4HLDA

Sulfonylpiperidines as novel, antibacterial inhibitors of gram-positive thymidylate kinase (tmk): compound 11
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
203
structure length
196
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Sulfonylpiperidines as novel, antibacterial inhibitors of Gram-positive thymidylate kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hldA00
3K0CC 1DAFA 3BH0A 5AUNB 3GEIA 3R7WA 3CZPA 4DT1A 3JVUA 3IBGA 3U3MA 2WJGA 2KI5A 2DWQA 4GFDA 3UK6A 2EFCB 4LV5B 4I1OA 4HZUB 5LB2A 3WBKA 4B74A 5CDFA 3X1DA 4M1OA 3P27A 3TW8B 2HF8A 3LO5A 2ODNA 2ATVA 2CBZA 3X1WA 3IPXA 4OI0A 2FSGA 1T6NA 4OKSA 4I99A 5FI1B 2QI9C 4DUGD 4EDHA 5K8UA 3U7EB 1TUIA 4YDHB 1Z28A 3ZVLA 4PC2A 1XEWX 3FFBA 3R20A 5AJXA 2V8OA 4ZDJA 2W2XA 4FMDB 3JZMA 4K46A 5L3VA 5HKKD 2JLRA 1KNQA 3RS7A 3SJZA 3BH7A 3B1WA 2O8CB 1XD8A 3AEZA 5DYGA 1W36B 1X1RA 4LV6A 3Q5DA 4TMKA 1WDTA 2OFXA 3GLHB 4OL0A 3FTQA 4YXWA 3VHLB 2OO7A 5DYIA 4KBGA 2ZAMA 2RHDA 1GL9B 3MCAA 3FHCB 2BJVA 1P61B 2FE4A 5CYPA 1NN5A 1XZPA 3BOSA 4B2PA 2GEVA 3BB3A 4C0KA 4NYIQ 2XB2A 2FDCA 3W90A 4URVR 3ZS9A 1SVIA 2O5VA 3GJ5A 5E7IA 3V00A 1GNRA 1DAKA 1HQCA 1YVDA 3SE0A 2WPDA 3SS8A 1RPZA 1AZTA 1OJLA 3LNCA 2O8BA 4D26A 1KAOA 1M6NA 2C03A 4C0AC 1T5IA 4XD7D 1H8HA 2EFEB 1N3BA 2GILA 3X1YA 3WHLA 4IOLA 2DFTA 3AP1A 1YZNA 2XX3A 4WZAE 1JI0A 2G0TA 5JSZA 1IY0A 4DCNA 1LY1A 2IYTA 2WKPA 4BECA 4DCTA 1MO4A 4GOJA 4LJ4A 5LD2B 3KFXA 3CNOA 4Z1MD 3ZVNA 5FBQB 2PJRA 3FKQA 4II7A 4UNSA 4F91B 4R98A 1QDEA 3C14C 2CE7A 1W36D 2ZRKA 4Q7KA 2G83A 5KUTA 2D2EA 4B3CA 1O3YA 2ZJBA 3NWJA 3W9YA 3TSZA 2AKAB 1KZ7B 5JFGA 4BASA 1IXRC 2IUUA 2IT1A 1HTWA 2W2TA 4BZPA 2FPMA 4AI6A 2V1XA 3EA5A 1W36C 2F1IA 2A5GA 3BD9A 1D8TA 2WVJA 4PSVA 4M0LA 1KI1A 2VHQA 4F4JA 5E3HA 3DEFA 1N5KA 1RE0A 4MDFA 1NBMD 3SJCA 3RS3A 3C5CA 4WA7A 1XJCA 1UJ2A 1XTSA 1UKZA 2HXSA 1G8PA 2FX3A 3B82A 1R5NA 4V0KA 1G8FA 3IILA 2HV8A 2IYQA 2D7CA 3KUDA 4Q01A 3FKSA 3FE2A 5DH9A 1SGWA 3RHFA 3SBDA 3X2SA 4KVGA 4ARZA 4YMUA 4A9AA 3UXMA 1N6LA 2NQ2C 1U0LA 3GLFE 1K6MA 2ZU6A 2H92A 4IVRA 1PV4A 2G1KA 2NPIA 2YJTD 2VYFA 3GQBA 4HB4A 3KQHA 3THXB 4DHEA 1XMVA 5HE8A 4Q47A 3UWOA 3EPKA 3EX7C 3KB1A 4L16A 3QPUA 1J99A 1FUUA 1ZINA 1KI7A 1OXUA 5AUQA 3F0TA 4RD6A 5FL7D 1AS3A 4DVGA 2O8FA 4LZZA 2CCKA 5A0FA 3GLIA 3JVVA 4PAOA 2DFNA 1KMHB 1G7TA 2XNDD 4Q7MB 3CONA 4JL6A 2WJYA 2JLSA 4CYMA 1TF2A 3D7MA 3T12A 4Q4JB 2OHFA 2FFAA 3QG5A 4FIDA 2VLIA 3QKSB 3C41J 3KQLA 4OQFA 5E4FA 1AIPA 4RZ2A 3PEYA 1S1MA 2HT6A 4Q5IA 721PA 4GZMA 3QF7A 4PZLA 5SZKB 4H9GA 2V4ZA 2PEYA 2VTKA 3E2IA 2IEYA 2WWGA 1KZGB 1YE8A 4RZUA 3U4QA 2XZLA 4IOKA 4YQFA 4TYQA 2FMXA 1FQKA 1KHTA 5F98A 4Q02A 4TMTA 4URUR 4DEXA 2Q9AA 1RRCA 4G5OA 3ZIAD 4EPXA 1G7SA 2J46A 4DT1B 3QSYA 3CF6R 2ZRGA 4N1AA 5EXSA 1Z6TA 4A2WA 4RJLA 3WNDA 2JLQA 2W2VA 1XPRA 4C2UA 3LBHA 3AM1A 1WB9A 2HLDA 1TU4A 2W58A 3KJIA 3X1ZA 1GNPA 1GFIA 2NO7A 2ZI4A 3SYKA 5CB8A 5J47A 4ZCMA 4BFYA 1OH7A 1GAJA 2DFKB 4DXAA 1Z22A 4PAMA 1OHHD 1AGRA 1E2IA 1ZM7A 3B1YA 2HDNB 4PHGA 4JL5A 3ND8A 1XU4A 2GZDA 4ZO4A 1WF3A 1KI3A 521PA 5EE1A 5GJVC 4KITB 4Q7JB 3QE0A 3GCGA 1CULC 1VMAA 3TJZA 3K1JA 4TQAA 4Y0VA 2IWHA 4KLNA 4LHXA 4M1MA 2QENA 1W0KA 2XTZA 3GP8A 2ONJA 2DCUA 1VG8A 2G1JA 3I72A 3FHTA 1NMXA 2YYZA 1KJZA 2WSSA 1E1RA 3D3QA 3TRFA 4A8JB 3PXGA 3HR8A 3PENA 5BN4A 1KO8A 3AGPA 3HU3A 2XTMA 3SU8A 2QRNA 4IRUB 3V9PA 5FBVB 3D6TB 5J4YA 2UZ3A 2IYXA 2LCFA 1YU9A 2BBOA 2WTUA 4M9ZA 5EZ6B 3TGPA 4V0MA 4PQYA 4QBFA 1NLFA 2CL6X 2WMOB 2F55A 1HYQA 1Q57A 3SR0A 2HEIA 1UBEA 1IN7A 4XSHA 1GG2A 4LRWA 4AKGA 4LHZA 2A5FA 3NBFA 4DJTA 1PLLA 2PMKA 3VX4A 1DTSA 3VR4A 2C9OA 4D2IA 1SHKA 1KY2A 1ZM9A 2YKGA 1DARA 1DAMA 1ZNWA 4JIMA 4BFTA 4E09A 2IYVA 1G4UR 1XX6A 5FOWA 3CWZA 5HR5A 2QN6A 1AS2A 4LPSA 4NL4H 4YONB 2QAJA 3ECCA 2DR3A 1Z2AA 2XJ4A 4CZ2A 5EXTA 1KI4A 1NF3A 2XNSA 3H2YA 4D0GA 1ZAKA 1UFQA 2G3YA 2NMVA 3RVBA 1A2KC 1Z29A 3EW9A 2XITA 4B43A 2EFHB 4C4PA 2OBLA 1JXOA 1D2MA 3AF4A 3ZYCA 2NIPA 5EUQB 4A8JC 4F4CA 1SVWA 1XEXA 2QROA 1TQDA 2W6ID 2PMDA 5B64A 1W44A 4LPKA 2J0SA 5DI3B 3EZ2A 3NIBA 3QBVA 4TMZA 4CT5A 1M8PA 2V7QA 2ZSDA 3RANA 1JALA 1E2MA 5FTLA 1G3IA 4UNRA 3K0SA 2G88A 5FBLB 4CVNA 1MO6A 1NVXQ 2JJ2D 1UBFA 3ADBA 1US8A 2GK7A 2ZIAA 3EIQA 4HUQB 4MGYR 3TNFA 2IYRA 1NIPA 2YC4C 1W4BA 4X8OA 2ZE8A 2OLKA 3LFUA 2RMKA 4JLVA 4RCYA 5HPYB 2RGAA 4Q9JA 4DRZA 5AUOB 2ZSAA 1ZRHA 3MJHA 5EE5B 1W4AA 5F2EA 4WW0A 5JEEA 2V3CC 3ZJYA 3IQXA 4MKGA 1TX4B 3MSXA 4OHYA 3UMSA 4UQOA 5JWRA 1XD2A 3O8DA 1F2UA 5BWMA 1KIMA 3VU9B 2V55B 1CR0A 1L7VC 2VBCA 4DDTA 1Z0FA 2AWOA 4DIEA 3ZVMA 5C1BA 4M9SA 5TARA 1P9RA 3DM9B 2YHSA 4P4TA 2GETA 1FMJA 1CR4A 4JBYA 3IHLA 1XFAA 4LCBA 3KTAB 5HZHA 1DAIA 1NRJB 1ZUHA 3LW7A 1LS1A 5KTYA 3ADKA 5KNCA 3BBPA 1TEVA 1AS0A 5FI0B 4LC1A 2GCPA 1VG1A 1M34E 1W0JA 3IQWA 1B0UA 3KXIA 1G4AE 1VG0B 3IUYA 1JAHA 2BKUA 4MGIR 4IEIA 4O25A 4R71A 1KSJA 3L0OA 4JVLA 4B47A 2J0QA 3K70D 4L5BA 1W47A 5JJLA 5E95A 3KKPA 4HLUC 4NKRA 4QBGB 4ZKDA 5HCNA 4PPQA 3HJNA 5JMTA 4TSFD 4AG6A 4JLBA 2OXRA 2ZANA 3WP0A 3HWSA 3LRPA 4C0SA 1QHHA 1ZNZA 2QRZA 4PTLA 2A5JA 1R0WA 4PANA 5CIQA 2Z5FA 1DAGA 4OYHA 4Q00A 1N6KA 3AKYA 1E94E 4LJ7A 2ZUBA 4URZR 3OFND 