4HLDA

Sulfonylpiperidines as novel, antibacterial inhibitors of gram-positive thymidylate kinase (tmk): compound 11
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
203
structure length
196
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Sulfonylpiperidines as novel, antibacterial inhibitors of Gram-positive thymidylate kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 83
structure length 196
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hldA00
2UZ3A 4JVMA 1RRGA 1N6KA 2GVDC 3HPRA 3MGCA 5H68A 4HAVA 1W36C 3MLEA 5FUYA 2J0SA 1SHKA 2Q21A 3TUIC 3X1WA 4B3BA 4JSTA 1KY3A 1N5JA 1Z06A 1VCMA 3SBDA 1XTSA 3I8SA 1US8A 4M21A 4ZCLA 4TWZA 4E09A 2O8FB 3QKRB 3DVLA 3I4LA 3KKPA 2O8BB 1KNQA 1W0KD 2A5YB 4Q02A 3IBGA 4TSFD 1IONA 2XOKA 3QENA 4DIEA 2QM7A 3UKDA 3QIAA 4RFSB 4B3GA 2WOJA 1Z83A 4Q7MB 4OHVA 5FBLB 1JR3A 4MA4A 4DEYA 1R5OA 4V0OA 5GJCA 3PEWA 1J90A 1M74A 3RANA 2D06A 2V55B 4MRPA 3PUYA 3AKCA 3SDZA 3UIEA 3TW4A 1JJVA 2NGRA 4KFRA 1NY5A 4WXPA 4O2RA 3SU8A 5TXGA 4AURA 1OPXA 4E22A 4LV5B 2O8DB 4I1OA 4WZ6A 4DB2A 3QF4B 1ZNXA 3DHWC 1NVXQ 3K70D 4HAWA 3DZ8A 3AGQA 1FNNA 2QT0A 3NC1C 2P65A 2WPDD 1DO0A 2PH1A 3CH4B 4X8OA 3FPAA 4PC6A 4CIDA 1CP2A 4K81B 4LJ7A 1YZNA 5IHPA 2B92A 5JWOA 5HCNA 3EPLA 3BH0A 5D3MA 1E9DA 1ZC3A 2NPIA 2ZI5A 3ADBA 2X19A 1Q20A 4MDFA 3AGPA 4L9SA 1AJEA 2W6JA 4W5WA 5SZIA 2IYVA 3RDPA 3PVSA 1Z6YA 5DGXA 2BWJA 1TEXA 1W0JA 1I4DD 2B7BA 4JBWA 5LD2B 4JLMA 5JMTA 1ODFA 4Q4LA 3L82B 4DUGD 3ZH9B 4PAOA 5AJZA 4OYHA 3FOZA 2HJVA 3EG5A 4Q03A 5FOUA 1AA9A 4PHFA 1HA3A 2ZTSA 4B6EA 3BBPA 3EIQA 3KQNA 3IO3A 4QOSA 1D5CA 4YXWA 2XXAB 2H8KA 1CJVC 1R0XA 3FKSD 1SVMA 1SVLA 5EUMA 1SGWA 5G53C 3LQQA 4IRUB 2VRWA 4BLTA 3EC1A 3C5CA 3SS8A 3ICEA 4M4SA 2Z0MA 1G20E 2BEKA 4ZDIA 1ESNA 4HB3A 4HAUA 4C0AC 4AKGA 3Q8XB 1PLKA 2YYZA 3QE0A 4MQBA 5HCIA 3K9NA 3OZXA 2J45A 1GL6A 3QY0A 3RYTC 2VP6A 4YLGA 2GHIA 4CW7A 1P75A 4DLXA 4C7OB 1T5IA 1Q3HA 2WOOA 3KL4A 4CT4B 3OFNA 3SQWA 5FPTA 4YMVA 1XEXB 1EFHA 3QVVA 1TF7A 5DHAA 1ESMA 1KO1A 2JJ2A 4B2IA 2YC4C 3EC2A 4B6FA 2BM0A 4OHZA 2CHGA 3UMFA 2R6GA 2R65A 4DSUA 2EFDB 1CRQA 1ZM3A 3GLFA 1BO6A 2FFAA 1PV4A 3ZLJA 5BQ5A 5DLQC 1MT0A 1TNDA 3AUYA 1NBME 2GZDA 4ERNA 4QJ4A 2JEOA 2UKDA 2OCPA 1MO5A 4G5GA 2QA5A 2X77A 3DL0A 4UNNA 5EE0A 2QBYA 1J7KA 2BMDA 1OYYA 2QMUA 4IOKA 3I61A 1UBGA 4MYCA 4NDZA 3GPLA 1XPOA 1KO5A 2GVZC 1MR3F 1HV8A 4TLAA 3MAAC 3BORA 1XD8A 3DZDA 4Q4HA 2W00A 4PSKA 2N1BA 1FZQA 4JS0A 4Z1MA 4B3CA 1NN3A 4TQ9A 1R0WA 2J87A 1CULC 2BEJA 2IYLD 4AIIA 4PPQA 1XTIA 2ZREA 1AGPA 2C77A 4RD1A 2YJTD 1E2PA 4UKDA 4PO1A 1RC8A 3AVXA 1M34E 2GJSA 1VDZA 5AUPB 3DM5A 3NH9A 4YMWA 2CBZA 4D0GA 4DCVA 4C2UA 1GSIA 4NCJA 1FMJA 3T34A 2JLYA 2GCPA 4CEJB 2AKYA 1VCOA 1YKSA 4TTRA 4EIWA 2PJZA 4KLZA 5FBRB 5HKKA 3B82A 4LBZA 3AH8A 4B76A 3I5YA 4MH0R 4XVUA 2MMCA 2ZR0A 1AN0A 4URVR 1G17A 3P26A 3UMSA 1DAFA 3B85A 1LW7A 1OH5A 2J7PA 1MRNA 1W47A 3CPHA 4WZAE 3VMFA 1J8MF 2JIZD 1G9XA 1OT3A 1CJMA 3K1JA 3TLXA 2OM2A 3CX6A 1TAGA 4R2IA 4C4PA 4TQAA 1RIFA 5L3SB 5CM9C 2ZE5A 2ZSFA 3KQUA 1RPZA 2CVHA 3VR5A 4JLVA 3OEED 4KXFB 2IK8A 2V6IA 3TMKA 2P67A 3GLIE 1XTRA 5FPKA 1SXJE 1I4TD 3DO6A 3VKGA 2GK6A 4C0KA 3GD7A 1EG7A 1XD2B 2FPMA 1SXJD 2FSGA 1AK2A 2BBWA 2IHYA 1N0VC 1BS1A 4OJKA 2IXEA 5SZHB 3RWMB 2OBNA 3DMNA 5GVRA 1HT2E 4RKEA 4WA7A 3LY5A 4TMTA 3GEHA 2PCJA 2F9LA 4Z8YA 5TY0A 1D9XA 5AJYA 3A6PC 3B60A 1HY3A 3Q5DA 3GFOA 3U6KA 5GJBA 2RGNC 5KSYA 4PQYA 1N6NA 2ODNA 4BEBA 3VTKA 2NZ8A 4NYIR 1G41A 4AWXA 4Q9HA 3GEEA 3NBZC 5H1YA 4FMDF 5DHFA 2QROA 4V03A 1JQJC 3KQLA 2OILA 4Q01A 3RNLA 3T35A 1ELOA 4B71A 3L43A 5C46F 2ZE6A 2QN6A 2J9RA 1KI2A 4JJKA 2HJGA 2JATA 2O8FA 3CWZA 5KO2A 3AVTA 3QKRA 2CL0X 3T12A 1ZIOA 1ZIPA 1ZD9A 3E1SA 3QQ5A 3QVUA 5JFGA 1KI9A 2YZ2A 4Q19A 5HTKA 2XGJA 2Z5FA 2ZYVX 5B57C 3FE2A 2O0JA 3PEUA 4G5OA 4RFSA 4NZYA 2D7CA 1Y63A 3F8TA 2HCJB 1IN7A 2KBFA 4KBGA 1E1QD 1DVRA 1N6PA 2XX3A 4AKIA 5JI3E 2RGGA 2ZSAA 1TADA 2HT6A 3DOFA 4R71A 1XNJA 2K5UA 1JQLB 5DSZA 1EWRA 3Q3JB 2JDID 1S1MA 1FQJA 2O8DA 3LO5A 4FXPA 4QBHA 3H4MA 3QF4A 3R9XA 3BC1A 1XCPA 4BRUA 1E79D 2OXRA 2EFHB 4XSGA 1E69A 1G3MA 4AKEA 4GP6A 1X6VA 3H1TA 2FEOA 3LLMA 4YMTA 4URWR 1EX7A 2OEPA 2Q3HA 2C95A 1XMVA 2R2AA 1IHUA 2WICA 2QRZA 3GJ8A 4HI0E 5FUWA 3SE0A 3VHLB 2FFHA 1E99A 3OE7D 4DDUA 3L8YA 4C0BA 4XSHA 1O3YA 5KOYA 2GEUA 4NCKA 1OFTA 5KSOA 1KMQA 2I1VB 4KHZA 5FBVB 2ZIAA 1GZSA 3B2EA 4HLDA 1PZNA 4D82A 5EE1A 2KB0A 4D26A 2IXFA 1KMHB 5FR1A 4TL6A 1G3UA 4QKQA 5F2EA 2FMXA 3UWOA 4PSVA 5FL7A 4JLJA 4NYIQ 4X8MA 1CJKC 2LKCA 3O8DA 2RCNA 1ZP6A 4PZYA 2GCNA 3QXJA 5JWHA 2O0HA 1ZC4A 4DVGA 1EESA 1ZD8A 3SJZA 3CPJB 2ZI9A 4Q18A 3ZVLA 1J2JA 2R6CA 1E6CA 2XXAA 4L16A 2WV9A 1SKYE 1NNEA 4K46A 1ZCBA 1XWIA 3EZ6A 4CDGA 1CEEA 2P3SA 5DH9A 3GLHE 4TL9A 4DT1B 1U0LA 4TMXA 3SYLA 4B3XA 2FX3A 2H18A 2GWHA 3I72A 1NVWQ 3VFDA 2G9NA 2QM8A 2J0UB 4HB0A 2G1JA 3THXB 5CK4A 4C7OA 4B2LA 3EASA 2OFXA 1K6MA 4LOAA 4TT3A 4OQNA 1WXQA 2ONKA 1UBFA 3Q85A 4AC9A 1OYWA 5AK0A 2XTMA 5EXTA 3OAAD 2L0XA 4HZIA 4I1UA 2LKDA 4BFUA 4HB2A 2DFTA 1OFHA 4QNMA 1CR4A 1E9SA 2CE7A 2V6JA 4RD6A 4JMPA 4B47A 1Z2AA 1NI3A 1IXSB 2WAYA 1QHXA 1ZUHA 1OFIA 2KJQA 1P73A 3IHWA 4Q4JB 