4H77A

Crystal structure of haloalkane dehalogenase linb from sphingobium sp. mi1205
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSVLGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
total genus 114
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h77A00
2IITA 2HA3A 1UK6A 1E89A 1WB6A 3CN7A 2Y2UA 3PICA 5A7GA 3DLTA 2WM2A 1A88A 4JUIA 3SC2A 3PE6A 3PUIA 1QIEA 4RPCA 1UZAA 1IVYA 5AKYA 4HXFB 2JIDA 2XMSA 5EGNA 1JMKC 1JT2A 1ZIYA 5CURA 5KBYA 3ESAA 1ZGCA 2WFLA 2XMCA 3G0GA 3D0KA 3QYJA 5HF6A 1ZJ4A 4B80A 5K5EA 3UUFA 4CG2A 4DNQA 3IURA 3D3NA 3F98A 2H9YA 1JFRA 3V1KA 3FOBA 3WK9A 2AJBA 5ESRA 4U2DA 2WIKA 2XMZA 3C5WP 1J07A 4B82A 2CZQA 2GBCA 1E3QA 2WILA 2WQZA 1CQWA 3QMWA 5T4EA 4W63A 1UWCA 1YB7A 2WUGA 5HZGA 4BRSA 2J3DA 4FHZA 4MWTA 1WPXA 3OPMA 3H17A 4FNGA 3C5VA 4AXBA 1H2YA 1J1IA 1JJIA 1ORVA 2WFZA 5HKAA 1NU6A 2D5LA 3FWHA 4J03A 3BF8A 3HEAA 2RIPA 4J7AA 2WIFA 4Q3KA 1YAHA 5ISMA 4YPVA 2Y6VA 1QIDA 3STUA 3IUMA 4P93A 4DIUA 1UXOA 4Y2PA 4Y2YA 3AZPA 1QTIA 1SCQA 1AKNA 3G9TA 4UHCA 4AO6A 2BAGA 4M0MA 1JJBA 3K9BA 3FCYA 3N0TA 1XZCA 3VJLA 1FFDA 3ESBA 1XZEA 4NVRA 1K6EA 2QTBA 3R3ZA 2WKWA 1C7JA 3WYDA 1HLGA 3VXKA 2O2GA 4MYSA 4J0JA 3RM3A 1QOZA 2Z8ZA 3M83A 5AKIA 1SCKA 1XKLA 5BWBA 3ZLVA 4GBGA 4L0CA 4NZZA 5HCUA 1JU4A 4PSUA 4Y2RA 3C6YA 1UKBA 1MNQA 2VTVA 1GQSA 3QM1A 5K3BA 1X2EA 3PF9A 4DMFA 2HIHA 2WIGA 3R3XA 5CBKA 1VA4A 1WHSA 4KAFA 4PO3X 3VJKA 2ES4A 1MTZA 5C7YA 3H2GA 4EY6A 4KYVA 4G8BA 4PQEA 2JGLA 5LZ8A 5KWJA 1GKLA 2QZPA 4MEBA 5AM4A 1ODCA 4AQDA 4QDUA 1AZWA 4HXGA 1HQDA 5DNVA 2XLCA 1VZ3A 1DINA 1ETHA 4ZGBA 1LBSA 5CT9A 5JD6A 3FNBA 4PSCA 4Y7DA 2QT9A 1HBJA 4BRZA 4U2CA 5ALYA 3QPDA 5E4TA 1QONA 2Q0XA 4IH9A 3DOHA 5I9IA 2XMQA 3AIMA 3TGLA 2XE4A 3BDVA 3PFCA 4W9RA 3E0XA 4N5HX 4Y2VA 5EHQA 4ROTA 4ZRDA 4D9JA 2WJ3A 2WHPB 1ZI6A 4L3WA 3ZLUA 3A2MA 2K2QB 1YAJA 2X5XA 1VE6A 4X6XA 4UBOA 4PSDA 3IUNA 2ZYHA 3DL7A 3DYVA 3WKBA 1YB6A 2ROQA 3EQ7A 5ALEA 5EHZA 5DYWA 2BKLA 3WL8A 4XX1A 4H7FA 3GELA 4QDOA 4GECA 2OQVA 4Q05A 4JYMA 4QEKA 2H7YA 2HM7A 4FOLA 1BROA 1P0QA 2WLSA 3D7RA 3W06A 3QMMA 1W4LA 1QO9A 2DHEA 3OM8A 4WFIA 5JD4A 3OOSA 4ZV9A 2DQYA 5AKGA 4HS9A 3KXPA 2PUJA 2XUGA 3A70A 1VOTA 4WDQA 1EXWA 1ZD4A 3BE8A 3WKAA 4B6GA 2WU4A 1TCBA 5FP0A 5AKEA 4BVKA 4FBLA 1EA5A 1EVEA 3FYUB 1XRPA 3C87A 5E2IA 2O2IA 2XQFA 5ALQA 4BYMA 1XLVA 2Y6UA 4BZZA 4O08A 4BVJA 4UBNA 2WTNA 4CG3A 3QITA 4C6HA 4FFVA 4DMKA 5AI6A 3B12A 2H1IA 3W9BA 5FDFA 2XT0A 3NWOA 4UPDA 1J06A 4TGLA 3WK4A 4AN1A 1FSSA 7YASA 5BOVA 5JZ9A 1THTA 3LS2A 5A7FA 2VF2A 2VEOA 4C4XA 3AUKA 1E8NA 5AOAA 1SOMA 2JBWA 3DJYA 3IUQA 4JYPA 3STTA 4FLMA 5HK8A 1A7UA 4Q3LA 1TIBA 1T4MA 1IZ8A 3C70A 4G4IA 4BAGA 5DNUA 4MYDA 1BS9A 4L9AA 1Q84A 4E14A 3P2MA 3FVRA 4UHHA 3WL7A 1ZD5A 3ILSA 5HQ3A 4K6HA 2EEPA 4N8DA 1GPLA 4EBBA 4Y2QA 3AILA 3O0DA 5HFNA 3SWWA 1QZ3A 4UHFA 1XQVA 4KACA 1K8QA 1XZDA 4FFWA 3R3WA 3V1LA 4M0FA 2OAGA 4DTCA 3WA6A 3AINA 4BATA 4N5IX 1XRMA 4LXGA 2HHAA 2AJ8A 3I1YA 3FAKA 3WWPA 1MAHA 3PFBA 4V2IA 5AIAA 2JGJA 4BCBA 1ZD3A 3DS8A 3PDCA 4RNCA 3BF7A 3O4IA 3A2LA 3VVLA 5AIBA 1MT3A 5JADA 2RGUA 5AI8A 2XQGA 2O2HA 5AKLA 2PSJA 4X85A 1DX4A 4J0GA 4WDRA 2ONCA 2XUQA 4W1PA 5DTIA 3NOXA 1CUCA 5AOCA 1JKMA 3HRHA 1K4YA 1CVLA 1MX1A 4Y2UA 1AC5A 3WWDA 3GZJA 2JGKA 3ZPXA 1GT6A 1WCYA 5JANA 2XI4A 1EHYA 2NW6A 1I6WA 4I19A 3VKFA 2I3DA 2RHTA 4G4GA 4CIAA 4GW3A 5CMLA 2ZJFA 4ZV7A 1FFAA 2DR0A 4EY4A 3ED1A 4EA6A 2HA7A 3WKEA 5KREA 4W1SA 4F60A 2GYUA 1RYYA 4QA9A 5BV7A 1CUJA 3RLIA 1Z68A 4UBKA 4CI9A 2RONA 3C8HA 2WUDA 4ZI5A 4MXDA 4HXEB 2CKMA 4GHWA 3SX4A 4RE5A 3HYSA 1GPNA 4YK7A 2Z3WA 5BWCA 3OG9A 4QDTA 2PVSA 5T4HA 3ANTA 3CN9A 5LZ5A 5A2GA 3PUHA 1FFCA 4QDZA 1W75A 1C4XA 1XZFA 5ALTA 4AN0A 5FUMA 4X6UA 5LZ9A 1BN7A 2VATA 4DNPA 3G9ZA 1QIKA 3WWOA 4AZ3A 3C43A 1UKAA 1SFRA 5I8PA 2O7VA 1XZAA 4P92A 1QIJA 1CUYA 3ZI7A 1QFSA 3I6YA 5IH7A 1QLWA 1XLUA 5JZBA 3FSGD 2XQKA 4DSAA 1ODTC 3WIBA 1LPPA 2OGTA 4UHBA 5CH5A 3RARA 2O7RA 1CUXA 3I6MA 1MJ5A 4BCCA 2V9ZA 2E3JA 2X76A 3WLAA 3PI6A 1X70A 1K5PA 2PUHA 1VXOA 4EB0A 5HF8A 3DNMA 3VVMA 5CH3A 3EQ8A 4K5QA 3A2NA 2D0DA 4K6KA 4WFJA 5AM1A 1IZ7A 1JU3A 3HI4A 1H2XA 4H7EA 5AI5A 2VQ6A 4OYYA 3NUZA 1KU0A 4EY5A 3W2TA 1R3DA 4UHDA 1CFJA 4F0JA 3D2AA 1H23A 1ZD2P 5EI5A 4F5ZA 4J0IA 4BDTA 4DNOA 2OCIA 5K3EA 1WPRA 2QXUA 2HA5A 2Y2VA 3G0BA 5ALRA 5IVHA 4MQMA 2ZYSA 2X8BA 1ISPA 2JGFA 5CTAA 5DTJA 5EIAA 4P9NA 5C81A 3V1MA 2OAEA 3DD5A 4UFNA 4WFKA 3UMJA 5HFAA 3C8DA 5ALNA 4P08A 5ALJA 5FV4A 1AMNA 3ANSA 2GYVA 3G8YA 4X92A 3EBLA 3WJ1A 1UKCA 2W6CX 1QFMA 4YASA 2G63A 3H1AA 3B3QA 4JNCA 3QPCA 4Y2JA 3HC7A 4H35A 2R8BA 3ZLTA 4H18A 3T52A 1CUEA 1R9MA 5ALPA 4LXIA 4HRXA 4NS4A 1R1DA 3IVMA 4HZGA 4MJ3A 3V9AA 4EY8A 3I2GA 3LLCA 1FFBA 3V1NA 3WWCA 2PPLA 1BE0A 4IH4A 3DCNA 1N5RA 3X3HA 1GZ7A 4H7HA 4L72A 1QIMA 5K3CA 1MU0A 4FWBA 2B4KA 3HXKA 1TRHA 1ODSA 1T2NA 4H7KA 1UK7A 2PU7A 2G5PA 1YCDA 5AI9A 2OCGA 1C7IA 3KD2A 2ZSIA 1WB5A 2DFPA 3BJRA 3MUOA 4X97A 5T4FA 4FNMA 1XROA 2UZ0A 2HA2A 2XUFA 5JATA 4W1RA 5A7HA 4C87A 3O4GA 5AI4A 2C5GA 5JZSA 3S8YA 1AQLA 5EHXA 4BB0A 4E15A 4Q3OA 1WM1A 3HLKA 3V48A 4ARAA 1UK8A 1UFOA 1G66A 2QJWA 5F4ZA 3OTQA 5ALFA 4KE9A 3H0CA 2BGNA 