1SEPA

Mouse sepiapterin reductase complexed with nadp and sepiapterin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
259
Chain Sequence
ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEPIAPTERIN REDUCTASE
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 95
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1997-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sepA00
4J1SA 4ND5A 3JQAB 1HEUA 3O9ZA 1S7CA 4A27A 1I3NA 1RWBA 1V3TA 2Q46A 4LK3A 5BSFA 4L75A 6LDHA 3CH6A 3OJLA 3WNVA 3WSWA 2EWMA 5L95A 2C2YA 1B0AA 4FOSA 3GLQA 4HWKA 3R3JA 1PQWA 5L7WA 4PLFA 3MJCA 1C3VA 4PZCA 4GLOA 3QE3A 2ZQZA 4GMFA 3PQFA 1Z7EA 1WPQA 2VYVA 3NAQA 3GC6A 4WKGA 2B69A 5JYEA 2R00A 3S55A 2GZ3A 1Q0LA 4DRYA 3ZV3A 2FRDA 2B0JA 5L53A 1T25A 4FC7A 3VPSA 1U7HA 1PGOA 3K30A 3WJ7A 4B4VA 3U4DA 1IL0A 2EW2A 1X7GA 3H7AA 4FS3A 1LU9A 1ZKMA 2GASA 1Q1NA 4GSLA 4U6QA 4Z0TA 4RPJA 4ND1A 1Y1PA 3BHIA 4MVJD 1R37A 2PK3A 4RVDA 3DTYA 5F1KA 4DBVO 1PJSA 1U2DA 2FR0A 2OXIA 2OZPA 1X13A 3MEQA 3ZGYA 3GEDA 3DZBA 3OFSA 4BO1A 4IQGA 3H4VA 1WAMA 1PJCA 2Q2WA 4YAGA 2PZKA 4Z9XA 5G0VA 1IYZA 3KSDO 2O3RA 4JJFA 1NFFA 1O95A 2O3SA 4Y98A 1VJTA 2G5CA 3L4SO 4NBUA 2YZ7A 4URFA 3BZUA 5JDIA 2BH9A 3I52A 2W98A 2DPHA 4RVSA 4W7HA 1E7SA 5BSEA 5JCJD 3EVTA 3C24A 2YY7A 4WJZA 1BW9A 3TZKA 1JAYA 1R4NA 1CRWG 4CR7A 4TVOA 3PHHA 1HDZA 1RYDA 2E49A 1V9LA 1ZUD1 4XZ3A 3A14A 3S2FA 1LDEA 3SXPA 3OEWA 1LRLA 2Q2VA 4NBRA 5IXYA 3SEFA 3ZN2A 2YFHA 2B83A 3W4JA 3KLMX 5I9MA 4B7XA 1ZNQO 2FSSA 3A28A 2HSDA 2VNAA 3KSUA 3PJFA 4FGSA 4R1TA 4XRGA 1YXMA 4IINA 3W8DA 1YRLA 3OA2A 1PGPA 4CLXA 3OF2A 1D7OA 2O3QA 5GZ6A 5KJ6A 4WLVA 1DSSG 3HZZA 4H15A 4ONEA 3DZFA 1P1KA 3JYNA 5AYVA 1UP7A 2BGMA 5BQFA 1EFKA 4MVJG 3AUAA 1MA0A 4JP2A 1C0LA 3DONA 4RPKA 1MB4A 2HJSA 5A5EA 4GGOA 2YV3A 4Z9FA 2VHYA 3PQDA 5AXDA 1H6BA 2PGDA 2EP7A 3DBVO 4CUKA 5CDSA 3PJDA 4KWIA 2YFQA 1DIAA 2AQIA 1HTBA 2DFDA 4YYZA 3RBZA 5EN4A 5L3ZA 3JQFA 3IC5A 1GEGA 1XU9A 1BRMA 1EMDA 1GZ6A 1ISHA 4HP8A 1NBOA 5CEEA 3F46A 1JWAB 4DWVA 4K9DA 2A9FA 2Q1WA 4D7AA 3TRIA 1HKUA 3RUFA 2A4KA 4TRMA 1W4ZA 4H3VA 1XHLA 3DHNA 3U49A 2HK8A 4OXYA 3TOXA 1PS8A 5DP1A 1OMOA 1T2DA 2WD7B 4OKIA 2PH3A 5COAA 5G4KA 1HDYA 4O1MA 5MGBA 2Y67A 4U6SA 3TFQA 5A03A 1HDOA 1UAGA 3DBRB 4II2A 3NTQA 1MG5A 3UGKA 3ZWXA 1JA9A 4IGFA 3JD4A 2I3AA 1XQ1A 4PRLA 2PD6A 4S3MA 4YRBA 4CQLA 3ANLA 1MFZA 4CV1A 3F1KA 2I76A 5L4SA 3D7LA 5AXBA 1FDTA 3RFXA 3ADOA 4XR4A 3STHA 1ZK4A 1DLJA 1QSGA 2RAFA 2YV2A 4UVGA 5A5FA 4CUZA 4GX5A 1T4BA 3JYPA 4TSKA 3WGIA 2C82A 3BMNA 2CF6A 4QO8A 2CY0A 3JYQA 4G81A 4PLCA 2G1UA 3MCVA 1W73A 2VTEA 3O38A 4YJGA 5B37A 2Y99A 1DHTA 3WGYA 3I3OA 5TIIA 3BTSA 1T24A 2NU7A 4BNYA 1BXZA 1ZK0A 2F1KA 1D8AA 2NTNA 4KDEA 5CDYA 4BQPA 3SBOA 1YWGO 4W7IA 2YHIB 2W4QA 4DL9A 1A4IA 5L7YA 3RI3A 4XB1A 4ZU3A 2FZWA 5B12A 3U0BA 2VHXA 2WSBA 2CVQA 2HUNA 4IBOA 2DBVO 1YL7A 4B3IA 3QV1A 2ZB7A 3CE6A 1ZMOA 2E82A 1EVYA 3FWZA 3EC7A 2BFOA 4R5HA 5TX7A 2EJWA 1MLDA 3ZWNA 3ZDFA 3WBFA 1J6UA 4BQRA 3I9MA 4O59O 5BSGA 3L6OO 2W2KA 4FN4A 1D1TA 4HADA 3VVBA 1R0KA 4UVEA 3SVTA 5KKCA 5G0UA 4ZQHA 3GFBA 4AJJA 1ZJYA 4FFOA 3GVXA 3OQ6A 4PLTA 3RROA 4ALNA 4ZN6A 4I5EA 5IN5A 3WQRA 4DTIA 4FFNA 2PFGA 1XYGA 4BNNA 2DUUA 1IY8A 3PPIA 1EUZA 1NPTO 3L6EA 2I9PA 4KMSA 3HN7A 3CMCO 2B5VA 1LDYA 4BNHA 4L9RA 3VOSA 4W9NC 4I5FA 3KOUA 1D3AA 3C1AA 3OJOA 1E1KA 4CQMB 3K92A 5TT0A 4KWHA 1W8DA 1Z45A 2EF1A 2C5EA 3ONDA 2OBYA 4RZHA 3RC2A 1EQUA 4BGUA 1H2BA 4NG5A 3WYCA 1LLCA 3MTGA 3EZYA 4KP7A 1NFRA 1O94A 2P5YA 2VHVA 3OM9A 3RU7A 3DTTA 1ZK3A 2UYYA 4BO2A 4D46A 1E3IA 4P4NA 5JSFA 1J5PA 2BGLA 3UAGA 4EYEA 4W82A 3WGOA 4J43A 4A0SA 3FWNA 3I4CA 4BO8A 5JLAA 4AJLA 2HMUA 4AJNA 4AFNA 2IDZA 2GUGA 1AHHA 4PN3A 3K2BA 5CEJA 3BAZA 3ZV5A 3P2YA 1LQTA 1P33A 4PLWA 3ABIA 1IULA 3DB2A 1R66A 1ZIDA 1ENYA 1EUDA 1M6HA 4PLHA 5DCUA 1E7WA 4U7WA 3WLEA 3ZHBA 3DMTA 4I5GA 3GRPA 3H5RA 2DTDA 1OI7A 5ILOA 3GG9A 3D5TA 1KYQA 2P9EA 1QORA 2AEFA 1NHGA 1HSOA 1QYVA 4E4YA 5IAAA 3RJ9A 2BFMA 1DLIA 3RC7A 4PG5A 3WG9A 4MVJI 3IUPA 1FXSA 1S6YA 3S2EA 4MOWA 4P8RA 3EYWA 1K6JA 3HG7A 2HMWA 4AJ2A 1JVBA 4QFCA 1E6WA 2DVMA 1I2ZA 2R6JA 1QMGA 4M89A 3COSA 2NVUA 4ITUA 5JDCA 4YQZA 2F00A 1HYEA 2CZCA 4W99A 3RUCA 3PQEA 4JX8A 4EDFA 2WEKA 4UUPA 1VSUA 2VYVD 2YUTA 5HBRA 1AUPA 1KBZA 1GV0A 1JDJA 1ZW1A 2EG9A 3WYEA 5IZCA 1P1HA 1OOEA 3PTZA 3RC1A 3C3XA 4YJHA 1RM3A 1E6UA 2IXAA 3OJEA 3G1TA 5TSDA 4PGFA 4CODB 2DPGA 1U8FO 2NVWA 3D3WB 3JD3A 3N7UA 3HSKA 3ASVA 1XLTA 2EKPA 4IIVA 4LMPA 3IJPA 3CSDA 2GZ1A 4RCVA 3OBBA 5CG1A 1LRKA 4Y9DA 1H6AA 2GSDA 2EW8A 4YVFA 1OFGA 4YBZA 3L07A 3PIDA 1KVTA 5EQDA 3L6DA 3E5RA 2O3TA 3HWRA 4HKTA 1GZ4A 4YT2A 3ROMA 5A3VA 3V1TC 4J4TA 4PLYA 3WQSB 1A5ZA 1VKNA 3OIGA 4HNGA 3D0OA 2O7SA 5FI5A 5I9NA 4BNTA 5DULA 2I5PO 2E6UX 3F5SA 4K28A 4CLRA 4ALMA 3GEGA 4J0EA 4IDFA 5JPIA 2OOSA 4L0QA 4GWKA 2FPIA 3RBVA 3I23A 4IM7A 3WFJA 3W6ZA 3QWBA 3DAGA 2VUUA 4RJTA 3NX4A 2X7HA 5HRUA 2ZTUA 1LXCA 3OMLA 1BVUA 3PVZA 3VH4A 1I8TA 4MINA 3A4VA 4ALKA 4J16A 4MKZA 5IN4A 4J2OA 3KEOA 1KVUA 1O6ZA 3AUUA 3NTRA 5BNFA 3V2HA 2O4UX 3O8QA 3VZQA 1E1LA 4DUPA 1PS9A 2Y1CA 4RQUA 2DBQA 5HWSA 4BNJA 4YEDA 1YJ8A 2O4CA 4ZJUA 2EP5A 1Z74A 2DM6A 