4HLDA

Sulfonylpiperidines as novel, antibacterial inhibitors of gram-positive thymidylate kinase (tmk): compound 11
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
203
structure length
196
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfonylpiperidines as novel, antibacterial inhibitors of Gram-positive thymidylate kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 83
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hldA00
2H17A 1UF9A 2OT3B 4TMXA 4BZPA 2H16A 2HJVA 5IK2A 2WSSA 3CPHA 4NTZA 4EFMA 3KQUA 4O25A 2XX3A 3B60A 1IXRC 5DN6D 3GD7A 4LJ9A 5AJXA 4DCTA 3NHBA 2D2EA 1T91A 3AH8A 4MGKR 4XVRA 4KVGA 5H70A 1VCNA 5KUTA 2GAOA 3C8UA 4Z8YA 2VLIA 1Z6XA 3GJ6A 1XEXB 2EWWA 3KKNA 1T0JB 2GTPA 2C9CA 3D7MA 4DT1B 3QG5A 2WTUA 4HLUA 2EFGA 1EXMA 3B6EA 2GF9A 3ND9A 1ZNWA 1N6HA 1GNRA 2ZS8A 4ZI2A 4LGMA 1T3LA 5KOYA 2G1JA 4MKFA 2BDTA 5F2EA 3Q72A 3ICQB 4F93B 3SJCA 1KK3A 4A8JC 3CZPA 3SHFA 4HUTA 4NYMQ 2C99A 4A4DA 3F3YA 1E9RA 2WKPA 3VNUA 3T12A 3FGNA 1Z8FA 3GJ3A 2WOOA 3A4LA 5F3WB 1KI8A 2KBEA 4XVUA 2R8RA 2IT1A 3CB4A 1ZU5A 2AFHE 3EZFA 1P60A 4V0LA 1GG2A 1JQJC 3ZS8A 5AJWA 5SZJA 3B1VA 4CEIB 3X2SA 2XITA 1ODFA 2QUZA 5FUYA 4BFTA 1S2MA 4A82A 2GBLC 3UIEA 3U60B 2F9MA 1UKEA 2O8FA 3L82B 4LC0A 4B6FA 4XSGA 3QVUA 3AF0A 3Q5EA 3AVVA 4NYIR 4TSFA 2PMKA 2QL6A 4HB2A 4TL6A 2ZRIA 4YMVA 2F7SA 2R6GA 5EXPA 1A7JA 3MD0A 3RS7A 3MJRA 5G40A 1NLFA 4C7OA 2YYZA 3H0KA 3EG5A 4BFUA 2BBOA 4Q4HA 4IDOA 1Z0DA 5HZHA 3A4NA 2NO1A 3OIYA 4QXAA 2ZSFA 3RC3A 5JI2E 4FXPA 3L0OA 2BVNA 3K8YA 1OT3A 3FFAA 3SFVA 2KJQA 1XCPA 3SE0A 3TE6A 3TUJC 1Q0UA 2Z5FA 3L8ZA 3I5XA 2GDJA 2J46A 3DM5A 3C7KA 4UNQA 1JR3A 4DLTA 3REGA 3B5JA 4RD2A 3OFNA 1ELOA 4OQNA 1ANKA 1QHIA 1SVOA 4XSHA 2Q9BA 4JYCA 4AURA 3CH4B 4O2RA 4WAUA 4RFSA 3CONA 4DZZA 3TR5A 1GP2A 2ZI5A 3R9IA 1DELA 4HI0E 2ZYTX 2H8KA 4B33A 4YMUA 2P0EA 4HAXA 5GJBA 1U8AA 2XOKD 3QF7A 4OHWA 4OJQA 4PR0A 2P67A 4GNKA 5BN5A 2ECKA 3BERA 1MR3F 2YWHA 1ZCBA 1KMHA 1CJUC 4JLMA 1JECA 4IOJA 2CEAA 4L16A 2R62A 3THOA 2ZITA 1EX6A 1N6KA 3A1UA 2QI9C 4KV9A 2JLQA 4YONB 4R98A 2GRJA 3CUEF 2FPMA 2IS2A 1JALA 5A0FA 3ZZ0A 4DHEA 1T8TA 4BZXA 1JR3E 1NY5A 2DWOA 1XMVA 4L9SA 2AK2A 3CRMA 4PO1A 2OCYC 3VQTA 3ZIAD 3WMGA 3LX5A 821PA 2CL6X 2ZRNA 3CX6A 4M53A 5GJCA 3WYAA 1G8FA 2IS4A 4JIMA 1CRQA 1GNPA 4F91B 1Q3TA 4X8MA 2RAPA 2X2EA 1EFHA 4LJ7A 1GRQA 3QXCA 3I5YA 3EZ9A 3KJHA 1JNYA 3TSOA 1W4AA 2UVQA 2NTYC 4HB0A 3RC8A 3WBJA 2N42A 2ZS9A 4LUCA 1TQ6A 1GM5A 3QI2A 3QSYA 1G6OA 3ADCA 2YHSA 5GADl 3G82C 4Q9JA 4UJ3A 3HU1A 5DLQC 4NU0A 1JXOA 3IKJA 1E2QA 1X86B 2C77A 4RJLA 1MH1A 4LBZA 3T35A 3EPJA 4JLNA 3LD9A 3W6PA 1DBSA 5F9HA 1R0ZA 2IBMA 4JBWA 1P72A 4OQLA 4C0KA 5CJ2A 2OBLA 5M04A 3AKEA 2FSFA 4OQFA 1A82A 1DO0A 4IDHA 2CLSA 1VIAA 2BM1A 2PBRA 1O3YA 4DKXA 2G6BA 3MGCA 2BJWA 3A1WA 2QM7A 2ZEJA 3B9PA 2HLDA 3MG9A 1Q3HA 2O0HA 4Q9LA 3SNHA 1ZNXA 4A0FA 1P75A 3TQCA 4D0LB 2W2XA 2BMJA 4Q1EA 3C5HA 1QDEA 1DAHA 1XBTA 2ORIA 4OHXA 3BD9A 3UKDA 2XEXA 1IJFA 4TMWA 2JGNA 4BFYA 2C9YA 3LXRA 1S0UA 4AY2A 4DXAA 3A37A 1UBGA 2C9OA 4US2R 4KSBA 1WP9A 3NKVA 1X8LA 3DKVA 3SQXA 3K70D 5J4KA 5JRZA 1F2TB 2FFAA 3EWSA 1ZIPA 4FINA 1KSJA 4EPVA 1OSNA 2XNSA 2IYZA 2GXAA 1U9IC 1W0JA 1YR9A 2XZOA 2W83A 1SQ5A 3EPKA 3ZLJA 3OEED 2O8BB 1U98A 4KSCA 1XPUA 4QRHA 3RABA 3AVYA 2IHYA 2QN6A 4WIAA 3KQNA 1NMZA 2BOVA 3KXKA 4C9BA 2ONKA 1PJRA 2O52A 4KYIB 1M6NA 1DAIA 4NZYA 1Q1BA 3IO5A 4LYFA 1J8YF 2WM9B 4PQYA 3ZD6A 4WA7A 3U7GA 1D8TA 1DOAA 1C9KA 2A2ZA 3ZVMA 1OPXA 3SU8A 2MSEB 4PC2A 5JJLA 4DLVA 1VDZA 2VSOA 1RRCA 3EA0A 3EIQA 1OLOA 1XTKA 1Z29A 2QP3A 5KSYA 4S2EA 3RANA 4MH0R 1Z0AA 3O8BA 3RRNA 4ERNA 1G7SA 1D9ZA 2PEYA 4Q1BA 1NMXA 4Q5IA 1E9SA 5FL7D 3THXB 4HLQB 3KUDA 1DPFA 2TMKA 2OAQ1 5ELXA 1YZKA 4FMCB 4D0NA 1F60A 3CWZA 3IGFA 3VMFA 3LW8A 3JVUA 3SR0A 4MITA 4ZIRB 3TW4A 1ZMXA 2ZTSA 5TV2A 2PH1A 2R6FA 5JCPA 2PX3A 1II8A 5TY0A 2X1VA 3R7WA 4A1FA 1XMJA 2VF7A 3RWMB 2EQBA 2ANCA 4XD7A 1P7CA 4JVNA 1GVNB 1RJ9A 4C2TA 3EPHA 1HTWA 4C0AC 4M0LA 4W5JA 5KHOC 4GI7A 4EQ6A 3CZQA 4LI0A 1BYIA 3RRMA 2WWYA 2PJZA 3F0TA 1E0AA 1W0KD 4PPGA 4RY2A 3TVDA 2CDNA 2FEOA 2ZROA 3WBKA 3AF2A 5EP2A 2FFQA 2O0KA 1BS1A 2IWHA 4EPXA 5KU1A 3CM0A 3BFKA 1AA9A 4DB4A 1LVGA 2E9SA 2XB2A 1CKEA 1FPMA 1Q22A 4KU4A 2D4HA 2Q9CA 4DLRA 2Q3MA 1ZC3A 2B92A 4PPNA 1US8A 3CRVA 3Q7PA 2IYYA 3QIAA 4F7WA 2B7BA 4KXFB 4QGGA 3GLGA 4A9AA 4ARZA 1TMKA 2B21A 3IPXA 3WRYC 4YQFA 4O0MA 1T9HA 2BMDA 2Z43A 4IOKA 5AJZA 2WIAA 3LH5A 4P3YA 2C5LA 2ONJA 1TL7C 3GJ0A 2G83A 1XTQA 5DYIA 4CYMA 3BORA 4MRRA 4NONA 1E4VA 2DY1A 3B82A 5DYGA 3GLFB 3THYA 1G9XA 1NF3A 2QP9X 3V4FA 1OH7A 3BFXA 2WWHA 2GK6A 2ZJYA 4LHWA 4CIDA 2J0UA 1RFLA 6Q21A 5JHGB 2ZRCA 3AUXA 1KK2A 4M1WA 4XWKA 5DH9A 5SZKB 4IHQA 3MRSA 1PUIA 1SKYE 4LV8B 1GOTA 2RGNA 3CO5A 4P32A 3W8NA 3KKPA 1F2UA 1KZ7B 1E9BA 1VECA 1OF1A 3NBFA 3KQHA 3GLIA 2CJWA 3HPQA 1AQYA 3L43A 1QG2A 2I1VB 3EAQA 4OK6A 2XXAB 5BYKA 1H8HA 1LS6A 1YRAA 2NGRA 1TUIA 3WNBA 4PANA 2H18A 1Z0KA 4IFBA 2QAJA 3E2IA 1R5BA 3GJXC 1E1RA 4TYPA 2H57A 1IM2A 3T1OA 4C4PA 3AUYA 1CULC 1GFIA 1N3BA 3LY5A 1B0UA 1XU4A 5JWOA 1L4UA 4TMVA 2QAGB 3LFUA 3GMTA 1IY1A 1U81A 2HEIA 4C0BA 1PLKA 2CCKA 2P6NA 3QKUA 5AUOB 