4H77A

Crystal structure of haloalkane dehalogenase linb from sphingobium sp. mi1205
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
total genus 114
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h77A00
4C89A 3WK6A 1K5PA 3O4GA 3BJMA 3DDUA 3JWEA 1XZDA 2HM7A 4RGYA 1ZD4A 5DNUA 3V1KA 5C8ZA 1JT2A 1N1MA 1CUDA 4H35A 2PL5A 3Q8WA 4GBGA 1OCEA 4FLMA 2XMCA 3DEAA 4PSDA 1PFQA 2WG2A 1ZIYA 4DTCA 4FLEA 1IZ7A 3HC7A 3WKEA 4J0IA 3KWJA 4DSAA 4BVJA 1SCIA 1QONA 2PSFA 2VF2A 1P0PA 3C8HA 4ARBA 4PSCA 4NZZA 4UBNA 1LLFA 5C8VA 1ZJ4A 1IUPA 1U2EA 3HJUA 5E4TA 5AICA 3D0KA 3A70A 3OURA 3R3XA 2DQYA 4X6UA 1YCDA 3DL7A 3R3UA 1BRTA 5AK4A 3STYA 1QJ4A 3DL4A 4UHCA 1VE6A 3RLIA 4F60A 2ZSHA 3WK9A 3M3DA 3WJ1A 5JASA 2Z8XA 4P9NA 3QBJA 1Q0ZA 1ZOIA 4E14A 1VLQA 4AMYA 1LPBB 4H7IA 2GZSA 3M81A 5AKEA 2QUAA 3BIWA 2O7VA 5AKXA 4PV7A 4QLAA 2IX9A 5AI0A 4YASA 4WFKA 2O7RA 2I03A 1LZKA 3VVLA 3FCYA 1ORVA 4OCZA 1XZMA 2HA6A 4L9AA 4X85A 3G8YA 5ALSA 1CV2A 4QDTA 1XKLA 1Z68A 4FBLA 2OGTA 4N8DA 3KD2A 2VEOA 3H18A 1C4XA 2AXEA 3K6KA 3AZQA 4ROTA 3K9BA 1JU3A 2ZYIA 3C43A 5JD4A 4QWMA 4HAIA 5AHXA 3QM1A 5FOQA 2QR5A 4MYSA 2OAEA 1HPLA 3LIIA 2JGIA 2DHEA 5KWIA 4GWLA 1CVLA 3T52A 2XQJA 1JJBA 4DNOA 3V9AA 3OG9A 4UHFA 5HK8A 1A8SA 1CUWA 4X90A 4J0HA 3AINA 3I2GA 1HDEA 4ITVA 1CUYA 5JALA 2BCEA 3WMRA 4U2GA 5ALOA 4B84A 2X76A 4QLOA 2DHDA 1SFRA 1THGA 4KRYA 4KR0A 1EVEA 1WB5A 4DMFA 3ICVA 4QNNA 4I3FA 1EA5A 2VQ6A 3ZWQA 1VA5A 2WG0A 5K3AA 3EQ8A 1OXMA 1F8UA 3G0IA 2XMQA 3I6MA 4KAFA 4UHBA 1GKKA 3ZI7A 3CCCA 4MEBA 4Y2RA 3C5VA 4BAZA 3O0DA 5FPPA 1BS9A 1H22A 4DNFA 4UBOA 1AMNA 5HK9A 4JYPA 2XE4A 4K5QA 4J03A 1VOTA 3G0DA 4LXHA 2CMFA 1HKHA 2BFNA 5EGNA 1SCQA 5AKHA 5EHXA 1AZWA 2XB6A 3D2BA 2VJCA 3E3AA 1K63A 1AGYA 3WA6A 5CT6A 4IH9A 5I8PA 5ESRA 5HZGA 1XZIA 4RE6A 5EFZA 4M0MA 5ALDA 5LZ5A 1SC9A 3ANTA 3I6YA 3F67A 1WM1A 4W63A 4X6YA 1N5RA 2WG1A 4EZIA 5D3KA 3QMVA 4XVCA 3RM3A 4H18A 1XZGA 5FLKA 3EBLA 4WY5A 1ZI9A 4XWGA 3QITA 5AOCA 4W9RA 1FFCA 4Y2TA 4MQMA 5JZBA 1H2XA 1CUSA 3BF8A 3STVA 3IUQA 3O9VA 1TIBA 5CH8A 1FFAA 3STUA 4BTVA 2XMZA 3ANSA 5CTAA 3O95A 5KBYA 4OB6A 5FPQA 4F5ZA 1ZD5A 4C01A 2Y6VA 5AKGA 2VJAA 2WLSA 4AXBA 2WTNA 3C45A 5ALQA 1B41A 3FNBA 3IUJA 5AKIA 3TEJA 3PF9A 4KAJA 4WCVA 3G9XA 3C6XA 2WQZA 5H3HA 2XUPA 2OG1A 4HTAA 5ALPA 5AI8A 3QZUA 4B85A 1EDEA 3FAKA 5HF6A 5JATA 1DT5A 3R40A 1C7JA 3V1MA 3KOOA 3LIPA 2PVSA 3LP5A 1BEEA 2VAVA 2ZSIA 5ALYA 4U2DA 5EI5A 5K3FB 4B83A 2XT0A 4OU4A 3WA7A 4FFVA 1NU6A 1Q83A 4H7EA 4Q3LA 2ZJ7A 4G4IA 3SWWA 1QO7A 2FJPA 3WWOA 5AKLA 5EIAA 1ZD2P 2OAGA 5A7HA 4BE4A 5CRIA 5DTIA 1J06A 1R88A 2W22A 3OTQA 3GA7A 4FKBA 4D9JA 4J7AA 3RK4A 3W06A 1DWQA 1B6GA 3VJKA 3FVRA 4XIIA 4TVKA 4KJXA 3W04A 4E15A 2I3DA 3FBWA 4Q1VA 7YASA 1A8UA 3OOSA 3H2JA 2RHWA 5BV7A 1CUUA 5CBKA 1IMJA 5HFAA 4G8DA 4JNCA 2O2GA 3VJMA 3IBTA 4ZV7A 1DQZA 4GW3A 5T4EA 1FJ2A 1AUOA 2GBFA 1AQLA 3AIMA 1E89A 2XLCA 4HXEB 2WHPA 4QDUA 5ALRA 1RYYA 3O4IA 2P8SA 4UBKA 1G66A 3M83A 4Q3KA 1LPOA 5ALWA 4Y2UA 2H7XA 4W1QA 1ISPA 5FP0A 1AC5A 4EY7A 2WJ6A 1MPXA 4F0JA 2BGRA 2YASA 2ACEA 1E8NA 1VKHA 3BDIA 3OPMA 1AX9A 3WL6A 2R11A 5K3DA 1CLEA 3QPDA 3I28A 4G8CA 3H2KA 4J0CA 1E3QA 1XQWA 4HXGA 5A62A 2PUHA 3H2GA 5ALEA 3BIXA 4Q34A 1MNAA 1ZIXA 5JAPA 4N8SA 1XRPA 3C8DA 2JGKA 1XRNA 1GQRA 4NMWA 2GYUA 4BAUA 2B4KA 1HQDA 1DU4A 3BXPA 5A71A 3D2AA 3BL8A 4AO8A 4U2BA 1J1IA 3C5WP 1EVQA 4Y2VA 1LBSA 3SX4A 1VXOA 3D5EA 5K5EA 5CXXA 4BRZA 3A2NA 5A6VA 1U4NA 5T4HA 4B0OA 1K8QA 4N5IX 4ZV9A 1R1DA 2XMDA 3E1GA 2JBWA 2W6CX 5HFNA 4CIBA 1Q0RA 4GDMA 2HA0A 4HZGA 1QTRA 2JGMA 1CUHA 1Q84A 3DYIA 5K3CA 1N5MA 2ECFA 4FFWA 3LLCA 3WWEA 1YAJA 2G4LA 3IDAA 4LYEA 1XFDA 3QYJA 3HSSA 1G42A 1CUJA 3WL7A 1XRRA 4WDQA 2QM0A 3WYNA 3STTA 3PE6A 3WLAA 5AI5A 5ALTA 2Y2VA 5LZ8A 4TPKA 4KAAA 1WB6A 1MAAA 4WFJA 3BJRA 4W1SA 4Y2YA 1QFMA 2HDWA 1NU8A 1UFOA 1CUIA 2D0DA 4BE9A 1EB8A 2XUQA 1VXRA 4MWTA 1QFSA 3WJ2A 4OUKX 1GPNA 4ZI5A 1UKBA 1GZ7A 3PFBA 4DNPA 5D3ZA 5KWJA 1O6GA 1PJAA 2XI4A 2GYWA 2QJRA 1HL7A 4GXNA 1Y37A 2WIKA 1XZBA 2RIPA 2K2QB 5AKJA 4X3CA 4XX1A 5LZ4A 4YX9A 4DM7A 4EY5A 1USWA 5ALFA 3DLTA 3V1LA 3N2ZB 1TCCA 3E4DA 4UHHA 5JANA 2HA5A 4AQDA 1EDDA 5E4YA 1F0PA 3G9UA 5DYTA 1NX9A 1ACLA 5LZ2A 2I3ZA 4M0EA 1FSSA 1XZAA 1ACJA 3WKAA 5YASA 2HU7A 4QDZA 2HA7A 1XZJA 2UZ0A 4A23A 4BDTA 4K2AA 2LIPA 5LKAA 3WYDA 3AZPA 2ZVDA 2BUCA 3PI6A 4A16A 3GFFA 3GROA 4C4YA 4BAGA 1QGED 4Y2PA 1JMYA 4L0CA 4FTWA 1XROA 1D07A 4FWBA 1ZGBA 4P92A 3AIOA 3WK5A 5AK3A 3WZLA 5JD5A 2XUHA 3WWDA 2WM2A 4AX4A 2J3DA 4OB8A 1CUBA 1SCKA 2CEKA 1IZ8A 1CPYA 1ZICA 1EK2A 5AI6A 3MUNA 4K6KA 2CB9A 5BWCA 2EDAA 5AKYA 1I6WA 5AJHA 4MYDA 4QDXA 1KU6A 2QUBA 1CIJA 2ORYA 4OYLA 3PICA 3TRDA 2PBLA 3WK7A 4EHBA 1J2EA 5FV4A 5AIAA 5FRDA 3VVMA 4F21A 4KACA 3G7NA 1TCAA 1XKTA 1M33A 2DCMA 4QEKA 1MX1A 3IURA 5AK5A 5JIBA 2XQFA 2HADA 2ZYHA 1LBTA 5HQ3A 5E2IA 1X70A 1QTIA 1E66A 4Q05A 1GPKA 4ZWNA 3NUZA 4DIUA 2XUIA 3PUIA 5ALMA 3GZJA 1XZEA 1ZGCA 5AM5A 1DQYA 1XLUA 3QMMA 1H2ZA 1RP1A 5AM4A 4FLFA 2Z8ZA 5HKAA 3JYHA 4K6HA 4DLNA 2BGNA 4W1RA 1QIIA 3I2IA 3WL8A 3F9CA 1W4LA 5CURA 1R9MA 4P08A 4BC0A 3ZLTA 2Y1KA 1EH5A 3DYVA 2H7YA 4HXFB 3WWPA 3EQ9A 4UUQA 