3L93A

Phosphopantetheine adenylyltransferase from yersinia pestis.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
b'NAMITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMFTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title X-ray crystal structure of phosphopantetheine adenylyltransferase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Transferase
total genus 53
structure length 161
sequence length 161
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3l93A00
3M5WA 2BYTA 1JIIA 2QUJA 1R6XA 3ZXSA 1EFPB 3F3MA 3TS1A 4WSOA 1EE1A 1JEEA 1M83A 4XSVA 2E0IA 3U1VA 4ZT4A 1ZJWA 1HYBA 4MUHA 4NATA 3UOWA 2Z09A 4EG1A 3QE4A 2OV4A 3KT3A 1T6XA 2WQ6A 1EFVB 1KH3A 4I6JA 4Q16A 2J07A 2A1UB 2CUZA 1QJCA 4Q93A 1EFPA 1QRSA 1XNJA 1N2GA 5HG0A 4U8HA 1EFVA 1N77A 2QUIA 4DNXA 3SZ3A 4EG7A 1KQOA 3N9IA 4ZCSA 4YP5A 1T6ZA 1M8KA 1J20A 2R5WA 3PNBA 3FWKA 4CQNA 2PXHA 1Q19A 4K03A 1OWPA 1N2OA 4MW1A 1MOPA 1PFUA 2GOYA 3HMQA 1T6YA 1OWNA 2A1TR 2A84A 1N2EA 4HJRA 4OUDB 3UY4A 2EL7A 3AKZA 4YP7A 2YWBA 1O96B 4G5YA 1ILEA 4ARCA 5DASA 3IVCA 3P0JA 4OUDA 4ND6A 1OD6A 1O94D 1GPMA 1NURA 4RUKA 3AG5A 2QUHA 1I6MA 4MAFA 4DDHA 2DEUA 1H3NA 1A8HA 3H05A 3JXEA 5HUJA 4YP6A 4J75A 3H99A 3CVWA 3RK1A 3ZJTA 3OTWA 4ZCRA 3GMIA 5J58A 4AQ7A 1VBMA 1M8PA 3CLTC 4I6EA 1IQRA 4HK4A 2E89A 3GUZA 3A04A 1G59A 3X1JA 3CLSC 1V47A 5TEVA 1I2DA 4AS1A 5KWVA 2HMAA 2QJTA 4EG3A 1OBHA 1R6UA 1D2RA 1WQ4A 1PG0A 3IMEA 1IFXA 5J59A 3ZIUA 1N2JA 5TS2A 3DV2A 3FHJA 3H9BA 4MUEA 1MB2A 3G59A 3ZXIA 2CT8A 4ZT3A 1MAWA 1M8JA 1EJ2A 1KKUA 1K4MA 1TYCA 4U63A 5FNZA 3FIUA 3IODA 3CLSD 2JAXA 5F23A 3BL5A 4MUIA 5IHXA 4G5FA 4MUGA 1MB9A 4ZT7A 2WSIA 5H16A 1COZA 2C5SA 4MW2A 1J1UA 4BWVA 2Z08A 4EG8A 1DNPA 1NZJA 1Q11A 4S1OA 4U7JA 1PFYA 1WQ3A 2E18A 1H1TA 1JMVA 2CV0A 1WY5A 4MUNA 3UC5A 3FNRA 3P0IA 1ZH6A 3COVA 4RPIA 4MWBA 2QTMA 3N05A 3PRHA 3RHSA 1RQGA 5FO1A 3AFHA 1QTQA 3KFLA 4PY2A 1J09A 1O0CA 3QTTA 3ND6A 2CV2A 1NUUA 3LE8A 1YIAA 3NV7A 2X0KA 1N75A 4ZT2A 1QU2A 1TEZA 4A91A 1M8FA 1JHDA 1MJHA 3IVGA 3IMCA 1NSYA 4XFDA 1KORA 3G5AA 2QUKA 3H97A 4JXZA 1WKBA 1EUYA 4P2BA 1PFWA 1UFVA 4NAHA 4CDNA 1O94C 4GU5A 4KR6A 3SZGA 3LCJA 3ISJA 3FH0A 1JGTA 1NUSA 4WNYA 1Q77A 4F4HA 1G8HA 1TQ8A 1Y42X 2DPLA 2A1TS 4E1AA 2J4DA 1KH2A 4R2LA 1GTSA 4X0EA 4K0RA 1YIDA 2HZ7A 4DLPA 2YY5A 3ND7A 2ZUFA 2DETA 4MVYA 1G8GA 1MBZA 5KCMA 1O97D 3VGJA 1JZSA 4MULA 2V0GA 3TNJA 4MVCA 3A2KA 3RK0A 1YUMA 1U7DA 3ZUGA 2OQ2A 2XRZA 3UK2A 4EG6A 4MWEA 3K32A 3ZJUA 1NUTA 2CYCA 1GN8A 3ZGZA 2A86A 5HUHA 1IQ0A 2PIDA 1WXFA 1GZUA 3E27A 3MXTA 2TS1A 2YWCA 4ND7A 3IUEA 4QRDA 1F9AA 2NZ2A 3IOBA 1NI5A 5AHWA 3OP1A 3LOQA 3Q4GA 3CVVA 2DR2A 4F3RA 2Z3VA 3HGMA 2QJOA 1K4KA 1V8FA 3MMXA 1K97A 1PFVA 4G6ZA 5DK4A 3P52A 3IOCA 4MW0A 3CVXA 2GM3A 3MLAA 4PBSA 1H3FA 1B6TA 3KT0A 1LI5A 3PXUA 4MVWA 2O8VA 1YULA 1QQTA 4R2MA 4EG4A 2CSXA 4XFJA 2EJCA 4NAUA 3X1KA 3ND5A 1KAQA 3N8HA 1IQUA 3FI0A 1N1DA 2V0CA 1J70A 1I6KA 1ZUNA 2WQ7A 2D54A 3FOCA 3D6VA 4KR7A 3AIIA 4JXXA 5BNZA 4EFKA 2IP1A 3AG6A 5H7XA 1OWOA 2J09A 1O95D 1X6VA 3N2YA 1VBNA 3FETA 1G8FA 1XJQA 1NP7A 2PZAA 4QREA 3TQOA 3L93A 3VRHA 4JYZA 2DXIA 1N2IA 4DJAA 3COWA 1JIKA 3CVYA 1QNFA 4YMIA 3Q10A 4DDKA 2H2AA 2NSYA 4MWCA 1T9GS 4ZCPA 5DB4A 1QU3A 1MAUA 4DE5A 1N3LA 1T9GR 4HJXA 2DUMA 2O5RA 2A4MA 4CDMA 3KT6A 5TGTA 3ZJVA 1WJGA 3NBAA 2G36A 3FG9A 2RD2A 2PZBA 1JILA 3CLRC 2HGZA 1EUQA 3IH5A 1FYDA 2PG3A 3DLAA 4HPWA 4KPUB 4YBRA 3P0HA 2JA2A 4I6GA 1I6LA 3GLVA 4JZYA 4NDAA 1NUQA 1QRTA 1TYAE 5JBNA 2VTBB 1Q15A 2QTNA 2CV1A 2X1MA 4KPUA 4L2IB 2AG6A 3INNA 1VLHA 1O6BA 1N78A 1KQNA 1EXDA 3D6UA 4OJMX 3NBKA 4MW4A 5FO0A 4EGAA 3K9WA 4ZT6A 3SP1A 2VTBA 3HV0A 3IUBA 1X8XA 3IMGA 4NZPA 1WXGA 1O97C 3MUEA 2D5BA 4L2IA 3RJZA 2H29A 1WOYA 1JIJA 3CLRD 4MVXA 3IVXA 5J5AA 1XNGA 3CA8A 3X1MA 4CT0A 1FFYA 1KP2A 3TZEA 3COZA 1J21A 4TS1A 1QRUA 5EKDA 2XRYA 3DO8A 4PBRA 2DERA 2QJFA 1R6TA 4MW7A 1K92A 1IH8A 1YI8A 1JZQA 2X3FA 3ELBA 3KT8A 4MW5A 2BTEA 1NUPA 3HL4A 2AZXA 3L92A 2A1UA 1VL2A 3SEQA 4DDMA 3PNVA 4MLPA 4UZEA 4UZFA 3TZLA 2A7XA 3CLUC 2WB2A 1TYDE 1N2HA 1YUNA 4MQ6A 2A88A 4MUJA 1JECA 1M8GA 1WXIA 2JANA 2ZP1A 1F7VA 1OWMA 2PFSA 1U0BB 1S4MA 1N2BA 1BS2A 1LW7A 4H3SA 2D13A 4J76A 1U7XA 1O95C 1IHOA 1WXEA 4MWDA 1TYBE 3CLUD 1IRXA 2PZ8A 3HFJA 1O96A 3ILVA 3S3TA 1U3DA 5K0TA 5IJXA 4FZJA 1LI7A 3FDXA 1IVSA 2GKSA 3HZRA 1M1ZA 1WZ2A 1F7UA 2ZUEA 1ZH0A 4ZCQA 5LLTA 5K0SA 1KAMA 1O5TA 3H9CA 2X1LA 1KQPA 3C8ZA 3RBAA 2AKEA 1TFUA 2IJGX 2I1LA 1NYLA 2CYBA 1KR2A 4EG5A 3SYTA 1GAXA 2E21A 1OWLA 5TEWA 4QBTA 3FY4A 4MUFA 1SURA 3RFFA 3MLBA 5DEOA 1KP3A 2B7LA 5LFAA 2VXOA 3PNYA 4ARIA 3I05A 1XNHA 1MC1A 3A4IA 4JFAA 3VU8A 3UMVA 1GTRA 4PBTA 1JEDA 2CFOA 2J08A 2CYAA 4NX2A 3CVUA 4EF6A 3CLTD 4KR9A 2QTRA 1OBCA 1O0BA 1PG2A 3G6KA 1J1ZA 5KHAA 3A05A 3AL0C 5LM3A 1VBKA 4ZT5A 3TQIA 1ULHA 3IDFA 3Q12A 1CT9A 3DPIA 1P7PA 4ZCTA 1H3EA 1KH1A 4GRIA 3SEZA 4MW6A 1F4LA 3CR8A 2DLCX 4R0NA 1WXHA 2YXNA 3IOEA 1U3CA 3QTBA 1MRZA 2IELA 2J5BA 3SDBA 2RE8A 4MUKA 3COYA 4KKVA 4MW9A 1GLNA
chains in the Genus database with same CATH superfamily
