1SEPA

Mouse sepiapterin reductase complexed with nadp and sepiapterin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
259
Chain Sequence
ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords SEPIAPTERIN REDUCTASE
total genus 95
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1997-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sepA00
2E49A 2Y66A 1ZZEA 4HNGA 1GPJA 3FWNA 3CZRA 3KTDA 3D5TA 4CM4A 1DPGA 2DLDA 3I5MA 3E48A 4W9NC 3RC9A 3WGHA 5EN4A 1ZJZA 3WDSA 3Q2IA 2AG8A 1PL6A 2ZB3A 2D8AA 4R1SA 3FWZA 4RZIA 3DDNA 1ZXBA 4FR5A 5BNFA 4YJHB 3AU8A 3PYLA 4YJHA 4TSKA 4CMGA 3C85A 3WYCA 1UUFA 3AJRA 1NQAO 3E9QA 4EGFA 3DFZA 4Z0PA 5I7SA 1YXMA 2DC1A 1E3LA 4XJSA 4KOAA 3KUXA 2G0TA 3CEAA 4CMKA 4ESOA 2C5EA 3AU9A 1SZJG 4I8XA 4AJ1A 1P0FA 1JAXA 2QZ9A 2VUSA 4ND3A 4BKOA 5K6AC 2QRKA 4Q3NA 4A0SA 3PWZA 3H5NA 2J6IA 4GAEA 3RC7A 1WW8A 1YBVA 1X14A 3GY0A 1LLDA 3ZV4A 3V1TC 2J3HA 3SLGA 1G1AA 4L4SA 3H9EO 4KWHA 2BF7A 4D42A 4YEDA 3PHJA 3HADA 3ETGA 1SMKA 5T64A 2YDYA 4OM8A 4FJ2A 4D44A 2QQ5A 5HWSA 2VYVD 2AEMA 2X9VA 4B7UA 4CMHA 1R16A 4YRBA 4Z6KA 4JXKA 4BKQA 4FS3A 2I3AA 1K0UA 1B3BA 3NT5A 4QECA 3GRKA 2F00A 4IBOA 1JQBA 3DOOA 1MFPA 1RWBA 5IDYA 5IDXA 2PTGA 2ZKLA 1EE9A 4JCOA 2PA3A 4D7AA 1V3UA 4AJJA 1DB3A 1QYCA 1GV1A 2C59A 5JDIA 2BFAA 4B4OA 1LNQA 2VRCA 4L4RA 3TZCA 4CM6A 1ZKMA 4YA6A 3V2GA 1VSVA 1AHHA 2X5KO 4YT8A 4GKBA 4D0SA 1I3LA 3WXBA 3E9MA 4YJGB 1EUDA 2P9EA 3ETDA 1ZFNA 3VTFA 3GN2A 2E48A 4DVJA 3U5TA 2XOXA 2PD4A 1UDCA 4LCEA 4ZA2A 3FNEA 1NNUA 2BKAA 1F8FA 4ND4A 1NHWA 1V0JA 4UVIA 4XKJA 1WVGA 2QHXA 4UEOA 4YT4A 3WLFA 5MGBA 3PWSA 4IINA 5I9LA 4L73A 2C0CA 1F06A 3AUAA 2A35A 1PU2A 5C7OO 3F9IA 4ZQEA 2OL4A 1T2CA 1IUKA 1K6JA 3LF2A 5JMPA 4JX8A 1CIVA 1CYDA 3RU7A 1HDYA 4RVGA 3CUKA 2E82A 4YBZA 2J5RA 1LC3A 1U7TA 5A1TA 2FN7A 1LDEA 4RJTA 4GMGA 2XPCA 5EERA 4MP6A 1NBOA 2H63A 1CQIA 1P0CA 2OP0A 2O2SA 3WX0A 3NAQA 5KJ1A 5IZ4A 1U1IA 3L4BC 2HLPA 3V2HA 2VT3A 1WAMA 5CEEA 1ZK2A 4XR4A 2IDZA 2EXXA 4B7XA 3GUCA 5CG2A 3AY3A 1TT5B 1I24A 3QHAA 1HE3A 1PGOA 4WNIA 2NU7A 2Z95A 3IUPA 3T4EA 4AG3A 3MJVA 2J8ZA 4JJFA 1BMDA 4A27A 2I66A 3B70A 3JQBA 1DIRA 4J3FA 5JDIC 4ALKA 5KJFA 3DWFA 4ZVVA 3GVXA 1GAEO 1XU7A 3RD5A 4Q3CA 4DBZA 3WYBA 1PWZA 5F5NA 3GVIA 3HDJA 3K6JA 4BV9A 1ISJA 1PZHA 3QSGA 4EYEA 1GV0A 3L6EA 2OP1A 3QIVA 4WK6A 1H2BA 3BZUA 3V2UA 2CMDA 3JYPA 5L3ZA 4D3FA 3F6YA 4BNWA 1I36A 3KZVA 3UUWA 5JO0A 1NWCA 2XXBA 3LYLA 4CLDA 4EEZA 2Q2VA 3DL2A 5KKAA 3H3JA 2DKNA 4RF5A 4BNGA 4BO1A 5TJHA 3NEPX 4G65A 4CR7A 3UF0A 1QYWA 1YQGA 2B0JA 3G49A 3WTBA 5JDCA 1DRVA 4C7JA 3ZNQA 1R0KA 3GLQA 1ZVMA 2GZ3A 3LF1A 2ZJ1A 1GPDG 4Y8VA 4YDRA 4D45A 4E4YA 4N5MA 1U2DA 4BGEA 4IJWA 4CMIB 3RJ9A 2PK3A 1DAPA 3JQ7B 4KMSA 3KHUA 1E1NA 1YDEA 3HN2A 3OEYA 4E0BA 5B12A 1A9YA 1YL7A 3CINA 5JLAA 3G1UA 1LSOA 3RUDA 4DL9A 2ZTLA 3GGOA 4BO3A 4Q9NA 1JVBA 4H16A 1XDWA 1KERA 4KTTE 4TZTA 1Y5RA 3DTTA 3ON5A 1XYGA 2O3RA 5T5QA 3I4FA 1XQ1A 2AQHA 1S7CA 5JC8A 1BDMA 3OJLA 3RFTA 1WP4A 4UUPA 4K6FA 1HTBA 5KOIA 3ZWOA 2EJVA 3BMCA 4HKTA 4N5NA 3RUHA 4BB5A 4NI5A 1KEWA 3OP4A 3PTZA 5JY6A 4RO0A 4TROA 3QWIA 4XB2A 4R69A 4I5GA 3GZ4A 2EKQA 2JAPA 3MTJA 4OGWA 3I6IA 5C37A 1AN9A 2O7QA 3VOSA 3W4IA 3ZV3A 1R0SA 2GN4A 4URFA 3H7AA 4A10A 1EK5A 2EP5A 1YRLA 2FMUA 2YHUA 3H3FA 4O59O 1UZNA 1GTMA 2BD0A 4BNKA 5F3RA 1ZXLA 2B35A 3W1VA 4ZQHA 5KVVA 3LU1A 4W7IA 4CV3A 3S55A 4WUVA 4YAJA 3F4LA 1T2FA 2WYVA 1MA0A 2ZTUA 3JYQA 2A94A 4R5HA 4F3YA 2J5QA 6LDHA 1SPXA 5JE8A 4FFOA 1WWKA 1RM0A 3L0DA 3WFIA 2W98A 1HSOA 4GX2A 4IPTA 4YJFA 1U3WA 1AHIA 2HU2A 1H93A 3DAPA 3C7DB 2EJWA 4W82A 4TRMA 2OZPA 3C24A 5LC1A 1VSUA 1NXQA 4J1TA 1LC0A 4EI2A 1NTOA 3ZCXA 5I8WA 4H15A 4C4OA 1U8XX 4YCAA 1Q1NA 3H5RA 5TIIA 1GZ6A 3OQ1A 1ADGA 1YQXA 4WLNA 2E6UX 5CDYA 1V35A 4PFJA 1FDUA 2HMVA 3ONFA 5I7FA 2GCGA 4RORA 1DC4A 4DQUA 1K2WA 4GI2A 2QG4A 5IG2A 4PLCA 2GERA 1KBZA 1G6KA 5COAA 1NQ5A 1PS8A 2HKIA 3MOIA 4E3ZA 4K26A 4JBHA 4ALLA 1Z6ZA 4MVJF 1GCOA 1PS9A 3K9QO 4E30A 2VCYA 2P2SA 2HMTA 1CDOA 4XJTA 3TWOA 3U4IA 4E2YA 1GYQA 5DBFA 2UAGA 1P1IA 2Y1DA 4O1MA 1IHXA 2EW2A 2DU8A 1QP8A 2FPPA 3IKVA 4CM7A 3QWBA 3GAZA 3I4CA 4EDFA 3WNVA 3K2BA 2EGHA 1C14A 5L4LA 4WLFA 1M75A 1W4ZA 4IGEA 3RSHA 1D3AA 4BNZA 3PQFA 3QE3A 4MOWA 5C5IA 1I8TA 1B3RA 4I9NA 1WDMA 2X8LA 1ZUD1 2Y67A 3FTNA 2CDAA 1K6XA 4ALIA 3DXFA 3OH8A 4E5PA 1EBUA 2VYND 1UZLA 1ORRA 4IJKA 1H6CA 2C7VA 2HSDA 2O4CA 4GGOA 1TI7A 5IDWA 5KTKA 2WJPA 4WEQA 1Q7BA 2I9PA 2NADA 2X58A 4CUKA 4DXHA 4CMJA 4QT0A 3GHHA 1OBFO 1P1KA 2C82A 3O38A 5T57A 2ZYGA 4ZQFA 1T1RA 4WOJA 2JHFA 5HA5A 3KRTA 3N74A 5TLSA 1JWBB 1PJLA 2H1SA 4RQUA 2V6MA 2YV2A 1U3TA 4C7KA 3IJPA 3JD1A 1O0SA 3OIFA 3VVCA 3ENKA 4B3IA 4E2ZA 4S1VA 4ZGWA 4BVAA 1W8DA 3O4RA 4LGVA 1QLHA 1YONA 5CFZA 1ONPA 4FFLA 3DO5A 4RQTA 5I8ZA 1WDLA 1Y81A 4B4VA 4G81A 4TVBA 1E92A 1E7YA 3UVEA 4BNFA 4CV2A 1N7HA 4J7CA 4EW6A 3V5NA 3MJEA 4WLEA 3VZQA 2ZIZA 3RUCA 2PKQO 1IPFA 2WTBA 2Y1OA 3FNGA 4R3NA 2WDZA 4R9RA 3D4PA 3HJAA 2X9NA 1YOVA 4MVJP 1CF2O 3NRCA 3S2FA 5TT0A 1P1HA 3MCVA 3CE6A 3TOXA 5EQFA 2Y1EA 4YJGA 2Y1FA 4OHUA 3NDIA 4RDIA 2J3IA 2AXQA 4DIBA 2VRBA 5CEJA 1SCUA 3WIEA 3ASUA 2P9CA 5G0WA 1RM3A 4YAEA 2BFPA 4E5YA 