1SEPA

Mouse sepiapterin reductase complexed with nadp and sepiapterin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
259
structure length
259
Chain Sequence
ADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords SEPIAPTERIN REDUCTASE
total genus 95
structure length 259
sequence length 259
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 1997-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sepA00
3JQ7A 4DIBA 3DAGA 2H63A 4UAGA 3UAGA 4YAKA 1B16A 2X0IA 1U3VA 4WLNA 4PLCA 3GH3A 5U1PA 4YRAA 3VOSA 1PZFA 1P0FA 1UZNA 3QQPA 5DULA 1TT5B 4P4LA 1CRWG 4PLHA 3F3SA 3WGIA 1QV7A 3U09A 4W99A 1Y8QA 1P1IA 1HE5A 3INRA 2DUWA 2OO5A 5JDCC 4GKVA 4GX5A 2HK7A 2Q4BA 4CQLA 4GMFA 3FCOA 2P2SA 4IY1A 4BNYA 2RH8A 4EDFA 1FDUA 4PLZA 1E3JA 3PTZA 4BNTA 3RAJA 1MLDA 4E5MA 3TOXA 1E3IA 2W4QA 1SPXA 3RUHA 1OMOA 4NDNE 5JLAA 4KWHA 4B4UA 4RF4A 3TZQA 3H2ZA 4NMHA 4W4TA 3HB4X 1ZK2A 1FJHA 5LDGA 1BMDA 2W98A 3ANNA 3FSRA 5I9NA 3K96A 2J3KA 3ZV5A 4R01A 4BQRA 3PWKA 1XDWA 1I36A 2OZPA 2C7VA 3DB2A 4GBJA 4I9UA 1QP8A 3SLKA 4IQ0A 2X4GA 3MJSA 4D45A 1G0OA 1TB4A 3F9IA 2ZB7A 1AUPA 1M67A 3GGGA 3BMCB 4Z9XA 5JO0A 5ITVA 4FFPA 1XYGA 4RQUA 1ZSNA 3A06A 1PSDA 3GN1A 4D0RA 5L45A 5GMOA 1XR3A 1KC3A 2YQ5A 1I01A 4R3WA 2JD2A 4LMRA 1ML3A 4LGVA 1DEHA 1F06A 1N8KA 1OOEA 2C2XA 4R5HA 3WGGA 4TKLA 4OOFA 4BNGA 1PR9A 2O7SA 1H6AA 5DCUA 3DC2A 2YJZA 1AN9A 5JMPA 1JAYA 2JHGA 3LVFO 4WJZA 1BRMA 2DM6A 1KC1A 4IS3A 5L40A 1Y8RA 6LDHA 3DBLA 4BNIA 3L0DA 1DC3A 1UP4A 3DQPA 4I5EA 3DONA 2AXQA 4Q3NA 4XQ9A 2PZMA 3JQFC 2HSDA 3LT1A 1ENZA 2G17A 1QSGA 1ZXBA 4NQZA 1IZ0A 1NP3A 1MUUA 4HX5A 2Z5LA 5KVSA 5JS6A 1YJQA 3K8ZA 4PLWA 4CM9A 4ZICA 4RVSA 4YJHA 4BKRA 3BIOA 3I23A 2JKVA 1WW8A 3NYWA 1I3KA 5JXWA 4BGIA 3H2SA 3ZWAA 3CE6A 4D44A 4BNJA 4XCVA 2IRWA 4IDDA 1N92A 3WNVA 4CV3A 2JL1A 4H16A 4RL6A 4XA8A 3TDKA 2EKQA 1P31A 3HNPA 1IUKA 4Z9YA 3WQRA 2YHIB 3ZV4A 3ZCXA 1YBAA 3GHHA 3H3FA 1UAYA 1LEHA 4UUOA 1ZIDA 4R5MA 4WLFA 3H9EO 4KP7A 2WM3A 2CMDA 2EEZA 4DYDA 1E3LA 1QORA 1UP7A 3C85A 4DQUA 4WKGA 4L8VA 2EG9A 1IB6A 2DU8A 4BKOA 1WDKA 1EVIA 3H9QA 3GA0A 3W4IA 3ZHYA 5COBA 2CDCA 3ZWMA 2EW2A 1I2CA 1M75A 3GT0A 1R0SA 2DVMA 4A5OA 4E13A 2FZEA 3D64A 4TKMA 4ND4A 3JQ7B 3LT2A 4YDRA 4CPDA 3MWDB 3Q3CA 3JQGA 3D4NA 4AJ1A 4MIEA 4CMIB 2ZJ1A 4RJTA 3DR3A 4OYRA 1UH5A 1NFRA 4FFRA 5JW6A 3KOUA 3JQ9A 3D4PA 2HJSA 2VCYA 3E9MA 3ETDA 1ARZA 2WE8A 4ZRNA 4F6LA 1BXGA 1HEUA 1WWKA 1YQGA 2NQTA 1I33A 4OOEA 3OECA 1VL8A 5C3MA 2Q49A 1P9LA 1Q2XA 3E82A 1R4NB 2WYUA 3MJ4A 4CR6A 1ZMOA 5EPOA 1WP4A 4FC6A 2VQ3A 4U8GA 5CPFA 3FR8A 4DGSA 4JP3A 1GZ3A 2O50A 1BDMA 4UVIA 1EBUA 1GV0A 1PIWA 4RPJA 1B0AA 2E6UX 2I99A 4L4XA 4ZA2A 3ETGA 3Q9NA 3IUSA 1ADFA 2Y05A 4OKNA 4RDHA 4N5NA 1VC2A 2G82A 1ZZEA 2VWPA 3CUKA 1BXKA 5IJZA 3ADOA 2ZATA 4E31A 1GPDG 3KRTA 4UUMA 1C0IA 4NFHA 2VUTA 3A4VA 2J8ZA 4RPHA 4MKXA 4XYEA 5A9TA 4YT8A 5DBGA 4CLXA 3PDUA 3BMNB 4CMGA 5C7OO 5B4TA 1T2CA 4IUYA 3FHLA 4YJFA 2RAFA 3W4KA 2CVQA 2O48X 5K6AA 5F1OA 2I5PO 2GUGA 4R9RA 1YKFA 5I8WA 4YAGA 1GDHA 4A03A 3OQ1A 5FF9A 5KJCA 2P68A 1Y9EA 3ENNA 4L4SA 3JD3A 3SLGA 1SAYA 3PEFA 3MOGA 1YVEI 4RZIA 3K5PA 4KQXA 4BNLA 1S6YA 4E2ZA 4NZ9A 3SJ7A 2YHUA 5EMHA 1Z7EA 3FNFA 4EEZA 2VHXA 5CDTA 2ZTVA 5G0WA 4D46A 4CMHA 3GFBA 5BSGA 3P7MA 5T67A 3L6DA 3OQBA 1OBFO 1WXDA 4R3NA 3ICCA 5A04A 4EJ0A 2O2SA 3R3JA 5EQDA 5AYVA 4E30A 2AQHA 1CF2O 1TA4A 4PN3A 4WECA 3ZU3A 3C7DB 1VLLA 4G81A 3ZNPA 2OHXA 4D7AA 4R4JA 2BRUA 3U9LA 3UKOA 3KB6A 3W4JA 3ABIA 3I9OA 3OHSX 3S2IA 2I66A 3EZYA 3WGQA 3UCXA 1TXGA 2X5OA 3I9KA 4J0FA 2YDYA 5AXCA 4PCVA 4A2CA 4HADA 5G0SA 5JBIA 7MDHA 1ONPA 4A73A 3PYMA 4J7CA 3W1VA 3D5TA 2PKQO 2DBVO 1LDBA 2EW8A 3O8QB 1PGPA 1QG6A 2I67A 3AJRA 3F4BA 1XQ6A 4XGKA 3X2EA 3IJPA 1K2WA 3N74A 4MKZA 3DZHA 5FYDA 5A9RA 1QYDA 3UGKA 2HMUA 1YWGO 4YQYA 2X5JO 4ZQGA 4UEKA 3ZWXA 3IKVA 5L7TA 2EHDA 3VH1A 4BMNA 4OAQA 2IZ0A 3AM5A 5L53A 1HKUA 2VZ8A 1U3UA 1G6KA 1HYGA 4QXMA 3WGHA 4TSKA 4GX2A 4DXHA 4ZRMA 5JE8A 4XIYA 1NNUA 5A02A 1WAMA 4EUFA 2ZQYA 4BL5A 3S2EA 1F17A 5IXYA 3FWZA 4BVAA 2ZB8A 2V65A 5BR7A 4OSOA 3RSHA 1LJ8A 1E7WA 3FNHA 4YJGA 3FPCA 1MXFA 4O63O 1LC3A 4ALKA 3IIEA 4CM8A 3CEAA 4PLFA 5DBFA 4KUGA 1MG0A 4IMPA 1EFKA 1EDOA 3RC2A 2IDZA 4WUVA 4PG5A 3KM0A 3H4VA 3E5MA 1P45A 2I65A 5EQFA 2BKAA 1X7DA 3EVTA 1ISHA 5JCXA 3JV7A 1Y81A 4YT4A 3DXFA 3WS7A 5A9SA 4BB6A 4JGBA 4FQ8A 4S1VA 1E3EA 2PD3A 2PV7A 1DJNA 3T7CA 1H2HA 4ILKA 3G49A 4C4OA 1D1SA 1N5DA 3RFVA 4FJ0A 4DPMA 1N1GA 1NTOA 2PA3A 3JYOA 4UVEA 1E7RA 3HDQA 3AY3A 1KY4A 3LDHA 3NEPX 5IDWA 1A27A 1KVUA 5B37A 3CIFA 3JQGB 2RHCA 4IPTA 5JYDA 1W8DA 4J2HA 2B69A 3EUWA 5DF1A 1DIAA 3P2YA 4NHEA 2GNAA 2QYSA 2ZCUA 2BELA 4OSPA 2VYVD 3F5QA 3VPFA 3H8VA 3PLNA 3GG9A 1ENOA 3L77A 1E7QA 1ONNA 3HE3A 1A7KA 3ONEA 4ITUA 4EEXA 1EVZA 4YPOA 5CHEA 5BSFA 1ISGA 3ZZNA 4E2YA 4JQCA 4WCDA 3RASA 4AJHA 2HO5A 3OA2A 2NLOA 2ILTA 1F0YA 1ZCJA 3BTVA 3IS3A 1NFQA 3ZW9A 2XAAA 1NPDA 3DTYA 1U3WA 1U5CA 5JC1A 3VPGA 2BGMA 2HMWA 2WTBA 3NGXA 1DBVO 1U8FO 3DBRB 1HWYA 3O03A 3OF2A 2D2IA 3TOZA 2G0TA 1O0SA 2D5AA 3DAFA 4L9RA 1UDAA 4ZVVA 5IG2A 1GTMA 1V0JA 2UVDA 3R1IA 4BUCA 3R3SA 4FD3A 3PDJA 4CLDA 2O3UA 3ZU5A 2VYND 4XB2A 2B5WA 1E5QA 