1BFKA 3IP8A 3K0BA 5C80A 3RW9A 2XBLA 1PK8A 3F3MA 1DBSA 1YS7A 4ZMRA 1JEEA 5K8LA 4RTSA 1OT5A 1YZVA 1LWOA 4PX5A 3THSA 1EFCA 1I1OA 1WB6A 2FWMX 2QRMA 2C2HA 3B7GA 3EWAA 3WRYC 1BO6A 3JD1A 1R1DA 3PPVA 2XBUA 3S1LA 4AIRA 1IY8A 2NTNA 3BHIA 4EY3A 3QLTA 1T1GA 2CBGA 3I1JA 4Z2YA 1N0WA 5FA8A 2WVGA 2ZE7A 4E5KA 1N2GA 3DQPA 5DPMA 1UJ6A 3O5AA 2NZWA 4NDZA 4RELA 1AVTA 4U8HA 4XJVA 5IEBA 5K01A 4MV6A 3ILYA 5ALIA 3DOOA 3VPAA 4HNGA 1Z08A 4AD8A 2EERA 2YVQA 3PPWA 5C51B 2JLVA 5JBIA 2Y1WA 1B6SA 3LYAA 4I66A 4ZDKA 2M1ZA 3HB7A 4R68A 2G4LA 4OJTA 3ZWMA 4CV0A 2GN8A 1XMJA 1XRLA 4U7GA 1N0UA 3G2KA 1ACJA 2Y3IA 1BCSA 1H8ED 1ZVKA 4IAOA 3GD5A 3ZXXA 4B75A 4G86A 2XNKA 4ITUA 4Z3KA 1O03A 2CDNA 2NVUB 1QMPA 1MOPA 3CPSA 2XNSA 1CWUA 2SICE 1N25A 3N2IA 3P5BA 1DRUA 1YDEA 3QRWA 5DM4A 5FBLB 5K3CA 4E7PA 3N2GB 4C04A 4Y1EA 3AWDA 1JLKA 4IOLA 4W5RA 3BJIC 2CUKA 4ARZB 2I91A 3SVLA 4CIXA 3V33A 5IZCA 3CJQA 4G8CA 1N33B 3UT5A 4YP7A 2ISSD 2YWBA 3AVOA 2FSFA 2PJZA 2RI0A 1TUBB 2NSHA 3FNIA 3NUGA 1XXHB 3I0ZA 3WDLA 3EASA 2ETXA 4H7JA 5DTRA 2IV2X 3UENA 2VF2A 5K6RA 4ZCLA 4RGVA 4CF6A 4P80A 3W4IA 3QX7A 2F67A 4YACA 3GBPA 1C0PA 1E1LA 1QH8A 1C9KA 1ICEA 2CK3A 1ADCA 3H5IA 4IJKA 4DMFA 2IF0A 3THWB 2GBFA 3DB1A 5KYTA 1Y6FA 3OQOA 5EZ5A 1EZ4A 1TK3A 3AU8A 4WBXC 3S99A 1WAMA 1ORVA 3I9FA 3RU7A 3W5BA 3W7VA 4FN5A 3DDUA 3OTWA 2F1HA 4ZCRA 5KX5F 4X7MA 1O7JA 3B52X 3IESA 5EA2A 5FUBA 3E8SA 4BJ6A 2ZIAA 3G7NA 3T5CA 1PT5A 3KUXA 4E33A 2PUGA 4WOBA 4NU8X 1M2EA 2XVMA 5IC4A 3HWWA 1JTEA 3LC0A 2I6QA 1CFZA 2VYCA 3F7OA 5EEHA 4LRQA 1D07A 1PR4A 1TZKA 4BZXA 2H85A 4MV9A 1UPFA 4EG3A 4YJDA 4JAVC 4BKMA 3R6WA 1PSZA 2VAMA 1GNPA 1X3SA 1WQ4A 3P4YA 4CEJB 4Q18A 2XB9A 4CKCB 4GR5A 2FSVC 5JTTA 1M5TA 2OC4A 2QXUA 3GT0A 3BDVA 3OX1A 5BWMA 3VPGA 4YY3B 1YA6A 4HI0E 4COKA 2QSYA 3GLFA 2W6IA 4CLHA 1HTTA 1N2CB 2DH6A 1A9QA 4QAQA 4WVFA 1W2GA 4UFPA 1JEOA 3LHSA 3AM1A 2R47A 4H7DA 1TTPB 4FHFA 3P9ZA 1D2HA 3FUTA 3WMFA 3EGXA 1Y0BA 2FW6A 5FL3A 1WCXA 1EM6A 3WKAA 4PLHA 3DHNA 2VRCA 4DEXA 2RBGA 1CZLA 6AT1A 1JG2A 4IFEA 3SZRA 3EFOB 1MG0A 3FTNA 2JAXA 3NM5A 2VJMA 4URYR 3D6HA 3JVDA 1BW9A 3BL5A 3REQB 4ZYYA 4MUIA 3QLUA 5EI5A 3RIEA 4G1BA 3ZVMA 3L4SO 4EHKA 1NBWB 4TV8F 3MAJA 3DE5X 3OFKA 2YWGA 4I4NA 1IWBB 1Z4OA 4O5OA 1Y9JA 3FNFA 1M9NA 3L6DA 2IV3A 1SA0B 4HL6A 1BEEA 1RJ9B 4K40A 2GILA 3TKAA 2IOQA 4M6WA 2E18A 1I10A 1U04A 1Z7GA 1Z7YA 3OWXA 1P7WA 2FOLA 2ZE8A 4MP3A 2H5IA 1AY0A 2I4IA 2JJ1D 5LOVF 1PR3A 1U6KA 3AEUA 3U4QB 1CRQA 3M4XA 2IQ5A 4H16A 4YAJA 4RPIA 5AW8A 1Z34A 2R65A 2OD9A 4Z5XA 5IJ0B 6ABPA 1PNRA 3RUEA 4QPJC 5LU9A 4LF4B 2VAXA 2BHRA 2NG1A 3PT9A 1F0YA 3UO8B 2IU3A 4TUYB 1II0A 4DQUA 1PYDA 2FPXA 3ZVKA 1FP2A 1KEEA 1UKAA 2XOEA 1TAHA 2HL6A 4FE4A 3T1OA 3BGSA 1NLFA 1UZNA 3WDMA 3HB5X 4QQKA 1WW3A 2ZAMA 3CCCA 4FGKA 4MYSA 4E30A 4ZU6X 1OFUX 2ZE5A 1K0FA 1PNOA 4FWIB 4CM1A 4YCDA 3BJZA 2VQSA 3W5DA 5I3ZA 2XYQA 1YQTA 5FFMA 3TEJA 2FMKA 3GDOA 4C0WA 3FHTA 4NFLA 4RPJA 3A3PA 1GRCA 2QUKA 3H97A 4FFVA 5DIZA 5E4FA 5KDOA 1EX7A 1J0DA 5D00A 5EZ6B 4TYNA 5C0OE 1WABA 3KSZO 4QU8A 1JVBA 2HY7A 1YQ9A 1CEXA 1UFVA 3FR7A 3HLTA 4CL8A 4OKNA 1Z6PA 3MTIA 2Z8YA 4CDNA 2JCXA 2WU3A 4BN5A 4P4NA 4JLBA 2GESA 2WKRA 5HA5A 3WP1B 4BECA 2IHJA 1QE5A 1JGTA 1PSDA 2ON6A 1EWTA 1E9RA 1FFHA 2E48A 3UXEA 3HZOA 5EG5A 3V55A 2XT9A 2C78A 4M9SA 1TKBA 2ANBA 4ES6A 2NTYC 1E5LA 1E6WA 2AW3A 4RJKA 5DWQA 5JFGA 3FVVA 3K8QA 4GMKA 2H08A 1MZPA 1HDOA 4I2NA 4IG4A 3G5UA 4R2LA 1J90A 1T0BA 2PXCA 2WAYA 5JSUA 3NKLA 4GGOA 1YR9A 2YY5A 3F2IA 2DETA 2IV7A 4MVYA 4ESOA 3L6CA 1MBZA 1YQWA 3ES9A 3P20A 4K3VA 1QORA 4KXLA 4PNPA 2AYYA 4XFKA 2BHLA 1O8CA 4XUCA 3NVAA 2WY2D 1EGAA 3ZE7A 5F2OA 3HXQA 1TIBA 3CMCO 2RGRA 5KTYA 2C2XA 1H4TA 2C83A 2W6MA 2IYTA 3A2NA 3HP1A 2VNKA 2O57A 4OQDA 4JV5B 3D8TA 3KXPA 1M6VA 3UWSA 3BMCA 2WV7A 3LW8A 3DTVD 3GXOA 3ZGZA 2G72A 4P3YA 1OXVA 2Q6KA 4YRRA 3WLOA 5FI0B 5MN6A 4TS4A 3LWBA 3QPCA 2XA2A 3SDSA 3WB0A 3C4QA 1A7JA 4FYKA 2FHPA 1KOGA 2PYDA 3QLVC 1MNQA 3LA6A 1LSUA 1U2ZA 1Q21A 2CC2A 2KI5A 4CQLB 4QRDA 1DXOA 4BBZA 4X7PA 1M0TA 2JRLA 3K73O 2G25A 4KDRA 1F9AA 2YWDA 1L3CA 2ZJ5A 2ZPTX 4KQ2A 1GEGA 1ODLA 1QH1A 1X38A 3RYFB 4Z4IA 2X6QA 3D6TB 5CVJA 1IE3A 4F84A 4XR4A 3WNVA 5IK2D 1FDIA 5C1IA 4BEVA 4UU1A 4OXKA 1DPGA 4LIPD 3OQ1A 1SZJG 1X39A 3B1ZA 2PZJA 3GJRA 3ZW8A 1A3CA 5FR1A 3EC1A 3O4HA 4D2IA 1DBVO 2CNDA 3WRXA 3AEXA 3ZZUA 4PBSA 1QIJA 4M9QA 2ZRKA 4UBIA 1A69A 4XCXA 4XGKA 4WK0B 3RIMA 4F3TA 4U2CA 1JIVA 3GDFA 3BTUA 1O57A 4NYMQ 1SVSA 5REQA 3TAHA 3GPBA 2WWYA 1NC1A 2B0CA 4XSHA 1DARA 4NG4A 1ZUNA 2HA4A 1L1EA 2GHRA 2R87A 5A1JA 4BYMA 1XK7A 3KS9A 1X7XA 2O2HA 1UBNA 3HDYA 4IDOA 4C4AA 4B6JA 4MA4A 3IE0A 2C8LA 4EI9A 3KQLA 2GVDC 2OG1A 1ZMRA 1AKNA 2R79A 3ETDA 2R00A 4RK1A 4RGQA 1SBYA 1Z2OX 1GT6A 2IP1A 2C1XA 2Y93A 3M6MD 4KIUA 3RUFA 3EDYA 1LNQA 2PT9A 2HNBA 1FFCA 3N2YA 4JI3B 1Q1QA 5C1DA 2UVPB 4WKOA 3LL7A 2RHBA 5CJ2A 5A3JA 1T5TA 4FGLA 1Q0ZA 3SR4A 1C41A 3KOZA 1KMMA 3OJFA 1FMTA 4HUJA 1PGOA 2WYOA 1UPTA 1VPVA 4ALIA 4GKAA 4V24A 1EXMA 4F85A 4Y9UA 2NXNA 5I9TA 3PRJA 4HQLA 4I9FA 3TIFA 4AO7A 4CCYB 1KO4A 4JI8B 1CF2O 1N5JA 2G9RA 2QU8A 3HQ4O 3FPJA 3M1AA 3R0JA 4HF7A 1V8PA 1LWNA 4YAWA 4HLUC 6CHYA 4PPQA 2YBEA 1G63A 1YQEA 3HY6A 2QR3A 2VCEA 3M6IA 1NBMD 4Q0MA 4ZO4A 4FIZA 1Y8QA 3IOMA 1FYEA 1L3BA 1WPGA 4Z8YA 3DMRA 1SULA 1YMVA 1ATIA 2F9MA 