1SEPA

Mouse sepiapterin reductase complexed with nadp and sepiapterin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
259
Chain Sequence
b'ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEPIAPTERIN REDUCTASE
molecule tags Oxidoreductase
source organism Mus musculus
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
total genus 95
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1997-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sepA00
1G0NA 3MOGA 1I32A 1ZSNA 2WMDA 4MPDA 1AGNA 3H5NA 5T67A 3GGOA 2VHVA 1DHTA 1JU9A 4FSHA 4TZKA 1EUDA 4JBGA 3O4RA 5I8ZA 3OECA 1A7AA 1E3WB 1AN9A 1BVRA 2C7VA 1VSUA 2GN8A 2RIRA 1C1XB 2QIOA 2JD2A 4CMBA 3GR6A 3DBLB 1LX6A 3DMYA 5TGDA 4L4RA 3GA0A 2HK7A 3GUYA 3WOHA 1YWGO 2B0JA 3LYLA 2C7GA 3MJTA 2ZB3A 3PFWO 3AK4A 3JYOA 3LZ6A 2FP4A 4YJHB 3PJGA 3HQ4O 5BNFA 3INTA 1F0YA 4F6LA 3ZCXA 3AJRA 3COSA 4GMGA 4NR0A 1LU9A 4CLEA 4CMEC 4GGPA 4FFPA 3DEYX 3WSWA 1YO6A 1JDJA 3K30A 2NVUB 1LNQA 1CF2O 4BNKA 4OXNA 4ROSA 5ILGA 3TL3A 4B3IA 4GGOA 3NGXA 2X7HA 4NHEA 5BNIA 3S2EA 4BO4A 5C7LO 1LUAA 3Q6IA 2AEMA 2FN7A 2IE0A 3BYZA 3EGOA 1LC0A 4D0SA 3NV9A 4EW6A 4YA6A 3DO5A 2PKQO 3TN7A 2J5RA 1E3LA 3U0BA 4J3FA 2DM6A 2J3JA 3AW9A 4L8VA 1OZAA 2PH3A 1U9JA 2DVMA 5B4UA 3B1JA 3FN4A 4BNFA 5TC4A 3OQ6A 1BHSA 2XOXA 2P4HX 3AFMA 4GQAA 3EVTA 3OJFA 4F46A 3FSRA 1PJSA 1R15A 1TT5A 5TLSA 4RLHA 2QYTA 1GZ6A 3FCOA 4CQLB 2DTXA 3ZU5A 1QLJA 4KWHA 4WECA 2X0JA 3SVTA 3UXYA 4CMGA 3FWNA 4MIEA 2YW9A 2HSDA 5JPIA 3NTOA 1O8CA 3KTDA 2I99A 4J2HA 4IXWA 3LT0A 4JJGA 3DHNA 1PGNA 1ZXLA 1O5IA 2GZ3A 3KYDB 1VL0A 1U2GA 3RASA 3PYXA 1SO8A 1SBYA 3DZBA 3WLEA 4RVHA 5T8KA 1MXHA 3DAGA 1Y5RA 4DLBA 1I5RA 4YBZA 4RLSA 5AYVA 1MP0A 3RC7A 4R54A 1GU7A 1UXGA 3ANLA 4UUMA 2VWGA 4L74A 5I7EA 4AJKA 2X22A 3NRCA 4E2WA 3PHLA 3TL2A 2UVDA 5JDCC 1C1XA 3M1LA 2JFGA 4YT4A 4R5MA 4TKMA 5DN9A 3BHJA 3WIDA 1UUFA 2V6BA 1R4NA 1ISMA 5THQA 3JV7A 5L7WA 3QIVA 4OSPA 1PS0A 2PZMA 3R6DA 1J49A 3O8QB 3OJOA 1DIBA 1T1SA 3WGQA 1GQQA 3DBRA 3DOCA 5DP2A 1NFFA 2BFMA 3RQSA 1JVSA 4E2ZA 4CMKA 3INGA 3FF4A 5A05A 2BELA 1EMDA 4J4TA 3HE3A 5TNXA 1Q7CA 2B36A 2EW8A 2P91A 3DZHA 1LDYA 3KXDA 3WR5A 1XQ6A 2RH4A 2PKRA 3KYCA 1WWKA 3KYBA 1UP4A 3VKVA 1KEVA 4J91A 1RYEA 4JBIA 4UVHA 4NFHA 3ZV4A 3JYLA 4WOJA 2FZEA 4AVYA 5TT1A 5ICMA 2NTJA 2W2KB 2W4QA 4KMSA 5IDYA 5JLAA 5U9CA 3GRPA 4ALJA 2PD6A 1NPYA 3KOUA 1MC4A 4B8WA 4BO3A 3WTBA 2G17A 3GGPA 4P4LA 4B7XA 3DWFA 2WD7A 3M2TA 3NYWA 1CJCA 1VL6A 5IZ4A 5JDCA 4CM8A 2DBQA 1JAXA 5F3RA 2Q3EA 2D2IA 1E1MA 3WWYA 4K28A 1NAHA 1UP6A 5A9SA 3CE6A 4B4VA 4Z6KA 1FDTA 1ZMOA 3RFXA 1EK6A 3EAGA 4CQMD 1PQUA 1I24A 4J1TA 4BNTA 5ADHA 2B37A 5JO9A 2HUNA 1U7TA 3H7AA 1ZNQO 4UVGA 3TZCA 1BW9B 2EKPA 4PCVA 1FDUA 3PIDA 1GL3A 2BFAA 1MG5A 4PZDA 1MA0A 1UZLA 3D3EA 4YDRA 2D3TA 3ONDA 3I5MA 2IODA 2PV7A 4R1NA 3RVDA 2Y1EA 1BVUA 2AHRA 1QYCA 3GF4A 3PYLA 1E6UA 3OP4A 4OOFA 1KVUA 3JQ9A 2B4TO 4FN4A 4J1NA 4EDFA 4CM7A 4FW8A 5THKA 5MGBA 2ZATA 3KM0A 2P9CA 4FPXA 4KQWA 3AWDA 4Z3DA 3HFSA 4GWKA 4CODB 5F1PA 4GLLA 1UP7A 3ZGYA 4W4TA 2UAGA 2O4UX 3O8QA 4J7CA 3CZMA 3D1LA 1SOWA 3PWZA 3ZWXA 1TVEA 3DBRB 2V6FA 4JP3A 1YL7A 4Z0TA 1ZKMA 4O5OA 3PPIA 3NKLA 1W6UA 2IZ1A 3RI3A 3FBTA 2E4AA 4URFA 4I5DA 1HXHA 4B4OA 5CHEA 1H0KA 3MJCA 1DAOA 2BRUA 4HNGA 3DB2A 1GYQA 1V0JA 3RIHA 3L9XA 5EINA 4MVJG 2NQTA 4CR6A 1KVQA 1OAAA 1ZBQA 4NG5A 4KDEA 4EUFA 3IJPA 1HETA 1AE1A 1ISFA 2B83A 1QYXA 2DLDA 4XB2A 6ADHA 3Q2KA 1I01A 1I3LA 2EWMA 1P33A 4UUPA 5G0UA 1E3SA 4S1VA 3FR7A 1GZ4A 1B8VA 4ND4A 2DT5A 4WKGA 1OFGA 4B8ZA 1RM0A 5JW6A 1KETA 2Q1UA 3FWZA 4WUVA 3BMNA 3H2SA 1P0FA 5G4KA 4DLLA 4CLOA 2V6MA 1DJQA 1C0IA 4YB8A 4XQEA 3ABIA 5L9AA 2E37A 1VE9A 1EFLA 5I7FA 3E82A 2I76A 2DFVA 3DXFA 4IQ0A 3U3XA 4XQCA 5BR7A 5MDHA 1W8DA 1KY5A 1KC1A 4OHUA 4KTTE 4NBWA 2HK8A 3ST7A 3DBLA 1C1DB 1QMGA 2BF7A 5FI3A 3H9EO 3OETA 2OORA 3K6JA 1KOLA 7MDHA 3ETEA 4FGWA 3RUFA 4XGNA 2CF6A 2P2SA 4Y8VA 1UDCA 1GY8A 3B1KA 3VC7A 5G0TA 3DOJA 2YV1A 3KBOA 1HF3A 2AXQA 4AJHA 1QYWA 3PHHA 1IUKA 2PGLA 2YUTA 3ON5A 2EKLA 2B4QA 3KSDO 2JCXA 2NACA 3TJRA 1PJQA 3ZH2A 3K9QO 4PZCA 3OJ0A 2WWRA 1E3JA 4QX6A 4W99A 2WEKA 4Y98A 1D7OA 3AU8A 3AOEC 3PK0A 2P5YA 2NADA 1L1FA 3IS3A 5JNLA 3MJEA 1A5ZA 2JJYA 4MVJP 3FI9A 5JE8A 4LMPA 3GG2A 5DCYA 4GAEA 1Y81A 1E7RA 1Y9AA 4GX0A 3U5TA 3EZYA 4MVJM 3I9OA 4XD2A 3KEQA 1E7YA 3OJEA 1DEHA 4IDGA 3V1YA 3C7DB 1VLLA 3L77A 4R16A 3RBXA 3R1IA 4BO0A 4J90A 1V3VA 2RCYA 1ZSYA 3ZV6A 3DHEA 2PZKA 4CMIB 4MKZA 1PS8A 4CV0A 2VRBA 1RKXA 1UXIA 2AQ8A 5A9TA 1B3BA 1IPFA 3KRTA 2OHXA 1ADCA 2PFGA 2GN9A 5CP8A 1B7GO 2YYYA 1MFZA 5T57A 2G82A 1NQOA 3U62A 3VOSA 2JFFA 3QWHA 2CDCA 2NTVA 1DC3A 5T5QA 3VH2A 3RC1A 4RVSA 1LSJA 4IM7A 4BO8A 3ZHBA 3AUSA 2I9PA 3CSDA 5CDSA 4OOEA 1JAYA 1QORA 4OH1A 4KOAA 4BO6A 1DIRA 1H6DA 4YAKA 5L4NA 1XDWA 4IJWA 4DYDA 4EUHA 4PN3A 1B3RA 3SJUA 5A5FA 4R1TA 4B7CA 4KP7A 1B0AA 2HLPA 3ETGA 3O26A 3OIDA 2TMGA 4XDYA 3ONEA 4QT0A 4OKNA 4WLFA 1LLCA 1CYDA 1M66A 1NQ5A 3EYWA 4OMUA 4YJGA 1UAYA 4DC1A 3Q0EA 5KVQA 3NT5A 4A73A 1XCBA 3VH4A 1E7SA 3JYQA 4U0KA 5JDIC 4ZJUA 1TT7A 5JS6A 3GLQA 2O2YA 2J5QA 4H7PA 2VWQA 3AU9A 4JROA 3HJAA 4DWVA 4NU6A 5K9ZA 4DBVO 5CG1A 1U2DA 1YDEA 1AHHA 