1SEPA

Mouse sepiapterin reductase complexed with nadp and sepiapterin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
259
Chain Sequence
ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SEPIAPTERIN REDUCTASE
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
source organism Mus musculus
total genus 95
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1997-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sepA00
5A3VA 4IBOA 2X0NA 3S55A 2PZMA 4B7UA 2YV1A 2BGMA 4YB8A 3O8QA 4BO7A 3WNQA 4JBGA 4MVJE 3VZRA 2DUWA 3UUWA 1DAOA 4LSWA 3ZWWA 3IOYA 2F1KA 5JDIA 3IUPA 4XX0A 2YFQA 5K6AA 5BQFA 1GZ3A 5G0WA 3SXPA 2E48A 2WMDA 2I3GA 4YVFA 1A5ZA 3WS7A 2PLAA 3FCOA 3NGXA 4J4BA 1BRMA 4GI2A 1EDOA 4TRNA 3GK3A 4XYEA 2Z1NA 3RD5A 1YOVA 1W73A 2QRLA 4EEXA 3VH1A 1PGOA 4CQMB 2ZJ0A 3AUUA 4GSLA 2NNLD 4INAA 3H9GA 2AG8A 1E1MA 3BMQB 4CM4B 2P9EA 4OXKA 4S3MA 1TT5A 1IB6A 1GZ6A 1YRLA 3ONEA 2NTVA 3GH3A 1LC3A 1V35A 1YJ8A 2PY6A 3BA1A 4XGNA 3CMMA 4W9NC 1HDYA 2AQKA 1J6UA 2O3RA 5DOVA 2VYVA 5EN4A 4FD3A 3P2OA 3WLEA 2B36A 1MC5A 3BZUA 1SBYA 2B4QA 1F8FA 1X15A 1I2CA 1NWCA 1Q7GA 2VRCD 1FK8A 4E4YA 3I4FA 2Q4BA 3UH1A 1VKNA 4FSHA 1NM5A 2PGDA 4HFJA 4DGSA 3QVTA 3U3XA 4GVXA 2I9PA 2R00A 2O7SA 2Y68A 1SAYA 3P5SA 3G1UA 4KDFA 4RDIA 1X7GA 3JD0A 3Q11A 5H81A 3GDGA 5BT9A 3RASA 1YS4A 1HE3A 4PZEA 4D7AA 4RVHA 2X22A 4NPCA 1HWYA 4CM7A 2C82A 3ETDA 2QHXA 4YRAA 4AJHA 3WGGA 4OHUA 5F21A 4NBTA 3S2IA 2BMAA 4JGBA 5EERA 3GQVA 1KEUA 3HDQA 1U5CA 2W2LD 2ZTVA 2YHIB 1XU7A 1KIFA 3PJDA 2X6TA 3A1NA 1L7EA 1Y9EA 2E4AA 4O6VA 3DMTA 3L4SO 1D3AA 4IQ8A 3KVOA 4J16A 1PR9A 2AQ8A 1H6DA 1ISIA 4YACA 3FR7A 3HB5X 1E0DA 4MIYA 5F1KA 2VWHA 4LVUA 2I3AA 1O89A 1LDEA 3QVOA 4CV0A 2GN9A 3JYOA 4IM7A 3DOOA 3IQDB 3M2PA 4ALJA 2PWZA 3H5AA 4WCFA 4WLFA 1SZJG 1VJ1A 4XR9A 4CM6A 3DOCA 5ILGA 1EFLA 4DIOA 1QG6A 4OJNA 1LBEA 5DT9A 3O38A 4PLWA 2EP7A 1LNQA 4PLYA 2WWRA 4OH1A 1JTVA 5I7FA 1GV0A 2WSBA 1NR1A 2VHYA 3DZBA 4Y98A 1UP4A 1JDJA 1BSVA 2ZQYA 1ADCA 5CG1A 2UV8A 3QP9A 1V0JA 4HFMA 3U49A 5C5IA 3OJEA 4TZTA 3JQFA 2W2LA 2UYYA 3WTBA 2IRWA 5EJ2A 3SBOA 3TWOA 4RVGA 4W6ZA 2G5CA 3C7AA 3F9IA 2CSUA 4A03A 1H93A 1VL0A 2CVQA 4GGOA 1E3IA 1DHTA 2X9NA 3NKLA 4QO8A 1N9GB 4AJJA 2QIOA 1ENYA 2X0IA 3W4KA 4AJOA 2GDZA 1PGQA 2EG9A 3JQBC 1PX0A 5ICMA 4DMLA 3OF2A 4ONEA 4LRTB 2OP0A 3BXXA 2O2YA 3U4CA 5DNAA 2VOJA 2CD9A 1MX3A 4AJNA 4BGEA 1UZMA 1ZK3A 3H65A 1Q0HA 5JO9A 4P4GA 4PRKA 1NPDA 4KMSA 5A02A 5THQA 5AXDA 3R3JA 2ZYGA 3UCFA 3JD3A 1NVMB 1WNTA 3V2UA 3TFOA 3QSGA 3VAZA 5A9RA 1UDCA 1BTOA 1H6CA 2EWMA 2CVZA 2HO5A 3AUAA 4J6FA 1HXHA 5EQDA 3SJ7A 3SJUA 5KNLA 4Z6KA 1E3EA 2Q4EA 2NVUB 1AHIA 5EQFA 1EK5A 2NSDA 4FOOA 3RU7A 3TJRA 2EF1A 4N54A 1E77A 3AI3A 3ULKA 1RM3A 5JAZA 1N5DA 3UKOA 3LYLA 2VT2A 2RAFA 4DBZA 2PGLA 1Y5RA 1E1LA 1NPTO 3H4VA 4KWHA 4BUCA 3H6KA 1G6KA 1R12A 4BIIA 4BVAA 1NR7A 2IYOA 5JMWA 1HTBA 5THKA 1DIHA 1P3DA 2GZ3A 2Y67A 4J7XA 2JJYA 2D1YA 4JQCA 4KZPA 4PVDA 3ZWPA 4R01A 4M87A 5IF3A 1QYDA 3L4BA 4LGVA 4XIYA 4U6QA 3RVDA 3KYDA 4BO0A 2C2YA 4PLZA 5TF4A 3D4OA 3BIOA 2V6FA 1T2EA 5EPOA 5JLAA 4AL4A 4D0SA 5JFOA 4KQWA 2P4QA 5TJ9A 2DTDA 5A03A 4U5QA 1JVSA 3DBRA 2X23A 3JQAD 2OORA 4FFRA 1DC3A 4DWVA 3ON5A 3QY9A 4MVJP 4I5GA 1I24A 4I9HA 2Q50A 1QMGA 2X4GA 4YT4A 3D64A 4C7JA 4DPMA 1VL6A 2O2SA 3HADA 4R69A 3OETA 3RC2A 4BO9A 1DO8A 3BAZA 1A27A 1GQQA 2P4HX 3AU8A 1IZ0A 5G4KB 4C4OA 5IZ4A 1GAEO 3TQHA 4E5PA 3Q6IA 1R4MB 1A4IA 4WOJA 4XJTA 3INTA 4YRDA 3LVFO 1MP0A 1LRKA 2PH3A 5JDCA 2DBVO 3JQCA 1YBAA 4RQUA 3DBHB 3OP4A 3I9JA 2OL4A 4R4JA 5CHEA 2O4CA 2VN8A 3AWDA 5JE8A 1DLJA 5DOZA 1NHGA 1F06A 3I9NA 1LC0A 8LDHA 4LN1A 1Q2XA 3LZ6A 1YO6A 2EKQA 1BW9A 4JJIA 2F00A 1BXZA 3RKUA 1XDWA 2FSSA 5CDYA 3KSUA 3TDKA 1IY8A 4FQ8A 4HBGA 5KWEA 1K5HA 1HDCA 2B83A 3JQAA 2CDCA 2B35A 4RPJA 2JCVA 1GYQA 4AVYA 2VZ9A 4BB5A 4R5HA 3VPXA 1SOWA 3ETGA 3H9UA 2J3IA 2Q1UA 3KB6A 4OL9A 5K0ZA 4CMHA 5KJFA 3M1LA 3AUTA 3NGLA 1B8VA 3H3FA 3OJLA 5TNXA 1M2WA 5EL0A 3RUIA 1AN9A 4CR8A 1BVUA 4J90A 2VZ0A 3I23A 4PZCA 1EVIA 3KZVA 4UUMA 3C8MA 1QYWA 1EUDA 1Z7EA 2GN4A 3JQ8A 1OFGA 4JJFA 1WW8A 2D3TA 4NJMA 4OKIA 1QV7A 2C2XA 3QA9A 2CZCA 3EYWA 3MJ4A 1NYTA 4NBWA 4NBUA 4E33A 1PZEA 3NJ4A 3DHNA 3PDJA 3WGIA 2J5RA 3DB2A 4XYBA 3BTVA 2LDXA 2IYPA 2PA3A 1LSSA 2B5WA 1KEVA 1EE9A 1ONPA 3EC7A 3GNSA 3ST7A 4WECA 1U4OA 1PQUA 3B1KA 1M66A 3F6YA 4RORA 4RPHA 5CDSA 3FBGA 2J3KA 5G4LA 1BG6A 3LF2A 1B0AA 4L4RA 1ZFNA 3AI2A 4QX6A 3ZNNA 3G3EA 2VTDA 3ASVA 4MKZA 4BNUA 3WGHA 1X0XA 3PVZA 1IE3A 3KHUA 1XQ1A 2YHUA 4L8VA 1QLHA 4J2HA 3ZU3A 1HDGO 4JXKA 5BNFA 3HE3A 4J91A 2BKAA 4HY3A 3V2GA 3DZFA 4KOAA 3ADOA 3NTRA 2ZB7A 4WE3A 1H6BA 3HZZA 1Y8QB 3N74A 3UHAA 5DBGA 2A9FA 2G1UA 1Y8RB 4RZHA 4MVJA 3UAGA 1PJQA 2YJZA 2XXJA 2O3SA 3LT0A 2HK8A 5HA5A 2C59A 5TT0A 1WDKA 3NT5A 1T2DA 1LQUA 3MJCA 1KS9A 4BNWA 1HSOA 4JLWA 2TMDA 5C37A 4GWGA 1K89A 1ZK0A 5ER6A 2GR9A 4HFNA 4FC7A 1PL7A 1CQJA 4CODB 1QSGA 2BHLA 3WICA 4YDRA 3TF5A 3MCVA 5HTOA 1U7HA 4II3A 2A94A 4UREA 3FSRA 1ADGA 5CEEA 3D4NA 2VHVA 3K92A 2AEJA 1BGVA 4FFLA 3AOEA 3DFZA 3KV3O 2IZ0A 1JLLA 2BI8A 3ONFA 2NUAA 3GHHA 2Q45A 1EDZA 3LT4A 4JCOA 2X0JA 3ZWMA 7ADHA 1R0KA 3H7AA 4OXYA 1DLIA 2AEMA 