1TAHA 2GBFA 5EHNA 1W1IA 2HRQA 4KR0A 5ALZA 3G7NA 2HU7A 2QXTA 3WZLA 4F21A 1EH5A 2XMDA 3BXPA 3I2KA 1EX9A 1N5MA 3D2CA 5AI0A 2GZRA 2VT7A 4GXNA 5AHXA 1DWPA 2WHPA 3L1JA 3TRDA 4DSZA 5D7BA 1ZI9A 2BUAA 3H04A 4CIBA 3E1GA 1QIHA 4IO0A 5EFZA 5C8VA 2RHWA 2B9VA 1UOPA 1AUOA 1KU6A 5DYYA 1MO2A 3QVMA 5JAPA 2B61A 2AJDA 1FFEA 4OB6A 3I2HA 5ALXA 3GFFA 4GI1A 5AKHA 5JD5A 2XUIA 2VJAA 1HDEA 2ZYRA 5K3DA 2DSNA 4DM7A 3GA7A 3F9CA 4H0CA 1WOMA 4BAZA 3H2JA 3DOIA 1DQYA 2JF0A 3I6ZA 5K3FB 2WUFA 4IH1A 1YS1X 4DGQA 1E8MA 2VAXA 1CLEA 3KWFA 5AICA 2QMQA 1X2BA 3C45A 1S8OA 2ACEA 6YASA 2ZVDA 4G9EA 1VZ2A 3O4HA 3NGMA 3BWXA 4HAIA 3WKDA 4EZIA 3FYUA 4CCWA 4QZVA 4EUSA 4GWLA 1XQYA 2ZSHA 1XFDA 2WJ4A 5AM3A 1WB4A 4OSEA 2OLEA 4X95A 4X00A 3DEAA 4UBJA 1SCIA 2JEZA 2W22A 3ZV7A 3AFIA 5K3AA 1LPNA 3GBSA 2OXEA 2IX9A 2CBGA 1XZIA 4B0PA 4JH0A 1EB9A 3QZUA 3WK5A 4LKOA 5HF9A 2PSDA 4B9AA 3AIOA 4FLFA 1LZLA 1USWA 5IVKA 1DT5A 4BC0A 5ALHA 2PX6A 4CCYB 1NU8A 2Z8XA 2VAVA 1CQZA 4G8CA 1Q0ZA 5DWDA 1GQRA 5ALWA 4XJVA 4E46A 1UOQA 2ZJ6A 4KE6A 1CPYA 1IUOA 3FLEA 5DLPA 3DQZA 5D3KA 1FJ2A 2BFNA 1VA5A 5AOBA 1H2ZA 3R40A 4QE3A 1A8QA 4Y2TA 4Y2SA 3I2FA 2WUEA 4X71A 3DKRA 3LP5A 2H7XA 3W05A 3G0CA 4DYHA 2XDWA 1DWQA 3C6XA 4Y9SA 2YXPX 3O9MA 1JMYA 2PM8A 3UUEA 5AM2A 1EK1A 2QR5A 3R0VA 4AO8A 4HTAA 5ALOA 4KE7A 4BAUA 2G5TA 4UHEA 5JIBA 1QE3A 5FLKA 1DTEA 3JW8A 5J3JA 1F0PA 3T4UA 4NMWA 1LZKA 4QWWA 1LLFA 5LKRA 5LZ7A 3FBWA 4WY5A 2OGSA 1IUNA 3H18A 3E3AA 3Q0TA 2JGIA 2IIVA 4FBMA 1U8EA 4HVTA 1GPKA 3WYNA 4GEGA 1CUDA 1ACJA 4CG1A 3VDXA 2C4HA 3H19A 2FUKA 3GUUA 2HFJA 5ALDA 2GBIA 3DYIA 4J0HA 4RE6A 3WQHA 5ALIA 2XUPA 4BBZA 2C5FA 2HFKA 1XQXA 1YSCA 4UBLA 1GKKA 4Q1VA 3BDIA 1MAAA 3M3DA 5ALVA 3IB3A 5CT4A 3G0IA 3K6KA 1XRQA 1JJFA 4WY8A 3H2HA 5JAUA 1QO7A 5CW2A 4K6GA 3N2ZB 4X6YA 4TPKA 4AMYA 1XZMA 1ZJ5A 2XLBA 1XRLA 2J3QA 3YASA 3WK6A 1EI9A 4H7IA 3MVEA 4G5XA 3I2IA 4X90A 2Z3ZA 3D2BA 1IUPA 3G0DA 3KOOA 4CFSA 3QMVA 3CCCA 4KE8A 3L1IA 3ESCA 5AK5A 5A6VA 4B7ZA 3STVA 2V96A 4ZWNA 1MNAA 2VT6A 1O6GA 1MPXA 2I3ZA 2I78A 1YASA 2QM0A 4BZWA 1U2EA 1XKTA 2J4CA 2HA6A 3S2ZA 1ACLA 2WIDA 2YH2A 1W52X 2ACKA 4W1QA 4N8EA 5CXXA 2HL6A 2WG1A 5E4JA 3IUJA 5ALUA 2XMBA 2QUAA 2WU3A 4IQ4A 2OPHA 3WL6A 3Q8WA 3IA2A 2ORYA 5D3ZA 4I4CA 5DNWA 2RAUA 3WZMA 2BGRA 5AJHA 5YASA 2PU5A 1G5FA 4RGYA 2HRRA 2VJBA 1LPAB 1CUFA 1EK2A 2PSHA 1VJ5A 4WJLA 1BEEA 1NX9A 1BCSA 4FKBA 2FJ0A 3EF3A 5FKJA 1D07A 3HSSA 3MGAA 4BC1A 1VXRA 4OD0A 5AKKA 1BEZA 5C8XA 4KJXA 1LPBB 2XUOA 5EIEA 1L7RA 1L7QA 2G4LA 4J3JA 5JASA 4H77A 1HPLA 1G4HA 4INZA 4FLEA 2VSQA 5ALMA 2WFLB 4G4JA 5ALSA 4X7BA 1DT3A 2XB6A 5ALKA 5A62A 1CIJA 3LIPA 4EHBA 2B20A 4LYDA 4N8SA 4MEAA 4QNNA 1EB8A 2FJPA 3F96A 1N1MA 4H7JA 5AKJA 5LYYA 2CJPA 3VISA 5AK3A 4UUQA 4U2GA 4XIIA 4GDMA 1Q0RA 2WHQA 2Y1KA 2PKYX 1E8DA 1E5TA 3HZOA 5AP9A 3FYTA 4LXHA 5AK4A 2WG0A 2C0PA 2EDCA 2GZSA 1R9NA 1CUVA 3L1HA 1GXSA 1XZHA 4PV7A 4C01A 3O95A 4B81A 4AX4A 1TKRA 2XQIA 5JAOA 3C6BA 4BVLA 4U2FA 3RK4A 5E4YA 2BCEA 3BL8A 2HADA 3CXUA 1O6FA 4KAAA 4LIPD 5FXMA 2PSFA 5C8ZA 2DHCA 3FCXA 1G42A 5I7UA 1ZGBA 3LIIA 3BIWA 4H7DA 5AKZA 4MQLA 2VJCA 2Z5GA 1IMJA 1A8UA 1RWQA 4OCZA 3K2IA 1XRRA 4A16A 1YS2X 3PF8A 2EDAA 5CXUA 2OGZA 4BTLA 3I28A 1AGYA 1YA8A 3STYA 4OPMA 5DJ5A 2ZYIA 5T4BA 1P0PA 1QIIA 3G9UA 5HK9A 3MUNA 3M81A 3H1BA 4PW0A 1EDDA 4YX9A 1CUIA 3FYUC 4E11A 3HACA 5FPPA 2PSEA 2WIJA 4G8DA 1QTRA 3EIOA 5LP1A 5AK6A 2DCMA 2YASA 2OQIA 3AIKA 1TK3A 4BP8A 1UT6A 1QIGA 4J0CA 1QGED 4PNZA 4XWGA 5JAHA 3G9XA 4BCDA 1BN6A 1CUZA 1OXMA 2JGMA 3D4LA 1XZBA 5JYCA 1LPSA 4JEIA 2WG2A 5AH0A 1U4NA 4ITVA 5HKBA 3FSGA 1LNSA 4IHAA 4U2BA 2XUAA 1W76A 2ZJ7A 2P8SA 5LIPA 5CT8A 1A8SA 3KDAA 2QKYA 4UBIA 3LCRA 1Y7HA 4ETWA 5ALGA 4BP9A 4DMHA 1UK9A 3A6ZA 3STWA 2QS9A 1GGVA 1H2WA 3I2JA 3E4DA 3WI7A 2XUHA 1ZOIA 2WFMA 2HU5A 2XUJA 3WMRA 2XMRA 5AO9A 4UBMA 5CT5A 1VE7A 1CEXA 1XZGA 3C6ZA 3IIIA 4ZXFA 3F67A 4G1FA 3R3YA 4I3FA 1LPMA 3OC0A 1DU4A 1TQHA 5CRIA 4OB8A 2ECFA 4J0KA 4BTVA 1QJ4A 1TCCA 4Y2XA 4C89A 3TJMA 4C4YA 1ZIXA 5K3FA 1JI3A 1PV1A 2HA0A 3AZQA 1XRNA 1R50A 2XUKA 3H2KA 3RKSA 4B83A 3U0VA 5LZ4A 4UFPA 5IKXA 5LKAA 1U65A 2V98A 4EY7A 3WK8A 1DQZA 5CT6A 2GBGA 4QLAA 4XVCA 2XUDA 4U2EA 4FMPA 3F97A 1PFQA 2QOEA 2OG1A 4TVKA 5IVDA 2V97A 3ICVA 5FPQA 1BCRA 5ALLA 3WK7A 1LPOA 1R4ZA 2AXEA 2JEYA 3QH4A 1W6RA 4AB1A 1CUAA 1R88A 4FDMA 3D59A 4B85A 3FLAA 1E66A 2DHDA 3WIOA 1OCEA 3DL4A 2JGEA 3O4JA 5CH8A 3W04A 2CMFA 3TEJA 2QVBA 4BDSA 1DX6A 2QUBA 4X3CA 3EQ9A 3GROA 1WHTA 3CCBA 4Q82A 4UFOA 4C88A 1M33A 4ARBA 1ORWA 4LHEA 5SYMA 4OU4A 2RI6A 4CCYA 1UOOA 2CB9A 2QRUA 2HA4A 5HF5A 4B84A 2OCKA 3U1TA 2LIPA 5LLSA 1AX9A 2BUCA 1F8UA 4G9GA 4X94A 2PBLA 5SYNA 1VLQA 3SK0A 4S0XA 3B5EA 1CUBA 4X93A 5LZ2A 3BIXA 1KEZA 1ZI8A 1CRLA 3AZOA 5KWIA 2CUTA 3STXA 5H3HA 2VJDA 4KRXA 4A5SA 4OB7A 2VA9A 2DQZA 1MX9A 2C0QA 1SC9A 4PF1A 4QWMA 3IDAA 3WJ2A 3I1IA 3WWEA 4OU5A 3H2IA 1CUUA 5AM0A 1XLWA 3D5EA 5IVIA 2C58A 1L7AA 3HABA 2YYSA 2J4FA 4BE9A 1F0NA 3HJUA 2I03A 4J0DA 1EDBA 1EINA 3DDUA 3FVTA 4C4ZA 2WSLA 1P0IA 2H7CA 1CUGA 2OCLA 1EDEA 1F6WA 2BUBA 4OYLA 4HRYA 3G02A 4GLBA 2XQJA 5HQ3B 1EVQA 1PJAA 1LBTA 4AMZA 1B6GA 2HDWA 2PL5A 4MWSA 4X91A 5A71A 3IULA 2WJ6A 1QIFA 3QBJA 5EIHA 1DWOA 3VJMA 2AJLI 1LGYA 4Q34A 3M82A 1VKHA 3KSRA 1ZICA 1XZLA 1Q83A 2R11A 1P0MA 3R41A 3R3UA 4KRYA 4ZREA 4KEAA 4BE4A 1XZKA 4DLNA 1K63A 3JYHA 4OUKX 4AO7A 4QDXA 2WTMA 1N8SA 1BRTA 1CUWA 2GYWA 3BJMA 1HKHA 1YA4A 3ICWA 3QPAA 1RP1A 1Y7IA 4DNFA 1CR6A 5JALA 4QLOA 5DYTA 1XQWA 1J2EA 1H22A 5JARA 5D6OA 1CUSA 4AZ0A 3WKCA 4Z49A 2FX5A 4B0OA 4FTWA 1TCAA 1AURA 2WHRA 4LYEA 3KWJA 1THGA 1CUHA 3ESDA 3O9VA 2C7BA 1MX5A 2BJHA 3JWEA 5AKXA 3W9UA 4A23A 5FRDA 4DMCA 2HU8A 4WCVA 3ZWQA 3R3VA 2XMGA 1Y37A 3AJAA 5AM5A 3WL5A 3DKKA 5FOQA 3FLBA 3F8SA 1BU8A 3WA7A 1XZJA 1MN6A 1OILA 1YR2A 4KAJA 2CEKA 2AJCA 4M0EA 4B9EA 1HL7A 1CV2A 4K2AA 3IBTA 3OURA 1B41A 2QJRA
