4HLDA

Sulfonylpiperidines as novel, antibacterial inhibitors of gram-positive thymidylate kinase (tmk): compound 11
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
203
structure length
196
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfonylpiperidines as novel, antibacterial inhibitors of Gram-positive thymidylate kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 83
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hldA00
4C2TA 1OW3B 1G3RA 3THOA 1GL7A 3ZGXA 4AYXA 3UWOA 2PLFA 2R2AA 3GFTA 5P21A 3FYHA 1PJRA 1G64A 1ZVQA 2WMNB 4DCTA 3C16C 4TSFD 5JS8A 4MKHA 1XJ0A 4Z8XA 5M04A 1EFHA 4BLRA 2I4IA 4BASA 4IW3B 1YR7A 3NDBB 1TUEA 4P4TA 1R4AA 2JLSA 1QHHB 2WKRA 3PITA 4TMTA 2WJJA 4JT4A 3BS4A 2Q3MA 1Q1EA 4P4UA 4QHYA 4RCYA 2FWRA 5DI3B 4PSKA 1R0XA 2P67A 2ZR7A 2VP5A 2V54A 1GAJA 4PANA 3THXB 4Q5IA 5FL7A 1LVGA 1VHTA 2W6ID 1IXSB 2YHSA 3L0SA 3LVQE 1GOTA 1M2OB 2YJTD 3B60A 4MUAA 5L3QA 1N6HA 3U3OA 2REBA 4MDEA 4AKGA 2ONJA 4G5QA 4NONA 1C1YA 1KSFX 1W0KA 2WMOB 1XBTA 4GBMA 1DO2A 3PVSA 1U9IA 1GTVA 2NO6A 4BFWA 1JPNA 2CEAA 3KKMA 3T12A 5EXXA 5G40A 3K0FB 4CRWB 4C0JA 3KQKA 2BHRA 2EYUA 5JHHB 1JR3A 1WDTA 2ANCA 4Q9IA 1X8KA 4C0KA 1CR2A 4BLOA 4QBFA 4D4LA 3NEYA 5ELXA 4GFDA 3FMOB 2XX3A 2FOLA 2WAXA 4G5GA 4HUQA 2D4HA 4RD0A 5F9HA 2XNDD 3AV0B 1G6HA 2QTVB 5EE0A 2F7SA 3HWSA 3T06B 4TL6A 1ODFA 3IPYA 4ZKEA 3I61A 1G3IA 3SBEA 2HEIA 4G5RA 2V6JA 4PPFA 4N1AA 1NMYA 4A8JB 4MUBA 2O8DB 1AA9A 3DM9B 2TMKA 2VSFA 2C8VA 4V0MA 5C2JB 2RH5A 2AD1A 1KTVA 4M21A 4EFMA 2WWWA 2YYZA 3T35A 4LOAA 1UBFA 3V4RA 4EQ6A 2FPKA 2CJWB 2WVJA 4V0KA 2H18A 4BLQA 2V1UA 3AVTA 2H57A 4HAUA 1G5TA 2ZRJA 4PO1A 3T1QA 1J2JA 4KFTA 1N5IA 1P75A 5FBVB 3PUVA 4Q4LA 3ZVNA 4NYIQ 3WYGA 1GNQA 2X2EA 4C0AC 3TQCA 1XF9A 1EFRD 4IEIA 1FPMA 1XZQA 4JS0A 3CX6A 3PQCA 1CJUC 2FSGA 4QHSA 3SQXA 1QVAA 4PR0A 4QJ3A 1Z6AA 1NMZA 4IXMA 4F38A 1E79A 3I62A 2JJ8A 4ZIRB 1N5KA 2FPMA 1ZINA 2A2ZA 4IDPA 4S35A 2WJIA 5HTKA 4Q9JA 1UPTA 2EYQA 4A4DA 1Z0JA 2AK2A 1N0UA 2ZRMA 4HAYA 3TUIC 2CK3A 3MG9A 2Q3HA 1U8ZA 3FWYA 1G41A 4Q47A 4A0GA 4PZYA 1XEWX 2JCSA 3I8SA 1E2NA 2GBLC 1VG0B 4IOJA 1OSNA 3AKDA 4DLZA 3F0TA 4G3XA 4PAMA 1I4DD 1Y63A 4UNRA 1E1RA 5AUQA 1HE1C 4K81B 2QP9X 4JLKA 1W4CA 4E07A 2ZXUA 3QQ5A 1YZQA 3HPRA 2ZUDA 1NIPA 1Z47A 3Q3JB 5CLQA 1XP8A 3CNOA 3EAQA 2MSCB 2VL7A 4A0HA 2OG2A 4Q1DA 1IXRC 2QGZA 1C9KA 3TUJC 5KPJA 3QPVA 3LA6A 4GL2A 1DE0A 2IEYA 4QXAA 3LH5A 1OXTA 2E87A 5CB8A 3THWB 4O0MA 4CZ2A 5FI1B 3ZQJA 3DZ8A 1ANKA 2G1KA 1QHSA 3ZJYA 1KKMA 3DEFA 3EPJA 2ZI9A 5JI3E 1R8QA 4QOSA 1KO8A 4KSBA 2DWPA 3UMFA 4CW7A 3NDPA 5TARA 4DIDA 4DDWA 3GJ7A 4K8OA 5FOWA 2CCKA 2HF9A 2QA5A 3QKUA 1NRJB 5IDVA 4IEEA 5B58C 1FX0A 3ZIAA 2NZ8A 3QXJA 3KQNA 1XTJA 3WP0A 1ZM4A 4KBFA 4Q4HA 1DEKA 2Z5FA 4I99A 5DGXA 4B2IA 2ODNA 3RRYA 2GVDC 4BFTA 3UWKA 2V55B 1P2UA 1II8A 3DMNA 4TZ0A 3EXAA 2PEZA 2PCJA 1TNDA 5DI3A 3V4FA 2IX3A 2BEJA 2ZSFA 2WJGA 2JJ2D 4EPWA 3IIKA 1IJEA 4M4SA 4B48A 1ZYUA 2WOOA 4LY6A 3KFVA 4JLOA 2P6NA 4NZYA 1EG7A 2A5GA 3EA5A 1G1MA 2I3BA 1ZNWA 4A15A 1GSIA 1JECA 3N2EA 3RC3A 1UBEA 2ANBA 5A0FA 2O8EB 4MRSA 3KKQA 2PT7A 3MD0A 4M2LA 1OH7A 4EJSB 2YVUA 2P3SA 4QJ5A 4V0ME 1AQYA 1NLZA 3T61A 4ARZB 4TYPA 2H5EA 2F55A 2YWGA 3ICQB 5FOSA 3FB4A 1Z6XA 1YE8A 1UDXA 3VNVA 2W0SA 2AK3A 5FL7D 2WWYA 1GRQA 3DKPA 4Q7JB 4UNQA 2GZAA 4GT1A 3SHFA 4YXWA 3OFNA 1DAHA 2EFEB 1GILA 3CNNA 1TADA 2V7QA 3WBJA 4ZCIA 1T91A 2CJWA 1C4OA 2Z6VA 1K6MA 1R0YA 3WMFA 3X2SA 3GPLA 2QMEA 2GXAA 5G53C 1BKDR 3X1WA 1SQ5A 3VU9B 3KFXA 4LV6A 3UK6A 1AZTA 4LPSA 2QPOA 1JB1A 3GEIA 1XFAA 4ZCMA 4TL7A 3QENA 2Q21A 1VHLA 2VP6A 4ZDJA 2J87A 4BQSA 2AD5A 3BBPA 4IDNA 2VBCA 3SYKA 3B1YA 4KLNA 4XIGS 1QHXA 3U61B 4JVNA 2XJ9A 1XPUA 1RW4A 1NN1A 1W49A 2L0XA 2ZITA 4CEJA 2C5LA 5DN6A 4DLTA 4WZBE 2ZRAA 4B74A 1VPLA 3QKSB 2GVZC 2VO1A 1AS3A 5HE9A 1KI1A 2Z43A 3LNCA 1E9CA 3RDPA 2Z83A 3PG5A 4LWZA 1D5CA 3MLEA 4HLUC 3MWJA 3EC2A 1WE2A 1ZNXA 3K0CA 2IYVA 2ZRDA 3KB2A 4EFLA 5SZKB 2B8WA 1G19A 4JLNA 3SYLA 4TLEA 4MRVA 4WW0A 3KJIA 1M1YE 4D2IA 1I4LD 1Q22A 2AFIE 2NG1A 2IYSA 3CWQA 2Q0HA 1COWA 4Q19A 3DM5A 3QXSA 3U6KA 3WYAA 2IXFA 4LYHA 2D7DA 3OHMA 4RD6A 4DLXA 2JLWA 1G8PA 4P4SB 3U3MA 2WWGA 5FR2A 5FPKA 4TMXA 1DADA 4HB4A 2FFAA 1FX0B 3MSXA 5FTMA 5H8WA 3PENA 1H8HD 3W8NA 2GF9A 1LW7A 3N2IA 5B30A 1S3GA 1N25A 1ZU4A 2DCUA 3QPUA 4UXJA 5BQ5A 2Z4RA 1J99A 4UXHA 1CLUA 2OZEA 2W2XA 2WZQA 3FTQA 3OAAA 1R2QA 1RPZA 3B8HA 1YU9A 1N6KA 2WM9B 4X8HA 1KI8A 3SN6A 1DARA 2Q6TA 4GMDA 1KK0A 4D82A 1RJ9A 1AGPA 4DSNA 3Q5DA 2QMOA 3L82B 4EQ6B 1KO5A 3CWZA 2BM1A 2ZI5A 1G291 4W5JA 5FUYA 3K9LA 3LX5A 4IOKA 2XTZA 3X1XA 2VHQA 4KO8A 4DDUA 3HJNA 2IS4A 2O8BB 4LYAA 3KKOA 4CVNA 4KCGA 2CHGA 4OQXA 3GLHB 5FPTA 5K8TA 1XCGB 1T4GA 1DAFA 4KFRA 1L2TA 4N3NA 3ZZTA 3L8ZA 4LDJA 1OLOA 1CEEA 2GRJA 1D9XA 1A7JA 1IN7A 3RS2A 3NG1A 1KI6A 2V3CC 2WKPA 3D6TB 3ZVRA 3GJ4A 1JALA 1ZBDA 4HI0E 3H1TA 5DNYB 3DHWC 4BLPA 4TTQA 3QXCA 3L0IB 2RB4A 3QG1A 2W00A 5TV2A 3NH6A 2IEZA 1WB9A 3UIEA 5JWHA 1KY3A 4B33A 4JYBA 2Z0MA 4Q4AA 2IYZA 1RFLA 2VHUA 2HLDA 3W90A 2QBYA 5K8UA 3HPQA 3VQTA 2ZE5A 1G18A 2D06A 5F98A 2VP9A 4ZPXA 1LS6A 2FEOA 3R8FA 4F7WA 1XEWY 2RGEA 1VCOA 1U2RA 4EUNA 1IN8A 