2PGJA 2HMVA 3KSDO 4QO7A 4ZU3A 5I7EA 2PKQP 1F17A 4R41A 2EP5A 3AFMA 5BR7A 3SLKA 3K73O 3K30A 4M89A 3EGOA 2DVMA 3PXXA 1OBFO 1I36A 1SPXA 1NX6A 2W2KB 1HLPA 3B70A 3C7DB 3D4PA 4G65A 3QVXA 3PWKA 2YFHA 1V6AA 5JSFA 3GFBA 4IDBA 3SX2A 4GX2A 4MJLA 1HYHA 2DLDA 3GR6A 5F1PA 4E6PA 5JMPA 3AM3A 3K96A 3I3OA 5L4LA 4YBZA 3R3SA 1AXEA 3UOGA 1GEGA 5L40A 1VPDA 3RUHA 3TRIA 3E03A 3GMSA 3QWIA 1XEAA 1DAPA 1ARZA 1P1HA 1E5LA 2VUSA 4J4TA 4MOWA 1LEHA 2H9IA 1A4UA 4CR7A 4AJIA 4GL4A 2D0IA 3SC4A 1NXQA 3CXRA 4DBVO 5T8KC 4KWIA 2IEDA 3ANMA 4RF5A 4EJ0A 3L6DA 3WIDA 1PZHA 5DULA 4QFDA 3T7EA 3WOHA 5KTKA 3PJFA 5CP8A 4CQMA 3TN7A 5AXAA 3FD8A 3BMOB 3O9ZA 3BMQA 1P1IA 2ZTUA 4CM4A 2C20A 4LCEA 2H63A 2X86A 3K2BA 3NUGA 3ZV3A 2O48X 4CMJA 1OC2A 3JD4A 1V8BA 3DTTA 4IZIA 5IAAA 3NT2A 5JCJD 4OQYA 3OIGA 2OHXA 1M75A 1RM5A 1PU2A 4D43A 2GN8A 2Y0CA 2GO1A 1QYCA 1UXHA 3WBFA 2VRBA 1CETA 4AJ2A 2O3TA 3L0DA 4XWYA 2OP1A 4CLRB 1U8FO 2C5EA 2X7HA 1I30A 2AE1A 4I08A 2QRJA 2J8ZA 3B6ZA 4GX1A 5GMOA 1N1EA 5FWNA 4TKLA 2UDPA 1GV1A 1F8GA 4LSMA 2Q1SA 2EERA 1SMKA 2HMWA 3HDJA 5DDIP 3VPFA 4D44A 2EGGA 4YR9A 5TLSA 1E6UA 1HSZA 2OBYA 1H9BA 2UUPA 2HRZA 1W8DA 3FTNA 4CL8A 4MP6A 3CIFA 2HJSA 4XYMA 1T1SA 1K6IA 1MFZA 4ILKA 1UAGA 4R1TA 3I83A 4UEKA 1D1SA 2ZB4A 2FR8A 3GZ4A 4R1SA 4MVJI 1I3NA 1U3VA 3PQEA 1ID1A 2YHIA 2DKNA 4L0QA 5KJ6A 3WWZA 2BH9A 2X9VA 3SLGA 3KLPX 1GYPA 3RC7A 4E2WA 4TZKA 2FN7A 3A28A 3F4BA 3I5MA 4CM3A 5FYDA 4BO5A 3DBLB 3L6OO 2HAEA 2J5KA 3ZU2A 1HETA 3UFXA 2PV7A 2NQ8A 5T64A 3NEPX 5IZCA 1HRDA 3V8BA 3EHEA 4GGPA 5HRUA 1CERA 2ZK7A 4UVHA 1P74A 2B0JA 4CJXA 4YWJA 1E7RA 3UCXA 4WKGA 1PL8A 3BMCB 1B14A 5IDQA 3GG9A 4PFJA 1IZ9A 5JDIC 3QIVA 2QQ5A 2ZATA 4WK6A 2FMUA 3F47A 2ET6A 5B4VA 2VWQA 4YQZA 3IMFA 1SB9A 1HYGA 3GUYA 2VWGA 2EEZA 3ORFA 2EJVA 3QHAA 4MP3A 1YL6A 4R16A 1YDEA 3CUKA 4Z0TA 4NFSA 1U3WA 2BI7A 4NK4A 1E3SA 4R68A 1KETA 4CMCA 3GUCA 5A06A 1WAMA 3ZN2A 2Q1WA 5I9NA 4GLLA 3QRWA 3MOIA 1H9AA 3AI1A 3JQ9A 4W7IA 2ZJ1A 2PTGA 2RH4A 4U0JA 1CIVA 2J3HA 3WNVA 5CPFA 1UXJA 4HWKA 4RF2A 1GU7A 1W0CA 1F12A 3OA0A 1IOLA 2NM0A 4NU6A 5T5QA 3KM0A 2X58A 4MVJH 1DFIA 4W7HA 3VTFA 1W6UA 1C0PA 4PVCA 3WTCA 1ZMOA 1SB8A 4LW8A 2NTJA 3C24A 3AY6A 3O4RA 2Q3EA 5KKAA 4RQTA 4E30A 2EGHA 4ITUA 3ZWNA 2WE8A 4XYLA 5JYDA 5F5NA 3DQPA 3GN2A 1TLTA 1YB4A 3FBTA 1T2FA 3G0OA 1S7CA 3OICA 1HZZA 4FJ2A 4CMBA 4CMEC 7MDHA 4FW8A 1D7OA 2R00C 3IL2A 4XQ9A 2VYVD 2BF7A 4WJZA 2DBQA 1FDWA 3GT0A 1O0SA 1QRRA 3RBZA 2Z5LA 4NZ9A 2D2IA 3GMDA 5G0UA 3NYWA 1BDBA 2W98A 2DTXA 3RKRA 3EZLA 3OEYA 2V6GA 3ABIA 5FF9A 1LXCA 3ROQA 1O8CA 4B3IA 3PPIA 5JBIA 2QYTA 3FI9A 1QP8A 2JD1A 4XEHA 4PG7A 4ALMA 2ZKLA 4DC1A 1S6YA 4I5EA 1CDOA 4WLUA 4AJKA 4D3SA 3DL2A 5A9SB 4B4WA 3DMTC 4FN4A 4BQPA 1E92A 5AXBA 1PWZA 5IN4A 3JQGA 4Y6SA 3AFNA 1HDOA 3QJ5A 4BO2A 1BHSA 1ZW1A 4Z3KA 4A27A 1SCUA 1P0CA 1U8XX 3JYQA 1ONOA 4M54A 1VRWA 5TGDA 3ROKA 4E2ZA 1PGJA 1GYRA 4YAIA 2OZPA 3GPDG 4HP8A 5L45A 3ZHYA 4ND1A 4BNZA 3T4EA 3UN1A 2WTBA 3KO8A 4JIGA 3S2EA 1E3LA 4L74A 4WCFC 4II2A 3NTOA 4CLHA 1PEDA 5C7IO 3STHA 1DRUA 5GZ3A 3MTGA 3PYLA 2UUOA 3NJ8A 4YXFA 4Z3DA 3S1LA 4UUNA 2Y99A 1R4NB 3QW2A 3RWBA 3GAFA 2JCYA 4EDFA 1C1XB 1Q0LA 4J1SA 1TA4A 3I1JA 4M1QA 2P5YA 3JQ7B 5CEJA 4XQGA 1E7QA 4DQVA 5G4KA 3VPSA 4WCDA 1FMCA 5EMHA 1TI7A 2YQ4A 3DEYX 3AOGA 3ZZNA 2NLOA 3DBHA 4ALIA 5CDTA 5ENVA 3AU9A 1ZIDA 3M2TA 4O59O 1V9LA 3VKVA 1B15A 2Y93A 4WOKA 4S1VA 4GLOA 5MGBA 1G0NA 3LK7A 4DL9A 3PHJA 2P2SA 5G0TA 2OO5A 3DZGA 1E7SA 4CV1A 1ISGA 2BFAA 1Z73A 2BFPA 2AMFA 3PHIA 4JBHA 2AHRA 1QR6A 3NDRA 3DAFA 1X1EA 2JAHA 1J4AA 1YBVA 4IDDA 4TROA 2I5PO 3GC6A 2JFGA 2DTEA 2GF2A 1KC3A 4B7XA 4J0FA 2VWPA 1YXMA 5I7SA 3BTUA 5FFFA 3PQDA 4WEOA 5C3MA 1MV8A 3KUXA 3HQ4O 1MLDA 3EMKA 4RVUA 3PP8A 1LSOA 5KVCA 3GGOA 3IUSA 2IE0A 3DXFA 4NJOA 1GL3A 4RF3A 5L53A 1I3MA 3TZKA 3A06A 3HFSA 2VHZA 3WSVA 4DPLA 2AXQA 3DMYA 4PGFA 5DP1A 4UVIA 1SOVA 4I9UA 4I9NA 3GEGA 4B7CA 4R1UA 3JYPA 3K8ZA 3WYBA 2D5AA 3RUEA 5A04A 2PD6A 4BNFA 4QUKA 1KVRA 4RCVA 4XD2A 3IJPA 5AXCA 4GWKA 2HMTA 5TSDA 4CMAA 3QLJA 1XIVA 1LI4A 5LC1A 4CQLB 1MA0A 1TT7A 1HE2A 1L1FA 2PZKA 3L4BC 1E3WA 1ULSA 3ZU5A 1HE4A 3PEFA 3BHMA 3PZRA 3VPGA 5A5EA 3LSYA 3K31A 2BFMA 2HQ1A 4UEJA 5HWSA 1LU9A 3CKYA 3LLVA 2Q49A 1EE2A 5JPIA 3DZJA 4QFCA 3HN7A 1XSEA 4PLHA 4FGSA 3PRJA 4Q3AA 3WQQA 1Y8RA 1FF9A 1SEVA 3JYLA 1PJBA 3HB4X 3AJRA 3IKTA 2CDAA 5TC4A 3OA2A 2QX7A 1NQTA 5B37A 1YQDA 1CRWG 5KVSA 4PLFA 1NP3A 3AM5A 3TPCA 4ZQEA 3L77A 4BO3A 1ZUD1 3W6UA 1P31A 1LLCA 4DPKA 4R5MA 2PKRA 3UGKA 4DLAA 2G0TA 5IN5A 3ZWVA 4EW6A 3GN1A 1X7DA 4DQXA 3H8VA 2WE7A 1MFPA 4BO4A 2NU9A 1UP7A 2DPGA 2Q46A 4JK3A 2Y0DA 3V5NA 1UH5A 4O63O 3DZKA 3JQ6A 2Y1CA 1I33A 1MXHA 4RPKA 2C0CA 1JKJA 4BKOA 1UZLA 4EBFA 3PWZA 3RBXA 3E82A 4B4VA 2HU2A 2OBNA 3QWBA 4NIMA 3D5TA 4NQZA 1Q1NA 3OQ6A 3KEQA 2VYND 4BMSA 4A10A 2HSDA 1K3TA 3F1LA 5L4NA 1Y7TA 4H16A 5TQVA 3KLMX 2DUUA 4LRSB 1H0KA 2NACA 4DREA 2B69A 1IHXA 2ZCVA 2D4AA 3WJ7A 2D5CA 3E48A 4MVJF 1YOVB 3K9QO 4RO0A 3ETEA 3U0BA 1SO8A 4BS9A 2ZCUA 1MXFA 4YAEA 3GAZA 3DZIA 1MC4A 1I10A 4KTVE 4B4OA 3EAGA 2V7PA 2OFPA 4OMUA 5JAMA 3R0IA 3FR8A 3N58A 1FDTA 5LDHA 3JQBA 3NV9A 3K6JA 3PZBA 1MUUA 1HKUA 2X1HA 3KYCB 4WUVA 2AG5A 