4ZI5A 1KGDA 1H4QA 1XMIA 2BGRA 3MWFA 3BULA 4A8TA 2XNCA 2MYTA 4IFIA 4XGRA 4DUGA 2D0DA 4K6FA 2R1TB 2IW1A 1GPLA 2C5AA 3GB9A 3TGWA 3V4PB 4ENRA 1ZEJA 1Q7CA 3OO1A 3OEWA 4B31A 4E5MA 1KYTA 4BATA 4OIFA 4X45A 4GDMA 5CR9A 1BDIA 3INYA 3HJNA 5BV1A 4EVIA 3IL2A 3RNOA 3ASVA 3HJTA 1L6IA 2RB5A 3INNA 5A04A 2RGDA 4TLBA 5CVDA 3ROGA 1H05A 2OVBA 2QLFA 1CBUA 1XTBA 1UAAA 1B76A 3HUDA 4OJMX 2YICA 4EGAA 4YV0A 3E9QA 5CT6A 1HRDA 1SUSA 4TLDA 4DANA 2QT9A 3S2FA 1QNLA 5BR7A 1PVOA 4L2IA 3G9UA 2Q6VA 5B7PA 2ZJYA 3T7EA 1WOYA 3ONEA 4Q1VA 2NUAA 5DYGA 3JTMA 4MARA 1EFRD 5K3SA 1BYUA 2P4QA 3IDQA 3C6BA 1S1MA 4URZR 1OJ7A 1XTRA 4CT0A 3GAAA 1CYDA 4CTMA 2Q1XA 2UUBB 4OHOA 1DC5A 2VSOA 2X8LA 4D4IA 5TMEA 1I1HA 1W4RA 3TZEA 4AKIA 3COZA 3QA3E 4J03A 1OQAA 2NQ2C 3QQ5A 3F4LA 4D0GA 4M7RA 1QB7A 2VNJA 4BFTA 1PR9A 2XRYA 5JI3E 3ZDBA 3IP3A 2IS2A 1HR0B 2AA3A 3EPLA 1JBQA 2YBDA 1AMUA 1Q0PA 1DV2A 1R0BA 1K6JA 2WBLC 3KB1A 2VQFB 2QE7D 2BTEA 4RTJA 2BE9A 4KTTE 5JNLA 4R2KA 1C1DA 1OIWA 2ZSBA 1KJWA 2C94A 1P1HA 1QFXA 2P9CA 5F33A 2FDCA 5NLLA 5HZHA 4ZZIA 4B3TB 1GNSA 4IR7A 5DW0A 5ER6A 2MR5A 4EJ6A 1PQUA 1LX7A 3ZHRA 3KTDA 5FX2A 1EWYA 4KXYA 1JMYA 3W77A 1KU6A 1NJ1A 8GPBA 2IRWA 3OCYA 5K0BA 2PX8A 3TE7A 1Z2AA 3DHVA 1SCJA 3AU9A 4HGYA 2XVZA 1HMPA 3LX4A 4ZGBA 1NW6A 5JMOA 1OWMA 3L8GA 1E1RA 1YE3A 3Q8WA 1R3UA 3CWCA 3MGCA 4IDFA 5IH3A 3RSZA 1KERA 1GYPA 2B4AA 1XCOA 2WD8A 3CURA 4QXMA 1UFQA 1KJJA 1W5TA 4TN5A 5BV8A 2VEDA 4CG3A 3ZC3A 2WE8A 4OPMA 4J90A 1NFRA 4ECAA 3I83A 3ZCRA 1CSEE 5KTSA 4AJKA 3ENZA 1UWVA 1I01A 2VJQA 1UZUA 1DO8A 2ZUTA 1FFWA 1S8NA 4REOA 3JWHA 3SICE 3DMNA 4DHEA 3H9JA 5ABPA 5C37A 4W5TA 1DLJA 1QOZA 2HWYA 3FZQA 5JE8A 5I7OA 4S1TA 1F7UA 3NEJA 2RHLA 3IHWA 4RTQA 1KMHB 3UPDA 3EGEA 3AQIA 4Z9AA 3R8CA 3UWMA 2KHZA 3I3SR 5BN4B 5LC1A 1XQVA 5KNBH 4WT7A 3KZVA 4TX1A 2H2FA 1EK2A 2TMKA 4P6VF 4GM0A 4JC8A 4Q7LA 5JUWA 4EG5A 4OJNA 1GCGA 4U5XA 2BFFA 1OFGA 3FUUA 3T1HB 3SE0A 3IUYA 3GWZA 3OOYA 1UAGA 4WY8A 3FY4A 2DSTA 1SURA 1RRVA 3JD0A 3RSCA 4F91B 2J30A 3GHYA 1A27A 3V3KA 4MCHA 2J46A 1K75A 1ZHHA 4MVJE 1EVKA 1URPA 1WP9A 1VE7A 1VGRA 4N18A 5HX7A 3NT5A 2XUGA 2JLQA 3CGWA 4ZMBA 1BROA 1FRVA 4CV2A 2CZCA 3VPSA 2VFAA 3OM8A 4QGAA 3WLNA 3ZWOA 721PA 5B4TA 3DWIA 2ZI4A 1DXQA 1J0BA 2QU7A 4CMHA 3OEED 2ZRDA 3E9EA 1B1CA 2WSLA 4Q4JB 2GVZC 3IALA 3TIIA 4F06A 1FDRA 2FPUA 5DNUA 3V7NA 2H1RA 2Z6AA 3P9QA 2V98A 5CW2A 1T0IA 4CM5A 2ONYA 5E1MA 4UVHA 1P74A 5IF9A 4DUZB 1ULHA 3RE1A 3M6AA 5F7JA 3ETJA 5HCIA 2I78A 3DPIA 1GNLA 2QAGA 5KOIA 3WC4A 2V8BA 1GLGA 2HRQA 2Y1XA 3NGXA 3ZQ4A 1WDWB 1MU0A 4EYEA 1GY8A 3MTDA 3CISA 4KBFA 4B8WA 1W8DA 1I3OA 3IAAA 4UOZA 1CZOA 3TR0A 4LZAA 1M2HA 4KXFB 3F8SA 4CKWB 3BJRA 4QQFA 1G7RA 3MBKA 1LNZA 1LPPA 1MRZA 2GCPA 2JD1A 4BDSA 2B8WA 5AICA 1P2VA 1YZGA 1GUBA 2W6ID 3F90A 3M6LA 4DC1A 2WTUA 4NPHA 3SF8A 2NSDA 2Y66A 3DULA 3FF4A 1Z26A 2RAFA 2FPIA 1O54A 4HAOA 2PE5A 4DV7B 4MUAA 2J6BA 2C82A 3QLJA 3E61A 5IDWA 1RSZA 2H59A 3O95A 4LF6B 5ECWA 2P2CA 4LMBA 3CE6A 3KXIA 4A0FA 1JHVA 1TM4E 5AM3A 5B5SA 1P8AA 3H3XA 4ALMA 2VHUA 4BNTA 1EFPB 3MHPA 1KF0A 4V0MA 1TEHA 1MHTA 3JQ8A 1W9HA 5A0VA 3DGEC 3RASA 5DX0A 3OZSA 2YZGA 5M7EA 2WQ6A 1T6XA 1EFVB 4M1SA 1KH3A 1VCHA 2ZRMA 3BT7A 2IZ0A 2P90A 1L9KA 2W9XA 3ESZA 3MCTA 2XTNA 4P0TA 2RJ3A 3GMSA 4DCMA 4PSUA 3KOMA 3MIIA 5AOCA 3SIWA 5CB6A 1QRSA 1X7YB 4H4EA 3U9TA 1JQKA 1Z2NX 3PX7A 1XRJA 2BFBB 3O4IA 4K3UA 3TTXA 3HBFA 3DF9A 3WRVA 3ZVRA 2IU4A 1BOOA 1ORTA 1YR3A 2H7VA 4K05A 3O8CA 1EFKA 3NETA 1U3TA 3CNOA 4I55A 4B79A 3L8YA 2CLMB 4WECA 1HDYA 1U2DA 1OPXA 2OXTA 2Q21A 4UUBA 1I3KA 1ZW6A 3IQIX 3EYWA 4LI0A 4BNXA 2ZIXA 2QW1A 5CYGA 3KJHA 2W83A 3DBIA 4RKQA 4UNQA 4Y2PA 2XUKA 4R1QA 2X3UA 1T6YA 2WUFA 5HQ3A 2BJWA 3WO1A 2EX4A 3TF5A 1N6RA 2QVYX 5CAEB 3ETNA 4W9NC 3RV4A 1C4OA 2OLEA 1ZSYA 1PJZA 4MK4A 2ZJ7A 4HQ6A 5GIPE 4Z7NB 3JQGA 4RQBA 3AKZA 1SC3A 1SXJD 4RS3A 1RVDA 1IHPA 3L7DA 4WNIA 5F9HA 2ONCA 4G5YA 3BSWA 4GXRA 1FFEA 5DASA 1G291 5AW6A 5IS2A 1L5OA 4UMEA 3DEIA 5EXTA 4EQZA 1C3LA 2EKBA 3PEEA 2R5FA 4L8VA 2ZK7A 1Z2PX 3DC7A 4ND4A 3THXB 1US8A 4HAZA 4UHFA 5BSVA 3VHXA 5K6TA 3C3XA 1QTRA 1TCVA 3EGCA 1G42A 4PSKA 4YJGB 4QUKA 2J4FA 1W6UA 1Y3CE 3EGWA 4YDSA 1QP0A 4MEJA 3RK1A 5M2QA 2XDQB 4N3BA 3O03A 3ZIAD 1POWA 2J3LA 4H15A 4P53A 3DG9A 2ZTSA 3D0KA 5AI0A 1NVWQ 5JZBA 2FJ0A 4ZYUA 5CG2A 1T2EA 4XEHA 2R60A 1NVFA 2W4QA 3KD2A 5JD4A 2BV3A 4H31A 3GJ5A 1BFDA 3D6MA 1AN0A 1P60A 1FLDA 1C8LA 3SOPA 2YASA 4QUIA 1MCZA 3VKFA 4LHXA 1RAIA 1CUAA 1VJ1A 1MJNA 2GJ4A 1N7HA 1W88A 1KFEB 2JH8A 5AW0A 4H08A 1XZNA 4OG2A 4YYEA 1Z29A 1AHIA 1PD1A 1AUOA 4YC7A 2PA3A 4KIJA 4L8LA 5ED4A 3STHA 3TW0A 3PDHA 3V7WA 4MVJI 4O0LA 4GWGA 3WLKX 1RYMA 5K3FA 1SU4A 2DKFA 3ZXIA 4UUOA 1PVDA 1QAOA 1XELA 4ZTBA 1RPNA 4NG5A 5JH7B 1DEAA 4IQ4A 1UMCB 1CQJA 1DLIA 4P38A 4UHHA 3DBRA 2HJGA 1GGVA 1YB4A 2JGEA 2JFXA 1TYCA 3GNQA 5F7OA 4MVJH 4C4RA 4KX5A 1KTVA 2ZUUA 2FGJA 3EB9A 4ESEA 2WZQA 1FDSA 3KL4A 4HNQA 4J0IA 5AVYA 4X1KA 4BQIA 2VYVA 2W8BB 4LG1A 4WW0A 1P2SA 1IONA 3GGDA 3O26A 4Y30A 2GARA 1VI6A 5IJZA 4WXRA 5K2OA 5DJ5A 2TECE 4DREA 2B7BA 2W0MA 4WTOA 4YHHB 5U1PA 2RFLA 1GL6A 2OV1A 4LXYA 1Q57A 2RONA 3O7MA 5TSDA 2F59A 4BGVA 4DA7A 3J81k 4FGJA 3WAJA 4MTLA 3AJ8A 3HR4A 