3L93A

Phosphopantetheine adenylyltransferase from yersinia pestis.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
NAMITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMFTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of phosphopantetheine adenylyltransferase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 53
structure length 161
sequence length 161
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3l93A00
4CDMA 3D6UA 1J21A 1O95D 5F23A 4MW9A 1OWPA 3FIUA 3Q12A 1KP3A 3G6KA 1WQ3A 3H9CA 1R6UA 3ISJA 1RQGA 3ILVA 4MUKA 5TEVA 3Q10A 3MMXA 1TYDE 1N2GA 2DXIA 2BYTA 1FYDA 1KH1A 1JILA 4EG7A 1GTRA 3AG6A 1JIJA 5J59A 1J70A 1IQRA 4E1AA 1K92A 3SZ3A 1IFXA 4PBRA 2RE8A 5TGTA 3CLSD 1MC1A 1Q11A 1ILEA 2CFOA 2QJFA 4XFDA 3GMIA 4ZT4A 1J1UA 4DDHA 3SZGA 4QREA 3CVUA 4ARIA 1T6ZA 2HGZA 3K9WA 3TQIA 2WQ7A 4AS1A 3LCJA 3K32A 3CR8A 2HZ7A 1P7PA 1M8KA 1KH2A 3IODA 2E21A 3G59A 3IMEA 5LM3A 4DDKA 1XNGA 1QJCA 2A1TR 2DERA 1NZJA 3CVXA 4MWBA 1MBZA 3ZIUA 1LI5A 3CA8A 4MUHA 3AG5A 1EE1A 1F7UA 1JEEA 3INNA 3N2YA 1T6XA 1M8JA 5TS2A 4A91A 3ELBA 4ZCSA 2ZP1A 3E27A 1JZQA 1GPMA 3G5AA 3QTTA 2A7XA 2QJTA 4ZT3A 1JIKA 1YUNA 1EFPA 1OWOA 2A84A 3RHSA 1QU2A 5DASA 4MUGA 4ND6A 2ZUFA 1F4LA 2VTBB 4MLPA 1K4KA 4YP7A 1OWMA 1V47A 2C5SA 2QUHA 1R6TA 3GUZA 1GAXA 2JA2A 1KH3A 3TZEA 3X1KA 4DNXA 3H05A 1J20A 1MRZA 1EFVB 2CSXA 1IHOA 2XRZA 1EJ2A 5H7XA 4MAFA 1J1ZA 1N2OA 4MUJA 3MUEA 4R0NA 2AKEA 1IRXA 1Y42X 4EG8A 1MJHA 1GLNA 4F3RA 5KWVA 3UOWA 1WKBA 5BNZA 3BL5A 1TYCA 2CV1A 3OTWA 2ZUEA 1VBNA 1HYBA 3D6VA 1T6YA 4NAHA 1UFVA 1GZUA 2EL7A 4HK4A 3TNJA 3FH0A 3CLRC 4AQ7A 4XSVA 2D13A 3N8HA 4MWDA 2WB2A 4GRIA 4JYZA 4XFJA 3LOQA 4RUKA 2VTBA 2CYBA 5J58A 1N2HA 1EUQA 1WXHA 1XNJA 4MW7A 3HL4A 3UY4A 3IMCA 3P0JA 1U7XA 4F4HA 1M8PA 1JECA 3P0HA 4YMIA 3Q4GA 1YULA 5LFAA 1I6LA 1S4MA 2A1UB 1JIIA 5HG0A 1NYLA 3CLTD 3SP1A 4OUDA 2A1UA 1ZUNA 1OWNA 1QNFA 1XJQA 2CYAA 1YUMA 4UZFA 1N78A 4R2MA 4U8HA 1WXEA 4MW2A 3RBAA 1IVSA 1NURA 1KQPA 4KR7A 4BWVA 3IVXA 1NSYA 1KR2A 1PFYA 4CQNA 4NDAA 3HGMA 4J76A 4U63A 1Q19A 3TZLA 4L2IA 5TEWA 3FI0A 3PNVA 3VU8A 2RD2A 5IHXA 3CLUC 4S1OA 1XNHA 3I05A 4KKVA 3IVCA 3SYTA 3COZA 1IH8A 2QTNA 2PZ8A 2X3FA 1U0BB 3MXTA 2PIDA 1V8FA 3A4IA 3ND6A 4KR9A 1MB9A 3DLAA 3QE4A 4G5YA 4MVXA 2O5RA 1N2JA 5FO0A 1Q77A 1G8HA 2CT8A 4EF6A 2DUMA 4G5FA 4ZT2A 3CVYA 4MUNA 3ZXSA 4WSOA 4JFAA 1GN8A 4ZT7A 1KQOA 3H9BA 3P0IA 1G59A 4I6EA 4NZPA 4JZYA 1KKUA 3FWKA 4ZT5A 5KHAA 2DLCX 3HV0A 3KFLA 1MB2A 2WQ6A 3VRHA 3IMGA 4MW1A 3CVWA 2CYCA 4EGAA 1OBHA 4UZEA 3S3TA 1X6VA 1T9GR 3L92A 1NUQA 3QTBA 2PZAA 4MUFA 1N2IA 1O97D 1TYAE 2QTRA 1G8GA 5DK4A 4EG6A 5DEOA 3IOBA 2EJCA 2PXHA 4Q93A 2IP1A 5IJXA 2QTMA 3OP1A 1EUYA 1VLHA 2NSYA 1ZJWA 4PBTA 1H3EA 4MW5A 5DB4A 5H16A 4NX2A 1WY5A 3H97A 1TQ8A 3X1JA 3FOCA 4DLPA 4EG4A 4MWEA 3TQOA 1VBKA 1N2BA 1NUUA 3ZUGA 3ZJUA 3M5WA 3COWA 1WXFA 5FO1A 2BTEA 1O6BA 1QRUA 2DEUA 1O94C 3KT0A 3SEQA 2VXOA 2V0GA 4JXZA 1O95C 3FETA 2HMAA 1KAMA 4KPUA 3A2KA 1IQ0A 3GLVA 2WSIA 1YIDA 4RPIA 4HJXA 4MW6A 1K4MA 5FNZA 4ARCA 1R6XA 4ND7A 4ZCQA 1KQNA 5J5AA 2J08A 3UC5A 1O96A 4EG3A 1WZ2A 4MW0A 3UK2A 3ND7A 2IJGX 4HJRA 2YWBA 2D54A 3ZGZA 4NATA 1KP2A 4YP5A 3CLSC 3RK1A 2V0CA 1WXIA 4I6GA 3U1VA 3CVVA 2CUZA 3C8ZA 3UMVA 3AL0C 3HZRA 4EG5A 2Z08A 1ZH0A 4L2IB 4CDNA 1B6TA 4MWCA 1MAWA 1YIAA 2TS1A 2Z09A 4MVWA 1TEZA 1SURA 1MAUA 1M83A 1KORA 5HUJA 2QUKA 2Z3VA 1ULHA 2JAXA 2PZBA 3HFJA 4YBRA 2DPLA 3IUBA 1H3NA 2X1LA 3KT3A 4MUIA 4CT0A 1GTSA 2AZXA 3ZJTA 1K97A 3HMQA 1PFWA 2IELA 1EFPB 4GU5A 2JANA 2J07A 2XRYA 3IVGA 2A86A 4YP6A 4EFKA 2PG3A 1IQUA 2E89A 4G6ZA 4K0RA 1LW7A 1WOYA 3KT6A 4X0EA 4ZCPA 3ZXIA 1F9AA 2E18A 3IOCA 2A1TS 2YXNA 2CV2A 2GKSA 1O0CA 1Q15A 1X8XA 1COZA 1OBCA 3DV2A 1PFVA 1JMVA 3A05A 3COVA 3RK0A 1O96B 4PBSA 4EG1A 5JBNA 2E0IA 1CT9A 2X0KA 1VL2A 3P52A 4WNYA 3DO8A 3F3MA 5KCMA 1H3FA 1NUPA 1ZH6A 1I6MA 3N9IA 4TS1A 1U3DA 2GOYA 1PFUA 3KT8A 2DR2A 1TFUA 3LE8A 4Q16A 1MOPA 1WQ4A 3CLRD 3FNRA 5LLTA 1TYBE 4ZCRA 2AG6A 2J5BA 2PFSA 4H3SA 3AIIA 2YY5A 1WXGA 3FY4A 4R2LA 1F7VA 3PXUA 1WJGA 3COYA 3DPIA 4MVCA 3FHJA 3SDBA 3PNBA 4OUDB 4ZT6A 3ZJVA 2J09A 3NV7A 2B7LA 2O8VA 1N77A 4MVYA 3CLTC 1NP7A 3RFFA 3H99A 2I1LA 4J75A 1EFVA 4U7JA 1M8GA 3MLAA 1J09A 4OJMX 2NZ2A 3IH5A 5AHWA 1PG0A 4P2BA 4DJAA 4FZJA 1QRTA 1O0BA 1QRSA 4NAUA 3X1MA 2H29A 4MUEA 4DDMA 2YWCA 4JXXA 3NBAA 3CLUD 2OV4A 1PG2A 3PRHA 1JEDA 1N75A 2A4MA 2GM3A 2OQ2A 1T9GS 2R5WA 4QBTA 3IDFA 1OD6A 5HUHA 4HPWA 1U3CA 1NI5A 1LI7A 5EKDA 3SEZA 4I6JA 1M8FA 3MLBA 1N1DA 1VBMA 1FFYA 1O5TA 1DNPA 3NBKA 1I2DA 1JZSA 1BS2A 1N3LA 3AKZA 3IOEA 2J4DA 3N05A 4MULA 1I6KA 4KPUB 1G8FA 1D2RA 4K03A 2QUJA 2QUIA 4DE5A 3AFHA 1QQTA 3ND5A 4MW4A 1U7DA 3JXEA 4KR6A 2G36A 1M1ZA 3TS1A 2D5BA 2H2AA 4PY2A 4ZCTA 3FDXA 1O97C 1H1TA 3FG9A 3VGJA 3A04A 1JHDA 1NUSA 2CV0A 4QRDA 2X1MA 3RJZA 2DETA 1QTQA 4MQ6A 1NUTA 5K0TA 3PNYA 1KAQA 3IUEA 1A8HA 1QU3A 2A88A 1N2EA 2QJOA 5K0SA 3L93A 1OWLA 1O94D 1EXDA 1JGTA 1YI8A
chains in the Genus database with same CATH superfamily