2JCVA 4CL8A 1L7DA 3HDYA 3LZ6A 4PZEA 1HLPA 3V1UA 4BB6A 1D1SA 3KYCA 2HK9A 3B20A 4ZICA 1WVGA 4C7JA 1L1FA 4J7UA 2NADA 2Q50A 2ZB8A 4IXTA 2NWQA 1OC2A 3AK4A 4AG3A 5IG2A 1YBAA 3KZVA 1VL8A 1LQUA 1RM5A 4XWYA 2WTBA 4YAIA 1PZEA 1CF2O 4ZD6A 5AOVA 1MXHA 1DC3A 1SC6A 1QYDA 2VZ0A 4LSWA 3RUEA 1HDXA 4UEJA 1U4SA 3OQBA 2NQTA 4PIVA 5A06A 5KJCA 1XR3A 4CM8B 2IYPA 1GD1O 2P4QA 1C14A 4EUFA 3PWSA 5A04A 4BO6A 1E6EA 3LYLA 1SOWA 5HA5A 5TNXA 1HL3A 2P4HX 3ZV4A 3NEPX 2WM3A 1PU2A 1V35A 4L4SA 4KTVE 3T4EA 4CV2A 1KEVA 1X7HA 1YQXA 4IPTA 2DAPA 4Q39A 2GERA 4B3HA 8ADHA 1HDCA 2HRBA 3AM4A 3C1TA 1PJQA 3RSHA 3BIOA 1RJWA 5JFOA 3PGXA 2D59A 3H8VA 2IRWA 3WNQA 2Y93A 3NT2A 1GAEO 3DZKA 4II3A 4YAKA 2QZ9A 2JCYA 1HE3A 1H6DA 3WJAA 4ZRNA 1CWUA 3DZJA 3P5SA 3SC6A 3NT5A 4KUHA 2H6EA 2HCTA 4E30A 2DBZA 4O6VA 5K0ZA 3E1KA 2NV6A 2ILTA 1CEQA 2V65A 1MC4A 3K2EA 5C7LO 2D4AA 2ZCVA 3KSZO 4XQCA 1WP4A 3GK3A 5B4UA 4BNXA 2V6GA 1V0JA 2H63A 3L9XA 2WYUA 3DO5A 3WR5A 4JJGA 2CNBA 1J4AA 1VL6A 5A9SA 3ZI0A 1MUUA 1E7YA 1M2WA 1TT5B 1YBVA 1FDSA 3FNGA 5DBIA 1E92A 3WQQA 2PD4A 4BMNA 2Z1MA 5TT1A 1YO6A 3GOHA 5CG2A 1KEUA 1N1EA 4BKPA 2V6BA 2QG4A 4RLHA 3MWEB 2HAEA 4CMIB 2GN9A 1WW8A 1B15A 4OL9A 2NQ8A 3UH1A 2ZKLA 3PZBA 1I24A 1QXSA 4MVJM 1NYTA 4CMHA 3AOEA 3ZHYA 2X86A 4MP8A 1GEEA 4P4GA 4X54A 2Y1EA 3DR3A 1ISFA 1E77A 2OHXA 3GA0A 3EVNA 2BFAA 3M2TA 4GX2A 4NFHA 3CINA 4MO2A 2BLLA 3WIEA 3TWOA 3IAHA 2VUSA 3PYLA 4O0LA 3ZWBA 3MJVA 4CMIA 4Y67A 2AEJA 3JQ7B 2J8ZA 2JFGA 2OBNA 3HDQA 3LT2A 2C54A 4CMKA 5JW6A 3W4IA 3GNQA 1R6DA 3OP4A 4DMMA 4WOJA 3V2UA 1Y5RA 4FJ0A 2QRKA 5I8ZA 1AN9A 3KETA 1AXEA 5A9RA 3H2SA 3KYDB 3NGXA 1I3MA 3GDFA 1GDHA 5IDYA 2C29D 1P44A 4LGVA 3ZU3A 1SO8A 3ZU2A 4U5QA 4E5PA 1YOVA 1NQAO 1K6IA 5TJ9A 5J23A 1VC2A 2VYNA 3IS3A 2IZ0A 1UP4A 2YQ5A 3HUDA 2VQ3A 4GSKA 4OM8A 3U5TA 1NWCA 5CPBA 4XDZA 4D43A 2JD1A 1IOLA 1EK5A 1O8CA 4FD3A 1DJNA 1HETA 4FQ8A 2I99A 3C7CB 4YACA 4OSOA 1BXGA 4M86A 4IMRA 1W0CA 2QW8A 1GPDG 3HFSA 3NT4A 4XB2A 1Q0HA 1SBYA 1LLUA 2IE0A 1KVRA 2D5CA 2VHWA 1Z75A 3JD0A 1ULSA 4UREA 1E3WA 4YT5A 1DXYA 1VE9A 3DAPA 3JYLA 3WB9A 1PJ3A 5KVVA 3ZH2A 1MC5A 2DKNA 1HE5A 2C2XA 1WDLA 1O0SA 2D5AA 1DB3A 4NDNE 2VRCA 3HADA 1ZH8A 1T1RA 1ZXLA 1C1XA 2PV7A 2XXJA 3ZU5A 3SLKA 3E9QA 2VWPA 3D4PA 1DIHA 5K9ZA 4IS3A 3GGOA 4F6CA 1IPFA 2BHLA 1ZBQA 4JK3A 4UEKA 2AXQA 3K96A 4GWGA 3W4KA 1SB9A 4ZQBA 1I32A 4YJFA 3ROQA 2BI8A 1GL3A 1FMCA 3VPHA 3ZW8A 1EEHA 3S8MA 1EVJA 3EAGA 3H3FA 3QRWA 2W8ZA 1SCUA 3WIDA 4BNLA 1KY4A 4CUJA 4BV8A 5TGDA 4BKRA 4NH4A 1HYHA 4XEHA 5T5QA 1HZZA 1A7AA 1O89A 2AMFA 3GNTA 3PXXA 1TEHA 2Q1SA 3RUAA 3W6UA 2PKRA 4XQEA 3I9LA 2ZJ0A 1ZEMA 3GZNA 1B2LA 3DHYA 2OMEA 4WK6A 4RORA 4D3DA 2P9CA 1LDNA 4J2HA 4PVCA 2JAHA 5F3RA 1LLDA 4QTZA 2ZQYA 1P0FA 1XQ6A 4QECA 1BMDA 1JKIA 2VOJA 3NDJA 3DMYA 4OHUA 1EDZA 4PG4A 3ORFA 4RPHA 5CHEA 5COBA 5H81A 1BW9B 1ZFNA 3INTA 1P45A 4E13A 1R4NB 1UUFA 1U2GA 3GN1A 1C0PA 2ZYDA 2NU9A 3ZWPA 1T2EA 2HRZA 4QXMA 1ADFA 3FBGA 1GUFA 2X23A 1GCUA 1I30A 5F5NA 5IXSA 3BHJA 1IPEA 3OIDA 4ALIA 1LLQA 1ZSVA 4MVJF 1YB1A 2GRAA 1JWBB 3LT4A 4R69A 1BWSA 1PTJA 3OECA 3M6IA 3IQDB 4Q3AA 3JQ8A 3QVSA 3E82A 3OEYA 4BNKA 2AG8A 4JROA 2NVBA 1AE1A 1I01A 3PYMA 1LEHA 4NJMA 4JXKA 3TFOA 3QQPA 3IP1A 3GVCA 4CLEA 3VDQA 3GAZA 3CKYA 3S2GA 5T8KC 2TMDA 4RF2A 1LSOA 5CDTA 5DF1A 3PLRA 2IODA 3JQBC 4PG6A 1EFLA 1I0ZA 2WD8A 5AVOA 3DFUA 4H7PA 5A4DA 3UCFA 4PFJA 3ZWWA 3F3SA 4Z3DA 4NMHA 4LRSB 2B4TO 3HDHA 1E7RA 4N54A 4JNKA 3M1AA 2PR2A 4RF5A 3Q2IA 4J4HA 4E21A 1R4MA 2D1YA 3PP8A 4R9SA 4CM9A 5A05A 5JYDA 3F5QA 4B7UA 2C7VA 4FW8A 4H16A 5EERA 1HE2A 3GDGA 5AXAA 5AXCA 1NVTA 4JLWA 4WLUA 2ZIZA 4DPKA 2RBEA 1M76A 2HQ1A 4CM7A 3V1YA 2OP1A 3S2IA 3JQ9A 5H83A 2B4QA 1GPJA 2GN6A 4IZHA 5G4KB 4OSPA 2H1SA 1WZEA 4AJOA 4FSHA 5ES3A 1UP6A 4J7CA 1DDOA 2HKIA 4BKQA 1JAXA 3KTDA 3WGHA 1AXGA 3LC1O 1VL0A 4HFRA 1X1TA 4CL3A 4F46A 1Q2XA 4E32A 4DPMA 4CQLB 1I5RA 1QRRA 1GZ3A 3H9EO 1E3EA 4AL4A 1KC3A 4NU6A 2DC1A 1F0YA 1CYDA 4NU5A 1NTOA 4WCFA 4XGIA 2QYTA 3B1KA 4DBZA 3BMNB 3GMSA 3K5PA 2X5JO 2JHGA 2Y68A 3H5AA 3RKRA 3ETGA 4J9VA 1NXQA 3OETA 4A03A 4KQXA 1SEVA 4YJGB 2DT5A 4TKMA 4CLDA 2I6TA 2FY8A 4DREA 4UULA 5TF4A 2ET6A 3AM3A 4R16A 2R00C 2X0IA 3I1JA 3ITKA 2X58A 3UKOA 4CMAA 3GUYA 4Z9YA 4DLAA 1DFGA 1UDCA 4DGSA 3EGOA 2Q4BA 4Q3DA 4M8SA 5B4VA 4AVYA 3IIEA 5BNIA 1U3WA 3D5QA 4NBWA 4DA9A 4IXWA 4IDBA 1H6CA 3M1LA 2Y0DA 4WNIA 1QLHA 1VRWA 3ANMA 4MIEA 2CMDA 1Y9AA 2A35A 2Z95A 5ENVA 3V8BA 4CMCA 2QYSA 1ARZA 1DIRA 2EV9A 2NNLD 3VH3A 2EIHA 3BTOA 4G5HA 2G17A 2W2KB 3DFZA 1PL7A 1F06A 3ZV6A 3VPXA 3LF2A 4CR8A 4QT0A 4TQGA 3OA0A 1G0NA 2ZATA 3HNPA 3T7CA 4CJXA 2BRUA 2AA3A 4F45A 4BNIA 9LDTA 5JDIC 4EEXA 3DZGA 2PNFA 3DHEA 1OBFO 3NDIA 3WYBA 4J6FA 4P38A 4UVIA 1VPDA 3C7DB 4Q3BA 4YDRA 5DNAA 1N5DA 2EERA 2FN7A 4NBTA 1PGQA 5JO0A 5L40A 2GDZA 4RPGA 4GKVA 3FPLA 4NR0A 3GZ4A 3KHUA 4Q3CA 4E5KA 4XYMA 5HS6A 1HYGA 2VZ8A 1Z7BA 3ZNQA 2ZYGA 3KRTA 4TZTA 4PLZA 4IMPA 4TROA 2PKQP 3DC2A 3CEAA 2X1HA 3PWZA 3VKVA 1F8FA 1O5IA 2IZ1A 5GZ1A 2J3KA 3E9MA 3PDUA 1YDEA 4EI2A 1N1GA 1LDBA 4RF3A 2Y1DA 1B8VA 2PGLA 1ULUA 3GRKA 4GQAA 3F1LA 3FTNA 4D3FA 3ON5A 4LCEA 2QIOA 5CDGA 5DOVA 2YDYA 4CR6A 1ORRA 3RFVA 4AJKA 