4Q48A 1C30A 1WX1A 2VF8A 1VMIA 3AZOA 1YS6A 1SG9A 4TXJA 3S1AB 2YZ7A 3SZUA 3EEBA 1QTQA 4UQLA 3PQDA 2P69A 2YNMA 2HPHA 3FXAA 3U9SA 5JXHA 2J3QA 1NM5A 1AD2A 1GXSB 1EQ2A 1H2ZA 1ZNZA 3MWEA 4TWBA 2E3JA 4HB3A 2CEAA 3DFFA 1PTKA 2FWBA 4XQ0A 4Z3OA 1OTYA 1OA0A 2CLDX 2QG4A 2VZLA 5LL6P 2OCGA 3W2FA 2HHAA 1JHXA 3TLBA 1RP1A 3L7MA 5D51S 5ERXA 4X93A 2ZKIA 3HU2A 3RRYA 4CIYA 1RJGA 2CMFA 2J0VA 2IIPA 1VLZA 1C9YA 4P2BA 4YA6A 4BASA 1XQWA 1DX9A 4GYYA 5G02A 4C7JA 5B4UA 3EULA 3VKUA 1B8VA 5CFRA 1MNAA 3PHGA 4KR6A 1M6NA 3GUVA 3TK1A 1A04A 3TTSA 4FMCF 2YQ5A 4NDNE 3LSTA 3U17A 1Z06A 3RADC 3B3JA 2FCRA 4JU9A 4GMDA 2P2SA 1NXQA 2GF2A 3BM5A 1YS2X 5FWDA 1RPTA 4WXMA 2QMZA 1RWNA 4A9AA 2PLAA 1A72A 2WAMA 3EFHA 2AFRA 2KX7A 4F72A 1FYVA 5DTIA 2VSQA 4AS2A 4JT2A 3NV9A 4UUPA 4MINA 1OW3B 5EXXA 5G4KA 2ALJA 2E4UA 3L82B 6Q21A 3BWDD 3KR1A 2BRUA 4OHVA 5CLIA 1N6NA 5KB3A 3AP2A 1XDDA 1HE3A 2W2MA 4MULA 4PR0A 5DWVA 3NI2A 1PF7E 2VJDA 5SYAA 4XJTA 4RETA 2LCIA 1W5BA 3HGQA 4P31A 1JDUA 2AFHE 4UARA 2Y67A 5ECDA 3UK2A 3PHBE 1I51A 4ENQA 3NW9A 2YV4A 3PUJA 4K8OA 4KK4A 2RJOA 1VE1A 3SC2B 1A8QA 4E1BA 4HRAA 1PYOA 1XU9A 2Q50A 2EBHX 4POAA 3KR2A 2OGZA 4B3JA 4ER6A 2ZIGA 4I1SA 3DEYX 2G82A 4TT8A 4DLXA 3OPVA 1NAHA 3NAMA 3K09C 1RPZA 4ZVNA 3R9XB 1YRBA 3NTQA 4X54A 3JQBA 2KLBA 1LC0A 1HRKA 1GPYA 5F2NA 3SSAA 1J0EA 1OX5A 3KLNA 1GARA 3HHEA 5E9WA 3U7EB 3LCVB 4ONEA 3GT3A 4QC2A 4O1MA 3UEOA 4U02A 4TTAA 2WLTA 5ITVA 1JHPA 4TS3A 4RH3A 1NMEA 4OGLA 2P4EA 1ZD1A 4P8RA 4A23A 4HMQA 2OECA 5JROA 3S8MA 1WV0A 1EFHA 3DYVA 1BDHA 4DIOA 4G9BA 2ZSIA 4FMDB 1G21E 4GPD1 1K8YB 3TSOA 3ZPXA 3GCXA 4DJDC 3IQZA 2CHQA 3BA6A 3K6KA 4JASB 4XIYA 2PUAA 1HYGA 5G0SA 3KSDO 2AQKA 5J4LA 1KOFA 1ZH4A 1P2FA 3M2TA 4I4TB 1J70A 1X7GA 1QLHA 1KJQA 2MT9A 3LL4A 3L49A 4GPBA 3BMNB 4P1ZA 4YFVA 5F73A 2MSWA 5DEIA 2F8TA 3H86A 4RAQA 5I8ZA 2QD5A 3NBFA 3H5WA 4F8EA 5FRDA 4KQKA 1PW7A 1VG9B 4UOEA 1SB9A 2OUKA 1K5HA 2Z56A 4HS9A 3RWOA 3ICPA 4NZ9A 3NB0A 4U6SA 3FKJA 3FMPB 3VR4H 3U13A 3WB1A 1R7RA 1CLUA 1TVKA 3WGGA 4DPKA 5KNCD 5LXTA 1ZOIA 4LCJA 4JYZA 1ECCA 1ONNA 1R4AA 1HZZC 2HCJB 4OY3A 3Q7SA 3VZQA 3BDIA 3COWA 4CEIA 2UYOA 5GZ1A 1RDFA 3E0QA 1ZCBA 1WE2A 4PIVA 2DOKA 2FUEA 4RZXA 3DO6A 1CUEA 3FYUC 3QWIA 4KMSA 4DXAA 4CKEA 4MO2A 4DEYA 2P78A 3QNUA 4LHEA 5TGTA 2W2KB 3VC7A 1XUOA 2MYNA 2W4MA 4HB2A 1YJBA 3FFTA 4KITB 3I4CA 4H18A 2AKYA 1VPWA 4LK2A 2FFBA 3CX6A 3NRBA 2YFYA 3BF7A 3FNGA 4KXXA 3SX0A 1GUDA 2EYUA 1MA0A 4ND8B 4O59O 2ZYRA 1TAQA 3OAAA 3RDPA 5F98A 3IA2A 4F2WA 3GP8A 4WESB 1PJ8A 4LNUA 1OYOA 1O4WA 2ZW9A 3ZGLA 1QP4A 4AJ4A 1ULTA 1TMKA 3T0GA 2VTBB 1NXSA 3GLGA 2WYIA 1G55A 3SU8A 3KVRA 2HT1A 4B35A 1M33A 1BXRB 1CNEA 2QRUA 3BAZA 2AW5A 3DVAA 1N0VC 2Y6UA 3OE7D 2RGBA 4ZAWA 1DC8A 3K6JA 1BN6A 3N8DA 4PNHA 1RHQA 1HNNA 2WHPA 2QB5A 1CQIA 3GN1A 3DVLA 3HV0A 2QZPA 5DNVA 1Z5VA 5KYWA 2PGIA 3H9QA 3KG2A 5GQSA 3IO3A 1K3FA 1JIJA 3DA8A 4XB6B 3VNVA 2RG7A 4FBLA 2XUHA 2JZNA 2A8YA 1PJSA 3EA4A 4WZAB 1R4MB 5A5EA 3GJ4A 4UTVA 1XCLA 2Y8EA 2RK3A 3NAQA 3ORRA 5K51A 3O8OB 2A4KA 4MI6A 2ZBGA 1F2TB 4IDCA 2UXDB 4ILEA 4XD7D 5G0TA 5LLDA 1CW2B 3B1YA 1TO2E 1RZUA 2QQ5A 3B3FA 4L9RA 1XDGA 3C8HA 4LGVA 2AFIB 4MV4A 3SXPA 1XD8A 4EGJA 1X7HA 1EXNA 5H59A 2D59A 1HQDA 2QJFA 5I47A 4ZZ3A 2V59A 5G41A 2JJ2A 2NO1A 3G9TA 1NUPA 5T4HA 1K9SA 2LKCA 4LGYA 3R7FA 5BXYA 3Q5DA 4FINA 2FFAA 1A77A 3ED5A 3UYLA 4MPDA 4UZFA 1MR3F 3IR6A 3ZI4A 3K0CA 3OOEA 1JA0A 4LJ7A 1IUPA 1P7YA 2C9MA 1ZG3A 3HRKA 4JR1A 4LHWA 5CH3A 2BY4A 3KK0A 4KQ6A 1QR2A 2C4KA 2GI4A 2JIRA 3PBKA 2H52A 4MJXA 4MZDA 1GL7A 4QUAA 1S2IA 3USCS 1K63A 3PI7A 2QE6A 1KYXA 5ENDA 2C97A 4ASUD 1EG2A 1U0JA 5JLAA 3RREA 2FX2A 5G3ZA 4OTZA 5T4EA 5CNKA 5TMDA 4D44A 3QE3A 1V1JA 3BMXA 2ZT7A 3AM5A 3OZGA 1GZHB 4DYDA 1FMCA 1N7IA 1ZMTA 4D98A 5CM8B 2BFCB 2GEFA 2WUGA 2DULA 1LQ2A 2AEEA 2B1JA 2O0MA 4ARZA 5M34A 4CF7A 3NQ41 1T9CA 1TT5B 2G8LA 2XUIA 3FPKA 4J0EA 2VRBA 4ND3A 2R6FA 4RVDA 4KK3A 1QHNA 3RSFA 2RG1A 1M1YE 1PDOA 2WF7A 3EARA 5CT8A 3WTBA 4HXEB 3AKDA 1R6VA 1IRXA 1W4ZA 3O8BA 2WJYA 9ABPA 1L2TA 3O9VA 3PSAA 5LXTF 1AO0A 5IRCD 2BBSA 2NU9A 2NLOA 2BCGY 1MB0A 1GKIA 1HYHA 3MEQA 3VXKA 5ADWA 3U7HB 1PFQA 1WLSA 3PR1A 3QUAA 1WZ2A 1RW4A 4JUDX 2XE6A 2ZBDA 3SE7A 2AUTA 5IYZB 1WDMA 2G1JA 5KQGA 4GGPA 2VDJA 4TLEA 4HPJB 1TFUA 2FZ5A 3ESCA 1H1DA 2PVPA 4RVOA 5ELXA 3THWA 3B6ZA 5DM0A 3Q7TA 1KR2A 5JS2A 5LLSA 3W3AA 3DEFA 1ZCFA 3O0TA 1DI0A 3ACDA 2QVGA 3CKKA 1EZ1A 4GPIB 4QVIA 2QJRA 2IYLD 4NEHB 2CXHA 1TZ2A 2FF5A 3G9ZA 4CIBA 3QZUA 3BWCA 1BVYF 2J9ZB 2CVHA 3L6RA 3NPAA 4HR7A 4EHHA 4WNAA 1QBKC 1EM8B 4KRGA 3CSUA 5JCJA 3WMEA 2ZFUA 3ASUA 4YMUA 1GPJA 1HDRA 3A4IA 3HCRA 3N6VA 2GA9A 5DTMA 2IF2A 5CD1A 4WHMA 1E60A 1T5DX 2HV9A 3QXSA 2DCUA 3ETGA 1TO6A 4MRSA 2X14A 4X20A 4ZAYA 1WDKA 3L8DA 3LUBA 4JLOA 4BWGA 5EMLA 1RBZA 1PZNA 2XCLA 3PD0A 2HK9A 1AM4D 1ZUHA 2F6RA 2GKOA 1KHHA 2VVTA 3A05A 1ULZA 2V6IA 3LVFO 1EVYA 1N0HA 5IG2A 1E6CA 3OPQA 2C4TA 2W58A 3AMVA 1JRLA 4AK9A 3D8BA 3ER6A 3ZKWA 5EE0A 2AJLI 2G76A 4BFLA 1ZN7A 3F8WA 1ECGA 4EFNA 3IULA 1S6YA 4M8KA 1ENZA 3CUKA 4HADA 4JZKA 3TL6A 2GPJA 3ZY5A 2EHDA 1ZIPA 2WUDA 3INTA 4WKPA 3HJUA 1RI5A 5CURA 1Y37A 5KQRA 2H3EA 3NS7A 1V8OA 1E8NA 1XFDA 3R7DA 1PTJA 2VOEA 2IXFA 