3E9CA 4B4KA 2X0FA 1U3FA 5KNBA 3KR9A 4UAGA 2EZUA 2WG1A 5CH3A 3RUEA 5DRTA 1XZIA 4AUEA 3Q12A 4F85A 3AGPA 3TG2A 2PMBA 1ZRHA 2BFAA 1NVVR 4KX5A 3TPCA 3ZYZA 4MDEA 4PQEA 4DABA 3IAM6 1U90A 1QYCA 2WT9A 2W43A 3L4SO 4H7FA 3U19A 1OH8A 2WABA 2GD2A 1XU9A 3DKPA 3PQ3A 4PAMA 5D87A 3TMYA 4INOA 1LK0A 3RNLA 3FYUB 5FTWA 4AL4A 4TLEA 1HFKA 5J59A 3DFMA 5BP7A 4WACA 2FV8A 1ZN2A 1UXIA 4DCPA 4TKVB 2R6ZA 2VRNA 4KCGA 3CLSD 3MOSA 2GBFA 4J4HA 1G4HA 2I4MA 1J9ZA 3LL4A 5DNYB 3K1AA 2CFOA 1TZJA 2YJNA 2E7ZA 3FCAA 1YE5A 3MMNA 4AX4A 5I5GA 5BSVA 1IOLA 5LP1A 1BKSB 1AIPA 1QG6A 3SZGA 4D0NA 5K6AC 4PCLA 3DWGA 1LBSA 2Y9PB 4ARIA 2FZWA 4KAAA 4BX3A 4D9BA 1KMCA 3PK0A 5CXXA 4CGYA 2B1QA 1EK0A 1PJTA 4KQ6A 4D9NA 1T0IA 3P19A 5CFQA 1ZK0A 5J2TA 4UFPA 2E21A 3F9IA 1JKJB 4DDKA 3R9KA 4YDQA 1NN5A 1QKIA 3PE4A 4JJFA 1L4HA 2IDKA 5DN6D 5JPCA 4GOMD 4ZDKA 1DV1A 1MBZA 5BQPA 2JW5A 2QP9X 5FBRB 4WNAB 3DEFA 1JHZA 2IU6A 4WUTA 3INNA 5KTSA 1FDOA 4BVGA 1PQ4A 2AMFA 3N3AC 1A9SA 1ZONA 1OIXA 1VL8A 2Z57A 4IIDA 2P79A 1LPAB 2V7WA 3X2SA 1IONA 5HP4A 3AILA 1LDYA 4ZP1A 1L8XA 4RWEA 4OHBA 1B8UA 3BJZA 5REQB 3T3HA 4KWIA 5EWJB 3A14A 3HBAA 3TEMA 4JOCA 4DIFA 4IDBA 3CR3C 4GI5A 4MRAA 4HAYA 3TW8A 4KLZA 1OFTA 4YP7A 1QF7A 2D6FA 2QUHA 1KKMA 1YS1X 3P1JA 4V38A 4RZ2A 4DC1A 4L73A 5EZ5A 1HI9A 1KH3A 2L82A 5TDHA 2WKQA 3THWA 4Y30A 2HN9A 2HQBA 2R2AA 1SELA 4Q9KA 5TT1A 2UZ4A 4OAQA 1RWOA 4EPWA 5IHPA 1QGUB 1XDUA 1HV8A 3UANA 3ABRB 3FSJX 3OE5A 5HQ3A 3T3IA 5IDQA 4CG1A 1IRXA 4N41A 2XR1A 4NEHB 1VE1A 4ZOLB 5FLEX 6NULA 1GLNA 1PAUA 2DKNA 4G26A 1R7RA 4BN5A 1USIA 2FPRA 3H5IA 2QD3A 3JZDA 3TRJA 3L6CA 2KYRA 1JHUA 2CJYA 1K8QA 3IALA 1N5MA 2J4FA 2HF8A 3TD9A 4V3BA 1FNDA 1T6NA 1JDNA 1IBSA 1OV4A 3JU3A 1YB6A 3Q3GE 4UHJA 3L4KA 4KMOA 2I34A 3NM5A 3X0DA 4BQNA 1DRJA 2ZR9A 4NIMA 1UP4A 3RW9A 5KQSA 3K70D 3K3PA 5MGNA 2Z4TA 3EDQA 4IY1A 2B1RA 5I6DA 4CCYB 3C8MA 3ZIDA 5DNDA 1RAHA 1RI5A 2JEOA 4AJ9A 2ANBA 1VI2A 5AVTA 4OD0A 2EW1A 2AKAB 2VTVA 1GPKA 5JQGB 4QNNA 2RSLA 4DIEA 4RE5A 4IH1A 3M70A 4EO9A 3PITA 1M8PA 1JECA 1RYBA 1ZA2A 2UUOA 3ICCA 1KZHA 1YNOA 1U8FO 1YULA 1LK7A 4J1QA 3MWLA 4ARVA 1SXQA 3NGMA 4DR4B 2CLEB 2ZBUA 2BTQB 3BH7A 3UWOA 3UBTA 2BL4A 3WGJA 1H66A 1ULUA 1U31A 4LC9A 1TAHA 4JX9A 5E8RA 3T3MB 1QHYA 1YCGA 1E9RA 4PSDA 5DT9A 3ZCXA 5B12A 1ZGCA 4I1IA 5JG7A 2CYAA 2H5LA 6AT1A 5KJCA 3HE3A 3DOJA 1PGJA 3WYEA 3Q7IA 5JAHA 3T95A 4MV5A 4ZVOA 1IVSA 4MW2A 2Y3IA 4J7AA 4PXAA 4ZQGA 3KAJA 4TSRA 3U3DA 3Q8WA 2X8BA 5B2FA 4JJ8A 2I7VA 3CF2A 4TKUB 2QU7A 1ZMXA 3MJDA 4CQNA 5CDGA 4J76A 3V2UA 3W7BA 1FNSA 1V6SA 2AD5A 4IDEA 2YJ5A 4MQEA 3BGVA 3ZPXA 1ZR4A 1DKOA 2FR1A 1RPTA 5PGMA 4D4IA 3VU8A 4BN0A 3VNVA 3KP1A 4DHWA 2YR0A 4X20A 3QBDA 4WGFA 3LECA 2DLNA 3VOTA 1YBVA 3Q1LA 4ZAVA 2ZI5A 2VATA 2WSLA 5DM60 2BMEA 2R7NA 2OCPA 2VPWA 2ZXFA 5ITSA 1H0HA 3QEBZ 2DOKA 1SRQA 3B36A 2YV4A 2PIDA 1DOZA 1M5TA 4LJ8A 1Y4AE 4UXHA 3TLXA 5KS2A 2Q6KA 4IZIA 1QRAA 2Q1SA 2ZBVA 1K63A 6PFKA 2O8DB 1PQYA 2J6CA 3G23A 4GOKA 4KR9A 4TZKA 2GZMA 1Q1NA 5TPZD 4CV0A 4KWEA 2P9FA 5CIQA 4JI2B 8GPBA 1FLVA 2R6GA 4C6RA 1NVXQ 1ZD8A 2QI9F 2ZBQA 3Q6MA 4FN4A 2R96A 5KSPA 3VTFA 5HKBA 3FHCB 3IS3A 4K05A 4N6GA 3DMDA 3AKYA 2AA3A 4PYQA 2X5NA 2EOAA 3AV0B 3SC4A 5L3QA 5IANA 1J2RA 1P3Y1 2VT3A 3H7AA 2PGJA 1Z0ZA 1C0EA 4IDHA 4QO8A 3X1DA 1DPGA 4ARUA 3VC3A 1Q7RA 2JKVA 3E5HA 4PR3A 4ZO7A 3R7AA 3SJUA 3T5PA 1EVLA 1W35A 4AVYA 5EFZA 3V5NA 1ZW1A 2XD4A 5EHQA 1DIBA 4HNUA 1E2EA 1J5PA 2RI6A 3D8RA 1GOTA 3TBHA 3HCBA 3VTZA 1K7EB 4UNNA 4YCAA 2JI7A 5G40A 2P6OA 4IRXA 3UH0A 1ZEJA 2BW0A 1BTOA 1GPLA 1GUBA 1G8GA 2VSOA 1KFCB 4LC1A 3D7LA 3LY7A 5FUWA 3TK1A 3UT6A 3TZQA 5LSAA 1EVQA 3PGKA 4XOUA 2PQ0A 3GGSA 2UZ3A 3IOBA 4QOSA 1J33A 4NQRA 4L9AA 5TJ9A 3G5LA 4Z1MD 5C5EA 3L79A 2ZW9A 4BO2A 1T4MA 4CEJA 2BFPA 3G17A 1Q1QA 3THSA 4P4SA 5ALPA 1X0XA 3OECA 1ISIA 3VTKA 2JGNA 5CYPA 3VZBA 3QNMA 4I19A 2BEWA 2B4TO 3ETGA 1QH1A 3I9LA 3A3OA 1MXFA 2Z56A 3LD9A 3QBJA 4B8WA 3ZDCA 1WXXA 1KL7A 1YFZA 3KHUA 2OV8A 4RZUA 2V6JA 4Q03A 4FGUA 3UAVA 3ZHQA 1N2BA 1V16B 2XYGA 4PNEA 5DWDA 1U2DC 5F4ZA 4EKIA 4EB8A 1IJBA 1IMOA 3SICE 2I2WA 4AQDA 4Z7JA 2FX2A 1YVUA 2ZRKA 3AK4A 4INZA 4P2GA 3D8HA 2GZDA 2EG5A 5HWSA 4UJ3A 3CXUA 4CLRA 1Y3CE 1E2BA 4H08A 3JZIA 1KDOA 1X7YB 2ZUVA 3ITNA 1KAMA 1RXWA 1IQ0A 4KN6A 2VPPA 3JATA 5KYGA 3A7EA 3BMOA 4JX8A 1UZMA 1GQSA 3QHQA 2M6KA 1AA9A 5JD5A 1R6XA 3A4MA 2IXFA 3S7ZA 2H08A 1XL0A 4JMLA 1R0KA 3E1KA 3A06A 3MXOA 2FSGA 3I0MA 3QBVA 1LNSA 2YCLA 4GZ3A 4IMIB 1NG1A 3E7FA 4WLOA 2CZQA 2G7MC 1LSOA 4XD7D 5KWEA 1FTSA 1ZJ6A 1JR4A 1ABBA 1KMHA 3O94A 5FWYB 4B43A 1QGDA 4ECEA 1JXOA 2AMYA 2XDWA 1X80B 3G0CA 4QTZA 2M6LA 4LF7B 4CNBA 4JR0A 2BJHA 3OY2A 2ZYIA 4LDPA 4UCXA 2GSWA 1XTIA 5E9QA 3WRVA 4IWXA 1ARZA 1ECLA 1Z4NA 2PZKA 4Z4CA 3NDBB 1KSFX 2EC5A 4HGPA 5D84A 1ZVQA 5FH9A 1SUAA 3O2SB 3NTOA 2HSDA 3VOSA 1NQAO 1XKXA 2BDEA 2UYGA 1R0WA 2ORYA 1T9BA 1U3VA 1TGYA 3F90A 1WE2A 3QMWA 4PEVA 1N9KA 1HG0A 3R0ZA 2WWYA 2J9YB 1UWLA 2RCNA 3FZGA 5FTJA 4B34A 5C8YF 3STXA 1QMPA 4FJ2A 1S5PA 3SKYA 1XF9A 3H7IA 2OCXA 4DQDA 4DRXB 2CXOA 3D7NA 3QUQA 4FYYA 4DBZA 1Q21A 1K66A 2XRYA 3B7GA 4UHFA 3TZHA 4QUHA 3THRA 3MJRA 1T2NA 2OFFA 2WFLA 2PBFA 3IOCA 3DC7A 3O84A 3AEXA 3O1HB 4AKEA 5FNVF 4CKWB 4RKWA 3U44B 4IIJA 2QTCA 4TUYF 1E2JA 3LKVA 3LXRA 3NHZA 4I4TB 5EMKA 2P6RA 4XGNA 1CKEA 2E85A 2H1FA 3WL6A 4KU4A 4KQ1A 2W83A 4MIKA 2IZZA 5HX7A 