2O8DA 1YZUA 3IIMA 3P32A 1GZSA 2YC4C 3GFOA 1X8JA 1PUJA 4EFNA 2ZPTX 2MMGA 4C0QC 1IN7A 2ZRFA 4F4CA 1N0VC 4N1AA 5FBRB 2NO7A 1NNEA 1MOZA 1W36D 4DLWA 1KI3A 4OJKA 3QUSA 4HUQA 3EZ6A 1W5TA 2G0NA 4PQRA 3BFVA 3LW7A 2QU8A 3KKOA 3PXGA 1GUAA 1Q1EA 1SVKA 1NKTA 2VPPA 3ZQJA 2P6RA 4GZMA 4HDOB 4ZDWA 5L3RA 1KI1A 1WF3A 1YRBA 1Z0FA 1HEIA 3X1ZA 2YWGA 3BRWD 3I92A 2HCJB 3CWQA 1JB1A 1RPZA 1L7VC 2ATXA 1OXXK 5A4JA 5TARA 4BE7B 3RHFA 4YLGA 1MABA 3NC1C 1M7BA 1U2RA 1ZNYA 3NEJA 1VCIA 2ZUCA 3GLHB 3W5JA 3VR4A 2V55B 3X1WA 5EZ5A 1NN1A 5EP4A 4MUAA 1DAFA 2IYLD 4PO8A 3SDZA 1AGPA 3THYB 2FJUA 2NG1A 2YZ2A 5JECA 4JJZA 1UDWA 3LV8A 3RS3A 3B1XA 1FX0A 2DPXA 4TYNA 2HJGA 2GJ8A 2ZJBA 3FMIA 4RD4A 3RRZA 2YOHA 1UKVY 3W8RA 1P2UA 3TNFA 1T5LA 4QL3A 1DTSA 2P6UA 2GCOA 721PA 3EPLA 1XCMA 2W00A 3GLGB 3LX8A 4AKGA 2BHRA 3AB3A 1G5RA 2ZU6A 2J0VA 1P2VA 3LAWA 4ZKDA 4B3CA 3THWB 1RRGA 2R2AA 4PZYA 1XWIA 2VP2A 1CS4C 1CU1A 1E2MA 3SBDA 3ASZA 3QXSA 4MGYR 4L15A 3I1FA 3PJRA 1U90A 4DJTA 3Q8XB 4OQMA 1UKZA 1E98A 5CYOA 3RS4A 3TK1A 5JSZA 3ZVRA 2HYIC 4C30A 1KO4A 1I2MA 1EX7A 4YXWD 2B8WA 2XNDA 1YJ5A 2PMDA 2GEUA 1JEDA 3A36A 4ACAA 2AL7A 4RVCA 1TEVA 1PLLA 1BIFA 4C3ZA 4X8HA 1YKSA 1P3JA 5DHFA 1QF9A 3VR3A 5HTKA 1QHNA 4KLNA 4B74A 2NO0A 2JLVA 1KNQA 2VP6A 3EARA 3QKSB 1GRRA 1NVXQ 1YZNA 1X1SA 4GOKA 4ZIRA 3SHWA 2D7DA 2ANBA 5FBQB 5BN4A 4NL4H 5J4VA 4KFUA 3AP3A 3RNLA 2C04A 2PCJA 1FW6A 4I81A 3GLHE 3FFBA 4DC9A 3I62A 1E2IA 1KGDA 2FGJA 2OBNA 2GF0A 2W6JD 3KB2A 2A3RA 3Q7QA 4EJSB 1BOFA 2W0MA 4OI4A 4JBYA 4PAMA 3ADDA 2V7QA 4OHVA 1ZD9A 4URYR 4TTPA 3TIFA 3PEWA 4PC1A 1TQ2A 2FG5A 2RGBA 4AG6A 5HE9A 2OAP1 4A8JA 2R9VA 4H1VA 3NBYC 1VG0B 1LNZA 4GPTA 3C16C 1OFTA 1HT2E 2JA1A 1E96A 2JLUA 1DARA 2IS1A 2ZREA 1E2LA 1K6MA 1A2KC 4FCVA 1XPRA 1DS6A 5P21A 3NIBA 3WRXC 1N2CE 4KFRA 4TYQA 3HR8A 1HY3A 4EUNA 4OKSA 2CLDX 1GL9B 4TLBA 5DSZA 2RGDA 3L2OB 5A5GA 1I4TD 1W36C 1OFUX 4MYHA 5L3SA 1WBDA 5CK5A 2AR7A 2WKRA 1D6JA 4HZIA 2OO7A 1S8FA 2FNAA 4I4LA 2IC5A 4CW7A 2FPLA 2V8OA 2BIFA 2GVDC 2WHXA 3BS4A 5L3QB 2ZSDA 1HQYE 3QOFA 2B7CA 1XJ0A 2VRWA 2PT7A 5FPTA 3WHKA 4NCJA 2F43A 5AUNB 1N6PA 1ETUA 3KB1A 3VKGA 3I4LA 3OEHA 1OIVA 3OHMA 3CBQA 1KNXA 4I1SA 4TQ9A 2RGEA 2Q0HA 4P0TA 2QMUA 4PHHA 3H2YA 3QPUA 1D5CA 2C95A 4AYWA 3MWJA 4IEEA 3IDQA 3PENA 2V9PA 4MA4A 1M8PA 2WWIA 5UKDA 3TVTA 1G17A 3PIRA 4NHOA 2VHQA 3SYKA 4JLVA 5JWRA 4QBGB 2QT0A 3BB3A 4IFEA 2OXCA 4HLCA 4DB2A 2AD1A 4LPSA 4QNRA 5DGXA 1II0A 3T15A 4D0GA 4JS0A 2W2TA 4ZCMA 3CRW1 1KK1A 4HB4A 1OB5A 4Z51A 3NBXX 1SVSA 1N5JA 1V5WA 4LWZA 4RD0A 3QXXA 4TLAA 1HQCA 5EJEA 2ZI4A 3PEVA 4H1UA 2CCGA 3GEIA 3SZRA 1KO7A 1AZTA 1F3OA 1XXHE 4NMMA 3KQKA 1E79A 4KBFA 2IWRA 4BRWA 2OILA 2BM0A 3BH6A 4TZ6A 4JVSB 1QZXA 2CHGA 1N0UA 1FMLA 4Q9IA 2ZSAA 5JS7A 2G0TA 5J40A 1WA5A 2R6DA 2FH5B 4TL9A 3P4XA 3VR5A 3AEZA 1NBMD 1JJVA 2F43B 1S3SA 1YZTA 1DO2A 3KJIA 4JKIA 5FBVB 1L8QA 1RKBA 4QM7A 3GP8A 2VIIA 5L3QA 2HCBA 2V6JA 3IIJA 1N25A 1XD2B 2O8EB 2RHDA 2VP0A 3ZD7A 4EAQA 2AXNA 4JMPA 4JVMA 1SKYB 4Z8XA 5C1BA 4WBSA 1YR6A 4H9GA 3VFDA 2JDID 3I8XA 2QRZA 3ZH9B 1FTNA 1N6LA 1VMAA 4PHTA 4V0KA 1SXJE 1SZPA 4G5QA 1N6NA 2J59A 2QTHA 4BFZA 2CBZA 1PV4A 1J99A 2ZI3A 1IN8A 2GHIA 4Q19A 4LV6A 4UXHA 1E2EA 2EFEB 4QC2A 1TQDA 2X2FA 1XTSA 2ZRKA 2VYFA 3VAAA 4NYJR 2PLFA 3VX3A 4D4KA 3K0FB 4HLDA 1J90A 2REBA 3REFA 4AC9A 2KSQA 3MMPA 4A8JB 3VTKA 1KJZA 4US0R 4MRSA 2AKYA 5FOVA 4BEBA 2IA5A 1N5KA 1KI7A 2JJ2A 4QHYA 3ZQ6A 1B23P 1CR4A 4M1YA 5FTJA 3KXIA 3SEAA 2YWEA 5EE1A 3T5GA 3TJZA 2VTKA 5KDOA 2Q6TA 2WVJA 2ZSBA 4C0SA 1Q1QA 4EPWA 4XWAA 2FV8A 4BLPA 1LF5A 2YWFA 1KIMA 1HA3A 2ERXA 3GJ5A 4E22A 4C7OB 2IYQA 5FPHA 5KDDA 3CPJB 4Q1AA 2GEVA 3O8CA 2NZJA 3PEUA 3F5FA 1G5PA 5FPYA 2IF0A 1G8HA 1CTQA 1LS1A 3OESA 4Q1DA 2QQEA 1IY2A 1J2JA 3AF1A 4TMTA 1RYHA 2ZI6A 3UPUA 2ZRAA 1VYVA 3IHLA 3C5CA 2B8TA 3IQXA 5FTLA 1RYFA 1JXMA 1LY1A 1VTKA 3CPEA 4I1VA 2O8CA 1JR6A 4CF7A 1FOEB 4TLDA 1K5DA 1XJCA 2CNWA 4RZUA 5FUXA 4D4MA 4A2QA 4F92B 1IONA 2ZRHA 1ESMA 4IEIA 3T5DA 2DB3A 2F1JA 1Z83A 1W0KA 3CF6R 1YQTA 4LPKA 4CT5A 4HEJA 3IIKA 5FOSA 4M9SA 1S9HA 3RVBA 2CLCX 3WHLA 1KKMA 2GWHA 4URUR 3PITA 2UZIR 4R9UC 4BZQA 4DVGA 5B30A 1NIJA 2RGNC 2IYUA 1S9DA 1SVLA 3OZXA 4IDPA 4QGFA 3VX4A 1OXVA 1UBFA 3CR8A 4AD8A 1W36B 3CNOA 4DT1A 1G5TA 2VHCA 3AKYA 2V4ZA 4URXR 3MUFA 2GCOB 4JLJA 5BYJA 2J45A 2R6CA 2DYKA 3W3AA 1RRPA 1H8EA 3TAUA 1SKQA 3DHWC 1CBUA 1KZGB 5E4FA 4QBIA 5AWFC 3MFYA 3TMKA 1Q44A 4L9WA 2J9RA 3SYLA 5CLQA 3TRFA 1U94A 4KO8A 4EPYA 1G8PA 1AK2A 4II7A 1AN0A 5FL7A 5HZKA 4QJ4A 3VKHA 3PV0A 2YNMA 2W6IA 2QSZA 1D2MA 2JJ8A 2QPAA 5G3ZA 1Z5ZA 3UMFA 3Q5DA 2PCLA 2Z6VA 2QMHA 4FMDF 4PHGA 5JS8A 4CEHB 4DIDA 1DAGA 4GMXA 3I3SR 1IXSB 1Z2AA 1CR1A 1NRJB 2V6IA 1N6IA 5CK4A 1GKUB 2GKSA 2QP4A 1ZM9A 1ZUHA 1RIFA 1E2HA 5EP1A 2BEKA 3P1JA 5BW8A 5FOWA 1SXJA 3FTQA 3K09C 3ZIAA 2OLJA 2WJGA 4PZLA 3RSLA 3U2QA 1KI9A 3B1ZA 3ZVNA 2A5FA 1PVOA 3NH6A 5FOTA 5CIWA 4E07A 1WCV1 1NIPA 2BMEA 4NPHA 4L4UA 5BQ5A 2SHKA 2JLSA 5FFMA 3GEEA 4I1OA 3I73A 3ZYCA 3UATA 4BECA 1T6NA 4DLZA 5J4HA 4D80A 3CKLA 2O8DB 5EE0A 2WWXA 4TMKA 2HV8A 2DWQA 2QBYB 1KDRA 3N2IA 2GETA 4JT2A 3PG5A 1WE2A 1T0HB 1BKDR 3QKSA 4C0JA 4WZBE 4ZV4A 1EFRA 4POAA 1JBKA 