4HLDA

Sulfonylpiperidines as novel, antibacterial inhibitors of gram-positive thymidylate kinase (tmk): compound 11
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
203
structure length
196
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Sulfonylpiperidines as novel, antibacterial inhibitors of Gram-positive thymidylate kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hldA00
2WICA 4OBEA 3C4JA 3K0FA 2ZRJA 4HLQB 2PX0A 1JR6A 4ZDWA 3NBXX 3NC0C 4TT3D 5KSZA 1YZQA 1GTVA 3KKQA 2IWHA 2VTKA 1EFUA 4MKHA 3T35A 3V9PA 3VNUA 5FPHA 3AVUA 1GNPA 2CHVA 2QSYA 2XJ9A 3AGPA 3SU8A 2OFXA 1P3JA 4U02A 4O0MA 2PL3A 1OB2A 2X2EA 4A92A 1KAGA 1P9RA 1ZD1A 5CIQA 3ZYCA 1H8HA 3HDTA 4WA7A 1VKJA 3C8UA 2QQ0A 4TTQA 4GRAA 4AYWA 1D2MA 1VG1A 2ONKA 2JATA 3A1TA 3THOA 1XPRA 4GL2A 1UDXA 4OKSA 4YMUA 1Z07A 4HLCA 1N5KA 1GG2A 1T8UA 5EP1A 1IBRA 1GRNA 4LX0A 3FWYA 4B6FA 5JS8A 2J41A 3EIHA 2RGBA 3F8TA 4QNMA 3DHWC 4BEBA 1UBEA 2ZQ5A 1EX7A 4WZAE 2HLDA 4KI0A 1LFDB 1OXTA 1P62B 2JIZD 2OBNA 4IEIA 5BQ5A 3T5GA 5KTYA 5JSZB 1KYIA 3X1ZA 4Q9JA 4Q1DA 2EFHB 2VSXA 1E9DA 3HPRA 4Q1BA 3AQ4A 3M4YA 2DCUA 4RZ2A 3NHBA 1SQ5A 4M4SA 4UXJA 4A36A 4PPFA 3OF5A 3A37A 4NCKA 2QPTA 1KY3A 4FINA 5TY0A 3U3KA 1OFHA 2VEDA 3CRVA 2AFIE 2BBSA 4MRRA 4QGAA 4XD7D 3A8TA 4B48A 3FE2A 5FTLA 2GAOA 3WYAA 3EZ2A 4Q4HA 1Z0JA 5G40A 4TT3A 2AKAB 1CJVC 1ZNYA 3BB3A 3IIKA 1P61B 1S0UA 2CDNA 3QENA 3LNCA 4PO1A 2HCBA 3VHXA 2V3CC 3MWJA 3LFUA 1HUQA 1W0JD 5L3SA 3EWAA 1GSIA 4HB0A 1T0JB 2B8WA 1QBKC 4Y0VA 4B71A 4II7A 1G5TA 521PA 1YQTA 3TJZA 3AF2A 2KI5A 4M9XA 1DELA 4HB3A 1GNQA 2QBYA 4ASUD 1G1MA 4TWZA 3WHLA 2BKEA 3BE4A 1OHHD 4YMWA 2AR7A 1ZM4A 1E79D 4OHXA 1N25A 1OXXK 2RMKA 3PEUA 2BKUA 4DSTA 1FP7A 1N0VC 3IEUA 4EDHA 2JIZA 2W6ID 4M0LA 4KXFB 5DO9A 3BFKA 3DMDA 4CRWB 3TSZA 2JJ8A 3N2EA 3I92A 2I4IA 1AN0A 2MMCA 3KKPA 2C04A 1PUIA 1D8TA 2DY1A 4DLVA 4MH0R 2QQEA 2CXXA 1ELOA 1X1RA 2XITA 5FBRB 1F48A 2ORVA 1SVOA 4WZBE 3PG5A 5CM8B 5H1YA 1COWD 4IXNA 1IOZA 1ZUHA 2HDNB 4XD7A 1KDPA 1P2SA 3G5UA 4JVSB 4JL5A 3NDPA 4JYCA 2R44A 4OQNA 3GD7A 4DDVA 2CL7X 2P0EA 1G8PA 5ELXA 1HA3A 1Z2AA 3KFVA 5JWRA 3KTAB 5EJEA 1VTKA 5GJWC 2PZEA 3PR1A 2IYUA 3AUYA 5JHHB 3PV0A 4GP7A 1W0JA 1HH4A 4AC9A 4ZDJA 1G3QA 1CJKC 4MA4A 5L3VA 3RVBA 1FNNA 2ZROA 2VP6A 3FOZA 5AUNB 4JLKA 3MCAA 4URUR 1XJ0A 4FMDB 2W58A 3CUEF 5DHFA 3TBKA 1AKYA 2QPOA 4ASUA 1NY5A 4EQ6B 2OBLA 4URWR 3SJBA 1IXSB 1LS6A 1OHHA 2QSZA 2ZJOA 3U44B 1E79A 4Q7LA 2OAQ1 1ANKA 3KL4A 2ZRCA 3FB4A 4TN1A 5EXTA 2WVJA 4V0OA 4D81A 2QTVB 3C14C 4D4MA 3CWZA 1G18A 1XZQA 2W6IA 3CM0A 2AHOA 5AJVB 4B47A 5KDLA 3SR0A 1XJQA 5AJZA 3MWYW 5KDOA 1F2TA 3A58B 4TZ0A 3TMKA 3ZS9A 4Q4AB 4NDZA 1XD2A 2BHRA 2PJRA 3EC1A 1JECA 4LV5B 2VP0A 3QKSA 1COWA 1K5DA 3C15C 1MH1A 1KO7A 1MO6A 1NMZA 1A1VA 1QHGA 2HV8A 4KFUA 3ZVRA 4CF7A 5AUPB 3CB4A 4CVNA 3I62A 3GJ0A 3AH8A 1FNMA 3AVTA 2IYWA 1W4AA 3C41J 4ARZB 2XXAB 3GPLA 3OFNA 2D06A 1MRSA 2ANCA 3T15A 3THWB 3U7EB 2HYDA 3SJZA 3PCRB 2FGJA 1KJWA 3CKLA 3ZZUA 2CCJA 2GA8A 1NG9A 3U3OA 4GOXA 2P5SA 3KXLA 2ORIA 2C8VA 4GNKA 4A6XA 1N6NA 4B3GA 2RB4A 4FXPA 1W48A 5J40A 3U6BA 2ZYTX 4LUCA 2GXQA 4D4JA 2BBWA 3PENA 3QG1A 2ZSEA 4LYFA 4HLDA 4Q5IA 1QHIA 4KSBA 3Q7PA 5FTKA 3A1SA 5H8WA 4JLJA 3QKRA 1KJZA 4D0GA 1YR8A 3N2IA 1XZPA 4M53A 3RS5A 4A9AA 3GJ3A 5LDDC 4N1AA 3SN6A 4Q1AA 5FUYA 721PA 2OHFA 2FZ4A 1KO4A 3AVWA 1NF3A 5JJIA 3EC2A 1KSGA 1XEXA 1G17A 3TVDA 2Z5FA 2J7KA 2QMHA 2ZI5A 1H65A 4IDNA 1AJEA 2Z0MA 4GZLA 2R62A 2AKYA 1OSNA 3HPQA 3HU3A 2WM9B 3X1YA 3RRNA 4URYR 4E07A 4HZUA 2JLWA 4C0LA 3TUIC 1KDRA 4IOJA 4KVAA 1QHXA 4D80A 1G8HA 2B7CA 3QNUA 2FWRA 2BMFA 1KI8A 3CF0A 2OLJA 5JI3E 4G0NA 1AGRA 3NIBA 2ODWA 5LB4A 3IPYA 3QPUA 2XGJA 1E9SA 2XZPA 1VCNA 1N0UA 4V03A 1DADA 1F3OA 5JRJA 5EP2A 1U81A 3SYKA 4LHVA 3K0SA 4D26A 3BH0A 5FOWA 2YNMA 2ZS7A 2LWIA 1Q20A 1XNJA 2A78A 2LKDA 1OH8A 2HCJB 3PIRA 3WXMA 2BDTA 5FOXA 3VU9B 3W6OA 5DN6D 1Q1QA 3NXSA 3SYNA 2J3EA 1HTWA 3QXJA 2FF7A 3RABA 4DEYA 3CLVA 2J7PD 5J4LA 2W83A 1E32A 1X8KA 1WP9A 4QG7A 3KX2A 5FTNA 1NP6A 3U3JA 2NO9A 3NC1C 5L3QB 3VNVA 2VL7A 3FKQA 2UKDA 1R4AA 1KDOA 2DHRA 1DAFA 2CMKA 3JVVA 2WWIA 5E7IA 4JLMA 2AK2A 1OT3A 2EU8A 1WA5A 3B78A 1P73A 3P1JA 4OK3A 2AWOA 1G8FA 1T3HA 1SKYB 2D7CA 2REBA 3QIAA 2DYKA 4Q1EA 3LXXA 3Q7QA 1QVRA 2BMDA 2ANBA 3GEHA 2JGNA 3EAQA 4B3CA 2WJYA 5L8VA 1GNRA 3DZDA 2C9YA 5EE9A 4TSFD 5C1BA 3NEJA 2VHUA 1XF9A 1M8PA 3BIFA 1E2GA 4Q1FA 3VR3A 3T1VA 2YYZA 4M9QA 4F4IA 4L16A 1G4UR 2QM7A 2SHKA 2OCYC 4EPRA 1K5GA 3EXAA 5FI0B 5HCIA 1RRCA 2X77A 1T9HA 1E6CA 4ZCLA 4DSNA 4Q4JB 2VRWA 4JT2A 5L3RA 3I4LA 4G5SA 1OV4A 3K0FB 3PEWA 1X8JA 4URVR 1MV5A 1S2MA 2CCKA 5HKKD 1RZ3A 2W6JD 3PEYA 2Z43A 3NH9A 1G3UA 1N0WA 2W2TA 3TIFA 2J59A 1UF9A 5DN6A 2ONJA 4LYHA 3U4QB 1JEDA 2J7PA 1OXSC 3PEVA 2WMNB 2OO7A 1P7CA 4LBZA 1GILA 1JPNA 3U61B 4KHZA 1G8YA 2J0VA 2BJVA 1KIMA 2YZ2A 3E5HA 3SBEA 4PR0A 1DG1G 1II0A 3U3MA 4OI2A 1IHUA 4D6PA 5CITA 4TLEA 1W4RA 4PSAA 1NVXQ 1ZCBA 1GL6A 3NTUA 2ZYVX 1IJEA 4TSFA 4LSGA 2ZSDA 2G77B 2QG6A 2NPFA 3X1XA 1XDBA 3VTKA 4OQLA 3SE0A 1WRBA 821PA 5P21A 4G5RA 4NZYA 2BV3A 1BH2A 4TLCA 2AK3A 1P4SA 2AD5A 4IJMA 1YZGA 4NPHA 4M1YA 1J99A 4NONA 4V0KA 3THXA 