1GV0A 1ZSVA 3GG9A 4CM3A 1CWUA 3F6YA 2ZJ1A 4K6CA 2D8AA 4PVDA 4GX2A 1ZEMA 3ZW9A 2PY6A 2O7SA 2ZQZA 3NAQA 1ZEJA 3NTRA 4YRDA 2PTGA 3PFFA 1J4AA 4WPGA 2P5UA 4XCVA 4KZPA 2F1KA 3JQ8B 3R3SA 2NNLD 3IOYA 3T7EA 2HO5A 1N9GB 4IGEA 3JQEA 4DREA 2HU2A 3LT2A 1H5QA 4RDHA 4WCFC 5KJEA 2LDBA 1Y8RB 4JXKA 3S8MA 2GLXA 4WLOA 5LCXA 1V8BA 4IJKA 3QE3A 3S2FA 4CMIA 3WS7A 2E49A 2YHIA 4CL8A 5BQFA 2V7PA 1QYVA 1H93A 1HDCA 1NASA 1H6BA 3RJ5A 3VVCA 2EJWA 5LC1A 4JP2A 1YONA 2QQ5A 1K0UA 2HRZA 4TWRA 2RHCA 1LC3A 2JD0A 3RD5A 4Y6SA 5DOZA 3WXBA 5JC1A 2FR8A 1CQJA 3TZQA 4BOYA 3F3SA 3FHLA 3N74A 2ZKLA 4A26A 3WDSA 3G49A 3TPCA 5JMWA 1EVIA 3JD1A 1X1TA 4EEXA 4YCAA 2ZYAA 3G17A 1MUUA 1UAGA 3EHEA 4AJLA 2FWMX 3LF1A 1XSEA 4CR8A 4DL9A 3BAZA 3AY6A 3PEFA 3JD0A 1K2WA 4I5GA 4WASA 1Z6ZA 1PZHA 1YB1A 4H16A 4UREA 3ENNA 3EDMA 1U3TA 5BSFA 2DAPA 4IIUA 1B16A 1P74A 5L51A 5L53A 2IZ0A 4Q3CA 1DAPA 4TRNA 1EE2A 1WDLA 1KERA 3GEDA 4J0EA 3UGKA 3ICCA 3PTZA 3UVEA 4NFSA 4ZRMA 5COBA 1NXQA 4PG7A 3OF2A 1FJHA 1I33A 4GL4A 1A27A 1UJMA 1V3UA 5EESA 1DPGA 1BXZA 1P1JA 4IDAA 4OL9A 4E31A 4BGEA 1EBUA 2YQ4A 4FFRA 3Q2IA 2DTDA 3NDIA 1PWXA 2HK9A 2AEJA 3DBHA 4DIOA 1X7GA 2Q2WA 3ITDA 1NFRA 3JQ9C 4XA8A 4KUEA 3TZHA 5F5LA 2C0CA 4ALMA 4DQXA 4R68A 3BTSA 3DC2A 1YRLA 2O23A 2VYND 4EUEA 2UYYA 3HN2A 2GPTA 2A92A 5AQ1A 4N5LA 1ARZA 4DUPA 3AUUA 4RPKA 4DPLA 1EE9A 5G0VA 2JFHA 5CPBA 1LBEA 2B4RO 2NUAA 1L7EA 5CEFA 3DHYA 4D3DA 1A72A 3IKTA 3QWIA 3OJLA 3NTQA 5IZCA 4E32A 5LDHA 2VHZA 4ID9A 3JQ8A 3HFGA 1OI7A 4NPCA 1LTHR 4JCOA 2SCUA 4MINA 1EVYA 2OOSA 3AM3A 3CINA 1I3KA 4I8XA 1EVJA 2ZTVA 1O9BA 2BGKA 2D59A 1I2BA 1U4OA 3LT1A 4HFNA 3TDKA 4PLFA 2DU8A 3UCFA 2CVQA 2QZ9A 4U5QA 2H5LA 3MZ0A 3K31A 2AMFA 3MCVA 2HJRA 4OXYA 5GZ3A 2Q49A 4CLDA 4PIVA 4A0SA 3VAZA 3A4VA 3GOHA 3JQAD 5A1TA 3EK2A 4PLWA 4JJIA 1IYZA 4NJMA 3A06A 3GMDA 3LDHA 3BMCA 4FCCA 2X9GA 3ZWVA 2ZTUA 3AI1A 5DULA 3ZWWA 4AJ1A 1ORRA 3H3FA 4E33A 1PJCA 3HSKA 1ISJA 1NVMB 1U3WA 1DOHA 3U4IA 4CUZA 4BUCA 3AOGA 3W1VA 4B4UA 4BIIA 4JK3A 2A4KA 1UZMA 5KJ6A 1PGPA 4N54A 2ZCUA 1GUZA 4FBGA 2Y1OA 2J3HA 4B79A 3X2FA 4CM5A 3PRJA 4MVJF 1PU2A 4J4BA 3BHMA 4KTVE 4ILKA 3HB4X 5CDGA 4XQ9A 3FR8A 5BNTA 3OIFA 4W7IA 2YZ7A 1DLJA 5H83A 1PX0A 4Z9XA 4OJNA 4L73A 5EMHA 3WX0A 4XR4A 3QHAA 4Z3KA 5H81A 3G1UA 4J7XA 2DC1A 1LLUA 2VZ0A 4CM9A 5FWNA 2IDZA 2BHLA 1GTMA 2HJSA 4IJVA 2C5AA 4GLOA 3U09A 4RV9A 5ENVA 4XRGA 2VOEA 3SXPA 4IPTA 5G2OA 3B70A 4AICA 3OIGA 3ULKA 1EQ2A 5JBIA 2P9GA 4GSKA 1ULUA 2O3SA 3GHYA 1DXYA 4Q3DA 5BSHA 5JSFA 1P1HA 5G0SA 1T2DA 3GN2A 1Q1NA 1YBAA 4EBFA 1PJBA 1IPEA 2Y93A 3BTOA 3KLMX 1N92A 4O63O 1MFPA 4U0JA 5GMOA 4YPOA 2OP0A 4BB6A 2OGUA 2J6IA 1KYQA 1XHLA 3FD8A 3DZKA 5CDUA 1XYGA 5I9NA 4PRLA 4B3JA 1P1IA 4ALNA 1UZNA 4LSWA 1R12A 1M67A 4IDBA 2C29D 4R69A 3PI7A 4ZQBA 4J6FA 3GPIA 4E12A 4RF3A 3PQDA 3RWBA 1I36A 2O4CA 3MTGA 5K6AA 3PJDA 5CEJA 4U7WA 2C07A 5EPOA 1O89A 2AQKA 4J16A 4MP8A 2FR0A 3UCXA 2GDZA 1UDBA 4RPGA 1LDMA 5JAIA 3UOGA 3UN1A 4FFMA 3JQ7A 3RROA 3GDGA 4XGKA 5C5IA 2X5OA 1UDAA 1I2ZA 2E48A 2R2GA 2GGSA 1MC5A 5JXWA 4YJGB 4E13A 2JCVA 4ZQFA 3SEFA 3WGTA 3ANMA 2WTBA 1JN0A 2QZZA 3C7CB 3I9LA 5EERA 1QR6A 4FR5A 2WSBA 2I66A 1G6KA 4K9DA 1AXGA 2JL1A 4HX5A 3E5RA 1CEQA 4WK6A 4II2A 2FSVA 4FS3A 5DBFA 4E6PA 3I6IA 4MVJA 4A5OA 1C0PA 1EUCA 4QXMA 4Y9DA 3UFXA 1U3UA 3OICA 4M89A 5IN4A 2VNSA 2P68A 3ROKA 4RORA 2AE1A 1H2HA 2FPPA 2PLAA 3GFGA 1H9BA 3DTYA 1YXMA 1Q2XA 4IMRA 3QW2A 3VTFA 3DDNA 1KC3A 1YKFA 3BZUA 3LF2A 4N7RA 1HLPA 1GD1O 2LDXA 4BGIA 1WMAA 4WE3A 3UHAA 1NM5A 1V35A 3FNFA 1U5CA 2Q1WA 1V9LA 4YAIA 2YHIB 3GZNB 5CPFA 3RAJA 5FEUA 2VT2A 1RWBA 1PL6A 4YT5A 1O94A 3H9GA 4IGFA 1S6YA 4HXYA 5CDYA 1VJTA 3D3WB 1CERA 1E77A 1YJ8A 2Q46A 3TQHA 2IYPA 2DTEA 5IG2A 4K26A 1HE4A 1X0VA 3GDFA 4UEJA 1OOEA 4F3YA 1ZUD1 3PP8A 5EQDA 1Y8QB 2CSUA 5DOVA 4DXHA 3OEYA 2I3GA 1VKNA 4YR9A 3DFZA 3TF5A 1XU9A 1BDMA 3LC7O 1NNUA 4IY1A 3RU9A 4JQCA 1V6AA 1BG6A 4RVDA 4BKQA 3IQDB 5H82A 1P45A 4NBVA 5IF3A 2AQIA 4BNNA 4IXTA 3T4EA 5CEEA 3F46A 4HWKA 5JYEA 1F12A 3KEOA 5JMPA 5TF4A 1YVEI 1A7KA 1Y1PA 5GZ6A 3EMKA 1WZIA 4E3ZA 4I5FA 2VQ3A 4INAA 2V6GA 4K1LA 4RJTA 4YRAA 3LVFO 3HDHA 1HYEA 1HDYA 4TMFA 1Q0QA 1LI4A 2Y1DA 3U49A 3PVZA 4LCEA 2EV9A 3DTTA 4R3WA 4BO2A 3IC5A 3H3JA 3NJ8A 1HL3A 1UH5A 2DBZA 3OA2A 3KO8A 3HZZA 4CMEA 3Q9NA 4M86A 3VDQA 4FOOA 2QHXA 4R9SA 4R41A 2QX7A 4XX0A 1WPQA 4BNVA 4WOKA 5EQFA 1RM5A 4R1SA 4XB1A 1X14A 3QP9A 3CPSA 3QRWA 1FDSA 3E03A 3Q11A 1WDKA 2AG8A 2CUKA 3GUCA 3GAZA 3ZI0A 3ZNPA 4O6VA 4YAGA 3ORFA 1PGJA 2X86A 4RQUA 4RZIA 3GH3A 1B2LA 4CJXA 1SCUA 4ZICA 2PA3A 4G2NA 4C4OA 1QXSA 2Y0DA 4BNGA 1NFQA 3ZWOA 2DKNA 5IZCC 2GO1A 3DZIA 3LK7A 4RF4A 1TI7A 2GNAA 4FOSA 3WQRA 3ADPA 2FY8A 5A06A 4WEQA 1UR5A 3WWZA 1NYTA 1FF9A 3G1TA 4FFNA 1O6ZA 3OH8A 4ONEA 2Q2VA 2HMVA 1T2CA 1ISIA 3OA0A 3P5SA 3PGJA 4U6QA 2NM0A 5JY6A 2HCTA 1YBVA 4E0BA 1M6WA 4J9VA 3N58A 4UEOA 1J6UA 4HADA 2VTEA 3BTVA 3F1KA 1DFHA 4HFRA 2GZ2A 1ULSA 4EI2A 3BMQA 3QVXA 2IXAA 1M6HA 1T25A 1GYRA 4ZD6A 3P2YA 4I1IA 2B5WA 5TJHA 5DCWA 3W8DA 1DDOA 2QW8A 2CY0A 4ZQEA 4MVJI 3PXXA 4ND3A 4BNUA 4YRBA 4UVEA 1VJ1A 4EGFA 1NQTA 3F5SA 5TRTA 3HDJA 4E5PA 1DRWA 2F00A 3Q9UA 3W4KA 5IXSA 4DIFA 1L7DA 2DBRA 