2J45A 5FOTA 1MV5A 1E2LA 4QC2A 2ZQ5A 4IOMA 1WBBA 3BB1A 2G6BA 4TLCA 3SFVA 3ZQJA 1O87A 2ODWA 4MRRA 1T3HA 1TQ4A 3GFTA 4RD3A 2J5XA 2WOOA 1NG1A 2YZ2A 3Q9LA 5SZIA 1SXJB 2PT7A 5J4HA 1Z0AA 2RAPA 3U2QA 4EJSB 4JMPA 1DPFA 2QAGB 2MSEB 1VCIA 2CJWB 3E5HA 4L9WA 4UJ5A 3N70A 1KMQA 2QP3A 4B48A 5HCIA 3N2IA 1Z6XA 2ZITA 2VPPA 1P2VA 1FX0A 4NYJR 1PUIA 2KB0A 3ASZA 4JL8A 3T5GA 3R9XA 3PUWA 2R62A 4KAXA 4P4SA 4DUGA 5FPTA 2KE5A 4MRVA 1EESA 2GESA 3GLFA 3BIFA 1UDWA 3B2EA 1R2QA 2WAYA 2FSHA 2I1VB 4DDUA 5DSZA 5UKDA 1D2EA 2ODBA 3LWNA 4C9BA 1M2OB 1M7HA 4DLTA 5FUVA 3RRYA 1DS6A 4WOPA 1VIYA 1W48A 2F9LA 4F7WA 3AVXA 4R7ZA 3W8RA 4TLDA 5JHGB 1G19A 4HDOB 2IF2A 5EE3A 1E4YA 4JLDA 1SXJD 4ACAA 3TMKA 5FUXA 5G40A 1GRQA 4LC0A 4TT3A 2GA8A 4Y0AA 5KPDA 2V6IA 1FFHA 2I4IA 3LV8A 2EW1A 4PC1A 1SXJC 4FMCB 4Q18A 3O8CA 1E69A 4EJSC 4JZKA 4KLZA 2QAGC 3KQKA 4S2EA 2BKEA 2FZ4A 2FSFA 2FH5B 2P6UA 1SKYB 4XD7A 2CL0X 1KDOA 1IAQA 4HAZA 1RYFA 2F3RA 3A58B 4BPBA 1ZU5A 1JECA 4QXAA 3VR3A 1X8LA 1NVVQ 4B35A 4HI0E 2FZLA 4JJZA 2Q9CA 4L15A 3NC1C 1NMYA 1HT1E 3QVVA 1E98A 4LBZA 4JLMA 1OSNA 2AK3A 2IXEA 4JYCA 4Z1MA 2FEOA 1G41A 2OCYC 2ZI3A 4B3BA 5ELXA 2OG2A 1MABB 4XWOA 1I2DA 2Y8EA 3LQRA 4GMXA 4C0JA 3HPRA 2GJ9A 3B85A 3OHMA 1P62B 3WNBA 2XZOA 1M7BA 2H17A 2C96A 2QMOA 2XSZA 2Q9BA 2PT5A 1QHSA 4LGMA 2QA5A 4JLKA 4OQXA 5FUYA 2QZ4A 1FNMA 4ON9A 4ZKEA 4M1KA 4OJKA 3UIEA 4PFSA 5BYKA 1YRBA 1FW6A 1KI8A 2RGGA 2HYDA 2O8DB 5D3MB 4GBMA 3KKOA 2GAOA 4ZV4A 4MRNA 4DDVA 1R4AA 5DE3A 3TAHA 1XTQA 2IXFA 2P6NA 1S8FA 1AQUA 2RGCA 4GOKA 3BFXA 4D25A 3LW8A 1Q1QA 5FPHA 3UANA 2GCOA 3K9LA 2YVUA 3QG1A 2AFIE 4YMSA 4PHFA 5H8WA 3AVUA 1F2TB 2WJIA 3GPLA 3LY5A 1NL3A 1YR8A 2GXAA 2OZEA 2W83A 5EP3A 3L8YA 2WIBA 3CX7A 3QQ5A 2X8AA 3VKWA 1Q12A 2JIZD 3NKVA 1BIFA 4ERNA 1OF1A 3JZAA 4LDJA 4BLRA 1RJ9A 1ZNYA 2ZM5A 4Q19A 4LX0A 4RD4A 121PA 2WWIA 4J0QA 4KYIB 2JJ1D 2ZJYA 3GEHA 2CHVA 3OZXA 2GVDC 4JYBA 3TQFA 2VF7A 3GJ0A 4ASUD 2A78A 2IYLD 1JJVA 1UEIA 4DLZA 1H65A 2VEDA 1P3JA 1Z6GA 3QXXA 1KGDA 3TVDA 2J7PD 4OHZA 2AWNA 2JA1A 2W0SA 4LBVA 1KDRA 4D0NA 1Z0JA 5IK2A 4B73A 1I4LD 3ADDA 3MJRA 1EX7A 3B9PA 4TZ0A 1TQ2A 4MYUA 1MKYA 2ZJ2A 2DFLA 4NDZA 4NZYA 5AJVB 3RRMA 1CRPA 1N6OA 3EPHA 1FTSA 1J70A 1F5NA 2WAXA 1X1SA 2REOA 2BV3A 4LBYA 1S3SA 4ZIRB 4OK3A 4A2PA 2WWHA 3OAAD 4LJ8A 1SHZA 2Z43A 4QM6A 1MR3F 5JWOA 2P5TB 4BFZA 1ZD1A 4JLPA 4QHTA 1NVWQ 1QHXA 4F4IA 4RFSB 4BEJA 3GEEA 2ZJZA 2RGNA 3GLGB 2F1RA 4D6PA 2NTYC 4MKIA 4QM7A 3HR7A 1N6IA 2RGDA 3OEHA 3KZ1E 4YDSA 1OXSC 2I3BA 5SZJA 1T0HB 4KO8A 2WBLC 1OHHA 3SC3A 4B3DA 4NYMR 2QGNA 1JEDA 3EZ7A 3B6EA 3FVQA 4US2R 1F60A 2Z4RA 3NBZC 3BORA 1N6NA 8OHMA 4NYIR 2J1LA 2FFHA 5FTKA 2O0JA 2UVQA 1G5TA 4FCVA 5DN6D 4BLTA 1GTVA 4FI3C 2BJWA 2Q3HA 1M74A 2GJKA 5L3RA 2BIFA 4BLQA 2CVHA 2A9KA 4AKIA 3U60B 1MOZA 4K81B 4LJ5A 3QXJA 1BMFA 5JBQA 1LFDB 2VP0A 2GWHA 2JAQA 3AP2A 3K09A 4JKIA 4NU0A 4PC6A 1VKJA 1FZQA 2QMHA 3NH6A 2BWJA 5TXGA 2X2FA 3NBYC 1E2KA 4IHQA 2O8EA 3K0FA 1II8A 2CLSA 2ZYVX 5DNYB 3IIKA 3AGQA 5G53C 3BWDD 1SQ5A 3A1SA 4B2IA 3X1XA 3THYA 2EWVA 1QHIA 1NMZA 4NMMA 1YZQA 1P2SA 1G17A 3CM0A 1E2DA 3PUYA 2YC2C 5FFMA 1QHGA 4NH0A 3SEAA 4KVAA 5BQ5A 4E07A 3I5XA 2GF0A 4HB0A 4KFSA 5LB4A 1E99A 2NZJA 4IDNA 2EFGA 4M9QA 1HURA 1Y3AA 4N0DA 2WJHA 4JKYA 4NYMQ 1JXMA 1P75A 4EPYA 1NN1A 2H1LA 1IHUA 1Z47A 3A36A 2ZYWX 3CIOA 3SYLA 4V0NA 5TV2A 5CJPA 2QPTA 3E1SA 2QBYB 1SVKA 1NN3A 4P4UA 3RSOA 4PQRA 1QVAA 3BB4A 2J0UB 3QEOA 5K8IA 2VP2A 2OE2A 5F9HA 4MRPA 4Q1AA 3I62A 2BMEA 4TL8A 3EG5A 3DVLA 3T1QA 5H68A 3VX3A 5JWHA 3HU2A 2YOFA 3B60A 1XXHE 1ELOA 4M1WA 3QPVA 3W5JA 2B21A 1NP6A 1J2JA 4TYPA 4F38A 1OIVA 1KJYA 1NY5A 2NPFA 1D2NA 2QP9X 3KUCA 3ZVRA 2ZRAA 2JLZA 3TUIC 4M1TA 2QGZA 2ZI5A 4OK5A 1CR1A 2W6IA 1VCOA 3PCRB 2YWGA 1Z63A 1SVSA 5C2JB 4IDPA 2YWEA 3LD9A 4FINA 2DBYA 3KL4A 4LYAA 4EUNA 4WXPA 3RDPA 2DWPA 1C4OA 3P20A 5TMPA 2FPLA 2ZS9A 3IBYA 3MLEA 5KNDA 3CW2A 1G7CA 4DC9A 3M4YA 2O52A 3EZ9A 4P32A 1DG3A 1TPZA 4MGZR 5IHPA 3A1TA 1C9KA 3NHAA 4XWKA 3HDTA 2R6DA 1I4TD 4TTQA 3AQ4A 1GKIA 2C98A 3P1JA 1BH2A 2J0VA 4G01B 1ZMXA 4HZIA 1FP6A 4TTRA 1LW7A 3AP3A 2ZRIA 2BHRA 4GMDA 4B3GA 4MYTA 4B2LA 4EQ6A 1E0SA 4OQNA 1WCV1 4AYTA 2PX0A 5DGXA 4IEEA 1PJRA 5J40A 3U7GA 4CW7A 3WRXC 2Z4SA 4KSCA 5AJWA 1RZ3A 3S1AB 3K0AA 5IT5A 3FOZA 2QORA 2KJQA 1NKSA 2AHOA 1FMLA 2B7CA 4HAVA 4CEIA 1NSTA 2DY1A 2A30A 3ONWA 3TW4A 1JBKA 2R44A 4PO9A 3KKNA 3B13B 2CK3A 2QUZA 5EE9A 5P21A 1ZBDA 3VFDA 2JEOA 4QNMA 3W3AA 4YMVA 4JVMA 5B57C 5JLJA 1OT3A 4G0NA 2QPAA 1E0KA 4Q9HA 1GDDA 3EIHA 4NCJA 4M2LA 2EFDB 2FPKA 5GJWC 2OAQ1 4A82A 1NVUQ 1OFIA 1RRPA 2WV9A 3NG1A 3J81k 3CWQA 3OIWA 4RZ3A 1G3UA 1XB2A 5DI9A 3I5YA 2A2ZA 2WOJA 4KHZA 5FL3A 5KDDA 5CM9C 1P60A 4S35A 1U9IA 1VCMA 2VQSA 3RABA 1G8GA 4PC3A 1EFRA 1W4RA 2OLJA 4CEHB 1U81A 1TL7C 3K8YA 3ICEA 1NLYA 2GBLA 4GRAA 2QG6A 1IOZA 2XXAA 4QFMA 2ERYA 3QIAA 1U98A 4L8GA 4C0BA 2VH5R 5F9FA 2UKDA 3ND9A 4TQ9A 3SOPA 2CNWD 3ZS8A 2IX3A 2D7DA 4G3XA 5F3WB 1DO2A 4DSOA 3R7WB 3QKRA 1G3MA 5J4VA 5JI2E 4QHYA 2AX4A 1OXVA 1AKEA 2ZRCA 4JS0A 2J3EA 1ZU4A 1Q21A 2OM2A 2ZJAA 5G41A 3VKHA 1T8TA 3EIEA 1E2FA 4HLCA 1HEIA 4LI0A 2YOHA 2ZRNA 1WQ1R 1S3GA 4UJ3A 1E9BA 1WBDA 1WXQA 