3KQWA 4M4SA 1RCUA 1E9AA 4MMZB 4YT8A 2PJRA 1PWHA 3HCWA 3H1BA 4KKVA 1P1RA 2VRWA 3HNRA 1OPRA 3CSDA 4Z0NA 1V25A 4ML3A 4AG3A 4XVHA 4H6WA 1YZKA 3KHKA 1TF5A 1FNBA 1DOAA 2YV5A 3I09A 3UHAA 3QKWA 1Y1TA 3HPRA 2WD7B 4RNDB 2ODWA 5CNMA 1Y7IA 2BUBA 1KI6B 1XZKA 1H0SA 4WSOA 1MOSA 1U1IA 2IYXA 1HG0A 2E0IA 4BFVA 3C1AA 1HYBA 1C3EA 2ZM5A 4RA6B 4GM4A 2Z09A 4B4KA 1T5HX 4XWAA 4LZPA 4TUYA 3R0ZA 2VYVD 1DHRA 3NXKA 1BXKA 4OJKA 3R09A 3BL6A 2FOXA 1CK4A 3FN4A 5EJ6A 1RRCA 1JFFB 1QMGA 2R84A 1K6EA 5HG0A 2ODPA 1EB9A 2ZAGA 1MOQA 2V5UA 1I4OA 4YQFA 1ZXXA 4PG5A 3ESDA 2J31A 3WWCA 3T41A 3ZCUA 3BK7A 2CFSA 3B1JA 2JAPA 1ZUWA 2D1SA 2GHTA 3ZWNA 1SU6A 2FEXA 5B3KA 5I7FA 3KU4A 1FVFA 1L3IA 1YDWA 2CMKA 3H4TA 1G2PA 4JEMA 5DCWA 3TEMA 3TJMA 4BKOA 2VHYA 2H2IA 2O8DA 1T9ZA 2K2WA 2YNMD 2CW5A 4RZHA 3MC1A 1G9XA 3E9RA 3OZIA 3ZG6A 1LBQA 2AN5A 4MW1A 5C7OO 1SZCA 3ZY3A 1VP9A 1ML4A 1GZ7A 3EZLA 2NPOA 3CY6A 1EIWA 1YTUA 3OY2A 1RXYA 2A1TR 1RACA 4B6RA 1FZTA 1KYIA 1NV8A 5A4IS 1VL8A 1SQFA 1SVLA 4GOXA 3P2YA 4M0KA 3ZXYA 5J43A 2B98A 1W36D 4L73A 4X1YB 1KMCA 2AOUB 1PBNA 3FSGA 3LUKA 4C88A 1A5BB 2D2EA 1TJ3A 2FPRA 3VR5A 1MC4A 4DY4A 1CS4C 2DLNA 1MZVA 1I7NA 4IQFA 2B30A 1B3BA 1H4SA 2RARA 3R41A 1TYZA 1HFKA 1QVAA 1N8TA 4R83A 1YS1X 2AMLA 2VZ0A 3ONVA 4Z0HO 5FNVB 3SYKA 3OT4A 4QKQA 4G89A 4GZ3A 4ENSA 3DWGA 1AKUA 4DA8A 1E4EB 2PYIA 3QH4A 3BZBA 8AT1A 3SBEA 3I5UA 3PXGA 4L6CA 2BFNA 5DMXA 1YCHA 3RHZA 5FLXA 6ADHA 2EARA 4E5DA 2FWNA 3TSZA 3S2SA 2NN3C 1YSCA 7MDHA 5CDGA 1BOFA 1IOZA 2VF5X 1CQZA 5L6MB 3N58A 2DUJA 1XDWA 2C2BA 2EKDA 4FE7A 4I5IA 4MS3B 2JI6A 2E89A 3IEVA 1GU1A 3GDHA 1W75A 2BWJA 2GR9A 1RJWA 3PKZA 1BE6A 4I19A 1C0KA 4WQMA 2WSBA 2PRIA 4M1MA 2FK8A 2K7ZA 5AKXA 4YRSA 3M1YA 1VKHA 2HF7A 1DJLA 4RLHA 4DLZA 3BTVA 3ZZ1A 3E9CA 3G68A 3K1YA 4Y6PA 4RXUA 4M1KA 1ZISA 1JDBC 3FZEA 3NVMB 3BVPA 5KTRA 2A5LA 5E95A 1M0WA 2UVDA 3ETEA 4WACA 3B48A 3KEQA 4MGKR 1PX2A 4I3GA 2PWYA 4QECA 2QI9F 4Y6QA 1D6NA 1P9LA 2H5JA 1JXMA 3NIDB 4L9AA 3WJAA 4TLAA 5IHXA 1T5LA 1VL0A 1NVXQ 2G83A 3GA0A 3AP1A 5H16A 1OXBB 1ZUD1 5CLHA 4JT4A 2OYCA 3SR3A 4TUYF 2H9IA 2P9EA 3Q3IA 5ALPA 4Q15A 4IF6A 4GOKA 1OX6A 3QMMA 4P84A 4FOTA 2OHHA 5AK0A 4D3SA 3U7GA 3DWFA 3AJ9A 3ZBUA 5JMPA 2PKRA 3QPUA 1GNRA 3SQDA 5KAMA 2AMVA 4BWFB 2BD0A 2XB2A 1MKYA 3HCEA 4IV0A 4KU4A 3I6YA 1SBCA 3V6LA 4FMPA 1Q0HA 2CLKB 2VHZA 1ISGA 4HMOA 2UZIR 4HN9A 4IDEA 4M0PA 3KTOA 4ZPXA 1ZJZA 4CCYA 3WQQA 1K5PA 1TU3A 5D7BA 4GI2A 4UVIA 2JGLA 3EF0A 4E3ZA 5J2UB 1ADYA 2IQIA 2ORYA 1M54A 3DE4X 2X0KA 2YV2A 2FN7A 1ZM4A 3G8BA 3EDCA 4OLJA 4Q3NA 5DHQA 3THYB 3F2VA 5A5DA 3C5HA 1PKEA 2PK3A 4EYSA 4ZHQB 2FN3A 4E0BA 2WI8A 3MINB 3D3JA 1GRRA 2Z04A 2VDMB 3NXSA 4K1LA 3RYHB 1R5OA 2EFCB 1XRPA 4AX4A 4EITA 3HJCA 3QMWA 4JXZA 1PZMA 3UXYA 3L4BA 1Z4LA 3GUHA 4BO9A 1W76A 3N1UA 1S1CA 3FDIA 4R7GA 5KYVA 1UT8A 3FRHA 3CH4B 1X15A 1BNCA 5GV7A 2E85A 2XYRA 2C3YA 4GLFA 4ZP1A 5TV2A 3NNDA 5D5PA 1XC7A 5K3EA 3PR2B 4YUVA 3MF4A 1NBME 3PZRA 3W05A 4EI7A 4F4HA 1G8HA 2VHCA 2CXSA 5KDDA 3RRZA 1NT4A 4V3CA 4JUBA 3N8KA 4N54A 5B53A 2F3UA 4CW7A 2BGWA 3YASA 2HOQA 4CMIB 5KYYB 4QTUB 5AKIA 2PH1A 3CZQA 5AK4A 4DV3B 4KGXA 2YMPA 1UDWA 4X84A 1CULC 2UYHA 2Y4NA 5ALMA 2ZSEA 4J43A 4DR4B 1GPAA 3JR3A 3ZW7A 4EHLA 4ZD6A 3ZOZA 4ZDJA 5CLFA 4OMFG 1ZBQA 3L6OO 4RMGA 4YLEA 1D0SA 1P45A 3AJDA 3V4LA 1JDJA 3BCRA 3EVCA 1ZI6A 2Q3CA 4IIXA 5KCMA 3VZBA 5ARBA 2PLFA 1QG4A 2IPAB 4QFMA 3TZQA 4NCBA 3AB8A 3IAHA 5CDUA 1GA6A 3UATA 4BNKA 5JAIA 5D5HA 1JE1A 3QUCA 2R7LA 2LR0A 3K32A 4PLPA 1T2CA 5FEUA 2VWPA 1AZLA 2VDNB 3Q6IA 4KSYA 1ZN8A 3FUCA 1A76A 3S2ZA 1ZZGA 3Q5EA 1XEWY 2O2XA 4RSRA 4TXLA 3B53X 3WGNA 4ZZ0A 1P9NA 3N70A 4NZZA 4Q3EA 4E1VA 1KDPA 4UATA 1E4VA 1J06A 4TYMA 4JCCA 4YQYA 5J5VA 3LVRE 4BE9A 1R16A 3TLEA 1DG1G 4EVRA 2EZTA 5B55A 1CUSA 2CHVA 4M21A 4MP8A 5JAHA 4LYJA 2I6TA 4QWWA 2JJ2D 3PNQA 2P8SA 3CVVA 2DR2A 3FWNA 3DEHA 1XHLA 1PFVA 4DLLA 5A02A 2I1VB 4CLOA 5J5CA 1PD0A 4WWHA 1Q1GA 2HAEA 4EY6A 4HFNA 4JI4B 3LCMA 4ABYA 1ULUA 2XCRB 2JIZA 3WIBA 2XQKA 1T4CB 3U81A 4YQZA 2ZTVA 1TTTA 3SSMA 3EUFA 2LDXA 3LF1A 2EJCA 2R4TA 1B42A 3X1KA 2Z9CA 5AUQA 3DNMA 3N8HA 1IQUA 4QASA 5H0IA 3QFTA 4P9NA 1I6KA 4JFRA 4K9MA 5HIJA 4DN6A 3FOCA 1HL7A 1IG0A 4Q9JA 3V34A 2XMSA 3HCDA 5JTUA 4I46A 2VBGA 3WLLA 4OSOA 3W6OA 2ZYGA 1KMHA 4DM4A 1J99A 3HY3A 2PRYA 4G25A 5K7SA 2R86A 3FTCA 1EMDA 2EG9A 3LBIA 4LY0A 2V7GA 4YPFA 4EJSC 2J09A 3KVYA 3ORSA 5BMVB 2JK0A 1EUCB 1G8FA 3GVPA 3WGOA 2P6MA 1XLWA 3OM9A 4E51A 2F3PA 1CUVA 2QN7A 1FPMA 4N76A 4MRPA 2JBHA 2Q1WA 4MQLA 4PFSA 3AYZB 3SYRA 1V3TA 5ENZA 5H4GA 3MT9A 2AOTA 1G8PA 3TL2A 3CR7A 2BM9A 1ZD3A 2FPSA 2H2AA 3H6GA 4MJ7A 5JSZB 3PA6A 1VJCA 3QJYA 1QVZA 1WU8A 5FUQA 4QUHA 5AKJA 3ZHBA 5ES3A 5DULA 3W5IA 2Z4RA 3WK4A 4LF8B 4MWGA 1ID8A 3ROQA 3MHTA 4HEA1 4C4ZA 3UPUA 1JG3A 4JC4A 4F9GA 1N92A 1VA5A 2PLNA 1O08A 1VPTA 4B44A 2UU9B 3BDAA 1J9EA 2PG3A 1FS5A 1TK9A 3I2FA 4D25A 4QYTA 1W30A 3C3EA 4UAUA 4DOMA 3RS4A 3NIBA 3ZDDA 2HIMA 4XR9A 2QPAA 1TYAE 2FP4B 3C48A 1L5KA 4WBSA 5I7UA 2GK3A 1GTJ1 5ETJA 5JAUA 3ROKA 2O07A 4UCXA 4YROA 1KEZA 1QUEA 2B36A 3PXDA 1GAJA 1MP0A 4OSEA 3UGTA 1K86A 2P3QA 5ELLA 1VKNA 5L3QB 3AIMA 4ZDWA 4BP1A 3I8XA 1ZK0A 1LJ8A 3VHLB 2LW7A 4QIHA 2BR5A 4QYWA 