3L93A

Phosphopantetheine adenylyltransferase from yersinia pestis.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
NAMITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMFTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title X-ray crystal structure of phosphopantetheine adenylyltransferase from Yersinia pestis.
rcsb
source organism Yersinia pestis
total genus 53
structure length 161
sequence length 161
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3l93A00
2EJCA 1ZJWA 3LCJA 1JIJA 4GRIA 4ND7A 4ZT6A 1GAXA 3AG6A 5IJXA 3CLSC 2X0KA 1NZJA 5H16A 4MUJA 4EG5A 1EFVB 4ZCTA 1O0CA 3A2KA 5LM3A 3E27A 4G6ZA 4J75A 1N75A 3K9WA 4PY2A 1KKUA 4XFJA 2CYAA 1U3CA 2O8VA 3AG5A 3NBAA 3HMQA 1R6UA 4FZJA 4KPUA 1KP3A 1F7VA 3CA8A 2DPLA 5KCMA 3G5AA 3SEQA 1J1UA 4MWEA 4NZPA 4MVCA 2QJTA 1OWNA 3FIUA 2HMAA 1WXFA 4MVXA 1JGTA 2CV2A 2GM3A 1FYDA 1QTQA 3RFFA 3COYA 3KFLA 3ND6A 2E21A 1XNJA 1TYBE 1M8FA 3L92A 5LLTA 1WZ2A 1PG0A 4EG1A 4MLPA 5J5AA 4OUDB 4U8HA 1J1ZA 3PRHA 1KQNA 3OTWA 1MB9A 2DXIA 3Q10A 1JHDA 1KAQA 1WOYA 1K97A 3TZLA 2YWCA 1COZA 1EFPA 4F3RA 3N8HA 4G5FA 2OV4A 2PG3A 4NAUA 3Q12A 4MVWA 2QJFA 4YBRA 2IP1A 3UMVA 4EG4A 5EKDA 2CUZA 1WQ4A 3S3TA 1H3EA 1PFWA 4WSOA 1J09A 1JZQA 2ZUFA 2PZBA 4NAHA 1EJ2A 4MW0A 3PNBA 2X3FA 3ILVA 1NUTA 3COZA 1JEDA 4PBRA 3IH5A 1IVSA 1N78A 3PNVA 1O0BA 3P0IA 1QRSA 2QTMA 4MVYA 4DJAA 4WNYA 4XSVA 4A91A 4ZT2A 3FDXA 1MAUA 1TYCA 1JIIA 3CVXA 1G8FA 3H05A 1IRXA 2DLCX 2E18A 1BS2A 3FETA 2R5WA 1JILA 4MUKA 1T9GS 2A1UA 3SEZA 4MWBA 1ILEA 3ZIUA 4JXZA 4I6GA 2A7XA 2ZP1A 3H9BA 3CLRD 3IOEA 2VTBB 1N3LA 4MW7A 4L2IA 1M8PA 1H3NA 5F23A 3FY4A 2AG6A 4QREA 1OWOA 2BYTA 4K03A 1KAMA 2A86A 2J4DA 1WJGA 3ND5A 1JZSA 4I6JA 5HUJA 1EE1A 1R6XA 1OBHA 2PXHA 1EFVA 3LOQA 4JFAA 4H3SA 2CYBA 3DO8A 3MUEA 3N05A 2NZ2A 4UZEA 4MAFA 1LW7A 2IELA 4MW9A 1M8KA 2A1TS 1T9GR 3PNYA 3X1KA 1EUYA 1MB2A 1O96B 1GPMA 3NV7A 3K32A 3D6VA 1IFXA 3AIIA 3CLTD 1R6TA 1QJCA 3INNA 1FFYA 4J76A 1N2JA 5K0SA 3MXTA 3OP1A 2J09A 4MUNA 1XNGA 4ZT7A 2H29A 5DB4A 1O95C 3CVUA 3IMEA 3M5WA 2V0GA 2E89A 4OUDA 4ARCA 4U63A 5FO0A 1M8GA 1PFVA 3N2YA 4GU5A 3CVVA 1VBNA 1MOPA 3KT8A 1TEZA 1YI8A 2ZUEA 1IHOA 3RHSA 4CT0A 1HYBA 3H97A 2A1TR 4PBSA 1NUSA 1M1ZA 3HZRA 3IUBA 2YWBA 1XJQA 3H99A 3ZJTA 4CQNA 1EXDA 3MLAA 1Y42X 3NBKA 1MJHA 2NSYA 4ZT3A 3ND7A 3UOWA 1I6LA 1ULHA 3N9IA 2QUKA 4R2MA 3ZXIA 4MWCA 3BL5A 3GLVA 1UFVA 1O97D 2A88A 4P2BA 1I2DA 2D13A 5HG0A 4ZCPA 3RK1A 4DLPA 5HUHA 4QRDA 3IOBA 1JMVA 1GTSA 2QUIA 1K4MA 1G8GA 2Z3VA 2YY5A 4R2LA 4KR6A 4HK4A 2GOYA 2PZAA 2X1LA 4I6EA 4EG3A 1N2GA 1MRZA 3KT0A 1LI5A 2C5SA 3UK2A 1TQ8A 4DDMA 2PZ8A 1Q77A 1J20A 2A84A 1PG2A 4AS1A 3VGJA 2WQ6A 2CV0A 2DR2A 1O94D 2VTBA 3DLAA 2H2AA 2WB2A 2RE8A 4JZYA 2WSIA 1K92A 2PFSA 5TEVA 3TQIA 3MMXA 2TS1A 1YULA 1DNPA 3CLUD 5AHWA 1WXEA 3QTBA 4PBTA 3ZJVA 3TS1A 1OBCA 1VBKA 3JXEA 4G5YA 5J58A 1G8HA 2YXNA 1NYLA 3H9CA 4UZFA 4ZCQA 1QNFA 1JIKA 4U7JA 2X1MA 2OQ2A 3IOCA 1EFPB 3Q4GA 3SP1A 3FI0A 4YP7A 1GLNA 4MW5A 4KR7A 2XRYA 1SURA 2JA2A 1OWPA 2J08A 3HV0A 4MWDA 1B6TA 1V47A 2I1LA 3UY4A 4DNXA 3FWKA 2DUMA 5KWVA 4MULA 2DERA 1O96A 5IHXA 1M83A 1F7UA 2AZXA 1N77A 2BTEA 3L93A 4OJMX 3IDFA 3ZXSA 2DETA 2XRZA 5TS2A 4F4HA 1OWMA 4Q93A 1EUQA 3CLRC 1VL2A 4MW2A 3IMCA 4AQ7A 1U0BB 3TZEA 3A4IA 1P7PA 1KORA 1T6YA 2D5BA 1T6ZA 1RQGA 3RJZA 2IJGX 4ZT5A 3SZ3A 2CT8A 4ND6A 3COVA 4RUKA 3F3MA 4JYZA 2CV1A 4EGAA 3CLSD 3HFJA 3VU8A 3IVGA 2CSXA 3AL0C 4MW6A 1N1DA 3X1MA 1YUNA 4CDNA 1YUMA 1NI5A 2J5BA 1F9AA 3AKZA 4S1OA 4E1AA 1KQOA 3LE8A 3ZUGA 3FHJA 4RPIA 4XFDA 4MQ6A 3UC5A 3RBAA 1D2RA 2D54A 1NUUA 1TYDE 4YP5A 1VBMA 4K0RA 5DASA 3HL4A 3FG9A 4HPWA 4YMIA 1ZH6A 2QUJA 3CLTC 3ELBA 3DPIA 1WQ3A 1KH2A 3G6KA 1VLHA 3FNRA 1GZUA 1ZUNA 3P0JA 5DEOA 1YIAA 4DDKA 1IQ0A 3IVCA 3HGMA 1QU2A 2V0CA 3TQOA 2J07A 4ZCSA 5LFAA 2RD2A 1NUQA 3U1VA 5TGTA 3IMGA 2QTRA 4KKVA 1M8JA 4MUHA 2QJOA 1S4MA 1MC1A 4ARIA 2O5RA 3P52A 3SYTA 1OWLA 1WXHA 3FOCA 5DK4A 1JEEA 1K4KA 3SDBA 3GMIA 3QTTA 1O6BA 4KPUB 1H1TA 1N2EA 1WY5A 1YIDA 3IVXA 1PFYA 1QRTA 3P0HA 1NUPA 1N2BA 1U7XA 2JANA 1U7DA 1H3FA 1X8XA 1QU3A 3IODA 1KP2A 4EG6A 4HJRA 4KR9A 3FH0A 4MUIA 4EF6A 2AKEA 2B7LA 1G59A 1U3DA 1ZH0A 2Z09A 2CYCA 3MLBA 1O97C 1TFUA 1KR2A 2Z08A 1KH1A 3PXUA 3X1JA 4DE5A 1Q11A 1J21A 1O5TA 1N2OA 1NSYA 3QE4A 2QTNA 1V8FA 3KT3A 2DEUA 4NDAA 1QQTA 1F4LA 4X0EA 2WQ7A 3CVWA 1WXIA 2EL7A 3D6UA 4NATA 3GUZA 2HZ7A 1CT9A 1J70A 1X6VA 3KT6A 4R0NA 1XNHA 1GTRA 3SZGA 4EG8A 1WXGA 4TS1A 1JECA 1IH8A 1IQUA 1O94C 5BNZA 1WKBA 4MUFA 1T6XA 1NP7A 3A05A 4MW4A 4QBTA 1KH3A 3CLUC 1NURA 2A4MA 3IUEA 4NX2A 1I6KA 2CFOA 2JAXA 3CR8A 4ZT4A 1IQRA 5FNZA 4YP6A 5TEWA 4MUEA 1PFUA 2PIDA 5FO1A 1KQPA 4Q16A 3ZGZA 5K0TA 5J59A 1LI7A 1I6MA 1Q15A 3COWA 2VXOA 3I05A 1QRUA 2A1UB 1A8HA 2E0IA 3DV2A 3G59A 1Q19A 3A04A 3CVYA 2QUHA 4MW1A 5KHAA 4JXXA 4EG7A 3AFHA 1MBZA 2G36A 3ISJA 5JBNA 4L2IB 1MAWA 1N2HA 5H7XA 3TNJA 4HJXA 4EFKA 3C8ZA 4BWVA 4DDHA 1OD6A 1O95D 2HGZA 3RK0A 1N2IA 3ZJUA 1GN8A 2GKSA 3VRHA 4MUGA 4CDMA 1TYAE 4ZCRA
chains in the Genus database with same CATH superfamily