1U1FA 4W1QA 5JS6A 4MQUA 4MB2A 1JMVA 5LIRA 1R74A 2XUIA 3LQKA 5K2MA 4IEIA 4BO9A 5DSZA 2FAXA 4XVQA 4YI3A 3RVMA 4UVHA 4UBMA 1OC2A 3JZAA 1UKAA 1VL2A 2HPHA 2W6CX 3CF4A 1DG1G 5DHAA 5IAAA 1YRAA 4J4TA 4LRTB 1YT5A 5I48A 2ARKA 5LQJA 1PYOA 1K3UB 1Z6TA 2KI5A 1GO2A 3A6ZA 3IR7A 3ACCA 3NUQA 1JSRA 2YYAA 4Q4AB 5LXTB 1B3RA 2YS6A 3SFZA 3TRIA 3LUHA 3GWZA 2HTFA 4U9UA 4U39A 5TMEA 3U80A 1C4WA 4MXDA 4AYTA 4C21A 3CLRD 4TLLB 4BDTA 1T3TA 3W34A 4QAQA 8LDHA 1HE1C 1KMIY 3C3YA 1O87A 4UDNA 4Q21A 2QF7A 3B3JA 4Y2QA 1TTTA 4N4AA 3L49A 4XB1A 2IX9A 1ZGJA 2AUMA 4M8KA 1XEWX 1G8JA 4ZAZA 3U6KA 2V4ZA 2WF5A 5M3BA 1S9HA 1ESCA 1XFAA 3EVCA 3VPHA 2DPMA 2COUA 2ZJ8A 3FGZA 3G1TA 2GRJA 4FMCF 4ZT6A 3SVLA 4HQFA 1AGYA 3FUUA 1B8NA 4ND8A 4G0OA 4R8VA 4ZYWA 3AIKA 1MRSA 2AG8A 2AUTA 3DV0B 5B7NA 3EZGA 2O8VA 1KYVA 3I0ZA 3GY0A 1UBHS 3S70A 3BB1A 4DLTA 4EX6A 2BMJA 3C7KA 3KQNA 4GT1A 2QROA 2QTTA 4A8JA 2JLZA 3UUFA 1BDBA 4NTZA 3HJFA 1VLVA 1C81A 1JR3D 1Z5VA 1T1RA 2YWFA 4MJ7A 1Q16A 4L8VA 1P7VA 2WA1A 2WINI 3R7BA 4KEAA 5FBVB 1WLSA 2DY1A 1O0BA 3BGOS 1SWVA 5C7IO 5G0VA 2B8TA 3GARA 1ZXLA 1CVRA 2W4MA 4QXMA 1VA4A 1IY1A 5ADWA 4JXXA 2YWCA 2ONZA 1DG9A 1HFJA 3V1TC 2EARA 4BX0A 1SK8A 5H1YA 4ZTZB 4LKOA 4UVGA 1GVNB 2FPIB 4DZRA 3T9AA 2WSMA 4OKNA 4Q7LA 3LPLA 3EQ2A 2CWWA 4HPWA 3Q0EA 1K0FA 4ZVTA 4CKXA 1P81A 3GVIA 5LQAA 4GUDA 1BA3A 3WV4A 3O91A 1R15A 1TQ4A 3G2LA 1O9GA 3ANTA 1V71A 4NBUA 5K1ZA 3NONA 1A2OA 1M8FA 3MLBA 4TXJA 1U9IA 3WYDA 3R7SA 5JJBA 2C61A 3IDZA 1O5TA 4BP8A 1DNPA 2QRMA 2UV8A 5EP3A 4UULA 1QH8B 5DGIA 2J48A 1H4VB 4U2GA 4FYJA 1N32B 5EEHA 2FWMX 1DI0A 1AKVA 2GUWA 4W1RA 3T3PB 4J0KA 3C70A 1XD2A 5HFAA 4C0QC 5A5FA 5CDHA 1Z62A 4M0MA 1BCRA 4O29A 5B58T 2PS1A 1WUKS 5H3CA 1QO9A 4E4TA 4MW4A 1GCAA 1O3YA 5DIFA 1OGYA 2XMDA 2UKDA 4F3TA 1E1DA 1MFPA 3QNUA 3NVDA 4YCCA 5LWQA 3LF1A 4O4HB 4YUAA 4JS0A 5K8LA 1JAHA 4EKGA 4PY2A 1OXSC 1GQOA 2CXRA 3S2UA 1HYQA 5B4TA 4Z4GA 2B3DA 3F1LA 3WDSA 1D8TA 1P72A 4LQ4A 4FHEA 3T4PA 2CV0A 1A8UA 1MAVA 1E58A 2JLSA 2AVNA 2KX7A 4LSMA 4AY2A 2V9CA 3UMYA 4H35A 2VT7A 5AJYA 4ZVKA 1ICEA 4J3JA 5DW3A 2QRPA 1PSZA 1KHTA 1X8LA 2P9EA 4O0LA 3UXYA 5DTIA 1R9NA 3M82A 3T3DA 4I5EA 2WUGA 1L4LA 3B51X 4K0KB 1DQYA 1A8HA 1XYYA 2GWHA 3DLTA 3HLYA 4HNQA 1RE1A 3E2PA 1Y3DE 3QYFA 2MYNA 4G8DA 1F60A 2HSWA 4NHEA 5ALZA 1MQSA 5E6RA 4CKCB 3OSZA 3BZBA 4M21A 3NTLA 4HX2A 1O94D 1N34B 1EXDA 1JGTA 1CRQA 3E2IA 4RAOA 1G4AE 3U4DA 3W6ZA 3H1GA 3INGA 5IS2A 1QB8A 3RGGA 5LR6A 3MS4A 3WYNA 2AOUB 2PUJA 3IO3A 4CQMD 4RSMA 2HCRA 5JCOC 1UKBA 5CH5A 4B75A 4FGWA 4ZEWA 3ILVA 3AOGA 3RRFA 1VMKA 2JCBA 4WBNB 4LWQA 1M6VA 2QAJA 3NM4A 3QLTA 2Z2XA 3EZ9A 4H15A 3P20A 4YWJA 3SHFA 3FHTA 1AUVA 1LRJA 2HADA 1A71A 4QUBA 5JVDA 1ORVA 1K92A 2GQ0A 2OL4A 4FT2A 1HDIA 1UL1X 3JQGA 3NPMA 2X9QA 1JSCA 1GPJA 1Q7TA 1ZNXA 3P9ZA 3C8HA 1QYDA 5A3SA 1JSLA 3WLQA 5AVQA 1HEIA 1NKVA 5E95A 3TAHA 4DJJA 3BSYA 3ZIAA 2P5TB 2YIMA 3NMUF 3ULKA 3ZHSA 3R3VA 2FZ5A 1XAHA 4HQ0A 4IIVA 1X8JA 5JNWA 1XCBA 5LMUB 1J0AA 2BFDB 2ZKIA 3BK1A 2HGZA 2PWBA 2WIBA 3EQ6A 1H65A 3O74A 3DDHA 4HDKB 2FFQA 4JI1B 4AS1A 3LCJA 4LHEA 1BE1A 1ZJZA 4IOJA 3ESXA 4GG1A 1KH2A 2IYAA 1M1YA 3BD9A 4OHXA 3FRIA 4URUR 2JFQA 1E6CA 3DZBA 3IMEA 2ZIUB 5L4NA 4J0JA 5SYNA 5JSHA 3A9RA 2CUNA 4G0XA 3OM0A 1R8SA 4JUFA 1V7PC 4M37A 3IMKA 3HKDB 4FU0A 4LZNA 4X6XA 3GG2A 3LHDA 3QZUA 1EE1A 2GT1A 4G1EB 4OI0A 1GPBA 5BSRA 2JHFA 5TS2A 2C7BA 4PICA 4C88A 2Q4TA 3G9UA 4R9UC 3GP8A 4CU5A 2Q62A 2ZP1A 2W70A 5BPFA 2POQX 3OA2A 3SSMA 2P9CA 2A7XA 1Q6YA 5A4MS 1UJCA 3GT3A 2O7NA 3C7TA 2ABWA 4RL6A 1C1XB 1JJIA 4W1PA 5EZYF 5B7GA 2TMDA 4ZEOA 4KZKA 4RTOA 1MGOA 2IBSA 1PKXA 2VTBB 1HQDA 1K4KA 2W4IA 1KO7A 1OWMA 1U4SA 1V47A 1VJGA 3EEFA 3TRFA 3WHPA 5A1JA 4RMJA 3FLMA 3NEJA 3B6MA 3AEYA 3FTNA 2REXB 4JT8A 1KJQA 2ZBEA 1J20A 1V7ZA 2WG0A 2O1SA 3D3EA 4KXVA 5E8JA 1EJ2A 2O8EB 1W0CA 3A6KA 4RLFA 4LQLA 1OAOA 2CVQA 2CUTA 3OIFA 4J90A 3SQLA 2R11A 2QVCA 3MINA 4LVOA 2FA9A 2AI1A 3I1FA 4AJ4A 4XQEA 3BIJA 3JYHA 3PWZA 1V1MB 4FQ8A 2VNKA 1WKBA 5AQEA 5T4EA 3NHKA 2ZUEA 3JQAA 3TX2A 4OAOA 4U7WA 2UXCB 3BE4A 3DHNA 4JJGA 4UM5A 4RZSA 1SCDA 1USWA 1TEHA 1ZK1A 3LY8A 4XWYA 3VMMA 1KAOA 4TVSA 3ICEA 3FH0A 1L6RA 4N8DA 4Q9DA 4QVKA 4GOXA 4US1R 4N48A 4LWPA 3T9EA 4ID3A 2D0OB 5HGXA 3RASA 2F1JA 4IF4A 1DE0A 5IH3A 2BI7A 2QVGA 3GLIB 2XE4A 1AD2A 1GFZA 5A0VA 1C80A 4YGXB 3BILA 2QMHA 3L6UA 5DEIA 1DOHA 4F8EA 4Z7OB 5IVKA 1R88A 1G18A 1Y6QA 1Y3IA 1NRJB 1SXJE 4JP8A 3UXMA 4CM7A 1WY7A 4YMIA 3GXOA 1CXZA 1Y5MA 3NX4A 3ZHZA 4XE5A 2AZ4A 4KQEA 4LCJA 2W0SA 2V97A 3IC5A 4ZVQA 3REQA 1CD5A 2LNDA 1QGOA 1RCTE 4PG4A 5JY1A 1BJKA 3WK5A 2P3OA 3SP1A 3I2GA 1EWQA 3QFHA 1M2WA 4PPQA 3MA0A 5CFLA 4KB5A 3JX9A 2VK2A 1C0LA 1GV0A 4JLJA 4PLVA 1TM2A 4R40A 4RH1A 3PWTA 2C2GA 2DULA 1CR6A 4CL8A 2A57A 2HRZA 2X0EA 1J5XA 2I2DA 3G13A 3HB1A 3BERA 1SVWA 4CF3A 3GFBA 3VVLA 2RIRA 1M2EA 4TMXA 1Q19A 1D2NA 1YRHA 2D1RA 5FDFA 2OGTA 3TRKA 2F3RA 2H9IA 4L74A 2YN4A 2H31A 1WU7A 3BIWA 1RAIA 4JJZA 2CDNA 3I5MA 4L08A 3GT7A 3S29A 1QHXA 4KKVA 3ZGLA 4KN9S 3KALA 2ORIA 4DSUA 1GP2A 2FOIA 1R8QA 1QZ3A 4INAA 3ZHOA 5J1TB 2JATA 2CNLA 1HWYA 4LOKA 1ZH4A 5EJFA 3AUSA 4R6XA 4TTJA 3IEVA 4A2WA 1SH7A 4WH0A 4N76A 3GX1A 1GA1A 3FPEA 