1NQOA 5TNXA 4HP8A 4D79A 3FNHA 2BLLA 3I23A 2G5CA 5BNTA 3UKOA 1YKFA 4ZICA 1UP4A 1EE2A 3OQ6A 3DZJA 1TT5A 3VPGA 3GFBA 1IZ9A 4HFNA 2B83A 2EEZA 4AL4A 3OETA 1VM6A 4GGPA 3RU9A 1KVRA 1LEHA 3TL2A 1VRWA 4J2OA 4BNVA 3P19A 1YWGO 1DRWA 2JJYA 3H65A 4U6QA 2FRDA 2O48X 3AW9A 3D1LA 3CZMA 3DOJA 4MJLA 1HETA 3GGPA 3DZGA 4OOEA 4JJIA 2HK7A 4I9HA 4PLWA 2C29D 1VL6A 2NVUB 1HKUA 3F47A 5JYDA 5L51A 1HDZA 4U6SA 4GX5A 3WWZA 1O8CA 4B8WA 1NX6A 4BO0A 3VC7A 3WBFA 3NYWA 2IXAA 3DTYA 3C1AA 2UV8A 1BVRA 3UW3A 1B8PA 4JBGA 1YB5A 5F1OA 3ZWWA 5HBRA 4CM9A 3JQ7A 4NFYA 3U3XA 3WBBA 1DOHA 1QG6A 5A5FA 5EJ2A 1NFRA 1A4UA 2IRWA 1GADO 1HXHA 4EITA 4CM8B 5HM8A 5A3JA 3PI7A 3ADPA 2DUWA 3WJAA 4ZN6A 4DA9A 1EDOA 2PKQP 4XGNA 2FZWA 4YJFB 5A9SA 5COQA 3UFXA 4KZPA 2EG9A 1HRDA 3DAGA 5THKA 1WMAA 2JCYA 1Q0HA 4N54A 4DPLA 3KETA 4RZHA 5F5LA 5G0TA 3DZIA 1F12A 3BMNB 4J6FA 1O6ZA 3RKUA 4I5DA 2E37A 4AVYA 4MKZA 4PN3A 1LUAA 3W4JA 2FR8A 3ETEA 4JIGA 4NQZA 3Q9UA 1FDVA 4XQEA 3T7EA 3OJ0A 3VPXA 2VUUA 3E5RA 3MJCA 3ZWYA 1HWYA 1MB4A 2NTVA 1JW9B 4LSMA 4J0FA 5L7WA 4XCVA 1EDZA 1SB8A 3OF2A 4L4XA 4FGWA 3FBTA 1ZW1A 2I67A 3OJEA 2GYYA 1PGQA 1EFKA 5A04A 9LDTA 1P1FA 3RJ5A 5JNLA 4WASA 3ZWAA 3RFXA 3EVNA 1PJCA 3DBRA 3WGOA 1N8KA 6ADHA 1HYHA 3ABIA 1PEDA 2PV7A 4HX5A 1NFFA 3RUAA 4M1QA 1BW9B 2DPGA 2O3QA 3D64A 3GDOA 3HHPA 4INAA 3WGYA 3ZNPA 1YL5A 1YQDA 4CLEA 5EQDA 4GLOA 3OICA 2C2YA 5KWEA 5CG1A 2DFVA 1F17A 2CVOA 5EINA 4CQLB 3TZQA 3W8EA 5L7TA 1O9BA 2YHIB 5IN4A 1C1XB 4E2XA 1NHGA 5GY7A 1TEHA 3ZI0A 2VYVA 1HDOA 4IUYA 4KDFA 1DIAA 3G0OA 4J43A 5KKCA 3KSUA 4BO4A 4NNJA 3RWBA 4NK4A 1X1EA 2IEDA 1SB9A 5CDTA 1DJQA 4CLRB 5EIOA 2YJZA 3DHYA 4ALNA 2OGUA 3HB4X 1PZGA 5JCJA 1E77A 2GR9A 4G5HA 3GAFA 1OMOA 1JTVA 3COSA 3BTVA 4JNKA 3GHYA 5G2OA 1LLQA 4MIEA 4M89A 1Y5MA 1K89A 5CP8A 1AE1A 2PD3A 5T6BA 2W2KA 1EUCA 4NPCA 2HK9A 4PVCA 1OC4A 1BG6A 3BMOB 1R37A 2EHDA 5B4TA 1T1SA 1NQTA 1XU9A 5A05A 2X0JA 1LLCA 4NFHA 2VZ9A 4FQ8A 2PGDA 5JAMA 3K96A 1TLTA 2VTDA 3WQQA 1ZEMA 3O03A 1PTJA 2P5YA 4EJMA 1IYZA 2HRBA 5ENDA 1U9JA 1D4FA 2PZJA 2HDHA 3PGXA 1A7KA 2C07A 3LC2O 4P38A 3RVDA 1QR6A 3VPSA 3CSDA 5IF3A 2P91A 3GEDA 2QZZA 1YJQA 3TL3A 3OJOA 2X9GA 3ZU3A 1KVUA 2OFPA 1DO8A 3EMKA 5AXBA 3EUWA 3IIEA 5AYVA 4AJNA 4BO2A 3N58A 3PJDA 5ICSA 4XRRA 3QVXA 1TT7A 2FR0A 3NX4A 3VZSA 5I9NA 3JQGA 1HT0A 4XZ3A 3JYLA 3PJGA 1HYGA 1P9LA 2RH4A 3F1KA 1B8VA 1LDGA 4WGGA 4S3MA 3PHLA 4CR8A 5IN5A 3P2OA 1NAIA 2EP7A 3FD8A 1DXYA 2ZYDA 5IAAA 3JQFA 4JJGA 3WSWA 1OOEA 5BNIA 1I3KA 2PFGA 4GL4A 1IOLA 2O3UA 3NUGA 3INTA 3K8ZA 4XYMA 5TX7A 3ZW8A 3EY4A 3FI9A 1C1XA 1DHRA 2CD9A 2AE2A 3BHJA 3INGA 4PZCA 2VTEA 3ITKA 1Y8QA 5FFFA 5JCXA 1TA4A 4XYEA 4ZRMA 3R0IA 4FOSA 4FJ1A 4BS9A 4DGSA 4BOYA 1QSGA 1YO6A 3ZU4A 1D8AA 4AJEA 4WEOA 5JFOA 1F8GA 1DEHA 1PR9A 4HNHA 4Z0TA 5AVOA 5IDQA 1T26A 2YDXA 3FN4A 4Q3BA 2POQX 1ZH8A 4KUEA 1EQUA 3LT0A 1KOLA 1W0CA 3E18A 3AI3A 3ZU5A 4HV4A 1MXFA 1BDBA 4BGUA 2C2XA 4O6VA 1IZ0A 4RPHA 1YE3A 3AOEA 1W73A 3MWDB 3Q0EA 2CZCA 1H94A 2PGJA 3D7LA 4JP3A 4LMRA 4CMBA 2FZEA 1K3TA 4HADA 3DEYX 4RPJA 2VWQA 3IS3A 1H0KA 1LDYA 1M6WA 3RUIA 4DC0A 4I5FA 3TPCA 4FJ0A 4CLXA 1O95A 1BXKA 1U3VA 2HAEA 3A14A 5DP2A 1S6YA 3BMQA 4IXTA 1ENYA 3QP9A 3S1LA 4CQMD 5DCWA 1AGNA 5L7YA 4YB8A 3WYEA 4ONEA 4RL6A 1E3WA 4XB1A 5JW6A 1Z74A 4IQGA 1X7GA 3GEMA 3ST7A 4MVJI 1N5DA 1I2BA 4QSMA 4RPKA 1UXKA 2Y0DA 1UP7A 4XGKA 2YFQA 5TQVA 3RC2A 1PJTA 2JKVA 2A92A 4CM5A 1H9AA 1FXSA 1PX0A 4OJNA 4O63O 2OXIA 1Z45A 1P3DA 3LT4A 3PIDA 4R1NA 4OH1A 1HLDA 3GQVA 2EV9A 3BA1A 3JQ8A 3ZNNA 3PZBA 1ADCA 3LK7A 4HWKA 5DCUA 4BNNA 5CDGA 2DTDA 2BFMA 1I3MA 5F1PA 1H6DA 3S2GA 1DBVO 1DDOA 2DT5A 4DRYA 5MDHA 3BTUA 4IDCA 2EKPA 3SC4A 1J49A 1U28A 3FCOA 3PXXA 1LSUA 5F21A 1J6UA 2FR1A 1Q0LA 1XIVA 5JBIA 3KLMX 4LVCA 4BNXA 1Z75A 1H9BA 1DFIA 4OAQA 1U7HA 5JXWA 4WLVA 3LC7O 2ZCUA 1CJCA 2AMFA 3RIHA 2GN6A 1Y8QB 1HDXA 3E82A 4RVSA 2NLOA 3DHNA 3F5SA 3GT0A 1UH5A 3LDHA 1F14A 1BHSA 1E7SA 2CSUA 3UXYA 1HZJA 3DZBA 1DC6A 1T2AA 4YVFA 4B79A 2X86A 4ILKA 1LQTA 4DBVO 3WTCA 2H6EA 1QXSA 2PH3A 3QWFA 3ONDA 3W6UA 3C8MA 1A5ZA 1PIWA 3EZYA 3RKRA 3B1KA 3L9WA 5TSDA 4YAIA 1EVIA 1E7MA 3INRA 3OSUA 3OJFA 3UCEA 3X2FA 1AUPA 2GDZA 4N18A 1VJ1A 1LXCA 1VJ0A 3BAZA 2D5CA 5J23A 3NDRA 1KC1A 4Z9XA 3FR7A 3QJ5A 2VNAA 5JMWA 3SXPA 4CL3A 1WDKA 5AXCA 1LTHR 3LLSA 4BNUA 2NTNA 4Z3DA 1C3VA 2IODA 3IP3A 3UCFA 3GFGA 4YRDA 3TF5A 3QRWA 4OKNA 3TZKA 3GDGA 3L6DA 1F0YA 1KEPA 1LSSA 1WXDA 2HCTA 1GD1O 4QX6A 1PJBA 3VH2A 1I0ZA 4CQLA 1E1LA 4BNLA 3I9KA 4DIFA 1WPQA 3H9JA 4ITUA 4QFCA 1ADBA 1ISIA 2OMEA 4DUPA 2QIOA 4J0EA 4NIMA 4FW8A 4YACA 2B69A 3WOHA 3ZWMA 4UUNA 4Y6RA 1OZAA 3SBOA 4D0RA 3BIOA 1P1JA 2I3GA 3QWAA 4JROA 2P68A 2GN9A 2NQTA 4RPLA 4IS3A 4BGVA 1YS4A 4R1TA 2TMGA 3HUDA 4BNJA 2DPHA 4BMSA 4FIZA 3GN1A 1JN0A 2QYTA 4E2WA 4R4JA 3LT1A 3DR3A 2D4AA 2G1UA 3ANNA 4NJMA 5G4LA 1E5LA 4ALJA 4AJPA 5HS4A 4MINA 3ZWVA 4R5MA 1R66A 3DBHB 1UDBA 1NR1A 3GNQA 2B4TO 4FFNA 4TKMA 1GL3A 1HE2A 1UP6A 4CV0A 4IQ8A 4BO9A 3CKYA 4KDEA 4P4LA 4PLZA 2PNFA 3F5QA 3STHA 3WQSB 3BTOA 1QV6A 2RBEA 2Q49A 3PLNA 1LX6A 2D59A 4L9RA 4D3SA 1YBAA 4EJ6A 2DBQA 2CF6A 4UUMA 4A26A 4BKUA 1E7QA 2IZ1A 1GDHA 2IZ0A 3I9JA 4K28A 3OMLA 