1VCIA 5FTJA 1NLYA 2C04A 3UATA 3F0TA 1VIYA 4LUCA 2AX4A 4TLBA 2IL1A 4A15A 1GKYA 1Z8FA 1BMFD 1OB2A 3RWOA 1QHYA 2C03A 3AB3A 3EPKA 1E0AA 421PA 2W0SA 5TV2A 4IDNA 4QBFA 2VSFA 5F98A 3QG5A 4D81A 1HTWA 4POAA 3RSLA 3QPUA 4G5RA 1GWNA 1NIPA 3A1SA 2BBSA 4LC0A 4X8HA 4DLYA 2CE2X 1ZM7A 4V02A 3TQFA 4I1SA 4I81A 4YMSA 4Q47A 3RAPR 3FHCB 4ASUA 5KSZA 3D3QA 3FB4A 1IXZA 1NKSA 4EKDA 3QKUA 5D3MB 1R0ZA 2DHRA 4DLUA 3GLGE 2WTUA 4MYUA 3U44A 4YONB 2QI9C 2EFEB 2IX3A 1G8PA 1UF9A 3BB3A 4Q7LA 4BLQA 3EX7C 3JZAA 1DS6A 3MMPA 4ZKEA 5KPDA 3AQ4A 1CS4C 2WJVA 3MWLA 3HP1A 3C4JA 2QTFA 5DN6D 3I73A 4JZKA 1EWQA 2P5TB 4O3MA 4FMDB 4MKIA 3U5ZB 3TE6A 3AVOA 4XTCS 1Q21A 4GPTA 1UPTA 1GOTA 1R5NA 1U0HC 2IS1A 1AKEA 3WYAA 1SQ5A 3RS4A 5KNDA 2OE2A 4MGKR 1JAIA 2AWNA 2Z4SA 2W6IA 4X8LA 3T1QA 1W49A 2D74A 3AF4A 4U00A 2BOVA 4C0JA 2QG6A 3O8RA 4BECA 5L3SA 3HYRA 4KFUA 3RLFA 3AM1A 2OUKA 2PX0A 1KJYA 3WMFA 1F2TB 2MMGA 4JBXA 2BMEA 3VNUA 3EA5A 2X1VA 4D25A 1KZGB 4RD3A 2BVNA 1W0KA 4TSFA 4JT4A 3ZVNA 1Z08A 3GP8A 1NVVR 5LB2A 1D2EA 2KE5A 1G21E 5JHHB 4RCZA 3C15C 3W8RA 4QGAA 4OQXA 2V1XA 4YC7A 1P62B 3IILA 1FTNA 1WP9A 3CR7A 2FSFA 3BGWA 1GFIA 4MKHA 4KSCA 4Q9KA 2IS6A 1G8FA 2VP0A 1QHIA 3P4XA 4OI2A 4LV6A 5EJEA 2ZJYA 5DI3B 4JIMA 2CLDX 2GJ8A 4Q4AA 4ZCMA 1W7AA 4PHTA 4US2R 2ASEA 4OI0A 5CLQA 3GLFB 1T9HA 2ZJAA 2C2HA 2JLSA 4IXNA 4OI4A 4MKGA 1BYUA 5TB5A 2CHVA 2RHDA 3PG5A 1W44A 4WOPA 5M04A 4IDHA 4US0R 1W4AA 2C9YA 2VHCA 2WPDA 2QP4A 1ZJ6A 4I1VA 4IKEA 4M9SA 3MG9A 4OJQA 2VF8A 5FTNA 1ZUNB 3BB4A 4TQUS 3ZGXA 2QBYB 1E2QA 1ZM9A 3HR8A 1OXVA 2CDNA 1QRAA 1N5LA 2PT7A 1N6LA 3AF1A 1RFLA 1F60A 3O47A 5EP1A 4A2WA 1H8ED 1FUUA 3MSXA 1GRNA 4BFVA 4GZLA 2EW1A 1SVSA 4V0ME 5JJLA 4OHXA 4PQFA 5G3ZA 3NH6A 5J4YA 1JJ7A 4ILEA 4ZI2A 4DUGA 5KU1A 4Q4HB 2J5XA 4A36A 2RGAA 4OI1A 4B48A 3H84A 4QBGB 1KHTA 2G0TA 1N5IA 4NBSA 3CO5A 1RJ9B 3WHKA 1EFUA 2VP2A 4J0QA 2F43B 3VKWA 1ZYUA 2O0KA 1GAJA 1Q0UA 2WKRA 2RH5A 4IFEA 5B58C 4GZMA 3FKSA 1F3OA 2FGJA 3IEUA 3UANA 4A92A 1KKMA 4C0SA 1ANKA 2B7CA 1N25A 3SJBA 4ESHA 3MWJA 3N5CA 4M8NE 4URYR 1VG0B 4QHSA 4A9AA 3DEFA 2ZRBA 1EGAA 3MD0A 5CIQA 4MGZR 4UNRA 3QXXA 3GLHB 4NCIA 4BFTA 4DDWA 5CB6A 3BE4A 2A2ZA 2F6RA 4QNRA 1VG9B 5EE9A 4C0QC 1WE2A 3SBEA 1JNYA 1H8HD 2JLWA 1AZTA 2A7QA 1FNMA 1AM4D 1E2EA 1FX0A 5GADl 2YOGA 4QRHA 1U99A 4B44A 2IYZA 1S3GA 3SR0A 3X1YA 1FW6A 1NKTA 5FR2A 3NEYA 2ZYTX 1KMHA 4GMXA 4JJZA 4G0NA 4RZXA 1N6IA 4QM6A 3V9PA 2GKSA 4MDEA 1KO7A 1NMYA 1D9ZA 2HXSA 4KODA 4BFZA 1YR6A 1OIXA 3CX7A 2OT3B 1LFDB 1VMAA 2NG1A 4JKYA 1KYIA 5AJXA 3CRW1 3GFPA 3FFBA 4JYBA 1ZW6A 4FI3C 2R8RA 3QPWA 4L4UA 2IYUA 4OK3A 4B43A 1QZXA 1WF3A 1DAGA 2UVQA 3KXIA 4NYMR 2A5JA 3P32A 4Y0AA 1ZBDA 3ZS9A 5FI1B 1W5SA 3DKPA 1UBCA 3QOFA 1Q1BA 5GJWC 3FMFA 4BPBA 3KFVA 5KNBA 1IBRA 1UFQA 1J70A 2KSQA 2AN9A 4BUJA 2OSBA 2J0UA 2QMOA 4BFYA 3THXA 2PZFA 2FPLA 1XEWY 1WRBA 1OKKD 2RHMA 4DKXA 3IDQA 1L4UA 1U98A 1SKQA 3GEIA 2IS2A 1UEIA 2JJ1D 3RC3A 4BLRA 4A6PA 3HU2A 2Z6VA 4RVCA 2D3WA 2C78A 5CLLA 1XCGB 4LPSA 3QEJA 4C0LA 2GETA 1X1RA 1J8YF 1F2UB 3EPHA 3VAAA 4Q4JA 1ZU5A 2IBMA 3IPXA 2ATVA 3NHAA 3HWSA 1CF4A 1T8UA 5A4JA 2QAGB 4JL6A 2BJWA 1T0HB 1GITA 5EQTA 3RRZA 3QXHA 1T3SA 5FBQB 4TMZA 1JAHA 1UKYA 1UEJA 1YVDA 4QGHA 4UQOA 2PBRA 4TYPA 4B2PA 3MFYA 1XMJA 1XXHE 3CF6R 1VYUA 1YRBA 3PV0A 3GJ7A 4KVGA 4OQLA 2GXQA 2P6RA 3L0SA 1KSFX 4QL3A 1GRQA 1A7JA 1OE0A 2JIZA 4EFLA 2OLKA 1AS0A 1TPZA 1VG1A 3P27A 4LYHA 2W83A 4A0RA 5F9FA 3TAHA 1KIMA 4DWJA 1ZMXA 1CLUA 2XSZD 2GXAA 1PJRA 3EXAA 2RGBA 4LHXA 1Q12A 4HYYA 2B21A 2J41A 4QC2A 3OEEA 1XPUA 5EP2A 3BFVA 1G7CA 1SULA 4ARZB 4XIGS 4ZV4A 4JLPA 5ANRB 1DE0A 1M7BA 2FFQA 3NIBA 4TYQA 3GLIA 1E2MA 1SXJA 3F5FA 4NYMQ 2Y8EA 4M1WA 3QI2A 2EQBA 2F3TA 3HYTA 4DC9A 2G1KA 5BXQC 1KNXA 4M1YA 3NC0C 3AVWA 1WMSA 4K8OA 2ERYA 2FZLA 2VIIA 4Q1CA 2CEAA 2OCYC 3P20A 3NXSA 2ZUBA 2QAGC 1E2HA 5BW8A 3G82C 3K9LA 4LI0A 2RGXA 4A2QA 2QSZA 1NJFA 2HDNB 4A4DA 3Q72A 1XDBA 1QVAA 1U0JA 4UJ5A 1XD9A 1IY0A 2FN4A 2Z83A 3C16C 2OZEA 1IM2A 3M1IA 1ONBA 1U8AA 1R6BX 2JJ8A 1WQ1R 4A2PA 2G77B 1TF2A 3I32A 3VR1A 3RC8A 4UJ3A 2OHFA 1F2TA 2GXUA 1Y3AA 2J0VA 3ZZUA 1NRJB 2OG2A 1W4BA 4PR0A 1GKIA 4YMUA 1CU1A 3E5HA 2IYQA 4PHGA 2H92A 3UG7A 5G3YA 2ZR9A 1SVIA 4TZ6A 1O87A 4OK5A 2DWQA 1G64A 2WWXA 4BFXA 5KPJA 4TZ0A 1G5PA 1LS1A 3IQWA 5JEEA 4GDFA 4N1AA 5FUVA 1E1QA 2NO6A 4YDHB 4LBVA 3QSYA 1UAAA 3DDCA 4NU0A 3CWQA 2WJYA 3U4QB 5FPYA 3SJCA 5LD2C 2C99A 2FDCA 3WNCA 1LNZA 2JDIA 4O0MA 4FWIB 5DI3A 3VR2A 2ANCA 2CK3D 3RSOA 1E9AA 2W2XA 3AKYA 1KDRA 1RE0A 2FU5C 2QTVB 3LQRA 4NCNA 3VKHA 2A5GA 2IA5A 1YJ5A 2QGNA 4D80A 1AQYA 4LJ5A 2NMVA 1JPJA 2V9PA 3KXLA 3O8CA 1SVKA 2ZSBA 1E0KA 1IQPA 1KK1A 2AR7A 1NBMD 1OSNA 4AY2A 3EPJA 4BRWA 5EP4A 1Q44A 4LK2A 2H16A 1UKEA 5JRZA 4A0FA 2X8AA 3AV0B 4DRZA 3LWNA 1E2LA 3HPQA 2AK3A 3OE7A 3P4YA 3CM0A 2ZVQX 4LX0A 5AJWA 2Q3MA 2AXNA 2YWGA 2ONJA 3S1AA 2ORVA 2G6BA 5JECA 2DWPA 1YZGA 3D7MA 3WNDA 2ZS9A 4DSNA 4QXAA 1Z29A 3B78A 2E9SA 1RJ9A 3AF3A 2JLZA 2F43A 3VR3A 5EE3A 1LY1A 3FTQA 1HEIA 3U44B 4C0HA 4DSOA 4WVFA 1NMZA 4E5UA 4P3YA 3SJAA 1P4SA 1QHSA 2QAJA 2GBLC 1QF9A 3OEHD 3A1UA 2CCJA 3FMOB 1W5TA 2ZM5A 1BYIA 1DAIA 4GI7A 4D0LB 1VECA 4BWYA 3WRYC 2YC2C 1D2MA 3GLHA 