1Y6JA 4OQYA 2EKQA 3EW7A 1LDGA 1NASA 1X1EA 4XCVA 4XGKA 1B26A 4RVUA 1KY5A 1GCOA 3HJAA 3ST7A 4MP3A 2UAGA 1UJMA 4J49A 4JBHA 4YWJA 2DTEA 2C7GA 1T2AA 3PI7A 1N7HA 3DZHA 4N5NA 3IOYA 4M1QA 1K5HA 4XJSA 1KOLA 3ITDA 1QV6A 1B16A 3S1LA 3OSUA 1Y8QA 4Y8VA 2P68A 4XYLA 2BD0A 4FJ1A 2VYND 3Q0EA 1YONA 2PLAA 3O03A 2VWGA 3PEFA 5I7VA 4XA8A 1PL6A 5ER9A 4E3ZA 5G0WA 3GF4A 3L4BA 2ZK7A 3KLPX 3JQFC 3K8ZA 4ALJA 4HBGA 3DOJA 4PLGA 3TN7A 3HB4X 3MOGA 4LSMA 3PYXA 5B4TA 4UAGA 1HWYA 4CM3A 2AQKA 3ZU4A 1FDVA 3KUXA 4E5NA 3AWDA 5DBFA 3E18A 1CDOA 1N92A 4IGEA 4OH1A 3AW9A 4J3FA 1I10A 3ROKA 2RIRA 5DBGA 3RJ5A 1EBUA 2NVUB 4MVJH 5C7OO 3RU9A 3E03A 2FR8A 2ZB3A 1K0UA 3GUCA 4KUGA 1E0DA 5LDGA 2BGKA 1LDMA 1EK6A 4BKUA 1P31A 2C5AA 4LVCA 3TZHA 5IZ4A 2VRCD 4EITA 2HO5A 5DZSA 1G1AA 1Z73A 3LT1A 4GI2A 2PD3A 5COQA 1UXJA 4WPGA 4YJHB 2Z1NA 3GQVA 5FF9A 2I65A 2FMUA 4S1VA 4CM4A 3RFTA 2AQ8A 1NNUA 2XOXA 2NTVA 3BMQA 4Z0PA 3JTMA 3ZHXA 3C1OA 3JQ6A 3DZIA 5I7EA 1YKFA 3KXDA 3MTJA 1JTVA 4I9HA 3RCBA 1J0XO 1JKFA 4R51A 4GMGA 2TMGA 3D4OA 2J5KA 4PLPA 4PG8A 3FPCA 4W6ZA 4DC0A 1E5QA 5TLSA 4RGBA 1YGYA 2VWQA 3F4LA 4GL4A 3H9GA 4P22A 1OAAA 2E48A 2GGSA 3G17A 4J1NA 4DYDA 4MKRA 4WGGA 1IUKA 1FJHA 2X22A 3AU8A 4CLRB 1GYPA 4L76A 3RQSA 3O26A 2GCGA 2WE7A 3RIHA 1JKJA 4AICA 3B6ZA 1KVQA 3I6IA 4LN1A 4YT4A 2GZ2A 3SJUA 3B1JA 1C0KA 5KJ1A 4BOYA 5CFZA 4A7PA 2PA3A 5DP2A 4YRDA 2NUAA 1NHWA 5EPOA 1UDBA 1NX6A 2GNAA 2IEBA 1Q7CA 2XPCA 3HB5X 4NZ9A 5IDXA 4IJVA 5KOIA 4F6LA 1QKIA 1DRUA 4BNGA 3FBTA 3O8QB 3KVOA 3QWFA 4ZQEA 3MWDB 1GY8A 3KBOA 3GFGA 4QO7A 5A1TA 5ADHA 2GPTA 2CF5A 3AOGA 1YB4A 2IEDA 4KZPA 1LSJA 1IHYA 4OJNA 1B3RA 1BHSA 1UZNA 3BMCA 1TVEA 4M87A 2AEMA 3TL2A 2VCYA 3VVCA 5JNLA 2AE1A 3KYCB 2QHXA 5CEFA 3JD2A 3WTBA 5EMHA 2JAPA 2I3GA 5JY6A 5CDUA 1P9LA 2J3HA 1YDWA 1HLDA 3QWHA 2RH4A 4BGIA 2Y05A 1K6XA 5GMOA 4EJMA 1CJCA 4XYBA 4BO5A 1TB4A 2E4AA 1IZ0A 5ICMA 1JU9A 1CIVA 4XGNA 2SCUA 1A71A 1B3BA 1U5AA 4RPLA 4D42A 1U7TA 3IKTA 4BNVA 5JC1A 4ZHSA 4UVDA 3SLGA 5EIOA 3U3XA 4XIJA 4I08A 3R3SA 5TJHA 3AU9A 4R01A 4FOOA 3RWBA 4YB8A 4BO4A 1VLLA 5BNTA 3F9IA 3KB6A 4Y6PA 1DRVA 1HSZA 1I2CA 2O50A 4R5MA 5TRTA 4ND3A 5ENDA 1ENOA 2YYYA 1ADGA 3OJFA 3FNEA 3R6DA 2W2LA 3ADPA 4HV4A 1C1DA 2DTXA 4E5MA 1UXKA 3IUSA 4O5OA 4CMGA 4CM9D 2PGJA 4D3SA 4XYGA 1P1IA 3I83A 3AFNA 1VM6A 3HFGA 3N74A 4CMJA 4EGFA 4DMLA 3JYOA 3WGTA 5KJEA 1Q0QA 4BNMA 3IP3A 1NAIA 2GF2A 2VUTA 2AQHA 2J3JA 5DCWA 3UW3A 3DXFA 2V6MA 1B7GO 4FIZA 1SAYA 4R1UA 3DMTC 3ONFA 1PQPA 3WGGA 1QYXA 3D3EA 2OFPA 1XDWA 5K6AA 3GVIA 8LDHA 1XEAA 2QRJA 3VTZA 4B4WA 4RV9A 3TNLA 1FF9A 1HRDA 1PWZA 4U0JA 4CMEA 3R1IA 4PG7A 3DBHA 2CVOA 4D41A 2QZZA 5G4LA 5C3MA 3LLVA 1NWHA 2X4GA 4J0FA 2HLPA 1C0IA 3GDOA 4JGBA 4FB5A 5KJFA 5JS6A 1O9BA 4OAQA 4GAEA 4XX0A 4RDHA 5THKA 3P2OA 5KNLA 3JCZA 4IIUA 2YHUA 1EZ4A 2C20A 5A9SB 5LC1A 1PR9A 1XKQA 3GNSA 3NYWA 1EVZA 2EXXA 3NGLA 4EW6A 5JDCC 3JQGA 1XA0A 4KTTE 3D1LA 4HFJA 4I5DA 3WGQA 1PJTA 3OHSX 1JVSA 1P74A 1E7MA 2JFFA 5EINA 4EJ6A 3AUTA 5JO9A 4C7KA 2O2YA 5IZCC 1KEPA 4UUNA 4NK4A 5JAQA 3TJRA 4BO3A 1IE3A 2C59A 4E2YA 4XD2A 4MVJE 4NJOA 4U0KA 3WOHA 2YV1A 2AE2A 2X0JA 2X6TA 3BMOA 1LRJA 1Q7GA 4NFSA 4PLVA 3RUDA 5A02A 3M2PA 2LDXA 1DOHA 4BNZA 4XIYA 1Y7TA 3CXRA 3VH2A 3BTVA 1V8BA 2BKAA 3PJGA 4TRNA 3HQ4O 1H9BA 2X5OA 1DAOA 3ZNOA 1ZK2A 4JIGA 3GVHA 4DC1A 3QVTA 4B4OA 1GQQA 2BI7A 4BO9A 5GY7A 3A06A 1P1FA 2X9VA 4BUCA 1LUAA 4YQYA 2JKVA 5DN9A 1XG5A 2UDPA 4GBJA 3RD5A 4FFRA 3WFIA 2RCYA 1N9GA 1XU7A 3E6AA 1H93A 1I36A 4FDAA 2EJVA 4TZKA 1M6WA 4C4OA 4OOFA 2VT3A 5I8WA 3BHMA 4ALLA 2FR1A 1DHRA 3FCOA 1YOVB 3KEQA 4FR5A 4E2ZA 1GADO 2QQ5A 5L4LA 1YE3A 3K6JA 5LDHA 1W6UA 3AY6A 4YT8A 1E7QA 1QLJA 4GH5A 3L77A 4JBGA 1P77A 1YL5A 5ITWA 3VKUA 2EGGA 1YQGA 3GY0A 4L8VA 3KO8A 4UVHA 1DBVO 1DRWA 3WDSA 5CPFA 3I6QA 2PTGA 3LLSA 3DEYX 1PZHA 4WLEA 4J90A 1BXGB 2YDXA 4WECA 1LX6A 4E0BA 1BDMA 5T6BA 1CETA 4IQ8A 2NACA 4ROSA 4ID9A 2AHRA 2FP4A 2JCXA 3I9OA 1E3WB 1ONNA 5L9AA 1YJQA 3ZW9A 1R15A 4DLLA 1WMBA 1E1MA 1WZIA 5TS3A 5ICSA 4NK5A 4FC6A 5F1OA 3QWIA 1Y5MA 3ZWMA 1K2WA 2EGHA 1QYCA 3WICA 2O3UA 5FFFA 5L4NA 2UVDA 1Z82A 1C1XB 1ZSYA 1DC5A 4I1IA 3PFFA 4E2WA 1GYRA 2G82A 2WE8A 1I33A 3AI3A 1RM4A 1LNQA 3U9LA 2JJYA 4FJ2A 5EL0A 3Q11A 1XGKA 1YB5A 3JSAA 2OUIA 2X9GA 4YJFB 4DYVA 3WMWA 2X9NA 4DPLA 1PJ4A 3BXXA 3Q9UA 4FGWA 5FEUA 1X0VA 4B79A 1GUYA 5G0SA 3ZWOA 1U1IA 2WYVA 2W90A 3MOIA 1DC6A 4IS2A 2BMAA 2Q45A 2EEZA 1EE2A 2CUKA 3O4RA 2CD9A 1PX0A 1T1SA 4I9UA 5TQVA 3NUGA 3QY9A 3ZWCA 4XRRA 4M55A 1T2FA 3GZNB 2CDCA 1P1JA 4GX0A 4D0SA 7ADHA 1XSEA 1M75A 5JAIA 2B5WA 3TF5A 3LVFO 4A73A 2FOIA 4JQCA 2FSVA 4BNUA 3ETDA 1YH3A 1PGNA 3GHYA 4QFDA 2D8AA 1JN0A 2HDHA 2Z5LA 1Y8RB 4LCJA 3UUWA 2VT2A 4NPCA 1PJ2A 3JQEA 1CQJA 1P3DA 2OORA 4WLOA 3RASA 4Z3KA 5L7TA 2CFCA 1PZGA 3GN2A 1NVGA 5BSHA 3MJEA 3JQ8B 3ASUA 3VPGA 4FPXA 2D0IA 1X14A 4J91A 3WS7A 1WDMA 1QYWA 2JL1A 3ZNPA 2HJRA 2OO5A 3JQCA 4KDFA 4NJMB 2HMTA 3JQAA 5BT9A 1U28A 3X2EA 1Y8RA 1LC0A 1QP8A 3AOEC 3VTFA 1D4FA 3UICA 4OIMA 3GH3A 1ML3A 4GVLA 4RO0A 1VJ0A 5FI3A 4CM6A 4Y6SA 3I9JA 1WWKA 3Q6IA 2AW5A 3ENNA 4WASA 3QHAA 3E48A 3LC2O 4BO0A 2IYOA 2ZTLA 2A92A 3UCXA 3UN1A 3ZWAA 1BTOA 4RZIA 2FHSA 