4U2FA 4LHEA 4HVTA 1LPMA 1XZKA 3BDVA 3WZMA 4QA9A 3R3WA 1H23A 3FYTA 3QH4A 3A6ZA 1RWQA 2V9ZA 2XLBA 4X95A 5EIHA 4KE8A 3BF7A 4HS9A 4J0JA 2HL6A 1QZ3A 4KE7A 4QDOA 5C7YA 3FYUA 2GBIA 3F96A 2QMQA 2WHPB 3R0VA 4GECA 1GT6A 1ORWA 1ETHA 3DS8A 3GUUA 4H7FA 1LPSA 4ZXFA 2HU5A 3HEAA 4CI9A 4Z49A 1EHYA 4X7BA 1G5FA 3MUOA 3VISA 5ALVA 1YASA 3IUNA 4QE3A 5AOAA 5AM3A 2QT9A 5HCUA 4X71A 3AILA 2WFLA 1W1IA 2CJPA 2B9VA 3F8SA 1DT3A 3ESDA 4OD0A 1GKLA 2QVBA 3WL5A 3DCNA 4BVKA 3AZOA 1XRQA 3Q0TA 1TAHA 1TCBA 3FLAA 3SK0A 1TRHA 2OCKA 4UFNA 1U8EA 3DQZA 4GHWA 3CN7A 5BOVA 1H2YA 2V98A 3FWHA 5I7UA 4BP9A 5EIEA 2PKYX 3I1IA 2VT7A 5FDFA 3UUEA 5AIBA 5ALXA 3NGMA 4IHAA 1XQYA 4BRSA 1XRMA 5KREA 3IUMA 4V2IA 4ETWA 1CUGA 2ZYSA 1TK3A 1XZFA 2IIVA 1F6WA 1X2BA 2FX5A 4FBMA 4NVRA 3S8YA 1E8MA 3DD5A 3L1JA 3G9TA 5J3JA 2RI6A 3HRHA 3K2IA 1UK9A 2J3QA 4PQEA 1UT6A 2JGFA 1JKMA 1R50A 5AP9A 5ALHA 2HA4A 1MJ5A 1LPNA 1W6RA 2GBGA 2OGSA 1CEXA 2O2HA 3FCXA 2HIHA 3H19A 3HACA 5IKXA 1UK7A 4UBLA 1L7AA 3W9UA 1ZJ5A 3VJLA 1GXSA 2X5XA 3AJAA 4AO6A 1QO9A 4Y7DA 2WJ4A 1IUOA 3A2LA 2VAXA 4INZA 2PX6A 5AK6A 3HXKA 3H0CA 5HF9A 4EY8A 4I19A 1MAHA 3H17A 3QMWA 2WIGA 2HU8A 3ESBA 4AMZA 1QIEA 4B80A 2RHTA 4B7ZA 1R9NA 3HABA 2XUJA 4FNMA 2OLEA 2WIDA 3WK8A 2WUFA 3WKDA 4HRYA 1PV1A 3U0VA 3R41A 3RARA 3TJMA 1MO2A 4DSZA 3E0XA 2VSQA 4DYHA 1G4HA 4DNQA 4FNGA 3RKSA 1THTA 5FKJA 1T2NA 3DKKA 1ODCA 3ZPXA 3WWCA 1YB6A 2XMGA 2PPLA 4C4ZA 2BUBA 1CUVA 3N0TA 3G0BA 3U1TA 1LGYA 3FOBA 4G1FA 4X91A 3UUFA 4KE6A 4OYYA 1XZLA 4KRXA 1UZAA 3AUKA 1XZHA 2OCGA 2GYVA 2G63A 1CFJA 1C7IA 1E8DA 5IVDA 1UOQA 3T4UA 1BCRA 5FUMA 5A7GA 4MEAA 2XUGA 4Y2JA 3C6ZA 4J0DA 4UPDA 4BCCA 5CT5A 1A7UA 3LS2A 1P0IA 2WILA 2PU7A 2VJBA 1VZ2A 2Y2UA 2HRQA 3C6YA 2G5PA 3PF8A 1YS1X 5BWBA 3C6BA 2QXTA 5EHNA 4GI1A 2XQIA 4J0KA 5AO9A 1UOOA 4QWWA 1VZ3A 3EIOA 1BEZA 5D6OA 2YXPX 1EB9A 4Q3OA 4PNZA 3FLBA 5AI9A 4LYDA 4BC1A 1AKNA 1WOMA 3NOXA 1XZCA 1XLVA 2I78A 4WJLA 4O08A 1A8QA 3S2ZA 2ZYRA 2ACKA 3CCBA 3QPCA 2DSNA 5AH0A 4U2EA 3WKBA 2DFPA 3LCRA 2NW6A 4AB1A 2RAUA 4IQ4A 1P0QA 2OGZA 1JU4A 3NWOA 4G9EA 3GBSA 3G0CA 3ESAA 5CT8A 4H0CA 4AZ0A 1XRLA 1JMKC 4JYMA 1MX5A 3VKFA 1LPPA 3EQ7A 3I1YA 5AM1A 6YASA 1YAHA 1HBJA 3YASA 3VXKA 3FSGD 3GELA 5FXMA 5DTJA 2QKYA 3CN9A 1BN6A 5HQ3B 3F97A 2R8BA 5C81A 3I2JA 4BDSA 3AIKA 3BE8A 3HLKA 3STWA 5ALUA 2IITA 4BBZA 4BB0A 2JF0A 5JYCA 2BKLA 5IVKA 3G02A 2HFKA 3I6ZA 4MQLA 5JAHA 2Z5GA 5JAOA 2YYSA 3KSRA 1ZD3A 1BU8A 4IH1A 2JGEA 1GGVA 4LKOA 4X97A 3FLEA 2AJLI 1JI3A 5JADA 4UFPA 2EEPA 5DJ5A 1YA8A 3EF3A 4UHEA 4H77A 4RE5A 2ROQA 2QXUA 3WIBA 1VA4A 4IH4A 1A88A 1EXWA 2AJBA 1CR6A 3DKRA 5E4JA 5LZ9A 3FYUB 4FOLA 2AJCA 4RNCA 1CUCA 4NS4A 5ISMA 2ZJ6A 3IIIA 2PU5A 5IH7A 4FDMA 5LIPA 1MNQA 1EX9A 2PSDA 3H1AA 3JW8A 4C6HA 2HHAA 2VJDA 5ALGA 3ILSA 2XQKA 1CQWA 2PM8A 3KWFA 5CH3A 1U65A 5DNVA 1EINA 2WFLB 4CCYA 4PO3X 4LXGA 1AURA 2H9YA 1W52X 1BN7A 2C58A 3ZLUA 4L72A 2WKWA 2VATA 2VT6A 3C70A 2ONCA 5K3EA 2DHCA 5AKKA 4UHDA 4PF1A 2BUAA 1DX4A 5F4ZA 5ALZA 3WIOA 2G5TA 5SYNA 3DOIA 2DQZA 4B9AA 1LZLA 4LIPD 2C0PA 2HFJA 4AO7A 1ZI6A 2FUKA 1KU0A 1EK1A 4MJ3A 4K6GA 1BROA 4H7HA 3QPAA 1WPRA 2WHRA 2XUAA 1WB4A 2XUKA 3ESCA 4RPCA 4N8EA 4X93A 1TQHA 1YB7A 4G4GA 1CUAA 1QIFA 2WHQA 4Y9SA 2WU4A 3WQHA 5ALNA 1CRLA 2Y6UA 1CQZA 1UKCA 1W76A 4AN1A 4CFSA 1DWOA 5HKBA 1LPAB 1CUZA 4B81A 3W2TA 2CBGA 4X94A 2PSJA 3WKCA 4UFOA 2ZJFA 2C5FA 3L1IA 2DR0A 2GBCA 3FSGA 4TGLA 3ICWA 4ZREA 1KEZA 1P0MA 1FFDA 4Y2QA 2WUEA 1UWCA 4MWSA 4UBMA 5ALJA 4DMHA 2C4HA 4XJVA 2H1IA 4BCBA 5DNWA 4LXIA 3H1BA 1FFBA 2J4CA 5A2GA 3D59A 2RGUA 4EY4A 2BJHA 1L7RA 5CT4A 4GLBA 4IO0A 3VDXA 1DWPA 1SOMA 2C5GA 2JEZA 3H2IA 1E5TA 4Q82A 1QOZA 1YR2A 2CKMA 4KEAA 4JEIA 4BVLA 3BWXA 3STXA 2WU3A 4FMPA 3R3ZA 5CXUA 3M82A 3FVTA 2JGJA 4EA6A 3DJYA 3G9ZA 1F0NA 3OM8A 4UBIA 3C87A 4N5HX 3X3HA 1CUFA 3QVMA 3SC2A 4U2CA 1BCSA 1TKRA 1Y7IA 2WTMA 4YPVA 1WCYA 1MTZA 4DMCA 2EDCA 1FFEA 2C0QA 4J0GA 2XMSA 3O4HA 2XDWA 3AFIA 4B0PA 4WDRA 1YA4A 2QOEA 3V1NA 2V97A 1UXOA 2WFMA 3PDCA 5EHZA 4UBJA 2OQIA 3TGLA 3D2CA 1MU0A 2JIDA 4C88A 2RONA 2ES4A 5T4FA 2OXEA 5AOBA 2XMRA 2QJWA 2PUJA 4ZRDA 5DYYA 5JARA 3L1HA 1MN6A 1N8SA 1R4ZA 1QIMA 4X6XA 4WFIA 1XQXA 3WK4A 4E46A 5DYWA 2CUTA 1GPLA 4L3WA 2QZPA 3HI4A 3PFCA 1K6EA 1XQVA 2HA2A 2XQGA 2X8BA 1BE0A 3ZV7A 4A5SA 2QRUA 4AZ3A 5ALIA 4AN0A 4OU5A 3W05A 3W9BA 1QIDA 1GQSA 5CW2A 4CG2A 5JD6A 3R3VA 3B5EA 4W1PA 1YSCA 3G0GA 2WUGA 5LLSA 1QE3A 3HZOA 5AKZA 2PSEA 2HA3A 2QTBA 4HRXA 3R3YA 1L7QA 4X92A 1IVYA 2JGLA 1IUNA 5JZSA 1LNSA 2B61A 1JFRA 1ODSA 1DINA 3D7RA 4ARAA 5LP1A 4BZZA 4BP8A 4X00A 3IULA 3DOHA 1HLGA 2OPHA 4KE9A 1JJFA 1XLWA 2VA9A 5K3BA 2FJ0A 2C7BA 2B20A 3MGAA 2JEYA 4OSEA 1UK8A 3ZLVA 4J3JA 3ED1A 1R3DA 3B12A 3IB3A 3UMJA 1EDBA 4JUIA 1WHSA 4CG1A 4OB7A 2CZQA 5LYYA 4H7KA 1WPXA 3O4JA 3OC0A 5AM0A 4B6GA 2Q0XA 4YK7A 5SYMA 3FYUC 3I2FA 3HYSA 4I4CA 4B9EA 2XMBA 4G9GA 4EB0A 4C87A 4Y2SA 1J07A 3KDAA 1WHTA 4BCDA 5ALLA 4OPMA 1JJIA 1DX6A 1K4YA 2WIJA 3IA2A 3A2MA 2OCLA 4QZVA 4DMKA 5IVHA 2QS9A 1ZI8A 1EI9A 2AJ8A 3PUHA 4BYMA 1Y7HA 1YS2X 4EBBA 4H7DA 1T4MA 1QIGA 5A7FA 4S0XA 5EHQA 1OILA 5CT9A 4BATA 4G8BA 5HF5A 4ZGBA 4KYVA 2HRRA 1S8OA 3D4LA 4PSUA 2Z3WA 2XUDA 3IVMA 2YH2A 2XUOA 4P93A 4CIAA 1UK6A 1QIJA 4WY8A 5I9IA 4E11A 2H7CA 5IVIA 1DTEA 2WJ3A 5D7BA 2WIFA 2D5LA 2V96A 2PSHA 2Z3ZA 5K3FA 1QIKA 1MT3A 4C4XA 4CCYB 4H7JA 1UKAA 2VTVA 4G5XA 2O2IA 4BZWA 5LKRA 2OCIA 3CXUA 3KXPA 3V48A 5ALKA 3I2KA 5DWDA 1X2EA 5AI4A 4GEGA 1VJ5A 2GZRA 4CCWA 1CUEA 5C8XA 3H04A 3H2HA 4M0FA 2AJDA 4BTLA 3B3QA 3MVEA 2WUDA 2WSLA 2J4FA 4PW0A 4CG3A 5HF8A 5CH5A 3DNMA 4EY6A 3F98A 4G4JA 4B82A 2XUFA 4Y2XA 3D3NA 4FHZA 5LZ7A 3O9MA 5JZ9A 1O6FA 1H2WA 2OQVA 3P2MA 1ODTC 1UOPA 1CUXA 5T4BA 4DGQA 4MXDA 2E3JA 1QLWA 2BAGA 2WFZA 1QIHA 1VE7A 5JAUA 1W75A 3WI7A 5AM2A 3I2HA 5CMLA 4EUSA 5DLPA 4JH0A 1MX9A