chains in the Genus database with same CATH superfamily
1KKMA 1W85B 2IITA 5EHGA 1J8QA 1QAQA 1M8PA 4OHXA 2VHEA 1E89A 3RD5A 3WRXA 1E32A 3LUPA 3HO1A 1M1NB 3FCSB 3HVKA 3U0BA 1AO3A 2ZTSA 4K81B 1Z5UA 3PICA 3JS5A 3CRRA 3VPAA 4NNJA 5I51A 1E9FA 4ZT5A 1EFPB 2X9QA 3DLTA 5AD1A 3QNUA 1E0KA 2OCBA 3KAQA 3WBKA 3QX9A 4LV6A 3LPLA 4U7DA 2W2KA 3N0VA 1HSZA 3S7ZA 1YT5A 3PUIA 4IL5A 3RUHA 5B7PA 3RVRA 4HFRA 2KWIA 2I54A 2PKRA 3OPYA 2ZUEA 5CA1A 4NY1A 3SIRA 3BC1A 1FSGA 1RXVA 2OFFA 1IVYA 2BZ1A 3PC8A 3RSLA 1XU7A 4UEOA 4AROA 4AZ3B 4YUWA 4ZCRA 5B6PA 1PR4A 2VHVA 3KJNA 3OF5A 1JT2A 4Y9UA 4PHGA 1UEIA 3NCTA 2HBYA 2J33A 5CURA 5K0LA 5B3KA 4O2BA 3A4LA 3W77A 2HHJA 1FNBA 5CJJA 2QUKA 3CZRA 5HE9A 3QJGA 1ZGCA 3JSXA 4EI9A 1QFJA 4OXNA 1KMNA 1K3UB 2P4SA 1WU7A 2QROA 1EFRD 2XRYA 2YIVX 5B58T 1YBAA 2WTBA 3TLYA 3UVEA 4LMRA 1GNSA 2IHUA 4BQRA 2BE7A 2VJNA 4J2OA 4AT1A 3DEZA 1NSTA 4ALLA 1WXHA 4RJIA 2AC4A 4NABA 2Q1UA 5K5EA 3FRHA 3HXTA 2X15A 2IEIA 2JVIA 2PLWA 3SVLA 4L4ZA 1VPVA 2CHVA 5A4KA 5AVXA 1TTPB 3FAZA 1JFRA 1KYWA 3CTPA 1FFGA 4UM9D 3V1KA 4K3VA 5FB3A 3PFNA 5HFJA 3FOBA 3EARA 4K46A 2O8CB 1OU0A 4LJSA 1SZPA 3EAGA 3K0CC 4NP6A 5ESRA 4WJZA 1PJLA 3ZDRA 2V7TA 4P4GA 3FOEC 3AI1A 2G7ZA 1N6HA 2BLLA 5JCJD 3AV0B 5EEHA 3ZC3A 3EX7C 4W5RA 3WHLA 5JS8A 1PQUA 1PS8A 1G8SA 4A6EA 1UWKA 2GBCA 1D2NA 1ZWLA 1ZN9A 4MUIA 3SX4A 4BNYA 3ACBA 4E5VA 4TV9B 3DZKA 2JRLA 1EJ0A 3QMWA 3A04A 1GRRA 4NG4A 4HBZA 1DELA 4CMKA 4OQXA 4E22A 2W6IA 5IJ9B 3TRFA 1QO0D 1CJTC 2J08A 3B9RA 3TNDA 2ODPA 2BHRA 1ZA2A 1P7CA 3VOTA 3B89A 1ZBQA 2CDCA 1YUBA 2UVDA 5SICE 5IC4A 4E6EA 1CB0A 2GZ1A 4CTMA 1TYEB 4FSHA 4YCJA 3ROTA 4A26A 4E30A 4MWTA 1OX6A 5E7JA 1DHTA 4BFCA 5A3VA 3FPLA 4F3NA 5IJWA 3WLJA 1V16A 1KPGA 2GKGA 5FUYA 4GE3A 3IQHX 1H2YA 2E4ZA 2PVCA 1JJIA 1MIOA 1RNLA 2VLIA 3I9MA 4BN4A 3PR1A 3SBXA 1UMDB 1VGVA 3H83A 4F8YA 3DHNA 1NU6A 3GLVA 2RK6A 3BWCA 1M75A 1WVGA 2D5LA 3T3MB 1J0BA 4N76A 3BF8A 2EJVA 1G21B 3TW4A 3MINA 1EP2B 1KO1A 1CT9A 1W5AA 1XQ6A 1Q7TA 2BM9A 3EZGA 4YPVA 2JHPA 5KVCA 2GK6A 4F96A 4Q4JA 1YDFA 2ODQA 3F73A 1UPCA 1FLVA 3BUSA 2FE4A 5FOTA 3L4BA 1UXOA 4Y2PA 5I4BA 3AKCA 1US8A 3ISTA 3E15A 1REQB 4JGGA 1LFDB 1ST2A 1UF9A 3AUXA 1U0OC 1T43A 3D1LA 2ZIGA 2LTAA 3PUYA 4D56A 3HUTA 3G9TA 4UHCA 2AN5A 2PQ6A 1GWNA 2BAGA 3AVTA 4O1HA 1Q0QA 1JJBA 3K9BA 1YH3A 4B75A 1M1XB 1PTJA 1AKEA 4BO1A 4HAXA 3QSYA 4N6NA 5JAMA 1P2VA 1WZEA 1FFDA 3E5RA 3OQ1A 3BCUA 3ESBA 3NDPA 3QVSA 4E0BA 3KYIB 3CZPA 3BVPA 4JLBA 4BNGA 5DW3A 2IH2A 3DZ8A 3GX1A 1A2BA 3BHJA 4NVRA 3TNJA 1EFDN 5IEJA 2QJOA 1GCUA 3KX2A 3EWNA 1T4CA 1XDBA 1IHOA 1BVYF 4GQAA 1ZIPA 721PA 2EG5A 1G38A 3LQ2A 3OO0A 4M37A 3ZCSA 3VXKA 1BEUB 4MYSA 1RYDA 3ILXA 3NXKA 1JR3A 2CNOA 4DDKA 4P0TA 2M2IA 3JAWA 5AKIA 3TS1A 4XWOA 2WF9A 4C7KA 2ZUBA 5AUPB 1ZMRA 3ZLVA 1W30A 3KPYA 1SU8A 5DN6D 3SDZA 3IT0A 1WSDA 3J7TA 1BXGB 4JI6B 4I36A 3PCRB 3R0QA 2R65A 3IPXA 3CNBA 1Q7EA 4HVLA 3QOYA 4E5YA 4ZHQA 1UINA 1UKBA 3E6AA 1A9YA 2YDXA 3G5TA 4RSRA 3QM1A 1T1RA 2PJZA 3BS4A 4XARA 1O77A 4RXTA 5FA6A 4UQLA 2YTZA 2EEZA 5AHWA 4DMFA 4RAOA 1BVRA 2CVZA 5JSYA 2CLHB 4G6ZA 4PO9A 1Z75A 1LW7A 2JJQA 4GC5A 4YJ2F 4BVFA 4PIPA 3LY7A 4KVFA 1GUZA 3R7AA 4IF6A 4NX2A 2BKEA 3L7LA 4EO7A 1FVXA 4V0OA 4MI6A 1RWBA 1ZD1A 3NHPA 1AMUA 4GOOD 4II7A 4EB6B 2QY9A 1K88A 4I50B 1DEAA 4CODB 4WK0B 3BA1A 5BW5A 3L8ZA 4G1EB 5ARBA 1E5XA 4OXQA 1WXQA 2QUIA 1ZK1A 2TRSB 1U2DC 4TTSA 5C7YA 3BL5A 1Z6TA 5DV9A 3IKJA 5A1JA 5DZSA 4JOSA 4IJ5A 3NAZA 5E4FA 4EAQA 2H8GA 2OM2A 2Y1GA 3D7SA 3QW2A 1UKVY 3OX3A 4PQEA 2JGLA 4CTJA 1QDLB 3BXHA 3I32A 2AS0A 2FQXA 3P7MA 1R9GA 3GZTB 1GKLA 1L1FA 2BI4A 4A2WA 2QZPA 3ZLBA 1GPJA 1INLA 4G24A 2R7LA 2NUBA 5C5DA 5AM4A 3CVOA 2I9PA 4PCUA 2QI9F 3NI2A 4TV8A 1ISIA 2BFBA 3AB3A 5AR1A 3RAGA 1MRSA 5K3SA 1E9CA 4FHFA 4EF5A 1B8VA 1PK9A 1HQDA 4LHYA 5DNVA 2XLCA 1VZ3A 1P7WA 2VYND 3RWBA 1I7SB 1OWNA 1UBTS 4XLLA 3RAJA 5AUNB 5BORA 3CR3C 1V4BA 1JEAA 2HOQA 3FNBA 3GDOA 3ND8A 4PSCA 3VC7A 4LV8B 2FPRA 4DREA 3L6RA 2AG8A 4R84A 2GA9A 3EY4A 4A2CA 2FW8A 4BRZA 3IAFA 1DEOA 2Q46A 1EFRA 3B3JA 3HRIA 4S1OA 2ONJA 4BYGA 4CUJA 3ZWKA 4JGIA 4KG7A 2JATA 2XNSA 2DJ5A 2XE8A 3F47A 4RVNA 4WNIA 5EAIA 2IBMA 4YJHA 5REQA 3MMNA 1EWYA 1CF9A 2P3OA 3ANLA 3I72A 4F5DA 5BNTA 4YCMA 4PWZA 1HDXA 3SY8A 1G21E 1BD4A 1Z4PX 1QKIA 3DFUA 3KELA 1G18A 4NESA 3KQYA 1XTUA 3VOAA 3VYUB 2XCTB 2GH1A 5D8DA 3FHTA 1ZIDA 2C4WA 5MFZA 3TW8A 3WFJA 1GLGA 2H2GA 4YRLA 5B7NA 1TZKA 1KY4A 5JNTA 1AA9A 1Z0DA 1KI6B 