3PHIA 2FPPA 2C0CA 2H5LA 1ZVMA 1N8KA 3PGJA 4N5MA 3E9NA 3WXBA 4WLFA 1R4MB 1CQIA 4EUEA 4IY1A 4NQZA 4A10A 1TI7A 1LSUA 2WJPA 1LSSA 2PWZA 1ZEJA 4ZVVA 4NHEA 1J49A 1BGVA 3IJRA 1GTMA 4CV3A 4OXKA 1P1RA 3I5MA 4B3JA 2NTJA 2PZJA 2V7PA 3QW2A 4A5OA 3W8EA 3ETEA 4BS9A 4EJ0A 1TA4A 4WLNA 4YTEA 3RUHA 4FCCA 4PVDA 3N58A 4R9RA 5THQA 3ULKA 3CIFA 1WDKA 4D79A 1YQDA 1MXFA 4J7XA 1T2CA 4J4BA 3IDSA 4BNFA 5F21A 3RVDA 4DIBA 3WSVA 3K31A 3LSYA 1SNYA 3GGPA 5IFLA 5BR7A 1NR7A 1IZ9A 2EKLA 4WCFB 3WX0A 4DQVA 5ER6A 4PRKA 1PQUA 2W2LD 5B1YA 2EHDA 3SJ7A 4W9NA 4JBIA 4Q3NA 1UDAA 1PZFA 3NKLA 4XDYA 1UXHA 3E5MA 1UZMA 3F4BA 4L4RA 4NI5A 3WWYA 2PY6A 3KM0A 1UAYA 2AG5A 1HF3A 3EMKA 4R1NA 2VNSA 3CUKA 1WNTA 3H9QA 1ZCJA 1ONPA 3UXYA 1YL6A 1HDGO 1EBFA 2Y0EA 3PDJA 5JXWA 4I8XA 2ZTVA 2NSDA 3ENKA 1ISIA 3VZSA 2O48X 3IKVA 3F6YA 2X0NA 2XXBA 4Z0HO 1WXDA 1UZLA 1NM5A 3I9NA 3CMMA 2IZZA 1U9JA 2DFVA 5T67A 4TWRA 3PWKA 3DQPA 4ND4A 1WMAA 1DIBA 4K1LA 4D44A 4R3NA 1E3LA 3DWFA 1F17A 1HDRA 4RVGA 5HTOA 3TL3A 3GGGA 1KIFA 4AJIA 3FI9A 4UUOA 2UV8A 5A9TA 1NP3A 2BF7A 4CMBA 4KOAA 4JJIA 2I66A 1VI2A 3LK7A 1A72A 4BMSA 4CLHA 4U8GA 1YS4A 1SEPA 2V6FA 3AI1A 3EY4A 3ONEA 3T7EA 3VH1A 4ZRMA 3JQDA 4IJWA 4MKXA 2B36A 3LU1A 3Q2KA 4XKJA 5ILGA 1SZJG 2LDBA 2Y0CA 3TZCA 1LTHR 4L73A 5JE8A 4IDDA 2WD7A 3U4IA 5KVQA 3W1VA 4TRJA 3RBXA 3AM5A 3B70A 4KQWA 1DFHA 1NR1A 3MZ0A 3ANNA 3DBRA 3BTUA 3PK0A 4E5YA 1U5CA 1LI4A 1N7GA 1PGJA 3RAJA 1LJ8A 2GYYA 6ADHA 4O63O 2OGUA 1A9YA 3OIFA 3A1NA 3Q3CA 2VN8A 2J3IA 4E12A 1R0SA 4FBGA 2O7QA 1RPNA 1WLYA 1GUZA 2X5KO 4G2NA 4P4LA 3TQHA 1N2SA 1SOVA 4NIMA 5A3JA 4L74A 2O2SA 1EE9A 3OJ0A 1X7DA 2XF8A 3TZQA 4Z6KA 3H2ZA 5JCXA 3VDRA 1OC4A 3TOZA 3GPDG 1PS0A 1E3SA 1MG0A 3U62A 4F3YA 5KVCA 4FFLA 3QVXA 4CM1A 5MDHA 4Y6RA 4XR9A 1ADBA 2YW9A 4HX5A 1SMKA 3SC4A 1E5LA 1Y8QB 2Q49A 3CPSA 1P0CA 2POQX 5I9LA 1LBEA 1PR3A 1FK8A 3K73O 3BYZA 2YHIA 1NQTA 3NJ8A 4QX6A 1U3UA 5CAEA 3GR6A 4EEZA 3PFWO 5DOZA 1E3JA 1KVSA 1HT0A 4K6FA 3WGZA 1IB6A 1QV7A 3PJEA 3ZHZA 5KCZA 3SX2A 5U1PA 4YRAA 1Y9EA 4N5LA 5T57A 4G65A 3H6KA 4JCOA 3L0DA 3VC7A 4RDIA 1ZSNA 9LDBA 3GEMA 4TRRA 3TDKA 1JW9B 1H5QA 4IJUA 3CZMA 3DDNA 3FD8A 3JQ9C 5HM8A 1M66A 3HHPA 5U4QA 1BVRA 1RYEA 3A9WA 5KTKA 4E33A 4W4TA 1A27A 3MJTA 1M67A 2Q1UA 5L51A 5TC4A 3WTCA 4GGPA 4TVBA 1IHXA 4R4JA 3ZWVA 2HK7A 1B8UA 1X0XA 4BB5A 3Q9NA 4INAA 4RL6A 4CM5A 4TMFA 1KS9A 2ZB4A 3HN2A 5ITVA 4CM4B 4BGEA 2VRBA 2WWRA 4BL5A 1Y81A 4WCFC 2DUWA 2Q3EA 1V6AA 3BMQB 3VHRA 2UUPA 1Z6ZA 5JMPA 2OL4A 2O3JA 1X15A 4N7RA 2CVZA 3W8FA 4CQMA 3UVEA 3PIIA 4IDCA 3ROPA 3RUIA 2X0RA 3IL2A 3P19A 4NBVA 4TKLA 1A9ZA 5F5LA 3G0OA 4LMRA 3BA1A 3I4FA 1I2BA 3H5NA 5JBIA 1UXGA 3QA9A 1BDBA 5KKAA 2R2GA 4EUHA 3INRA 4MPDA 3NRCA 3PHJA 4YPOA 3LF1A 4YCAA 1MP0A 4MVJP 4BKOA 1XCBA 5T64A 3FNHA 3JV7A 1XELA 4MIYA 4OMUA 2CDBA 3ZWYA 1R12A 4L4XA 3NV9A 1PWXA 4OYRA 5FWNA 2J5RA 3KV3O 3GG2A 3AY7A 1TT7A 4GX1A 4DLBA 2B4RO 1DIGA 1CERA 1L7EA 4MP6A 1RM0A 3AY3A 4BMVA 1XWFA 3AFMA 3UF0A 4BNWA 1AGNA 1VSVA 3FN4A 3QWAA 4PZDA 2ZTMA 4EBFA 1U8XX 5JC8A 3BMCB 4R3WA 2GD1O 2VTDA 1ISMA 3VPFA 1F8GA 1GV1A 1SB8A 4M49A 4MVJA 2QX7A 4IQ0A 4Q9NA 3FNFA 4GVXA 2Y1OA 2ZYAA 3WMXA 4HY3A 4RVHA 1ID1A 2G0TA 2JD2A 3H65A 3HDJA 4OO3A 3LDHA 3ICPA 3JQAD 2GN4A 4AJHA 3DOOA 1U3VA 2WMDA 4OGWA 4OXNA 4E2XA 1DEHA 2GN8A 1BG6A 2HMVA 4BO7A 1HZJA 4B7CA 4DIFA 2Y66A 1SPXA 1V3VA 3MJSA 4OKNA 3UCEA 4DQXA 7MDHA 5EQFA 5JCJA 3OQ1A 1GFSA 2BFPA 1FDUA 2JHFA 3U4HA 1MV8A 2PZMA 4IDGA 1GYQA 4R1SA 4RVFA 1NAHA 3JD1A 4WE3A 4MDHA 3GHHA 3D3WA 5L45A 1C1DB 3DAFA 4QSMA 3F47A 3V5NA 3G79A 1G6KA 1PL8A 3QVWA 4A26A 4B8WA 3UOGA 2Q99A 1NQOA 4JN6B 4IDEA 4ZQFA 3RC9A 3TSCA 2RHCA 1MGOA 3G1UA 4HFMA 1KEWA 3TZ6A 4KUEA 1ZZEA 5U9CA 4YAEA 3PRJA 1BXKA 3QVOA 2WYWA 4R41A 1NFQA 3EDMA 1NVMB 3QLJA 3EK2A 1EUCA 4BHTA 1EVIA 3FR7A 4LVUA 4ESOA 4YXFA 1MFPA 3L4BC 4HFNA 4XYEA 1OZAA 3T4XA 3LQFA 3DBHB 3FSRA 1NPDA 2CDAA 2GO1A 4YAJA 5IJZA 3DL2A 2P2SA 2YQ4A 3E8XA 1NPYA 4E6PA 3FRJA 1BSVA 1TLTA 3FR8A 5EESA 1HXHA 4J1QA 1UH5A 5KWEA 3AJRA 3C8MA 4B8ZA 2VOEA 3ZZNA 3C7AA 4XJTA 5AQ1A 3JQGB 4QEDA 5IDQA 1DJQA 1DC4A 2P91A 1NQ5A 1AHIA 4DXHA 5I7SA 3G3EA 1H2HA 1EDOA 1ZMTA 1LC3A 4WEOA 1ONOA 4OQZA 3WLFA 1B14A 1QR6A 4UUMA 3CZRA 1PEDA 1GQ2A 3KYBA 1VJ1A 4XQGA 2E37A 4HUJA 4UEOA 2YJZA 3VZPA 4ZA2A 5C5IA 2PH5A 3B1FA 3OICA 3BMOB 3PZRA 1ISGA 2B37A 3H3JA 4QUKA 2IXBA 2OP0A 2P9GA 3FTPA 5H82A 2VHZA 1GU7A 3VAZA 1K89A 1T4DA 4FFPA 4EZBA 5JAMA 3NDRA 3FHLA 1T26A 2DU8A 4WCDA 4YR9A 5I7FA 1F12A 2BELA 4CM8A 3K9QO 4IJKA 2GR9A 3UHAA 5IF3A 4CLOB 5JAZA 3QIVA 2UUOA 3R0IA 4WUVA 1MX3A 1V3UA 3WWZA 2WDZA 1XIVA 2Y1FA 4D0RA 1UR5A 3QP9A 1H94A 1I3LA 2NU8A 3Q1LA 1GR0A 3EHEA 4A2CA 2VZ9A 4FFMA 3DOCA 5IDWA 5DDIP 1N9GB 4N18A 5DCYA 1ZJZA 4E31A 4DIOA 2JFHA 3INGA 2PZLA 4IZIA 2HU2A 3GVPA 1Q7BA 3FF4A 1KERA 4CLOA 4HNHA 4B4UA 2B35A 1KETA 5JMWA 1PJLA 1ZO8A 4IUYA 1DAPA 4QQRA 1H0KA 2FPGA 2CSUA 3GPIA 4D45A 4R68A 3WBBA 1VKOA 4DVJA 5JY1A 5CP8A 3NJ4A 3PHLA 5GZ3A 4BV9A 2I67A 4BGVA 4J9UE 1R0LA 3H9JA 2JD0A 3UFXA 1ENPA 5LCXA 2DQ4A 4RQTA 1I3KA 4OOEA 5C37A 4K26A 4IDAA 3X2FA 1UXIA 3GAFA 4LRTB 3EUWA 4MJLA 3U4CA 4BVAA 3U09A 4CPDA 1ISJA 1JLLA 1DFIA 5FYDA 1TT5A 