chains in the Genus database with same CATH superfamily
3QU5A 4HEA1 4R83A 3CRNA 3JYQA 4F8JA 4XLLA 5JS6A 2VPTA 4TLMB 3O4GA 3P9YA 3IMKA 1ESZA 4MI3A 2B8WA 3JWEA 1L3BA 1XZDA 4DBLE 5AR1A 2VP5A 5FTMA 3MTQA 3KC2A 1OC4A 2H2FA 5T7BA 3KT3A 1JT2A 1LY1A 1FP4A 1R6BX 2JBAB 3IO5A 3VPSA 3AKCA 3UPDA 5JCPA 3AY7A 4H35A 4L85A 2ID7A 5DX0A 5EWJB 3A4IA 4OFWA 3D6VA 1H0RA 3D02A 3TAXA 2I8LA 2WG2A 1TK2A 4RD1A 1HZZC 4DTCA 1R7RA 4RTKA 2OFOA 2O5VA 3HC7A 3KWJA 5CEEA 4B6JA 1DC3A 4D57A 3KQOA 4WCFA 5JYDA 1X0XA 2XNSA 5EAIA 4BVGA 3ZE9A 4GM4A 4LC1A 3BTOA 3C8HA 2DF8A 3TRFA 4RXMA 1L5VA 3AXTA 1J2RA 2HD4A 4J0QA 1EFTA 4F4HA 4PSCA 5HCIA 2AQKA 4EGCB 4F71A 1KNQA 3NM4A 5GY7A 1HFEL 1JT9A 1ZJ4A 4KOAA 1N1EA 4OI2A 2WWIA 4Z9FA 2OFXA 2Z6AA 2BONA 4BO0A 1IUPA 5B6JA 4B40A 1SC4A 1YHZA 4EPWA 2B6HA 9ATCA 2O07A 2QTZA 1JHDA 3PWZA 4B7CA 5CVUA 2QT1A 1UXJA 3A70A 2P3LA 3OURA 2W0SA 4XRRA 5DWQA 2DBZA 2R8PA 1ZHHA 4X6UA 4RXUA 3QNUA 3CF2A 1XU9A 1TVKA 2VJLA 2NZVG 3RYIA 3R3UA 1BRTA 1WMFA 5HUJA 3NT2A 5EMHA 4TQ9A 2O3RA 4ADSG 2WABA 1CY2A 3EAGA 1WRBA 1O77A 4I6EA 4UCQA 4F60A 1UJ5A 3FFBA 1YBVA 2G28A 1Y3FE 5GMOA 3WK9A 3I04M 2PA3A 1QZZA 4WZZA 2FMHA 5JAZA 1T4DA 1TJ4A 3W9SA 2X15A 4RH0A 4MKZA 3WJ1A 3L5OA 4F7DA 1YR1A 1KBZA 1UUFA 2UVDA 2ZJYA 3OE4A 1CZNA 1Z2OX 3QHPA 2Q5LA 3O38A 4RHEA 4P9NA 4WFQA 5CUQA 2B7LA 1L5HA 4UDYX 3JAMA 2HEGA 2X14A 3QY0A 1ZOIA 3E9CA 4AUKA 3ZV5A 3IQFA 1VLQA 3OU7A 2ILVA 4AMYA 4EPVA 1GWNA 3GYGA 2MCFA 2RJOA 3M81A 3VYWA 2PH7A 4ONEA 3JQ9A 3OU6A 2HBQA 3AUXA 3BIWA 1EVYA 1XXHB 2L82A 4JS0A 3H86A 3G2QA 5E6SA 5JQGA 1ITZA 4WVLA 4NS1A 5THXA 1OHHA 3K0EA 3H2SA 2VWGA 5C4GB 4GRAA 2IELA 2AEJA 3OE1A 4EHAA 5IWAB 2O2YA 3P5BA 1AXRA 1TM1E 3OLYA 3VVLA 3MINA 3FCYA 5H5JA 3D6JA 4BFWA 3ED5A 1U94A 2HA6A 1QYCA 5KJEA 4L9AA 2GZ2A 3QEJA 3TNJA 5ALSA 1CV2A 1XKLA 4N8SA 1Z68A 1W36D 1H4SA 1GZ5A 2YX1A 4DLZA 1SELA 3ET4A 1TM2A 4MQFB 1YVDA 4N8DA 621PA 1ZPDA 4DV5B 3GRPA 3T3DA 2OKGA 3H84A 2IDMA 4FGKA 5IN5A 2C03A 1Z4NA 3K9BA 1JKJB 3EOAI 5EPEA 1PT9A 1W88B 1X8JA 5IU6A 3PFNA 5FOQA 2XA2A 4J4BA 4JBLA 3SKYA 3FRHA 3ZVRA 2OAEA 1HDCA 4AJ4A 4C2TA 4FJ0A 3LIIA 3QIAA 4ZRMA 1GSAA 3Q10A 5EPUA 1AN9A 3EG9A 2OV2A 4BX2A 1WMSA 2EBHX 5AMXA 1CQIA 1KOJA 1JJBA 1RYNA 1II8B 3B6ZA 3LHIA 4K9DA 3DTVB 5J40A 1W0JD 3Q11A 3TBKA 3AVOA 4G4SO 2RB4A 4IWNA 5JWRA 4RKYA 3V42A 1YUNA 3DO5A 3WMGA 1E9EA 1Q1NA 5TQ2B 1CDDA 4IGFA 3LT5A 4ALLA 2O50A 4GLOA 2G67A 2EYQA 3HFJA 4K86A 1ZM4A 3WMRA 4D8WA 4NJMA 5F2NA 1AK9A 3DKIA 4JELA 5FWNA 4NMMA 4DQXA 3CRMA 4EYQA 1N8TA 2P40A 2QGNA 3F8TA 2Z58A 3NDPA 5BQOA 3HNOA 3OO1A 4BNYA 2EJUA 2FZ5A 4A8JC 3QLVC 4MUXA 1D1TA 1E2JA 4HTFA 4AJHA 3FETA 4JGIA 1E3TA 4Y1EA 5FADA 5BYBA 1IVNA 3HRKA 3S1AA 4AP9A 4QBHA 3VHXB 5HMLA 1LF0A 1KGSA 2OV6A 1CJKC 2JHGA 3ICEA 3EVTA 1VG0B 1OGIA 2QD2A 4FOOA 3RH0A 1OWNA 3V7WA 1EA5A 3QQ5A 1F0KA 5HE8A 5L7TA 4PPYA 2CNOA 3PNOA 1T9GS 2JD2A 2ZRMA 3QXXA 3I23A 4K1XA 4R2XA 1PV4A 2IUUA 4O5OA 2E55A 2WWRA 3ILHA 1N5LA 4AVYA 1F8UA 4BFTA 5K4AA 4F4CA 1K7YA 1YUMA 2B4QA 3G0IA 4H60A 2ZJ5A 1GKKA 3O2NA 1K8ZB 1BH6A 1GNVA 1Z26A 2FCAA 1YZLA 2Q2VA 3CCCA 3B1JA 1OWMA 3KZNA 4M37A 2YOFA 4MEBA 2C59A 4Y2RA 1E1DA 2IUSA 3C5VA 3G1TA 1H1LA 4TMKA 1G3IA 1XX6A 2PWPA 4Q1CA 5DPMA 2Y9PB 2G1PA 3VR2D 4ZEMA 1A1SA 3NT5A 5J2TB 4I7EA 1H22A 4G2NA 2J30A 3BE6A 5CR9A 3ZQ6A 2DTDA 2ZBDA 1OREA 3LY7A 4N0DA 1C3VA 4K8RB 2P2LA 4Z8XA 3PU6A 3NFRA 1VHTA 3MMZA 2ZIVB 3TOCA 1BYIA 3LP6A 1EX7A 5HK9A 2D74A 1XAIA 3IJEB 3M5PA 3PXAA 4K5QA 4OYRA 4R8MA 2IZ1A 2XNCA 3NC0C 2R65A 1K75A 2WINI 2GD1O 1U1GA 4DILA 1GKYA 3ND8A 3AKYA 4LXHA 5D00A 3RU2A 1MIOA 3CW8X 1VTKA 2CMFA 3UBMA 1MH9A 4YRNA 1N3YA 5EGNA 3COWA 1SCQA 5I7WA 5AJXA 2NTYC 3D2BA 1UKVY 3OZGA 3ZE2B 4LWQA 5D5PA 1AGYA 3PYLA 3VPFA 3AK4A 4BE7B 4D2IA 1L5OA 3MTIA 3ONFA 4DQVA 3W5VA 2QN6A 3K70D 2EERA 4DCVA 4HB3A 2R8XA 5ESXA 4FGSA 3W5BA 3DMHA 3KALA 4PYRA 5HILA 4NONA 2Q4DA 1P0CA 4IR7A 3ANTA 3O8CA 1W5AA 2XWSA 2B2NA 1P1RA 3BMXA 2V6BA 2JI4A 3P71T 1WM1A 2VNHA 3CYFA 1KAOA 1PJ3A 4FJ1A 1W34A 3K8QA 4ZVNA 4TRRA 3QTLA 4ZCRA 1MUUA 1VIVA 4YRJA 2WK1A 1D4FA 4YDHB 5H16A 1H9AA 4XCXA 3LTNC 1N5RA 2F1IA 5DBIA 1DHTA 4FFPA 4OGFA 3MD9A 4CQMD 1W4CA 2GVNA 1RLMA 2DRIA 3FDZB 4GYYA 4BPBA 1C5KA 1L7EA 2AEEA 3L7YA 5D3KA 2DZDA 5JYEA 3O47A 3OT1B 2VNAA 2J3EA 3OZRA 5ADUS 4INPA 3SQXA 1ODIA 4BVBA 3PVZA 3I6IA 4O4IF 2NTVA 4LG1A 1FFYA 5KDLA 3TQIA 2A5LA 2WICA 1KDOA 3EXG2 3ZDCA 1U1EA 2ZR7A 3N2GB 2GUGA 2VDNB 3C7AA 4JT2A 4Q6WA 3SR3A 4D6PA 4X1KB 2AUNA 5AOCA 5BN4B 