3UW3A 2JAPA 5T8KC 2A9FA 4RPLA 3WFIA 5A5EA 1PGNA 2VT2A 2J5KA 3HFSA 5A05A 2X22A 3WWYA 4O6VA 2VOJA 2Y1CA 3KYDB 5KWEA 2CY0A 1K6XA 2BI7A 1ZNQO 2Z95A 3PPIA 4NU5A 4XZ3A 4WGGA 3ZNOA 3STHA 4EUHA 2CDAA 4XIJA 1F8FA 1R16A 1DB3A 2QZ9A 1YH3A 1KVSA 4J4HA 5A5FA 4J7UA 4TZTA 2PH5A 5L9AA 1Z75A 4KUHA 1MB4A 2JD0A 4OJNA 1GD1O 1KY5A 3ASUA 2X9NA 4B7XA 3VTZA 5U9CA 2GGSA 4GGPA 3JQFA 1IPEA 1QKIA 2X9VA 5FFFA 3LK7A 3TL3A 2PLAA 5L4LA 1LA2A 2OBNA 4M1QA 1PGOA 1MFPA 1ZVMA 1YS4A 4Y6RA 1V3TA 1DPGA 1GQQA 3B6ZA 3RWBA 4D0SA 1BG6A 2W2KB 3VDRA 1SOVA 2AA3A 4B8ZA 2ZQZA 3TL2A 5JYEA 4HFJA 1X15A 3BTSA 4F46A 4RO0A 5CDGA 4AJJA 3NDRA 3EC7A 3HDJA 1YDEA 1BSVA 3RJ5A 2X8LA 5TX7A 4YAEA 1U3TA 3BHJA 2PH3A 1O6ZA 3INTA 4GX1A 3UVEA 2X9GA 4HWKA 2R00A 5L7YA 3TZKA 1UP6A 4N18A 4HUJA 1D4FA 1GY8A 3A14A 5TF4A 3AI3A 5DDIP 2X86A 2X0JA 5I7FA 3M1LA 1NQ5A 1RPNA 5KKAA 4BO5A 4CM8B 4WLOA 4WOKA 3D1LA 4PG7A 5HBRA 4Q9NA 5H82A 1JA9A 1P1KA 1NYTA 5KIAA 3HUDA 4IDEA 3CKYA 5AXDA 3GEGA 4NPCA 3KLPX 4NI5A 5KJ6A 3PJEA 2YZ7A 3DL2A 4IM7A 4WEOA 3RUCA 1YBMA 4KDEA 2PD6A 4BNFA 3ZU4A 1ZK3A 1E6WA 3DOJA 1DFIA 1NVGA 4M86A 4QUKA 3E6AA 4JCOA 2DBRA 2YV1A 4NU6A 4N54A 4XDZA 3SBOA 3KLMX 2X58A 1U5AA 3RVDA 3CINA 1EE9A 2O3SA 1EBFA 4ID9A 4EGFA 3MCVA 1D1TA 3GG2A 3GMDA 2PK3A 4IGEA 4JBIA 1NQAO 3RUDA 4CL3A 2OORA 1A72A 4P22A 4R9SA 3W8DA 1C1XA 3VKVA 2QZZA 2FOIA 1WMBA 3VPXA 1MA0A 1YL5A 5LCXA 3CZRA 1N7GA 3MJVA 4Z9FA 1IOLA 1JKJA 1K5HA 5IZCA 1L1FA 4PVCA 4AJKA 1EVJA 3Q2IA 1RM3A 4PZCA 4BNUA 2V6MA 4BNVA 3I5MA 1N1EA 5G0TA 3VVCA 3ZWWA 3BTOA 2BF7A 2ZCVA 2NSDA 4YAJA 2DC1A 4WPGA 1DIRA 5JSFA 4BMVA 1PGJA 2VWGA 3JQBC 5TS3A 4GX0A 1R4MA 4IQ8A 1NXQA 1WMAA 3ZV6A 4I5GA 3RFXA 8LDHA 4EZBA 1ZEMA 3WLEA 1GFSA 2POQX 3DZBA 2PKRA 3C3XA 1FMCA 1RYDA 3OA0A 3OEWA 2DQ4A 3GDOA 2YV3A 2IZZA 3MWEB 3R6DA 4FJ1A 3VAZA 4JK3A 1ONOA 1E7SA 4UEOA 2NVUB 2E4AA 2D4AA 3LLVA 5JC8A 4XGNA 3JSAA 3IC5A 2ZTMA 5JAIA 3AK4A 5LDHA 4RQTA 1XGKA 1IPFA 4AJEA 1LSUA 5ER6A 3PFFA 4G5HA 1Z45A 3FI9A 1E3WA 2X7HA 4IDAA 2VWHA 3VZQA 1PS9A 5KJEA 2D5CA 1UXGA 4U6SA 3WNQA 4ALJA 1V9LA 2NWQA 1PQWA 2BD0A 4DWVA 3HN2A 5B1YA 1JWAB 3WOHA 1YB1A 2NV6A 1ZFNA 1PTJA 1GPJA 2HMTA 3U49A 5KVCA 4JBHA 1PWXA 4BGVA 3AOEA 2OMEA 3PJGA 2NTVA 2G5CA 4LCJA 5A3JA 1DO8A 2DAPA 3AU8A 3UH1A 1IHXA 1QYCA 4Q39A 5G4KB 4EJMA 2PZLA 1SOWA 5THKA 1EDZA 3WMWA 3EW7A 4IDBA 2VZ0A 3ONFA 1PJSA 3WFJA 5CG1A 3NJ4A 4CLRA 2WD7A 4WEQA 3OP4A 2PGLA 5MGBA 1N7HA 3D3EA 1NAIA 1F12A 2YQ4A 4TVOA 2VHZA 4CQMD 3ZW8A 4XEHA 2O4UX 2X6TA 2Y0DA 1E77A 4PLPA 1CQIA 1QMGA 3UOGA 3ROMA 2PR2A 1ZO8A 4M55A 2EJWA 3EZLA 2BH9A 2XXBA 1DJQA 1NHGA 1X13A 3Q2KA 5DNAA 5LC1A 3I9LA 1BW9A 1PJ2A 1H2BA 3KXDA 2ZTUA 1B8PA 3ZWCA 4CR8A 3DFUA 4DVJA 2CVOA 1R66A 2UUOA 1GYQA 9LDTA 3LU1A 1HZJA 4BNHA 5EN4A 3WJAA 2Y93A 1UUFA 1K6JA 3GUCA 3IL2A 4BGUA 5TJ9A 1DLIA 1ZJYA 3H5RA 4BQPA 3NV9A 1Z6ZA 4BOYA 9LDBA 1BXGB 4MP6A 4YWJA 3P19A 2CVZA 3AU9A 1CYDA 3QHAA 5T64A 1ULSA 1I10A 3LSYA 1SC6A 1KIFA 2E48A 1BVRA 4GMGA 3FNEA 3V5NA 1OFGA 1HDGO 4IJWA 1U28A 2I9PA 2HK8A 2PKQP 1YL7A 2JFHA 4MVJE 4JIGA 2VHWA 3E9NA 1C1XB 1UJMA 4A0SA 3K73O 4IMRA 2C0CA 5IXSA 4JXKA 4BO2A 4DA9A 5TT0A 4A27A 4YCAA 4FOOA 3AW9A 3PYXA 4OKIA 3HG7A 4J4BA 3GF4A 3DMYA 3WMXA 1H0KA 3OEYA 3GVCA 1X0VA 3F5SA 4WCFC 4CLOA 4E32A 4RZHA 1GV1A 1VSVA 3AUUA 3IOYA 4FGWA 4K6FA 4XR9A 3ENKA 4AJNA 2Y0EA 4E2XA 4BO4A 1SBYA 1QLJA 1ADGA 5DCYA 4II3A 3MZ0A 4E2WA 2GN9A 3MOIA 1AE1A 3NDIA 1C0LA 3L4BC 3EAGA 4ZQHA 4AJ2A 4DBVO 4ZQEA 4RPKA 3RU9A 4E21A 1DC6A 1YXMA 1VPDA 3LC7O 1YB4A 1KVQA 4TROA 4J90A 1ZJZA 4OXKA 3ST7A 3HDYA 3TRIA 3JQ8A 1H94A 4IIUA 2OUIA 3DFZA 4J9UE 3PHHA 3PI7A 2R2GA 4Y67A 3BMCA 2FPPA 3L6EA 4CMEC 3A1NA 1JQBA 2BGLA 3LLSA 1LLUA 4DIFA 3DMTC 3GPIA 1ZUD1 3O9ZA 4QFDA 1C0KA 3WTBA 2DPHA 4RLSA 2E37A 3U3XA 4JJFA 2EKPA 4CLHA 4NFYA 2Y1GA 2GLXA 3PZRA 5U4QA 3K6JA 4HFMA 3DZJA 4A10A 1ISMA 4Y8VA 4GWKA 5KNLA 3QVWA 1W0CA 3WGOA 3OIDA 2WD7B 4K6CA 1T2DA 3E48A 4CQMA 4DLBA 1NVTA 2C07A 2PNFA 3OJEA 4E5YA 3EVNA 4R69A 4JLWA 4PG6A 1JKFA 3ITKA 1XCBA 3PQFA 5TGDA 2ZYAA 2IYOA 1HF3A 4YRDA 2GDZA 2PY6A 3GUYA 1IYZA 1DRWA 4AG3A 2J3IA 3FPLA 3FF4A 2AG8A 1XA0A 3TZCA 3JQ6A 2EJVA 3WBBA 3KYCA 1E7YA 4XQCA 4K28A 2HDHA 2NADA 4M8SA 5HRUA 1UZLA 1GYPA 1LQTA 4MKRA 1ZXLA 4GGOA 3RC9A 3VKUA 3FTPA 1E5LA 4B79A 4Q3BA 3E1KA 4TMFA 5IFLA 3ASVA 1E6EA 3FWNA 1QYXA 2EERA 3DZFA 1TT7A 4DIOA 1CJCA 2VYNA 3I52A 3ZHXA 4R1TA 4DQXA 1B15A 2P9GA 1K0UA 3JQAD 5IAAA 3G1UA 4Y6SA 4CMAA 4JNKA 3DDNA 4IZHA 5L4NA 1JKIA 4WCFB 4BNWA 2HKIA 4W9NA 4XYLA 1HE3A 2DPGA 1E3WB 2EF1A 2TMGA 3DMTA 3WGZA 1L7EA 1LSJA 4O59O 3KZVA 3ULKA 1GQYA 4BGEA 2DBZA 4HFRA 3U62A 2AEMA 2GO1A 2NVWA 3DAPA 1EQ2A 5TT1A 3GNTA 2FPIA 4ND3A 3I9NA 3ZV3A 4J1TA 1EQUA 1SB8A 3AOGA 3HFGA 4HY3A 4D79A 2OGUA 1P1JA 3NRCA 5BT9A 3HB5X 4XRGA 3AFNA 4DPLA 2JCXA 1VL6A 2RBEA 5CEFA 4IIVA 2VN8A 3ADPA 3H5AA 4TZKA 1HDCA 1O9BA 3JD0A 2F1KA 3GVHA 4TWRA 3UFXA 1BGVA 3WR5A 2WEKA 4E0BA 5HS6A 1P74A 4L4RA 4NIMA 1GUZA 3OMLA 1J6UA 4GLOA 1XQ1A 3KO8A 4GQAA 2Q1WA 1V35A 4CLRB 2CD9A 2VRCA 3PQDA 3NUGA 3SC6A 3VPHA 3F46A 3GZNB 1PJ3A 4NJMA 1JTVA 4D41A 2AHRA 2VOEA 3ROQA 3BXXA 4AJ4A 4URFA 5I7SA 4Z0PA 1CERA 3JQ8B 4BNZA 1M66A 4BHTA 5I7EA 