3LC7O 4RLSA 1HE4A 1U3TA 4ZQGA 4AJEA 4ILKA 4R54A 3CTMA 3D4NA 1K3TA 1YVEI 1E1NA 2P5UA 3LT0A 1B8PA 5KVSA 2G76A 3L9WA 4I9NA 1G0OA 4WNCA 4WEQA 4NFYA 5G0TA 5T8KA 3OH8A 1LA2A 5EJ2A 3I9KA 5DT9A 1A7KA 2XAAA 4K6CA 2O23A 1F14A 3JQBA 4RF4A 3AUSA 4CV0A 2Y1GA 2NU6A 4ZGWA 1R16A 4PCVA 1ZXBA 4MIOA 2VWHA 1EQ2A 3TPCA 1GQYA 2NLOA 2Q4EA 3JQ7A 2C07A 4AJ4A 2DBRA 3GMDA 4BIIA 5HS4A 4ND2A 1H9AA 2D3TA 2J6IA 1QG6A 3MJ4A 1KC1A 1PIWA 1ZK1A 2NM0A 2RH8A 4XQ9A 3NTOA 3C85A 3PHGA 4M54A 3P7MA 2ZJ1A 2FWMX 2D2IA 3EZLA 4AJ1A 1U4OA 2J5QA 3HE3A 1ENZA 4GKBA 4NNJA 5F1PA 1JQBA 1FDWA 2DLDA 4Q3EA 5K6AC 4GPD1 4YA6A 2Q1TA 3KYDA 4JP3A 2PKQO 2RHRA 3D64A 3DBLB 3H9UA 4CMEC 4GLLA 3V2GA 4YJDA 3VZRA 3ZNNA 2A94A 3QJ5A 4AJPA 2Q2QA 4WOKA 2FZEA 5G2OA 3RKUA 1TXGA 5KIAA 4HXYA 3ICCA 4LISA 3G49A 4J1TA 3IMFA 4CQMD 5C7IO 2QRLA 1ADCA 1YBMA 1DO8A 1RKXA 1PSDA 4DQUA 2GLXA 3QSGA 1A4UA 4LW8A 3DBLA 3PLNA 2H9IA 3ZCXA 1PJBA 2X8LA 3GT0A 2HMSA 3AI2A 2ZCUA 1DPGA
chains in the Genus database with same CATH superfamily
5J5AA 1HEUA 4IHAA 1RAGA 3P32A 3KJHA 4TYQA 4A27A 1RWBA 3CSUA 4LK3A 5BSFA 1UKVY 2CKMA 4L75A 4AQ7A 1JJVA 3PQ3A 1ADJA 2KX7A 3OJLA 2IBSA 4UXIA 3HL0A 3SY8A 4NV3A 3WNVA 2EWMA 3O4VA 4UXHA 2C2YA 3CRNA 4DIUA 4F11A 3LX4A 1A7UA 2IYAA 3E3AA 3NBZC 2C7QA 4FGZA 3W2IA 2O2CA 3ETHA 2IFTA 3N87A 1C3VA 1QRAA 3K8QA 2OB1A 2L82A 1BRTA 3P9ZA 3QE3A 2X7JA 1Z7EA 1R9GA 3PUHA 3QKIA 5H7XA 2VYVA 1Y8ZA 4F8JA 1K8QA 2O1SA 2WJGA 3C3DA 4IEEA 4WKBA 1KMIY 4WKGA 3TLYA 2O8BA 4DCTA 3S55A 3AKZA 1Q0LA 4I50F 3LX8A 1OAOA 2Z9CA 5L53A 1POXA 1NBMA 3N8NA 1PGOA 5CFPA 2QBYB 3AF2A 5AVVA 2CB9A 2EW2A 3UWDA 5CA0F 3GCGA 4FS3A 4MB2A 5IARA 2Q4RA 4RPJA 1KJQA 3GCXA 1NSFA 2O2GA 1IVSA 3IAS1 2EW1A 4RV5A 3NBUA 4YP7A 4QBHA 3FOAA 5HTKA 2AFHE 2F1JA 3GJQA 3DTYA 4DILA 1UC9A 5IABA 2IQIA 2VYCA 1O9GA 1IOZA 1U2DA 2H9YA 4B2YA 3P96A 2P9TA 4B4KA 1BJTA 3DOEA 2DF8A 4PZUA 3MEQA 4Q93A 1YCGA 3DZBA 1SUCA 2VQSA 2WPDA 1WAMA 1PJCA 2Q2WA 3AM1A 3HTXA 2IK8A 3ENWA 2DX7A 3QHPA 4DG9A 4M3NA 4QBTA 1O5OA 1XXLA 3VNQA 3DE2X 4CI9A 1DADA 4NBUA 1YE8A 1G6HA 2QUIA 1M2OB 2VNIA 3BZUA 1QM5A 1TIPA 3O83A 5P8WA 5JDIA 2BH9A 3I52A 4IUCS 5FXMA 4D4LA 4R31A 4PYJA 1VE3A 4J0GA 5BSEA 3OZ7A 4OHOA 2CHUA 1ODIA 1PNQA 5JCJD 2PXCA 1BVYF 5K0LA 3WLAA 5BUCA 4G0WA 1IONA 4LOIA 1HG0A 1FRNA 1YZUA 3H9CA 4DMCA 3FMVA 1JAYA 4Z86A 5DHAA 4C7BA 1FIUA 1ZUNA 1R4NA 1L5HB 2SKCA 3NIFB 3PHHA 1HDZA 1RYDA 4P0TA 4BWYA 1PJAA 2HH9A 1V9LA 1ZUD1 2IHKA 4AMYA 2QVZX 4MS3B 5BP7A 3S2FA 1GNRA 3IGFA 3TW6A 2RHMA 3JS5A 1LRLA 3LFHA 4N3AA 4YRCA 2H0RA 4MPPA 5DN6D 4E5UA 1VL1A 1LF0A 2O8EB 2B83A 3G2HA 5GONF 5ALDA 3EZ6A 3KLMX 3UXEA 1E2LA 2DHCA 3CUWA 4F3TA 4K6HA 5JZBA 1Z6YA 1IJFA 4ZIRA 2FSSA 2GHRA 1LGYA 4XRGA 4LWPA 5JJKA 5HILA 2V1XA 3PFHA 4YO7A 5HUJA 3W8DA 4F84A 1YRLA 1PGPA 2DWCA 5KVAA 1ML4A 2ZJ2A 3RK0A 4BFXA 4CLXA 5KSWB 3CVWA 2QL9A 3DEZA 3RWMB 4CEJA 4IIFA 3BJIC 5GWXA 3G8YA 3T9AA 4I14A 4KJXA 4IH4A 4URHA 3AB8A 4RKQA 5CVJA 1RRPA 2IUFA 1XTQA 1U3CA 3DZFA 3MB5A 2FSPA 3O8LA 4X00A 3WK7A 1R64A 2NNWB 4I4TB 5IDVA 4DQDA 1E2KA 3LZDA 3ELWA 4OK5A 3DUFB 1CY0A 4V02A 3AUAA 2R7KA 5JRDS 4QYIB 1WY5A 3DONA 1E1QA 3F90A 4L07A 4RPKA 3EFHA 3NZEA 3MIIA 4PZZA 3OX3A 1UMBA 2VHYA 2O1XA 4ZI7A 2RBKA 3V8MA 4Y2JA 4MW0A 4CUKA 3W5SA 5KYKA 2HW8A 4E4RA 1F6BA 3QUTA 3W06A 4LI0A 3FFBA 5CFQA 4EFLA 1UKZA 1HTBA 1RJGA 4RK4A 3B7PA 3D81A 5K3BA 2UU9B 3F9CA 1HMPA 2O6LA 2JFQA 1VGQA 1S2OA 3JAWB 4JC0A 1GZ6A 4RIHA 3VMFA 4ZGBA 1ZIYA 5CYPA 4BRSA 1TKCA 2ZR7A 4LQCA 3TIIA 4TMTA 2Q9UA 2WKSA 3TLEA 5HHTA 3DVAB 1R88A 2MTBA 2VTKA 4JR0A 4LEIA 2RJOA 2Q1WA 2O52A 5FWDA 5THXA 1EESA 4DB4A 2V4UA 3KKMA 1ULBA 4Y1RB 4TRMA 1C30B 1UFVA 1JHDA 2E87A 2PAAA 4LNUA 3UBTA 2HK8A 4OMDA 5JQGB 2AX4A 4YLGA 5AVYA 4K9RA 1A96A 2VP0A 1HDYA 1WEKA 3BA6A 2PSEA 2FKAA 3UK7A 3WLMA 1R8XA 4KQ1A 5FI1B 3X1XA 5I4CA 3IIKA 4GM0A 2ZIXA 3EC1A 3LYAA 4JSTA 3DBRB 3KAQA 4II2A 3AONB 4XSVA 5BXQC 1XDBA 3DXZA 4RK0A 2XGSA 1PDVA 2EFGA 3JD4A 4GC9A 5DM70 4S3MA 1B42A 4BUZA 1N3LA 3EQ2A 4EI7A 4FBLA 4IUBS 4H7HA 4M7WA 4CV1A 1E99A 2OO5C 2X8AA 4LV5B 1FDTA 2AOUA 1WCIA 3IOMA 1G8FA 3FAZA 1AHNA 1W4BA 3STHA 1JXOA 4UVGA 1QSGA 3U9SA 4IIGA 2P1ZA 1T4BA 2JLZA 3IERA 3JYPA 2Q9BA 4BE9A 2DUMA 2IP1A 2XYRA 2P4SA 1INLA 1IHOA 2WOJA 1DKMA 4IRUB 3JZIA 1W73A 1XJ0A 2QTFA 4WFIA 3ZI4A 5B37A 3VX3A 4X7RA 1EWYA 3R0ZA 1FSPA 4B84A 4M1KA 3HJFA 3T99A 1T6BY 4PAGA 5C5CA 2Q3DA 4BNYA 2G04A 1ZK0A 4MWCA 4FUTA 1IQ0A 2NPOA 2C5BA 3H2KA 1NW6A 2CFIA 1YWGO 4W7IA 2DFPA 2UZ0A 3BXHA 3HR8A 1GRNA 2WSSD 3RI3A 5EJ5A 3W5UA 2YW2A 1VP9A 1MV5A 3DNMA 4OHWA 2HUNA 2X5XA 4QPDA 5FO1A 4G4SP 3T34A 5MN6A 2DBVO 3C5VA 3QV1A 4M4SA 4C05A 2G9QA 3ZHTA 3DOIA 4H1TA 3HYCA 3EC7A 2BFOA 3OU2A 4G97A 4NMWA 5B6IA 1JECA 3VISA 2K5UA 4GZ3A 4K9SA 4KFTA 4DCCA 3K4HA 4R1PA 4DS3A 1MLDA 1QONA 3CVOA 3ZDFA 3ZWNA 1AZTA 1J6UA 4BQRA 2ZZNA 4O59O 2OO3A 5AICA 2MSLA 4TLDA 3ZDDA 2QP9X 4FN4A 5G3ZA 4HADA 3T3HA 4LF9B 1C3JA 1NA5A 1YB2A 3SVTA 4J03A 4MAMA 3VYRB 5CVCA 1RRGA 5J1TB 4H6VA 2YWRA 4BLWA 3CNQS 4INOA 5DU2A 4C06A 4ALNA 1EXMA 3CF0A 4IHKA 4DNXA 5IYZF 2DWPA 4S1OA 3N28A 5CW2A 4NYMR 4ETMA 1F9EA 3PPIA 1GRQA 1NPTO 1KR5A 3CNNA 4KAFA 3P2IA 1V16B 1AN0A 5D5QA 