8A 3D4IA 3BRWD 4QFDA 4S0ZA 2FR8A 4E1AA 2VN8A 4BO3A 3FCEA 3SZ3A 1IWPB 1MQ9A 2ADOA 4MWCA 3GOHA 3P2JA 2QU7A 4D9JA 4H35A 4DR1B 2EBUA 3U4CA 3B1XA 2NACA 4W1RA 2JD1A 4L95C 1CYDA 5CHYA 1N2JA 5IX8A 3L02A 4QYIA 2GOYA 4P31A 3JU3A 3EG9B 4RMHA 3AONB 3DKKA 3FFWA 5JCJD 4YAUA 4MH0R 3G2QA 3HDTA 3HEMA 3MTJA 3OOEA 5ALNA 4F2DA 1KS2A 1E2HA 1T8UA 5C32A 5AJXA 1H6BA 5HRCA 1C7JA 2IW1A 4JP2A 3ESAA 1UQTA 3JQEA 2RHBA 2ZIXA 1VHQA 3H86A 1YMUA 2R7AA 5K8IA 3HKEA 1JF8A 1SZJG 3SG0A 3QX7A 4EB6A 4LJRA 3TI9A 5A4FS 5DHFA 4F3CA 3EFHA 2GYWA 3GVXA 3I2KA 1OFHA 5I9BA 3KQKA 4U2GA 4GMHA 1G38A 4A82A 3GLIE 5CM8B 4CFZA 4H4CA 4L8GA 3N2GB 1RLUA 4UFOA 4XQCA 4Z4GA 1UF9A 1Q95A 3NVAA 3PIDA 4B6QA 3WB1A 2YZ2A 2E85A 1U8CB 2GH1A 3O47A 1SBZA 2FXVA 2K2WA 3V48A 3MSXA 1Q7GA 1G3UA 3EZXA 3DBRA 3OX3A 3UW1A 1DQRA 3N2YA 3AJEA 3IP8A 4FI3F 4X24A 3KB2A 4UMFA 3KXLA 3RVNA 1I4TD 5JADA 3TTVA 2UUBB 3FDIA 4D8VA 1AY0A 4ZEMA 4HO1X 4RJJA 4BNXA 3TRHA 1O5OA 4GPBA 3JWIA 3MOIA 2ZE8A 1AUXA 1ZUWA 5C80A 4DJEC 3NHMA 3IVAA 1DIBA 2ST1A 2WM2A 2X5JO 1SRQA 1GPYA 3GLQA 1EA7A 4A6PA 3QKTA 4HN9A 2PZMA 1R00A 4Y7DA 4FCVA 3ORYA 2JEYA 3KXPA 3DL7A 3FW1A 5BQPA 1E92A 1FYVA 3KJXA 4IEEA 4N82A 5JZOA 4PAOA 3FWYA 4LHZA 2ZWMA 1W93A 4B73A 3HO8A 3P19A 4UHFA 2A35A 3JAKB 3V1NA 1J8QA 2VLIA 1H4QA 1QE0A 5AMXA 1HGXA 1P1FA 4HAXA 3DMNA 3VO2A 4JKYA 4RZQA 5KYVA 1H2XA 1U7WA 3GCXA 3CONA 1NMYA 2PY6A 2HLDA 3R3VA 4IIBA 5EMLA 3GI1A 2M98A 4B6RA 5EJ4A 1Z88A 1C1DA 2MMGA 4OGLA 3KQLA 3ZV6A 2V8OA 3DGEC 1WTAA 3H4VA 4QGBA 4JB8A 5GGYA 1YA6A 1TD9A 3GDGA 3PT9A 3MTQA 2A84A 4J4BA 2JEZA 4FYIA 4R41A 4UPEA 2AN5A 1EIWA 4E22A 1DT3A 5KNDA 3MWKA 5CLJA 3SM9A 3TLXA 1JIJA 3OZIA 1M34E 4FE7A 4BNMA 1GLGA 3BGIA 3S2IA 2VYND 1I6KA 4W6QA 4RENA 4E2FA 3GA5A 4D9CA 1CY8A 2G70A 4YHHB 1IJFA 3HXTA 3CKYA 3GLUA 2Z6UA 1X2BA 1ZL0A 2Q9BA 1XU4A 5KHAA 2XZOA 4PN7A 3GRKA 3I9MA 2RHTA 3RIGA 2BKUA 3OETA 2OAQ1 3WNCA 2O8FB 2AR7A 3GAMA 1FBTA 3MINA 4M1SA 1ZQ9A 1JKIA 4M53A 1FRVA 2AFIE 4KO1S 5EQFA 3VM6A 4Z4FA 1OBVA 1YB7A 4BNNA 4FGJA 3VH1A 5KQPA 1CRLA 1T5SA 1XFDA 5JG7A 4AMBA 1E5XA 3FCUB 5KTPA 4S04A 2H4WA 5IKMA 3E9EA 2BFDA 4LFAB 2GBIA 3TF5A 4EA7A 1EXNA 4AY6A 3G0OA 1DUIA 5H16A 5E2AA 1U80A 1WDTA 3RYTC 5B6JA 2Q3HA 3EXEA 3RJZA 5AW0A 4WNIA 5JW6A 4BY9E 4R1OA 2VK2A 3WZ2A 2NU6B 2YXNA 5KTMA 4TTIA 2WQ6A 4DA8A 3K0BA 5CM2Z 3UBTA 2PGNA 4OYLA 2R96A 4PNEA 4RY8A 1TT5B 1IY2A 4GP6A 5ALSA 4D0SA 4UNNA 4I1OA 4OQQA 1K8ZB 2H5EA 1FSZA 3EVCA 1P29A 2IYEA 1NW9B 3F71A 4EL0A 4RTMA 4EJ2A 3SNHA 4CLRA 4ARUA 3DMGA 4OBXA 4XD7D 3U7RA 2P91A 4DXHA 2NTJA 1KAMA 1E5DA 2ORIA 2ATVA 1VJ0A 4HR7A 2KX7A 3HO1A 1EKXA 4PHHA 1AKQA 1R0SA 1U4OA 5TNXA 2A57A 4X1IB 3OOJA 1PJQA 1RTKA 2PD6A 2AG5A 4FLFA 2GZRA 3IIIA 5ALZA 3HJCA 2Q3DA 4U6NA 1A9OA 3WK4A 4LPSA 3HA5A 1EE1A 4RV9A 1ZVQA 1ZGCA 5DGDA 5A6VA 3JZFA 1WBJB 1XTSA 1XEAA 2JGLA 4AO8A 5KNLA 3CLUD 5IK2D 3ETDA 2F3PA 4LGCA 3HN6A 1ORVA 2WWFA 3M6AA 4GXTA 3GGSA 2DC1A 4IKOA 4JLJA 1NM5A 3LDHA 3DA8A 3GZ4A 1L5HA 3EVFA 3SX4A 4AFNA 2WFAA 2KQUA 3EFOA 2DPHA 2GESA 2WF9A 2VP4A 3KWJA 4B2YA 3KE9A 2FPIB 3H1EA 5CMLA 2CWWA 2YZNA 1YJBA 1NUTA 4FFRA 1T0UA 2H2DA 4NK5A 1L5RA 4LJKA 4ER3A 1Z2AA 2J45A 2VTDA 3WLRA 4HLUA 1PEYA 3TXYA 3R44A 2RB4A 1E1MA 3KKOA 4Z2AA 1G5TA 4L28A 3M9XA 2QMHA 1GG2A 2ZSDA 5BWMA 1KK3A 2VJKA 5H4HA 1AURA 1QOQB 2PSDA 1U8XX 2VRCD 3OJWA 4M6WA 5SZKB 2PUWA 1FTNA 4YC7A 4U5XA 5K3CA 3SF0A 5JO0A 3D7MA 4BEJA 1Z5OA 4RGVA 4CZ2A 4LWQA 4FFNA 1PQWA 4Q01A 3PYLA 2FPSA 3RABA 1Y9DA 1PEDA 2HF9A 1RJEA 2CJFA 1J99A 1X1TA 2R7KA 2NZ2A 2L17A 3FF1A 3HSYA 3HBLA 4W8OA 4YRQA 1DE0A 3X2FA 1VECA 3QMMA 4O4HB 4UVHA 5AK3A 4KR9A 3D43A 5DSZA 5JZBA 4RPGA 2IZOA 3ULKA 2XIQA 2E37A 4O8CA 1VE3A 4A8PA 3PXUA 1USGA 1S2OA 3HK2A 4EY7A 4N3CA 4M89A 1W4RA 1V7ZA 