4G5HA 4CLXA 5HTOA 2R00A 3WQSB 1EQUA 3M6IA 3P7MA 5B12A 4ZHSA 1JWBB 3OQ1A 3FRJA 1E1NA 1TT5B 2C82A 2EP7A 5C7IO 4U6SA 1ONOA 3ENKA 4DMLA 1GQ2A 1JTVA 2NU8A 2CFCA 5DBIA 1QV7A 5HA5A 1NR7A 1LQTA 3PGXA 1A4UA 3WIEA 3GRKA 4Y67A 4WNCA 2P4QA 1N2SA 1X0XA 2UUOA 4MIYA 5TX7A 4WLVA 2B35A 1HTBA 2DFDA 3BHIA 4NK4A 4CL3A 1T4BA 4BS9A 4BO1A 4R3NA 4BKRA 1TXGA 4ZRNA 3ROPA 1T4DA 4MDHA 4WJZA 4KDFA 1HE3A 1Z7EA 3NT2A 3CTMA 1OC2A 2H9IA 3L6EA 2OXIA 4BNIA 1DRUA 2EGGA 4MO2A 3VPSA 4XZ3A 5FF9A 3SBOA 1GV1A 1MGOA 5J23A 1G0OA 5L45A 1FDVA 1F8GA 1FMCA 4D42A 1DIHA 2EEZA 4QSMA 4BNWA 3F5QA 5L4SA 4HFMA 4C7JA 2QRKA 1C0KA 1PIWA 1I0ZA 2C20A 3DAFA 1DC5A 2NVUA 1PTJA 2WYVA 4I5EA 4NU5A 4OQYA 2CD9A 1A9YA 4BB5A 2GYYA 4BHTA 3Q3CA 4D7AA 3JD3A 2OP1A 5GY7A 4IDEA 3VPHA 1GUYA 3JQCA 3WGOA 5CG2A 1E3IA 4JBHA 1D8AA 3BMQB 2FZWA 3E18A 4GBJA 3V5NA 2UDPA 2YJZA 4BMNA 1Q7GA 3L07A 5C3MA 3IDSA 3QJ5A 4TVBA 4XIJA 2AEFA 3LQFA 2FPIA 3E5MA 3RKUA 1IHXA 1K6JA 3B1FA 9LDTA 2QRJA 4AFNA 4A7PA 2J8ZA 3WG9A 4BO5A 1GCOA 3VZPA 4XIYA 4H3VA 4BQPA 3HWRA 1HKUA 1H6AA 3VH3A 1E7WA 1NP3A 2GCGA 2VRCD 5A4DA 3WLFA 5B4TA 1TEHA 2I67A 1GPDG 1F14A 1X13A 2JHFA 1LSOA 4DVJA 2WD7B 1T2FA 1ZMTA 4BNMA 4YQYA 4WCFB 1VI2A 1LLQA 3I9JA 2VWPA 3NGLA 4PG6A 4WLUA 4BGUA 5KVVA 4CM8B 2XXBA 4HBGA 3UAGA 3UICA 1IOLA 1JKJA 1B26A 3H65A 2C59A 2PH5A 4LMRA 3DONA 4J9UE 5F1OA 2J5KA 3KYDA 4GMFA 4WLNA 3U4HA 2ZCVA 1HRDA 2EHDA 3WJAA 5C37A 3F4LA 1E3WA 1B8PA 3B6ZA 3RUIA 4H15A 1WLYA 1BMDA 3WYCA 3MJVA 1HDXA 1QRRA 2I3AA 5DT9A 3ZHYA 4KUHA 1VSVA 3H5RA 1Q7BA 1ZO8A 4W9NC 3UH1A 5TQVA 4FC7A 3WGGA 5LDGA 4D41A 2NU9A 3H9JA 4O59O 2CF5A 4MJLA 4TRRA 3LLSA 3FPCA 2DQ4A 4TVOA 4YWJA 1RM3A 2NVBA 1NVGA 3KSZO 1O95A 2R6JA 1R66A 1IE3A 1ZK4A 3ITKA 3RUHA 4DLAA 3ROMA 2EIHA 1PGQA 3PLNA 3GVHA 1HLDA 1PGOA 3WNVA 3ZHXA 1XQ1A 1HWYA 1N1GA 1V3TA 1OMOA 4Z0HO 3WFJA 1NQAO 4YXFA 4QTZA 4EITA 2Q99A 4MVJH 1HZJA 3ZV5A 3RFVA 3GZ4A 2ZQYA 4FB5A 4L4XA 2A35A 3ETDA 3ASUA 3KYCB 2VOJA 3AI3A 3SLGA 1R37A 1D1SA 3UW3A 3VZQA 5I8WA 3F1LA 3ZNNA 5JDIA 3GFBA 4FJ0A 2YV2A 2W2KA 4AJ2A 4CUKA 3IIEA 2BD0A 1P1KA 1DBVO 3CKYA 4XEHA 5B37A 1GQYA 2Q45A 5T8KC 4E2YA 4TROA 3KVOA 1ENPA 2ZTMA 3R3JA 2W2LA 3S2IA 3WTCA 3ASVA 4MKRA 1DIGA 1QV6A 5ITVA 1MXFA 5KJCA 4Q3NA 3BTUA 2Y05A 1NTOA 4LN1A 3UKOA 2GUGA 3OSUA 1YE3A 1J0XO 1XLTA 4NJOA 4D79A 3CEAA 4GPD1 3BMNB 3V1TC 4PG8A 1VL8A 5U1PA 1PL8A 5ES3A 4PG4A 2FPGA 4QFCA 1VM6A 1XEAA 1K5HA 1X7DA 3V2HA 1VPDA 3W4IA 4LGVA 5DDIP 4OYRA 4YT8A 1HSOA 2OMEA 2VUUA 5ER9A 4MP3A 3RC2A 4EJ0A 2RHRA 2VYVD 2DPHA 3WQQA 1WVGA 3JYPA 3ZWCA 3CH6A 5DNAA 2YFHA 3IMFA 5JY1A 4IJUA 3GNQA 3GY0A 3R0IA 4P4GA 4ALLA 3KHUA 2G1UA 4D3SA 4RF5A 1LLDA 4RO0A 2ZB4A 3MJ4A 4JLWA 4YAEA 3A28A 3EY4A 3FTPA 4IDFA 3DZJA 4EZBA 1LJ8A 2VHWA 3Q1LA 3K96A 2GD1O 4O0LA 2XXJA 4PFJA 3ZHZA 4E5MA 4L9RA 1Y6JA 1FK8A 1XWFA 5JC8A 2X0RA 4GKVA 2NWQA 2VZ8A 3CZRA 2X1HA 4IZHA 4RGBA 3GMSA 1PQPA 3WMWA 5F5NA 1I10A 3WBBA 1C3VA 5KVSA 2Z95A 2OL4A 1PJLA 4PLGA 3O9ZA 2P9EA 2X8LA 4RPHA 1KY4A 5ICSA 2C2YA 3CXRA 1H6CA 2PGJA 3JYNA 1ISGA 1ENZA 4PLZA 4Q3AA 1D4FA 5A3VA 4NMHA 2Q50A 4JGBA 4KQXA 4OGWA 4XRRA 4CUJA 4RVUA 1JW9B 4BGVA 1T1RA 1HSZA 2EKQA 3HADA 2HAEA 4JJFA 3TOXA 2C2XA 2GASA 4J1SA 4IDDA 1KS9A 4WNIA 5HS4A 3IUSA 5TS3A 1JVBA 4TQGA 2W98A 3AM4A 2ET6A 3H5AA 2A9FA 5A04A 2GN6A 4E2XA 5EN4A 3RBVA 1BW9A 5FI5A 2E82A 2EP5A 3DZFA 4MVJE 2JHGA 2E6UX 4LISA 1HYGA 1KVTA 3BXXA 2DUUA 1DB3A 1EDZA 1SZJG 2JD1A 2VT3A 3SC4A 1XA0A 2X0NA 4IIVA 3OM9A 3RC9A 1OBFO 1E3EA 5HRUA 2Y1GA 2WE8A 3KSUA 3FBGA 4DIBA 2GN4A 1SB8A 3FNEA 1R4NB 4QFDA 4BO7A 4M49A 1A71A 2PNFA 2NVWA 2HDHA 3I9NA 1XR3A 4WCDA 2NLOA 3VHRA 3NDRA 1Y9EA 2IEBA 5HM8A 2Z5LA 5G0WA 3PYMA 4D3FA 2PD4A 2AW5A 1Q0HA 2HQ1A 1GZ3A 1P9LA 4ND2A 5EL0A 3D0OA 4YQZA 1W4ZA 2NU6A 3C1OA 3AFNA 3K73O 2ZYDA 1GAEO 5HWSA 1DLIA 3RFTA 1CIVA 5G4LA 3L6OO 4D43A 3DR3A 2OO5A 4PLCA 4U8GA 2PZJA 3G3EA 1PL7A 2VHYA 5DZSA 5L4LA 1ZK1A 1AHIA 3D4PA 3RKRA 1T26A 4EYEA 4HKTA 2GF2A 2BLLA 1GPJA 2ILTA 2PZLA 3OBBA 1YQGA 5I7VA 3GVCA 4HFJA 1ID1A 1YDWA 1N1EA 2O3RA 1ZZEA 4RVGA 5I7SA 4CMAA 3E8XA 1YQXA 3ANNA 3M2PA 2JAHA 2VN8A 8ADHA 1Y8RA 2FRDA 4X54A 4DC0A 1XGKA 1JKIA 2JCYA 1WP4A 2PR2A 2O3UA 3BMOB 3FPLA 4PRKA 4TRMA 3I23A 3C1AA 1CETA 1D3AA 2POQX 1W0CA 3HNPA 4XYGA 3RUCA 1GEEA 5A9SB 5IFLA 1B14A 1HT0A 1K89A 4CM9D 3C1TA 1E6WA 1TA4A 3BIOA 2YDXA 4TSKA 4CQMA 3GEMA 1N8KA 3RJ9A 3JTMA 3E9MA 5BSGA 4GX5A 3IL2A 1BWSA 2Y99A 5A02A 4CLRA 1C1DA 1X15A 5IN5A 1I3MA 2I6TA 3F4BA 4ITUA 3GDOA 5DP1A 4E5NA 2R00C 4MP6A 4WLEA 1E5LA 5ER6A 3T4XA 3QVSA 3C3XA 1XU7A 3WGIA 3W4JA 1R0SA 1U4SA 2TMDA 4QEDA 5JCJA 3K92A 1W73A 2H1SA 3LC2O 1PR9A 3HDYA 1GUFA 2WDZA 2ZB7A 4GI2A 4IINA 4IBOA 4ND5A 1GCUA 5IAAA 3QWBA 3DL2A 1K3TA 4A2CA 4GWGA 5L40A 3L9WA 4BL5A 4FIZA 2XAAA 4NDNE 4FD3A 4QO7A 5CDTA 1GFSA 3GNSA 2YHUA 4A03A 2YV3A 2VNAA 3DBHB 4RVFA 5A03A 3P19A 5AOVA 4Z0PA 1MX3A 2G0TA 3I1JA 1A9ZA 4M54A 3FNHA 4NK5A 2O7QA 4I08A 4YACA 2B5VA 1RYDA 3K5PA 5T64A 3LC1O 1KEPA 4D44A 5C7OO 5L95A 3QLJA 4ESOA 1SC6A 1MLDA 4RL6A 3D4OA 3E48A 4RCVA 1N9GA 1DFGA 1X1EA 3JQ6A 4NBUA 5DF1A 3ADOA 4ZN6A 3MEQA 2CVZA 4O1MA 3VZRA 4J1QA 5ILOA 2ZIZA 2Q2QA 3O38A 4IZIA 4JN6B 1P31A 2C5EA 1NAIA 2BH9A 