4CKWA 1RJEA 1WXGA 1SBHA 1QR6A 5DV9A 4L3WA 1ZK4A 1LLDA 4UUQA 2A58A 3S5UA 1EE2A 3GLQA 5HSGA 3TB6A 4KMMA 1PZGA 4FS3A 5BRNA 1K7FB 4H4CA 1Q44A 4OUKX 1K8ZB 5EWLA 2GNAA 1QIKA 2D1RA 3STWA 3WL8A 4DYHA 5JI2E 4II3A 3IIMA 1N36B 1MDBA 1HBJA 3EY4A 3QPDA 3WQRA 2DPYA 3JSAA 4YNBA 1E3MA 1XAJA 1QLWA 3GPDG 4LGMA 1P1BA 1QV9A 4WVLA 2ZYIA 3ZGOA 1Z0AA 3NBQA 2X3FA 3R7WA 1FJ2A 4L3OA 3MUNA 5BVHB 3NNNA 4QOIA 4RM2A 5CTAA 3V2IA 3L92A 3RS2A 4U00A 3ZZ0A 1LRKA 3IE1A 2P9TA 2J3KA 4LSWA 3EXIA 4I4IA 5HF5A 2MSEB 3BRQA 3Q5GA 1W2HA 3V9PA 1VCIA 3H11B 4O4IB 1YKFA 2A7XA 3I9V1 3WB9A 2Q2VA 2H4JA 7REQB 4NBNA 3T38A 1KI4A 1JXAA 5CUQA 1MX5A 2NUBA 1NVMB 2RAPA 3C3PA 4UNSA 4EB0A 4R6XA 3C87A 2UYYA 1E7YA 1RWKA 4YJFA 4N5NA 2QN2A 4YB8A 1NVTA 3N0RA 3OLCX 1XVAA 4JGGA 3PYLA 4O2BB 1H94A 1YNOA 3KPJA 3KYDB 4TKUB 1QH0A 5HF6A 3R8XA 3NHBA 3Q9LA 5DE3A 1G7CA 1PAUA 2LIPA 1DHTA 4U8GA 1ZD4A 2CKDA 4M53A 2G5GX 1KYWA 4LPSA 5DOVA 4JI5B 4ETNA 3BXOA 2GCNA 3NPMA 5LKAA 2RHRA 4F45A 4Q4LA 4H6VA 3U3JA 2B35A 2PMCA 4YJ3A 3UWDA 2I2CA 5CAEA 8OHMA 3NDBB 2GPWA 2J1LA 5JRZA 4RDIA 3Q8LA 1SBZA 3BUSA 3ON5A 2WWWA 3U19A 1W5EA 4O2LA 4LXUA 4PTZA 3DFKA 5F5NA 3RU3A 5F12A 3ILVA 1MO3A 2RC6A 4NWIA 2AUNA 4XM2A 4F7WA 3KE8A 1YZFA 2GN2A 3GXBA 4EP1A 4C14A 4HAIA 5EHIA 3LS2A 2D62A 2GFQA 2HK7A 1IUNA 1B16A 4AN4A 1CZHA 1PT7A 2X1LA 1KQPA 4J1SA 4YJGA 1WZNA 3C70A 4JI2B 3EOBI 3LY8A 2P1ZA 1UM9B 3G1WA 3NAZA 3FSGD 1UWKA 1EG7A 4GP7A 3D4PA 3LDHA 5TEWA 3DTTA 1L5GB 3OHSX 5GY7A 2PR7A 2PUDA 1JT2A 1GRQA 5SV2A 5JVDB 1I9GA 2OB1A 1SXJE 2WMDA 4HN2A 1C4KA 5CXUA 1F51E 1LXCA 3OLVA 3TLJA 3C98A 3D6NB 3O8RA 2NXCA 2FUG1 3Q15C 3EPHA 2YVKA 1TL7C 4TTVA 2AWNA 2O52A 3Q11A 3IB3A 4G0OA 2BZGA 2OO7A 3LI2A 5E6SB 4OHPA 2EF0A 2JKYA 2H17A 4LY9A 4RF4A 1I7DA 3H2HA 1OU4A 3GRPA 3F4KA 4WOJA 1D2EA 2CYAA 1DQZA 2WE7A 4UDOA 3CVUA 3VKGA 1PS9A 4OQ4A 1CY6A 2AC2A 3DXFA 2ZRLA 5JSYA 4LZJA 4C06A 4CZ2A 1YR1A 2X0JA 2IHKA 4JLJA 2XD9A 4R3UC 3H1TA 5HF8A 1SRQA 3KPUA 3LDFA 4LJSA 4KR9A 1CG6A 2GTHA 2V7TA 4NBVA 2ZXEA 5KHAA 3RYIB 1XKXA 1UKEA 2EHJA 4E03A 2GHIA 2BN4A 4R01A 4UXJA 4HDMA 3ZXUB 1TUEA 2FMIA 1CRPA 3OEHA 4ZOEA 5AIAA 1E98A 2XITA 4L57A 3ZDEA 4PQGA 3HCPA 2DT8A 4GZMA 1H3EA 1FP4B 2HMTA 2W98A 5JH7A 5ITSA 2HF9A 3D8RA 3CR8A 1UMCA 1ZGGA 4YV2A 2ONKA 2G8NA 4G23A 1DUVG 3D7RA 1CLEA 1AV7A 2NMVA 1EKXA 2ECOA 2QTFA 3RFXA 4AF6A 1D0VA 1GT91 3C7TA 2L2QA 4HEHA 3MSCA 4NARA 3ZY4A 5LSAA 2ZUEA 3VV2A 3COYA 1NGSA 1ZZEA 2CVFA 3ORQA 2XPCA 4NIMA 1X1CA 1EWRA 3A9UA 1YE8A 1PBTA 2ZR8A 5IVKA 4LX8A 1YD7A 4H77A 1ZW1A 4BZPA 4ZIRB 2ZI9A 4G3XA 1N57A 4XSVA 4EHIA 3DZ8A 2QV7A 2ZJOA 2XJ4A 3K71B 3A1WA 3VJKA 3LKZA 2BMDA 4E70A 3KEMA 2OV4A 3V7YA 5GIOE 2VG8A 1JTFA 4X64B 2FWAA 1L6RA 4EO7A 3WV4A 4GM1A 3R24A 4J07A 1C1YA 2PXAA 3T1YB 4PXAA 2YJ6A 2W2LA 2XUQA 4Q01A 3NP7A 2DR0A 3BXPA 3GMTA 5IT4A 2W2NA 5EGSA 3KVOA 5ALNA 4IEEA 4MR7A 4TRNA 1LBTA 4NOMA 1ZA1A 3TG8A 4CMEC 2HA7A 4RTMA 1JU3A 2EQ5A 3T4PA 1R5JA 3VA7A 1KFJB 1T6ZA 2R6JA 1T3SA 1U7ZA 1Z8DA 2EV9A 5FI3A 2Q5IA 4Y2SA 4BQQA 5B1EA 2VCYA 1CKEA 1BCRA 4MITA 4CDRA 3I2YX 1SD1A 5A03A 3LWNA 2OV3A 4JVOA 1SCBA 3TLZA 1IIBA 1CRWG 1EVZA 1IBSA 4WFQA 4URUR 5KKAA 1PFUA 3HMQA 1JR3A 2HJRA 4RD1A 3G8CA 4F46A 3EXHC 5HK9A 4EZIA 3V80A 1USVA 1KP9A 1RM3A 3VZRA 3DCIA 4OP3A 2ORED 3KJGA 1CQXA 4CT4B 4B46A 2HSWA 3BCUA 1DQSA 4WXEA 3G5TA 5DF1A 5JFTA 1Y6GA 2IXBA 4WY2A 1FK8A 1Y4AE 5AI8A 4EHJA 1Z6AA 2NW6A 2RGUA 5I45A 2CY0A 4KN5A 4ARCA 2ZAOA 1LEHA 4TYYA 1QJ4A 5F5XA 3F5DA 2QN1A 1YZNA 1JA9A 1NURA 4MYCA 5HKLA 3EEYA 4UULA 2VOJA 3AUFA 3JALB 1WVIA 1PJBA 4CM8B 2AXNA 4Q82A 4DJFC 4KGVA 1PG5A 3EY9A 3GL9A 4RSGA 3VR3A 4E5NA 3JXEA 5EJGA 1O2DA 4Q5IA 4UU8A 1ZI9A 1GNTA 1XTIA 4F0JA 3GAZA 3BAFA 4P32A 2BISA 5D3ZA 4QO7A 4FWTA 4KNWA 4DCNA 3GMIA 4Y9DA 1M8PA 2W2VA 3K0AB 3KNZA 3UKDA 1Y82A 3TIGA 1Q1ZA 3HJBA 3GEMA 2RC5A 2YTZA 3IKJA 4TMZA 1XZBA 4WPGA 3WKCA 3VYUB 4AZWA 3T1QA 1T2VA 1E1NA 1OXMA 1SEPA 3WFIA 2QGZA 3TBKA 5DCYA 1IN1A 2WSSA 1RAHA 2H9AA 4KXWA 2R6GA 3WBJA 1EGHA 4ZICA 1IAVA 5JH7F 4MR9B 2HCFA 5FBHA 5KVCA 4QARA 3L8CA 4EENA 3WL5A 3PJFA 1Y7HA 2XXBA 1H2EA 3LH5A 1J2TA 3C3MA 1IK6A 3NIFB 3PFHA 4WV3A 1E9VA 4B2PA 5CA1F 1AQ6A 5I9MA 2QM3A 1GZ4A 2C57A 3CUVA 3WY9A 2EGGA 5CVCA 2Z9DA 1N5MA 4D4LA 3E9YA 3OWOA 4WIAA 3TSCA 3QYFA 1CEEA 3J7TA 3SPXA 3ZK9A 2D0PB 2I80A 2XWQA 4H7EA 5GJCA 3B20A 1RT9A 4I4TA 2CXNA 5F23A 3PUZA 3BMNA 1Q1NA 1E79A 1FMJA 2VF4X 4J1QA 5UKDA 3IAUA 2JFYA 1E2UA 2P9JA 1F1JA 2JIZD 1W4AA 1EGMB 2HCBA 1D1QA 1FA9A 1QFMA 2VH5R 2ZRQA 3D02A 3T3HA 3VI4B 5ICEA 4XDYA 1Z0FA 3UN1A 1YVPA 3HM9A 3SYMA 2D0IA 4AICA 1L4YA 4EPRA 1W52X 3LGXA 5L7TA 1VIYA 3P2KA 4MUNA 1T8WA 3PDIB 1D7OA 1QK3A 4G5QA 1QGED 1QM5A 3CRZA 3IQHX 3SZMA 4C4TA 4IO1A 4C0JA 4EPTA 2XF2A 3PRHA 2B4KA 3LIPA 2OWDA 5H80A 3RRNA 4B47A 5BV7A 5LDDC 5JQWA 2R96A 4Q3DA 4Y2TA 1B1AA 1WCIB 2G0AA 4QM7A 3ITNA 1GTG1 1OASA 2Y0DA 3COSA 3CUTA 3OLWA 3WSVA 1J22A 4B71A 4E4YA 3KDAA 2W42A 3DAYA 4NKRA 4DKJA 3WRYA 1RRPA 4NNPA 4HEQA 1GP2A 3PX2A 2CCJA 1Y8ZA 4BAGA 3RWBA 1G8SA 2ZYWX 2VK2A 3RJ5A 1SPXA 2VP5A 5A6VA 1M34B 4NNJA 3W1EA 3T7AA 2D4AA 1U2SA 4XJXA 3ET5A 1OILA 1KORA 1KAEA 3E2IA 4JBLA 1Q0TA 1DAIA 2ID9A 1WKBA 4IFBA 2WD9A 3PUXA 3UHOA 5LP1A 