4U0KA 4PIVA 1SB9A 5ENVA 2AEFA 3QVXA 5G0VA 3RQSA 1FK8A 1V6AA 3WTCA 3IQDB 5GZ6A 1R37A 1R0LA 1Z82A 1MX3A 1JVSA 4YACA 1K89A 4TRMA 3C1OA 4JROA 3JQAA 3K31A 5EJ2A 4TVBA 4PRKA 1LNQA 1LLDA 2GYYA 1Y6JA 2ZKLA 3DBVO 3K9QO 4CV1A 4YTEA 2NTNA 3V2GA 4IBOA 2Y68A 1HDXA 3WSWA 1C0PA 3SC4A 2PZJA 2EGGA 3HHPA 3OM9A 4XX0A 4WLUA 1GZ6A 1Y5MA 4AL4A 4HKTA 3QRWA 4RORA 2JAHA 1YL6A 5JMWA 2C82A 1E6UA 3F6YA 2F00A 1LLCA 1T26A 3GGPA 4JJIA 4GPD1 3A28A 3GAFA 3NGLA 2IZ1A 2O3QA 1UDCA 1TI7A 4ESOA 4RDIA 2Y1DA 5C7IO 4DC1A 3QSGA 1BVUA 4QTZA 4K1LA 4OQZA 4CUJA 4E33A 4CUZA 1SO8A 3WIEA 2Q50A 2UAGA 5ES3A 4WNCA 2HJRA 2Z1NA 1OAAA 1U7TA 2OBYA 3UXYA 4IJUA 4KTTE 3GQVA 1VM6A 2YYYA 4GKBA 2WD8A 1IY8A 3Q6IA 1DIBA 4OMUA 3GVIA 2LDXA 1I2BA 5T5QA 1XKQA 1VJ0A 3ZWPA 3PWZA 4FGSA 1ZSVA 2FRDA 2Q1SA 3IP1A 3N58A 4ROSA 2Q3EA 5BNIA 2QRLA 3SXPA 3JQ9C 1R12A 1T25A 3FRJA 3GK3A 3OFSA 4NBWA 3ICPA 1D3AA 4NJOA 1ULUA 1VE9A 3ZU2A 3QVOA 3GPDG 2ZB3A 2NM0A 1DFGA 2CDBA 4H15A 4Y6PA 3KETA 2OXIA 5CEJA 3NTOA 4ZQBA 4I9HA 4XQEA 2BMAA 4BKQA 2PZKA 5JDIA 2VTDA 4AJOA 2FR8A 2GN8A 5G4LA 1I0ZA 3EK2A 3ZH2A 4GAEA 3O26A 3TSCA 2ZJ0A 2XXJA 4QO7A 1V8BA 4BV9A 4GH5A 3AY6A 4J16A 8ADHA 5JAMA 3I9JA 3ON5A 2W2KA 4XR4A 1LRKA 5EIOA 2AE1A 3RUAA 2FPGA 4B3IA 5BNTA 3UUWA 2DTDA 4FFOA 1K3TA 4IINA 1PJCA 4D42A 1YO6A 3I4FA 2UDPA 3I3OA 3MJEA 1OC2A 1PJTA 5JO9A 5BQFA 1NWHA 1VSUA 4DTIA 5IZ4A 2BFMA 1DC4A 3DHEA 3DHNA 4F3YA 1DOHA 5FWNA 3QVSA 1I5RA 1D7OA 2WSBA 1SMKA 2W90A 1OZAA 1Q0HA 2OP1A 3ZI0A 1F14A 4J9VA 1C1DA 1HLPA 3K92A 3OJ0A 3UCEA 4CODB 4PG8A 2NU9A 4G2NA 2IEDA 4BO6A 2G76A 1U2DA 2W2LD 4OHUA 2DT5A 2BGKA 4IXTA 2GD1O 3ZN2A 2DTEA 3H65A 4LISA 4ZN6A 4FN4A 1JLLA 4XRRA 4RVDA 5C7LO 1BHSA 2CF6A 3GAZA 2QRJA 4WNIA 1PQUA 4ALMA 2D0IA 3K30A 3NT5A 1HSOA 1KOLA 1R0KA 1I30A 3QLJA 3ROPA 1BXZA 2WE7A 5EL0A 3IKTA 2GN6A 4FFLA 3RROA 1P1FA 2X23A 3F47A 3VC7A 2Q99A 1WNTA 1EFLA 2B36A 2JCVA 4II2A 3OICA 3GVXA 3VDQA 3WX0A 5CDUA 4YYZA 3C7CB 3ROKA 1IL0A 1YJ8A 2VWQA 5A9SB 4IGFA 5BNFA 3OIFA 4ND1A 2AW5A 1KEVA 3ETEA 4FJ2A 2ZK7A 4MINA 2HK9A 4QX6A 4HP8A 3QY9A 3B20A 3E5RA 3GEDA 1DSSG 1JVBA 3U5TA 3DBHA 2NUAA 3ONDA 4XYBA 2RIRA 3PZBA 5AOVA 2QRKA 1A4UA 2GERA 3U4IA 1LC0A 4MIOA 4YEDA 3ZWNA 1LUAA 4LSMA 2G1UA 3OSUA 2NU7A 4M54A 4Q3EA 1V3UA 4OXNA 1TLTA 3OH8A 4NFSA 2HMSA 3ZNNA 5AXAA 4E6PA 2QW8A 3FBTA 1KEPA 1MGOA 2P5UA 2IEBA 5JAZA 1I3LA 2GR9A 4OXYA 2FHSA 4W9NC 5TSDA 3WIDA 5ILOA 5JPIA 4Z3DA 1B14A 2XF8A 1U4OA 2IE0A 4TRJA 5DP2A 2QQ5A 4YXFA 1A9YA 2BFOA 3GEMA 1GQ2A 3BMOB 4KZPA 3VH3A 4B4VA 1ZK0A 3ZHZA 1LDNA 1M2WA 2J5RA 2YW9A 2XPCA 4U5QA 5CG2A 5IDQA 3GZNA 3JD4A 4PFJA 3JTMA 1QR6A 1DRVA 2I6TA 1ISFA 4MP8A 2AE2A 1I8TA 3UF0A 1YQXA 3AI1A 4O5OA 3L4BA 4BO7A 3C24A 5C5IA 2HUNA 5CEEA 2VT3A 2EGHA 4BO0A 3HWRA 2YY7A 4B7UA 1T4BA 3MEQA 2VTEA 3HJAA 1C14A 2GCGA 4PLVA 5TRTA 4EYEA 1Q1NA 1HDYA 1SZJG 4PZEA 4YAIA 5JDCA 3VVBA 2D59A 2CSUA 3GDGA 3WJ7A 1SNYA 3EY4A 1KEWA 4AJPA 1T1SA 1G0NA 2B37A 5G2OA 3JYNA 4I9NA 5TIIA 4TQGA 3KHUA 3QE3A 3P2OA 3S55A 1NPYA 2B4RO 4DREA 3OQ6A 1CIVA 4BO9A 1JDJA 1EUDA 2ZTLA 2Q2WA 3JD2A 3G1TA 2C2YA 1GAEO 4P38A 3IMFA 2NTJA 3MJTA 2EWMA 3UCFA 1LSSA 1GEEA 1H6DA 1A5ZA 2UUPA 4CM3A 4YRBA 1ZH8A 4TRNA 2BFAA 1FDSA 1WZEA 4B7CA 4GL4A 2CNBA 3CTMA 5B4UA 3RUIA 1TVEA 3AM4A 3B1JA 1QLHA 5KCZA 2O4CA 1YBVA 5JCJD 4EBFA 1R15A 2H9IA 2V6BA 2YFHA 4PRLA 1LLQA 1K6IA 3DOOA 2X0NA 3O4RA 4L75A 3B1KA 1Q0QA 4LVUA 3O38A 3H9UA 3E03A 3RKUA 1AXEA 4MP3A 5CFZA 1B8UA 3G79A 3PHGA 4QFCA 1QXSA 1DRUA 4ZJUA 5KOIA 4J91A 5JAQA 4OO3A 3IAHA 5TLSA 2C5EA 1LQUA 1UR5A 1WZIA 1PU2A 2OFPA 3B1FA 5IF3A 4IJVA 1GUYA 1HYHA 4R51A 1P33A 2H1SA 2I76A 1Z74A 2W2LA 4GSKA 4IS2A 4BNXA 3GFGA 5KKCA 4PLYA 2C5AA 3GLQA 1NX6A 2SCUA 3CZMA 2HAEA 1NBOA 2AEJA 2RCYA 4OQYA 1IULA 3ZWYA 4CUKA 3EMKA 4I1IA 5IN5A 3H3JA 1B26A 4JP2A 3GRKA 4S3MA 3JCZA 3VHRA 3D3WA 2QHXA 4J6FA 3JQBA 1U8XX 3DWFA 2VUUA 2J3HA 1E0DA 2Z1MA 1LX6A 3KTDA 3PLRA 3T4XA 3TQHA 5C37A 3QW2A 3K2EA 5DBIA 3D4OA 4E3ZA 1PS0A 3VZPA 5A03A 2EIHA 3GN2A 4R16A 3QWFA 1V3VA 3QJ5A 4LK3A 2H5LA 3FBGA 3T4EA 4P4NA 1U2GA 4RF2A 2PTGA 3PVZA 2P4HX 3SX2A 1DIHA 1SCUA 3EYWA 4NJMB 4YQZA 2FP4A 5HTOA 4AJLA 2NVBA 3M2TA 5DP1A 5I8ZA 3WQQA 1GCOA 1W4ZA 1QV6A 1GCUA 2P91A 3M6IA 1NFFA 3PWSA 3M2PA 3LZ6A 4CM7A 1H6BA 1A7AA 1LI4A 4BS9A 1I3MA 1KYQA 1PZGA 4CJXA 3MTJA 4JJGA 1X1EA 4RVUA 4WLVA 3FTNA 5CPBA 1EMDA 4CR7A 5DT9A 1GADO 1O8CA 1MV8A 3DZKA 5AXBA 4DQVA 2VUSA 1QRRA 4U0JA 5JFOA 3F1KA 5JY1A 4Y98A 1PL6A 4C7KA 1SEPA 3QWAA 2A94A 4NNJA 4YBZA 4XYGA 4A26A 2D3TA 5ENDA 4L74A 2GN4A 4F6CA 4E4YA 1DIGA 1LDYA 1T4DA 3H9GA 4KWIA 1NAHA 5DCWA 3OETA 3PYLA 3QWIA 4L76A 3RC1A 4J4TA 5F5NA 1VKNA 5ITWA 1MXHA 5DZSA 3V2UA 1T24A 2QIOA 2C20A 3QIVA 3C8MA 4KMSA 1JW9B 3VH4A 3Q9UA 3MJCA 1PL8A 3HADA 1UXKA 4MVJG 4BNMA 5ER9A 1M6WA 3HZZA 4FFMA 3TF5A 3IDSA 1NR7A 4FCCA 1Y8QB 1PJLA 3KBOA 1FXSA 2V7PA 1XELA 4B3HA 4NBVA 2Y67A 3JD1A 4RCVA 1J5PA 4FIZA 2P5YA 1UZMA 3NDJA 4N5LA 2A4KA 3FN4A 5DOZA 5H83A 1Y1PA 2GZ3A 3V1YA 4J3FA 2FR1A 4B3JA 4Z6KA 3JQCA 1EVYA 1GYRA 3L9XA 2R00C 1QYVA 4FW8A 3WWZA 4CLEA 4M87A 1JU9A 1YGYA 3JQDA 2X5KO 3WICA 3PHJA 4ZU3A 2BLLA 1A4IA 1T2FA 4R68A 4W6ZA 3RU7A 2Q45A 3H9JA 5HA5A 1O94A 