3ND8A 221PA 1P60A 3GJ5A 2MMGA 3CRVA 4KYUA 2D2FA 2ZAOA 2J7KA 3AP1A 3QXHA 1VYUA 2HJGA 3BXZA 4HZUB 4LJ9A 2VF7A 5E3HA 4PQRA 1O3YA 2G0NA 4CEIA 3RLFA 3FDIA 2FGJA 2P5TB 5JHGB 1TQ2A 4A2WA 1S4QA 5JEDA 4QC2A 1Q21A 1OH8A 3AEZA 1N2CE 1NY6A 1Q3HA 4RJLA 3GFPA 1TU3A 2B92A 4OI2A 2WHXA 2KSQA 5KU1A 3NBXX 1IJFA 4OQLA 2AKAB 2VSOA 4PHGA 2V8OA 4LJ6A 4YMTA 1XMSA 1XMVA 3KKPA 3QIAA 4D4MA 5FOTA 3K0FA 4JBXA 2IYQA 2IC5A 2QROA 4EPYA 2QSYA 3GEEA 3VR2A 2N46A 1AQUA 4DUGD 1V5WA 4LX0A 4TQUS 3FVQA 2NGRA 3RWOA 3ZH9B 3BAFA 2C96A 5BN3A 1Q1ZA 2I1QA 4HUQB 4MYUA 4LJ7A 4R2HA 1OIWA 2DY1A 1S1CA 3KJEA 4TQ9A 1L4YA 3T1TA 4KBGA 1ZUHA 3LXRA 1BMFA 2B8TA 1R10A 3L0OA 4NHOA 3IO3A 1IN6A 4NP6A 4FCTA 4YMWA 3UMRA 3PV0A 1Z8FA 2CMKA 2EFDB 3FGNA 2XOKD 1KZ7B 2QQ0A 4DRZA 1Z07A 5G3ZA 3HR7A 3QVVA 5DSZA 3RRNA 1F2TA 4JLMA 4R2IA 1LB1B 1Z6YA 3FKSA 5JMTA 2XZPA 3C5HA 3K09A 3K0AB 4ZIRA 3KTAB 1QG2A 1V43A 5DN6D 2NTYC 3K9GA 3AF0A 5GVRA 4PO9A 1P73A 3LBNA 5D3QA 5FTKA 1JEEA 3EZ6A 4PC7A 2QP4A 2PT5A 1II0A 2ZE8A 5CB6A 2X1VA 3QNUA 1R0ZA 2DWOA 4TWZA 4DDVA 4ESVA 1NSTA 1TF2A 4ZO4A 3IUYA 4NYMR 3BIFA 2O0JA 1E2EA 2CL0X 2J5XA 3PFIA 2OBNA 2PZEA 4M1YA 1KK3A 1AN0A 4HSEA 4FMBB 3IQWA 5L3QB 4DT1B 2FX3A 4EFNA 2IBMA 1EK0A 2RCNA 2ZRCA 1F5NA 2A5YB 1VCNA 2R44A 2ORIA 2ZROA 3AQ4A 3CRMA 4PHFA 4DSUA 3FPAA 2F1JA 4HAXA 5EP4A 5FTJA 5EXTA 2QAJA 3REFA 3TKLA 4FN5A 4HB0A 1R5BA 5FOUA 4URZR 5L3RA 1F60A 1G6OA 3GJ0A 5EE1A 2CVFA 1M6NA 2X8AA 4B3GA 1WF3A 2H16A 3EA0A 5DI9A 2RGAA 1SHKA 1NSFA 5FFMA 1NJGA 4BLSA 6Q21A 3B13B 1N5LA 1T8TA 2UZIR 3I3SR 4KHZA 2P6RA 2A9KA 2PEYA 1IOZA 1OIXA 2XEXA 3VR3A 1W1WA 4FCWA 2XB4A 5JSZB 4U7DA 2FFHA 3DMDA 1HUQA 2JJ2A 3QXXA 4JKYA 2BVNA 3NHBA 4OQNA 5BN5A 3BK7A 2QENA 3LRPA 1IAQA 4LHVA 1TQDA 4JBYA 1T0HB 5AJZA 1W47A 1E96A 1DAMA 1SVIA 4YQFA 4F93B 3R9XA 1X3SA 4DKXA 2AN9A 5SZHB 3W8RA 1F6BA 3AVXA 1Q12A 4C0BA 2G9NA 4WIAA 2REXB 2IS1A 3LY5A 4EDHA 4LHWA 3KQHA 3GJ3A 1ZUIA 5C4GB 5L8VA 2GAOA 2XAUA 3CX7A 1GUAA 4KFUA 2WIAA 4B3FX 1E2KA 4C0HA 2J0VA 5TVKA 2VHJA 5EXPA 2KBEA 2FGKA 1KJYA 4PHTA 4XTCS 5LD2C 4C9BA 1KI2A 1ZIPA 4JYCA 2ZRGA 3VTKA 3I8XA 3IEUA 4Q9LA 4FCVA 1N0WA 3BRWD 1E2MA 3JZMA 1HQYE 2J41A 1FOEB 1BMFD 4D0GA 1OH5A 2P2LA 2KJQA 1XCPA 3GD7A 4WZ6A 1Q20A 4V03A 3RRMA 2A3RA 4MDFA 5HCIA 4Q66C 2K5UA 1MO6A 3B7GA 4LUCA 1XPOA 5GJWC 2JJ1A 3W34A 2F43B 4C30A 3ASZA 1MR3F 3D8BA 2VA8A 3TSOA 1TQ4A 4O25A 4YMVA 1K5DA 1J90A 1Z3IX 2GK7A 4DDTA 2GJKA 4ON9A 4BFSA 4EJSA 1FMLA 5LDDC 2C9YA 5EUMA 2QRNA 5FR1A 1F2UB 5CITA 5TY0A 2J59A 1VMAA 3AUYA 2AR7A 4QGGA 4TLCA 1X8JA 2UKDA 3CUEF 3WMEA 1AS2A 3T34A 3A4MA 2A78A 2HV8A 3KL4A 3THYB 1U8AA 2G77B 3VKGA 5EZ5A 3GJ8A 4CF7A 2QNRA 5DLQC 1T6NA 4PC3A 2ATVA 1MOZA 4P31A 4F4IA 3QKSA 1JNYA 1W4RA 3MJRA 1F2TB 3FFAA 2GCPA 4RZXA 3B2EA 5FOVA 1E9BA 2WSSA 4BWYA 1E99A 2AXNA 3NC0C 2IF0A 4NYJR 4QG7A 1UEJA 2PJRA 4KVAA 4B32A 1DBSA 1DTSA 2VF8A 4Q4JB 1H8EA 4IVQA 1U0LA 3IBYA 4PQFA 1FQKA 3V00A 5CYPA 4TSFA 3NC1C 3SE0A 4AKEA 1E1QA 4JIMA 4EPXA 4WAUA 3CNLA 4XVQA 1KSJA 3SI7A 1NLYA 2O5VA 3AVPA 4HDQB 5FBRB 4CDGA 2J45A 4AURA 2HLDD 4Q4AB 4V02A 3IPXA 3EASA 3NTUA 4WVFA 1KK2A 2JLUA 2F3TA 5FPHA 2IHYA 4WXRA 3BERA 5LB2A 4A6XA 4UNPA 4DJTA 3U3KA 4A2QA 1W44A 3PR1A 2IYWA 3B1XA 3GEHA 4IFBA 2CDNA 2F9LA 3VNUA 5AJVB 1NF3A 1GWNA 1BYUA 4Q1FA 3VMFA 4PZZA 2PLRA 2XB2A 1ZW6A 3LQRA 3LO5A 3VR1A 4AI6A 5H70A 4OI0A 2ZE7A 1XTQA 3EZ9A 3KXLA 2R6CA 2OLJA 4WOPA 4QFMA 4HATA 1VIYA 1T3LA 4D80A 4IDOA 3SJAA 3IEVA 1R5OA 2IYRA 2VEDA 1L7VC 3EZ2A 3CPHA 3R9IA 4XVUA 1RJ9B 5B57C 2GDJA 4UXIA 3THXA 3I73A 1AJEA 3TSZA 3CZQA 1VTKA 1E0SA 1Z08A 3AKCA 1W2HA 1E9EA 1G8YA 2YC2C 4BECA 4Y0AA 1OKKA 3CW2A 2X2FA 4M1SA 4QHTA 2IT1A 2JDIA 3IDQA 4PSVA 4URVR 3QVUA 3AVQA 4ITRC 5FH9A 4PPGA 2NMVA 1NBME 3K70B 3CR8A 2YWEA 4QBGB 3ZVMA 1VG9B 2G6BA 3U44B 1LY1A 3I92A 1XDBA 1NG9A 4OL0A 2GNOA 4FMDF 1SXJB 3A36A 5EP1A 4TYWA 2Z4SA 4A1FA 5TB5A 1KI6B 3OFND 1JEDA 4IDHA 4MRRA 4DSTA 1NN0A 4GI7A 2XTNA 4N0EA 1F3OA 1DOAA 2LCFA 2WIBA 4M53A 3SHWA 3ZZUA 1Z0DA 2WWFA 1TL7C 4XWAA 5CM9C 5DYGA 2GEVA 4A0RA 4IHQA 1Z2AA 4PXAA 4RD2A 5KDOA 3D3QA 3IO5A 3C41J 2ZSBA 2ZYUX 3LV8A 3MGCA 3SNHA 1GM5A 1G8GA 1UEIA 2ZRLA 1CP2A 1GZSA 2QY9A 3P20A 4US0R 4BFXA 2V6IA 3VR6A 2FDCA 3RHFA 3KTAA 4G01B 4II7A 1JQLB 2IYYA 2WV9A 4A92A 5KNDA 4U00A 3WYFA 721PA 4LHZA 4DLRA 5L3VA 2QUZA 2F1IA 3A4LA 1UKVY 3AVOA 1WXQA 2YOGA 4OHYA 3AVVA 5D3MB 1PVOA 3B78A 1II8B 3CH4B 3P4XA 4GOJA 3ZD6A 1NVUQ 3GJ6A 3L8YA 4D0NA 2ZTSA 1PLJA 3RNLA 4W9MC 1YRAA 2PZFA 4B47A 4F92B 4B2PA 3LWNA 3TNFA 4LJYA 5K8LA 4XJXA 4DEYA 3TUZC 3ASYA 1W36B 4YONB 1U0HC 4LJ4A 3NXSA 3CR7A 1JAIA 1KJZA 2ERYA 3TR0A 5B64A 2DYKA 4JLVA 1UKEA 1SKYE 3MMPA 4G1UC 1AM4D 2ZQ5A 3OEHA 1S2MA 2FZLA 2GEDA 2PX0A 2FE4A 4B6EA 4I81A 1GKIA 4LBVA 1XJCA 1BH2A 1MKYA 1X8LA 1ZM3A 4BRUA 1N6PA 4K46A 4MYTA 2IWHA 4YXWD 2B7CA 2YZ2A 2A5JA 3CIOA 2QRZA 2YWHA 4KSCA 3BB4A 2ZU0C 4LV5B 1YJ5A 2GA8A 4UNSA 2BWJA 3B1WA 4RCZA 2XJ4A 5SZIA 4H1VA 3KB1A 5EP3A 5TXGA 1P9RA 1E2QA 4PZLA 1W4AA 1ESMA 3TVTA 2GK6A 4HEJA 4PAQA 1EWQA 1IN5A 4LC0A 2ZR9A 2ZANA 3EPKA 4QBHA 3GP8A 1E9RA 1HV8A 5KHOC 3MWYW 4Q02A 5FPSA 3IILA 3FHTA 5BXQC 1X6VA 1A2KC 1RVDA 4OQFA 3W9YA 3MUFA 3EWSA 2O8FA 