1GWNA 1GOTA 1KI2A 3RRZA 1IONA 4UNPA 4LK2A 1E4YA 1HE1C 3C7KA 5CB8A 5HKKA 2W6JA 4QJ5A 3A4MA 4J0QA 3RS0A 621PA 3GJ7A 1GZSA 2HXYA 1NIJA 2ZRAA 4GP6A 3TQFA 3LQQA 4EQ6A 1EFCA 4D82A 1YZUA 1ZCAA 2OT3B 3U60B 3U44A 3G82C 5KOYA 5HR5A 1VG8A 2ODNA 3BD9A 1JPJA 2IYLD 3X2SA 3W8RA 3HJNA 2ZRMA 2ZU6A 3OIUA 1DARA 3L82B 3UKDA 3H4MA 3NKVA 1V43A 2V1XA 2ZRHA 3GLHE 2ZTSA 2PLRA 4MGYR 4PZLA 2G9NA 8OHMA 3EW9A 5CYOA 2IK8A 4Q4AA 4UNNA 1Z3IX 1F2UB 2CL6X 3BH6A 3KQNA 3DL0A 4RFSB 3U5ZB 4US2R 2TMKA 1ESNA 2ZITA 4JBWA 2YJTD 1MO3A 4IDOA 2J0QA 5JCZA 4BZXA 2F6RA 2ZE7A 4Q9IA 2D62A 4P4SA 3K53A 1KZ7B 2V55B 1J8YF 3B82A 2C9CA 2UVQA 3QUSA 5LB2A 5KNCA 4ZV4A 3KQKA 1SVMA 2CHGA 4QXAA 2KJQA 1LTQA 1JR3D 2JJ2D 3CBQA 2WWWA 4MYHA 4W5HA 5FPSA 4C0SA 1KO5A 2GBLC 4L5BA 4ARZA 2XXAA 4PAOA 1EFRD 3CRQA 1VHTA 1AZTA 2ODEA 1TQ4A 3K09C 3FGNA 5JEEA 4DDUA 2BIFA 1Z0FA 5CLQA 2W00A 2FEOA 2PMDA 4X8HA 5C46F 3THWA 5JJLA 1XTIA 1TAGA 3VR5A 4S2EA 1BS1A 4B74A 4BLRA 3RRMA 2QP4A 4JKYA 4V0ME 1LV7A 2BEKA 2GTPA 1YVDA 5KNBA 4GMXA 1U8AA 4LHXA 3K9GA 3KQUA 2JLZA 1R0XA 3AF1A 4G1UC 4ZO4A 1KGDA 5EXXA 421PA 2OBMA 4XIGS 3WMFA 1CR1A 1U0JA 3GFPA 3GLGE 3A36A 4AWXA 3AKCA 5AJYA 4FCWA 3CPJB 2V54A 5HCNA 1XTQA 4ON9A 4C2UA 4D0LB 1FP6A 1N6HA 1E98A 3OESA 2HT1A 5G3ZA 5HE9A 2WAYA 1E2FA 3CZQA 1XJCA 1P6XA 4JJKA 1N3BA 1E94E 4DZZA 2QP9X 1FL9A 4ZIRB 4RY2A 1XMIA 2QT1A 1J90A 3IPXA 4IHQA 4L4UA 2IX3A 2Q9BA 1XD2B 4BFZA 4O2RA 2WKPA 1NLFA 1TPZA 1HT1E 4Q4LA 1JR3A 2JJ2A 4QHYA 5GJVC 1U0LA 1E1QD 1T5LA 5DH9A 1E9CA 3IO3A 1XCPA 5KUTA 3ZH9B 1UFQA 1NNEA 1JQJC 4LJ4A 4V0NA 2OE2A 4BGDA 4G3XA 4URZR 2H5EA 4ILEA 3FDIA 1L8QA 1ZRHA 3EPHA 3F0TA 1J8MF 2Y8EA 3A1VA 4B3XA 2QTFA 2ZI3A 3B8HA 2RGEA 2W2VA 1OXUA 4RD0A 4TQUS 3W6NA 4LV8B 4TLBA 5KSYA 2GETA 4QM7A 1BYUA 1GUAA 4HAYA 5M04A 1YE8A 4NP6A 3T61A 1FMJA 4EIWA 2PCJA 5IHPA 4C0QC 4I99A 3Q5EA 2R65A 1YR7A 2O0KA 5F9HA 2EYUA 3GJ8A 3EWSA 1XP8A 1MABB 3IBYA 3R8CA 3GLIB 2H57A 2ZI4A 4A2QA 3U2QA 1M6NA 4A4DA 4HZIA 1XRJA 2JA1A 4NE2A 1G7CA 5E95A 5KU1A 1AS2A 4HAXA 2H92A 1FUUA 4MGKR 5DNYB 2O8FA 4JL8A 1R0WA 3SJAA 1U8ZA 3QKRB 5FBLB 1GITA 1U8YA 1U2RA 1ZM7A 5CJ2A 1SXJE 4EPWA 2QMEA 1I2DA 3I73A 5L3QA 4JBXA 4OI0A 2FX3A 1E1QA 3CH5A 5FPTA 2A7QA 4WOPA 4BEJA 4DB2A 3OHMA 1Z6AA 4JMPA 5D3MA 4DB4A 3G0HA 4XVQA 2QGNA 3QI2A 1WCV1 4C0BA 4IDPA 2XB2A 3UMFA 2NMVA 1KHTA 2FZLA 3SQXA 2VBCA 4TMTA 4FIDA 5LPNA 1P2TA 2GZDA 4Q7KA 3ZLJA 3NH6A 4ESVA 1WBDA 3IIMA 1Z8FA 3LVQE 4KAXA 4PC6A 2KWIA 3DKPA 1ONBA 2WV9A 2FA9A 3LAWA 3MJRA 4IOMA 2J45A 4L15A 4PZYA 3KQHA 2HEIA 1TU4A 4PHHA 3OIWA 2BBOA 3TUJC 1CJTC 4FWIB 4D25A 1RRPA 4DVGA 3ZVMA 4Q4JA 2G0TA 1AQYA 1Q21A 2OZEA 4OI1A 4IEEA 4PAMA 4PC7A 4NCHA 5CK4A 3VX3A 4QOSA 3VMFA 3UIEA 4A15A 3ZD7A 1JAHA 2AN9A 1TNDA 1CR2A 3U4QA 2YOFA 3L0PA 1CXZA 4MYTA 3QOFA 1Q22A 1SKYE 2X2FA 2NOAA 3VR1A 3PUXA 4M8NE 2GJAA 2C99A 3NEYA 1NSTA 3P32A 3DEFA 4NU0A 4Q01A 2ZETA 4MUBA 3K0EA 1MT0A 2GEVA 3QF7A 4XTCS 1T3SA 4Z54A 4IW3B 4HB4A 2WOOA 2B21A 4Q47A 3SOPA 4OQFA 4C30A 4ZPXA 2IUTA 5JMTA 2O8CB 3ZVLA 4CT5A 2QUZA 2YINC 5LD2C 4TMVA 2ZJAA 2QAJA 3CX8A 3W5IA 3KB1A 4M1SA 1NN5A 5TV2A 1FOEB 3VR6A 3B6EA 4DHEA 2Q9CA 4TYNA 3EA5A 2Z4RA 3I8SA 4KV9A 4B32A 4HLUC 3AV0B 4BFUA 1D5CA 1W4CA 2J5XA 4Q21A 1K8RA 1CRPA 1IM2A 1S9DA 1NY6A 1YRBA 4ACBA 1F6BA 1X86B 1RE0A 4BE7B 1DPFA 1ZNWA 4EPTA 2PT5A 3LWNA 2Q0HA 4OHZA 3D31A 2ZRDA 3D7MA 5B2ZA 1NBMD 4HUTA 1NKTA 2E9SA 4LJ9A 3U7FB 3PUZA 2V6JA 4FI3C 5IT5A 4IFBA 1SKQA 2BVNA 1EK0A 3QE0A 5G3YA 3FYHA 4NCNA 3Q72A 4OJQA 1M1YE 1AA9A 4L9WA 1DOAA 2EFDB 3WYFA 1VIAA 3UXMA 1W0KD 5BYKA 1QHNA 2UZ3A 5CB6A 3Q3JB 4R9UC 3ZJYA 4HAUA 1MRNA 4FMDF 3LLUA 2GF0A 1EG7A 2ZI9A 3DVLA 1S9HA 4A8JC 2J0UB 2FH5B 2PLFA 3M0EA 2A5JA 2FFAA 2WWHA 4MRPA 5TARA 3VKGA 2N1BA 2Q9AA 3WP1B 4LPSA 2WJIA 4BRUA 3CWQA 4JYBA 1F2UA 2R6FA 4KFTA 2YOHA 1W7AA 1HV8A 1DVRA 4QNRA 4D0NA 4RFSA 2IT1A 1ZU5A 1KSJA 2JAQA 2JJ1D 4PPQA 1DAKA 4NYIQ 3TW8B 2A2ZA 2YHSA 1RFLA 1W46A 1Z6YA 3F3YA 3I72A 3KKOA 1E3MA 2EFCB 2FNAA 2RCNA 1E99A 1CIPA 5GVRA 1W44A 3B85A 2IEYA 3P20A 2WJJA 3DM5A 1KOFA 4CGZA 4TYQA 2VSOA 1QVAA 2PZFA 1KI6B 1NBMA 2ZRKA 4TL6A 2AWNA 4UKDA 3MFYA 4CEJB 4KITB 3THXB 4BQSA 4TZ6A 3KJIA 5LD2B 2YC2C 1C9KA 2GXSA 3DO6A 3UK6A 5CIWA 3GMTA 4LY6A 1JJ7A 1LNZA 3RC8A 5FBQB 1G7TA 3LQRA 2XZLA 1W0KA 2QRZA 1AK2A 1WXQA 4LRWA 2F1HA 2FSIA 3NDBB 5UKDA 4RD3A 2D4HA 5DHAA 2XZOA 2V7QD 1KK3A 4BFYA 5JRZA 1YR6A 5B57C 3AVOA 1JNYA 1Z0AA 3A1UA 2WTUA 3UPUA 3LD9A 1E2JA 3PJRA 3KJGA 3QQ5A 4BFXA 4NMMA 2OFOA 4FWTA 2QROA 3W3ZB 3CNNA 4ZIRA 4XH9B 2ZRIA 2JJ1A 4E5UA 4AYTA 5F3WB 4MGIR 1GKIA 2JLXA 4TYPA 1BOFA 1NVUQ 3FHCB 2FPKA 3BS4A 3NBYC 4U5XA 5FUXA 2XNDD 4RCYA 1YRAA 2PMKA 2HF8A 5CDFA 5KPJA 4F91B 2WJGA 2BM0A 1TUIA 4P4SB 1E9BA 2ZM5A 3WRYC 1ZINA 4A8JB 1M34E 2J46A 4P0TA 2ZYWX 3U7GA 1KK0A 4CW7A 1EXMA 4B2IA 4Q1CA 2GK6A 1F60A 2A3RA 3CRRA 3OIYA 5KSOA 1JAIA 5DGXA 3IGFA 1E9FA 2A30A 2HYIC 1S8FA 4PX9A 5EE3A 4A0GA 3SQWA 4P31A 2FE4A 1E96A 4TL8A 4WXRA 4IRUB 4TMWA 3VX4A 3WHKA 3AVQA 1R5BA 2H7VA 2F43B 2V7QA 3MWKA 4FMCB 2GBLA 5TXGA 1NL3A 1MABA 3WYGA 3GLIA 3K09A 2C78A 1Q57A 5SZHB 2ODBA 1JJVA 221PA 4IKEA 3CRW1 2GRJA 3SFVA 5FFMA 1XTJA 1XPOA 2VF8A 3OEHD 3THYB 