4QEDA 2PZMA 2X1HA 2Y0EA 1GYRA 3V8BA 1IE3A 1RYDA 3D3WB 2JD1A 2VRCD 1I5RA 4J9UE 5K0ZA 1J5PA 3WSVA 3HQ4O 4CMAA 4Z3KA 3B1JA 3Q1LA 2GGSA 1XA0A 3WB9A 3DZHA 3AUSA 4CM8A 3KSDO 5KNLA 2QRJA 4DPMA 2I5PO 2YZ7A 1VPDA 2PWZA 3KV3O 3PP8A 4MP8A 4E5KA 4D43A 2B4QA 1X15A 1Y8RA 5IFLA 2C5AA 1PR3A 5L4NA 2YQ4A 3H9GA 3ROQA 1NPTO 1ISMA 3CXRA 3CIFA 3KYCA 4CLHA 1HDCA 4XIYA 4J1QA 1B2LA 2GN8A 3JD0A 4IZIA 2HRZA 3TZ6A 3ZH2A 2VHZA 4M55A 1DIGA 4FSHA 3VTZA 2G76A 3K30A 2YYYA 2FP4A 1XEAA 1L7DA 2CDBA 3PFWO 3VH1A 3JQ8B 2ILTA 4II3A 3WGGA 1HL3A 4GBJA 3H9UA 4M8SA 5AXDA 1KY5A 1Q2XA 5CAEA 4MIYA 2JHGA 3H2ZA 3SX2A 1T2DA 1M76A 2AHRA 3A06A 4GMFA 5ILOA 3JQCA 1N9GA 1WZIA 4UUOA 2Y05A 1KVTA 3OIGA 1VKNA 4RVDA 3C7CB 4WNCA 4DLLA 1XELA 3RAJA 4HFMA 3IJRA 5CHEA 3IOYA 4EZBA 2C54A 4I9UA 2JCVA 4NBRA 3ROPA 2CNBA 4XQGA 2UUOA 4DLBA 1GEEA 1PJQA 3AM5A 2RH8A 4NR0A 2XAAA 3HSKA 4YPOA 2OHXA 4QO8A 1QMGA 3QVTA 2V6FA 3JD3A 3Q11A 2CVQA 2W8ZA 1WZEA 3D3WA 3L4BA 1ENOA 1DIBA 4J91A 1ULUA 4ZD6A 1E0DA 3LZ6A 1MFZA 3JV7A 4H7PA 4E12A 3C7AA 1IY8A 4HUJA 4NBWA 2HUNA 2Q2WA 4GLLA 4K1LA 4I5EA 1XLTA 4AJKA 2D1YA 5KVSA 1AXEA 5DN9A 4U0KA 5TJ9A 2J3KA 1DSSG 3FRJA 1ENPA 3GG9A 4R9SA 2X4GA 3JQ9C 4JN6B 3RFVA 4U0JA 1KS9A 4BO6A 3EGOA 4DQVA 1SAYA 1KYQA 3JYOA 4QO7A 3WS7A 5JO9A 4BNIA 4B3HA 1TVEA 1QYDA 3BMQB 4WCDA 1U3UA 5DT9A 5DULA 1BSVA 1C0IA 2EF1A 1GZ3A 3B20A 5JAQA 4YYZA 2P4QA 2Y0CA 1R4MA 5DOZA 5FYDA 4PG7A 4E33A 1E6UA 4YR9A 2BELA 3JQ6A 4FGSA 3GMSA 3PIIA 2VWGA 3DMTA 4PRLA 4TWRA 2JAHA 4CLRA 2P9GA 1VE9A 4ROSA 5BSFA 4DC1A 4D46A 1XGKA 1LBEA 2ZYAA 1GQQA 1YBMA 3RBZA 2Q50A 4BO8A 1LRJA 4Z9FA 1VL0A 1L1FA 3TNLA 3ONEA 1MG0A 2AE1A 3RASA 1PQPA 2GF2A 1X7DA 3QLJA 5I7EA 4FC6A 2NV6A 1SC6A 1GUYA 4IJUA 1N2SA 5DZSA 1LRLA 1T4BA 2VHVA 3E9NA 1CERA 4E31A 1HDGO 1UXHA 3HDYA 4OMUA 4LSWA 2Q4EA 3ZWXA 3E03A 2VN8A 4LRSB 5H83A 3SC6A 4XDZA 4IGFA 3FTPA 2OO5A 2X6TA 1Y7TA 5DDIP 3I52A 3VH4A 1RKXA 1Y9AA 3RI3A 4CM1A 4E6PA 4UREA 2YW9A 5U1PA 1M66A 4XWYA 3EDMA 2P4HX 4UVHA 2OBYA 4IDGA 1EFLA 2RAFA 3HB5X 1EBFA 1B7GO 1Y1PA 5U9CA 1EEHA 2HQ1A 4W9NA 4XQCA 4GKVA 4CMEA 4LRTB 4EUHA 3OFSA 1RYEA 5K6AA 4WECA 4FN4A 1A4IA 2AG5A 4FD3A 2X0NA 5TT1A 2ZQYA 1QORA 1C0LA 5JSFA 4BO7A 1E3WB 2YV1A 2V6GA 4IIUA 2XF8A 4W4TA 4UVEA 3W8FA 1EQ2A 1MXHA 2LDBA 3GRPA 4RVUA 3FF4A 2Q1SA 2D0IA 2IYPA 3C3XA 3ZHBA 2AW5A 4NBVA 4OXNA 4RGBA 1MX3A 2BH9A 2WD7B 4Y98A 2BI8A 3NT4A 3PWKA 1JA9A 3GVHA 1ZK3A 1NWHA 2HMUA 3D0OA 1LSJA 2Q1WA 3K31A 4RF2A 5CDUA 1R4NA 1GQ2A 4E5NA 3DC2A 3IMFA 3CH6A 3B6ZA 3PEFA 2ZB4A 4QQRA 5FEUA 1ADFA 2VT2A 2NNLD 5GMOA 3OBBA 3AUTA 2V65A 1X1TA 3EYWA 1YDWA 3E8XA 2AA3A 1CRWG 3P2YA 5DBIA 1JVSA 3HG7A 5HTOA 2GASA 3OM9A 1P45A 1I2ZA 3K73O 3DBLB 4KWIA 1IPEA 4HXYA 4M86A 5THQA 4TRJA 1YOVB 1JDJA 1OFGA 1ONOA 2B4RO 2LDXA 2JD2A 2ZQZA 4LVUA 5G0UA 4IJVA 4CMCA 5L4SA 3DFUA 3JQ9A 3RQSA 4B8ZA 5GZ3A 1IHYA 3WGIA 4ND1A 1BXGA 4H3VA 3AI1A 1HLPA 2VWPA 1DLJA 1O89A 4HBGA 2UDPA 5BSEA 4YT5A 2Z1NA 5HS6A 3WGZA 3VH3A 3GNSA 3I9NA 1NASA 1P33A 4LMPA 5IXSA 4ZJUA 1SEPA 3PQDA 4MKXA 3K5PA 1JWAB 4DMLA 2WE7A 4IY1A 1E7RA 3MOGA 3ZN2A 4EUFA 2YV3A 3ZWCA 3PZRA 3JQAD 4PRKA 1PJ3A 2I76A 1T2EA 2V6BA 3D4OA 3UGKA 1ENZA 1H2HA 1R12A 2BRUA 3BYZA 1KEUA 1UZMA 2O3TA 4IMRA 4L0QA 3IL2A 1P74A 3GZNB 4UEJA 2Q99A 4Q3AA 5ER6A 5BT9A 3FNFA 3L4SO 1MLDA 3GH3A 2Y93A 1X13A 2GD1O 1C0KA 4TKLA 1DRUA 2OORA 1JKFA 3PRJA 4R16A 5TF4A 2PZKA 1ZK1A 8ADHA 3JQEA 5A4DA 4A5OA 4F6CA 1B8UA 2YUTA 3MJTA 4GX0A 1ZO8A 3AWDA 3PHIA 3ORFA 1I3NA 1OI7A 3BHMA 3R3SA 1O94A 2JFGA 1NFQA 2H5LA 4MVJA 5G4KB 4BGIA 3ULKA 2Q1TA 2PR2A 2X22A 3IC5A 3P5SA 1ZCJA 2ZTMA 4II2A 4Y9DA 4MKRA 4RVFA 2X5JO 4ALMA 3HFGA 2ZB8A 1YB1A 2ZTVA 5ER9A 3KO8A 1IB6A 4PZDA 2VHXA 4PCVA 1N1GA 3ZHYA 4F46A 4ZQBA 3SJUA 4M54A 2OBNA 1YGYA 2ZK7A 4FBGA 4GH5A 4N7RA 4Q39A 3UOGA 1R15A 1W6UA 3WG9A 9LDBA 2I65A 1KC3A 1ML3A 2UUPA 3JQBC 1LQUA 4M87A 2ZATA 4GQAA 3W4KA 3M6IA 3MEQA 1T25A 1T24A 5A9RA 1NP3A 2DTEA 3DMTC 2B37A 1FJHA 5FI3A 1P1RA 3X2EA 4UEKA 1GY8A 3KB6A 3GEGA 4DIOA 4R68A 1MC4A 4YAGA 2GPTA 3F46A 1PSDA 2A9FA 4I08A 5LCXA 4IDAA 4HFRA 3MTGA 1D7OA 5COBA 4HY3A 3AOEC 3WQRA 4DMMA 2UVDA 4UVDA 3WFJA 1V8BA 3ASVA 4OQZA 2VYNA 4FFMA 2GO1A 3AY6A 3OEWA 4MPDA 3NGLA 1SOVA 1LDMA 4ND2A 3D4NA 4DLAA 3ZWPA 2VHWA 2JD0A 3Q9NA 4AJ4A 4PLTA 1PL7A 1QLJA 2C20A 2VOJA 1E6WA 4TZKA 1BXZA 4FOOA 3EZLA 3W8DA 5KCZA 1PJSA 3D5QA 2R2GA 4R51A 3QVSA 1U2GA 4GVLA 3ZW9A 2GSDA 4UAGA 2VOEA 1DC3A 3M2TA 3PLRA 4EUEA 3JQDA 3ZU2A 4GPD1 3WR5A 3ICPA 5CEFA 4DYVA 8LDHA 2PY6A 2QRLA 4JLWA 3ANLA 5C7IO 1CWUA 2Q2QA 4Y67A 4P8RA 3ROKA 3NJ4A 2NWQA 1KY4A 1E1MA 3O26A 4GSLA 3S8MA 3ZNOA 4YT2A 4D3DA 4J1NA 4MVJE 3PJEA 3U49A 2X0RA 4BMVA 2IZZA 5JY1A 3KLPX 3TSCA 4W99A 4NBTA 4AICA 1D1TA 1PQWA 4L8VA 2RHCA 1DFHA 2NVWA 4CM9D 4QTZA 4DQXA 2A4KA 2NTJA 4JGBA 3VPFA 4AJOA 5JYEA 1MG5A 1ISFA 1E3IA 3CPSA 4X54A 3KOUA 5F1KA 2DM6A 5ADHA 1UDAA 4NG5A 3PK0A 1H6BA 1I32A 1GCUA 1YVEI 4JBIA 4WLUA 5KJCA 1B16A 1GUZA 1N9GB 2J5KA 1NVMB 1U5AA 3E6AA 2O23A 5H82A 1E6EA 5B4UA 2G17A 2BGLA 3DMYA 4J9VA 1HZZA 1LDNA 4WCFC 5CDSA 4R41A 1Z82A 1N7GA 5AOVA 3DBRB 3RUFA 5JCJD 4FDAA 2CF5A 4L74A 4PLGA 4RPGA 1XKQA 2JL1A 3DB2A 5DOVA 3GG2A 5JAZA 