3BMOA 4CLOB 4DPMA 2VCYA 1JA9A 4AL4A 4L76A 5AXDA 1IHYA 1LRKA 2D0IA 1K6XA 3L4SO 3W6ZA 4DPKA 4WGGA 1PZGA 1N7GA 3PHJA 1E92A 4W82A 3U4CA 1BXKA 3WJ7A 1KVSA 3EUWA 3M1AA 4CQMB 2AG5A 1R6DA 3NT4A 5IJZA 1LDGA 1PWZA 1RJWA 3SX2A 5JAMA 3GGGA 3V2UA 3H9UA 1Y7TA 3SJ7A 2CZCA 3KETA 4W6ZA 1KEUA 2X5KO 3TOZA 1M2WA 3I83A 4UAGA 1DHRA 1UXJA 4BV9A 2CNBA 3KB6A 2OUIA 1ENOA 1KVRA 3ZU3A 4XJTA 4ZA2A 2I65A 5GZ1A 2G76A 1BXGA 4NBTA 3V8BA 3WB9A 1WAMA 1SNYA 3FNGA 3QWFA 3VPFA 2Y0EA 5JO0A 4BV8A 4I9UA 5IDXA 4EEZA 2WYUA 4C7KA 4Q39A 5G4KB 4E30A 4XYLA 4MVJD 2Z1NA 1DIAA 5KVCA 1ZJZA 3IKVA 2UV8A 3NDJA 3PDJA 4CR7A 1EFKA 4UUOA 3AM5A 1E5QA 4DTIA 3TFOA 3I6QA 5K6AC 4YYZA 4DQVA 3VH1A 4UVIA 1HDZA 2Y67A 1ZCJA 3ZWAA 1X7HA 5B1YA 3I9MA 2O50A 4NQZA 2FHSA 3SLKA 3TSCA 4KWIA 1QYDA 2UUPA 3JQGA 2FR1A 1VC2A 3GPDG 3TRIA 1EEHA 1UXKA 4IQGA 1DC6A 2NTNA 1NHGA 2VYVA 4LK3A 1IL0A 2D5CA 3W8FA 3HG7A 4OAQA 1ZH8A 3C24A 4UUNA 5COQA 3S55A 4R1UA 4OSOA 3JD4A 5CAEA 2BKAA 4YT2A 1EBFA 4UVDA 1JQBA 4FJ1A 1I2CA 2GRAA 1PJ3A 3JQFC 3TNLA 3E6AA 4CV2A 3DOOA 1A4IA 4CV1A 1T24A 1IB6A 4IMPA 3QVTA 3K8ZA 3PZBA 1ADGA 3PWSA 2VTDA 3ZWYA 4II3A 4Z9YA 2Q4BA 4RF2A 1HDOA 2JKVA 2WJPA 4DRYA 1LRLA 3WNQA 3L0DA 3C8MA 3E9NA 4YJDA 1MV8A 4B3HA 2HMSA 3KUXA 1J5PA 1I3NA 2H6EA 4MKXA 5BT9A 1YQDA 2NV6A 2O3JA 3L6DA 4GKBA 3RUDA 5JAZA 3E1KA 2IZZA 4BNXA 1JLLA 1U28A 3CMCO 2D1YA 2Q1SA 3D5TA 3ICPA 1I8TA 3KV3O 1XG5A 4LVCA 2WD8A 1YBMA 4HP8A 3ZZNA 4JNKA 2BFOA 2HMTA 5KWEA 4BNYA 1Z45A 1BXGB 3MTJA 2NQ8A 3K2BA 4R51A 4XDZA 1G1AA 4W7HA 2HMWA 3RCBA 1LDBA 3A1NA 2O3TA 1R4MA 1M76A 7ADHA 1XIVA 2EW2A 1KIFA 2AE2A 1SMKA 2VRCA 2ZYGA 1HYHA 1Y5MA 4B7UA 3CIFA 4AG3A 1YH3A 3TZ6A 3AUTA 4YEDA 3UCEA 2JAPA 4J43A 4CM4A 1IZ0A 2G5CA 3JQFA 1ADFA 1TLTA 4P38A 3VVBA 3WBFA 4XGIA 4W9NA 2YY7A 1IY8A 3JQGB 1YGYA 1BSVA 1YB4A 2W8ZA 2VUTA 8LDHA 4GX1A 3IUPA 1WMBA 1ZK3A 2XPCA 3K2EA 1E1KA 2Y66A 2EJVA 1QKIA 2H63A 3ROQA 4CM6A 1LSSA 3G0OA 4BKPA 3BA1A 3LLVA 1E7QA 1SPXA 3ZWPA 3JQBC 4AJEA 4NJMB 2RBEA 2GR9A 1UXHA 5U4QA 1QLHA 3ZU2A 3ZU4A 5IDQA 4M55A 3EVNA 2VUSA 4Q3EA 4P4NA 1Y8QA 1LDEA 4FFLA 4CLRB 4R01A 3I4FA 4N18A 3ZWBA 4I9HA 4HNHA 3OFSA 2GERA 4WEOA 1GEGA 1YOVB 4J7UA 4CLHA 3QA9A 1F06A 5FFFA 1BGVA 3PZRA 3SC6A 4CM1A 4UULA 1Z82A 2CVOA 5A3JA 1CDOA 1QSGA 4LCJA 3U9LA 1CRWG 1M75A 4LRSB 3DQPA 4PLPA 1ADBA 1O0SA 4ZQGA 1N5DA 3VPGA 3WICA 4XYBA 5L3ZA 1SEVA 3E9QA 2ZK7A 4R5HA 1U1IA 1XKQA 3N7UA 4YVFA 3RUAA 3AUAA 2PK3A 5A9RA 3JCZA 1SOVA 2QG4A 4AJNA 4FFOA 4XQGA 3IJRA 4FC6A 3MWDB 4Q3BA 1JWAB 4ZQHA 1ZK2A 3C85A 4OIMA 2IXBA 4BVAA 1NWCA 4YJFA 4RZHA 1BRMA 1OC4A 5JYDA 2BI7A 3TFQA 4RDIA 2DUWA 4XKJA 4M1QA 4ZU3A 3WYEA 4G81A 1Z7BA 2X4GA 5CFZA 4J0FA 4Y6RA 3MWEB 1R4MB 3PDUA 5TT0A 3JQBA 4TKLA 3GK3A 3PLRA 5A5EA 3I4CA 2YFQA 3WFIA 4YTEA 1H9AA 3PWKA 3QWAA 3GQVA 4YAJA 4N5NA 2ZTLA 3HN7A 1LQUA 1PS9A 1AUPA 1LXCA 2W90A 3H9QA 4XYMA 1ZW1A 1PJ4A 3AY7A 3WSVA 3RUEA 1SAYA 1E6EA 2GSDA 3GVIA 4PG5A 4QO8A 3UF0A 1KBZA 1WW8A 1C14A 1HEUA 2OBYA 3EW7A 1YB5A 3LU1A 3H8VA 2IRWA 3OMLA 3GZNA 3JD2A 4IS3A 1P0CA 3S1LA 3ZDFA 3H2ZA 1YL6A 3I3OA 4TZTA 3VTZA 1R16A 4I9NA 4GSLA 1LA2A 1BTOA 3RBZA 3AY3A 1IULA 3BMCB 2EG9A 2RH8A 5HBRA 3GVXA 5BSEA 3STHA 3WGZA 4RQTA 5KIAA 3DAPA 2HMUA 4FDAA 4A27A 4PLVA 1DFIA 4BNJA 4LSMA 4NFYA 1HZZA 1DO8A 2AA3A 3DFUA 4GVLA 3VKUA 4RPJA 4IS2A 4DBZA 3DBVO 2D4AA 3HDQA 1WNTA 1LEHA 1P44A 2OBNA 3DZGA 3VZSA 1SB9A 3WGYA 3IP3A 1YL5A 1N7HA 4L75A 1C0LA 1U3VA 3MOIA 3ZN2A 5KTKA 1ONNA 1YOVA 3LT4A 3CUKA 2X58A 3G79A 1PSDA 3NEPX 1ZFNA 1TB4A 3ZWMA 1LRJA 2CDBA 2FOIA 1MG0A 3IP1A 2QRLA 2FMUA 1IZ9A 3PJFA 2HRBA 3H4VA 3JQDA 3PQEA 3A9WA 1R0KA 1XELA 3AOEA 2WE7A 5F1KA 2X9VA 3GEGA 1B15A 3I52A 3F9IA 3PHGA 3WMXA 1GR0A 4HUJA 3GC6A 4S3MA 4J4HA 3LSYA 4UEKA 3GAFA 4CV3A 1NWHA 3GN1A 1T2EA 2BMAA 4OXKA 3WYBA 1YJQA 4DA9A 4XR9A 1ZIDA 3PIIA 3W8EA 5AXAA 5KOIA 3HHPA 3OHSX 4EJ6A 1ZK0A 4YJFB 2D5AA 4BKOA 3JQAB 2PWZA 3JSAA 4AJIA 1QP8A 4HY3A 1YS4A 1EK5A 2X0IA 3CMMA 4Q9NA 3P2OA 4L4SA 1FXSA 3DMTA 3EZLA 4LW8A 2OFPA 3GT0A 4AJOA 1PJTA 4QECA 1T2AA 5TSDA 4AJ4A 2X23A 2IEDA 5IXYA 1NVTA 1S7CA 3IAHA 4M87A 5DCUA 4TRJA 4NH4A 1SEPA 3NX4A 5B4VA 1ISHA 3ZNOA 5IDWA 1Z74A 5AXCA 3VDRA 5AXBA 1R0LA 3TZKA 2X6TA 2DPGA 2GZ1A 2I5PO 4L0QA 3V1UA 4BMVA 2ZB8A 1PEDA 3H6KA 3PQFA 2X9NA 4PZEA 1NR1A 5HS6A 4XWYA 3QY9A 1E0DA 3PHIA 4EJMA 4R9RA 4IDCA 3KZVA 1D1TA 1PR3A 1E1LA 4N5MA 4BO9A 4ZGWA 6LDHA 1WXDA 3L4BA 3JQ7B 3S2GA 2J3IA 2C54A 1LSUA 1P77A 1VJ0A 2ZJ0A 5EJ2A 4KUGA 3KLPX 4DMMA 1EDOA 3FTNA 4AJPA 4D0RA 4OKIA 1GDHA 2XF8A 3A14A 3F47A 4K6FA 1PQWA 3U4DA 1Q0LA 1GYPA 1H94A 4XYEA 5KKAA 3AI2A 3L4BC 2FSSA 1ENYA 4NBRA 4PLTA 5I9MA 1HE2A 4GH5A 2OZPA 2VWHA 1H2BA 1PZEA 1ZJYA 1DSSG 3OEWA 3QV1A 4BNZA 3O03A 1F8FA 1NPTO 4OO3A 2YDYA 2VHXA 2EERA 3HB5X 4NNJA 2O3QA 3ONFA 2W2LD 2RAFA 4ZVVA 4E21A 4D46A 1U5AA 4FJ2A 2O48X 1P1FA 4P22A 4R4JA 5T6BA 3B20A 5AVOA 1QG6A 4E4YA 2V65A 2PKQP 5TIIA 1MB4A 3QSGA 1NX6A 1FDWA 2Q4EA 5KNLA 1ONPA 5JFOA 1WZEA 2VZ9A 4A10A 3TWOA 1VKOA 2PD3A 5TJ9A 4CPDA 2BFPA 1PJ2A 5COAA 4IQ8A 4DYVA 2WM3A 4ND1A 3QVWA 2VYNA 4QUKA 4J49A 5I9LA 3W6UA 2IYOA 2AQHA 4Z9FA 5L7TA 4PVCA 4RPLA 3DMTC 5KCZA 4CM4B 4BQRA 1PZFA 3JQAA 2QYSA 1JKFA 1ML3A 