4RFVA 1GIAA 1T91A 1E2DA 3GQBA 5DI9A 3ICQB 2I1QA 1DG3A 1W1WA 4GI7A 5FTJA 4R2HA 4KBGA 4RKFA 3QG5A 2XNDA 3OZXA 1NMYA 2JLSA 1KI4A 3L0IB 2EWVA 4URXR 4C0AC 4W7SA 1G7RA 4C2TA 2Q21A 2P6NA 4Y0AA 1FUKA 4LJYA 4AYXA 1D2NA 3L0OA 1IN8A 4F4CA 3CF2A 4OI4A 1N6IA 3SDZA 4ZCMA 1NVVQ 5HTKA 3NG1A 4N3NA 4A6PA 4BFTA 4M1WA 3AM1A 1E2NA 2QN6A 4Q18A 2OILA 4HUQA 4HAZA 2R6CA 1S1MA 1IXZA 1UEJA 3UMRA 4AG5A 2ZE5A 3Q85A 3IEVA 4AURA 2ZU0C 1YU9A 2BCGY 3BBPA 2G83A 4GBMA 1ZNZA 1Z28A 3EX7C 1VYVA 2AL7A 1YHNA 3KXIA 1C1YA 1M7BA 4PZZA 3OIVA 2AXPA 4B76A 3VKWA 5BWMA 1W5TA 4HYYA 2CVFA 4M2LA 3TGPA 3SHFA 1Q1EA 4JJZA 4M1KA 4LBVA 1A5TA 3ZZTA 3B9PA 3OEHA 3WNCA 2V8OA 4BWYA 1QHYA 3U3RA 4KYIB 1CP2A 2VSFA 2ZUCA 2IEZA 3KKNA 1CULC 5J4VA 4QGGA 2L0XA 2ZJYA 4LJ7A 2JLYA 5FL3A 1Z29A 2IYSA 4JS0A 3VR2A 4IXMA 3VR4A 1IAQA 4I1SA 6Q21A 2O8FB 1Z83A 1DAMA 1SVLA 1G64A 3BERA 3I3SR 5E4FA 2VPPA 4HSEA 4MDFA 1DAIA 2ZI7A 4CEHB 1VG0B 3QSYA 4V02A 1W47A 1R8SA 2DFNA 2B92A 2YWGA 4A2WA 4B35A 4QFMA 2IS2A 1OLOA 3L8ZA 2O8CA 4K46A 2G0NA 4HDOB 3GEEA 4LI0A 1AS0A 5D3MB 2ATXA 4AK9A 5SZIA 1EFHA 5BN4A 4DLSA 1MOZA 4CEIB 1XD9A 4NYIR 4FN5A 4XWAA 5HE8A 3VKHA 2D74A 1KKLA 4WW0A 1ZVQA 2Z4SA 1T3LA 4JVLA 4EFMA 1Z6GA 5JFGA 2QU8A 4GPTA 4NCIA 3ND8A 2A5DA 3WNDA 4E03A 2NO1A 5EZ5A 1MKYA 2DBYA 4QBGB 2QEQA 3I1FA 2O0HA 4Z8YA 3EA0A 4DCSA 1FTSA 3JZMA 4IVRA 3CPHA 2NO7A 1TF5A 3CR8A 2GHIA 4UNQA 1RYHA 2CHQA 4DSUA 4RZUA 1Z63A 3P4XA 1QHSA 3QXXA 3R7WA 5BW8A 2VP4A 4IOKA 4JLBA 2FPLA 1YZLA 4LZZA 5KO2A 3BGWA 4TLDA 2V6IA 3SZRA 3CR7A 3RWOA 4CIDA 2P6UA 2VP5A 1P75A 3OAAD 4PFSA 3SYLA 2BMJA 1ZMXA 1M7HA 1G5PA 2BCJQ 2VP2A 4OHVA 4LDJA 3TSWA 4A1FA 4K81B 1MR3F 1DAGA 2KBFA 1XXHA 2VO1A 2Q3MA 2R6DA 2BJWA 4DJTA 5D3QA 5FH9A 1X3SA 1PV4A 4AKHA 5BN5A 2IYQA 4EAQA 3AP1A 4NYMR 4BASA 3UMSA 3GFOA 3FHTA 3TR0A 1TQ2A 5J4YA 2J0UA 3DM9B 5EE5B 1ZAKA 2IXGA 5K8IA 3LRPA 3MJHA 5C4GB 2B8TA 1A82A 2QMOA 3L2OB 2ZREA 3PITA 5BYJA 1BYIA 4DCTA 1AZSC 1PLKA 2PZGA 1L7VC 3TK1A 2ZSAA 3MRSA 3ND9A 4BPBA 3IIJA 1Z22A 4UJ3A 2XTZA 3EZ9A 3M6AA 4O2LA 4TTPA 3V4RA 4BLSA 4RD2A 1JXMA 3QBVA 4AKIA 4RKEA 1N2CE 2GVDC 1TEVA 1BKDR 3WP0A 2GILA 2OM2A 3CX6A 2FFBA 1RYFA 3V00A 2F55A 1KNXA 4I4LA 2EWWA 2ZRPA 4TTRA 1KMQA 3Q8XB 4JLAA 1RRGA 2CLCX 5EUMA 3LXRA 4MUAA 1KI6A 3RNLA 1QG2A 4JLOA 3VAAA 4CEJA 4WIAA 3B9QA 2D7DA 4ACAA 4WAUA 1CR4A 1DAHA 4RZ3A 2CE2X 3QVUA 5FUVA 4I81A 2H1LA 4NYJR 1TU3A 4B73A 3OAAA 4MITA 3TE6A 3GJ6A 1W2HA 2J9RA 2IBMA 1ZP6A 1TL7C 3IQXA 3ONWA 4HLUA 2ZJ8A 3B1VA 1KI3A 1E1RD 5J4HA 2CJWB 1Q0UA 4KBFA 1P5ZB 1NG1A 3L43A 4MKIA 5FR1A 4US0R 3AB3A 3FFAA 2AD1A 2EQBA 2GF9A 4DDWA 2NQ2C 3HWSA 4H1VA 3HU2A 4P33A 5G41A 4D4LA 3TSOA 2OXCA 4NHOA 2C95A 3FFBA 3TH5A 4LOAA 5JLJA 4JIMA 1NLZA 4LHYA 4QJ3A 3EPLA 1W36C 1XU4A 1FZQA 4G01B 2K5UA 2FOLA 4DXAA 2WWGA 4WVFA 3EZFA 3CF6R 1E2MA 4EJSC 1OH5A 3QEOA 2WOJA 3MD0A 1A2BA 2GDJA 2REOA 2ZPTX 2IXFA 4A8JA 5C4MA 4F92B 4MYCA 5GJBA 1ODFA 2PH1A 2P65A 1JB1A 1NVVR 2X19A 3DPUA 1HYQA 3B1WA 2QRNA 4TYYA 1Q44A 4LPKA 3HU1A 3R9WA 4MRNA 1ZBDA 1YJ5A 2O0JA 2ZAOA 4OJKA 3KJEA 3J81k 3U7HB 4PSKA 3EPKA 2FEMA 3CNOA 3WMGA 2IL1A 3AP2A 4EPVA 3AGQA 1ETUA 4KLNA 1LVGA 1E1RA 1BO6A 2DFKB 3K1JA 4DLUA 4AKEA 4B2PA 5JS7A 1G19A 1SVKA 1EX6A 3V4FA 4PC3A 2F43A 3C5CA 2GJSA 3DOEA 2OSBA 4RJLA 3MMPA 1GKUB 2ERXA 1RPZA 3QKUA 3TLXA 1AS3A 2QT0A 1PVOA 2IC5A 5EQTA 2BOVA 4KSCA 2GWHA 2IF2A 2IHYA 4KFRA 3REFA 4AY2A 4R7ZA 2FSHA 3EIEA 4LYAA 1OF1A 3RANA 4GZMA 3THYA 1G41A 4AKGA 2C2HA 1TMKA 2IYRA 3KUCA 4LJ6A 1XTRA 5AUQA 1IQPA 1YZKA 1CR0A 2QGZA 3AF4A 2OCBA 5AR1A 2QP3A 4R98A 1WMSA 3TR5A 4BUJA 2ASEA 4M1TA 4X8OA 1IN7A 1Q1ZA 2HF9A 1OXVA 1Z0DA 2HJGA 3FHOA 3PFIA 4LV6A 2XNSA 3EARA 2OCAA 1XB2A 3HP1A 2C5LA 2VQSA 2FSGA 3MGCA 4EFNA 2ZS9A 1GRRA 4XVUA 2F1IA 3IHWA 4PANA 1EFRA 2C03A 2GZAA 4HB2A 4Q9HA 3T1QA 4JT4A 2P67A 3EIQA 1VPLA 1PZNA 4Z8XA 4C0KA 4BFWA 1ZM9A 5HZHA 4UJ5A 1W36B 4HDCA 4MGZR 3C16C 2ZRBA 4DBLC 1II8B 1TQDA 4LWZA 4ZKDA 3AKDA 1J7KA 5AK0A 1JQLB 5A0FA 2E1RA 5KNDA 1DE0A 1ZW6A 1US8A 3IBGA 4RZXA 4XTRA 3MUFA 2P5TB 1S3SA 1HEIA 3LA6A 1S4QA 3PUWA 1RVDA 2QNRA 2GEDA 3MLEA 1TF7A 4IOLA 4LJAA 4NKRA 1ZJ6A 5TDHA 4D2IA 3RYTC 2XTNA 1LY1A 1O87A 2OLKA 2A5YB 2YWFA 4P4UA 1NKSA 5FPYA 1JR3E 1G4AE 2QORA 3K9HA 3RS2A 2QA5A 3P27A 3K70C 1CBUA 1T6NA 2ORWA 1KSHA 2ZE8A 3CPEA 3N5CA 2ZXUA 1W4BA 1PLJA 3NVAA 3FTQA 1G3RA 5E7JA 4NL4H 2A5GA 1OFTA 3PXGA 3TNFA 4CEHA 3GLFA 1YKSA 4M22A 1HE8B 3B5JA 1G16A 1UJ2A 4UNRA 3PVSA 1M7GA 4A0FA 3REGA 1N5JA 2WKQA 4Q66C 1H8ED 2W2XA 4CEIA 3JVUA 4KCGA 4Q19A 2WZQA 3BXZA 2IW3A 4NCJA 2GCOA 3GP8A 1X8LA 3T5DA 1HQYE 1CLUA 3AKEA 2DWQA 1A2KC 1E2QA 4I1VA 4Q7MB 1RW4A 4TQ9A 5B64A 2QMUA 4HUQB 3WBJA 1OIWA 2N46A 4CT4B 2RGDA 2KE5A 5FBWB 4GT1A 3AEZA 1W49A 4WZ6A 5JZVA 4U00A 1R5OA 1AGPA 1FQKA 1KSFX 2R8RA 1NN0A 2CE7A 5AUOB 1VYTA 3QKTA 3R9IA 1TTTA 1Z5ZA 2LCFA 2AXNA 3F5FA 4B44A 4JLVA 5JI2E 1IY0A 5EUQB 2DB3A 3O8BA 4M9ZA 3PQCA 2G6BA 4PC1A 1GRQA 2C96A 2CCGA 1G5RA 2G3YA 3KXKA 4B3DA 1UBCA 4RD6A 2XEXA 3W5JA 4CZ2A 1CEEA 2GKSA 4PXAA 3RAPR 4JLDA 4GMDA 2LKCA 2D2FA 4DEXA 4P3YA 1WE2A 3ZQJA 1YR9A 4DSOA 2CBZA 3K0CC 1SULA 5IF9A 2GEUA 2O52A 4JSYA 4EPXA 5F9FA 3FVQA 2NZ8A 5K8UA 