3H4VA 1HEUA 1I30A 4EBFA 1GU7A 2Z1MA 3WMWA 3AM3A 5KJEA 4CUZA 2HMWA 2NVUA 4AJIA 4BO5A 2IEBA 3PJFA 1ZNQO 1T4DA 3CMCO 4KQWA 3AM4A 3I6QA 3ENNA 1GEGA 4BNMA 5ITWA 3ADOA 3FHLA 3SLKA 1EVYA 4P22A 3KBOA 3F1LA 4J7UA 3ZV5A 1I01A 4XYBA 4BQPA 5IZCA 3NTQA 2W2LD 2W90A 1UXJA 2P5UA 3TFQA 4BKRA 4PLYA 1J0XO 2BHLA 1X7HA 2SCUA 4KTVE 4LK3A 5A06A 1UR5A 4BHTA 1XWFA 1VI2A 2X5OA 4KP7A 3L77A 4BQRA 2Q1UA 3UH1A 1CQJA 2NM0A 1TXGA 3QY9A 4RV9A 3UAGA 3VZRA 1U8FO 4JP2A 1ZSNA 4P4GA 2R00C 3S2IA 2AEFA 4LISA 2O50A 3HE3A 3VKUA 1UJMA 3DZKA 4CUJA 3PVZA 4KUHA 5LDHA 2AQ8A 3MJ4A 2HK8A 5EPOA 2E4AA 3U9LA 4XQ9A 3FPCA 3KSZO 5JPIA 5L40A 2EWMA 2Q4BA 4CLOB 3KVOA 4NJMB 3IQDB 1G0OA 4WOKA 2UYYA 1PGPA 3M2PA 3QWHA 4CLOA 1NPDA 1NVGA 2BGKA 3UHAA 5A3VA 4XDYA 3AUUA 1YJ8A 1PGJA 2EKLA 4E5MA 5B1YA 3U09A 4WPGA 3UN1A 1U5CA 3M1AA 1SEVA 4PG5A 3UICA 1ZMTA 4G2NA 4BUCA 3KM0A 5A5EA 2Y1GA 5KJ6A 1NVTA 1EVJA 3OIDA 3JTMA 4OQYA 4IIVA 1C0PA 1I2CA 4M49A 5DNAA 2O4UX 3T4XA 4A2CA 2WEKA 4CL8A 3DBLA 5AXAA 1A7AA 1B14A 3W6ZA 3MJSA 3QA9A 4K6CA 5TC4A 3HN7A 3JQGB 1OAAA 1D1SA 1N1EA 4NU6A 1DIHA 3TJRA 4OYRA 1A27A 3L9XA 4ZHSA 2O2YA 4IQ0A 4IDDA 4N5LA 4NH4A 1LU9A 3WMXA 4E21A 3F3SA 5H81A 3O9ZA 4BIIA 3GVCA 1LI4A 4TMFA 1P31A 1RPNA 2PGLA 4CM4B 3TZHA 2D5AA 5LDGA 5C3MA 1JKIA 3JD4A 1HE4A 3H9QA 5A03A 1V9LA 2WE8A 5AQ1A 3ZV6A 1FMCA 1R4NB 5HRUA 1ARZA 4YQZA 3DQPA 4AJ2A 1IL0A 3L07A 3HDQA 3NKLA 4F45A 4CPDA 4NBUA 3R6DA 1CEQA 1Z7EA 3VKVA 4NFSA 1CETA 2I6TA 3RUEA 3VDRA 1B15A 1PGNA 3ZWNA 3BMOA 1L7EA 3L6OO 2DFDA 3LLVA 3PQEA 1E3EA 2RIRA 3BMNA 1R6DA 2VQ3A 3O8QA 1M6HA 4IMPA 4NMHA 1NR7A 4IDBA 3WIDA 4RF3A 4F6LA 4U8GA 4ZQGA 2NACA 1JAYA 3B1FA 1C1DA 3LC1O 4CQMB 2B36A 3IDSA 3A9WA 3K92A 2GLXA 1XSEA 2FY8A 4QXMA 1O5IA 4FCCA 3QV1A 4NU5A 4KUGA 4E13A 2OOSA 2HO5A 3KEQA 1M2WA 2HJRA 3FR8A 2WYUA 3I3OA 4Q3DA 1FDSA 1VC2A 3ZZNA 3OA0A 3E1KA 3I1JA 4EJ0A 4XYGA 4LCJA 2X7HA 4I1IA 2CUKA 5KVCA 4RF4A 4XA8A 4WJZA 4B4UA 1GZ4A 3DBHA 4E32A 4NJOA 1EVZA 1YB4A 1BRMA 1PS0A 1Q7GA 1QYXA 4DREA 4RCVA 1XQ6A 2FOIA 1Q0QA 2HMSA 3E5MA 3DZFA 4NK5A 4BNYA 1ZMOA 2C7GA 2DBZA 1N92A 4IXWA 4MO2A 1GFSA 1PJ2A 1BWSA 2D3TA 1V3VA 3R3JA 2X0IA 1SO8A 1G0NA 2HJSA 1B0AA 1LA2A 2DQ4A 3G3EA 4IZHA 5DCYA 1Z7BA 1ULSA 5BR7A 3TDKA 5B4VA 2R6JA 1NAHA 3D3EA 3PYMA 4CODB 1QYVA 1FK8A 5G4KA 3VAZA 3BXXA 3GDFA 4CM3A 3EC7A 1FDWA 1YL6A 5C7LO 1DAOA 2PKRA 4IS2A 4LN1A 1TB4A 1ID1A 3VZPA 1ZK4A 2BMAA 1DJNA 2PZLA 3K2EA 4U5QA 1XR3A 3JD2A 3VDQA 4YXFA 3TFOA 2W2LA 1UXIA 1X0VA 1PWXA 2JFHA 3MZ0A 2YFHA 4U7WA 4XR9A 3EK2A 2VNSA 2EW8A 3NGXA 3GZNA 2QX7A 3RBVA 1HE5A 1DHTA 4CR6A 4L75A 1R4MB 2ZB7A 3A28A 3GUYA 5EMHA 4DTIA 3T7CA 4JK3A 2R00A 2DUUA 1VLLA 1E3SA 1VL8A 3CMMA 2WD8A 3IKTA 3KXDA 1SOWA 2FHSA 2FPIA 4R54A 3QVWA 5K9ZA 5GZ1A 3HDHA 3JQFC 1YH3A 5T8KC 3GGGA 3GA0A 4FPXA 1WNTA 4TVOA 4BNTA 1P77A 4XIJA 5A9SB 4YJDA 5IZCC 2VHYA 3DHEA 3PHHA 5JAIA 5G0VA 1UXGA 2EIHA 3ICCA 1R0LA 4J7XA 1Y9EA 2CDCA 4PGFA 4Y6PA 1QV7A 4PLFA 3HZZA 3TN7A 4MIOA 2O3SA 4IM7A 5TGDA 5L45A 5GZ6A 4AJLA 3EHEA 3FSRA 4DPKA 2DBRA 1LDBA 3I9LA 1MP0A 2CY0A 3PDUA 3IUSA 4PIVA 1U4SA 2EERA 5DP1A 3NTOA 3LSYA 1QKIA 4YTEA 3C1OA 4J1SA 1PJ4A 3KYBA 1V6AA 4BL5A 1FF9A 3WNQA 3V1YA 5T67A 5KIAA 3KYDA 1ZSYA 3WWYA 2WYWA 4ID9A 3JSAA 2Q46A 3JQAA 3NDJA 2DVMA 1KETA 2WMDA 3Q3CA 2YY7A 2ZJ0A 1SBYA 1IULA 2XXJA 1ZBQA 4NHEA 1U4OA 2VUTA 1A72A 3R1IA 5DF1A 2GZ2A 4IDEA 3OA2A 4CJXA 3S2EA 3RBXA 1MV8A 2VZ8A 4Q3EA 3DONA 4ZU3A 3GK3A 5ILGA 1ZIDA 4BKPA 7ADHA 2X23A 4W6ZA 4EEXA 1E5QA 5JS6A 1MUUA 1XHLA 1JKJA 1UAGA 3HWRA 4CMEC 1LLUA 2G82A 2CVZA 1E7WA 3GNTA 3NJ8A 1K5HA 4A73A 4B4WA 2WD7A 3AFMA 5A02A 3JCZA 3HNPA 1ZK0A 3VHRA 4J4BA 3U4DA 4LW8A 1PZEA 2NU6A 1C1DB 3ZWBA 5BSGA 1BVUA 3H6KA 5DBGA 3U0BA 4WCFA 3M1LA 1Y6JA 2Z5LA 4OL9A 2ZCVA 2QYSA 4JQCA 3MWEB 2W2KB 1JLLA 3EW7A 4J16A 2PH5A 3P7MA 4RVHA 4TRRA 5L9AA 1KEVA 1GQYA 4Y6SA 1NPYA 1H5QA 4BV8A 5A9TA 3G17A 3IP1A 4DYDA 1ZSVA 3SJ7A 5ITVA 3LT2A 2GNAA 3WGQA 4OOFA 4J2HA 4OXYA 4R3WA 2GZ1A 4P4NA 3HFSA 4J4TA 3WICA 3PHGA 4WE3A 2NU8A 1UAYA 3Q6IA 4R1UA 3BTSA 1ZEJA 4RDHA 4J90A 1DC5A 1OC2A 3UCXA 4XGIA 2GRAA 3PGJA 3U4CA 3FBGA 4GVXA 2YQ5A 3ITDA 3PFFA 3LQFA 4GSKA 4J49A 4O0LA 5EESA 3OHSX 4TRNA 1I33A 1KVSA 3A1NA 2Y68A 3LVFO 2BGMA 4XX0A 3RC1A 1QRRA 4PG4A 4UULA 5TRTA 4CMIA 4YRAA 2V7PA 4NDNE 2W4QA 2ET6A 5G0SA 3AOGA 2DAPA 1V3TA 1MC5A 3GR6A 3G79A 5I9MA 3TOZA 2WWRA 4PVDA 1WLYA 2WM3A 4OXKA 1I10A 1VKOA 4WKGA 3TQHA 4B7CA 4XYLA 3SVTA 4PG6A 3KYDB 2D2IA 5IXYA 1PZFA 2BFOA 1E3JA 2O7SA 4MP3A 4MVJD 2NU9A 1P44A 4MVJH 7MDHA 3GPIA 1LJ8A 4FB5A 2OUIA 2NSDA 1BGVA 4MVJG 3ROMA 3V1UA 4NZ9A 2O3JA 4QFDA 4HFJA 4DWVA 4O5OA 3DAFA 2Q3EA 1FDTA 2AQKA 1PL8A 2NQ8A 4PG8A 2CFCA 1ISHA 1XG5A 5L95A 1XCBA 1PQUA 1MGOA 5KVQA 5IJZA 3WJ7A 3GC6A 5ES3A 2AEJA 4J4HA 5ENVA 1X0XA 4BNHA 2DTXA 1GR0A 1A9ZA 4GWKA 3C1TA 5CPBA 1B26A 3FPLA 3ZHXA 2FPGA 4FC7A 5EL0A 4YQYA 1M67A 3EVTA 2NVBA 1KVQA 4PLVA 4XEHA 1EZ4A 2FSSA 3H8VA 3GOHA 1JU9A 3OQBA 3WLEA 5L53A 4AFNA 2RHRA 3GF4A 3IAHA 1ZJYA 2I99A 3JYNA 3GVPA 3A4VA 1EK6A 3DBVO 4PLPA 4WLOA 4MDHA 4FFRA 4WCFB 2IXBA 5JDCC 5FI5A 4MVJM 1HF3A 5BSHA 3H2SA 4A7PA 2NUAA 2B5VA 1A71A 2QW8A 3U4HA 4BB6A 3QQPA 3DOCA 1GYPA 