3U0BA 3KYCB 4KOAA 1ID1A 1KVTA 3BMOA 1X14A 2O23A 3H6KA 2NU6A 2PGDA 5F1KA 4H3VA 1A9ZA 1CEQA 4I5FA 4R1SA 5CDYA 5K6AC 2P9EA 1CQJA 2NNLD 4J0EA 4K9DA 5A3VA 5K9ZA 2HLPA 4XDYA 2PWZA 3PIDA 2VNAA 2IODA 4KQWA 1RM0A 5HWSA 3CMCO 3RKRA 1KVRA 2C54A 3P5SA 1E1MA 4P8RA 4BO1A 1ADBA 1ENYA 1KBZA 4ZHSA 3K2BA 3ZGYA 2B0JA 4A7PA 3W8EA 3AY7A 1KS9A 1ISJA 1MC4A 1C3VA 2D8AA 3KSUA 3NTRA 4I5DA 5DOVA 4I8XA 4IDGA 2EV9A 3D5QA 2W8ZA 2OOSA 1U9JA 4CMBA 1NPTO 4B4WA 2A35A 2Q1UA 1X7HA 1HTBA 3QV1A 1GEGA 5IZCC 5MDHA 2JHFA 2FSSA 4M49A 1C1DB 2LDBA 1NWCA 1ZBQA 1CETA 5ADHA 1MP0A 3Q11A 1VJ1A 1I32A 1Q7CA 3KV3O 4AJIA 3S2GA 5I9MA 2EXXA 1XIVA 4WLEA 2CUKA 4YJHB 2Y0CA 1GL3A 1YDWA 1H6CA 3E9QA 6ADHA 4YT5A 4HBGA 1W6UA 4XB1A 4J7XA 2V6GA 4R54A 2NU8A 4LSWA 4ZD6A 2IYPA 3GC6A 4INAA 1DLJA 1PGQA 4OM8A 1OI7A 2PGJA 4HXYA 3F1LA 2FWMX 4FC7A 5L3ZA 3INGA 4NK4A 1YONA 1ENPA 2VRBA 4Z0TA 3AFMA 4RLHA 4CM4B 4MVJH 2J5QA 1HETA 1MFZA 3TNLA 1PEDA 3I6QA 3KEQA 4CM1A 1T1RA 4Z0HO 1PJBA 2GSDA 2H6EA 3B70A 3W6UA 3RUEA 1UXHA 1HLDA 1NR1A 2QX7A 5JCJA 1P1RA 4LW8A 2WWRA 2B35A 2BHLA 3RUFA 1RWBA 2GASA 3CXRA 3TZHA 1J49A 3RFTA 1L7DA 5F3RA 2YDXA 1ZKMA 4LMPA 3G0OA 2WYWA 2VYVA 1NQOA 1YQDA 4D43A 2HQ1A 3D3WB 1GR0A 2JFGA 4YJFB 4CMIA 3GMSA 1X7GA 1XU7A 3NT4A 1EZ4A 4MDHA 4QQRA 3AUSA 2WDZA 4HNHA 4QEDA 4CM6A 4Z3KA 1XEAA 3JYQA 5F21A 3VZSA 3FD8A 4MJLA 2HCTA 2O3RA 3GNSA 1LDGA 4NBRA 2A92A 3WXBA 5B4VA 1UDBA 3IUPA 1EUCA 1JWBB 1OC4A 2CZCA 4M89A 1PQPA 3LC2O 1ZEJA 1ZW1A 1VKOA 4BNNA 1LXCA 4J1NA 1G1AA 1LRJA 4LVCA 2AQKA 4YR9A 1O5IA 4MIYA 3PHIA 3SJUA 1B8VA 1HZZA 5JNLA 1E3SA 3BZUA 4IZIA 5L95A 3GHYA 4QSMA 1BDBA 1P1HA 3NAQA 3QA9A 3FR7A 4FR5A 1ZK1A 3V1TC 4JX8A 4FPXA 4O1MA 1I24A 4U6QA 1AXGA 3PJFA 3LC1O 3OJOA 2PD4A 4LRSB 3TPCA 1R6DA 1HL3A 3BHIA 5ILGA 1PJQA 3OIGA 4FDAA 1B3RA 1XU9A 2QYTA 3NJ8A 5EESA 4EUEA 3H5NA 5FEUA 2DFVA 3F4LA 4RVHA 3TFQA 1Y5RA 2DTXA 4MVJP 1UAGA 2Y99A 1YOVA 1CWUA 4ND5A 4YA6A 4CMCA 3I4CA 4GVXA 5BSEA 1DXYA 1WPQA 5F1PA 2WJPA 1DAPA 1HSZA 1Q0LA 3LT0A 3OJFA 1E1NA 3PP8A 3O8QA 1TEHA 1X1TA 2FMUA 1LBEA 1FF9A 4J1SA 4W7IA 4DYVA 4K26A 3I83A 4D3FA 3EDMA 2XOXA 3S2FA 3NX4A 4RF3A 3H7AA 5ICSA 1AHHA 1NM5A 1CDOA 2FN7A 4WK6A 2CF5A 3ZWBA 1ZMTA 1JN0A 3DZGA 4DUPA 3A9WA 1E7MA 3TFOA 3ORFA 3ANMA 4PGFA 4XD2A 3KYBA 1AHIA 3PQEA 3LYLA 4IDFA 4IXWA 3G3EA 1U4SA 4J2OA 5EINA 4QO8A 5TQVA 1H9AA 1D8AA 3WQSB 4CM4A 2B83A 4AVYA 4UULA 4MVJA 2HU2A 5G0UA 4JN6B 5T8KA 4WCFA 1E1KA 3T7EA 4YB8A 1JAXA 3KUXA 4WE3A 5AVOA 3WDSA 4GVLA 1NQTA 1O95A 2AQ8A 4CMJA 4EI2A 1ZSYA 2P4QA 2Q1TA 4D3SA 5I7VA 4ONEA 2GF2A 1PS8A 5COAA 3RBXA 1KERA 3I9MA 4UUPA 3VPSA 1VI2A 3QP9A 3CPSA 2NQ8A 4PLTA 2C7GA 3ZNQA 1T2AA 2EP5A 3E18A 1FDVA 1UXIA 4LN1A 3RBZA 1ZK4A 2AMFA 5GZ3A 1ISIA 1DDOA 1HDZA 3S1LA 3C1AA 1H5QA 1EEHA 3C7AA 3KVOA 2FY8A 4PG4A 1YB5A 2OP0A 4BV8A 1VJTA 4Y9DA 3GRPA 3CSDA 5TJHA 2Q4EA 3KEOA 1T2EA 1BW9B 3IP3A 2O3TA 4CV0A 4OL9A 4UVHA 2GPTA 3KSZO 2NVUA 3RC7A 2VNSA 3PIIA 4HV4A 2OL4A 2JD1A 5EERA 1IHYA 3NT2A 4NG5A 4EITA 1VL0A 3ZWVA 5TNXA 3JQAB 3I6IA 3BAZA 4NR0A 5CP8A 1Y7TA 2J3JA 3RCBA 1B2LA 2ET6A 4J1QA 4F45A 5JDIC 5F5LA 1H9BA 3WB9A 1F8GA 2R6JA 3QVTA 3L07A 4Q3AA 5GY7A 3D0OA 1HT0A 1S7CA 3ZDFA 3DZIA 4YVFA 2ZB4A 4LCEA 3SEFA 3HN7A 1PZEA 3OBBA 1H93A 1MC5A 4XYMA 3VH2A 5TC4A 2AQIA 1HXHA 1O89A 3R0IA 2HRZA 3LF1A 5L4SA 4OH1A 4DPKA 4CMKA 3JYLA 2YFQA 2DFDA 2WMDA 5G4KA 4J49A 1YRLA 4X54A 3AUAA 5A06A 4CLOB 5ICMA 4JBGA 2X0RA 3RIHA 2EP7A 3AI2A 2JFFA 4C7JA 1LTHR 2O2YA 4CL8A 3GDFA 1XWFA 5BSHA 1WDLA 3KSDO 1YOVB 5L51A 4U7WA 1GZ4A 3SVTA 1DAOA 1E1LA 3L6OO 1IE3A 4BNKA 3RD5A 2PFGA 3Q1LA 3VZRA 3RI3A 4DLAA 4RVGA 3CH6A 4G65A 4WOJA 5A1TA 4YT2A 2Y66A 4DL9A 1LRLA 2DLDA 2C59A 1U7HA 3DHYA 4XGIA 1HDOA 3EGOA 4DMLA 1Q7GA 2ZIZA 4ALLA 3BHMA 5A4DA 1DHTA 2BFPA 5IN4A 1Z7BA 1HE4A 3PGXA 3BMQB 4NH4A 4TRRA 4GWGA 4CMEA 2DUUA 3M1AA 1RKXA 1HYEA 5L7WA 3BYZA 1HDRA 3IJRA 3NKLA 5KTKA 1QYWA 5H81A 3BTUA 3LT4A 2BI8A 4BO3A 2GRAA 3DBRA 2GZ1A 1DC5A 3WGYA 5T6BA 3LF2A 3FNGA 3TWOA 1TT5A 3UHAA 2DBQA 2YHIA 4D3DA 3JQEA 3Q0EA 4GSLA 1EUZA 4Q3DA 1PR3A 2I3GA 3PRJA 4KTVE 4RVFA 2TMDA 1KETA 1Q7BA 2FZWA 3PFWO 1N9GB 3GY0A 4LRTB 4FS3A 3ZHBA 3C1TA 4KUEA 5COQA 1UXJA 3KYDA 4XJTA 1PZHA 1P77A 3G17A 3MTGA 2HMVA 4R1UA 4RGBA 3V2HA 1PJ4A 1YE3A 5FI3A 4IQGA 4WASA 3TZ6A 3PXXA 3W8FA 2O7QA 4OGWA 2RHRA 4E5KA 1LSOA 4DRYA 1LDEA 5FI5A 3AOEC 3U4DA 4YJGB 3WSVA 2JCYA 2Y1OA 3CMMA 4FOSA 3PGJA 1I2ZA 1DHRA 3AWDA 2FSVA 5KJ1A 2VHVA 2B4QA 3TN7A 2D1YA 4PLGA 3WLFA 4DMMA 4YJDA 2Q2QA 2E82A 4FBGA 3AUTA 3L4SO 1X0XA 4OIMA 3UN1A 4KDFA 2Q46A 5IDXA 1HE2A 4BIIA 5I9LA 4NBTA 3L9WA 4ALIA 1EK6A 4MVJI 4MVJD 2QG4A 1M76A 1WDMA 3HDHA 5IDYA 5B12A 4H7PA 4ALNA 1RYEA 4GI2A 1J4AA 3S8MA 1NVMB 3GR6A 3DEYX 1BWSA 4J43A 1XHLA 3E8XA 4L0QA 4B8WA 2RH4A 4L73A 2Y1EA 4UREA 2HRBA 3GOHA 2V6FA 3DBLB 2YV2A 1FDWA 3DBHB 4P4GA 5CAEA 2NACA 4CQMB 4NBUA 1XG5A 3GZ4A 3HQ4O 3N7UA 3QWBA 4DC0A 2CFCA 3BMNA 2AG5A 4RV9A 4N5MA 1PX0A 4ZGWA 1U1IA 1I3NA 2ZYGA 3PJDA 3COSA 4RPGA 3WGTA 3DO5A 4MVJM 2O3JA 1W73A 4UVDA 2IXBA 4CQLB 1MG5A 2UYYA 1FDTA 3PHLA 1SEVA 4W82A 5T57A 5AQ1A 4BMSA 4MPDA 2X1HA 1P0CA 3BA1A 2VRCD 4AFNA 1XSEA 2YUTA 1EK5A 4HFNA 3WBFA 5HM8A 4NK5A 