1Z8NA 3AXTA 1I4DD 3DT6A 2ZUWA 3KDSE 5CYOA 1UWLA 4Q9NA 2IPLA 3VU3A 2G08A 5K9ZA 5LQRA 4UQOA 3QEMA 2EJUA 1VP9A 3TQRA 4RNCA 1JPJA 3WKBA 2DBVO 2HCRA 2ZI6A 4HAYA 1QFYA 2FZKA 2QN3A 5DRTA 3KG2A 4EHFA 4AUEA 4WLEA 3N59A 4V0QA 1A5AB 1LZLA 3LLVA 5K45A 1OV6A 1QH8A 1ONNA 2OYCA 4J91A 1PNVA 3L8YA 4HFNA 3WC4A 3OZGA 3G89A 2YV2A 4TYQA 5ALDA 1JH8A 2W4QA 2Y1FA 4R2JA 1D6JA 1WKVA 4RJTA 3DXYA 3JVVA 5C0OE 4C76A 3GW8A 2J7KA 5EIFA 1YA4A 2W6JD 5DNEA 1ILEA 1SQSA 3QWHA 3QX8A 2AUTA 1G2PA 3K53A 3C8ZA 1YE3A 5BYBA 2WTEA 1DXQA 4CKWB 3ND5A 2YQ5A 1VSVA 4G67A 5D3QA 1YOVB 4HBGA 4XUCA 1NVGA 2O1SA 4XE5A 5JZMA 4M9CA 1KI6B 1KO8A 1Z2PX 2GEVA 2XBLA 5D5QA 1UJMA 4C6TA 4PCVA 5FL7D 1GG8A 2BZGA 3M4NA 1TM4E 3P9NA 3BFXA 2HYDA 4NNOA 1PD1A 3BXEA 2ACWA 1P9OA 3AY0A 3PQ2A 4RORA 4ENPA 1BS1A 1T10A 3FFBA 3FSJX 3QXHA 3R3YA 3Q5DA 4HBZA 2ERCA 3U4GA 1EX7A 3M7IA 5AO9A 3ZZNA 2YRFA 1AKVA 3TKLA 3NTXA 3KSRA 4P84A 5C3UA 4YJHA 4JOSA 2QXYA 2ZBQA 1F4VA 3I04M 1CUYA 5AK4A 4ZVPA 3WQBA 4D4LA 1UAAA 1Z2NX 3I64A 3EXG2 3KYCA 2VJPA 3ZCSA 3LP6A 3B1FA 4UCQA 2NUAB 3JR3A 3WLIA 2QRLA 3QV1A 2P65A 2YWHA 1HBJA 2I91A 3DE4X 2IP1A 3UA3A 1TJYA 5A3SA 2WAYA 2Q1YA 2D8AA 4JJ4A 3F6EX 1FU8A 4NOKA 3ETGA 3OE4A 2JAXA 3RB8A 1RQRA 3CVWA 1DEHA 3SYKA 1KP3A 2P69A 3ZK7A 1QAQA 4AICA 5IC5A 1XP8A 3BTSA 3KQHA 5EQTA 3TR0A 2IZ6A 4AMVA 4RZXA 5EKTA 2WHEA 2W6MA 5ITZB 2OO7A 4WBNF 4Y6PA 4DV7B 3CVJA 3GEEA 1LI5A 4ZKDA 1TA9A 1X7GA 3EW9A 1G19A 3P9SA 3DEYX 2VDMB 4OK6A 4G5GA 3SZRA 1D2MA 3C45A 3GBSA 4MW5A 3ZX5A 4BFTA 5CLFA 2I4TA 2VDPB 5BMOA 2FUKA 5F4ZA 4LXGA 3TZCA 4YUZA 1C7IA 2OBFA 1N0HA 4MVWA 5CW2A 3MB8A 2B1QA 1F2DA 2OE2A 5E7JA 3W34A 4RGQA 2WYHA 3CLUC 3AEZA 4UMDA 4TRRA 4YCCA 3DD1A 3HJGA 4GRDA 1JIVA 3LCJA 3VR4H 1TQ8A 3IURA 1UJBA 4KJZA 1RQ7A 4OATA 3QF4A 5DSTA 2EKLA 3W1WA 4V1CI 1VSUA 2F9LA 4Q15A 3AEKA 3VPGA 3U3OA 4AG3A 2YZGA 2IYSA 3D8BA 3DVSX 4QA9A 1YZYA 1OHHA 2O5RA 2XQFA 3TQQA 3EWAA 1OI7A 3PUKA 5K51A 2GM4A 1NU6A 4OX9B 3LTEA 3OCVA 3TW8A 4MPJA 3AW8A 4OOEA 4CF7A 1H23A 4URFA 3EIQA 4M9XA 2EWMA 2KW5A 3ANLA 2JJ1A 3PCXA 5TF4A 3WGKA 3WIBA 2VYVD 3MMNA 5ITWA 1TUBB 1WULS 2FZGA 3SQOA 3I83A 1QTIA 2GM5A 3FCOA 1EUCA 3BOSA 3KQQA 4R2IA 5ELMA 5J63A 1Q1AA 3N6VA 1U2SA 4LUCA 3J7AC 4OHBA 4B3HA 1U9JA 5LA6A 2VHWA 3C4QA 3TOCA 3KSDO 1ZZEA 2XA2A 3B2NA 1GV1A 3F6SA 1DKLA 3EUWA 1WZ2A 1E2QA 2IXDA 4V0OA 5F98A 1L1FA 2J9FA 3ZWNA 2R79A 4HQLA 1PR2A 4BRUA 4QQKA 4MEAA 2MSEB 2OG2A 3HXOA 3TOSA 3OE5A 4KSBA 1YS6A 3C3KA 4BMPB 2QSZA 1R37A 3UXEA 1XFAA 2WUVA 4QRDA 1P0CA 2FPPB 3IKTA 1LLCA 3N3AC 5JJKA 5IMBA 1JKJB 3PJFA 2PUFA 4X6LA 2O8BA 1QE5A 1VGQA 2HK9A 4QYTA 5DTEA 5HKAA 5KC9A 2VHEA 3UVEA 5LYJB 2DLDA 3DLTA 2BKLA 1C80A 4L5BA 4XLTA 3BRSA 2R84A 3O73A 4NJMB 4FONA 5JHHB 2UVQA 3QF4B 2B6NA 2FH5B 2RAPA 1COZA 1W34A 2DETA 4M8KA 4IKEA 1DDIA 3BWVA 1VG8A 3NDBB 1BX0A 2ZYAA 3OZEA 1IG0A 1O54A 3BH0A 4J2HA 4KG7A 2B2XA 4NAHA 3UJ3X 4BFYA 4EFKA 1C3OB 5JVDA 3FZGA 1EJ6A 1Y3AA 4MRMA 5BN3B 3ROXA 4QDZA 2VAXA 1IZ8A 1DCMA 2YYYA 3IAXA 1BDBA 5EE5B 3LMKA 3ETNA 3DJYA 3O4GA 2E18A 2YWGA 3A6FA 4GZ5A 4JJZA 3M9WA 2Q7OE 2FHSA 3HZRA 5DULA 3GV0A 4YMHA 1P0MA 4IXDA 2X0EA 4I5DA 4AY5A 2P35A 4MVJH 2HA0A 4C4AA 3HCRA 3FGOA 4QBGB 3DMHA 5GV7A 2VDQB 3GWGA 1HFEL 2OGTA 3IHKA 3L0DA 5GY7A 4ALMA 4EPRA 2O54A 5T8KC 4LE1A 1J8VA 4XYGA 3AKDA 3ONEA 4EGQA 1XTTA 4C03A 4NK4A 1FMTA 1WM1A 3KOZA 1SOVA 3DF7A 2GN8A 1K7CA 1UXGA 1OD6A 4LWPA 3N0WA 4A27A 421PA 4BNTA 2VDNB 1Y33E 2PMCA 1CY2A 3HE3A 4R2HA 3I9OA 1Z29A 1J2TA 3FPLA 2ZK7A 2OAP1 3KX2A 3WXMA 1NXPA 4UVGA 4NCNA 3IJ5A 3SKXA 3VYTB 5BQOA 1LRKA 4RZ2A 2C88A 1UBEA 3OCZA 3SC3A 4RELA 2EW8A 4E94A 2VHYA 2IHKA 1A5TA 1SBCA 3UUFA 4FFBA 3VX4A 3K1YA 2R97A 1V1RB 2XYVA 1JDJA 4G23A 4K40A 4QOHA 5IAEA 5BSGA 1DINA 2JVIA 4NMWA 