4ALKA 3FPBA 4ZK2A 1IUNA 1GU0A 2D5AA 1C30B 1HUQA 4ND7A 1AGPA 2QV7A 2WUWE 3R5JA 4MNTA 2H3HA 4OL0A 5H16A 2DHCA 2ZRCA 4CKXA 2FMKA 4ZVKA 2A92A 3QBDA 4ACAA 4TTJA 4QGSA 3A2KA 1GTJ1 4IH9A 3R7DA 4TX1A 3UW3A 1KKUA 2XAAA 4G67A 2ISCA 2PFGA 1U3CA 4UEQA 1L8OA 1L7XA 1QK5A 2QLMA 1YVEI 1X42A 2PX0A 3F90A 3NWOA 5AVZA 1I94B 1X8JA 2JGFA 3GG9A 1LDBA 3MS7A 2PL5A 4LY3A 5KAPA 6PFKA 4JXKA 1F14A 3HP1A 4JVOA 3I83A 2EZUA 3BYZA 3SHWA 4TTQA 1CJCA 4OLJA 4MWEA 2P65A 2JJ8A 5JAPA 2FX2A 2P5UA 3A1CA 3DGEC 3A3NA 4D8WA 4E51A 2GN9A 1QZZA 4OQPA 2CVFA 4UBOA 2AX3A 4OHPA 1DFHA 2VIIA 4B8YA 1KEKA 1RI2A 3QEAZ 3P9QA 4X97A 2CUNA 1CLUA 4GSKA 1CX9B 1QP8A 4QHYA 3Q8WA 2JKZA 1EGMB 4EP1A 3AL2A 2DJ5A 3EWAA 4H08A 3IALA 4HDCA 2JFHA 5TQ2B 3B48A 2LKCA 5FBWB 1P29A 3OFSA 4MLPA 3VR2D 1E58A 1ZOOA 1VIMA 2IIBA 4KVFA 3A6GA 3GEHA 3DEKA 3WGZA 1Z8DA 4H60A 2FEMA 1O6GA 1WDLA 3AR7A 3DBRA 4HNTA 4GOMD 1TO1E 3UUWA 4GMKA 4IDOA 4IIEA 3UT5B 3B1JA 4M60A 1XJCA 4Q03A 3FZQA 3CKMA 1M66A 3K0BA 4QGBA 1WHSB 5CU7A 4LPSA 3I9MA 4M7PA 4XGRA 3WWZA 1EDDA 4CM3A 3B8EA 3JSAA 1FQOA 3CR7A 4HPXB 1TAHA 5HFJA 4CKYA 4F3RA 5HP4A 3OLVA 4WKBA 3MG9A 1G7CA 2H07A 4Z86A 1L5FA 1GNRA 5ALUA 4L0MA 3ICVA 1CQIB 4PG6A 3UO8B 2C0CA 5IHPA 4ZVRA 2X0NA 3A11A 5IM4A 2XVYA 4NF2A 5K01A 1JZQA 3C45A 2VHEA 1UEXC 3QVOA 4DG8A 1YMVA 1H1LA 2RK4A 4O1MA 4C7JA 3OJ0A 3QQ5A 2GCPA 4KACA 5BP7A 4LQ4A 2NZYA 5AI5A 3ZGNA 5JE8A 2HCTA 1G8YA 1PN3A 2WHYA 3NO4A 3D4NA 1O0BA 2FPGB 5I7AA 4RXUA 5AMXA 4FYPA 5K1ZA 2WSYB 4BV2A 3SVLA 1KZ1A 4TZ0A 1G8FA 2GGSA 1JTFA 5REQA 4B6PA 3TB4A 1IAQA 3ODGA 2GYYA 1NXPA 2E4XA 2MSEB 4OJTA 1X7WB 3M3HA 4XAQA 4Z1MD 2G76A 4G1FA 2UUCB 1NRWA 2A1UA 5ALWA 5B3AA 2GMWA 2ZIXB 3AFGA 1EBFA 1L4FA 1FW8A 4PV7A 3P97A 3WRWA 5JROA 2ZP1A 3BEOA 4GFDA 2IP2A 1H2ZA 3O4FA 2YBEA 3WYBA 3EY9A 4X90A 2A9RA 4FOSA 4FHFA 2OORC 1M8PA 3DYVA 5DBHX 4XVUA 4LWPA 5KTKA 3UB3A 4PYKA 1ZIXA 1G2OA 1OC2A 1OWOA 3WA6A 3GGDA 4MXDA 2BYTA 1E8NA 4JB3A 5H83A 4AKHA 2EBHX 1MX1A 4AUMA 1EWVA 3BTSA 4ED9A 4XQEA 3E18A 5JXJA 1Q0ZA 3W3AD 3RARA 3V2UA 4BXOA 4G5QA 4ZDKA 1W85B 1D4FA 4DIDA 1FOEB 3O6VA 2CLKB 1E66A 2XVXA 4JU9A 1NP3A 1SQ5A 2X58A 3B78A 4M0LA 4MKIA 1NT2A 2ZWOA 3KJEA 3HWSA 1R6XA 4B3IA 1TUBB 2DQZA 1WW8A 3U17A 2Y68A 2XB9A 3EGWA 2ST1A 4WBSA 5AM5A 2FMHA 3R3WA 3OSZA 1V1RB 5CXXA 3KKNA 1R5BA 2PYZA 4N40A 5CMLA 4HMPA 4L57A 4NH4A 1M6YA 1XCJA 3MXOA 4J3FA 3X3HA 1R0ZA 3X1YA 4NOLA 4BOYA 2A1TS 2JZNA 3H5TA 1Z0FA 4LRUA 2LW7A 4UNPA 4F5DA 3WLRA 5J1SB 1Z2AA 4MR7B 1BN6A 3KB8A 4RBNA 2C7RA 3ZTWA 4O4IB 1SUDA 2ONYA 5BO5A 3K05A 5JHHB 3TG2A 1WZIA 1GPMA 3J7TA 1OB5A 3NUGA 4EW2A 3IPLA 4HH1A 3MWFA 1IEQA 1TVCA 3FCUB 2WTUA 5I9SA 3A25A 3D1LA 5LLDA 1V7ZA 3R0XA 1CULC 3B1KA 3DZ8A 3MUOA 2FWRA 3TQCA 3DT6A 1E94E 2FSVA 3MCAA 4W9NC 2H5IA 2I91A 3PQDA 4Z54A 1GG8A 1PDOA 2EBFX 3EIUA 3HP7A 1FVHA 4RPGA 4BGVA 5IJ0B 2A8YA 2ZDGA 2FN9A 3MBKA 2JHGA 3ROGA 1Y37A 2OHIA 1R0XA 3DEZA 3IDSA 4JXXA 1A88A 2RGEA 1NNEA 2AUNA 1OC4A 1PG5A 1MLDA 2Z95A 4FGSA 2J9YB 3QE2A 2GZAA 2VJBA 3D4OA 4KRGA 1MC5A 2WIAA 1CIVA 2P3LA 4EVQA 4LVOA 5IAOA 1KMIY 1TEZA 1FZQA 1UAYA 5JFGA 3DKKA 3H86A 4DCNA 2R8EA 4NR0A 5KSPA 3WWYA 3G9XA 4M1WA 2I7TA 2NXJA 2XE7A 5E8RA 3A6EA 1H6DA 1NM5C 2PUJA 3MGAA 1DCKA 3H99A 4DG9A 2WU8A 1DCTA 4FJ0A 4W5TA 2UZ1A 3VHXA 4U8GA 4GR9A 4EVIA 2WF8A 3TLXA 2JFYA 1L4BA 2FQWA 4G4SO 3OUUA 1XEFA 3C3EA 4MV1A 3ND7A 3Q9NA 4YLEA 5EIBD 3QX8A 5FI0B 5FQOA 3DAGA 5GZ3A 1AQNA 1X74A 3AFOA 4MWCA 4W5HA 3DA8A 4BY9E 4OSEA 2KB0A 3EN0A 2BSXA 1U9IA 2PBLA 3F46A 5AVTA 1MJGM 2F7SA 2FF5A 3OJLA 4X8HA 2NVUA 3WMGA 2NNWB 2BFCB 2VOJA 2GPJA 3D7RA 3EEBA 1XZBA 3PXCX 2CVZA 3SBXA 1J0CA 2IYUA 1E1MA 3EXHB 3KOZA 3M6FA 4QRHA 5HG0A 3ZCRA 4TN1A 1P5ZB 3CX3A 3GWGA 3F5SA 1Y3CE 2BKUA 1EESA 1E60A 4LRYA 4LECA 4KR6A 4MUYA 2F1JA 2RFLA 4GZLA 3U7EB 4PEVA 4BQRA 3K0AA 3M9XA 5CIYA 2PYIA 5GJBA 1N2GA 1FP1D 1X39A 2R1TB 3DDOA 2XVZA 5CYOA 1N1GA 4FMPA 4C4AA 2BPOA 2EQBA 1QHXA 3BQMB 4M7WA 1Z0UA 4G97A 3VJLA 1UADA 2J67A 1PTJC 4BGIA 2BCEA 3FSGD 4CEIB 3GH3A 4NBUA 5A2GA 4LYHA 5IAJA 3CZRA 1KL7A 3HY3A 3GT7A 1CB7A 4IIYA 3S55A 4KODA 3TSCA 1CSEE 3B9QA 3ZDXB 3N7UA 3CLUD 1IBLB 1U9YA 1JFTA 3CX7A 1YRQA 3WL6A 1OQAA 4U7PB 2QTFA 3SEZA 2P0EA 4K05A 4IP0A 2GARA 4BEBA 3EW7A 5A3VA 3QE3A 4DHWA 1XZHA 1WY7A 4LQCA 1G41A 4TZKA 4ZI2A 1F6WA 5H3HA 3PJRA 1B43A 3EZLA 2MSWA 3EODA 2GSWA 1YMQA 4MW5A 5MGNA 4GX2A 1SA0B 3TCXB 2XJ9A 3W9UA 3G1TA 2WZDA 1QZUA 6NULA 4G07A 3CZAA 1T8UA 3MTQA 4AIIA 1B6TA 3F3YA 3LUGA 3Q3JB 2P2NA 4YCLA 3RFXA 4AZVA 4DSTA 2GESA 3ICQB 5IX8A 2AFIB 1TMKA 4YCMA 2JZOA 4AYWA 2AZXA 2B1GA 4RA9B 2ECPA 3TOVA 5GZ1A 1E3TA 3CVJA 3I2KA 3AY7A 3MQ2A 1JDBC 2WWRA 2CHUA 3PVZA 3PGJA 4OAOA 4WFJA 5A05A 1J2UA 3KKQA 4E5MA 2XUAA 1VL2A 1XUOA 2ZSJA 3RVJA 2HF8A 2V6BA 2AE1A 4E4TA 2R6FA 3LVQE 3ZEAA 1U0OC 3GMDA 3FTPA 3NR2A 1SVWA 4JNCA 1QUEA 1SUEA 4QX6A 3TZBA 1TUEA 2NZVG 2JKVA 1W9MA 2HMUA 1U0GA 3KZKA 3WVNA 4Z4FA 4HP8A 3SSNA 1O95A 1ISMA 2NYUA 4HYEA 3D0KA 1WP9A 1N57A 2OXEA 5IASA 1SBCA 4IINA 1CYDA 4B7XA 3ZR4B 4FX2A 3TR0A 4EB6B 1T4CA 1D6JA 5J4HA 4ANFA 1YRHA 4TYQA 2A0FA 2AEMA 4WN9B 2D1YA 2HH9A 5EKUA 4J3NA 3X1MA 5EE0A 1XVIA 4W7SA 5LBUA 2IS6A 2Q99A 1FRFS 2P4QA 2WM8A 3E8XA 4YNBA 1K8RA 3QFTA 1QVVA 3OAAD 2CMHA 1XZGA 4XFDA 4HVLA 4TKMA 2XVMA 4EG7A 3NJ4A 1Y89A 2CVHA 1EZZA 4H27A 3T99A 1RRPA 2GZMA 