1Y9AA 3WYCA 4EJ6A 3UICA 1GUFA 2EKLA 4Q3CA 5JY6A 4GLLA 1ADCA 1Z73A 3GVPA 1GU7A 4FFNA 2GZ2A 4XJSA 4I08A 2UV8A 3PK0A 4CV2A 3ITDA 5DN9A 5HS4A 3EHEA 3RBVA 4BKPA 1EE2A 3U4HA 1IZ9A 4EW6A 2Q2VA 4O0LA 1J0XO 2C29D 4UUNA 3OJLA 4AICA 4R41A 2B5VA 3WYBA 2WYVA 3WYEA 3TJRA 3X2FA 3BMQA 2B4TO 4QT0A 1A71A 4UEJA 1P3DA 1AGNA 2VZ9A 2P9CA 3U4CA 2J6IA 2ZYDA 4MO2A 3GNQA 1NASA 3V1UA 4FSHA 2Y1FA 3QWHA 3LQFA 2E49A 3JYPA 1M6HA 1PL7A 3HSKA 1R4MB 3DTTA 4CM5A 5J23A 1LU9A 1KEUA 3ZWOA 3GGOA 4R1NA 3VTFA 5K0ZA 1RM4A 1DFHA 4QECA 1ORRA 2I3AA 3W6ZA 1R4NA 3NTQA 4BB5A 4IJKA 1Y8RB 1RJWA 7ADHA 1N2SA 1WVGA 1XLTA 2DKNA 4PZDA 3WG9A 1N9GA 4RF5A 1BTOA 4B4OA 4MOWA 2VHYA 4DLLA 1WLYA 1LDMA 4UVGA 1VRWA 1NHWA 5GZ1A 1B3BA 3D7LA 4ND2A 3V8BA 4ZQFA 1PWZA 3ANLA 1RM5A 4N7RA 4E12A 4BKUA 4E5PA 5KVVA 3I1JA 4MVJF 1B7GO 4PVDA 4FB5A 3AM3A 5KJFA 4W7HA 5CDSA 4XQGA 2JJYA 3DOCA 4DBZA 5KVQA 4CM9D 1E92A 4XWYA 5THQA 4E5NA 4XKJA 4HNGA 3RJ9A 4BO8A 1P44A 4IDCA 2FR0A 2IXAA 1HRDA
chains in the Genus database with same CATH superfamily
4RH3A 4DIBA 1U0SY 3G2KA 1XZBA 2HCFA 2QT0A 4YP7A 1AVTA 1YS6A 2X0IA 4G1CA 4PLCA 3GH3A 1RI3A 4YRAA 4QYIA 4LA4A 1KORA 1PZFA 1ZOOA 1DQZA 3P4UA 3E2PA 3SEQA 1SU6A 2CYCA 3I32A 1UZNA 3QQPA 2YOFA 2AJLI 5DULA 4DNFA 2RIPA 1WB4A 3GP5A 1ZJ6A 3F3SA 3WGIA 1QV7A 2GD0A 4E03A 3I5XA 4AZVA 4LHSA 3GRRA 1P1IA 2I4LA 3E05A 1HE5A 5CUQA 3STWA 4RTPA 2ZZNA 2OO5A 3ETHA 3OSZA 1M5RA 4M0DA 1X1DA 1IZYA 3M4ZA 4NENA 4NCHA 2VQDA 4ZI5A 4D99A 3D3QA 1ZRHA 3BGSA 5CA0F 1OT5A 4BFWA 2UVQA 3K16A 2FGJA 2ODEA 3B3QA 5KWSA 4C5CA 3RAJA 4E5MA 3P2JA 1U9ZA 1Z5ZA 4RCZA 1TM7E 1KMQA 3D8RA 1W5FA 2GBPA 2W4QA 5A3SA 1R5JA 4N01A 1PNVA 1ZBDA 1RSZA 5EMKA 4D81A 1C7RA 1OWOA 5LDGA 5JVDF 2G71A 3NIWA 4O29A 3JZIA 2PRZA 4FZVA 5JZBA 3KVVA 5LZ2A 5AOBA 1VYHA 2H8KA 2WLTA 3ANNA 1UKBA 4QZVA 3OHPA 4JB2A 4AZTA 3K96A 1S2DA 4F4DA 5I9NA 2BMVA 1Q22A 2GXQA 3O8OB 4MPTA 1I36A 2X3UA 5TF0A 3FMFA 3E22A 1FCJA 3ZCTA 3DJYA 2I1LA 1A9XA 3K0EA 2OGSA 5G40A 3T9CA 5M29A 1X19A 5B2FA 1CKEA 2ZSBA 1W5AA 2JGDB 3BMCB 4Z9XA 4HAUA 3HWWA 1ZM7A 4UHCA 1ONBA 2XBLA 3OT4A 1R88A 3R3XA 4FFPA 4XM0A 2XT9A 4DUYB 2O59A 4BC0A 1ZSNA 3CLRC 3EBLA 1DV2A 4JXXA 2BZGA 3RK4A 3JXEA 3PCTA 5AK6A 1W46A 2Q27A 3W1WA 5CK4A 1U90A 4TSRA 5ITZA 1H5NA 1I01A 4R3WA 2RGCA 2JD2A 2YQZA 4X92A 1ORWA 4RJKA 5G41A 1M34B 1N8KA 1VCOA 2JJMA 3AHJA 3AP1A 1SOMA 4EENA 4OQLA 2F2TA 3OLZA 4OOFA 4BNGA 2EG5A 3CV3A 1R10A 1M2VB 3DC2A 2YJZA 3FCUB 3N6RA 5IM5A 3TDNA 1QFMA 5JMPA 2FLWA 3N07A 2JHGA 4B2YA 3URKA 3IURA 1BRMA 1BN7A 2DM6A 2JGIA 2XDYA 4IS3A 1VHLA 5L40A 5JPCA 4M9SA 2P7HA 2XNCA 5H68A 1QCDA 1VMIA 3DBLA 5HCIA 2F9MA 3L0DA 3TLGA 3ZHOA 4EHHA 3HXQA 4I5EA 2J4CA 1E0KA 4GL2A 1UZUA 5EMMA 3LT1A 3VSBA 5KDOA 1GVHA 1CR0A 1T9CA 3ZVRA 2G17A 1NXOA 1QSGA 2A1UA 1XRQA 3UJDA 2JFUA 1MUUA 4HX5A 4M76B 4IDQA 5JS6A 3IELA 5CNIA 1OXTA 3E8SA 4PLWA 4DKXA 1FNNA 2GFIA 4YJHA 1RAEA 4YGXB 1EK2A 3DDCA 4Z51A 2QDXA 1WW8A 2L19A 5H70A 3VNSA 2BEJA 3LUAA 3I6YA 4NBKA 1I3KA 3W79A 1E9AA 1H0RA 3ZWAA 2BFDB 4ECEA 4XPIA 5FAXA 1O9GA 4D44A 2ZUSA 3NHPA 4PAMA 1CFJA 2ORIA 2DPLA 3R3ZA 4WBNF 4XLLA 5EZYA 1CUVA 2EAUA 2INGX 3L1KA 4Q1VA 3LNTA 1FTSA 4YJ2F 1JPVA 1V1MA 2H16A 4IJ6A 3VA7A 4KAFA 3T3IA 3D0KA 4JJ6A 4RL6A 1J7KA 5ALPA 1ZC3A 3IHLA 4JP5A 3NJRA 4JQSA 4M36A 3HNPA 2VDWB 3TIXB 3ZV4A 2Y27A 3H3FA 1UAYA 2MR5A 1ZIDA 2XR1A 3WLNA 4DCPA 1JJVA 4JDUA 1YBHA 1QORA 1UP7A 4U2GA 2ATEA 4WKGA 4L8VA 3MYRA 4Z9BA 1VLJA 2XHZA 1FQOA 2EG9A 1IB6A 4K05A 3X1MA 2IP4A 1WMSA 2DFLA 3EARA 4ARIA 1MQ9A 1UFOA 4LRUA 4RA9B 3EGEA 3ZWMA 3GT0A 1A88A 2ZRMA 3PVSA 4GIBA 4OFWA 5D7NA 4ATNA 3ROGA 2FZEA 3X44A 1RJ9A 4C4SA 2D2XA 2P1ZA 3DUWA 4C0AC 4RGYA 4D3XA 2VF7A 3D4NA 2JH9A 2C5LA 4AJ1A 5DX1A 4WD3A 3KU4A 4LGCA 1QDLB 4CMIB 4F3CA 2HRRA 4EW2A 1BZYA 4OYRA 3ESYA 4FFRA 4F8YA 3FHTA 1RWQA 5JYCA 5L3QB 4NULA 5EKDA 3RC8A 2H07A 4QXOA 3D6NB 3LCRA 2BKUA 1FYXA 4G1BA 1RWPA 3ZE1B 1Q1AA 1R8YA 3GJ4A 2NG1A 3QVGA 2PXCA 2ZJ4A 1O54A 4TTRA 2B82A 5D5HA 5A4KA 4PV7A 2Z8YM 4R1QA 5GV8A 4R6WA 4HT3B 2PUBA 2EKBA 3ZZ1A 5KNCH 4QT4A 3KPJA 1IC6A 4DM7A 1C0EA 1LH0A 5C3MA 1L7RA 1XDZA 5ICGA 3HR4A 1XNQB 3E82A 2BEWA 2WYUA 3MJ4A 5LXTF 1A9XB 1JXQA 2NSHA 2VDLB 3EGXB 5EPOA 2IZ5A 4FC6A 4HDMB 1HI9A 1WB6A 3AEUB 4LQLA 4YP6A 3TCNA 1F6WA 2QAIA 3HCBA 2Z57A 1RRKA 3KD3A 2O50A 4UHHA 3PUVA 1BDMA 3CUWA 4PS1A 4UBKA 2FHPA 3G6WA 3LHDA 4KO3S 3K9WA 3HL4A 5KPJA 1L5ZA 3CG4A 1JAIA 2I99A 5A7FA 4NZOA 1OQAA 4D82A 2H4HA 4DJTA 5JZOA 3OZGA 3DT6A 1VC2A 2Y3IA 1YIAA 2G82A 1EGHA 3CUKA 3GRZA 4NCIA 3D81A 2MMGA 1BXKA 2XB4A 3TDMA 1OX4A 3ADOA 3R9KA 3FGOA 2ZATA 4C05A 5DXJA 1GPDG 1EGAA 3KRTA 3QI2A 5DTQA 2WF9A 5BSKA 4U4AA 1SOUA 2IW3A 2VUTA 4XYEA 4AZSA 3J81k 1QGAA 4YT8A 1O6BA 4X9XA 4JLAA 3L0PA 4M1KA 4NE7A 4WADA 3BRWD 1QCZA 3L6BA 1O94C 5C7OO 1XQWA 5IFKA 2OLKA 3G7UA 5C1PA 3FJYA 4OQMA 1T2CA 2C0QA 3FVQA 2BTOA 3EISA 4YJFA 1C4XA 2RAFA 1UT8A 2YYAA 4M88A 1J2YA 4QREA 2FN9A 3U0VA 4NYMR 2PVPA 2AL7A 3GAMA 4GP6A 4BV2A 4QDOA 1YKFA 1Y4SA 1YZ3A 2GF9A 2V9CA 2HBYA 1P73A 4WNAA 1DBIA 3SF0A 4A03A 3JX9A 5FF9A 2ZULA 4WY2A 3TLJA 2ZVJA 1Y9EA 3IBYA 3WIBA 3PEEA 4P9NA 1X74A 1HFWA 1YFKA 4H27A 1QH1B 1SAYA 1L4UA 3PEFA 3QEMA 1VLHA 4IOMA 