1DC4A 1A9YA 3QVWA 4CLEA 4MIEA 4CR6A 3UF0A 4RGBA 1ZVMA 1EMDA 3H5NA 3KXDA 2GNAA 5COAA 3WQSB 1N7GA 1U2GA 3VPHA 1M76A 2Q99A 4XRGA 3HWRA 4Q39A 4AG3A 5F5LA 3HDHA 4PLCA 1V3VA 1X0VA 2Q1TA 2VYNA 3TZCA 1ML3A 3NTQA 4FJ1A 3KRTA 3LT1A 4D3DA 2HMUA 3BMOA 1DB3A 4H3VA 5C7LO 5GZ1A 1Y5MA 3GZNB 2V6MA 2FR1A 4JP2A 2X5JO 1H2HA 5EIOA 3ZV5A 2DM6A 1GQYA 3O26A 5BSGA 5L4SA 4OSOA 4PG6A 4XCVA 3D7LA 4HV4A 2X9GA 3ZWCA 3VH4A 2D8AA 1EQUA 4F3YA 4BNGA 1HEUA 1R66A 1U9JA 2BD0A 1GUZA 1JQBA 3OJFA 4DMMA 1GR0A 5I8ZA 5L7TA 4FPXA 1EVJA 4CLXA 1NASA 2P9CA 4QT0A 1UXGA 3TSCA 4MVJD 5JAIA 4K6CA 2VQ3A 2GRAA 4MPDA 1YVEI 2GSDA 5AQ1A 3GNTA 1J5PA 3FTPA 1J0XO 1RYEA 9LDBA 1YL5A 3DHYA 4DQUA 1H94A 1NQAO 1XU9A 3I9LA 3NAQA 1U7TA 1I32A 2JHFA 1N92A 2Y1EA 2HCTA 3CE6A 1OZAA 3WMXA 4PZDA 4WCFB 4YAGA 2A35A 2WD7B 4B79A 1E5QA 4BNNA 1B8UA 3VKUA 2XXBA 3WIEA 4CM8A 5CDGA 4EGFA 4YJGA 4YJHA 3IDSA 1E1KA 3OSUA 2B37A 5KKCA 3IC5A 1DC5A 5ER9A 3VDRA 4EUHA 2PNFA 4IJKA 3PIIA 1WMAA 4CLDA 1GCUA 2WM3A 4R3WA 3DBLA 5JYEA 1QORA 4F45A 4XB2A 4O1MA 1JAXA 1C0KA 3RFVA 1DEHA 3ROMA 3OH8A 3MZ0A 1B3BA 1TEHA 3DWFA 3F4LA 3A4VA 1X7HA 2AQHA 1VLLA 4GKBA 4IS2A 3Q9NA 3RROA 3H9EO 4GPD1 3DC2A 3Q1LA 4A26A 1IPEA 3U5TA 4FFMA 3BMCA 4K28A 3GEDA 2X5OA 1ZSYA 5DCYA 4IMRA 5T57A 1QXSA 1NQ5A 4YTEA 4E5KA 4WLOA 1CEQA 3TL2A 1YQGA 1LX6A 4IDEA 2VNAA 4J49A 1I3KA 2C7VA 1KOLA 3K2EA 1ZBQA 2HKIA 4WASA 4X54A 3LDHA 3WFIA 1ZK2A 3BHJA 4P8RA 3D5QA 4U8GA 2UVDA 5DP2A 4D42A 3OHSX 3OIDA 3MJSA 1MGOA 3U09A 4QQRA 3GDFA 1H6AA 4TQGA 3MJVA 3TOXA 2C54A 2CUKA 3WGTA 1KBZA 4PG8A 3KBOA 3RUDA 3W6ZA 4O0LA 2PKQO 4F6LA 1KVSA 5I8WA 1H5QA 4J1TA 2FP4A 2CY0A 3PHHA 3CH6A 4CLOB 5JNLA 3F46A 1AUPA 5BSFA 5EINA 3H9JA 5JAQA 3F1KA 3GOHA 1R6DA 5KJEA 4CQMD 3RFTA 2QW8A 5ITWA 4WNCA 2NQTA 2PK3A 3WFJA 1R16A 2JD0A 4IXTA 3ZWOA 4EUEA 1B26A 3HDYA 1B16A 4F46A 1BMDA 2XF8A 4R3NA 3PDUA 3LC1O 2EJWA 3PGXA 1WDMA 5COBA 2IEBA 5KVVA 1T26A 1JWAB 4L4SA 2VUUA 1A72A 2XAAA 3EK2A 4D79A 2DC1A 4IY1A 1ISHA 4CMIB 2HDHA 4PLGA 1YBMA 2PZJA 1Y6JA 1IULA 2EV9A 3WSWA 3OMLA 4XB1A 3DBRB 3JD1A 1VC2A 4PG5A 4UUOA 3FNEA 3P19A 4HXYA 1XELA 2H5LA 1XGKA 3DBVO 2EIHA 3NX4A 3UW3A 2B4RO 3AK4A 1ZKMA 2NVWA 3DAGA 4KDEA 3W8FA 4BNTA 3C1AA 5KVQA 5A9SA 3W1VA 1VM6A 3M6IA 1UZNA 4QECA 4BO8A 4QXMA 4E32A 4BNIA 1LLQA 4MINA 2E6UX 5IJZA 4YAJA 5MDHA 3AUSA 4J43A 3ADPA 3TZQA 2NV6A 3WWYA 1I2BA 2Z1MA 1ENPA 4Z9FA 5FI5A 2GGSA 1PQPA 1ISFA 3G79A 2GUGA 1PS9A 1E1NA 1ZCJA 2PH5A 4DXHA 4W99A 4AICA 4AJLA 4GX0A 4TMFA 2FPPA 5A9TA 3EVTA 2GN6A 1VE9A 4MKXA 3F5SA 3ASUA 3SVTA 3QE3A 3QWAA 4PG4A 2CMDA 4CL3A 4DC0A 2HK7A 1Q7CA 2DT5A 4BKRA 1FJHA 4KUHA 4TRRA 1RKXA 1R4NA 4ZRNA 3JD2A 1C1XA 1U4SA 2O50A 3JQAB 2D59A 3GG2A 3UICA 3JYNA 3JQ7A 2I6TA 4R1NA 5AYVA 5B1YA 1DXYA 4J9VA 4L73A 1YJQA 4RZIA 4L75A 3PIDA 3JQDA 4D46A 3MTJA 4YJFB 1J49A 3V2HA 3RQSA 1E3JA 2J6IA 1UAYA 2PR2A 1QKIA 2DU8A 3PGJA 5BNIA 1NBOA 2EHDA 4Q3NA 1R0SA 3HG7A 4Z9YA 2O3JA 3OIFA 4BNJA 2CF5A 4M8SA 4UVGA 2V6BA 2FPIA 4EJMA 3EZYA 3TOZA 2ZYDA 3INRA 3O03A 3S2FA 4N5MA 1EFKA 4DIFA 2FZWA 1JW9B 1U5AA 4O5OA 5GZ6A 1T2CA 3RAJA 2A92A 4A0SA 1CF2O 5B4TA 3ZW9A 1HL3A 3OFSA 4R9SA 4U0KA 5C7OO 2Y1DA 1Z75A 1B2LA 5K9ZA 2W8ZA 1ZSNA 3ZH2A 3PK0A 4D0RA 4QSMA 4R51A 1K6JA 5JS6A 1XLTA 4Y9DA 2Q2WA 2EKLA 3MEQA 4OQZA 1AXGA 4J0EA 4P38A 1ZMTA 5T8KA 2CVOA 3OQBA 2ILTA 3U62A 4ZGWA 3VDQA 1FDUA 4A73A 1WMBA 3GVCA 1GPJA 3SEFA 2I99A 5K6AC 2E82A 1AE1A 1ZJYA 3ZU4A 3RC9A 2VHXA 3L9XA 4YT2A 3EDMA 4PIVA 4PLVA 4G81A 1EVZA 4WEQA 1YB5A 3EY4A 3GNQA 3B1FA 2W90A 4J9UE 1DPGA 4A2CA 1D8AA 3D0OA 4FR5A 4OKNA 5IXYA 4FFNA 1W4ZA 1JA9A 1P0FA 2I67A 4D45A 5ADHA 4AFNA 3I9OA 2NU8A 3GLQA 1WWKA 1JU9A 4RPLA 5ITVA 2SCUA 4M55A 3BTOA 1P33A 3D3WB 1M6WA 4XR4A 4CQLA 3JCZA 3VHRA 4NG5A 4EI2A 4IPTA 1N7HA 4EJ6A 2BGKA 2NWQA 4IMPA 3DONA 1N9GA 4OSPA 4BO1A 2B5VA 3H2ZA 1LA2A 1XG5A 5G0SA 4DUPA 3L6EA 2QG4A 3KSZO 1PR3A 3WX0A 4RJTA 4JBIA 2UAGA 4M86A 4N5NA 2O23A 1DIAA 2QZZA 3ENKA 2HRBA 2BRUA 4W82A 1R15A 3OJ0A 3QWFA 4FS3A 2YZ7A 4BNXA 4MP8A 3ICPA 2YW9A 1LSJA 4XDZA 2GASA 3GF4A 3VZSA 1DIGA 4BGVA 2GLXA 1XWFA 1P1FA 3FNHA 1PL6A 1PIWA 1AGNA 1C3VA 2QRKA 4C7KA 3GPIA 2XPCA 4Q3DA 4HX5A 4BNLA 4DYDA 4QEDA 3NRCA 4NHEA 4IGFA 1UXIA 2NVUA 2FWMX 2GPTA 3ZW8A 4L4XA 3E5MA 3IAHA 3AW9A 3DOJA 4ID9A 4EYEA 3L07A 4ZQFA 5H83A 4CUZA 3LLSA 2B4TO 1NHWA 3ZV4A 1YE3A 4E5YA 4H15A 3H9QA 1E6WA 3Q3CA 4AJ1A 1YDWA 1E7WA 4YJDA 4FBGA 1CYDA 3WGYA 1DIRA 1JKIA 1LTHR 2YDYA 2Y0EA 3GVIA 3PLNA 2P68A 2FPGA 3GEMA 2DPHA 4DIBA 3WXBA 3C3XA 2J3JA 2FRDA 6ADHA 4D41A 5JY1A 1NFRA 4BMNA 4EUFA 2DQ4A 4HNGA 1U3TA 2NTNA 1CQIA 4JN6B 3W4JA 3ZHZA 4ALLA 1E7MA 4B3JA 4E0BA 1TVEA 4AJEA 1WZEA 2JFFA 3P2YA 1N1GA 4J1NA 4TVOA 3KEOA 3PQFA 4XGKA 4AJPA 5CFZA 1BWSA 2HLPA 1YB1A 4K1LA 4JNKA 3CPSA 1WLYA 5LDGA 1Y9AA 1K0UA 3E9MA 1O5IA 1U2DA 1P1RA 4BKPA 3BMNB 5U9CA 1LDGA 1DSSG 1LUAA 2R6JA 4TWRA 2AQIA 3Q2IA 3JV7A 2ZTLA 4BKUA 4UVDA 1KY5A 3LQFA 4GKVA 1XYGA 1BVRA 4MO2A 3U4DA 3ZGYA 1RM4A 1GPDG 5CAEA 3KYCA 1FDSA 2O7QA 4N18A 4BNVA 4OGWA 3JQFC 4E31A 5ICSA 1UJMA 4DRYA 4J4HA 3T7CA 1R4MA 3WLFA 1OMOA 1HDRA 5I7VA 2I66A 1QYVA 3S2GA 4DLLA 1U28A 1Y81A 4FFOA 5KJCA 2BLLA 4M49A 1EZ4A 3H3JA 5FI3A 3WYEA 2Y66A 