6Q21A 4YAJA 3EIHA 1ODSA 2WIGA 5EHNA 4DLSA 3AERA 1UPTA 4YPFA 3OFNA 3EDQA 3Q4GA 3U9TA 2AB0A 2WBLC 2MMCA 1MZVA 2Q2QA 4INOA 5E3JA 3Q3HA 3TFQA 1WB4A 4NF2A 2QQ0A 3SN6A 1EQAA 1RZVA 3SICE 1EDBA 4MV1A 1GTVA 2OB1A 3BK7A 1QVRA 3M6UA 3TX2A 4YXFA 3EC2A 3FOBA 3FWKA 2R6HA 4WXYB 1NVWQ 4B1FA 3X1ZA 2G28A 5IVPA 1TO6A 1IEQA 3I2GA 4MQBA 3KL4A 2XCSB 1JKJA 1FJXA 5FULA 1W46A 1Z5VA 1UBNA 1UJ5A 1IUKA 2J0UB 1PEAA 4AD8A 4C01A 4OMUA 2DQSA 5LP6A 2VBGA 3TLCA 1ZJWA 1G2OA 3OOYA 4HN2A 5CT9A 3ZHYA 3SYTA 3AUSA 2J6CA 5T4HA 3W77A 2WWYA 2WP8J 4UXJA 1FP2A 1UKYA 4NYMQ 5JBIA 1UXOA 3BZUA 4O4IF 2FMHA 3IMGA 3OU7A 4F7WA 4I2VA 1SXJE 2W9XA 2CLFB 4BFUA 2GK7A 1V47A 4EG6A 2KI5A 4X7MA 3NWEA 4M46A 4TMTA 4MSUA 3UHPA 4E07A 2ZREA 2B3DA 1H2ZA 1XX6A 4FU0A 4LS3A 5AOBA 5FI5A 3AM5A 3GROA 3N76A 4DNPA 2NZVG 4F4CA 4BX0A 3MRVA 2E0IA 2N1MA 2QLJA 3PD0A 4PEVA 3GQVA 1W6RA 2HDOA 4DVJA 2JJQA 2C4NA 2VJNA 2W2OA 3UFXB 1G1MA 1VLVA 4YRSA 2JLQA 5D84A 3UC9A 3AYXB 4QOFA 2QAGB 3S70A 4EKYA 1XI2A 3H2KA 8ATCA 3HYCA 2QTMA 1O4WA 1B8NA 3NOXA 3WNQA 3WGGA 2C1ZA 2GEKA 2VJMA 4BNUA 4WTOA 2DBRA 1RAHA 1A9ZA 1O8BA 3TL6A 1UK9A 2RHHA 3AF2A 2F3RA 3DHEA 3GNTA 1OZFA 1W85A 4XW2A 3WLLA 3EEBA 1I7DA 3UMJA 3VJLA 1M2HA 4INPA 5K3FA 2BBWA 1YR2A 4I1UA 5I01A 4RK5A 1S2NA 2B8WA 2Z8YA 3B9BA 1TGVA 2N0SA 2O0MA 5CVUA 4BFLA 1KXJA 3JYHA 4ZDIA 2NTYC 2VCHA 3I01A 4Q3AA 4AJ9A 1B0ZA 3F97A 3D4OA 3IBGA 1VIDA 1MABA 3FB4A 3T5PA 1NYTA 3CO5A 3BWMA 1M74A 1SHJA 3ANMA 3CT4A 3Q88A 4XFJA 1A1SA 3JRNA 1T1EA 2BF4A 3FFTA 4K1LA 4MJ7A 3RFCA 4FIDA 4B7AA 4F8YA 3TH5A 4A0SA 1WF6A 3GN1A 2J4FA 1NT2A 4Y0VA 3KUCA 4HDSB 2ON6A 3EVGA 3FR7A 5U4QA 2XGJA 2VF7A 1LD3A 2J3IA 1MHTA 5E7QA 2C7GA 1YQTA 2GPBA 3OCJA 3U3DA 5CDUA 4W7SA 5ITZA 2O2SA 2XKKA 1NOKA 3DDHA 4YRCA 2EWVA 4S05A 2NLOA 1B6TA 2XDAA 3O5AA 2IQ5A 4GBMA 1NQAO 2FVXA 3CF0A 2ALJA 4OJQA 2HJ9A 3ZY4A 2G8NA 1JV2B 4CLRB 2O2CA 1IMOA 3CLSD 2BFNA 4CKXA 1T8WA 2R6GA 2J4CA 1CQPA 5EC8A 3IE0A 2NUPB 4F2PA 1YNOA 2GF0A 3I4CA 3L6UA 1K88A 3AI7A 2LDBA 2IY8A 1IJKA 1B00A 1YBHA 5G02A 5LNK1 4HJRA 1PJ2A 2KMLA 5JAQA 3HNOA 1HQYE 4M0CA 3RWOA 4A0QA 1CDZA 3OJCA 4EVIA 1XD8A 1ZU4A 3CXUA 4P2BA 5CXXA 4MGYR 2E7ZA 3EXFB 3DKVA 1Y4AE 1NOIA 2X15A 1NKSA 2DFTA 4XVHA 3KS9A 5L9AA 1KO4A 5B7NA 2B4YA 5EHIA 1T4MA 1NULA 3K30A 1IJBA 4DMMA 1I8TA 2FOIA 3OLCX 1C9EA 1IE3A 1QIGA 4JYPA 1HDXA 3BAFA 3KUXA 1KAHA 1MXFA 1WXDA 3EGWA 4BKRA 1CJVC 4OI2A 2C0PA 4O2BA 1VGVA 2DQ4A 2AFHA 5EZ5A 2IYFA 2W0SA 3M3HA 4OHWA 1OGYA 4YMWA 5EXTA 4X44A 1KDOA 2XUDA 4PAGA 1EWQA 1BWQA 1TM7E 2QRVA 2PRJA 2EG9A 3LAWA 2V55B 4M6WB 2CD9A 5M3BA 2Q9AA 4LHXA 4YBZA 3VVBA 1C4WA 1N6NA 3DDWA 1MG5A 3MUOA 5D3MB 3VPBA 2XOXA 4A23A 1SULA 3PRHA 4HH3C 4JUAA 1VL0A 1XD2B 3FWZA 2VA9A 4XPIB 3G5TA 4NBTA 4HYTA 3TKAA 3GLTA 2X14A 2YJZA 3AL0C 3RNLA 1ICIA 1RKXA 2QROA 3K2BA 3OZUA 1HE1C 4NL4H 2XADA 2PFGA 4R8MA 5J59A 4BATA 4A8JA 3GMDA 1FS6A 1C3XA 1J2EA 1P2SA 4CEHB 1FQJA 2JB9A 5L51A 2O6HA 5KS2A 4PS1A 1XRLA 1ZMTA 3O8DA 4ALKA 2J5XA 4JJKA 3D31A 4QPPA 1V7CA 3NXKA 4PU0A 3EJ6A 4DWOA 4M9RA 1WCV1 3IMEA 4MR8A 3WFZA 3MJDA 4WPGA 1L7AA 1Z07A 1TK9A 1U8AA 3PVCA 4PBSA 4TX1A 3ZYCA 1FLDA 5D2CA 4L0QA 1RWOA 2ZGVA 3SXPA 1IVSA 1W88B 3BWCA 3NU1A 3ZHRA 3W4JA 1P61B 1HEUA 4HC4A 2BGWA 3OLZA 4RH1A 3X1XA 2OBYA 4IJVA 3Q9UA 4EAQA 4TXHA 1TO2E 2GRJA 1W88A 3CW2A 1QWSA 4PSVA 4EHBA 4EZBA 1O0CA 2HGSA 2C1XA 3S1AA 4D3YA 2NNLD 3LUAA 4QGGA 4E5YA 2QJWA 2H52A 3BAZA 3IL2A 3PKZA 4QVKA 4Q37A 1KI1A 4ZGBA 3KT0A 4LMRA 4AN0A 4HGZA 5KI6A 2R44A 1IPHA 1MPXA 4L6IA 2NU6A 3GO4A 4G4SP 3O26A 1CR6A 4TWBA 1QLWA 1CZLA 1K5HA 3DBRB 1P1RA 2H7XA 3C7CB 2G3YA 3F6RA 3ICPA 3Q9SA 4ALIA 1N0IA 4A16A 1RWQA 2EYQA 5JNTA 1PVOA 1MMFB 3IJRA 3K0FA 1DTWA 2D1TA 3MMZA 4F8JA 5DN6D 1BJTA 4CYMA 1W8DA 4RHEA 