5IJ0A 2IS6A 4G5GA 4HAWA 2YOGA 1NBME 3MIIA 3OQVA 1P8JA 2JFYA 3GT0A 2CC2A 4JOBA 3RSFA 4XYLA 1UOEA 3KKEA 3PUJA 4ND5A 4D81A 1SO8A 4OQYA 1U2DA 4RDIA 4ENPA 4GZMA 2WJ4A 1G8HA 1GGHA 2EFEB 3EOAI 4F2HA 1QHHA 1B41A 4G5FA 3BXZA 1LBTA 3G0IA 4IOKA 1SZCA 1ZNWA 4QUEA 5JE8A 4N5LA 3N2GB 1BIFA 3QMMA 1D2MA 4DF3A 2V3VA 3EIXA 2D5AA 3CQ9A 5GJBA 2BH2A 3AVVA 1KJ9A 1GNTA 2QZ9A 4RGVA 4DMCA 2FB9A 3CJTA 3K6SA 1CY2A 3EPHA 3KDAA 1LBQA 1JQJC 3DXZA 5HXAA 4CIYA 3R5KA 3EQ8A 1AMOA 2XUKA 2HDHA 3K8YA 5C51B 2VBIA 2G1AA 5C8XA 4YJGB 1Z8HA 1KY3A 3L7DA 4X60A 3C14C 3MLEA 5JNVA 2O8FA 4LMRA 3LYHA 2PZAA 3PPWA 4Q9AA 1OFVA 1TFRA 1N36B 1Z2PX 2NMVA 2H57A 4DDTA 2BGMA 4YP0A 4I1PA 2OZPA 2EQ5A 2NNLD 1Z6XA 1B23P 4OQZA 1C0KA 1LS6A 1S2OA 2P8SA 3CV3A 1DJOA 2MWMA 4Q93A 4QPJC 5GOTA 5EIEA 1HH4A 3ZEIA 3EAGA 2C31A 1BDMA 2XY4A 3L6DA 4TVBA 4CLXA 2CDBA 2EXXA 2J46A 1RP7A 2PO7A 3E7DA 4RULA 1NPDA 3V00A 1W76A 1MU0A 2A9KA 2YXBA 4HAXA 4QT4A 3EZ2A 4KAJA 3EQ7A 2M1XA 2P5SA 2UVDA 2Y99A 3B9RA 5CA0B 1EIWA 1T43A 4U02A 4RK7A 3I28A 3WQRA 2PJDA 2JFWA 3QV1A 2XUZA 2VYNA 3ZUGA 5L3VA 4YV0A 2JJ2D 4MS1B 3UBMA 2HF9A 1XPOA 4ZGGA 2G1JA 4NV1A 5AIAA 1NBMD 3NWOA 4KWTA 1CZKA 2J6BA 1TM5E 4MZXA 3ZG6A 4ESHA 1RQNA 2GTHA 4D9HA 4BVKA 1AOXA 1P60A 1U6JA 1ZK4A 2I76A 3NNSA 2V7GA 2NU8A 1J23A 5EWMB 2BD0A 4DSNA 3L82B 1WU8A 3HYTA 1Z0DA 2A5GA 2PVPA 4NYMR 4R8MA 1VJRA 3DVSX 2V7QA 3CUVA 3EULA 3H8VA 3MWKA 1L5GB 3RJTA 4E2ZA 1E4EB 3FCUB 3O0DA 4S05A 3SIRA 5AVXA 1SCJA 3AERA 1NW5A 1Z4JA 3HDGA 3I09A 3QELB 4PO9A 2KQUA 3AI3A 3DEJA 3QU4A 4CKEA 5BVHB 4LYFA 5C7OO 5KHLB 3NHFA 4KXWA 2ONJA 2HIMA 5E2AA 4OI4A 4IKEA 1XK6A 4Z3DA 3MRTA 5FNVB 5IKEA 3UK2A 3BTVA 2O20A 5K3BA 1TJ3A 3B1XA 4ZYLA 4U6SA 1E9DA 3HP4A 4K6GA 4NATA 5JQGA 2V0CA 5K6RA 4I6GA 1VIMA 3H16A 3R9XB 2RDMA 2GK3A 4PQFA 5KYKA 4ITUA 2I8AA 5LB2A 1A04A 3TW4A 3EF0A 3LVFO 4BQOA 2YTZA 3D4IA 3I9V1 2KMLA 2Q2QA 1QONA 2WAYA 2RHBA 2W6JA 3HVHA 3I9JA 2TS1A 3JZMA 4G37A 1DCKA 3IIMA 4Y1FA 1PSDA 3D4BA 3GDOA 3RRZA 1OHHD 1SVMA 3TMAA 3ORQA 1KWKA 2VSYA 1D6JA 3H1AA 1KI8A 1N3BA 5E0OA 4MTLA 1ZOSA 1I01A 3SK0A 1TX4B 3NTRA 3NP7A 4JP3A 1YQGA 3QX3A 1UMKA 2GYYA 1YGPA 2ZJ2A 3ENNA 2BGKA 1IY9A 2XAUA 3AFMA 4RABA 4U7FA 5A6SB 5T57A 2B2NA 1X2BA 4AZ3A 3L8ZA 3N1UA 4V24A 2WJYA 1PIWA 3HMQA 3IAM1 4F93B 1WD7A 4M60A 2WPDD 3VKHA 4MQMA 3FHOA 3IV9A 4LYYA 4KMSA 1EFPB 1KVQA 1Z38A 1ORHA 3HHPA 2IYWA 1PGQA 1E6KA 1H69A 1V7CA 3MTJA 4JLDA 1IQUA 1GADO 5HKLA 1EINA 3DMTC 3I23A 3LVBA 4FZ5A 2OM2A 1F9AA 2ZR0A 2MSNA 4QXAA 3VTAA 3P2MA 4A2CA 5I7SA 1SZJG 2H9YA 1VHJA 4M1WA 5FTMA 4ECAA 1TKRA 4GBJA 1UXOA 2P67A 2BY4A 3CVJA 4LYDA 3IPYA 2NYAA 3O7WA 4F9EA 5HRAA 4AUNA 3O8CA 1O0CA 5MFPA 4IHJB 1GNRA 1U0HC 5AM2A 2JFPA 3O9MA 3U16A 3GAZA 1V9SA 5AVOA 3ODGA 4K8RB 821PA 1QX4A 2ZYHA 3CCFA 4AJEA 2C7QA 1FIUA 3K2BA 5SZJA 4MKGA 1EWTA 3LPMA 1JB1A 1JS1X 3F74A 2IK8A 4YT8A 4QBKA 5MN6A 4TYMA 4NY1A 4L4YA 2P2GA 4W9MC 1JQKA 3ZK9A 2OOKA 1QO7A 1CB0A 1X13A 3D1JA 2HA0A 3CMCO 3LVRE 4MEBA 5HTKA 1PS9A 4ENUA 4UTVA 1T8PA 4ARBA 4JI7B 1ONBA 1IJFA 4FE7A 1Q44A 2F8SA 5CVJA 1W2GA 1ZGGA 4G9GA 2GO7A 3RPEA 5HJ5A 2OG2A 5KU7A 4W7IA 3UJNA 3KLBA 2YJGA 2JJMA 3I8OA 1IYZA 3EZXA 5NLLA 1ISPA 1YBHA 4XKJA 1ATZA 3N87A 3OE1A 2VH5R 4JGBA 4Y1GA 3WRYA 4TYWA 3CRRA 4UMVA 1CQJA 2J7PD 1YZTA 1O57A 1S2MA 2C94A 3OQIB 2HXGA 1YAJA 2OHFA 1WJGA 3A6LA 3PXUA 1DT5A 1M34B 3NANA 3ZQKA 4C3ZA 4Q3OA 4UEOA 3IXQA 5KSZA 1LVGA 1ACJA 3V8MA 2BMAA 4MVCA 4R7GA 1TC1A 4EMUA 4D44A 3KZXA 1JA0A 4QDUA 2OD7A 3SLGA 3KPWA 5CXQA 3LHIA 4WFJA 2WLTA 5SYAA 2JHGA 3MERA 1N77A 1EUDB 5JH7F 1P2FA 2C4NA 4N0PA 1P1BA 3NT2A 4OPMA 1OKKA 4C03A 3OWHA 4JP1A 3N7UA 1E60A 4IFTA 4RJLA 4JB2A 4QOGA 1JAYA 4A8TA 4DAOA 2AW3A 4WKBA 5ENVA 1ZA1A 5TLSA 3LUPA 4DIBA 3BMCA 4ZRNA 4QUGA 1F3OA 5H9VA 1FW6A 1F5NA 1JRLA 1XPJA 2ECQA 4NBNA 4G24A 4M83A 1VCIA 5CNIA 4PX2A 4UM9B 3VC2A 4RF5A 2PXAA 3GJZA 2NP6A 2MR6A 5DM1A 1MG5A 2BRUC 2RGBA 4W7SA 5EYPB 1NT2A 2X15A 3HADA 4GZLA 4I0WB 3W0LB 5AM4A 4AROA 2J9GA 4Y6LA 1UJMA 4AS2A 4QGHA 4RFSA 3SZRA 4TS3A 1K9SA 2JVJA 3A37A 1N57A 2E4VA 2O3SA 2V9PA 4ZO8A 3ZBQA 4POOA 4MP8A 5KNCA 3AZOA 2F48A 1CPYA 3HY4A 4HWKA 2CHGA 4MS4A 4TMFA 5F1PA 3JQ9C 4EHFA 3IUNA 3IEIA 1PT8A 1N1DA 3ELDA 2JB9A 4EKEA 4BP1A 2WP0A 4B3MB 3HU2A 5K3DA 1WWKA 4FNAA 4OU4A 1V9LA 1PVVA 3DEKA 1UKZA 2C2HA 3IOEA 5JXHA 4X8OA 1LFAA 1W6UA 4URHA 1AC5A 2EBWA 2WU8A 1E0AA 4XI9A 1D2RA 3ZWNA 1GA4A 1YQQA 4R69A 1Z5UA 2QUJA 3I2KA 4AJJA 3FOEC 1C5KA 1NXXA 3WYGA 2FEOA 3D8UA 3EC1A 3IFSA 3JXEA 4D98A 3VNUA 5HDQA 1E3QA 3SPXA 2VYCA 2P4HX 1T36A 1ZQ1A 3O3CA 3TS1A 4R2IA 2H2AA 4IUDS 3R9WA 1LI4A 1ADGA 5CD1A 4X6UA 1JEQA 5CM8B 4ZCTA 3D6TB 3Q1KA 1NW6A 1OBOA 1L4MA 2HLPA 4IJ6A 3FG9A 4MI6A 4PSVA 3OEHD 5TB5A 3RABA 3U7FB 4C0JA 4DUGD 4B80A 3KSRA 1E0DA 1NLZA 1MT0A 2X5XA 3JD2A 4I2NA 2JI8A 3LW8A 4GVXA 2OQVA 4EK9A 4G81A 4O59O 1B73A 3K15A 4YT5A 3UJ9A 1BOFA 3FNGA 1TOAA 3I1YA 2I3AA 4JVMA 2D3TA 1U8EA 1FRQA 1DKNA 4C3VA 4HB0A 4AMBA 1U5BB 4FCWA 1TAUA 1W0KD 2RKOA 4IFEA 3CUTA 3QOXA 3CUYA 3I6IA 3U60B 3AHDA 1GCOA 2VHZA 3BB3A 1ODKA 2QZJA 4BNJA 1YR2A 1DAGA 2QGZA 4C30A 2IEGA 5KCZA 3LX8A 1VPEA 1ACMA 1LXCA 1N1EA 5J23A 1HDGO 2ZRMA 1A5ZA 1M73E 4KWHA 4X7MA 4MW9A 