1EFTA 1VG1A 2F1HA 4WXPA 1JI0A 1YE8A 1ZW6A 4QHTA 3RAPR 1Z63A 5HE8A 2O0JA 4YMWA 4QHSA 4MDFA 3VHXA 3H4MA 2ASEA 2WPDD 5TB5A 3KFXA 2AXPA 2VF8A 4BFVA 2OBMA 2VQSA 4Q21A 4LCBA 3DDCA 4PSAA 5FH9A 5KNBA 1XXHA 1OKKD 2D2FA 1NG1A 3SJBA 2XXAA 1GRNA 2BEJA 3R20A 4IW3B 4HZUB 1NG9A 2WOJA 4LJ5A 8OHMA 2CJWB 2GEDA 3AVUA 1U0JA 2GNOA 1WRBA 2GCNA 4GP7A 1E4YA 4MUBA 4ASUD 2VO1A 1ZINA 1R0YA 3C14C 2IW3A 1XZPA 3MCAA 2JLZA 4TQAA 5G53C 2P5TB 2FOLA 3EC2A 3T06B 4BASA 2IUTA 5KSOA 4CEJA 3B7GA 2ZUDA 1DAKA 1KJYA 4RKEA 5LB2A 1DAMA 4HAWA 3W34A 2QEQA 4B32A 5EXTA 4QJ3A 3DEFA 1NN0A 3QY0A 4LJ6A 1ZUNB 4V0MA 4EPRA 1OXTA 3QPWA 1UM8A 1KK0A 4G5GA 4PC6A 3KQLA 2EVWX 1ZU4A 4N3NA 3NH9A 3VR2A 3AGPA 3NWJA 5IDVA 1KSGA 1NSTA 3PVSA 1FX0B 1IOZA 3TLXA 2FE4A 1X3SA 2WJIA 3SS8A 3GJ8A 3LVQE 4V02A 5K8TA 3FHOA 5C2JB 1JPNA 1XF9A 3LBHA 4GT1A 4PAQA 1M2OB 2W6JA 4XTRA 5HPYB 4DDVA 1US8B 3GLHA 5IRCD 2B6HA 2KBFA 2JLYA 4CEJB 1UADA 3FHCB 2C03A 1T3SA 3OAAA 5JZVA 3K0EA 3OIVA 1E32A 3BOSA 4PSVA 3HJNA 4IOMA 4JLKA 3TSZA 2A5GA 5IF9A 5AUPB 1UDXA 2HF8A 1FP6A 1EFUA 2Z4RA 3SC3A 1X6VA 3R9WA 1XXHB 2ZJOA 5EE5B 1OIXA 1T3HA 4TL8A 5FPKA 3IPYA 4BFSA 4MQBA 1Z06A 2OLKA 1FNMA 1VCMA 4CT4B 2CVHA 2IHBA 4BFXA 3NC0C 2WJVA 3NVAA 4Q01A 2KE5A 4HUQB 5AUQA 3FMFA 3AGQA 4ESVA 4LV5B 1E2KA 3GJ7A 3VU9A 1Z6AA 1VKJA 1II8B 3D8BA 1E69A 2Q3FA 4M1SA 3UWKA 1AIPA 5IT5A 3AVPA 2CK3A 1EWRA 2ZAMA 4QFMA 4BPBA 3B13B 4P4SA 3SQWA 1J7KA 1KDTA 2ZRLA 5KSPA 1CRPA 4Z1MD 1W5SA 4TT3D 4YXWA 3X1DA 3HU2A 2GXSA 3U3MA 1P4SA 2GA8A 2YV5A 2Z0MA 2CMKA 3WXMA 621PA 1KI6A 4UXJA 3S1AA 3LLUA 3CX8A 3M4YA 3ZVLA 5CJPA 3NTUA 4RD3A 2KI5A 1ZNZA 3QEJA 4BUJA 2YKGA 1NY6A 5KSZA 3AV0B 4QGHA 3FB4A 5JCZA 1R10A 2IYRA 2ZANA 5H1YA 3LQQA 4TN1A 2CCJA 4B44A 1E2DA 2A7QA 4GDFA 1F2UB 3LVRE 2HF9A 5B64A 1P9WA 1A2BA 1WMSA 2ZR9A 4IRUB 4D2IA 1OE0A 1W1WA 1ZD1A 4EJSC 3EC1A 3G0HA 1HURA 2IYTA 1HT1E 1FMJA 3DMDA 2O8BA 3BXZA 4J0QA 4OI1A 4TYYA 1EWQA 3AQ4A 1XTJA 2WMOB 5TXGA 3I8SA 5BWMA 2ORVA 1DE0A 2WJYA 4O2LA 4RZ2A 4S35A 5DNYB 1G3UA 2GBLA 3KKMA 2GZHA 3KTAB 3TUZC 3EIHA 2C96A 3LLMA 1OJLA 1Z0IA 4DWJA 1KI2A 1QHHA 2ZJ5A 3QXHA 4WVFA 2PZGA 2NO6A 4HYYA 4ARZB 4IXMA 4N0DA 1ESNA 4QG7A 3RYTC 4HATA 2W0SA 3FE2A 4M8NE 4I99A 4URWR 1I4LD 4Z54A 4DCVA 4M1KA 2GZDA 4DBLC 3NEYA 3AVQA 4U5XA 4V0ME 1A4RA 3HP1A 2FSHA 4NKRA 2DFKB 5JJKA 1S1MA 3FVQA 1KAOA 2WSSD 3ZGXA 3AKCA 1EG7A 2QROA 4LY6A 4Q7KA 1SULA 5KNDA 2RKOA 3ETLA 3UMRA 2FF7A 1UFQA 2Q9AA 5DN6A 2FSGA 2YOFA 1EK0A 5HCNA 1XDBA 4MYUA 2RH5A 3T34A 3WNCA 1TTTA 2REXB 2O8CB 3BBPA 4KVAA 3CRQA 2PJRA 5LB4A 4RKFA 2EW1A 3QG1A 3TQFA 1H8ED 2D3WA 2Z4SA 2RB4A 1YU9A 1MO4A 1W4BA 1TU3A 4C2UA 3QQ5A 2QE7A 2YINC 4DUGD 3BK7A 2HXSA 3IBYA 1AJEA 4HDCA 1E0KA 4JL6A 4PFSA 5F98A 4X8OA 4BLOA 5LDDC 1MO6A 2JJ1A 2XJ9A 1RVDA 4QBFA 5HCIA 3TUIC 5C46F 2J0QA 2F6RA 1G7CA 2QENA 1AM4D 2CK3D 3LA6A 2ERYA 4B75A 3THXA 2EYUA 1R8QA 2DFNA 5IHPA 2QRNA 2Q3HA 5F9FA 1UBEA 4LDJA 3HYTA 3PEYA 2IXEA 2BBWA 3RDPA 1QHGA 2BMFA 1FQJA 1G1MA 4YDSA 2NZ8A 4ABYA 2ZIAA 2ZI9A 2OESA 2DWPA 1Q57A 1U9IA 1G18A 1HH4A 4PO9A 2RMKA 3K0FA 4P4UA 1GWNA 3ASYA 3E70C 5EZ6B 5EE9A 121PA 3C41J 2JIZD 4AWXA 2FPKA 1IQPA 3QBVA 2ZSEA 2DFLA 4FWTA 2N1BA 4NYMR 3K9NA 2E1RA 1XTRA 3HR7A 4IJMA 3QF4A 4DLSA 4F4IA 2MSDB 1Z6GA 1IN6A 4GSYA 3SOPA 1RC8A 2ZE5A 2P65A 1KDOA 2F3RA 1UPTA 1NBME 3IEUA 4P31A 3RS2A 1W0JD 4AI6A 4DDTA 1AGRA 2I3BA 4KYUA 3JZAA 2JLWA 1XD2A 2O8EA 2ZRJA 1SVWA 2VHUA 4Q4LA 4JLAA 4PPFA 1CEEA 5KYKA 1KY2A 4BLQA 4LC1A 1OXUA 3U6BA 1AS3A 3K9HA 1Z07A 3KJGA 2QE7D 4DCUA 4JLBA 3CX7A 1YZQA 2ODWA 5JLJA 3L8YA 4B3GA 3HU3A 1D2NA 4TTQA 3O47A 2P5SA 2QSYA 3AVTA 3B8HA 4CZ2A 4QGAA 4KHZA 5DO9A 3GPLA 3N2EA 1E6CA 1NJGA 1OFHA 2NO9A 4NCIA 3K0SA 1Q21A 2BJVA 3A1VA 1NVVR 4ASUA 1ZP6A 1OH5A 1DG3A 1IAQA 4LHVA 3BAFA 2JASA 1CF4A 3U7HB 3FYHA 2VP5A 2AN9A 1WDTA 3BH7A 4LHZA 3TSWA 1SVIA 2W58A 4B76A 5BN3A 4LBWA 5FI1B 2GJAA 4CVNA 5KNCA 4WXRA 1OKKA 2ZYVX 5LBIA 4Q00A 3SJAA 3K9LA 1L2TA 4NH0A 4DSOA 4EKDA 1N5LA 3AP1A 2LCFA 3DO6A 1KSHA 1C1YA 1N6OA 2D7CA 2EFCB 2ZJZA 1GIAA 4OBEA 4C0HA 3CW2A 4ZI3A 2LKDA 4DLXA 4Q66C 1XD9A 1TX4B 1CJKC 3DM9B 5FI0B 3GQBA 3ZS9A 1OHHA 1QVAA 4UNNA 4GL2A 4JLDA 2FZLA 4W5WA 2JAQA 3RRYA 4HLUC 4TL7A 1G8YA 2ZVPX 2Q21A 3BE4A 2YJTD 1ZCAA 4JT4A 1G6HA 2ZR0A 1IY0A 4CDGA 1YZGA 2NPIA 4IKEA 1HUQA 2OUKA 1JJ7A 5B58C 2PL3A 5AK0A 5CITA 4E03A 2C78A 5KPDA 3N5CA 2IYWA 4GRAA 3KX2A 3BC1A 4R7ZA 2J41A 4PSKA 4W9MC 2HT6A 5J47A 1XEXA 1FUKA 4TQUS 1YR8A 3GCGA 4DRZA 1PZNA 4DDWA 1NSFA 4R71A 1Z3IX 4IDNA 1BO6A 1JAHA 4PX9A 4DLYA 4GOJA 3B85A 2XZPA 3LDAA 3FKQA 4L5BA 4A0HA 1HE1C 5L3SB 4QM6A 4IVPA 3MLEA 1P2SA 2WSMA 1J8MF 3CRRA 4NYJQ 2IS6A 1G291 1KMHB 1FP7A 1TF5A 3Q3JB 4LJ8A 4TWZA 1E94E 3LNCA 1NVVQ 1U8YA 2FMXA 1YR7A 3DOEA 2OM2A 5FR1A 1MRNA 1ZAKA 1G20E 3CF0A 2ZS7A 2V1XA 3BB4A 5FTNA 1R8SA 5GVSA 2OV2A 2XJ4A 2H92A 4KFSA 4LJAA 5K8UA 1G8GA 1E9FA 1GDDA 1VG8A 1R5NA 3RLFA 5JMTA 3B78A 3GJ4A 3F8TA 1Z08A 1T5IA 1LV7A 3CF2A 4WW0A 1CP2A 2J3EA 4XD7D 2IYVA 3SYNA 1G3MA 5K8LA 2MMCA 1VCOA 3SJZA 2OZEA 1FZQA 4RCYA 3NBZC 4KLZA 5ANRB 4B3FX 4Q4AB 3WMFA 3TW8B 5C18A 1COWD 1W48A 2XSZD 5AR1A 4EJSA 2PX0A 1L4YA 2ZE6A 4YMSA 2VHJA 4GP6A 3FKSA 3LBIA 1M1YE 