3CZ9A 4TS4A 5E4TA 5H4HA 1JQDA 1LDYA 4BNHA 4JT9A 4GPEA 3G2JA 3VOSA 1ULTA 4W9NC 1RLIA 2O2ZA 2O2XA 3PUZA 4I5FA 4L6AA 1SVIA 5C35A 5JI3E 4G84A 5F3WB 1C9KA 1Y1SA 4GMHA 1W8DA 1Z45A 2ZAMA 1C3XA 3EARA 4WKOA 3RVPA 2ONCA 3WLTA 4OH7A 1GFWA 1N33B 3VNAA 3GLFA 4RZHA 4WXYB 5HOEA 1GZHB 2CK3D 4U2GA 5FBHA 4JP8A 1V6CA 3MTGA 1XQVA 1V11A 1V3QE 3RU7A 3ZIDA 1AQNA 2YNMD 2YHAA 1MGPA 4IIBA 3LOQA 2Q8PA 4A0SA 1GPUA 2JLUA 4KVGA 1HUQA 2FZLA 1BXRA 1Y9DA 3I4CA 3L1JA 5ISMA 4O8CA 4OLHA 4LUCA 1PV2A 1O5TA 2GXUA 2M32A 2HMUA 4G63A 2QX6A 4AJNA 4YLYA 2IDZA 3NONA 5BR1A 3K2IA 4M76B 5I5EA 1RDFA 3S0JA 1JNYA 2GUGA 1AHHA 2ZJ3A 3I62A 5CEJA 2XOKA 4RE5A 3FROA 4YQEA 3ZV5A 2GF9A 3FETA 1P33A 1YC2A 3OZAA 1QO0D 5ALTA 2JJ2D 3ILSA 1DRKA 1ZI8A 4KXWA 3RTAA 3LUKA 1M6HA 1MA3A 1HQCA 2OWEA 4AP6A 3FDFA 2AJDA 5DCUA 3D6NB 1E7WA 5H3LA 2ZBEA 3IEVA 1SXHA 1KZGB 4P3KA 2PSHA 3ZDYB 3IPCA 3KYJB 4TTSA 4I5GA 3E3NA 1OI7A 3AB7A 4FNGA 5B58C 4HLDA 2WF5A 5KAPA 1TX4B 2H7YA 1A77A 1B0UA 1RXIA 3A6LA 5IKOA 3AVWA 1SC3A 4EJSB 1Z16A 5LP6A 2UZIR 2GWRA 2W6IA 4XW2A 5C1OA 3BIFA 3DSRA 3O84A 4EFNA 3MIZA 1NUAA 1LFAA 4HB0A 4P8RA 1O4WA 3EYWA 2Q3LA 2HMWA 3HG7A 1V1RA 1WZNA 2HJHA 1DEXA 3OU7A 3NBFA 5LZ9A 2DVMA 3MERA 2F1RA 2R6JA 4MUXA 2BIFA 3FRIA 4M89A 1QP4A 3K6SA 3COSA 1DBWA 8MHTA 3A1UA 2GMWA 5DFAA 1YRHA 3L7NA 3NP7A 4YHBA 3GEIA 3NVMB 4ITUA 3TR5A 4AF6A 3M6MD 4A8TA 5JDCA 3T1OA 2JGLA 4W99A 2FP3A 2FWIA 3RUCA 3PQEA 4Y6LA 3ZY3A 4B3FX 4QEKA 4EDFA 1TJPB 4UUPA 3VOAA 1JFLA 3V32A 3L1HA 1A9QA 2VYVD 1VGVA 2IPOA 2Y6VA 1W25A 3ACBA 5BV1A 5LQMA 1KBZA 2XRZA 4ZYZA 1GV0A 1UFOA 1ZW1A 1J0BA 4P2GA 5CB8A 4AWXA 2UYOA 2FW7A 5DYNA 1AQUA 3SBEA 1OOEA 4EOGA 3IPRA 3LGAA 3RC1A 3ZGNA 4YJHA 5I3CA 1E6UA 2IXAA 1NBMD 4DLKA 1J2YA 2XMQA 3OJEA 1W5FA 2EYUA 2DPGA 2NVWA 3D3WB 1ODSA 3DDHA 4PGFA 4PU0A 1VPEA 4CODB 4MS4B 1E8MA 1UK7A 3HSKA 3QF4A 1XLTA 2EKPA 4V0LA 5I9IA 1CUDA 4R0MA 3LK6A 4JLDA 1GFIA 1I0IA 5KTKA 1AY0A 2YFYA 4CKBB 2P41A 1XZFA 1OFGA 1RI1A 3HKDA 3X43A 3KU4A 4YBZA 4B33A 3AVVA 4KXFB 1EX1A 3HWRA 5B6PA 4YT2A 5AM2A 5A3VA 3V1TC 2D1FA 2O0KA 3R23A 4UAJA 4CDMA 4FS8A 1PUJA 3PHCA 4Q7LA 4FZVA 2O07A 2WPDD 3BDVA 3OIGA 4HNGA 3D0OA 5KSPA 4EH1A 5FI5A 5GAJA 4AQYB 4BNTA 2BH2A 5F78A 3MN1A 2E6UX 2GN1A 3R7DA 2JIMA 1IBCA 2VK1A 3I6BA 5DLEA 3V8PA 2B8NA 2HA0A 1G9TA 1UPTA 3QPCA 1I7QB 2UXDB 2CMFA 3NOXA 2UZ3A 5EQJB 1QGYA 2ENUA 3ILXA 1NVEA 1I5OA 4GWKA 3BWVA 4RIIA 5DNDA 3OWOA 2F8TA 4G0PA 4C0XA 5HRUA 2YVQA 2GEKA 3OMLA 1I8TA 3UHJA 2QRVB 3OTGA 4ZO8A 4ALKA 4XOUA 4B9EA 3A4TA 5IN4A 3GCZA 1WQ4A 1Q0TA 1KVUA 1O6ZA 1V7PC 3V2HA 2O4UX 3U0VA 3VZQA 1E1LA 1XTRA 2V7GA 4J2TA 4DUPA 2Y3IA 1OFUX 3K09C 4M7OA 4RQUA 1WZ2A 4A6DA 3QPUA 2J0QA 3MQFA 5B6JA 3B6MA 4GDFA 2CYCA 4MRMB 5PNTA 3R40A 5AHRA 1KK2A 2BTEA 1STOA 3LZ6A 4BB6A 2PWPA 4IOMA 3DO8A 1W2HA 5TEWA 4ZICA 1K3FA 3E4DA 3R5TA 1FFYA 1RCFA 4HN2A 3ZLVA 4ZCMA 5LIPA 1WXXA 1F38A 2E55A 4OYYA 2RGNC 4LJ7A 4CCWA 4ZC1A 1ISSA 1GNPA 2FUCA 1X42A 1Z6XA 2NWQA 3CM0A 1GLGA 1Z18A 1XQ9A 2ANBA 1GUAA 2L0XA 2Y4NA 3IPXA 3NLLA 4OMCA 4RD2A 4DJTA 2WHPA 2VSOA 4ZD6A 1O54A 2QL5A 1DC3A 2XUQA 5AOVA 1QYDA 5IULC 5EIHA 2VZ0A 4LSWA 2BI4A 3VBEA 3OQBA 4JLMA 5IAGA 1AK1A 3BD9A 2EJBA 3E70C 4PIVA 3VC1A 5KJCA 5KOHB 3DDZX 1KZ6A 2HOQA 3LSTA 5ALFA 3K16A 4EVIA 5FH9A 1GD1O 1TYZA 4EUFA 2JCSA 3CIOA 2O8DB 1ZA1A 1E1QD 4YJ2A 4QTYA 3E81A 3SNHA 4Q03A 4ER7A 1KR2A 1GAQA 1L4EA 1VLQA 4WT7A 4R7TA 3QELA 5IJAA 5TNXA 2P4HX 5E2BA 2WM3A 1XRJA 1JT9A 1U8UA 4JHXA 4ZQGA 4XI9A 4CV2A 1FA9A 1ELOA 3IQIX 1BD3A 2NZ8A 1X7HA 5DB4A 4BFCA 4L50A 1KK3A 5TR9A 3CEMA 1KFEB 4ZQCB 8ADHA 1TQ6A 2ID9A 4IFEA 4RESA 3AM4A 3C1TA 3R2JA 3PGKA 2XECA 1XDSA 2AMLA 3AF5A 1V6SA 4ZI7F 5H3CA 2FZVA 3AEKB 3SR3A 1RJWA 3M7IA 2BMWA 4HWGA 1YF3A 4M1OA 4EY7A 1IMJA 3CKKA 4II3A 1NUUA 5SY9A 4LBWA 3FIJA 5BUQA 1YSCA 1OBOA 1N4DA 1UJ2A 2JCYA 2ZKIA 4LVOA 4PAOA 1HE3A 3S70A 3IMCA 3WJAA 2V9ZA 2VPIA 3N8DA 3P5SA 4FSXA 4GIBA 3F98A 5BWNA 2H6EA 2A57A 3A27A 3QVJA 4HTFA 1T34A 2QR3A 2BM1A 4V2IA 1OY1A 3E1KA 3TYXA 2IH5A 4Q48A 2NV6A 3WBKA 3F2VA 4HC4A 5C7LO 5BXYA 2BWJA 4LYYA 3KSZO 2ZYWX 2MIIA 1Y34E 1IVNA 2ZSBA 3PPWA 4B43A 2GVZC 3CWQA 1V0JA 3RH0A 1G8JA 3L9XA 3AESA 2WYUA 4FB4A 2C9MA 2QZSA 4BMCA 1JSXA 1QQAA 1JLLB 5D6OA 3DMPA 3AKDA 2HRDA 4IIEA 4Q7MB 4JX9A 4RIGA 2OYSA 3J81A 1Z4NA 5H59A 1MUUA 1RWQA 3OKPA 1YBVA 5EZYF 4DSZA 3G9ZA 2J9FA 5TT1A 1YO6A 2Q3CA 3CF6R 4BKPA 1NI4B 2XUHA 2XMSA 3BGOS 4WXRA 3MWEB 1SURA 1IHPA 3QKTA 4D98A 4JR2A 2RGXA 3B38A 4J0HA 1B15A 4FE3A 2I54A 5CT9A 1OV4A 1NONA 3ZCRA 4BVFA 1W2WB 3E61A 4MVJM 1OVMA 3AR4A 1NYTA 2BUBA 3FH0A 4RJIA 4YRLA 5B7QA 1CV2A 2JNWA 4MP8A 2AFHA 4X54A 2ZI6A 3NNSA 1ISFA 2OG1A 2OHXA 1LWNA 3CZQA 3N59A 2WILA 3GA0A 1OA1A 1YU9A 1XPJA 2R8YA 4W5HA 2TSYB 1NBIA 2ESRA 1V45E 2FRXA 3BD6A 3CINA 3I9V1 2OLJA 4GX2A 1GSAA 1GU0A 1ZUIA 2AN5A 2D1QA 2J32A 2NU6B 2BFBB 3ETJA 3IP6A 2JG3A 4C76A 4KRYA 2D2FA 4N7MA 3UMMA 3ZWBA 3L7IA 4Y67A 2AEJA 2P27A 4IF4A 3JQ7B 4NEGA 4DLWA 4MRSA 1A3CA 2GB4A 3IT1A 4YRTA 3CGWA 1K6EA 5JW6A 3PD0A 3HBNA 3STXA 2AOTA 1U0FA 3GNQA 2C4TA 1ZD2P 3HP7A 3V6MA 2WIJA 5LMUB 16PKA 4WOJA 1MO5A 4M99A 4U7TB 3T3PB 2I9KA 2F7SA 1M72A 1VG8A 5C51B 4AY5A 3VNRA 3IR7A 5A9RA 