2EGGA 2Q45A 2PLAA 1DLIA 3JQAB 3QW2A 2GUGA 2WSBA 5ICMA 3ZGYA 3PPIA 3I83A 5B37A 1NM5A 3NTRA 3ANMA 1EMDA 1RM5A 4GX1A 5JC1A 2F1KA 4PZEA 3NT2A 4B3JA 2PD6A 1BW9A 2RCYA 3CTMA 3PDJA 4GWGA 5FWNA 1Z73A 4IDFA 1EUZA 3NV9A 4BMNA 3RROA 3F4BA 1RM4A 2J3JA 1H6AA 3Q2KA 4OO3A 1KIFA 4ND5A 4YAKA 2AQIA 4TQGA 1AXGA 1BTOA 3ZHZA 1LRKA 2H9IA 3SEFA 1Y8RB 1Q7CA 1HSZA 2IE0A 4OSPA 2YHIA 3G1TA 2Y1CA 2VZ0A 5I7VA 4A03A 4XD2A 3KYCB 3VPHA 5U4QA 4ZRNA 4Z0HO 2JCXA 2JFFA 3H5AA 3BHIA 3I9MA 3KEOA 2IYOA 1DFGA 4OKIA 1WMBA 3AY7A 4R01A 3GPDG 3RCBA 4OSOA 3O8QB 2BI7A 3GMDA 3AI2A 1ONNA 1SNYA 1GUFA 4CV1A 3AFNA 5TS3A 3VVBA 3EAGA 4KQXA 4CQMA 3N7UA 3BMCB 4RLHA 4QUKA 1J4AA 2VWHA 3OECA 3TRIA 1HDRA 3U62A 4FFPA 4D41A 4OIMA 1K6IA 3PYXA 5FF9A 5BQFA 4AJHA 3I9OA 1BXGB 1ISGA 4RLSA 4PLHA 2DBVO 3AK4A 2TMDA 2Y99A 4XRGA 4UVGA 1HYEA 1NYTA 3QVOA 3WGTA 1RJWA 4Z9YA 4L76A 4YWJA 1VJTA 4W7HA 2FSVA 4K9DA 5T8KA 3ZDFA 1E1KA 2B5WA 5CPFA 2FWMX
chains in the Genus database with same CATH superfamily
7YASA 4XWKA 1ZZEA 4FILA 4ASUA 4DMKA 3FWNA 4P83A 3D5TA 3ASZA 1KO4A 5KMGB 3EGCA 3I5MA 4ZFNA 2HPAA 4KQJA 1KTIA 3HR4A 3RC9A 3RBAA 2G9ZA 4G8DA 1P19A 4KZKA 1ZJZA 5EN4A 1ELOA 3Q2IA 2AG8A 4C0JA 4S04A 2D8AA 2VAVA 3FWZA 4G0QA 4M1MA 3IQZA 3AHIA 4YJHB 4N0QA 1PDOA 1RMQA 3AU8A 4KAAA 4RFVA 4YJHA 3X0DA 2GDJA 1XPJA 2NUAB 4D8YA 1WULS 2HZ7A 3E9QA 4F12A 3DGFC 7ABPA 4A8TA 1YXMA 1P80A 4BVHA 4EI7A 3GMIA 5SYAA 5B58T 4KLZA 3FETA 1K86A 4MJXA 1Q91A 4PX2A 2GZMA 4CMKA 1X8JA 4ESOA 3TSYA 1DAKA 4I8XA 1TKAA 2NUPB 1JAXA 2I2WA 2IGTA 1TW2A 4C3VA 1XX6A 1M2VA 5EZ6B 1W4RA 2VH1A 3B9BA 3PWZA 1I6KA 3CR3C 3H5NA 5ALUA 4F4FA 2J6IA 4UHHA 4RTNA 3OZCA 4A6PA 3EF1A 3GY0A 2G1JA 4G0OA 3TEMA 3ZV4A 1G1AA 4OP3A 5B1DA 1O4VA 4ZZ3A 3H9EO 1Y33E 1VMIA 2Z8YA 4DMCA 1SRQA 1VHTA 1F48A 3NBQA 1YRHA 3FNBA 3UXHA 5B3LA 1FSFA 2HH9A 3ETGA 3F5MA 3EDRA 1AS2A 5J2TB 1XK6A 4DZZA 2L82A 1K88A 3A3YA 2MR6A 3CH5A 4I8DA 5DIFA 2HRQA 5JJ5A 4D96A 1YJXA 1M5UA 2NG1A 4OGLA 4YRBA 3PEYA 1BE8A 1JE0A 3H13A 1UBUS 3KE9A 3ZJVA 4JXKA 4FS3A 4JOSA 4LJ4A 1EVLA 1NBHA 1K0UA 1XZAA 3KKEA 1WD5A 3HCBA 1DG1G 2F00A 2R5FA 3GEPA 1SKAA 4Y2YA 2RB5A 4EQ6A 1JQBA 4IDQA 4HQFA 2MSLA 1LZKA 3RV3A 3E35A 2ZKLA 2PA3A 1V3UA 1RABA 3VR5H 1ZJ6A 4KOEC 3SGLA 2IHKA 2YL2A 3GEIA 2YYSA 1FS4A 2ZWMA 1LNQA 2VRCA 2W6ID 3B9QA 1UBGA 3W90A 3DBIA 3N2KA 2ZRGA 4CM6A 2BGNA 2NV0A 2AMVA 3V2GA 1AK9A 1AJEA 5NULA 4P54A 4GKBA 5BNWA 1I3LA 1K4KA 3QVMA 4G0WA 2P9EA 5J5AA 1ZFNA 1MVOA 3GN2A 5AHXA 3TINA 3U5TA 4G0UA 1TO6A 4ZGGA 1RJ9A 2WFAA 1SOUA 3C6MA 3ER6A 1RQLA 4LI3X 4XUCA 4ZEXA 5DXJA 4EGSA 2PD4A 3OLQA 3I5YA 1UDCA 2V54A 1BMQA 3HMQA 4G9EA 2NZYA 2OHGA 1XCPA 4P34A 1NHWA 4A6XA 3TE7A 4E94A 1QU3A 2CFOA 2WWXA 4YRCA 5JV5A 3ZQKA 4HEQA 1NXSA 1PT7A 5I9LA 4L73A 2BCGY 2A35A 1PU2A 3IIMA 5C7OO 3M6VA 2FZGA 4F3KA 1T2CA 1Z8HA 3GJRA 2C4MA 1K6JA 1E8DA 1RQXA 5M5BA 1ZU4A 1JI3A 1A76A 4BFTA 1HDYA 2ZB2A 4LV5B 4US0R 1SCIA 1SQGA 3LFHA 4YBZA 2J5RA 1PEAA 1OXVA 3AHCA 2VPTA 4AWXA 4RJTA 4GMGA 4FN5A 3O9MA 1P0CA 4MROA 4ZQIA 4JLVA 4JQYA 2O8FB 3UIEA 2O2SA 4DQKA 1DJMA 4M22A 3ENQA 5FOSA 5DX0A 1K7FB 2CCJA 2P1RA 1U1IA 4KLNA 3MCAA 1NQWA 4XARA 1JB1A 2I1LA 1D1PA 1P4SA 4UD6A 3KAJA 4FE4A 4KYTA 2C3YA 3DFFA 2H4YA 4RKYA 1WAMA 3W5UA 3KJEA 4XR4A 4PINA 4QGSA 1SVKA 5A3RA 1ABEA 3LNTA 2C2BA 3C70A 1VYUA 1CUUA 1HY3A 2E55A 1UBCA 1GSAA 1MJNA 2E1RA 3MELA 1Q1QA 4JB0A 4G0YA 4NICA 2C4VA 4AG3A 2G0AA 3D0QA 1FXWF 5D6NA 4ZYVA 1OHHD 4KWTA 4A27A 1TLLA 2ZETA 1L7VC 1DIRA 2BUCA 3B70A 5BV0A 2C2ZA 3H42B 5FULA 4ALKA 5JDIC 4UFPA 1KO1A 2HCFA 4RQBA 3LCMA 4OL0A 2M6LA 3TTYA 2XA2A 4WN3A 2YN2A 3RS7A 3OI7A 1OU0A 5EHQA 3HGTA 4ISBA 1GZVA 3O47A 2I6QA 1GGFA 1P2TA 2W2XA 4KMRA 4RSGA 3KQLA 3IOCA 3AV3A 4M0DA 2VDJA 4HXGA 2QYOA 1U0SY 2PYDA 3O0DA 1I36A 5KPDA 4FR2A 4YGYA 3UUWA 2CFSA 3BG5A 5JO0A 4NXNB 3CX3A 1SIBE 4KQHA 4MV4A 5GV8A 3A3KA 4DDWA 2VAPA 3RVRA 1JBQA 1WEKA 3KHTA 2DKNA 4AX4A 4F5EA 5HKAA 5AIAA 4MA5A 1KZ4A 4AQYB 1S8NA 1GTL1 3NC1C 5CNKA 2PL1A 3NEPX 1U3FA 1ZM9A 1GVNB 2FW7A 3CSUA 4G65A 3U16A 3UF0A 4G5OA 4RIGA 3TUJC 1YQGA 5L3QA 3WTBA 1ONSA 1EP3B 3AUFA 2XUFA 4P31A 3OU7A 5ECYA 4BEBA 3GLQA 2ID7A 4N47A 2PJDA 4LUCA 2ZJ1A 3II6X 1PNTA 5CT9A 2QI9C 5EXEA 3WKDA 5BVHA 5K0GA 4ABYA 2IYXA 4D45A 1TJ4A 3EOBI 1E64A 4YROA 4BGEA 4F92B 1U99A 1UBHS 2YIVX 4WD3A 3FMFA 5IKEA 5ALTA 2PFSA 4S05A 3COWA 3D1JA 3HKBA 3L05A 1DTSA 3FNQA 4IHJB 1DTEA 2R4UA 4E1AA 1TFRA 1YDEA 1CD5A 1V16B 4ETIA 1XEXB 2ODWA 5B12A 1YFLA 2PMKA 3TPFA 1V16A 3F96A 3G1UA 4GLBA 5JLAA 4WOBA 1V8FA 3KKLA 1W0JD 5KDLA 4L9WA 4BO3A 2ZRPA 1NXXA 1XRMA 3KE8A 4Y2XA 4H16A 1XDWA 2PKEA 2PL9A 2VXOA 3DEKA 3PC8C 1Y5RA 1GGNA 4KTTE 2DUJA 1OX4A 1XQYA 5CH3A 3LPAA 4DMUB 5BV2P 2RSLA 1S7CA 3BRWD 3AEUA 2QGNA 3C3JA 4KYUA 2XUHA 5JC8A 3C8HA 1JR6A 3KFLA 2VZEA 3P9SA 2Q6IA 1HTBA 2XKJE 3O8OA 3PKIA 4K6FA 4P32A 1JFRA 4RWZA 2J07A 5E9AA 3TQFA 3WY9A 2YJ4A 2YYZA 4N5NA 3RUHA 1MQ8B 1UFQA 3PNOA 1G6HA 1JLLB 1UBFA 4NI5A 5CLHA 4B8YA 4TROA 5LU8A 3IIIA 2QT1A 2WU3A 4R69A 3PX2A 4QYTA 4KFCA 2ORWA 1AK2A 4I5GA 2EKQA 5DT2A 1XZEA 3DFIA 3I6IA 1V45E 3H9CA 2GXUA 3VOSA 1GZ5A 2WPDD 1SQ6A 1QYRA 3ZV3A 4URFA 3UXMA 1CC1S 2FMUA 3WHPA 2D7JA 1NJSA 3RC3A 