2EXXA 2DFVA 4XQCA 3MWDB 4EITA 4CMEA 4TVBA 2V65A 5DCWA 1JAYA 3OECA 3GZNA 1C1DB 4HADA 3R6DA 4L76A 5KJ1A 4CPDA 1UXKA 4Y67A 2IZZA 1NAIA 3RIHA 1PJ3A 1ZO8A 3ZNQA 1ZZEA 5I9LA 1LQTA 1KYQA 4UAGA 2E49A 4WLVA 4YEDA 1PJTA 5DN9A 3BYZA 3PTZA 2FOIA 2Z95A 5JY6A 3CINA 1HT0A 4XGIA 3WG9A 3PHGA 1LDNA 4IS3A 4E5MA 3V1TC 1V3UA 3ANLA 3ZDFA 3WBBA 3DDNA 3VOSA 4ND2A 3N7UA 4U7WA 5CPBA 1NTOA 4ZQBA 3MJTA 1EBUA 2BGLA 2IXBA 3PJEA 4J7UA 1ZK4A 4H7PA 3NDJA 5A1TA 4IQGA 2BFOA 4UULA 2VRCA 3AY3A 2Y05A 1TB4A 4BGIA 3IKVA 3E18A 2RBEA 4W9NA 4CM9D 4RF4A 1NVTA 5TX7A 4OYRA 1B3RA 1BXGB 5HS4A 4CM1A 1ZXBA 3E5RA 2WD7A 3QQPA 1NNUA 5IDYA 4CM5A 4FIZA 4RLHA 3BHIA 1YKFA 4KTTE 3NT4A 1MG0A 4ALKA 1L7DA 5TS3A 1GZ4A 4BGUA 4DVJA 4QTZA 2CNBA 1E6EA 5L3ZA 1F14A 2EKPA 4MVJM 3S8MA 2AA3A 3NDIA 4URFA 3TZ6A 1WXDA 2I76A 4E21A 5CDUA 1XCBA 4GH5A 3L9WA 4U6SA 1PWXA 4ZVVA 4ESOA 2AE2A 1ONNA 1ZJZA 3I6QA 4MKRA 3ZI0A 4YYZA 1Y8QA 3I6IA 4DTIA 1JVBA 2IDZA 2HUNA 2P5UA 3M1AA 1H2BA 2WDZA 3WJAA 4A7PA 4YT8A 2Q2QA 5IDXA 1AHHA 1JN0A 1GUYA 2WD8A 4BKQA 1T1RA 1T4BA 1R0LA 3UXYA 4IXWA 4WPGA 5TRTA 3KOUA 4YPOA 2C29D 2PD4A 4ZN6A 1RM0A 1LDBA 1ZSVA 2YDXA 2PZLA 3GHYA 1IUKA 3ZCXA 4CMGA 4YA6A 2HJRA 1RYDA 4FFPA 4IDFA 4CM9A 5DCUA 4JX8A 4MIOA 1XA0A 1WDLA 1PS0A 3R1IA 4HUJA 5B12A 1PJLA 2WYUA 1DJNA 1GFSA 1PJ2A 2JD2A 1G1AA 4FDAA 2AW5A 4KQXA 4L9RA 4GMGA 3P7MA 3GA0A 5JDCC 1NPYA 4BV9A 2A4KA 4RLSA 3DHEA 3MWEB 3TL3A 4NFHA 2NU6A 4IDAA 2CDBA 3O8QB 3ZWXA 3FPCA 4NR0A 1C14A 3FN4A 3GVHA 3ICCA 5LCXA 2ZQZA 5KCZA 4RDHA 3BTSA 3OQ1A 1NAHA 4IDGA 4OOFA 1YONA 2GZ1A 3RU9A 2YYYA 3HFGA 4B4UA 3D1LA 4F6CA 4J2OA 3H2SA 4XIJA 1YL7A 3U9LA 4GBJA 4ZQHA 1I0ZA 5A5FA 4CLOA 1DHRA 3W8EA 4LK3A 2OGUA 3GVXA 4GAEA 1ZNQO 3RC1A 1VKOA 2JL1A 2PFGA 4BOYA 2YY7A 1O9BA 2Y1OA 3FF4A 3WGOA 2W2KA 1PS8A 2XOXA 2RCYA 3U4HA 4NNJA 1E7YA 2VOEA 3AM4A 4B8WA 3IP1A 4RVFA 3KETA 1P77A 4BNHA 8ADHA 1O95A 4WNIA 1NWHA 3V1YA 2YV3A 3GDOA 3WR5A 3HNPA 4ZICA 2YQ5A 3ITKA 3JQGB 4XDYA 1ZXLA 5HS6A 5G2OA 1KVQA 3DR3A 3IIEA 3RJ5A 4IJWA 5F1OA 1VJ0A 3CEAA 1KC1A 1NVGA 1ZEMA 5U4QA 1TT5B 1GCOA 2Y1FA 2FR0A 4IINA 4CUKA 1K2WA 4NU5A 3WGQA 4CMIA 5IDWA 1XR3A 3LF1A 4OXNA 1T2AA 3RUCA 3B1JA 4P4NA 2OMEA 4PN3A 4N7RA 3RUAA 1KY4A 5TIIA 4FC6A 3GRPA 5BSHA 3DO5A 3TNLA 2WYVA 4TSKA 1MG5A 5A05A 2YV2A 1SNYA 1PJSA 4ZJUA 2G76A 3GRKA 2RHCA 4E13A 1CJCA 1GUFA 1T25A 2GYYA 3GY0A 4R9RA 1DC6A 3KYBA 3PI7A 4IIVA 1EK6A 3SC6A 1EUZA 3CTMA 1DJQA 2W4QA 3Q0EA 4ZHSA 4NK5A 1TXGA 2WEKA 4FGWA 2C5AA 2JCXA 5J23A 4BQRA 3TFQA 5IXSA 4LMRA 4ZA2A 1PTJA 4OO3A 1UUFA 3HUDA 4CUJA 2DBRA 1ADFA 4K26A 4NBVA 4PLTA 3LC2O 4CLRA 2DFDA 4LMPA 1V3TA 1CWUA 1HDXA 5TJHA 3EUWA 2VHWA 3E1KA 3OBBA 4E2XA 1IHYA 3E9NA 4DLBA 4LISA 3E9QA 1EQ2A 1IL0A 3MJEA 1LDMA 4EEZA 4Q3EA 3ZNPA 4FJ0A 1M6HA 3HJAA 4YJFA 3AOEC 1PQWA 5FEUA 1NFQA 4IGEA 5ENDA 1FDVA 4RVSA 3C85A 4KUEA 1ZEJA 4GQAA 4BV8A 1HDZA 3HSKA 2IZ1A 1DOHA 1Z6ZA 2ZTMA 3C7CB 3DZHA 3E6AA 4YT5A 1IYZA 5JO0A 1HLDA 3ZHBA 2HK9A 3AY7A 5L7WA 3GVPA 1P1JA 1YH3A 4A5OA 3I4CA 4IQ0A 2GERA 1EEHA 3A14A 4RV9A 4MVJG 1QV6A 4ZQGA 5L9AA 6LDHA 1ISMA 4JP3A 5IG2A 5KOIA 1KVUA 1C0IA 1P1KA 4K9DA 1P45A 5I9MA 4HKTA 4BHTA 4Q3BA 1HYEA 3JQEA 1YGYA 1R37A 5HBRA 4Z0PA 3QV1A 4BNKA 4I5DA 4R54A 4PRLA 3FHLA 4LVCA 1E3WB 4RL6A 2NADA 1EUCA 4B8ZA 1F0YA 1ISJA 1U3UA 1PJCA 5KIAA 1PGNA 3F5QA 4P4LA 1D1TA 1VSUA 2RHRA 3VTZA 4NBRA 3ZV6A 3X2FA 4XZ3A 1I01A 4GMFA 5T6BA 1YQXA 1GD1O 1O6ZA 2CFCA 1OOEA 2QZ9A 2HMSA 4YQYA 2DAPA 2O3QA 2FHSA 4B3HA 1JKFA 2BELA 2G17A 3E8XA 1DRVA 3RJ9A 1D4FA 1KEPA 4FCCA 1PJ4A 3PJGA 5CG2A 3D3EA 3LT2A 4I5FA 2P91A 3DTYA 3FWNA 1VJTA 3D3WA 4NH4A 3V1UA 4G2NA 3LC7O 4CMKA 3C1TA 1N2SA 5JW6A 5ES3A 2VTEA 2H6EA 4TRJA 1DBVO 1X14A 3OM9A 4DA9A 3U4IA 4Z9XA 5JXWA 2WJPA 4Y6RA 3Q9UA 2O4UX 3WYCA 5EESA 4BMVA 3G49A 1LDYA 1Y1PA 1JWBB 2LDBA 1PSDA 2G82A 1X1TA 1LLDA 1QYXA 4ND4A 4Q9NA 1I8TA 3ONDA 5CEFA 4CV2A 1WVGA 2J5QA 4NI5A 1PZGA 2EW2A 4RVDA 4NMHA 3RCBA 3CSDA 3G1TA 4FB5A 4ND3A 2JFHA 4WLEA 4Y6PA 5A3JA 3RI3A 1T24A 4J3FA 4TKMA 2POQX 5AOVA 3VC7A 3ITDA 2O3UA 3F3SA 3ZNOA 5B4UA 3OEWA 2X5KO 1RJWA 1BXKA 2ZIZA 2VUTA 1ENZA 1K6XA 1LSUA 2E37A 1WZIA 3H5RA 3KYDB 5COQA 3ZWBA 1UP6A 3PFFA 4JJGA 3X2EA 1OI7A 1XQ6A 4DYVA 4Y8VA 4NDNE 1ZH8A 3OJOA 3VVBA 1UDBA 3VH2A 2WYWA 4MDHA 3HHPA 2H1SA 1P44A 3I9KA 1A9ZA 2YUTA 4AJ4A 4XA8A 1PZFA 4IJVA 1UDAA 4K6FA 1NQOA 2ZB8A 4E5NA 5IFLA 3T4XA 5BNTA 1G0OA 4IDCA 1PGPA 4XJSA 3VVCA 3GGGA 3C1OA 4KUGA 4OAQA 4WGGA 1ZK1A 1GQ2A 4W4TA 3VZPA 4UUPA 4JROA 4RPGA 1I2ZA 3FNGA 1ENOA 2R2GA 4YCAA 1RPNA 4IZHA 5IZCC 1P9LA 1I3LA 4OM8A 4IJUA 5HM8A 3W4IA 3GFGA 2I65A 2PD3A 5F3RA 3ZHXA 4TRMA 3WGZA 4HNHA 1Z74A 3WB9A 5JC1A 3PYMA 3BMNA 4J1QA 1VSVA 4BB6A 1O94A 1WP4A 2GZ2A 4OOEA 2GCGA 4P22A 4E3ZA 1EBFA 2ZYAA 4GSKA 5U1PA 4BNYA 1BW9B 4PCVA 5H82A 3FWZA 4FOSA 1DRWA 1FXSA 4ZD6A 1NFFA 1DFGA 4GVLA 3EW7A 2C07A 5L7YA 3VH3A 3ZWAA 1UR5A 2Y1GA 3FPLA 5JC8A 3ZWYA 1LRJA 3CMCO 2OXIA 2OOSA 2QYSA 3LU1A 4NFYA 4IUYA 2CF6A 3FRJA 4YAKA 5ILOA 2JKVA 3GGPA 3B20A 3COSA 1HZJA 3WDSA 4I8XA 3JQ9C 4UVEA 2X0RA 3UCEA 4WLNA 4E2YA 1IPFA 4ZRMA 3KTDA 4OIMA 1ORRA 2VCYA 3JQ8B 3IJRA 4NJMB 5T67A 4BL5A 1MB4A 3IP3A 1C1DA 5BSEA 3PYXA 4N5LA 4XQEA 