5ALSA 1QRAA 1V9CA 4KMOA 1KRHA 3LO5A 4OB7A 3TINA 3PL1A 4BNLA 1NVDA 1Z0ZA 4IX9A 4UXHA 3RS8A 1CS0B 4E2ZA 2PXXA 3W78A 4YUWA 4H1UA 3IJ5A 4HDNB 4KLZA 4XPIB 3ZDBA 4EEZA 2VHXA 1U1DA 4FYJA 3UXEA 4LAFA 4D46A 2XA9A 3LLCA 1DAMA 1JLSA 1QNLA 4LIPD 4XSVA 5LDDC 3P7MA 1OFHA 2ZUVA 4I2NA 3LS2A 1FU8A 2A58A 4R3NA 5KNBD 3ICCA 2ANBA 2GARA 1SC9A 3OCWA 4EG5A 3TOSA 1VYVA 4EJ0A 3R3JA 2V98A 2CXNA 2L2QA 1R8JA 2ZROA 2BGNA 2CXHA 4WECA 1S2LA 3C7DB 2H9YA 3COPA 3H1FA 5TPZA 4C22A 5LSAA 1PR5A 4FN5A 1ILWA 3DE7X 1MEEA 2BRUA 2W2XA 2AOXA 4QBGB 1NV9A 5JZ9A 3INYA 3LC0A 3U9LA 1E66A 3R20A 4PIPA 4RS4A 3FY4A 3UKOA 5FUMA 2ZYRA 3ABIA 1SVOA 1W2WB 5F51A 1XX6A 1GXSB 2MIIA 2I66A 3OE5A 1U2QA 5EIHA 3HVJA 2CSXA 5HKLA 1RCUA 5JR3A 2BTEA 2DY0A 3UMGA 2R751 2ZWAA 4PCVA 4OI4A 5DV9A 5G0SA 1ZRMA 4A2CA 4G4IA 1M8GA 3M6WA 4Q02A 4A73A 3PYMA 4Q47A 5AHRA 1EBBA 1JAHA 1KK0A 1FP2A 1UDWA 4HRYA 4Z7OB 1G7RA 1TK2A 3G89A 5I9BA 4ZYYA 1LY1A 2JLUA 4PYNA 2I67A 1YZLA 5E38A 5KDDA 3ZDEA 4CI9A 1LCIA 2I6QA 2XTAA 3F4BA 3O7MA 3NHJA 3SS8A 1Z5WA 3X2EA 3IJPA 4R71A 4MGYR 4HH3C 2A0WA 2JNWA 3N74A 2ZIAA 5JSZB 2YRWA 3DZHA 5FYDA 1E2EA 3H3XA 2LXNA 4ARZA 2QZ4A 3SFZA 5JV5A 4RZ3A 5JSQA 4ZQGA 5KYUA 5B1EA 1Z4PX 3KHKA 4C6RA 3DV9A 4F8EA 2EHDA 5J4KA 2OXEA 3EGXA 3ED5A 1J24A 3AEUA 2ZSHA 3G2QA 4GRIA 4MB0A 2B92A 2V3CC 3EX7C 1Z3IX 1NJ8A 1W0KD 4FZJA 1HKUA 3E3OA 3D0QA 1RMYA 4DLSA 4YRIA 3GRYA 2CFSA 4FGUA 2UXDB 1L2TA 3NG1A 4G41A 4TSKA 3WNCA 1HFEL 4DXHA 3ODPA 4QC2A 3PEUA 4G1MB 2QI9F 4P5DA 1JIJA 2MWMA 2H06A 3NU1A 1W4CA 3Q5EA 2O2XA 2ZQYA 3AETB 1OX6A 5FLKA 1DDGA 1V4NA 2CNOA 3UM9A 1TM3E 1F17A 2WP0A 5JD4A 3FWZA 3FYUB 4MR9B 3RLFA 4LHZA 4BVAA 2ZB8A 2V65A 4TOIA 3FNHA 4KHZA 4KR2A 3SK0A 1MXFA 1J99A 2WJ4A 1LC3A 5EJ4A 1K7XB 3IIEA 4INJA 4RA6A 2YXDA 4PLFA 5DBFA 2QD2A 4YECA 3AERB 1NBAA 3R23A 2XUKA 1M8JA 5DBOA 4IMPA 3LQQA 3RC2A 4WUVA 3H05A 3BFVA 1RCFA 3KM0A 5F2KA 2PVSA 4MW6A 4POOA 2KPOA 3T7SA 2I2WA 4QPNA 4TWZA 1X7DA 4MV9A 3AHFA 5BYBA 3WS7A 4XOIA 5CGQB 5A9SA 2CMGA 4WNAB 4N39A 2PD3A 1S1MA 1CUUA 2QAGA 2JAUA 3GJZA 4TYMA 5EWLA 3UMVA 1W5BA 4CCWA 1UOPA 1SU8A 2VT7A 3JATA 2DULA 3OZWA 2XQIA 1H2HA 4KLAA 4JJ8A 4CEIB 4ES6A 3PD7A 2O0HA 3C15C 3IXMA 2A9VA 1QFSA 4FGLA 1N5DA 2ZYIA 1ZGAA 2R7AA 3TR6A 1YFZA 1N1GA 3JYOA 1R9JA 5EMJA 1RADA 5KSYA 2G7MC 2GBLC 3LDHA 3NEPX 1GZVA 5ERGB 3TGLA 5IDWA 4EHAA 1CPYA 3FUTA 4LECA 1KI8A 1KVUA 1NDHA 1WLSA 3JQGB 5KQMA 3BGOS 3I9V1 4EIWA 5B3KA 1ZC4A 2QX4A 2B69A 1Z63A 2YS7A 2OQVA 1BCRB 5TQ0A 2JFWA 2JLRA 1T3LA 4GP9A 3REQB 1BVYF 2CCGA 4HLDA 4K8RB 1YTUA 1AMOA 3LA6A 4KAJA 3MUFA 3H8VA 3WV4A 3CB4A 1ZHOA 3PCXA 5JJCA 3O95A 4GBMA 4DYHA 3DE3X 1ONNA 2DMRA 1A7KA 3T3NA 3VX4A 1AUXA 4YPOA 3D31A 4YCLA 5CHEA 5LP6F 3OX2A 4BY9E 5C18A 2RB4A 2G83A 4JKOA 4JQCA 3SX4A 2FP3A 4AJHA 3LBAA 2NLOA 5FBWB 1HUQA 1ZCJA 3QJYA 4OEHA 1NFQA 1ZCFA 4BP8A 3PDHA 1TTPB 1ZH6A 3I6ZA 2PA0A 1Z0AA 1NNSA 2HMWA 5CLLA 2K87A 1DKMA 3NGXA 1U8FO 3OF2A 4CCSA 3S4YA 1YS2X 4RE5A 1O0SA 1RC0A 3CUVA 1M34E 3WL3A 1OAKA 2Y2VA 3GFRA 4LF5B 3CN7A 2Q2OA 4D8TA 5K4GA 5C8ZA 4MW0A 4HUQB 2UVDA 3R1IA 2FX3A 4EKYA 3COZA 3R3SA 4Q5IA 3Q8XB 1NI5A 4RVOA 4E46A 5JJKA 3ZU5A 1QF7A 2Y1XA 4XB2A 1E5QA 4D4IA 3FKSD 3M5PA 4RPLA 1BC5A 3UWMA 1RRMA 2BMDA 2C9CA 3QBDA 3WFIA 5A5EA 1XD8A 2J5KA 2IH4A 1ZRSA 2X22A 2XUZA 4DBLC 2XEDA 5KWEA 1VB3A 2R7MA 2GQ0A 1H0HA 3AUFA 4HQ0A 4OLFA 1M0EA 4XQ0A 1V48A 1XZNA 4G9GA 4WGGA 3B2EA 3ZNOA 3VR4A 4EUHA 3BDVA 3HVUA 1YZTA 3VR4D 4J4HA 4PFQA 1YMVA 3A9RA 3R5TA 3U3RA 5A5FA 4RTSA 1NXPA 1ORDA 1PV2A 1Z75A 2NO4A 1WMEA 1MB4A 1UBEA 2PH5A 3KZNA 4M0CA 4OJNA 4AMYA 5U9CA 1B93A 4IIGA 3KOYA 4Y30A 1QKIA 4Y9RA 4UTPA 5IUNC 4ZHQB 1SCIA 3Q8LA 1XHEA 4HDRB 3LK7A 1CNEA 2GBIA 2Z8XA 4XM1A 1D6MA 5EGNA 1Y4UA 3C98A 1JEQB 3J7AC 2DWOA 2PZGA 1PGOA 4MUYA 1BDHA 2JRLA 1JFSA 1FMFA 4R8RA 3MN1A 4YRKA 4OK3A 3RWBA 3A31A 3LCJA 2W2KB 4JR1A 3I2HA 3P9PA 5ADHA 1JR2A 2CNWD 1X15A 4FEEA 2AFRA 1DTEA 2CNLA 2XWPA 3BTSA 4F46A 1TFRA 1NC1A 3EWSA 2WPDD 3HVRA 3SHOA 3LOQA 1WU7A 2IUYA 3BM5A 2FMXA 4H35A 1EWYA 4L5IA 4O2RA 3RJ5A 2IVZA 1X2EA 3INTA 4C7VA 2HWKA 3VKFA 1YV9A 4HWKA 5F4ZA 1V4VA 2FAXA 2R00A 5DHRA 4N8SA 1C7FA 3NRBA 1WQ4A 4N18A 4JHLA 1X7ZB 4RX1A 2IH2A 3EMBA 2IOYA 4QEZA 4EVIA 1D0VA 2X0JA 4FHFA 5I7FA 3CB2A 2IITA 4TYQA 3A6DA 1SR8A 3L0YA 4PGMA 1LW6E 1U31A 5KYXA 1E2LA 2HLNA 2PZ8A 4CM8B 1WEKA 3BIFA 4C4ZA 5HOEA 2RE8A 1JU3A 4WOKA 3UK2A 2WTEA 3AX6A 2OKGA 3K9NA 3QOWA 1NJFA 1P1KA 1XTSA 1BAPA 4QA9A 2H2IA 2DUJA 3RREA 3VGPA 4R8MA 4RV5A 3RABA 3R5KA 1A8IA 1MW9X 1GTG1 4NPCA 3KLPX 2EKDA 1OW3B 4NAUA 2C4KA 4QNMA 5AW6A 4KNYA 5GTDA 1ODKA 2YZ7A 3HS3A 3O3OB 4WEOA 3RUCA 4O4HF 4BNFA 1KAHA 2AH5A 4XGRA 4C5AA 2J5BA 2F6RA 2QVZX 4KQKA 3ND9A 1TF5A 4S0ZA 3UHJA 2DEUA 1VE7A 3WK7A 5SZHB 1S8FA 2QNBA 4GG1A 4M86A 5DM4A 3FBWA 5C8YB 2OYSA 3R5HA 3HLKA 4AY5A 2DBRA 5SY9A 3N2NA 5D87A 1U80A 3PPVA 3SBOA 5IJ0A 1KYZA 2X58A 3RVDA 1NBEA 5DWDA 3CINA 4CG0A 5C5DA 5MN5A 3T9DA 1EBFA 2Z1DA 5IW8A 5JI2E 1D1TA 2B6HA 2RBGA 3GMDA 1V1RA 2PK3A 1CUBA 4JBIA 1Y3DE 1NQAO 3AINA 3RUDA 3ADCA 3LY8A 1UQUA 4PAGA 1HKHA 2OORA 2BSQA 4O4JB 1APBA 2GWHA 5LA6F 1XTVA 3UV3A 1QRUA 2QZZA 2NYVA 5AVZA 4JC0A 1WUKS 4HDAA 1RVDA 3VPXA 3ZE2B 