1TDJA 2JNWA 1W93A 5E9WA 7REQB 2C7PA 4ZI7B 2QP3A 1VL6A 4C7VA 1XEXA 3QPUA 3JVEA 2A3NA 1OXVA 4MQMA 5FIUA 1RI3A 5HUQA 4KIUA 3FZQA 1SPBS 4OQFA 1VYVA 4DHWA 5E2AA 5BRNA 1G291 2QL5A 4PZPA 4Z7QB 2JHFA 1QVVA 1WHTB 3N8KA 4FOSA 4UEWA 3U7GA 3K0CC 3EXEA 3BF8A 5D1HA 5KYXB 2P9GA 1YI1A 3IUQA 1CW2B 3AV0B 3QV1A 4YRQA 1TIBA 4JKYA 4L28A 4UCFA 2OOSA 2PK3A 3IP5A 2BKUA 5JD3A 4BO6A 5CH8A 1FFAA 4RY0A 3JZIA 1ZH8A 3STUA 4BTVA 3IBFA 4JQOA 3WIUA 4L5BA 1M2HA 3QLJA 3O95A 2PN1A 1QS0B 3T7JA 3CLTD 4U7FA 4GZLA 2HPAA 3ICCA 5DOVA 3TTUA 1ZD5A 1YC5A 4C01A 1Z33A 3FCAA 4TKUB 2IEDA 4B75A 3RD5A 4P3NA 4G3XA 2AUTA 1ZQ1A 3GXOA 4NFYA 3UXYA 4A0QA 4E22A 1KKMA 1P1HA 3Q15C 4LK3A 5G1NA 3T1OA 3IUJA 3D6AA 1GR0A 3PF9A 1OXTA 1GFZA 1R12A 3JWGA 3TSAA 4WZAE 5G0TA 1LJUA 4DJDC 3K0SA 2KLHA 1CHNA 2NU9B 2IA5A 2IXGA 1NVGA 4QTTB 3WBJA 5TB5A 5IXYA 2FK7A 5K0FA 2L0XA 4DEVA 3G9XA 5JFGA 4O2RA 2FNAA 3EFHA 3FRIA 4WOBA 2KE5A 4K87A 1MBZA 1NZDA 2R751 3HDVA 4PHFA 2PNJA 1G3QA 4DTIA 4J7CA 2IVZA 2JCYA 4YGXB 1KDZA 1P1IA 1EX1A 2GM9A 4UOZA 1ZDMA 3QZUA 2ANCA 3P5SA 1I3LA 5FV7A 3SFTA 4AJ2A 5DHPA 3DMTC 4QTZA 1NYRA 4IJ5A 1X1EA 2BELA 5C53B 5A05A 3KOOA 1IIBA 4D25A 4TZ6A 1JIJA 1T15A 4G01B 5DLEA 3VC7A 4B2PA 1BWQA 3O2QB 1FMLA 2CWWA 1GUYA 5ALYA 4B83A 5EI5A 2FJUA 4IIVA 2PEYA 2BIFA 2RKBA 3WA7A 2HF2A 2BSQA 2ATVA 4LDJA 5IDWA 1U5BA 2VWHA 1LB1B 3O31A 4B4VA 1MVLA 1B14A 1PSZA 1XF1A 2MYUA 4Q3LA 1V6AA 3QVVA 4RKQA 1RADA 4TS3A 4ALNA 3PEWA 4XJTA 3R9WA 1IEXA 4FGUA 4DEYA 5A02A 3WIVA 1V41E 1E1LA 2VQDA 4B7AA 1GU7A 1V37A 1FBTA 2GEVA 3JQBA 2AKAB 3IT1A 3LKBA 3M6AA 3LUBA 3WFIA 4B6OA 3JQRA 5F7ZA 3JWJA 3WWOA 1ZC4A 2A9QA 4UTRA 4NATA 3L0CA 3I6QA 4KNVA 4CKWB 1X6VA 1XTTA 3DL2A 2PX3A 4OJTA 3NCHA 5C34B 2AW3A 3K6JA 4J90A 2VZ8A 2HDOA 1QZTA 4E0BA 1H8HA 3SFZA 2PLNA 3A9SA 2ZTLA 1NFRA 5FI1B 5EJ4A 2DR2A 3GPIA 1CU1A 5JNRA 1R88A 1KYXA 5JFOA 2JLCA 1PZFA 2EJTA 3H1TA 4NPHA 1TU0A 2R1TA 3RSQA 1UMKA 5CYGA 1R9JA 1TMKA 2BFDB 2IP2A 4GI7A 1JFSA 4LV8B 3GA7A 5EA2A 1XMSA 4OX9Y 1FSPA 4FKBA 2BHNA 4XW2A 2ONZA 4IGEA 5KOIA 2X0KA 4BV9A 5IM4A 3OTIA 3U26A 2KI5A 1KWKA 3ORSA 2GO7A 3CV3A 2NO1A 3RK4A 1P3Y1 3K0KA 3VO8A 4OHVA 4C43A 1MXHA 5ITZA 4EEKA 5CITA 1NW4A 3HKCB 1BD3A 1NR5A 3NM5A 5DXJA 5E3HA 1DJLA 1S3FA 4PFJA 1FJGB 3QVSA 1L4FA 1J9ZA 4PCAA 3VX4A 3G82C 3B6KA 1I3MA 3AEQA 3L7IA 1KK1A 1Q11A 4IIUA 4WZBA 1P7PA 4CIVA 4K7JA 3Q7PA 4IIDA 4KV9A 1U0NA 3NCTA 1G4AE 2AOTA 4W82A 4HNRA 3IVCA 3OF2A 4D74A 3KT6A 3I4LA 4LDNA 2BY4A 4Q7EA 5HIIA 4JASB 4G8DA 4GO1A 3ETGA 4JNCA 3KYIB 3RTAA 2IEGA 5ELXA 5LQCA 1DTWA 4R7ZA 2FRVA 4ZV7A 1FX0B 4C6TB 3GW8A 1AKYA 1OFUA 4PYLA 2QLTA 3O03A 3QJ5A 4O4JA 4GW3A 5KYYA 1E9AA 1T0UA 2H4HA 4OHZA 4M53A 1P31A 2QMOA 1FRZA 3ZHXA 1TMOA 5BO5A 4CBVA 3EUEA 5REQB 5ITWA 2OCBA 3U4CA 4Q9IA 3EMDA 4EUFA 1RYYA 5BN1A 2R48A 1JQKA 3O4IA 2CFIA 1L5ZA 4H7PA 2Q8QA 1EFHA 4M36A 4UBKA 3WRVA 3KLNA 4BGDA 4I5EA 2PRYA 1XCJA 3LQ4A 3M83A 1IJFA 3ADBA 1N8KA 1LPOA 1RC1A 5AW2A 2J85A 3GFGA 2PT7A 4CGYA 2V0NA 5CD9A 4LFAB 5F1YA 1IULA 1I0IA 4CQLB 1F3LA 3RANA 4CQJA 4C0AC 1V8DA 2QX6A 4CKBB 4ARSA 4GICA 2QTRA 4IVNA 1AC5A 3C1AA 2F3TA 3JRWA 3R77A 3F47A 1QCZA 1U2DA 3O1IC 4WA7A 1MPXA 1OTXA 3P9SA 4QIHA 4F0JA 4OJQA 1MENA 5EY5B 4Z3DA 2ACEA 3TL6A 4YCCA 3I9V6 3BL6A 1EFVA 1PZMA 3QENA 3IE1A 1S4MA 3IIJA 5HS6A 1MX3A 1S5PA 1EXNA 2CC2A 1E3JA 5JSFA 4OLFA 1VKHA 1G20B 2GOYA 2VPXA 3M7IA 3T7DA 2I71A 3GCGA 3KL4A 3QWIA 4BMCA 5FEUA 4MHTA 1YB1A 1PU2A 3FB1A 1MB0A 3HZHA 4KBYA 1H9CA 4UEOA 5K45A 5ESDA 1AX9A 3LV8A 4I1YA 3OKCA 5KI6A 3ADKA 2R11A 2DBYA 1M8PA 1PK8A 4PLGA 2I9PA 3O7WA 3Q7IA 4AS2A 3T3OA 1U4OA 3DZKA 1YS7A 4MNTA 1XQWA 2NN3C 2EF1A 2ZI5A 3DF9A 4HXGA 2YICA 3AOGA 3LH5A 4HF7A 3WYEA 2I2CA 1NQOA 2H4JA 4JP8A 1N2BA 3EWSA 3GLHE 5THQA 3M4ZA 4BFUA 3QLUC 3EGIA 5ALEA 3S8MA 1Y42X 1ZUNB 2PWBA 3BIXA 2B36A 3MW8A 4Q34A 1PZEA 3UC5A 3ZE1B 4JI1B 5B6PA 4YMTA 3EPKA 3E7DA 3NKLA 5JAPA 3DO8A 3E05A 4FQ7A 1G5QA 2B5WA 1H65A 2Q1WA 3NEYA 1WBDA 4IIXA 3C8DA 4URFA 4DADA 3CSDA 3LZDA 4H1HA 4XSVA 4Y7CA 3TMKA 2BHLA 4GOND 2W58A 4EG8A 4BQIA 3UTDA 2O8BA 2YWJA 2FTKE 2WF9A 4QFBA 4BNFA 4D8XA 1M7HA 5H8WA 4QPJC 3TM4A 2C4WA 2YOGA 1F2UA 4W7IA 4BVHA 2C4UA 4F96A 2B4KA 3EEFA 3JV7A 3RTGA 1DU4A 2F90A 4C6RA 4OMCA 2AG0A 2ZCVA 3B85A 3O1LA 4KQJA 4OQXA 1AV6A 3NTLA 1N2JA 1ZJZA 3A11A 3DQQA 3K1AB 1FA9A 3C5WP 3RABA 1QHYA 4JOQA 2YMLA 4PGMA 2HK6A 3K8YA 1GRCA 1KK0A 1L3CA 4MIKA 3E27A 3AVTA 1JHYA 3D5EA 2JFZA 3IOCA 4GWKA 2PZ8A 1X7YA 3T5DA 1VG1A 3LCJA 1W4RA 3ID6C 3BDAA 1U4NA 3Q7RA 3AF2A 1BKSB 3FVVA 3GVXA 5H9VA 4G1EB 3GBVA 4ZV9A 1AUXA 4UXIA 1M1YA 1CJVC 3GEIA 2XMDA 5EWLA 1TCVA 3HXPA 5DP1A 1I7SB 3W34A 4K3VA 2W6CX 1DKLA 4LDPA 3OIUA 3CLKA 3G2IA 5HFNA 4X44A 2CSXA 4AKHA 2BGLA 4IIJB 1SXQA 2RI0A 4GPBA 4RANA 5DCUA 1WOYA 2YYYA 5IAOA 1OLXA 3QKRA 4HZGA 1GEEA 1QTRA 3DOOA 3V7YA 3WNVA 2J1LA 4YJ3F 3H83A 4QLBA 4KQ6A 5EIXA 2WWXA 3IUPA 4MQ6A 4RK4A 1IOLA 2O1WA 4WBNA 2PDAA 3FMGA 1FUYB 5K3CA 3K6SB 4NNOA 1IOZA 1J2UA 3LLCA 2XSZD 3WDMA 4HRAA 4NCHA 3A4MA 4OFBA 5EJIA 5HE9A 3ZD9A 1P9WA 3IODA 5CBPB 1FP7A 5CB4B 1TVEA 1ST2A 4IIEA 2QTTA 3F4LA 3K9LA 2XCQA 3NNDA 2C00A 1T8TA 4MICA 4XQ0A 1E9CA 1G5RA 1G42A 