1XKQA 5DZSA 3CZRA 3FNFA 1I5RA 1OAAA 1BDMA 3EVNA 1DFHA 1KEWA 4CV3A 1OC4A 4YRBA 5DBFA 4CM8B 5TT1A 2NU7A 3ROPA 4YJGB 4YJHB 4KP7A 2VZ8A 9LDTA 5DBIA 5JCJA 3RSHA 4ROSA 2VNSA 2FZEA 1WPQA 1B7GO 2JHGA 1X13A 3WMWA 2P9GA 1VI2A 1KVTA 4XRRA 3I9MA 1DIBA 3PLRA 2IODA 3HN2A 5DF1A 1LLUA 2AEFA 3MOGA 3JSAA 2VT3A 1QLJA 3ENNA 3I52A 5GY7A 2X8LA 3PHLA 1BXGA 4Z0HO 3RUFA 4EZBA 3IS3A 1U1IA 5A4DA 2IXAA 4HFRA 3CZMA 4XKJA 4PLPA 1B8PA 1KERA 1HF3A 5JCXA 2DBZA 4J7CA 1T4DA 1A71A 1XHLA 1M67A 1RWBA 2FY8A 4BNMA 2GD1O 3INGA 4LCJA 2Q2VA 3VZQA 3Q2KA 1YWGO 4UEOA 3A9WA 4D3FA 1SC6A 2JAPA 3RFXA 3JTMA 2C7GA 1GEEA 2FSVA 4XYGA 4Q3CA 4BO6A 1GTMA 1LJ8A 1GDHA 3QVSA 4E12A 5L51A 3ANNA 2TMGA 3PWSA 2RH8A 1A7AA 3PFWO 3DAPA 3WQRA 2NVBA 3K5PA 1A7KA 1N8KA 4I1IA 1Z45A 1SEPA 1EVYA 1Q0QA 1VL8A 1DDOA 1Z7BA 1GY8A 1Q7BA 2OUIA 3TZHA 3RBVA 3W8DA 4GX5A 3UVEA 3DFUA 5G0VA 1ULUA 1C0LA 2ZB3A 5L95A 4ALNA 1HE5A 2RIRA 4G5HA 4ND5A 1ADBA 1LRLA 4IIUA 5AVOA 3G17A 3QWHA 1Z82A 1GADO 2EW8A
chains in the Genus database with same CATH superfamily
3R5KA 5A3VA 3Q3GE 2X0NA 2G07A 2H18A 4ZVNA 1M2OA 3QQ5A 4BP9A 3AF2A 2ZBFA 1DADA 3LQ4A 2OSBA 4Q1BA 3T3PB 1W5BA 4BMXA 4OCZA 2P0AA 4BO7A 1SN7A 3BX1A 4DT1B 2Q8QA 1Q84A 2KI5A 3I2JA 2QP3A 3QE9Y 3ZIUA 1YFKA 2ZT8A 4LSWA 4UHFA 5LM3A 2ZAOA 3D2BA 5NULA 1IJBA 2B25A 2PWAA 3WBKA 4ECAA 1NSTA 1XLUA 2C0PA 4CG3A 4KGVA 5JRZA 1C7JA 4GZMA 3D6NB 2PLWA 4XVUA 3KZ1E 2VUIB 4HH3C 4UNRA 2CNNA 1BU8A 1DXHA 1ICIA 3GNLA 1A5ZA 2QZPA 4M1ZA 4B2IA 4TT8A 5FKJA 4EY8A 3I0ZA 4Y9RA 5AJWA 3ZLBA 3PB3A 5GJCA 4U2FA 3G2PA 1RADA 3WMWA 5BSMA 4BTEA 4E5DA 4YCSA 4ZOBA 1HFJA 2A88A 5DWVA 2NYUA 2Z1NA 1OPXA 1YOVA 3E8MA 4WIAA 1QIGA 1A97A 1EFPB 1PGOA 1TEVA 1XZKA 2C4HA 1A88A 1MOZA 1L6RA 3BFPA 3IXLA 2AG8A 1E1MA 4PCUA 1BEEA 3JQRA 4BMCA 4CM4B 5BR8B 3NDBB 3R5HA 5FWYA 1BVYF 2J9YB 3QYPA 2V54A 5SZIA 3TD9A 2CL5A 3PUXA 5E2BA 2IIQA 3MC1A 3H5OA 5LB4A 3WBJA 1YJ8A 1SQ0A 2B92A 1LV7A 3A7DA 2ENWA 3VR6A 4OBBA 2PY6A 4ZYXA 3CMMA 4W9NC 2Q6LA 1NXVA 1Z12A 5KSOA 3A1SA 5I9SA 2GYUA 5L3SA 4GUAA 2C3MA 4LXIA 3K5IA 3LQRA 5DOVA 2VYVA 4RKYA 4M4SA 3A8TA 2IYRA 2C2WA 3CQ9A 3MJDA 4URUR 3RV3A 1U2RA 3AQIA 2O8DA 3BRWD 2B4QA 2PH7A 1IVNA 4HPXB 4BMZA 2QM7A 2H8GA 4QPNA 1YMVA 2HDNB 4WZ6A 2CXQA 5CD1A 1GTZA 1X7WA 3RAPR 3EAQA 4Q1FA 1VKNA 4HDKB 2C3PA 1BROA 1EDBA 3OMWA 1XRRA 4GEKA 4BQIA 4DGSA 5C8ZA 4OF4A 1VPWA 4X93A 3TBKA 4UU1A 2DR2A 1WKBA 1KPHA 2YMQA 2Y68A 1O6GA 2ZYWX 2JARA 4EYOA 2TS1A 9ABPA 3BE6A 3G1UA 4AKGA 5H81A 3JD0A 2FI1A 4AO6A 1QK4A 3ZZUA 1HH4A 4TOIA 3OZTA 1J1ZA 4Q4LA 4RVHA 1FNNA 2CLSA 3EJ6A 5A2QA 3HB7A 4MJ7A 2C82A 3E1GA 2QDXA 3ETDA 4YRAA 4YWHA 1IG3A 2VBIA 5HF9A 3KKOA 4QDKA 2HA2A 2BM9A 4OHUA 3U7QB 4EHLA 1EIWA 2ZANA 2CXTA 4JGBA 2X40A 3ZHOA 4MKGA 3VNAA 3E7PA 5EERA 4D97A 1NDHA 3OCJA 4DXDA 2AOUB 4B6OA 3IPLA 3DEFA 1JXQA 2W2LD 2GETA 2YYZA 3DOIA 3PJDA 1PCXA 1I6MA 2X6TA 1T3HA 3OBIA 4Y2QA 1K7XB 3EG9A 3K6SA 1Y9EA 4S0ZA 4BEVA 4O6VA 2JZNA 4OXIA 3IO3A 3L4SO 4PTYA 1YUNA 1LF5A 1D3AA 2H7XA 1TKCA 5TQ2B 1Z06A 2GJ4A 3VKWA 4K9KA 1ISIA 3LFHA 1E0DA 3HJRA 1L7PA 4DLUA 4XAQA 5FBZA 3N3BC 5IARA 1C7FA 1F8XA 3L1IA 4K05A 1E1YA 4CTNA 1LDEA 4JVNA 4M8KA 3GLVA 5EMKA 4CV0A 1P6QA 3EC1A 2OV3A 3IQDB 2I62A 3M2PA 4ALJA 4JH0A 3RRBA 2I6SA 4WLFA 4DM3A 1SZJG 1VJ1A 3WIUA 3GCXA 4BIMA 4DIOA 1NNI1 1LBEA 3CLVA 2QTFA 5IYZF 2IOYA 2EP7A 1AB5A 1XTJA 5EJ4A 4PLYA 4OH1A 3ENWA 3QU4A 3O2JA 1R4AA 4F7DA 4BX0A 2CXXA 4ED9A 1OXSC 2VHYA 1DG1G 5LZ8A 1HYBA 3ZY2A 3HHEA 4QD3A 1L5GB 1VE1A 1DQPA 2JKZA 2D1RA 2EFEB 1Q3HA 1UANA 4IO0A 4O4IB 1K7SN 3ZI7A 1GNPA 1L4GA 1ZESA 1FP1D 3ELWA 5HQ3B 1Z8FA 5EJ2A 1Z4NA 5LQJA 4M21A 2IHVA 4RVGA 2X0DA 4W6ZA 2JK0A 4TV8F 1OV6A 2YWXA 3C7AA 3KDSE 1NKVA 3H1TA 4GGOA 3BJRA 3LZDA 3WB1A 1ZCAA 1QS0A 1NW6A 1OLXA 4ZO7A 2GRUA 3NKLA 1L0BA 3KEFA 4EB3A 4PYMA 1YNSA 4DLVA 2X0IA 3W4KA 1HTWA 3B53X 3DV9A 2QU8A 1L9XA 2GHQA 3L41A 3MTDA 2K2QB 1V1MB 2OLEA 1P2VA 1LZKA 3A9TA 4ONEA 3W9UA 1O95D 3BXXA 2QJWA 1YVRA 3JU3A 3MHTA 5DNAA 1PZNA 1MX3A 4AJNA 4BGEA 2BV3A 1NVUQ 1CDDA 3LNCA 4RJ2A 1Q0HA 2A59A 3SNKA 2FMHA 3ORSA 4E09A 1T29A 4TUYB 3A9VA 2FW9A 3RVQA 4X64B 4PRKA 4DCSA 3ZHUA 1I2AA 2OHIA 2ONKA 3ZC3A 1FOEB 4Y2XA 2PSSA 3HXOA 3JD3A 1I80A 1V8ZA 2HZ7A 3DE6X 4PC7A 3RO7A 1BHQ1 2QGFA 2XYVA 3B9BA 1Q16A 3N8GA 3TFOA 3TSZA 2VA9A 3EF0A 4LE0A 2XMRA 3RG8A 2YVKA 2HB6A 1N2XA 3PRHA 1SBHA 3VR4D 2HO5A 3AUAA 3K53A 3F3MA 3W0LB 3A1DA 3O4IA 1JR3E 4I4CA 2R6FA 4YRLA 4ZRDA 4J6FA 5ERXA 4GMXA 4IFBA 1QDUA 4X1OA 3TNDA 2R48A 3SJ7A 4BVEA 2VP3A 2Q4EA 1BVHA 2OECA 2JLQA 5EQFA 4AD8A 2QRUA 3TJRA 4FOOA 4PX5A 2CMKA 3IE0A 3IHWA 2XH8A 5D7BA 3C97A 1N5DA 5CFQA 5DNWA 3QJYA 4OQPA 4IEEA 1LTQA 2NO4A 3L5KA 3NATA 3RUPA 4ZOQI 2GX6A 4C6TB 4DBZA 3RU3A 3WGUA 3CKMA 3JATB 1Z26A 2XUHA 3A2NA 1E1LA 2QVBA 1Z4PX 1U98A 3H4VA 4OREX 5BY2A 1FFDA 2X1VA 1G6KA 4YYEA 1F20A 4BIIA 2P2LA 4BVAA 1FQKA 2IYOA 2ZAGA 4UW9A 2ZYRA 3T94A 1IWBB 1D2MA 4L22A 3RYCB 1T3ZA 1ID8A 1GXSB 2ZG6A 4R01A 3GZTB 5IF3A 3L4BA 4LGVA 4AF7A 1PFQA 3CX8A 1KI4A 1OLSB 1QO0D 3KYDA 4P84A 1SCUB 1IN8A 4U6QA 2OYRA 3Q9SA 3L0BA 4A3SA 1TX4B 2XA9A 3B6EA 1B1CA 1AO3A 4AL4A 4EKNB 2HCJB 1YRYE 3B3JA 1W49A 2IPOA 1TCBA 2QL6A 2DTDA 2CNDA 2RARA 3FDZA 