5DYGA 5FT9A 3UIEA 4DARA 1AF4A 2H57A 3OOHA 2QBYA 1HY3A 2NQTA 2CK3A 5F1KA 2WNHA 1UQTA 2DQSA 4HRAA 4BX3A 4OU5A 3JTEA 4HR7A 4K8OA 3ADOA 1Y9AA 2RH8A 3FWPA 5TNXA 1J5EB 2P67A 2GHIA 4C2TA 2YHIA 4E2FA 4R31A 4MS3A 4D57A 1EHYA 2X77A 3BMQB 1RWVA 4BNNA 2IYNA 4BV9A 4IQ0A 1YGYA 1DIAA 4U3JB 1PDWA 1ZHFA 1QBKC 4LMBA 4R1QA 3UK7A 1L5WA 1JUDA 4I1YA 4WZAE 3M3DA 3W90A 1CY7A 3ZX4A 3IMGA 2YCLA 1DB3A 1AKUA 2QTRA 3O47A 1S2LA 4E08A 1W1WA 1ZCBA 2UZ0A 3PFWO 5DLPA 3MS4A 1EGQA 2VI5A 2YZ2A 3KB6A 3OQ6A 4JN6B 5F51A 1F0PA 3IERA 3WLJA 3C7TA 3ZD7A 1GSHA 1W1UA 4MDEA 1MOSA 2VUTA 3IUJA 3SSOA 2LCIA 3ZY2A 3WNCA 2J0QA 3CCBA 3STUA 1NV9A 4HKTA 4YVFA 4P34A 1QQ5A 5HKOA 1ODIA 5DRYA 1KJZA 2I8LA 4BDTA 1CUFA 1X7GA 3TBHA 4FI3C 1SCDA 2DG2A 2IHUA 2BBTA 3BHNA 1HZZA 4WOCA 1KC3A 4MVJP 4MR9A 2HLPA 4GM1A 3WFIA 1FNDA 3CGGA 3ZVLA 2ZIUB 4RLFA 4RV5A 4A0GA 5KYKA 2AFHE 4NK4A 2O2DA 1EEHA 4Y2RA 2E5FA 4M0PA 1WVGA 2QK4A 1JT9A 2GF0A 4N0EA 4GAEA 3HA3A 5TS3A 1HDOA 3B3JA 1YZ3A 1M6VB 2AUTA 2QSZA 2G82A 2O8DA 1J21A 3KYIB 1AKNA 3NHBA 4C30A 5EIOA 1ZNZA 2VLBA 3BGSA 3IVRA 3TJMA 3VHLB 1E8MA 1H5QA 3F7NA 4CGYA 2XWQA 4ZCIA 4OHBA 7YASA 3R1IA 1C0PA 1LLDA 4KN8A 3WK4A 2N3ZA 3E5HA 1D4AA 1N4DA 5EXTA 3SF8A 2X0IA 2FKNA 3GUZA 3OPNA 3ZVKA 4MOWA 3O93A 1U7ZA 5L3VA 2B9VA 4GC5A 1B2LA 3QP9A 1KOGA 4JH0A 5DHSA 2Y4OA 2G6TA 2X7HA 3L8CA 3RYIB 1ODFA 2VDPB 1HE3A 1SM4A 1WMSA 2YJ6A 2ZJFA 4I5IA 2GB4A 3LNTA 4DOMA 4HLQB 4J0EA 3RVPA 1O94C 2Y1WA 1EIWA 1DBVO 3RYCB 5EVJA 2C20A 5JXHA 5LWHA 3GLFE 4I9FA 3QBVA 3CURA 5F3RA 3MOGA 3WO1A 3EGDB 2J1LA 4LE1A 4X1IA 4D9NA 1MJ5A 3JQ6A 1P2BA 2M9MA 3K2IA 2OE2A 3KEFA 4R2WA 4RDHA 3I9FA 3A1UA 3AOEC 1JKJB 2R85A 4WJZA 4L5AA 2WP8J 4Y6QA 1EWTA 2VJAA 3STHA 3UGTA 3Q5GA 8LDHA 1DLJA 1BGVA 4LI0A 3ZVNA 1F8FA 2G9NA 4LF9B 2G8LA 4NONA 5JSZB 3G2QA 3WADA 2Y77A 1PGQA 4X1KA 3KYJB 5ELMA 3DT9A 4RJTA 5LMNB 1UMDA 2YRXA 3OIUA 2PMCA 3FFTA 4TVKA 4WUTA 4DNPA 1DV1A 1TAGA 1ODKA 2KX7A 2WJ3A 3D3WB 2VHYA 5EE1A 3VTZA 1JRLA 4EUHA 4JCOA 3ZWYA 1JSCA 2WFAA 2QVBA 1K7CA 3BMOA 3H1PA 3IX7A 1CC1S 3O82A 4I14A 3BIWA 1OCEA 1OX5A 3I05A 1KVSA 3RWBA 4CEJA 2HW8A 3TAHA 1CDOA 2F1OA 4J7CA 2W6PA 4TV9F 5HZMA 3E81A 4F1WA 4X64B 3P9ZA 2EIXA 2YWHA 1W88B 4N9QA 4WXRA 2X2EA 5IN5A 3R7WA 3W6PA 4CBVA 1J0BA 5AVYA 1TCCA 3BRQA 4X20A 3W34A 4MV7A 2G06A 3HJNA 3IT3A 4O2AB 1ULZA 4OGGA 4Y30A 5G2OA 1NW4A 1Y82A 2NSJA 1RPJA 3FYHA 2QS9A 1SD5A 3NHSA 3OCVA 3OEWA 5EESA 2OVBA 3HN2A 3A0RB 4XVQA 4BWVA 5CYGA 3K4QA 3DDUA 5HZGA 3KR0A 3VRHA 5CP8A 4X7BA 1DJMA 3UM9A 2JRLA 1WUYA 5CDSA 4FE4A 4D6PA 1VHLA 1OJ7A 1ZSVA 3R6TA 4KJXA 1E7SA 3TEJA 3B53X 3FGZA 2AEJA 4I1RA 1U8UA 5ALDA 2YZGA 4JJ4A 3M9WA 4J0FA 2CXUA 2CL6X 2CDCA 2YV3A 1CEQA 1KI6A 2P9TA 1VSQA 4JUFA 2QSUA 2RAFA 1FSSA 3R0IA 1U4OA 1IMOA 3G6WA 3I30X 3TLKA 4HNQA 3FZGA 4AY5A 4EPVA 1QIKA 2BFDA 5FPQA 4FUQA 4BGUA 4EAAA 3MJCA 3W9SA 1RI3A 3GYBA 1KU0A 3EB9A 3QVTA 5G41A 3ZCSA 3MD0A 4I99A 3U6BA 3GL9A 3DUWA 4QNRA 3KEMA 1LWNA 2K2QB 1HFWA 1E99A 3GLGA 2A0WA 1XI2A 3NASA 5JAZA 1BDBA 4Q4JB 4RHFA 1UT5A 3R7FA 4BNYA 1ZJJA 4ZHQA 3IPCA 1HE5A 1TC2A 1TK9A 1EVLA 4OXNA 3MJSA 3QKRB 1UUFA 2QI9C 1XNQB 5D1HA 4HRXA 3FRJA 3AM4A 4XOUA 4DG5A 2QAJA 5DW3A 2Z8ZA 5CFZA 1OSNA 3N2KA 4D41A 3SIWA 1C7ZA 1IULA 3U3JA 1YA8A 2O9JA 3K8OE 5EQFA 4S2UA 4QU8A 5IH3A 1I24A 4B6GA 4FMBB 4OQNA 4EL0A 3AETA 1K97A 2HDNB 1OAKA 2ILTA 5IULC 1A4IA 2D1SA 1MIOB 2IITA 3JQGB 3W04A 5DI3A 1ENPA 3KIPA 2WF6A 4FFWA 4OL9A 1QE5A 2V1XA 1IN4A 1R0RE 4R3UC 1OI3A 3L40A 4EQZA 2YC4C 3QNWA 5CBPA 2IPOA 2VDLB 3CUSA 3M1AA 4MWTA 4ZD6A 4P31A 5AFSA 5KYXA 3OI7A 4GUAA 1VSBA 2JGRA 4AP6A 1PV1A 1QWOA 1G0OA 1G7SA 3PXBA 1EK0A 3T34A 5AVXA 3UJ9A 4GI1A 4B85A 3KQUA 4RK1A 1S2OA 1Q0UA 4ROSA 4UE2A 1S7CA 1RABA 1ZINA 1KMHB 3RUHA 1SRRA 4MA0A 2OILA 3JYLA 4OJYA 5IT4A 2F1KA 4GLLA 4ZT2A 3FDXA 5AP9A 1V3VA 4L8LA 1FUEA 3WL7A 1GD1O 1JIIA 2CDNA 2W6NA 4DRZA 4RTSA 4PSAA 3ZXUB 4GR5A 4D0SA 1IWBB 1NR1A 3EFEA 4G5HA 4JIGA 2AWNA 1DXHA 1NTRA 3DLTA 1V2GA 2FCAA 2O7NA 1QFSA 2OGZA 3ETLA 1COWA 1T8TA 1UPCA 4TRNA 1OZFA 5J1TB 2ZQ5A 2OV1A 5L9AA 2QP9X 1JNYA 4L9WA 2X0EA 2XOKD 4JXZA 1XDZA 4UU8A 4YRCA 5ALPA 3CLRD 3MRSA 4D5EA 1OXKB 3EWIA 3RS3A 2H1CA 4Q3KA 1YB5A 2I3ZA 5AW0A 2X8WA 1OVMA 4F84A 1OZ0A 6LDHA 4WLEA 1KYVA 5AOCA 1O54A 3L43A 3M4NA 4KX5A 1RM3A 4JBHA 3USZA 4ARAA 4BKRA 2AN3A 1R66A 3FGOA 5CXUA 4UFOA 1TK2A 3F2IA 4C07A 4CMBA 5DTQA 2EKQA 2FA9A 4ND8B 3RIXA 3VR3D 4EAQA 4LG1A 4P7KA 2LIVA 1BJTA 3QI2A 3PIRA 5EYPA 2AG0A 5AVOA 1QCYA 4IH1A 1IZ9A 4D8VA 4Q12A 4I8XA 4RD1A 4BNJA 3ICEA 5JMWA 4QJBA 1NXSA 1U7UA 4NBWA 4QUIA 3TZHA 3OEED 1ZCZA 3RSQA 2QX6A 2VXBA 4S35A 3DV9A 3UCXA 2QWXA 3Q6NA 4A15A 5DV9A 2AFVA 1M2FA 3ND8A 3B20A 5AXCA 3KL2A 2PWBA 3C5HA 1LW7A 1PWZA 5FYDA 3KSMA 2EGGA 2ZJOA 3UWDA 3VYSB 1EDOA 2XE6A 3CPJB 2CJXA 3MMZA 4HAOA 5FBHA 3T06B 5GOTA 1I7LA 2CVPA 5J4VA 5JNUA 3W5HA 4BNKA 2EW8A 5ALFA 2VPTA 1PL8A 3FCAA 4OMUA 4RYDA 1QHHB 2C8VA 5FTWA 5K3SA 4D0RA 5CAEA 4DUPA 2PUWA 2BMFA 4UDYX 3FOFC 1A8IA 2ZWMA 2PUAA 3TM4A 2JAWA 3QSYA 3BJRA 4O4JF 2ZSEA 3JAKB 5I4IA 3ONNA 3DOEA 6Q21A 1OHHA 4JBXA 3ZE7A 2B6NA 1VRWA 2AK3A 4ZIRB 2YKGA 2W98A 5DBGA 1HORA 3IXQA 1L7QA 4WOKA 2BSAA 1T5TA 3RABA 1N0VC 4CMGA 2BEWB 1DRKA 