4LYAA 1E2FA 5L3VA 4MDEA 1DVRA 4MGIR 1QHSA 2A30A 2EU8A 3L0IB 2GJKA 2ZXUA 4A92A 4HAYA 2O8FB 5TVKA 2F3TA 1RZ3A 1CR2A 4LYJA 1U0HC 1VG9B 1UEJA 5J4LA 4ZCIA 2C2HA 5FTKA 4D25A 1R4AA 2BKEA 1LFDB 4CEIA 4PQFA 3V00A 1FFHA 2WAYA 3U7FB 3U3JA 1TADA 4P4TA 1G64A 4FCWA 5DI3B 2BC9A 2RGGA 2WWFA 2VSFA 4BLTA 4URVR 2GCPA 3H84A 3MAAC 3VKWA 5LD2C 3DZ8A 1E79D 2Z83A 2REOA 5JSZB 1W7AA 1NP6A 2DR3A 3ND8A 1ZVQA 2W6ID 4D4JA 4HAZA 4ITRC 1TEXA 3UG6A 5CYPA 2WJHA 2JLXA 4B3BA 3M0EA 1GITA 4WZ6A 3EZ2A 2A5JA 3KUCA 4A6PA 3THWA 5E7JA 5JEDA 1KO1A 2IXGA 1XZQA 1Z2CA 1CJVC 2D62A 1XMSA 2HLDD 3VNVA 3FOZA 2C8VA 2AX4A 2J0SA 2R6AA 2WBLC 2G1KA 1NKSA 2GVZC 4Y0AA 4RZ3A 1P9RA 2VHTA 3KZ1E 1D9XA 1XJQA 1SHKA 1OYYA 2XAUA 3JVVA 2XSZA 1A1VA 1P9NA 2FN4A 5CIQA 3E1SA 1GILA 2ZYUX 3DL0A 1N0WA 4BQSA 1E1QD 3RS5A 1FTSA 1GSIA 1LW7A 4IDQA 1CLUA 4G0NA 2ZE8A 3NXSA 1R0XA 4EPTA 3R8FA 1DAEA 2VSXA 1MABB 3QXJA 5B2ZA 4LJ4A 1G7TA 3LXXA 4B3XA 4D26A 4WZAE 4DCNA 3ZZUA 1TPZA 5KO2A 3WYFA 4XVQA 4JL8A 1AS2A 3ZZTA 4IVRA 1K5GA 4PZZA 4Y0VA 1H65A 3ZDQA 1TQ4A 3TAHA 1Z0JA 1MRSA 5AJYA 1IBRA 3WP0A 1P73A 2OFOA 1Q20A 3EW9A 1QHXA 2VP4A 5FUVA 1TUEA 4PC3A 5C4GB 5LD2B 2X19A 2FX3A 5D3MB 4R2HA 1U99A 4LBYA 3PUVA 2CE2X 5CDFE 4DLUA 4AIIA 5FOXA 1ZBDA 4KFTA 2JIZA 1CJMA 2WZQA 4V0NA 3U4QB 3U3RA 2OSBA 1ONBA 3K0AB 4G01B 1E2GA 5E7IA 5FR2A 1CJTC 4Q1CA 2G9NA 4MRNA 4AG5A 4FD2A 3X1YA 3EXAA 4IXNA 1G16A 1SVMA 2IXFA 3J81k 2QAGA 1XCGB 4FWIB 1G19A 3AF4A 1Q1ZA 4M9QA 4JBXA 4QJ5A 2JLRA 2WKQA 3HWSA 1TU4A 4M2LA 2XOKA 4DDUA 3PUZA 2Y8EA 2CE7A 5FBWB 4MGZR 3OE7D 3MWLA 1QBKC 2DBYA 4Q18A 1KO8A 5JRJA 4D81A 2GK7A 1GKIA 4M1MA 2ZRGA 1F6BA 1M34E 1O87A 1HE8B 2IYXA 2WWGA 2WMNB 4JSYA 3GLIB 4YDHB 4DCSA 1NMYA 1JEEA 1SGWA 5IK2D 4AK9A 4MYTA 4ZKEA 5EE3A 2G3YA 5DI3A 3NHAA 2F55A 2LWIA 2ZR7A 3KKQA 4Q7MB 3M1IA 4UNSA 5DHAA 2J0UB 4PPQA 3AM1A 2QT1A 3R8CA 1JR3D 2AHOA 2AD5A 3V9PA 3UANA 1KDPA 4B43A 4LOAA 2FEMA 4V03A 3GLFA 4URZR 1U0LA 4GFDA 1G7RA 2ODEA 2CVFA 3BH0A 1Y3AA 4ILEA 1NBMA 3K70B 2FFHA 1KO5A 1XTIA 2L0XA 1VYTA 4OQXA 5CB6A 1BYUA 2F9LA 5LPNA 4D6PA 2WAXA 2ZYWX 2BV3A 1ZM3A 4YC7A 4FMDB 4A0GA 3W3ZB 1DEKA 1KY3A 4JL5A 1XEWX 4NBSA 2GJ9A 1NI3A 2VEDA 2YC2C 3CLVA 3TKLA 1BMFD 1W2HA 5DI9A 2ZE7A 1II9A 3MJHA 4WOPA 3LRPA 4JZKA 3VR6A 2GAAA 3HDTA 3GFPA 5H8WA 1OIWA 1G3QA 1ZYUA 2LKCA 3PFIA 5G41A 3U61B 1XEWY 3X1XA 3ONWA 5JJIA 2QGNA 5TDHA 4G5RA 3PUXA 3GLIE 3P27A 4RZXA 4FI3C 5GJVC 1QRAA 4M22A 5TMPA 4OK3A 1Z6TA 3OE7A 4B2PA 1IN5A 5KTYA 3QKTA 2XZLA 3RSOA 4EQ6B 3I32A 3PUWA 4Q02A 1UBCA 2NPFA 3A6PC 1RJ9B 5E3HA 4PXAA 1T8UA 1IJEA 3D31A 4NCNA 4GOXA 4JJKA 1AZSC 4G3XA 4NYIQ 3D6TB 5E95A 2J1LA 2J87A 5FTMA 4ZDJA 3R7WB 5FOUA 2VH5R 2IX3A 4XJXA 1G4UR 4OL0A 2I4IA 2OCBA 3RWOA 521PA 4TTRA 4A15A 3IILA 3W6NA 1P61B 1W46A 4BFWA 1AQUA 5SZIA 2RCNA 2QY9A 4JKYA 2HYDA 3NDPA 4PTLA 3ZJYA 1XFAA 4FMCF 4AKIA 3NG1A 4LHYA 1DADA 2P2LA 1MKYA 4FCTA 5J4YA 1GAJA 1CIPA 2EFHB 4JSTA 4RD6A 3U5ZB 4XOIA 4NCHA 2XNDD 4M4SA 4CRWB 3P4YA 3QE0A 1G21E 4B73A 2H7VA 3T61A 2PEZA 5E7MA 2RGAA 4RFVA 3I61A 1YZLA 3IEVA 1P5ZB 1OYWA 3M6AA 1GL6A 1CXZA 1IN4A 2QMEA 2GESA 1MO5A 1E2JA 4X8LA 5EQTA 4L8GA 1LTQA 2J7PA 2PZFA 4KI0A 2OG2A 1P2TA 4A6XA 2QORA 2JATA 3TR0A 1V43A 1NVUQ 2A9KA 2VA8A 1TF2A 1E1QA 2FSIA 4GBMA 2V54A 1KI4A 1OV4A 1E9EA 4CGZA 5AJVB 1R0WA 1NL3A 2ZJ8A 3C4JA 3EX7C 2R44A 1F2TA 2JDIA 4MKIA 4UQOA 3SI7A 1JPJA 2HXYA 4QNMA 4IVQA 4ZO4A 4ZCLA 4TLCA 3UG7A 4D4LA 3CR7A 2OCAA 2X77A 4US1R 2OHFA 3PR1A 1GNQA 3ADBA 3B2EA 1XEFA 4LBVA 4XH9B 1OFIA 4B3DA 1LB1B 1MT0A 1ZRHA 421PA 3NDBB 1R5OA 2QPOA 3GLFE 1R7RA 4PC7A 2V7QD 4EIWA 5JWHA 1W4CA 5JHHB 3FWYA 1EESA 2AFIE 1MO3A 4Q47A 1NLYA 3IBGA 3UMSA 1R6BX 2IUSA 3A4MA 2ZJAA 2CHVA 5EUMA 1OXSC 3A58B 3U6KA 3DKPA 3SFZA 3AKDA 4BWYA 3R9XA 2K5UA 1S3GA 4F4JA 2ZM5A 1XPOA 1NN5A 1VYUA 2IYSA 3UK6A 3EASA 2VL7A 1QVRA 3P26A 2ZRBA 4KCGA 3KXLA 4LZZA 3QF4B 2PZEA 1ZD8A 3WP1B 4KITB 2OCPA 5BXQC 2EFDB 1FL9A 1BMFA 4XIGS 4MRPA 1FUUA 4TMZA 4OHYA 3H1TA 2OEPA 3U44A 1GTVA 221PA 1OHHD 4TYWA 4Z1MA 1WQ1R 1KSFX 3U3KA 1ZUIA 4UJ5A 3QEOA 3WMEA 1I2DA 2EYQA 3AVOA 3K0CA 3WY9A 1K8RA 2OXRA 3EA5A 3A1SA 3L0PA 4QKQA 4LJYA 2FA9A 1E2NA 4TLEA 1E3MA 3VR1A 2GZAA 1H8HD 4JYBA 1E9AA 2OFWA 1A5TA 4KBGA 2NIPA 1COWA 5CM8B 2ZU0C 1ZM4A 3OEHD 4DSUA 1KTVA 1XNJA 3BGWA 4R2IA 2ZRPA 1WBBA 2CXXA 3FMPB 1XMIA 1QHYA 5CDFA 4A0RA 4ZDIA 1E9DA 1WB9A 2F1IA 1Y63A 2O5VA 4M9XA 1G4AE 2CL7X 5FPSA 3HYRA 4A2WA 4UNRA 4E5UA 2E87A 1PLJA 3UWOA 2QMOA 3K9GA 2D06A 2V3CC 4G1UC 3U44B 1N6RA 4B47A 3L0SA 3ICEA 3K09A 2ATVA 4ZDKA 3IO3A 3T1QA 4DEXA 4ACBA 4AKHA 5DISB 4LK2A 1JAIA 5B57C 1VHTA 3CIOA 1D2EA 4RFSB 4W5HA 4LYHA 3W9YA 5JEEA 4DEYA 5KDLA 1G3RA 3DZDA 4RD1A 1S4QA 3EWAA 3C15C 2RGCA 3K53A 5GJWC 5GVRA 1N5IA 1ZM7A 1UAAA 4OI0A 2ZETA 3N70A 2J7KA 1UJ2A 4MYCA 5HKKA 1IHUA 1YVDA 4K81B 2XTMA 1X1RA 2QA5A 4FN5A 3O8RA 5KPJA 3DMNA 4PAOA 2WV9A 4GMDA 3GEHA 2FZ4A 4ESHA 2ZUBA 4UXIA 1E0SA 4EDHA 2W2VA 2QNRA 4Q4HB 1RE0A 3QJYA 5EUQB 2NOAA 4B2LA 3FKSD 3K1JA 4KJZA 4D82A 1E9CA 3MWKA 1M74A 3AF3A 3B1WA 3U3OA 2FWRA 1RRFA 1M7GA 5FUWA 1XB2A 1XD8A 1QHHB 2HT1A 4M1OA 5EXXA 4XWOA 2R65A 4NDZA 3H86A 3KTAA 2A5DA 2I1QA 4B48A 1E1RD 2BCGY 3QENA 3FMOB 