1E79D 1VIAA 2JJ1D 2R6FA 3AVUA 2HT1A 1L8QA 1YVDA 2G1JA 5J4HA 2QORA 4NL4H 4I1UA 3RRZA 3PUWA 2D3WA 1DG1G 4BZPA 4EKDA 1I4TD 2ZI6A 1NBMA 3SU8A 3O8CA 3GLHA 2KB0A 4AKHA 3QBVA 4JSYA 2O0HA 1G7CA 3R7WB 5JEEA 1SZPA 1KO1A 4WBSA 1IM2A 2QE7A 4HAVA 4DB2A 4TMZA 2E1RA 4ARZA 3KUCA 5JBQA 2QPTA 5BYJA 1DAEA 3ONWA 2LKCA 2ZS8A 4H1UA 4LGMA 5JCPA 2ZYVX 1GP2A 1TEXA 4HLDA 3CF0A 2WWHA 1TTTA 1IQPA 1KSHA 2OM2A 4LHXA 1G8FA 3F5FA 2FJUA 4O3MA 5GADl 4Z54A 2F9MA 2YINC 3DPUA 2W6IA 3A1TA 1U98A 3TE6A 5J4KA 4DB4A 3T1OA 4QRHA 4A8JC 4RD3A 3U6BA 2ZIAA 3OZXA 4HB3A 4EPTA 2ZJAA 5AJWA 4RVCA 1S3SA 4GP7A 4XWOA 2ZPTX 1Q57A 2ZSDA 3AGPA 4JVLA 4NKRA 4V0NA 5G41A 4TZ6A 2HT6A 2C77A 1JJ7A 4FINA 2OCYC 3A1SA 3LQQA 1E9AA 1E1RD 1VG1A 2RKOA 2GJ8A 4NE2A 4M9SA 1W36D 3KQLA 1OJLA 1KO7A 1HQCA 5CIQA 4EPVA 3IHWA 3A1VA 1MH1A 1XB2A 3QKTA 1G3MA 2DFLA 2ZRFA 2ZM5A 4M1TA 2IUUA 4Q03A 3C15C 2QT1A 2OXRA 2ZJYA 5GJBA 3QKRB 1ZNYA 3CRRA 3WHKA 2WPDD 3Q8XB 4A8JA 5FL3A 3VR4A 2ZRHA 4UJ3A 1ZUNB 4LYFA 3U2QA 5J4YA 4M9ZA 1N6OA 3Q72A 1AKEA 4RFSA 1XXHA 5FBWB 3VX3A 2YC4C 5AK0A 3QF4A 4BRWA 3W5IA 4Z8YA 3BOSA 4EIWA 4BLTA 3NHAA 4D6PA 1XMIA 3M1IA 3R7WA 1WQ1R 5KSOA 2NZJA 2J46A 1S0UA 3RAPR 4ACBA 4BFZA 1CR4A 1WBBA 2ZU6A 2JLZA 4R7ZA 2B7BA 2OSBA 4M22A 5HPYB 4GOXA 3KJHA 2F3RA 3K0AA 3ZD7A 3EW9A 2GXSA 2GKSA 1P4SA 1CJKC 3GCGA 1YZKA 3U3RA 4Q9KA 4KAXA 5AWFC 1Q0UA 2D74A 4L5BA 3WMGA 3V9PA 1W48A 1FL9A 4XH9B 1JXMA 4E09A 3DOFA 3OIWA 2N42A 1U8YA 1WBDA 1E0JA 2VHCA 1NBMD 1NKSA 1NN3A 3SYNA 4ASUA 2FA9A 2J1LA 4JJKA 1YZTA 2XTMA 3AF4A 1E2GA 3EC1A 4LBWA 2BKUA 1EFRA 1OFUX 8OHMA 1GG2A 1P61B 1AKYA 2QE7D 2IA5A 2ZVPX 2DFNA 4A36A 1OFIA 4IDQA 4I4LA 4P4SA 3PEWA 1M7BA 2CL7X 4M1OA 1EGAA 1SXJA 2W6JA 4MYHA 5SZJA 2PBRA 3AP3A 2W58A 1P3JA 1KYIA 1W0KD 4MGIR 4U02A 4FWIB 2ZJZA 1CJMA 2FU5C 2C9OA 1U90A 3B1VA 1SVLA 5DYIA 4CGZA 3Q9LA 4HLCA 3T1VA 3THWA 1ZAKA 2JIZA 3JVUA 2IXGA 5F3WB 2C98A 5BN4A 4MA4A 5F2EA 3LX8A 1S96A 2NPIA 3CZPA 3ZYCA 1NP6A 3QEJA 3M6AA 5HKKA 1R0WA 2VPPA 1UAAA 4Q1AA 4D0LB 3TVDA 4PQYA 4A6PA 3NEJA 1YZGA 3GLGB 2BJWA 4N0DA 1JR6A 5DHFA 5E7JA 1MRNA 3QJYA 1EFCA 1DVRA 1P72A 3G5UA 1YKSA 3EX7C 1Q1QA 3KXIA 3SR0A 1VCMA 3BB3A 3EWAA 3QF4B 4AKIA 3TW8B 4WXPA 5EE5B 2G83A 3SZRA 1U0JA 4C0QC 1E3MA 2ZYWX 3AKYA 4B43A 4L4UA 4GDFA 3CRW1 2RGGA 1ZC3A 2OT3B 3QPWA 1YQTA 2ZJ8A 5HCNA 4DSOA 2ORWA 5FUVA 4EAQA 1LNZA 3W6PA 2GXUA 2D62A 2YOHA 3P27A 1CS4C 3OF5A 2AHOA 2CCGA 3A4NA 4C4PA 1KI4A 2F43A 2FV8A 4AYWA 1IY1A 1NVWQ 4FD2A 4D4KA 4M1KA 1G7TA 2GWHA 3EZ7A 4UQOA 2FEMA 3CF2A 1NVVQ 5JCZA 2O52A 4PPQA 2BBOA 3OE7A 1MABA 1D2NA 3TLXA 4QM7A 3EPLA 1KDOA 1T3SA 1KAGA 2H7VA 1F2UA 2WJYA 2PMDA 1UF9A 2P0EA 3H86A 2W83A 3I1FA 3L43A 1E2PA 3BORA 4ZKDA 2A5DA 1M34E 1XD8A 2ZJOA 3PJRA 2PX3A 3SJBA 4MITA 1Z28A 3U5ZB 2IW3A 1ZP6A 4Q1EA 5CLLA 4B2LA 3TBKA 3O8BA 4E5UA 1E9SA 1DELA 4KV9A 3WNCA 1QHIA 3AUXA 1JJVA 5JFGA 3VX4A 2AL7A 4L15A 1BYIA 2ZI4A 3FOZA 4MRPA 3ADBA 4BEJA 1XXHB 1EX7A 2J7PA 1N0VC 5GJCA 2DBYA 2AXPA 1HT2E 2DPXA 3ADDA 2QI9C 3R9WA 5FUXA 2BMFA 5GVSA 3U3JA 2W2TA 1OYYA 3VHXA 4NCKA 3PXGA 5C4MA 3GLGA 4NH0A 5FTLA 3W3AA 2VHTA 4JLAA 1SXJD 2W6JD 4ACAA 3BH7A 1QRAA 1HY3A 4FIDA 2O8DA 3I32A 4M9QA 1DPFA 2Q9AA 4RD1A 4DWJA 1XPRA 2REOA 2ZE6A 1NMXA 1BO6A 2IXEA 1J8YF 5F9FA 3BC1A 1Z6GA 3P26A 2OFOA 4KXFB 4DEXA 4YLGA 1T8UA 3CONA 1XTRA 1S8FA 2LWIA 3MCAA 1HTWA 1LV7A 1L4UA 2NPFA 3WHLA 1E9DA 4AD8A 5EZ6B 3OEEA 1HT1E 2ZUBA 3D7MA 4M8NE 2DWQA 4URWR 3VHLB 2HXYA 3CRQA 4X8LA 5JWOA 4C0LA 3H2YA 2VRWA 2J7PD 3WRXC 3LVRE 1SVMA 2VH5R 2GTPA 1G5RA 1ZD8A 3LAWA 2YNMA 5TDHA 2JASA 1KMQA 1SXJE 2AWNA 4LC1A 4A82A 4HZUA 1HA3A 1KMHA 1KAOA 2OFXA 2OAQ1 5DE3A 3QEOA 1XD2B 4JLJA 2P6UA 4ZI3A 5EE9A 1SVKA 3IQXA 4DCVA 2FF7A 5J5CA 4YMSA 2XGJA 4Q18A 4QM6A 3HYRA 1KI7A 4XOIA 2DFTA 4BZXA 3KKNA 2RHMA 5FUWA 3VU9A 3R20A 4LV8B 2BMJA 1E94E 1QHYA 3QG5A 3PUZA 3U7GA 1MRSA 3UG6A 4MQBA 2O0KA 5J4VA 4B71A 3Q5EA 1FFHA 3THYA 2WJVA 3OIYA 2EFGA 2QAGB 4Q9HA 4JBWA 5IRCD 1R5NA 2BKEA 1KO4A 3LW7A 3PUYA 3LW8A 1UADA 1ZNZA 4FMCB 1FP7A 1ZM7A 2GHIA 4XVRA 3IKJA 1CRQA 1UBCA 1H8HA 4IJMA 3ZZ0A 2BCGY 3X1YA 1COWD 1KHTA 2QGNA 4URUR 4PSAA 5KTYA 2J0UB 3VFDA 2BOVA 3LBIA 1E2JA 1NI3A 1YRBA 1GL9B 2WPDA 2CHVA 2ZAMA 3CKLA 4ZCLA 4B75A 1KI9A 4LZZA 1JBKA 3DVLA 2CHQA 2QZ4A 4HUTA 5FI0B 821PA 4GP6A 5DIFA 3K0EA 4DLSA 2H17A 1YHNA 3I4LA 2WTUA 4RZUA 2F6RA 4B3DA 4P33A 1SKQA 4DCUA 1Z06A 4ZDIA 3VKWA 1P6XA 4IFEA 4WA7A 3SJCA 1DG3A 4US1R 3HU1A 3RWMB 3SQWA 3HP1A 5J4LA 5HZKA 3W5JA 1ZJ6A 1Q44A 3EARA 1P2TA 3Q7PA 4F4CA 1SHZA 4HZIA 3OIUA 2BMEA 2XZLA 3PEVA 3A1WA 1KDPA 4LBZA 2GF0A 2RHDA 4GPTA 1G9XA 5AR1A 4LPKA 2B6HA 3U4QB 1AK2A 3TRFA 4HB2A 1JAHA 1EWRA 3P32A 2ZI3A 2OXCA 4JVSB 2OCPA 4GSYA 4HAWA 3X1DA 1I2MA 3GFOA 1G20E 4MYCA 4Q7MB 4KITB 5C18A 1XD2A 3RS7A 3J81k 1P2VA 4KJZA 1E4YA 2OE2A 2KBFA 1GDDA 1W4BA 4B73A 4OKSA 4M9XA 2CL6X 3BFKA 3X1ZA 4LSGA 1G4UR 3I72A 3OE7D 1LS1A 4FXPA 4LRWA 3E5HA 5EE3A 2AWOA 3PUXA 3HU3A 5L3SB 4RZ2A 3GLGE 5KDDA 4Z51A 1FMJA 3I5XA 3T5GA 1Z0IA 2R8RA 3BB1A 4TYNA 2ZRBA 2HUPA 4JJZA 1LF0A 1QF9A 1EFUA 1RRFA 1W5TA 2FG5A 3SBDA 2BBTA 1JR3D 5CK4A 3FKQA 4LHYA 1NIJA 2O8BA 1FTSA 3SDZA 1RYHA 2PH1A 4IVPA 2BJVA 1VKJA 1ESNA 2QM8A 