4FWBA 3R7LA 3ZUGA 2XLBA 3JQAD 4RZSA 3V7NA 2I4NA 4X95A 4A8JB 3CF2A 2EJCA 3QY9A 4MVJP 4PQFA 1E5DA 3ZWQA 4MMXB 1D4AA 3Q87B 2MR6A 4UTNA 5JBNA 3BE5A 5KNCA 2EL7A 4CKZA 4MROA 4G9BA 2DFKB 1GZHB 2KWIA 2EFYA 4DPMA 4N76A 3PNYA 3WGJA 4PQGA 3CXUA 2A0UA 2AKYA 1QZZA 4QOGA 1H2EA 3BAZA 3GD5A 5CBKA 3AU8A 3D31A 5I8PA 1GAEO 4UHHA 3TQHA 1LPMA 2ORIA 3KBBA 2V7QA 1HEIA 1R4MB 1XPJA 3Q3HA 3INTA 4LE1A 3LVFO 2XMGA 2Y77A 2DBVO 2F6RA 3I39X 4RQUA 4R4JA 4ZCRA 1DWOA 1L5RA 2OL4A 1RQ7A 4D6YA 1J2EA 2I1LA 16PKA 1T9GS 1VG9B 2WA1A 4Q7MB 3N8IA 4YMVA 1N2GA 2BTQA 5FNVB 3I9NA 5LOVB 4DMKA 2JIBA 1O96B 3I30X 4M0PA 5M3BA 4ZCPA 1O57A 1Q2XA 3WHPA 4DSUA 2EKQA 1NF9A 1PTKA 3G9UA 4B44A 1JSXA 3RKUA 4X7MA 2QW0X 2ISQA 3TDKA 1FS6A 1L7AA 4HBGA 2CDCA 4EG0A 2JLYA 2AD5A 3FSGD 5D7NA 3FCCA 3VPXA 2NYRA 2WQ6A 5JJ5A 3OOYA 4RHEA 1XN4A 4BP8A 1M6YA 1U0RA 1ZHFA 4WOCA 3F6EX 1JSLA 3CY6A 1T9DA 3PE3A 3OOJA 4EY3A 1Q77A 2NO9A 4TXMA 3SYLA 4B6PA 1M2WA 2XCIA 5ELMA 5FHQA 2XCSB 1JEYA 3B5IA 4LY3A 3QU9A 2JFVA 2VZ0A 3PEYA 4MWBA 4UUMA 3C8MA 2DHRA 1EUDA 4RLQA 1Z7EA 3JQ8A 4JLBA 4JJFA 3BK7A 3JW8A 3SVZA 2D3TA 4YMLA 4AI6A 1T5BA 3JVEA 2EKZA 2QD3A 4RMHA 3EDYA 3WNDA 1S8FA 3GFTA 3L7CA 1PZEA 4CF7A 1KSGA 2P90A 4XYBA 2BAGA 4YRGA 3BTVA 1QCDA 4MQLA 4QBGB 1CZKA 4ER0A 1BGXT 2D5LA 5LU9A 1T3GA 2B5WA 1QK3A 2VDKB 2WSIA 3ST7A 3L3BA 4B0OA 4WL0A 4B4KA 3D8NA 5CB4B 2ZUWA 3REOA 1D6JA 3VQTA 5I7WA 3FBGA 2REXB 3OCWA 5FQNA 1UK9A 1KQGA 3LF2A 1B0AA 2X2EA 2CL7X 5TPZA 5DKFA 5A62A 1ZFNA 2YIDA 4HYYA 4RFSB 3HLYA 2F3SA 2V6IA 4LV6A 2IU4A 1NBHA 3WA7A 3E3NA 2PFKA 2VNKA 1XQ1A 3ZU3A 4L8VA 1QLHA 4J2HA 4L6IA 5B64A 5IP5A 1FTWA 3IILA 2JA2A 1PJAA 1QLWA 1V16B 3VYWA 1HT1E 1LVUA 2GJSA 4IDQA 1VQ1A 4NHOA 5JHGB 4TMXA 1KDYA 2FDRA 4CQJA 2G28A 2Q7OE 2C1EA 4KOAA 3WHIA 1H6BA 4AM8A 3UHAA 2GQ0A 4DEVA 3T1HB 2A9FA 3IP6A 1Y8RB 2J87A 4XSHA 4RZHA 3TLBA 1J0BA 1ODIA 2VH5R 1PJQA 1Y7HA 2LV8A 1NNEA 2YJZA 1FFWA 5DNCA 2Z43A 2HK8A 4F9TA 5JZVA 2PXHA 5PNTA 3SQXA 1T2DA 1LQUA 4DV2B 3KKPA 3NIBA 4H6PA 4BBAA 4LPSA 2A0XA 3W3AH 3WBBA 5C37A 3C3CA 1XVLA 1K89A 2AWOA 4RTQA 1ZK0A 1KHTA 2ZRAA 1XD2A 2GCEA 2XZOA 3LWDA 3UBTA 5A0TA 2XMBA 2WIDA 1PL7A 4EVIA 3VU9A 1HNZB 1QSGA 3P8ZA 4MUXA 5C81A 2OD9A 3FUWA 4TQUS 4ASUA 4GXQA 4A8PA 3KSMA 4II3A 2GT1A 1LKZA 4M9ZA 4YJ2B 3QTLA 3TMYA 5FHRA 3NHBA 3K92A 1YA8A 2R6CA 2AEJA 1O4VA 2X4IA 3W5DA 2ZIUB 1CS0A 3A37A 4FFLA 4HGRA 4UXIA 3TTWA 5C3UA 2QLLA 4M8IA 3TIFA 2WHRA 2Y6UA 4ISBA 4JCOA 1JDUA 1OCEA 4H59A 4EJSA 2AEMA 4HK4A 2FAXA 4OQMA 3TNFA 2W6OA 3CRW1 3T5AA 3ELYA 4F6RA 2B1RA 5EIAA 1F17A 2EP5A 2XKBA 2FFHA 2YH2A 3AFMA 2PXAA 4Y1RA 3K73O 3K30A 4GOOD 4LA4A 5DU2A 2QLTA 5DMHA 4UAJA 4EYGA 1MGPA 5D01A 1LPPA 4NXMB 1UBSB 1ZGZA 3U4QB 1MT3A 2O0MA 4EG8A 1NX6A 2R8PA 1HLPA 3B70A 1G60A 4FBMA 5D2CA 1GAWA 2FRVA 3QV2A 4Q01A 5BMOA 4L4ZA 8GPBA 3IHLA 4CNBA 1KOJA 3PLAE 3NIGB 2HSJA 4MQ4A 5TQJA 1ULAA 3O1HB 1DJOA 4FZJA 4E6PA 3GR6A 2DLDA 2A0FA 2B8TA 2F59A 3BWCA 4YGYA 4HI0E 5L3RA 1QG2A 2IBTA 1JDZA 1DDIA 2EDCA 1CXZA 4C0SA 2ID4A 1LPOA 2QMHA 4D4HA 3SSAA 2CYAA 1X9IA 2J6BA 2RC5A 5JH7F 3DSRA 1AXEA 2BFBB 3LQ1A 1YZVA 2VDWA 3HYSA 1EP1B 4DMCA 3AF1A 3U26A 4K2AA 4HNAB 5K8CA 1UAAA 3HR7A 3RUHA 1YRQA 3GMSA 4X71A 3O8RA 1CIJA 5GM2A 1XEAA 1YDHA 1DAPA 3H75A 3RS9A 4MOWA 3E7FA 5J4KA 4JWTA 4QDXA 3TSAA 4CR7A 3P9PA 3C3PA 4ZDWA 1W5TA 5G02A 4GL4A 3SC4A 2XQJA 1XDGA 1JDNA 1F4LA 1Z63A 5T8KC 4EJ0A 1NOIA 3ANMA 1GHTA 4EPRA 2QM8A 5L8VA 2QNIA 3L6DA 4X1IB 6REQA 5EMMA 3GRCA 3BL6A 3OE4A 2HNAA 3T7EA 3PJFA 1M3SA 3ZJTA 2JFPA 1L5YA 3FD8A 5AXAA 1U1EA 2X2PA 4P93A 2QN7A 2P1DA 4AZ0A 3SYRA 2AUMA 2OENG 4PYOA 1TMGE 2R87A 3GJ7A 5J59A 4QWMA 4IHJB 2Z8YA 4P81A 3TB6A 5KNDH 5LN1A 1M1NA 1J70A 4ZKDA 4HGZA 3JD4A 2PZ8A 5K0JA 1Z34A 2P9ZA 4NZPA 4D9GA 5IAAA 2M1XA 4OQYA 4PRZA 5C2JB 2OHXA 5JCJD 4D43A 1ZOLA 2EIXA 3LMKA 2WD9A 5KOJA 2QJOA 1NU8A 2GO1A 2RGXA 2XTNA 3NP7A 5DBHX 4DV5B 3E9ZA 3K15A 2VRBA 5CBPA 2H8KA 1UWKA 5KWIA 3E35A 3D6VA 3T35A 3V1LA 2FTKE 4C78A 2HPZA 4XWYA 3A3YA 1BD3A 1K4YA 1U8FO 3MN1A 1BOFA 1MEJA 2YNMC 2YWDA 1I30A 3P1JA 5D87A 4I08A 3SIWA 3TLAA 2J8ZA 4KR3A 2WJZB 2PUHA 5GMOA 5EGSA 3I92A 4BZQA 1L4BA 2DF8A 2UDPA 1FXWF 1ZP6A 4LXHA 3BGSA 2DUMA 2CEAA 1WZ2A 4RTKA 5KHAA 2EERA 1NA5A 2VT6A 5F52A 2HMWA 2FSVC 3OU7A 3WNCA 5K3EA 2IYQA 2OYCA 4D44A 1P29A 1ICEA 5BVHA 2BRUC 3L8CA 2OBYA 2V8BA 4NAHA 2H5JA 2HRZA 2PX0A 3B51X 3IP9A 4ZQCB 4BV2A 4ER6A 1AV7A 2R5NA 1X86B 3DNPA 4N49A 1O58A 4HH1A 4MP6A 3FYCA 1TLLA 5EUBA 1W9HA 1K6IA 2JI4A 3DTVB 2XITA 1U2EA 1FA9A 2FR8A 4XVRA 1JMKC 3BERA 5GTDA 1GFIA 1G8FA 3ISVA 1JIJA 2ARKA 1ID1A 3ZE8A 1J00A 2C1XA 3IVCA 3RC7A 1IZ8A 2GA8A 4WUTA 2XRMA 3LPNA 4JT9A 4O2AB 3ANXA 3I5MA 4YY3B 1G9SA 3E61A 3A6JA 5AKEA 5FYDA 2B2CA 4GI3A 3JX9A 3NM5A 5TMBA 3C8HA 1HETA 3BEDA 3UFXA 3FWYA 1XCLA 1L4HA 2JKYA 4DRXB 2QI9F 4CT5A 1T4CB 2PU5A 2WAAA 3RW9A 3PSHA 1S3FA 1QYIA 2I54A 3KAJA 4ANFA 1O1YA 4PAMA 1BKSB 3SK0A 1CHDA 2OILA 3EZXA 2QG9A 1LCIA 1HT2E 3UA4A 4QPJC 1A9OA 3BMCB 5ALMA 4G0ZA 4OL0A 4YP6A 1EUCB 1C8BA 3KQQA 2QYOA 1F0KA 4TWJA 4WACA 3K0CA 2GKGA 2ZWMA 1PSWA 2QQ5A 5FV7A 1E32A 5EWJA 1MH1A 1X7YB 1JLKA 2IXEA 2ZI3A 1SB9A 3B8HA 1N6PA 1QCYA 3GUYA 3ODGA 3ZKWA 3QHAA 