3WKAA 1GTMA 1KH3A 2YIJA 3C0KA 2YWHA 3SIWA 1ZXLA 1MPTA 3W1VA 3G1WA 2I78A 3DA8A 4H0NA 1ZNYA 4UATA 3R0XA 5KVVA 1M54A 5LVAA 1NQVA 4Q1CA 5J4LA 3F97A 1ZMRA 1Z4LA 1D6JA 2PWBA 2YJ3A 3MHPA 4L4UA 3DTVA 1T2FA 1RXWA 2WYVA 4LDZA 2ZTUA 1N6NA 1XEWX 2A94A 3T5CA 3BEDA 1X80B 1XZLA 3FKSA 4TQAA 4CI9A 1RLMA 1JVNA 4NABA 2X7XA 1IBSA 1Y1RA 2PNJA 3CX7A 4FFOA 5AR1A 1FY2A 3WFIA 1ODCA 3HP1A 3PUZA 3INYA 5JQGB 1V8DA 5P21A 1TEZA 4JUBA 3AERA 1WUKS 3DAPA 3C7DB 4YJ2B 4B6PA 3OPYA 5FBZA 2OZPA 3H5TA 2C9ZA 1VSUA 1WHTA 5C8YA 1NXQA 3A27A 3H4MA 1LC0A 5DM2A 3PKZA 3NKFA 2E6KA 2MU1A 4A82A 3TOSA 4HQ0A 4IUDS 4C4OA 1MD9A 4R9UC 1WW2A 1U8XX 1T6BY 4FDMA 3TTUA 4BQSA 3UPUA 4KKVA 3DE4X 3FHTA 1Q1NA 2ZJ6A 3H5RA 3IR5A 1E5TA 4AF6A 2WRZA 1GZ6A 2C9YA 3OU6A 2NXJA 3LXUX 4TOIA 5A7GA 4DMGA 1OB5A 2F8SA 5IT4A 3GP3A 1JIIA 1NDUA 2C92A 4WLNA 4D9KA 1U02A 4KXVA 2CJWA 2BSXA 2J4FA 1FDUA 2KW5A 3MBKA 4WZBE 1DKPA 4KC0A 5HCNA 1ZL0A 3FM9A 1X7ZB 1DC4A 2V7XA 4EF5A 6Q21A 3Q7EA 5KYUA 3R44A 1HK7A 1WR8A 1UBTS 2I6UA 5CFPA 3CTPA 2QL9A 5I8PA 4GYKA 2JLXA 4HDRA 3ZY5A 2O2GA 1YD7A 3BWDD 1W0JA 1MT3A 2PAFA 3TE6A 5BPFA 2GHIA 2IBTA 1RJFA 1NJ8A 3VNSA 3W5DA 1XMVA 1DAGA 1EA5A 5M7EA 1E4EB 1PS8A 4E3ZA 2FPGB 3LDUA 4K26A 1KFJB 4M1KA 4ALLA 3CKMA 1K8YB 4QEZA 4QFMA 3G8AA 1ITZA 3RSLA 4KREA 4MVJF 1C1YA 3M9XA 1DCFA 1PS9A 3K9QO 5BNZA 4OQQA 5CDFA 4BWGA 4L28A 4EI8A 3IEKA 3U4IA 1DQNA 1ZGHA 1MAWA 1GYQA 2X19A 4KYVA 5DBFA 4E2YA 4FS8A 3QVJA 3GRCA 3ICQB 4QUBA 2EW2A 3QTBA 1SJ9A 2I2AA 3FDJA 5CCDA 5GVSA 3OQMA 4H77A 3QWBA 5IVHA 4EDFA 3Q6NA 4RM2A 3K2BA 2XH8A 5DMXA 1CJUC 1E2HA 1A3CA 1EVKA 1VJ5A 4IP0A 2VIIA 3BFPA 1NMQA 1YQ9A 2Z2JA 3MILA 4P0TA 4ZZ2A 2PUGA 4OK5A 2MJLA 5IX8A 4D9NA 1V4BA 4YY3B 4RK1A 4I1YA 2OQIA 2FFJA 3LFTA 5TMDA 2GXAA 1YUNA 2HHJA 2YZNA 1FFWA 3MRVA 4Z2YA 4HEA6 2A1UB 4Q21A 4AN1A 1HBJA 1NNI1 4XOUA 3BDIA 3DXFA 3UK6A 3I2IA 1QUFA 4XWOA 4E5PA 1AO0A 1TM3E 4DT1A 3IUJA 1C8BA 2XYHA 4IJKA 2HSDA 2C7VA 2O4CA 4OB7A 1TI7A 1VHWA 2WV9A 4QUEA 5DK4A 4WEQA 3CLHA 4BTLA 1E2DA 2X58A 3MRXA 4K9KA 3DGEC 3GHHA 4MI1A 4IUBS 1OBFO 4QT0A 4XM1A 4BRUA 5EJ6A 1BU8A 3Q0TA 1JHDA 1TGVA 3H4TA 1Y8ZA 5BP7A 2GCPA 4EL5A 1KJ9A 3AT1A 5HA5A 1COWD 3FVTA 5HZMA 2PBLA 3KRTA 5ERYA 5BV7A 4RQUA 3TG8A 3GLIA 1EQAA 1U3TA 1INLA 1JH8A 1R6TA 3CU5A 2OZEA 3JD1A 4GKAA 2HRDA 2H5EA 4R0MA 3E05A 5JZOA 4S1VA 4LGVA 1C3XA 4ZHQB 2WK1A 3B5JA 5CFZA 1ONPA 1L7BA 2OYSA 3FVWA 4FZJA 1MGPA 2Z2KA 3NEYA 3SF8B 5LKRA 4GZ3A 2WQ7A 4RLQA 4BXOA 4JI8B 3A9VA 2BGRA 2B6NA 1W2HA 3IE0A 5ALWA 4Z7NB 1ETUA 2C4WA 2EDCA 2QY9A 3A6DA 4JR1A 5TVGA 4JI3B 1O3YA 4R9RA 2W83A 3RS3A 1XL0A 2WDZA 2HO4A 1XRJA 2JI8A 4X90A 1BJRE 3OZAA 5DLEA 4AYTA 3HJAA 2VDWB 2GEKA 2VT6A 1YOVA 4MVJP 4Y2VA 1JNYA 3NHAA 5JNUA 1U90A 5TT0A 3MCVA 2ZYVX 2I3ZA 3VMMA 2AN9A 4C7BA 2VPYA 3TOXA 4NCBA 3ZDRA 1X1BA 2C9BA 2VDVE 5EQFA 1HFKA 5H02A 1QFYA 2FYTA 2FMTA 1ZLXA 2R6AA 1Z4KA 4UPVA 2M6RA 3AO0B 3HBNA 4Z9AA 4NCKA 2UUAB 1AXRA 4HCJA 4U8HA 1RM3A 3ZVLA 2BFPA 2H0AA 2UKDA 4KGVA 1NQOA 3GRZA 2ZVPX 4LY0A 4DA7A 5C5EA 3ZDEA 5KYWA 3DEAA 4JEHA 4HP8A 4X8MA 4D79A 2IHYA 2WKQA 3ETJA 3FNHA 3H11A 4HDSA 3UJPA 3GJZA 3PNBA 1M1YA 4RKQA 1BOFA 1OF1A 3B48A 4FTWA 4MWOA 2G5CA 3TLJA 4E4RA 1M1YB 3F8WA 5BNTA 3PLAE 1HT2E 3UKOA 3BQMB 4A92A 3VVMA 3HU2A 4NDAA 1QVZA 1N0UA 1FVXA 1PWYE 3DZJA 1A7JA 1W88A 1IZ9A 1P62B 1EB9A 1L5RA 4LGCA 1MU0A 4OU5A 3NHBA 4B3DA 4B83A 4E70A 3U61B 1G8PA 1SVNA 1OIWA 2BKVA 2EEZA 3N7AA 4LQLA 4GGPA 3RU9A 4AL4A 1TF5A 4DMHA 1A9SA 3RH0A 1YWGO 2JAXA 3SHTA 5H80A 2FRDA 1BCSA 4N82A 4TLMB 3DOJA 4MJLA 2WHRA 1DKUA 2CE7A 3FCXA 4LZLA 4WT7A 1G8JA 1RU3A 2UVQA 2WU4A 1B73A 4OOEA 4QU5A 5DMHA 5DW0A 3K1JA 2WWWA 4B2LA 4DIKA 1JMYA 3OO0A 4O1IA 1HR0B 4B6EA 1NVEA 2NVUB 5C18A 2WA2A 3MB5A 5JYDA 2N47A 2WWGA 2Q6KA 4U6SA 2OTCA 3H8WA 4MV5A 4UNQA 4B8WA 4BO0A 1GLNA 3NYWA 2XI4A 3MHTA 3C1AA 1J5XA 2IU4A 3F4KA 2P9QA 1M2JA 2HU7A 3FI0A 3A6FA 4DTIA 1NN3A 1YB5A 5F1OA 4IHJF 1WMFA 4HGQA 4UPDA 5K3AA 1RZUA 4WBNB 3M5WA 3W06A 5EIFA 1NYLA 3KX2A 3KAQA 1VIYA 5AW2A 5EJ2A 4DLUA 2PRKA 1CRPA 1NFRA 1ZJWA 3Q85A 3BN3A 1PK9A 2JIZD 2D0DA 4DG5A 3T4PA 1P7PA 4IWNA 4HOYA 1DDGA 3VAYA 2OZVA 3ADPA 3QVUA 3WJAA 3L3BA 1GNRA 4DA9A 5CB4A 2VTKA 2Y8EA 5LQMA 1YAJA 2O2CA 5K8CA 4JASB 5D1HA 1Y3AA 4KE6A 2QUJA 3CW9A 4AUEA 4BFYA 3MUFA 1U2EA 2C88A 4HNAB 4LJ9A 3UFXA 3IHTA 2PH7A 1J0DA 2P77A 3DAGA 2QMYA 2B82A 4OY3A 3RHSA 2EX1A 2XNCA 4NKRA 5CLJA 1MNAA 4KAJA 4RZHA 5EE3A 4JGIA 1PHPA 2BFDA 2I91A 3BMNB 3BCSA 1O6ZA 1DDIA 3URMA 4I5DA 2F67A 4JODA 4AVYA 4JXZA 4PN3A 5ALXA 1JEJA 3Q9UA 1ZN7A 4CKXA 1VL1A 3OQPA 4I4LA 1IMOA 3JR3A 2NTVA 3N3BC 4TMTA 2WVJA 2ZZMA 2OZLA 1EDZA 1AY0A 1SB8A 3G9QA 2FEXA 3OF2A 4FGWA 4C4SA 3K1AA 2F90A 4Q1BA 5DGCA 3CLRC 1H1LA 1ZVVA 2AFHA 1EFKA 4KXNA 5A04A 1DIOB 5DU2A 1P1FA 3TLGB 4NQRA 2Q4TA 3UMRA 1DT5A 4FCTA 4AW9A 5JNLA 2WHXA 2VHJA 3HXOA 1M8FA 1WY5A 3QBTA 4WASA 1OGJA 1IZZA 1QIIA 4EX6A 3V7NA 1HYHA 2RC6A 3ABIA 3ANYB 4H31A 4UNNA 3GEBA 1GAXA 4QUAA 3GXBA 3LW7A 3L6BA 3TDMA 1DAEA 1I1OA 2O3QA 1ZA1A 3EQ2A 5FOUA 1M6EX 3SN6A 5KWIA 3ZCVA 1E4OA 4F56A 2C5LA 4INAA 1FFGA 1AS0A 2J3LA 3OZIA 3WGYA 4RLFA 4JC4A 4MLZA 3RQIA 3ZNPA 5AK6A 2J85A 2WM8A 2EWWA 3OICA 3DQZA 