4FFRA 1WD5A 3ODGA 2BKEA 2F1RA 4NAHA 2YWFA 4GWLA 5T3YA 1X0XA 3WDKA 4RJTA 2PT5A 1DKLA 3TUZC 2WZBA 2YXBA 2ZWIA 4GEKA 4ZRDA 4AO6A 2BSXA 2YWEA 4GI1A 4MIOA 5BR4A 1PR2A 1VIVA 1DU4A 2J9RA 2O5VA 3ANMA 4YCNA 3SNHA 5ES4B 1H9CA 5F35A 3A58B 4KRYA 4ZVMA 3RAJA 3NORA 2CWDA 3L9XA 4R7ZA 4PRKA 5FIUA 4CTJA 3U6BA 4E1AA 1IZYA 1ZIOA 2J67A 2J0UB 1LK7A 4OYLA 4DA9A 4NXNB 1SELA 4JITA 3NMUF 2BH2A 2QMQA 3KKEA 1VHQA 4Z8XA 2XHEA 3OIVA 1F2TA 2H8GA 4UBKA 4G4IA 4RF2A 1MLDA 1V3QE 2HNAA 1UC4B 2C9CA 4BO6A 5T67A 2DPMA 1RE1A 3RRFA 1RWWA 2UUPA 1KBZA 4MUMA 3TNYA 3RRBA 3VGJA 1ZVJA 1F8GA 3C7CB 2ECPA 3F6CA 1K9VF 1LLUA 3A7DA 3IVRA 1IG3A 4RQAA 2EIHA 1EIZA 4JQYA 1PL6A 3NATA 3T6KA 1C4WA 1PDVA 3SIRA 4UDYX 3V4FA 1GN8A 1NN0A 2GAJA 5ILGA 5TE9A 3TW6A 1L5SA 4HN4B 3ZBPA 1KRHA 1DUSA 1F2DA 1PDWA 1IQ0A 5CG1A 3LCUA 3K8ZA 3ITKA 3SVTA 2YWCA 1DG9A 4AZ0A 2IVZA 4P08A 1UXOA 4FT2A 5L4SA 2QSZA 1UEXC 5HQJA 5AJZA 2WTNA 1FP7A 2ZRNA 1XK6A 4GIBA 4GSLA 2JGJA 4YRCA 3V8VA 1ESZA 5IKMA 4HPXB 4II7A 5IVPA 2DPHA 4JJAA 5JNVA 3HGMA 4RIFA 1YCDA 3GQVA 2I62A 4I4TF 5E7IA 2PZMA 1C7RA 1YB7A 1IVNA 1W1IA 1NZFA 1BMFA 5BW8A 4RLQA 1C9NA 1N8KA 2R11A 1PL7A 2VBIA 3AYXB 2NU8B 3QX3A 4IDAA 2E82A 5KC8A 2IUFA 2ZBPA 3B8EA 2FSVA 2PCJA 3E03A 3LPMA 5FBZA 4ZQIA 3ZTTA 1XDSA 4GRDA 2CXXA 3ND5A 3V48A 1I2BA 4TSRA 5LDHA 5E4TA 1ORIA 3L1UA 3MWYW 4Q6BA 1FW8A 4EPWA 1LY1A 3B13B 1ICIA 3HA7A 1ENPA 1V7ZA 2B2NA 3HVKA 3NOXA 4JBYA 3EPJA 3P26A 2IHNA 1Q1AA 3NG1A 3LYUA 5U4XA 2APJA 4KR7A 4HX9A 4QLBA 2OLJA 4CFSA 1D1TA 1P3DA 2P11A 2B4YA 1P81A 2ASEA 3HHPA 3KZCA 1O95D 1X6VA 2RIRA 3G7SA 2WILA 3QPWA 5G1NA 1W35A 1XJQA 1T36A 1CQPA 3C0KA 2AL7A 1G7SA 7ADHA 2SCUB 5HDBB 3SCZA 4RPLA 1HOTA 3PQ4A 4F5EA 4DR3B 4ZVKA 4N9QA 1T8RA 3RAGA 4FFSA 1AURA 1XZ8A 2X9GA 3C6KA 4ZCPA 3RRJA 3Q85A 1J00A 1E2EA 3O84A 4BGIA 1EM8A 1N3LA 1PV1A 2IE8A 4ND1A 1TMGE 5GP1A 1CEYA 1YB6A 3NFRA 4GGMX 2AJTA 4DXHA 3ZJVA 3GPIA 2G28A 5U9CA 2OCIA 3BXXA 1QWOA 4X66B 1Y8AA 5ENVA 4CIWA 3IKMB 3QPBA 1FYDA 5JSFA 2W6CX 1ONBA 4OH7A 2V6FA 2RCYA 3T8YA 2FG5A 2HM7A 4HUTA 4RFVA 2J3JA 3V1KA 1XKTA 2GEVA 4BNVA 5IDQA 4KFTA 1OZAA 1VG8A 4I7EA 1DDGA 2ZJ8A 1XCJA 4UHJA 1BE8A 3SM3A 1EUDB 2I76A 3NTRA 3KX2A 4LNHA 1JPNA 1ORRA 3KRTA 4BGUA 1PV4A 2WZCA 1Y98A 2GZ3A 4FKMA 4IH9A 2QG6A 1U6IA 1WR8A 2E37A 2RBEA 3BILA 4LAFA 5C18A 2OESA 3EEOA 1YJ8A 2MIIA 3ICWA 3FPLA 3H7AA 4FJ1A 4ALJA 3CRMA 2G17A 4CL2A 1J0CA 1RMTA 1S2GA 3QSYA 3S2YA 1HFWA 2Q0XA 4JUFA 1E2HA 2VPWA 3AEKB 3U3XA 1P3Y1 2NZVG 4DAEA 3OEHD 4S2EA 1I0ZA 3FNHA 2WJJA 3LSYA 4HZUA 1KZ6A 1SVNA 4HH1A 1AZSC 5ESDA 3D2CA 2QTLA 4FCVA 1KP2A 3KYBA 3E84A 5FWYB 1RLTA 5JNRA 1J21A 2L0XA 2WD7A 3IAFA 1LQUA 5KNCH 1TZMA 4MCJA 1PGPA 3MVEA 1KI6A 1GGFA 1OKKA 2QA5A 4AJ2A 4G81A 1KEVA 4IMIB 4KWCA 5EKDA 2DERA 2DE0X 3TNDA 4RA6A 2HLDA 2P5YA 4KDEA 2N1MA 5DMHA 3KCNA 1G66A 1IH8A 4BFWA 2R8RA 2YMMA 5CGQB 2NUTB 5JBQA 1RYEA 1HDZA 1BQ4A 1F4VA 1R0WA 2G09A 3TFWA 4AXBA 1E0DA 4LXQA 3KB2A 5AYVA 4ZMSA 3AK4A 2OQVA 3KTAA 4DDMA 2GPAA 1R12A 3E70C 4EA9A 2YYYA 3JARB 2PFGA 3CNBA 5EQTA 4UFNA 5AI5A 5AVOA 3Q98A 2QL9A 2WU1A 3L8FA 5HYVA 1OT3A 4MDEA 1WMBA 4PNZA 2B6HA 3LHFA 4PGHA 4QVGA 1W19A 221PA 2BMVA 2CSUA 1HTBA 5A2GA 1RLMA 2ZVPX 2C4MA 2BI7A 4Y1RB 3TQFA 4J9UE 1RNLA 2W2LD 3AKYA 4CKZA 2IBMA 2BI8A 3GFBA 1M2OB 4HGQA 4NZNA 4ARBA 3AFGA 1S4MA 2BDEA 1R18A 4KLZA 4RPCA 1X42A 3TJRA 1X94A 4Y67A 4BV3A 1IY1A 3NRJA 1IY0A 2X3YA 1M6WA 1LW7A 1Z18A 2PA0A 2ZJ2A 3NOOA 1DQRA 3F47A 5JS8A 1EJ6A 4F1JA 3FFXA 3DPSA 2GN1A 1KU0A 3GBVA 4LHZA 2EKZA 2VLIA 3K1ZA 1E59A 5KQLA 1E6EA 5E8RA 3CZ4A 4YGYA 1YAJA 1MO6A 2R0QC 3QG5A 4BLWA 5CIYA 2XE7A 2ZG6A 1LA2A 3F6YA 3GC6A 3FDXA 3NC1C 4G1FA 3D4IA 4ZRMA 4A26A 4D4KA 3FCUB 4XWTA 5JYCA 1S4QA 3V1UA 1IQPA 1UFRA 4DW8A 1T1JA 1ZH0A 1JR3D 5KHOC 1XZHA 2JFQA 3E7DA 4ZREA 5C4IA 3EH2A 5JZOA 2WNSA 5FPPA 2FP3A 3RBAA 1JFTA 4JSYA 3WGMA 4D9EA 1P0FA 2JFVA 1PO7A 3MTAA 4JQCA 5CHEA 2DSNA 1H2YA 1GITA 2IC5A 2SKCA 2ECQA 3LQYA 4DWWA 4PLWA 3CO0S 3L7AA 3VPDA 2D0OB 2IY8A 5DKFA 3I73A 3EVTA 3X2EA 5DN6A 1UIRA 1YXMA 1CPYA 2I2DA 1KP3A 1I4TD 2XMGA 3CW8X 4M22A 3FNBA 4AY4A 2W6QA 4MS3A 2AFHB 2WJPA 1SUFA 3C24A 3M70A 3M89A 3MXOA 5EWMB 3TI7A 3X1ZA 2PMWB 2HWXA 1QHFA 1OX4A 4IOKA 1ZD2P 3FIJA 3L7OA 4IXMA 2HU7A 4J6EA 4BP8A 1GTRA 4G01B 5DBHX 1OA1A 1DIBA 1XVUA 1VMKA 5EJ8A 2PYZA 1NR7A 1K68A 3NZEA 4N0QA 2R6R1 3GIWA 2CVQA 4G0WA 1PZXA 2HIGA 1P5HA 4RCVA 5C7YA 2VNAA 2QTRA 3ONDA 4HLUA 4P4GA 1GV1A 3O4GA 4J1TC 4Q3LA 3BFVA 5LM3A 1QHHA 1AGRA 1AUPA 3PGKA 4QX6A 2PD4A 3QLEA 1THGA 2HUPA 1PS0A 1H8HD 2COKA 3RLFA 3L0PA 3MS4A 5DGTA 2LE0A 3MBIA 3U60B 1P4AA 2WSSD 2PWPA 4EDHA 3WYAA 1Y89A 5FOSA 3L0ZA 2VK1A 4LSMA 3AL2A 1Y4UA 2O2CA 1CR0A 2IH5A 2HX1A 1UADA 4TGLA 4U2DA 4WNCA 4EJMA 1JKXA 1WXQA 1UCFA 2HSZA 2ZI7A 3ADPA 4LJ9A 1ZFNA 3UUFA 4CFZA 1EEXB 3C7AA 3L2OB 5P8WA 1VECA 1IHXA 1A7KA 3LX6A 2VYFA 5TRTA 4AUNA 1I80A 4IFTA 2AG5A 3SFZA 1B23P 1A9YA 2XVYA 5CBPB 2HCTA 4E09A 1QB8A 2O7QA 2BFEA 5EGNA 4DLVA 5CJPA 4DLKA 1DBQA 1I13A 3E7PA 4PAMA 3L8HA 5JU6A 2JGNA 2YFKA 4MKIA 3N0XA 3ONWA 3NHKA 5EMKA 1VYTA 1T4BA 1EAMA 1BXGA 1N5LA 3CNHA 1E79D 1GQQA 1C3OA 4XDZA 4EG1A 3VPFA 5FKJA 1N1MA 3D5QA 1SWVA 3FPFA 4PLZA 1SEVA 3IELA 4E22A 