2CHQA 1KYIA 3BWDD 4M21A 4BRUA 1UKYA 2QTVB 1S1CA 1KMQA 3AVXA 4MRVA 4K8OA 5JI3E 3OFND 4M9ZA 4V0OA 2ODNA 2VBCA 2GILA 3FHTA 2GXUA 2BBSA 3CNLA 3RS0A 3W5IA 4DUGA 4W7SA 2OE2A 1EFRD 1GKYA 3OIUA 1X8KA 4JLPA 4B71A 4UKDA 4UNPA 4DSTA 2WICA 4MKGA 5DIFA 3CNNA 2IL1A 3ECCA 4EFLA 3ADKA 1QG4A 2HUPA 1AKEA 4KODA 2FFBA 5FL3A 2CL0X 5G3YA 1KHTA 2FU5C 3PQCA 2VP9A 4P33A 5SZHB 5JBQA 2BBTA 1Z47A 3E5HA 1E2PA 3S1AB 4G5SA 3W6OA 4TT3A 4BGDA 1KI6B 1F48A 4AYTA 4PHFA 2GJSA 2HDNB 1NN3A 4NCKA 3OIWA 3QPVA 5HKKD 2X8AA 2N46A 1XX6A 2IEZA 4LX0A 2ZI7A 4FIDA 3T1TA 3O8DA 4LRWA 1OW3B 4P4SB 4DIEA 4HB3A 1OB2A 4B2IA 1AKYA 4JLOA 1HV8A 1ZJ6A 2UZ3A 5DE3A 3CH5A 3PCRB 4MKHA 3W90A 3LO5A 3VU9B 1JQLB 1RW4A 2ORWA 2XTNA 3QNUA 2XTZA 4Q48A 3OEEA 3JZMA 1SXJD 5D3MA 2OFXA 1CR0A 4N0EA 5EP3A 5H68A 1E99A 1XRJA 1Z6YA 1YHNA 4A2PA 1ZIOA 2NQ2C 2BKUA 4LSGA 1KJWA 4Q9HA 2ZAOA 1NLZA 4HAUA 4G5OA 3Q85A 1G41A 1S96A 5J5CA 2NMVA 2WIBA 3PUYA 1LF0A 4U00A 3VHLB 3SBEA 1G3IA 3A1TA 4E09A 5HR5A 2QM8A 2FGKA 2PT5A 2JJ2D 3K0CC 4QOSA 1EGAA 4IOLA 1W49A 2F1RA 4NE2A 1KOFA 1I4DD 4K46A 2BWJA 1KKLA 2P3SA 3QVVA 4HAVA 4M1TA 4RSGA 4C0LA 3AVWA 4FW9A 4Q4JA 3BB1A 3P20A 1UEIA 1E0JA 1T4GA 2WPDA 3QKRA 1U8ZA 4LHXA 3SN6A 1TNDA 2PLRA 2FDCA 3BJIC 3B9QA 2KWIA 3K70C 4HDQB 4ON9A 4BLSA 1Z28A 2IF2A 4Q7JB 4ZPXA 4OYHA 4BEJA 3WNDA 3WYGA 4KAXA 2A5YB 2WWWA 3MSXA 2QG6A 2EWVA 4GZLA 3KFVA 1TAGA 4OK5A 4FMBB 2IUUA 3T1VA 5JFGA 3U7EB 4TZ0A 2H1LA 1R2QA 2RGXA 4QBHA 3LWNA 2RHMA 1VHLA 3Q9LA 1XP8A 3IUYA 4Q9KA 5FBLB 3TBKA 3QBTA 3EZ7A 5L8VA 2MSCB 2C98A 4RCZA 4BLRA 3FPAA 3AP2A 1BH2A 1FQKA 3D3QA 3IHWA 4HSEA 1W44A 4A36A 3DVLA 4OI2A 2ZRDA 2IK8A 3TGPA 4TSFD 3MWYW 1W2GA 2JEOA 2AWNA 1M7HA 2YOGA 3KL4A 2ZQ5A 4HZUA 1P6XA 1W4RA 2G77B 2DHRA 2IEYA 1FNNA 2ZJ2A 2ZVQX 3G5UA 5C4MA 2JCSA 2YVUA 4B34A 2QPTA 4F38A 1TF7A 3KDSE 4B35A 4DSNA 2ODBA 3GLGE 1VPLA 1ZM2A 1HYQA 2DCUA 1MV5A 1GL7A 3OF5A 2AKAB 2XGJA 1KAGA 3BIFA 1EFCA 1VIYA 2A78A 5CB8A 2QAGC 3V4RA 4JVLA 2BCJQ 5K8IA 3OAAD 3KJEA 2QBYA 4O3MA 4U02A 1OH8A 1AS0A 2G88A 1SXJC 3DOFA 3EIEA 1C4OA 3K0AA 3QKRB 1F5NA 4B6EA 3U4QA 1Q12A 3LQRA 4XTCS 4Q4JB 4YMTA 2JJ1D 2QGZA 3IQWA 4NP6A 3UXMA 2UKDA 3I72A 4I1UA 2XB4A 5EXSA 4Q4AA 4U7DA 1ZC4A 2WJJA 2QTFA 1W47A 3HPRA 3TH5A 3A8TA 5CLLA 1SHZA 1DG1G 1Z22A 1J70A 1IXZA 3DPUA 2QQ0A 1SXJB 1WXQA 2V1UA 3GFTA 4AYXA 3LBNA 2DFTA 1OH6A 4Q1FA 5D3QA 2J5XA 2KB0A 2D74A 2QZ4A 2H5EA 4AKEA 2GXQA 1NJFA 4OHZA 2J7PD 1NVWQ 4Q03A 4CEHA 2AWOA 4Q7LA 2AK3A 1P62B 3FDIA 2ZRMA 2CNWD 5CM9C 3B1YA
chains in the Genus database with same CATH superfamily
4LHSA 2OCLA 4RV9A 3LFTA 2H16A 5JXJA 3AZOA 2HJVA 4IM7A 2GCEA 3DE4X 1N32B 3RYFA 1ZN9A 2FMHA 4NTZA 2OYRA 3WV4A 5IVKA 1BVHA 3FROA 2XX3A 3OM9A 3JYHA 3EQ7A 1E18A 5D5PA 1IXRC 3GD7A 3AH8A 5HIKA 1DIBA 3FWZA 3G89A 5H70A 4EATA 5BRNA 4MW1A 5T4HA 1UFOA 5L53A 1Z6XA 2Q5EA 4BU1A 3STYA 4U8GA 1E5LA 4RTLA 4K3UA 1HM5A 3KKNA 1B7GO 1T0JB 2IY7A 4WASA 4BQFA 2CJXA 1YBFA 3OCWA 2EFGA 3L7MA 2AEJA 4DRXA 3VSBA 3S2ZA 3ND9A 1N6HA 2PXCA 1GNRA 1ZMOA 3FZEA 2GUGA 2WHYA 3WGTA 1DFIA 2HK9A 4RSMA 2FXIA 3IS3A 2CLLB 1BJTA 1KY5A 1NTOA 2G1JA 1NU6A 5F2EA 2IHNA 2ZSIA 2QTTA 1J56A 1L3CA 1P1CA 1YHZA 3V7NA 3OQJA 4MPTA 3CZPA 1GPWB 4J7XA 1YUBA 4HYQA 4HUTA 3O8LA 3OSZA 4AMBA 1NF2A 1X7ZB 4BGVA 3HVJA 3T12A 3FGNA 5HSGA 4RQBA 3LTNC 2NSHA 2QNBA 1DMRA 3JQ7B 3OZGA 2KBEA 1CIJA 4LXTA 1VLVA 3MIIA 1U8EA 4GICA 4P7JA 4B82A 4UPEA 2EZ4A 5JPIA 4CV1A 3KQOA 5AW8A 2C0CA 3O1JC 2QUHA 1M83A 3V1TC 3ER6A 3BCSA 3ZCTA 1KORA 1U3GA 5FUYA 2JEZA 3ZWMA 2H2WA 4KQKA 4CE6A 2VTBB 2AC4A 3U60B 1FNSA 1GPBA 3FAKA 2ISQA 4H4DA 3L82B 1K27A 1XCBA 4OM7A 1KU0A 4GF5A 3W0LB 4B3RB 3DS8A 1KKUA 3ISVA 3Q5EA 4DQUA 5E2BA 3AVVA 3VPCA 3EGDB 1HO3A 1TVKB 1ADJA 4DV7B 2R6GA 1A7JA 3RS7A 2I55A 1R0BA 3E3OA 3SLGA 3GVCA 3II6X 5FWAA 3EBOA 4GGOA 4JI1B 4BJ3A 4EARA 2IKQA 2N0SA 4XJVA 2PMEA 3OIYA 1I6MA 3RUEA 3T1NA 4JLUA 2ZSFA 4TROA 3QVWA 4FIZA 1J0XO 3M1AA 1XVLA 3FFAA 2HDOA 4RDXA 3E4CA 1S8AA 1XCPA 1DEOA 4IJWA 1Q0UA 2Z5FA 3L8ZA 4L75A 3I5XA 1NW7A 3CT4A 3RVJA 5FUQA 1LDGA 3DM5A 1IWBB 2OCKA 4XDHA 4E1BA 4KQHA 4MHTA 4RHUA 2HGSA 3L0DA 3OFNA 1ELOA 5IHXA 2COKA 1JDSA 3I28A 4OXKA 1Z5VA 2FB9A 3CH4B 3HKBB 3QK7A 4R16A 1JKJA 3M6IA 4FSDA 4RFSA 3IUJA 3RBVA 4DZZA 3TR5A 1GP2A 2OENG 3H2IA 3DWIA 4HI0E 3MB8A 1P80A 2ZYTX 4RV5A 3SHQA 4YMUA 4L4YA 2MU1A 2WNSA 4DJEC 3U09A 2I2CA 1U7DA 3QF7A 1M0SA 4KQIA 4EI7A 4Q37A 2R4TA 3NWOA 5HF5A 1AK1A 1WD7A 2E3JA 4GI1A 2VHWA 1MIOB 2ZIVB 3ORRA 4C0XA 4AX4A 5AJTA 2R62A 2WZCA 2ZITA 1AKWA 4XUGB 5CVTA 4XI9A 1N6KA 3P0HA 2ZUEA 3NAZA 3RVDA 1DBQA 1GPMA 1UXHA 3QVGB 3HABA 4LDPA 4Q6BA 3UHFA 4DQVA 4EVSA 4NJEB 1V1JA 1NVFA 3O4IA 2BFAA 4EVIA 3CUEF 2IS2A 2Y6VA 1T8TA 1YV9A 3CW8X 3I58A 1XMVA 4L9SA 4E6EA 3NOXA 3TBHA 1MGPA 1NTRA 2OLEA 1ZO8A 4J03A 1Z36A 2FPUA 3NNDA 4ONEA 4ZREA 3ZIAD 4QU5A 3DBIA 2A0WA 3LX5A 3D7RA 4MB0A 4ATNA 2CL6X 1Z2EA 2VSNA 5J2TF 3CUVA 5KYUA 2P11A 1P6QA 4FYIA 1O94C 1E0DA 4JIMA 5K4AA 2AMLA 3V3KA 5CCEA 1Q1NA 3ND6A 2BE7A 4F91B 2AI3A 2RAPA 3ABRB 1EFHA 4LJ7A 1YJBA 2X23A 1NVTA 1R27A 1QU2A 4X20A 2R1TA 3TPZA 3U0VA 2LDBA 1JNYA 5B1HA 3TSOA 2PLAA 1W4AA 4UHEA 3MC1A 4LEIA 3WWPA 1VZ2A 4L0CA 2RHCA 2ZS9A 2ZYRA 