3V46A 5HQ3B 5JVDA 2BMFA 5CG1A 4BXOB 1NF3A 5AW4A 1I2DA 2CVOA 1BDIA 5EWLB 2OQVA 3AVVA 2WT8A 3I12A 4I6EA 5IN4A 2V9CA 4J03A 4E6EA 1NHGA 4BJ3A 2PMBA 1ZVQA 4RVNA 1HDOA 1W93A 2A9JA 4FKBA 4IUYA 3QTTA 3WL4A 2H3HA 4EHHA 3RG2A 4RGVA 5JQWA 5LLDA 2XNDD 3WLRA 1NKSA 2SNIE 2C2WA 4G5QA 4ZDWA 5JEDA 2J9FA 3KSUA 1YA8A 4BV3A 3NWEA 3BIXA 2VTVA 5KKCA 3AVYA 3QPAA 1SB9A 5YASA 1BEUB 1DJQA 1ZWKA 2YC2C 4CQJA 2HMAA 4UTOA 5DYGA 2CXRA 3I92A 3OOSA 5EIOA 5HJ7A 5IUNC 3HPQA 1TK3A 1ACLA 3PPYA 1FYEA 1MIOB 2NT3A 3CC8A 2PRSA 5IC5A 5JCJA 1KMCA 5T4HA 5CB6A 1BA3A 1MH1A 2B3DA 2LTAA 1H0SA 5BWBA 2PZBA 5E9JA 1RNLA 3BTVA 2YWJA 4PYKA 2A58A 4FQ5A 4J8PA 4WV3A 3RAPR 2YQZA 4DC9A 4XEUA 4DT1B 4MIEA 1I0IA 4EELA 3R3VA 3AHDA 2UVPA 4IV8A 2FF7A 5IKPA 2VQDA 3SD7A 1EUCA 2MIIA 4RAQA 5JADA 1C2YA 3CJTA 4YP5A 1KFKB 2IC5A 2QS9A 1R37A 1SVIA 1SU4A 4FMPA 3NPAA 1T1SA 4Q4HA 4UNIA 1MC1A 3EX7C 1XU9A 4HGOA 1DV1A 1CUDA 2HLHA 2JZOA 2VZ9A 1CQZA 5JAMA 2DHCA 5DRYA 1YR6A 3TAHA 2VTDA 2EFYA 1RLUA 4TTRA 1RKBA 3UJDA 3WQQA 4I1PA 1OT3A 1U2SA 2AR0A 2EJBA 5DRTA 2IYSA 2NTYC 3TM5A 2JFVA 1UKAA 2ZXUA 3IDQA 3ORQA 1D4FA 2PZJA 3UATA 4RTMA 3LC2O 4R05A 4L8WB 1E2LA 2H7VA 5GONF 3VPSA 5IF3A 4M7PA 5DTRA 5CA0A 3T5TA 3QM1A 3EOZA 1TKRA 2O8CA 3OJOA 3LFUA 3BD7A 4RULA 3ZU3A 1Q3TA 2GEJA 1GKYA 1KZ7B 1TUBA 4CKWB 1YVUA 4AJNA 3O93A 4BO2A 1HYBA 3N58A 2F62A 1AM4D 1W96A 1M0WA 1P3Y1 5IJ0A 4B47A 2EIXA 2QN3A 1NT4A 1OBHA 3PDHA 4RYDA 1H2EA 1MTOA 1CW2B 1UK9A 5DX1A 1CIPA 3COVA 1VXRA 3PJGA 2RH4A 1FX0B 2W6MA 1B8VA 3NHUA 4HUQB 4MRVA 2GZRA 4HT3B 4D02A 3GRFA 3GP8A 5LNK6 3JVIA 1Z0KA 4OBWA 2EP7A 1OIVA 1X94A 1XJ5A 1XZKA 3JQFA 1T3HA 3CLKA 4L85A 4GL4A 5BNIA 1TOAA 2J3QA 3GAAA 2ES4A 2VDRB 1IOLA 2O3UA 2PVCA 5TX7A 3R5TA 3ZW8A 3FI9A 3OKCA 2CJWB 2CD9A 3BE4A 1E62A 3OIVA 4QYSA 4Q6WA 2VTEA 4TLEA 2EYUA 1Y8QA 1W0KD 5FFFA 5JCXA 1L5MA 5E4YA 2X2OA 3DW1X 3U37A 2WF9A 4BS9A 2Z3WA 2UZ3A 3LX6A 3S2ZA 1TAUA 3FLAA 2DQYA 1NN1A 3N0XA 1ILEA 1QSGA 1YO6A 1UK6A 2XB6A 2CB9A 1GITA 4FT2A 3ZU4A 3THXB 2JJQA 2P1DA 1Y6GA 2B2CA 4X92A 1D8AA 1PJZA 1KI6A 3AINA 4FU0A 4U2KA 4OHVA 4AYWA 2IZ7A 1PR9A 4LC0A 4F9FA 1T8YA 4ZJYA 5IDQA 1T26A 1NVKA 4Q3BA 5JQGA 1JILA 1EP1B 3KZMA 3HFRA 5ALPA 3LT0A 1WUIS 1YVDA 3NV7A 3ZU5A 3AI3A 2PUWA 4YCBA 3DT8A 3MC1A 3VU1A 3EA5A 3I4LA 2Q4RA 2QTVB 4O6VA 4E1VA 3RADC 2M32A 1TM7E 4LFAB 1YE3A 1DXOA 2QRHA 3PENA 4MQEA 2JIBA 3CEMA 3EBLA 1KH2A 3DNFA 2FEWB 3JTEA 3NWOA 3QG5A 3D7LA 4NS4A 3X1JA 4B6SA 2J9YB 1ST3A 3CNQS 3LVBA 5E3IA 1XMSA 4LJYA 3K0AA 4LMRA 5JH7F 1X7XB 3BQNB 2M6KA 4EHJA 3PC8A 2I0FA 2OWDA 2ZIVB 4KWEA 4JI5B 2C8LA 2BJHA 4U7GA 1H0KA 1TQ6A 1WHSB 1LDYA 1ZH0A 1WNFA 2FWBA 2L17A 2PLNA 3NHYA 2IPXA 4WOPA 4B76A 1LCIA 1OZ0A 3NBXX 1BXKA 1M2OA 4MA4A 1U3VA 1XA4A 2MYTA 3A14A 3B3JA 1S6YA 3BMQA 3OESA 3PC3A 5DP2A 2IHNA 4UXHA 2PVSA 4KPGA 4OUKX 4V38A 2FPWA 3QP9A 4YRTA 5D5PA 1RWPA 3P0EA 4I4TF 4LQ4A 1WCXA 1KP9A 1OLSB 4AG5A 1T9GS 4ONEA 1VDZA 4B2YA 1KJWA 3EF3A 1CKEA 1EHIA 2VJLA 1KI8A 1Z74A 4RFSA 1BMTA 2M9MA 2XADA 3V1NA 4EHKA 1E2PA 1P91A 1PYGA 1UXKA 3LHDA 1M74A 3A7EA 1JHVA 3UTDA 3AH8A 2A92A 2FPOA 1JH9A 4OJNA 3PD7A 4LE0A 4MYHA 1P3DA 3LT4A 4LFCB 3WBJA 4Y6QA 1LK0A 3HXPA 5A3QA 3SEAA 1HLDA 3E4CA 3JZAA 4WZAE 2NU9B 1OVGA 3JQ8A 3U4QA 3GCWA 4AY2A 1QRTA 2XNSA 1UJ2A 3WB2A 3PITA 3A4LA 3C3YA 2IELA 3ELYA 4BNNA 2IOQA 1FFSA 1H66A 3QUBA 4TS3A 5LB4A 2DTDA 5JSKA 2BMEA 4GUDA 2CGEA 4XH9B 4ZYWA 3QF4B 1ODSA 2FZ5A 1E66A 5D51S 1Z0DA 2B20A 1G8MA 1DDOA 2DT5A 5MDHA 5DNUA 3I01A 2PT6A 1JDBB 2Q5OA 4UFNA 4WN9A 3SC4A 1U28A 3FCOA 3PXXA 4BJ5A 4CN9A 5IASA 3I04M 4EABA 2BISA 2CCGA 2BMWA 3CKLA 2FR1A 2ERYA 3PQ7A 3UOAB 4BYMA 2G28A 3C16C 4GPEA 3FDXA 3KLMX 4LVCA 1R27A 2FQYA 4ETMA 3TJMA 4BLRA 4GR9A 5EQTA 2YINC 3QLTA 2FW1A 3L41A 5A4AA 5BN3B 1GRVA 5CM8B 4RYLA 2FDRA 3IV9A 3ZTYA 4HS4A 2PZGA 2AMFA 3URKA 1Y8QB 2ZSBA 3O4JA 2WJHA 4C7OB 2ZI7A 1ZI8A 3GQBA 3KOOA 4U3JB 2O0JA 5K51A 4Q9AA 3E82A 2H4JA 1E3QA 3UHFA 5HF6A 4FHFA 4UCQA 5FB3A 3RT9A 3F5SA 1OFVA 1JJFA 3HBJA 3TLCA 4HGZA 3ZUGA 1G1MA 1E7SA 2QSYA 4YUVA 4GRIA 2WNSA 1L4YA 4Q02A 1QO7A 3R9XB 3KOXA 4G8CA 3A6ZA 4M7RA 5LYYA 2OXFA 4PZYA 1AA9A 4GT1A 3PCRB 1M5RA 3WTCA 2BDUA 2H6EA 1QXSA 2VJOA 2CLLB 1O97D 3ONDA 2IU3A 3C8MA 3BH0A 3O4VA 3QKUA 4L6IA 3B1KA 2QZSA 3HLTA 3BXPA 2OOKA 3G2LA 1UMCB 3HSYA 3KOYA 2QQFA 3LTEA 4LNUA 4X20A 1T6NA 3VC2A 1A88A 4B43A 3CZ9A 3INRA 3OSUA 5E38A 4PNPA 3P0FA 3QNWA 2Z09A 2H2HA 4RHCA 3X2FA 1AUPA 2XHZA 5LIRA 4N18A 4OQEA 1YCDA 2O0HA 3BAZA 3MQFA 2D5CA 2G77B 3AIIA 3NDRA 2ZREA 4Z9XA 3QJ5A 1YU6A 1JP7A 1R8YA 4RKRA 3QE2A 3SXPA 1A77A 1XD9A 2HW8A 1WDKA 5AXCA 2Y9PB 1TQ8A 3LLSA 2P79A 4BFLA 5KC9A 3NFRA 2IODA 3G0HA 2QX9A 3KDAA 4C0SA 1YZHA 2WJ6A 1RTTA 4C3ZA 5T3YA 1NOKA 1F0YA 1LSSA 4K40A 4NHOA 2QDXA 4PWYA 1XAIA 6YASA 3W78A 1QHIA 2AL7A 3TIGA 5ICGA 2PAAA 4HDRB 3VVLA 3W2GA 4LE1A 4RHYA 2EKZA 3PR3A 1FLDA 1I0ZA 1P9OA 5AHWA 5TGZA 1T8PA 4DIFA 1KKMA 2X2FA 2QJTA 3GBPA 4DUPA 2OMEA 3EZFA 4DLPA 1CZKA 5DW3A 4GU5A 2FSFA 1B76A 1YA6A 1L4UA 2YNMA 2A5FA 3PA8A 4UE3S 1PLKA 4YP6A 2PKXA 4YDHB 4KNVA 3QWAA 1WPXA 4HPXB 3HB9A 1J5EB 5FL7D 2P68A 1ZUNA 1VCHA 4QBHA 2O8BA 2OHIA 4IS3A 4NBLA 4RPLA 4BGVA 4GOJA 3DFKA 4R1TA 