1J0CA 2WJ3A 3K9CA 4ZI7B 4GLLA 3DMYA 2ZIWB 5LP6C 3ZLUA 3TJRA 3EGEA 4D46A 4FYHA 3H5AA 2TS1A 1SUWA 2HF9A 2JLVA 3DA8A 4QTXA 1RXUA 5MF6A 1JB9A 2X5XA 2A9JA 1DP4A 3PBKA 4R2HA 2EAUA 1U2QA 1W29A 3PX2A 3I09A 4DV1B 3DL7A 3ROXA 1TM4E 3C6KA 5F2EA 5AJTA 2VTEA 1VJDA 3FMIA 4UVEA 3RHSA 2QGZA 2J7PD 1AK9A 1ZSYA 4LZJA 3JARB 3QP9A 3FKJA 2QYSA 5DI9A 3FOCA 4II2A 2BKLA 2WOJA 3TIGA 3WL8A 4XX1A 1TCUA 3ZY6A 3ZW7A 3O8QB 3PUZA 3D3KA 5I4CA 4YY3B 2OQVA 1PJQA 1W34A 3NYQA 4MGZR 4OMUA 3W1VA 4FSXA 3HS3A 1PBTA 4L95C 4GMHA 4UULA 3ZDZB 3AVYA 3SZRA 1QB8A 3MGGA 1E2BA 5DDIP 3LRXA 5DT9A 5CCEA 4RPJA 1I3KA 3T9BA 1RCUA 3PLAE 3JAMA 2NIPA 3F3KA 1ODLA 4RTSA 1TGVA 2HM7A 3PHGA 4OQFA 3VR4A 3UJAA 4FKZA 1BROA 1KSFX 2PWAA 5HQTA 3EXIB 2WI8A 4IZHA 1M9NA 4D57A 4NHOA 1GT91 1P0QA 2WSMA 1G4AE 1LF5A 1SUDA 3O93A 4LVOA 3ZR4B 4DM3A 3RC1A 5C4IA 3OJWA 4WK4B 5ERGB 1NIJA 3ZHVA 1S02A 5M34A 2UVQA 5JD4A 2WB2A 2FN9A 4WFIA 2HK9A 3OZCA 2NVBA 4RHCA 2UAGA 5G53C 1OT3A 3KTAB 1XAIA 5IKMA 2XHZA 2G9ZA 4QOEA 2TMGA 4RK7A 4EW3A 5EJ7A 4WT7A 2QYOA 2FJUA 1E9DA 1KBQA 4DTIA 4G81A 3LBHA 4OA5A 4QEDA 1SH7A 1A9XB 3EOAI 1L5MA 2QPAA 1E98A 4BFZA 3B6ZA 2C57A 4RMGA 4G2NA 5AKEA 5CB0A 1FE8A 2G9NA 2VRCD 4K9LA 4BJ1A 3UYKA 1WETA 4FBLA 1ECCA 1QGYA 3ADPA 3ZEIA 1EA5A 2IEYA 4OHWA 3T3GA 2QRGA 4RETA 4KXQA 4E6PA 2VZLA 4BGUA 4DWOA 2FSFA 2REXB 3IMKA 4PYNA 5DFAA 4WBNF 5AW9A 4FM9A 2KE5A 2J30A 1O9HA 2XQFA 5KSOA 3TTYA 4U7GA 5CLIA 3IQZA 5K0TA 4AUMA 1IXRC 1U81A 4X1KB 4WN9A 1W36C 3UW1A 4HNSA 3LDHA 4B3CA 4P4UA 3GRYA 2H52A 3RU2A 2PV7A 1RHJA 2A0XA 2EIHA 1ZO8A 3PGVA 4BZQA 3HLYA 3PNKA 1G6OA 1HR0B 3PSAA 1ZGJA 1LFAA 2GD2A 1OGIA 4PAGA 4YUZA 1OH5A 1C1HA 1NJ1A 2JD2A 3VC1A 1KYXA 3CF2A 4CG3A 1KARA 4YRMA 2XR1A 1L5SA 4KX3A 4DMKA 2IHBA 3B52X 2PWPA 5K2OA 3GJYA 2F4VB 1K6IA 4WEOA 5FYDA 3K20A 3PC2A 3W9BA 2XT0A 4D4IA 1GG2A 1J06A 5AJZA 3Q8LA 2QD1A 5JV5A 4RL4A 1WXGA 2FSGA 2AMLA 5EP3A 4B44A 1LQUA 3BWBA 4D8YA 1OFUX 1OI7A 2CLCX 4HQKA 2JIPA 3KAKA 4FR5A 4WEQA 2FK7A 4WH0A 7YASA 3ANNA 2FLWA 1NGSA 4P32A 3RE1A 4IZOA 3OAAA 3OQJA 3PGXA 2CNKA 3DCYA 1WF6A 1LJ8A 4L6AA 1NRIA 1YJQA 1YXMA 2XOKA 5DGIA 4L22A 3EVGA 1NE2A 4FR2A 5J2UB 1BAPA 2N0SA 4PCLA 1MXFA 1Y8RA 2PKCA 3FRIA 4JQSA 5BQFA 1GITA 3HR4A 1CKEA 5FTKA 1YL7A 4ZMSA 5CBPB 2VHQA 2IKQA 3EQ2A 3IEIA 2JBWA 5ARCA 3NHJA 4YB8A 3E48A 5JLAA 1N4DA 5KDLA 4LNAA 4RENA 2UZ4A 1LUAA 1AS2A 4IWXA 4B6QA 4CW7A 3QVOA 1E3EA 2IW1A 3IGFA 3ASYA 3N6VA 3RU3A 2Y1WA 2P2SA 3A3KA 4C0JA 2F1IA 1I5RA 3KVOA 1A5SB 2WAAA 2XWJI 3OHMA 1MO3A 3TW6A 3W2IA 1KS9A 1N3BA 4F3KA 4CIWA 1LEHA 2JIZD 3BBPA 3UXMA 3TOCA 1GG5A 5DNYB 3ER9A 1TIBA 3RC8A 1VHLA 2FPXA 3RTAA 4GL2A 1IZ8A 2IPLA 4KQ2A 2F3UA 4ZEOA 4B87A 4G4IA 5G2OA 5KYWA 5JFOA 3UUWA 5H68A 2ST1A 2LDBA 1OT5A 2WNIA 1N5KA 5CK4A 5DNUA 1BS9A 1LNZA 3VU9A 5EJFA 4CXMA 4IDQA 3P2MA 4UTNA 1HXHA 3ZK7A 2ZKIA 4AJ2A 5HJ2A 3WRXC 5E6RB 2CLSA 5JPCA 3KOUA 3OEYA 2W6JA 3MJSA 1UFKA 4PRLA 3AKZA 3REQA 4X44A 2EEPA 5BQXA 3KQWA 1V3QE 4UCQA 1ZXLA 3KE8A 4KXMA 3OCJA 2W48A 3KIPA 2QIOA 1OYWA 1TQ4A 4JBIA 3ZN2A 3SHOA 2QTLA 1Y33E 3O0DA 3W4IA 1GNQA 1S7GA 3ZXXA 1JGTA 4EYSA 2CXRA 2EZ8A 3R7BA 4B3GA 2JH8A 4GFDA 1XQVA 1EEHA 3IV7A 4GX5A 5B57C 1ZHHA 2SICE 3PC8C 4U00A 1GG9A 3E2PA 4CUKA 1KDTA 1LTKA 2D0OB 2CFSA 3KNZA 4DLRA 1E2DA 2LCIA 4E5DA 4LKRA 1GTJ1 1V11B 3IRUA 4XWYA 2ISSD 3KJFA 1ID1A 3PDWA 4GRAA 4U3JA 1K92A 3RHTA 5LP6F 5LDHA 1QC5A 3D3WB 2I6GA 3U3ZA 1V26A 4IX9A 1SR8A 2WTUA 2FUEA 3ZZTA 5FR1A 1J0EA 5ICSA 4R2JA 2O6HA 1J22A 1LBHA 2WWRA 2PQ0A 1FEZA 3R24A 4TXLA 3Q87B 1QQ6A 1ZKMA 4HF7A 3BMOA 3ZXUB 3HYLA 2HHAA 4EG5A 3ROZA 3DBRA 5EZYF 3USZA 4QREA 2QN3A 3NFYA 2DAPA 3WWPA 3M34A 2X8JA 3HFRA 3PFBA 4V2IA 1GTG1 1N8NA 4BCBA 3TLEA 1JJVA 1EESA 2GJ9A 3GNLA 3O4IA 5AIBA 3A2LA 4PO8A 4KV7A 4PX9A 3PJRA 3U4CA 3MOSA 1ZM9A 2WTAA 3T4PA 4HNRA 5PGMA 4DIMA 3JU3A 1NNLA 1LBQA 3NVDA 4RF2A 2AN9A 1NY6A 4X85A 1WQ1R 3WS7A 2Z56A 5COQA 3GEIA 5B1EA 1FP4A 4IIDA 5CIQA 3SVZA 1CP2A 3BMXA 5DTIA 4ASUD 2YRXA 3U7IA 2C9BA 5AOCA 3RVBA 3V4VB 2R66A 4Q02A 1JKMA 4CKYA 1D5WA 1K4YA 1DAOA 2QVCA 1RT9A 4AVYA 2GD1O 4Y2UA 2W0MA 3DAOA 3L7IA 3WWDA 1N7JA 1SUIA 2YMQA 3WSWA 5FI1B 2Q8NA 3F5FA 1VBNA 1J23A 5E8RA 3PL5A 1ATZA 1RRKA 4OHMA 4ZTBA 5I7EA 3FTEA 5L7WA 2P65A 4GQBA 4M1SA 1JG3A 1EHYA 4LHVA 1SCJA 4FFSA 3ORSA 1I6WA 4MS4A 2J3HA 1ADFA 4IIGA 4B7UA 4OBEA 2ZATA 5J5AA 3GDGA 2RHTA 5KNDD 3QE9Y 2HMTA 3IR7A 3CUUA 5BR4A 3GYBA 4L2IB 4P4SB 4LGMA 3WO0A 1K6JA 2XTJA 3DXXA 3L40A 1Z9BA 2F9LA 2ZJFA 5LD2C 4QUBA 1NQAO 4PBRA 5K0EA 3ED1A 4IIJF 3RSOA 1WW2A 3OWOA 4CF7A 2V6GA 3WKEA 5KREA 2B21A 3D6MA 4FS8A 1CJVC 4LQ4A 4W1SA 3TLCA 3V33A 1HYEA 2GHQA 3ANYB 4I5IA 4F60A 4HV4A 2Z2ZA 1M5RA 4TMXA 2NYVA 1T8YA 3LC1O 1LBEA 4Z4HA 5DGHA 4O8ZA 2X14A 3RGWS 1XYYA 4DJJA 1Z68A 3NTVA 3B2QA 3JV7A 3L4BC 2ARKA 3VAYA 2WUDA 4ZI5A 2FPKA 4MXDA 1EAYA 3FF4A 2DQ4A 4HXEB 2X13A 1E4VA 3IP1A 4MCHA 4QOIA 4WUVA 1Q0TA 1X80B 2V4MA 1E6CA 3P2KA 3QVLA 3ABIA 3OQBA 1EPUA 4RE5A 1VB5A 5FUXA 2R44A 4YUVA 2IV3A 4DRXB 4DVJA 4DDWA 1T29A 2NTNA 5FCDA 1SKYB 3MEQA 3QTBA 5BWCA 3OG9A 3VPXA 1Y1PA 4Y6QA 4ND4A 4KPFC 1PTJC 3LL4A 1P9RA 1U9YA 1JIVA 2MSWA 2VL7A 3AUAA 5CAEB 5LNK1 1Z3IX 3VR1A 1AZSC 