4AJEA 1U5BA 4NBLA 1OT5A 3KXIA 4P33A 3JZMA 5DSZA 3UPTA 4H3KB 4G0VA 2FRDC 1F60A 2VLIA 2XNJA 1NONA 2XE8A 3FYTA 5EPUA 1M8GA 1PFVA 4NQZA 4CTMA 3PDWA 3NHKA 1DAFA 5ARBA 2AKYA 4K5QA 4DSNA 2FCRA 5LUAA 3K09C 1U80A 2BKLA 1VZ3A 3QWBA 4YJ2B 5LQJA 2VP0A 4YRAA 4KGDA 4RZUA 3RLIA 4TL7A 2CEAA 4BCBA 3AP1A 4IBOA 1YTUA 1V3QE 3K6SB 5IVKA 2C5EA 1HRDA 3BORA 1X15A 2MYUA 2GTPA 2DPMA 2ZKLA 4R1LA 1LSJA 4YJGB 3PEUA 3FDZB 5GVRA 1CBUA 3NBKA 3I6IA 3TSYA 2PHZA 3JR7A 2XYVA 3A3OA 1PQWA 4YP9A 4QUGA 1JEJA 2DU8A 5U1PA 2ZFUA 3GY0A 1UBTS 3FWZA 2V5VA 4N8SA 1PWHA 3WI7A 2FOIA 3ANMA 3GT0A 1FXSA 1HE8B 4YV1A 1QM5A 4DY4A 3ZWBA 1K8YB 1HDIA 1KYZA 2HRBA 3A3KA 4NJEA 2VDWA 1I2DA 3WLMA 4C7VA 4IEIA 3BB4A 3EUEA 3X1ZA 4KRYA 4L73A 1AMNA 1R50A 4FFBA 1MG5A 3ASVA 3A1FA 1CZLA 1GR0A 1R8XA 2EFGA 4HGOA 4R2LA 3DNPA 4DWOA 1CVLA 3PLNA 4GR4A 5DULA 2VF4X 2C2ZA 3V1NA 4A1FA 1ADYA 2DB3A 1JHPA 3TLGA 1OXXK 1UPUA 2FLVA 1GDTA 1YJQA 4K40A 3LWBA 1I1QB 4B32A 2Y99A 4OGKA 5A5FA 1FS6A 5HNKA 3VSEA 1HM5A 1Q2XA 2ASVA 4I46A 1PX0A 4DL9A 3T54A 5LQDA 1Y6JA 2XMZA 3AF0A 3UB4A 1VKJA 3FHOA 4BV8A 1Z5VA 4ZFNA 1DNPA 2BF4A 2GJ9A 5JRJA 4MV9A 4YYZA 5I4KA 1M2VB 2X9GA 4Y2PA 3JXEA 2XMRA 3OT1A 2ZJ0A 4UZFA 3EYWA 2HN9A 4OUKX 2P68A 2X1MA 2XHZA 5CA0A 4GVLA 4YEDA 4CKCB 2P2LA 3HM2A 2L82A 4RJIA 1X8LA 1T29A 3D8RA 3HQ4O 5LYJA 4PCUA 1WMEA 3TD9A 3LFHA 3L79A 5JDCA 1BD4A 4ARBA 1OROA 1FPQA 1MIHA 3L3BA 3WL3A 1XQ9A 1DU4A 3AHGA 4HQNA 5HSGA 1DC5A 3KQMA 3VDMA 2PVPA 4PLCA 4EGSA 2WB4A 2XPCA 4TWBA 4M89A 3L9XA 4Z9XA 1DX4A 4RV9A 3WK7A 1ULTA 1UBMS 2CWWA 2GN1A 1E9DA 2ODTX 1EVQA 3AHJA 3E0XA 3QV2A 3PGXA 4GLOA 4U1RA 3UJ8A 1PGOA 5BNIA 1Y8QB 2PS1A 5KKNB 1IIRA 1NVDA 1B8PA 4NESA 1PR4A 2Q1SA 2DBYA 3SC3A 3TSZA 1USVA 3EZ2A 1EUQA 4ZTBA 9LDBA 4FTWA 2WPNA 1AGXA 2YTZA 3EVGA 1JDPA 5GM1A 3V8RA 1IY2A 2BAGA 3LQ4A 4TMWA 5EHNA 3H5LA 3M81A 2YINC 3TZEA 2BMDA 1C4XA 4W63A 1Q95A 1IOWA 2H9IA 3RJZA 5CA1A 5TQJA 3I9V6 1DKOA 1SHZA 1PJSA 2P79A 3KALA 1M1NB 3NU1A 4AG5A 4UTNA 5IC6A 3KAPA 4G65A 3ZNQA 3FLBA 1YZKA 5PGMA 3UNXA 2OMEA 1GEEA 3C70A 4E15A 4FEAA 4MS4B 3C3JA 2K4MA 1BRTA 1MO6A 2WEKA 3KHUA 4LXHA 1GQ2A 4B35A 5THQA 1NN1A 1AGYA 3JQ9A 1UP7A 2FLKA 5TJHA 1M7BA 1QGDA 1DIGA 1Q1AA 4QXMA 3O4HA 1K0UA 3P0FA 4UMEA 1I36A 4KXMA 2F8SA 3ZUGA 2AJCA 3Q2IA 2ZKIA 3CZQA 3G2NA 2GCIA 1T3SA 5EFZA 3Q41A 4E12A 2AQKA 1M2OA 4ECEA 2D62A 1GRRA 5GADl 4F21A 1T1GA 2OHOA 3F3SA 3N87A 3OT4A 4C4TA 3CNLA 1ZCJA 2P75A 3EFHA 4PG4A 3CZMA 1GKKA 1YH3A 1NJ2A 4QT0A 5LD2B 2FTKE 4QSMA 4IQFA 2GPAA 4LYFA 4BO1A 4CCAA 2H5EA 2XZDA 5E4TA 1YFLA 5CB6A 1O3YA 2DY1A 2NXCA 4JB8A 1CJVC 2FWMX 1IQ0A 1NBMD 3GLUA 4I66A 1LUAA 1UJBA 1E32A 2ERYA 3NXSA 4X3CA 1E2PA 4JJGA 3EGOA 5LFAA 3PT9A 1Z83A 2PX8A 4E0BA 3VR2A 3KL4A 2H2FA 5JI2E 4RK6A 4HCJA 3IOYA 3P32A 2IDJA 4JJFA 4DANA 3FMPB 4GL2A 2CNNA 2QMEA 1NRXA 4F38A 2Y92A 4UNNA 3D7MA 2IYEA 3HJGA 1SXJB 4LVCA 1O6BA 2PO7A 4Q9IA 2I4RA 4J1TC 4JLAA 4QXRA 4EI7A 3VPBA 3N2GB 2FH5B 4FQ7A 3T4UA 4MI3A 1RXWA 4J6FA 3RADC 1ONSA 3PFHA 4PX5A 2DSTA 5DYNA 4A82A 3LQFA 2UVPB 5CFNA 4R69A 3U3ZA 3K9HA 2OPHA 3DYIA 3SZMA 5A04A 2D0IA 3FYUA 2OGWA 1TD9A 3GJ8A 1U7DA 3M1YA 1DZ3A 4PAOA 3TH5A 2YJ4A 3WY9A 5AW3A 1NZDA 3W7AA 2C29D 3DWIA 3HRIA 2QTLA 3UWMA 4QDOA 3VUEA 2PGXA 3G0DA 1TIKA 2FYTA 2IRWA 4JK3A 4EG6A 4F71A 5JS8A 3CNQS 4P0TA 1VP3A 2DVMA 1ZH0A 3SX0A 2XITA 2OP0A 2XQKA 1HL3A 4LJ5A 2GDJA 6REQB 2RGRA 1RDFA 3U44A 3TLCA 1W2WB 2EZ4A 2XZOA 4DV0B 2QTNA 3QHQA 4BB0A 3EDCA 3PC8A 1IL0A 3G7SA 3QXXA 5EUCA 3O1HB 3PPYA 2CCJA 4M4SA 4WQMA 5DTEA 1ZR2A 2WICA 4GKVA 4DWJA 1RHKA 4X0EA 4BBZA 3A9UA 1RACA 1WXIA 3W8FA 4TXLA 4D9IA 3JASB 4DPMA 5CCEA 5TPWB 1VDMA 3JYOA 1BYIA 3T7KA 2IXDA 5FIUA 4CM8A 1CZOA 3HRHA 1W5FA 3CFYA 1MEJA 2PA3A 3M5PA 3O2NA 4LXGA 5KNCD 1B0AA 4TS1A 2H9AA 5FUXA 4PC2A 1B2RA 2A9QA 1JQJC 2ZSDA 4URUR 1I6WA 4J9UE 3CUTA 2EFCB 4QYWA 1M1YA 4A0QA 2LD4A 4X1OA 1K75A 5ECYA 1L7MA 4O1HA 4DWWA 5J63A 3R0ZA 3OO0A 1WBDA 1X2EA 4PYRA 1DKLA 3F78A 5I7SA 4MV6A 1J90A 1Z39A 3ZKAA 2OV3A 4DM3A 3GLGE 1KOFA 1R0LA 4IGAA 1SVNA 2J0EA 4YRFA 3RC3A 2D2VA 3JD1A 5B3LA 1E3SA 4AUKA 2ZTHA 1WETA 1K3TA 1DC6A 1THZA 1YR9A 3IUEA 1ULAA 2DC1A 1O2DA 2A9KA 3NIFB 2JAXA 2R87A 2XUDA 3W3AA 5A1JA 4HEQA 1ZXLA 2CL0X 3A9VA 5C5CA 4V0MA 4DZRA 2JD1A 3RUAA 3REQA 1IZ7A 1X7DA 1ZQ9A 5IZCC 2W93A 3B3QA 1R4NB 4B4KA 4CCYB 4QQ8A 5FO1A 2FSFA 3GJ0A 4R1TA 2INGX 2VDOB 3VXKA 2PZMA 1LI7A 3HA2A 2GEFA 1OLSA 4P7FA 1JFFB 1GYPA 1R4ZA 4DCOA 3P9NA 4I81A 1GPWB 1UP4A 3TUZC 2QLNA 4FDAA 3LDUA 3NYQA 3E9EA 4LJ7A 4BNVA 4D9KA 4F2WA 1QH1A 4FYVA 4HN9A 3B5EA 4EMSA 1NSFA 3R3YA 5K45A 4A8JC 4KPEC 3PFCA 3VI3B 2OO7A 3O90A 3SYLA 3CVYA 4DR6B 1HRKA 1E79D 1Z4LA 2CF6A 4QWWA 1G5IA 3G8YA 5H9VA 2AD5A 3AI1A 4MROA 1TC1A 1GADO 3RNLA 3TRFA 2BMVA 4Y6SA 1T91A 4DEVA 4QG3A 1GZ6A 5AW6A 5KOJB 5LQNA 5I7FA 2BFNA 4KHZA 1H2EA 1VHJA 4NG5A 4QD3A 2YWJA 2AJBA 2E5WA 2GD6A 3IAHA 2XUQA 2E6KA 3IUPA 1EXVA 3ESCA 3P71T 5FI1B 3SLGA 4PLZA 2WUFA 1ZBQA 3H0CA 1TCUA 3D9QX 4YV7A 4BKUA 4CU5A 4YUAA 2FN3A 3B1YA 1U02A 4YTEA 1XXHB 4B48A 4RH3A 3RTGA 1ADBA 1PNQA 2PQ6A 3PFFA 5H59A 3ST7A 2ZS9A 2IU6A 4D4GA 4CIXA 2R3SA 3HJRA 5BV0A 4DB4A 4ZT6A 1GILA 4GWLA 3NORA 4PTYA 5KVQA 5E8JA 2DOKA 3WJ2A 1FVXA 