3K0CA 2CNWD 4Q7KA 2AK2A 4LJ8A 1P9RA 2BV3A 2FV8A 2IYRA 2VF7A 2YVUA 3NBXX 1E2DA 1CIPA 1DAHA 4HLUA 3L0IB 3A1WA 5L3QB 5L3VA 3QBVA 2CHQA 3TR5A 2JLUA 4FMCF 2PL3A 4KJZA 1G3IA 3RS3A 3SN6A 4WIAA 3FGNA 5DE3A 3TUZC 3RABA 2JA1A 3OAAA 3K0AA 5E4FA 2H17A 4Q1AA 1TTTA 3K0SA 2X2EA 4AI6A 1XX6A 2HXYA 3SFVA 3PIRA 2ODEA 3PEVA 1W48A 3AP2A 2IUUA 4OL0A 5ELXA 2ZAOA 4P32A 5AJVB 4EPVA 2YWHA 1NJGA 2GCOA 4DLWA 1ZINA 3C8UA 4U02A 4ZI3A 4JLKA 4XWKA 1NF3A 1GILA 2WSSD 1BMFA 4RZUA 4EPRA 3WXMA 5J4HA 4M1KA 4AD8A 3CRRA 4P31A 2HF8A 2OAQ1 4WBSA 2OFOA 3T06B 4DJTA 1E96A 1PUIA 3ECCA 3LVQE 3OIYA 4A6XA 3ADDA 2W0MA 1P2VA 3B1YA 3BIFA 1U9IC 4QHTA 2VH5R 4Q4AB 4B34A 4BASA 5FUXA 3I5XA 2PCLA 1LF5A 3K70B 5HE9A 3I8XA 1KJZA 4TLEA 3QNUA 2W6JD 1DAKA 2QE7A 3H2YA 1R10A 3CIOA 1MH1A 2RMKA 3BFKA 2QY9A 1KTVA 1P2UA 3TJZA 2ZQ5A 2FG5A 3QF7A 4GSYA 5B64A 3BJIC 3K09A 2J46A 1KDPA 1OHHD 1F2UA 1IN4A 2PT5A 5EXSA 1Z28A 4V0LA 2GILA 2PLFA 2QAGA 2EWWA 2CL6X 1JR6A 2AKAB 4MRRA 2CCKA 4TTPA 1CBUA 3ZD7A 1U94A 4MGIR 4YXWD 1TUIA 3SEAA 3KKOA 1Z63A 2R6FA 4F92B 5E3HA 3AKDA 5P21A 5KUTA 1FOEB 4AYTA 3BOSA 5F9HA 1YZLA 1P2TA 1H65A 1YZTA 2FF7A 3GJ3A 4ACAA 5A5GA 2G0NA 5JI2E 3U61B 2D7DA 3KKQA 4RD4A 2CL7X 1XB2A 3FKQA 3I62A 4LC1A 3T5GA 2REBA 2PMKA 3K70C 2QZ4A 2ZSEA 2Q9BA 1GNQA 3A58B 4LBYA 5CJPA 5KDOA 5CDFA 5IK2D 1R2QA 1II0A 4DZZA 4E07A 2ZXUA 1ZAKA 4ARZA 4KI0A 1R0YA 1NLFA 2CJWA 2XAUA 4UXJA 3LW8A 2JJ2D 1YR8A 4NTZA 2VSXA 4PO9A 4IDQA 2R6AA 1J99A 2H5EA 3LVRE 4G1UC 1FX0B 3PEYA 3U7EB 4LJ4A 3R20A 4QM7A 3AEZA 3I1FA 1XP8A 2O8CA 2BBTA 3K0FA 2C8VA 4ZCIA 4LDJA 2VBCA 2FNAA 5SZJA 1IN6A 1BH2A 2CCGA 3B1WA 4LY6A 1ZNYA 4CYMA 3AVYA 2E1RA 1L2TA 4H1UA 4DCNA 1S4QA 3K9HA 4CVNA 2X2FA 1HE8B 1G8YA 1YR7A 3LXXA 4NPHA 3FDIA 1MABB 1XJ0A 3ZQ6A 3TNFA 1RVDA 3O8BA 4RKFA 1Z0IA 2GZHA 2UZIR 2ZAMA 2WSMA 3A8TA 3ZYCA 5KDDA 4M9QA 2B8TA 3U60B 2IW3A 1UBEA 4IVQA 3T1OA 2XTZA 2J7KA 1UADA 1NP6A 5DYGA 4TYYA 1H8EA 721PA 2ZSDA 4HUTA 2GF0A 3PUWA 1GNPA 1E94E 1NN5A 4I4LA 4MRNA 3HU3A 2QPTA 5BN3A 1DAMA 1XPRA 2OXCA 1UDXA 5EP3A 3ZS8A 1A4RA 2RGEA 3G0HA 4P0TA 2VHQA 3QXSA 1G16A 1G1MA 5DI9A 1KI6B 1T3HA 4KAXA 3TRFA 2B6HA 3FWYA 3GJ4A 2DB3A 1OXUA 2ZVPX 3U4QA 1KOFA 3H86A 3UXMA 2WMOB 3R7WA 3NDBB 2GBLA 2F1JA 4IDOA 3G5UA 4F38A 3BK7A 1LTQA 3EA0A 1FTSA 2YHSA 2XJ4A 4B35A 2IEZA 2NTYC 1SVOA 2AFIE 5JCPA 4Q21A 5HZHA 2HT1A 5FFMA 3BERA 4NYJR 2HLDD 1G7RA 3WHLA 3T5DA 2P6NA 2OFWA 4II7A 3CH5A 4MKFA 1YZKA 1Q1ZA 3QKSB 3A4MA 1E0SA 1RW4A 2WZQA 2QU8A 4GL2A 1FL9A 2WWFA 4QG7A 4WW0A 1JXMA 5LBIA 3IPYA 3IBYA 1X8LA 3Q9LA 3RRYA 2DBYA 1T5LA 2ZJOA 1SZPA 2QT1A 2ZJ8A 1JECA 1V43A 1DEKA 2F1RA 3Q7PA 4A0GA 2ZRJA 4DLSA 3AF0A 2FH5B 1E2FA 5E7JA 1OLOA 5FOXA 3U3JA 1BKDR 2HF9A 4P4TA 1XEWX 3ASYA 1OXXK 1M7GA 3CR8A 4PXAA 3KJHA 5G41A 2CVFA 1OXTA 1D2NA 1G5TA 2XNDA 3HR7A 3IIJA 2IYSA 4KCGA 1SXJB 3GLIB 3KTAB 5HPYB 2REOA 5LDDC 2H57A 1KDOA 4D4MA 3L2OB 1GL9B 2FGKA 3UPUA 1W1WA 1MV5A 3WY9A 3W5IA 4PANA 1U9IA 2GZAA 2DY1A 5LPNA 5JJIA 3VNVA 4HUQA 2WJIA 1S96A 1XFAA 2QUZA 2BIFA 2FA9A 3ZDQA 1NSFA 1EFRA 3A36A 1AIPA 3X1ZA 1AKYA 4B32A 4NKRA 4D4LA 3NHBA 4TMVA 5L3QA 5B2ZA 1TX4B 4MUAA 1WBBA 1QBKC 4GFDA 4R98A 4XWAA 1JALA 1T91A 2NZJA 2NO7A 4GOXA 1JB1A 1OV4A 2DFNA 2JJ1A 1GUAA 3PQCA 3C41J 1XRJA 3KJGA 1TU3A 1F48A 4I99A 2QSYA 4KITB 3TSWA 3MUFA 4GP7A 4LHZA 2V3CC 2BJVA 1IN8A 2J1LA 2QP3A 4LGMA 3NEJA 4EQ6A 4A82A 1P9WA 2A9KA 3B5JA 3U3OA 4JL8A 4NYJQ 4GT1A 1NN1A 2Z43A 2G88A 5J4KA 2TMKA 3N2EA 1YZUA 2NPFA 4OKSA 1KSJA 2G83A 3DPUA 5FPSA 4FIDA 3KDSE 1DAEA 4PPNA 3SZRA 1CTQA 3NDPA 1SXJC 1WA5A 5EE5B 3QPVA 1AGRA 1DO2A 5EXPA 5LB4A 4C30A 1DG1G 4IOJA 1M6NA 5KNCA 3V4FA 1PLLA 1G4AE 5EZ5A 1KAOA 2IHBA 4F4IA 3U7HB 4QJ3A 3EAQA 3N70A 3SHWA 1VIAA 3FHTA 2ECKA 3AP1A 1B23P 1G4UR 4TN1A 2XSZA 1KSGA 3ZIAD 4MYTA 4M0LA 3T61A 1IN5A 2QNRA 4R2HA 2GAAA 4KYUA 3ZJYA 2QMEA 3VQTA 2BBOA 2LCFA 3K53A 1IY1A 4JLBA 5TARA 3R8CA 4PC1A 1G291 1N3BA 3ZZTA 5BN5A 3EW9A 4F7WA 1N6HA 1P6XA 3AVPA 2QRNA 5KDLA 2XZLA 1LVGA 4OHYA 4GOJA 2AHOA 3REGA 1E2JA 1OXSC 3TUJC 1GRRA 1MO6A 1OFUX 3LX5A 3S1AB 1G7TA 1S9HA 1KAGA 4BLPA 2V54A 2WHXA 1K5DA 5C4GB 3B1XA 2RKOA 4LHWA 3U3MA 3VR4A 4EJSB 3UG6A 4QJ5A 4W9MC 2GTPA 3KB2A 5CYPA 4JVLA 4HLQB 4L5BA 2YWEA 1XTQA 221PA 2Q3FA 3KKMA 2WWIA 4KYIB 1Z6GA 1U81A 3KQKA 2NO9A 1GM5A 5K8LA 4KV9A 1WDTA 3LW7A 4FD2A 4RZ3A 4AKHA 2BMFA 2OLJA 1ZM4A 2NQ2C 2WMNB 2IF2A 4XOIA 1QG2A 4DCUA 2ZRNA 4MYHA 1GNRA 3KUCA 1SKYB 1E9EA 3CNNA 5AUOB 2I4IA 4LJ9A 4KFTA 4TT3D 5C4MA 1FPMA 2A3RA 1EK0A 4Q9LA 3UMRA 3MWYW 1TEVA 1NG1A 3TH5A 2DR3A 4M9XA 2IWHA 4MGYR 1IOZA 1E32A 2XZPA 2QP9X 1PLJA 4US1R 3FFAA 2C9OA 2DPXA 4M1TA 4IDPA 1G8GA 1MKYA 2AWOA 4IEIA 4Q00A 4EDHA 4CRWB 4ZDJA 4UNQA 2R44A 3BH7A 3PR1A 4H9GA 3K0AB 4Q9JA 4DLZA 3L8ZA 2WJJA 1U90A 3ZZ0A 4LHVA 2ZU0C 3PCRB 2ZS8A 3BD9A 3GMTA 4PAQA 3SYNA 4DCSA 3U3KA 5KHOC 2CK3A 2WWYA 2Q9CA 2HYDA 1HUQA 4UNSA 2FZ4A 4O25A 1P5ZB 4Q48A 121PA 2E87A 3W6PA 4BZQA 4F4CA 4CGZA 2GCOB 1MRSA 4YQFA 1FQKA 2VLIA 3ND9A 1MABA 5SZKB 5JCZA 3B9PA 1NBMA 5BYJA 2CLSA 2XTNA 5K8TA 3GFTA 2ERXA 6Q21A 1VYVA 3TR0A 1W4RA 2YV5A 2KWIA 4BLOA 8OHMA 3FVQA 4PFSA 3X2SA 3VX3A 1XZPA 5AUQA 5TDHA 3Q5EA 1VHTA 2FOLA 2V4ZA 4V0KA 3EZ2A 