3KJHA 1G8MA 2FMKA 5LZ5A 4CKBA 4XLTA 5IJ0A 3PUHA 5AHOA 3A06A 1FQJA 4ACBA 2XVAA 2QL7A 3B78A 3N9IA 4OGLA 5EXTA 3HPQA 4HAZA 3HXQA 2ZWVA 4P36A 3OQHA 3TTXA 3H9EO 1GL7A 4BEBA 2HGSA 1RZ3A 3FB1A 4KK4A 1U1EA 4MHOA 2J0VA 4R0VA 1JXMA 1UXJA 3MWDA 2VATA 4WX2B 4X63A 4DNPA 5JNLA 3G9ZA 3VUFA 4NV3A 2RHJA 4QTTB 4DFDA 4D2IA 2WAMA 3C1AA 4EH1A 5INTA 3FDZB 4N41A 4OJKA 2L19A 4M1MA 4ROSA 3CF4G 4W9NA 1JHRA 1FUUA 1KHTA 1JSLA 1J90A 2R00A 3S2FA 3WRWA 4HQFA 3ESRA 2YXDA 1RI2A 2WP0A 3AM3A 4LDNA 1QIJA 1DFGA 4GNRA 1G1AA 2J9ZB 3PFFA 4PPYA 3W4KA 4HGRA 3I6YA 4P7BA 1L4BA 3ZI7A 4JYBA 3UCEA 3KQOA 3QF7A 4DJDC 5GVSA 3L8CA 1K27A 2J3EA 3M9XA 4GI5A 3S55A 4E08A 3K1YA 4HB2A 3W7BA 4MWGA 3AQ4A 4BNXA 3W2HA 1VSQA 2ZJ1A 4RTLA 3SXJA 1JFSA 4N12A 1WBJB 4BNWA 5JSZB 4REQB 1BQ4A 1I8TA 3KQVA 1GD1O 1ODTC 4HVAA 4WLEA 5IARA 3WIBA 2JCVA 3FBGA 3ZY4A 5BSFA 5JHHB 1AHPA 2RHOA 1WNTA 4KIUA 3W6PA 2OGTA 1EEXB 4EIWA 5E9JA 5CH5A 1IOLA 2VBCA 3MTDA 4GPD1 2O7RA 3WLKX 4PC6A 1E2QA 3A11A 1C50A 2XQVA 1BVHA 1NNI1 2FNAA 4ZCTA 5F2NA 1ZOOA 2X76A 4N3GA 3WLAA 4ZYWA 2C8VA 3SE0A 5AW2A 3K0FA 2J45A 3AL3A 2OZLB 2PGNA 4MUAA 3VYSB 1E1RD 1NVGA 4PG5A 4D6PA 1WY5A 2KLBA 2QUZA 3U5TA 1K5PA 3E9YA 2W4MA 1MQSA 3IQXA 3OEED 5BRAA 5CDGA 1K5DA 5EIWA 2PXXA 1KORA 2ZTLA 3DNMA 5CA1F 3AX6A 5DX0A 4CDNA 4YMVA 4CCSA 5HUJA 4FE7A 1XC7A 3GEDA 4CMJA 2F8TA 3M33A 5BQ3A 1P75A 2ZE6A 5BN3A 1SXQA 4NWIA 1Q0SA 1K97A 5CH3A 3UXEA 1Q12A 5CDHA 2O8DB 5KVQA 4BMSA 1DKLA 1YQQA 1YS6A 2ATIA 3I52A 5CFZA 4B7CA 2QP4A 4CQMD 2J0QA 5DM2A 4EUNA 4CNQA 4O2BF 4K6KA 3ZX4A 4FVTA 4V0LA 4PZYA 1YVPA 5LXTF 2LVBA 1IZ7A 1GPAA 1Z4IA 1JU3A 3IIJA 1HMYA 4H7EA 1B15A 5AI5A 2VQ6A 1KZ1A 3GY0A 4OYYA 3VH2A 2XE7A 2D62A 3TOSA 3GRKA 4HDMB 1CR4A 4IG9A 3ZWBA 4EY5A 5J4KA 4MP6A 4DV2B 4UVGA 2Y1CA 1KH2A 2V0NA 4ND8A 4B4KA 1H23A 3C1OA 4Z0PA 2BGJA 2JK1A 3VPSA 4FR0A 3H9JA 1Q95A 4HQRA 1QZZA 2Z1NA 5EI5A 2JI4A 4DN6A 1JEJA 3SE7A 3KU4A 3DONA 4N5LA 3OLYA 5K3EA 2RAPA 1XKXA 1C8BA 1PQYA 2AHRA 2QXUA 2HYDA 4XAQA 3VU8A 1SCDA 2HA5A 2A35A 2G8NA 2ZG6A 2ZSJA 3G0BA 4DSNA 2O2DA 3SQOA 1K6MA 4EB3A 3TSCA 3I5MA 4R9SA 2UU9B 5IZCC 4PPQA 2EJTA 2JJ1D 2GRUA 5FNVA 1HDIA 2ZYSA 2JH3A 2YY7A 2O19A 5DTJA 1MRNA 2H1VA 2P68A 4ZU6X 5BV1A 2ZROA 3O4RA 5FBWB 3WMWA 4Z3OA 3PEVA 3UPUA 2FAXA 3N0XA 3AHEA 3NHMA 1J56A 1U3FA 1PDVA 2XNCA 4UFNA 3UMJA 2HRDA 3FBTA 3RBAA 2NSYA 5DHUA 5ALNA 1JG1A 1MOSA 1SKYE 2VKTA 4EYQA 4ZK2A 4JJAA 5FV7A 3RRJA 4YDRA 3ZD6A 1MZVA 4CF5A 3KBOA 3K7EA 5ALJA 5K1ZA 2HHCA 1JECA 2WJAA 4PSAA 2HJ9A 3UMRA 5EJ6A 1E1QA 4LOJA 4C3UA 1VHDA 4YP5A 1AMNA 4RVUA 2BZGA 1RSZA 1XELA 3UJHA 4CEIB 1ZUNB 3BMQB 3CO0S 1WUYA 4JP8A 4J2TA 4AJPA 4ZJZA 4UVIA 5HRUA 1SU4A 2HUPA 1I32A 4P84A 2CXSA 3WLRA 2IHNA 2W6CX 1JXQA 3IO5A 1C9NA 2CT8A 4IJVA 4M1YA 5FJIA 3DZGA 1H0KA 1QFMA 2B1RA 2GO7A 3CEPB 3ORFA 2C61A 4YASA 3S5UA 3UZUA 4CKWA 4MLDA 3H1AA 1F2UA 1JYSA 1GUAA 1UMBA 2GM9A 2ZULA 1KEPA 2EKPA 3RH0A 2GJKA 3ENWA 4HI0E 3N39C 3O03A 5LQJA 4D9KA 3K1AA 3BXFA 4RM2A 5HG0A 5BQPA 4XGQA 5EWLB 1FRQA 3UKJA 3ETDA 3UKOA 4FB5A 3L77A 2ZRBA 4R7ZA 5FADA 2YJ3A 3R5TA 3HP1A 3QY0A 4GF5A 4AD8A 1W4AA 2AR9A 2XIJA 5GM1A 5KQLA 1FA9A 3JQFC 3ET4A 4YJ2B 1O87A 4B3JA 1E64A 2IGBA 1R1DA 1L4GA 1QR6A 4FFBB 4HZGA 3T7JA 1XEWY 4HZUA 4L0MA 2ZBEA 4MJ3A 4KLZA 4BUCA 4HYEA 4CMEA 3K70D 1QMGA 1RWPA 2GCPA 3RDPA 4ARIA 3P9XA 1G6Q1 1N7HA 5C31A 5G1OA 2RHGB 1WP4A 2PPLA 3PGA1 3V1NA 1I13A 1M66A 1BE0A 1V5WA 2H2FA 2KHZA 3IQEA 1M1YA 3FDJA 3RUFA 2I2DA 3KR9A 3CB4A 4WI1A 5TMDA 3X3HA 4H7HA 1E0SA 2OKGA 4DSOA 1YZVA 1MU0A 2ZUSA 4OATA 3MCZA 2FLKA 1ZNQO 4EG8A 2O8BA 1TRHA 1ODSA 4CEJA 2PU7A 4BNKA 1U1IA 2HLDD 4JJ6A 1R2QA 2A7QA 4O33A 2OCGA 4HWPA 2F3QA 2IELA 2ZSIA 3D8BA 5L3VA 3BJRA 4CM7A 1ZCBA 3NWBA 3MHPA 2CXOA 2NZYA 4WZBA 4EF6A 3IJ5A 2X77A 5GIPE 3GLIA 2X40A 2HPVA 2ZSAA 1O9GA 1XTZA 2HA2A 3UAYA 4ZHQF 2XUFA 5L4LA 3RRMA 1R0SA 1EVZA 4UE6A 4LYFA 1KFJB 3ETHA 2A9QA 2O50A 4NU0A 4GP9A 1AKQA 3LQYA 1EZ1A 1HE4A 3S8YA 2X41A 1MG0A 5EERA 3PC7A 3OX2A 2HO5A 2YBDA 3IBFA 1HEYA 2IU4A 4D81A 4DMUB 3KQSA 3ZQ4A 2ZW9A 3ZJUA 1RPAA 1T2AA 2CW5A 1EA7A 1GIAA 1NATA 4PHFA 3K2QA 1DRKA 1OLSB 5E6SA 3FPFA 2EX0A 2IW3A 3T3DA 3ZGNA 3GLTA 4N03A 4Q3OA 5HM8A 3B1VA 3T3NA 1U63A 3C3KA 3HWRA 4DYDA 1NOIA 4CIYA 5EVCA 5PNTA 1UK8A 4C3VA 1W4CA 2AI3A 2D8AA 4RS4A 4RESA 2YWHA 3OF3A 3KS9A 1ISJA 2FHPA 3OTQA 4XYBA 5HS4A 3OQIB 4KE9A 3H0CA 1BX0A 2Z8YM 2H2AA 3WGYA 4CF4A 3OFND 3WVNA 3X1DA 3WDLA 4DJEC 3CH7A 1TAHA 3JQGB 4XVUA 1NMXA 4QFDA 5DN9A 2NUTB 3GCXA 3EVTA 5DM0A 5HX7A 3QELB 3WZLA 3UJ8A 3HVHA 4N49A 5ABPA 3X1ZA 4AS1A 4D0NA 5AW4A 4K05A 4YO8A 3R8XA 4AAYA 4LI3X 1N5MA 3D2CA 3INGA 5AI0A 2GZRA 5AYVA 3NRBA 3L0ZA 4LCEA 2WHPA 4MVJD 4TV8F 4HDKA 4L74A 5KTPA 1HETA 1YVDA 3LT1A 4M4SA 2JJ2D 2VT3A 5DHTA 3GAFA 1JSCA 5HIKA 1ZJZA 4LECA 3K8OE 1ZI9A 4H0FA 5D7BA 3SDSA 4JJIA 2O8NA 2QTHA 3X2FA 2BFDA 4E94A 2ZBGA 4CF3A 3ZH2A 1UBKS 4CIBA 3C4JA 1QIHA 2V8BA 2JA1A 3HJBA 5BQ5A 2I1VB 4C2AA 2FR0A 1NUSA 2G25A 1AUOA 1L5FA 1J0XO 3BFVA 3K6SA 4D8UA 4CT4B 2YWRA 5H82A 1J2JA 1I2ZA 1GU0A 3PHCA 1J24A 3Q5GA 5ANRB 4BECA 3OE1A 1JR4A 4OB6A 4B4WA 3B60A 4YRSA 4KMRA 2QSUA 1XHLA 3NGLA 4GI1A 5FAKA 2D1SA 2OT3B 5L3ZA 