3WMEA 4LY6A 3CX8A 4Q4AA 5G3ZA 3IEUA 3AVPA 3GLHE 3NDBB 1EX6A 1GOTA 1KNXA 2XOKA 4QGFA 5D3QA 4PC7A 1KKMA 3K9HA 4BFXA 1KI6A 2BOVA 4ZDWA 1XEFA 3VNUA 4PHHA 3LVRE 2WJJA 4AKHA 2JASA 4LJYA 4FXPA 1P73A 4I1UA 3QEJA 3U7FB 3RC8A 1NBME 1XD9A 4KXFB 2GJAA 2WHXA 1OIXA 1IJEA 1RKBA 1F3OA 1Z2CA 3I1FA 4WXRA 5DO9A 2CCGA 4KFRA 5LBIA 1YHNA 2C04A 3LBNA 3D8BA 2ZSEA 2D06A 2YOGA 4N0EA 1UADA 1E2NA 3BXZA 1R10A 2IHBA 4Q1CA 4X8HA 4W7SA 4RVCA 3L8ZA 1G21E 1DAHA 2VHCA 1DOAA 2XAUA 3FYHA 1L2TA 3LBIA 5GJCA 3TLXA 5FOUA 2LKDA 2ZE7A 3WMGA 4R2IA 3KXKA 1NJFA 1XCMA 4OHWA 4LHYA 1F48A 2CEAA 3HPQA 3CZQA 2JLWA 2O8BB 3B5JA 5KPJA 3SYNA 2ATXA 4QHSA 4Z51A 2F43A 2WWYA 4L4UA 5HTKA 3AVQA 4UNNA 2OCPA 3AF3A 4M4SA 4AD8A 4FMCF 4KSBA 2WWXA 4HLQB 2RHMA 4YMTA 2P6RA 4KBFA 1RW4A 2ZPTX 2B7BA 2YWHA 4IXMA 5FBWB 4MYCA 5JSZB 5FOXA 2J9RA 4DLXA 4KI0A 1KTVA 2OBNA 4TMXA 4RKFA 1CLUA 2ZE5A 4B76A 3VKGA 5AK0A 4CEJA 1N0UA 3T15A 1XTKA 1JB1A 1XMIA 3MFYA 2ORWA 4WVFA 5KSPA 3DPUA 5FTMA 3A1WA 5EP1A 3DMDA 3PJRA 4Q1EA 5EE0A 2FGJA 4TWZA 1B23P 2EWWA 3MAAC 4O2RA 5JS7A 4C3ZA 1GZSA 3KJEA 4A0RA 3ZZTA 1RRGA 3FMFA 3LDAA 3UPUA 1OKKA 2GXQA 2WSMA 1N2CE 2PX3A 3SJBA 4TYWA 2B8TA 2HUPA 4ITRC 4M1SA 3RS0A 1A1VA 3T1TA 1H8EA 1GUAA 2ZRHA 2ZJ5A 4LYJA 5FR2A 2C8VA 4QBHA 5H70A 5FPSA 4QGGA 3C7KA 1IY1A 5FR1A 1H8HD 1L8QA 1R0YA 1VHTA 1I4DD 1ZNXA 3QF4A 4Z8YA 3SN6A 2NO0A 2AL7A 2VA8A 4ZDKA 4AWXA 3PQCA 2MSCB 4KFUA 4PAQA 1S4QA 1W5TA 5FUWA 3ZZ0A 3EAQA 4DWJA 1R7RA 3R9WA 4QJ3A 1FP7A 4FW9A 3PITA 4ARZB 2E1RA 1EFTA 1CU1A 2ZRDA 3A1VA 4HDQB 1COWA 1GP2A 1GRRA 1X8JA 1GVNB 4JVNA 3BJIC 4PPNA 2YINC 2NGRA 3C15C 3RS2A 2ZS8A 4C7OA 2CDNA 3BE4A 1LB1B 3O47A 4Q4HA 1W46A 5L3SA 4DDWA 4E03A 3OIYA 2CVFA 5L3QA 4RD1A 4MYHA 4DCSA 4QRHA 2W6JD 2O8FB 4V0LA 3UATA 5JI3E 3FWYA 3GJ3A 4DSUA 2GEUA 1GKUB 1G64A 2I1QA 2JJ1A 4JVSB 3GLIB 2CCJA 1E9CA 4B33A 1Z5ZA 3EC2A 2HCBA 3CR7A 3I3SR 5HE9A 4Q4LA 4EKDA 4TZ6A 4ASUA 4IDQA 2HT1A 4EFMA 4RCZA 3TUZC 3LVQE 1VYTA 2WM9B 1I2MA 5CLQA 1CJUC 1Z6AA 2RGEA 3GJ4A 3QXCA 4BFVA 2J7PA 5EQTA 3WYFA 2ONKA 4GOXA 4EPWA 5KDOA 1XMSA 4Q1DA 4Z54A 4AYWA 4HEJA 1E1QD 4NCIA 2ZI7A 4DCUA 4DCVA 1AQYA 4US0R 4XOIA 1P7CA 2F1HA 3U4QB 2ZTSA 5IF9A 3FPAA 4IFBA 3QKUA 2WKQA 1XXHA 2J59A 1AJEA 1HUQA 4TYYA 3Q72A 5E7MA 4KYUA 4A6PA 3OAAA 1GRNA 2PJZA 4KJZA 1P2TA 2QY9A 4GT1A 4MKHA 4IDHA 3GD7A 4HB3A 3HYTA 1OFTA 3AF0A 2Q21A 3K0CA 1KDTA 5A4JA 1YR7A 2LWIA 3ZD7A 3G0HA 1YZKA 2WMNB 2ZJOA 1TMKA 1HH4A 3WMFA 2P3SA 3SI7A 1QG2A 1D9ZA 1BO6A 4TMWA 5E7JA 2WICA 4LYHA 2VIIA 2V6JA 1NI3A 2ZYTX 2FN4A 2J87A 4I4LA 5DISB 1D6JA 1Z07A 3HYRA 2FJUA 1ZM4A 2CL7X 4N3NA 2IBMA 4M22A 5EZ5A 2VO1A 1JJ7A 3G5UA 1PVOA 1E9RA 2PL3A 4A15A 2WWWA 1UEJA 4CDGA 3GFOA 1SVMA 4A0HA 2QM8A 4C0QC 4D81A 1KKLA 5GADl 5JHHB 1A5TA 2ZRBA 4BQSA 3LA6A 1DADA 2B92A 2LKCA 4M9XA 2JATA 1DBSA 3CBQA 3CKLA 1TUEA 2GRJA 4D4JA 2V9PA 2QE7D 3DOEA 1YRAA 3TAUA 1NVVR 4PQFA 1U94A 5CYOA 5B2ZA 2R2AA 3K9GA 3KQNA 1UAAA 4W9MC 2QEQA 4TQUS 3U6BA 2CMKA 2ORIA 2GHIA 4NCKA 5HKKA 3NHBA 3PUZA 1Q1ZA 2HLDD 2P0EA 2QL6A 2R65A 3V4RA 3Q3JB 2IYYA 2WWFA 2ZJ8A 3I61A 1TF7A 4XJXA 2DPXA 1EFCA 1XPUA 1AKYA 5GVSA 5KO2A 1R0ZA 1OE0A 4QNRA 1V5WA 4PO1A 2RB4A 4MKFA 1YZTA 1OYYA 1ZM3A 4ZI3A 1IBRA 4EIWA 2HYIC 1VYUA 1S9DA 2NO1A 2YV5A 3DOFA 4HZUA 3T35A 4HSEA 5CM8B 5FH9A 1CP2A 1HE8B 2OAP1 1VHLA 2ZAOA 2QT0A 3QJYA 3KB2A 4P31A 5DHFA 1ZM2A 5AJYA 5BYJA 4C0HA 3CF2A 1XTRA 3NXSA 3T06B 2Z6VA 4BLPA 3H84A 1YZGA 3EARA 4OQLA 1CRQA 5JZVA 3EZ6A 1YKSA 3HP1A 4ZDIA 1X8KA 3W6NA 4D4LA 4TN1A 1IJFA 1KK3A 2ZE6A 1E4VA 1E1RD 1J8YF 1UBCA 1N6HA 3MWJA 2MSDB 3OEED 4O0MA 1KSFX 1TNDA 1ZUIA 2QTFA 4O2LA 3EA0A 1S2MA 3UG7A 1U8ZA 4WAUA 3EZFA 1U90A 3NBXX 1FPMA 3PV0A 2KBFA 1BS1A 2BMFA 4JLOA 1Q44A 3MGCA 4XH9B 1WE2A 4PSAA 1TADA 1XEXB 4PXAA 5FTJA 2O8CA 1C1YA 1ODFA 5CLLA 3LQQA 1S0UA 3RS5A 4MH0R 5BXQC 2IXGA 4AYXA 3EASA 4L9SA 4GNKA 1KJWA 5TDHA 3A4NA 3M1IA 3GLHA 4W5WA 4DLSA 1K8RA 4RD0A 3LX5A 1ZUNB 2WZQA 1T91A 3LXXA 4DEYA 2ZVQX 1US8B 4UNPA 1P5ZB 3TSWA 4F92B 3F8TA 3WHKA 3I8SA 3TUJC 1AM4D 2IF0A 3B1VA 2XGJA 1Z6YA 4K8OA 1NBMA 4YLGA 3CO5A 2XJ9A 4XWAA 1OFHA 1PZNA 4V0OA 1G18A 4XIGS 1XD2B 4EPRA 3CUEF 1F2UB 4OK6A 2RCNA 4WBSA 2C2HA 2ZRMA 4OHVA 1V43A 1QZXA 4U02A 3QPWA 1IM2A 4UXHA 1CJMA 2QM7A 2OEPA 3TBKA 1PUJA 3TIFA 4XVUA 3A6PC 3M6AA 2F1JA 2RGXA 5CK5A 1MRSA 3KDSE 1EWRA 3L2OB 1ONBA 1AN0A 3DZDA 1TTTA 1XZQA 2BM1A 2F6RA 4HDCA 4QGHA 4ACBA 3MWKA 4CRWB 1XP8A 3BERA 4RZXA 4BRWA 3FFAA 1MO5A 5FL7A 5KHOC 2FOLA 1KO7A 3QXHA 4LJAA 4A0GA 4B6EA 2XNDA 2NOAA 3AVVA 1KO4A 2BEKA 1SXJE 3IGFA 1LNZA 4XTRA 1NIJA 3G82C 1LV7A 1PLKA 1BKDR 1GIAA 4LHWA 1E96A 1EK0A 4IXNA 4V02A 2JLYA 4DB2A 1A4RA 2REBA 1QHHB 4B6FA 3OF5A 3WNCA 3KX2A 4CT4B 4GZLA 2IWRA 3DZ8A 4OI2A 4GP7A 1OXTA 3LAWA 4ZCLA 1P2UA 4YC7A 1RVDA 3PUXA 2FU5C 2C95A 3B9QA 1IY2A 4MITA 4DLYA 4NHOA 2CNWA 4QBIA 2XEXA 3THXA 3AF1A 1N5IA 1XNJA 1XCGB 3ZIAA 2BBWA 1KY3A 2JCSA 2ZRLA 2QTVB 1HQYE 1OXXK 2ZSFA 5TY0A 4MRSA 5J4LA 2R6GA 4KV9A 4FCWA 5L8VA 2VSXA 4TLBA 2G77B 3PVSA 1E3MA 1XWIA 1KOFA 3CB4A 2QP4A 3CPJB 3QOFA 4UKDA 4BZXA 4GL2A 2ZI9A 1VECA 1HA3A 5FPYA 1ESMA 2X1VA 2ZR0A 1KMHA 2OBMA 3P32A 2VRWA 2H18A 1E79D 4JSTA 3FHOA 6Q21A 1FX0B 