1DJNA 3X2EA 4FGSA 4NIMA 1HE5A 1ZXBA 1EVZA 4YJHA 2O2SA 3D5QA 1WDMA 4PLHA 4BMSA 3D3WA 2Y0CA 4DGSA 3GHHA 4BKUA 4LVUA 3ZV3A 3UUWA 2YQ5A 1I30A 3RU7A 2B69A 2BI8A 2Y1FA 4F6CA 2A94A 2Y68A 1ZVMA 3D4NA 2BGMA 5KKCA 4ALKA 2J3KA 3V2GA 3NUGA 5ENDA 1P1RA 2X5JO 1K6IA 4NZ9A 2Y1CA 5FYDA 5L7YA 5EIOA 5JCXA 2WYWA 1Z73A 3GVPA 4E5YA 2CDAA 4IUYA 4D45A 1U8FO 1VRWA 1LDNA 1HDRA 2NSDA 1NBOA 1E7MA 1GADO 5F21A 3D64A 3C7AA 3ZNQA 3ZW8A 1BDBA 4B4WA 1HDGO 1EUZA 4FQ8A 2BGLA 2PGDA 5DBGA 4BNLA 1B8UA 4BNHA 3ZWNA 1KEWA 4QQRA 4G65A 5JAQA 1Z75A 4ALIA 4AJJA 5K0ZA 4M8SA 3GNTA 3INRA 1U7HA 2NU7A 1F17A 3OQBA 4NI5A 1U8XX 1DRVA 3VPXA 1RPNA 3QVOA 4CQLA 5KJFA 3HUDA 3WGHA 2CMDA 5JCJD 1NPDA 3QQPA 4Y6PA 3EC7A 4DQUA 9LDBA 4XJSA 4HV4A 2EXXA 1CQIA 4GVXA 3PJEA 2EF1A 2Z1MA 4LRTB 3RSHA 4CMHA 2Q1TA 4J2OA 3T7CA 4MIOA 4E5KA 1NHWA 1P3DA 3NJ4A 4OQZA 2HKIA 3MJSA 4JIGA 2EGHA 4JX8A 4OM8A 1EZ4A 4WCFA 4CMCA 4PGFA 1DC4A 4CMJA 2DBVO 4MOWA 5ITWA 5KJ1A 4P8RA 1AXEA 1RM4A 4PLYA 4F45A 3I9KA 3D7LA
chains in the Genus database with same CATH superfamily
1E9DA 4MUNA 1JHYA 1RKQA 1Y3IA 1ZSNA 5K8TA 1TQ6A 1AGNA 2DH6A 2I78A 4TYYA 2VHVA 3FROA 3G2NA 4QOSA 1X1QA 4UASA 3OF3A 3OECA 2FYTA 4CIYA 3B3AA 2GXQA 4LF8B 4EI7A 1ACMA 3ZYCA 4CXMA 1C1XB 2JD2A 3BJRA 3EGDB 2I2AA 5ALJA 3DBLB 4Q00A 1CY1A 3ZY4A 5DN6D 4DSAA 3QOFA 1XDSA 1NVUQ 1QVRA 2G28A 1T8UA 2GJKA 3NHBA 2NOAA 3BXZA 2B0JA 3C45A 4S0ZA 1PJZA 3OOHA 4S1PA 3SKVA 3AK4A 4ZCTA 1HDEA 4M22A 4DG5A 4WBNA 1DKNA 1NUQA 2FP4A 2YXEA 1TVMA 3BERA 2H4FA 3A6JA 1H66A 3OZAA 3INTA 3P9IA 3TLCA 1V5FA 3ZCXA 4YRMA 3DLTA 1LU9A 4KLCA 3AKZA 2JJMA 4GGPA 4FFPA 1RWQA 4RMHA 5FUVA 5TQJA 1GAXA 3WB2A 4HWSA 1J0BA 3KP1A 6REQB 5SY9A 2DXIA 2Q41A 3GWZA 2G5GX 4BNKA 2V3VA 4OXNA 4QOFA 1EB8A 4YAOA 3TL3A 3QFRA 4B3IA 1FFHA 1N5RA 3L7AA 1TLFA 3T41A 1XP8A 1HT2E 1PP4A 2CBGA 2O1SA 3HY6A 2AEMA 3Q6IA 4FUTA 2QRHA 5AKKA 5C7LO 2FN7A 4MICA 1XD2B 3B82A 3HJNA 1CUHA 1C7RA 3EGOA 4D0SA 3WO0A 2CE2X 3EASA 1I3OA 4O29A 1S9HA 1YIDA 4XLLA 5CBPB 3ROTA 4GBMA 3GW8A 2PKQO 4LJ8A 1W88B 2DKFA 3TTWA 3LCRA 4P93A 3O3CA 3STXA 3QY0A 1ECLA 2H59A 4O4IA 5IDVA 5M5BA 5DPMA 1OZAA 3G9ZA 2F3SA 2QTMA 2DVMA 1T5TA 3AEZA 1TTPB 3FN4A 5JXGA 5TC4A 2HDOA 4RCZA 3FPKA 3HCOA 1N5KA 4LXGA 4YUAA 2P2YA 2XOXA 2P4HX 1WUJS 1CTQA 1Z8FA 2Z9BA 2QJTA 3AFMA 4GQAA 3OJFA 4H6WA 2WHRA 4UHCA 1PJSA 1R15A 4F46A 2H1IA 1KK1A 5C8DA 1M2OB 1VXRA 3S1AA 4CCWA 5TLSA 4TL6A 5AJTA 4CQLB 1TZCA 3GLFA 2FZCA 2WQ6A 1L9XA 2J33A 3AF3A 4WECA 5TQ0B 5CD9A 1YVPA 4CMGA 2F64A 3FWNA 3USES 4EIWA 5DX0A 4WHMA 4QPJC 1OIWA 1UDXA 5JALA 1SHTX 3LXMA 5ELMA 5HZGA 1OX6A 3JXEA 2P62A 1YHYA 5KTOA 5KU1A 3ZHSA 1L2TA 1O6GA 2VUIB 5HRAA 4L4YA 2ZJAA 2I7VA 1VL0A 2J7PD 5DLQC 2EOAA 2IPLA 3ZVKA 1M74A 3OLXA 3PYXA 1SO8A 3DBOB 1MJHA 4IOJA 1SBYA 4GXNA 3DZBA 1GPKA 2JFQA 5DNUA 1GL9B 1LD3A 1QR2A 1SCNE 1RWOA 2R9VA 3F0TA 3Q5GA 4FX2A 2C42A 4RLSA 2I0FA 5AYVA 2G1JA 3UQZA 1CEYA 3G0HA 1GU7A 1UXGA 3ANLA 4OQMA 2WAOA 2FEAA 2QE6A 3JWEA 5LD2B 3TW8B 3KOOA 2JIQA 4D4HA 1D6JA 4LRYA 4IVQA 4MV1A 1UKVY 2FLKA 2XF2A 2JFGA 4YT4A 1J5XA 4R5MA 4QPCA 1D6SA 1YU9A 4I4TA 1LGYA 4I8DA 2PL5A 4LECA 4PYKA 3O1JC 3RIYA 3WIDA 3CGGA 4UM9B 5KYUA 2HFJA 1R4NA 3IYLW 5THQA 4RAOA 3OTOB 3LPMA 3JV7A 2NSJA 1M5UA 3QH4A 2IYLD 3OCVA 3QIVA 4O3FA 4TWJA 3UJPA 5IKMA 2OO7A 2JGIA 2PZMA 1NVKA 4MW9A 1BKDR 3I1IA 3O8QB 4FHFA 2AL7A 4NBLA 3C6QA 2IWHA 1T1SA 1U1GA 1GTRA 5E9WA 3DOCA 3HXKA 1V1RA 3C3WA 4JVOA 3MJDA 4E2ZA 3IUMA 3T1TA 2OC4A 4CMKA 1D2GA 1N5MA 3TW6A 4B3SB 5A05A 4A6EA 2XE4A 3WR5A 3DZHA 4UM9D 3KXDA 4P92A 3TIFA 2RAPA 3E9DA 2CNNA 2RH4A 2ES4A 3RVQA 3X1KA 5ALLA 2Z4TA 5DNCA 1WWKA 3P27A 3QFTA 1KJYA 1R4AA 2JBHA 1C3OA 4DB2A 1BGXT 3F6EX 4K05A 1NF3A 1BKSB 3P2EA 4R1LA 3LUJA 3PFGA 5TT1A 5JVDA 3W2FA 4ZGBA 1QRDA 4EWLA 1N2OA 3NEJA 1NUTA 4X6UA 5JLAA 2N46A 5U9CA 4OATA 2JF0A 4IZ6A 5ICCA 4Y1RA 1MC4A 4M0CA 4B8WA 2OFWA 3KHTA 5FV4A 1RPAA 2KBFA 5CCDA 5ANRB 4P4LA 3T3PB 2V96A 4FOTA 1WXIA 5LZ2A 1QHIA 1AQJA 2WT8A 4B7XA 1HKHA 4AN1A 1FZQA 3OZRA 2WKQA 4GKAA 5DM2A 4D9GA 3VA7A 2G70A 3NYWA 4L7VA 3PRHA 4ZVMA 1UFVA 2NZXA 2ZR9A 2DBQA 1JAXA 3QBTA 4DM7A 5KNBD 5K2OA 3FPEA 4HB2A 1LPOA 3O0TA 3LWDA 4HQNA 2RCNA 4ZOAA 2V1XA 1RI5A 3RW9A 2V45A 3U40A 3VR2A 4BMYA 4Z6KA 2D1FA 3FLAA 1EK6A 1N75A 1F48A 4L51A 1IN7A 1U2PA 3MCAA 4D3XA 2G9UA 1JYSA 2VJQA 3FMIA 3FUXA 3L5OA 3PDWA 2A9KA 5FBHA 5JO9A 2B4YA 1FE8A 3KCNA 3TZCA 3AW8A 1ZGHA 1GFWA 2EKPA 5FEMA 3TLYA 5FAKA 4DCVA 1SCIA 2B94A 1F5SA 4BP8A 1G63A 4PZDA 2ISCA 2WINI 1VE1A 1J2EA 1UZLA 5ARBA 4HB4A 4DR7B 2HGZA 3L0ZA 4Q9IA 5ALEA 1E2FA 2Y9MB 3G13A 2YBDA 4KQMA 3RVDA 4HH3C 5K0EA 5SY6A 2FG6C 3TW8A 1QYCA 3OP4A 4WV3A 2B2XA 3JZAA 4FN4A 1TYEB 2CXXA 4EDFA 3MVEA 5THKA 1F6DA 3NEAA 4LY6A 2P9CA 4KQWA 4NAVA 1XNJA 4EPXA 4TVSA 1VYUA 3IA7A 2ZETA 4ZAYA 4N3BA 4KITB 2XGMA 3HYTA 3MYYA 1NOIA 3LX6A 4W4TA 1RWPA 3DWGA 2O54A 1C7JA 1ESCA 1OLUB 2Z0MA 3NP7A 1NW9B 3O8QA 3VX4A 3UBMA 1AKYA 3N2GA 4IFEA 1K86A 1TVEA 1HY3A 2PWAA 4H1VA 4Z0TA 4HGZA 1JXAA 3ZZMA 4M3NA 1QFZA 1V11A 1W6UA 1JJBA 1ND5A 1AUXA 2J3MA 2WG0A 2VEOA 2IZ1A 4U9HS 3QTTA 3FBTA 1HBJA 5DYGA 1BE8A 4URFA 1TZ2A 4KO1S 2IHNA 1N2JA 4UMEA 1D6MA 1JEQB 2F1RA 5CHEA 1H0RA 1WBJB 2YFYA 