3VKFA 1GM5A 1G6OA 1QH8A 3G1UA 1CLEA 3JZFA 5THXA 4C89A 4YAKA 2X2PA 1F6DA 2H7CA 2YHSA 3WQBA 3UOAB 3ADCA 1XI2A 4QULA 2ZOSA 4NU0A 2EKDA 3IKJA 2I34A 3LRTA 4CKXA 4EZIA 2C31A 4RJLA 3T35A 1MH1A 2GFIA 5EKTA 1LVHA 4MZDA 3UB3A 4CTMA 3LD9A 1X7DA 5F9HA 4D9MA 1Y1LA 2JFVA 5F64A 2OBLA 3EW7A 4GM0A 4CMBA 5JNRA 5M04A 6GPBA 1S7GA 2FSFA 3V4SA 4MP6A 1BHSA 2Z2KA 1XAGA 1Y42X 1YQXA 2RD2A 3PC7A 3D6HA 2XHZA 3MGCA 1DT3A 3JATA 2ZEJA 4IICA 3F71A 1W2WB 1Q3HA 2O0HA 3SNHA 1ZNXA 4LQLA 4MV6A 1P75A 3TQCA 5AO9A 5T8KC 1WW8A 3AETB 2BFDA 1GGJA 1QDEA 1DAHA 1TYEB 1EFPA 2HFKA 2J08A 3E84A 4YHBA 1NQTA 3VMMA 4CG2A 1WY7A 4NCXA 3UKDA 3P9NA 4TMWA 3T3IA 2O2GA 3DEJA 4JFRA 1ZSNA 3C3PA 5B7GA 1RI5A 5DCUA 1CHDA 3A37A 2CXQA 1CG6A 3K1AB 3UC5A 5K7SA 2WDPA 5IC6A 2IX9A 1WHTA 1JQAA 1CZNA 2C9OA 2XXBA 4N6OA 3OTWA 4C1BA 1UIRA 5IXJA 5KNCH 5HZGA 3SQXA 4KJXA 3IP7A 5KOHB 2G04A 3R5FA 4Q4DA 2I8CA 1FCJA 5J4KA 5JRZA 1H1LA 2GD0A 2VK4A 3S55A 4JELA 5KX5A 3KTOA 5BNIA 1YR9A 2IPNA 4DMKA 3I0MA 2PV7A 3UTDA 4Q3DA 3DEKA 4QSHA 3NONA 4G9EA 2O8BB 4ZVPA 2DSTA 5DGCA 1DZ3A 3S2EA 2HU8A 4N3AA 4YGXB 3TIXB 5AVZA 2JW5A 4FZ3A 1KARA 1DUIA 5IBQA 2BOVA 2JK0A 2AZ4A 1L5WA 5DX0A 2ONKA 1PJRA 4UREA 2GCGA 3NM4A 1M6NA 3ABIA 3DLTA 4NZYA 1L5MA 2B8NA 4NAUA 4EX7A 1XHEA 3I64A 1QKKA 1ZEJA 2WM9B 3CG0A 5EMNA 4K1XA 1CY2A 2G5TA 2QR2A 2PUEA 1OPXA 3FCXA 5HQ3A 3SU8A 2JAOA 4PC2A 1ISFA 2Z8ZA 3JQ8B 1K7FB 3UAZA 2VWPA 4DLVA 3JQPA 4DDMA 3IKTA 1DRJA 1XAJA 1RRCA 5EUCA 5EYPA 4D3FA 4CM5A 1IQ0A 4UZEA 3ISJA 2QP3A 2Y2VA 3PD0A 4TV8B 3SKXA 3TX6A 3WQQA 4EGCB 3BWEA 2EJTA 4TVSA 3K92A 1RHKA 2QDKA 1Z3CA 1J8FA 1G7SA 3MWEA 1D9ZA 3QUQA 4RY0A 5DXJA 4Q5IA 1IDN1 4HLQB 4PXYA 5A0TA 4HJRA 1DPFA 4PRZA 2NYAA 3CCCA 3ODGA 2OAQ1 4FHFA 4KQEA 1IY9A 2CD9A 1F60A 2PUAA 2PWPA 2CJPA 3KL2A 3N87A 3TW4A 2ZTSA 5TV2A 2PH1A 1L8AA 2R6FA 4PLGA 3M6XA 3G0IA 5LP6F 2C1XA 1UT5A 4OA5A 4H7KA 4LSZA 4X97A 5IBPA 3ZXSA 4INJA 4A1FA 3UMVA 4D9HA 2VF7A 5H7XA 2JGFA 2HPZA 4OMCA 2EQBA 2YS6A 3RVOA 1TK9A 1XHFA 2DRIA 4JVNA 4EY4A 1NQUA 1GVNB 2A9RA 3OZVA 3RVLA 3HEAA 3TLEA 5TPZD 3WZMA 4C0AC 2FEWB 1JAZA 4M0LA 5DHSA 2YV3A 4GI7A 3RKUA 1AKRA 4IFTA 4AF6A 4E94A 1BYIA 4WERA 3DBRB 1KPIA 1GR0A 5AW9A 2PKCA 1Q2XA 4IZOA 1E0AA 1WO8A 4WTOA 1M34A 4ESOA 2QW0X 2ZP1A 5DTRA 4BQRA 1BS1A 2IWHA 4C05A 4Z9BA 1AA9A 4WGGA 1TT5A 4DB4A 1CKEA 4KKXB 2BEVA 4A5SA 1BW9A 1WIWA 2RH9B 1BDIA 3C7AA 1CUAA 4G23A 5K01A 2YUIA 1QV7A 2E37A 1FNBA 3L77A 3ZJ4A 4MLCA 2VTEA 3COYA 2W2KB 1D07A 1GXSB 2EGHA 2OBFA 3BGSA 4PPNA 2KLHA 4B6PA 5KU7A 1US8A 3CRVA 2IU4A 2Q9UA 5F33A 1KBQA 5FBKA 4GX5A 4F7WA 2PXXA 5K4GA 1HRKA 3LUDA 1L7MA 2GF2A 3CCFA 4ARZA 2QQ5A 4KQ6A 1FRNA 4EF6A 3CGWA 4DA0A 2BMDA 2PU7A 2C3PA 2VK1A 4H0CA 5AHXA 2X5OA 1X74A 4HDKA 3WBFA 5J2UB 4UCWA 2XUIA 3BORA 4PLPA 4MRRA 4RA9B 4NMHA 2OAGA 3PHHA 1Y0BA 3IKLA 4NFLA 3THYA 3MUOA 4BMNA 2HB6A 3EEIA 1OH7A 4F6RA 2WWHA 4TXLA 3W6UA 1EQ2A 2ZJYA 2VDNB 3LA8A 1UFKA 4BNGA 5BWBA 1DCMA 4KREA 4FYWA 3ZN2A 3L7CA 4LY3A 1L5NA 1LK5A 1PQPA 2MJLA 3G2QA 3JWHA 4MYSA 5EN4A 4ES6A 1LTHR 4DCGA 4F97A 1KK2A 3PXUA 3WGYA 2JIPA 1EFLA 3NHPA 3ZD8A 4OB8A 1GOTA 4H4EA 2C8LA 1E7SA 2QQGA 3TO5A 3F2VA 2H5IA 4AZ0A 5ALVA 2ZUTA 1KZ7B 3L0CA 3RYHB 3HO1A 3HR4A 3GLIA 4RQAA 3H2KA 1T5DX 1CY0A 3EMVA 3EAQA 4OK6A 5ED4A 5BYKA 2XXAB 1H8HA 1RWNA 3GRKA 4RIIA 1TUIA 1XZJA 2KHZA 1AQ6A 1Z62A 1SUDA 2DAPA 4G07A 2EWMA 2QAJA 4U7PB 4EMTA 3H5AA 2UDPA 1XA3A 4B3SB 3LMKA 4EGAA 2XT0A 1E1CA 2FPOA 3IAFA 4YMHA 1JXAA 1CULC 3KLOA 1WZIA 3ADPA 1L5HA 1N3IA 1XU4A 3DW3X 3CRNA 4X41A 5K3FA 1CRZA 4TMVA 1JMKC 1B0ZA 3PHJA 4X00A 5DKFA 5A2GA 4Z4EA 2I7VA 1GT91 2P6NA 3MBKA 3RH0A 3Q6IA 2CUTA 3OPXA 2AFIB 3IRVA 3U26A 4ZJUA 3GFOA 2VATA 4KUEA 5HKOA 1TM1E 3L79A 1L5GB 3L9XA 3W4KA 2C5GA 1V3UA 2NO7A 4J4HA 3OHPA 3B70A 5CLFA 1NNEA 1WULS 1E1CB 3EVZA 3EZ6A 4N8DA 4HR7A 1OAOC 2G0NA 3UENA 1P18A 3QLJA 2DOKA 5BV1A 1IVYA 1GU7A 3LDFA 4KAFA 4N6NA 3LBYA 1E8DA 5LQUA 4Q9NA 1Q1EA 3SQNA 1SVKA 1Q50A 5BPFA 1NKTA 2VPPA 3LKDA 5C8ZA 4RSHA 1YA8A 4GZMA 4HDOB 5JAPA 3NBQA 4ZDWA 3B6ZA 4A16A 3NVMB 2ZATA 5K8VA 3CKKA 1HEIA 1Z2OX 2WYUA 3I0NA 3SD7A 4FGZA 3QPCA 3EDQA 3I92A 4W1RA 4CLHA 2PA3A 3CUYA 1DBRA 2ATXA 2PUVA 1O95C 1A76A 3RHFA 2ZTUA 3RBXA 4PTYA 1L5VA 3RRXA 1M7BA 2V5VA 3V1UA 3E7FA 1VCIA 1IZYA 5GOTA 3RE1A 3RS9A 1H6CA 4GO1A 1W5FA 3VR4A 5KZMB 2ZVDA 1ZEMA 1MNQA 1RYBA 4MUAA 1T4BA 2JAUA 5GONA 3RU7A 4PO8A 3SDZA 4A8HA 1JBEA 5I51A 2KPOA 2HMUA 3SP1A 2YZ2A 5LQMA 2BYTA 2ODQA 2VQFB 2Z8YM 5ITVA 2H4HA 4BE9A 2XDWA 1LDNA 3GNLA 4BJ6A 3TLGB 3RRZA 4RD4A 3E18A 2FWNA 3JAWA 3U4IA 1I24A 4R8SA 3GUZA 4HX9A 4QL3A 3HVRA 2GCOA 3PRHA 3QVOA 2SBTA 721PA 3QLVA 1XCMA 3EPLA 3U4MA 3PDIA 3OPYI 4AKGA 2BHRA 3AB3A 4GNRA 2J0VA 4M0CA 3IMFA 5HUJA 1ESEA 1WDLA 4AP9A 2VNAA 3W2EA 2RAVA 3SIPA 1RRGA 4XLLA 1ZH0A 1GXSA 4ICIA 1NZFA 2FSVA 4X63A 4EW1A 1BKSB 4MGYR 1VDMA 3OLVA 1NGSA 5IAKA 3PJRA 1ORTA 1ZDMA 1U90A 4MQ6A 4OKNA 3W1WA 4DJTA 4BEVA 4OQMA 1UKZA 5B4UA 5CYOA 1GV0A 1XMPA 3VPXA 3ZVRA 4A03A 4DCJA 5A5VA 4RL6A 1VA4A 4L0DA 4B8WA 4EO7A 1EX7A 3KQTA 3FF4A 3EZGA 4BZWA 1USVA 1ATIA 1UOQA 1WPGA 4TXMA 4LKOA 1OGIA 2AL7A 1HE4A 2ZIZA 1PLLA 1RBZA 4Y2TA 2WQ6A 1A5ZA 1FTQA 2IE0A 1QF9A 2L19A 2FVYA 