1EFHA 4Q4JA 3U5ZB 3Q5EA 2IYZA 3BFVA 3DO6A 3I8XA 4P4SB 3QKSA 3GLFB 2VP4A 2HXYA 3C4JA 3RS4A 2WKRA 4YMWA 3QBTA 2BC9A 3R8FA 1T0JB 1GSIA 2IYUA 3QUSA 1R8QA 1UF9A 1ZIOA 3KJGA 1CS4C 1JNYA 1EGAA 1SKYE 4GP6A 2QQEA 1ZCAA 5AUPB 2QMUA 3QI2A 2ZUCA 1EWQA 4OQMA 1OFUX 4D0LB 1G16A 1L4UA 3D31A 5AJZA 4UNQA 3VHXA 4CF7A 2DYKA 3UMFA 1ESNA 2O0KA 1KK2A 2RKOA 3VMFA 4CGZA 3AKEA 4BFWA 3EXAA 2BBSA 2GKSA 1XTIA 3GFPA 1R0XA 3BC1A 2YNMA 5IRCD 2BCGY 3LLUA 3U44A 1UDXA 3W6OA 1U8AA 1LF0A 4EFLA 2R6CA 1JPJA 3KKQA 3T61A 2PZEA 2ZREA 5BW8A 5CB6A 1II9A 1Z83A 2PZFA 3RYTC 3TSOA 1S1CA 2IHYA 4JLJA 1G5RA 2P65A 1DAEA 5KSYA 2ZETA 4QG7A 4BE7B 2PLFA 4JT4A 1S96A 1IXZA 1T9HA 1XJ0A 2P5SA 1UKEA 5C4MA 3MRSA 2VL7A 2P2LA 3VR5A 5K8TA 1NNEA 4IVQA 2Q6TA 4EFNA 4H1UA 2N46A 2ERXA 3B1ZA 4QOSA 1S9HA 3WYAA 2QQ0A 5K8LA 3LX8A 3QENA 4F93B 4RSGA 1K5GA 4TYNA 1LS6A 1XEWY 1TF5A 2C78A 4HAWA 4Q66C 3ICQB 3SNHA 4JLAA 3U3OA 1XBTA 3L0PA 3N5CA 5KYKA 1Z0IA 4IW3B 3ADCA 2GK6A 1FNNA 2BMDA 2AKYA 5DLQC 4A8JA 5CITA 4TT3D 4Z8XA 3AKCA 1FTNA 4LHVA 3SHWA 2D62A 1GL7A 2GXUA 3AVOA 4NBSA 2N42A 4RD2A 4PZZA 3ASYA 1FUKA 1P72A 3I92A 5GVRA 2V1UA 2GCNA 3U6KA 5JS8A 1N5LA 3F3YA 3Q8XB 5KDLA 2REXB 2R8RA 2WIAA 1Q22A 3DM5A 4Q7LA 3RWMB 4BLSA 4BWYA 4U7DA 2PEZA 4BGDA 4EAQA 1Z3IX 3W5IA 3OE7D 2AD1A 4GI7A 2OILA 1OB5A 4W5JA 4C0LA 1ZC3A 1JQLB 2AFHE 2A5DA 4QGAA 1NJGA 4EPTA 1X6VA 2JJ2A 2QSZA 2JDID 2GCOB 3CF0A 621PA 1IXSB 1W5SA 2FEMA 4D4MA 4HAXA 1W2HA 3W6PA 1OW3B 1OLOA 2G9NA 3T34A 2EYUA 1HV8A 2F3TA 3P26A 2BMJA 4B71A 2F9MA 1CF4A 4JBWA 3L0SA 1BYUA 3TQCA 1CBUA 3P4YA 4PPGA 1E9SA 3R8CA 1QBKC 2PZGA 4MUAA 2W6JA 4BFUA 4B3XA 1RJ9B 2K5UA 2OV2A 4A1FA 4DLVA 1K5DA 2B6HA 4HLDA 4IKEA 2BM0A 2XSZD 1ZD8A 1W7AA 3PEWA 1G6HA 2DWOA 2PH1A 2Q3MA 4MQBA 2HF9A 5DHAA 1CIPA 4X8LA 1XRJA 1JR3D 2JGNA 3AKDA 4G5SA 4Q48A 3SFZA 3OESA 2D3WA 1YR6A 4LOAA 5DI3A 1XJQA 2XB4A 1N25A 3FGNA 4HLUA 1E0JA 3IIMA 2Q0HA 1GNQA 2ZUDA 1E1QA 3GLGE 1J8MF 2IK8A 2FWRA 1OV4A 2XTNA 3H86A 4WZBE 4HUQA 1SVOA 4FCTA 3AF2A 1AGPA 3PUVA 1AK2A 3PFIA 3WP1B 2AXNA 3IPYA 5SZHB 4TSFA 1CKEA 3A4LA 3M0EA 3ZQ6A 1WP9A 4RFVA 1T3LA 2DHRA 2NO9A 3VNVA 1DVRA 4E5UA 2IA5A 5LD2C 2IS4A 1ETUA 2F7SA 2FA9A 2R9VA 3MUFA 3VU9A 1KO1A 4G5RA 3EPJA 421PA 4FN5A 3OFNA 3WBJA 3ETLA 3GMTA 5TB5A 3EPLA 2CHQA 1DE0A 1G3RA 2H7VA 2FSIA 1BYIA 1J90A 1E2QA 2IUSA 2VF8A 1II0A 1GKYA 2GAAA 2ZR9A 1E2EA 3KTAA 1ZCBA 2FFBA 3C8UA 2YWFA 1WRBA 3E70C 1UKVY 2BBTA 1NN0A 2OCAA 2FGKA 4AC9A 2KWIA 4NE2A 4PHTA 1P6XA 1U8YA 4TLEA 1OH5A 1ANKA 3UG6A 4M8NE 3V4FA 2UZIR 2V54A 4ZPXA 5IK2D 3GJ7A 221PA 1T5LA 2PLRA 5JJIA 1Q1BA 1A2BA 4JBXA 2NO6A 3ZZUA 1Y63A 4ZCIA 5FOSA 3EWAA 4G1UC 4AURA 3VAAA 3TH5A 2QE7A 1E6CA 3AVYA 2NZ8A 1R5BA 4DSNA 1AA9A 3DKVA 1UKYA 1UBGA 3NDPA 2O8EB 4IJMA 3K0FB 1CJVC 1II8B 4Q21A 2DB3A 4P3YA 3T1OA 2EU8A 3PEUA 3F5FA 3U44B 4U00A 1TEXA 1R6BX 3THYB 2CE2X 1GWNA 4NONA 2BDTA 1CJKC 1U99A 3RRZA 1DEKA 2ZYUX 1E2JA 5AR1A 3P4XA 4B75A 2CHGA 2AR7A 3OEHD 4LBWA 3TVTA 4Q1FA 1W49A 2OFWA 2J7KA 1SXJA 3FB4A 2RGNC 1GL6A 4EJSA 2OT3B 4OI1A 2QAGA 1GITA 4LK2A 3AVWA 1RYHA 1JR3E 1Z06A 3QVUA 4KODA 2CJWA 3CRW1 3CX6A 2ANCA 3K53A 4C30A 2CLDX 5TVKA 4E22A 4HUTA 2GDJA 1DG1G 1OIWA 4KCGA 3CPHA 3FDIA 4AK9A 3U3RA 1NKTA 1VCNA 2H16A 3DHWC 3RSLA 4B34A 5EXXA 1R5OA 4LJ9A 2IS2A 2PCLA 4A92A 2D4HA 2GNOA 4JJKA 1BMFD 3RAPR 2IC5A 1HE1C 1Z08A 3SQWA 2QSYA 1Q3HA 3DKPA 2ZRPA 3W3ZB 1P4SA 3UWKA 5LDDC 1UM8A 3OEEA 1VIAA 1VYVA 1QRAA 2BCJQ 3L82B 3OIUA 2A7QA 5A5GA 3THOA 2C77A 1E9FA 1KK1A 1SULA 1Z0KA 4G5GA 3VR6A 3BAFA 3K09C 3RLFA 4URXR 3L0IB 1IN6A 4XVQA 2ZR7A 5BN5A 2QT1A 4OBEA 3RNLA 1MO3A 3IDQA 3H1TA 3CH4B 2X19A 2PBRA 5FPKA 3DL0A 3U61B 5B30A 3ZD6A 4HAYA 4LYFA 3WRYC 4YXWD 1TQ6A 2C5LA 4PPFA 4DLRA 1QHNA 1XPOA 5C4GB 4QL3A 3T5DA 1W2GA 2JLVA 3MG9A 1L4YA 3N2EA 1ZJ6A 2Z83A 5KNBA 2WPDD 4A2QA 3BFKA 4JLNA 3PG5A 1JR6A 2IL1A 1NY6A 3CNLA 3CRQA 4FWTA 3EC1A 4HAUA 2J41A 3MD0A 2A3RA 2ECKA 1XTJA 2EQBA 4BEBA 1DO0A 3THWA 4OJQA 2ZU0C 3SBEA 3AB3A 3CNNA 5KSZA 4PSKA 4GSYA 4PO8A 4EQ6B 1YQTA 2IW3A 1N6RA 2ZI6A 1N0WA 4JT2A 4LUCA 2FFQA 1E9DA 1EG7A 2G0NA 5CJ2A 3EWSA 5EUMA 1N0VC 1MABA 4DLUA 5J5CA 2B8WA 3A37A 1Q0UA 3K0AB 5M04A 2ZEJA 1ZYUA 3KQUA 4P33A 3IHWA 4A0FA 1KYIA 1YR9A 4CEIB 2P67A 3U3KA 2JIZA 3KJHA 3TE6A 4A6XA 4TMVA 4NPHA 4KFTA 1ZD9A 1G6OA 2VSOA 1VTKA 3K70B 2AD5A 1E2PA 4UXJA 3Q7QA 3SHFA 3C5HA 3BK7A 5EJEA 4U5XA 4POAA 1G7RA 1JEEA 4MGKR 3UKDA 5FBRB 5FTNA 1YZUA 3ZH9B 2O8DA 5D3MA 3CR8A 3VR2A 2QMEA 1D5CA 5HZKA 4OHXA 5CDFE 2SHKA 1Z8FA 3AUXA 1E32A 4D82A 2H5EA 1HT2E 2A5YB 2CXXA 3WY9A 4LWZA 2EVWX 3FKSD 3BS4A 3PR1A 4TL6A 3TK1A 2XXAB 2D2FA 3I73A 2ZSBA 1F2TA 3PEVA 1QHYA 3O8RA 2C99A 2VP6A 1YZLA 4R2HA 5C46F 4I1VA 3QKRB 1R8SA 1G9XA 2C9YA 1BOFA 1VG9B 3NEYA 1OB2A 2IYSA 3MWYW 2BVNA 4AKEA 1XDBA 2ZXUA 3C16C 2GXSA 3PIRA 2AXPA 2HJVA 2CK3D 3BGWA 1U0JA 4IDOA 1E79A 4FWIB 4DLWA 4Q4AB 2IUTA 1CJTC 3DMNA 3A1UA 5JCPA 3KXLA 1JAIA 3AUYA 3CRRA 1D9XA 5LPNA 3K0EA 1MT0A 1TU3A 3GJ8A 3IKJA 4P0TA 1KI6B 3K70C 4CIDA 3H0KA 1IQPA 2AK2A 1RRFA 1W4CA 2OESA 4NCHA 1QVRA 1NLZA 1IN4A 1GILA 2XZPA 4Q03A 2RH5A 2HJGA 3SDZA 1ZVQA 1EFRD 2H8KA 2GJ8A 5DN6A 5G3YA 3R9IA 5ANRB 1OH6A 2GEDA 4XTCS 5J4KA 