3K0CC 4GNKA 4ESVA 1GVNB 2IUTA 1BOFA 1LB1B 1UDWA 2P2LA 3CRVA 4JVSB 4HLUC 4XH9B 3TK1A 5KYKA 5JS8A 2JLXA 2I1QA 2VHJA 1ZU4A 3B9QA 2EVWX 1KI6A 4PX9A 2WVJA 4M2LA 1P60A 2QTHA 4G01B 3LBHA 1V5WA 1T6NA 3GLGB 1KSHA 1PVOA 1KK0A 2F1IA 4N0DA 3W3ZB 2AD5A 1FP7A 4Q1EA 1P72A 3OEHA 3SC3A 1T3LA 2O5VA 3JVUA 4M53A 3THWB 4LBWA 2ZS7A 1VYTA 4ZDKA 3RRMA 2QQEA 3TBKA 5B30A 1M8PA 2ZR7A 2VPPA 3LA6A 4IOMA 1L8QA 1Q57A 2GF9A 3W8NA 2CNWA 3V00A 4NMMA 2W6ID 1E3MA 3KUDA 2H7VA 2IYTA 3CONA 3BB1A 4EPXA 1DTSA 1XF9A 3BH6A 2F3RA 3QKSA 4C2TA 2A5DA 2FEMA 3CNLA 1QHNA 1HH4A 1KI8A 1N2CE 5HE8A 1CJTC 1CJUC 2A78A 5DISB 1KK3A 1W46A 4FW9A 3KKNA 3CPEA 3BFXA 3RS7A 2QORA 4LV8B 4LSGA 1AZSC 4EPTA 2D62A 2CMKA 2QPAA 4DXAA 4QHYA 2XB2A 3JZMA 4NHOA 2CJWB 2ZRFA 3FMIA 2EYUA 4S2EA 5DO9A 3TSOA 5FOSA 2OAP1 2FPKA 2WSSA 3KTAA 4Q7JB 1K5GA 1KO8A 1TUEA 2RB4A 1RKBA 3K09C 4BLSA 1E1RD 3BXZA 4PO8A 1YZQA 1E2KA 3OIUA 1R4AA 4LYFA 1R5BA 2O8CB 3IIMA 2DFLA 1G19A 3K0FB 3CZQA 5IF9A 1MO4A 2ZRHA 1DARA 2WKPA 4JT2A 3GJ6A 3E70C 3LXRA 4PPGA 1EFCA 5TVKA 3QBTA 3EZ7A 2W58A 4ZKDA 1BIFA 3DOEA 4N3NA 5CK5A 4C9BA 4PZZA 2HCBA 3AVQA 4XD7D 1KK2A 2C9CA 1NMXA 1U8ZA 1QG4A 4JVNA 1T8TA 2GJKA 1C1YA 1F5NA 1R8SA 2Q9AA 1OHHA 1VKJA 3RVBA 4WZBE 5FTLA 1OIWA 4DBLC 3U7FB 5BN4A 2IXGA 1TF5A 5JLJA 2C5LA 1COWD 4UNPA 4O2LA 2PEYA 3IIKA 2NIPA 4FMBB 1LS6A 4OBEA 4OQFA 2ZRCA 1ZNZA 1OF1A 2VP9A 4Q1BA 3GQBA 1OW3B 3VHXA 2J59A 3WYFA 3LNCA 2FSHA 4FCVA 1VHLA 2WBLC 2WKQA 1E2GA 4LJ6A 1KI3A 3W6OA 3IQXA 2IUSA 3LAWA 1JXOA 3M0EA 4EJSC 3EZ9A 3R7WB 3AP3A 1UM8A 3T1TA 2ATXA 4D6PA 1G5RA 3IO5A 5CITA 2FE4A 4CEIB 1T4GA 4MRSA 4P4SA 3WNBA 2GRJA 2V7QD 1E79A 3MJHA 4LJAA 1U2RA 1PUJA 3PXGA 4BZPA 2XEXA 1EXMA 1QVRA 2Z4RA 1IY2A 4LYJA 5J4VA 4RCYA 5IK2A 1Z47A 3W6NA 3NVAA 3TVDA 4B3FX 3OIVA 2P0EA 3H0KA 5J40A 3W9YA 3R9IA 1XBTA 3HJNA 1HYQA 1E9RA 3SHFA 4ZIRA 4EAQA 3L0PA 5JRJA 2VEDA 4F91B 3R8FA 2ZRIA 3IUYA 3RS2A 3EARA 3QJYA 2FFBA 1ZVQA 2XNSA 1S9DA 3EIEA 3EZFA 1W2GA 1JPNA 3X1DA 3A1TA 4EJSA 4MRVA 1DG3A 1CRPA 2F55A 5L8VA 4HDQB 2D2EA 2B8WA 1Z3IX 4E03A 3QXCA 4HDOB 1EX6A 2OCAA 2XB4A 4C3ZA 4DEXA 1E9FA 1XEFA 5EXXA 3THYA 1A2KC 3DKVA 3ETLA 2EFGA 1YU9A 4TTQA 5C18A 3ICQB 5BWMA 2D2FA 1II8B 1W4CA 1D6JA 1S8FA 4JLNA 2IYXA 5AR1A 4EFNA 5UKDA 1NVUQ 3ZQJA 2NO1A 4HUQB 1ZD1A 4XVQA 3VU9B 2EU8A 2I3BA 3HU1A 2JCSA 3M4YA 2NOAA 2ZUDA 3M6AA 4QGGA 4ZO4A 3ZVMA 1OB5A 4OK6A 1RRPA 1OJLA 3W34A 3U7GA 3AUXA 2QGZA 4LWZA 2EFCB 3QUSA 1R7RA 2LWIA 1NIJA 3KX2A 4FCTA 1T0JB 2XOKD 4KO8A 2O8EB 1MO3A 1JR3E 1Z0FA 2O52A 3VR6A 1KDTA 4IXMA 2QENA 2F9MA 1A1VA 1JR3D 2HYIC 1Q22A 1F6BA 1OH6A 1E9CA 1RYHA 4RZ2A 5AUNB 2FSIA 1QHGA 4EQ6B 4ZDWA 1Z0KA 2CXXA 4B74A 2GEVA 4L9WA 3LV8A 4PC3A 3TSZA 3W5JA 2PLRA 2XJ9A 2OV2A 2QQ0A 2ZANA 4JLOA 1Z6XA 4HDCA 4BEJA 2HLDA 3LD9A 1G3QA 1P3JA 4M1SA 5CJ2A 5FPHA 1ZUIA 1S1CA 2DCUA 4Q1DA 1XXHB 1K8RA 4GMDA 4Q5IA 2SHKA 1I2MA 4DLTA 1A5TA 3CKLA 2KBEA 2FJUA 5CM8B 3ZD6A 2QPOA 2HUPA 1D8TA 2HV8A 5FL3A 1A2BA 4Q66C 1W2HA 5AWFC 1OH8A 2R6DA 3IGFA 3PENA 4CEHB 3QG1A 5FBWB 1FMLA 2VTKA 1E2IA 2GXSA 5JJKA 1KI7A 5L3RA 2W2TA 1W0JD 4F4JA 4OQMA 4Z8XA 3WP0A 5C1BA 1JEEA 4HAZA 2EWVA 4B33A 3THOA 2ZI4A 3C7KA 2ZITA 3GJXC 3X1XA 821PA 3GLGA 5IT5A 1P9NA 4U7DA 3PFIA 1P2SA 1TQ2A 1E4VA 1Z2CA 4Z54A 1RRFA 2OBLA 2YWFA 2VHUA 5J47A 4S35A 1GDDA 1FP6A 4B3DA 5DN6A 2AFHE 4W5JA 3THWA 4LYAA 4QGFA 1RYFA 4IEEA 5JS7A 3CNOA 3C5HA 2ODWA 3CB4A 1TQ6A 1X3SA 4DLVA 1DELA 2IEYA 3WBJA 1L7VC 1N0WA 2PX3A 1I2DA 2IF0A 5JSZB 1R8QA 5FOTA 1SHZA 4JBYA 1GTVA 2IC5A 2MSEB 1NSTA 1OH7A 2O8BA 4ZPXA 3QEOA 621PA 1TU4A 1ZNWA 4DCTA 3OHMA 2ZJBA 4HLCA 1TQ4A 1II9A 3TAUA 1HQCA 2VQSA 4RFVA 1X8JA 3OFND 2ZYWX 3R9WA 4B75A 3TQCA 4KVAA 5EUQB 4RJLA 1U8YA 3CZPA 3LBNA 4JYCA 1QHHB 3I3SR 3IEVA 2VP4A 4URXR 4URUR 3GLFE 3GJ0A 5FOWA 1GKUB 2QMHA 3D8BA 4HAXA 1ZRHA 4R9UC 4TYNA 5E7MA 4PC2A 4XJXA 1VTKA 1CKEA 1KZ7B 4HZUB 3WP1B 2GESA 2NO0A 3ADKA 4BFWA 1RZ3A 2JLVA 2F1HA 1HQYE 3OESA 4DIDA 3D6TB 4QBIA 5E95A 2A5FA 3NG1A 3ZIAA 1NY6A 2ZRMA 4TL7A 4HAYA 1S2MA 4UXIA 3T1VA 3SQXA 3VX4A 1P7CA 2EYQA 1N5KA 4KU4A 1E2NA 4A0HA 3K9GA 1UKVY 3RHFA 3CLVA 1Z07A 4PAMA 3D31A 2GNOA 2PEZA 3LFUA 1DADA 1E98A 2GJ9A 3NTUA 3OF5A 1ZM2A 1IXRC 4JLAA 2RAPA 4Z1MD 1E9BA 2VHTA 3CRMA 4NL4H 2BCGY 2GK7A 3WYGA 5CYOA 5E7IA 3FHOA 3OIWA 1CR2A 4WAUA 1OIVA 2ZI7A 3GCGA 2Q0HA 3QKTA 4V0MA 2ZJ2A 3PITA 3U6BA 5JBQA 3P1JA 1UJ2A 5DNYB 4TLCA 4A8JB 4DB4A 3KB1A 4DDTA 4Y0VA 1I4LD 4FN5A 2GDJA 2QL6A 3EIHA 5HKKD 3SOPA 3MCAA 1XCMA 4G3XA 3LX8A 3SFZA 4CEIA 2VA8A 3RS0A 4GRAA 4G5QA 5H70A 4DHEA 1XU4A 3LBIA 1LF0A 2IWRA 4AG5A 2J7PD 1EFTA 2PZGA 3W3AA 3V4RA 3AVUA 3ONWA 3LRPA 2ZJ5A 4AG6A 1FUKA 4FMCB 4NONA 4PHHA 1W36D 1UKZA 1XEXA 3EWAA 2CLCX 3Q7QA 4KBFA 1GL7A 4PZLA 4FCWA 4TMKA 4XVRA 1KGDA 4L15A 5JZVA 4FINA 3CBQA 1XTKA 1DOAA 4NCHA 1H8HA 3CUEF 3ZVRA 4IVRA 1US8B 5GVSA 1WB9A 5IDVA 3ASZA 1C9KA 2IS4A 3AKEA 3SYKA 1KO4A 1VPLA 1Q3TA 5FH9A 5GJVC 3NKVA 4M22A 4TL8A 4HEJA 1YHNA 1CR0A 2ZRLA 1P61B 5H8WA 1KY2A 3WMGA 4DLRA 2R9VA 4A8JC 2ORWA 4LPKA 2GA8A 2GEDA 4BQSA 1FFHA 3BAFA 1VG8A 1Z0DA 4IFBA 1KI1A 4L8GA 3AF2A 2DWOA 5FTMA 4GOKA 2IYWA 1II8A 4MITA 1E4YA 5D3QA 2ZRKA 4G5SA 4B73A 2AD1A 4EPYA 5JHGB 2G3YA 