4PGAA 4ZYWA 1ETHA 4BO9A 3ED5A 3ABZA 3OM9A 4U3JB 5EEHA 1F06A 3WQSB 1OMOA 4AY3A 1S7GA 4E7PA 4ND4A 3RRBA 1ABEA 5JAPA 1YKFA 1NVXQ 3CF4G 4BKOA 4KHPB 4YRMA 4J0EA 1IBCA 3HKEB 1FS4A 2F8MA 2NPIA 1LBQA 1J6UA 1Y4ZA 2ZJ3A 3P1JA 2I62A 3PFBA 3QHPA 1FMFA 3KQOA 2BGLA 1LW7A 1TE2A 3WYFA 2R87A 2FSUA 2BKEA 4CU2A 4XR9A 4LAFA 1P39A 5HFAA 4Y30A 2IV3A 5JXHA 5LOVF 4MV8A 2P79A 2H11A 1DOHA 1QZZA 2J08A 3KVYA 3G68A 3RS8A 1NQVA 3TLEA 2I8CA 2QVGA 1I7SB 3AHJA 4XJVA 1X7YB 1TM3E 4EW3A 5ADVA 4U0JA 2XGSA 3SYNA 1QMPA 2BTQA 5HA5A 1XVLA 4ZC1A 3THRA 2FEKA 1I33A 5DN9A 4ZTUB 1OA1A 2B9VA 3IXLA 3G1WA 4Q7QA 3AHIA 4G4SO 5D5PA 4FFOA 4DHEA 2XQVA 5DM2A 1VFNA 2PH1A 4MYRA 4YAEA 5BNFA 1QLHA 2EFYA 2QRGA 4PYRA 2RGEA 1G5RA 4DCMA 1KMIY 3ZVLA 4P5DA 2EQBA 1A04A 2WKRA 2XTNA 3HKBB 4WOPA 2DXIA 2QRJA 2PAFA 1ZGJA 3IOMA 5HYVA 2WSMA 4C4SA 3ORRA 3V2HA 3OEHD 3RHFA 4S3MA 4P4SA 1V0JA 3LK6A 1PG5A 1L4BA 1QOPB 2NP6A 3I9NA 3U17A 1NKTA 5B1IA 2OENG 2P5SA 4YA6A 3EXG1 4W5WA 3GLGE 2CHUA 3PQ5A 4MRNA 3EQ2A 4ZT4A 3EQ8A 1QR6A 4CJXA 3H5WA 4ZICA 2JCXA 1C7QA 2ZRQA 2GJ8A 5CFPA 1X1RA 2BFEA 3GUVA 2OHGA 3HJAA 5DI9A 2Q4OA 3PF9A 1SCBA 4M0PA 4CL2A 4C4OA 2QTZA 4P0PB 4LK3A 1Y6RA 1HDCA 1WBDA 1MB3A 4A91A 3SZGA 2B7CA 4LOJA 2A5LA 3ZDCA 3U6BA 2OO5C 4KV7A 4BNZA 1JR2A 4X1YA 4EI9A 5HXAA 3KYJB 2R1VB 2PTGA 4F6LA 1NOJA 5K3FB 1T0HB 3WOVA 4A0FA 2I4IA 3LW7A 1V7QA 3M89A 3Q85A 4J07A 4IZOA 4M0LA 2G80A 3BWBA 1N8NA 2PRIA 2Q9CA 3DBIA 1UOOA 2ZETA 1U2GC 2W5UA 3WLOA 1EM8A 4K0KB 5KSOA 5EUMA 4IDDA 5CK4A 1HDRA 3F4BA 1TZCA 1P9LA 4JU8A 1QKIA 1T0PA 1U0SY 1AK2A 2QX6A 2XT6A 4DE5A 2GMWA 4OYYA 1W30A 2XX3A 2J3KA 3CR3C 4NJEB 1ST3A 2W11A 1N3YA 4LY9A 5FQOA 4X3OA 3KR1A 1F3OA 3T1HB 4KR3A 3WAJA 2CN1A 3GXOA 1X7YA 3KJNA 3SKYA 4ZZIA 2VRWA 3TIFA 1TCAA 4PTLA 3VVCA 1KHHA 1X70A 2O23A 3EMDA 3FETA 1M8KA 3KJHA 3MTBA 4FHGA 1IVYA 1J0CA 1OKKA 2ZJ5A 1DLJA 4YDHB 4NCBA 1SBNE 2YWXA 4IPTA 1WXWA 5F5XA 4EPXA 3B9PA 4MQ5A 5JQGA 4F46A 4BQNA 1SC1A 4HX5A 3V80A 2AG8A 3UANA 1AHNA 4O2BF 4IDFA 2G9UA 5MN5A 3L7DA 3LBAA 1PWYE 3HUEA 5EWJA 4F3RA 3I9V6 5L95A 1RXWA 2IOQA 3PQ6A 4RZUA 4C06A 4RLQA 3SFZA 2C0CA 5JAZA 3HB1A 1KIMA 2FR1A 1E18A 2B8EA 2F17A 1PT5A 1VFPA 3H5RA 1U3FA 4OQZA 3GRPA 3UTCA 3Q5GA 1PNTA 2ECFA 4AMGA 1BDMA 1ZRSA 1NRJB 2F4VB 4ESOA 1LVUA 3ZGNA 1OCEA 1E58A 2V6FA 2QPTA 4OI0A 1AT1A 1ORWA 2YXLA 2EX4A 1XWWA 1YJ8A 1WCXA 4BGIA 2EWWA 2WIJA 5P21A 4I5FA 4UTZA 2QUAA 3AOEC 2A3NA 2RBEA 3C70A 3MS7A 3OEWA 5K4HA 2HHHB 4TWJA 4PBTA 3R5HA 5HCUA 4HDSA 1YU6A 4F5DA 1BRMA 4LVUA 5FTMA 4EAAA 3ZDFA 2HPVA 2QVYX 1VCHA 1A4XA 1T3SA 1NIJA 4OEHA 2PH7A 5PNTA 4ZAVA 2Q7DA 1EDDA 1EFPB 1PJCA 2PX4A 4E5KA 1A97A 1Y63A 4L75A 4AULA 4H18A 3WGJA 4AZ3A 1ISHA 4C7XA 2RG7A 4X20A 1UKCA 2JRCA 5GZ6A 1Y6ZA 3SYLA 2IY9A 2X7XA 4DEYA 1E4EB 1TUEA 1H1LA 2MSCB 3IT3A 1GQQA 3NYRA 3QNUA 3C6MA 4BQEA 2RGRA 5DTQA 4EIWA 2FKNA 1Q0ZA 2ZRMA 1SHKA 1KFCB 3OZVA 4MWSA 4X8OA 4U8GA 3KQSA 1KYZA 3KT6A 5JZSA 5IHXA 2VRBA 1JIUA 2ETXA 2PSHA 2XNKA 3L93A 3N86A 1PJBA 4P7JA 5EMHA 4N65A 1HRKA 4O25A 1XCBA 3NPMA 3CB2A 4X45A 2ZBVA 3GFFA 1ND6A 3BXHA 3HCPA 3LFHA 3G5LA 1TMGE 4MCIA 5ALTA 3G6WA 3MRXA 4R8VA 4S1WA 2OBLA 4B81A 2E5FA 2BLLA 4GQIA 1VOTA 1JU4A 1Z7WA 3JALB 3A32A 1K0UA 2PCJA 4WUTA 3K09C 1TZKA 3P0IA 1JE1A 2QYSA 3CLTC 2UYQA 2IS4A 4DJTA 3LCMA 2JFHA 4IDPA 2IYTA 1VCOA 1ZA2A 2IOHA 2XVXA 3I4FA 4ONEA 3TRJA 5K8VA 3C85A 1K7EB 4EB0A 2XBMA 2G77B 4KKVA 1VJDA 2FX5A 2HHJA 1XE3A 3QMPA 4PYNA 4S1PA 3GFGA 2ZXUA 2G76A 4UCWA 1PWXA 4V0NA 4XB6B 1KEVA 2ZZKA 5H9WA 5BMVA 3BULA 1LK5A 4E12A 5BQXA 1FSPA 1J0BA 4WBXC 1K5PA 4TMFA 4NU8X 3SY8A 1Y7TA 2ISQA 4BFCA 1R6TA 2X6QA 4CEIA 1UXIA 5E1MA 5B5SA 3PWKA 5B1SA 3G2MA 2Y4OA 2VWQA 4QJ5A 1MQSA 1SD1A 4WEQA 4JBXA 4XQGA 2GPYA 3II6X 3P2EA 3GMTA 5DN6A 