2EJVA 4AB1A 5KOHB 2Q7DA 3CUKA 3IV9A 1OJLA 3VHXA 4UQLA 2O8CB 2BI7A 2OZLA 2W2QA 1E3SA 2IOFK 1RHUA 3D4LA 2VPIA 4CMCA 3LCRA 1J8QA 3AF6A 3LUGA 3ZN2A 4O2BA 3R3VA 2H1LA 4GQIA 4C0LA 3QRWA 1ORHA 1U2DC 2FEXA 3MOIA 1MEOA 1H9AA 1ZQ1A 1QO7A 5DNEA 4ZGBA 2ZJ1A 1GZVA 2PTGA 2IQIA 1ZCFA 1ZGCA 1DEAA 2J3HA 5CPFA 2DPYA 1JHXA 3QFCA 4UJ3A 4ERXA 1XVUA 4N03A 3SIRA 3U3RA 1FDOA 2JJ1A 4MRPA 2ZR8A 3KM0A 1FUEA 1ETHA 1S02A 2WHYA 4A91A 1OH5A 3A9UA 1KE1A 3VX3A 1K7CA 4TM7A 3ZDRA 2JRLA 2LRHA 2GK4A 2PO7A 2XZDA 4L8WB 3FPSA 2QRVB 4P7BA 1Q57A 2WF6A 4YAWA 4QOHA 1IQUA 1PG5A 1ZMOA 3TSWA 3KR2A 4FIDA 5EKXA 3WB0A 4BC1A 4DIEA 4UTPA 2NTJA 3C24A 3O4RA 5EGNA 3ZDFA 2Q3EA 3ZBPA 4HDOB 1XNJA 3PHCA 2GEDA 4UUBA 5C51B 2CV2A 4RQTA 3H5TA 1PRYA 3G9XA 4M9UA 1WHSB 3DW1X 5MFPA 2IZ5A 3BQNB 3ECAA 1ZOPA 1YI8A 1XNRB 1RQLA 2UZIR 1XFAA 2WE8A 3SE0A 1F6BA 4XYLA 3ROXA 5JYDA 3VR6D 5F5NA 4HWOA 4QHTA 3EIOA 3SICE 3FYHA 1XPRA 4A8TA 1S7CA 4M0UA 3TI9A 1Q7TA 4FJ2A 3KZNA 4YRMA 3V8PA 3C74A 3LUJA 2AZ4A 2VYVD 5FDFA 5HEKA 4DNPA 1RE0A 3WIVA 3R41A 4X65B 1U0OC 3ZK7A 1QAOA 3N7TA 2ZRHA 5JCOA 1LBQA 7AT1A 3HUUA 3GAMA 1HE8B 4LZNA 5FUVA 5K3SA 3CLRC 1BDBA 1TM5E 2ZBDA 3BWVA 2C4WA 1AIPA 1NMQA 3R6TA 4G1CA 4OA5A 2IZOA 5E9JA 3SMVA 5HJEA 5IMSA 5JYBA 1IN7A 4WTOA 4C4XA 1O8CA 2B9VA 1JR6A 5BSWA 3PPIA 3BMXA 2ZUBA 5B58C 3R8CA 1M9NA 3KZOA 4H3HB 4JQOA 4ALMA 1HOTA 1S6YA 2ATCA 3OQJA 4GYKA 4WLUA 4ZAXA 1J2TA 3H11A 3RG2A 4AJKA 5L6LB 5JPDA 2WB2A 1CTQA 4BP3A 1LVGA 3R7FA 1Q20A 4MR9B 4JFAA 1AG9A 1PWZA 3P5BA 2R25B 3I8SA 2FPXA 5FFNA 2FEOA 3M6VA 4RZ2A 3V6MA 4BO2A 4CL2A 3N8KA 1BA2A 2R6R1 1UOPA 4A27A 2CC2A 4FMDB 5F3DA 3CZ5A 1Z36A 1P4AA 5DX8A 1M73E 1JEQA 4GXNA 4YAIA 3T5PA 1PGJA 1GYRA 1DAFA 4FE7A 4PC3A 2OZPA 4F91B 1AA9A 3ZHYA 4KPEC 4OJTA 3CURA 3HDVA 2WTBA 1IM2A 4I2NA 4JIGA 4L74A 4WCFC 3S2EA 4II2A 3NTOA 3SJZA 4M7RA 4CLHA 2C04A 4FMCB 2VH1A 2FX5A 3STHA 4TYWA 4MI9A 1JHVA 5GZ3A 4E14A 3ZE7A 3G8AA 4ZJYA 4Q1CA 1VZ3A 3NJ8A 1UM8A 3HYRA 4Z3DA 3S1LA 5J3JA 1M7HA 1UKVY 2NZ2A 4L2IB 1P4RA 3QW2A 4EHBA 1L5SA 1HFEL 5HZMA 3PVCA 1Q0LA 1TFUA 4J1SA 4M1QA 1PE0A 1Z8DA 3LI2A 1T0PA 1CP3A 2P5YA 3JQ7B 1E7QA 2ZBEA 4E5SA 4XM2A 3IQXA 5G4KA 3VPSA 3AKCA 2IV3A 1PYOA 3A1EA 3TE6A 5KX5A 4C4RA 2XZTA 5LMUB 1YZHA 1OHHD 1R6VA 5FUBA 4RTPA 3CCFA 2YQ4A 3G7SA 4GI7A 3QVGA 4HAWA 2NLOA 1OH7A 5AVQA 2QRQA 1E9DA 1KYIA 2FJUA 3VGJA 5BUCA 2Y0PA 2WT8A 4ALIA 5CDTA 3AVUA 5ENVA 3AU9A 1ZR4A 5HCUA 3CRZA 2Y93A 1G0NA 1G6Q1 1PZXA 1VI5A 1VLJA 2J85A 3B6KA 4M1WA 3CRVA 1JHQA 4E7OA 4LXGA 3ANYB 4ZCSA 1E7SA 1OWLA 3FH0A 3RVMA 3EODA 4CV1A 3Q5EA 4S12A 2BFPA 3AHIA 3CZ9A 5GOTA 4RM2A 1TKAA 2YS7A 2VBCA 1UOOA 3NDRA 5ALKA 3TD2A 1AA6A 3CVYA 2JAHA 1R5NA 2A14A 4TROA 2L42A 2JFGA 1UDXA 1JQDA 1SVUA 5I7SA 4U7JA 4U3JB 3ZDBA 1G55A 5C3MA 2FSPA 1MV8A 3RHTA 5CCXA 2EDAA 4NYIR 1MLDA 4PR3A 3OC0A 4RVUA 3D6JA 1XZLA 3X0DA 4NE7A 3TW6A 5KVCA 3IUSA 3CEPB 1FIUA 4MV0A 2P30A 1DOZA 2HIHA 3ZW7A 5L53A 1I3MA 2XZPA 3TZKA 3IBGA 2J9XB 2WHPA 3U31A 1QFXA 3COZA 4OFWA 1G5FA 3HN6A 4KB5A 3UZUA 4ML3A 4W9RA 1P2UA 3HKDA 4DPLA 3FSEA 5DP1A 4FLFA 2AXNA 3ZE6A 3F4KA 2YY6A 3U4MA 2Q07A 1EJ0A 3JYPA 1UKCA 3WDLA 4F71A 5EJ6A 1DPFA 3K8ZA 3WLOA 3WYBA 1A98A 5A04A 3EPRA 2PZFA 2PRKA 1XTTA 4Q4HA 3QF4A 1QZTA 2GCIA 1KVRA 2I1VB 3E5NA 1COZA 1VHJA 4BJ5A 4YP5A 1PBTA 4ZK6A 4GWKA 3G82C 1NVBA 5IULC 1QVZA 3EAFA 4CQLB 1LI4A 5FLKA 2PVPA 1MA0A 1M72A 1TT7A 4B3CA 4DANA 5IS2A 4TN1A 4RHCA 4LFCB 3SXUA 2PR7A 4LDQA 3WMRA 1OVGA 4PM4A 3KOXA 5TVGA 4DZTA 3P94A 1GPAA 2OC4A 2P9HA 3L84A 3OP1A 4A0GA 3PEFA 5A5EA 4G41A 1NYRA 3K31A 4XOUA 4RD0A 5KWSA 4P4SA 3L01A 1HLFA 2CLFB 2Q49A 1HOXA 3GAAA 3R75A 5LLDA 5JPIA 4MGEA 3S44A 3T1VA 2C98A 1TC2A 2BJWA 3IP8A 2DKFA 3ZDYB 1M1XB 1KI1A 1XSEA 3A6KA 3C3JA 4ZOCA 1SKYB 1Y5NA 3WQQA 4KXNA 4OI1A 3LV8A 1SEVA 4C6RA 4K0KB 3T5TA 2ZJAA 2IEIA 1G5QA 3DE5X 4LC9A 2XVZA 3CLTD 2F64A 2V9CA 2F67A 3P0IA 2HEGA 5TC4A 2AG1A 1AKNA 1YJCA 5B37A 5K0NA 4Y9SA 1YQDA 3BD6A 1RYHA 1UC8A 2ONYA 5KVSA 2HYDA 1GKUB 1YI1A 1MTOA 1RC0A 1A5TA 5B57C 2IP4A 4LDNA 4PIMA 3TPCA 4NV0A 1VIVA 2ZRMA 3G88A 1LLCA 1FTQA 1V9CA 4MR7B 4PX2A 5FOXA 3UGKA 1NT4A 3A4YA 3DKKA 2G0TA 1RTTA 3WDKA 4P32A 5KNCD 1XO1A 4RKFA 2V74B 1KAGA 3HO1A 2CXNA 3I2IA 2R7NA 2WE7A 4JLNA 2PL3A 1SBCA 4LHSA 1U3CA 1KQNA 3V5NA 2FFBA 2OESA 2Q27A 3ZQUA 4ZCTA 4Q82A 2UYOA 2V7QD 4MDFA 1PHRA 2C0CA 2ZEJA 3NS7A 3N7AA 1W75A 2Z6AA 3QEOA 4Y2YA 5C4GB 4B2YA 4EBFA 1MORA 4Q4CA 3AHHA 5LR6A 2NZVG 3E82A 1HEYA 3M0EA 1G1MA 4B4VA 2HU2A 2WP8J 4C21A 3BXFA 4TYMA 2REBA 3PKJA 4PF1A 2W8BA 3IAFA 3LKBA 3GYGA 3HKCB 3F1LA 2BEVA 5B5SA 5TQVA 1AKEA 3ONVA 2IOFA 3WLNA 3IEKA 2NACA 1PT8A 4LRSB 2B69A 2OD2A 5K09A 4OMFG 2ZCVA 4HGPA 3SIXA 2D5CA 2FRXA 3E48A 4RO0A 1KEZA 3K9QO 3U0BA 3UENA 2ZCUA 1MXFA 1W5FA 4KPGA 4YAEA 3GAZA 3QUTA 4MUBA 4BS9A 1TZ2A 3K1AA 2O7VA 3JRXA 3U1BA 4Y2TA 1VG0B 2AS0A 3UK0A 1V25A 3UMSA 2V7PA 2WTNA 3GP3A 3WFZA 1AMUA 2QX6A 3HP4A 1K63A 5AK5A 4FEGA 3NONA 3DP7A 1H0HA 1JYEA 2WT9A 3NNDA 5CGZA 3KYCB 1NU6A 3WRVA 1JDBB 3AFGA 3P9RA 3TI7A 3BKXA 4ZZ0A 3QVWA 4CLEA 3EYAA 3F6RA 3SSNA 2JVIA 2OCGA 4IMJB 3UF0A 3BB4A 3X1JA 1BMTA 1X80B 2COKA 5A1JA 2G1AA 4ZCLA 3H5NA 3QKSB 3IAEA 3KXDA 4TMVA 3JPYA 1KKUA 