4QJ4A 2FV8A 2ZRFA 4FMBB 3ZGXA 1T3SA 5BN3A 1U9IC 2ANBA 2ZS7A 1M1YE 1OYWA 1CXZA 4ZIRA 5GJBA 2GBLC 4HATA 3AH8A 3LXRA 4TTPA 3KFVA 4AIIA 4DKXA 1HY3A 4G5QA 4IFEA 1P9NA 3TKLA 821PA 4A4DA 4RFSA 1T8UA 1OH8A 4ESHA 5AWFC 2RGBA 4HB2A 4GPTA 3GLGA 1LTQA 2X2EA 1RC8A 2MMGA 1G8YA 4GDFA 2ORVA 3FMIA 1J7KA 1X86B 2F43B 2TMKA 2XOKD 2N1BA 1QF9A 2O0HA 1WMSA 4C2TA 4LSGA 4PZYA 3CRMA 1AZSC 2VHJA 2JJ8A 1KSHA 3B1XA 2NG1A 1IONA 4PR0A 3B7GA 1W1WA 4KU4A 4Q9LA 1MRNA 1ZP6A 4TL7A 4B3FX 2GTPA 2E87A 2GVZC 4CEJB 1E9AA 3OIVA 1Z0DA 3U7HB 2MMCA 2GZHA 5JRJA 2EYQA 1CEEA 1IN5A 1W0KD 4FMDF 1EXMA 3CRVA 3L43A 5IDVA 1E9EA 1ZC4A 2WSSD 1SZPA 2IYWA 2VHTA 3W8NA 2PCJA 3LH5A 4WZ6A 1P9WA 2R6AA 3I32A 2GF9A 4H1VA 3QKTA 3VTKA 3NTUA 4Q1BA 3B8HA 2OUKA 3A8TA 1EFUA 3IEVA 1G1MA 1VPLA 3NEJA 3IO3A 3U3JA 2FG5A 2ZRJA 4OI4A 1MH1A 4NYJQ 4ABYA 4WIAA 3QF4B 3OE7A 3REGA 3SQXA 4B44A 1LF5A 2VSFA 1QG4A 3GLIE 3THWB 3RC3A 1KI2A 4Q9KA 1XF9A 3QY0A 1NG9A 4EPVA 1RFLA 4RKEA 3WXMA 3NH9A 2HCJB 2JDIA 4DIDA 4DSTA 3TR5A 2QBYA 1KAGA 3QNUA 3HU1A 4MA4A 2W0MA 1IN8A 2JLUA 2GJSA 4IOJA 2J0UA 3VQTA 4C7OB 1LVGA 2Q3FA 2AN9A 4US1R 4Q4HB 1KSGA 3UMRA 3IO5A 3SZRA 1X3SA 3AV0B 5H1YA 3VR1A 5L3SB 3ZLJA 1U0HC 4MDEA 2QU8A 3K9NA 4AG5A 5L3QB 1E2HA 1CR2A 3I4LA 2QTHA 3FMPB 2KBEA 2OFOA 4QJ5A 3SJAA 1KI9A 5CIWA 3T1VA 1G3QA 1CTQA 1XCPA 3NC0C 4UXIA 4NTZA 4XVRA 5B58C 1A7JA 4BUJA 5FOVA 1OKKD 2R6FA 1T4GA 1Q3TA 1JR3A 1ZIPA 3IIJA 3Q85A 4RY2A 4BFSA 4HYYA 4QKQA 1H8ED 1VDZA 5EP2A 2IEZA 3CLVA 1G291 3NVAA 1U2RA 1SKQA 3REFA 4URWR 5JJKA 2V7QD 3RRNA 2Z0MA 2BEJA 4V03A 5KSOA 2VHUA 4ESVA 2VP9A 4BRUA 4MUBA 2KSQA 2C9CA 4I81A 4TLAA 1OPXA 1XXHB 3A4MA 2WJVA 3CH5A 1COWD 1FQJA 2QPOA 3GJ6A 4AY2A 1JPNA 3LLMA 4LJ6A 4B32A 5JRZA 1A82A 5KU1A 4A36A 2FF7A 2GZAA 4FD2A 3ZDQA 1YJ5A 1FL9A 4Q9IA 4XSGA 4D4KA 1G8HA 3CPEA 3AVTA 3MWLA 2OSBA 1FOEB 4TL9A 4ZI2A 1E0AA 5JECA 2ZVPX 1N6PA 4BLOA 2ASEA 4LV8B 1F6BA 1KK0A 5C18A 1N5JA 3S1AA 4O3MA 1JQJC 4M21A 5CK4A 1XMJA 2D74A 3Q7PA 4IVPA 5JEDA 4W5HA 3TR0A 2E9SA 4X8MA 2JLXA 3WYGA 1TAGA 2ODEA 4DB4A 1NSFA 1Q20A 1G5PA 1W0JD 3DDCA 1KO5A 1RIFA 3B78A 4URYR 4V0ME 2FNAA 4I1SA 5JCZA 1G20E 4PX9A 4NP6A 2H57A 3KKMA 3MMPA 3O8BA 2OXCA 2ZROA 4JSYA 3BH6A 1M7GA 4M53A 2W00A 3W34A 5EP4A 5EXPA 3RWOA 2VP5A 4BZQA 2CLCX 2IS6A 4NCNA 1DELA 2X77A 2OCBA 2IS1A 5KOYA 3QXSA 4ILEA 4D80A 3GJXC 4R9UC 1SVLA 1UPTA 3H4MA 2L0XA 4DZZA 4CEHA 4M1YA 1Q1EA 1ZW6A 2QNRA 3BRWD 3FMOB 5DIFA 1E2GA 1GM5A 4DBLC 1PLJA 1KDPA 1WA5A
chains in the Genus database with same CATH superfamily
5AH0A 2RC6A 4OOFA 5FORA 2G8NA 1W94A 4QE3A 4PN7A 3B2NA 4FYVA 3TQOA 2C5HA 1NTRA 3RQIA 4BWVA 1RYNA 1WR8A 3GLVA 4EI7A 3MJVA 4WKCA 1NM5A 1ORDA 3OLZA 4AMVA 4BO7A 7ADHA 1B8PA 3T7TA 1RI2A 2PTHA 3ZY3A 5K0JA 5KYTA 3ZKAA 2EFCB 1P7VA 3M4XA 5B5SA 2XY4A 2WDZA 3MRVA 4PF1A 1FDOA 4PLGA 3X1DA 5GY7A 4KRGA 2OQVA 3DMYA 5ECYA 1JWLA 1TZ2A 2H1HA 2EFJA 2HF8A 3DE1X 3LO5A 1W35A 4P2GA 3NOXA 3JQ9C 3IPXA 1J1UA 1WW8A 3H11B 2FSGA 4OKSA 4I99A 1OV6A 5TRTA 4P2BA 1S7CA 2DCMA 3JD1A 5DGHA 1TUIA 3F6RA 5FI3A 2VVTA 1LRJA 3HXTA 3FROA 3LX6A 3TIIA 3W78A 3DB1A 3ZVLA 1FS4A 5AW6A 1A8PA 1XEWX 4WY2A 5DM60 4JI0B 2E18A 3EQ6A 3R20A 1Z9BA 4PQGA 5AJXA 5A4AA 1DKLA 2BYTA 2W2XA 4TV8B 5SYAA 5L3VA 4MJ3A 5A7FA 4YJ2F 5HKKD 1HDIA 2LTAA 2JLRA 2XTAA 1KNQA 3DGEC 1OT5A 3P9SA 2G40A 3BH7A 3BKXA 3EVTA 3ZV7A 5EHQA 1IHDA 5A06A 4GE3A 4BP9A 1RTTA 2XDQA 1H2WA 4M8IA 3L06A 4CKYA 3HXQA 2RD2A 3IQGX 1A9XB 4Y67A 4QIHA 1OR8A 3VJRA 5TIIA 4BQNA 4YALA 3RRJA 1Y1PA 3G0CA 1UAYA 1R9MA 5DYIA 3DEYX 4ZV4A 3GRFA 5CYPA 1P61B 1QMPA 2CUNA 1PYGA 2LRHA 4B2PA 4B6QA 1AQJA 3BB3A 1NOJA 1KMMA 3B51X 1T4CA 4ARUA 3E9QA 1EX1A 1ONNA 3LIIA 3P8ZA 4PQEA 3ZS9A 4AUNA 3KQYA 3OECA 5IUKC 3P7MA 1H05A 3ZUGA 4FQ5A 5I7VA 2YZGA 1U0OC 2JJQA 3SE0A 3E23A 1AGXA 2NV6A 2G1UA 1F0KA 1VL1A 3D4OA 1CB0A 2XGGA 3DL2A 1FNSA 1M6NA 2C03A 1GUFA 1HNZB 1I10A 4NJMB 1H0KA 1I8TA 5KYYA 2EFEB 1N3BA 2GILA 4TTVA 3GIDA 5HDBB 3RVLA 3OI7A 4IOLA 4MWSA 4OB7A 4E3WA 4YPOA 4HGZA 1QK4A 4WERA 3PGA1 5C7YA 2XX3A 5EA2A 3GI1A 5A3SA 1GFSA 2G0TA 2JVKA 3KSRA 5IXYA 1LY1A 4XQEA 4KO4S 5EI5A 4DIFA 5IVIA 5LD2B 5HMLA 3KFXA 4N0QA 2C7GA 4HWRA 4JNKA 4A0RA 2NQTA 3DUFB 1EUDA 1PT5A 3LF1A 2RDMA 1P5HA 4BVLA 1Z25A 1A77A 2Z2KA 3BL8A 3R5SA 1VE7A 2VNIA 3GOHA 2ZRKA 4Q7KA 1QSGA 3MD9A 4LOJA 4QRDA 2ABWA 2D2EA 3NWJA 4RSRA 5LP1A 1BGWA 1R3DA 2BFMA 3TSZA 4F6CA 1J33A 2PJUA 2Q8PA 2YRFA 4FNOA 3DT8A 5AK5A 1AXRA 3BBLA 3ZHYA 1UDAA 2V8BA 1A7AA 2HNAA 2HZBA 4KB5A 2A5GA 5FWXA 4LTDA 1YOVB 1FVOA 4E5KA 1JDTA 1VBKA 3EIUA 1Q83A 1WMAA 2PL5A 2CXNA 4TXJA 2PS1A 1V1JA 4MZDA 1DFIA 4PYNA 2FMHA 2SCUA 4P34A 2HXSA 1EWYA 3GZ4A 2FX3A 4DQ0A 3B82A 2I2WA 2Z09A 3QYFA 2HHAA 2HV8A 3I3OA 1C3OB 4BVBA 1QH9A 1PT8A 2A88A 4YNBA 1D2AA 2XVXA 5G4LA 5EJ6A 1EVKA 3SS7X 3CPSA 1BDJA 1LSJA 1MORA 3C45A 5BRJA 1RMYA 3AEUA 4DV3B 3RHFA 3FAKA 2IKQA 4KVGA 3SBDA 4ARZA 3H4VA 1N6LA 2NQ2C 2C2MA 5AI8A 3NIDB 1EGHA 3PDIA 4IVRA 3LZDA 2NPIA 3KQHA 1DBPA 3THXB 3Q8MA 4DHEA 2A84A 5C1OA 1YIOA 4UMDA 4O1MA 1E7SA 2A33A 3E3AA 4S1WA 3VU3A 4DKJA 3DEHA 4P83A 1O03A 4AJJA 3JRWA 5AUQA 3F0TA 3I1IA 4RD6A 1AS3A 4N3CA 4DIKA 2CW5A 3C3WA 2F2TA 4PFQA 3EIFA 5EVJA 