4MKIA 3WNBA 4DVGA 1RZ3A 5JS7A 1GVNB 1OHHD 3K9HA 2OESA 3U44A 4S2EA 2YWFA 3GLIE 3RC8A 1WA5A 3B9PA 2WSMA 4DIEA 4M0LA 4UNNA 4Z1MD 3DKVA 3OAAD 3E2IA 1OPXA 5CK5A 5EUQB 1XRJA 2FNAA 1R8SA 3U7FB 4CEHB 1G8HA 1VECA 2CLCX 4L9SA 1H65A 4KU4A 1J8MF 4DZZA 4KI0A 4BE7B 4DHEA 1U9IC 2NO1A 3W3ZB 2OO7A 2VQSA 4B76A 2F1RA 1KJWA 3TSWA 2JAQA 2EWWA 2GXQA 2MMCA 2ZJBA 3RSLA 2O8EA 3K53A 1I2DA 1XU4A 1RE0A 1EFTA 4G5SA 2G88A 2OBLA 1KMHB 1OYWA 4FI3C 2O8FB 1FNNA 4NCNA 2VSXA 1EESA 3ADKA 3P1JA 1QHGA 3R8CA 2XITA 3BD9A 3AVYA 4KFSA 1W2GA 2VYFA 4QNRA 3U4QA 1P9NA 1YR8A 3A8TA 1A5TA 5E4FA 2FFQA 1Z0FA 1LF5A 3TGPA 2C95A 5LBIA 2KWIA 3HU2A 3CM0A 1JPJA 1JXOA 4Q00A 3C8UA 2XXAB 2DB3A 1GITA 1PLLA 2FSHA 2QAGA 3BJIC 2A7QA 1Q3TA 3KDSE 5JWRA 4YMUA 2CNWA 5JZVA 1F48A 4Q48A 3ETLA 3FKSD 1SVWA 1MV5A 2XZOA 2ODEA 4TLAA 5L3SA 2CE7A 3AB3A 1U94A 1T9HA 1X1SA 4HLUA 2W0MA 2ZUCA 1HE8B 4D26A 2WWIA 2ZS9A 4TN1A 2NOAA 2QMUA 2QL6A 3JVVA 4DC9A 2BM0A 4TTRA 1NG1A 4GZLA 4NU0A 2O8CA 1YZNA 1KOFA 1NKTA 4GNKA 5C1BA 2NQ2C 1WP9A 4M1MA 3ND9A 4DUGA 5C46F 4HDOB 1CXZA 1TUIA 4GRAA 5CJ2A 1CIPA 3MJHA 3TR5A 2BC9A 2J0UA 3TK1A 2PL3A 3KUDA 2OEPA 4QL3A 1TMKA 1Q1BA 3SS8A 3C14C 3MWLA 4IRUB 3FMIA 3FMPB 1KI3A 4HAZA 3LLUA 1BIFA 1NY5A 2C2HA 3CLVA 1XTSA 1KSGA 5A4JA 4DCNA 2FPLA 2EQBA 5E95A 4BPBA 2QTFA 2BV3A 3LFUA 4C0SA 3NKVA 1DAIA 1GNPA 1VYTA 4NYMQ 4OJKA 1K8RA 2XSZD 2ZR0A 4XTRA 1Z29A 1E69A 4R9UC 1OT3A 5JI2E 3BWDD 4FWTA 1GRNA 5AUPB 2WWXA 5CYOA 1EXMA 1T3HA 3K70C 3B9QA 4M1WA 2V4ZA 3UMSA 2ASEA 1AS0A 3L0PA 4NYIR 4QGFA 4XSGA 5FTNA 4Z1MA 3SOPA 2EFHB 3KXKA 5HZHA 5CDFA 3GQBA 3N70A 2DFKB 5JLJA 3VAAA 1G7SA 2WAYA 4O2RA 3OEHD 1AIPA 2MSDB 2G0TA 1Z0KA 1ONBA 3UKDA 1IN4A 1OIVA 4F91B 4TYYA 4PPNA 2C99A 3WP1B 3AKEA 4OJQA 3U60B 2Q3FA 2FN4A 4RKFA 4I1SA 2CE2X 1YR6A 1K5GA 3N5CA 4I1OA 4IVRA 4NPHA 2CLDX 1E2LA 1E4VA 2SHKA 4TT3A 1ZCBA 3T5DA 4BFUA 4MKGA 1OKKD 1PV4A 2R65A 4AIIA 2NO7A 4R98A 1NL3A 1OB2A 3PCRB 4PFSA 5HR5A 4PHHA 4URYR 2JEOA 2YOFA 4NYJQ 5EQTA 1OE0A 1XJQA 1N6NA 2OILA 3GLHE 4JL6A 5AJYA 2FH5B 2ZYTX 3K0SA 3NWJA 4B3CA 4G5OA 3CO5A 3S1AB 1TU4A 2BIFA 1TEVA 1OXSC 2QG6A 4AYTA 1KNQA 4CEIB 4U5XA 4ASUD 2QEQA 1TPZA 2IYXA 4A9AA 3CF6R 4TT3D 3K0CC 3EG5A 2IYLD 1NLFA 2J0QA 2EWVA 2PMKA 3FFBA 2ATXA 1M7HA 4NCHA 3E70C 1XTKA 4TYQA 1A1VA 3NIBA 4IOLA 3WY9A 4XD7A 1XZPA 2GCOB 3T15A 4AG6A 2AFHE 5IK2A 4ILEA 1W5SA 5BW8A 3DDCA 2A5FA 2QTHA 3OEED 3FHCB 4DXAA 1E2DA 2E9SA 4OHXA 1XWIA 3QKRA 4JL5A 1ZD1A 1NJFA 2G3YA 3AF1A 1G5PA 1PUJA 4QGHA 2OHFA 2V7QD 4YC7A 5FBLB 1T5LA 2ODWA 3OIVA 4RFSB 2GEUA 1UKYA 3MAAC 2YKGA 1QHHA 2QMHA 3L2OB 4JT2A 3P4YA 5KSYA 1TF7A 3TAHA 2XSZA 1TQ6A 1GIAA 2C78A 5IT5A 4PC6A 3EIHA 1Z0AA 2RAPA 2QP3A 1SVSA 4UJ5A 5UKDA 3PEYA 1NVXQ 1W46A 3D31A 3TMKA 4L16A 4AK9A 4P3YA 2B21A 3EPHA 2FFBA 2GCNA 5BWMA 4PX9A 3SJZA 3RS4A 2MSEB 3SEAA 2BMDA 4Q21A 3TAUA 1MO5A 3H4MA 4RKEA 3U7HB 2AKYA 1Z22A 4XD7D 2LKDA 2IL1A 4NCJA 1N5JA 4BFVA 4DLUA 1G7RA 5ANRB 1FQJA 4TMWA 5E7MA 3NBZC 4NTZA 2KE5A 3I5YA 1ELOA 1CR1A 2JGNA 4OK6A 1KY2A 1BOFA 1XXHE 2UZ3A 3DL0A 4LYJA 3K09C 2GJAA 5AUNB 2GAAA 4A0FA 1FUKA 4GZMA 4TMVA 3K8YA 2IK8A 3IGFA 3REGA 3S1AA 3GLIB 5KPDA 2FSIA 5JECA 4G0NA 5GJVC 4MH0R 4OI1A 4JLPA 1FP6A 2H92A 2IF2A 3ICEA 5DH9A 2JLRA 5KNCA 2IHBA 4ZDKA 2HCBA 1J70A 1DS6A 4PC1A 3UG7A 1UBGA 1US8B 4X8MA 2ECKA 2XNDA 3FE2A 5CDFE 2JLVA 4D25A 1DAGA 2BEKA 2JLXA 1JI0A 2UVQA 4YDHB 2JLYA 4QGAA 1E32A 1PZNA 3ADCA 2EU8A 5KO2A 3TQFA 4Y0VA 4RY2A 1IONA 1IY2A 2GJSA 5EXSA 1R6BX 1G4AE 1Y3AA 4RZ3A 1GKYA 1QHNA 1QG4A 1XEFA 3K1JA 2CBZA 3CB4A 4ERNA 1P5ZB 4TLDA 2PZGA 1KGDA 3F8TA 2P65A 3G0HA 4BZQA 2GZDA 5KUTA 4C7OA 2WSSD 2C04A 421PA 2IS6A 4BUJA 3FMFA 4E03A 2DHRA 1G21E 1NN5A 2VTKA 5CJPA 2QPAA 121PA 4UKDA 2OAP1 5AJXA 4ABYA 3QSYA 3QY0A 4EJSC 3C5CA 1ZD9A 3KZ1E 1B23P 2ONKA 2R6AA 2BBWA 2OCBA 1KZGB 4QNMA 2CXXA 3CH5A 2ORVA 1BS1A 1GNRA 2ZRPA 1Z6TA 1PLKA 2WOJA 1IHUA 5KDLA 2JA1A 3BFXA 4FMDB 2J3EA 3A6PC 4US2R 4KVGA 1AZSC 4AWXA 3CPEA 2FSFA 5KOYA 4TL9A 1M7GA 1MABB 3B5JA 4ESHA 3SFZA 4DCSA 2HJVA 4HYYA 1KDRA 3MRSA 1UM8A 5JRJA 3AVWA 1XEXB 4MGKR 3O8DA 2QSZA 1TAGA 2EFCB 2QT0A 2ZRIA 3H0KA 3PIRA 4W5HA 3Q85A 5KSPA 2GCOA 5KYKA 4L8GA 1WCV1 1CTQA 2WICA 1Z5ZA 4QJ4A 1N6RA 4RSGA 3ZDQA 2RGNC 1E98A 1MT0A 1GFIA 2HXSA 5AUOB 4GMXA 4JVMA 4ZV4A 2C9CA 1ZC4A 3ZIAD 1CF4A 1G3UA 3DOEA 4HLQB 1II9A 2ODBA 2CCJA 2IWRA 3EIEA 4Q7LA 3LDAA 3QF7A 1A82A 1CULC 2GETA 1VDZA 3BE4A 1NVVR 4CIDA 3M0EA 2W2VA 4R71A 4AC9A 3GLFB 3NH9A 4WZAE 1J7KA 5IF9A 5TMPA 1JQJC 2OFWA 1IBRA 2OLKA 2V9PA 4LJ5A 1RC8A 4V0LA 4QKQA 3RVBA 1D6JA 2F1HA 3O8RA 2BCJQ 1YR9A 3LXXA 2FZ4A 2BBSA 2VLIA 1O87A 4PO8A 4W7SA 1A2BA 1HURA 2QQEA 1W36C 5JJIA 2FMXA 3K70D 2JATA 2IYUA 3JZAA 2QM7A 4MGZR 4TMKA 3RSOA 1S1MA 4B44A 2WKQA 4Q4HB 3B82A 1E0AA 3GMTA 2RMKA 3OESA 4IXNA 3ECCA 3H84A 4RFVA 4MRNA 2ZEJA 2ZSAA 3QE0A 4E22A 1G3QA 4CEJB 5FBQB 1XMJA 4C2UA 5K8IA 2RGDA 2N1BA 1QZXA 4CEHA 1FZQA 3C4JA 5JRZA 3EIQA 3KX2A 5BYKA 2QAGC 4KYIB 2BDTA 4Q01A 1MO4A 2HDNB 2EVWX 3C7KA 3NBFA 3TIFA 1R7RA 1ZM2A 2AX4A 1OHHA 3QOFA 1X1RA 4V0OA 3UANA 5JJKA 4ZI2A 1SGWA 1E2HA 4NCIA 4KODA 1KNXA 1WMSA 3RS3A 5LD2B 2V1XA 4OHVA 4RD4A 4DLYA 4OYHA 2QU8A 3VR5A 2P5SA 