2TMGA 5GGYA 3HUDA 5AW1A 2HT1A 3QKRB 5J2TA 4XSGA 2XWPA 1XQVA 3BSWA 3PT5A 2DPHA 1E2FA 3EXAA 3O2NA 1IM8A 3LT1A 3THXA 2H2WA 2G1UA 1MB9A 1DT3A 2AJDA 1E5LA 4K86A 1P7VA 3ZQJA 1WX1A 3A6HA 3KT8A 3DBHB 3L1IA 3QVGA 4M83A 1CY7A 3FUCA 3LUHA 5FHRA 5A7HA 4V2IA 3ZKWA 4TKMA 3NETA 2IUFA 1UP6A 3C6KA 4JHLA 4DQDA 4KDEA 5AKLA 3DLIA 3ZXUB 2AFHE 4OXXA 4OLHA 1FFAA 3HXTA 4QJIA 4DA0A 3FH0A 4EWLA 1G4AE 2OM6A 4N0MA 3PC4A 2I4OA 3BTOA 4F93B 1U8YA 1K06A 1HZZC 2PXCA 2RBEA 2Y92A 3FGNA 3PLNA 1TYEB 3SBDA 4DANA 3LC0A 1YBAA 4C21A 4YCSA 4XGQA 2CF6A 4UUMA 4BKUA 5KU7A 3CX6A 4JI4B 2GZAA 2IZ1A 2RHBA 4XM2A 3R7WA 4JT9A 3UAOA 5LQNA 2BTEA 4YAFA 4CCYA 1ZG3A 1NF9A 3L7MA 1XNGA 3V8BA 4LF8B 5CA1B 3D3WB 2JD1A 3LKZA 3IQGX 4WW0A 4J9UE 5K0ZA 4L8GA 4EFNA 1GA6A 1T3TA 3WSVA 4AD8A 3COPA 4IZ6A 2FETA 3Q1LA 2FOLA 5EQJB 4R2IA 4BZXA 1F2UB 3HPRA 1AHNA 2CLMB 5FUMA 3WB9A 2GBPA 3DZHA 2HIGA 3G6WA 1YJ5A 2YYAA 3IUQA 3PUWA 1W2WB 4TYWA 3PP8A 4MP8A 4LRQA 4PYQA 4E5KA 2DWOA 2B4QA 3S28A 3QXSA 3SDBA 4D43A 2W2QA 4HLUA 2VSOA 5DGTA 3TRKA 1CQWA 3Q0IA 4OREX 3IOMA 5L4NA 4PSDA 4QXQA 1N6KA 5KQLA 4CLHA 4XIYA 1NUTA 2XNDA 5LXTA 5GIOE 3RF7A 4IZIA 2WKPA 4C14A 3WAKA 2CUTA 4P84A 1G2IA 1USVA 1DIGA 2QMZA 1KYZA 1WETA 2GBGA 5BQ5A 3C5CA 1GSHA 3X43A 4LF4B 1HDEA 1C9DB 5ELXA 1JA0A 1XEAA 2CDBA 2FP4A 1C81A 2Z04A 3IIKA 3JQ8B 4HQ6A 3U4QB 2ILTA 4II3A 4MCIA 5DE3A 2BEUB 2RAVA 2Z4RA 5LZ4A 2V6IA 4G1FA 1GARA 5CAEA 1YR2A 4I1SA 2MCFA 3SX2A 1L5FA 3EQ6A 3TVYA 3KWLA 1WZIA 2ZJ3A 3HEAA 1Z4QA 1KTVA 1KVTA 2V7UA 4U6NA 1TM1E 1OLOA 2Y76A 3OIGA 3G02A 4XW2A 4EA6A 1I94B 1PP4A 4RVDA 2WJJA 5KQGA 3FG9A 3L0PA 4RTKA 2C4HA 2R60A 3EGXB 1VB5A 3IJRA 3ZYZA 4ZYLA 5FUVA 4IRMA 1D2RA 1UZAA 4ZXFA 5IT9A 2EVWX 2QLNA 4I9UA 3WGNA 4CTKA 5HKKA 3UUFA 5I7RA 1PV2A 2X8BA 4YPOA 2ZUEA 2XAAA 4S1TA 4IDNA 4EG0A 4CDGA 3HUTA 2I22A 3L7AA 3QVTA 3F6PA 2V6FA 3JD3A 3T35A 4NZOA 4L6CA 4CIXA 3NJRA 1C0EA 1P0IA 4CKBB 3E8SA 1MTZA 3OPXA 3D3WA 3L4BA 1ENOA 3CUEF 4YJKA 4J91A 1VYTA 2P69A 4JL6A 4ZD6A 3L8ZA 1T9AA 3SS7X 3W5VA 4LGYA 1N5MA 3ZQUA 4DLKA 3JV7A 1ORIA 1RZVA 4QDXA 1Y1QA 4YHHB 4E12A 1SUDA 2ZRCA 3C7AA 2CJFA 4GLLA 4K1LA 1Q0SA 2WKSA 4AJKA 5KVAA 4GI1A 2R4QA 1W49A 5F2EA 5BWNA 1OAOC 4RFSB 3ZY6A 3GG9A 4EHBA 4X8OA 3SSMA 1Q83A 1KS9A 2CLDX 3WSTA 4RAOA 3RRMA 3DT9A 4ZI5A 3KWMA 1KYQA 1NVVQ 2WT9A 3JYOA 3P9YA 4HYEA 1WB5A 4RELA 4B3HA 1SVSA 2ZW9A 3VR6A 1TVEA 3BMQB 4TWBA 3K70D 3SQXA 1SHJA 3CW8X 1DQSA 4A15A 1P8JA 3DLHA 4E1BA 2V4MA 1J0BA 4D9IA 3B20A 5ITZB 1REQB 1E3DA 5DOZA 3A6KA 2AZ4A 4QDKA 1TJ5A 2DH5A 4N3CA 5DBHX 4DRZA 5FTLA 2IDMA 4JEMA 3I1YA 3K09A 1E6UA 5DEOA 1N9KA 1ZLYA 3AZQA 1CVIA 3N28A 4N65A 5DTJA 4FGSA 4BCDA 4CFZA 3GMSA 3PIIA 5CAEB 1JJ7A 4C03A 3CLUD 1QCCA 2B6HA 5AJHA 4D25A 4TWRA 4V0MA 2GPSA 4DC1A 3CFYA 2ZYAA 3GCDA 3I8OA 1GL7A 2V8BA 3RBZA 2Q50A 5IANA 4L5JA 5CLGA 1M8JA 1VL0A 2I3BA 2LKCA 3P9PA 3DF9A 2AE1A 1PQPA 1U2QA 1X7DA 1ADYA 3MFQA 1GM5A 5I7EA 1NSFA 2Q5JA 3G5AA 2JLRA 2NV6A 1SC6A 3MWYW 5CBKA 2O8DA 1LH0A 5DZSA 4H7HA 1CERA 3EEYA 1VCOA 1T5SA 4FOLA 5TV2A 2JBAA 5IC6A 2Q4EA 2WAMA 4LZJA 2XA1A 3KS9A 3BL5A 1C3OA 4AUMA 2VN8A 2X41A 4LRSB 1JQLB 5H9VA 4ASUD 4K9LA 4KO8A 3RK0A 1FTYA 5DDIP 3TMAA 1ZESA 4QTXA 4FNAA 1DP4A 3MF4A 4ZAGA 4ZI2A 4TT3D 3X44A 1H2FA 4NU8X 3VAAA 4E6PA 4HDAA 2YW9A 1GGHA 4YR7A 1M66A 3M9LA 1B6SA 4M8NE 4XWYA 1NATA 3EAFA 4DSAA 4FGLA 1T6XA 1A95A 2P4HX 1IWPB 1JSZA 2W6OA 1EXNA 2XQKA 1CUCA 4IDGA 4QAQA 3EVBA 1STOA 4HTFA 5B30A 2TS1A 1EBFA 1B7GO 3GZTB 3X1YA 2IYRA 1JHOA 3O3MB 3WRXA 1E4YA 4GKVA 5P8WA 3GDHA 3HL4A 5K0BA 3PEVA 4ZU1X 1RYEA 5K6AA 3A32A 3PX7A 4HD8A 3FZQA 2ZYRA 2QL6A 4OFWA 3R9XA 2X6QA 3H86A 2MSDB 1CNFA 1O6FA 3ZH9B 2WM2A 2VF8A 3JQRA 4TL6A 2BP7B 1W44A 2R8ZA 3W8FA 1MX1A 2QT9A 2AB0A 1WCWA 1EQ2A 1Z2AA 2JLBA 3GRPA 1Y42X 3TSZA 1FU7A 3C3XA 4LEIA 3RREA 1A69A 2KMLA 2AW5A 3T52A 1MX3A 3B6KA 1C4WA 4Y98A 4JZYA 1C7RA 2BI8A 3NT4A 2ILVA 2JVJA 3PA6A 1VE3A 3PWKA 3GVHA 3D0OA 3EGWA 2Q1WA 3FGPA 2ECKA 2OB1A 2RAUA 4CI0B 3FOWA 3BH7A 5FQOA 1SIUA 3HVJA 5G1NA 3A1EA 5JWHA 3RIGA 4E51A 3EFEA 1W7AA 2BFNA 5EIXA 4RADA 1RHQA 1W29A 5FEUA 1J97A 5TQ0B 2NNLD 3NVMB 5GMOA 1A9XB 4ZDJA 3AUTA 1YS1X 2LWIA 5CVDA 2ZPTX 3O2QB 1X1TA 1I3CA 1R7RA 3ZWQA 1ATZA 1CRWG 2IK8A 4MMZB 3ZE9A 4TV8A 1D07A 3AF5A 1RXSA 3FJOA 3OM9A 2AF3C 5L6LB 3LL4A 4RDXA 5GINE 2LUOA 4H3SA 3P71T 4TKVB 1IPEA 1Z62A 3LPLA 4FIDA 1NI3A 4L8FA 2B4RO 5BORA 1U2GC 4G5GA 4ZVOA 3NONA 2Z3VA 4LKRA 3T6KA 4YDQA 2XMZA 2PX4A 3V4FA 3N8IA 2WP8J 4ND1A 2A5GA 2YY6A 3OTIA 4GUAA 1I80A 3A6GA 9ABPA 1BVHA 1OV6A 1QZUA 3MYYA 4AF8A 5KYGA 2XNHA 1HLPA 1C9YA 1ECGA 1CUWA 4H17A 4PAGA 3BF8A 3L1HA 2CBXA 4X71A 4CNQA 1QVWA 1OLSA 2BFCA 2VJQA 4KXYA 4YT5A 2Z1NA 3I61A 1SCAA 4C1NA 3VH3A 3GNSA 1NASA 4RD6A 3KWJA 1VLMA 1IJFA 4QL3A 2GM9A 3PQDA 1H1LB 1A1VA 3HLKA 2PSEA 3LDFA 2FWIA 1ZUWA 2BBTA 4LYHA 1A4RA 2MR5A 4FZRA 4IXNA 1N9ZA 1YDMA 4IY1A 1Y5NA 2ZRFA 13PKA 1SOMA 2C5HA 4LJ7A 3PCXA 2YV3A 4RS3A 1AK1A 1PT5A 3KTFA 1WEHA 2V6JA 5I48A 2I76A 1T2EA 3I28A 2OO5C 4X9XA 4X5OA 5I9BA 3HDVA 1W4CA 1H2HA 1R12A 5JS1A 1UZMA 1G55A 1Y3FE 1R9JA 1Z2DA 1FLAA 3IL2A 4Q9HA 5HYVA 2AOUA 2IS6A 3FNFA 2A78A 1DOZA 5D7NA 2BBWA 4JSYA 4BP9A 4UUAA 4BJ6A