2OQ2A 2W2TA 1M2GA 3K9CA 1CUJA 3L2OB 3A7DA 3VTFA 1E1NA 1XRRA 3VKUA 5DN6D 4F3TA 4BO4A 3VV2A 4W5JA 5EE9A 5BSKA 1B2LA 2FSVA 4HS4A 2GN0A 3EBOA 5CW1A 1ZNZA 2XRMA 3SBXA 3WYNA 1JLKA 3STTA 3PE6A 4KGDA 2O8EB 4MULA 4KQKA 5A1JA 5CD1A 1HR0B 2BFPA 4P5EA 4BNKA 1DJMA 1K5GA 3GRCA 1KZ4A 4R0MA 4TZTA 1RS0A 4YXWD 4R69A 4R31A 5ALTA 4ECEA 2W2PA 2YS6A 5LZ8A 4UARA 1GKIA 4HQNA 2Q5QA 3GLGA 1SB9A 4GGOA 5LA6A 4DRZA 3HWSA 2P67A 3JQFC 3ZDXB 2P4UA 1GG8A 1EMDA 1EAYA 1V39A 2C77A 2JAPA 1NBWB 4FFRA 3N86A 4QXOA 3W1EA 4YRMA 5KSZA 3BJRA 1PJ2A 4Y2YA 4ZZ3A 2Y1DA 2B94A 4HPJB 1QFMA 1GNLA 5C51B 4MO9A 4EWLA 1UFOA 2VDJA 1TEXA 3ZY6A 1QZUA 1Q7GA 2HWKA 1EB8A 2XUQA 4I4TF 4LJSA 1D6SA 4DLAA 2H18A 2IZ5A 3K31A 3ZHOA 4EENA 3H3XA 5A3QA 3L05A 3NHMA 5LDHA 4D4KA 4XYBA 2DLCX 4QECA 1SUWA 2VZLA 1KP3A 3OMXA 4HB2A 2GRJA 1V1MB 4MYCA 4C7OA 2VBGA 1GZ7A 3PFBA 4Y6QA 3VAAA 3QXJA 2W6IA 3Q7SA 1JAXA 5FL7A 1H2RS 2J3IA 1FLVA 4WK2B 3TD9A 4PYKA 4A9AA 1SHUX 2WYUA 4WLVA 3RBXA 5EJAA 5K3SA 1O6GA 1T9DA 2AF3C 3SJBA 4WWHA 1PJAA 4I9NA 4MUAA 3OLQA 2QYTA 3LBYA 2RI1A 1Y3AA 4KQ9A 4BFVA 2DPHA 1KO7A 1P7VA 1XGKA 2PZGA 3C6QA 4GU5A 4PZLA 3CRQA 4RPHA 5CM8B 4GXNA 2VBIA 4Z0PA 5BVGB 4KKXB 4HP8A 1VGQA 1FUEA 5L4NA 4UTOA 4FIDA 1L8XA 2WIKA 5TT0A 4DDUA 4F92B 5CYPA 1DHRA 2R87A 1CQPA 1YDFA 3IO3A 4XQGA 4LE1A 3CT4A 2XGOA 3N75A 3PITA 1UH5A 2B7CA 1XZBA 4R6XA 3VNUA 3FSJX 1UBFA 4X3CA 3IDQA 1ADFA 3NC1C 3U7IA 2XNDA 1H2AS 4MR8A 3PPVA 4HLDA 1FYFA 3VAZA 3IXMA 1EE1A 3MNFA 3FUCA 2J7PD 3UZUA 5HOQA 3N3AC 1OOEA 3B1FA 3FDXA 4QL3A 1J8MF 1O08A 1PYGA 3R24A 2PUFA 3SMVA 2H11A 4AECA 4MVJP 3E4DA 5B58T 5JWHA 2F55A 3K96A 3Q8MA 1TAUA 4M8SA 2NYVA 5KX5F 1F0PA 4RFSB 1YRWA 2CDBA 3KUDA 1DLIA 4QGSA 1OR8A 3VH4A 1OA0A 2PT9A 2D2IA 5HR5A 1NP6A 3TDMA 8ADHA 5ICCA 1X42A 5COBA 1IE3A 2BGJA 1TC2A 4UTVA 1BMDA 3A1UA 2I3ZA 1PR6A 1XZAA 1IIRA 3DBVO 3U2QA 4TN5A 1ACJA 1HMPA 2G40A 4FMCB 4W5HA 4QXPA 1KRWA 1E7YA 1KPHA 5YASA 1VBMA 2SNIE 3TXYA 1XZJA 2VEDA 3DCJA 3GJXC 4TS9A 5EXPA 1OBCA 4K0KB 2F9LA 3SQNA 3HXMA 4XPZA 4RHTA 4BDTA 4M55A 4NU6A 4K2AA 5FNVF 1HT0A 3MT0A 3GP5A 2Q5HA 2PTGA 3BFPA 4LOAA 3ASVA 3P2OA 4XUEA 2IWHA 2XCOA 2Y1GA 3FAZA 4NBSA 3TFWA 1PKEA 3KB1A 3NTVA 4HLUC 2PRKA 4PC7A 2BFMA 1PW7A 3I12A 4W6QA 1YTUA 1UMBB 5BMVA 3FN4A 4L0CA 1MJFA 4FTWA 4YCSA 2FPUA 3W1WA 2CK3A 1C9DB 1V16A 4KWHA 5KO2A 2AZTA 4H1UA 1NDHA 5IJAA 1RR6A 5CNKA 4FWBA 4NAUA 2I34A 4U2KA 1CDEA 2CLHB 3G13A 4P92A 2I4MA 4C4OA 2FQXA 5JRZA 3SC3A 2WB4A 4BMDA 3RB8A 3TJRA 2ZUTA 3WZLA 1U2QA 1GM5A 2WM2A 3VU9B 1B23P 3E7XA 2CHFA 4NOMA 2R4QA 5B55A 2YUIA 1CUBA 2CEKA 4M86A 2WVAA 4X3OA 1PQYA 4P1ZA 1WQ3A 2NU8A 3T5MA 3RYCB 4J43A 1ZXBA 3D1VA 2KPOA 2R62A 5DSTA 5K09A 3L01A 1J99A 1GAXA 3O7MA 2OUIA 5AI6A 5F98A 5BWCA 2UZ1A 3FY4A 4YQFA 2GHQA 3DHNA 4MGZR 1V3QE 2BMEA 5GOTA 4B32A 1O95C 3FOAA 1I6WA 1DIAA 4MS1B 4OH7A 2QYOA 5J4VA 4MYDA 1NV8A 1KERA 1FSZA 2I8AA 5KTOA 1EP9A 3DMDA 2ORYA 3FI0A 1E77A 1J8DA 3UT5A 3TRDA 4JXKA 2RGWA 3E70C 3KYCB 4CF3A 4HDNA 1TT5B 3RF6A 3H1PA 3RVPA 5B5SA 2VZ0A 2JJ8A 3TGWA 4JC8A 1BGVA 1J2EA 1E9FA 4QGGA 5I7VA 3TM5A 3JZMA 4IBOA 4XAQA 3V4FA 2RK4A 3I76A 3VVMA 2R3SA 5KKCA 5KNCD 1G38A 1U0EA 3F73A 2XWPA 1KY2A 3PGLA 2HMVA 2J4DA 2BMAA 3KTFA 4RK5A 1FBNA 2QUHA 4RIHA 4MS3A 3LECA 1YRLA 4RW0A 3KZOA 1CULC 1W0KD 5EE0A 3FYDA 3N28A 2XQFA 1E0SA 1QLHA 4OHCA 4LJ9A 4AKEA 5HQ3A 5E2IA 2X4GA 1YS6A 2NUTB 3KVOA 3O1JC 4HDRA 2V0GA 1CQJB 3UH0A 1QTIA 2FFAA 1M8GA 4D9FA 3Q3CA 1G3RA 3NUZA 4ZWNA 1ZMBA 3HB0A 4REQA 1QCYA 4IYJA 4M0KA 4P84A 4UZFA 1OY1A 3BK7A 4HGOA 5DULA 5ED0A 2H1HA 5AD1A 4UUNA 1KQGA 3A3OA 1CF9A 1C3JA 5AM5A 2MIIA 3JCZA 1JIXA 2A7XA 2AXNA 9GPBA 2OZKA 3ITEA 3M9LA 4ZYVA 2EFGA 1RP1A 2X5OA 3O4RA 2FV8A 2VXBA 5TMBA 1BJTA 3BMNB 4JR0A 2Z8ZA 5HKAA 5I3CA 4BU1A 3JYHA 3NBMA 5SV2A 2NVOA 4DLNA 4KHPB 4UMDA 3WLEA 1LC3A 2BGNA 4P3KA 2IDKA 2A0UA 1PNQA 2OECA 2H85A 2PTHA 2YQ4A 3KSMA 4UU8A 4YDRA 4YAGA 1HF3A 2IOHA 2PH3A 4AP6A 1PJ4A 4F3RA 3L7CA 1GV1A 3X44A 3ETLA 5LMNB 2YY5A 2Q50A 2PKXA 2KBFA 3CNHA 3TSCA 4S3MA 3DYVA 3E8SA 1YJCA 4GBJA 1JSLA 1V25A 2P68A 2Q4TA 2YMMA 4Q1BA 3UOAB 3VU8A 1KXZA 1KEEA 3GP8A 2I1LA 5DDIP 1V7QA 4BFSA 4Q7QA 5GINE 4LHEA 5EOVA 3EIHA 3LA8A 3ZDYB 1TEVA 1BVRA 4FYYA 1G2IA 1T9AA 3BDVA 4II2A 5AUQA 1RWOA 5BUSA 4MUMA 2CL0X 1ZAYA 2J09A 2MR5A 4QA9A 5F52A 3W2HA 4RFLA 3ZCQA 1EAMA 1RRFA 1H23A 1WF3A 2HCBA 2NZ8A 1W85A 2P9CA 1ZU5A 3FXAA 1G9TA 4L9SA 2KMLA 5D5HA 3A6ZA 3WRWA 3WLHA 4DIEA 1RWQA 2DFNA 3KCNA 3S2GA 2GN9A 1YMUA 2XLBA 3OJOA 3FKSD 4ZHQF 4KO1S 1P2TA 5EIHA 4CLOB 3BF7A 3GDGA 5IUKC 1R3UA 4AI6A 2I1QA 3DPSA 1DOZA 1XDZA 3L4SO 3ABRB 3B2QA 2QQEA 5CXSA 1BKDR 3WNBA 3RROA 5E6RB 5JI3E 4URHA 2DY0A 3OMWA 2WHPB 3CEPB 2JGAA 4EMTA 2OV4A 3DM5A 2UUPA 4GECA 2OFFA 2O7QA 4QBFA 1ORWA 3CBQA 3QXGA 4C0WA 4Z1MD 3FPGA 1ETHA 1JHUA 3OSZA 2GF9A 4HDCA 4D4LA 5JNWA 1NLMA 2W2LA 3OI7A 4HN9A 1Y5NA 2RGGA 5LQMA 2NZWA 5TE9A 2GLTA 2HU5A 3PFWO 3VI4B 3AF1A 2GBLA 3SKVA 3BD8A 5KYWA 4CI9A 4DGSA 4HC4A 4Z49A 1EHYA 5GJWC 3LPMA 4KYTA 1QH9A 5T3YA 1MRNA 2O3SA 2O2JA 3C1UA 4FDAA 5GPBA 4PN3A 1XNGA 2RD2A 4NE2A 1FUUA 1UBJS 3QF4A 4KPEC 3WB1A 4L22A 3FJOA 5IX8A 3N5CA 1R4MA 4EJSA 3NONA 3AF4A 