2FSFA 5C18A 1A7JA 3L0SA 1NI3A 2IS4A 4MDEA 2ZI6A 4DLXA 4DLYA 3R20A 4C9BA 2ZVPX 121PA 1E2PA 1H8EA 1S3GA 1Z6TA 2VHCA 4R2IA 4FW9A 2JEOA 3NBZC 4WBSA 2VF7A 3W9YA 4K8OA 5BXQC 1GP2A 3CH4B 3WMEA 4DIEA 4ESHA 2OUKA 2F9MA 4OQXA 3W90A 1R0YA 2EFEB 3K70B 2DFLA 2XSZD 3T34A 2DWOA 4RD1A 3HR7A 3AF3A 5JWHA 4OK6A 2VYFA 3LLMA 2RGCA 4LC1A 3AKYA 5EP4A 1KKMA 3RC3A 3RSLA 1D9ZA 4HDQB 1KZGB 4EPYA 3BWDD 5TVKA 1QRAA 3SNHA 4O25A 5CM9C 1OIXA 2ZR0A 1ZD8A 1KJYA 4YMVA 4Z51A 2F1RA 3ZDQA 3BORA 4F7WA 2GXUA 4XSHA 4C7OB 1R8QA 4YDHB 4JBYA 1UKZA 4QBHA 4KVGA 3R7WB 4A0RA 2VP9A 2ZEJA 3FMPB 3Q5DA 4OHYA 2WJVA 2HXSA 2WSSD 3LW8A 1XMSA 2CJWA 2EW1A 4LGMA 2YOGA 2EVWX 2MSDB 4YDSA 3O8RA 4HAWA 1QHHA 3M1IA 4W5JA 3KJHA 5JECA 1KK2A 4AD8A 4LBWA 3FPAA 2OEPA 2YV5A 1E2KA 1XXHB 4OK5A 5GJCA 3B13B 4QC2A 3HR8A 1E0SA 2PX3A 4H9GA 3QF4B 2GZHA 5JWOA 2VH5R 4KO8A 2JDID 2GK7A 3BC1A 5KHOC 2DR3A 2FFQA 3RDPA 5DE3A 1SZPA 3CW2A 3P26A 1I4TD 4C4PA 2A9KA 5EP3A 5J4KA 3EPJA 4S35A 2XSZA 3WY9A 2QZ4A 1Z6XA 3IKJA 2ERYA 3LBIA 1XWIA 2ZUDA 3FMFA 3VFDA 4DLTA 4TMXA 3MG9A 3PUYA 4JKIA 2WSMA 2ZJ2A 1CRQA 2B6HA 1OJLA 1OYYA 5HPYB 5CLLA 1E0AA 4BZPA 4FD2A 3IHLA 1E9EA 4Q9KA 1J70A 4KFSA 4UQOA 4MYUA 2YWEA 4IVQA 5FTMA 4PPGA 1AKEA 5E3HA 4B43A 2ZRGA 4LHZA 4DCVA 1T4GA 2JLUA 4CYMA 2WPDD 2GNOA 2HJVA 1OPXA 5JBQA 1W36D 1Y63A 3K0AB 1AM4D 2WSSA 1A4RA 4YONB 3AUXA 2X1VA 2ZRLA 5CJPA 4C0HA 1KMHB 4AG6A 1KNQA 2JLQA 1EESA 3LV8A 1UKVY 3LO5A 2MSEB 2WMOB 2REXB 3GLHB 3VHLB 1NRJB 4UXIA 1R10A 4KJZA 2AFHE 4KYUA 1U99A 3QXHA 2P6RA 2UZIR 1SHZA 4N0EA 4QBIA 4YQFA 2JDIA 3IDQA 2ZRFA 2NO0A 4NYMQ 1S1CA 2GAAA 4BLQA 4FMCF 4W9MC 1DEKA 1EWRA 1G291 1T5IA 1R6BX 5FBVB 1FTNA 4B2LA 3GJXC 2VHJA 2O8BA 4KU4A 4N0DA 2FFHA 1II9A 2BC9A 2ZAMA 3OE7D 1XMJA 2BBTA 2FG5A 1KDTA 3OFND 1TEXA 1P2UA 1MO4A 5EXPA 1Z06A 4IDHA 3DDCA 1G20E 1ZIPA 3BFVA 4KODA 4DLRA 5DYGA 3EASA 1PJRA 3IUYA 1UAAA 2O8DA 2XTMA 1NBME 3H86A 1XEWX 1BIFA 2CEAA 4Q02A 3B2EA 2IUSA 5EXSA 3I5YA 1LF0A 2GESA 1B0UA 2O5VA 2ATVA 1UBFA 2VA8A 4BLPA 1OIVA 2KB0A 5KYKA 3QXSA 1M74A 1DO0A 1UKYA 2WJHA 4BECA 3K9LA 2WPDA 1OH7A 2OXRA 4Q00A 3LVRE 4BRWA 2DFTA 1SXJC 5FOUA 1XX6A 4O3MA 1II8A 1DAEA 3VQTA 4PC2A 1VYUA 4EJSA 4NYJQ 3CRMA 1XTSA 4C3ZA 3GLGB 3SBDA 4PHGA 3BJIC 3L8YA 1ZIOA 1OFUX 2P2LA 5F2EA 1AQUA 2RAPA 4QJ4A 3GCGA 2V9PA 3TW4A 2E87A 1R7RA 2RGXA 1N6OA 4I1OA 1M2OB 4YMSA 5DISB 1GVNB 5SZJA 3CIOA 4B3FX 3OE7A 1L4YA 4ERNA 3HYRA 2F3RA 4QGHA 5CDFE 4DIDA 5DI3B 1ZD9A 1L4UA 2RHMA 2ZR7A 4QGFA 1V5WA 2QPAA 1TQ6A 3KB2A 3LY5A 1JXOA 3T1TA 3RWMB 3ETLA 3RS4A 3E1SA 5B58C 1FX0B 1G7SA 1JALA 3S1AA 3KKMA 3AVYA 3EZ6A 2QAGC 1Z0KA 2NPIA 3GEIA 1NJFA 1OB5A 4NH0A 4POAA 2DWPA 1VCIA 5HZKA 4QRHA 4P32A 3B60A 3FKSD 5FOSA 4IVPA 1GM5A 2IYYA 2WWYA 1RJ9B 5C2JB 2QM8A 4XJXA 2FDCA 2V1UA 1U9IC 3K70D 3EZ7A 2Q3FA 5CK5A 4JL6A 1KTVA 1HT2E 4YLGA 4D4KA 4DRZA 1T0HB 1Z0IA 3IO5A 5AJWA 3KQLA 1KI9A 3ASZA 2F9LA 2N42A 3O47A 3GLIE 2OG2A 2RGNC 4JLPA 4XWOA 5TB5A 5IRCD 2GVZC 2O8EA 1E9RA 2GJKA 1P2VA 1W5SA 2CL0X 2PEZA 4MQBA 2R6AA 2ZJ5A 1NIPA 2FPMA 2JLRA 4Z1MD 1US8B 1LB1B 3QBTA 5CYPA 1CKEA 2FN4A 4MKFA 2ZUBA 3ADCA 2CNWD 2OAP1 1FFHA 1YZNA 2IS6A 3NWJA 1SXJB 1WDTA 2PBRA 5FR2A 1E0JA 1KAOA 4WXPA 4JSTA 5J5CA 1ZYUA 2BMEA 1D6JA 3ADKA 2IF0A 3D8BA 1ESMA 5FI1B 4GOKA 3JZAA 4PQYA 3RS7A 4ZI2A 3R9XA 4TQAA 2XB4A 4A82A 1G8GA 4L8GA 3FMOB 3QVVA 1GAJA 1CJUC 1P72A 2ZIAA 2F3TA 4IFEA 1R5NA 3FKSA 2EFGA 4LJ5A 2FV8A 1LS1A 3GLFB 4DT1B 4LCBA 1TF2A 4U7DA 4DLWA 1E2IA 1IN6A 3AVXA 2ZJZA 1XCGB 2H8KA 4GDFA 3ZD6A 1WBBA 2GCOB 4FCVA 5EE1A 1E2EA 3SHWA 2ZVQX 3H1TA 3BOSA 1P60A 4H1UA 5IDVA 2QAGB 3HYTA 4QM6A 2YWHA 2WWXA 1G6HA 5JCPA 2B7BA 3BB1A 4Z1MA 3I8XA 4JVMA 1ZU4A 1G21E 1UBGA 2BEJA 1EFTA 3P4YA 4XVRA 1HY3A 4C7OA 1NMXA 2AX4A 2CNWA 3BFXA 2GCPA 5JSZA 1U90A 2XJ4A 3IQWA 4US1R 1VHLA 3BB4A 5A5GA 3H0KA 1U0HC 3QJYA 4PSVA 1FPMA 4B3BA 1SGWA 3SJCA 1RIFA 2F7SA 2J0SA 2F1JA 3RLFA 2H16A 2G1JA 4NTZA 1UM8A 2JCSA 2ZSFA 3UWKA 3X1DA 5A4JA 2IYTA 1XMVA 4R71A 1BMFD 5K8LA 1UADA 1RKBA 1UDWA 3QF4A 2NIPA 4W5WA 1EWQA 1QG4A 1X1SA 4PO9A 2J87A 3ADBA 3BH7A 1IXRC 1TADA 1TUEA 2FU5C 2RKOA 2CLSA 5LBIA 3RRYA 4YMTA 3OEED 1DS6A 4L9SA 5AJXA 3SI7A 5FUWA 1Y3AA 2VHQA 4F38A 4PHTA 1JBKA 4JLNA 4A2PA 2RHDA 1VDZA 1Q1BA 2HUPA 3KFXA 1OFIA 4HI0E 2IUUA 3X1WA 2BM1A 3B1ZA 3K0CA 2HT6A 3SS8A 3QEJA 2BWJA 1UEIA 3TKLA 1E69A 4DDTA 3EG5A 1G6OA 4ABYA 4LHWA 5JJKA 3AVVA 4UXHA 2ZSBA 3ECCA 3B1YA 1HQCA 3DMNA 3GFTA 4B6EA 1VMAA 3DOFA 4G5QA 3UWOA 5IK2D 1HURA 5JEDA 3N70A 4Q48A 1KO1A 3WRXC 1WF3A 2FGKA 1IN4A 3PUVA 1SHKA 5JHGB 1E4VA 2NGRA 4MKGA 1DTSA 2W0SA 1OYWA 2VHTA 1Z47A 5DYIA 4KLZA 2C77A 1IY1A 1XD8A 5GVSA 2PEYA 2C98A 4PAQA 1VG9B 1IY2A 1XXHE 1LW7A 3A1WA 3K0AA 4C0JA 1VIYA 1Q3HA 1GFIA 1AIPA 3I5XA 3CO5A 5TMPA 3Q9LA 4UNSA 1KMHA 2FMXA 1YZTA 2YVUA 4OHWA 2QI9C 2ZANA 1UPTA 2ZR9A 3A4NA 3GLHA 4QHSA 4HEJA 1BMFA 2DPXA 5H70A 3ZQ6A 1ZM2A 3FMIA 3LX5A 1OKKD 2RGGA 4GSYA 4M1MA 1QHHB 1RRFA 3KTAA 3T06B 2FJUA 1N5IA 3OEEA 2P3SA 2KSQA 4DWJA 2IS1A 4LJ8A 1GL7A 3AF0A 5KSPA 1VECA 2GJ8A 3CONA 3ICEA 2G1KA 1ZC3A 4Q4HB 5ANRB 4BLOA 2NTYC 3LX8A 4TYWA 4TMKA 5BN3A 1QDEA 3T12A 4QL3A 4XSGA 1N6RA 2WKRA 1IN5A 2I3BA 3KDSE 4DCNA 1ZUNB 