1N6OA 2WWGA 3BS4A 3KXKA 1JI0A 2YOFA 3GJ5A 4PPFA 2QE7D 2QEQA 3VU9A 4NH0A 4JLDA 4UXHA 3T15A 3KJIA 4NP6A 3UK6A 4CF7A 3HDTA 3N2IA 3WBKA 5A0FA 2ZE8A 2WWHA 1OKKA 3A1VA 3K0EA 4JKIA 5C2JB 3KQHA 4LRWA 1GG2A 4HATA 4IHQA 4CEJA 4XTRA 5EZ6B 4BE7B 2GAOA 4F93B 3B7GA 2O8EA 1S0UA 2WJHA 4M1OA 4TLDA 2RGDA 3U2QA 1G8HA 2IT1A 2OCBA 2OESA 1SVWA 2RGNA 4DSTA 4M1MA 4YDSA 3A37A 4Z51A 4CT5A 3CX8A 1AQUA 1HE1C 2ZRAA 3B8HA 4XWOA 4BFSA 2BKEA 5FOVA 3SI7A 1M7HA 4H1VA 2FWRA 1GP2A 2ZI3A 5HR5A 1LV7A 2PMDA 3PUZA 3TIFA 2HEIA 2ORIA 3MRSA 2BM1A 1XMSA 4W7SA 1M1YE 2JAQA 4TMWA 2KI5A 4PQRA 1QDEA 4IW3B 1YR9A 2ZUCA 1Z0AA 4IOLA 1XXHA 4JL5A 3BRWD 1Z5ZA 3IHLA 4PC7A 3REFA 5CDFE 3FMPB 4Q9IA 2WJGA 2XZOA 1X8KA 2WAXA 3U3RA 3NBFA 4P4SB 4AYXA 1WBDA 2WIBA 2WM9B 2WWWA 4KFSA 3MJRA 4URZR 3LLUA 1XD2A 4EPWA 521PA 4CEHA 2ZRGA 3RS5A 3TW8B 2BC9A 1KI4A 4OHWA 5FTKA 1NN0A 2JASA 2ANBA 1DBSA 2JGNA 3B6EA 1S3SA 3F3YA 2ZYUX 2ZE7A 4ITRC 4D4KA 3NBYC 4RD2A 1AS3A 1JBKA 1XMIA 1XTJA 2VYFA 4ZIRB 2N42A 2GJAA 4PTLA 2REXB 5TMPA 4LJYA 2YKGA 2P6UA 1N6RA 3W90A 4JSYA 3PUVA 2YINC 2W2VA 1E1RA 1WCV1 2ZU6A 5FL7D 4EFMA 3ADCA 3PJRA 3IKJA 1HURA 2PZEA 1B0UA 2VSOA 4Q1FA 2ZI6A 3KFXA 4KSBA 2BKUA 5IRCD 3B1ZA 1GIAA 2YNMA 1Z6AA 1XJQA 1Q1EA 5G40A 4AK9A 1IAQA 3FYHA 5JEDA 3I92A 2DFKB 2ZEJA 2J0QA 3WRXC 4LHYA 5JSZA 2ZRPA 4FWTA 3THYB 3EWSA 1X86B 2YOHA 4GBMA 3J81k 1NL3A 3TGPA 5J5CA 5BYKA 5K8IA 4XD7A 1NLZA 2VL7A 4LCBA 4WXRA 2A30A 4NE2A 4RY2A 4HB4A 4MUBA 2F7SA 5DIFA 4BZXA 3CF0A 4U5XA 1X1SA 1KJWA 1G6HA 2BDTA 4PSAA 1M2OB 4QFMA 2VP5A 1NG9A 2MSDB 2IYYA 2ZJZA 1COWA 3MWKA 1Z0JA 3PUXA 1TQDA 1QHHA 1C4OA 2H1LA 4P4UA 1G18A 1N0UA 4LZZA 5K8UA 1Z6TA 1TL7C 2MSCB 1XJCA 3TKLA 2XITA 1ZCAA 4TYWA 2RGCA 3KZ1E 2WIAA 3UWKA 3CW2A 2AXPA 4N0EA 3DM9B 4D2IA 2OO7A 3B1VA 1AS2A 4HZUA 2V8OA 3A4NA 1A82A 4ABYA 1YRAA 4EUNA 3A4LA 3B13B 2BMJA 1NVVQ 1DPFA 2JLRA 4P33A 4W5HA 4KLNA 3CRQA 2V7QA 3CF2A 2OBMA 4IJMA 4AYWA 2PJRA 2C96A 2Q6TA 3KJEA 1IJFA 1W36B 3LDAA 2N46A 2ZETA 2R62A 2ZPTX 3K8YA 1E0JA 5KSPA 3WMEA 2ZROA 1VCNA 3JVVA 4M9ZA 2AL7A 4HSEA 4ACBA 2D4HA 5HZKA 3L0OA 4BGDA 3ND8A 4RD0A 1RRCA 4D4JA 1TMKA 1G7SA 1YE8A 4D0NA 4ASUD 2V1UA 1Q1QA 2P5SA 4V0NA 5F3WB 4DDVA 1JEDA 5FI0B 2J3EA 2VO1A 2XNDD 4ON9A 5KTYA 1G3RA 1HT1E 2C98A 1XZQA 3AVVA 5DYIA 4A1FA 4RSGA 3NWJA 1MOZA 4IVPA 4A8JA 3E2IA 4CZ2A 1ETUA 2BCJQ 2JLQA 3DMDA 2BHRA 5CIWA 1CXZA 4DT1A 5JWRA 1Z22A 1KKLA 3RRNA 2DYKA 2ZRDA 1L4YA 1YQTA 3C14C 5CB8A 4R7ZA 1EFRD 1IJEA 1G6OA 3TVTA 5J4LA 1CR1A 3LH5A 3SNHA 3BWDD 2ODBA
chains in the Genus database with same CATH superfamily
5SYAA 4JNCA 4JVMA 9LDBA 4H4CA 2R60A 1N6KA 3ESZA 4QDKA 4KUHA 1ZN9A 4B4UA 4BB9A 1SHKA 4S2UA 1LGYA 4B80A 1VCMA 1HORA 2QL5A 2OC9A 4HL6A 2AE2A 1AMNA 5FJIA 3C7DB 4BLVA 5AVSA 3RKUA 2G5GX 2A5YB 3UKOA 4ZQHA 4DA8A 3IS3A 1HM5A 2GRUA 1ADFA 1H2RS 1JDSA 3QENA 2PUFA 3UKDA 4B3GA 2HRQA 1Z83A 3CZ5A 2BD0A 2RCYA 4FZVA 3NONA 4OHVA 3SZUA 3T7TA 4BU1A 4MA4A 4YFVA 1R5OA 2GYVA 4V0OA 5HILA 5BV8A 3IR7A 3I45A 3TTSA 3E1GA 2D06A 4F2GA 1DI0A 4FKBA 2A9QA 5F4BA 2X9QA 4I14A 3N6VA 4X94A 3UIEA 4CLRA 3TW4A 2CKDA 1JJVA 1OCEA 3RGWS 4UBKA 1E3TA 1SRQA 5FQNA 5FB3A 4LV5B 3LC1O 2FR8A 2O8DB 3LGAA 2RONA 3PF8A 4D9MA 4KNYA 3LFHA 1ISHA 5IMSA 2OQRA 3VI4B 1ZNXA 1JXQA 1VI5A 3DHWC 1TM3E 4KI7A 3CLKA 1ORHA 2FZ5A 3WGOA 1EUZA 1WW2A 2WPDD 2FQYA 4B4OA 4CIDA 5EIWA 3ZCTA 5C5CA 3BCUA 3EK2A 3NEPX 4N9WA 5IHPA 5HCNA 5JWOA 3EPLA 3D81A 4D8VA 4E1BA 1E9DA 3DDZX 1T8WA 2X19A 4R6XA 1C30A 1E3DA 2YXDA 2VC2B 3BIJA 3WSVA 5IX8A 2BFMA 2F8TA 1FFDA 3H87A 3FCEA 4NMLA 1A4UA 5KYYA 1I1QB 5CVVA 3KSAC 4RHFA 3RDPA 1QOQB 3B70A 4JBWA 4W8OA 4MKXA 1N8NA 4AB1A 1YVPA 3L82B 3AERA 3RAGA 3ILSA 4MS3B 4DUPA 4QYSA 1HO3A 1X80B 3I2FA 4EEKA 4W9RA 1TTPB 4KAAA 2GCEA 3PHBE 3EN0A 4FUQA 2H3HA 4LWPA 4B3HA 1V39A 1XUOA 1HA3A 2P90A 3I5AA 4PHFA 3TGWA 3ZWKA 4GEKA 3B8EA 3T0FA 3KWMA 4XAQA 1T5HX 3GEBA 3O5AA 4M1EA 1P0IA 1OI7A 3OCVA 5IUNC 4IZOA 1Z13A 2JH8A 1ZD3A 1CJVC 1DQSA 2H8KA 5E2BA 2W2KB 1SVLA 2J5KA 3Q4GA 4ZEOA 1BHQ1 5D1HA 3T3GA 4BLTA 2IIPA 3GX1A 3PXCX 1PR3A 4OF4A 1WWKA 2BEKA 4RS3A 4HB3A 1UMDA 4ZDIA 2JLBA 5SICE 3IL2A 3RYIA 3CT6A 1ZI8A 4OSOA 4MWOA 2OV8A 3SIPA 1PLKA 2YYZA 5HCIA 2LCQA 1XRRA 3K9NA 4JJEA 4JUBA 3GLVA 4NNPA 4BMOB 2R0QC 3RYTC 2VP6A 4L6AA 2GHIA 4CW7A 1CNEA 1D4AA 3NHSA 1T5IA 4J49A 4CMGA 4KL8S 4MWSA 4PO3X 4AZ3A 4YRGA 4K6OA 3OWXA 4YMVA 2P2NA 4MUMA 5IBCA 4KPFC 1T6BY 3FUTA 3JRNA 2GQ0A 3RD5A 1YF3A 3CEAA 3O2NA 5KKCA 5H83A 4CG2A 2PL5A 1Q7GA 1FEZA 3BGOS 4Y2HA 2EZ4A 3D4LA 4B6FA 1DQRA 4JASB 3UMBA 4ETNA 5M5BA 4CL8A 2R6GA 2R65A 3U56A 1QH9A 5IJWA 4QUKA 1YS2X 1AQJA 1CRQA 1ZM3A 4KKXB 4YT5A 3KD2A 3GLFA 1U0BB 4G36A 1M73E 3O4IA 2C3OA 3D2CA 7GPBA 5BQ5A 5BOVA 1KBQA 1T6ZA 1U1FA 2QL7A 4ZAVA 1O57A 4AJPA 2IYPA 5A0VA 1RWBA 3AUYA 1NBME 1VLQA 4FQ5A 4CJXA 5MFPA 4G5HA 4D96A 1YAJA 2QA5A 4HX9A 2NV6A 4UNNA 1J7KA 1TYCA 5IXSA 3BE5A 2PS3A 1GTL1 2PGJA 4GDMA 1KETA 4IOKA 2ACKA 3BL6A 3H9UA 1L0BA 1UBGA 2JK1A 4MYCA 4Z86A 1A8PA 4UTXA 1KO5A 3LHKA 3PNPA 2GVZC 3LPNA 4GPIB 1Z5WA 2G6TA 3ZEAA 4PF1A 3SZMA 4PLVA 4QEDA 1A9XA 4Z1MA 4B3CA 4A5SA 3G0CA 4OAPA 4DIKA 1R0WA 1YZHA 3CHYA 3ZGLA 3NHJA 1AK9A 4RD1A 1F0YA 1XTIA 2ZFUA 