3NGMA 2C99A 5CURA 5BRJA 3TD2A 1QOQB 3ABSB 4N6OA 1GTVA 4Q9DA 1LBTA 4HS9A 4LGVA 1SO8A 2EWVA 5I51A 4O2BB 4LKOA 1YI0A 1FTQA 1U98A 2DCUA 4JA2A 3WVNA 2HA5A 3BFJA 1K6IA 3CLKA 3DV9A 4EFKA 3ESBA 5AK6A 3MTAA 3BIWA 3NHFA 1C1HA 2VYNA 3DEAA 3G13A 3QV2A 4MV6A 4S24A 1UP4A 2YQ5A 2XVXA 1HDEA 3HUDA 4WNAA 3SJCA 3TLZA 4REMA 4B1FA 3VYUB 1QH8A 4AMVA 2ZRPA 3TPZA 1LI7A 1NOKA 1SD1A 1TA9A 1XJQA 1EK5A 2YJTD 1GNQA 1Q92A 3OJCA 3A31A 1AB5A 3LIPA 4FQ8A 1N1MA 2NZVG 5M29A 4OP3A 4DKJA 4YACA 1IQPA 4C89A 4GFDA 3ADCA 3T3IA 1ZRMA 3HFSA 2PCJA 5LL6P 3EVZA 3A10A 2E1PA 1Q0HA 2CLIB 1FFCA 1LLUA 2XWBF 2D5CA 1T36B 5J2TB 4GUAA 1Z75A 1GDTA 1GU1A 1ULSA 1E3WA 2O9JA 4UBOA 3VR5H 1IN4A 3EG5A 2IVZA 3KB8A 2W7TA 3D6FA 1PJ3A 4ISBA 3T9CA 1S5PA 1KDZA 4F6RA 4ZJYA 4UOQA 2HSZA 5ALEA 1GGJA 1U9IC 3U16A 1Z35A 2CCGA 2KM1A 2GYVA 4X6LA 1PR1A 4HXEB 5LBUA 1QTQA 4F04A 1UMKA 2XOKD 3DJYA 5D01A 1TPZA 2CW5A 2XXJA 1Z0AA 4AY6A 4AG6A 2HJGA 2OAQ1 1JF8A 3D2AA 4C2UA 2BDUA 1DIHA 1JQKA 3QM1A 1PK9A 3L7DA 5DWVA 3N2KA 3GGOA 1J8VA 2NGRA 1IPFA 4F6CA 4B82A 3OM0A 2HN9A 2BHLA 4RK1A 3TJMA 2OD9A 4UEKA 5HIKA 4OFBA 3BRCA 1JPNA 3OPYA 2YBEA 3L82B 4LECA 1YRYE 1L3BA 2FE4A 4BX0A 5CLFA 3IEMA 1EP9A 1I32A 3CUEF 1J42A 4YJFA 4U7HA 4ZJPA 4N76A 1FMCA 2ONYA 3BB4A 3L7JA 3MS2A 3L7AA 4XSHA 3EB9A 4P0PB 5DT2A 1EEHA 3CZ4A 3W04A 2W6ID 3TQSA 1YRQA 3EAGA 3H3FA 1FPQA 2BYTA 4KIFA 1DQNA 1KY4A 4BJ3A 4F93B 2IYLD 1QYIA 2RKOA 3OQNA 2R3SA 4O4HF 4XEHA 5T5QA 3WP1B 5AUOB 4REQB 1QIFA 1UKCA 3L8FA 4MWZA 5HX7A 4YNBA 1TEHA 4C21A 2AJCA 2PKRA 4XB6B 4C03A 3W5CA 1ZOLA 3I9LA 4PAMA 1ZEMA 1B2LA 3DHYA 2AOVA 4RORA 2J48A 1WCWA 2V58A 1LDNA 2WOOA 1KMNA 1YQTA 5JRZA 2YRWA 3LRXA 5LP6F 4MDFA 4ZYTA 2IXTA 3OZDA 2JCGA 4D9CA 4EYGA 1XQ6A 3LBHA 3L8DA 4LXXA 4HNSA 4PQEA 4G2TA 4QECA 3RRZA 1BMDA 1JKIA 2CCJA 2VOJA 2ZB2A 3C3JA 3NIWA 4PG4A 5AI6A 3VR5A 1ZFNA 2MYTA 4AS1A 1QK3A 2BJHA 4QBGB 1U2GA 3NHJA 1HE1C 1A95A 4LGYA 3PR2B 3KT3A 1C0PA 4KBYA 3HV0A 2Q4DA 2WFLB 3VOBA 3I73A 3Q5GA 5FHQA 5D84A 2FMKA 4LZJA 2CXPA 2ZVDA 2X23A 4PC7A 4LE0A 4MHSA 4QJ4A 3ZDBA 4C30A 1AM4D 3FCCA 5DW0A 3OIDA 3PUYA 1HFJA 3HCAA 5JNTA 1ZSVA 2QRGA 1YB1A 2VF2A 1JWBB 3HVKA 4UE2A 1T9DA 2DSTA 5CM2Z 4DBLC 1N8TA 4G85A 5G53C 3RYHA 3UAZA 3V00A 4BEJA 2Z8YM 4Q3AA 5EZ6B 2PUDA 1G5QA 4B6RA 3E82A 4BQNA 1DKQA 1ZJWA 1LH0A 1N78A 2J4DA 2R7MA 5HE9A 3V42A 5KDDA 3OLWA 4MUBA 4YDSA 1AE1A 3H17A 2IC5A 4JA0A 4GC5A 3PXAA 4JUDX 3UXHA 3P9CA 3S2GA 2CV1A 1QTIA 4RF2A 2RI0A 3I9V6 4EHBA 1D4OA 1Q22A 3MMXA 3UGTA 5EP2A 5LM3A 1EFPB 3UZUA 1OV6A 3DE1X 2F4VB 2QI9C 4H0CA 3EDRA 5E4YA 3JQBC 5FBQB 5IHXA 1F8YA 5KYUB 4PG6A 1T1GA 1ORHA 1CXZA 2QS9A 2Q2NA 3O2JA 4MH0R 3RIXA 3LDFA 5ALVA 1EFLA 1RC0A 2QT0A 3WRYA 2G40A 2PTHA 4CNQA 4F5WA 2WD8A 4QUAA 2LD4A 2F4NA 4B75A 1JDBC 3O2SB 1UM8A 1NZJA 3NIDB 4JP1A 3UCFA 4B6SA 1SUBA 2Z6UA 2YNMC 3F3SA 5IPFA 2O5CA 3HU5A 4OSEA 3MTIA 1H2WA 4NMHA 1RYYA 4LRSB 1KYWA 3AR6A 5A3SA 2JGRA 4KPFC 4YR7A 2PG3A 3GDHA 4JNKA 1JFRA 4RF5A 2K7FA 1IBMB 5AVQA 3ZD8A 3Q2IA 2VXCA 3PA8A 5DGDA 2D1YA 3PP8A 3UV7A 2VDRB 4Z8YA 3H75A 2BOVA 3OJWA 1XTUA 2GM4A 1KYVA 3VU0A 4IDOA 2J9GA 3MTQA 5KYNA 4WOPA 4KWEA 4JLWA 4WLUA 3LGSA 2Y9PB 1F0KA 5BW5A 2WUGA 7MHTA 3TRHA 4UFNA 4ICIA 3QUCA 4G5OA 4ENSA 4A82A 3MXTA 2BPOA 3OQHA 2VVTA 1H2XA 2GKGA 3V1YA 4BRUA 4E5DA 721PA 2RE8A 2O54A 1MJGM 4K5QA 4IZHA 4YMHA 1A5TA 2X9QA 5IBPA 3BXGA 4EG3A 4YRZA 4AJOA 1Z2AA 2IOYA 1Y63A 2MINA 5DNVA 4E94A 3AETB 1DDOA 1RYFA 1XRRA 4LPKA 1JPUA 2NN3C 5HIIA 4HAIA 5TGZA 3LC1O 1VL0A 1X1TA 3CX8A 5JH7F 3WP0A 5JT1A 1Q2XA 4E32A 2V98A 5DM2A 4DPMA 1I5RA 3UJ9A 1QRRA 3O74A 1GZ3A 3SYTA 1KC3A 1FFDA 2TMKA 4U9HS 1X3SA 1QCCA 5K5EA 4JCCA 5FPPA 3VOTA 1FRFS 4GUDA 4CKXA 1F0YA 3AJAA 1CYDA 4EAQA 1IVYA 4XGIA 3TE7A 3LQ2A 1XE3A 1MVNA 2LKCA 5DTEA 1ZQ9A 2WHQA 3BMNB 2RHGB 2X5JO 2JHGA 3FW1A 3IT2A 4OLBA 3C6XA 5AIBA 4Y9SA 2XQJA 1OKKD 2W6NA 1OZGA 3V3KA 3ETGA 2LW7A 1NXQA 3OETA 2VDWA 2P67A 1SEVA 1GDDA 4PC6A 2DT5A 4YJGB 4A03A 1RJFA 2NUBA 2FY8A 4TMWA 3TTVA 4DREA 5K4AA 3C0KA 4UNPA 2G5GX 3AM3A 5T4BA 1NLFA 4HVCA 4OGGA 1AF4A 5F1YA 1OAOC 3OOJA 2EX4A 2V7BA 3O0DA 3PE6A 4M22A 3UKOA 2OZEA 3NVDA 4Z9YA 1ETHA 3RYIA 1UDCA 3EGOA 2Q4BA 4M8SA 2AFVA 2IIQA 5BNIA 3NKFA 4WRRA 5BW6B 3JAMA 4HRXA 4L5IA 1W19A 3IVXA 1M6NA 3T54A 4PCLA 6CHYA 2BEJA 1ZLXA 3M1LA 4LYFA 4K6MA 4QGGA 4Q1VA 3Q7QA 4A0RA 3M6LA 4LYAA 4MIEA 2R8BA 1C9MA 1U2DC 4OGFA 1P4RA 5ENVA 2W00A 2QYSA 5TPWA 2LR0A 4ZYXA 5AVSA 1DIRA 2CZQA 4Z9AA 5IMSA 2G17A 2W2KB 4AKSA 2AKAB 3W7BA 3SDSA 1OX6A 1PL7A 1F06A 4N01A 3EGIA 4IWNA 3LF2A 3VPXA 4QT0A 2GXAA 5AKXA 4TQGA 4DRXB 2ZATA 2XQKA 4CJXA 2J33A 5AVXA 4CCAA 3MPOA 3ZD9A 2E9SA 1VOTA 4ATNA 4BNIA 2NP6A 4OL9A 2Q5HA 5JDIC 5FL3A 4L0DA 1XRQA 4RVCA 2ECOA 2OPBA 1UPBA 2XI4A 4H31A 5I4IA 4MROA 2YHBA 3WYBA 4J6FA 1X77A 2NO5A 4P38A 1I7LA 2DJ5A 2QSZA 4UVIA 3K9HA 3ROEA 5K7SA 1N5DA 4NBTA 3H6HA 1Q17A 3GLRA 1OU4A 3TK1A 5AVTA 5JO0A 1CPYA 2GDZA 4Q1AA 4LRWA 1RRFA 1V7QA 3A9CA 4GKVA 4RM3A 4NR0A 4U8HA 3IBYA 1ECCA 3G89A 4ZP1A 4B46A 4E09A 4E5KA 5A5VA 4I99A 5A71A 1G59A 5D7BA 3S28A 4TZTA 3BILA 5IRCD 2PX3A 2X4IA 4IMPA 1EFCA 5AHWA 2A5FA 3GJYA 3FDJA 4EYKA 4IIHA 1OZFA 3H3XA 3PWZA 5HIMA 2HR1A 2A1TR 1WEHA 