5FBHA 1MA0A 1YL5A 4F60A 5LCXA 2QTLA 4M37A 1PEKE 4DZTA 1JHQA 1R0RE 4ZPJA 1JKJA 4JVSB 4D9GA 1F5NA 2K2QB 3CF2A 5IZCA 2GDJA 4PVCA 4Q3OA 1EVJA 4DJFC 1ABEA 2IOFA 1OUMA 1XZAA 2HCJB 3IA7A 1P62B 2EQ5A 3HYSA 5FNVF 3H4IA 4FOPA 1H5UA 1N1DA 3T1TA 2X1LA 1U0EA 5D3MA 4N3GA 2CZQA 2NSDA 4LOAA 4YAJA 4WPGA 5F9HA 1DIRA 1PGJA 2ZIWB 3KPYA 5TS3A 1KZ6A 1WV0A 4R8KA 1R4MA 4IQ8A 4ZC8A 1NXQA 2B7CA 3OY2A 2C8LA 3ZV6A 5GVRA 3C14C 3K0KA 4M53A 4EZBA 1UF9A 5G1NA 2IZOA 1NLUA 3B13B 3WLEA 5BMVB 1UKYA 1GFSA 3AY0A 3HUTA 3ILVA 4FKMA 2PKRA 3CVYA 1EK0A 1RYDA 4X84A 2RI0A 4V02A 2D7DA 2ZJ5A 2IZZA 3IAFA 3R6DA 4FJ1A 1ECJA 3VAZA 6YASA 1SUBA 1GAWA 2HO4A 3G1WA 3KR9A 4M0MA 3RVQA 3IE0A 1LD3A 3QFRA 4ZREA 3A1DA 4KPUB 4B6JA 2FDCA 3JSAA 3M9WA 3AK4A 1WG8A 4NV0A 4AX8A 1RC8A 1IPFA 3EQ6A 1QDEA 1WBJB 1BYUA 2HA3A 2GCIA 4B71A 3O1LA 4G5HA 2RAPA 2DKFA 3FI9A 4U3JB 3OC6A 1HRKA 1N2CA 3D8HA 3VZQA 5CT6A 1USKA 3O92A 3KOWA 3NP9A 4N7BA 5KJEA 4ALJA 3T1HB 3N8KA 1QK5A 3QA3E 2I7TA 4GECA 4W8OA 4G5YA 3RNLA 3WLIA 4PSAA 1YJBA 3HN2A 4U7JA 3LUPA 1DZIA 4PR0A 2ZDGA 2VPYA 1F2UA 2NV6A 4MVCA 5UKDA 1JLHA 2GEVA 3W5VA 3MD9A 2CJPA 5EJFA 4PXSA 3ZJYA 1RWNA 2YBDA 3L4KA 4IV0A 5AKXA 1PWXA 3AOEA 2OMEA 1GDDA 3F6SA 3JRXA 1YULA 3O31A 3PJGA 4X6YA 3Q1KA 4J3NA 4OH7A 1E4EB 1VG0B 1BE6A 1QYCA 1U9CA 3PKJA 4PO8A 4EJMA 2FFJA 2OZVA 3NWOA 3EW7A 2O0MA 3PR1A 1Q7RA 2JI8A 1PJSA 4MUEA 4OCZA 1QE3A 3WFJA 1NJ6A 4QYXA 2AI2A 1OSNA 1PNQA 3R5FA 3WK5A 4B3MB 2GETA 2II6A 3FPBA 1A8QA 3RS2A 4BBPA 1N7HA 5MGBA 3UMYA 5TPWB 4JMLA 2AMJA 4C4PA 1HYQA 4DKJA 3QPWA 3D8BA 3I73A 4BN5A 3QKSA 4PSUA 1DKOA 3SEAA 1XTJA 2Z3VA 5JSUA 2ZJYA 1WBBA 4BJ1A 2O4UX 4C0JA 2QPTA 4HNSA 3C16C 1E77A 2F1OA 1MD9A 2QDKA 3IV9A 1OIWA 4K3VA 4QQKA 1A69A 1QMGA 1TUGA 2C9ZA 2PR2A 5SICE 3UOGA 4DQ0A 4GPAA 1UJ4A 2BH9A 2XXBA 4WN9B 1JPUA 1Q15A 3AFIA 2OCYC 3I9LA 1H2BA 2D1SA 2VPXA 2WVJA 4N65A 4TLLB 4CF6A 1EM8B 3DFUA 4RANA 4DVJA 5KVAA 2JANA 1UUFA 3OPVA 5HKOA 4AYTA 1KMMA 5TB5A 1L5YA 1QRSA 2NU8B 5A2QA 5DYTA 1US8A 3GA7A 3NV9A 1T4CA 1TJNA 2P40A 2HCRA 2CL5A 1VIYA 3BWEA 4NCBA 1E5DA 1F2TA 1Z8DA 1TOAA 5B58T 1C2YA 1BXGB 1I7DA 4C76A 5T64A 1YQUA 4YQEA 1ULSA 1G20E 1CUSA 1KIFA 3MGAA 4FDTA 2E48A 3AUJB 2WUFA 1QIDA 3KPUA 4Q1EA 3V5NA 3CWZA 3C3WA 2B98A 5D3MB 1HDGO 1GKUB 4IJWA 5HDQA 3UGJA 3LX8A 4ER7A 1STOA 2HSWA 3TUIC 3VU9B 1NVKA 2BSXA 2C88A 2GZHA 5LZ8A 1C1XB 1FX0B 4IMRA 4IVPA 2C0CA 1G55A 4BFCA 3H6GA 4JXKA 1K5PA 4DA9A 1Q0PA 3K8YA 2WU1A 3HJRA 4LDZA 5TT0A 1NW8A 1FBNA 3QXSA 4AQ7A 2H2HA 3AT1A 3LKBA 1AGXA 3CH7A 3AW9A 4L8YA 4MWBA 2ZRAA 2RSLA 1RHRA 3HG7A 4J4BA 4BX2A 1GPNA 3DMYA 4ZDKA 5GADl 1EE1A 3GVCA 1J9EA 3DLIA 4RWEA 4C01A 3STVA 5EUCA 4C87A 2WAYA 1NUUA 4H7EA 5FHRA 5HQTA 4PYRA 4I8IA 3BERA 3BL6A 3EXIA 3NUQA 2ZRKA 1XDUA 3L1HA 4K6FA 4XR9A 2GFQA 2Q3LA 2ZI9A 4PPGA 4PQFA 4BO4A 2C9YA 2AFIA 3LHSA 3AJ8A 3AR9A 1OAOC 1EFVB 2XJ9A 3OFJA 2WIFA 1UBHS 4PINA 5DCYA 4ZAGA 4ESEA 1N77A 3IAAA 4E2WA 4F84A 2QNRA 1DCFA 2ID8A 1X7XB 2X8BA 3MOIA 1FS6A 2OBMA 4B6EA 1EUCB 8OHMA 1FLDA 4J3JA 2RB5A 1G38A 4WZBE 4ZOCA 5JBNA 1QVVA 1DC6A 2G67A 4GC5A 1KI9A 2H4JA 4L16A 1YB4A 4LXYA 4TROA 2QR3A 3R7FA 4K86A 5SYMA 2W7TA 3HBJA 2OHGA 4KIUA 4ER3A 1WUTA 4QJ3A 1H94A 4IIUA 4AMZA 3K1AB 4J9UE 4OBWA 5ALWA 2PNJA 2MYNA 2P9BA 3PI7A 3DXXA 5EEHA 5LBTA 5CIQA 3DTNA 3PVCA 2R2GA 1SG6A 4Y67A 4H1HA 1PYGA 1AS3A 4CMEC 1U0LA 3OMXA 4FI3C 3V4OA 4QXRA 2VHUA 2BGLA 3O84A 3TTUA 1QHYA 4ZT2A 3A6GA 3M49A 2SKEA 1ZUD1 1T9BA 2DPHA 2JZOA 3R41A 4RLSA 3QPCA 2JPDA 2EKPA 4DC9A 4NFYA 3IXQA 3MF4A 5F2OA 1AA9A 4A10A 1VXRA 3DEFA 4GWKA 4Y8VA 2IW1A 3F74A 5E4FA 5EXPA 3WGOA 3TD6A 3SZOA 3T3DA 1KI3A 1O2DA 3CCCA 1NVTA 3MCZA 1K1EA 1G3MA 2C07A 2LKCA 2PNFA 2GVDC 3OJEA 1YB2A 4P33A 3GCDA 3I2KA 2FSFA 2WHQA 1T8RA 5KYVA 3QG5A 5FWDA 4F1WA 1AF4A 1NNEA 5ALXA 4QQ8A 2ZUEA 3ABZA 1M7HA 2J67A 5EUQB 4N0MA 3LV8A 1WXWA 3H16A 3F6CA 5K1ZA 4B0PA 1V71A 3EVZA 4YRDA 2FWIA 5JNTA 1M5UA 1PD1A 1XTUA 2P5SA 4Q7EA 2JFBA 4WZBB 1DRWA 3QFSA 4NOJA 2CBXA 3FF4A 4N0EA 2XGMA 2I78A 4Q3KA 2NZWA 3TZCA 4XQCA 3CA8A 3DS8A 1N2JA 2NADA 2VCEA 4YQFA 4M8SA 1I1NA 1LFDB 1NN3A 2I2DA 2H1WA 4DNQA 5REQB 1UZLA 3UMBA 1GYPA 2NZ8A 3JZMA 5AVTA 1D0SA 3W5SA 5CCXA 5FJJA 3VKUA 4B79A 1QU2A 2XOEA 4Q3BA 3UJ7A 1D4OA 2D5LA 3FVTA 1Y1TA 3LDAA 3BE8A 5KTRA 1GGFA 3EEYA 3FWNA 4HDQB 4Y0AA 1TT7A 4C3VA 2Q41A 1NF3A 3H1EA 4E1BA 3FWPA 1UQRA 3SC2A 4DQXA 5F64A 2ZYUX 4DNXA 4E1AA 3PUHA 2OCXA 4XUEA 2R0QC 4UHKA 4JJ4A 1W85A 2I3BA 4BVFA 2QP9X 1KKMA 4EI9A 5D7BA 1NMXA 4BUJA 3DMNA 1J9GA 2HKIA 3WGVA 2DPGA 3UTDA 1E3WB 2EF1A 2TMGA 5FNVB 5KQSA 1L7EA 2B4KA 4O59O 3FYCA 3I76A 3KZVA 4FHGA 4EJFA 1XPRA 1E9SA 2UYOA 1WF6A 2BR5A 3IERA 2R7LA 3HXOA 2NGRA 4IQ4A 4BBZA 1W5TA 3EXEB 3PXAA 3C8UA 4URVR 4HEHA 2BDEA 1EQUA 1SB8A 4DSAA 2I6XA 3QIAA 5BT9A 1P1JA 1Y3BE 4BMCA 3HB5X 1T2UA 3FXAA 1UK6A 1ZH2A 3AFNA 4DG9A 5FQOA 5IWAB 4Q1AA 1XT6A 2PCLA 3SZRA 3FTEA 2IA5A 1LS6A 3PUIA 4IIVA 3WLSA 2ZE5A 1VCHA 1CUAA 3M33A 3CR7A 2BPOA 2DFPA 1W88B 1QPBA 4LJ4A 3GVHA 3CF4G 1EX6A 4P81A 4V0OA 4ZOBA 3O93A 3HRIA 1P74A 1Y7PA 5LXTB 1GUZA 3OMLA 1X7XA 2QAJA 2XLBA 4GQAA 4N6GA 2Q1WA 1IIRA 4BECA 1M0WA 1RTKA 3CLTD 3SC6A 4XJXA 2VJMA 2VK8A 1Z62A 2L18A 1CS0A 