1NVWQ 4EKDA 1O3YA 5L3SB 2YC4C 1XCMA 1Z2CA 2RH5A 3QY0A 5IK2A 2CK3D 1N6PA 1ZC4A 2NO6A 4DKXA 4DCUA 3K8YA 3E2IA 4E09A 2G88A 3U6KA 1XTKA 1VCMA 2RGAA 2QBYB 4V0MA 4FMBB 4B75A 3ZIAD 3TAHA 3B7GA 3AVPA 4Q7JB 2WHXA 1EGAA 1JEEA 3A4LA 1Q3TA 3CZPA 1KK1A 1TX4B 3DZ8A 1LF5A 4XWKA 4YXWD 3KUDA 3GLGA 1RC8A 2GXAA 3BK7A 2A5FA 4M9SA 4MRSA 4Q9LA 1NJGA 2VLIA 4TLAA 2IHBA 4OQMA 4RVCA 5EZ6B 3ZS8A 1KI7A 4P4TA 1OKKA 1E9AA 1G9XA 1N6KA 3QPWA 1PUJA 2IYXA 3W34A 1OH6A 3RS3A 4PPNA 1P9WA 3E70C 3ASYA 4FCTA 1Q12A 5F98A 3WNBA 4Q03A 1D2EA 2J1LA 3BAFA 1GKYA 4AI6A 2C9OA 5DI3A 1SXJD 4NBSA 1N6LA 1P9NA 2NG1A 4G5OA 3H84A 1IJFA 1R0ZA 3RSOA 5E7MA 1FQJA 3H2YA 3MAAC 2O8BB 1XEWY 3D3QA 1FX0A 2H17A 2WIAA 4DUGD 1VCOA 2CK3A 3QXCA 1J2JA 3TUZC 1PLLA 2PT7A 1JI0A 4IDQA 1SVWA 5FL7D 1I4DD 2H18A 1CTQA 1SVSA 2QE7D 2GCNA 3AP3A 3I61A 4ZCIA 2Z6VA 4EUNA 4V0LA 2O8DB 4JZKA 3ZIAA 4X8LA 1S96A 2MSCB 2D2EA 4PTLA 1RJ9A 2OFWA 3ZGXA 1L2TA 4YC7A 1XFAA 1Z08A 2CLDX 2WAXA 4PO8A 1R2QA 5DLQC 1WB9A 5K8TA 2R9VA 1E2LA 5G53C 2IA5A 2WBLC 4MRVA 2Q3HA 4YXWA 3LH5A 1KI1A 1X6VA 1F2TB 1QF9A 2ZS8A 1B23P 4RCZA 4DC9A 4EJSB 3CNLA 3BRWD 1KO8A 4ZI3A 1W2GA 2KBEA 2YKGA 3ADDA 4TL7A 4ZDKA 2IWRA 3QKSB 2QY9A 2R6GA 3I32A 3W8NA 5GADl 1K6MA 4RD4A 3A6PC 2OCPA 5J47A 4ITRC 1ZNXA 4BLTA 2WIBA 1XEFA 2GJ9A 4E22A 2JLVA 1SXJA 1G3MA 2QTHA 5FPKA 2XOKD 4M1OA 4AIIA 1E0KA 1FW6A 1OE0A 1CF4A 2OV2A 1KY2A 3UATA 5H68A 2ZRNA 1T8TA 3W3AA 1U94A 4I1UA 3SFZA 1C4OA 5FOTA 4DUGA 1NSFA 2ZJBA 4ZKEA 3R8FA 5FL7A 4BFVA 3GJ5A 2IYVA 2QE7A 4BZQA 5SZKB 4TMZA 1SVIA 1QZXA 4GFDA 3TAUA 3QPVA 3SEAA 4PHFA 3S1AB 4ZDIA 2V4ZA 2Z83A 3ZVNA 4LC0A 1XBTA 3LBNA 4DT1A 1N5LA 1ZM3A 2XAUA 5DIFA 3B1XA 4HAVA 3RHFA 3TQCA 3WBKA 4QKQA 1ZUIA 1MO5A 4PQFA 3VU9A 1GDDA 4F93B 3CX7A 4TL9A 2X8AA 2OESA 3MWLA 2EYQA 2IXEA 3D6TB 4B33A 3O8CA 1XPUA 2W0MA 5DSZA 5AWFC 1F5NA 1NN3A 4PQRA 2QAGA 3DKVA 3UG7A 4BFSA 2VIIA 4LBYA 2QENA 3LDAA 1CU1A 1H8HD 1OW3B 2WWFA 2MMGA 2R2AA 2XX3A 4HATA 1CJMA 1U98A 4OL0A 4JVNA 2CVHA 1NLYA 1NN1A 1XEXB 5EE0A 3TVTA 3UANA 2O8EB 1I4LD 1UKEA 4RSGA 4F4JA 1DBSA 5B30A 4EFLA 3GJ4A 2PJZA 1G3IA 4CDGA 2Q6TA 3TRFA 1CS4C 3C5HA 4DLZA 3NHAA 2XOKA 1U9IA 5KPDA 4QBFA 4LYJA 2HLDD 2ZE6A 1E2HA 2I1VB 3IILA 4HZUB 4M21A 2QL6A 3GLFE 4G5GA 2RGNA 3ZZ0A 3NBFA 5FOVA 2PCLA 3UG6A 3KZ1E 3MSXA 2NZJA 1GL9B 2D3WA 4X8MA 3LBHA 4B34A 1I2MA 3O8DA 4QHTA 1FMLA 4A0HA 2ECKA 4OYHA 3W6PA 4GOJA 1D9XA 2IYZA 3K9NA 4XOIA 3SC3A 1WQ1R 5KDDA 3T1OA 2ZYUX 3LW7A 1DO2A 2JASA
chains in the Genus database with same CATH superfamily
3JQFC 5DHSA 4W1SA 2DM6A 3OJEA 1Y6ZA 3H5IA 3R4VA 1IOWA 3K0FA 2OG1A 4CTJA 1W5FA 4HLQB 2PX0A 2QX7A 1DBQA 1PEAA 5HUQA 2VPTA 2FQXA 3KCNA 3D4OA 1X8XA 4MKHA 1EFUA 3IRUA 1F4VA 2IWHA 1Z8HA 1A5BB 2EIXA 3EPPA 3OPYB 3HBLA 3R3JA 3GNSA 3QOWA 3F3SA 2PJUA 5AW6A 1GNPA 1SR8A 1DMSA 2CHVA 2QSYA 2XJ9A 3AGPA 3OT4A 4U02A 1P3JA 2ERCA 3ZLUA 2X2EA 4A92A 4EHDA 2HK9A 2PS1A 2V7XA 1KFJB 2UU9B 3EUFA 1XPRA 1D2MA 1VG1A 1T26A 5REQA 2HU2A 2PANA 4JT9A 1L3IA 4YCAA 5SICE 3IP6A 3C98A 1XZMA 4P3XA 4PXYA 1I7PA 1Z07A 2H4WA 4HLCA 5EP1A 1T8UA 4LJSA 5K7SA 4XLLA 1IBRA 1YBHA 4B1FA 4LX0A 3W05A 5JJ5A 2B61A 2Q3BA 1H3NA 2XUHA 1SEPA 4B6FA 3G2JA 1S02A 1CRZA 3EIHA 1L7AA 5EWMB 3F8TA 5A5EA 2PMEA 3IPCA 2OOSA 2AYXA 2CN1A 4M38A 1EX7A 3TOVA 1EB8A 1LFDB 1P62B 4IEIA 1RAGA 2IEGA 4U63A 5JSZB 2DLNA 1K88A 4GOLD 1O96A 3PGKA 4YIHA 1BFUA 2ZYHA 1TTHA 3SY8A 2JCXA 2P6MA 2QTZA 2GBPA 4MUEA 5ADUS 5HIKA 1POXA 1F9AA 2O7NA 3L8HA 3M4YA 3MQ2A 4RZ2A 4N6NA 4B83A 1WW3A 2OUIA 1R4ZA 2HKIA 3IOYA 4KACA 4NCXA 4PPFA 3HHEA 1PT9A 2YFKA 3BZWA 3QE2A 1P0IA 3K73O 2Q3DA 2XH8A 1QP7A 1OFHA 4QGAA 3CRVA 2AFIE 4MRRA 3GA0A 2NP7A 1BD4A 1FLAA 3PDCA 3O6VA 1NATA 3EZ2A 4JI1B 3R5FA 4O4HB 1N2CB 3TJMA 1CIVA 1AOXA 1EM8B 4M0EA 2ZFUA 2XIQA 1W88A 3OZCA 4L22A 3WKBA 4DMFA 2CDNA 4HADA 1H0KA 2BT4A 1BW9B 1U5CA 3LNCA 3PUKA 4F2PA 3LFUA 5FAXA 2PBLA 1XV5A 3ESRA 3E5RA 4RMHA 2MT9A 1T4CA 2B8WA 4L85A 5EJ2A 3U4HA 4EF4A 5D51S 2UDPA 4FYIA 3LYAA 4II7A 2V7TA 4XJSA 5GM2A 3TJZA 3UMGA 1J1UA 1ZKDA 4R5MA 2JGKA 4M9XA 2VCEA 2HWWA 1W52X 3HVKA 2H11A 3HYLA 1KDZA 4EVQA 4CKBA 1MN6A 3M3HA 1VJRA 1G1MA 3GYBA 3DL2A 1FCJA 2AOTB 2PIAA 2BKEA 1X38A 4BTEA 2CFCA 5GIOE 1ENYA 2RFLA 4EJ0A 3THRA 3F7MA 5A02A 1U6JA 1C3LA 2D4AA 3F9IA 4H7JA 5C5EA 2JFUA 1DP4A 4QSHA 4KJXA 5H16A 1OWNA 1OXXK 4PXSA 2X5NA 2BKUA 1FP7A 1N0VC 3IEUA 3OPVA 4HWOA 4M8LA 4N5DA 3OZSA 2W6ID 4M0LA 4B4KA 3DMDA 3TSZA 2LE0A 2APJA 3CH7A 1TVCA 3PYXA 3SJUA 3KAQA 3KKPA 1MAAA 1PUIA 1D8TA 1QRRA 4X6XA 4DLVA 4MH0R 3ZTWA 1PSWA 1WTCA 2UV8A 4RTRA 5DVZA 3R77A 1X1RA 4GO1A 4WZBE 1ITZA 5CM8B 4B40A 1IOZA 5CBPA 4XD7A 4EJ6A 4TWRA 3WAKA 5TLSA 2BTOA 3AHEA 4JL5A 4JYCA 2R44A 4OQNA 4UUPA 2P0EA 3KPUA 3PUJA 3FWNA 2V97A 1MOPA 4W8GA 3HVHA 3L5OA 4WV3A 1XZJA 2YMQA 3DEZA 4GP7A 5IJ9A 3RARA 1EQAA 4AC9A 3QPAA 3TLBA 4ZDJA 2CBGA 1U0FA 1FNNA 4D8TA 2DX7A 2QIOA 3E61A 4GXRA 1K7SN 3TZHA 1QCZA 4TS4A 5BN3B 4QUJA 1E6UA 4HWGA 5C7IO 4URUR 5A2GA 1OVMA 4GH5A 2W58A 3WGNA 4B6OA 4KKVA 4AAYA 1YI1A 2OO3A 2QPOA 3KR0A 4CKWA 2C5EA 5K3EA 1T3ZA 3WL3A 2Z2IA 3G59A 2W22A 4EHHA 4EQ6B 2OBLA 4IJ5A 1NDUA 2UVDA 1SXIA 1ZBQA 4URWR 3JQPA 3ANLA 5AVVA 4GQIA 