1KYQA 1IK6A 3BD8A 3CO0S 2ERXA 2NZWA 3D3WA 3H1EA 1W85A 2NTEA 4RY2A 1AV6A 3L0PA 2HMTA 4U5XA 3QEAZ 1O1YA 1NI3A 4G5HA 2FEAA 3ISJA 4HXYA 4JQYA 4QXQA 4DV5B 3CCBA 2R47A 4ZOBA 4AU1A 4IDPA 3FUCA 1XJ0A 4QODA 4MPDA 5C1DA 5KMGB 1RYFA 4L22A 4RC9A 1H6CA 2HRDA 5BSKA 3I04A 4Q3NA 1AS3A 3QI7A 3U3KA 2JAHA 4ZJZA 5J4VA 4N54A 4GPD1 1EHCA 4YJHB 4BY9E 2VYFA 2ZT7A 3K0AA 3WLKX 5F3DA 3KQYA 4ETNA 2ID7A 2X9LA 2G77B 2Q6IA 2HA6A 2P2SA 3GMIA 1H1DA 4BO7A 4AKGA 3HY3A 3K9QO 4UOQA 2OV1A 5G2OA 1P33A 3O8DA 4Y2JA 4W5OA 3T3NA 3L0SA 2RH4A 3IDQA 1O94A 4ZU1X 4ETWA 1PUJA 1JHPA 4BKOA 4D25A 3OZGA 2PQ2A 2R0QC 3ENWA 3G1WA 4MH0R 1OT5A 1PFGA 2P1DA 4FFBA 3PQ4A 4XLTA 1JVSA 1P91A 2B9EA 1ZG3A 1BWQA 1N92A 2GTPA 2O7QA 2VDPB 3N7TA 4FUTA 4V02A 3KOMA 1SBZA 4JL8A 1D9ZA 1JHVA 1UJ2A 1L8LA 3CUKA 3DMYA 6REQB 4WLEA 5BYJA 3WISA 8AT1A 3HJTA 3TI9A 2YH2A 4YCLA 3WR5A 3LZ6A 2H4JA 1SOWA 1JWBB 3R3HA 2HPZA 3V46A 5BO5A 5IASA 2VK8A 5CRIA 3G7UA 5EINA 5ESDA 5HUQA 2DBQA 3E27A 4KGZA 1W1WA 2B21A 2GYWA 4MV4A 3V4SA 3W5VA 4QUIA 1FS4A 1OI2A 5HZHA 2A84A 2YJTD 4GDFA 1DBVO 2VA9A 5INTA 1HRDA 2IHJA 4PRLA 2B94A 4BNFA 4F9FA 2NAPA 2BP7A 4BOYA 2B99A 4BECA 4D80A 1PHRA 1Q5PA 3T1YB 5EIFA 4XVHA 4KNYA 1DUIA 1JLMA 3WXMA 5L40A 4LBYA 4KXFB 5B3JA 1KOGA 5A7FA 4WJKB 2JLBA 2WI8A 1XZMA 4GX5A 4IIJF 2RGXA 4GEKA 1I51A 2Z98A 4GX1A 2OCDA 4W6ZA 2O2JA 1MZVA 2H9AA 3CRQA 3E9EA 1WBBA 3A1UA 3DZFA 3TBKA 3UWDA 1MH1A 1T0PA 2X9NA 4LVNA 1MJHA 5BSMA 3IP7A 3WGIA 4JSTA 3RYTC 4TTIA 4OQMA 2CV1A 3BL5A 3TQQA 3C3PA 1NW7A 2O6LA 3GJ5A 5HKKA 1IZ8A 4FYXA 1FU4A 2YQ4A 1RNLA 1F4PA 1KAGA 3MIZA 4F60A 2YVUA 1Q6ZA 1XWIA 1Z33A 3M4JA 1I5OA 2PX6A 3LY5A 5HZMA 4U2BA 3O92A 5A3JA 4RKFA 4LYGA 4O2BF 1U5CA 2NXCA 2BFBB 4L1KA 4TUYA 1J8FA 4KXXA 1KU0A 4XFJA 3HXTA 3GLFA 2DFPA 3AJ8A 5FAKA 3H2IA 1GGMA 3NC0C 2XA2A 2I22A 3VZDA 1XVAA 1IZ7A 2GEBA 3OBBA 4D92A 1Y4UA 5KNCD 3R5JA 1DKPA 1JNXX 1KYZA 2ODAA 3JWPA 2V6FA 3KB1A 1A7UA 1BCSA 3A3PA 4QDTA 3S2YA 2R4UA 2OC9A 4MS1A 1US8A 2OXCA 3IE1A 1HLPA 5CB0A 3E0XA 3FNBA 4IJKA 2H1SA 4LZAA 1BXGB 1Y7LA 3HZOA 2I80A 4MGIR 3GVPA 5E3HA 2WFAA 1QP0A 1JFVA 2C4KA 3B2QA 5J2TF 3MCTA 3GUCA 5K6AA 2G04A 3UJCA 4HAOA 4AWAA 3EVBA 2BEUB 4D79A 3H4IA 2FSUA 4CEIB 4G4SP 2OEPA 2O8CA 4TT3A 4WRRA 2SBTA 3IP5A 4BNYA 4PRZA 1KEEA 3FR7A 3OPYI 2EZ9A 4LYHA 5KJEA 1SCNE 3ROFA 1NAIA 4BWVA 4EPTA 5IFLA 5FJIA 4DG9A 5BMVB 5LKAA 1NP3A 1HETA 3JQ8A 3OMLA 2Z83A 3IBCA 1KIMA 3GZNB 2JLQA 2X4LA 1DO0A 3LBFA 3ZU4A 1JA1A 1FNCA 1BAPA 3CLUC 5C5CA 2QS9A 5DXFA 1C30B 2XCLA 4P5DA 2JIBA 2ZB8A 5E0KB 1D6NA 4EHKA 4EITA 1UBFA 3SE7A 4EABA 3M6AA 3X1YA 2X3FA 4G4IA 1U0BB 1WUIS 1Z22A 1A4UA 3UVEA 1CG6A 1I0LA 4RDCA 2R8YA 3DE4X 4UHEA 4M6WA 1LZLA 2NUAB 1V1JA 1W5SA 2XF2A 4H1HA 4CL3A 2FFRA 1T8RA 2R65A 4EGJA 1L1FA 3QK7A 3CT6A 3NHWA 3QE4A 4QUKA 3J80A 1N2JA 2XA1A 3N59A 1X1DA 1L3IA 3AM4A 1DARA 3N28A 4LJ5A 4Q02A 4QYSA 1SVUA 3NBYC 3KZKA 5CCBA 1P74A 4K2HA 2UZIR 1VHQA 2WWXA 2CJPA 3U4IA 5LKRA 4G97A 3N74A 2XB6A 3OAAA 3PYMA 5DTRA 1EH5A 2JGEA 1YL6A 4P82A 1G291 3UHJA 2EBUA 2NTVA 2C77A 1MB2A 3LMKA 4G86A 5EQDA 4DC9A 1QJ4A 3MSXA 4H60A 1V11B 3KUCA 3TSOA 5CLGA 1ILWA 4YCBA 2WA2A 3ZVLA 3CVWA 3RUHA 3CKYA 4DR1B 1TF5A 5DFAA 5SICE 3WJ1A 1H4SA 2VOEA 3V55A 1CCWA 2OP0A 2OTCA 4I1YA 1QIIA 4LHYA 1X8KA 5ALWA 1G6OA 3QWIA 4WOCA 2QRQA 4D96A 4UBNA 1N7IA 4PFSA 4EG6A 2NYVA 3ZYCA 1XJ5A 1PEAA 3DTNA 1VM6A 2VSQA 3TPZA 2W9XA 4FP9A 3DEHA 3GA0A 1M67A 4FDTA 5E7MA 3VU0A 4Z3KA 2DKFA 4NQZA 3I9KA 2B4KA 2P8JA 1Q50A 2CLLB 4B3HA 4P5EA 4CDGA 3KSAC 1FVOA 3CNHA 2OZLB 3DDUA 2HLDD 2WM2A 3LDFA 4ERNA 1SQ5A 1TQ8A 4DLPA 3PRJA 1ULBA 1WMFA 5HK8A 4S0ZA 4MO9A 3TNFA 2CCJA 1NUUA 1UEJA 3KKKA 4AY3A 2Q1YA 1E5LA 3ZDDA 4JU9A 3KV1A 4WHMA 5TVGA 3QV2A 4ND1A 1NZDA 3DS8A 1O6BA 1W46A 1VMAA 3DBVO 2IOYA 4B85A 2X22A 3WMXA 5IXSA 1Z2CA 1X7WA 3LHSA 2YXPX 1TW3A 3E84A 3B1KA 2BF7A 4XYGA 5EKSA 5TS3A 1TA0A 1PD0A 4WKCA 5G0TA 1NBWB 1T9DA 5AT1A 1CEQA 3G1UA 3VNQA 1NQ5A 2R8ZA 1HT2E 4U4AA 5FNZA 5IC5A 3WMGA 1GILA 2P5UA 4XRGA 4TMTA 4I9NA 4WOPA 4ZCQA 5AW1A 2I6XA 3DMTA 1MO2A 2VOJA 3OIUA 2VWHA 3OZIA 2VF2A 3HWSA 4ZAWA 3K96A 3RUFA 4EEKA 1Z45A 2DQSA 1EG2A 4KR6A 1NF2A 3CPJB 3N8IA 1ZIPA 2BOVA 2EF0A 2C57A 2IJGX 1J06A 2YWBA 3E7XA 5EUBA 4B5KA 4DT1B 3F47A 4ENVA 4O08A 2RB4A 4WIAA 3E70C 2JFZA 4D0SA 4BFTA 4R1LA 4H7IA 2R1TA 4KYIB 5EN4A 3C3EA 5JEEA 2I66A 2AK2A 2FXVA 2B34A 3GGPA 4KMMA 5EZYA 1ZH0A 5M04A 1W4BA 4Q6WA 4B3CA 1TKCA 1Y9ZA 1STOA 2VNSA 2EJWA 1S3IA 1XCGB 3G7NA 4FD3A 4MVWA 2PT9A 4ZO4A 5FLKA 1H9BA 2VYND 2C2OA 4BO8A 1JQ5A 2Z3VA 4ER7A 3OJLA 3QM1A 2OFWA 4JT4A 1YK0A 1Z56C 2D0PB 1N2CA 2DPLA 1YKSA 4FE3A 1HLFA 5DOZA 5J2UB 2OYCA 1ZINA 3FWPA 4GGPA 4OFBA 5ESWA 3BAFA 4DWJA 1LFDB 2RBKA 2UVPB 3TX6A 4BMCA 4F5DA 1KETA 2G25A 3MWDA 3DONA 2WF8A 3DBLB 1ZXBA 1A9XB 1O4WA 5THXA 4DQUA 4LMAA 2V3CC 5G41A 4KODA 3ANLA 4WPGA 1LU9A 2J3KA 1IG0A 4JKIA 3BHIA 2PZJA 3R0VA 5AIBA 5IVHA 3V6MA 4MVJG 2QNIA 3PKIA 2OCYC 4GECA 1ZCAA 1L4YA 1NX6A 2EKDA 2JHPA 3B1ZA 2AOTB 2HZBA 4X66B 3PI7A 1X7XA 2Y68A 2ZULA 2CK3D 2NNWB 1KI2A 5JECA 2BONA 2GN1A 3DLCA 4Y9UA 5FLYA 5CK5A 3WBBA 4DPMA 3P9YA 3O90A 1IZ9A 3ELYA 4U7PB 4G09A 3JYPA 3PR3A 4UVEA 1SCUA 1BN7A 2W0MA 3AEUB 3W6NA 4D45A 