1UANA 4Z7QB 5CB0A 2H92A 1BNCA 1WXXA 2XVAA 3BHIA 1EFKA 3DBLA 1W5EA 2QENA 3AP2A 3OLQA 3RFTA 3SJZA 3ZOZA 2ZYGA 5AW8A 2XDYA 3TR6A 1K6JA 3V5NA 1NT4A 1GA4A 2JDID 4KWTA 4P4TA 5K1ZA 5A9RA 7ABPA 2C2ZA 4NIMA 3R5FA 4A92A 1SXJD 1Y42X 1TRKA 2X0KA 3CJQA 4M55A 2R47A 1N1GA 1P9RA 2OCIA 1OW3B 3B1VA 3L1JA 4BBPA 3EFBA 4KDEA 3DCNA 4C0SA 1C0KA 3F9RA 2ZS7A 5KU7A 3L3BA 1E8DA 4JOQA 4J8PA 4YT8A 1W36B 4R3UC 3SHTA 3CPHA 3ICOA 2O3RA 1EWKA 3LP5A 4NBRA 2PO7A 1F6BA 3S5JA 2CYAA 3GDOA 4QUBA 1XCJA 5KWSA 2IEIA 1C8BA 3RTGA 2VK4A 1RWPA 3ELUA 4II7A 3I53A 4RXMA 1Z5ZA 3UC5A 1THGA 1RNLA 4RAQA 2OHIA 3LYHA 1QYIA 2CE7A 1AGPA 1PZFA 3AZQA 1C4OA 5AM5A 5E95A 5H3HA 5LXTB 3E9DA 1YZFA 2C5AA 1JU3A 5HW0A 5AUPB 2ONJA 3Q7TA 2V65A 2PA0A 3JPYA 4WESA 1S2GA 1MJ5A 5A3VA 1PV2A 3IE2A 4F86A 1GTL1 2QTFA 3EEYA 4Q1AA 4K28A 3ZCRA 4GECA 3AR7A 3BGWA 4EM6A 4REOA 3E9CA 4MRPA 1PNOA 5GIPE 3C16C 1KVRA 3F4KA 4Q4CA 3BORA 3JQ7B 1XZFA 1GARA 1DKUA 4JY7A 2HUNA 2V6GA 3CH4B 3LDGA 1N5MA 4JSYA 4R0NA 5A6SB 2ZW9A 3ZGYA 4CMEA 3H3XA 4IHJB 3A9RA 2FGJA 5A5DA 1ZAKA 2W42A 2JFOA 4DWJA 3ILSA 3QPWA 3CIOA 4YQYA 1Y89A 2OVFA 3DDOA 4NOJA 3K4QA 4Y9RA 1N8KA 5T67A 4YO8A 1U9YA 1OAOA 3U31A 4WASA 3UO8B 3QVVA 1W94A 1TCBA 2VNSA 5F1YA 1DJOA 2JAQA 5HFNA 3MUEA 3CKLA 2BVNA 2V7PA 1B43A 3G7SA 4WEOA 5K0FA 1HYQA 2Q2VA 1RYEA 3VOSA 2IUUA 3O4IA 4K6OA 1T6XA 1AB5A 4ESHA 1YQDA 1SKYB 2HC9A 2AYYA 2C5LA 4H27A 3JD1A 3ROTA 4A3SA 3DKPA 1YR1A 4Q24A 4G41A 1A8SA 2W6CX 3I9LA 5DTJA 1KE2A 4X5OA 2HSJA 1YWGO 1XN1A 1HT3A 4B6JA 4OA8A 1FTYA 4HNHA 1I5RA 3DTVB 4X1KB 1XCPA 3NOQA 4MYHA 3UWOA 3ZW8A 1SQFA 5KJ1A 2GAOA 1PHRA 1O6CA 4TL8A 2BDUA 2R00C 5E7MA 4UTXA 2OPHA 3AR5A 3V7FA 2RI1A 3DSRA 3LI2A 1NBAA 5H82A 1M1YE 4B6GA 4NTZA 4UC0A 5A0VA 4MS4B 1XYGA 1TKBA 2QI9F 1Y8QB 1OC2A 3K72B 3O9ZA 4IIEA 3O2JA 4ODIA 4DRXA 2AMJA 4L07A 4KKXB 3FLEA 2BGTA 4KVFA 2VYQA 2BGKA 3L6OO 2HQ1A 4JWTA 2I3AA 1GPKA 4TXJA 4EK9A 4K9KA 3CR8A 1CKEA 4QLBA 3KAJA 4HGYA 2FOXA 2I03A 3JRXA 3WJ2A 4JLPA 1UMCA 1FFWA 1G8PA 5BSKA 1Q3HA 4PO3X 2FUCA 1EFVA 2Q6OA 2VAVA 3RS3A 3OLWA 4CCWA 4ZJUA 5IZCC 2J9GA 1EBUA 3IIJA 3MOSA 3IR5A 5C34B 3UICA 4DR7B 1U5BB 1JECA 3FAZA 5FPQA 1JI3A 3FPEA 1SCKA 2W98A 2YCBA 4IY1A 2D2XA 4TWIA 2BEWB 4WZAB 3BMOB 4ZAYA 2JGEA 3L0SA 4WXPA 3HUUA 2JGFA 1G5IA 2AWOA 1P4HA 1E64A 1Z75A 4NEQA 4OXXA 4IQ8A 1KI6A 3L06A 2A7QA 3FKSD 2GVDC 4FC6A 1YA8A 4HTFB 1FNDA 4P35A 1P1CA 4Y18A 4TMVA 1EWRA 4Q16A 4CMGA 5BT8A 4FHDA 4AWBA 2AI3A 3EEIA 1JLSA 1OIVA 1RKBA 1TTTA 2P2SA 2Z95A 1QG2A 4M1YA 4L0MA 2QP3A 4I9GA 2W2VA 4G5XA 2GBPA 1CR1A 3C6XA 3PFHA 1E1QA 2CUTA 4R6XA 1UJ6A 4HV4A 1BXKA 5FPKA 1TZMA 3LHFA 1HLFA 2ODAA 3IPYA 3QXCA 4E32A 5KNDD 3ZWQA 3GAAA 4NZOA 3FVQA 2HADA 2QM3A 4QOIA 3IAAA 2CVZA 1W75A 4AK9A 1GAWA 2W2PA 3A2NA 3STUA 1P4SA 3ZWPA 1P77A 4UZFA 1UBGA 1UDCA 1Y8CA 2ORWA 3QKRB 1SNYA 1GRQA 4XAQA 1D1QA 3BB1A 3PD1A 4FHCA 4RKEA 4ACAA 4BZQA 2OY0A 1QFZA 3L5OA 4G1UC 5LR6A 1MOQA 1QOZA 2B61A 5AIBA 3NNDA 1E3TA 1F2UB 3C8UA 3CLRD 3N0XA 4L27A 4MA0A 2BRUC 2VT7A 1W35A 1TMYA 2NU7B 3DPIA 4DZZA 1TAUA 2PL5A 2XB9A 4R9SA 2RH8A 2C07A 1OBFO 1ZCAA 4GI3A 4NZNA 4G0ZA 2CUNA 4WY2A 4LQCA 5KOIA 5DASA 2NMVA 1AVTA 3SBXA 5JCXA 3GGOA 4P83A 2ZBRA 4DKXA 3TVTA 5REQA 5FLYA 4C3VA 1UEIA 4DC0A 5DM60 3BCRA 1M72A 5COQA 1K75A 1UL1X 3T9FA 1XT6A 2X4GA 4TXNA 4X71A 2V3WA 1IY0A 1QE3A 2Q2OA 1AUQA 2LCFA 1SFRA 1L5NA 2XB6A 4R1QA 2FJPA 3I3SR 2ZANA 4GFDA 4RXUA 3CUTA 4FW8A 4MV9A 4XUDA 3VC1A 3HFGA 4JP3A 4Q1DA 1KDTA 4LK2A 1JMYA 2JIBA 2G83A 3OUUA 1QTNA 1OPRA 3I5UA 3E6AA 5EVCA 1S3IA 2RBGA 3FZEA 1CDEA 2FRDA 5CIQA 1CE8A 2I99A 2XUKA 5DF1A 5JFGA 2WF7A 3QLVC 2W4MA 3VH4A 4B3IA 5AJVB 5JNSA 2YICA 2OB2A 2YWFA 2AOUA 1GZVA 1QFXA 3JYNA 3Q0IA 3AF0A 1PSDA 2ZJ6A 4AL4A 4C6TB 1VMDA 3Q72A 1DAMA 