1V5FA 3NBQA 3HWRA 3WK8A 4F6LA 2RJ3A 2BBOA 3R7WA 2I33A 3ZR4B 1JYSA 2REQB 2X6RA 1EDEA 4KFTA 1RZUA 1V3VA 1X0VA 1YS9A 2DJIA 1ML3A 1OT3A 1VJ5A 2J67A 4JEMA 4I8IA 1SZCA 2PUCA 3HPRA 3QXSA 5LVAA 3W04A 2GNPA 3BMOA 1DB3A 1UMCA 4H3VA 3AETA 4WBNA 1FB5A 2Q2NA 4KRYA 2OM2A 5LUBA 4BXOB 2RAUA 3LDGA 4B3DA 1P61B 1XTZA 3GPCA 1RJDA 2WA2A 3HY6A 4JP2A 5ANRB 3BGDA 3WOHA 3UXHA 2A3RA 3UK7A 1YB6A 4BUZA 4XIIA 1TAHA 2NT3A 3DMGA 4P3PA 3UO8B 5CJ2A 4HV4A 3ORYA 2AN3A 4FI3C 5BOSA 4AUKA 4Q47A 2XVXA 2WLTA 3VH4A 2D8AA 4F3YA 1Z15A 2IXTA 4OPMA 4C5AA 4N3NA 1I1QB 1GUZA 3ILYA 4IG4A 2XUDA 1EXNA 3DG9A 4LUCA 4YP9A 1GR0A 4AP9A 5L7TA 1BZYA 3NHPA 1G8PA 1XRMA 1RHMA 2QV0A 4WH0A 1UXGA 4R8SA 1Q74A 1RRVA 3USCS 2GRAA 4AC9A 4MPDA 1SH7A 1YVEI 2GPYA 3HCAA 4R05A 1VRCA 1J0XO 3BSYA 1RHKA 1YL5A 3MBKA 3E0QA 4LC0A 3CUUA 4JLMA 1P5RA 4A0RA 3D8SA 2AVNA 1KJWA 1Z33A 1XU9A 1C30A 2DBYA 3NAQA 4GMKA 2BKEA 1L1EA 1U7TA 2FF5A 4ZALA 2Q62A 4BLSA 3WJ2A 4C7XA 3INYA 2HCTA 3TW0A 1G64A 3WMXA 5DXFA 4HUTA 5M7EA 3GRZA 3CLUD 1J09A 4WCFB 5K3FB 3DLBA 4KGZA 5EJ5A 3BHNA 4DG5A 4L9WA 1WUTA 3OPYA 4BNNA 1IY1A 4BVJA 2XXBA 5CDGA 4HNQA 1EFUA 3IDSA 3ZY4A 2BM0A 5BPHA 1ECBA 3IC5A 2O0JA 5CVCA 5TGZA 4KIJA 4BLUA 2PWYA 2F2TA 5K20A 1TZKA 2DETA 5KEIA 3FB4A 1E5XA 2DHDA 2IF0A 3T7TA 1R0RE 2BBTA 1H23A 5ICCA 3IURA 3WV4A 3EGDB 4WADA 2B30A 5JYEA 2QOEA 4MICA 4F45A 2QQFA 1V26A 2WU4A 2WV9A 4FHEA 5ALHA 3R9XA 1DEHA 3ROMA 3OLQA 1JT2A 1YACA 4CF3A 2DWOA 5DRTA 1B3BA 4MA4A 2JK1A 1CUFA 1DZIA 1WB6A 2VF8A 3DWFA 5REQA 4FTWA 4AY5A 4GKBA 4M1MA 1XAIA 1ESMA 4DV1B 4OQEA 4GPD1 4A26A 3GJRA 1KXJA 1E2HA 4C4AA 4ZI7B 1Y5IA 4K28A 4JI0B 4B0PA 4G0QA 1F2TB 5KYWB 1CB0A 4W8GA 5LQDA 1QVAA 2RH5A 1IEQA 1JHMA 3Q85A 1YQGA 1LX6A 2CLHB 1EFVA 2VNAA 3AL2A 3HYLA 4IDEA 5IM5A 4JBNA 5ES4B 1HPLA 1H3FA 1D2RA 2O7RA 3G85A 2J48A 1KOLA 5KPJA 4PTLA 4EHHA 2NUPB 2QTAA 2I91A 2H59A 3N0WA 3KQKA 3LDHA 2PL5A 3WFIA 4BNDB 4REQB 3NALA 4P8RA 4U8GA 2BCGY 5IVIA 1OE0A 1SBNE 3HKBB 4ZEOA 1DBWA 4K81B 3O84A 4JVMA 3OHSX 1VXRA 3OIDA 5DW3A 2ZSEA 4AWBA 3U09A 4BQNA 3KJEA 4QUJA 1E99A 2O5CA 4K46A 1MVNA 1ODKA 2E9SA 4TQGA 1IMOA 4JLKA 2Z6QA 2B6NA 2MIIA 3AY0A 3FYUA 1M0EA 2CMGA 2B99A 1KBZA 3RUDA 5I8WA 4O0LA 2ASEA 2F17A 3FZNA 3CR7A 3QW4B 1TJPB 3ISTA 5TDHA 2CY0A 1NXSA 2R7AA 1PT9A 5J2TA 4QDTA 3NHWA 2OHFA 2QZSA 3KR1A 1U0SY 1Z5UA 1FFSA 1E2FA 3F46A 3G59A 3MTAA 1X3LA 5BSFA 4REOA 5CK4A 4KXMA 4UHCA 1SC4A 2RD2A 3F1KA 4LC1A 1ZGJA 4OHWA 3QPWA 4B3BA 4TTVA 421PA 5KYUA 1Y1LA 2NZWA 3QPVA 2ZUFA 4GP6A 4CDGA 3ID6C 4TN5A 7YASA 3BXZA 1Z7GA 3T54A 3WFJA 1F7UA 2JD0A 3CE9A 4MQFB 3I6MA 3G68A 2HF2A 4LHZA 4YP7A 3SS9X 6NULA 4XJXA 3ZWOA 3AL3A 1B6GA 2FUKA 2R79A 2YIMA 3HCPA 4OGFA 4MWOA 4DDHA 2O9JA 2WIFA 2YRWA 3BORA 4WN3A 3EA4A 1Y3AA 2ZRGA 3LUCA 4OHMA 3JRNA 4TL8A 3TD6A 5DFAA 3K9GA 1JWAB 3MGBA 3MFYA 4F3RA 2VUUA 1A72A 1KDOA 2A8YA 2AOTB 2OY0A 2ZI7A 3E8SA 3CH7A 3OOWA 5EJMA 3D2CA 3IUEA 2Q5FA 1ISHA 1ZNWA 2IXFA 1YBMA 4D8UA 4I50F 5ADWA 3L6UA 3R7WB 2PZJA 3P2MA 4GC9A 1W0KA 1TTTA 5LMCA 3E70C 2IUTA 2ZVDA 3DBRB 1KYXA 1VC2A 2FOXA 3I42A 4MEBA 3FNEA 4UUOA 3SSMA 4BVGA 2XMCA 2C4VA 5MN4A 1XELA 4XFJA 3CZCA 3D0RA 4O2BF 1XGKA 3SP1A 1E2IA 1RI4A 1P80A 2P0EA 2B4RO 1OXMA 3AIOA 3AK4A 3NX4A 3UW3A 3W8FA 3IUBA 1JKMA 2ETXA 3GYBA 3OTWA 4QE3A 5A9SA 1IWPB 4HB4A 4R84A 4M1EA 4F5YA 4QECA 1Q0RA 1C5KA 3WL3A 4EHDA 4MINA 4A0HA 4YAJA 1FTGA 4B31A 3N1UA 3HI6A 1XMQB 4OQFA 3ROEA 5AKHA 4ZV9A 1NXTA 1O6BA 2PMWB 2QY6A 2FX3A 4Z9FA 4TL6A 2J9FB 4E4RA 3N2ZB 1ISFA 1VSQA 2C00A 3G79A 4RD3A 1VHQA 2G8LA 3QKTA 2CDNA 1TQ4A 1T9KA 1NBAA 4LV8B 1IU9A 3O4FA 4TMFA 2RJOA 1UJNA 2FPPA 1L8QA 2P2CA 5DXAA 5A9TA 4BV3A 1WMFA 2EZTA 2QS9A 4MKXA 1KIAA 1OX6A 2XEDA 3SVTA 3ECSA 1PFVA 1VHTA 1A82A 3AR5A 4PG4A 1QPGA 2XT9A 1JR2A 2CMDA 4MRRA 4MW6A 3NEJA 3U9SA 5AOBA 4TVSA 1WX1A 2YJ6A 3V8VA 4UMVA 1G21A 2C77A 2DT5A 1WIWA 3HK2A 1FJHA 4TRRA 4BWVA 4KK3A 4ZRNA 4HDKA 3VJLA 3UUEA 1C1XA 3X1WA 2WOOA 1C9NA 1FNMA 4KL8S 3GG2A 2ZJ3A 3UICA 2QTVB 4KLZA 4UM8B 1S4QA 3GP5A 4WVFA 3ZG6A 4FLMA 3PNBA 1XTUA 3FWPA 3K2QA 5KTYA 3HJTA 1Z5WA 4X61A 2JFBA 4MPRA 3OE7A 3P9CA 4YJFB 2GBLC 4QOIA 3V2HA 4HVLA 1O7JA 3RQSA 4RZXA 1SC3A 4NG4A 5ADUS 3PGJA 5LB2A 5ESXA 4GRIA 4V0QA 4ENTA 1QC5B 4ZOLB 1SQGA 2Y71A 3D1JA 4A6PA 2ZVJA 3QM1A 1OAKA 1FJXA 2DY1A 1IOZA 2ZYDA 1J99A 3INRA 4RS3A 3PKZA 4K9PA 3PPYA 4N3AA 2WIKA 1Z39A 1SOAA 3IMEA 2FZWA 3AVTA 5GZ6A 2PT6A 2CFSA 4OM7A 1E0SA 2VXOA 4PFSA 3ZLTA 4A0SA 4EAQA 5B4TA 1D6MA 3OFSA 1U63A 4R9SA 2Y8EA 1W4BA 1Y4SA 1ZGBA 2YJNA 5C7OO 5K9ZA 1YNOA 3F73A 3DVRX 2YBEA 1ZSNA 3X1ZA 5AJHA 1BGWA 2MJLA 2R4TA 3ZWDA 4BKMA 5KREA 1W87A 4J0GA 1AS0A 1TIPA 2BHNA 1E79A 3SI7A 2Q2WA 4MWGA 5ILQA 1Y82A 5JS6A 5L6MB 1E2QA 3K70C 4K2HA 4LJ4A 4N12A 1ZIPA 2E5LB 4J94A 2ILTA 1RLTA 3TLKA 4AQ7A 1FFCA 4A73A 2I99A 1EX7A 2R8RA 4H7FA 1MAAA 4NECA 3W06A 3ZU4A 1Z2OX 2DQSA 4Z7QB 3L9XA 3G8DA 4PLVA 4G81A 1J22A 3F98A 4RVCA 2DWPA 1XXHB 4WEQA 5ALZA 5HP4A 2I3ZA 2QTWB 1KJNA 4O4IA 5KX5F 4J9UE 4OTZA 1D8AA 2EL9A 4L27A 2CJWA 2I67A 4HQRA 4P31A 1Y1KE 2C3OA 3PE6A 3I9OA 3LBYA 4D45A 5KC9A 1P91A 4RELA 3MWGA 3UAOA 3GRUA 4WZBB 1P33A 1C3XA 1DRKA 5CCDA 3JCZA 3VHRA 1G8JA 2J0UB 1JG3A 4FYJA 2AN4A 1O97C