4UMVA 1P61B 1CD5A 3D6NB 5A4IS 2AOUB 1V1RA 1WUIS 2AZDA 2H9AA 1FNSA 1G3UA 3BMNB 4MVJG 1J7KA 1TA9A 2WSIA 4PZ0A 1HDEA 3UWKA 1YFKA 3Q7TA 3ZHZA 1H0RA 2Q1XA 3QFRA 4TYMA 3D5QA 1C3OA 1RWVA 2E87A 2PX5A 3GA7A 1AGNA 3T1OA 5LNK6 5DM70 2PUGA 4H0CA 4NH0A 2IU6A 2X19A 4BAZA 3H2JA 3SC6A 3OTOB 3EPRA 4CM9A 1KYQA 1FS5A 4M0DA 2QRMA 4RV5A 3DOIA 3OQPA 5NLLA 1TCVA 2FLVA 4TTIA 3BSYA 2BFCB 2OAQ1 5U4QA 1OLXA 4PTLA 3QK7A 3W3AA 2IZZA 2AN4A 2CBZA 3I05A 4E31A 2AG1A 2G5CA 1O96B 4Y18A 1ULHA 5C52B 4JXKA 1T9GS 1T36B 3JR7A 1OHHA 3KWFA 1IWBB 1GGHA 3MT9A 3NT2A 2FDXA 3R7WB 3H2SA 1TA0A 4BFWA 2ACEA 5CGZA 1M8JA 4C3OB 4Z1OA 1YDWA 2A0UA 2NTJA 2BYTA 3QVUA 5H4HA 4K1XA 3CO5A 5AVYA 1N77A 1U5BA 4R1UA 4XVHA 4O5AA 3TB4A 3TSAA 1GFSA 3K16A 1MUUA 4PYOA 1R00A 3TTSA 4X64B 3B82A 3Q72A 4HAIA 4DT1A 4LF6B 3KFLA 3PDUA 4C5CA 1QYWA 1LLQA 1BZYA 1QDEA 2CDBA 3BGWA 1OZ0A 1TT5A 1HC7A 3DOCA 2P11A 1Q17A 1HE5A 4I1SA 3GCWA 3HU5A 4FXOA 5BURA 1Q1BA 4WBNB 3AM1A 2ZQ5A 3ON5A 5H8WA 1AZTA 1NMYA 4WSOA 1RZRD 5K09A 3MTQA 2W6QA 5H83A 3N0WA 2FETA 2A1TR 2IYYA 3IAUA 4RZXA 5DPMA 3MUFA 4R5HA 1N0HA 5K4AA 2P41A 2ONYA 3DNFA 5B1DA 4BLQA 1NP7A 3C4QA 1RCTE 2HIGA 4MV4A 2MMCA 3NCHA 3PNMA 2VF7A 4JKYA 4RVSA 3U4DA 4JLUA 2AOTB 3K5PA 1YA6A 1RXCA 4A5OA 4KQJA 5EUBA 3BT7A 3TKLA 3OJFA 1SCIA 1PS9A 2REQA 4I9FA 3T5MA 3UC9A 1DTWA 2OSBA 3RSGA 1VHQA 2FSVA 1P7YA 3AFIA 2R68A 2ZYDA 2FGJA 2GM5A 3L9XA 4QUDA 4J75A 5K3AA 3F8WA 1CDOA 1ZZGA 1O3YA 2Q1YA 3RRBA 2RHHA 3JZIA 3OU6A 4C2UA 2OXEA 1VJ1A 1GZVA 2H8KA 1B23P 2HZBA 5TV2A 4FHCA 1WSBA 1T1JA 4H60A 3ZQ6A 2RFLA 4CWAA 4QJ3A 5K0CA 4D02A 1AUVA 4EX6A 1E77A 2YV3A 3PXXA 1AM4D 5TNXA 5CVTA 3ZKWA 3DTTA 1EGHA 1ZCAA 2I7CA 2QB5A 3UUGA 5ADWA 4QM6A 1WHTB 1YC2A 4Z4CA 3UXYA 1MFZA 3I73A 4OH1A 2EW8A 4EECA 3AIOA 5FR2A 1LZLA 4PINA 2NTEA 3V4LA 5EPUA 3WHPA 1GLNA 4GH5A 1TQ8A 1TJ4A 3MUEA 4RELA 1GGFA 1VIYA 2DM6A 2LXNA 3OKPA 3OO1A 3QWIA 2IS1A 3DT8A 3L79A 5ALHA 3TRHA 4BC0A 1XTIA 1NXPA 4FPXA 5GMOA 2QN6A 3UJ9A 5TIIA 4BP1A 1EGVB 2D3WA 2Q2OA 3RB8A 1ZH2A 2MSLA 4B43A 2NOAA 2VA8A 3B2EA 3RROA 4PLGA 4PR3A 2PGDA 1WJGA 1JIKA 2A0WA 1HFKA 3K94A 2PDAA 4AXXA 4EKGA 3D3EA 1JWLA 4K6OA 1J5EB 3B1WA 4E5KA 1LSUA 1QYCA 4AWBA 1ZU4A 4HAYA 4BNDA 4WCFA 5BWNA 5ALWA 4I1OA 2B4RO 4RADA 1PEYA 1LD3A 1QRSA 4E46A 2VBGA 2M1ZA 2WYIA 3PRYA 1BS2A 4HPWA 1W5SA 2FRDA 4GM0A 1AQNA 2V59A 3OA0A 4YUAA 2OKCA 2B94A 2K6GA 1UOQA 4KE6A 4KIJA 4R1LA 3UBMA 2ZETA 4XR9A 1PWEA 1AXGA 2PO7A 2YWJA 2XD4A 4P0PB 4C7OB 3ETCA 2UYGA 1JDPA 3HGMA 4KBYA 3RQIA 3W5UA 3OICA 1NF2A 5AOVA 1RHKA 1K68A 4HEA1 3LNTA 4IRUB 5CUQA 2DBYA 1T8WA 3R40A 2X9VA 3GFTA 4M1TA 1YRWA 4P5DA 1A8QA 4Y2SA 3JQAD 3TQCA 3I2FA 1VKOA 2WUEA 4Z1MD 5JS7A 1EFTA 4JT4A 3HH8A 2E5WA 1Z38A 5CXQA 2H7XA 4RJJA 2ZJ3A 1VLVA 3Q7PA 4DARA 2PMWB 5H4GA 1DWQA 4OQLA 4IDCA 4A2QA 2YXPX 1A9OA 1M5UA 3CX6A 4L5AA 4ZCPA 5TEVA 5HUHA 1DZ3A 2Z5LA 3R3SA 5B6IA 3FROA 5KYYA 2E4VA 3LE8A 4LPSA 3GJ7A 3CA8A 1W47A 3A32A 4JOQA 3UUEA 4DXDA 1O97D 1R6XA 1RHMA 1SRRA 1HT3A 1OKKD 2OWEA 3TXAA 5AM2A 1YZ3A 2RC6A 3P26A 4YCAA 4IYJA 3VX3A 1SKAA 1QVAA 3O92A 5LM3A 4FWTA 1DBIA 2OESA 4QARA 4W9NC 3M70A 4FEYA 2R00C 1RTTA 2E4AA 2JH9A 5LP6B 4HTAA 3BWMA 3MOGA 5J4VA 1EUZA 1N6OA 3GGGA 3EG5A 4ME6A 5ALOA 1ADGA 4XR4A 4LJAA 2OP0A 4U63A 2G5TA 4UTXA 5JIBA 1L5VA 1Q57A 3HB1A 2NO4A 1TEZA 3E23A 1N6RA 3Q7IA 1HLPA 5FLKA 3WLLA 1P4AA 1KQFA 4HEHA 5EZYB 1PDWA 1DTEA 2P2NA 3AR8A 4G5FA 3RUCA 2HHHB 2ADOA 4D8WA 1CCWA 1F0PA 1DKOA 2W00A 3A6HA 1LZKA 3DDZX 3T4UA 1LLFA 13PKA 1OZGA 4XRGA 1F38A 2C83A 2I91A 1P5RA 3QUSA 5LZ7A 1VSUA 2Y3IA 1GZ5A 1RYBA 4NPCA 4MWBA 2B2XA 3NBZC 1XXLA 3IJPA 1KMIY 3TDMA 4QQKA 3E3AA 2PMDA 3DMHA 4HADA 2IIVA 5K0JA 1T1IA 2V74B 4Q93A 3NP9A 2ZT8A 4WGFA 3QOFA 2BGIA 4UUMA 1TAGA 1Y7PA 3WYNA 1T5LA 2RAVA 2C4UA 1T2FA 3IT3A 1HTBA 3KLMX 4ZOLA 4EPYA 1T15A 5BYBA 2PANA 2EGGA 2X3YA 3C3EA 3O91A 3PDIB 1RQNA 2C4HA 3ETLA 4U0KA 1OREA 4XSVA 3VNQA 5BN4A 2BZSA 2EOAA 3G89A 4WD3A 3E35A 4NBLA 3HVRA 1J97A 1LTHR 4UM5A 1BDJA 3GUUA 4BU0A 5BVGA 1R6UA 1BOFA 4UMFA 521PA 2CNBA 1Z17A 2D1YA 3AU8A 1GYPA 1RHQA 4HDOB 4P53A 2OC4A 1E4EA 4X3OA 2R6CA 5H80A 1P2UA 4B7AA 4K9NA 1X6VA 2YJ4A 3IILA 1RPJA 1XQXA 4V0MA 1XEXA 1SXPA 4RPIA 4JDPA 4DAEA 1NUHA 3DLHA 3BTUA 1SVLA 4RF4A 1E63A 1BXRA 1QHHB 3GC6A 4RDHA 4TSFD 3W3AH 4CEHA 4FNAA 1MAAA 1L7VC 3M3DA 2VBFA 4RD0A 1HOXA 1VSVA 1X8JA 1SN7A 2BFEA 2WZDA 1JKJA 5GZ6A 3G0IA 8LDHA 2V3VA 3A9RA 1C30B 1R9JA 10MHA 3TFWA 2WKQA 1N5OX 1KPIA 3KM0A 3H2HA 2B7LA 2R4TA 2DSTA 2NGRA 3H99A 4IIJB 1H8ED 4XM1A 3TVTA 3GZNB 1NT4A 4M0PA 5EIBC 5IK2D 5LSAA 4IHQA 1WZCA 3N2ZB 4XSGA 1W36B 4Z3DA 4V0NA 5CHEA 5BR7A 3NW9A 4AMYA 4NXMB 3DOJA 3HA3A 2XLBA 1LSOA 3SYMA 2XCUA 4TX1A 4G5XA 5F33A 2I6QA 1FX0B 1FF9A 3HJAA 4D9IA 1E2FA 2O5EA 1Z7BA 2AE2A 4HUJA 3D2BA 4QYSA 4G26A 2J46A 2C3UA 3HBJA 5DSXA 4RY2A 4EKEA 3DXFA 3P19A 5B53A 3KK0A 3KOOA 2HCJB 4JL8A 4TKUA 2XNJA 2A9FA 2C8LA 4HY3A 1HM5A 1XP5A 3EYWA 4BNIA 4CFSA 1B43A 2CMGA 4K8RB 1UBJS 2E6KA 4KE8A 4RM3A 1PD1A 1ZESA 1K7XB 4RDIA 4AZ0B 3CNNA 4NCKA 4B7ZA 5A6VA 1WZ2A 3HEMA 3U44B 1GGKA 4JJ8A 4CIXA 5JQGA 1ML3A 1BGVA 3AR9A 4TS3A 2Y9MB 1JZTA 1NBAA 2XW6A 1Y1RA 2FWNA 1G8GA 4U7PB 