2ZREA 3I76A 4WXMA 1E2PA 1MBZA 3TCKA 4IKOA 1RC8A 1C8KA 1PG2A 2PUHA 1VDZA 3N2NA 5AHRA 5AI4A 3DM5A 3BE6A 1CUHA 5AUPB 5B3KA 2CBZA 1Q2UA 4D0GA 3FNFA 2VSYA 3D1LA 5HS6A 4YMLA 1FMJA 2ADFA 2JCXA 2GCPA 4Y6QA 3CNBA 3T34A 3KM0A 1VCOA 2P6PA 3HKEB 4JOBA 5KYYB 4TTRA 4EIWA 4G0VA 2VTVA 1DTWA 4MHTA 3IT3A 2BGGA 4KX3A 5FBRB 5HKKA 3CUVA 1ITZA 1KFKB 5AM4A 1FNSA 4S1WA 4XVUA 3F3MA 1P4GA 1I7PA 1G17A 1J2TA 1Z36A 3PCXA 4Z5XA 3BE8A 3HCDA 5ES4B 1DAFA 2WP0A 4A8HA 3V2IA 4BNUA 1LW7A 5C81A 4BC1A 2J7PA 5AKHA 3DWEX 5I4BA 1IVSA 1TZKA 3VMFA 3TLMA 4UREA 2JIZD 4EK9A 1H94A 1M2NA 3B3FA 4P3OA 3HEMA 1JDPA 5G4KA 2OM2A 2X0NA 4DS3A 4QPCA 3VOSA 3OO1A 1TAGA 5AOBA 4UULA 1DC5A 2PS9A 1OGYA 1DFGA 3EGIA 3PD0A 4YLEA 2ZSFA 3QZUA 1ZHHA 1HDYA 3B7PA 2IUEA 2CVHA 1OZ0A 2VSQA 4M8LA 4BFLA 4JLVA 5IT0A 3AYZB 1RPZA 3D6FA 4IO0A 1PKEA 1SG9A 1YGYA 2D59A 1EVZA 2IK8A 2JKVA 2V6IA 2YQ5A 3CJQA 3LI2A 3GLIE 5FPKA 1N2CB 2GWRA 3IB3A 1OI3A 1HDEA 4NQRA 1FTWA 3I39X 1NR7A 3C3DA 1YQDA 3GD7A 1BGWA 3NWOA 1SXJD 3WJ1A 1YDMA 3QHQA 2IHYA 3PHGA 4W5NA 1BS1A 4R1LA 2C61A 3IVAA 4MP3A 2IXEA 2J4DA 1X70A 1YI8A 2BT4A 1N7HA 5GVRA 3IKVA 3LNTA 4MIOA 1GFSA 1YKFA 3FVVA 3G0OA 4DMLA 3GEHA 1XC7A 4YJHA 1Z0ZA 1C9DB 1Q92A 2F9LA 2NQTA 1AB6A 4QXPA 5TY0A 2YJ6A 4X44A 3A6PC 3B60A 1HY3A 2Z3VA 1ZPDA 1NKVA 5ES3A 4QG3A 5KSYA 3U6KA 1JSRA 2VRNA 1EEHA 2OOSA 3AUUA 4PQYA 5DTQA 5DYTA 1N6NA 3V4OA 4PNPA 4ZALA 1EWKA 5A5DA 1RCUA 3IRUA 3O3CA 4BEBA 4YRMA 2CLHB 3VTKA 1QYRA 4NSNA 4Q3OA 1MNQA 1PN3A 1YAHA 3WLEA 4AWXA 3NBZC 4UTOA 3F5QA 3WLAA 4FMDF 2AV6A 2R25B 2JS7A 1XXLA 1JQJC 2HLPA 3QLUA 5J1SB 3I9KA 1ELOA 4OGKA 1DQPA 4B71A 3SWWA 3ILYA 2YWBA 3OT1A 2J9RA 1UBJS 3IUQA 5LMZA 3OE1A 2O8FA 4KQCA 5KO2A 3AVTA 2GKGA 3T12A 2OHHA 2PKYX 3E1SA 1H2WA 5JFGA 4V1CI 1KI9A 1M6HA 2XGJA 3PNVA 4J43A 5HTKA 1ATIA 2ZYVX 3O83A 1UBUS 2JIOA 4CEIA 1U4OA 5AESA 2HBQA 4E32A 2D7CA 2HCJB 1IN7A 2I6XA 1IM5A 1J21A 2PGNA 3DE7X 4QDOA 1DVRA 4YDRA 1E63A 4F5EA 3FZQA 2ZSAA 3DBLB 4DV0B 3A1NA 2HT6A 3DOFA 4WZBB 3CVJA 2FYTA 1T9AA 3ROPA 3BK2A 1IAVA 4AQYB 3N6XA 3NBAA 3GRPA 4P22A 5TE9A 4E2WA 1MEEA 1U0EA 3VR2D 5ITZA 3LO5A 3RODA 1GQFA 1E6WA 1NGSA 1EVJA 2YY5A 4OG2A 1VOTA 4IAOA 4ANFA 1YR3A 4BRUA 4N8DA 1ACLA 4YA6A 2V4MA 5C5DA 4UHJA 3NOQA 3IT1A 1G3MA 1IZ0A 3EVFA 3JVIA 4AKEA 4CF6A 1U2QA 5CD9A 3AF6A 4RACA 3BRWA 3ETGA 4UU8A 5C8YF 2VUHB 3DHYA 3DTYA 1AZWA 4QU5A 3ZV7A 4ARCA 1D1QA 1RWVA 3G3EA 2HSDA 2EG9A 2ZBGA 4BVFA 4L4XA 2GM3A 3JRXA 5IYZB 4J0CA 3ZE0B 5BSHA 1XIVA 3GVXA 5CFQA 2C95A 2DPYA 3ME5A 3AUAA 2ZM6B 3FWKA 4X93A 3GJ8A 5CW1A 1VRWA 4C0BA 5EGNA 2DBQA 4DDUA 1AQNA 5KOYA 2GEUA 4NCKA 1Y4UA 1F1JA 1DQYA 1I4EB 1KMQA 3BYZA 4G5XA 1N9KA 4XARA 1FZTA 3B2EA 4HLDA 4ZRDA 3IUEA 4YCNA 1WUKS 2PU7A 4RKYA 5FR1A 4TL6A 2GM9A 1I2ZA 2NXEA 3E4CA 3GUHA 4RF2A 3L6EA 5IT9A 1YOVB 2FMXA 1N7IA 4PSVA 5CNKA 4R7GA 1GCGA 3TVYA 4V2IA 1ZQ9A 4PZYA 2Y0EA 4CCYA 4FOOA 7AT1A 1RWNA 3DOHA 2XA1A 2BM8A 2HGSA 2YWRA 2ZJFA 2Q1WA 3SJZA 4D99A 4WCFA 4PG8A 3T7DA 4M83A 4L16A 4R3WA 4LA4A 5K4AA 1XVAA 3D1VA 4AFNA 1U9YA 1C3EA 1FPQA 2PGLA 1XMQB 1NNEA 1W581 1FLDA 1I9CA 3A32A 4M8IA 4GI2A 1SAYA 3TJRA 3G7UA 5C5IA 1CEEA 3QOWA 1A9ZA 1NBEA 2H4HA 2YDYA 1U0LA 3WB9A 2HJSA 4EG0A 2B3TA 2ADOA 2P5UA 2F17A 3R7DA 3TMAA 2H18A 1ZG3A 2LDXA 2PZKA 2YR0A 3ZYZA 2J32A 4E1VA 4H4DA 1VPTA 2IGBA 2J0UB 2QM8A 3LKDA 4BO8A 2H1FA 1F17A 3DTTA 3OFJA 3OTGA 4C7MA 3FUVA 1N32B 2IH2A 4BLUA 3GRVA 3DBVO 5BWLA 3AFMA 2PKWA 5EHQA 4K2AA 1GEGA 1HX7A 1OYWA 4IXTA 5AK0A 2XTMA 1B8VA 1ZQ1A 2L0XA 4EJMA 1QC5B 1WSWA 4ZOQI 5LFAA 2VNSA 4BFUA 3MA0A 3TOXA 5LP1A 2FW6A 1Z9BA 3MEQA 1OFHA 4BKMA 1Q5PA 3CEHA 1E9SA 3MLAA 5EEGA 2V6JA 5ALIA 4FFBB 4B47A 1Z2AA 3QLVC 1QHXA 1ZUHA 1OFIA 2GB4A 3U7QB 3H7AA 5FOQA 4UOQA 5FTJA 4JGGA 3WR5A 2P2YA 4TMYA 3DWGA 5DT2A 2UZ4A 3QE4A 1CNFA 3HL4A 2VXBA 4LYDA 1UJ4A 4YR7A 4LXIA 1FXWA 2JCBA 3Q0IA 4H7PA 4IUYA 4XQ9A 1Z8FA 2HWKA 2OHVA 1IZ8A 2E89A 3O92A 5TJHA 3RIEA 3SMVA 2LPMA 2E18A 4LE0A 1Z6QA 2POQX 5CVJA 5BMVB 1OB2A 3K5HA 3S44A 3AB3A 3EPKA 3KUXA 3CKKA 1FQWA 3UMCA 1C2TA 3BJEA 3ZVKA 5F9FA 3HE3A 2XECA 3ZCXA 2P9TA 4D81A 1HTWA 2W90A 4JBLA 3GUUA 4G5RA 1TVCA 4D9NA 5COQA 1NIPA 1YASA 3RRXA 3ZNOA 3CR3C 1OWLA 1EK5A 5JXGA 1D0SA 2WQZA 3HRHA 4LC0A 4OM7A 4MK4A 4X8HA 4YH1A 2OMEA 3WHIA 4HDRA 3CC8A 4JX8A 4GIBA 2YZKA 3NWEA 4I81A 4OQ4A 2UYGA 1P5FA 2XDYA 2PX5A 3ETCA 3PJFA 3WGVA 3D3QA 4ZT3A 4BBJA 4J16A 3JSAA 2NUPA 2NU7A 3P9KA 1I3CA 1I3LA 1MENA 1LUAA 1MAAA 1R0ZA 2JJMA 2WM8A 2V5AA 2Y1WA 3D0RA 3GFGA 4MYUA 3I6MA 4YONB 3U44A 4BMSA 3HA5A 5EIBD 2IX3A 1EIWA 1NUSA 4Q7LA 1JKJA 4ZV9A 3EX7C 1IWBB 3MTIA 3MMPA 4U6NA 1PS8A 1BMDA 3EWIA 2C4KA 3AQ4A 1CS4C 4FLFA 4J76A 4KPUB 4LY9A 4QIHA 5CB4B 2HQOA 4Y9UA 5IAJA 5DN6D 1GARA 4RQBA 2VDVE 2BZSA 2FPGA 3N2ZB 5ADUS 1WSBA 2P5TB 5GZ1A 1W85A 2GD6A 4FMDB 3VAYA 3TE6A 3AVOA 3AUFA 3DP9A 3EGOA 4XTCS 1Q21A 2HHLA 3ZNPA 1XRSB 1UPTA 1V0JA 4G4GA 3OX1A 4QXMA 5HK8A 4FSXA 4ID3A 2QL9A 1C1DB 2NVWA 3DV2A 3NT4A 5GWXA 3WYAA 5C35A 2MHCA 4IIYA 1SH7A 2XD4A 1KZHA 3EJWA 1N2ZA 2AFHB 4BBPA 3VDRA 2GZMA 3AIOA 4G23A 1QGOA 4GE0A 1JAIA 1Z0SA 1BD4A 3IUBA 3T1QA 3AF4A 3P9RA 4XWGA 2E3JA 3UJNA 5C1OA 1OAOA 3T9CA 3HYRA 1KJYA 3WGGA 1E0DA 3F67A 2BMEA 