2EDCA 3IT1A 3O1LA 4OQQA 3W3AH 1Z0SA 2XXBA 4TMTA 4OEHA 4PRZA 4DJDC 3L77A 3LPCA 1D1QA 4ZCTA 1I3LA 1N9GA 1V0JA 3PJDA 4W5QA 4ZRMA 2GK3A 2P5TB 1BVHA 1BXGB 1Q92A 1FYVA 2QNRA 3RTAA 4QSHA 2L18A 5FD8A 5KIAA 4BJ3A 1GGHA 2IYOA 3FUCA 2WT4A 3HKDB 3LQ1A 2QYTA 4BECA 2POCA 4DSOA 5C7IO 1T0PA 3GP8A 2O4CA 3G0CA 5LCXA 5T8KC 1RCFA 4IWYA 3ZYZA 2D2FA 2YJZA 3NIGB 4KVGA 4TM7A 3CZ9A 1L5RA 4JVLA 5K3EA 1NXOA 1FRZA 3GZNA 4JUBA 2GM3A 4GYJA 1AK1A 1J0DA 1FYDA 3EVEA 4I1VA 3NALA 4JEUA 2PJRA 1MD9A 3NFYA 3KVNA 2H7XA 2I22A 1LQTA 4MQBA 3DTTA 4MDYA 2Y9MB 1FBNA 3NOXA 5EJEA 1PR9A 3ZE0B 5LLTA 1ZRMA 3OM1A 8ATCA 2ANCA 1UPBA 1H0HA 2J5RA 5DWVA 4ZDWA 3MB8A 1Y5NA 2ZZKA 1W9HA 3ROZA 3U26A 2ZTUA 3A1TA 4OHXA 1UMCB 4YUVA 2V59A 2Q4OA 3D31A 1UJMA 3EVCA 4FS3A 4GQBA 1FUYB 2J9ZB 1L4UA 3GXBA 5AUPB 1H66A 4GMXA 2DRIA 5E9QA 5ITWA 3IRUA 3GRYA 4X6XA 4G5FA 3ZZTA 1SOUA 1ZXBA 5BNFA 3LQKA 4I55F 1Z36A 3IULA 1ACLA 1ONNA 4YROA 3TQQA 4XB2A 4KK3A 4F97A 4LRTB 1QYDA 1YIOA 3B38A 4HL6A 3FSGA 3GMTA 5EP1A 3T5AA 5DWDA 1DRVA 4ZYWA 4IUBS 1PFWA 4TMVA 2BEVA 5H5JA 1ZFNA 4MKGA 4UOEA 1LCIA 1P2FA 3LQYA 4PAGA 3UKDA 4JLDA 3RTBA 4UM7A 4OHVA 5AIBA 1VCNA 1SU4A 1E6KA 5EJ7A 3BWBA 3U39A 4I5GA 2Y6VA 4KYTA 1ZN9A 1P2TA 5E2IA 5ALVA 1LK5A 3MJHA 2ODNA 5JVDB 1V2HE 2ZYDA 4EYGA 5JT1A 4IDHA 1G5HA 1XD2A 1YOVA 3CNHA 4G5OA 1FVFA 4PX9A 3NPAA 4PYIA 2NZ8A 2O1SA 4KP7A 2A0XA 3KEOA 3C8DA 2XUJA 3W2HA 2YMPA 3CKYA 1J8YF 3F49S 3IAEA 4LZAA 2I33A 4P3KA 2PVSA 4M55A 1SXIA 5JAMA 3R40A 1T13A 2A9FA 1KOJA 2PJDA 3H9BA 3PEFA 5K8IA 1H9CA 3IOEA 3RUFA 2BHRA 3K9QO 3UW1A 3PRYA 1KJQA 1ZI6A 2HFJA 2V4ZA 3NTOA 2X9LA 4QICA 4R5HA 4UAGA 5KQSA 3ERCA 4RFSA 2Z3WA 4OIMA 3SDZA 3BAFA 1VYUA 5EMKA 5BVGA 5BSMA 3TMKA 2HYIC 1NBHA 3X43A 5HM6A 3O4RA 3C3MA 2ZUWA 3RFTA 3BULA 1P1JA 1J00A 2YFQA 4EECA 3FKSD 5E1DA 1RQXA 3WKAA 5G4KA 3RU2A 2XX3A 3AEZA 2B7BA 3ZGOA 2H8KA 4CETA 2OESA 4O4LA 1DEAA 1FLDA 2PT9A 3IKLA 1FTQA 1B23P 4RVHA 4BIIA 2YZNA 3QEMA 3KTFA 3WYCA 4WFQA 4IEEA 1BVYF 2GJAA 1KY4A 2XZPA 2F00A 2GRJA 3BFXA 4Z7NB 3JYQA 2NPFA 1DC7A 3W2IA 4P5DA 5J23A 4MIOA 4ZP1A 2JLYA 4X6YA 4WADA 3L46A 3AM5A 3G9TA 1EUYA 1R9GA 4WE3A 1R5NA 5A06A 4IIJF 2F3SA 4WBXC 1Z62A 3OAAA 2BHNA 1QVWA 2H1WA 1RXSA 2QL9A 1ZGGA 1QKJA 1TF7A 3CZ4A 4I5DA 2AVDA 3ZHQA 1U6KA 4LE0A 4NFHA 5AW9A 5A6SB 3FYDA 2GJ8A 3KM0A 3ZDQA 4DT1B 3LPLA 2YHUA 2GM9A 5CGQB 1ZICA 1ZMXA 3G8AA 3PZRA 5GY7A 4HUQB 1W4BA 5HKBA 2D00A 2ZULA 4G1MB 5C9ZA 3UJDA 5KC9A 1FFYA 4J76A 2FWBA 3DVAB 3G2IA 1FQJA 2WVJA 1ENYA 3A06A 1PS9A 4PYQA 4L76A 4NFLA 3UATA 3EJ6A 1LPMA 2AW3A 3QOWA 3T1QA 4A73A 2VP4A 4GF5A 2C1EA 4HDOB 3VNUA 3DUFB 4G8JA 4RVOA 4P0PB 3EXIA 4KFUA 2ZTLA 5KTYA 4P9NA 1Z29A 4L50A 3MWDB 4MWOA 3NLLA 4PQGA 2J6IA 4U9HS 3FB4A 4XI9A 5BWNA 3FGNA 4CGZA 1WHTB 2V5UA 2JIMA 2UKDA 5ERGB 4NEGA 2WINI 1YVPA 1NNUA 1VJ5A 3E1SA 1OPXA 4WY5A 3T52A 1U0SY 1EK5A 1DDOA 1GTG1 5E95A 3AP3A 3FUWA 4XVHA 1F4PA 5I9LA 2VJPA 1N6NA 3LT1A 4RM3A 2IYWA 3G13A 2P9GA 2FZKA 3CB4A 4JGIA 5E3JA 4ZARA 1SUSA 3T7AA 4ZWNA 3NHAA 3WGOA 4ATNA 4NSNA 3GRKA 3SX2A 5GINE 2QZSA 4N5HX 2YY6A 3DPSA 1W47A 3B3GA 3OIGA 4PQFA 2VK4A 4RLHA 1FP4B 2GJSA 1T1IA 3N9IA 2JGJA 4G85A 2QUKA 4FI3F 4FXPA 3L1KA 2B7CA 1SD1A 4ZVMA 2IYLD 3RJTA 3WLQA 5BUQA 1JFLA 1A98A 1VJTA 5C18A 1EHIA 2YHBA 5I6DA 2PKQP 1P75A 3OQNA 1T1SA 2VVTA 3K5IA 3ZWOA 5CLQA 4RVDA 4J2OA 5BXQC 2Y0EA 1YQWA 4E2WA 2WQZA 2PGLA 5FEUA 4GI3A 1T26A 2V7QD 3H9UA 1YQXA 3IUSA 5EERA 3TLEA 3C0KA 1QC5B 3PT5A 4IHJF 4BAZA 2O5CA 1DBSA 2X1LA 3ORSA 3RS2A 4DR3B 1EEXB 1GRVA 2WY2D 1R6VA 3ENQA 3UK2A 1TQ8A 5JQGB 1VXOA 4L6IA 4EY8A 2ZAIA 2RIRA 4OLBA 1PZMA 3PRJA 5DLDA 2I66A 1K88A 4QUJA 2C7OA 1PJZA 4C6TA 3EIHA 4CQMD 4RGVA 2IPLA 1MB0A 3FGPA 1PGJA 4FNAA 4H4DA 1RZUA 2QORA 1O94D 2OG1A 3DLAA 3M4YA 1N0UA 4FZ5A 4FC7A 1QH8A 1N0HA 1V35A 1X38A 2P27A 2ZSIA 2WILA 2QRNA 2ZRIA 3I2IA 5KNLA 3ZU5A 1Y33E 2PFSA 3QVSA 3MM4A 2Z9DA 4OCZA 4Z0PA 4BBPA 1M2JA 3OZWA 4M46A 4PSCA 3JZDA 4PBTA 2CBGA 3RUIA 3W79A 3TS1A 1YZYA 3TD2A 4EYKA 1D2MA 5G0VA 3FAZA 4ZCQA 3AIMA 1BCRA 1JI3A 1T36A 1YACA 2V3WA 3MWGA 4YJHA 1QNFA 3A6PC 3ANTA 1ULSA 3FVRA 2OQ2A 3B8HA 1EFPB 3MA0A 3G82C 1G60A 2OHVA 3HC7A 1X7ZA 2HT6A 2Z9BA 3CCFA 1A2OA 3NDJA 1ZJ4A 3HYRA 2JJ2D 1IZYA 2AMYA 1JMKC 2ZRAA 3HV2A 3T1VA 3E53A 3UWOA 1E0SA 5DDIP 2YXLA 1M72A 4A6XA 4RMJA 2CD9A 2XCSB 1HFKA 4AF8A 721PA 3JALB 4MHSA 4PZDA 4TV9A 1JKXA 1TGYA 3WIVA 4DQVA 5HJ2A 3WISA 3B3FA 2PH5A 4DR5B 1TZ2A 1XX6A 2WR8A 1CFZA 1Y80A 2OD9A 4D2IA 5CDTA 1UBLS 2NU9B 1HDXA 1OYOA 3TDMA 3DCJA 1MT3A 3DQPA 4NOMA 4E3ZA 3MUNA 5K3DA 3I28A 4LJKA 2MINB 5C1DA 3ZE9A 3QVMA 2YV2A 4LSGA 5NLLA 3UJ6A 3OE5A 2UXCB 1X1TA 4BMCA 4NC9A 3PQFA 3IPXA 2W37A 1EQ2A 2WWVD 4C4SA 1MB4A 1YJXA 5AJZA 4MWGA 2ZAMA 2X4LA 1EYZA 3R7AA 3T5PA 1B3RA 2QVCA 2GHRA 1T10A 2OTCA 3AKCA 3F3MA 3NHPA 2VYFA 3G0BA 1CEXA 2ZROA 121PA 2OZLB 2CW5A 3QVVA 3ZZ0A 2AXEA 3JATA 4B7AA 4JA0A 5EKTA 1IZ8A 3RVBA 3EPPA 1YUNA 3QPCA 1BYUA 3O8QB 3I52A 3LVBA 2ZIZA 1KBQA 3PGVA 9GPBA 1JR6A 1H4VB 2I6FA 2OM2A 2D6FA 3JQRA 4E94A 4L72A 1XZPA 2EQAA 2LP4Y 2ZYWX 4Y3UA 3R20A 4PTLA 3G89A 1CZNA 3UC5A 1F51E 2X5XA 3M6MD 2QP3A 3KVYA 2EQ5A 5DISB 3OWOA 4BWGA 4KR0A 1AUVA 1N1EA 2KBFA 4I7EA 1XK6A 3WSVA 5EZYB 