5AW9A 6NULA 3WV5A 1FSPA 2Q0XA 1E6KA 1KMHB 5DF1A 2P5UA 4UAJA 4TUYB 1A71A 3VISA 3KLNA 3ZWBA 3SHTA 4ZHQB 5FF9A 3T12A 4Q4JB 3EQZA 2IXBA 2XUGA 3S2YA 3UJPA 5CA0B 3KAJA 2FR8A 3FKJA 3HHEA 4JI6B 4RMJA 2I3DA 1HOXA 2WNSA 4WK6A 5BV8A 1G8AA 2TS1A 2O19A 1G55A 2X76A 4IJ5A 1O94C 3RREA 4BQFA 2PAAA 4HP8A 4F4DA 3BPSA 4YCSA 2H00A 4RJTA 5SZKB 5I5EA 2VZ8A 2VTKA 2OQ2A 2IEYA 2WWGA 1YE8A 4NPAA 3E7FA 5HMMA 1XKQA 2QSJA 4TYQA 1W85A 4E5VA 3EZGA 4UATA 5ERGB 3K9BA 3VHXB 4KQGA 2Q9AA 1T9AA 3EOZA 4Z2AA 1YDMA 1Z6QA 3HADA 4CMIA 4YUVA 2FZEA 1OBCA 3V1MA 3Q1KA 4Z4FA 2EZUA 3S2UA 3A9VA 1X39A 3LUFA 2FW8A 4FYJA 3E27A 4OHCA 3ZLVA 4KXLA 1K7FB 1OZFA 2WPNA 2JLQA 2CMHA 5HFNA 1DCFA 5BWNA 3O7MA 3QVGA 4HH3C 3ZD9A 1W6UA 4B84A 3JZIA 4MWZA 2HLDA 2N1MA 4EHFA 5LMCA 2ALJA 3FBWA 1ILWA 3H2SA 4QT4A 2NO7A 1GFIA 2PGOA 1CE8B 4RESA 3CF4A 4LSZA 5EIFA 1J0XO 1JR4A 5F3RA 4KQFA 4CJXA 2WA2A 3LY9A 4JT8A 9LDBA 1Z6ZA 2AZXA 1IPHA 1YI0A 1GTZA 2FW1A 1ZM7A 4X71A 4ENUA 3F5DA 1GG5A 4NBWA 3DAGA 1TVKA 2CVZA 3LBFA 4ND7A 1KI3A 2XT0A 2CY0A 1FMTA 2QZ9A 1ZH4A 2V5AA 1BQEA 5HFJA 2P79A 3BDVA 4F46A 4BPRA 4WASA 1CULC 4M36A 1HDCA 2IE0A 1O95D 4J4BA 3RHTA 3M3HA 1BZYA 2CFCA 4LHXA 4IWXA 5T41A 2GPJA 4N4AA 4S2UA 1DKQA 2NWQA 4FSXA 2B83A 1XTUA 3TQRA 4YJ2B 3FOWA 4OLHA 2WB2A 1NMXA 1L1FA 3RT7A 5BV0A 4A8JB 4BP3A 3A4IA 4HX9A 5BN4A 3PUIA 2UZ1B 3AGPA 4CQNA 3AWDA 2XTMA 5DASA 3MUOA 3SU8A 4R83A 3V9PA 5FBVB 3Q7EA 4MJLA 5J4YA 4GS5A 4RJJA 3U7QB 3I5AA 3S8MA 1D2HA 2H1WA 2LCFA 3CY6A 2YV3A 3L05A 1ZXBA 3PBKA 4G5YA 2WSIA 4UTPA 2G82A 5EZ6B 3UCFA 3TGPA 1UPFA 4V0MA 2YNMC 3WYNA 4ZCPA 1AG9A 1BROA 3AL3A 5H7XA 4WGFA 5J1SB 2VNAA 4E14A 1OX4B 5B37A 1IN7A 4LRWA 4Z86A 3ET4A 4LDQA 1ISRA 2YDXA 5DHTA 1IOLA 3SXUA 1DTSA 4D2IA 4ZXPA 1WEHA 4UBLA 4HGPA 4NXNB 4HEA6 2Y0PA 1ZM9A 3L6EA 4J9UE 2WYIA 5E1MA 1WHSB 4QVKA 9GPBA 2EERA 1E3IA 1F6WA 1NFFA 2IYVA 1G4UR 1XX6A 2I2FA 3EQ8A 4KGZA 4WKGA 5FOWA 5IU6A 1HMPA 2VATA 2B4AA 4BDTA 4CM9D 2ZVJA 1NQTA 4M88A 4FHDA 2OZPA 3LUDA 5DKFA 2DR3A 1Z2AA 2MWMA 3NPAA 4RIFA 6ABPA 4G0YA 5JDCA 3OPMA 2JGDB 2OTCA 2XJ4A 3QMWA 4IQGA 4LA4A 4N9WA 4ZQGA 3ZBQA 4CZ2A 4LF9B 3AR4A 3P97A 3LQ1A 3QMMA 4Y7CA 4D0GA 4DA6A 4P81A 4IUBS 1PJ2A 3HJRA 2WF5A 4RKYA 4Q24A 1ZAKA 3DMGA 4ZWNA 3O74A 4EA7A 3FJYA 1XUOA 1UFRA 3QNWA 3KHUA 4F1KA 2AT1A 1A2KC 1Z29A 1MC5A 4HGRA 4C4PA 1RJGA 1U4SA 1DNPA 3EQ9A 3YASA 2OBLA 5I51A 5HIAA 1D2MA 3AF4A 5IJ9B 3IA2A 4JGGA 5KEIA 1BW9B 5C0OE 4IH9A 2BFNA 5IM4A 1XEXA 5EUBA 1IJKA 4LDRA 3RVPA 1QQAA 2J0SA 4LPKA 5KZMB 4PLYA 1M0SA 1HLFA 2YCBA 3D43A 3QBVA 5BVGA 3SM3A 1CY4A 1JALA 4H16A 2XBLA 4O29A 1G3IA 1YMUA 3CLSD 4OAQA 3BXGA 5FBLB 1GEEA 1NVXQ 1POXA 3FYCA 2COUA 2ZIAA 4YO8A 2HA5A 2XA9A 4X1YB 4EY8A 1NC3A 2W6ZA 4ZVOA 2GB4A 3AZQA 3DBIA 4Q9JA 1MX5A 2UUPA 2PX2A 3ZEAA 1SKBA 1GR0A 2C4NA 3CC8A 4DRZA 5HJ2A 1MHTA 4G36A 1UBRS 2I7XA 4G67A 1H4TA 3MJHA 1W4AA 3HY3A 1NXQA 1RCUA 1OX6A 4LWQA 2PNFA 3BJZA 4TRNA 4YB8A 3VDXA 4ZZ0A 2WYUA 1ILEA 4YREA 2EG9A 2CGEA 2P7HA 2OXTA 3VU9B 4EGAA 2V55B 1CR0A 1HDYA 4DDTA 5KQSA 1Y34E 4F9FA 4JB2A 2E1PA 1P9RA 4UUQA 3GOQA 4L50A 4KWTA 1DJOA 1M1ZA 1SC4A 4P4TA 2QVBA 2IHNA 4HG2A 1NUTA 1XZDA 4ITVA 4H77A 1SVUA 4R69A 5IUJC 2ACKA 1NW9B 3KTAB 1JDBB 4QA9A 1NRJB 2I3ZA 2NSDA 4UHJA 4ZVTA 3STXA 3UW3A 3ADKA 3LKBA 3K6KA 2OORC 2VDKB 3L79A 4RO0A 5DWDA 3V46A 3ZE2B 4E2XA 1I7SB 1SUDA 2Q49A 4RL4A 5ALIA 1JDJA 5KJFA 1GSHA 1LPMA 1OILA 1F5SA 1V3TA 1W0JA 1VG0B 2FEPA 3IQWA 1KEUA 3KXIA 1RAHA 3NP7A 1O6FA 5F2OA 3L0OA 5DTRA 4B47A 1ZI8A 3WL4A 1XAHA 3LUCA 4ZV9A 4FJ0A 4PG5A 1CY1A 4QOJA 5E95A 5FNVF 2H5IA 3OZAA 4PPQA 5IP5A 5C8VA 1FSZA 4HY3A 3SGLA 1S2DA 2ZJ3A 1P17A 1ZONA 2QWXA 4JLBA 4PXSA 4TSFD 4AJOA 4DXHA 8LDHA 2VDUE 3UWPA 4CKCB 4DJEC 2A5JA 4LE1A 4PANA 4ZC1A 3N3AC 1KC3A 4Y98A 5CIQA 2X0FA 1X80B 4IGEA 1N6KA 5JO0A 3WGVA 1JUDA 2ZUBA 2QM0A 2ZVDA 4LJ7A 4P3OA 4Z1OA 2J45A 5I9SA 5LZ4A 4RVUA 2ZQ5A 1FQOA 4G0QA 3SX0A 2WHRA 4GX1A 1O87A 1Q17A 1T3HA 1TQ4A 1UINA 3HCRA 4RD3A 3Q9LA 2WOOA 1NG1A 5LC1A 4HNVA 1SXJB 4QLOA 1C4XA 4ZVNA 4EJSB 1C8LA 1DPFA 1UXKA 4YRRA 3K73O 2QL9A 1FFEA 3E5HA 3SVZA 1JVBA 2XCSB 1KMQA 4RIGA 4W7IA 2MR5A 1SPXA 2D6FA 3ORRA 5HCIA 2FW7A 1DHTA 1Z6XA 2VPPA 1O0CA 3LVBA 4Q82A 1WDMA 1P29A 3FFTA 3K2IA 3T5GA 1NFQA 2XKKA 4UU8A 5JJBA 1LI4A 2J6BA 3MOSA 4AZWA 5AM0A 2Q6KA 4MRVA 1RC0A 5FA6A 1EESA 1TK9A 3B2EA 3ZDEA 4DLAA 4XE5A 3SDSA 1TXGA 2WAYA 5IBPA 3TRIA 2AN1A 3PX7A 2HJRA 2ZULA 2WUWE 4LDZA 4MXDA 1D03A 2VFAA 5IZ4A 4MYDA 3BGSA 3W5SA 3DXZA 1ADGA 1ARZA 1I14A 3RRYA 4WOPA 4NK5A 1UOPA 4OXIA 4YX9A 4MCAA 1KMNA 3C3EA 3HKEA 3OKPA 5BSGA 4LI3X 2RKBA 5JVDF 1DIAA 1G19A 1T8WA 2J85A 1SXJD 4F5DA 3RRXA 4ZP1A 3TMKA 3WMXA 5FUXA 1NJSA 4K0RA 4KLAA 1POWA 5KYNA 3D6FA 5KPDA 1UJNA 3C7TA 3OZSA 5ICCA 2PUJA 2I4IA 1UMKA 4PO3X 2EW1A 4H4EA 1U7XA 2J3LA 4FMCB 2F90A 2JBWA 1AK9A 1B3BA 5KI6A 5F1PA 3ED1A 3L07A 2BKEA 2FZ4A 2P6UA 3QV2A 4ZU6X 3TVYA 3WBFA 3SC6A 1LGYA 1KDOA 2B82A 3EVBA 3IP9A 3VV3A 5DLYA 4D8XA 3QVLA 1GU0A 1TQHA 2F3RA 1KAQA 3EBLA 4PAWA 2BD0A 5ESXA 3WGNA 4D43A 3VR3A 4BPBA 1SBQA 1X8LA 1NVVQ 1XLVA 1YRLA 3OWXA 1SHJA 3D2LA 4B82A 2Q9CA 2RARA 4X3OA 4PNHA 3JQ8A 1U2DA 4EITA 1JLMA 1PSWA 1E98A 4LBZA 3BZUA 2NZVG 