1AGRA 2ZJ2A 4HDCA 3UXMA 5IK2D 2ZSEA 4CT4B 5IHPA 3HDTA 1E2IA 4EPRA 1P2SA 2ZS7A 3E1SA 4B35A 1G16A 1VYVA 4DLWA 2XXAA 1HYQA 3TJZA 3DO6A 3ZS9A 2IUSA 2ZVQX 4NMMA 3ZVLA 1ZCAA 3A58B 3NBYC 1YZLA 2QN6A 2WBLC 2ZRKA 5H1YA 1Z2CA 2OUKA 5CIWA 2VP4A 2GILA 4BFYA 1XTIA 4OK5A 3ZQ6A 3GLFA 2CVHA 4TLBA 1D9ZA 4LBYA 4B6FA 3WNDA 1H8ED 3IHLA 3G82C 1XX6A 4BGDA 2YV5A 2ZREA 3A1UA 1U99A 4I1VA 4QBIA 1TF5A 2WJHA 2HF8A 621PA 4JZKA 3B85A 4URXR 2J9RA 3TW4A 4H9GA 1TX4B 2ZJ5A 3LBHA 1N3BA 5A5GA 3SFVA 3RANA 1DAKA 1CJTC 1DO0A 4KLZA 3IBGA 3AGQA 1EX6A 2EW1A 3O47A 1P9WA 4LJ8A 3AP2A 3HR8A 4Q7KA 1UDWA 2CLSA 1GL6A 5DO9A 2GZHA 2KI5A 4PAOA 3CBQA 4D81A 1P7CA 2GBLA 1LFDB 3LLMA 2QBYB 1ZM9A 1ZMXA 1RRGA 1E2FA 4TQAA 3IIJA 3WBKA 1P62B 2JLQA 4P0TA 1OXXK 1SXJC 4A2PA 2OV2A 3AF3A 4C3ZA 5LB4A 5J47A 1YZUA 3RS0A 3U7EB 4O2LA 1ZRHA 3GJXC 5FPYA 2NO0A 1E6CA 4GOKA 1RRPA 1U81A 1QDEA 5KSZA 4JL8A 4P32A 2GESA 5DHAA 1KIMA 3AF2A 1FW6A 3Q7QA 3QUSA 1UKZA 4Q1BA 1D2MA 1T5IA 1UJ2A 2PJZA 4PC2A 5EJEA 2RGCA 3BH6A 1CKEA 4X8OA 2C03A 2R62A 3AM1A 1T0JB 4B3BA 2HYIC 3UATA 3HYTA 1W0JD 5JJLA 3BGWA 1XCMA 3WXMA 2ERXA 4OBEA 1US8A 2CK3D 5JSZA 1OFTA 2IYTA 4Q1CA 2HCJB 5FOXA 1W7AA 4LJAA 1CU1A 1OFHA 4XWKA 4JSTA 2H1LA 1SVOA 3AH8A 1N6IA 4DLVA 2HYDA 3QBTA 5LPNA 1OXVA 1PUIA 2ZETA 1S9HA 3F3YA 4DBLC 4F4JA 2RGNA 2Y8EA 1B0UA 1OH6A 1JR3E 2GJ9A 3CPJB 3M4YA 2IUTA 4OQMA 4AG5A 2ZRNA 4BEBA 1ZU5A 1GRRA 2PCLA 2O8CB 1MO3A 4JKIA 1FNMA 3EZFA 2CNWD 3W6NA 3B6EA 5D3MA 3ZS8A 3SC3A 2X77A 1SKYB 1VCIA 3RS5A 4Q4JA 2D7CA 1S9DA 4POAA 1XNJA 1X86B 2Q9BA 3K9NA 2D2EA 4J0QA 4XSHA 5HKKD 3A37A 2XNSA 4B3XA 3W6OA 3RYTC 2H8KA 5J40A 1CJVC 2ZI7A 4MGYR 5G3YA 2RGBA 1KDTA 1FUUA 3B1ZA 1A4RA 3CX8A 3QI2A 2OCAA 2DR3A 2R9VA 1OXUA 4LI0A 3IIMA 3WRYC 3FHOA 4PTLA 4DT1A 4OK3A 2JDID 3GLIA 3KQUA 1KKLA 1Z83A 4AY2A 4LK2A 4B34A 1G17A 4ZDWA 4NDZA 1OV4A 2JIZD 2OBMA 4TTPA 1LTQA 3LD9A 4IKEA 1CRPA 1E1QD 5H68A 2VIIA 2A30A 1E9FA 1RIFA 5DISB 5HE8A 1XD9A 1XEXA 1OB5A 5B2ZA 3GLFE 2X19A 1GKUB 1M74A 2RGXA 3VKHA 2NO9A 4YDSA 3MWKA 1VG8A 1CBUA 1CR0A 1KK1A 1IY0A 1HEIA 1RYFA 3MFYA 4JLDA 3RABA 4L9WA 1D8TA 5E7IA 1NNEA 1QBKC 3KJGA 1QVRA 1WRBA 1Z63A 2VP2A 5EP2A 1D2EA 2Q9CA 3UPUA 4JLBA 2VP0A 4NBSA 1UFQA 3TH5A 1RRCA 2IS2A 2I1VB 4CT5A 1ETUA 1FTNA 4OHZA 1M8PA 2R6GA 4D4JA 4IOMA 4C7OB 3DZDA 1N6LA 4CYMA 1E0KA 4TL8A 5KNBA 2XOKA 2R6DA 3PEUA 521PA 1RKBA 1OF1A 4W5WA 4OHWA 1W0JA 3BFVA 4MKFA 4JMPA 4FW9A 4OI4A 5CM8B 1SULA 2J0SA 4LCBA 3ZLJA 3BH0A 3NVAA 4FMCF 2NIPA 1HH4A 1IXZA 1ZIOA
chains in the Genus database with same CATH superfamily
2H9IA 1NZDA 2ENWA 3NANA 3OCWA 4G8CA 4RK5A 1IK6A 4N6GA 4J1TC 3VA7A 1GPUA 1L5SA 2PLFA 3W5CA 1QRSA 1G2OA 4XCXA 4DUYB 1FBNA 5TGDA 5P21A 3MELA 3FYHA 3GUYA 1HZJA 3MS4A 4YRLA 4ECEA 1HYGA 2UZ4A 4G0UA 4DCTA 3DE3X 1EB9A 1YVEI 4L4ZA 7MDHA 2X5XA 2YYAA 2HRQA 1HZZC 3C16C 1U0NA 1XJ0A 2IVZA 3BGOS 4JR0A 2IXAA 2ZQZA 4PXYA 3S6JA 5M04A 3MHTA 2PKXA 3HWWA 2PA0A 2XOXA 4ZYUA 4LTMA 2IHKA 5IVDA 4MUGA 4RQTA 1R4AA 2JLSA 4DXHA 3NMUF 3PITA 2B0JA 2F90A 4MUJA 4TMTA 2B1QA 1V7PC 2PVPA 4JT4A 4EYOA 3BS4A 4YIHA 1NURA 4CKEB 1TCVA 1CG6A 3I9OA 5K99A 1R8XA 2FWRA 4GM4A 4OFBA 3LWZA 4AJNA 4CKWB 4CQLA 4JKOA 2HRCA 3H1PA 2IJGX 1X92A 1K5PA 4UBLA 2ONYA 3THXB 1MJFA 4ENTA 1VHTA 3LLCA 5CM2Z 1M2OB 2IY7A 2OGSA 2ESRA 3B60A 1LX7A 2ECQA 3U3OA 3IMKA 4BHTA 1PJLA 3Q7IA 4NONA 1C1YA 1KSFX 1W0KA 1J2EA 3NLLA 4Q9AA 3R75A 1GZ4A 1OLXB 1GTVA 1OZFA 2GYYA 1JSCA 2NO6A 2HWXA 3OX3A 2NTJA 4KGZA 4LOKA 4FFPA 3SFTA 4YAEA 5EXXA 3O1LA 3WSVA 1QIIA 1MENA 4G0QA 2BHRA 2EYUA 5ESXA 1JR3A 1X8KA 1E1DA 5FQNA 3HL4A 1ZMBA 1D04A 3DTVD 2IDKA 2VXOA 3CFYA 3EOAI 5EL0A 1W36B 2OQ2A 2YHAA 2VJNA 5F5LA 5F1KA 3WDLA 1ZUWA 1T2FA 2Y0DA 4OOFA 3VNRA 3VNBA 1UWKA 2FW0A 4IXWA 1Z4NA 3EVCA 4XRRA 5EE0A 2F7SA 3UJ7A 3ZGVA 1G8JA 3QEBZ 4PONA 4TL6A 4B8YA 3IPYA 4NZMA 1G3IA 2HEIA 2V6JA 5K45A 1U7WA 1J25A 1H05A 4XZ3A 2QK4A 1KQFA 2QJOA 4BGVA 4MEAA 2IEGA 3PRYA 4FFBB 2AD1A 4H4EA 4PZEA 5C2JB 1KTVA 2RH8A 4M21A 1Q1NA 3T35A 2HBQA 5EZYA 2FP3A 1IDN1 4C0XA 5TMEA 1UOEA 5KYVA 2H57A 4HAUA 1G5TA 3F1KA 1I80A 4PO1A 1BHSA 1OJ7A 3C3DA 4KFTA 4NFSA 5EMLA 3QOXA 1Q14A 2KMLA 4NYIQ 5A4DA 4G1CA 3TZQA 1GNQA 1NV9A 2X2EA 4C0AC 5JUWA 3G6KA 4JS0A 3CX6A 3RFCA 1WSBA 4R54A 4HLNA 4RSMA 3RARA 2J08A 1YE3A 1LPPA 1KZ1A 2BFCB 4HQLA 2OGZA 3EQ2A 4G9EA 5FORA 4P80A 1Q7CA 3AUFA 2FPMA 1MX5A 4OIMA 1RYMA 4IDPA 1NUTA 2CZCA 1FJXA 4BV8A 2WF9A 3E9MA 2WM2A 4F2HA 5IAJA 4A4DA 4IJVA 2AK2A 5BR7A 2AZXA 2ZRMA 4HAYA 3OQOA 1IU9A 2PT9A 3ECAA 1DTEA 3N76A 2Y1FA 4WJLA 1QS0A 4A0GA 2YMQA 2OGTA 4PZYA 4CM3A 1AO3A 1E7MA 5I3CA 2OV1A 2GBLC 2GEKA 2EGHA 3BTUA 4DLZA 4I19A 4GU5A 1I4DD 5MFZA 4P92A 3TQHA 1E1RA 5AUQA 4K81B 3U4GA 4ZU3A 5IHXA 4X1KA 1FP4B 2JCYA 4FFVA 4X84A 5CEFA 1OT5A 1ZUD1 5TC4A 2ZUDA 2AN4A 4XARA 4Q16A 1Z47A 1YVRA 3S0JA 3Q3JB 4PF1A 5FPQA 4C76A 1WABA 5CAEB 2ZTMA 3FW1A 1IXRC 3HY6A 3M2PA 4ZT7A 5KPJA 1WKCA 2QZPA 3PQ8A 3SPXA 1GQOA 4R69A 4AN1A 3SQNA 4LY3A 3TS1A 1OXTA 2A1IA 3V9AA 2OYRA 2E87A 4F06A 4YT4A 2GCIA 1LCIA 2QXTA 3THWB 5DCUA 3WLNA 5FI1B 4CZ2A 2YJGA 2G1KA 1Y3CE 1JI3A 1ULAA 3DEFA 1AUXA 3UTDA 4IO1A 4XDHA 5K9ZA 3ZJTA 4PLGA 1KH1A 1KO8A 1M2JA 2DWPA 1A77A 3LK6A 