3BDIA 3GH3A 4H2DA 1O96B 1I7LA 4QTTB 4RNDB 2WKWA 3RQIA 4LV8B 4FCTA 3WO1A 4BMPB 3AEQA 5IRCD 4MS3B 1H4QA 5HMLA 5I01A 1FXWA 3TECE 1WBJB 2ZSHA 3G2MA 4QICA 1AURA 3HL0A 4QEDA 1NYQA 2V98A 4NG4A 3CSDA 4OCZA 3L01A 4GM4A 4EY6A 1G5FA 3UJAA 3UGKA 1W9HA 2Q6OA 2Y67A 1A9PA 1Z8NA 4GMGA 4A5SA 2GESA 1V2HE 1YO6A 1RQPA 4FHCA 2WY2D 3WK7A 2QWXA 2ZTLA 3QVJA 4YAUA 1MLDA 1UFQA 3HKEB 5GONA 1KEUA 3CZ5A 4Q16A 1C3JA 2HUNA 3WLMA 3IPRA 1K2WA 3K9HA 4ZCRA 2Q8QA 3KELA 3LUCA 4EI9A 3LQ2A 4HDMB 1TEXA 4ESOA 4RS3A 3CPHA 4WLUA 3TNDA 5ISMA 3AIIA 2VJMB 1E2QA 3R3SA 3GRYA 3QVTA 2EGHA 5ESRA 5IKPA 1X42A 3C6KA 1F0PA 1FDTA 3K92A 2RGYA 3WBKA 1Q22A 4YQZA 4IYJA 3SDBA 4F72A 5FV4A 3K8QA 2X6TA 3PGA1 3D3JA 1GAJA 1IEVA 1LV8A 2OHHA 5DI9A 3GZNA 2IOHA 5A0FA 5EE0A 4C4AA 2JHCA 2ATXA 2JJQA 2ASEA 5ALFA 3RFFA 4FOLA 1II8B 3K4HA 1GRQA 4XR4A 2Z8ZA 1H94A 4UHBA 4KRFA 4OHCA 3RAFC 9LDBA 1P2UA 1WZCA 4K9SA 1BN6A 3R7WA 1RKBA 4PCVA 2Q50A 3BB4A 3K0KA 3L5OA 3HABA 1CE8A 2EF1A 2O14A 3GUYA 1JB9A 2CLKB 1TF2A 5FAXA 3UK0A 4CHTA 3QMPA 5T5QA 2YQ5A 4C4PA 4DDVA 3LNCA 3KBBA 3U4AA 3C1UA 3QUSA 4PZPA 5PNTA 4RJTA 4NAUA 3USCS 2O1EA 3BMQB 4MUEA 4DDMA 4LECA 1PT6A 4FR0A 4G8CA 3M6WA 5BSGA 3WICA 3KETA 3ZGXA 3E3AA 1LSSA 5DYNA 3OX3A 721PA 3I37X 5K3FB 3PCTA 4KP7A 2VAVA 1P1KA 1A9ZA 3F9RA 3I6YA 4NCAA 2NVBA 3NJ4A 4X6YA 4BB0A 1KMNA 2CL7X 3T3EA 4OHVA 4ZWNA 1NW3A 1PYGA 4K26A 3L9WA 3TGLA 2CXXA 1VBMA 3NEYA 3GEBA 5F64A 5LDDC 1U0RA 1JZSA 1IN7A 1M76A 4JYCA 2XYRA 1VLZA 3U48A 1MORA 2X0DA 2J4DA 2YBEA 1G4UR 3C41J 4HN9A 5AM5A 5JJLA 1G8FA 4U6NA 4JJEA 2CF5A 3AETB 1FDRA 2ADOA 5IMBA 1QDLB 4BUJA 1DOAA 2NVWA 1VE5A 3S2IA 4RLSA 3RU9A 4Z1OA 3D6AA 3GA5A 2RG7A 3MAGA 1J8QA 2EFJA 5EJ9A 2DFKB 1EXNA 2QX6A 3PNMA 1FFWA 1XCOA 3WQHA 2LCFA 2UVQA 1N8NA 2WJ3A 2WWFA 3BULA 2W2XA 3HVKA 3F97A 5BV0A 1EUYA 1JG1A 2V5VA 5T4HA 1CRWG 5KYYB 5DI3A 5EXXA 2E1RA 3WIEA 3ZK8A 4ENTA 3A04A 1K8RA 1P7WA 3QU2A 1VSVA 3IV6A 3L4EA 4L7VA 1QDUA 4PX9A 4WK0B 4JLBA 5ELLA 4UVDA 2NSHA 2QP3A 3RYHA 4F2GA 2VJPA 5I7WA 2IV3A 4EW1A 4XSHA 3VQTA 1EM6A 2ZAMA 4F6LA 2G4CA 2J7PA 5FQNA 1RABA 4J3NA 1DS6A 3MTAA 4NCJA 1OE0A 1XVLA 1Q0UA 2GEJA 2WE8A 4PGGA 3AL3A 3P9XA 2PK3A 4WJLA 5M7EA 3PWKA 2CFIA 1OR8A 3KJFA 2EKZA 3DNPA 4P38A 3OTQA 5TF0A 4DCNA 5YASA 3B9PA 2D1SA 2NT4A 3IGFA 4Z8YA 5JD4A 4US0R 1BVUA 3E61A 3UAYA 2OMKA 1S4QA 2Q3HA 1RHRA 1Y33E 4QPNA 3KQKA 2IU3A 1SQFA 1ZDMA 1FTQA 3P45A 4AI6A 3NVMB 4X61A 4DCCA 1HQYE 2O50A 4H4DA 1G20A 1PE0A 4O1MA 3AHJA 4RA6B 1JT2A 4UCWA 1BWSA 4NJOA 4QBFA 2WR8A 4OXQA 4P7FA 5AM0A 2XEXA 4ZC8A 4CRWB 5BR8B 2UXBB 1BO6A 5EG5A 1R6VA 2XGGA 4ZJPA 1R6UA 4LG1A 5EUMA 4A15A 4NZ9A 1UP6A 3LLVA 5KIAA 1MDFA 2P4QA 2G1UA 4FFSA 5FPYA 5L7YA 3TJMA 3EY9A 3WLNA 1JVBA 1L5SA 2I6TA 3RANA 2L17A 3F5QA 4KFSA 2FOLA 3GK3A 4EHIA 4GXTA 1JDBB 5G0SA 4Z4QA 5ALGA 1MQ9A 4LDQA 1PZXA 2TYSB 1PNVA 3VO8A 4LNHA 4ZZ1A 3K9FC 1O6FA 4DA4A 3PEYA 2HLDA 1X3LA 2EWMA 4IJMA 2A5JA 5AOBA 4AIIA 4RD4A 5FPKA 5FNVA 4N5IX 3TVDA 5KTOA 1DKUA 3ZWMA 4OQQA 3NW9A 5TQJA 4HB3A 2WM3A 2ZUSA 1YS9A 4OK3A 2A9OA 2O07A 1G0NA 1W8DA 2ZWVA 4C4TA 1JFTA 3CRNA 1B0PA 1BS1A 4W7HA 4ED9A 2H92A 3H84A 4I55A 3WWCA 1SOAA 3OQJA 5EQTA 4M98A 4PLPA 1YHNA 2PWYA 2HL6A 2CZGA 4MWOA 4OREX 4BKUA 5A5VA 3KCQA 2X76A 5BW5A 3BT7A 3KYCA 4P34A 4UMDA 3IQDB 1IXKA 3W2GA 3T0FA 4MWBA 4Z4IA 2PM8A 2E4AA 1SY7A 3CG0A 4WNCA 1U1GA 5DYYA 1NLUA 1DIHA 2X1HA 4R81A 2B7CA 4D5EA 2Y1EA 5B4UA 4M1ZA 4DS3A 1M72A 3H1TA 3CG4A 1DUSA 1NPTO 5BR7A 2JLXA 3FM9A 4WFQA 3WL5A 1ADCA 4B0OA 1N2SA 1F2UB 3SCZA 4EYEA 1TIBA 2ZQZA 2VP6A 1J6UA 4P7JA 4ZTBA 4ZJYA 2FDXA 3EG9B 3FAZA 3LRTA 3QU5A 4FINA 2EKPA 3G5AA 3EODA 3H9JA 4GD3Q 2CFRA 4GNKA 3SC2A 2WWWA 4X45A 1V35A 3J7TA 3ZOZA 3Q40A 5IC4A 3V4LA 4DZZA 4FB4A 1M3SA 2H4YA 4ND6A 3OT1B 5BW6B 4D3ZA 5JZOA 3GDWA 4DZTA 3O8BA 2B6HA 2YIVX 3AFNA 4MLPA 5CLHA 5BSUA 3UUEA 3DA8A 3GAAA 3GLTA 4NZMA 4Z9XA 4AIRA 4M2LA 3TDNA 2INGX 5JFOA 1TGVA 1G98A 3EIUA 3FPLA 4DNXA 3G2PA 4NL4H 4PPGA 4X20B 3EIFA 2OA0A 1ESMA 2DM6A 2FPLA 2RK4A 3DZDA 3WYBA 4E2YA 9GPBA 1NOKA 1M74A 1EA5A 5BPHA 4WY8A 3OQPA 4YJGA 1TPZA 2PMKA 4O2AA 2OKCA 1Y42X 3GROA 4TZTA 4C43A 2AI2A 2QVXX 1ISHA 3IP3A 1XPRA 1N5KA 3RVJA 1L1EA 4F6RB 5KWVA 4C0AC 2EATA 2PGNA 2VI5A 1YDHA 1D6SA 3AYZB 4GIBA 1YZNA 1DU4A 3SHWA 2F43A 1ZQ9A 2IA5A 1PQPA 3A31A 4TSFA 4YECA 4YVFA 2GUGA 4HMPA 3GPBA 4IYRA 4D46A 2VT6A 5L3QB 1PSWA 3GYGA 1AB6A 4GRIA 2BUCA 4MROA 4NU6A 1K7YA 4Q7EA 4XOIA 3INYA 5CIWA 5ALUA 5HKKD 1XQVA 3HVUA 3TD2A 1GPAA 2MYPA 4NZOA 5KJ6A 3PUYA 2VRBA 4LN1A 3G8AA 1YTUA 3GJ7A 3G8YA 1E1RA 3IOMA 4QPZA 4KIUA 3M6IA 2IEZA 2ZE6A 3FFXA 1SKYB 4RV4A 4TMWA 4CUKA 3U44A 5ALXA 1XXHA 4EB6A 3W7AA 5E4FA 3Q3CA 2WJPA 1EFAA 1UQTA 1TJYA 3JQ9A 4IS3A 4L9WA 4RLQA 3EEQA 4R51A 4AUKA 5K8UA 1XXHE 5I7EA 1DBQA 2W8BA 3AHFA 2NO0A 1T1IA 1E64A 2WIAA 4FPXA 1JN0A 3L7NA 3NBMA 4O8CA 4ZVMA 5A2GA 5A4KA 4QM7A 1JQBA 2C3UA 5L3ZA 2RJOA 2AG1A 2L0XA 1OX4A 4CM9D 4U8HA 4R05A 1CZNA 3GHHA 4TVOA 1NURA 3H9UA 3I32A 2CLHB 4DGQA 3L8EA 1CLUA 1CULC 2Q46A 3SD7A 1JLSA 4NJMA 5BSFA 2QD4A 1TMYA 3B3QA 4OK6A 2ZUUA 3ZZUA 2EX4A 4A7PA 4BJ5A 1Q0SA 4EELA 5MDHA 2Q45A 5CCXA 1Q0TA 3ETHA 4OHZA 2XUAA 3RSLA 3CWCA 1YUBA 3OVMA 2D5IA 2VCEA 2X2PA 