2QSZA 4JHLA 2G25A 2ZJOA 1ZK3A 1P8JA 4Q7LA 2DWUA 4UVEA 2Y1WA 4EA8A 4S1NA 2G5PA 3L7KA 2Y9MB 1Y9EA 4R54A 3CM0A 5JYEA 1FDRA 3CTPA 1NURA 3OX4A 1AUOA 3EEIA 4XYEA 5IBQA 5KDLA 3UJNA 1ZJJA 5TRTA 1F2TA 4Z49A 3ELBA 1T3TA 3GBVA 5KNCH 1DTEA 2JGDA 2O5RA 3I1JA 3Q7TA 4NDZA 1XD2A 4XXHA 5KKNB 2WQ6A 3RSQA 1SHUX 3QKSA 4BQRA 3C15C 1MH1A 1MO6A 2ZRQA 2W6CX 1XZCA 3U7QB 5CG1A 2PKYX 1AZLA 1CY8A 3U16A 3AH8A 1GZ5A 3DHEA 3SSAA 2IYWA 1N5RA 4FXOA 5U9CA 4AJNA 5CIYA 4LNHA 3V8VA 4ARZB 3QI7A 1EP9A 2EX1A 2BGRA 2XXAB 5H7XA 3N5KA 1CRLA 4LF4B 2X2OA 3FCAA 1TZ2A 1HFEL 4ND7A 3KHUA 4AMBA 3PR2B 2ANCA 3SJ7A 5JZ9A 4FFBB 4G1FA 4IHKA 3HWRA 5YASA 2PAAA 3GZ4A 4AM8A 3I9V1 4YJFA 1P7WA 3PCRB 3ZZUA 1QHFA 4P84A 4KWEA 2CCJA 4GEKA 4KQHA 4OPMA 2Q5FA 3AY7A 3ICWA 4NZPA 3U3OA 1NG9A 2P5SA 3GFRA 2O05A 5I7AA 1WMAA 3GRYA 2FPSA 3K7EA 3K72B 5A4FS 3ND6A 1JTVA 5DZSA 5J40A 4ALKA 5TPZD 5T4HA 1KAMA 3DKIA 3L01A 2CXQA 3QG1A 2PHZA 3JPYA 4HQLA 3KC2A 3T7TA 4QULA 5FTKA 2IUFA 5H8WA 4JLJA 3QKRA 1LLDA 3ZI0A 4EKGA 1XZPA 4Q3OA 3RS5A 4A9AA 2PUVA 3GJ3A 4KQIA 4U0JA 2O2YA 4JXKA 2GCEA 2HA3A 3SN6A 3G0BA 2OHFA 2P2ZA 5ALTA 4ZWNA 2IDJA 4RHEA 4N76A 2XE7A 1T6XA 1KSGA 5FYQA 4BNWA 4KXXA 2IKQA 2J7KA 2HQ1A 4LRXA 1GZDA 3DLAA 4WCDA 4X1KB 1DIAA 3K16A 4II3A 4WOKA 2XF8A 5KREA 5TMDA 3T4UA 2AKYA 5CB4F 1T8RA 1PS0A 3V7YA 1Y4ZA 3EXEA 1MX5A 2OO5A 1OROA 2WM9B 4JMLA 4KO2S 3BFPA 1TK2A 1CDDA 2AMVA 4XI9A 4LWQA 3K5IA 3D5QA 5D5QA 4ISBA 1RKQA 4XPIA 5JC8A 2IIPA 2FMIA 4LJRA 3TUIC 2WB4A 1B0ZA 2XVAA 3GPBA 1BXGB 3OCUA 5LBUA 3W1EA 4JJAA 3C0KA 3QNUA 3EVNA 3LPAA 2FWRA 3GGCA 3KUXA 4FOLA 4WL0A 5CB4A 2ZWVA 4AUEA 1N9GB 2OHVA 1GNSA 4E11A 5ELLA 3ER6A 1H4TA 1ECPA 1M2JA 2R86A 1NP7A 4YAWA 5K45A 1E9SA 2BI7A 3KO8A 3SKXA 3O9MA 3G7NA 2QM3A 1JX6A 1R9JA 2PSFA 3ZE0B 1F3OA 5HRCA 1WEHA 5DPMA 4EH1A 3SYKA 1R8YA 2HM7A 4V0SA 5EG5A 3ERCA 3FUVA 3GRPA 2CFOA 1DIRA 1TZCA 2LKDA 3WXMA 2BDTA 1MB0A 2R8XA 2GHRA 4KQGA 1NBEA 4X6YA 5J63A 3VYUB 1H2RS 2CFRA 3A2MA 3CZMA 4FFDA 5FOXA 3SLKA 4TVBA 2AC4A 5FADA 2X0FA 4CL0A 3NT5A 3ULKA 1Q1QA 3NXSA 3GY0A 4G9BA 4U7JA 3SYNA 3QXJA 4DEYA 1ZG3A 2OLEA 3CLVA 3VI4B 2W83A 2PKQO 4R83A 2NUPB 1WABA 4ZMSA 4UDNA 3PX7A 2G4CA 4FFLA 5HA5A 4LYDA 3KP1A 3PPIA 5L3QB 4DBLE 1DWPA 1Z38A 4RZIA 2VTBA 2HU8A 2HREA 3EAFA 1ACJA 4GICA 2WWIA 3RSZA 2AK2A 1L4MA 3LBAA 4PNHA 1KE2A 3VV3A 3VO9A 3JW8A 1G8FA 1BE1A 1SKYB 1U8FO 2H4YA 3BM5A 2DYKA 3RK0A 4BQIA 3GNQA 4G07A 3LXXA 3B1JA 4C08A 3I6QA 2JC3A 1SC9A 2J3QA 4NNPA 4C1BA 3FCYA 3FYUC 3SZMA 3DB2A 4FHCA 2WJYA 5L8VA 1QH9A 5F1PA 3PEEA 3EFOB 1LBTA 4TSFD 3HLKA 1Z35A 1MW9X 3TIVA 1K0FA 1YCFA 3AXSA 1BS2A 1ZUD1 3VR3A 1A1SA 1QYXA 4K9DA 4F4IA 4L16A 5T6BA 1JI3A 4IF6A 3NHUA 5E9WA 3OJLA 1K5GA 4A6EA 3FMGA 3EXAA 4DE5A 3ZK9A 2WF8A 2X77A 1E6CA 1F2DA 4ZCLA 2VRWA 4LISA 4DLPA 3FETA 5AW7A 2XUDA 1J4AA 4AJHA 4G5SA 4XRGA 2C57A 3K3PA 3KYJB 5LUBA 2EFJA 4QD3A 1S2MA 3OSUA 1E7QA 1Y8AA 2D5IA 4JLSA 5DULA 3WYCA 4DFDA 3OZFA 4C43A 3CTMA 1Y42X 2F4NA 3IR6A 4QFBA 3T7JA 3PEYA 1ZD2P 3LPDA 1ID8A 1J2EA 3BL5A 3CW9A 4MWEA 4LYHA 4HV4A 3O4FA 4OXRA 5KBYA 3U4QB 1ZJ4A 3KQSA 2N0SA 2RAVA 5D84A 4BCBA 2RJNA 3ZKWA 3JYPA 2WMNB 2OO7A 1P7CA 3PEVA 5IG2A 1FTYA 2DRIA 4P08A 3PCXA 1JPNA 2R85A 3U61B 3OU2A 4A03A 1UFKA 2EV9A 3S7TA 1G8YA 3K15A 2J0VA 3WV5A 1G2QA 5B1HA 4ENTA 3ODPA 3GUVA 4RIHA 1KIMA 2R8PA 3AFMA 3MINA 5AKLA 4GKJB 4PR0A 2QRJA 3O8QB 4ILKA 1GR1A 5GTDA 3U3MA 3VC7A 5G1PA 3GPDG 4HNAA 4EG6A 3DO5A 2D00A 4DTCA 4OAPA 1TJ3A 1UOQA 4PSAA 3NCHA 5IAAA 5JD5A 5B4UA 2NVUA 1IDOA 2P7IA 2NU6A 4Z4HA 3DWGA 5A0TA 1SCJA 3EA4A 4K9PA 3PD0A 5HJ5A 1G8AA 4YHBA 5AKZA 2QG6A 3L7MA 1RWVA 4QXRA 5DT2A 1FLNA 1J0DA 3SE0A 1UC5B 1WRBA 1YI8A 4G5RA 1U1EA 1P4SA 1O7JA 2AD5A 3C97A 4DPLA 1NJSA 2VAVA 1R66A 4ZCRA 4LF8B 1ISGA 4PZEA 1J99A 4NONA 1N2OA 4DPMA 3EXHA 5EWJB 5FPPA 7YASA 3R3UA 2WA1A 1YBAA 3MTDA 4EAAA 5LQNA 2ZZKA 2JIPA 2W6PA 3CX4A 3ELYA 4MUIA 2I34A 3DW1X 4QJ5A 5JVDB 621PA 1SELA 3HCRA 4XJTA 4Y2XA 1X7ZA 2HXYA 2ZXEA 5F7JA 3VR5D 3KT3A 2FWBA 1KOJA 1U0NA 2JB9A 2ZRAA 3OKCA 3TQFA 2I8LA 2CHUA 5C8YB 2VOEA 5HSGA 2K87A 3PWTA 3ID6C 3EWIA 3N7UA 2LNDA 1NJ2A 1MB9A 2OCGA 3AM5A 4OXKA 2WUGA 3B2NA 3G82C 5KOYA 2QN2A 2OZPA 3DCIA 1X74A 2ODNA 4G0OA 1V0JA 3QX8A 4ND2A 1X1TA 2QTVA 1SKMA 1GLNA 3GUZA 3H4MA 1B26A 3W5AA 1HTBA 4PG4A 1CY7A 1DTWA 1V43A 2EBWA 2BEWA 3BKXA 3DE5X 1ODTC 3IVCA 3NKVA 4QDTA 8OHMA 5CX1B 3HXOA 1J2YA 1C1XB 1UT5A 5CYOA 1XWWA 4Q4AA 4OX9B 4M0CA 4KAFA 2A86A 2PX8A 4H3SA 2CL6X 1FYEA 4RFSB 4ZAZA 2ZITA 3H83A 4JBWA 5EMHA 2YJTD 1MO3A 4IDOA 2J0QA 2ECPA 3DFFA 4IV8A 1HZZA 1OAAA 3W5HA 3WYBA 5FOVA 3B82A 1O6ZA 2ZTHA 3DC7A 3NC4A 3PF9A 3QUSA 4FYXA 4RUKA 4U7WA 4ZO9A 1B8VA 3OPYI 5IPFA 1P1FA 1TVMA 5BSTA 2KJQA 3H5LA 4QOHA 4OJYA 2QL9A 3L1KA 2WWWA 4KRYA 1XIVA 4MYHA 5FPSA 4C0SA 5I8WA 2ZAIA 2XCSB 1ORIA 2B35A 2FW1A 2WUEA 5IT4A 3LP5A 4OLBA 1O8CA 1VHTA 1AZTA 1TQ4A 1P4AA 3GFQA 2BIFA 2VDQB 1X94A 1Z0FA 1F2VA 3QTTA 2PMDA 2VZ8A 3HO1A 1NHGA 4I50B 2P75A 2OB1A 1TAGA 2HMUA 4NFLA 4B74A 2FN7A 4K3VA 4DNPA 2QP4A 2XWPA 3B9RA 1YVDA 4M60A 1X87A 5KNBA 2E4YA 2ZIXB 1DAOA 3E18A 3II6X 2HUNA 4NMWA 4XX0B 5IABA 4BVEA 5TT0A 3P9QA 1IVYA 4EFDA 1X7HA 2X7JA 3AF1A 3IVMA 2JZNA 421PA 