5FNVF 1UK9A 4PG5A 2NT3A 3A31A 4FYKA 3GJ7A 1NPTO 4G84A 4K8OA 5FOWA 1JKIA 2B8EA 1T3GA 2HF9A 2JVJA 3EHDA 5JH7B 3K1YA 1SCUA 2IPMA 3QKUA 5IDVA 4ZZ3A 1FSZA 1FX0A 1G20B 5A9SB 3SSAA 4EJ2A 1CUWA 2ZWPA 3KQNA 3EQ9A 4ZJZA 3CNHA 1QFZA 2X9VA 3PFKA 4KBFA 3HUDA 4TOIA 2DKNA 4ZQHA 2B82A 4IYJA 2CXNA 1G42A 1XLUA 3JD0A 3GPIA 3MNFA 4MW0A 1KH3A 3IERA 3TTUA 2VQEB 2NTNA 2GVDC 3QA3E 1P2UA 2AG1A 3PDWA 2Y9MB 3QVLA 2OBYA 3OX2A 5SYNA 4C2BA 4CF3A 5FNVB 1QE5A 2PEZA 3EXAA 1TNDA 2XB9A 5M5BA 1FFSA 3AZOA 2BEJA 2ZSFA 4LJKA 3UNXA 1DUIA 2EP7A 3G9XA 3K35A 2QW0X 4M4SA 4UMFA 4X20A 4FYPA 3SAJA 1CRPA 2XUGA 3KFVA 4LK3A 1TZJA 3U4AA 2A5GA 3ISTA 2WJAA 1FNDA 2R87A 4DDUA 3MWDB 4NHEA 5IKOA 4MR7B 3SX2A 4ZVRA 3RC3A 3I04A 5KOJB 1EUCA 2PMFA 1U1FA 3INYA 4Z9YA 4CN8A 5ECGC 2UUAB 2O8EB 3KKQA 4OAPA 3NJ8A 3KSDO 2X13A 4ER6A 4BMDA 3MD0A 1USIA 3NNDA 4M2LA 4TPKA 2ETXA 2YVUA 4EJSB 4Z49A 1HLFA 5KJCA 1AQYA 4WE3A 5DGIA 3PUKA 4DC1A 1JHVA 2VUTA 3IP9A 1BN6A 1VE1A 2VZ8A 4D96A 3ICQB 2X4GA 5ALNA 5H81A 1YWGO 2IOQA 3ER9A 3I9V1 1D0IA 2YDYA 3CISA 4NCXA 1U0TA 4RK7A 1CJCA 1M73E 4P35A 3MWEB 3RJ5A 4MQEB 3DKPA 1QK5A 1IMJA 4RKYA 2PUTA 4KQ1A 5LMUB 5AT1A 1ZVVA 3ZHBA 2L17A 3DDZX 1T9BA 4U63A 3NETA 4Y2QA 5K0GA 1IEQA 1TADA 2QYTA 1BDJA 3LX4A 4ARUA 1CVIA 3WBJA 1F1JA 4IR7A 3TM4A 4N54A 3X2SA 2GF2A 1NYLA 4HXGA 3KUKA 3BXFA 1I7LA 4GXNA 5G53C 5BURA 5CFLA 2FUG6 2HQSA 4BO3A 1CRWG 1EX9A 1I5OA 1QRRA 3UK6A 4AKSA 3WGZA 4MQLA 1SCUB 1JB1A 3GEIA 1XFAA 1NT4A 2OHJA 3DL4A 3FNQA 3KNZA 4NJEA 3NTOA 2IX9A 4OFWA 3FYUB 4TL7A 2YR0A 2PIDA 3BX1A 4BQSA 5B1IA 2Q5CA 3F5MA 1ZGHA 3BBPA 5HJ5A 4IDNA 1FSSA 2Z1DA 4OOEA 4KLNA 1QHXA 3ZNOA 3K1ZA 3RG8A 4C0WA 2D7JA 2XJ9A 1DQRA 1BXZA 4TTIA 3T7SA 3ELDA 2BFAA 4ENPA 4BKMA 1YA6A 2WTAA 3IEKA 5DN6A 2C59A 4CEJA 3DFMA 5I48A 2FJ0A 5CB4B 1FS4A 5DRTA 2YCLA 3BWYA 1Z7EA 2A0WA 1TJ5A 2B3DA 2HU7A 3F6CA 3G17A 3LKBA 3QKSB 2XQJA 4IH4A 4EO4A 5LN1A 2RE8A 3E48A 5AKIA 3SMVA 2MSNA 5CUQA 3RDPA 4TV8A 2Z83A 1ECBA 1T8SA 1ADCA 1FP4A 4RMIA 3C3JA 4F72A 1AC5A 1U1IA 2VAMA 1J20A 2HLHA 2ZB3A 3EC2A 2MYNA 2PUVA 3MWJA 4X90A 2IYVA 5AI4A 1RXWA 1P1IA 4U2KA 4RESA 4F9GA 2R8BA 4EFLA 1GVHA 4OF4A 5JQWA 3L4KA 1J0EA 1UBUS 1YB5A 5LQNA 3HCNA 4X93A 1M1YE 2QTNA 4XLTA 1I4LD 1BQEA 3ITDA 2IYSA 3CWQA 2Q0HA 4CT0A 4AZ3B 1EVKA 5FWAA 3D8UA 2PUCA 4G9GA 1HI9A 3R9KA 3HBNA 1TW2A 1CZLA 1WU8A 2HHJA 1UK8A 2P77A 3UMVA 4IQGA 3OHMA 2H7YA 1MPTA 4RD6A 1SPXA 4DLXA 3P9SA 4FC6A 1PWHA 2JLWA 1M8GA 2WIKA 2WWGA 4FDLA 5FYDA 4NZZA 1IE3A 3SHOA 4MTLA 5HF6A 4ZOLA 3RJZA 4HB4A 3TLAA 3RKSA 4NMLA 4JP5A 1TM7E 1CX9B 3KD2A 3PC4A 4D9FA 1FX0B 1G20A 1R27A 4QFBA 4MO9A 5EHNA 3RKUA 3WJ7A 4CCAA 4JENA 2IZOA 2C7BA 3GLKA 5CP8A 1NW9B 1N7IA 3N2IA 2C0CA 3JYLA 1RAEA 4XUDA 3PPVA 4BP8A 5C3MA 4YUXA 2W2XA 4PAWA 3R3VA 1X8XA 3Q9UA 4IIXA 4YJFA 4DV1B 2FZCA 4HWPA 2H3HA 2WG1A 2P2YA 1X0VA 3R6GA 2HJRA 4LQDA 3AY6A 2JGIA 3ZV5A 4REQB 1H85A 1RJ9A 3STVA 5JD5A 4KRYA 1UFKA 3GFVA 4CGYA 4DSNA 2QMOA 3EGEA 1EZ1A 4W1QA 3AUSA 1IQUA 5DTQA 2BM1A 4W5JA 2BEVA 5FUYA 2L18A 4BYMA 3LX5A 5LQCA 3V1LA 4Q3LA 3HJNA 2IS4A 1KWKA 3ABIA 3KKOA 3RTGA 4C7JA 1LPBB 4CVNA 1YKFA 4QU5A 4OB7A 2I7CA 1BZYA 3K5HA 2Z5LA 2ICAA 4MR7A 5K8TA 5KYTA 3ANYB 1XCGB 1FU7A 2AG5A 2XUDA 4RU1A 1VDMA 4KFRA 1SKUA 4N3NA 2DX7A 1DXOA 3ZZTA 1OLOA 1A7JA 1ISSA 1B8VA 1CB7A 3NG1A 4FJ1A 1DTWB 5EVCA 1T4CA 1XA4A 1E6EA 3DE0X 1K6XA 3BRWA 3EDOA 4JX8A 3LS2A 4NATA 1PD1A 4HI0E 1EUZA 2AG0A 3LMKA 3NTXA 4B3RB 4V39A 1UMCA 3ORHA 3QXCA 3QG1A 3M9WA 4EY5A 1KY3A 3HJUA 3O21A 2Z0MA 2PFGA 4KSYA 1NHWA 1RFLA 2HLDA 3V4LA 2QBYA 3T3OA 1ITZA 1BWRA 2JZNA 1RM5A 3HPQA 1G18A 2D06A 2BE9A 4ZPXA 2Z95A 3OE1A 2IYEA 1GQSA 3WNQA 1J00A 5LSAA 3CKYA 4EGJA 1QGDA 5HKOA 2Q0SA 2RGEA 1PFQA 4M49A 1YCFA 2AI3A 2OGWA 4WADA 1R50A 3MUOA 5JH7F 1SC4A 2C3UA 2WD9A 1XC7A 4DLNA 5JALA 2D2FA 3AP1A 3QXHA 1IFXA 1VYUA 1V8OA 1ECJA 4JB2A 1Y1SA 4AQ7A 2PG3A 4HZUB 1A5ZA 4CEIA 2XOEA 1ZA1A 1O3YA 4HQOA 3O0DA 4PQRA 5ECDA 1YF3A 4QQNA 5JHGB 4DV0B 1OLUB 4ES6A 4KBYA 2CT8A 1DEOA 3BQMB 2HSDA 4KWHA 1NY6A 1YQ9A 4WK4B 3GFPA 4FQ8A 3O38A 1TU3A 3ZPXA 2PDAA 4OI2A 2NQTA 4R84A 1CZNA 3FTDA 4JITA 1IJFA 4OQLA 4FSDA 4RO0A 1KQPA 3GI1A 2VSOA 5CTJA 4XJTA 5L6LB 3V8QA 1EGHA 2FFRA 3KKPA 4KZPA 5C8VA 5IJ0B 1A5AB 1U8XX 2A9RA 2GOYA 2X0IA 4RIIA 2IIPA 4JBXA 3U0BA 2IC5A 1VIVA 2QROA 1YH3A 1RLMA 3MGAA 2HF2A 3GEEA 5IFKA 1U02A 1AQUA 1DPGA 5HEKA 3RPEA 4TTVA 2NSHA 1BWSA 1SB9A 2NGRA 1H4TA 3AF5A 3FVQA 3WLRA 1EI9A 2P0YA 3BAFA 4GMKA 1QGAA 4NH4A 2LRHA 1DC7A 4HD8A 4E15A 2AF4C 5KNDH 4LJ7A 1H2YA 1CQZA 1M8KA 1SBCA 5C34B 1NR1A 4G9BA 4A27A 1J24A 1SELA 3P2OA 1L9XA 1SBIA 4BVKA 3LECA 4ZT6A 3LXRA 4YS6A 3RVDA 3ZW8A 1EA5A 2I4TA 2JLBA 3L9XA 3HB4X 3IO3A 1IN6A 4XEHA 3O92A 4YMWA 2IHJA 5E0OA 3M6XA 2XA9A 3ANXA 3PV0A 3NOXA 4CMKA 3PT5A 3INRA 4K03A 3W5VA 3RRNA 4OU5A 1H9AA 4L22A 2CLOB 3MCUA 2VRBA 4MLCA 1Z6YA 4MJLA 3D9QX 4R2IA 3ZE7A 4QYWA 3K09A 2H1SA 2KM1A 1Q0ZA 3KTAB 1V43A 1H0HA 4Y9TA 4BAUA 3K9GA 4ZIRA 5CBPA 1TEHA 2CJYA 2KHZA 2UZ0A 1QH0A 3JQ8A 3NBUA 3OWHA 3KVVA 5D3QA 5GVRA 4YCAA 1JEEA 1U2GA 3IAM1 4PC7A 2QP4A 4NAUA 3CE9A 3J7TA 2FW6A 4ZXPA 1QB7A 5TQ2A 3RCBA 1VA5A 1RHKA 3QNUA 3OICA 4R81A 2JANA 4RJJA 3ACDA 4ESVA 