1KKLA 1TRKA 2YX1A 1M1YE 1ZD8A 2JFWA 4I5FA 4L75A 1R1DA 4YLGA 3NTRA 3PD0A 4RQAA 4MRAA 1VIVA 4OP3A 1KZHA 3MW8A 1EG2A 2DT8A 2Q8NA 3PBKA 3UMGA 1XHEA 5JJIA 3L8YA 3UVEA 4RSGA 1CYEA 3ILHA 4HGPA 2H1IA 3A4TA 1IVNA 5BR1A 4D4JA 3FHTA 4LZNA 1FYFA 3K0FA 3MSCA 2FB9A 4IVPA 2R751 5JCPA 5KVCA 2QVXX 1SHTX 5TGTA 3ZOZA 4V0ME 4WCFB 3T5GA 2QI9F 1K5HA 4GOOD 5AI0A 4DMMA 3WS7A 1BE0A 1Z13A 2FW6A 7AT1A 4UHFA 3SSMA 3WRYA 3H4TA 1U7PA 2FR8C 3DLPX 1VI2A 3BDAA 5M2QA 1HE2A 1JEEA 1P72A 1NVVR 1Q12A 1PT6A 2IWHA 3ZDRA 4EWLA 1TXGA 4IXTA 3K70B 1ZO8A 4IY1A 1KI4A 3MCUA 1WY5A 3QVWA 5CFLA 1CEEA 1C14A 5DGTA 3N8KA 3WHLA 4AJ1A 1IUOA 3F2VA 3P9SA 3ROKA 1ZM4A 3C4VA 1L4NA 3AONB 1P0IA 3EQ7A 4RTOA 2HWWA 4N8DA 2N42A 3DVRX 2KW5A 3MCVA 1K7YA 2WA2A 3L1HA 3FJOA 3SC6A 3R4CA 2A5DA 5IABA 1DEXA 4YONB 5M34A 4E5KA 3G0IA 4M6WA 4YV2A 4FS8A 1SR8A 2WKPA 1LLFA 4RJJA 2E85A 2E87A 2OENG 2QX8A 1NSYA 4KXUA 1QE0A 1JL3A 1O03A 3VZCA 5CFQA 1J6UA 5F2NA 1ZVKA 2UYGA 4DV1B 4MPDA 4K1XA 4RZSA 1ZD4A 3C3PA 1L9KA 2HSJA 2X6TA 4YRPA 3NDIA 4R8LA 1G9SA 3KWLA 4FBGA 2W22A 2VHVA 4IHKA 3F3KA 5BSUA 1KDVA 3ITNA 1IY8A 3IIJA 3NYRA 4QUHA 4R8MA 1QHFA 5JLAA 1DG3A 1IH8A 1NDUA 1S6YA 2XOKA 2Q0QA 3FZYA 3C1UA 1WSDA 1ISJA 2AFRA 4LBWA 4E32A 3W9BA 3NP9A 4JLUA 1NUHA 3JTMA 3C43A 3U4GA 4QBGB 1IMJA 2EJTA 3TZ6A 3ONWA 3IE1A 5BVHB 4MR8A 3NHWA 5BSWA 4D9HA 4HNSA 2OZPA 3QHPA 2FMFA 4BUCA 3VBEA 1WWKA 4NX2A 3EAFA 3UJHA 4UTVA 2Y76A 3KYCA 5KCZA 3NUQA 2E1RA 3H1GA 4E7PA 1PWYE 1D9ZA 3LT5A 1ZJZA 4WH0A 5KMGA 3FNHA 2G09A 3B1FA 4MA4A 3VR3A 3WNDA 3I01M 4ENWA 1SPBS 1PFUA 5KYWB 2Y0BA 3LFTA 1CRLA 1YJBA 2GXAA 1L5HB 1L4KA 1ZDMA 4P83A 2QM7A 3SHTA 1DC8A 3OEEA 3D8UA 4R81A 5IT5A 3KD2A 4W8GA 3LG2A 3W5DA 1JKFA 3RV4A 4R1SA 1ACJA 3DV2A 4X8LA 2BP7B 4D9GA 2CUTA 2HRQA 4URYR 3N6RA 5TC4A 2CFIA 4HATA 1PEKE 3UV3A 3ZY6A 2WIGA 3HCBA 4TLDA 2P78A 3J81k 3NIDB 1Y7PA 3ISJA 2JLAA 1VL1A 4O4JA 3WYEA 5SYAA 4XDYA 2W2QA 2X8JA 2XYPA 1S2DA 1Y8AA 3MFYA 3P0EA 4Q3LA 1Q16A 2QENA 4EGQA 2JHFA 1SHLA 2WTNA 2WW8A 1JAXA 3P2YA 3VC3A 2UDPA 3NXKA 2WMOB 1N2IA 2C04A 4PGAA 1J1IA 1JG4A 2R6ZA 1EK1A 3IHKA 2GBGA 3CT4A 4GRDA 1ZH2A 3WWEA 3I9OA 3FPGA 4Z7QB 1NX9A 2G25A 4ZCRA 2W2VA 5JCOA 3C4QA 5ADVA 4RTKA 1ZJWA 3MB5A 4K9PA 4E46A 1ML3A 2EFEB 1GQFA 2FUG6 1XL0A 2IOFA 3AKYA 4C0SA 4F7WA 1GAXA 2GNAA 5B36A 1M3SA 3IP8A 2DBRA 3GROA 3U9SA 3CJQA 3NTQA 3EGVA 2AOUA 4JCCA 5CVEA 4B6JA 3CIOA 1DQYA 3QWAA 4U2KA 3TZKA 2Q8PA 1YUBA 3CY6A 4MS1B 4B44A 3ONEA 1JTVA 1TM7E 3N39C 2FFAA 2JD2A 4G3XA 3UENA 5FBZA 4P1ZA 2B2CA 4CKBA 1BXKA 3E9DA 2LKDA 5SY6A 3HMQA 3FLAA 5F9HA 4C2BA 3R41A 1ZGZA 1R9NA 2ECQA 1ABFA 2HK7A 3ET5A 1IK4A 2Q2WA 3TE6A 5I7EA 1J1UA 2OPBA 1E4YA 2A58A 2VK2A 3DXFA 4I9GA 3UEOA 4BJ6A 1GZVA 3T9FA 4YX9A 4KQ6A 4BLUA 5LC1A 3RHTA 2E4UA 5EP2A 5B3KA 1OGJA 1OWNA 3D1JA 3OLWA 3P27A 3SLKA 4EJ0A 5KINB 5A4JA 3GZJA 3C39A 5BW8A 2IHNA 2HUPA 1NVWQ 4UNQA 1W4CA 2B30A 4IJUA 4UVIA 2G07A 3L92A 2V6IA 3NHLA 4AQDA 5A0VA 1QDUA 1RTTA 3OQHA 5L3SB 3TW6A 1G5PA 2O7QA 2GPSA 3ZQ4A 4BRZA 2FP4B 2V03A 2ZM6B 4RQBA 3LWZA 2OBBA 4OUDB 1RRVA 5TVKA 2G1PA 5MHTA 3KWMA 3UHPA 1GFIA 2PRKA 3OJEA 1P4GA 4XWYA 2ORWA 3RF7A 3LDAA 3PGMA 1EX6A 2MU1A 1ZD3A 3B1VA 1Y7LA 3U13A 5BT9A 4H16A 5IAAA 4LAFA 4QUAA 2K6GA 4LQDA 2F1RA 2HCJB 3PX7A 1NVXQ 4UHKA 3R0VA 3NGMA 4QO8A 2HKIA 3DD1A 1ZK0A 1W36C 3C3DA 3L7MA 3B5IA 2VRCD 2ZRKA 5E7JA 2EARA 5KC8A 1KA9H 1JX6A 2AXQA 5IKMA 3EFBA 3PR3A 4LV6A 4XCXA 3KR9A 1R0BA 4GQIA 4RS3A 4Y1GA 4ZGGA 1H3EA 2OBXA 3NOVA 1CE8A 3VZBA 2V3VA 2VC2B 3AEQA 1NRJB 4NAHA 1PYOA 5C81A 3LL4A 2Y2UA 4PCAA 4AP9A 5CM2Z 5GPBA 3I45A 4BGEA 1ZL0A 1L5ZA 3R3SA 2J6CA 5CDFA 3U7FB 3F5DA 3E5NA 1X19A 4F12A 3C7AA 4PRLA 5EXEA 1KQFA 4WXHA 4WNYA 5BSVA 1SOVA 5F1OA 1AVTA 3WK6A 1IRIA 1SC6A 1L4LA 2E4WA 2MWMA 3C6KA 3CRNA 4KO8A 5A5DA 2R9VA 4WXYB 1NJSA 1FLVA 2DWCA 1C29B 2IEZA 2KLBA 2VPWA 3SQLA 3T35A 5C52B 3HB9A 3L07A 3PXAA 2BF7A 2GN6A 2R5WA 3CPHA 4EHNA 5ITSA 5JDIC 1FNCA 3OQBA 1T4DA 1T9GS 2NTNA 1TPZA 2BFWA 2ODBA 5KTPA 3KSZO 1NLFA 4FN5A 3JZAA 4JI5B 2CFCA 3DCIA 1FDRA 2O3UA 1CVRA 4ND1A 3TI9A 1ZJ6A 1AJEA 3N2ZB 2BT4A 2GLTA 3QM1A 2BONA 4QREA 1Z12A 2R86A 5TQVA 1N5KA 1E2KA 1GRCA 2VEDA 5DX1A 1JYSA 4NAVA 1RIFA 3AR6A 1Z4MA 2ZS7A 4DKXA 4DV7B 2VZ0A 3L6OO 1JEYB 3EDYA 3N3AC 3ND5A 3NP7A 1K06A 2C7VA 2Y0CA 2BRUA 3AHDA 5IYZA 3SJUA 4OREX 1V8DA 4NJOA 4F96A 3EGIA 4O4HA 3OCXA 4O3MA 2XIQA 4FYWA 4YMUA 3GHHA 1NDHA 4X3PA 4EUSA 1MTZA 2VJQA 1EFVA 2YUIA 5LLSA 3MT7A 4B9EA 2P6UA 2VG8A 1DMSA 3BXPA 3MUEA 3GPDG 3R9XB 5FUBA 4E6EA 1JQEA 1Y48E 4JEIA 2G4VA 3I1JA 1YJCA 2Q41A 1L7VC 1P6QA 1TMOA 3MTIA 2YNMC 3PLRA 2ONKA 4TLMB 4A10A 4QXOA 1QQ6A 3GLHA 4AXBA 4CQLA 5C1OA 2KQUA 1GG2A 4BL5A 2ZJ1A 4FDMA 4HHEA 2FEOA 4A26A 2VT7A 3E22B 1E2FA 5LXTB 2I5PO 3W1VA 1R6DA 3BGDA 1I7PA 1TQ4A 1YTLA 3OP1A 4YJ2F 1RYNA 2DKFA 2JCGA 4ZT7A 8GPBA 1Z4JA 3DZBA 1FCJA 1C2YA 3BFPA 2HIAA 3G68A 2OCAA 3ODPA 4Y2SA 4ARVA 4NBKA 2HHHB 1G3UA 3OP4A 2AR9A 3AY6A 2J4FA 2CFTA 1NBMA 3NGXA 3W8RA 1BC5A 3SK0A 2J0VA 3LCUA 4D0LB 1E7QA 1X7YA 1KWKA 3W7VA 1NOKA 3MN1A 5IN4A 4UARA 4TXJA 1U94A 5A4KA 1NA5A 1NBEA 3MFQA 5FOUA 1HF3A 1CRQA 2GNPA 3H8JA 1D5WA 3LLUA 4FD2A 2Z1MA 4RJKA 4P7GA 4JLSA 3PC7A 4TKUB 4KH1A 4QARA 3V4OA 