4KDRA 1RFLA 2MT9A 2QU8A 1DKUA 1THMA 1TUEA 2OP1A 4G09A 5IKMA 4I3GA 2O06A 1ISSA 2JS7A 3AILA 1N6NA 2P41A 1GYRA 4NICA 3GEBA 4Y18A 2WOOA 4AG3A 1U2TA 3GARA 1POXA 4ZI2A 5KNDH 4H17A 4Q3EA 1W73A 4R68A 3AY3A 3F8SA 3MUEA 4CU5A 2YXEA 2FZEA 1HC7A 3BCHA 5DXFA 5A1TA 1Q3KA 3DL0A 4LDRA 3O8OB 4CIWA 5L6LB 4RAOA 1W4BA 1HDIA 2JJ1D 1IWBB 3DA8A 3HFSA 1RYFA 3AZOA 1XNRB 3LQQA 4QPCA 1TAHA 1L1EA 3SAJA 1BC5A 1TCBA 3VR4D 3UG6A 1LX7A 1WXXA 3VDMA 4II3A 1Z4MA 4E51A 1TRHA 2EBFX 1C2TA 1A9XA 3I83A 1H2YA 4R9UC 1E9VA 5CVTA 2GA9A 1ND5A 2APJA 3G5MA 4I36A 4Q4JB 4XUCA 2DWPA 4BP9A 1M6NA 4S35A 4CF6A 2V9CA 4CM3A 2BOVA 2B8JA 4JLUA 1TM7E 2ENWA 1QYRA 4Q4CA 1CHDA 1PTJA 1NI3A 2W8ZA 4JXJA 2F8TA 1RPNA 1GRVA 2VT7A 3EC2A 1QHFA 3CKLA 4MDEA 5FDFA 2G0AA 2W6ZA 3CEAA 5JH7B 5AIBA 4KXUA 5D6NA 1XQYA 2B1GA 3PWSA 4Y6SA 4YRLA 5T8KC 5LBIA 1JL3A 1X87A 5KREA 1N9GA 4LSWA 4X8LA 1G5IA 3LUAA 4HNHA 5IFLA 1XEAA 2JVKA 3R7DA 4V2IA 4ETWA 4ZCLA 1VJ1A 1N36B 1CUGA 1MMFB 5JXGA 1XZFA 3LHSA 4N6GA 1BQ4A 3QF7A 4LYGA 5LC1A 5CVDA 1GVHA 4EHLA 1X2BA 4PYMA 3RASA 1NN5A 2O1EA 3AHGA 1U2ZA 3RIEA 3V97A 4CT4B 3S8YA 2WWGA 4ZTBA 3DZ8A 5AW0A 1L7VC 5BSTA 3W8DA 1PFGA 3UHJA 4EHDA 1D4ZA 3AB3A 4L2IB 3U4QB 3D0QA 5EFOA 4AY2A 4Q02A 3TLJA 3JWPA 3RRJA 3K2IA 1COWD 4EKYA 1Q7BA 1KNXA 3OJXA 4PQEA 3TLXA 1HOXA 3GFQA 1UT6A 2C95A 4I4IA 3ZZTA 2JGFA 5CA1B 1HTWA 2O3TA 2W4MA 1R50A 3ZWYA 4EKEA 2H08A 1IJKA 2HA4A 1RXSA 5ALHA 1VI5A 3I58A 2DXIA 2P9ZA 3SC6A 2PWYA 2R8EA 1W6RA 5EJEA 2GBGA 1JQAA 2VUIB 3H05A 3K05A 3SHWA 3QHQA 3NYRA 5T57A 2G06A 3TZKA 2B6NA 2BM9A 3G2KA 2IBMA 4ZVSA 2KB0A 1FTWA 3D3EA 5JDCA 1DC4A 2VHWA 3K4PA 5EIWA 2EKQA 3MWYW 3HU5A 4WNIA 3LPNA 1O5IA 3DEJA 4RH1A 3LT1A 4XQCA 3PHCA 2N46A 3VJLA 3ZLBA 1M72A 5EJ6A 2X5XA 4GE0A 3RU3A 3AJAA 4JLVA 5L45A 3BXFA 1NMYA 2HJGA 4OQEA 5CP8A 4B6RA 4TWAA 3TKYA 3WMWA 1QO9A 2PMBA 3E9QA 3IV7A 3K1YA 4S24A 5BSRA 1JXMA 3PUJA 1IHOA 3C98A 5B1EA 3BUSA 1VYUA 1NJ8A 1QFZA 2M6KA 2QAGC 1NUSA 4BNHA 1NXQA 4IEEA 2OBFA 3KPWA 4L8FA 4Q1DA 1MO4A 1ZRMA 4K9NA 3B7WA 4M7OA 5AK6A 3JD1A 3RS4A 3V4SA 5B64A 1SA0B 3MCAA 3SJZA 5JO0A 4HDAA 5FAXA 2R47A 2EHDA 2AC2A 1JLMA 1T36B 1CDZA 4TX1A 2EV9A 3QMWA 4HH0A 3GK3A 2WIGA 2BPOA 3GUHA 3QVOA 1Z6XA 2HK9A 2HU8A 3BILA 2YXDA 3LSTA 4NCNA 2VK1A 1L5NA 1M67A 2LTAA 3SJCA 1XG5A 2COKA 2J3MA 5DM70 4URWR 1BS1A 3O8BA 1BDJA 1C3EA 4AUNA 4JP1A 4PZAA 1V4NA 1R9NA 1XRJA 4MR9B 4RC9A 4XDYA 3HB5X 3MK31 4HMOA 4LZWA 2BFBA 4BO8A 3AO0B 3P0EA 3SOZA 2H8KA 3EC1A 5AW5A 2CNDA 3UHOA 2WIDA 3FJYA 3H6KA 5CCEA 5AVOA 1Q0PA 3RUEA 3DOFA 1QB8A 3LU1A 1OLSB 1PIWA 1RWVA 4HRYA 1T2VA 3AH8A 3U0VA 3KFLA 3BB1A 4UU7A 2JZNA 4DDWA 5I7RA 4ZTUB 1OAKA 2EGHA 1XN1A 1U1IA 1VI2A 2DOKA 3LBAA 1YA6A 3HYCA 1A5BB 1XQ6A 4JMPA 5E8JA 3IPLA 1R0RE 3IHTA 3P9CA 4HOYA 4YAFA 5JBIA 1BA3A 3U6BA 2O54A 4NBNA 3VDQA 2BI8A 4MVJH 1WE2A 2J5QA 3GLKA 3M4YA 4OBXA 1XDDA 5IBPA 1UL1X 2DYKA 5AJUA 4C4ZA 1TZKA 1GTL1 2R7KA 4XYMA 1WY5A 5EPOA 2HEIA 4EPRA 1LLUA 5FTJA 5EIBD 3G0BA 1Q0UA 2WKQA 2OCPA 5AHOA 4YV0A 1D4AA 1XTIA 1R0KA 5AHKA 2AVNA 1ZW6A 4RESA 3IDFA 4RA9B 3H6GA 3L1VA 2QUJA 3TX6A 3HJRA 1ESDA 1M0WA 4G4SP 4X91A 2C4NA 4ZAWA 3SR4A 1KI7A 1NMZA 1L7OA 3M33A 4YALA 4MLZA 3IDSA 2ZAYA 3M5CA 3L7MA 3EDOA 1JBKA 4KRXA 4F11A 4FB5A 3K0FA 4TLLB 1YMVA 4I55B 4JJGA 1IBKB 1ZYUA 1WJGA 3EH2A 1XZHA 4JQSA 1TO2E 1Z62A 3A1WA 2C57A 1YF3A 4IJWA 2YXNA 4MV4A 1UWVA 3E9DA 4WEOA 5AW8A 2XTJA 2ZWOA 1PLLA 3EE6A 1ECFA 1C4WA 1P3JA 4L5IA 1XAJA 4Q9LA 3ZK8A 2V7WA 4MEAA 1PFUA 3NGLA 5D1NA 2ODBA 4ZV4A 2B0JA 3DB2A 2OWEA 2I7XA 4EW6A 4AUEA 2QD5A 3FYHA 4BKMA 3F3YA 2HH9A 5CT5A 1A7UA 1QGYA 2A9KA 2FU5C 3LS2A 4OHOA 3THSA 1IY2A 1EHCA 3EVEA 3KHTA 1Z35A 2HWWA 1P0IA 2RG1A 4Z4FA 3OHSX 2WILA 1QH1A 2PRSA 3AJRA 4DFDA 2PU7A 4DC1A 4FDLA 1ONOA 2Y2UA 4DSTA 4S1OA 3TZBA 1BSVA 1DP4A 2H0RA 1T8RA 3PF8A 4HJXA 5E0KB 3T1NA 1X1TA 2F17A 3TIIA 2CLSA 5ARBA 2XGGA 1RC8A 2EZUA 2DFLA 4IDOA 1TJNA 3IOBA 1UMDA 3X2FA 4U9HS 2DSTA 3MCVA 1PJLA 3ZDEA 1YIAA 2NXNA 2A9OA 1OH7A 3RSLA 3L0ZA 3LDAA 3QKSA 3TD6A 5FNZA 1ZVMA 1YBMA 1NLZA 3I53A 3HBLA 2TECE 4E5DA 4ZDWA 1L6IA 1VZ3A 4L4ZA 3GCWA 1L1QA 2NVBA 3N8IA 4I1RA 2X9VA 4JJIA 4MPDA 4HUTA 1YKSA 1YQXA 1Z63A 1LRKA 1BEZA 3LDUA 4GR5A 3V5NA 2ONKA 4I66A 3THYB 3B52X 1M1XB 1Z0IA 4RD2A 3L1UA 5F5NA 4JVMA 3MGGA 4RVDA 4YCAA 1JHZA 4EDFA 2IJGX 2PD4A 2AV6A 5AOVA 2MYTA 3ZOZA 3WGUA 3EISA 3FTPA 4LYDA 4R8KA 2I4LA 1AKNA 4EITA 3OX2A 4D81A 3OZXA 5K99A 5L95A 1VKOA 3I9V1 3S81A 2DTEA 3FVQA 2HF9A 5IHPA 3O0TA 1WDMA 3BXGA 4QSMA 1PTKA 5TGTA 4G6ZA 2I78A 1OTHA 3GDFA 3K0AB 4DCGA 4WJLA 5TPZA 4FEGA 1LRLA 3DE4X 2D1QA 1W25A 3CCBA 2I7CA 3QVJA 5FOTA 3COYA 2ONJA 5HQTA 4Q7JB 1BTOA 4HQLA 1BMQA 1B73A 3OCXA 2NWQA 4PX5A 2QXYA 4U2EA 3Q4GA 4F9FA 1DAHA 4IYRA 1ISMA 3PXGA 1G8GA 1WZCA 2NW6A 3LDFA 3PD0A 2GEUA 1FDSA 1P0QA 1SIWA 2PCJA 1T0BA 3IQGX 4KVAA 4K1LA 4LBWA 4TYQA 3RS5A 2V7PA 3BFJA 4D9KA 3NWOA 1Z2DA 1D5WA 1MZVA 3FHCB 5F4BA 3ZWWA 3UFBA 3G0CA 3WC4A 1TAQA 4ZZ0A 3I5YA 2AEFA 4GM1A 5KTMA 2F8SA 1R0LA 4BMNA 2FMXA 2H48A 3EZ2A 5KVAA 2Q07A 5J2UF 4RIFA 2CXQA 5F3WB 4Z9AA 4JYMA 3I72A 4TTVA 2P9BA 2HHLA 3B9RA 3UJNA 3QE3A 4YAKA 3DXZA 2HHCA 1QC5A 5FTWA 1LPPA 1VIAA 3MMNA 