2CDAA 2ICAA 2ZB8A 1J0XO 3NDIA 3W2FA 3JTEA 5K20A 3CRVA 2WWWA 1SY7A 1DAPA 3UOAB 2P9TA 3U6KA 5BN5A 1F5SA 2H1VA 4GS5A 2Q7XA 3WK7A 4QU8A 5LKAA 3FZQA 3MWJA 3OX1A 4TQUS 1SH7A 5LZ7A 4BPRA 4DSAA 3C4VA 2UZ1A 1LRLA 4FK8A 2J5BA 2ZATA 4GLLA 4I1YA 1OB5A 3COSA 5AW6A 4WINA 2HSDA 4AQDA 4OHMA 4PZCA 1XEXA 1OXMA 2BMVA 4LDZA 1NGSA 1L7QA 5EXEA 1X1CA 4ILEA 1XNHA 2QJFA 2UYYA 4AWXA 1W76A 1WY5A 1P0QA 5HKKA 2HRQA 3LGXA 2F64A 3ICCA 4NJEA 4NMXB 4ISBA 4XDGA 2EF1A 1E2MA 3B7GA 3CNOA 2OZLA 3FBWA 3GJZA 4M83A 1HZZC 1WP9A 2WYIA 3CW9A 3O0DA 4N7BA 3PL5A 4YX9A 3JVIA 5EKUA 1O6GA 1QZUA 2JI8A 4QBFA 4ZOLF 5K3SA 2OXTA 2GPNA 5JISA 4AYWA 1FXSA 1CXZA 4IHKA 3G85A 4C21A 3MTAA 2ZZMA 2DEUA 1RWMA 3RR2A 4EY8A 3GJSA 5FTLA 4CR7A 1PJRA 1BX1A 1TAGA 1ZJJA 2GQ0A 3FGNA 4L08A 5GV8A 2FPWA 3IPXA 1A27A 3PGA1 2WK1A 4D80A 1MNQA 3RAPR 3TZHA 5HS4A 4GL2A 1RWXA 3DDNA 1PL0A 3NBAA 4W63A 4FFLA 1W4CA 2DR3A 2YZMA 5DGXA 3MYYA 1E32A 3U3XA 5BPFA 3OAAA 4ZEXA 3VDXA 3GLHE 2AMVA 2WSSD 3PLRA 1SBYA 3UKDA 4MZXA 4BASA 5THXA 5IABA 2FU5C 1GTRA 5CNKA 3TQOA 2OLEA 3V2GA 3C6KA 5HTKA 5ICFA 3IP6A 5L53A 2EKBA 1C7FA 2VF5X 1RPJA 2LTAA 2C5HA 3HC7A 4CM6A 4ZHSA 3HB0A 4XXHA 5IAJA 1M6YA 4RLHA 2EDCA 3ZJYA 5IC4A 2PJZA 3R4CA 4TL9A 1G5QA 5KTOA 1W0KD 1PBNA 4KU4A 2YWEA 4ZU6X 3CZ9A 3EG5A 4LY3A 2Q99A 2ZULA 3K0CA 1E4OA 1RLOA 2ZTHA 2ES4A 4MQ6A 5ADWA 2BZ0A 1KOJA 2H1SA 3D4PA 1VI5A 5C1PA 2XZLA 4G6ZA 3OTHA 4TUYB 1F1JA 4IH4A 1T25A 1UPCA 1EQ2A 2X5NA 3QMVA 4XIFA 5FOWA 1YZLA 2ZRPA 1A9SA 1GPDG 1JQ3A 1QZXA 1GIAA 3OT4A 5ENVA 4G07A 1GTZA 2A9VA 2V6BA 3C7TA 4MB2A 3GRAA 4BP3A 1W4ZA 1JNXX 2QR5A 1ZN8A 3BGDA 7MDHA 5JI2E 3O6VA 5A0FA 3ZE7A 3GPDG 1AX9A 4ECEA 3DCYA 3M2PA 4MRAA 2CL7X 1YR6A 3PJRA 4U2DA 4GX1A 5CVCA 4L0DA 4QJIA 4JLKA 4OFZA 2ATCA 3KK0A 2IFTA 4FI3C 4UUAA 3GAZA 5E8JA 2ODTX 1ODLA 1T8RA 2P9ZA 3ZGXA 5BWLA 4GMGA 4FOSA 3MELA 2J3MA 1NYLA 5CCBA 1VKOA 1EFPA 2QSJA 1Q12A 3FNFA 2WM8A 3A1UA 4GIBA 4UHDA 3UH1A 5FDFA 4POOA 4GNRA 4C3ZA 4YUYA 3QEKA 2X3UA 3O8QA 1YB4A 1E1RD 2WJ4A 3OZFA 4HRYA 4BQFA 1UZMA 4IOMA 4RD3A 5K6AA 1OVMA 5CFMA 1IN7A 1IC6A 3D6MA 1MG0A 2W93A 3OP4A 3KM0A 3NP9A 1Z63A 3FTFA 1EX6A 4PZPA 1M5TA 1KBZA 1NJSA 2Q5FA 4K05A 4ZT2A 3VR6H 5GZ1A 1YB5A 4RIFA 3H9GA 1TGYA 3RD5A 1ZP6A 3LJKA 1QIJA 1YS9A 2P6PA 5HIMA 1B8UA 3PYMA 3U4IA 3KJQA 5TS3A 3GY0A 3M6XA 3ZWDA 1LBTA 2V03A 3A10A 2CL5A 2XECA 1MAHA 3A9SA 4JI2B 1N2CB 2DPLA 4HZIA 2ZRFA 2P2DA 3C3CA 3RI3A 1KRWA 3OHSX 2QY9A 4EB6B 1X92A 3HCBA 3X2SA 5CFRA 5DIFA 1T3TA 2FPLA 3FDJA 3LPLA 3ITNA 3JY6A 4NE7A 2A78A 1YZGA 1HZZA 3NBKA 3O8QB 3QPBA 2P77A 3EQZA 2WJ6A 3QNMA 4WCFB 4JI8B 4EATA 3FCSB 2PJDA 4F9FA 2RG1A 3DE0X 1M1UA 3U4DA 5FFNA 1KYVA 1YR8A 3CN9A 1DRJA 2FZLA 1XTKA 4MR7B 1GOTA 1CJBA 1GAEO 4YQEA 4JBLA 2IT1A 1RABA 2BSQA 1P9WA 1NMSA 5ALWA 3R0IA 4J43A 3S8YA 1L8QA 1H6DA 2BTOA 4JFRA 4MAFA 2QVCA 1ULAA 5JBNA 2PBZA 1HDYA 2E6KA 3VA7A 2JHCA 2AR9A 4TV8A 2Y0EA 1R0XA 3UTDA 8ADHA 2WLTA 4V0SA 1MJNA 3KO8A 4DS3A 2KE5A 1SXJA 2QPAA 3GG2A 1JIKA 1T8PA 1VHLA 3A4YA 3O7WA 3AP3A 2GTIA 1LBIA 2X22A 1K9VF 3VR5H 5DX1A 5EJ5A 5IM4F 3IVMA 3NHZA 3AR8A 2PCLA 3AFNA 3L8EA 3CWZA 4UHHA 4HAVA 1SCUB 3BB3A 3HN7A 5JDIC 4RKRA 4RTPA 2PKRA 4RVDA 1P8AA 3DLPX 3CINA 1O95D 4X1YB 3SC2B 1UMKA 4XLZA 4LZWA 1AQLA 4FKBA 5FBRB 2BELA 3CRQA 1KOGA 2VUHB 1EX9A 4BFWA 2F4NA 2C4UA 2AEFA 2OOKA 4B84A 3V4RA 3FG9A 4ALNA 4TMZA 3T34A 4N5DA 4YHBA 1T1IA 3E3NA 3ESZA 3LXXA 4GKVA 4RFVA 5KVCA 5EYPB 1FFSA 3BFVA 5KX5F 5LMCA 4CMJA 3AOGA 2WJHA 1NFFA 3B7PA 5LQDA 4PCAA 3R24A 1N25A 1YZQA 4QAQA 1EAYA 4N7MA 2ZTMA 3HXKA 4E0BA 3G5AA 1IBMB 4W5NA 1XOIA 1II0A 4EZEA 4IDHA 1CEEA 2VP6A 3EF3A 5D8DA 5EE1A 1II8A 1EK1A 5IDYA 1PF7E 1TA0A 3LBFA 3NYQA 3PCTA 4XDYA 5I47A 3A6PC 2P3OA 5I9NA 1XTPA 5LDDC 2ZUDA 3EIEA 