4CF4A 3AV0B 5FTJA 1H2RS 4FZ3A 4JY7A 3EGEA 4TSRA 3M4XA 5FJIA 3V2IA 4AC9A 2R8PA 4ARSA 4HUTA 2PVPA 4RF3A 4XLTA 3L8GA 2EL9A 1B8VA 4UASA 2PGLA 1ULUA 4JLAA 5EFOA 3FTNA 4IGAA 4D3FA 5CDGA 3UWOA 4FD2A 3DLAA 3KVRA 3UJCA 4AJKA 5BN3B 4YMLA 2RHDA 2PL5A 3DG9A 2HWUA 2CN1A 2EKQA 3Q3JB 3LV8A 1KARA 3NYQA 2I03A 1DJPA 2VTVA 2WUDA 1GCOA 3AXTA 3HJAA 1RJDA 5C8DA 2IZOA 1TPYA 2UAGA 3H9BA 3P5BA 2G5TA 2QUBA 4KO3S 1XZAA 3I6YA 4CFYA 4F0JA 3PI7A 3RYCA 2HA2A 3QFSA 4YALA 1T4MA 3CH7A 3IOYA 4M1QA 4JOBA 3AX6A 1XMOB 3J81k 3ITDA 5BR8B 1JB1A 4RTNA 1C50A 3JW8A 4IWYA 1IU9A 3K1ZA 1B16A 3A25A 2H29A 4FOLA 3CG4A 1AV6A 3OPNA 2Y76A 4XVHA 4DUYB 3N1UA 3FDZA 4AG5A 3PF8A 3RVKA 1VFPA 2VYND 4KYVA 2PLAA 3TMKA 3QITA 3SHTA 4EJ2A 1QGUB 3KEFA 4QUDA 1CUIA 1PL6A 5GINE 1VP3A 4KE8A 4UTOA 5G0WA 1KY2A 4XUEA 3KLPX 5CLJA 2BFCA 3K8ZA 3L7BA 4HBGA 2PMBA 2FK8A 1RACA 3MOGA 2B0CA 4NDAA 4N8DA 3UMYA 1OGJA 3U56A 4RPIA 1OLXA 4BXOB 1HWYA 1WXEA 4CM3A 2GKOA 3HRIA 3TD6A 2AQKA 4BQFA 4MLDA 5KSYA 4YN3A 5DBFA 4IGEA 3RE1A 4RZSA 4J3FA 4FFBA 4BP8A 3JU3A 4GNKA 2V8BA 4GZ5A 3UAXA 5DBGA 1EBUA 5LYJA 2NVUB 4DMRA 5C7OO 3R44A 3TCXB 4F12A 4XPIB 2LCIA 1C9YA 4GI7A 1EK6A 5EGNA 1P31A 3C87A 1KI4A 1J2RA 2REOA 1R3UA 4K46A 2O5VA 5HQTA 3K0FB 5C8YB 1J07A 1H5UA 4K7JA 4PIMA 3VKWA 2DETA 5FD8A 1F2VA 4L9SA 2MWMA 1XPUA 2WWIA 1EXNA 1RCUA 2M98A 2GCOB 1P4GA 3VC3A 3WL7A 3E3OA 1ZM2A 4ND8A 3DHVA 4YV7A 1VZ3A 4EMSA 3DZIA 5K51A 3WMFA 1UANA 1VA5A 1Y7PA 2YQZA 3KXDA 4I9HA 4LSGA 4U2KA 1JKFA 1I2AA 3JVUA 1VBMA 4GMGA 3WWOA 3PEYA 4PG8A 1BMQA 1TM1E 4DADA 1L7MA 4B32A 1YGYA 1DRJA 1Z4QA 3M1IA 2FEWB 1XAJA 5EKSA 3RVRA 3L06A 4GL4A 4ARZA 4ZMRA 2C9ZA 4L28A 2VSFA 4DYDA 1JVNA 1JSCA 1GPMA 5AKIA 1VMEA 4D9FA 1E64A 4RFSB 1QS0A 5KDLA 3SWWA 3PQ2A 4DR1B 4OQNA 3EJWA 3AC0A 2G07A 2P1RA 4NTZA 4BEVA 1SFRA 3M4ZA 4IAOA 3FWPA 5F64A 3B6ZA 5I7RA 1YCDA 1E62A 1V37A 1QNLA 3PKJA 4IV5A 2GZ2A 4PYQA 3WLNA 3B1JA 3VR5D 1EBBA 1QIEA 3O91A 1BDJA 2FMHA 5G1OA 4YRDA 5CHYA 1H3NA 2V4ZA 3DGFC 2WP0A 3PV0A 1EFAA 1NHWA 5DEIA 1UDBA 1NX6A 1Q7CA 3GX1A 1HNNA 2WJ4A 4P4SB 5KOIA 4F6LA 4XE5A 1QKIA 3RU3A 3U4MA 3RADC 1DRUA 1M2FA 1RMTA 1VRCA 2OQIA 3O8QB 4GF5A 3KVOA 5EJFA 2X40A 3WSTA 3QE2A 4HNUA 3L1KA 1JG4A 1JJAA 2FG5A 1YB4A 1IATA 3MOSA 4LTMA 4R1MA 1LSJA 1IHYA 3R3XA 1B3RA 1N1DA 3R4CA 1VJDA 5HCNA 3UJ7A 2AEMA 3QOWA 3PPVA 2VCYA 3X0DA 2JFYA 3L46A 2AE1A 1WDTA 2IYXA 4NPHA 2QHXA 5FA8A 4EMUA 3CZCA 2QORA 5D86A 3P0HA 2JAPA 3CXUA 5CDUA 4X5OA 2J3HA 4DWWA 3ZJ5A 2E6KA 1K6XA 3H2GA 4BGIA 1EI9A 3WB0A 4MDEA 4M0CA 4CZ2A 2ZYRA 1T0UA 2GDJA 3I2FA 1AKNA 1T3SA 3A8TA 1CIVA 3M3HA 4HDMB 2SCUA 1GGKA 4ECEA 4D42A 1Y3DE 2O8BB 2GM5A 1U7TA 2Q1XA 3CEJA 1KWKA 1XMIA 2ZRIA 3LUJA 5HJ5A 2AS0A 5D3KA 1ODCA 4JLNA 1TKBA 1Y7HA 5CVUA 3ZE8A 1VCOA 1G7CA 4I08A 2EZ9A 1QOPB 2W93A 2ZSFA 5TJHA 4RD6A 2HT6A 4FOOA 3C6KA 3ZK8A 4YB8A 1KNXA 2O2JA 2H4ZA 2RI6A 3A2LA 1Q6YA 1TDJA 3AJ8A 1BOFA 1FUUA 1MAWA 4RDCA 4BO4A 5BNTA 3KB6A 2O50A 4UPVA 1WUKS 4R5MA 5ENDA 1ENOA 2YVKA 4GLJA 1XJCA 3MTDA 3Q85A 2A5JA 2G71A 3R6DA 3FNEA 2QJOA 3MWLA 3ADPA 1C1DA 1XZMA 1T9CA 1UXKA 3IUSA 3WLQA 3P27A 4DLUA 4YREA 4K0RA 1MOPA 2JIOA 2H59A 4JB8A 3OURA 1C8KA 2QNRA 2FFQA 2VPYA 1F60A 3WK6A 1R0YA 4C2BA 5KTTA 3JASB 3HCBA 3LQ1A 3OZCA 3DT6A 4GEGA 1S96A 3UC9A 1IY2A 1M7BA 1RLTA 3CV3A 4MV7A 4X1KB 4XX0B 2XTJA 2X15A 3DXFA 1L7BA 1LPPA 1P61B 1SQ0A 2XCIA 3MSCA 3IEIA 4FIZA 3V9PA 1C4WA 2QTTA 3B3FA 3ONFA 1PQPA 3WGGA 3FYUA 4JXZA 5K6AA 1XDWA 3RM3A 1Z8HA 2PUTA 3GVIA 3PFGA 4X85A 2H0AA 2QRJA 3R7BA 4B4WA 5FUMA 2HRRA 1XLVA 1R6UA 3TNLA 1NVXQ 1PWZA 2H4JA 4B80A 4CMEA 1TK3A 1S8FA 1KFCB 1YJ5A 4PG7A 3BK2A 4X1YB 4F21A 5LP6C 4BBAA 2F8MA 5B3KA 1YDGA 2C2GA 4MUMA 5C3MA 4WIAA 1NWHA 3LBYA 1XXHE 2HLPA 4HYTA 4FB5A 1Y4AE 3IXQA 5KJFA 4WVLA 5JS6A 2P2NA 5THKA 4HB2A 1WXHA 3C1UA 1FNBA 3JCZA 1SC1A 3REFA 2YHUA 4C4AA 1G21A 2ZBQA 3ISVA 3V1NA 2C20A 2F9MA 5A9SB 1FLAA 3RRBA 1PR9A 5DCLA 4E5SA 2EXXA 2CCKA 4DCGA 4EW6A 5JDCC 1ZGHA 1XMSA 5KBYA 3JQGA 4D25A 3LHIA 1AX9A 3IHWA 4Q1EA 3D1LA 4XFJA 1JNXX 2AX3A 2Z8XA 4I5DA 5DBEX 5FA6A 1TCAA 1CUSA 1JVSA 3Q87B 1E7MA 1ESNA 2AOXA 5AM4A 2W6MA 3F6BX 1IB0A 2PUWA 2AR7A 2O2YA 1KEPA 2X0FA 3RUPA 1L4LA 5BWOA 3PVCA 1PSWA 4PZYA 5JAQA 4XFKA 3TZBA 1O0CA 1RWKA 1C1YA 4XD2A 4MVJE 4NJOA 1QF7A 4HUQB 2DKFA 3ZUGA 2YV1A 1LBIA 1Q7GA 1W47A 1XLTC 1ZQ1A 3LBFA 1Y80A 3THRA 2I1QA 1QCDA 3T94A 3QPAA 2ZTSA 1KHTA 3BXFA 2ZIGA 3IPLA 4BNZA 3PUXA 1N6LA 1BFDA 3BTVA 4DEYA 2PO5A 4TRNA 3HQ4O 2GRJA 2WWXA 1U2QA 4YFVA 3LG2A 3HBJA 3WYAA 5KO2A 1NOIA 1ICIA 1LQ2A 4RTPA 1GQQA 3MUEA 1WSAA 1XVVA 2B20A 2G28A 2HLHA 2RBGA 1KRHA 2X9VA 3CR7A 4J7AA 4WZZA 3R0QA 5CBPA 2AHOA 2K7ZA 3A3PA 2ASEA 5CVDA 3RD5A 3KXLA 4FFRA 3U7EB 3WFIA 3EDYA 1CYEA 4U2EA 1XQWA 4S1WA 2FF7A 4AAYA 3TGPA 4M9RA 3LKDA 1I36A 2VJMA 3DV0B 1SA0B 2QVBA 3MSXA 4UMFA 2PSJA 1FYEA 1TK2A 3HVIA 2J4FA 1N0HA 2EJVA 1TADA 1CX9B 2PQMA 4WN3A 4OOFA 4C4OA 5I8WA 4BTEA 2FR1A 4C2TA 1TYBE 1YZLA 1U0SY 3V4RA 3E27A 1MO4A 1OTYA 4PONA 5L4LA 2ONJA 1W6UA 2RHWA 2FP4B 2FETA 1BS1A 1CJSA 4GH5A 4X97A 3ZH9B 2QB5A 2QX9A 3MHPA 3DVLA 1XI2A 2EGGA 3KO8A 5ALZA 4FMDF 1DRWA 1HBJA 1RI2A 5CNIA 4BC0A 2OVBA 2ZP1A 4GT1A 3LLSA 5P21A 4ANFA 3DEYX