2GPTA 1ST2A 2DFKB 1U1EA 3G1WA 4C22A 4KLAA 4N12A 5CD9A 1FB5A 3GT4A 1F0KA 3GJRA 1GOTA 3GNSA 1Y42X 1LEHA 1EE2A 2NSYA 3HBJA 3CF0A 5CW1A 4BPBA 4LHZA 5IAGA 1A76A 2Q7DA 1E1LA 3VR5D 4LTNA 1AXGA 3H5VA 4BCCA 2XUFA 1L1QA 3R0QA 4OFXA 3WOVA 4X8MA 4E31A 1XBTA 1GYRA 2I87A 3VU9B 5B53A 5C37A 1ZUNB 3H2YA 3EOBI 2HV8A 1UWCA 1IN8A 2QW8A 2KYRA 1EWRA 5HUHA 1RLMA 1FE8A 2R00C 5ALMA 3VV2A 4RY0A 1Y3AA 4A8TA 2CCGA 4RX1A 4YJFA 2HC9A 5IW8A 2I9KA 1FY2A 1Y9DA 1HYGA 1V96A 2IXTA 1P0QA 4HK4A 4OKSA 1JVNA 1CS0B 4LZWA 1NXXA 5F2KA 4U2DA 4UD2A 1R3DA 2E1PA 5E6RB 3V8MA 4QDJA 4QFBA 1Q77A 5F52A 1AKEA 4D4HA 2GSDA 5IU6A 4CRWB 3AQIA 5L7TA 3EPJA 4PNEA 3AUYA 3HUEA 4UU1A 2R6CA 4EK9A 1XTTA 1E64A 1PV4A 2XTNA 3MJVA 1UP6A 2ANBA 5KNCA 4EQ6B 1SVUA 1I2MA 4CUKA 1UC9A 2OORA 3HJCA 5COQA 2RHTA 1MXHA 5KJFA 3PUXA 2IF0A 2REQA 4CTJA 4ZGBA 2HYDA 4GZ6A 1N25A 3GR6A 1WXEA 1AA9A 1LBQA 3EQ2A 1YDFA 3KTAB 3QTBA 3U4QA 2HZBA 2H65A 2WJWA 3L6EA 1Y3DE 4Q34A 3WLIA 1WLYA 3EW9A 4AQYB 3S2EA 1EFAA 2DULA 2EOAA 2D3TA 1FSFA 3HN7A 5JFOA 2HNKA 2WWTA 1I1NA 1SOAA 3HFGA 3DBLA 5D6OA 5DMXA 3ACDA 3Q4GA 2F2TA 4YRJA 3WGJA 3ENKA 3E5RA 4C0QC 2O20A 1TQHA 2YV1A 3C5CA 4TPKA 4ZO6A 3MSXA 2IXFA 4D97A 4KQXA 1LPOA 2BFBA 5EXSA 4HAZA 2VWHA 3SFTA 3T0GA 4K81B 2K7FA 3OBIA 5F9MA 1LBEA 1E63A 1YGPA 2APJA 3H19A 4U9UA 1NIJA 1MZVA 1I3MA 1RAEA 4W8HA 2GCOA 1NQOA 1Z6QA 1UZNA 2VJKA 3W5VA 2HJWA 1YBAA 2YL2A 4D3DA 5B7PA 3ZBTA 5K4HA 3R4VA 1QHSA 1G5RA 1VSTA 4Q9JA 1YDGA 4N7BA 3L8HA 3EUAA 1V16A 3CRW1 3D6TB 1S3IA 2A2ZA 3VFDA 5K8VA 1C1YA 5TS2A 1SCQA 5L4NA 1L5NA 4ETIA 2DLNA 2C83A 2YR0A 4IMRA 1LV8A 2TECE 2GK7A 3QPWA 3R75A 5B58C 1E79A 5MN4A 3IURA 1HL7A 5K05A 5K7SA 1LK0A 5KQLA 1T6YA 5KNCH 1R9MA 2RAVA 4YT2A 1PZNA 4CT4B 3PNMA 1WEHA 5ARDA 4CUJA 1QK3A 1E2GA 1N5OX 1Q0LA 2R8RA 3G02A 2FK7A 1IEWA 2BGGA 3HXOA 4EVRA 4NCBA 4IV5A 4WXPA 2IS4A 1DKPA 2F62A 3UQYS 3JYPA 1YCDA 4TKVA 4JYZA 4FSHA 1J06A 3INYA 1RPNA 4CMIB 1SHKA 2BELA 3E9RA 1PTKA 3IPAA 1HYHA 2DFLA 4PHTA 4C3OB 2X19A 2O6HA 1M2HA 3DOCA 5GV7A 4B6QA 3V7NA 2AC7A 3DHEA 1AE1A 3FA2A 3DOOA 3P9XA 2YYAA 4LF6B 3TNFA 1QMGA 1GNLA 3HVKA 1S1CA 2R6JA 4CF5A 3KHKA 2ZRQA 4D74A 1GKLA 1T3ZA 4U2BA 4D99A 3EOAI 2P3SA 2B4RO 4LOKA 3OIFA 1GCUA 5HVNA 3Q72A 2JVIA 1O6ZA 1ODSA 4Q3DA 5CT9A 5HA5A 3H87A 5KHAA 1JA1A 2FDCA 1NVTA 1T3LA 4JYPA 5TQ0A 1RYMA 4DCJA 5EJ8A 2ERCA 1NM5A 1N1MA 5ELXA 4RW0A 3B1XA 2DH6A 2XGMA 5J2TB 5FRDA 1SKQA 4KXYA 4RPHA 1TO2E 1P62B 2ZXEA 3O92A 4X7RA 3CPEA 3W6NA 4B8ZA 3H5NA 1VBMA 4Q5IA 3QUSA 3IIMA 3TW8B 3ZU2A 4LJ8A 1P1RA 3LP8A 3TL6A 4PGHA 3L7AA 2A5JA 3CLTC 3C6QA 4C3UA 1ECBA 4I3FA 1FFGA 1NI4B 2WPDD 4V0RA 5LDGA 4AB1A 5JD4A 1DWPA 1HC7A 1Z07A 2EP5A 2LNDA 2HREA 3EZFA 4P3XA 1XD9A 5G53C 3PUHA 1YIAA 1ZK1A 4NYJQ 4Z6KA 1PVDA 1MQSA 4BTLA 3S68A 1OTYA 3HB7A 4IH4A 1NUQA 1LD3A 1PYDA 5K51A 1PUIA 1Z5PA 3UFXA 3ER8A 5AQEA 3QXSA 1P3DA 4D26A 4DDTA 1JVBA 4D4LA 3GJ4A 1L5KA 1SEPA 2IW3A 1V7PC 3I2YX 4KYIB 1KSHA 2FSVC 2ZOSA 5LVAA 4LTMA 4M36A 4X92A 3NZEA 4RCVA 5EJ6A 1FLNA 3C16C 2XF8A 2OQRA 1YQQA 1XWFA 3D8TA 1G21A 4I55A 5J43A 4RTMA 4X84A 4EW1A 3QG1A 4IQ8A 3F73A 4I50B 5EIAA 3T15A 2XBMA 3A27A 4QATA 1A5TA 1PTJA 1YIDA 1FP2A 2H11A 2IXAA 2RKWA 3KZNA 3C6XA 3I8XA 3DXXA 1KAOA 1ND5A 4BVAA 4DLKA 1L4MA 3HB1A 3RDPA 1EKXA 3WKCA 1AHHA 1B6RA 4WKNA 5EMJA 3QEBZ 2NUBA 1Z6AA 1JEQB 3PP8A 3NEYA 5F3WB 3WGKA 3FH0A 2JI9A 3OF2A 4XB1A 4JI1B 2QYHA 1F38A 3FZNA 5SYNA 3KPWA 4IJKA 3TQFA 4KZKA 3E7WA 1NQ5A 2Z09A 1NFQA 3EVTA 4W7IA 1R2QA 2QLFA 1KH1A 4MKHA 1Q11A 4YA6A 2II6A 2IV7A 3TIXB 3VNBA 2ONCA 3LKVA 1F1JA 4KO4S 2G63A 4AP5A 2XTMA 2YHAA 3D7NA 4H7EA 5D2CA 5CITA 4KSYA 3FOAA 1KYXA 1Y5IA 4GWKA 2EFDB 2ESRA 3ECSA 2ERXA 4D8YA 4FSDA 3ESQA 1J70A 5ALRA 2EAUA 3IQXA 1G64A 5BQXA 5LN1A 5DBIA 2X40A 2ZUCA 3VPAA 2IZ6A 3PA8A 3UXYA 5FCDA 2XIJA 2D8AA 5GIOE 3DAYA 3ADPA 3QMPA 2Q5CA 1AKVA 1L4YA 4X7PA 1CUBA 2BGRA 4DPLA 3K35A 3VKVA 4QTTB 1OREA 2HJRA 2RGAA 4CLOB 2PS0A 4XM0A 3NB0A 4TXHA 1NBOA 2BC9A 4UAJA 4HYTA 5ADHA 4P86A 4LE2A 2DM6A 2R2AA 1WTCA 3EEQA 4TZ6A 1CHDA 1E5XA 2IC5A 2VRNA 3QJYA 3AXSA 3DP9A 4JB0A 4MP3A 1E3WB 2VJCA 3HXQA 3ROMA 4AZ0B 5KYVA 1R4MA 3UZUA 3FCXA 3FKSA 4CEHB 1V48A 3TZCA 3WLAA 1W5BA 2B20A 2HU8A 5B37A 4Y6RA 3DXYA 3BSSA 1VB5A 1EFTA 2K2WA 4C05A 3NKLA 2PZGA 4ZO7A 1KQPA 3EA0A 3TTXA 3KVRA 4BWYA 2Z04A 1RLUA 4IIJA 4KUHA 1G3MA 3BD8A 1L4EA 4CG1A 3O4JA 3UV7A 2QM8A 2O5EA 2F9LA 2PR2A 2E0IA 1TU4A 3DEYX 1GNPA 3ILSA 3IVAA 1U7HA 3B1WA 4J1SA 2IHYA 4KXWA 1F12A 2QE6A 4WNAB 1MORA 1NW9B 2RHRA 4Y2YA 4CL2A 2NV2B 1C9EA 4RF2A 5CPFA 5K0EA 4K9RA 2PVCA 4KREA 3ZQ6A 2Z6VA 1N0IA 3QLTA 2ZBQA 3ENWA 4GXNA 3FM9A 4IKPA 1ADGA 2Z2KA 4ONEA 3SR0A 1L8LA 2MSLA 4BAGA 5MF6A 1V8BA 3ZOKA 3ZDEA 1O57A 4ZQBA 4JBLA 1ISGA 1XT6A 1GN8A 4FSXA 3S7TA 3W5SA 3IBSA 3M6XA 2JLWA 2BR4A 1ZMBA 3HDGA 3UWSA 4M1OA 5CDFE 4W5NA 3HS3A 1KDZA 3VX3A 4UPEA 2ORVA 1XEXA 4G26A 4MYHA 5LKRA 1F6DA 5ILOA 4MYCA 1Y8CA 1CNFA 1WABA 2QXUA 2JCXA 4Y0VA 3KLNA 4B43A 4ZI3A 5JAOA 2RHHA 4J75A 4J49A 3AUJB 1QGZA 1YO6A 4FYKA 1NQVA 1M33A 3VO2A 4A0FA 3UJNA 3I39X 1NU8A 3TNDA 1ZUWA 1JB1A 3D0RA 2VZ9A 1H2YA 2F67A 5DTRA 3S27A 3WNZA 4BNWA 3OMWA 3P2KA 4BB5A 2Q07A 2I2CA 1BHSA 3FN4A 4NARA 4OFZA 5TB5A 1M2EA 