1NKVA 2HRDA 3COVA 5GV8A 5TMBA 4CCYB 3TZLA 4DTCA 1GYQA 4EYOA 4KSYA 3GFRA 2NQTA 3VNVA 1KVQA 5GJBA 1AHNA 3ID6C 1T35A 1UC8A 2QN2A 4DMCA 2YN2A 4HNRA 4EUFA 1AJEA 2ATVA 1ISFA 3GBPA 4WY2A 1QU3A 5ALXA 1NUUA 3DD5A 4FCTA 5C1BA 4ND8A 4BEJA 2OGTA 1KA9H 4G8CA 4Q1BA 2Z8XA 4S1VA 4URUR 4UUPA 1JJFA 1IVSA 4C1NA 1GZ4A 3UYLA 1B8VA 5DCLA 1GARA 3IP7A 2YWDA 2BCGY 1KQNA 2ODEA 1EJ0A 1UC4B 4BIMA 4WNAB 3I2GA 1NM5C 2BR4A 5BVHB 1A9XB 3F5FA 4MAFA 4B8ZA 3DKVA 1FYEA 4MGZR 2CJXA 5L3QB 1KK2A 4QAQA 5JW6A 4A36A 3SFTA 1WDTA 1GAJA 2M32A 3OM1A 5I3ZA 1P0FA 4J0HA 1ECCA 2ALJA 3EIWA 4Q93A 1C0IA 2H1CA 3DKKA 3FDZA 4YB8A 2WC1A 4YV0A 4RTQA 1M2KA 4JI4B 4V3CA 3K5IA 5L9AA 2B8TA 2AX3A 3USCS 4YS6A 2A78A 4DBLE 4XQCA 4LBVA 3PNBA 3PNYA 3VR6D 4WXYB 4E5DA 3I1FA 3RK0A 4X8LA 1KC1A 1E1CB 1JP7A 2VQSA 4PTLA 4DLYA 5K45A 1NJ2A 3DBLA 3UG7A 1Z6PA 1CLEA 1ZIOA 2BF7A 2GPJA 2Z3ZA 4UQLA 3K6JA 1KOLA 1JAHA 3CH5A 3ETEA 1N7JA 1PLLA 4FGWA 2IX9A 2PUFA 2P2SA 3L8ZA 4D1YA 3ZE8A 1L5HB 3LE8A 5AW5A 3B1KA 3ZY3A 1RMTA 2MYNA 2LGJA 3R3WA 3DHWC 3EVEA 5H59A 3HJBA 1W36C 3KBOA 1X1SA 2IY8A 2IYRA 4KXQA 4BZXA 3U4QA 3A2KA 1SCQA 3PHHA 1IUKA 3QU5A 2BW0A 4HYEA 4TLLB 1SHZA 4N3GA 3WMEA 4G01B 4PZCA 1MC1A 3OX2A 4FN5A 5DGIA 3OJ0A 2XR1A 2WWRA 4WBSA 4WZAE 4Y98A 4W99A 2WEKA 1J2UA 4V1CA 4G67A 4QKQA 4EJSA 1H0HA 3Q8MA 2NADA 1L1FA 3IS3A 3QEMB 4HRAA 5EUQB 2QS9A 4L5CA 4V0QA 4E5SA 1VIYA 3OFKA 1E4YA 2JJYA 3I9V1 1AKRA 4G8DA 4RM3A 1IFXA 1AS3A 3CLUD 4CKEB 3TH5A 3GG2A 1SK9A 4IR7A 1Z0SA 4GAEA 2YASA 1AK1A 5CBPA 4IZOA 4X9XA 2Q5IA 2X1VA 4FGUA 4WXMA 1O96A 1KO4A 2WOOA 3U1TA 4XD2A 3RADC 1PHPA 3V1YA 3IVGA 3CSSA 1VLLA 4K6HA 4O4IB 3DTVD 3R1IA 2NSHA 5DHUA 2PRJA 1ZAKA 1V3VA 3WDMA 3V33A 3RWOA 1ZSYA 4BB9A 3SDZA 3ESCA 3PNPA 4RV4A 3A7DA 3N87A 5ALIA 2EFCB 5JD3A 2AR7A 1MO3A 4PIPA 3K15A 4DEVA 2IE8A 3RSZA 2XOKA 2CMGA 3E0QA 2PG3A 2VL7A 1KO8A 3MTDA 4ZIRA 1VKRA 4QG7A 1TNDA 4B33A 2AQ8A 2OKCA 3HR7A 1JQEA 3CLHA 3ESDA 1ZMXA 2OHXA 4LXQA 1PFGA 3OCCA 2PFGA 4GYWA 1KBQA 1ZGJA 1JG3A 5CP8A 1TYAE 2CFRA 2LCQA 3ZIAA 1MFZA 1B93A 1E8DA 1E9FA 1NQOA 2G82A 3HXTA 3U62A 3KSBC 4QNNA 2IYNA 4FZJA 5IS2A 5CAEB 1J8QA 3GGJA 3IRUA 2F4VB 2CDCA 3ABOB 4G1UC 3FYDA 5CXQA 3C8ZA 2QTCA 2NTVA 1A76A 1DC3A 2W6ZA 2AKEA 2VDOB 1A9XA 4IM7A 1QFJA 4BO8A 5KQPA 4RM2A 2VSYA 1YZ3A 1S2LA 3B9BA 3FPJA 4OOEA 5EZQA 1FTNA 4HQ0A 1DIRA 1II9A 3ANYB 4WZBE 5L4NA 1XDWA 1TQ4A 5JRDS 4EUHA 4FYWA 3O1LA 4UU0A 4KP7A 3VPCA 1PJAA 3EXEA 5FBWB 3WY9A 3LBHA 2A7XA 4EENA 5IKPA 2HLPA 1M1NB 2ZM6B 1JR2A 4NL4H 1U0EA 3ETGA 4IEIA 4DT1A 2RKWA 4DKJA 3ONEA 4FT4A 4QT0A 4OKNA 3GLGE 1NBWB 2VT6A 3N5KA 5DWVA 4A92A 4AMYA 4B3DA 4D81A 3B3QA 5B2ZA 4Q9KA 2A30A 3FZQA 2P2GA 3CTPA 5C1OA 1E7SA 1P0IA 2GCPA 5JDIC 1K5DA 5AIAA 1TT7A 5CUQA 3SQLA 2O1XA 4JROA 1EDEA 1K7XB 5FOTA 3MF4A 2B4AA 5CYPA 3TLMA 5EJ8A 5J4YA 1FTSA 1SU6A 3E23A 4NU6A 5K9ZA 2JVJA 1GGJA 1AHHA 2EX4A 2X1MA 2YY6A 1T3SA 3DT8A 1NRXA 4U02A 1PUJA 3A7EA 4PONA 1CUWA 4LF7B 1ZITA 4XCXA 4GX2A 5ESRA 1IMJA 1ZEMA 3B12A 3I9FA 5FNVF 5BNZA 5JCZA 3RYCB 1K92A 3ZBUA 4YRDA 3NTRA 4V02A 2GPNA 1RBYA 1RZVA 4ZPXA 4LYGA 5LMUB 3QVVA 1J4AA 4WPGA 5CM9C 1O03A 2P5UA 1XUOA 3ELUA 4XCVA 3O8LA 2AN5A 3JQ8B 4F86A 2FA9A 4H7DA 1WF6A 2O05A 4NEGA 1BNCA 3QF4B 1X92A 1MQSA 3SQMA 2VDRB 3T7EA 1JSLA 1O96B 4G56A 4IGEA 4OK3A 2ZT6A 2Q3CA 3MGBA 3WKCA 1I6MA 1KRWA 1H5QA 2QE7D 4LMBA 4XUDA 2LDBA 4PX3A 4E1BA 2AMVA 4UDYX 5DK4A 1SXHA 1HNWB 3JVUA 4FU0A 1V8BA 2V3CC 1QIIA 4C7MA 1CJTC 3L6UA 3H1PA 2W70A 4CMIA 1K5GA 1KZ9A 5JWOA 4KPEC 2YHIA 5FNVB 2V6IA 5BQFA 2P9FA 4ZV7A 5I4BA 1HDCA 2P3OA 1H6BA 3VVCA 3VU3A 2EJWA 4N1AA 1YONA 1NJGA 2XZDA 2GQ0A 1DAEA 4PX5A 1XZMA 1Z17A 1EAMA 2QQ5A 3EN0A 3HB1A 5AMXA 1GSAA 3IPYA 2BDEA 3BULA 4DV0B 4XFDA 4Y6SA 3ZY2A 5JC1A 1SVIA 4ZCQA 3PNMA 2FMFA 3F3SA 2ZKLA 4A26A 2GK4A 1PKEA 1PR4A 1XFDA 2JLRA 3FFBA 1KAEA 2CK3A 4N12A 2QD1A 3QVKA 2Q5LA 3IPLA 4EA7A 1JA1A 1IUOA 3I32A 3V34A 1PK9A 1SG0A 2XB9A 4WI1A 3UICA 5HQ3A 5K8LA 1NY6A 4GHWA 3R7DA 4ARZB 3IB6A 3CRMA 4CR8A 4DL9A 3VBEA 3BG5A 3AY6A 3PEFA 4MRPA 3JPWA 1C3EA 4G41A 2FEOA 4KLNA 2GPAA 2ZAYA 1Z6ZA 1DRJA 3LBYA 4FCVA 5AUQA 5GGYA 3T5DA 1QH8A 2WU3A 4LDPA 4NAHA 3EDMA 1U3TA 1GQRA 2EZ8A 2DAPA 2MSEB 1KJQA 3Q9SA 3VTKA 4TV9A 5L53A 2QAIA 2R1UA 3NI2A 4Y0VA 5KC9A 3ZHQA 1OLOA 3CO5A 3LQQA 4J0EA 1MOPA 3ICCA 4KU4A 3UVEA 2BFNA 2PLRA 2WF5A 2UKDA 2AOTB 1ABEA 3QXGA 3LVQE 4WH0A 3C5HA 3QKTA 1I33A 4GL4A 1UJMA 1NBME 1B00A 1DPGA 1EGAA 1W4CA 1XAIA 2KMLA 3B89A 3E7XA 3LCMA 5EC8A 1MEEA 5FWDA 2YQ4A 3CBQA 2GYVA 4WIAA 2R47A 4BGEA 4UNRA 2QE7A 1JLRA 2J9RA 3MMSA 1GNVA 2QXYA 3NAZA 4RD3A 3VISA 4BJ1A 3KQLA 5MHTA 2HK9A 1K9SA 2QI9C 3ITDA 4MHOA 1CVLA 4XA8A 4KUEA 3HFJA 3TZHA 5F5LA 4DQXA 1BS1A 2XDAA 3EE6A 3MWDA 3BTSA 3DC2A 4OLFA 4EUEA 4NEHB 4QBHA 3EGEA 1TJ4A 3HN2A 2SHKA 3QEAZ 2Q6IA 4FYKA 3FYTA 2BI4A 1JEQA 2J5XA 4X6XA 3KJNA 1EE9A 1OAKA 4UAUA 1FXWA 2JFHA 5CPBA 1SWVA 5K0BA 2B6HA 4MDYA 4OHMA 1EDBA 3DHYA 3AVPA 4EVRA 3WI7A 3PUXA 2GD0A 4JVLA 3BXGA 4ID9A 2IEYA 4MR7A 4QWWA 721PA 1VLMA 3HFGA 5A6SB 4NPCA 1CU1A 1BXRA 1KQ3A 3FYUB 2SCUA 3QMPA 4AQDA 1L4MA 2QJRA 2OOSA 2OV1A 1IWOA 1UJ4A 3OIYA 1EVJA 1DUIA 1BEEA 1SC3A 3DEKA 2FFJA 2OBMA 1O95D 1Q6YA 1O9BA 1ZISA 