2B3TA 2ZT6A 4LEIA 3EXEA 1MDBA 2VT6A 4JVOA 2CJWA 2VDOB 2I3ZA 1QNLA 1YASA 2CXXA 2DH5A 4BZWA 4C7JA 1U2EA 4RK1A 2BJVA 2L2QA 4TKLA 1VPWA 4BQEA 2NACA 2FCRA 2I6TA 1EUDB 3OP1A 3A4NA 2OK7A 3S2ZA 3CVXA 5BNIA 4URHA 3NATA 2YH2A 4TOIA 1W52X 3ZV6A 1YKFA 3UWMA 1N2BA 1VLMA 1X77A 2Q21A 1WPGA 4NENA 4Q15A 2PA0A 3VNBA 2OHGA 4ETMA 2REBA 3KRTA 2QUAA 2WU3A 2VDJA 2A7XA 3B7WA 1AGXA 4GI3A 1I3NA 4JVNA 4MW5A 3WL6A 1DQNA 2DXIA 2GTPA 2QD4A 1YMVA 2YZNA 4YMUA 4NBTA 4CVNA 2RDMA 1KMQA 2JGNA 2VH1A 2WHYA 1V25A 4URUR 4I4CA 3D9QX 3IJEB 3LYUA 3HP4A 4LX8A 4YQFA 4C08A 4P54A 3MCWA 3MBOA 1XZNA 4QPCA 5ELLA 5FBRB 3SEZA 1BJKA 3NP7A 3K9GA 3PHLA 1QGDA 2JW5A 3QXCA 3DVAB 2PFKA 3PT9A 4TXNA 3I9OA 3KKMA 4PG6A 5CDFA 2VJBA 2I34A 5IC6A 1IHDA 3REQB 5FPHA 1RAHA 1CEYA 2DB3A 1G5HA 1CUFA 3HB7A 2IHZA 2NAPA 4CMEC 1FDSA 2WTEA 1IEQA 4GZ3A 1EK2A 1U6JA 2XXAA 3PENA 1BO6A 1VLJA 4V2UA 4BGDA 3ZWNA 3ODGA 1L8LA 4PC2A 4TZTA 4UKDA 4GOND 4DV5B 2VDQB 1K86A 2YVUA 4ILEA 4NZYA 1BCSA 5F5LA 2X5KO 3SIWA 1T3HA 3IMCA 5FKJA 4W9MC 1ZVJA 1W0JD 2W2KB 3GO4A 3HSSA 3MGAA 5EHIA 3KTFA 3OPYB 3DTNA 5CA1B 3K09C 2DFTA 1ZJYA 4MQBA 1LPBB 4JELA 1JRLA 1D2GA 4JQZA 4Q9AA 4XWWA 4DR3B 2PZJA 4XE5A 1EFKA 3RRYA 4B8WA 5BSEA 2M32A 2ZSBA 4ONEA 1S3IA 4INZA 1OJLA 1PGOA 3PX3A 4O2BB 4AK9A 1OFIA 1ILWA 1O5IA 2VSQA 3FGZA 3LBNA 1N7IA 1P8AA 5LXTB 4UOEA 5KTMA 3HBFA 4QBGB 5ALKA 3M6LA 2I87A 2OK8A 2VNKA 3T6KA 1WV0A 3LIPA 1Z8FA 1JP7A 4LDQA 4MS1A 1WAMA 3CURA 2OBYA 1NWCA 3IA7A 2M6SA 3CSUA 4N8SA 2R0QC 3HO6A 4QNNA 4YAWA 2FJPA 1HLFA 4A0HA 2LWIA 3ZZUA 2H4WA 4P22A 1RBMA 2CMDA 3BJEA 3DMNA 3THSA 5CNIA 3LX8A 3QWAA 3MIIA 4ZOEA 2DFNA 4WFQA 1MW8X 4UTOA 2R86A 1Y3DE 3VISA 5AK3A 2NO1A 1YD7A 3O8BA 1HG0A 1D8AA 3B5IA 4DDVA 3LYAA 5I7SA 3DO5A 4R1MA 4A73A 4MUMA 1DBQA 2BMJA 4EMSA 1XMJA 3KT8A 5LFAA 1NKTA 2CYBA 3OJOA 2RC5A 4GDMA 4OEHA 4BJ3A 5BPHA 2E5FA 5CB6A 2JIBA 1NVTA 4R5MA 3OIFA 3SAJA 3ZZMA 1Z7YA 4EO4A 1H2AS 4P80A 4OHFA 1I9GA 1VL2A 2XODA 5KQPA 4YQYA 2XZPA 3FYTA 3HSYA 4PQGA 1DMRA 5DX1A 4TRJA 5AK4A 2OHIA 3WNDA 2LIVA 3ZYZA 2X9LA 4KODA 5HXAA 1PQWA 3L7BA 2I7TA 3FZEA 3Q9SA 4PRZA 3S2EA 2GFHA 1WDTA 1R9NA 3IAEA 2XGSA 5M3BA 1ITZA 4F9EA 4ZEVA 3L1HA 4MTLA 4B47A 4D3SA 1MTOA 3H65A 3N3AC 4LYHA 4UU8A 1XQ9A 3ASZA 4BX9A 2YHBA 2IC5A 2Q9UA 3LVBA 5K8IA 1PWXA 3OIVA 3KZXA 2J0EA 1A72A 5LOVA 2NADA 3F5MA 3L06A 3O9ZA 3PXUA 1FDUA 3ROGA 4A15A 2VEDA 5JD3A 3T5PA 1LV7A 1PLJA 1V16B 4WJKB 4BFUA 2IEDA 1OXVA 4AX4A 1PEDA 1TKRA 4R1OA 1SZDA 3TAUA 1UM9A 3M4XA 4BIMA 1WLSA 3OPQA 1JEOA 1ESDA 1JG7A 1MIOB 3E58A 5H81A 5LD2B 2FFBA 1J4AA 4TSFA 3U17A 5E4YA 3C39A 3FPHA 2VHYA 2JB9A 3NASA 3RAPR 1NAHA 1Y3CE 1RQ7A 3GMTA 1MAVA 2DWOA 2C2GA 2HTFA 4M22A 4TWBA 4B8ZA 2HQRA 3MINB 4OI2A 3I62A 2BI7A 1O6FA 3ECSA 4UM8B 3L49A 1W4RA 4F04A 4EHFA 3C5CA 3E4CA 5C8ZA 5KC9A 4GKKB 2XRMA 4Q4JB 1H8HA 1ZFNA 3FCXA 3GAZA 1G42A 3A14A 4QO7A 4WKOA 4K1LA 4QSHA 2Z6AA 2QZ9A 1H8EA 2E21A 3DMPA 1L4KA 4DWVA 2CNWD 4Z3KA 1US8B 4V1CI 1Z18A 5FNVF 1AKVA 4X8MA 1CVIA 4YRQA 3MLAA 1G3RA 2RHLA 3ZE6A 4L5IA 3QKIA 5C32A 1RWQA 3H1EA 2F2TA 3B20A 5D1NA 3K2IA 3SMQA 5JJ5A 3HWSA 1JBQA 3PF8A 1E9EA 3FRJA 1K7EB 2EDAA 2OGZA 3G1UA 2OYCA 1AGYA 1C0EA 1CULC 3A1VA 4Z7JA 3P9YA 4Z9XA 2QPOA 2ZYIA 3X44A 2EBFX 2UKDA 1TUGA 3HJRA 2DFKB 1W4ZA 2O52A 1JDZA 3GJRA 3MUNA 2A5LA 4LRWA 2I7XA 4PLYA 3W5AA 3TEFA 1T4CB 3PYLA 3J7AC 3M81A 2E4YA 4D6XA 2IXDA 1E7QA 2GM4A 2OO5A 4JT8A 4PW0A 3FTNA 5T3UA 1EDDA 1C3EA 4WERA 5GV7A 1M8FA 3JAWB 3MIZA 1QANA 4TROA 2ISCA 4FS3A 1AGRA 4RTPA 3AJ9A 1JG2A 2J3MA 4G4SO 4DSTA 2FZCA 1E18A 1FYDA 1NHWA 3R6WA 4OFWA 1H4VB 5EVJA 1ULZA 2HXYA 2TSYB 3PIRA 4CM3A 1OV6A 5CFRA 3VZBA 5LP1A 3L7JA 4AU1A 3EAFA 4ZHQB 2HW8A 1IY9A 3EJ6A 2DCMA 1RYHA 1KE1A 3AIKA 4A0QA 4ENUA 3F7TA 2Z1DA 4Z4FA 1H5QA 2QENA 2YFKA 4XQGA 4MICA 3B8EA 1T24A 5C1BA 2BKVA 2J3JA 1SY7A 2ZJBA 5DEIA 2FSSA 1G0NA 3UAXA 1JEEA 5EUCA 4JLKA 4QGGA 4J49A 4M1QA 3KR2A 4IZIA 3ZGXA 4KLNA 3R8CA 2Y77A 2OR3A 3BILA 2VS1A 5BN1A 1YJBA 2IXBA 2PRZA 2WSSD 3CX8A 3GJ0A 2V0GA 3G9XA 2AG6A 1MHPA 3BKXA 4LGVA 5LLTA 4M46A 1OXMA 2JGMA 3A6FA 5JS1A 3CUWA 1B8PA 5JYCA 1LPSA 4JEIA 2RKOA 4MUEA 2WG2A 2OC9A 2IPXA 3VKWA 3W9YA 1Z12A 4RJLA 3T06B 1XD2A 3A7DA 2B92A 5DT2A 4ITVA 1RU3A 4URZR 1R5OA 2HNKA 4ARUA 1ORHA 5EYPA 1QV9A 4TLMB 2EARA 4QDJA 2E6UX 4E1BA 2GTHA 2RI1A 1RJWA 5EIOA 1C3LA 5CT8A 5CFNA 3QEAZ 1Y8QA 3PTAA 4OX9B 2A3NA 2QTGA 3QVWA 4L9RA 3U3RA 1QDUA 3T35A 4FD3A 3W79A 1R5JA 3ABOB 3EG9A 1Y80A 3H5IA 3DO6A 3JQDA 4J4BA 5BRNA 4DEVA 5C2JB 3DBVO 3MCUA 5C5IA 5CM2Z 1J9ZA 2BKUA 4ETWA 5JRDS 1V3TA 2I2FA 2PRSA 3L8GA 1O4WA 2BFBB 4TV8B 3W1EA 4DMHA 5KPDA 1ULAA 3Q3JB 2OWDA 3A6ZA 5THQA 3STWA 3CJQA 4QO8A 2QS9A 4GOLD 4WCFC 4TYPA 3OT1A 2G5GX 3RJ5A 4ZO8A 1ZMTA 4FE3A 3BK7A 2YVAA 5D6NA 2GCGA 1CJKC 2FRDC 2ZYGA 1NI3A 3IBCA 2FPPA 2ODTX 3UV6A 1ZGAA 1R74A 3V80A 1VGQA 2IVFA 2QWXA 3TOZA 3OZIA 4FYXA 1F48A 1U6KA 4NNPA 1V48A 3JASA 4EMTA 1KRXA 2BEKA 1N1DA 3KKPA 1UJMA 2UZ3A 2XSZA 3Q9NA 2QRLA 4NE2A 3TNYA 5CG1A 3ZK8A 3AEKA 1CEXA 1E3DA 1X38A 4AJKA 1BFKA 1T9KA 3F67A 1NJGA 4YJHB 5REQB 3BX1A 3R3YA 3VHQA 3IAS1 4AJNA 4EI2A 2AR0A 3OC0A 1DU4A 4IY1A 1TQHA 4E13A 2JLRA 2Z04A 3NH9A 4RK0A 3TM4A 