2QJTA 2DJIA 2YY6A 3H18A 3JQEA 1JIQA 3O9VA 4C3VA 4RPCA 3DV2A 2FPIB 2ZFUA 1TCCA 2WDZA 1X80A 3NTVA 3EARA 3IBCA 5TQJA 4Q9DA 4EW3A 4ETNA 3AJ8A 4I3GA 2W2PA 3T3HA 1NVXQ 5B1YA 4ZV7A 1KY4A 3WDKA 4GHWA 3SQOA 3ML1A 1M6HA 2UVPA 4GOKA 1BS9A 4K8RB 4TM7A 3I62A 3HFGA 5FV7A 4UULA 4YAOA 2ADFA 5A02A 3BJMA 3QTTA 4OFZA 1ZL0A 2OHGA 1QV9A 3RNLA 1WB5A 2X1HA 2AJ8A 3H2BA 4BQOA 2FZWA 3TVYA 1NAHA 1U9ZA 2DWCA 3PC4A 3G5AA 2ICAA 2FGJA 2OBNA 2W6JD 3KEQA 5K9ZA 2AOUA 3NT5A 4OI4A 4PAMA 2V7QA 2VG8A 4I6EA 3D64A 4M0UA 1U2DC 4RMJA 4P5EA 1L5QA 5CYGA 3PEWA 1FNDA 2HCFA 1TQ2A 2FG5A 2JGDA 3GFGA 3NTQA 4PC1A 2HIAA 4AG6A 4E5PA 4UTPA 2OAP1 4L4XA 4A8JA 1O95A 1TMGE 4LVNA 4PX3A 3W5BA 4WJZA 1W88B 3ETCA 2ZBVA 2EP5A 4RXTA 2OP1A 2IFTA 4TZTA 4EYOA 2BHSA 1DBWA 1OFTA 3QMWA 1HT2E 3U7JA 2JA1A 5CUQA 1YKFA 5YASA 3UUWA 2JLUA 1ECGA 4KGDA 4WDRA 2IS1A 1BMQA 1RC1A 2DUUA 4JNKA 1LQUA 3HADA 3RO7A 4I6GA 1K6MA 1AGXA 5DT2A 1A2KC 1GGMA 3TTWA 4RF3A 2FE1A 2Q3CA 1OFGA 2XW6A 3O4JA 4Y6OA 3NIBA 1NW3A 5B4TA 1SZDA 4K05A 5D2CA 3RSCA 1C0KA 2VOEA 4FFNA 2ZIFA 2UXCB 2OAEA 2JFPA 3F74A 1L7AA 2OQ2A 1BFKA 3Q6MA 4GMKA 5B3KA 2YXPX 3ORHA 4WLOA 3S99A 4QODA 3HHPA 4TLBA 3EZXA 1O96A 3KR1A 3VC7A 4RA6B 3FN4A 2RGWA 2UXBB 3TRJA 4KQXA 4BJ5A 4FYKA 4L2IA 4MYHA 5L3SA 5CK5A 3JTEA 2AR7A 3OZTA 4QLOA 4TXHA 3AEYA 1QH1B 3UJHA 1DBPA 2IC5A 1T4MA 2FPLA 1WVIA 3CGGA 2BIFA 4KPUB 5KOJA 5L3QB 3K1AA 2UXDB 4MGHA 2B7CA 2A9VA 1Z8HA 1KFEB 4UM5A 5AKEA 3QWAA 1KA9H 4P7BA 2WA1A 2PT7A 3WHKA 1W35A 4NCJA 4C7BA 3MZ0A 1ETUA 2W9XA 3OQIA 4PG6A 2GM9A 3KB1A 4RW0A 3WDSA 4CLOA 3I4LA 3DBLB 3K31A 5LQCA 1OIVA 1ILWA 3A6EA 4IGAA 3IIIA 1QE3A 1KNXA 3OHMA 3UA4A 2Z5GA 4BQNA 3QU7A 4EUHA 1WDWB 2ID9A 3NBKA 2RBKA 4AS1A 1T6BY 1XEAA 2RH4A 4Q3LA 1AC5A 1MRZA 1SUBA 1XLVA 3OOSA 4TS1A 3UYKA 4NK5A 1K8XB 3V8RA 1G5HA 4Y18A 5UKDA 2G5GX 4MDYA 4WNYA 1XDWA 1JWLA 1G17A 3PIRA 5F7XA 2VHQA 4BTVA 3WGNA 2C5SA 2R7KA 3FCUB 2IH5A 5DN9A 4QBGB 3BB3A 3RVMA 2VDWA 1PK8A 5DGXA 2FK7A 1SD5A 4D0GA 4UM9B 2W2TA 4ZCMA 2F2TA 1KK1A 2XE6A 3CRW1 3TRHA 4Z51A 1JDJA 1BC5A 1SA0A 1P4RA 3DHYA 5DHTA 3K0KA 5DTEA 5AFSA 5I4KA 1N5JA 2PT9A 1N5MA 3GP5A 2P9FA 4H1UA 2IHUA 2CCGA 2ETVA 1I5EA 1XFDA 3SZRA 1YJ8A 5CG1A 2FEXA 1N8NA 5E9AA 2GD6A 1G4HA 4KBFA 4I4CA 4FOPA 2OPBA 2OBYA 4AP6A 1K6XA 2BM0A 1VBFA 1DUSA 5DCYA 1QZXA 3EGCA 2CHGA 1N0UA 2BKLA 2C2MA 4CCYB 4PIPA 4XCQA 5K20A 3BMCB 4FZRA 2OCIA 5K3BA 4C1NA 3DAYA 2K2QB 3QEAZ 2R5FA 3I0ZA 3AUSA 2R86A 5EPOA 5TQVA 1JJAA 1WSBA 4TL9A 3X1MA 3P4XA 4F5YA 1EFAA 1NNLA 3VR5A 2EL7A 3J7TA 3BXGA 5HMLA 1JJVA 2J6IA 2NUTB 1UZNA 1S3SA 1PO7A 4BO2A 1OTXA 1YZTA 1DO2A 3KJIA 4JKIA 3CT6A 1L8QA 4P4GA 2CMGA 4BRZA 1TFRA 5K3SA 1F0NA 5AW0A 2VIIA 2BD0A 4R83A 5AW7A 5KOJB 5JXGA 2V6JA 3IIJA 1H6BA 4NAHA 1E4EA 1G66A 4RPLA 2RHDA 2HCRA 1OZAA 1Y3DE 2DHDA 3OOJA 2PRZA 4F2WA 4JMPA 4UU1A 2R8EA 3N2LA 3R4VA 1SKYB 3AFMA 4C7XA 3A1CA 2OZKA 3RBAA 5IANA 1DBIA 2YMPA 3JW8A 4H9GA 2YXEA 1VL1A 2QRZA 4L74A 1I01A 3RV3A 3ZZMA 4OHOA 3NP9A 1ZX1A 1VMAA 3MMNA 4PHTA 1SXJE 6NULA 1A9QA 3MYRA 3SSNA 2RJNA 3ZD9A 2NT4A 3WLPA 4OFWA 4ND5A 2PWZA 4UXHA 3FDZA 3ZDCA 4DIFA 1DFGA 4X62B 4OL9A 2EFEB 3W8EA 1WJGA 4HG2A 1Z13A 2E85A 1QV6A 4MJXA 3D5QA 1E1NA 4E4TA 3HNPA 5G4KA 2ZRKA 1ZL2A 1TE2A 3Q11A 3ZCRA 4MR9B 1ZJJA 2WIDA 3K0FB 3EOBI 4HLDA 1X8XA 2Y27A 3Q98A 2X5JO 2DHQA 2X9GA 1KJZA 1OAKA 3MFQA 1UZUA 1WOMA 2OECA 4MRSA 4F86A 4UBJA 2IA5A 1N5KA 3GLSA 4ARCA 4RHEA 4HLNA 4L72A 4QHYA 1M1YA 1GA4A 1CB7A 2HKIA 1HDIA 1D1QA 1OWOA 3KXIA 5FLYA 3T5GA 5I7EA 3PKJA 2VTKA 2WVJA 1G21A 1QYCA 4A26A 4FZJA 1ONNA 1G20A 2YWFA 4Z49A 2NT3A 4E22A 5BR1A 1NKVA 1QFYA 4GX0A 3LC7O 4Q1AA 3O8CA 4YAGA 3DXFA 3PEUA 4RHTA 3BBLA 4LGVA 2IW1A 5FPYA 3V1LA 4F6CA 4J7CA 1G8HA 2Z95A 5IH3A 4RTRA 1LS1A 2H4JA 1AGNA 2JIOA 4LXYA 5H59A 1IY2A 1J2JA 3AF1A 5TQ0B 1GQOA 1RYHA 1X80B 1GQYA 4MR8A 2UZ0A 4RZIA 2ILTA 4C6RA 3O92A 2X6TA 4DR5B 2EOAA 3IBFA 5FTLA 2R8ZA 4UVEA 1SA0B 1RXCA 4I1VA 4LG1A 3T7KA 2O8CA 1JR6A 1QSGA 3KLNA 3Q41A 2A94A 3GVPA 3KKEA 3URMA 1YQDA 1FOEB 3D0OA 1DJQA 1Z5UA 4A8TA 2B1IA 4OGWA 4KIJA 1XJCA 2CNWA 3MTBA 4RZUA 4D4MA 4ZJPA 4F92B 1IONA 2ZRHA 3STTA 5EQJB 1V5EA 1RI4A 3T6KA 1W0KA 3QHPA 4DBZA 3HCNA 1YZHA 3CF6R 5HG0A 3DUFB 4CT5A 4HEJA 3BTVA 4I8IA 5FOSA 1VPTA 2PS3A 4R7TA 3HL0A 3RVSA 2PKWA 5KYXB 2CLCX 2ZB8A 4DS3A 4K0KB 3K73O 4URUR 4M55A 2EX0A 1YCFA 2XTAA 2VHXA 2UZIR 1LZLA 4R9UC 4X1OA 4HDSB 4I9GA 1D7AA 3AK4A 5IYZA 1Q0SA 1GYPA 1SVLA 1UZAA 3DFFA 3OZXA 3VX4A 3LF2A 4F4UA 2X6RA 3GGJA 4EHHA 1CETA 1QVWA 4DT1A 1G5TA 1HDRA 2NYVA 3ZDRA 2GCOB 3B2QA 3CZRA 4R0NA 3O8NA 1CY4A 3DKIA 2R6CA 4P3KA 4G56A 5E6RB 3WBBA 1S6YA 3NT2A 4J91A 2DYKA 3WFZA 3W3AA 3OMXA 1THGA 1D2HA 1KYZA 2WI8A 3FPEA 4YJ3A 4RF5A 3H4TA 4QBIA 4WMLA 2HZBA 4RXMA 2J9RA 4OQYA 1IHDA 3IDZA 3EXHB 4EPYA 3R0JA 1U1GA 2QK4A 1AK2A 3F3SA 3OECA 4YAJA 1LQ2A 5HZKA 2RFLA 3NUGA 5DYTA 5T4EA 1SK8A 1V5GA 3TSCA 2Q5CA 2JJ8A 5K3CA 2O1EA 5CRIA 4NZMA 4PHGA 1SEVA 3I1JA 1JFVA 1LBEA 1UJNA 3G8AA 4OBXA 3W04A 5JAHA 3AOGA 1ZLYA 4CG3A 4BVHA 3LL4A 1N6IA 4LXXA 2Q1WA 4R54A 1GKUB 2GKSA 2FUKA 1D03A 2QP4A 1V47A 3PXDA 1ZUHA 4WH0A 1UDAA 2AX3A 2Y9MB 4S1PA 2F48A 1NR7A 4XXHA 2BEKA 1LDEA 3VTAA 3OPVA 2K7FA 1C9MA 1ZGHA 