2RJNA 4LZWA 4JLJA 6CHYA 1CG6A 3DOEA 3AHEA 4Y2JA 4J07A 4KR7A 4LHVA 5JRJA 3U7HB 4PYIA 3MRXA 3SHTA 2RAUA 3LT1A 3TDKA 3VJMA 4ZYLA 5DASA 3DKPA 1GZHB 2Y77A 4IRUB 2H5LA 5GZ3A 2XRMA 4CLDA 5LP6B 4E11A 2QJOA 4P08A 3RTEA 1URPA 2JI9A 5A0TA 4H7FA 3FDZB 5DMXA 3HFRA 4LF5B 4E14A 5A1TA 1GAWA 1JRLA 2C4HA 3BGWA 3A06A 4BNHA 4W5RA 2GPSA 2IZ5A 4LNAA 4KZKA 2X9GA 3ZWVA 1FSSA 3OTWA 3Q72A 5DULA 4AJ1A 4BN5A 2MR5A 2XUAA 2QDXA 2J85A 3H3FA 1OBOA 2H4JA 2WUGA 3P0IA 4HAXA 2QN8A 4LYHA 3ZKWB 2I2CA 4BATA 1U3WA 4P83A 2BYTA 2IH2A 3EFOA 4WRRA 4BIIA 4BUCA 1MGPA 1T8TA 4O2BA 2ZAGA 1WMFA 4QJ5A 2F55A 3EQ7A 2CFTA 1Z4MA 5B55A 1PGPA 1YQQA 1LPBB 1ONSA 1YTUA 4L8WB 1HG0A 1NN0A 3LBNA 4Q48A 1OB2A 3GPBA 5DM1A 4ILKA 5LPNA 4QUAA 3HBNA 4C01A 1KMMA 1USKA 5BNTA 1EB9A 2ZS8A 3FAKA 2VPQA 4W7IA 2YZ7A 2OVFA 2ETXA 1P2TA 2O5CA 3PX7A 4HZIA 1UK9A 5I7AA 1Z6XA 2E4UA 4OJNA 4YUXA 3WX0A 1P6UA 3QHAA 1M2HA 4L22A 5B1IA 1VE7A 2DC1A 5J40A 2IDZA 4IGIA 3NQ41 2BHLA 1GTMA 1U9CA 2HJSA 3JX9A 3ORHA 1GPMA 2GAOA 4GLOA 5ENVA 3G9QA 3SXPA 2QUAA 1HFKA 4PYMA 3B70A 1RP7A 5G2OA 5GIOE 3K6KA 3ULKA 3DZ8A 3U5ZB 1SXQA 4GSKA 1T1GA 4DCPA 1DWPA 1XRLA 1ULUA 1VJ5A 5BSHA 5HQTA 1TK9A 3IOMA 1T2DA 3PXCX 1YBAA 1IM8A 2JFWA 4EBFA 4CHGA 5GMOA 4C7XA 3NOXA 4NENA 1MFPA 4N8EA 2XMQA 3KUUA 2VAWA 5AW7A 4BB6A 2OGUA 3S5UA 1UQUA 3GDWA 1ESDA 1KZGB 1ZJ6A 3TE7A 2NZ2A 3V7NA 2VJPA 1U1EA 2GBLA 3FD8A 3DZKA 3HH8A 1IUNA 1QZ3A 1XYGA 3BS4A 3SJZA 2IS6A 3EFEA 1P1IA 2Q8PA 1H1LA 1R12A 1T29A 1RLIA 2DQKA 5B3JC 3CB4A 4ZQBA 5F3WB 2G88A 5JCOC 5JZBA 2C31A 2J3DA 4E12A 2H4ZA 4QUGA 1X1CA 1HEIA 3BZBA 5CT6A 1I36A 3MTGA 1MJGA 2FF5A 3ZCUA 5K6AA 4KR6A 2HNKA 2WLTA 4LY0A 4PSUA 3FTQA 3T3HA 2AZTA 3QYJA 5EPOA 4M7WA 1SXJD 3VYWA 2AQKA 1UDRA 3LS2A 4BQFA 2L17A 4YGYA 1GT6A 1J20A 1EFRD 3R2JA 4RPGA 1LDMA 2AN3A 5JAIA 3UN1A 3L8MA 5KTMA 4XGKA 3TG8A 3OEEA 2JCSA 3E22A 4K9RA 2ZJ4A 2W2QA 4PQEA 3JASB 1RNLA 2GGSA 4W9RA 5LQKA 1EFVB 4OHWA 4DYHA 2E1RA 3HN6A 4QJ3A 4ZQFA 3MRSA 4H4CA 5AKEA 4PHHA 3ZDAA 2QZZA 1P2FA 4QULA 3NHRA 2PL9A 2A9VA 2VUHB 2R1ZA 1QR6A 4M1YA 1P6QA 2WSBA 3HVHA 4XM1A 3NLLA 2NYVA 4BBJA 5CFPA 1G6KA 3KKNA 2FWNA 2BJVA 3EVZA 3SYNA 1GL7A 4HX5A 3T54A 1JIXA 4D26A 2C7PA 4WK6A 2WZBA 3L3BA 3OJWA 1S2OA 3LTEA 3NVAA 5JSKA 4ZMSA 1PFQA 3AJAA 4MVJA 4NCXA 1RRCA 5TEWA 2W7TA 5DMHA 2ODTX 2GH1A 2XRFA 10MHA 3TGPA 2Q9BA 1L7NA 4NU8X 1XZIA 4TT8A 1CVRA 2AZMA 4QTXA 3I62A 5CA1B 1NI4A 2AI3A 1TQDA 2WAYA 3GP5A 4QEZA 3PFNA 1XCLA 1DKUA 2QU7A 2YMPA 4K9OA 3DYBA 1RT9A 3W04A 2F8LA 4HMPA 4RORA 3IAFA 4CCYA 3ZJTA 1H2HA 2GA9A 1Z47A 1JDTA 1UOOA 4IILA 2WFLA 4FEYA 2W5UA 4N8SA 1W44A 2R2AA 5JJ5A 1KK0A 2FP3A 2W2TA 3W5IA 2H2AA 3ZWDA 4F3CA 2ZSBA 1Z4KA 1KC3A 2BFEB 2XI4A 1EXWA 3IAEA 3LF2A 5E1DA 2QVXX 1FY2A 1R6AA 1GD1O 1XZNA 3ZOKA 3UHAA 2FX3A 1SKUA 4ZI5A 3U7QA 1G18A 5IT4A 1T5BA 4EPVA 3CZPA 1SHUX 2CLFB 2YHIB 3HWX1 3QQ5A 5CPFA 3RAJA 2VXBA 3ADKA 2GZSA 4MVXA 4BX0A 4RIHA 1O94A 2NU9B 2HWKA 5CDYA 1AH2A 1VJTA 3D3WB 1JT2A 1J8YF 2ZT5A 2Q46A 3LTNC 1G8MA 3IULA 3PDIB 4K26A 3GDFA 1X0VA 5ALGA 3B51X 3WL7A 1N32B 4D3ZA 5ALKA 3NVDA 1RSZA 1A96A 4F3YA 2Y27A 4QYSA 5EQDA 1ACJA 1EWQA 1P72A 1N0IA 2I3GA 5HQ3B 1U0NA 1GTVA 5IT5A 1DXHA 3MLBA 4NCHA 4MCIA 1BDMA 3RBAA 1IG0A 5D84A 3K70D 2VPXA 3RU9A 5FYQA 1YI1A 1ZD9A 2CV1A 2D0PB 2PZBA 3OQVA 3OZUA 1BYUA 4DZRA 4YRSA 2OCYC 1U0FA 1JEAA 1GSHA 1YK1A 1Z18A 3A05A 3AYZB 3CHYA 3IQDB 3CF6R 4BKQA 1VG0B 6ABPA 1TU4A 2XYGA 4EB0A 1P45A 2GETA 4YP5A 1K7CA 5BWBA 1OYYA 4GPBA 1U7UA 3HA7A 4DLVA 4N6OA 1PFWA 4HTAA 2WAXA 4C3UA 1X1AA 2V6JA 1FMTA 3KEOA 1H23A 3QXHA 2Z8YA 3JASA 5L3VA 3EMKA 1OZFA 4GNRA 4ETNA 2NU7B 3Q7QA 2IPNA 4INAA 3N2KA 3IMEA 1F8YA 4K1LA 4YRAA 2CXOA 3LVFO 1KJJA 2PUVA 1UIRA 4R8RA 3HHEA 4TLMB 4E1AA 3OTGA 1HDYA 1N0HA 5KTSA 3AVUA 1NR5A 3U49A 4ZCSA 4G0XA 4CL2A 3R3YA 4IX1A 1IK6A 4TV9F 5FXMA 1IQUA 5KOHB 4RABA 4EHKA 1LBSA 2Q3MA 5F1YA 2B1IA 3T5TA 3VV2A 5F9MA 4TN5A 1BA3A 5EQFA 2QMEA 4JLVA 5DXAA 2P8JA 5DGHA 3KQTA 1N3IA 3QRWA 2H2WA 1KI9A 4UXHA 4BFSA 3ZNPA 4P0PB 2CLMB 2SICE 3GAZA 5K99A 4EATA 4LOLA 2G07A 2X86A 4B48A 4IYJA 4GFDA 4ABTA 1KGDA 3I2HA 3FUCA 4QBFA 3CISA 5ITSA 2Q5FA 1IOVA 4C4OA 3FGZA 4N40A 3OUZA 2VA8A 5IZCC 4DLPA 2D7DA 3A0UA 4RF4A 1TI7A 2GAIA 4UUQA 1DQRA 2RK4A 1FZTA 2ZLBA 1N2CA 4URHA 1CV2A 1NYTA 3UAYA 1SXGA 2XEXA 1NXSA 1DV1A 1Q84A 2O2XA 4FFNA 5EQTA 2PQ2A 2AOUB 5EGSA 4KWEA 4AYTA 4AYXA 5H9WA 4TMXA 5MFPA 1Y6FA 2FW6A 2C4UA 4ONEA 4JCCA 3OA0A 1T2CA 4YMTA 2F3TA 3PGJA 1Y1QA 1JU3A 2NM0A 1O94D 2GD2A 3PDIA 4GPAA 4MUAA 4U6QA 2RGXA 5EI5A 4E0BA 2RHBA 5JY6A 1LPAB 2ZITA 4NCKA 4DV5B 1IBKB 3M9WA 3UPDA 4IUBS 3A10A 4HLNA 1EXNA 4DE5A 3U44B 3KNZA 2IXAA 3ETHA 3EXFA 5BPFA 3EQ2A 3BJEA 1GYRA 5DW3A 4ZD6A 2RGRA 3EBOA 3EF0A 3L4EA 5TQ2B 3GUZA 4LYEA 1JL3A 3G0DA 2N1MA 3P4UA 5BMVF 1FYDA 3NM6B 4M53A 4O2BB 2V8OA 3R7AA 5EJ5A 4OBBA 2OCBA 3WHIA 1I5EA 4C4ZA 3AR5A 3S0JA 1TGYA 5AO9A 2X6RA 3GEPA 4IDOA 2R62A 4YRBA 1Q1QA 2BFFA 2VP0A 3OM8A 4DV1B 3KL4A 3KR1A 2JATA 4IJ6A 1DRWA 3FI0A 4IVPA 3Q9UA 5ED0A 1T1IA 4DWJA 1H9CA 3U6KA 2J41A 1XTUA 1YJCA 2N75A 1NVAA 2NZYA 2F1JA 3QMMA 1EQUA 1L3CA 1SZPA 3P7MA 5B12A 1NVFA 4FOLA 5C31A 1LVGA 3SS9X 4WZZA 4QNMA 1WXFA 2ZYIA 3FRJA 1E1NA 1CULC 1GSOA 