1N3LA 3R44A 4JBXA 5DSTA 3C3BA 3EA5A 2J5BA 2RG7A 2X1VA 4D25A 3FPLA 4RADA 5I4IA 3ECAA 3N74A 3DHNA 5LU9A 3STUA 2BFBA 1FK8A 2VCEA 4RVNA 3CF4A 4XRRA 2Y1CA 4WI1A 1T3GA 2QKYA 1OXBB 3W8RA 2D5AA 1TJYA 1SUEA 2B1IA 4QGAA 3GGPA 4E1AA 3JALB 2V1XA 3EQZA 3B6IA 5ARDA 4ZU6X 1F38A 3G0BA 1GCUA 1FTNA 1T9GS 5I7RA 3JARA 3P2EA 1GG8A 4EA9A 2VOEA 3ONNA 2IS6A 5EJIA 1G8FA 3ZIDA 3IAS1 4XGIA 3PLNA 1WLSA 2TMGA 2WA1A 3L93A 2BR3A 1MJGA 1WP4A 4Y9TA 4AY2A 2GJ8A 2VYQA 3L8MA 4QDZA 3KU4A 1M54A 1V8FA 4KNVA 4IQGA 1QZ3A 3GVIA 3OX3A 4IXNA 1P44A 3PRKE 4RMGA 4YRCA 5TB5A 3V8BA 1OZHA 3T94A 1SHUX 4GHWA 4IDHA 2NAPA 2VHCA 2WPDA 4I1VA 4UVIA 1AMUA 3WLHA 2VF8A 3MT9A 3ZGXA 4GYYA 4C3OB 2P9BA 2A5LA 4CU5A 3AHGA 5BR4A 4EA7A 5F35A 1FFXA 3LZCA 3QWFA 1OXVA 2B0CA 1RPTA 1N5LA 3AF1A 1SELA 3F8WA 2YV1A 3M9WA 3X1JA 1GXSB 1H8ED 2HA2A 3CZ4A 2OD7A 4G8BA 3L01A 4LECA 4P98A 4A26A 4BFVA 2MTBA 4HXGA 4J4TA 4KH0A 4W7IA 4OHXA 5FLEX 5G3ZA 5IH3A 3NEAA 2SICE 3EXFA 3DEZA 1XZFA 2WTMA 3MPUA 4JVOA 3RVNA 5L6LB 3H84A 1XU7A 4RWZA 3OZGA 1CUDA 3QFTA 5HZGA 1N5IA 3CO5A 4X71A 1X7WA 4ZVLA 1RJ9B 1DJLA 4BVBA 3H5TA 1M76A 1NWCA 3FPGA 4C2BA 1XVVA 4DR3B 3VKWA 2O0KA 2EAUA 3SC4A 2GAIA 3TIVA 2XGGA 1G2QA 2CNOA 4GWLA 2WKRA 1L8OA 5B58C 1UK7A 3T5PA 3IMFA 3SEZA 2G9RA 4GS5A 1HKHA 3J80A 4Q6WA 1F3OA 2H11A 1RBYA 1EQAA 3L6CA 3UANA 4A23A 4A92A 4EGFA 1WW3A 3H2KA 1TGYA 4F3TA 3VH2A 1X9GA 4DG5A 3TSYA 1Z4MA 3MWJA 3N5CA 3IMCA 4QHSA 3KYIB 1VC2A 4UTZA 3B3AA 3UK2A 4C0XA 4QYXA 1G20A 3V6LA 3UW3A 2YMLA 2PSFA 3R0IA 2FUNB 4MLDA 3I9MA 4NCIA 5DHSA 3U0VA 5TF4A 4DDWA 5TQJA 4PBTA 2QN1A 3RGGA 1C8BA 4CR6A 2XUKA 1U5CA 1K66A 4C0QC 4HPXB 5KTPA 4C6RA 4W4TA 1HLDA 1NMSA 3II6X 2UXBB 1LDYA 3S3TA 1I0IA 1Z45A 4GQIA 3T0IA 1HYHA 5LUAA 1ULSA 5ALYA 3OQIB 1AXGA 1SCBA 3PEFA 4LDAA 1Y34E 4UNIA 1TAHA 4B44A 1R37A 4MCIA 1YZFA 1FLNA 1S3GA 4JP3A 1JDTA 1NKTA 5FR2A 1RMTA 2XT0A 5FLYA 4G0NA 3S68A 5U4XA 1E3WA 1ISPA 4KODA 5T4HA 5U4QA 4YLYA 2C7RA 4EI2A 1GQYA 5EHNA 1VMAA 4JKYA 1KYIA 4BQFA 2PNJA 1RZVA 1JR4A 3FFBA 4JB0A 4DMMA 1IU9A 1SXPA 5EIXA 3GGGA 1OBOA 4FI3C 4AQ7A 1TM2A 1WEKA 4GG1A 3G2KA 4L4UA 3EFOA 4OK3A 4Z4FA 4DNOA 4DQVA 1LH0A 3DTVD 3PC7A 2TECE 5CW2A 1Q6ZA 3CJRA 5FUQA 2IXDA 1QCZA 1VMDA 1A97A 3AONB 1P18A 4UMVA 1Q83A 3ANXA 5GJWC 3FMFA 3TKYA 3HKCA 4ZYVA 3VU1A 3KVOA 2D5BA 3UPDA 3RKSA 4NS4A 1J70A 2KSQA 2ZKLA 4BUJA 1ZIXA 4F9TA 1BFKA 3AEUB 2QMOA 5DGDA 3THXA 1FFEA 3DCJA 3GN1A 2VRCD 3PNYA 4B3IA 2Q41A 1A5ZA 1ECJA 1VJ0A 3K4PA 4LI3X 1OKKD 2H1VA 1J0DA 3FDZB 4S1TA 1L4UA 2C4HA 4W1QA 1SKQA 4CKCA 4QUIA 3IVMA 1CD5A 1XMXA 5CD1A 4MUGA 4PQEA 4KOEC 2D2XA 3VU3A 1NVGA 3HU2A 4BLRA 4W82A 4RTNA 2A1UB 3OZ7A 4GLBA 2Z5LA 3H83A 2VJQA 2GETA 4YB8A 2Y76A 1F2UB 4FBLA 1XQVA 1O5IA 1K6JA 5PGMA 2OV1A 4CKEB 3E7DA 1HDOA 3IPXA 4BZZA 4OGWA 4B3TB 3SK0A 5A4JA 1OGJA 4MWGA 3DMYA 1EUDA 2A0WA 1IQUA 3QXHA 3RRZA 3HR4A 4MI3A 2FMTA 4RGYA 3A9CA 2PBRA 1BN7A 1XTBA 2QTZA 1B0AA 4NBNA 4TYPA 4B2PA 3ACBA 4D9BA 2WNSA 3CF6R 3D2BA 4BVEA 2V9ZA 3IVCA 3UJ7A 1KEZA 2CXNA 2P6RA 1RJWA 2C9MA 1QIFA 4YTEA 1MC1A 3BL5A 4W5OA 3GRAA 5J2UA 1OE0A 2JIZA 3HBLA 4Y2RA 2IPOA 1G2IA 3ED5A 4TKUA 1FFWA 1TPZA 4FYIA 3SLKA 4DPMA 4KN5A 4LYHA 5CA1A 4ZT5A 2W83A 4A0RA 3GWGA 3NGXA 4AN0A 4JP8A 3KQTA 2FWNA 2WYWA 3BG5A 1CLUA 2GXAA 1MEOA 1XAGA 4MVJE 3LDFA 4WWHA 3UCXA 3V1KA 5BSKA 4P58A 2RGBA 2X42A 2YV3A 4HYYA 4J94A 5HXAA 1Y7IA 4QC2A 1SY7A 4JYAB 5TMDA 1B74A 1RWKA 2X4LA 1KPIA 3GCDA 3JVEA 5EP2A 4CMIB 4X65B 2CXUA 3E9ZA 5CX4A 3GCZA 5FORA 4XQCA 4ZV4A 1ZVVA 4IPTA 5ANRB 1DE0A 2FFQA 1KZ9A 3GAZA 4JLWA 1CE8A 1V47A 1SXJA 2B82A 2WFLA 2RHHA 2WUFA 3ID6C 5JO9A 4NYMQ 1X77A 3DCNA 4Q02A 1E59A 2FMFA 1WDLA 2NWQA 4PRLA 1EQUA 4MVJF 5DTEA 4DC9A 1ULHA 4EUEA 1PI3A 3VA7A 1E9VA 1E7MA 3JU3A 3NC0C 5CGZA 3H2BA 4KTTE 4PG5A 5IJ9A 2ERYA 1OPRA 2FZLA 5HM8A 2CEAA 2I2AA 2OCYC 2OK8A 2YHBA 2YNMD 2CDCA 2ZUBA 3KZMA 2NP7A 4HGPA 1I4WA 4KIFA 5IM4F 3K9LA 1L4MA 3TYXA 5LQDA 5LSAA 4O5AA 3SE7A 3TLZA 3VVMA 3BMNA 1U7PA 4DY6A 1XDBA 3J81A 2H4ZA 2FN4A 2EIHA 4GR5A 4TTSA 5LZ9A 3HWRA 3KYCA 1DXHA 1EBUA 3NORA 2BE7A 4REOA 4RXUA 1TCBA 4O4HF 1U8AA 2N9UA 5ENZA 5KQRA 3ZY2A 1KYQA 1QKKA 4HMPA 3VR1A 3T4PA 1TMOA 3VJKA 5FYDA 2XQFA 1H1LA 2G80A 4UJ3A 3RVOA 3ZZUA 4OBBA 2HMTA 1VL8A 1FMCA 4OO3A 1C7ZA 1U5BB 2OG2A 4PR0A 4MAFA 4MGEA 4BNHA 1IJKA 2CFIA 4I2VA 4FC6A 4PHGA 3UT5B 2ZR9A 5HKLA 1G64A 4HD8A 2WWXA 3UHPA 3KETA 4JYMA 1EK2A 1LS1A 3OFSA 5JEEA 1R8XA 3KP1A 5IDXA 4GDFA 3H2JA 4LBVA 1NULA 4D9CA 3WI7A 1D4ZA 2GO7A 1YS4A 5I7AA 5HQ3A 3G23A 3TCXB 3U4QB 2E5FA 4JJ7A 1JLSA 1AKMA 3VR2A 4CPDA 4E6EA 1E9AA 4BWGA 2E4AA 3K15A 2WHEA 3AKYA 5B3AA 3F9RA 4NCNA 2QTVB 5EN4A 5ALVA 5C8XA 2R7KA 5CCBA 5JYDA 2A5GA 3I8OA 2IA5A 1YJ5A 1AQ6A 4LJ5A 2J3IA 3GPIA 4J03A 4Y1RA 1JPJA 1CDOA 3AL3A 2X4IA 3FDJA 4I2NA 1SVKA 4RK4A 4C4SA 3O8CA 1BROA 2AEMA 1J09A 1W73A 2WUEA 1FSFA 3MJEA 4LK2A 4LGVA 4NFYA 5JRZA 4A0FA 5M29A 3COPA 3M8KA 2OXIA 2B37A 4C29A 2ZTUA 3QFCA 3C87A 1HZJA 2O9JA 2BUCA 2ZVQX 2Q3MA 2AXNA 3F9CA 2NYVA 4EJ0A 1G8SA 4YR9A 2E4YA 2QTGA 5AKIA 9LDTA 2UUAB 4NBTA 5KPDA 2ZUWA 2GPBA 4NJOA 1GZ3A 2Y9MB 1T5BA 1Z4KA 5JECA 2HOQA 4IUBS 4GUAA 1MAUA 2V7VA 3DZBA 1S8NA 3PU6A 4QQ8A 1UC4B 1P2BA 3B78A 5FJJA 