3FTQA 3JQAD 3K09C 2D1YA 1Y3FE 3TLJA 1ISHA 3T94A 5TGTA 4ZYTA 5IAEA 1DIOB 3RSLA 4CM1A 3JQ6A 3QLUA 3B1ZA 5AICA 4YP9A 3ZVNA 2A5FA 4H0NA 1RZRD 3GG9A 3KWFA 3OT1A 4D8TA 5IWCA 3NH6A 1PVOA 2LIPA 3WGOA 5ISMA 3ZGVA 5CFOA 4JI4B 1NIPA 1CUGA 1PF7E 1N3LA 2XDAA 5I5EA 3S7ZA 3ZY6A 5LJIA 3PNMA 1FQOA 3I73A 4I1OA 2AFIA 2Q3BA 5BQPA 3UATA 3U62A 3ZYCA 5JNLA 4JJ8A 4EHNA 1OBVA 4QA9A 5TMDA 5EE0A 2WWXA 3KWJA 1EA7A 1H2EA 2DWQA 3K5IA 5BMVF 2QBYB 2A0UA 3HN7A 4DQ0A 3F73A 2GETA 5IBRA 1QQAA 1IFXA 4OXIA 2V98A 3UW3A 2JHPA 5G4LA 1CEQA 3F5DA 4RK5A 4BO5A 4Z2YA 4C0JA 3UUFA 2UV8A 2QS9A 3HLKA 3OZWA 3D8SA 1VG1A 4NE7A 4OA8A 4UM7A 3RK1A 3UCEA 3RAPR 4H7JA 3S6JA 3E5RA 4Y1RB 4YR7A 1RP1A 4KHPB 1WSAA 4MDFA 2FZ5A 3H4MA 2WPDD 3NYQA 3KFXA 3OMLA 4I4TB 4QPNA 2VF8A 4NV0A 5IKOA 4D4GA 4BFVA 2PRJA 5GMOA 2FMFA 2VQSA 4BAZA 1MAVA 3BE6A 3H16A 3VYWA 4PSAA 2HQBA 3SX2A 1D6SA 1V1MA 1NG1A 1N2OA 2XXAA 2BEJA 5CAEA 4HZUB 1Y6JA 2WOJA 3FMGA 4LJ5A 5E3IA 1MPTA 3NU1A 4ZEMA 1U0JA 1QOQB 2GNOA 1WRBA 4GP7A 4ZEOA 1E4YA 4Y1FA 3UQYS 1O2DA 1QWSA 2VO1A 2C9BA 3C97A 4G4SP 2QL5A 2QLLA 3KO8A 3F4BA 2IW3A 3TMYA 4JJ6A 3Q88A 4CQLA 1XZPA 3ESYA 4CMIA 1NVMB 4TQAA 3ZNQA 4J4TA 5EJ4A 2P5TB 1QR2A 1YQUA 3R7BA 2NVUA 4S04A 1JLSA 3TTVA 4RK4A 5THKA 3EG9B 4TLMB 2VYQA 4OAOA 4RKEA 2ECOA 1X92A 5B6IA 3DXZA 1F8GA 3DEFA 3O4GA 3OF2A 1NN0A 2OMKA 4LJ6A 2I2FA 5F77A 4OKIA 1OXTA 1PL7A 3B6MA 2Y67A 1E1YA 4D1YA 2BZGA 2OQIA 4JA0A 2C2GA 3SG0A 3TNLA 1U0BB 2EVWX 1ZU4A 5E2AA 4MEJA 3JAWB 3AUTA 3H04A 3NP7A 3NWJA 4HBZA 5FA6A 3VR2A 1LRLA 1KSGA 3PSHA 1YR3A 2DTDA 2FETA 2ZWMA 3LVQE 4X7MA 5JW6A 1FLNA 4QO8A 5FKJA 4PF1A 4BYMA 2GEKA 1BXGA 4WK2B 1VSQA 3N05A 4FC6A 4NAVA 3M6UA 3MB5A 2C7QA 2G8NA 4UTXA 2X0IA 5KNBD 1UPCA 3AY0A 5CDTA 1QRUA 3LO8A 4DM4A 4CEJB 2NTEA 3EFBA 3A3PA 3WAKA 3IP5A 4YRFA 3VU0A 2C03A 1PW5A 3B2NA 3KXDA 2I9PA 2ZWIA 4XCXA 4NV1A 3HBJA 3O1IC 2BJHA 2WFMA 2PT6A 4HP8A 2ZZNA 1U7OA 4DJJA 4D92A 4JLKA 1UEXC 4HDNB 4AUEA 2RK6A 2Z4RA 3AEQA 5IP5A 3DBRA 3TI7A 2ZJOA 3L5KA 5EE5B 1OIXA 3UJDA 2OORC 2VPTA 4TL8A 5FPKA 4JI3B 4KH1A 4R1NA 1QP0A 1Z06A 4IUBS 1X13A 1FNMA 3SYTA 1CS0B 4RKRA 4GMHA 1GPYA 4CT4B 1JFTA 2XECA 4BFXA 2ACWA 3NC0C 2YIJA 3PPWA 3AERB 3JQGA 4LE1A 4R2JA 4Q01A 5AUQA 3W7AA 3TF5A 1MX3A 2HZ7A 3FMFA 3EVDA 1UINA 5IMSA 1E2KA 3U3XA 3U4AA 1V0JA 3NGLA 1II8B 2Q3FA 1QHFA 3I23A 2X0DA 2CK3A 1T2CA 4G67A 3MTDA 4FUQA 2ODPA 5E8JA 3B13B 2ZJ1A 5I9TA 5KSPA 2OSVA 2D5BA 2OV8A 4TT3D 4XDYA 1M73E 2AOTB 4LWQA 2VRCA 2HHLA 3CLKA 4UDNA 4UOEA 2GXSA 2FW6A 1E5QA 3C39A 1P1HA 1E63A 5JVDF 3ZU4A 4NZOA 4B84A 1KI6A 2FSVC 4EJ0A 3FX2A 2Z2ZA 3I5UA 3L6RA 3I6BA 2P2CA 3KUKA 5CJPA 3SHTA 1VMIA 3S2UA 3NTUA 2CLKB 1HYBA 1X7HA 1OGYA 4QYSA 3OKAA 1XL0A 3K4QA 1PEKE 4ZQGA 3ILYA 5IMBA 3MOSA 1N4AA 4EB8A 1JIVA 3TNYA 1RZUA 3JPYA 5JCZA 2IYRA 1XZBA 2PKRA 5H1YA 3QPBA 1QPBA 3PIIA 4QUKA 1DL5A 1ORIA 1VKHA 3BM5A 3I83A 4TN1A 3WLRA 4GDFA 2IGTA 5ESRA 4D3XA 1A27A 4WOKA 2J9XB 4YDRA 1P9WA 2ZUSA 1WMSA 1DKNA 4J9VA 3ASVA 3GT0A 1UJCA 3T3NA 1OE0A 2Q8PA 1ZD1A 1SWVA 3VZQA 3ZE9A 4FSXA 5IABA 1HT1E 2C42A 3OQVA 1S89A 2J3KA 3TGWA 2FP3A 3ANMA 1T0IA 3BXZA 3L6CA 3FPGA 4ZVOA 5A3JA 2AW3A 3DP7A 3ENVA 3Q0TA 1QP7A 1HPLA 1U6JA 2CNBA 2QIPA 3GVHA 1ICIA 1GYQA 1U3VA 2L18A 4CR7A 5HS4A 1VBNA 3HM9A 5D84A 4GLJA 5FXMA 1LBIA 4LK3A 3GR6A 3KKMA 4U2FA 4P8RA 1ZPDA 3TUZC 1PD0A 1DI0A 1XRSB 1OJLA 5E6RA 1RPNA 1YFKA 2LCIA 1KAHA 3T0FA 1EZ4A 4DDHA 2NO6A 4HYYA 2DUNA 4IXMA 4M0KA 4N0DA 3ZR4B 3MMZA 4PLWA 5EA2A 5KJFA 4URWR 1P0IA 1XU7A 2W6PA 3TD2A 5G1OA 4TTTS 4ZU1X 2BZ0A 3VDMA 4BDTA 4WECA 1W4ZA 2DFKB 4C0WA 1CDDA 1XGKA 5JJKA 1SELA 1TRHA 1S1MA 3VR3D 2WSSD 2WZDA 4ZOQI 4LE0A 2ZUWA 3H8WA 2GLTA 3G0DA 2DM6A 2DBQA 1ENPA 1P2DA 6PFKA 4YI3A 2P3QA 1HRDA 3R3WA 1LCIA 4UUNA 3WNZA 4ZYYA 2RKOA 1G8AA 5D01A 1P5RA 4KDFA 1RI2A 1X1EA 3D0KA 4UMVA 4X6XA 3UB4A 3MF4A 5B12A 4QFBA 2JCYA 3WKDA 1W5AA 1NBAA 2FN7A 1UK6A 2J33A 4QICA 3IDFA 2NTNA 2X76A 3DD5A 4KVAA 1BGVA 4B81A 1IBCA 2H0AA 1PRYA 3C5VA 3IVCA 2PJRA 3RW9A 3P9SA 4OJTA 4RKFA 1U7HA 1UC5B 3I2GA 5IW8A 1GCOA 3SIWA 4CHGA 2EEPA 1MA3A 1MOPA 3O4FA 3ZWQA 1AQLA 1MO4A 1W4BA 3KSRA 2G28A 3K1TA 1Q7CA 1WUYA 2FPXA 1RVV1 4DV5B 1IMJA 2ZT6A 5DTJA 3OUTA 1QTRA 3E8XA 4HDCA 4MI6A 5D85A 3D2BA 1DIHA 1W29A 1WNTA 4GXRA 4HQ6A 3WGJA 2Y0EA 1EM8B 2JJ1A 1N7IA 3FJOA 5HCIA 1Q3KA 5BQOA 3S2YA 4BNFA 4R9VA 4MOWA 5EIEA 2MWMA 3QEKA 4B75A 5EFZA 5I7FA 2PZLA 5B55A 2PMBA 2QRNA 1Y8QB 3MCWA 4G8DA 4DR1B 3HYTA 1PYOA 2QRKA 2GZSA 3RDPA 1YL5A 1YULA 3SC2B 2CYCA 2VPQA 4MLPA 5SY6A 2BMFA 2QYSA 4ABYA 1UBRS 2NZ8A 3K9QO 1ECLA 2ZI9A 4KXWA 1O97C 1VE9A 1F12A 1Q57A 4GEGA 1ZHFA 3N8IA 5FADA 1HH4A 2PKEA 2FKAA 5DZSA 1Z15A 2HL6A 4P4UA 1YL7A 1H22A 1JTEA 5EZ6B 1C8VB 1RLMA 5EE9A 5AVYA 3C41J 2CGEA 2VZLA 1UAYA 1GNSA 1JZSA 3SY8A 3D5TA 2INGX 3F6YA 4C88A 1Z38A 3QBVA 2O7VA 2BEWB 5AW1A 2TECE 3HC7A 2E1RA 1VL2A 3HR7A 2EIXA 4GKJB 3QF4A 4EKYA 4F4IA 5EQDA 1RXSA 3MS4A 2MSDB 3BGOS 1RC8A 3GGDA 4E7OA 2ZE5A 2P65A 3WRYA 1M2VB 3ZDAA 3G0CA 2F3RA 3BN3A 5AVKA 2B6NA 3ZI7A 3IBTA 1QK3A 3UYLA 1W0JD 1LC3A 3E3LA 1UC4B 3AEUB 2QN7A 2ZBEA 3OCYA 1P7ZA 2YWBA 3IAAA 2VHUA 4Q4LA 2B25A 2XMRA 4JLAA 4UU8A 3U9TA 2HK7A 1KY2A 3QTLA 1I3MA 4RV4A 1OXUA