2E4VA 3EPRA 3N2KB 2O06A 4MI9A 4YN3A 1G20B 3PHCA 2IXGA 5KO2A 3NYIA 2H07A 2VHUA 2IOHA 3OTHA 4B17A 3EPKA 3SIWA 4FMPA 2CFCA 5K8UA 2CLEB 2WTUA 2R6DA 2DKOA 6YASA 3DV9A 1P9WA 2QLNA 4GZ6A 4LXXA 4PYQA 3T1VA 1NBEA 2DH5A 3LL7A 2ZIGA 4EZIA 1XRJA 2B7LA 4FEGA 1XEWY 1Z5PA 2QGZA 1N9KA 3GRKA 1F2UB 1XBTA 2PL3A 4KMRA 1U1FA 5JLJA 4X91A 3W2EA 1MB2A 1LK5A 3B2EA 3FNRA 2B35A 2DFDA 2Z1DA 3A4TA 4NK4A 4NENB 1T4BA 4TS3A 3A3NA 4BS9A 4BKRA 1TXGA 1WZNA 3NT2A 4FSXA 1Q0RA 2JK1A 1ZESA 3FLEA 4GUDA 4L5JA 2H9IA 4MWDA 4PNZA 4UQPA 4DLSA 1EXDA 4DHEA 1Z22A 3CKMA 4WNYA 4MO2A 3O93A 3VPSA 5DSXA 3EVCA 3UK0A 4LBZA 1S8NA 3SWWA 3ZBPA 1SKMA 2QUIA 3CRZA 2UYGA 5EP3A 1MGOA 2OHOA 1YRQA 5L45A 1FDVA 2BONA 2JIPA 2ZJBA 1ADYA 2DE0X 2O2CA 3H2KA 4D42A 4EECA 1TPYA 5B3LA 1C9EA 1KYTA 2HCRA 3NNDA 3NRBA 1W76A 4QSMA 4YDQA 3T5AA 1WETA 2P9HA 2PX3A 1HURA 1NSYA 4HFMA 3W5SA 2VG8A 5HKOA 4IFTA 1C30B 4Q1VA 2XW6A 1DC5A 1UJ2A 2AOUA 2E4WA 2WUWE 2X9LA 5FL3A 1FRZA 2D0OB 4I5EA 2R6R1 4TWAA 5KTKA 3VKWA 4OQYA 1A9YA 3KKKA 4BB5A 1ZCZA 2W6JA 1UWLA 4D7AA 4DUZB 1TAHA 2AR0A 2OP1A 3ZS9A 3JQPA 2V7WA 2XVXA 4LDNA 2WNIA 3R8CA 4EPWA 5K8IA 1V16B 3OESA 1UBNA 4WY8A 3HTXA 4IAOA 4Z7OB 2NN3C 4JBHA 2IS4A 2HOQA 1FFGA 1U8ZA 4L57A 5CNMA 4HEHA 5FHQA 3G5MA 1VYVA 2PS3A 4CG0A 3OAAD 4EPYA 2PA0A 5FKJA 2UXDB 1SG9A 2D8MA 2YJZA 4RESA 4XTCS 1Q7GA 4YFYA 4ZV9A 2WWXA 4GP9A 2F1IA 1D4AA 1G9XA 2DZDA 3KR2A 4TVBA 5HE8A 5BYJA 1FFBA 2CWWA 3E5MA 2BMJA 9LDTA 1A2KC 3C98A 1GGHA 2J9ZB 3CH7A 4RX1A 4BQQA 1BFKA 4XCQA 3PGVA 1WW2A 3OOEA 2EF0A 3KQWA 3D7KA 5AI5A 1Q17A 5KSWB 3MMPA 4H3VA 1HKUA 2ZP1A 4CBVA 2YZKA 3IBSA 1E7WA 1NP3A 2GCGA 4MLPA 3RS5A 3H6HA 3QFCA 4IH9A 1XPJA 2A3NA 1KMQA 1LQ2A 2C61A 1YR2A 2PX8A 3PITA 1X13A 4ZVOA 3T7AA 4DVJA 4X65B 2WWTA 5AHXA 1MV5A 4YQYA 1LI5A 4WCFB 3I9JA 5JZMA 3JVDA 2O7NA 3EG9B 2FSPA 3ACBA 2JKZA 2C9DA 1JKJA 3D8UA 5EXSA 1NN1A 1XVUA 3TQRA 3UAGA 1QCDA 2OG1A 1JEJA 3H2BA 5AKJA 3RWMB 2C59A 2FXVA 3TD6A 1G8GA 3O4FA 4J9UE 1Z39A 2J5KA 4IYRA 3GA5A 4WLNA 5HZHA 2ZCVA 4BCCA 3RSSA 1E3WA 1GU1A 1MRNA 4P98A 3QPCA 4H15A 1WLYA 3DL4A 1VHDA 1ZN7A 2KJQA 3HYRA 3NV7A 3RYFB 4RW0A 3EEIA 5DT9A 4EGAA 1DUSA 4KUHA 4UQOA 5FADA 3O74A 1IWPB 4DJFC 1WZCA 1Y9DA 3OCUA 3UH1A 1CUVA 2VF8A 3E9EA 3HA5A 4FC7A 3WGGA 1TTTA 3LOUA 4FYYA 4D41A 2NU9A 3QLVA 4YRTA 1C2YA 4O59O 4CKZA 2WT9A 4FYJA 4AMZA 2CL6X 3JWPA 2QZSA 3FPCA 3LLSA 4JJEA 1JKMA 2IK8A 2IYFA 4L95C 5K20A 4X60A 5FOXA 2FNAA 1O95A 1RLTA 1NBMA 1PAUA 2ODAA 3A8TA 3CW8X 3D8RA 4RJIA 4JENA 2BZ1A 3PLNA 4KE6A 3RH0A 4XVUA 1PGOA 4B2YA 2WA1A 4JL8A 3WNVA 3ZCRA 4IMJB 4W5TA 1HWYA 4Z0HO 1XD2A 2IP2A 2BFDB 2JFYA 4D4KA 1GA4A 1GA6A 2Q99A 4URWR 1D03A 5LXTA 1HZJA 2WTMA 1Z6GA 1YR6A 3EF3A 2JFXA 3OHMA 1OPRA 4YJ3B 3PEEA 4X84A 4BYMA 3PBKA 3T7DA 3T99A 1Z2DA 3FVVA 3ASUA 3ZWQA 3UW3A 4NECA 3GNLA 3VVMA 3VZQA 3FCUB 1V16A 521PA 2FF7A 3DZCA 2ADOA 4GOMD 2HSWA 2I1QA 2XUOA 1OLSB 2QQ0A 3KK0A 1FUKA 3IIEA 4AJ2A 5A2QA 4KNYA 2V7EA 2BD0A 4NE9A 4L5BA 4M38A 5IAKA 3TLBA 4C2BA 1M2OA 1B6TA 3EDYA 4Y1RB 2X0EA 4MI3A 2Q45A 1CQIB 2H2FA 4OLAA 4JXZA 1IZYA 1T34A 1VL2A 2REOA 4C0QC 2JBWA 4GYJA 4G5YA 4ND8B 2Q7DA 1G17A 3QI2A 5F7ZA 3R3JA 1THMA 1G66A 3ASVA 4TM8A 2HN9A 1KI2A 1QV6A 4QYIB 1J2JA 4EKEA 2O5RA 5GP1A 2FDRA 4LY3A 1NBMD 4FE7A 4NMLA 3M3DA 1HR0B 4G5QA 3BTUA 1NI5A 2GHQA 2Y05A 3R3ZA 4W5HA 4XTRA 3N0WA 4QRDA 2J32A 4LN1A 4YECA 3A9VA 3Q6NA 4OYHA 1YE3A 1XLTA 1VGVA 2EQ5A 3BMNB 4U4AA 3WLHA 4CN9A 5ELXA 3AGPA 1JS1X 4PG8A 3P2KA 2E4XA 4ASUD 5U1PA 4C07A 4CGYA 4M0MA 2BZGA 2H2IA 1Z6QA 1T4MA 3GZJA 4ZDJA 1INLA 4EHNA 1R0WA 3DL0A 3HCWA 3QG1A 5DDIP 5SZHB 3S70A 3TVYA 2OMEA 2XD4A 4RVOA 4MP3A 2VYVD 4I4TB 4QLAA 3KTFA 3V3KA 4YCNA 1FS5A 4ZAZA 5BUCA 3JYPA 4OSEA 5DNAA 1R27A 2YFHA 4MYRA 4W63A 1D2NA 5DSTA 1K6MA 2CMFA 2PT7A 1IQ0A 3GNQA 3GY0A 3F5DA 1A04A 2V55B 1QB7A 3KHUA 4DWOA 4RF5A 3VHXA 2ZB4A 4YAEA 2Q8NA 1V26A 1OWPA 2IH4A 1YACA 3FTPA 2XQVA 1LWNA 1UBKS 3DZJA 1TYZA 4QDKA 2R7KA 1BHJA 1QX4A 1Z12A 3ZHZA 1KYYA 1WD5A 4L9RA 1DCKA 2NYUA 1FK8A 3HACA 1OLUA 3ZX5A 4GKVA 4UNNA 5CLJA 3AP1A 3CZRA 3P0JA 1AZSC 4AS2A 4BJHB 4IZHA 2H4XA 4URZR 4YO8A 3I6ZA 4RGBA 2C9ZA 1XF9A 4V0NA 3S2SA 1NBHA 1R74A 1FRNA 1KO5A 3NTVA 2WV7A 4DSTA 1Y98A 1NVWQ 3WBBA 3VU1A 3H2JA 3TQQA 2IC5A 5KVSA 2OL4A 1PJLA 1QIHA 2FE4A 4PLGA 3O9ZA 4YP6A 2X8LA 1OIXA 3GJXC 2OWEA 3H42B 5DYIA 1KHHA 2C2YA 4RD2A 1H6CA 3AFHA 4KV9A 4PLZA 4C29A 2DSNA 5JQGB 1D4FA 1DX4A 1WQ1R 5A3VA 5P21A 5CJJA 2QPLA 2I8AA 4DRZA 4F84A 3BE5A 3EIEA 3DA8A 1X42A 4C4RA 4XRRA 5IJAA 4R8LA 4RVUA 4GL2A 1PD1A 2G09A 1PK7A 4BJ6A 4ZIRB 1XPUA 2D5BA 3QX7A 4QGBA 1TQ8A 1JEOA 1JKXA 3HADA 3TOXA 3VR6A 3EQ8A 2G4CA 4J1SA 2B7CA 2IV7A 3FUUA 1NJFA 3L05A 3C41J 1KS9A 4WNIA 5FA8A 5KQLA 2KSQA 5TS3A 2W98A 2O59A 2QD4A 5CA0F 4O5AA 3H5AA 1Z4LA 4TKUB 5KMGB 3SM3A 4E2XA 2F3RA 5D5QA 2O6LA 2GCOB 5AQEA 3TOVA 3RBVA 2TMKA 3UM9A 4MRNA 1RMQA 3KZXA 5IWCA 2BKVA 4MVJE 3DZFA 4INJA 2FQQA 2XZOA 3MSXA 1XNHA 1PSWA 3B3JA 2RHJA 5AHOA 4ZAVA 2JLYA 2DFPA 4Q1AA 1A77A 1DB3A 1HL7A 1DJPA 1SZJG 2JD1A 2VT3A 1HI9A 2X0NA 3IOCA 3OM9A 4OMCA 4LGCA 4M9UA 3GFOA 3SC4A 3UV6A 5HRUA 4FGLA 4HRVA 2WE8A 3HYLA 3Q3JB 4MQLA 3GUUA 4QYWA 2J0SA 1ZRHA 4LIPD 2Q6OA 3KZOA 4GOLD