1NSTA 2VQ6A 4WN9A 3PGMA 4NYMR 2O0JA 2FQQA 1R18A 5K4AA 2OBNA 4ETMA 2FSPA 3O84A 4KIWA 3OF2A 1Z34A 3BILA 1UBRS 1P18A 5IZCA 5AVXA 1RFGE 4HSEA 2I87A 3CGGA 4FMBB 5L3QB 1A88A 2DH5A 1T5DX 1L8XA 4BLUA 1T35A 3H2KA 1B6RA 4HHEA 2CC2A 3SXUB 3DDSA 4QDKA 1OAAA 2C4HA 2CV2A 3GJZA 4ZI5A 5ALRA 4B84A 1BJTA 3HU5A 3KEQA 4DSUA 4RKQA 1GDTA 2F1JA 3B51X 5JG7A 1GCIA 3R0VA 5EP4A 5FTJA 5EXTA 3CXUA 2W11A 6REQA 3O74A 2I71A 5FOUA 1Q1AA 1PT6A 1CUIA 1PV1A 1GTL1 1PVVA 2AR9A 1V95A 2HDOA 2X8AA 1I2CA 3GJ0A 4ER3A 3EA0A 1Z8HA 3WA6A 2DPYA 3KZXA 2PQ2A 4MVJA 4FYVA 1V6SA 1N7GA 4UTZA 5FFMA 4BLSA 1AUOA 1N3IA 1OLXA 1Z4OA 2OZKA 3FCOA 4QQFA 3I3SR 1UZUA 2A9KA 2PEYA 3NDIA 4EF6A 5K4GA 2C1EA 1QQ5A 2BL4A 2AG6A 5EPUA 3HYCA 4HGRA 3CR3C 3E9YA 4U7DA 3I58A 5FLKA 4A6EA 5B3LA 2JJ2A 3ONNA 2SICE 4YJGB 3QXXA 5E1BA 3NTRA 1KDZA 3DC2A 3NHBA 3LDGA 4JLWA 3G3EA 4OQNA 1EHYA 1NBEA 3HKDB 3BK7A 4O4JB 1UMCB 1F0KA 2Y27A 4JBYA 1BD4A 1J0BA 4TRNA 5AJZA 4BVHA 4GX1A 4DLAA 3HKEA 1X3SA 2ACKA 4KACA 3H13A 3W8RA 3K30A 2R7MA 4O4IF 3AVXA 1R12A 1T2CA 2IS1A 4WIAA 3GLUA 4LHWA 2JK1A 1ODJA 3NT2A 2CF6A 3UXEA 1XVUA 4GBJA 3OFJA 1G5QA 3GJ3A 3ZD9A 5C4GB 2BRUC 5L8VA 3JRXA 3KTOA 3CX7A 4KFUA 4B3FX 4H16A 4QICA 1JU3A 1SXGA 1H2AS 2XUKA 3AI3A 4PTYA 5B4VA 1PN3A 5EXPA 2KBEA 1L3IA 1PBNA 1N2XA 3TW8A 4JMLA 4C9BA 4W5NA 2HWUA 3I8XA 4Q9LA 3ZY6A 3PP8A 4W9NA 3DAFA 2AJDA 2C61A 1C7EA 3CY6A 4JOQA 4QYIA 3H8WA 1VL0A 4L73A 1N0WA 2J09A 4NC9A 4WN9B 3QEAZ 1JDUA 4AO8A 2J41A 5ALPA 4ARSA 4D0GA 5TJHA 1KYTA 3E22A 3P5BA 1T0BA 4AX4A 1XCPA 3GFRA 4ZVVA 4JIGA 5JVDF 4MDFA 4ALJA 3HABA 3IR7A 3R77A 4IG4A 4EF4A 3DLCA 3M4NA 4C01A 3LWDA 3E03A 1JTEA 2ADMA 2WIFA 3SHTA 4DPMA 4I4TB 1CF2O 3W9UA 4FFDA 3TECE 4RJIA 3UJ9A 4M0CA 3D8BA 1P1FA 3TSOA 4DJFC 1C9NA 5CBKA 1J5PA 2LGJA 4O25A 5ITVA 2PZBA 2DQKA 3CRNA 2GK7A 5AK6A 1ST3A 3C98A 5IC5A 4OHKA 1IB6A 3KWMA 5KQLA 2CJPA 2ZXEA 4MZDA 4G24A 4HDKA 1A1SA 4J0GA 2BKXA 4QO7A 2HO5A 3OX4A 4DQXA 2C9YA 2JFFA 2X41A 3F1LA 5B7GA 1EB8A 2DUJA 2QRNA 5CITA 1F2UB 2ZCJA 5LNK1 1K8XB 2CNBA 1CV2A 3ROFA 2I3AA 1N34B 4QGGA 4XW2A 4YEDA 3W04A 1UT5A 5E6UB 2UKDA 3CUEF 2Z2YA 2H1IA 1GAWA 1U6KA 3OSUA 4LY0A 5BORA 2HV8A 4GL4A 4X3PA 1SKBA 2REQA 3LVFO 4ZJPA 1U8AA 3MM4A 1U4SA 2SCUA 2WA2A 3GJ8A 4UAJA 5HMLA 2WUDA 1M5UA 3N8IA 4D02A 1MOZA 4P31A 2YMLA 4F4IA 3FFAA 3M6LA 1O9GA 2GCPA 5AKEA 4CV1A 4QYTA 4DR1B 2X1HA 3H19A 1E9BA 2EXXA 1Y0BA 3DAYA 5GIPE 1Z2EA 1MQ9A 1B15A 2IF0A 3NC0C 1CUAA 1NW4A 3RGGA 3I30X 1LVUA 4ZGGA 4KVAA 1L4HA 1M8JA 3AT1A 3DOJA 3H4TA 3LUGA 5DWDA 1JYEA 5C32A 2ID7A 2D1QA 4IVQA 1IBSA 3PXUA 3PKIA 4PQFA 1FQKA 4LRTB 4P8RA 3S27A 4LF4B 1AKRA 3QYFA 4TSFA 4X45A 1ZGAA 1Z73A 4LSWA 1E1QA 4JIMA 2OL4A 4HL6A 1AUQA 4QPZA 3WQRA 3DLAA 1ACMA 1EVZA 1LXCA 4H7KA 4BE9A 1NLYA 4CKBA 1W9MA 4L02A 5HJEA 1XZBA 3W1EA 5BP7A 1J6UA 1XQ9A 4J43A 3ROXA 3PL1A 5AJHA 3FOFC 1VLQA 5DLPA 2HLDD 3FLAA 4Q4AB 3EASA 1KK2A 2AC4A 3NZEA 1XNQB 2NPOA 4GMFA 2EP8A 3FPSA 3BERA 4A6XA 4DJTA 1T36B 3D5QA 4A2QA 1I1OA 1KPHA 1J8FA 1UPUA 4CKXA 4B40A 3VNUA 5BWNA 2FMTA 2Y0EA 4Q1FA 4AJKA 3PWZA 4L9RA 2PLRA 1ZW6A 1IZ9A 1HG1A 1KC1A 1V16B 3ENVA 3F3KA 3F7OA 3MJSA 4BATA 2XECA 4OI0A 3S8YA 2ZE7A 3EZ9A 4DDKA 1Y3FE 2R6CA 3QVOA 4HATA 5HK9A 5KTPA 3FHLA 2AJTA 4IDOA 3SJAA 2ZJFA 3IEVA 1QC5A 1O0SA 4CWAA 1L7VC 1DXYA 2JH8A 4XDZA 3CPHA 1DT3A 3I1YA 2C83A 2A1TS 4RH1A 4XVUA 3AIIA 1VIDA 2GDJA 4UXIA 4WRRA 3U62A 1AJEA 2H4HA 3IUNA 2BEUB 3CZQA 4M88A 4PGFA 3EF1A 2YWJA 1LBEA 1G8YA 3AR6A 3CW2A 2X2FA 3EBLA 4CQNA 2IT1A 1UH5A 2JDIA 2ZIXA 3IDQA 2ZSJA 2YL2A 1UZMA 1F8YA 3FIJA 3MT9A 4I1RA 4U7GA 4ZJUA 5FH9A 5AVUA 3RSHA 2YWEA 1AQIA 1VG9B 5IKEA 1Z6ZA 4OL0A 4WBXC 2Y93A 2D1TA 5CR9A 3DNPA 5EP1A 2IV7A 5B7NA 4R2JA 2FLVA 3QELA 4DSTA 2IZ7A 3WMWA 1ESEA 2IEAA 4JDUA 4YCDA 3SHWA 3SXJA 5AM3A 2WIBA 3ZZUA 3GPLA 3K72B 1Z0DA 2BZ1A 2D5LA 2WWFA 5LJIA 4MULA 5HS6A 4YRIA 3LC0A 4ND4A 4XAQA 1XZDA 2NQ8A 3A2LA 1GPBA 5EJ5A 2PUHA 4A0RA 1BQ4A 1IC6A 1SURA 2BFDB 3JATA 1U3UA 4IHQA 4LA4A 3IO5A 3C41J 5EVJA 2ZYUX 2WUWE 3LL7A 4R8MA 1XJ5A 3FI9A 3KPUA 3NVKI 1G6KA 4DTCA 4K6CA 1GZSA 4GWKA 3EBOA 3K73O 1O0CA 2VYVD 3AHIA 3UPTA 1JQDA 1H2WA 1NVTA 1ZICA 2DR0A 4II7A 3WZMA 2UUBB 1JYFA 3C39A 4A92A 3DV9A 4CV3A 5L3VA 4JEHA 3FDXA 1YK0A 2QUZA 5IDXA 5ENDA 1WXQA 2YOGA 3C2QA 1LEHA 1PKXA 4GD3Q 4WZAA 5TT1A 1PVOA 3ZD6A 1QIFA 1SJ9A 2ZTSA 3CE6A 3S4YA 4E5VA 3E7FA 3CUVA 4OKNA 2NT4A 1LI4A 5CW2A 4FSHA 1PU2A 1GGMA 5F51A 2PZFA 3IX7A 4PLFA 4LZLA 5IWCA 3DEAA 3A9TA 3R3HA 3NBAA 4Y1EA 2G07A 3WWPA 3DPIA 2YJ5A 1YDFA 2JGEA 5TJ9A 4IGAA 2O50A 1HLGA 4W7IA 3CR7A 1KJZA 3CTPA 3KVRA 5B64A 1D6SA 2DYKA 4V24A 3UBMA 4NZOA 3TDMA 5L6MB 3F49S 1NTOA 2J3QA 3I9KA 3TLZA 4NV1A 5JDCA 1U8FO 2NXWA 2PX0A 2QOEA 2FE4A 3DFZA 1YBHA 3OJOA 5EXDA 4B6EA 4FYXA 4NXNB 1XJCA 2VCHA 3RH0A 3BG5A 1ATIA 4EHLA 2FEWB 1MKYA 2W22A 4UU7A 5E0KB 4BUZA 4UBKA 3UJHA 4FQ5A 3IVXA 4O5AA 1I36A 1N6PA 4NE9A 2IWHA 1OBCA 5IH3A 4DR3B 3U1TA 1E64A 5AVZA 1PYGA 1XTUA 2QRZA 2XLBA 4UFPA 4QREA 1GN8A 4L5IA 4LV5B 3MWEA 1MGPA 4UNSA 1ABEA 2XJ4A 3QLTA 1K3UB 5SZIA 1O2DA 4UEKA 5DT2A 2XVXA 4H1VA 4H27A 4YALA 5TLSA 3KB1A 5EP3A 2ZBFA 1P9RA 3IP5A 1E2QA 1CQIB 4ZHQB 5IXYA 5KWEA 3ZHOA 3HADA 2PY6A 3OO1A 2M6SA 