1FNSA 3RVJA 3C6ZA 3OA2A 4KIUA 5I9IA 1KBQA 1EDOA 2XCUA 3EIWA 3IDZA 2J3JA 4KQXA 1JH9A 2Q3JA 4M87A 1HYGA 4U7PB 1S9DA 1MHPA 4MULA 4HNQA 4FX5A 4QUAA 5A02A 2UXBB 3NVDA 5CA1B 1HNXB 1IN5A 1REQB 5B1EA 4FDVA 2HDHA 1N5RA 1M8GA 2UVPB 4KIWA 4QJ3A 1BFKA 4P8RA 3VSDA 5M5BA 2UYHA 3EGVA 2WLSA 5AM3A 5KQMA 3IUBA 2LW7A 3UJ6A 1F60A 3V9AA 5HZMA 1KY4A 5CH5A 3B2QA 2WJAA 3W8NA 2JLBA 5IM4A 1E2GA 4K6GA 3WL3A 3HP1A 3ZJ5A 4AJJA 4CCSA 4N6OA 1CR2A 4HDCA 4F38A 1YZNA 2EBWA 3WLNA 3PDCA 1U0OC 3G0IA 1AZWA 1OLOA 2JL1A 2Z6VA 3HCCA 4V0LA 3WK9A 5SY6A 4N9QA 2PKEA 3WYBA 3ZV5A 1YBFA 3H2HA 2OCYC 3R75A 1RC8A 4WD3A 5ALQA 1DWQA 1W8IA 2DJ5A 2XYGA 3R5TA 2FHPA 3IQDB 5C53B 3L8DA 4B7UA 3IUSA 3ROQA 4N7JA 3ZCTA 1Q0UA 1RP7A 2OD2A 4OMCA 3Q6MA 1NR7A 1SOWA 5LC1A 4G09A 4R71A 3RBVA 3UJ7A 1ZM2A 2YHIB 1LPNA 4I4TF 4QUEA 2NOAA 4L2IA 2ZJBA 4FFMA 4IH9A 1HT2E 1NMZA 3IOBA 3ZJ4A 4EUFA 3BN3A 1RRCA 3EN0A 3GRYA 2RDMA 3K31A 3X43A 2R8ZA 3BE8A 4UNIA 5DJ5A 3TINA 4E70A 2B3TA 1JEYA 4TWAA 3ANYB 1I0LA 5CNMA 4BQOA 5K0SA 3FI0A 2PQMA 1GZHB 5F12A 2OUIA 2FW1A 4FOOA 1Z5WA 3CV3A 1IEWA 1JFSA 2VEDA 4OP1A 4BXOB 1XK6A 3GA0A 4FILA 5TQVA 4YRBA 4EJFA 1STOA 2PWZA 5B30A 3THSA 3N5CA 1L5KA 3T1QA 4XRRA 3GFBA 1VKHA 5MN4A 3HZHA 3DLHA 1PLLA 1GFZA 1WTCA 4JK3A 3LT0A 4LOAA 3P0JA 3BMCB 2QM0A 4KMMA 2JBHA 3VVLA 4E3WA 4F1WA 5F23A 1YOBA 1DWPA 1I7NA 1E7QA 2QAGA 1KK1A 5BXQC 1XLWA 1BFUA 5KVSA 2F3SA 4YTEA 4AWAA 1KAGA 1MLDA 2PXCA 3FZNA 5K3DA 3EMBA 2D13A 5K4AA 4B3CA 2I2AA 2DQYA 5HSGA 3P45A 2OLKA 1ISMA 1NRXA 3NB0A 4NHOA 3WADA 1P3JA 1UDBA 3AH8A 4LC1A 3W3AH 4EJMA 4F6RB 2QYTA 3NS7A 3WQRA 3LX5A 1ZD3A 2B5VA 1C3VA 4ZI2A 3JASB 2JGAA 4HGOA 3RS7A 1KE1A 1KVUA 1Q2XA 1XO1A 2FVYA 2QM8A 3LQKA 5JMWA 4FM9A 2VXYA 1JZTA 1I51A 4IV0A 1Z4QA 1O9BA 1ZKMA 2OL4A 2GEDA 2IODA 1FRZA 5KJCA 4R8KA 2HHAA 1E6EA 5DBEX 1WPRA 1H3FA 4JLUA 1SXGA 4A8JB 3ICVA 1US8A 4QGFA 5DI3A 3K09A 3Q3GE 4RULA 2HW8A 4RMNA 4INAA 1SXJC 3L4BC 4OU5A 1PQPA 2ZR8A 2J32A 4M1QA 2I2FA 2E3JA 3UK0A 4RK4A 2ZRNA 1XG5A 4D8TA 3B12A 2AW3A 5CLQA 3MAGA 5C5DA 4OI4A 4HLUC 4J0FA 3OT5A 3OLVA 4R9RA 3AHEA 1E1LA 5F73A 1GADO 3TCKA 2II6A 2AMYA 3TBFA 3K9CA 2B30A 3NT4A 2GJ9A 1KETA 2VJMB 2LR0A 2RJ3A 3A4MA 3PNOA 4M98A 1C9NA 1CUBA 3PR2B 1X7HA 3CJTA 3KAQA 3OVMA 4HQKA 4LV5B 3PNBA 4KLCA 3BHJA 3ACBA 4GPIB 4RD6A 4Z7OB 2C8JA 5AKLA 4N39A 3IESA 3IEMA 4ZK2A 3ICQB 2SKDA 3ZXYA 1TIKA 3D3NA 3KSUA 4QJ4A 1MH9A 4DOMA 2JIPA 5BN4B 1QK5A 3BIFA 3L6EA 3IAHA 4M8IA 4BL5A 3THYB 2VQFB 2CNNA 1XNQB 1BMTA 5DI3B 5FBKA 1X80A 2ODEA 2Z08A 3LCUA 4JITA 4ZCTA 1FFYA 4DMGA 5DBGA 2R8BA 4HH4A 3N2KB 1ZD2P 1L5GB 4CKYA 2G7MC 4I4NA 5CEJA 3MF4A 1QIIA 4N12A 4BKUA 4QE3A 3DGFC 3NKFA 1XTQA 1I24A 2PL3A 3H5TA 5L6LB 5EWLB 1JJFA 1B15A 3NETA 4B7XA 2C5EA 3P9KA 1RXCA 3FI9A 3MHPA 4IR7A 4MJXA 4HUTA 4NAVA 4TV8F 1JQAA 1NR1A 1U2RA 3EIXA 4AJHA 4M1WA 2INGX 4N41A 1VKJA 1FW6A 2CDNA 3K6RA 3FCXA 2D5BA 3FTNA 3NEYA 4CV0A 4F4JA 2WJGA 3I2HA 3FKSA 1UKAA 1IONA 1ZN9A 2GN0A 3JSAA 3R40A 4LE2A 4PPGA 1QS0B 1CF9A 1MJHA 3VNBA 2DWQA 4I8DA 4O4JB 3ENNA 2VHZA 4FW9A 2Q0SA 3ZD8A 5LP6B 1NF8A 1YL5A 1CE8B 3MNFA 4W9RA 1W2WB 2IHVA 5HUQA 3IPAA 2PKCA 1HFJA 1TJ3A 5CG1A 2I1QA 3INYA 2O3SA 1QPBA 1YV9A 1EUYA 5LIRA 3OX2A 3C5EA 5LD2C 2AN9A 1SVKA 3W6ZA 4BMSA 1ZM7A 4MNTA 4TZKA 4E11A 3HEBA 2W00A 3B6KA 4PHTA 2ET6A 5UKDA 4B3RB 3B1KA 3U7FB 1K0FA 4CKBB 1N6KA 2I2XB 1NKVA 1TO1E 2XLBA 3DPUA 4ZOLB 4Z0PA 1U8YA 2MCFA 2YQ4A 2CDCA 1VBKA 1V11B 1ZD8A 5AM4A 1ACLA 2K6GA 3WL5A 2OECA 2PGOA 1QRSA 5BQFA 1OA0A 1O6FA 2X2EA 4LDRA 4XH9B 3PD7A 4XVUA 1WW2A 3BQMB 4QBTA 3EOBI 1HT1E 2ZUUA 2Y1EA 3SR4A 4NATA 1XVVA 3HBJA 3ENKA 2A92A 4G1MB 1B1CA 4ZTZB 3R6LA 4L73A 4PW0A 4EGFA 2DCMA 4V02A 1ECBA 2EX1A 2JA1A 1AKMA 1D4AA 4E03A 4WE3A 5HM8A 2YVLA 5E6SA 4OMDA 