5A3JA 3SEFA 821PA 3MIZA 4PLVA 1UPFA 3ZV3A 1ZIYA 2JB9A 4PFJA 1AHIA 2IYXA 4I9NA 3TOCA 3IQFA 1BH6A 2HEGA 2RCNA 2RH9B 1SVMA 1EZ4A 4I2VA 4MGIR 2IEYA 3QLJA 4PO3X 5L7YA 4C14A 1CZKA 4DA8A 3L5OA 2CLMB 2PBRA 3REOA 2EGUA 2WK1A 1TYBE 4Q7MB 4YP1A 1SZDA 1Z26A 3QFHA 4NMMA 4QYTA 3JARA 2YJ5A 4ENRA 3HR4A 3H2JA 3K4HA 5ICGA 1B15A 2QTBA 3EA5A 4PYNA 1J42A 2XWBF 2WD9A 3RG8A 1O89A 4MYDA 3ML1A 3KKMA 3JD0A 4QYIA 4RSHA 4DQUA 4IHJA 5DT2A 2VF7A 3KOUA 3PUZA 2EP7A 2IW1A 3VX4A 2H00A 3EG9B 5FPHA 4EL5A 2WKRA 3LQ2A 1XVUA 2XXJA 2FE1A 4E70A 5GV8A 2V7QA 1A2QA 2XGGA 1UFRA 3JX9A 3VYVA 4BQNA 3UC9A 1YL7A 1XKXA 2IFTA 2SBTA 2WD8A 2HY7A 4TLBA 5E4YA 4H15A 3RO7A 5BT8A 1JJBA 3Q9UA 3TZLA 1YCHA 2PS3A 1JPUA 2HHJA 3K96A 4Y1RB 4IGIA 5JOQA 4Q6WA 1H6AA 4CQMA 2Z6QA 4XPIB 1U2SA 2IOYA 1JBEA 1T0HB 4KR2A 4LIPD 4C7BA 5JVDF 1O94A 1GPJA 2HQOA 2WZCA 4LFCB 3IILA 3OY2A 3WRXC 4E5PA 2ZRHA 2XWSA 5CG1A 1IPFA 2AR7A 2CCKA 4K26A 4R05A 3JWIA 1PK8A 3RU7A 1K1EA 3AF5A 2QT1A 3M4XA 5L4SA 3BSWA 1CDZA 5GONF 3HCDA 3JWHA 3OF3A 5A02A 4LK2A 2RJ3A 4EARA 2JIDA 3AOEA 3Q3HA 2A9PA 3UMCA 5I8WA 4BIMA 1N78A 1LDYA 1GCIA 1GA6A 2QTMA 3KFVA 4G25A 4EHIA 2XUHA 4WEOA 1NC3A 4AVYA 1NBME 3JRWA 1A96A 1D7OA 2OKCA 5BOVA 2P77A 3ZY5A 4YT8A 4UM9D 4EKIA 4LDPA 4UCQA 2JJ2A 3HY6A 4MQFB 2TYSB 1XKTA 2WYWA 4ND4A 3GVPA 1SQSA 2E18A 3EIQA 1GKIA 4V02A 3PQ4A 2EERA 4LCJA 2RHLA 4D82A 3HCNA 4EOGA 2WF7A 4GSYA 1DI0A 4MUKA 4YQZA 3L1IA 4C7OA 3HBNA 3Q6MA 3AVWA 5DIZA 3CONA 5HF6A 2NT4A 4UM9B 1OV6A 1W59A 2A7XA 4GKBA 5K3FA 4BQIA 1GL9B 2VJMB 3TEMA 4ZVSA 5DK6A 2ZRNA 3U09A 3H9QA 5KTOA 2XYGA 3MRTA 4IO1A 1CKEA 2WUDA 1QHGA 1U7TA 1KZ9A 2X7JA 1GTZA 4G4JA 4HXFB 2BMEA 1MDBA 4DCSA 4ZEWA 5LNK6 1T2UA 1JQ5A 2RHDA 5TGDA 4EIWA 2W48A 3RFUA 1E1DA 3YASA 1XRJA 1KAMA 1MAVA 1U6IA 4UU7A 2YMMA 3GA0A 4J0HA 3MJ4A 1J2TA 2YW2A 3ISTA 4H59A 4OA8A 4RGQA 3ORHA 5ED0A 4P32A 5C8XA 2V96A 4OQEA 1T6BY 4MRMB 3Q98A 5BN3A 3X2FA 1E9CA 1D0IA 5EJ9A 4TGLA 1YDWA 5CNKA 3BN3A 1AQJA 3HSYA 3HDQA 2ZU0C 5FPTA 3LBNA 1ML4A 5ITZB 4HXYA 1DC4A 1SUCA 1N7IA 4NU6A 2AJTA 2PD4A 4OPMA 2X0FA 3GT3A 2NO9A 3DO8A 4YACA 3IJEB 4FFNA 5AVUA 2BCJQ 3PNYA 1D2NA 1G8AA 2XCQA 1EWKA 3N0WA 1FDIA 5HF9A 5FR2A 4WJLA 2FPPB 3D5QA 3HB5X 2Y05A 3C5VA 3R24A 3RAPR 1YJAA 2ADMA 4HZUB 3OVMA 3DF9A 3IDOA 3K32A 1P1IA 4Q05A 1TT7A 4J29A 3VU0A 5LR6A 3H7IA 4IVRA 3C3KA 2J9FA 2NYAA 1C0LA 3RRNA 4BFCA 4EM6A 3AIIA 3WMRA 1R6TA 3U1BA 2XGJA 1J8FA 2AJ8A 4YT4A 2QRQA 1P60A 3ORQA 4LJSA 3QA9A 4TUYB 2ZWIA 5IF9A 5AJVB 2VH2A 5K0JA 4ZV4A 2R4TA 2OCLA 5JD3A 1JJFA 2RGBA 5JXGA 1TIBA 4E4YA 2NN3C 5HIKA 3AEUB 1IYZA 1JXMA 3LLVA 3OECA 3HDVA 4WIAA 4YR9A 3QELA 5I3CA 2Y1DA 1VMDA 2Z4TA 3QIVA 3U16A 4I8DA 5K20A 3IBYA 1PNVA 1RMYA 1UXKA 3KQYA 3GN1A 5E6SB 4OI1A 2B5OA 4AJ4A 5C3MA 5HTOA 1T2CA 4HB3A 5BMOA 2JH8A 3Q9SA 1PBNA 4UAVA 3KQKA 3Q8LA 1G19A 2B25A 4G1CA 1DADA 3A9SA 3DNFA 1DJNA 3E3LA 4ZO8A 2BGJA 3SXJA 5BOSB 5F3DA 1T9BA 1VCMA 1XELA 1OA1A 1T0UA 4HAUA 4PZ9A 2V4MA 4G9EA 3ZHXA 3ANSA 4QUEA 3V7YA 1UOPA 4Z2AA 3GUYA 2BJVA 3PWSA 4FK8A 4K6MA 4LBYA 2A0UA 1MH1A 3VVLA 3SF0A 421PA 3HZZA 4CT5A 4YJ3F 3CUYA 1F3LA 3U4AA 2NNLD 1EVKA 5ECWA 1ZA1A 1WMAA 5BMVF 3ASUA 1T2AA 1H05A 4PVDA 1ZUIA 3GI1A 4M0UA 3LLMA 4E88A 1NN0A 4J3JA 1VE5A 2QRGA 1F8YA 3CNEA 1YOBA 1UZLA 2C9MA 3OMLA 1NDQA 4HB2A 5H1YA 1TFRA 1MVNA 2YY5A 1E9EA 1YAJA 4CHGA 4HTFB 4L95C 1Y7HA 1ZVMA 3L7BA 2FW7A 3PHCA 3THXB 2VP9A 2E49A 4BVFA 4Q7QA 1MO2A 1WF3A 2BM1A 3SQOA 1TTHA 1UEJA 4AZTA 2PRZA 1KE2A 2ET6A 4RYLA 5TXGA 3TSWA 4AJ9A 4NWIA 4TTTS 3WLSA 3SKXA 5AXAA 1YVDA 5LP6C 3QG5A 4YMTA 4TYNA 4J90A 1NXVA 1ZWKA 4L6AA 4RVUA 2BVNA 4Q18A 3VVCA 2PUEA 2WB2A 2W2PA 3H3JA 3HXLA 6ABPA 3WKBA 1S1MA 2NO6A 1K7EB 4IHQA 3TQIA 3MMXA 4JL6A 5D7BA 4N47A 3C98A 4NEQA 4IJ5A 1XFDA 2B4KA 2HA3A 2ZSHA 3IPRA 4OHMA 4BO9A 4AJOA 2VDNB 3F5MA 4C0AC 1G2QA 3HU3A 4M86A 3LPNA 2JASA 5K8UA 3H6HA 2H4YA 4CLDA 1WS6A 1QKKA 1S8AA 1NJGA 2W2KB 1LPSA 3KYDB 4G8CA 1II8B 2JH9A 3I9NA 5AJYA 5IBRA 1E2MA 3S2ZA 2VTVA 2A5YB 3CSUA 5TRTA 1DO0A 2BHSA 3G9UA 2PWAA 4YP7A 3T7EA 3V8PA 2X86A 4A0RA 3I64A 3U7QA 1WPQA 2FE4A 3K1TA 4AK9A 4S1NA 4UMVA 2QIPA 3GBPA 3QOYA 5I4BA 3UK0A 3CBGA 3F4LA 4JR0A 5AK0A 3L0IB 3L0YA 5DTMA 4ZA2A 1ZRNA 4IIHA 4MULA 5DMHA 8OHMA 1QQ7A 1SC1A 4XX0B 1G21E 1DT3A 1JSLA 2JCBA 3D8NA 4CM1A 4OHUA 1A8QA 1RAHA 1ZGHA 1BW9A 4RKRA 3ZXSA 4BRWA 4IFIA 1SBTA 2ZQZA 5I7VA 3FCSB 3OG9A 3JQ8B 1P39A 3WE7A 1KWGA 4IIXA 1BMTA 1KZ4A 2HNBA 2Q28A 4CM4B 1PCXA 2QZZA 4K9QA 4D8XA 5IKEA 2W2LD 3URMA 5ALXA 1GDDA 2O3RA 2O2EA 3L4EA 3GNLA 1OXUA 4UU0A 1GSAA 1G7RA 4JLMA 4CV2A 4F85A 4JLOA 5LWQA 4ZT5A 2NU8A 4BQOA 2P3QA 2FPIA 3DTVD 4L1KA 1LQUA 3OM0A 2ZPUA 2VAWA 3Q3CA 2DF8A 4Y98A 4YAOA 3HDYA 1FUIA 1CRPA 4LC9A 1HK7A 1GAWA 3MCZA 1KDYA 3W4KA 4P80A 3V7FA 3IVGA 1ULUA 5A7FA 3SXUB 5FTNA 1NX6A 5FADA 5EZYF 2JH3A 2ZEJA 3OF5A 4W1RA 4N76A 2Q5OA 4QBHA 1KEEA 2YFHA 1E0DA 2XCLA 1XAJA 3NNDA 4G1BA 4PHCA 2QMOA 4S1OA 1PJCA 2P1ZA 5JZMA 3NFRA 3LE8A 3MMNA 1AS0A 4ZKDA 3QKRA 4BASA 4C4ZA 5HFNA 3VVBA 1YU9A 2ZREA 2C2XA 3BHMA 3D8SA 1RIIA 3WK9A 2NUTA 1RBMA 1YK1A 4YP5A 1B16A 2WAAA 3N74A 4HFJA 1YKSA 3OZTA 4ZK6A 1GEGA 1F3OA 3FG9A 3KQPA 1DO2A 3LHSA 3QU7A 4YMIA 5EPOA 5CB4F 4WD3A 3TRJA <