3VR6D 3D0RA 2IXEA 2XF2A 3ORSA 3WQBA 2FEOA 3BIJA 2NTVA 1MABB 3T7CA 4UQLA 2WVAA 3GO4A 2Y8EA 3X43A 1O89A 5E8RA 3FPHA 2AOUB 3OOJA 3HPRA 2GJ9A 3B85A 3NRBA 3K31A 1RPJA 1U80A 4I50A 2H17A 1Z4NA 2UZ0A 2J3DA 3EXFB 3GUYA 2XSZA 4WNAB 4EW2A 3UAYA 1DBIA 4AF8A 4OQXA 5FUYA 1QFMA 1E61A 5K3DA 5BYKA 1JG7A 1WXWA 2J5KA 4OJKA 4XZ3A 4EI2A 3UAXA 3ZCQA 1KI8A 4ZEOA 2FCRA 3K2EA 5KIAA 4FQ8A 4EX7A 2X1HA 4UMVA 3BD8A 3R8XA 2HYDA 5JROA 3TGLA 4GBMA 2XNHA 3KKOA 3P5SA 3E9RA 4BQQA 4MRNA 5HIKA 2RHHA 3UK7A 3HVHA 4JKOA 2I8AA 3ELUA 2IXFA 2YR0A 1I1NA 1S8FA 1U8EA 2GNAA 2IYPA 4JA2A 5JAUA 2RGCA 3AHDA 3BFXA 2BJHA 1PGJA 1XZFA 3KJXA 1Q3KA 2W6CX 2XXJA 3MW8A 3UANA 3AW8A 3ZHSA 3PA6A 4WK0B 2QJTA 2HLPA 3AVUA 2VCHA 1F2TB 2WJIA 3HLYA 5G4KB 2ASVA 1YR8A 1VL2A 2VJAA 1DBRA 4O5OA 1N34B 2PMEA 1I0IA 4AJ1A 5HXAA 5LIRA 1YRHA 1GY8A 1P1JA 4DRYA 2OXFA 4R2MA 4CU2A 2ODAA 3QFRA 5E6RB 2X8AA 3WRVA 4TKUB 4TWIA 1Q12A 3HGTA 4LYGA 3HR4A 2ID4A 2FVYA 3NKVA 4ZT3A 3VR4H 3I6ZA 4ERNA 1OF1A 4LDJA 4QWMA 4BLRA 3OPYB 4U9UA 1ZNYA 5LQMA 1K75A 4LX0A 4NS4A 2QYHA 2MDTA 1XQ1A 1ZZEA 3F3SA 2PMWB 4KXWA 4KYIB 3P45A 1WY5A 5E6UB 4AUKA 3HB7A 3MA0A 3VDMA 1GPMA 2ZBVA 2GVDC 3UAOA 4F6RA 5KVVA 2FR0A 2VF7A 2E5FA 3N8IA 4M0MA 2FPSA 4EYGA 5T4BA 5CFQA 1GZ4A 4LGVA 2EIHA 1P3JA 2HMTA 3ICOA 1LA2A 2HQSA 3T4EA 3M9WA 2OZLA 1KGDA 3TW0A 4X64B 5JBIA 4OHZA 1JFFA 2JA1A 3N7UA 4MV7A 4IIJF 5CLHA 7GPBA 5AVJA 4TTSA 4CN9A 5EIBC 2JHGA 2Z4TA 2WKSA 2ZJ6A 3DXYA 3EXEA 3RM3A 3B9PA 2JAHA 3BKWA 3BGDA 2R87A 4Q3AA 4TZ0A 3OQOA 4ZAGA 2AJDA 3JRNA 1EAMA 2DFLA 3L3BA 5TGDA 4NDZA 3ZI0A 4JD5A 1U9YA 3D7LA 3EGOA 1SXIA 1JI3A 4WKNA 1ZDMA 3FWKA 1FDIA 1N6OA 2XRFA 4GQBA 1AQNA 4JWKA 2OAEA 2KYRA 4TZKA 1FTSA 5ECDA 4F2WA 3EPHA 3Q41A 5DSXA 4DXDA 3K6JA 4D4HA 4LBYA 1HC7A 4BNZA 1Z7YA 4A2PA 3ZCRA 1R9GA 5LWQA 2WTMA 2PT9A 2FPPA 3SZ3A 3DCNA 5EL0A 2R6R1 1SHZA 2SKEA 4CKZA 5C5EA 1MR3F 1NW5A 4JLPA 3IEIA 3QZUA 5K8JB 4HDKB 1EFPB 2F17A 3G1TA 3UOGA 4GYWA 2Z58A 1WDKA 1SD5A 5I9BA 4EZBA 4CTJA 3STVA 3ZQUA 3DNMA 3K8QA 1XDDA 1SUCA 5HIJA 3O3NB 5K4AA 1K86A 1ZR4A 4D6PA 2NTYC 3G7UA 4MKIA 4U2EA 4UHCA 3EEBA 3IEKA 2PT6A 3H5OA 1ZK3A 4YDSA 5HQTA 3L7OA 2WUFA 4W5TA 4LRSB 5ARBA 5EMJA 4E13A 3V4SA 2C92A 1N2HA 3D0QA 4BMDA 4BYGA 2QGNA 3CT6A 5BOSA 1F9AA 4KREA 1NZFA 1PQYA 5BSEA 4JI4B 2Q5OA 2RK3A 2V5VA 2C0QA 3C87A 3EK2A 4NYIR 5LYJF 4KX5A 3ZGZA 1E3EA 1NPDA 4XIFA 1DC5A 5DNCA 3LYLA 1QS0A 4Z3KA 1RLIA 2BJWA 2I6QA 1GTG1 4H7KA 4N3GA 1M74A 1QTNA 2Z8ZA 3AEYA 1MAHA 3AX6A 4QXOA 4MWTA 3QVKA 4WA8A 3S1LA 4AMUA 2HCFA 4MWGA 2CVHA 2A9KA 2PGJA 3GFFA 4AKIA 4WI1A 5JBQA 2AA3A 5KNCH 3MEQA 4R0VA 3SLKA 1TQ8A 4C0XA 1EGQA 2VZ9A 2MYUA 3BQMB 1EDEA 3I2IA 2BE9A 4KUHA 5TXGA 2DMRA 3DWGA 2O8EA 4FP9A 2OB2A 3K0FA 2CLSA 2ZYVX 3TTTA 3IIKA 3IQZA 5G53C 1MJ5A 3BWDD 5JVDB 1SQ5A 3P9QA 2E4XA 4B2IA 2Z9CA 2AUNA 1RBQA 2PX5A 3LX4A 1S8OA 4NMMA 3S27A 3R0IA 3SJUA 3AIMA 2HBZA 3CM0A 3RYIA 5FFMA 3SS9X 5BYBA 3WRYA 4M0EA 1O58A 1XCLA 4ZC8A 1K9VF 4WEOA 4RH3A 3P0FA 2A1TR 2RSLA 4KFSA 5ADWA 5JH7F 3JR3A 2NZJA 2RHGB 1ORIA 4JQYA 4M9QA 2JANA 4MLCA 4OMCA 1JXMA 5I7SA 1LH0A 1PNOA 4MVJH 1WX1A 2DLCX 1ID1A 2DUNA 4HXGA 3SYLA 5F4BA 3LTEA 3T5TA 1OXKB 4O2AF 1DOZA 2A1UA 3RBZA 1VL0A 3EIWA 1JTFA 1L5HB 2VNJA 1M6HA 1KFEB 1P7WA 4KIGA 1VB3A 4DV6B 3CEPB 4P4UA 5J9FA 3RSOA 3S70A 2AMFA 3ESBA 3VTFA 5BNWA 2HJWA 4AKTA 2PA3A 4ZU3A 1BDBA 4A6DA 1YS2X 3DCYA 4E30A 5F33A 3E5NA 4Y2XA 3VAZA 3I62A 2HIHA 4TL8A 4CL3A 5EESA 4NX2A 2XCRB 3VX3A 5JWHA 1QCYA 4B9EA 5BR4A 1T0BA 2YOFA 5CT4A 3GRRA 2XT6A 3E6AA 1Q7TA 1EGMB 1XXHE 3F97A 3N9IA 1ELOA 2E4UA 3H2IA 3OY7A 4J6FA 4M1WA 1GDTA 1V41E 2QE6A 3PLAE 1NP6A 1J2JA 3EFOB 4NEGA 1ODKA 5HIMA 3RYFB 4F38A 2C31A 3RVDA 4QODA 3NALA 4DBLE 2ZRAA 13PKA 2QMYA 1EWTA 3CLRC 3WIBA 2Z1MA 3ETNA 3KUUA 3LC0A 3PQDA 1Z63A 3LQYA 1WQ4A 2K2QB 5C2JB 3AF6A 2B36A 4HNRA 4IDPA 4WXYB 5DDIP 5JOQA 5KB3A 3LD9A 4PX3A 1PVDA 4FINA 4M37A 5DGTA 1GGEA 4P7KA 3ROGA 3D3NA 3LF2A 2FMIA 2W8ZA 1C4OA 3P20A 1EK5A 4DMLA 4LTNA 16PKA 1FSFA 3AFGA 3PHLA 4IWNA 2OQRA 4L73A 4B81A 1JEYB 1ZSNA 1GSAA 2V9CA 1QIHA 3QYAA 3IBYA 3MLEA 1VPVA 3DZFA 1AC5A 1G7CA 1YB7A 1J25A 3H3JA 1MB4A 4KYVA 3M4YA 4P32A 3VU0A 3MAGA 1DG3A 3MIZA 1F38A 1M33A 2GPAA 3NHAA 1WZCA 3ZJ5A 4OJTA 2GD1O 2G76A 2QX7A 3O95A 4IIBA 2QTBA 5CFLA 3OHSX 3N2YA 2SKDA 5I7RA 3RU7A 2Y1FA 4TTQA 1FYDA 4RK6A 3BMQB 2PMFA 4HK4A 3AQ4A 3GPIA 3TZHA 3GGPA 3D4LA 2O4CA 4H35A 2XUFA 3DFKA 1XL1A 2AG5A 3QPBA 1ZMXA 4U2DA 5A1TA 1OI2A 3EMVA 1YVPA 4TTRA 1N78A 1UBMS 1T36A 1T5DX 4GMDA 4YRTA 2ZIZA 4CI9A 4B3GA 1E0SA 4OQNA 2LZ0A 3UB2A 3GCDA 4NABA 3ZN2A 4AYTA 5J40A 1PWYE 3UUEA 4IQ0A 4GPZA 3TAXA 3ZXYA 2Z4SA 2V97A 4CFYA 2HY7A 3FTEA 1DUIA 1RKVA 5AJWA 3S1AB 5IT5A 2X9VA 3K0AA 1ZLYA 3OHPA 3OTQA 1U1EA 3IDZA 1NKSA 4ND1A 1KFJB 5AXDA 3HBMA 4FNAA 2AHOA 1Z5PA 4HAVA 4KQMA 4BGEA 4EG8A 1NSTA 1WUIS 3HL0A 3ONWA 3QKIA 3TW4A 3TZEA 2I3GA 2QY6A 3ROZA 3UMBA 1JW9B 2FPWA 4MQ6A 1UIMA 4FDAA 3FUTA 1XQVA 5BQFA 3DZKA 5TQ0A 4E5MA 2IBSA 3HM2A 1XXLA 3A2NA 5P21A 1ZBDA 3DXFA 4JVMA 4HTFB 4CNBA 4RETA 1YA6A 4G0NA 2QPAA 4MA5A 4MV0A 4JI5B 4NCJA 4M2LA 1HL7A 5A4KA 5K6AC 2OAQ1 1ORVA 2IUEA 2Q4TA 2WV9A 3RTGA 3TFOA 4FWBA 4L27A 2M6LA 3OIWA 5I9NA 