5PNTA 3MRVA 1R9NA 4DLBA 1E0AA 3VAAA 2A0WA 4A82A 1QF7A 5G0VA 4NJEB 2P2YA 2DY1A 3THYA 4QT0A 1Q16A 4HZGA 1LTQA 3DT9A 2PMDA 4KNVA 2NYAA 4PTLA 1L8XA 3LD9A 5A06A 4S2UA 2CBXA 3CUSA 4OSPA 3WGYA 4D57A 5AVTA 2COUA 3K5WA 4M9XA 3F1KA 2ATXA 4HB4A 5E9QA 5LB4A 5SZJA 3ETCA 1LCIA 1N5RA 1FDWA 1ZIXA 3FPHA 3K2IA 3ME5A 1SBIA 3H2BA 1HF3A 2IXEA 5MN5A 3D2AA 1ZSNA 4UXHA 3ZI7A 3STUA 2J9FB 4ZCMA 2A6PA 4TTJA 5A3SA 1DKQA 1J25A 1SK8A 1T8PA 2AFVA 4DSUA 1IK4A 2B3DA 2ZPUA 3W34A 1Z82A 1Q7BA 1TRHA 5T4BA 4CU2A 4D4HA 4JSTA 2OEPA 2EL7A 4R69A 1XYGA 1OR8A 2ZBFA 1WV1A 2UZAA 3CKLA 4KSBA 2PAAA 4GKJB 4J0KA 4MKRA 3PGJA 4PGAA 3HLKA 3I9JA 3JZMA 2IUTA 1ILEA 3RJMA 4LHVA 3P0JA 5IABA 1RHUA 1Z17A 2YX1A 5AUNB 6REQB 4XPZA 3HTXA 1YUBA 2XNDA 2XADA 3AL3A 1I6MA 1PNQA 2WU8A 2VKQA 3LLCA 4GG1A 1MH1A 1GZ6A 2MYPA 3G2LA 3RF7A 4AJ1A 3UW3A 4DCJA 4DDHA 3IB6A 5CH8A 3B6MA 2NO7A 2H65A 2E6UX 2WTEA 4GBGA 4R5MA 3TPFA 2EVWX 2OHFA 3I01M 3GNTA 4DWJA 4F4FA 4D92A 4LJKA 3AR5A 4EUSA 3K30A 2ZI6A 1QV6A 1N1EA 4KYUA 1V5WA 2H57A 4NHOA 4QLAA 5HS4A 2ODAA 5AW5A 4DBZA 2NZ8A 3SG0A 2ZJZA 3AIKA 2I8AA 4L72A 5KJCA 3DKIA 3GLGE 5AVRA 4HK4A 4IL5A 2XRFA 3DAFA 4EA6A 3HXOA 4QGSA 4Y9RA 3K0FB 4ZXFA 1E3JA 5EJIA 3WHIA 2EWVA 1P4JA 3K3PA 5KWVA 2Z43A 2HMAA 4Q7KA 1I2CA 5LD2B 5D3QA 4MDFA 2WFAA 3FD8A 2IZ6A 1F2UB 3AB3A 1E1MA 2GCOB 2XZLA 4RYLA 3IHTA 3F5FA 1YZHA 1AK2A 1AXRA 3CTMA 2WWTA 5J59A 1JVSA 4F56A 5KIAA 4WUTA 3DV2A 3OZXA 1S8AA 5HGJA 4FW9A 4M1WA 3ENQA 2PUHA 4MUEA 1MB2A 2OVFA 2X7JA 2J4CA 3EQ2A 4BVAA 4KIWA 1T4CA 1TA4A 1PJLA 3L7IA 4KMRA 5HQTA 2ETVA 1UJBA 3I1IA 3WLPA 3BEOA 4KWIA 4FJ0A 4KQ1A 1OXUA 1GN9A 4BNDA 5LQUA 3PQ2A 1J39A 1XDZA 2N75A 5IXSA 3C3JA 3K4QA 4MQFA 3H4IA 4OX9Y 3ANSA 4HNUA 1L7QA 2BKXA 3UH1A 1LSJA 1HLPA 2BUCA 3GRAA 1BMFD 1JMKC 1ML3A 1ZXBA 4HMPA 2PBLA 4OLHA 4ZA2A 1NG9A 2O8FB 1XZQA 4LMAA 4X00A 4S1OA 1DEOA 2BJVA 4NP6A 3WK8A 2ZBEA 2WKSA 1FFXA 2Q1SA 2FKAA 3K2BA 3C74A 3IIIA 2BZSA 1EUCA 1W9MA 3GLHA 3K8YA 3LU1A 2OA0A 1CR2A 2KQUA 1TCBA 4CBVA 1RMYA 3T4XA 2HW8A 5J2UF 3ER8A 2HA3A 1VE5A 3GRRA 2AEFA 3DOCA 3E8MA 3OKAA 4H1TA 3L06A 4JQOA 2QR2A 5EYPA 4RE5A 3FFAA 4HAYA 1IXRC 2RHCA 4ZHQF 4YJ2B 4RXTA 2Q8NA 1Y9AA 2B8EA 1KDOA 1Q95A 1K2WA 1Z4QA 2ZAYA 5C1PA 1YB2A 1PEAA 3DYIA 1H85A 1J09A 1Z5PA 3I76A 3LG2A 3E18A 1WEHA 3UJ3X 1NUUA 2RGWA 2GEBA 1XQ6A 2FZGA 1FTSA 4OQQA 2QX9A 2VC2B 2IWHA 4P3XA 4JL8A 2HRCA 3K6SA 4MVJP 4REMA 2FU5C 621PA 4WOKA 3DLTA 1F5SA 1KR5A 1UXGA 1FXUA 2FP4A 1M8FA 2EX1A 5DM1A 3WMWA 1GV0A 1G1MA 1QRRA 3DOJA 3IMCA 1ZD9A 4MA0A 5AMXA 5LU8A 3BZWA 2WTMA 4F2DA 3WBFA 5L3RA 3BCSA 3SJUA 3RTBA 1XXHE 2NQTA 1A8IA 4LV5B 1JVNA 3ZU5A 1KAHA 4F2GA 121PA 4LE1A 1KI1A 4QJIA 5F3DA 4CTKA 1V7CA 3HDQA 1EGVB 2WYWA 3FROA 3S28A 4RTOA 2Y1LA 2GZMA 3NHLA 4OKSA 3T35A 1PJAA 3KTFA 2H0AA 4BNZA 1DCTA 5ALQA 1W94A 5C5IA 4WD3A 2QLLA 2GWRA 3PFKA 1OBOA 5BMOA 5CDTA 3IIEA 1DFGA 1VHDA 1DTSA 1JFSA 1DKUA 2L82A 2JHPA 3H5TA 2Q0SA 2EGUA 2C7GA 1QC5B 2WPNA 1LDMA 3KJIA 3TINA 4CU5A 3OF5A 5ALFA 3UTCA 2DBYA 1RZ3A 4DBVO 1HKHA 1YK0A 1NPDA 1KH2A 2VUIB 4DCPA 4EYOA 4W9NA 2WK1A 3H5OA 2C5BA 1G20B 2QUAA 3PT5A 1FNDA 4K0RA 5L3SB 2JI8A 1KGSA 2BGLA 2EP5A 4K81B 8MHTA 1H0RA 3VKVA 1QKJA 4NFHA 1CJUC 5EFOA 3RARA 1GZ5A 3LUCA 3NWPA 3KQTA 1RXSA 3DAOA 3E7WA 4WY5A 2F3QA 2X77A 4WN3A 5D3KA 4W8GA 2DBQA 3L77A 4QUJA 3WP0A 3PPIA 2Q4OA 1S0UA 4JR0A 5LUAA 2OQ2A 1OLXB 3M9XA 5BVHA 1KQGA 1H22A 2PO7A 5BYAA 1NJFA 4RMHA 2ZBQA 5ITZB 4WLUA 3WLSA 4PN3A 3KKKA 2FEWB 1YJCA 2HQRA 4O4IA 3EE6A 1UXHA 1ZWKA 1FRNA 1N2CE 1BHSA 2CXPA 1BRMA 3AONB 3FPBA 2OPBA 4JD5A 4IUDS 1OKKD 3OJEA 7REQA 3E27A 1UBOS 3ICEA 4OXRA 1BJKA 1JXOA 2HLDD 1TLFA 2PPLA 3G13A 3EVBA 3FFWA 4IXDA 4PC6A 3AINA 2WJ6A 4PQYA 2FMTA 2WIGA 1SZPA 3AKCA 4TKUA 3WJ2A 3BIOA 4S1PA 4UHDA 1G8KA 2Z3VA 5L8VA 4RULA 4M88A 3TW8B 4DNQA 2D06A 4IIGA 1XRNA 5CPFA 1ZEMA 4BEJA 1FQWA 1XMVA 2JGDA 3CH6A 1GNVA 3DHWC 3Q1LA 4NCKA 3ZHVA 1P5FA 4MW0A 4UU7A 3LBAA 1AMOA 4JL5A 1F0KA 2WP8J 4RK0A 1MAVA 2WV9A 3EXAA 2A92A 1UBSB 2MTBA 3GEHA 1F17A 1MEOA 4EG4A 4LUCA 4IHAA 2HA6A 2OORC 4BO8A 3EWNA 1T8UA 5BMVF 2Y9MB 4JVNA 4Q1DA 4CLDA 1LLFA 2R8BA 2H00A 3OCCA 5L9AA 1T5SA 3DDZX 5FOXA 4I8DA 3IEMA 4YRFA 3TOSA 4XGIA 4DLNA 3ML1A 4TYWA 2VN8A 3V4ZA 4YRAA 2J9XB 2R44A 2YZNA 1KPHA 4Y2QA 4UBLA 1U0NA 1V1RB 2AC4A 4W82A 2QNIA 1ISPA 1G1AA 2YVAA 3FF1A 1LPOA 3ZV3A 4AJPA 5KSOA 5IT0A 4A5SA 4ZJYA 2NZXA 4RD4A 1OHHA 4K9DA 5DGHA 1XE3A 5AO9A 3L93A 1GYRA 3TMAA 1RM0A 3OJCA 2QD3A 2CD9A 4RA9A 4HWTA 2JGRA 4CL0A 3F74A 3LK7A 1S3FA 1OSNA 4L4ZA 2QX8A 1MPXA 1QAMA 1RAFA 5JJBA 1B2RA 1PN3A 2ODQA 4XIGS 3ANLA 3QU7A 4C08A 4CDMA 5K03A 5TNXA 1WCYA 4Y0NA 4G1MB 4HDCA 4YXFA 5KYUB 4UPEA 4HLDA 2FI1A 2WP0A 1A98A 1Y3FE 1GU7A 1OLOA 3FMIA 3H2SA 4YBRA 1K8RA 3O90A 4J94A 5DN6D 3Q87B 1J23A 3PENA 2NP7A 3H6KA 4GLLA 5FFFA 3RYIA 1E9SA 1HXHA 1ORHA 2VNIA 3HH8A 4LMRA 1E1YA 5GZ6A 3VMFA 5EJ4A 4QU5A 5HKBA 2ENUA 2OR3A 2AQIA 4KPUA 3SM9A 2PX5A 4AJLA 1G8MA 2J3DA 1J8MF 1TJYA 1FP4A 1VLHA 3O3MB 1ARZA 1KJYA 3RVKA 1U3WA 4X7BA 4BO7A 1MQAA 1G2OA 4D9HA 1G8JA 4D4GA 2XMCA 5DNCA 1D3AA 1GPNA 2J6IA 4NZPA 2XI4A 5DBIA 1E3LA 4ABTA 5D84A 1YTLA 3MTBA 3RUDA 2JLWA 4K2HA 3LXUX 1DUIA 1S96A 1NW7A 4OM7A 3UVEA 2Z8ZA 1KAOA