1DQYA 2QJFA 4AJ4A 4URFA 4Z0PA 1GGEA 2CLFB 2PEYA 1SCNE 4KIGA 2YV5A 1M66A 2RARA 4BNZA 1MJFA 4U0KA 4PZZA 4RESA 5AVQA 5I7EA 4JJKA 3E4DA 1OGYA 4TXNA 1FK8A 3RQSA 1V6AA 3TE7A 1XKTA 3IQDB 4H7JA 4EBBA 3CJTA 5I7UA 521PA 4QTYA 2ATVA 1ZAKA 4YMUA 3EA0A 5ARCA 1GA1A 1IJKA 3BXFA 3HO1A 1MH9A 3C1OA 4RAQA 4ZAXA 3JQAA 5EJ2A 3RVKA 2G9RA 1XAIA 1GG8A 1UDXA 3IEKA 2FW9A 1DS6A 4MUXA 5MGNA 1Y6JA 4CV1A 4N03A 4ZCQA 3EW9A 1FFAA 4BFXA 1GQOA 3EXAA 4Q48A 5BSWA 1CUWA 2NO0A 1WU8A 4GOJA 2ZYWX 4G37A 1IN6A 3DOEA 3IB6A 3OCZA 3RYTC 4CEJA 2PMCA 4EB6B 4UNRA 1TZJA 4GOKA 4XX0A 1AGRA 2AVDA 5JMOA 1ODTC 1IM5A 1D03A 1WZCA 2CCKA 2YWDA 1VMDA 4JUIA 4AL4A 1NKVA 3EHDA 2JAHA 1YL6A 1KSHA 1V7ZA 1U7PA 3F6YA 4Q9IA 4Z9AA 3K0CC 1KKUA 4I4TA 3TM5A 3VHQA 4C14A 2C96A 4U9IS 2A3RA 5EIAA 5EP4A 1FUKA 2LTAA 2K7ZA 2O3QA 3HA5A 1TI7A 3L92A 2GZMA 3W3AD 4ESOA 4RDIA 5LL6P 3R0QA 3IAXA 2XVZA 1CVIA 3KQNA 1BVUA 5AICA 2WICA 4M98A 1L5WA 4OG2A 1YRBA 2OXCA 3HI6A 4ARBA 4X91A 3H11B 2BLNA 2GPWA 2I7DA 3AF4A 3SXUB 1RQLA 1ECFA 4D9EA 1YR7A 1YUNA 1Z37A 2FX5A 2YR0A 3NH9A 3I62A 2AUMA 2MOKA 2HREA 3OPYA 3F3KA 1PUXA 5ESWA 3VZBA 4IJUA 3FOFC 2PUVA 4M1OA 1VM6A 2YYYA 3LRTA 4GKBA 4LHXA 1IY8A 1MQ8B 5H9WA 1JGTA 2LNDA 3GVIA 2LDXA 3L7AA 1XKQA 3VMMA 2MYUA 5IAKA 1J5EB 1XRNA 4F71A 2V4MA 1H1LB 1VIDA 4NONA 4HBZA 1RJDA 3VTFA 1U2GC 1SELA 1VZ2A 2OXRA 1ILEA 2H4ZA 3WNBA 1ZM4A 5BNIA 1NIPA 2QRLA 2HY7A 3JQ9C 1U5BA 3ZY3A 2FF5A 1T25A 5D1NA 5CFPA 2ZUUA 1D3AA 1OR8A 2ADFA 4TT3A 1JE0A 4W5TA 3HCPA 1XMPA 4J0DA 4MUHA 3QVOA 3ZU2A 5FWXB 1XZFA 2NM0A 2CDBA 4Q12A 5CVUA 4UNQA 4BZXA 1KI7A 3DNMA 4ZQBA 1XNHA 2HLHA 4GBGA 3U4QA 1GU1A 3N2EA 5TQ2A 3K6SA 3KG2A 1ZS9A 3PNKA 3QITA 2Q5LA 3O26A 1RAAA 2XXJA 1V8BA 1CZRA 4NEGA 4BV9A 4GH5A 1A5TA 3AY6A 4ZYLA 5AO9A 3I72A 3I9JA 4C2UA 3SOPA 5K0GA 5LOVB 1T5BA 3G2MA 1R9GA 4CIVA 2R66A 1T5HX 1HL7A 2HQRA 2XTMA 4Y6GB 3UUWA 1EU1A 2W0MA 4LV5B 1PJCA 4B82A 1YO6A 2FA9A 3TTXA 1FQWA 3MJEA 3I2GA 4WFKA 3PS9A 4YCBA 3IHWA 3RSFA 1PJTA 5JO9A 5BQFA 1FNBA 5DSXA 1NLYA 4DTIA 1N6LA 5L3SA 2BFMA 2ODTX 3DHEA 4FMDB 1EWQA 1AUOA 5LUBA 1I5RA 2YL2A 3MT8A 2PX8A 4P5EA 5LOVF 2NPFA 3ZI0A 4JSYA 3KJGA 3EIOA 4GZ6A 3K92A 1HLPA 2PRIA 1F6DA 5DASA 2COEA 1O77A 3HDTA 1UZAA 1EINA 2W2LD 2IYFA 4N0QA 2DT5A 4BE7B 1T91A 4XUCA 2TYSB 1N0WA 2EX1A 3T1QA 3X43A 4ZCSA 5HDBB 5BYKA 5FTLA 3Q41A 4NYIQ 3GFSA 2DTEA 4ZN6A 1RYZA 4QD3A 3I2FA 4CKYA 2QD3A 3K0FB 4XRRA 5C7LO 3R7BA 3GAZA 4WNIA 1YR9A 3TSOA 3BUSA 2D0IA 2X8JA 2XY4A 3K30A 4KAXA 4OSEA 1K8QA 1TRKA 3USZA 1I30A 2RFLA 3ROPA 2J85A 2QM3A 5EL0A 4PPNA 1C50A 4EI8A 2EFHB 3DCNA 4NABA 5K3SA 5IANA 2X23A 4GR5A 4AKTA 3F47A 1AKMA 1YI8A 2FVYA 4IUCS 4M46A 3NGMA 5JAUA 1ZRNA 2ZT5A 1FFEA 2JCVA 5JSYA 3OICA 3O3NB 2ODNA 4A8PA 4BVEA 3QEBZ 3GJ8A 3NKFA 2XB6A 3ROKA 3ETJA 3O3MB 1IL0A 4A92A 3KOXA 3P0EA 5BNFA 1DV1A 2AW5A 3ETEA 4FJ2A 4ESVA 3H4MA 3PDIA 3I0MA 3OLQA 3E58A 4B5LA 3AYZB 4NPHA 1KH2A 1VKRA 2VAVA 3ONDA 3UO8B 2RIRA 3OWXA 2AF4C 4IFTA 3SXUA 3OOYA 4MDFA 1S0UA 5J63A 3RRJA 1NZJA 3SIPA 4DRZA 1SOAA 4G01B 1T6ZA 1N75A 3ZWNA 1XTZA 1VP3A 2JDIA 4Y2GA 2NU7A 3C2QA 1YZFA 3OH8A 3L7NA 4YRFA 1C3XA 1NBIA 2D3WA 5CT5A 3PFKA 2XMQA 4TMYA 3TSYA 2NZ2A 2BUCA 2IEBA 5ILOA 1I3LA 4W9NC 5TSDA 2AC2A 2LCIA 3O74A 1H1LA 1L1EA 1U4OA 2IE0A 3K8QA 4G1EB 1CHDA 4ZCTA 5DP2A 5DIFA 4YXFA 3FWKA 2BFOA 1PX2A 3GEMA 4KZPA 1NVWQ 3B1ZA 5BR4A 3ZHZA 2GEJA 2WVHA 2Y1KA 3CIOA 2JIMA 2Z8YA 3AG6A 1MO3A 1E8DA 1W1UA 1AK2A 3DKIA 3ESAA 1R5BA 3FOWA 3O9VA 5BRNA 4D9NA 2PUWA 2XCIA 5EIBC 3JTMA 4AIIA 2EFYA 3BD7A 2FRVA 5EXXA 1QGUB 2AE2A 5CVJA 1IN4A 3ZTYA 1OH7A 4LYGA 4O5OA 4BO7A 2RGBA 1I9CA 1YQ9A 4I3GA 3RRYA 2VTKA 4OYHA 2WNSA 1S8OA 2F3SA 3KPVA 1K63A 3FUCA 3MEQA 1DT5A 4K40A 4B3CA 5JZVA 4TYYA 1C14A 2GCGA 5TRTA 4EYEA 3TLZA 3GCXA 1HDYA 1SZJG 4RE6A 4RY0A 5JDCA 2NXNA 1GCGA 1QO9A 5FX2A 4TUYA 1V16A 2PJRA 1Z18A 1SNYA 5A4JA 4ZEOA 1S3SA 1T1SA 1RI1A 2IQ5A 2Z5GA 4QTUB 1CUYA 1XD2A 1TVCA 1JIQA 3G5MA 3IHTA 5KC9A 4DREA 5KMGA 3OQ6A 1JDJA 4LWPA 1ZONA 2QTFA 1X7ZA 3G1TA 3JD2A 1GAEO 4JQZA 4QGGA 4BE4A 2RG7A 5J2UA 1FQJA 1FP4B 2HUPA 5FBQB 3MJTA 2IYZA 1LSSA 5AJXA 1GEEA 1K08A 2O8BB 2UUPA 4D4JA 1N5IA 1QG4A 4AKIA 2BFAA 1NBHA 1P9WA 1SQ5A 1X70A 2M1ZA 2ZIUB 2Q0XA 4RC9A 5DK4A 4TGLA 5AVJA 5B4UA 1MHTA 1Q1EA 2CUNA 2I9KA 3ND6A 1DXQA 2E1RA 4A2QA 5E3HA 2Z3ZA 3HCCA 4UMVA 1Z16A 2O4CA 3G0IA 4RWZA 5JCJD 3Q8MA 1E2MA 1FJXA 4PRZA 5AJWA 1E63A 1R15A 4PWZA 1N25A 2V6BA 1H42A 5TGZA 3GRCA 3ISTA 4L50A 2E4ZA 2C2ZA 1K6IA 3DOOA 3O4RA 4ZAYA 2HXSA 2V97A 2AJDA 2H1FA 4JODA 3H9UA 3FTFA 3TFWA 4YYEA 1ZA1A 4MP3A 1E2KA 2E5LB 1F4PA 2OCIA 1G17A 2H4XA 2XNJA 1ESNA 1QXSA 3FZNA 4BRSA 2F8TA 4P82A 4D9FA 3NYIA 4J91A 5JAQA 1Z39A 4OO3A 2W6IA 3T7IA 3TVTA 4ZZ0A 1PU2A 1KFJB 2HEGA 4IJVA 2J0VA 4DLYA 1I7PA 1XUOA 3EPHA 1YSCA 1J9ZA 1RBQA 4AN4A 4IS2A 5C4MA 3GFGA 4PLYA 1UFKA 5ULLA 1NX6A 5K8JB 3CZMA 5DX0A 3RFCA 1GKIA 2RCYA 1IULA 2XAUA 1LNSA 4FHEA 2UZIR 2GPNA 1U0GA 2D1RA 3L7IA 1AX9A 1OV6A 3JCZA 1D4AA 4HOYA 4KLRA 4R6XA 3KQQA 2YNMA 4B8YA 1RQNA 3IE2A 1B76A 3BWMA 3E9CA 5F9MA 5EJAA 1Y8ZA 2J3HA 2JIZD 1QZZA 3TQHA 3T4XA 3KTDA 3EF3A 3VV3A 2X9QA 3I0NA 4EVQA 1L4KA 3K6KA 3N2IA 2Z2KA 3D4OA 4HYEA 4E3ZA 1PS0A 3VZPA 1L7NA