3QJGA 5KC9A 4XIGS 2FEWB 1W85B 1I33A 4AUKA 1ULBA 3G2LA 3BN3A 4LSWA 2IGBA 2YWBA 1CR1A 3TZ6A 3WR5A 2PBFA 3O8OA 5LA6B 3GLSA 3AKCA 3R44A 4NCAA 1NJ1A 2RC6A 1Q17A 3CPJB 4ON9A 2L19A 1N6HA 5JXJA 3L8EA 1F4PA 3LT5A 5G3ZA 2WAYA 1E2FA 5HE9A 2Y2UA 1XJCA 4D3DA 3O1JC 4NULA 1N3BA 2DU8A 3TTVA 3WIVA 1ISPA 2JANA 3ZXUB 3ZJVA 2WB2A 5AJTA 5A5VA 2G67A 2QT1A 3KL2A 4JB0A 4OB8A 9GPBA 3QUCA 2V03A 3AR2A 1DFHA 5HX7A 2WNIA 3DTVA 5E4YA 1ZKMA 2XA1A 5B1EA 1TVEA 5A5FA 3BA1A 4CMKA 2J4CA 3V97A 1NLFA 1GPDG 1EGHA 4J16C 1JR3A 2JJ2A 4QUBA 3TNYA 2B4KA 4QHYA 4V38A 1U0LA 2AS0A 3ZDFA 5K0ZA 2GX6A 5B58T 3ZH9B 5KUTA 1UFQA 1KEVA 1JQJC 1KDVA 3RUEA 4XPZA 1IEVA 1NNEA 5BQPA 4ZVMA 1JMVA 3B3AA 4ILEA 4UEQA 1H1TA 3WQRA 5AQEA 3GCWA 2Y8EA 1KIFA 1LJLA 4IX9A 2R4QA 5DK6A 2WV7A 5KQRA 1XZDA 2G4VA 2AMYA 2H4HA 3OZAA 5JO0A 4IDBA 1EUDB 3BWVA 3QVJA 2RGEA 2VWHA 3NT4A 4QSMA 3C3DA 3A6HA 3EGXA 1TUBB 2HNKA 3IODA 3W6NA 3BMXA 5KSYA 3KFLA 1R1DA 2F62A 3AZPA 1GUAA 2QUAA 3KTFA 1NT2A 4FWBA 4HGYA 4L0QA 5G0UA 1JMKC 4RKWA 1NI4B 4NP6A 1IY8A 4ETIA 3R41A 1DJMA 4BMPB 1QGOA 3DBRA 4Q3DA 4ECAA 3B6MA 4V2UA 3IVAA 4X7MA 4BIMA 5KTKA 3VVBA 3IBYA 1E1CA 1S5PA 4FGZA 3T7SA 2DUNA 1FTWA 3EGDA 2H57A 2ZI4A 3GLIB 1YQXA 4ZHQA 4ZU6X 2YS7A 1QHEA 5JNRA 1XRJA 5LP1A 1GR0A 4O5OA 1SBTA 2NNLD 3ZGOA 1S2NA 5E95A 2QVXX 2C3MA 2H7CA 5A9TA 4ZK6A 4DREA 3QFRA 1MRZA 1PDWA 3GQBB 5K6AC 4MGKR 1PT8A 1R0WA 1V6SA 4JL8A 2VDLB 2XXBA 2BFAA 4Z7OB 5FBLB 2NZVG 1OLSA 3DOJA 3WLPA 2D54A 4HQRA 5F5NA 5CJ2A 1SXJE 4DR7B 4EPWA 5BWCA 3I73A 4LC9A 1KKUA 3Q3IA 3CH5A 1GGKA 4RPJA 4BEJA 1EFLA 4ND4A 1ZK2A 2W2LA 3H4IA 4UVGA 1H0RA 2EQAA 2Y1GA 3SM3A 2QNIA 4YR9A 1SXPA 3ER8A 4XVHA 1MFPA 2DBVO 2I4LA 3MCZA 4KC0A 1HFJA 4HQOA 4PCVA 4YDRA 4H35A 5AD1A 4YRGA 2WE8A 1QKKA 3K1ZA 2RGWA 3DFIA 4ENWA 3GUCA 3TRKA 4LZOA 1NR7A 4AUNA 5JZOA 3FVTA 2HK7A 1CIJA 1KGSA 2B34A 5CHEA 5MFPA 2B3TA 2FZLA 3EXIA 3U9TA 5A1JA 4TMTA 5LPNA 1Y6JA 1P2TA 1KPGA 3TB6A 5EOVA 5EHZA 3DOCA 5CB0A 1ZQ9A 3NH6A 3ZWNA 3PEFA 1T9CA 4BVFA 5CLJA 1MFZA 2QLBA 2HTEA 3LFHA 4KAXA 4YAEA 4BVKA 2JJQA 2KWIA 3LAWA 2AJLI 2FA9A 4OJMX 2J45A 3KQHA 7REQA 3OM9A 3AJEA 5C51B 4PG5A 3OIWA 1CJTC 1RWPA 1XDSA 5IC6A 1LBEA 1IYZA 3PNKA 1IBSA 4OLJA 3UQZA 2B36A 1W5EA 4R8KA 2ZT6A 4OI1A 5HQTA 3WIEA 3R7SA 4MWDA 5JNSA 2Z5VA 1TCCA 3QVTA 3UCEA 3VX3A 1AO0A 2DSTA 1GN9A 5J5VA 1ZGHA 3BDAA 3V3KA 4BO1A 4ZYLA 3ZY2A 5D5PA 1I6WA 2JS7A 1FYVA 3VJLA 4A15A 1P44A 3P2IA 2FPIB 3FIJA 3CG4A 2VJYA 2YOFA 1JXAA 3D6UA 4P22A 2WJPA 3L0PA 3AQIA 1QS0A 4MYTA 4DQXA 2X2FA 1ODJA 2NOAA 2VATA 2XGMA 3VOSA 1U7TA 1DL5A 1JIXA 1NSTA 1ID1A 1C0LA 1HT0A 1XLWA 3FJOA 2PH5A 1M83A 3HZOA 3JATB 4NU0A 2ZETA 4QJIA 1I1NA 4ZZ0A 3NO4A 3PX3A 4XTCS 2X9LA 1T3SA 3ORSA 3F4BA 1X39A 4MLZA 3E2MA 3AI1A 3L6DA 4J7CA 4UE3S 5ERGB 4IW3B 4Q6WA 4YWHA 1OAOA 2QTBA 3NHLA 1L6RA 1B8OA 5KMGB 2JAUA 1T2UA 4YJ2B 2OBYA 4C30A 3U3ZA 5C53B 1UH5A 1Y1SA 5IASA 5K3OA 5CLHA 2O8CB 1ZJWA 3ZR4B 4CT5A 4KYTA 3PC8A 3QLVA 5F3DA 3L8GA 3U4MA 2YINC 2YIJA 2NSJA 3W5IA 3GPCA 3PK0A 4PYLA 4D9FA 4UEKA 2RC5A 1WOMA 5KJ6A 1NN5A 2XE6A 1YFJA 3MLAA 4EGCB 3KPVA 3VR6A 1EJ6A 3O03A 4QOJA 3EA5A 2Z4RA 4MUHA 2ABWA 5MHTA 2WYWA 5TEWA 3LUHA 3AV0B 1MP0A 1PNVA 1OLUB 1NZDA 2J5XA 2QRVB 2YHIA 1BJTA 4MULA 4FYVA 4PG7A 4BGIA 1K8RA 4L57A 4ENQA 5IVKA 2A0KA 4IR7A 3W8EA 1F6BA 1X86B 1RE0A 2Z9BA 2QLLA 1ZNWA 2WVHA 4RZHA 4EPTA 2DKFA 5CT4A 2Q0HA 1XNGA 5CT6A 2IGTA 3G6WA 3F3MA 1GUYA 1NKTA 1KARA 3OPQA 5HG0A 3EEYA 4WGFA 1IH8A 1SUWA 3DZCA 1OWMA 3HEMA 2INGX 1SU6A 2WSLA 3OBIA 4DR2B 2XY4A 3NWBA 2B0CA 2PR2A 3R2JA 5G3YA 1WZEA 1KOLA 3JCZA 1P5RA 4DV2B 3GC6A 1VGRA 5CH3A 4BEVA 1W0KD 5E8RA 2CC2A 5BYKA 1QHNA 5CB6A 2RJOA 4PVDA 3Q3JB 3UW3A 1Y5MA 3ZJYA 4JI6B 1Y33E 4R1SA 3QVGB 5BN5B 3ND7A 3UV3A 4BGEA 2GF0A 2XQFA 5AHWA 3SHOA 4Q1VA 5DGCA 3WRVA 3ZOZA 3N0TA 4A8JC 3M0EA 2FH5B 4N01A 5CXXA 3CVWA 2P77A 2V65A 3P9CA 1AURA 2TRSB 1X7YA 1XT6A 3GDHA 4DNQA 1Z0ZA 4LHSA 1XF1A 1U02A 5ECYA 4EB3A 4F7DA 1A4UA 1D3AA 4QNRA 4D0NA 3NZEA 1S4MA 3SIWA 3USES 2R25B 3OWHA 4H6PA 4CXMA 4Y6GB 3M4XA 4OBBA 3JZFA 2CY0A 2WD8A 4RDIA 4WVLA 4OHPA 1G55A 1DX6A 2C94A 3R3SA 3Q2OA 1RFLA 2GUWA 1HNZB 3D8UA 3F3YA 1CQIA 3OF2A 4KI7A 4BVLA 1N7IA 1BD3A 4JJ7A 5GZ1A 3T1YB 4CM9A 2Q41A 3UKOA 4O4IB 3NIWA 5GVRA 2IXAA 2HIHA 3HVRA 2IEYA 3TW6A 3DUFA 4CGZA 4RPLA 1PS8A 1L5FA 2F00A 2B2NA 1ONPA 1QVAA 1G0NA 1KI6B 5KYNA 4UCFA 2AWNA 4CEJB 4LDRA 1W9MA 1MX3A 4BJ1A 4P54A 3THXB 1GGHA 5FQOA 1YOVA 5LU8A 1Y7IA 3OQIB 2YC2C 2FW8A 4C3VA 5GOTA 3BCRA 3UK6A 3ZHOA 1JJ7A 4WRRA 4EO7A 4R41A 4YRIA 3KDPA 1G7TA 4BQOA 1JDSA 3A1EA 1T29A 2QRZA 3UT5A 2ZZNA 1LW6E 5J2UB 1AK2A 2MWMA 3GCZA 3UGKA 4BVJA 4FYWA 2FSIA 1CNFA 3IESA 3NDBB 3I01A 3U31A 2D4HA 5LOVA 2BSQA 1RMQA 5G02A 1YR6A 2VJMA 2PN1A 1JNYA 1Z7BA 2FVXA 3IT3A 2WVAA 2Z8YM 1JH8A 4RENA 3U3DA 2O20A 3UPUA 5B53A 1A9YA 2VDUE 6GPBA 3A1CA 4RJJA 2GBCA 1SA0A 3QQ5A 4BFXA 2Q49A 2A0WA 5D6OA 3HADA 4CQMB 4L76A 3RVRA 3OWXA 3CNNA 4XYLA 5THQA 1E1LA 3ZV5A 2ZRIA 2JJ1A 2P30A 4PAQA 4AUMA 1RMTA 4D3FA 3D8NA 1PR4A 1V16A 1JHXA 3IBTA 1WDKA 1PSDA 1GKIA 1MAVA 2G09A 1XCJA 3HFGA 4YQYA 1BOFA 2D59A 4YV1A 2JLXA 2FPKA 1XTPA 3BS4A 5I51A 3E1KA 4PZ9A 1WXGA 2GPBA 3BCSA 3I83A 