1OX6A 1U1DA 1YRQA 4M8SA 3TQFA 2ACWA 3QG1A 4BFUA 1DC5A 4R41A 1DCMA 2V0NA 1IH8A 4BNTA 4OMCA 1GPNA 4MDFA 2PGIA 2ZXUA 1NHWA 3ELUA 3BBPA 3TWOA 5IWCA 4H7KA 1NOIA 4F3YA 2FUCA 1R9JA 4NCNA 4ZC1A 4XB2A 2HJRA 4EJ2A 2IE0A 5K0FA 2AHOA 5FO0A 5L3SA 1EI9A 1XDWA 2Y77A 4XDGA 3SVTA 4AULA 5I4KA 4TUYB 1E69A 4B3FX 1LPBB 4LXXA 2LV8A 3ZXSA 3M6VA 5CXUA 3QKWA 1Y48E 1SK9A 3K0HA 3KTAA 2FLVA 4P5PA 3QXSA 3K9NA 3KKPA 5CT6A 2JIOA 3EISA 3ANXA 3DZ8A 1L4KA 1EXWA 2ZPUA 3KQUA 4CGZA 1W1UA 4X9XA 1U8CB 2Q4EA 4UEJA 2I71A 3FD8A 4CV1A 1VJ1A 2D7CA 2WSSA 5COBA 5CVTA 2CYCA 1OB2A 4DVGA 1LLDA 5BWOA 3F7MA 1L5HB 3F3KA 3PZBA 1IULA 3PP8A 3WGOA 1TUGA 4YY3B 2YIJA 2XQFA 3JVUA 1O97D 4Q66C 4RIIA 5AD1A 3VR2D 5HIKA 1F8GA 3SBOA 5M34A 3DT9A 3PC8A 3AONB 1GKLA 2X2FA 3ANMA 4JLPA 5DEOA 1W36D 2HPVA 3UGQA 1BMFA 2EJCA 1DZIA 1U0TA 1JPJA 4YONB 3WGMA 3LQ1A 3NGXA 2GPSA 3QKRB 1Y7PA 1OBFO 1ZLXA 2KHZA 1OMOA 4JWKA 4PZDA 3UCEA 5AFSA 5J1SB 5ES3A 1HDZA 1OFGA 2ODEA 4LBWA 1TYEB 3K70B 2WYIA 1FBTA 3I2YX 3WFJA 3V8PA 4TYYA 4CI9A 5FO1A 1PF7E 1J9GA 1EX7A 1FE8A 1Q7BA 2IVFA 3BMXA 3B2EA 4WEQA 4YJFB 1O94C 1YZKA 1I2BA 2OZVA 1VIYA 3VYVA 4BNMA 3R3ZA 3CX4A 3M6LA 1R37A 4FC7A 4I4TA 4RIHA 3V2GA 2PAAA 2Z9CA 4RVDA 2NM0A 2CKMA 1V5IA 3CONA 3KLNA 2F1OA 4DMFA 1KPIA 3DZHA 3FRHA 4Y2SA 3GRPA 3LRPA 1JEAA 5KYXB 3FOFC 5T4BA 1PNOA 1UM8A 4ER6A 4ZYTA 2ZPAA 3AP2A 2SCUB 5ENDA 2PXCA 2NADA 1EFTA 1F12A 4DNOA 4DUZB 4L4XA 1OIWA 4XPZA 1PJRA 4UAJA 4HJRA 2ODBA 3Q9NA 3ZGZA 3IPCA 1XZHA 1KTIA 1WUHS 1ZZGA 4N1AA 5EIBD 4Y6PA 4Y6SA 3LUDA 3QUCA 5F9HA 2EQAA 1A9RA 5SY4A 1SHUX 3R5HA 1QWSA 1VL1A 2GTIA 4BCCA 4FYWA 2BV3A 3LPAA 4L2IB 3H2KA 4R9SA 2I7XA 1SG9A 1JHYA 2A0KA 3CBGA 4G0NA 5HJ7A 2Z6QA 4IWNA 3VO1A 4S35A 4OGWA 3AUYA 2GEVA 3ITKA 5A4IS 2EFYA 3MZ0A 3FN4A 1SCKA 2HSEA 1ZM3A 1W44A 1T10A 1CE8B 2V8BA 3E7WA 3ECCA 1N0HA 4L72A 1BMQA 2R6FA 5BWLA 1A0OA 4MUIA 5IT5A 4JDUA 2WTXA 2ZR8A 4N5NA 3ONNA 4JJAA 2Q3MA 1JPUA 1GRVA 3A1FA 4Q48A 3FTDA 3ZW8A 3DW3X 4Z4HA 3L1JA 1D4ZA 1LQUA 4HRVA 5AP9A 5DTQA 1K2VN 5BWMA 1C4KA 3C6QA 4GE0A 3TRDA 3E4CA 3T5MA 4DA0A 5C32A 3DOHA 1RZRA 4AWBA 2HT6A 4ENRA 1TK9A 3BZUA 4KPFC 2JH9A 2ZAOA 2BAGA 1FPMA 5EJ2A 4V0RA 2QT0A 2YZKA 4L0QA 3U6BA 1A77A 2VHCA 1WMBA 2GF9A 3MGKA 4B7UA 2WTUA 3GPLA 4LOAA 1WX1A 5CITA 2UYCA 3OQ1A 4OQLA 1JJBA 2FPXA 2B69A 4RVOA 5C52B 2CV2A 4NONA 1RHQA 5DIZA 1E2PA 1WXQA 2PT6A 3B1FA 5CYOA 2J0EA 4DBVO 2BKXA 2XNDD 3SHQA 1T3ZA 3OJEA 2VBGA 4JYMA 4L07A 5DMHA 1PFVA 1ZS9A 3SSAA 1OAAA 2WUEA 1JKFA 2YMPA 1HURA 4O33A 4B7ZA 3UQZA 2LKCA 2M2IA 1UMBB 2IODA 2NYRA 3GAMA 3KJHA 1Z2AA 2HRCA 3EGVA 2KM1A 3ETNA 5CB4A 4GKAA 3DLPX 3CIOA 3S2GA 3M4YA 1I13A 2H1RA 2Y1DA 5JXGA 3KQLA 3VSBA 2Z5FA 2FG5A 5FYQA 3F3MA 6CHYA 4F8JA 5KTPA 2YV5A 4KE6A 1Q17A 2HNKA 2XKKA 4H1UA 3FF1A 2Y0CA 2YV3A 2QENA 5HS4A 5L45A 2AEJA 3NHYA 4NPAA 5JQWA 1X87A 2DR2A 2CNOA 3HK2A 3HRHA 1QH8A 2Y1LA 2ZWPA 2QRZA 1OASA 4H7HA 1FP7A 3H3XA 3GEIA 5F33A 4IXDA 1KZGB 1EDBA 2HDWA 2QORA 4P98A 3NWJA 3RM3A 2J4CA 3DVQX 1VI5A 2VDKB 1HZZC 1LS1A 4B4DA 4YBZA 4IDNA 1X9IA 3DM9B 5DYIA 4CUZA 2FN7A 1VJ5A 5AI9A 1OFHA 4FXPA 5LP6C 3HBFA 4YV7A 1XQWA 1RBQA 2ODPA 4PCAA 4HUQB 3TSAA 1EFRA 2H48A 4Z4EA 1H8EA 2GCIA 2FWAA 4JDPA 1WDKA 1H1LB 1SBNE 1XK7A 3D4PA 4PAWA 5SYMA 3T7JA 1Z5GA 3WDLA 1BZYA 1A97A 3HACA 4E31A 3OIYA 1AH2A 2C2BA 2H85A 2XUQA 3U39A 4KYUA 2BGUA 2GN6A 3AR5A 1PS8A 3KVYA 3PKZA 3PT5A 3VNAA 4JBLA 4NE7A 3DUWA 4O6VA 1EE2A 4PZAA 3LOPA 3HO6A 4RKEA 1H0KA 4HP8A 2WU0A 2X8WA 3IQEA 4ZV7A 5IEBA 1WD5A 2PJRA 2H8KA 3BXHA 4AZTA 2IHTA 5TPWB 3RJ5A 1RFLA 3L7YA 1LNZA 1JDPA 2OCIA 1T8SA 3HKCB 2I4IA 3G2HA 3RUCA 3F6EX 4LBVA 5CB8A 3FWNA 3OD1A 2ZCVA 4HXGA 5CFPA 2IPMA 5U1PA 2G6BA 1QC5A 2FWJA 2IDMA 1DKQA 2Q07A 3EUEA 3N2LA 4NK4A 2C7RA 4BP9A 1V5GA 3L46A 5KWSA 3NYWA 4BEWA 2UZ1A 3R0IA 1K5GA 1XTSA 5ENZA 1Z08A 3IDFA 5HUHA 3Q72A 4DV6B 3N2GA 1KY2A 1FOEB 2ZITA 1NF3A 2G5TA 4YRPA 3LNTA 4UPVA 1U8ZA 1OIVA 2AE2A 3JQQA 3KZVA 4CZ2A 4JWTA 5AI5A 4OH7A 2K4MA 3NT4A 4P4TA 3FPGA 2XXAB 5BMVF 2ZETA 2E4XA 1GDTA 3EN0A 1F1JA 4G1FA 2XE8A 1N3LA 1Q0HA 4IGKA 3EIQA 4HH3C 4HXFB 2P0EA 4JIMA 3DCYA 4M38A 1BYIA 2AG5A 4QYWA 1KVTA 1QNLA 4RS4A 1L5KA 4AY5A 2CFSA 2ZJYA 1I6KA 3P94A 3R8FA 1PR4A 4BAZA 1PL6A 2A8YA 3QENA 3C6ZA 4URFA 3FBGA 1ZUHA 4IMJB 4XWKA 2JAWA 2AJLI 3WLFA 2H1IA 3D4LA 2FK7A 5BR1A 1U7DA 3EGDA 3BK2A 4Q00A 2DBVO 1SD5A 5K0JA 2G1PA 4MLCA 1FNNA 3TCKA 4DG5A 4DLXA 1Z74A 5JZMA 2RI1A 3VYWA 1N7GA 1ZJYA 2COEA 2C4MA 1DBRA 1CDOA 2GBLC 2QYSA 3FVRA 1GG9A 4BLUA 2CBXA 1AN9A 3F2IA 3REGA 4G89A 4DAEA 1YDWA 2EJVA 1AKUA 3FPFA 1ORTA 2PZMA 2XT9A 5E1MA 3S1SA 2F1RA 2ZI7A 4WXRA 4M55A 3KUDA 4K2AA 3U56A 4ZYUA 5EJEA 1CDZA 1Z4MA 4YP1A 1IL0A 4DSOA 4HYQA 1EVJA 3Q7QA 2FETA 1W0KA 5B1DA 4XVRA 3RYHB 5TQ0B 1L2TA 4QDKA 1VE3A 4CG2A 2WYOA 4FMPA 4MQ6A 4CLEA 4RHXA 5FI0B 1M1NB 1QGUA 3CN7A 3A6JA 2PMCA 2C0PA 2GF0A 4FMCB 5CU7A 1XI2A 1T4DA 4ZVVA 1XKTA 3FRJA 1FL9A 3HUDA 3K0CC 3L0YA 2C20A 4IF6A 2WBLC 2D74A 4IDFA 4RD2A 1MV8A 3NGLA 4WD3A 3JR7A 4QGFA 5BOSB 5ICCA 5K8CA 5BQ5A 3D6UA 4HN4B 3W2IA 4XGRA 3TFQA 2PT5A 2V6BA 4ZO9A 2WB4A 1J2EA 1M1XB 3FPJA 2H2GA 1OU0A 5KOHB 4YRKA 3AI7A 4IVQA 4GQIA 4RJIA 4X3PA 1DX6A 1ZI8A 2IFTA 2UAGA 2VKTA 3FMIA 