3OTHA 1V8OA 2A2ZA 2WOJA 2OVFA 1J4AA 2PH7A 3O84A 5CM9C 4ZYYA 5JT1A 5KYVA 3W5BA 4WFJA 2DLDA 4C14A 5TMBA 3CNEA 1G8GA 3QW4B 4D8UA 4MGEA 2JGKA 3K8YA 3EODA 1NLYA 1GXSB 2J3KA 3T6KA 1HZZA 2CHEA 4QYIB 1I4WA 1T2UA 4NE7A 2D4AA 4HQNA 5DBHX 2ERYA 3GELA 4L8GA 1KJIA 5FCDA 1GCGA 1VKZA 4C3OB 5K5EA 4TQ9A 2IX3A 3PGKA 2CNWD 1QFSA 4EY7A 1FYEA 3WL5A 1QQTA 3IV9A 1EVYA 3KO8A 3D1JA 2Y71A 1HOTA 3KK0A 2Q2QA 1AKEA 2CLOB 1P8AA 1ZU4A 4HLNA 3L8HA 1JSLA 1Q50A 1T8TA 4HHEA 1J1ZA 3EIEA 4DPKA 1GCUA 3KEMA 4FZVA 4WGGA 2AQ8A 3FNGA 3LSTA 3P9CA 4O1HA 3IVAA 4XB1A 1WQ1R 1S3GA 2XEDA 3D8UA 3OMWA 4U9HS 3V1UA 3ZBUA 1RWNA 4C4YA 4E46A 1MZPA 4TS4A 2GFIA 4EB6B 3A2MA 1HYBA 3FYSA 4S0ZA 1WVMA 5G3ZA 1R8JA 3IEUA 1SCDA 4OBBA 3UPTA 1ECLA 2EHJA 2XOKA 4NENA 2PUAA 1WHTA 1IZYA 3K9HA 4HH1A 4XX0B 5K0CA 4NESA 1KI6A 4BFXA 3IDFA 2RG1A 5ADUS 3ZU3A 3CVUA 4P98A 4AKHA 4QOIA 3DKKA 4XCQA 2IHZA 1L5RA 3QWFA 3K72B 3MN1A 3NWOA 3BTSA 3QEJA 4YP9A 3TLAA 4KXFB 1Z8HA 1DRJA 1GU1A 3NT2A 5K3BA 1RKBA 1NA5A 2DAPA 4NI5A 1CHDA 4RVSA 2UAGA 4KEAA 4HN9A 2CCGA 1RI5A 4BCCA 3FD8A 4W99A 2PKCA 5IJXA 2ZSEA 3KBBA 2GOYA 1ZMRA 2D06A 4N0EA 4PSCA 3QQPA 3VZSA 1FLDA 2IHBA 2BR5A 5ALOA 1X1DA 3JU3A 1FTGA 1UK7A 1KPIA 4ND5A 4KMOA 4RVCA 3GCZA 3QWHA 1SVNA 1UR5A 3IERA 3T3GA 2FEKA 4E15A 3SVLA 3P2JA 5CX1A 3MAJA 4D0RA 3FYHA 1CF9A 4JFRA 7REQB 5FOUA 2ZE7A 3PDUA 1E3TA 1NJFA 3B12A 1Y3BE 2JZNA 4OHWA 3CG4A 1RYMA 4LHYA 3DPIA 3QRWA 5BUZA 1VHJA 1T5BA 2IU6A 3PCTA 3COSA 5DBOA 4Z4IA 3CZQA 1X7WB 3KOXA 3OLYA 3B5JA 2WE8A 3HJBA 2B99A 1RQ2A 3PPYA 4P7JA 4UM9B 3FZGA 2Q3BA 4AJEA 2VTDA 2ATXA 2WE7A 4CCAA 2F43A 4Z51A 2WWYA 2GAFA 1QKIA 1UBHS 1CEYA 4R8RA 1F9EA 4AD8A 3AF3A 3FW1A 3VYUB 4HEQA 4KSBA 2I4MA 1PQ4A 2RHMA 5ALKA 4XPIB 2HPVA 4ZO8A 3C6BA 2W2PA 1RW4A 1PAUA 3CRNA 3F5MA 4EKNB 2ZPTX 5M7EA 5LM3A 5FOXA 1CNEA 1T0PA 4BGUA 3ZGNA 3HO8A 4KX3A 3VKGA 5ELLA 1C1XA 5AK0A 3IAAA 1MD9A 3DAYA 3MQFA 5JNSA 4XWKA 2VNSA 3HKDB 3MFYA 2ORWA 4BCDA 1YOBA 1CNMA 3EGDB 3GNSA 2VRBA 3LZ6A 3R7BA 1VA5A 1KEVA 2GBPA 3J80A 2VXYA 3ISTA 3PJRA 4CTMA 2XE8A 1QQ7A 3H5IA 1RM0A 4BAUA 1B23P 3NAQA 2W98A 2EWWA 1Q11A 3MAAC 4I55B 1PL8A 3DF9A 5A7GA 4BC0A 4DBVO 3KJEA 4J0FA 2HFKA 5E1DA 4H6XA 1OKKA 2WSMA 3UJHA 1ISHA 1N2CE 3FYUB 1TRHA 1ICEA 2HUPA 4RLFA 4KQEA 3C5WP 1MQ9A 3T1TA 3OT4A 2YHIA 3N8KA 4QDOA 2ZJ5A 2PRSA 4PIMA 1CVRA 1F4VA 3ZPXA 1P0IA 4QBHA 4JX9A 3OD1A 4FVTA 1R4MB 3QEMB 1IY1A 2D5BA 1X9HA 3SFTA 3VHLB 4BGVA 4BNNA 4Z0TA 1H8HD 1VHTA 1FDRA 5G1PA 3DCJA 5FOQA 3SN6A 1H2EA 4PZUA 5JV5A 1NJ5A 2NO0A 3FGOA 4K03A 4IIDA 4FS8A 4QNNA 4YCNA 3LDGA 1E3WB 2MSCB 4QSMA 1W5TA 2DZDA 3ZZ0A 2XUJA 1Z5WA 4DWJA 1PX0A 1GN9A 1R7RA 3QLTA 3R9WA 3H7AA 2OKCA 3PITA 3SYTA 4BNTA 2FMKA 3FLMA 1YKGA 1MJHA 5IVDA 1MJNA 4O2BF 3DBOB 3QWBA 4BHTA 5C32A 3PL5A 4NNPA 3RLIA 3U1BA 2CDNA 3BE4A 4OBWA 4D9HA 2Q7XA 5B7NA 2UUCB 1QIKA 2ZWVA 4OGLA 1ULAA 2H4ZA 4XDZA 3JWGA 1PV2A 1PWXA 3OIYA 5KTOA 1J09A 2CVFA 1AO0A 2PWBA 1LCIA 1X1TA 3F96A 2VQ6A 1E60A 3GPDG 4QRHA 5COQA 5THKA 3ANTA 4WUTA 5AXAA 3WGHA 1Z2DA 2NU8A 3UATA 3KYIB 5JI3E 4BRSA 4Y0NA 4E5NA 3INRA 1GKUB 2BKXA 3NCHA 4JVSB 4KQJA 4YV1A 2CCJA 1PSZA 4B33A 4XGQA 3IKLA 3UT5A 3HCAA 4EKDA 3BWBA 2H4JA 4MV1A 3G9ZA 5C34B 1QC5B 3LE8A 4EFMA 3FSEA 4Q37A 1EVEA 4FSHA 5K20A 3U09A 2GZ3A 4HYQA 4MKRA 5CLQA 1VLJA 3AY6A 3I6IA 4I0WB 4L0DA 3WYFA 5DTEA 1ZN9A 4DAOA 2FP4B 5EZYB 5LL6P 1RFGE 3OZTA 4UPVA 2WWVD 3FOAA 1ZRMA 1K8QA 1BRMA 3AUFA 4FEGA 4N82A 4TS3A 3TOSA 2VF4X 2ZI7A 4DCUA 3IB6A 4US0R 1IAVA 3CUTA 2F1HA 4RAQA 4TTAA 3IOEA 5IF9A 5KJCA 3PJFA 4O4LF 4IFBA 2CNOA 3K5HA 1Z4IA 2VDMB 2WHYA 2WKQA 3GN2A 1XXHA 4AMZA 5I01A 4TROA 1HUQA 3BXXA 3EFHA 4ABTA 4TYYA 3AY7A 1IL0A 1QH0A 5A9TA 3SEZA 1IVSA 3L7KA 1GRNA 1GPLA 4J75A 1COZA 1XLWA 4MV9A 4XB6B 6REQB 4KXVA 4IDHA 2Q1YA 4DRXB 5KWSA 3A1EA 4HB3A 2OQIA 4A23A 3S2EA 4LXTA 2CLLB 2Y4OA 3WE7A 3AV3A 3HDQA 3PR3A 3JQ7B 2ZJOA 4UVDA 4X44A 1RQPA 3WGYA 4G1FA 1OWNA 3WMFA 2WF7A 4M7PA 1G5QA 2P3SA 5KWVA 1A96A 1QG2A 1X7XB 5KNDH 3MLAA 4RY0A 4Z0PA 3FNHA 7ABPA 4JV5B 2BEVA 1HSZA 3CH6A 1C3LA 2B2XA 3KZOA 4RABA 2Q1WA 3ZD8A 2VP3A 1G42A 4IHJF 4M6WA 4I4LA 3GIWA 1X9GA 1D6JA 1GYRA 2IEAA 2XYRA 3A31A 3EUFA 3KT0A 3F6YA 3UC9A 5EZ5A 4E5SA 1UPAA 5HZGA 1JJ7A 3U4MA 4N3AA 1K08A 3FCXA 2HZ7A 3G5UA 1SCBA 1WG8A 1Y9DA 2HOQA 3IXLA 1M1NB 3JQ9A 4KVFA 1GKKA 1M67A 4H1HA 1V3UA 3GFOA 4I36A 1FUIA 2JIPA 4MJXA 3QM1A 4X63A 2ZOSA 4D81A 5ITZB 1VP9A 5JHHB 1R18A 3ZH2A 2PXXA 3LA6A 4JITA 3WGMA 3O8NA 4MVJP 4M46A 3ANYB 1DBSA 4R84A 5B2FA 4BBPA 1KYYA 1O6GA 3T3PB 3WFJA 2ONZA 5KYUA 3DOEA 1EGVB 2ID8A 3EYAA 1YRAA 3L7BA 3TAUA 1VCHA 1BHJA 4CG0A 1MQAA 4TVOA 2VJYA 2L42A 5CYOA 4AMYA 1O8BA 3BMNA 3ZHOA 4PU0A 1EPUA 1ORTA 4PZ9A 4MW5A 2X8LA 5KWIA 4Z7QB 2CMKA 3LCMA 4JU8A 3A26A 1ULTA 4OXRA 2BHLA 2QL6A 2FX2A 2R65A 4BX9A 3V4RA 3Q3JB 4U2CA 2ZJ8A 1SA0A 2LIVA 2RGWA 4K9QA 1TCUA 4YBRA 2IITA 5DV9A 2PMBA 1EFCA 1SZDA 4EUKA 2OCLA 2RJ3A 5DCWA 4QYWA 3AF5A 4AS1A 1LWNA 4MKFA 5HKAA 1TZCA 1EFLA 1C1DA 2JRCA 3GAZA 4AP6A 4WUVA 5AKGA 2KM1A 4WN9A 5EIXA 3L7MA 3O90A 4J1NA 2HYIC 2OO3A 3ZWDA 3OVMA 1ISJA 1A9YA 3OZRA 2NO1A 1S9DA 4G41A 4ODIA 1KVUA 1ND5A 4R68A 1D4ZA 5CM8B 5FH9A 5LIPA 3TW8A 2MSWA 2ZAOA 5T3U