4IAOA 2OYCA 5B2EA 1H2RS 4HEJA 5ICFA 2I7VA 2C4VA 1EWQA 1COZA 1TCCA 1FDTA 1IHPA 1I3CA 2ZANA 4JP2A 1E9RA 3GP8A 1L4LA 5G0WA 5KHOC 1T0UA 4HSGA 3IILA 4PTZA 1EK1A 2BZSA 5CGQB 1XRNA 2VJLA 3KZVA 1X6VA 1RVDA 4TXMA 2W2OA 4IIJB 2WKSA 3CF4G 4KXXA 3O2NA 1IMOA 4LF9B 3JASB 5FNVA 4YRDA 3AHEA 3QOYA 4I4NA 3VHXB 3W9YA 3JZDA 3MUFA 3WKAA 4DRXB 1IBMB 1E79D 4M0DA 4Y6GB 3RM3A 2ILVA 2JJ1D 1FYVA 2HT1A 2A94A 4IDCA 4FHEA 1GCOA 3FDZB 5SV2A 5SYMA 2QORA 5L40A 1N2GA 2D13A 1DEAA 1HT3A 4LF7B 5EMJA 3G88A 4OREX 2GBPA 5ADHA 1Y9EA 4YFYA 1FFXB 2NW6A 3LQ4A 5HRUA 2QL5A 4JI0B 2PSDA 4CM1A 2I03A 2KB0A 2OKGA 1EUCB 2O0HA 2FX2A 3RUHA 1GSOA 4Q6BA 4ZOLF 4WBSA 1M2EA 5ITZA 1TK2A 1LI5A 1IM2A 4S24A 4C87A 5B6PA 3IIIA 2D0DA 4HAVA 5BUSA 5I4IA 3DXYA 1YBAA 3GRZA 1Y3DE 1W73A 2FQ1A 4Q93A 2BGGA 3DMFA 1RCFA 2I2DA 4LGMA 4AS2A 2DERA 3N2KA 4AMBA 3ZKWA 3SD7A 1TEXA 1JSZA 4F2PA 4OCZA 3Q8MA 4HPXB 3WICA 2VDWA 1JQAA 2AX3A 2XHZA 1DDOA 4NENB 4KE6A 1KR2A 3T7AA 4FZVA 4NLLA 4OGFA 1L4MA 3KALA 3F5FA 1I6KA 3ZCVA 3GVIA 3HDVA 1WUYA 3NYQA 3VDQA 4RABA 5TEVA 5AW6A 5GADl 3OZDA 4EDFA 2UXDB 2GN4A 2PKWA 4FOPA 4MJ3A 4P3NA 5CNJA 1U98A 2Y2VA 4DV5B 3CF4A 4K8RB 4RUKA 1XVLA 1ZR2A 2HWYA 3UCXA 3VXKA 4UVGA 4D9NA 2C4UA 1RQ2A 3P19A 3MLBA 3KAPA 4HB3A 3AIOA 4ZJYA 4KB5A 4GP7A 4XWOA 1Q57A 4OAOA 1SU7A 4IINA 4AJHA 3WLKX 1T13A 1RYBA 2C77A 1USKA 1O7JA 3KR0A 1TVKA 1E9AA 4EW3A 2DCMA 2YHBA 1GZ5A 3RU7A 1JIXA 3WA7A 4G6ZA 2ZTLA 4G8JA 1WKBA 1BCSB 4LKOA 5F3DA 4MPTA 2AOUB 1T5HX 1NF9A 1VHDA 1HQCA 1JN0A 2FKNA 4FOOA 3OE4A 4R8SA 3T9AA 3GBSA 4BLWA 1I4WA 5BWCA 5JYEA 2PUAA 1F14A 1Z18A 3PT9A 1M2VB 4M1TA 2IUUA 2QT1A 1BXGB 3O9ZA 2X8BA 3IEXA 3FNHA 3QKRB 1ZNYA 1ISFA 4JBIA 4BV2A 3OTHA 5J4YA 4H2DA 2ZRHA 3NIWA 4UJ3A 3VR4A 2E4YA 4I2VA 2BZ0A 3QLUC 1YOVB 4M9ZA 3ZCTA 1T9DA 3E3LA 5ERXA 1P6UA 1XXHA 1GNVA 1W4LA 4O2BF 4GI1A 3U37A 1YJAA 2FB9A 3EVAA 1N9KA 3W5IA 5HX7A 5HW0A 2AXEA 4RKWA 1I32A 4Z8YA 3TJMA 1OGIA 3NHAA 4UBNA 3M1IA 5DM1A 5G0VA 4MS4A 5KSOA 1P44A 4F3NA 5H0IA 3M6IA 1XP5A 3L6UA 4TKZA 1K7XB 2ZU6A 3OTQA 1WBBA 1F2VA 2HGZA 3C6KA 4FR2A 4M22A 3KU4A 1F20A 1S2DA 4LZPA 3I01M 1USGA 1G1AA 1QYIA 4LVUA 4WGGA 4DC0A 5BYAA 1GPWB 1IVSA 3AL0C 1RXYA 3EW9A 2GXSA 2C84A 2GKSA 2OFFA 1Z13A 3PNQA 4QE3A 4J3NA 2LD4A 1V4VA 4KAXA 4RDIA 1Q0UA 2JGFA 4L5BA 3UAGA 1J1IA 1V1RB 3WMGA 4PZDA 1E58A 1FL9A 2OC4A 4BU1A 3PDHA 5EJ4A 4TTAA 2K6GA 2N42A 2P1ZA 1E0JA 2VHCA 3BK2A 1TYCA 4K0KB 1NN3A 1CDZA 4F5ZA 2FA9A 3HJGA 3IAAA 5EHGA 3KK0A 4X00A 1E2GA 5DGTA 3B5IA 4YMIA 4WXHA 2JRCA 1OFUX 4HX9A 4FGZA 2I6XA 4KQEA 4MSUA 5A3SA 4MVCA 4NMXB 1BDBA 4JYZA 3MXOA 1PT8A 4XR4A 2ZVPX 1OFIA 4E2FA 3WK5A 4P4SA 3KZKA 1M7BA 5BMVA 4M1OA 3EMDA 1EGAA 1FTYA 1SXJA 2W6JA 3L8MA 3I42A 3BWBA 3PNYA 5CNKA 5AHXA 5IJ0A 2PBRA 3AP3A 1YB1A 2ZCUA 3G0DA 1P3JA 4MUYA 2LCIA 4MOWA 4WK2B 3F5SA 5K3DA 1NFFA 5CB0A 2B4KA 1GUBA 3W2GA 3W3AH 4FWIB 1JV2B 1GT6A 1XZCA 2BY4A 2C9OA 1PG2A 1LLUA 1SVLA 3GEMA 4J03A 3Q9LA 2JD1A 5TQVA 2G63A 2JFZA 2O8NA 5F2NA 5BV1A 2CLIB 2JIZA 4OLAA 1SUAA 2ZYGA 1J5XA 4MA4A 3IVRA 3LX8A 1CUUA 3LJKA 3NORA 1X1AA 1R0WA 4L8YA 1DRKA 4PQYA 5FLYA 3NEJA 1JJAA 2XDQA 1T15A 2UYYA 1BAPA 1E60A 1WF6A 1TGVA 1EFCA 1J8DA 1EFVA 2OHHA 2PLNA 3GGJA 3GRKA 3ITEA 1SUIA 1DTWA 2A0YA 4IIEA 1KMIY 1Q1QA 1K6EA 1X7ZB 2IYFA 2EX0A 2P30A 3KXIA 4E3ZA 2CYBA 2RD2A 2E3JA 1VCMA 2PVCA 3HDQA 4Y1RB 3RC1A 1T25A 4F3KA 5ITSA 2GM3A 3T7KA 4C1BA 3AFOA 2A9OA 2EL7A 3SZRA 4J1TA 2CFOA 3K6KA 4GZ3A 5HUHA 4C7KA 2ZYWX 4IQ0A 1XZKA 3FAZA 1MH9A 4B43A 1BDIA 1GGJA 3L01A 2P9CA 2FR8A 3EUEA 3UAWA 4AXBA 4NX2A 1NQOA 2X0KA 2RGGA 4YV0A 3CN7A 2I5PO 5JO9A 1RM4A 2ZWVA 1YQTA 2XCUA 2COKA 2ZJ8A 2NYVA 4LE0A 3W5SA 4B4WA 4EAQA 4EATA 2WD7B 2ZIUB 4QASA 4KIUA 2JA2A 4IHJB 3ET4A 1MA0A 1QIDA 2AJ8A 1R66A 2RIRA 2YOHA 2CWDA 3IE2A 3P27A 4Y7DA 3EXG1 5ALSA 4B0OA 1LRKA 1M6YA 3R40A 1Y89A 4GQAA 4K05A 2WYUA 3RQIA 5KQPA 2YVQA 3AEYA 3QX9A 4XYGA 4PRKA 4D4KA 4M1KA 3L7KA 2EJBA 1GR0A 2R8ZA 3LUCA 1OZAA 5ICMA 2RBEA 3A6LA 3ZXYA 3EZ7A 4UQOA 2FEMA 3LYLA 1JEJA 1KU6A 2O52A 4EZEA 2TMDA 4I9NA 4EGFA 4IIJF 5C8DA 5KVAA 3EH2A 3HEMA 3DV0B 2W4MA 1DIAA 3A1DA 2P79A 1B6TA 4YA6A 5FNZA 5KX5F 2WJYA 3CLSC 4B7AA 2PMDA 4MWOA 2UZAA 3H86A 5DMHA 4HR7A 2XADA 1M2OA 1U8UA 4FPXA 4F93B 1OLSB 3BORA 2DC1A 1ZK3A 3VR2D 2BGIA 3WWOA 4K7JA 3PJRA 1T2NA 1OBOA 2PX3A 1RC0A 3EVEA 2XGOA 2PWPA 4UM5A 4BQIA 5JBNA 1SCDA 5I47A 3ZHRA 3AM4A 5CLLA 3U5ZB 3HHPA 5C0OE 3S1SA 4R1PA 4RVFA 1QE0A 3NRBA 2BT4A 1TLFA 4WTOA 4JK3A 3EGIA 3FJYA 1DELA 1JEAA 2JHCA 2NXJA 2QRMA 3F7MA 3MTJA 4JQZA 4GO1A 4Y6PA 1K63A 2CDCA 3A4YA 3QX8A 4GPBA 2H48A 5CCEA 2LZ0A 4LHSA 1GZHB 9LDBA 2QF7A 3FOZA 1XXHB 5AHWA 3ZK7A 3TNJA 3UMJA 3R9WA 2BMFA 2Q1SA 5GVSA 5B36A 1G9SA 1OYYA 4GLLA 2FN3A 1PI3A 3OTWA 4NCKA 1UC8A 3A28A 3SZ3A 3B6ZA 1RKXA 2VHTA 1SXJD 2W6JD 5ALTA 3BH7A 1ZD2P 3DEJA 5BOSB 4OQ4A 3CNBA 2QY6A 4PSDA 1BCRA 1YL5A 3ER8A 2EG9A 1EGQA 4PCLA 1L3CA 3UV6A 4DWJA 3G2PA 3JQEA 3FVWA 3PNVA 1GQYA 1FUYB 1XZMA 3N6VA 1BG6A 3MQFA 3H5LA 3T7IA 4NOKA 4PXSA 1GGKA 1T8UA 3NTQA 4EBBA 1K8ZB 3LOQA 4GXTA 3TZEA 1JFFB 3PE3A 1NP7A 3NHMA 3G9ZA 3S28A 3WHLA 2B94A 1E9DA 3PHBE 3GRRA 4H35A 3M5CA 1H94A 3W6UA 2FR0A 4CE6A 2JB9A 3OEEA 2J5QA 4M38A 4N5HX