4UZSA 4ETMA 5HGXA 4RDIA 2I4TA 3PNVA 1JG4A 2Q99A 4JC0A 4WXRA 4Z9XA 1X1CA 4AQYB 2WTXA 3EZFA 4EYEA 3N0XA 1NLFA 4C0JA 4EI8A 4RPGA 5JV5A 2QKYA 2GLUA 3I5MA 5B3JC 3IQXA 1LSOA 4Z7NB 2Z56A 1UBSB 1L4GA 3F97A 5DK4A 2GTHA 3L8DA 821PA 5KWSA 2ZS8A 1IBRA 1FDRA 3NVAA 4QEDA 4BDSA 2HN9A 2ZZMA 1WQ4A 1E3SA 3AIKA 2HMAA 3BE8A 3UMCA 1NW8A 2ZE5A 1YDWA 3O6VA 2YNMA 1NXOA 1NSFA 3D3QA 4Q15A 4PLTA 3VMFA 5SICE 4D3XA 2QAIA 5LOVA 1UZLA 2JF0A 2Y1LA 3CH5A 3WLTA 2VOEA 5DW3A 4EIWA 1QE5A 1U6JA 1T5BA 5JYCA 3DBHB 4R0NA 3EY4A 4GMDA 2BKLA 3OQIA 2XE6A 2UZ4A 3TQSA 2R00A 3CNBA 3T7TA 2ZRNA 1FSFA 4KODA 3P0IA 2WFAA 4L51A 1DADA 5JAHA 3A4NA 1YZHA 2HF7A 2X3YA 1ZD3A 5FJIA 1P6XA 3JR3A 3G23A 5B30A 1JEAA 3EXHB 4JLJA 1JQLB 4ERNA 4NH4A 4FC6A 2E5WA 4OVKA 4CMAA 4KZPA 1GGVA 2W6NA 3X0DA 3PQ7A 2FLKA 1QANA 2ZGVA 5CDFA 3B6MA 2YJTD 4ND1A 4Q48A 4F6CA 4NBUA 1S6YA 1K3TA 2FXIA 1ISGA 2YZ7A 2G6BA 5KU1A 5F35A 4B3DA 4WKGA 3G2OA 1ZA2A 4QTUB 4I9FA 1MCZA 2O6LA 2OB2A 1L4BA 2FPSA 1QRRA 2YFYA 2PUBA 2ZWVA 3UJCA 1NAHA 3GLQA 4GQBA 3KM0A 4EW2A 1FDTA 1FS5A 1XD2B 2HO5A 1JIKA 4UFPA 2NUAA 2YVUA 2X1LA 4FYJA 4GOXA 4LV5B 1VL5A 3W8FA 3E7PA 3WAKA 2R6GA 2MWMA 3EFOA 4BZQA 4CEHA 2ZJ2A 4F12A 3W8NA 4ZJYA 4ZAYA 1O89A 3IV9A 2P2DA 1SXJB 3H65A 1NJSA 2FN7A 1RCUA 4QJ4A 2EGGA 1NOKA 4RE5A 3S2EA 2CXUA 4U6SA 5BN3B 4FW9A 4OHWA 1NJ5A 3ZK9A 3WLPA 1NVXQ 3X1DA 1UT8A 3G5UA 4IH4A 5BV0A 1A88A 1PG0A 1M34A 4JBYA 2BR3A 2QRJA 1E7RA 5DGDA 1ZIOA 1S8NA 3FOWA 4MKIA 4IUCS 3GD7A 4QXQA 4DMLA 1BO6A 1NGSA 3FF1A 3LPAA 2AJBA 4KH0A 5SZHB 4AROA 2PKEA 3GVHA 4RSRA 1FS4A 5CVEA 1JEQB 3DEYX 4GLFA 1DS6A 1VPTA 3P2JA 3RQSA 3URMA 4G89A 5EWMA 1WVMA 3OE5A 4HH4A 3ORRA 1FXWA 3AY6A 2WVJA 1X7WA 2Z2KA 4JHXA 4XD7A 3VU3A 1N34B 1IEQA 3AWDA 5FTNA 1CNFA 2ZJ6A 3JVVA 1YZKA 1ZEMA 1M2VA 1OYYA 4ZCTA 1FRQA 3PD7A 1AB5A 1PDOA 1PG2A 4NJOA 3OOYA 1QLJA 4B33A 5HIKA 5JBQA 1BXRA 1CBUA 3DTVD 3PXBA 4FN5A 4YUAA 4FYWA 1WCIA 3FA2A 4IDGA 1XXHE 3DTYA 1EX9A 1C41A 1J25A 2I99A 2QM7A 3H1AA 1PDWA 3VV3A 1MD9A 1DKQA 4ZVLA 4URVR 2VHJA 5KOHA 1XTJA 1A2KC 1M3SA 3B53X 4PGHA 3OQ6A 4N5DA 3BCUA 4TOIA 2Z9DA 2QR2A 3KWFA 3M6UA 3WWZA 1VGRA 4TMFA 2PRZA 4R5HA 4WRRA 4NCAA 1NNSA 5DBOA 2JCBA 2R6R1 2AZ4A 2WFLB 4REMA 1M5UA 1OIWA 3LQRA 3CUSA 4O33A 3U31A 4DDHA 2CB0A 2O20A 3WLLA 1BZYA 5DMXA 1HLFA 3GWGA 2E7ZA 2H9YA 3ZK7A 3E58A 1GN8A 5IMSA 3THXB 4YROA 3SF8A 2C58A 3QE0A 4UM9D 2AHOA 2XB8A 2HW8A 2FF7A 4L72A 1ADBA 3TBFA 3UM9A 2I6XA 2ONCA 4BNMA 1TD1A 2UKDA 1ID1A 3CNQS 3HCDA 3L7DA 3OJEA 4FSHA 4E12A 2WZDA 3F6CA 2J31A 1GPBA 1C1XA 2EHJA 3M5DA 3ME5A 5HKLA 2I54A 3S0JA 1AKMA 4ZGWA 4LNUB 4HPXB 4QOFA 3RADC 1LI4A 3NHFA 5I48A 1YRYE 3ZOKA 3EARA 1WKVA 2BUAA 1SBTA 2E4WA 2ZRHA 3FMPB 4RZ2A 4Y1GA 4MW4A 2WSBA 4IZIA 1DX4A 1OI7A 4KXLA 1A71A 5F4ZA 3RBAA 4EVQA 3LTEA 5DGTA 1IOVA 2FX2A 2G5TA 1C8BA 1KYQA 5SYNA 2CMGA 3AR7A 3TPFA 4B9AA 1HLDA 2F43B 2QL6A 2MTBA 3RSFA 2G1UA 3DWGA 3TI9A 2AC7A 1JV2B 4FGZA 3QI2A 4U7DA 1M7BA 3IEKA 3L8GA 3GLFB 1XZ8A 2CDNA 4QJBA 4MUYA 4U6NA 4B6SA 3AVUA 1H8HD 3PFFA 1CD5A 1Z0DA 1CKEA 2BEVA 2W6OA 3OP4A 2GUWA 2QTCA 1JH8A 1FVHA 2BFOA 4UM8B 1VDMA 1SUSA 3JQGA 4CKCB 3FMVA 3JATB 3LBIA 4MJ3A 3T35A 4LF4B 4IHJB 4P7KA 4X1YB 2WIAA 3K2BA 2JGDA 4CRWB 4EL0A 3K9GA 3U6KA 1VLHA 3BH0A 5F73A 3TKAA 4RYDA 4AJPA 1WPRA 5EGSA 5H4HA 1L5RA 4FX2A 1W6UA 2PE5A 1F0YA 4D8TA 1KQ3A 1OI3A 1VKNA 2Y1CA 5K0SA 4LNAA 2REQB 3GV0A 4O2BB 4QG7A 5EZ5A 1H69A 2CW5A 3IBSA 3UV6A 2ZLBA 3GJ7A 421PA 2HIGA 3AETA 1VDZA 1JEEA 4IFBA 4JIGA 3R6DA 1ZH0A 1W1UA 4I5FA 3Q6IA 3GRZA 3VZBA 3KBBA 5IVPA 1ADYA 2W2XA 1TQHA 1CUAA 2PUAA 1QIFA 4K9QA 4CM4A 2ZTVA 2N9UA 3N07A 4O4LA 2BI7A 4GKAA 1NBMD 3MWKA 4Y9SA 3TEFA 1D6MA 3DB1A 4P4SB 4DMUB 5AW7A 1OI2A 1Y1KE 2AH5A 2PUCA 4L02A 4AQ7A 3IAS6 2Y6UA 1N7GA 5JEDA 2FUG6 1GG2A 4E6PA 1UKCA 1JIQA 1LWNA 3HJAA 2X2OA 1LPAB 3N2IA 5HKBA 2VCYA 1PHRA 2OT3B 3L6RA 2ZAGA 4IFEA 4KX5A 3TVDA 3GIDA 3RT1A 3ZHUA 1C1DA 1ILEA 4US2R 3QEMA 1XKQA 4LTDA 2HSWA 2N3ZA 4RTLA 3F90A 5K20A 2QRHA 2WPNA 2PSJA 1A4XA 3NPMA 5I7AA 3W90A 2ZJFA 3B9QA 2C5FA 5HTKA 1PT7A 4Z51A 3HEBA 1JLLA 3L1IA 1YVUA 4GRIA 2WR8A 3E48A 4EG7A 1KJNA 3U4MA 3K4HA 2P77A 3FSGA 4MTLA 4ZT4A 2XECA 4TGLA 2VPQA 4C5AA 1P4GA 3ICWA 4ZREA 4I50B 3CPEA 3P9PA 2XVAA 4RKWA 1LW7A 4RYLA 2YIMA 3CR8A 4Y2QA 1FZTA 3H1GA 1VMKA 2BZ0A 3W5HA 3ZQUA 5C35A 4FCWA 2Q45A 3KQTA 3ZV4A 4O2AF 1Z2NX 5ALJA 3BQ9A 1XVVA 1XDGA 3E2MA 3SKXA 4HMPA 1FL9A 1H0KA 2VNSA 3TZEA 4WA8A 4BCBA 4BZXA 3KYDB 4DSUA 1UBUS 1HDXA 3K16A 5DNWA 4PRKA 4E4YA 1RTTA 1NBME 2I8CA 3L07A 1V5WA 1Y4UA 4HPWA 3GEDA 1NXPA 3MB5A 1FFBA 3KHKA 3SSAA 3MJCA 5K0JA 2OHJA 3D43A 1EXVA 1IAQA 1CX9B 4LF9B 4ZEXA 1J42A 2HB6A 4OP1A 4OXQA 3ISVA 3R7WB 2ZVJA 4KHZA 2P6PA 4IO0A 1V5GA 1QQBA 4GP9A 4PANA 1GSIA 2G9QA 1MVNA 5EKTA 4OF4A 2GD0A 2GTIA 2JEZA 2DULA 3O2SB 1CS0B 2ZWIA 4XX0B 4J07A 4DLVA 1IY8A 1G5TA 1ZL2A 4RCZA 5KSYA 4KEAA 5GJCA 4ER0A 3ZG6A 4RORA 3KVYA 5F78A 2F6RA 3ROFA 3T9DA 2VUHB 4OJMX 3RJZA 2G5CA 2VXCA 3F5MA 5HTOA 1JQDA 2CNNA 1RQXA 4F93B 5JW6A 1SQ5A 4RM3A 3BSYA 2YJ3A 3MFQA 2Q2OA 5CXUA 2NP7A 1SXPA 4OSOA 2ZRKA 3F8WA 4YHHB 3J81k 1GP2A 3IEVA 1O2DA 1UP4A 2JGJA 2L19A 2NQ2C 1AKRA 4M88A 3DJYA 