3B6IA 3PLNA 2BGGA 2P9CA 3BWVA 1V39A 3TJMA 4JLNA 1NR7A 2G1UA 3TW8B 4ALIA 1M8KA 3AUYA 2DTXA 1JI3A 5FBVB 3K9FC 3KC2A 2HA0A 5BV8A 1P2DA 1Y8AA 4YP6A 2OV4A 4XUDA 3RKSA 2FFJA 2DWCA 1TLFA 1JI0A 4ZZ2A 4BNNA 3KQKA 4AUEA 4LN1A 3R6LA 5G02A 3LFHA 3V1YA 4F9FA 4B74A 2VN8A 1HE2A 1YI8A 3NHAA 4TTRA 4DJ5X 3U3DA 1U65A 4GIBA 2AFIA 2GZMA 2X2FA 2VSFA 1PGNA 4I4LA 3FOZA 2BEVA 2CJYA 3M4NA 4CKCA 1TU3A 2C03A 2QW0X 1MT0A 3CVJA 4NV0A 5AJYA 4DQLA 4F5WA 2EFEB 2HV9A 3N2KA 4F2PA 4RU1A 1V8BA 2B1QA 2RK4A 4J7CA 5BSRA 4XVCA 3FGNA 5IKOA 4FJ0A 1XU9A 3EMVA 1T0HB 1EXDA 2W83A 1WSAA 2APJA 3KJQA 4U2EA 4AP9A 2ZRAA 2EKQA 3DVSX 2BSXA 2XD9A 1G20E 1IVNA 4L07A 3RRZA 3ZHBA 3CV3A 3CLKA 3ZXIA 1JR3E 1OOEA 3HCOA 3OCCA 4HRVA 1TYAE 5FPQA 3TVDA 4B31A 2COUA 1U9CA 1DXYA 4MUNA 3U7JA 2I1QA 1G2QA 3A9VA 4DEYA 1SVMA 1FIUA 1LPOA 1VCNA 2F3PA 1W6RA 1KC3A 3PXBA 1UC8A 5EZSA 4F2DA 5HR5A 4FFPA 2GEUA 3CH6A 4Y3UA 1TPYA 1P5JA 1EGQA 4R7GA 4BZPA 2H1HA 4FDMA 4GD3Q 4OV6B 3K71B 4CJXA 3EGIA 4R98A 1TEXA 1QK5A 3OH8A 1QGOA 3D59A 3F6BX 4FDLA 1T9ZA 1E66A 1EZ4A 4YONB 4EUKA 5B1IA 4PZ9A 4KR3A 4HGOA 2CNWA 1SBIA 3HJGA 1H65A 5KQRA 2I4MA 2QTZA 3OSZA 4NC9A 1OCEA 3DL4A 3JTEA 4HVCA 4XUCA 4RZ2A 1EDOA 1F3OA 1TDJA 4H4DA 4CM4B 1OX4A 3NNDA 3HN7A 5CH8A 3W04A 2CMFA 4TVOA 3X0DA 4LY6A 2QVBA 2YHUA 3ZLJA 1GGNA 3IKTA 2QRPA 1YTLA 2F1OA 2AYZA 2H1WA 4Q82A 3CCBA 3EDOA 2VYVD 4LXUA 4E5MA 3WTCA 1NMQA 5FT9A 1XDGA 3EIEA 1DQPA 1JQBA 4ZKEA 4NFHA 1NQOA 2BHSA 1D9ZA 1GQOA 4KGVA 4OSOA 3W4JA 2EQAA 2D5IA 3VYRB 1AXEA 2CB9A 2IPAB 2QRUA 3HMQA 1R18A 3DH0A 2YW9A 3L0IB 2GGSA 4UJ3A 5HF5A 1WXFA 3IIMA 3UMGA 3K96A 1QG0A 4JCOA 3U1TA 3W5SA 3NV9A 1JEDA 2C4TA 4WN9B 2O57A 5HE8A 4TL7A 4DCJA 3MJTA 4LTMA 1YR1A 4EL5A 1KKLA 5B3AA 4CM5A 5E7IA 1IBSA 3AEQA 4FYIA 4XYGA 5J2TA 1J5XA 3LVFO 4ETNA 3LC2O 3U9TA 1W44A 1VL0A 4IQ0A 3PWZA 2CFIA 4S0XA 5FQOA 1PJCA 3B5EA 3BK2A 1CUBA 1U7PA 3QE2A 1GNPA 2PLRA 4X93A 3M5PA 3QHAA 4PFSA 1KEZA 4OGGA 3C2QA 1DC6A 4AF8A 4TM7A 2IYNA 3AZOA 5DIFA 4KYIB 2R751 1RWKA 3JQPA 3ZS9A 1QGUA 2CUTA 5A3JA 2GPTA 4Q39A 1SQ5A 2VZEA 4Y9DA 3U1BA 2WNSA 3PL1A 3RJMA 4AZWA 1F8GA 2QXYA 2D7DA 3Q3HA 4REMA 1ZRSA 2ZRNA 3SF8A 4A5SA 1E3LA 1Q1NA 2C5SA 4JOCA 2ZUFA 1G5IA 2FP4A 3MGKA 3IMEA 4ER7A 6REQA 1GZDA 1BX1A 2JFNA 4L27A 1PVOA 2MYUA 3Q10A 2C0QA 2WSSA 4EEZA 4ZKDA 1NUTA 2X0KA 2YUTA 3KT0A 1T8PA 5DOVA 2R8XA 4QWMA 4E70A 1N2HA 3P0FA 5T8KA 2GESA 2A9PA 3HUDA 1LA2A 2B0CA 3UHFA 1QG4A 3C7CB 1QZTA 4QQ8A 1EHIA 2P2GA 3GG9A 3I1IA 1Y8RB 2CHUA 3WJ2A 3WWEA 3ZGOA 2P4UA 2RE8A 2XBUA 1CUUA 2YZKA 4MYTA 3NKFA 3WO1A 1BH6A 1OUMA 3TBHA 1OIWA 1OSNA 1WMDA 5EMJA 1GFWA 2VUSA 1ECPA 1Q77A 1X1DA 5TLSA 1TIKA 3D4BA 3CZCA 3R09A 4MRVA 3MM4A 4JSTA 4WOKA 3EWAA 4MEJA 4BPRA 2FDRA 2LGJA 2HNBA 3DKVA 3I6BA 1TJPB 4G0VA 4J0DA 3O7WA 1Z22A 2FSIA 1UXIA 1P0IA 2ZUUA 3RRNA 1CUGA 1D4OA 1YR7A 2NO5A 1LRLA 2Y99A 1FDRA 2YFQA 4Y6OA 1XN1A 2Z4RA 2QLJA 3VU9B 1C4KA 5EP1A 5C34B 4QYWA 2BUBA 4BEWA 2XKKA 3IV9A 2QL5A 3IYLW 5BW4A 4L5JA 3R76A 4D3DA 2HPAA 2VZ9A 3DHWC 1KETA 1TU4A 2W2PA 3HKBA 3KKKA 1FNCA 1EVQA 2EFJA 2PKEA 3DEIA 3MNFA 4RHEA 3WLQA 4NYJR 3RVSA 3FLMA 3WSTA 2JLZA 4ETIA 3ZV3A 1OYYA 4QT0A 5A71A 3HU2A 4C0AC 5FYQA 1AQJA 4KWCA 5A5EA 3U7GA 2AEMA 2PH3A 3QQPA 3JQCA 2MT9A 1OLUA 3WIUA 1C3JA 4L02A 4P6VF 3C74A 1G4UR 3QBJA 2GZ2A 4HGZA 4O63O 5F1PA 1T8SA 5HDBB 4C9BA 4HFJA 3KG2A 4F9GA 3QTLA 2WUWE 2C92A 3RSZA 4ZQIA 1K66A 4BKOA 1UJ6A 2AJLI 4EJSA 3QE4A 4PS0A 1YQWA 4U3JB 3UHPA 1A9SA 2IUYA 2QAIA 1YOBA 1QC5B 3M82A 4M21A 5CFLA 1Z82A 1Y4SA 3KSRA 3ND9A 3WGJA 4B79A 1Q83A 1KJZA 2F1HA 3SYKA 1KYYA 2GDJA 2QM8A 4HEQA 3V2GA 5HJ5A 3R41A 3LK6A 2OBFA 1KMCA 3SR4A 1RVV1 4CIDA 3BMOB 1ORTA 3PUKA 3ROKA 2D7CA 2C99A 3WFZA 2FSHA 1KJNA 3DBRB 1K63A 1L3CA 2PGJA 1A3CA 3G7SA 5B4UA 5KJ1A 2X8JB 4AO7A 3MG9A 2WE7A 1YWGO 2IHYA 3B48A 3EQ6A 3CG4A 1OI4A 1JV2B 3GOQA 5DLYA 2FFQA 1N8SA 3QUQA 1WABA 4OQEA 3K8QA 3MCTA 4R0NA 5ECYA 4YPFA 1EFLA 1QXSA 1T5DX 2PZKA 3MPUA 4BO5A 5HTOA 1XCBA 5H16A 1Z07A 1YB2A 3THRA 3UJNA 4FGWA 1NKSA 2UYYA 3TFQA 2IXFA 3GVCA 5FLEX 1KFKB 3GU3A 3RRXA 3BE6A 1H5NA 2Q0QA 4N5DA 1I6KA 1UT5A 2PX3A 1FP4B 4Y9TA 5GOTA 4P35A 4ZOLF 3N2YA 3LWZA 1OU4A 3ET5A 3ZQJA 3MN1A 2AZTA 3PQ7A 3EZLA 1MQ9A 3NV7A 4MOWA 3AONB 2IZ7A 5FORA 1SHTX 1PG0A 1RWXA 4EYOA 2DUNA 2FVYA 2XA9A 3T9DA 4K86A 2PH1A 1CR6A 4U6NA 1ZNZA 1K06A 3PZRA 3RK0A 1J20A 2X9GA 3NPMA 1PNOA 4G84A 5HUQA 1HYQA 4FYPA 3QPVA 1GQYA 4CMIA 2H5JA 1XL1A 3MMSA 3AHDA 2FX5A 3KTDA 1Q44A 4RSMA 3EUFA 2ODAA 2WDZA 5DX8A 1I3OA 3IPAA 3GI1A 1NDHA 2V7QA 4C3ZA 1ANKA 2EFCB 4DA0A 5CM8B 1W0KD 3N7TA 4P4TA 2C2MA 3MJDA 4OI0A 1CUHA 1TM2A 5C51B 4AKEA 3PTZA 1ECBA 4MS4B 5EJ5A 5JI2E 1JAHA 2LDXA 1WZUA 1EQAA 3SMVA 2GCNA 3RT9A 5JUWA 4RTNA 4G4SP 4A23A 2C88A 1QTNA 2PKQO 3G0OA 3KQQA 5FRDA 1K7YA 2CXNA 1A9PA 1HA3A 1A76A 2I99A 2YZ7A 5I3ZA 5FLXA 4ANFA 3BQMB 4ZANA 5F9MA 2IYPA 1EP3B 4V3BA 4Z9AA 1R8YA 1WNFA 3VSEA 3ACCA 3I0MA 5AM5A 4X66B 1ZD8A 2IODA 3VAZA 3WL5A 4CL8A 2YW2A 1IDN1 4WCDA 4AJHA 3KEQA 4BNVA 3F8SA 5HKKD 3K3PA 1XTJA 5I7FA 4JZYA 3EBOA 1ES9A 2GPBA 5EZ5A 4Q1CA 4HN2A 1J8VA 1V45E 2J59A 1GO2A 4ESHA 2E9SA 1T6YA 3OZRA 4LMAA 2Q7DA 3EIQA 1IN7A 1G6HA 2GZHA