5JAPA 2E9SA 2I67A 3AF3A 2PD6A 3I0MA 1ZD4A 1K2VN 3FTQA 1K88A 4YJ2B 4C0HA 4EHNA 3V4VB 4MUYA 4P3YA 3SJAA 4ZU1X 1TLFA 5DCLA 2XKKA 2CMDA 4XDGA 1PW5A 4MP6A 4YP7A 3UJ6A 4EVSA 4XYGA 2YJ5A 3QNMA 4S0ZA 1QF9A 1KAHA 3A1UA 3K5PA 5HQTA 1W5TA 1N1GA 2F4VB 1JI3A 1HOTA 1JP7A 2C83A 2HU8A 3JWHA 3TW0A 3S70A 4D0LB 1C81A 3KZKA 3WFIA 2C58A 4HGQA 4HBGA 2XB9A 1D2MA 1H9BA 3E9EA 3EDQA 4WLUA 2MINB 5DXFA 3W79A 4Q7KA 3MCUA 2FEKA 5CVCA 2BV3A 1AUOA 1RXSA 3IOEA 5KTMA 2Z8XA 3L0IB 5L3VA 4PNHA 3S2FA 3QBVA 2CHQA 3TLCA 1O96A 4WY2A 1IMJA 2G8LA 2XHZA 4YV7A 4FM9A 3IODA 4CM6A 4CR8A 3ZH2A 2VNJA 3H8VA 4MPRA 4QO7A 1F6WA 3S8YA 1OXKB 3K0AA 2JAWA 3IR5A 2IYOA 1L5LA 2WFZA 1ZI9A 2AN4A 4XCQA 1L7RA 1XX6A 3SFVA 1USWA 3HUTA 2ODEA 4ZU3A 3PEVA 4AY3A 1W48A 3AP2A 4ARSA 4JOQA 4YRSA 2PT9A 2JIMA 1F8UA 5ELXA 1W93A 2NTVA 4M38A 3TD6A 4C0WA 1ENPA 4ENWA 4DLWA 4U02A 4AJHA 1TCVA 3DQPA 4ZI3A 1ZR4A 4O08A 4JLKA 4XWKA 2F67A 3UGTA 2WSSD 4F3YA 4CTNA 3WTBA 4RZUA 3E9RA 4WEQA 4BNZA 4JK3A 5CT8A 3BMOB 4BC0A 4AD8A 3VO1A 4BMDA 3CRRA 3CN9A 2HF8A 3K2EA 2OAQ1 3U4MA 2CDBA 2HCTA 3VYVA 3EMBA 1PUIA 3EE6A 2WHPB 3GUVA 5HF6A 4AU1A 4AMZA 4DJTA 4JFAA 2W0MA 5EJGA 3O3NB 2NXNA 4HN4B 4EA6A 1QHEA 4PW0A 2Q4EA 2F3PA 1QF6A 2I29A 1N9GB 1F0KA 1IRXA 2WE7A 3O38A 2C3PA 3WLKX 1ZGZA 2CUTA 4RLSA 2F8LA 2P2CA 3I5XA 2PCLA 1WU7A 2QLJA 3K70B 2GM5A 2MSLA 5HE9A 4ADSG 1UK9A 4XKJA 3DYVA 3P71T 3H1GA 1R10A 2FETA 1NQTA 3X1MA 4UQLA 2EQAA 2VJMB 1V26A 1MH1A 3M6LA 1NWHA 3VH1A 5BUCA 4NQZA 1QB7A 5T4FA 4OQZA 5A9SB 1NJ5A 3RYCB 3F4KA 4F2DA 1IEWA 4BMPB 1NUPA 3Q3EA 4BQOA 3GGJA 3GMIA 2J46A 1KDPA 3GIDA 3O7WA 3TOZA 3AUSA 4IGFA 1OFUA 5ALTA 4RABA 1Q74A 1RAIA 2ZT7A 5EXSA 1O89A 3DBOB 3GWZA 4H16A 2OAGA 5DBEX 4KAJA 2XGMA 2EWWA 1HEYA 1D7AA 3BF7A 1PTJA 3CKMA 4YWHA 2OFFA 4H0FA 3KC2A 2FEAA 1YZYA 1AUPA 2IEIA 2NZWA 3LDHA 3SEQA 1CBUA 5EHZA 3CVYA 4EB3A 1H2AS 1U94A 3E3AA 1TECE 4DYHA 3SEAA 1E62A 2IXTA 3IUSA 5K3FB 4BY9E 2Y1GA 2EP8A 3OM9A 4R81A 1KQFA 3H6KA 3HYSA 4Q9DA 2Q5EA 1YZLA 1P2TA 2MU1A 2YFQA 3I2KA 1L4KA 1CY7A 1YZTA 5HFJA 3SBXA 2SNIE 5JRDS 3LTEA 4Q05A 1GQOA 2GZ2A 3HXMA 3VM6A 5IKPA 3DW3X 5NLLA 4WOKA 4N01A 1JSXA 1U8FO 3NTLA 5ALGA 3WIBA 4RD4A 3CTMA 3FKQA 4ZZ1A 2E4XA 3GV0A 1OQAA 2PZLA 2WKWA 5JNUA 5JE8A 2HL6A 4Y2YA 2IHNA 1NX6A 1M6VB 4HNAB 2XXJA 4D1YA 2IPNA 5F73A 3BWCA 4HDMB 2XWBF 1GNQA 5REQB 5CJPA 3GHHA 4BO5A 5KDOA 5CDFA 1SKBA 4A91A 3NP9A 3O2QB 4L0QA 2IPMA 4TV8F 1VZ3A 3U17A 4ARZA 2JJ2D 3OECA 1KJ9A 3C39A 1RQLA 1U7HA 4NTZA 4BKUA 2VSXA 1YL7A 1IHYA 3DLAA 1KAEA 2R6AA 4YCJA 3I01M 3JQBA 1F2VA 1DC4A 3AHDA 3PGMA 1G21A 3UTCA 1R0CA 2KHZA 1I5RA 3ICWA 3QLEA 3U3XA 1Y4SA 1NLUA 1K7CA 4IIBA 2BKAA 4BWVA 4CQMD 1MA3A 1XQ1A 3AEZA 3CJTA 3ZV6A 5KVQA 4KPEC 1N36B 1LV8A 4UAGA 5IARA 2J4CA 1RHRA 2O8CA 3V9AA 1CEYA 3FSRA 3WISA 3AHEA 3K0FA 2C8VA 3PKZA 1C7IA 1CY6A 1JKXA 5HF5A 4HDSA 4DV5B 2PZAA 3RS8A 5SZJA 4FFLA 1UIRA 3QYFA 2Z2XA 4IILA 4RHTA 1YCFA 1J8VA 2E1RA 4RL6A 4H1UA 5FLXA 5KNLA 1NTRA 3K9HA 1LDBA 3BIOA 1HE8B 1XAIA 3IOBA 2GA9A 3SS9X 3NR2A 2F8SA 1HSZA 1MABB 4WZZA 3ZQ6A 1J0EA 4GM1A 1LK5A 1UWCA 4FONA 2FG6C 4KP7A 4MV7A 5HJEA 1ISIA 1Z0IA 3HDGA 4GUDA 1D6SA 1TO6A 5DTIA 2R8OA 2WSMA 3A8TA 4KUEA 2WJ3A 2HA4A 2B8TA 1ZK3A 3WLPA 1W88B 1O94D 2XTZA 2Q7OE 4A6EA 2J7KA 3OQBA 1UADA 3SXUB 2AYYA 3QVLA 1H8EA 1YQWA 2WTBA 4R16A 4RK1A 2GF0A 1N75A 3PUWA 3IAFA 3L79A 3HU3A 5IKXA 4DHWA 1FC0A 3PFKA 2Y0DA 2AC2A 1NVEA 2OXCA 3EQ7A 3T7EA 3V8EA 3NV9A 3WL6A 1A4RA 2RGEA 4PAWA 1G5IA 1TO2E 2QM0A 3WL8A 3S4YA 1CUWA 1JYEA 4HEA1 3ZN2A 1N34B 1JHMA 3T99A 1G16A 4CDRA 1BVUA 4IL5A 1G1MA 3EXEB 3J7TA 3OMLA 1NXPA 4AT1A 1KI6B 1T3HA 1NJ6A 1UPUA 2OAEA 2NSJA 5CX1B 2DQZA 2ZVPX 3VR6D 5I5GA 2EGHA 3HS3A 3MJTA 2WMOB 4Q6BA 1M34B 3R7WA 4GI3A 5A9TA 2F1JA 4BAUA 2Z58A 1YBVA 4C6TA 5KJ6A 1WUJS 1Y8QA 3BK7A 3O84A 5BQPA 5K3OA 4DVJA 3JD0A 2VZLA 1G6KA 1ORDA 1Q0QA 2XJ4A 2XQVA 5J59A 3OM0A 4TTVA 1BXRB 2JHAA 4IJ6A 3HCEA 4KQ9A 1Y1TA 4EHDA 3CQ9A 3BERA 2HLDD 4C07A 1G7RA 3SC2A 4TUYF 2QQGA 1TZ2A 1I01A 2X3YA 2CBXA 3EZGA 3T5DA 3MJVA 5F52A 2BSQA 1TK2A 3WWYA 1DJOA 1EP9A 4II7A 4MKFA 4GL2A 1E0SA 1RW4A 1VE3A 1Y9DA 4P7GA 3DZCA 2CLLB 2HSZA 2NADA 5K3EA 4J4HA 3EVDA 1G60A 2ADMA 4WW0A 4HNHA 4QVIA 3E7XA 4WZAB 2BGKA 4R54A 3A9VA 1IG0A 2PPLA 3IBYA 1X1EA 6GPBA 1N5OX 5I45A 2X14A 4C1BA 1FBTA 1SZPA 1NW6A 4R4JA 4O2AB 1DEKA 3IAUA 3Q7PA 3E9MA 5EJMA 4K1LA 3V1LA 4KR2A 4WBXC 3QYJA 1FRVA 1G8AA 1OT5A 1E2FA 2FH5B 2PUWA 4DLTA 4EW6A 5KOHA 3OHPA 2VXOA 3JVDA 2PMBA 4WT7A 4KLAA 1JDBC 3AWIA 2OHJA 4FW8A 1M7GA 4MR8B 4G4SO 3ZY4A 5EJ8A 1JG6A 3DMFA 2IYSA 1C7RA 1NI4B 2REOA 1ABEA 3H2IA 3JWEA 4E21A 5HPYB 5I7FA 1PFWA 4R9SA 1M66A 2JBHA 2WZBA 2DCMA 3OUTA 2HWYA 3DTVA 4UUNA 4WKGA 1YVRA 4C4YA 4QODA 3MYRA 4D6YA 2QJOA 3WKCA 1JWBB 4LOIA 1U9IA 3NHRA 3O1IC 3EOBI 3LQ4A 3VR0A 3A0UA 4NU8X 3RIMA 2QMQA 3RJTA 1ZD5A 2OQ2A 3ETHA 2FA9A 1R50A 2AYZA 2QIOA 3DUFB 4YX9A 5A3QA 5JJ5A 2LP4Y 3CZCA 2VRCA 3H8JA 2Z4TA 4TMVA 4HQ6A 3BDIA 5KS2A 5B2ZA 2VJCA 5L3QA 1F8YA 1WBBA 3R6GA 2OC4A 2JFUA 4GFDA 4CMEC 2XTJA 2XR1A 3NJRA 1R12A 1J1UA 4OQEA 4F97A 3KB8A 2CYBA 3KJGA 4FKMA 4F72A 1TU3A 1F48A 2QSYA 3P8ZA 5H5JA 5CDHA 3TSWA 1XNGA 4GP7A 4YCMA 5IU6A 5H59A 3RREA 2BJVA 3