4IDGA 4EUKA 1O94D 4ZDJA 3RVRA 4ROTA 3KEMA 2FAXA 1O94C 1ZW1A 2IUTA 3NOVA 4OH1A 3AUKA 2YMLA 4YY3B 5EQJB 4QSMA 1X7XB 1H0KA 5JXJA 1A77A 1NQOA 2B4RO 3R3JA 1NN3A 5JS6A 1W25A 2GO1A 3ZCPA 4LF6B 4YP0A 5JQGF 1JQKA 1F17A 1EVEA 1VJRA 2G04A 3QTLA 3ESCA 3VZQA 2GCGA 1CY4A 2VYCA 2JPDA 2XUIA 1XAJA 1UZAA 3TJRA 1TZJA 1R0ZA 2MYTA 1UP7A 3C3JA 4DWWA 2OCAA 3U56A 3ONVA 1BO6A 2J6HA 4RA9B 3QI7A 1XPOA 1LA2A 2OG1A 2VIIA 3NH9A 3GJ5A 2JGDA 4HB0A 4F93B 1E3SA 1SZPA 3BA6A 4L3VA 3GP5A 2ZRHA 1A2QA 2VKQA 2YXEA 2NSDA 621PA 3DDUA 4L8FA 1ENOA 5CDFA 3RYHA 3TUJC 1WZCA 4QDTA 2VYFA 2B36A 1EK0A 5DMHA 1U3TA 1SOMA 2HOQA 2TECE 1VL8A 4CHGA 4DVGA 1Z8HA 3MJTA 5LVAA 3AIIA 2JFPA 3D4NA 1QHFA 2YX1A 3NKLA 2GM9A 2KHZA 6AT1A 3LVQE 1JLRA 1I0ZA 2P2YA 1ULBA 2NN3C 2P3QA 5TARA 2BI7A 3GEPA 2YCLA 4NDAA 1C2TA 1HDZA 2OV4A 3D5TA 1TI7A 4JZKA 1OLSA 4QELA 3U26A 2IXBA 2W6QA 3PRYA 4WZBE 2VDWA 3T9EA 2C7RA 1OIXA 1V5IA 1VE7A 5GVSA 2Z5FA 3QW4B 5IAGA 2OBNA 5DKFA 1Y4UA 2ZUVA 3PC6A 4C3OB 1IHDA 4Q00A 1ATZA 1SD2A 2AXEA 1W36D 3P26A 1DSSG 2FMKA 4RHYA 4WY8A 1L3IA 4WXRA 3H0KA 2YBEA 3QKIA 5LZ4A 1IM2A 1LDGA 1QYDA 4FYJA 4K9DA 2OP0A 2VT2A 2ZPTX 3RYHB 4HAOA 3TW0A 1KSFX 1T36B 1D0VA 2XVZA 2VTEA 2J0EA 3O91A 2JGMA 2DFPA 1SK9A 2XTMA 4FQ5A 3FPFA 1EXMA 3UXHA 2E4AA 3G9XA 3LYAA 2BBSA 1EJ0A 5A62A 3G8CA 5HMLA 4ZYLA 1BROA 3VZBA 1C7ZA 1QF7A 2ZI4A 1SKYE 3EZNA 3W8EA 1T13A 3EYWA 3A0RB 1JJIA 2WZBA 2O8EB 1SN7A 3VJMA 5FOQA 5KAMA 4UZSA 3TNLA 2G1KA 2OCLA 4DRYA 1FRQA 3UWMA 2WP0A 1YZTA 4JYAB 2HA4A 2Z2ZA 3K0SA 3BD9A 1HO3A 3QY0A 4FNAA 4OLJA 4OKSA 5I7SA 3ZHCA 1JE0A 5ALJA 2D0DA 2YRWA 5LKRA 1XJ5A 1II9A 2O7SA 2P68A 1XPRA 1VCNA 4DYVA 2QAGC 1KI8A 1HC7A 2XE8A 2X8JA 3MD9A 3NHBA 3KV3O 4U8HA 2AL7A 2JJYA 1Q7BA 3F90A 4P4NA 3ZKWA 3W6UA 5AW9A 3AC0A 5J2UA 1EAMA 1K8XB 3OMLA 4R3WA 2PGJA 3KNZA 1RC0A 5E1OA 3WL8A 4DZRA 4LOKA 2PIAA 3CZ4A 3I2IA 3P9XA 3URKA 4YIHA 4G9GA 3WK6A 2NX2A 1E4EA 3M1YA 4ENTA 3JQ7A 5J4HA 1D7OA 3BE6A 3DQZA 3FHOA 2X77A 1VYTA 2QQEA 3C7KA 3PV0A 3WLPA 2JJ2D 1P2UA 2TYSB 4XKJA 5AP9A 3ZLJA 3MGKA 4M49A 4XB1A 1N2CA 5DGCA 4RTJA 1BOFA 3PLAE 3ELBA 2I5PO 5HK9A 3EVBA 5AKXA 5FL3A 4BMNA 2VZ9A 2FSVC 2VF2A 3BFPA 5CM9C 3F96A 1WB9A 4LF4B 2M6LA 4B8ZA 3ZX4A 2O0LA 3T7RA 2IDZA 4C4RA 2PEYA 3HBNA 1IJEA 1T9BA 1ZUNA 2ZRLA 4RLFA 2IV2X 3PGVA 1JAZA 5WRFA 1I01A 1R2QA 4DDKA 2M1XA 4LF8B 3QE9Y 4U4AA 5FH9A 1Q0TA 5LBUA 4RF2A 4BZZA 4A15A 2GCEA 1LDBA 1RFLA 2I1WA 3TQTA 5ALHA 4WDQA 5I3ZA 1I6MA 2PUGA 4WDRA 3TCNA 3BT7A 2I7DA 3D81A 2JKZA 3SZUA 1CHNA 3I52A 5GADl 3JQFA 2J9FB 3JQQA 2CNKA 3H9EO 3H9JA 4LYFA 4CIDA 1Z6YA 3CWCA 4AS2A 2HD4A 4C1NA 2B25A 5AI9A 1ISRA 1U31A 5DM1A 4KBYA 4CMCA 1ZSYA 4NV0A 2IYOA 1AQ6A 5C4GB 3ZEIA 4B3XA 3GN2A 4ANFA 1EE2A 1RWKA 5C1BA 5F2OA 1EI9A 2AX4A 1YDMA 3D6VA 1BMFA 4XD2A 1ES9A 4AJ4A 1Y5IA 3DFZA 4IUBS 4F2HA 1YRWA 2H1LA 1OZHA 2PRZA 3JSXA 2JI4A 3FE2A 3WK5A 4C4PA 1EVIA 4AN4A 4CG3A 5J2UF 3DAFA 2IUFA 5ABPA 2AZTA 3ZOKA 5CFQA 2G06A 1CJMA 1CUEA 4AX4A 3KQPA 1QGAA 3RBXA 1AKTA 3N8NA 2LPMA 4KUGA 2IZ0A 4Q05A 3HYRA 1DDOA 4PC3A 3EHDA 1WUJS 4LRYA 4NULA 2UAGA 4TV9A 3TAUA 4BLRA 4BQQA 1TA4A 1ZR2A 3CT6A 4CR6A 1BG6A 3L40A 4MLDA 4ON9A 5D87A 4TTSA 4RQBA 2QW0X 4C0WA 2EGHA 1X19A 3QFHA 3HJUA 2GA8A 4BLSA 2CLIB 4U2BA 4KE9A 4REMA 1MU0A 2ZSHA 2FDCA 1Y3IA 2RK3A 5G1NA 5A2GA 4YUWA 4LJ8A 5FUVA 1RIFA 1I30A 2A0FA 3D6FA 2FRVA 1SC6A 2EAUA 2ZU0C 3L7MA 1N0VC 3ER9A 4MPPA 2IVZA 5BRAA 1SVLA 4MB6A 4JIGA 1ZXLA 3HRHA 4N1AA 5J2TA 3AJAA 4HDKA 5EVJA 3N7AA 4Q7MB 3NBUA 1RZ3A 2QT9A 4ME6A 4KMRA 2PWYA 4GZ3A 1GYQA 1JLMA 4OHPA 1SKUA 1BCSA 2HWKA 3ERCA 4BMXA 1H8ED 5FHQA 3L6CA 4ESVA 3TD9A 4I46A 4X1IA 3W8DA 3E23A 4K03A 1PGJA 2CJPA 1TCCA 3LNTA 2QTBA 4QFMA 4QXRA 4CWAA 1IXYA 4PQRA 1RLMA 4EG7A 2AKYA 5ARCA 5ECYA 2AJT