4YWHA 1Z6TA 2R6CA 4QUHA 2O5CA 4G0NA 4FCTA 1KYWA 2NZXA 5EQJB 1E2UA 1KY3A 2GJ4A 2P4HX 3FZEA 2YWXA 3QVMA 2D8AA 4HDQB 1PSWA 3SC2A 4HYEA 4J2OA 3X1XA 1U98A 3MS7A 2R8OA 2CCKA 2ZUVA 2WU1A 3OLVA 1FY2A 3ZCUA 1ZRNA 3BHIA 2BMVA 2C2ZA 3CSUA 5CCBA 1SCUB 3TEMA 1VLJA 5DHQA 2GN6A 4TMXA 5EUCA 3SJAA 4XYEA 1WCYA 3SYLA 4CUJA 4P33A 2DKNA 4ES6A 5L3QB 3H8JA 4JA0A 4LJ7A 2H2HA 5LNK6 3EMVA 4DMCA 3G7UA 1I7QB 2LDBA 2QG4A 4KQWA 1FFEA 1ZG3A 4D9CA 2NMVA 1H6DA 4XIFA 1WMBA 4J0GA 4W9NA 4W7SA 2YQZA 1QUFA 1W19A 1ZMTA 2X9GA 3CM0A 3KEOA 4JK3A 1TFUA 3WGLA 3O4HA 3FYCA 1NBAA 2ZRBA 1IPHA 4F1JA 2YBEA 3AFIA 1JXAA 1ZX1A 4L3OA 1T3TA 3VH1A 4AJ1A 1VLLA 1PL7A 2OTCA 3EVBA 1JEJA 2QOEA 3MTBA 5FOWA 2PSSA 3V1NA 2CLMB 4FVTA 2NYRA 3OMLA 4LJLA 1G1AA 1N8NA 1PFVA 4URZR 1HSZA 3LQ2A 1JWAB 1M1NA 4TWBA 3N05A 1UMCA 1ZKDA 4M3NA 1VP3A 4RVOA 2H2AA 1T4CB 1VC2A 4J0EA 4PG8A 1MU0A 4DVGA 3HO6A 3RNOA 1CZRA 1E3WA 2YYZA 1Q15A 3MD0A 2GKSA 5T4FA 1CIVA 2W6JA 2OXEA 3TFOA 4QDJA 4R7TA 5JSHA 1G7SA 3UWKA 5B7NA 1FFGA 2ODAA 4RV4A 2B1IA 1SOVA 1KC1A 1U2SA 1UPCA 1U2RA 2ZB8A 1M6EX 2D54A 3CS3A 3GUVA 3NW9A 3OT4A 1BMFA 1JDVA 5DYYA 3A3YA 2A59A 3LX6A 1R4ZA 5K1ZA 4EARA 4DR2B 3P7MA 2VTBA 1RJWA 2QQFA 3AFHA 3KAQA 1HDGO 1H4QA 2A86A 1NW3A 4B35A 2JARA 4YRZA 1Y1QA 1BGWA 2KS6A 2IIBA 3QXCA 4H59A 1Q0LA 1XTSA 1Z6ZA 3GFPA 4L3WA 3RAGA 4B74A 4RLSA 1P9RA 2QZPA 3RUHA 3KKPA 4GX5A 5DMHA 4Q12A 5IJ0A 4RY2A 3HM9A 4HADA 3R5SA 3I64A 2AFIB 4AZ3A 4GUAA 3WR5A 2BWJA 2G83A 3U5ZB 4M87A 2B8EA 1DZ3A 3GUYA 2XQVA 4UMVA 1BWPA 4QO7A 3CO0S 3SLRA 4G85A 1LWOA 1QIDA 3PA6A 1GQSA 3JQ6A 4KGZA 1UT5A 1WF6A 3H0EA 1GL3A 4NPAA 1UXGA 3OEEA 5JQGF 4CG2A 3W2IA 2EOAA 3CLSD 1FDWA 2BD0A 4W1PA 4KZKA 4PG7A 3G0GA 1VBNA 3SSOA 2I3BA 4YAIA 5LLSA 4IDPA 3CX6A 5B12A 5KNLA 2OHOA 4ZQFA 4DS3A 4C0XA 2DB3A 2ZUBA 4EKIA 1ZCAA 2XXAA 1DG9A 2P2YA 5B1DA 2O8VA 5KIAA 3NALA 2HMWA 5E7QA 2IY7A 3QEBZ 1Q3HA 5DEIA 3O4FA 2NTEA 1UBEA 3FE2A 4OI4A 3JQAA 4IINA 3VO9A 1T9GR 2DPMA 4A8JB 4P7FA 5JZSA 3NKVA 3HJGA 5ELLA 2X8AA 4BX9A 3EA0A 1V47A 3MWEA 2FZ4A 4G2TA 5C2JB 1MW8X 1ZC3A 1WQ1R 4BP8A 2IYXA 4EABA 2C5BA 3URKA 1I2ZA 2D2XA 1E3IA 1IB0A 1KVTA 2B83A 4FXPA 4KJZA 4DR3B 2OPHA 5I8WA 2PXAA 1XLWA 4EL5A 1I14A 2H0QA 2Q2QA 2H65A 3ZDRA 4BVEA 3ASUA 2FJ0A 3OF3A 4CMKA 3R9IA 4B3GA 4ZAZA 1EM8A 4XGIA 4D45A 5D5QA 1O58A 2ZAIA 2D4HA 3ZWXA 5F9HA 4UTXA 1X15A 4Y6LA 5EVJA 5CU7A 2V7XA 4ZVOA 1P3DA 3MGAA 2JEYA 2W6ID 3TTSA 1QV9A 1T26A 3DFUA 5FL7D 3WNCA 1JDJA 4XFKA 1GGNA 2ETXA 3KJIA 5KSOA 2HPVA 4LF7B 2ZM5A 4N41A 1D8TA 1N5OX 1THZA 2CWDA 2PO7A 3PWKA 4JT9A 1Y6RA 5AJTA 3UMJA 1EDBA 4ENVA 2WYVA 3GJ6A 1GGMA 2OXCA 3QVUA 1VE1A 1A9ZA 2P27A 2WM9B 3CA8A 1WHSA 4KMMA 1H93A 3QLEA 4UE6A 2BCJQ 4NZMA 5CA0F 2YL2A 3I39X 1PP4A 2ORVA 4WLUA 3ICOA 3ZDFA 5GAJA 1UCFA 4A0FA 5IH3A 5KB3A 5JSZA 4FQ8A 2X13A 2DAPA 4FYMA 4KB5A 1RLUA 3AUFA 3IQIX 5G0VA 1ULAA 1VE3A 1IH8A 2QDXA 2IODA 3OC0A 1SUEA 3OLZA 2PXCA 3TXXA 1R6UA 2HJ9A 3ZEAA 4JDPA 3E3MA 3D31A 4ZOLB 3ZNNA 5JCXA 3S8EA 1D7OA 4PSKA 4OA5A 2XNDD 4ND5A 1JB9A 3DMFA 1FRFS 4HG2A 1GITA 3A6EA 3FYUC 4BB6A 5B3LA 5MDHA 3I2FA 3PC8A 1QKIA 4PSVA 3LQKA 4R9VA 1CF2O 2J59A 2QLMA 3K1ZA 4G9GA 2FRDC 5B1YA 2ZM6B 1EWYA 3FOCA 1J07A 3ISTA 2O5EA 5G02A 4F6RA 1JILA 2C5HA 4BCDA 2XYVA 3U7EB 3EJ6A 1QU2A 1UBCA 2WJAA 3MBIA 2CD7A 5EUBA 1JJIA 3H11A 4NEHB 2OBYA 1U8TA 2OCLA 3FCUB 1U3CA 1QH0A 3DZJA 1XA3A 3JTEA 1T2UA 4W6ZA 5IYZB 1I7PA 1ZI8A 2WI8A 3PDHA 1FEZA 2YZ2A 2I87A 2AJ8A 5C7OO 1BXGA 4PHCA 1NY5A 1XLTC 2Q9UA 5ILGA 4JP2A 4JBNA 1Y7HA 1KZ6A 2A33A 5K0NA 2V3VA 4G0OA 5TDHA 5LXTA 1Y89A 4XASA 1DEOA 1L3IA 4B3FX 1T4MA 2VTDA 4TL9A 5ENZA 1X3LA 4YR7A 1QIGA 2NU6A 1TYDE 4MGEA 1SWVA 2B0CA 2GVZC 5J4HA 1OILA 4MAAA 4BATA 2AF4C 2O2SA 3PGXA 2A88A 2DQ4A 1XZQA 2R8YA 3GVPA 1XIVA 3KKKA 3LRTA 3PHHA 1KYZA 4G8BA 4IFTA 4BNJA 4ZMRA 1Z82A 1SQSA 3GCZA 4MLPA 2HNAA 3OQBA 4PM4A 4PYNA 3ENNA 2HYIC 3PCXA 3BMCB 1N32B 3CUTA 3A3KA 5FYDA 3DBRA 2CVQA 3WG9A 4PSUA 4F38A 1XTUA 3DLPX 4B5KA 4O29A 3IVMA 4Q3NA 4ARZB 1US8B 2LNDA 3RVOA 3AR3A 1JVBA 1VKRA 2WP8J 3CJQA 2XUZA 3CNOA 3PYMA 4MRVA 3AESA 4P93A 1CXZA 4BBPA 3CHYA 3R5JA 1JKIA 4IXMA 4KBGA 2QY9A 3ZHBA 2H7CA 5IVIA 3QVKA 4TKMA 1JALA 1X1DA 1YOVB 2NV0A 3WX0A 3U3KA 3ROKA 5GVRA 1M10A 3DE5X 2FMTA 4AD8A 5D7BA 3BWYA 4EPYA 1PBTA 4JBGA 1QH8A 2IQIA 1AM4D 1AO3A 1UC8A 2N42A 1I5EA 1RMYA 5AJYA 2O8FA 1QQTA 3DXYA 1W36C 2AG5A 2Z3ZA 5K3FA 2QG9A 4Z9BA 1X7ZB 3ZCTA 1UQRA 2O14A 3EYWA 1JAYA 4LDQA 2QSJA 3GJYA 4H7JA 3TOSA 2OBBA 5JHGB 4TYPA 1UKAA 2QDKA 3AF6A 4ZT6A 5JU6A 1IG3A 1OBVA 2OENG 3TW6A 4DDVA 4ARCA 1IK6A 2V65A 2UYHA 2Y9MB 3JD0A 4WACA 3ISJA 3AONB 3AW8A 1WZ2A 3DBIA 4KQIA 2QU7A 3BGSA 1SZDA 1H0SA 3JAKB 4OJKA 3UJ6A 2ODWA 5LKRA 1GZSA 1MG5A 3HM2A 4D97A 1AT1A 3GFBA 3V48A 3KR9A 3EPPA 3Q85A 4L8WB 4PO9A 1FX1A 3ZW7A 3KU4A 3CLUD 3OA2A 3DDOA 2DY1A 3IYLW 3GQVA 2OO3A 4TV8A 5KPJA 1GDTA 4UEKA 3RVKA 4JVSB 3AYZB 3A27A 3ITKA 2ID9A 3M9XA 3TLAA 4GEGA 1S4QA 2AFHB 1J49A 1J33A 1U3WA 1VJ5A 2Y3IA 3CTPA 3KOWA 4GNKA 3F5DA 4NFHA 2BH2A 1CUEA 4AJNA 5JG7A 1WNTA 9LDTA 4C7KA 2AR9A 3TQCA 5KUTA 1PJ8A 1QPZA 3B3QA 4HZUB 3MVEA 2WUDA 2WSLA 1EK5A 3NIGB 5HDBB 3B8EA 1P1CA 3R0QA 4CG3A