2CGEA 1CJCA 4N8SA 1HPLA 5EWLB 4AUMA 5BN3A 1YJAA 4YT2A 1OY1A 3WLRA 2NPOA 2DXIA 4RJ2A 3VPAA 2BYTA 4ZREA 4Z51A 4KDEA 4RHUA 3OIDA 3M6UA 4FFDA 1R64A 1JTVA 1KDTA 3F6BX 2H54A 1GTZA 2XNKA 2AMVA 3PCXA 2R8XA 5KINB 2IHVA 4EPRA 1OW3B 2W2MA 3K4PA 3O2JA 4O2AB 1RJDA 5CHEA 5EIBC 4EHHA 3HJCA 4G9BA 5FD8A 1FTYA 5C8YB 3QSYA 5I9BA 1MOSA 1CY8A 5LUAA 2VA8A 2FFAA 4K8OA 1Z3CA 3W1WA 2F59A 3OJWA 4PVCA 2QE7D 3D7KA 5BSWA 3DJFA 4BVLA 3TQIA 4HSGA 4JNKA 4K9LA 3K32A 5K6TA 1C8LA 3BXPA 4RYLA 4C7KA 5FPQA 4K86A 3G0OA 3NYQA 5CDUA 2BE9A 4B4UA 1NXVA 4XXHA 5AUNB 2AOVA 2AOUA 4KVFA 4R3UC 5TMPA 2BMWA 1BSVA 5C3UA 3RSGA 4E3WA 4NARA 1XQXA 2QVLA 1K68A 3A2NA 2OWDA 2BR3A 1RQXA 1U1IA 2B7BA 2O3RA 3NATA 4IINA 4J16C 4PIPA 5A6VA 1P1FA 5EWMA 1A98A 5FTKA 4XJXA 2ZE7A 3TCXB 3V1UA 4CKCA 1ZD2P 4IOLA 4M1KA 3ZDQA 2A9VA 4UE6A 5DHRA 3WZMA 2A14A 1CFJA 3GN2A 1TMGE 3CUSA 3HFRA 1GPMA 2FN4A 4EGFA 3F6YA 5KOJB 4Y7CA 1NN1A 2OCGA 2XWPA 3M1IA 4KC0A 4DR5B 1P2BA 1GYQA 2IT1A 1UZNA 4TKUA 5A5GA 2ZUFA 4BYGA 4BYMA 1VLQA 2Z3WA 3A4NA 2DBRA 3N2KA 4IEEA 1Y9EA 5IWAB 5CEEA 2P3SA 1N5LA 1XVVA 2QQ0A 2W11A 2XUJA 1XRMA 3DG9A 4OOEA 4V2UA 4XD2A 1IHOA 1QFZA 5EWLA 1Z5PA 3LCCA 4MAFA 4ASUD 4UTPA 4XWOA 4BC0A 1X1RA 3QOFA 3VHXB 3F1KA 1Y1RA 2J30A 4F9TA 4JYAB 5CLIA 2R751 1C3XA 3K1TA 5JXWA 1OREA 4RENA 1IBKB 1TYCA 1CIJA 1GAWA 2B36A 3PL1A 2G9VA 2F00A 4WV3A 5CLQA 4MS3A 1M2NA 1R4AA 5BV7A 3MQFA 2UXDB 5DHUA 2GS9A 3UW3A 1JBKA 2WAAA 4JL5A 4Q1BA 1XNQB 1UFKA 3DOCA 3BF8A 3GNQA 1TQ2A 3OIVA 4W5WA 4PSKA 4G3XA 5T3YA 1KO5A 3ZVMA 1CY1A 1RKVA 1MVNA 2P1RA 3OLWA 1XX6A 4L0MA 3S6JA 4MA4A 4A2QA 5BNTA 1SEVA 4ENWA 3DAPA 2PRJA 4JYZA 2X14A 2FR8C 5IYZB 1ZW6A 1MN6A 2Z5VA 3IAUA 5JRZA 1XNRB 1Z8DA 4C87A 3W5BA 4M9XA 1KRHA 4MAMA 5FPPA 3QWAA 2WTNA 2P0YA 4ZHQB 2PA0A 1PJ4A 4NPHA 3MJFA 4WZAE 5DCUA 1SJ9A 3RUIA 1I8TA 3TUIC 3CX7A 4A10A 4DKJA 3I4CA 4FGKA 1II8A 4WXHA 2PUWA 3DBIA 3BQMB 3TVYA 2VG8A 2GAOA 5B3LA 4O4IF 4E46A 3SVZA 1CUAA 1ISGA 1CUEA 1NSFA 2GJ9A 3LUKA 4O1HA 4HLUA 1XQYA 3WA6A 4A5OA 4UQPA 4H6PA 3DB1A 2Z43A 3NHJA 2PH3A 1N3IA 5BNIA 4MKIA 5AVUA 5JCXA 1H1LA 2B4AA 4J7CA 1U6KA 3QVUA 5ALDA 4TM8A 4B3XA 3SQOA 1F6WA 2WMYA 2W5UA 3ZBPA 1KAHA 3RI3A 3MGBA 2J3EA 3HGMA 4Y67A 2TECE 5CM2Z 1UWCA 3NC4A 2NUPB 1G8KA 3IEUA 3R8CA 3QVSA 1J8VA 1J00A 2I4OA 2EDAA 1BA2A 3KEFA 1FFGA 1INLA 1JR2A 3BEOA 1DTWA 2FZ4A 3O4FA 3P2YA 4LI0A 1M7HA 3G8CA 4TL7A 4XPIB 3OZXA 3DTVB 4LXHA 5G3ZA 3O26A 3SYTA 5KVVA 2VHUA 3STWA 1XD2B 2Q41A 1I7QB 3LQRA 3MXTA 3BJIC 2NQ8A 4YJDA 1W6RA 2IU4A 2OHIA 2VDMB 3A6FA 3DTYA 5T41A 4F6RA 1JIVA 3TLEA 2FSHA 3H17A 2W58A 3C74A 4JOSA 4RCZA 1VHWA 5CP8A 1P5FA 2Z1MA 4Q12A 4B82A 4BWFB 3PNKA 1J1IA 2GPYA 2GPTA 4I50F 3MAAC 4LBZA 4UE2A 1KMHB 2AFIE 3A70A 1JR3E 2O5RA 3BE6A 3ONFA 5FBHA 5FA6A 2FUKA 3FVTA 1FXUA 4ZT2A 2WAXA 3ETDA 1CW2B 4JFAA 2OXIA 1GQYA 3GUUA 3R5XA 4FKZA 1XN4A 2IIPA 2QYHA 1EUZA 3PHCA 3TE7A 1QPZA 1WHTB 2Y1WA 5JMWA 2XIQA 3DMFA 4HAUA 4QVGA 5JH7B 4KR0A 3ILYA 2QUAA 3KFLA 4Q1DA 5JASA 5AK4A 4J07A 1AHPA 4EGAA 3DF9A 4BS9A 4U2KA 1PK9A 5GADl 1GL6A 1NUQA 3CE6A 3QTBA 3EG9A 4MUFA 1N2IA 2QTRA 4QL3A 3ZI7A 4F1WA 4YAKA 5I7HA 3KL2A 4MPPA 2RHMA 5FCDA 4IZHA 4WMLA 4D4KA 4ZOAA 1IB6A 4LAFA 4LFBB 5DHTA 4HLDA 1M2JA 3K5PA 5C81A 2DE0X 4JD5A 1RQRA 4KDFA 2V7VA 3OP1A 4MA0A 2YWEA 1TJNA 1FNMA 1OX4B 2AOXA 2OZLA 1JHMA 1NBEA 1XIVA 2QZSA 3PGLA 4AG6A 1WAMA 5JWRA 3B53X 1Z18A 2YV1A 3SKXA 5A04A 3IUQA 5KBYA 3IOYA 2C99A 1FUYB 5H16A 3SAJA 1OXVA 1QCCA 3KHSA 3TQOA 4RFLA 1LPMA 1P3DA 3NHAA 4FMDF 2B2CA 3EXHB 4ME6A 3EAQA 2QW0X 3PSAA 4CM4B 4DCTA 4TQGA 3MWEA 3SNHA 1JAZA 4BXOA 1KC1A 1GT91 1GPUA 2UZAA 4HS9A 4M7OA 4RA9A 5HM6A 1O95C 3GIWA 2NO5A 2Q5CA 1ESDA 2PZEA 2FKAA 2HMAA 2VF7A 2VAMA 3G89A 4CG0A 3EDMA 3OQIA 3NJRA 4RPIA 4DRZA 2Y27A 4DMRA 5HEKA 5EJIA 4CL0A 3WIVA 1A2BA 4D6YA 5EP2A 3BYZA 3SNKA 2RGUA 5K0CA 1PK8A 4BNUA 1D0SA 4GPZA 4BEVA 4QYIB 2BFDA 4PW0A 3I04M 3OU7A 1B6GA 4RXUA 4Y2XA 3ZLBA 2PUCA 3TEFA 1MKYA 2CLFB 2G9QA 2XODA 3G02A 4RH3A 4YP5A 1I80A 2J9RA 3HVRA 1IZZA 2X6RA 4AYXA 5FL7D 3E23A 1SUIA 3S40A 1P29A 4GSKA 3UMVA 1YKFA 2ANCA 2C8LA 2H63A 2Q2WA 3GJ3A 4J0GA 5DYTA 5GJVC 7ADHA 3DT6A 4J29A 2FRDA 3UT5A 3RAGA 4BIMA 1PJ3A 1YIAA 1ZI6A 2ZSUA 3PUIA 2DH5A 2GRUA 2ZAIA 1Y34E 4H1TA 2PRIA 1GDDA 3GPIA 3HA7A 2QD5A 4MVJF 2A2ZA 2OK8A 3EC2A 3WK9A 3RIMA 4E14A 4Q9LA 3PDIB 1A5TA 1H6DA 3EVZA 4L4ZA 3SC6A 4YALA 4D9CA 3TLAA 2OBYA 3I8XA 3FE2A 4IIHA 5AYVA 3AF0A 3G7SA 3PRYA 3VR5D 3N53A 2AE1A 1JF8A 5FORA 1FJGB 3E8MA 3RTGA 1R0RE 4J2HA 5CW2A 1YJ8A 1H05A 2W00A 1RC1A 1Q7EA 2G07A 3OFNA 3OPXA 3VR3D 3WIDA 5KKNB 1NNEA 1X14A 2YWGA 1RRKA 4CM1A 1CLEA 4JEIA 1JXMA 3EWAA 4CI0B 3D81A 4TZ6A 5H68A 1MQAA 2Q3EA 1P39A 1X94A 3Q85A 4L5AA 1JH8A 1QB7A 5CTAA 2A1TS 4FR5A 1F48A 1BQEA 4NFLA 4AWXA 1R8XA 2IYPA 1IHXA 1M2OB 5LP6A 3KDSE 2FTKE 1Q15A 3OA0A 2PRSA 3V4OA 1COZA 1ZD1A 5IAJA 4MJXA 2FVXA 1L7NA 1ZH8A 2GASA 5JSYA 2WJZB 4D6XA 3HCDA 3MB5A 2H0AA 2ZKLA 1W2HA 1W59A 3SYMA 4GR4A 2ZJ0A 1M6WA 3O5AA 4FFNA 3UHFA 3CGGA 5A71A 3ROKA 4YLGA 1G5TA 1GL7A 2BCJQ 5CURA 5IX8A 2Z5LA 2SCUA 3IAFA 2YKGA 2GJ8A 1DFIA 4CW7A 3BGIA 1MTZA 4G65A 3VUFA 4DRXA 3LGXA 2BELA 4HWGA 4RX1A 5GZ1A 2OP1A 2BZGA 1DHRA 1EP2B 3N9IA