5HF8A 4P98A 5AM1A 3MJFA 1UC8A 5MF6A 2WJGA 4DAOA 2Q8NA 3O75A 4K9RA 4B87A 1TM4E 5FWNA 2Z2YA 4P4SB 1T9GS 2IP2A 4XVCA 2AKEA 4IIDA 4DR3B 2O2ZA 4LKOA 4CHGA 4L3VA 4ZQCB 4EHFA 1B76A 1DKOA 4MUYA 2Q99A 4H0NA 2ZUSA 3AV3A 1ULTA 3GT7A 4LDPA 1N77A 1DBWA 1F60A 1YO6A 2XE4A 4CLOB 5KNBH 2W6OA 4ZO8A 5DGXA 1BTOA 3IGFA 3X1MA 1LRJA 1MUUA 1OBHA 3DE2X 3G2MA 2OCIA 2PMFA 4LRQA 5EE3A 4NHEA 4A0GA 4CF5A 4B3RB 1P2DA 1NZJA 4P31A 1G5IA 1E96A 5JH7B 2AYYA 4WXRA 3VX4A 4MV6A 4ZV9A 2YQ5A 1KP3A 2ZT5A 4IMPA 4UPEA 2C58A 3CFYA 4PN7A 1TZMA 3LTNC 4INAA 3WYGA 1KJNA 3TBHA 1UXHA 4MEBA 2G82A 4G8JA 4J49A 5EJ8A 3G5LA 2ODBA 4IKEA 2Y1DA 5F3RA 3CRW1 1QIFA 2NQTA 2NXWA 3QMVA 1SQSA 1XTJA 1XPOA 1YB1A 1C9MA 1KXJA 2PRZA 2VF8A 1BKYA 2YDXA 4KQ6A 4LZWA 4EGJA 1QCDA 2FPOA 5DSXA 1ORDA 2XCOA 1PS9A 3KVOA 4HGPA 3SDSA 2IOYA 1RS0A 1NW3A 3HLTA 3QG5A 4GOOD 4J0GA 4RKFA 2JLSA 1KI4A 4HTFB 3TR6A 4IIYA 3ZCSA 5J3JA 1YAJA 2AV6A 4BGVA 4DRXA 1H2AS 4C0AC 1RYMA 2XT6A 2GBFA 2BN4A 3BEDA 5E6UB 2X0EA 1EIWA 2IRWA 4Y0AA 1WB4A 4AYXA 1BH6A 4F4CA 1IN8A 1W73A 2G9ZA 2XWJI 3LRTA 4ZCMA 5CFZA 2KQUA 3ACDA 5M34A 3WIBA 4KNVA 1J22A 4N3NA 1X7XB 3AM1A 5KOJB 2NT4A 3V8EA 2C8JA 2NSLA 5DBHX 4TKUA 4JCCA 1FBTA 4CV0A 3KWMA 4RVGA 4YRAA 1IXZA 2CKMA 4MUMA 3I6YA 1BGXT 3IEVA 4XZ3A 1SPBS 3Q85A 1ZGCA 3DR5A 3TXYA 4AURA 4K28A 3BBPA 4KLRA 3TCNA 4CIBA 4AP5A 1JDBB 1N5DA 3F8SA 4GBMA 1ZNQO 1ZNZA 2W6MA 4IEFB 1MO2A 2B9EA 1C1YA 1EXWA 2R1TA 3OIVA 2AXPA 4PZZA 3VKWA 1W5TA 1ISMA 4HYYA 1KJ8A 1IK6A 3G2KA 1I4EB 3ENNA 4LQLA 1Q1EA 4JJZA 3V2HA 2NXJA 5BNFA 2Z2ZA 2C8LA 4PTZA 3VDMA 1VL0A 3ZZTA 1HMYA 4AROA 4MHTA 3RS8A 3D6JA 4PGMA 4ZTZB 3OEHA 3WNCA 2PT9A 4DADA 1QFYA 1EP3B 3S2YA 3THYA 3FGPA 2FRDA 5K0LA 2VSFA 1RXCA 3WA6A 1M2VB 1GAWA 1XA4A 2IEZA 3DLPX 4JI3B 4BZZA 1JUDA 3MUNA 4S1TA 1GY8A 4ESEA 1V9CA 1Y8RB 3IQFA 1RXSA 4HRXA 4RL6A 5BW5A 3U13A 5K8CA 1JR2A 3HCFA 3DXYA 2JLYA 1X7WB 4IZ6A 2C3UA 1Z29A 5FL3A 2IYSA 3VU0A 3Q7EA 5COQA 2DZDA 1NW8A 1O95D 6Q21A 2IXTA 2O8FB 2Q5LA 1CUJA 3VZBA 3WWYA 4A8PA 3E5NA 1SWWA 2XZOA 3IAFA 2HMTA 2ZI7A 3UJHA 4TTTS 2H7XA 5P8WA 4MR7A 3JWPA 1R8SA 2X5JO 4U2EA 5IAOA 2EEZA 3TDKA 2IS2A 2AR9A 3L8ZA 4AF8A 1O6BA 2G0NA 3PTZA 4P0QB 4HDOB 5IBPA 1CV2A 4I5FA 2COEA 1AS0A 3ILVA 5ALFA 1N36B 1VPVA 4AK9A 1U8TA 1LDBA 4I1YA 5SZIA 5BN4A 4DLSA 5KVSA 2H1IA 4CEIB 2BFFB 3I6BA 2OWEA 3GDWA 3HFRA 2E48A 4FN5A 4B17A 4R1UA 1ZVQA 2Z4SA 4OQYA 2XI4A 4FFSA 1Y3CE 1Z6GA 3GH1A 3DEIA 5I7VA 2B69A 3G02A 4GPTA 4CFSA 2MOKA 3EFBA 3QVLA 3NAZA 5BNTA 2A5DA 2OK7A 5EA2A 3NBMA 4FJ2A 2H2AA 3ZWOA 3NX4A 4E03A 4QBGB 1J9ZA 3T3EA 2VBFA 3NASA 4Z8YA 4PLCA 3HU5A 4MICA 3STHA 5JFOA 4FYYA 1BCRB 2AOUA 3IB3A 3PHIA 3ESBA 3PJEA 3WK7A 1RYHA 3LP6A 4RZUA 5BY2A 1Z63A 3RIGA 2VP4A 2H4FA 2XTJA 4LZZA 1YZLA 2VUHB 3BGWA 4TLDA 2EF0A 9MHTA 2BR3A 4LXYA 3ZE6A 5GPBA 3OAAD 4FSXA 4X20B 1GUZA 3MZ0A 1QMPA 1ZMXA 2PTGA 3QVMA 2P0YA 4K5QA 4KMOA 5T7BA 1SCQA 1LX7A 3VKFA 2R7AA 4MW4A 4LRTB 2KBFA 2RCYA 2WILA 3EIWA 4GPEA 1XHFA 4JP5A 3H97A 4F4UA 1YAHA 5JQWA 4EAQA 1C50A 3C7AA 3UMSA 3GFOA 1TQ2A 4EG1A 4UAVA 5J4YA 4MPJA 4Z4IA 2OHOA 1P8AA 3UJBA 4XIYA 1PGPA 1ZHHA 4EHNA 5KZMB 5IUJC 2BH9A 1A82A 3A10A 4K9KA 2VSQA 4S1OA 4JODA 4DJAA 2RBEA 3WHPA 1UODA 1U1GA 4CQMD 3WSTA 3LIPA 1YTLA 3MRSA 1CS0A 2QSJA 3IIJA 5HZGA 2XTZA 5F33A 4H0FA 2B82A 3M6AA 1OGIA 2PLAA 4Y7CA 3TW8A 2JW5A 1K75A 4DA6A 1X80A 1D6MA 5K2OA 5IDWA 1WVIA 3C8HA 4WBNB 4BNUA 1HSZA 1P4HA 3ZV7A 4F9GA 1A8SA 2GILA 3AL3A 5LP6C 1J8DA 2FFBA 2WTMA 4XASA 1VMKA 4I4LA 3V00A 5JZMA 3RH0A 3ZE7A 2ZRPA 3GIDA 1XNQB 4Z4CA 5C3MA 4JLAA 2RSLA 2XRMA 2QVGA 3A06A 2Z1MA 5EUMA 1MJFA 1XDGA 3O2JA 4M8IA 4MUAA 2G04A 3EC7A 1FUYB 2X7XA 5TF0A 4EO4A 2Y77A 3FTFA 4WAUA 2YRFA 3A9WA 3L6RA 3W79A 5EJIA 1LBIA 1ISFA 3BDVA 4L1KA 5BNIA 3DDWA 3KYBA 4I81A 2R84A 3ZLTA 4H1WA 1A98A 1W2HA 2YJ3A 1BA3A 1F14A 4CBVA 4D9BA 1QB7A 2P5YA 4PGAA 4F8YA 4Q37A 3IQXA 1LJ8A 1JDPA 1O6GA 2CMFA 3ONVA 1HYHA 2K6GA 3ONWA 1T5SA 2PGNA 3PICA 1RZUA 4HXYA 2F17A 3BWBA 4OO3A 1JDVA 3PSHA 4OUDB 4P3KA 1LVHA 2QN3A 3CUSA 3G2QA 3IH5A 4NBVA 3UJPA 3GWGA 4RE6A 2CZGA 4G1MB 5TE9A 5JU6A 4DDWA 1B4DA 3U1TA 4HNTA 3JAWB 4QWMA 1ECJA 3HCOA 4IWXA 3WSWA 4H1VA 4P33A 1E3EA 1JHRA 3AMVA 3CR3C 3TSOA 5KTOA 4N65A 2OXCA 3AHHA 1MJHA 4FSHA 4LOAA 5JLJA 4JWTA 4XYGA 4JIMA 3SZUA 3A1DA 3MHPA 1QFXA 3T7KA 1HQKA 4LW8A 4BCDA 2BYTA 1FZQA 2YWDA 2FOLA 4RKQA 4DXAA 3W77A 4HH4A 1DBPA 2WWGA 4WVFA 2A14A 3MAJA 1J25A 3M1LA 3MT9A 4ZAFA 4YJ3B 3TW0A 1I0IA 1TW2A 3GG9A 3G5TA 3JR3A 3QEOA 4LN1A 3ZCQA 4FJ0A 3T7RA 4P2BA 1Y4DE 1A2BA 2REOA 1QK5A 2BFCB 4Q16A 4EI7A 4V1CA 3SBXA 2OYSA 3OA0A 4F4FA 4DF3A 1P77A 4JU9A 2I80A 2ZPAA 3RKRA 4AQDA 2QRNA 2W37A 1ABBA 3K1AB 2NU8A 3C3CA 4WOCA 4FB4A 3B5IA 1RWOA 3WKAA 3CYFA 3MT7A 2J48A 1ZWLA 4ER6A 1UMCA 4DWWA 1P80A 3KJEA 1QG6A 2MDTA 2BZSA 4AZSA 4H16A 3CJTA 1QIHA 4TV9B 1N92A 3NP9A 2DPLA 1L5OA 4PSKA 3UJCA 4M8SA 2FEMA 5JAIA 4GLJA 1OXBB 2IL1A 2VCYA 4EPVA 2Q1UA 1ETUA 2I3ZA 3H18A 4BKQA 1THMA 2GYUA 2O07A 2O2GA 3K1JA 4DLUA 4ZJPA 3KEFA 5JS7A 2PWYA 1SVKA 3DCJA 2F43A 3C5CA 4I6GA 1SZJG 3MMPA 4V2IA 3UMVA 2R6R1 4HNRA 3WE7A 4C88A 4PNEA 4HGZA 1TM3E 4XQCA 2Q6IA 5EQTA 3JY6A 1U65A 1A9ZA 2VYNA 3IUJA 2OYCA 2GWHA