3L93A

Phosphopantetheine adenylyltransferase from yersinia pestis.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
NAMITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMFTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title X-ray crystal structure of phosphopantetheine adenylyltransferase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Transferase
total genus 53
structure length 161
sequence length 161
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3l93A00
2OV4A 1J09A 1Y42X 4G6ZA 1XNGA 2H29A 1PFYA 2J08A 3PNVA 2D5BA 3FNRA 1I6KA 1IRXA 3UK2A 4DNXA 1GTSA 1K97A 4CQNA 3VRHA 4ZT7A 3I05A 2CV1A 4H3SA 4MWBA 1ILEA 4EG4A 1U7DA 1NUTA 1PG0A 4MUGA 3LE8A 2DPLA 5DK4A 1QRUA 3RJZA 1N2IA 1WJGA 4MVWA 2GM3A 1U3DA 3TS1A 3AG5A 3A04A 4DLPA 4F4HA 5K0SA 1EUQA 2V0GA 3IVGA 1VBKA 4K0RA 5BNZA 2A1UB 5HUHA 4K03A 3X1MA 4MW9A 4YP5A 2IP1A 1WXHA 3KFLA 3G6KA 4MQ6A 3CLTC 1WKBA 2J4DA 3LOQA 1KH2A 2A7XA 5EKDA 1FYDA 1F7VA 5IHXA 3AL0C 4Q93A 1QRTA 1PFUA 1QRSA 4MW1A 2XRZA 2DUMA 3CVWA 5KWVA 2QUIA 1SURA 1YUNA 2E21A 2YY5A 1LI7A 1NZJA 4MUEA 4J76A 2WQ7A 4J75A 2HGZA 1R6XA 4I6GA 3SP1A 1KQPA 5HG0A 2A1UA 1NURA 2VTBB 1QU3A 1TEZA 2D54A 1YI8A 4HJXA 1M8KA 3QTTA 1N78A 3F3MA 1JHDA 4CDMA 4MW4A 3MUEA 5J59A 2PFSA 3UOWA 3A2KA 1ZH6A 3MLAA 3IDFA 4EG6A 3IUBA 4HJRA 1M83A 2X1LA 3Q10A 1ZJWA 3NBKA 3S3TA 3U1VA 4YMIA 1KAQA 4MLPA 4MW6A 4YP7A 1N2GA 3RBAA 1UFVA 1IH8A 2E89A 5TGTA 1KR2A 3ZJVA 1MOPA 3P0HA 3IVCA 2VTBA 3RHSA 1O0BA 2DETA 3SEQA 2JANA 1IVSA 3N9IA 2HMAA 4CDNA 1RQGA 4DJAA 1K92A 5TS2A 4MW5A 1G59A 3NBAA 2B7LA 2YXNA 3PRHA 4PBSA 1I2DA 2H2AA 3L93A 1WQ4A 2V0CA 3TQIA 3CVUA 3CLTD 3KT3A 4WSOA 4JYZA 3BL5A 2OQ2A 1J1ZA 4EFKA 1YULA 4DDHA 2QUHA 1V47A 3ILVA 4YP6A 2A1TS 2DR2A 3MMXA 3LCJA 3CVYA 4G5FA 1OWNA 4HPWA 1TYCA 1EFPA 1QNFA 3PXUA 4KR7A 3AFHA 3X1JA 3H05A 2X1MA 1JILA 1JIIA 2QTRA 4EG8A 1M8FA 2IJGX 3FY4A 1YIAA 2VXOA 3H99A 2DEUA 1MB2A 2QTMA 1KKUA 3AG6A 3TZLA 1O0CA 1T9GR 3X1KA 1COZA 3FDXA 3K9WA 3MLBA 4ZCSA 1NUSA 2PXHA 1KP2A 2EJCA 2GKSA 1JZQA 4L2IB 4EG7A 2BYTA 1Q15A 4U7JA 4EG3A 4TS1A 3ND5A 4XFJA 1MRZA 5J58A 4XFDA 4AQ7A 1F4LA 3CR8A 4YBRA 3HZRA 3NV7A 1IQ0A 2RE8A 4BWVA 1I6MA 1WY5A 1OWOA 4NDAA 1EUYA 4P2BA 4OJMX 2WQ6A 1KORA 5KCMA 3ZJTA 3FIUA 1FFYA 4OUDB 2AG6A 3ZXIA 4MUNA 3IOCA 4EG5A 1S4MA 3GMIA 4L2IA 3MXTA 1N2HA 1GN8A 4RPIA 1U0BB 5IJXA 3VU8A 4MWDA 1OBCA 1IFXA 5TEWA 1U7XA 1BS2A 2EL7A 1YIDA 1A8HA 3DLAA 2O5RA 1OBHA 3INNA 1GAXA 1J1UA 2DLCX 1NSYA 3KT8A 1F9AA 3CVXA 1GPMA 3IH5A 1V8FA 4DDMA 1WXFA 3TZEA 2ZUEA 4MW0A 3Q12A 1O95C 1OWPA 4MVYA 4ZT5A 4OUDA 3TNJA 1LW7A 1XNHA 4UZFA 1VLHA 3IUEA 3HMQA 4KKVA 1KH1A 1X8XA 4S1OA 4HK4A 1K4KA 2DERA 1NYLA 4RUKA 1QU2A 1NI5A 2BTEA 2R5WA 4MUJA 1O94C 2J5BA 3FOCA 1F7UA 1MAUA 1N2OA 3ZXSA 3CLRD 3ZIUA 3DO8A 1ULHA 2QJTA 3KT0A 3COZA 5FO0A 2A4MA 1N1DA 1JIKA 1WOYA 1VBMA 2A86A 2QJOA 1NUPA 1R6UA 3PNBA 1EJ2A 4MWCA 2A88A 3SZ3A 3CVVA 4GRIA 2PIDA 3IMEA 4Q16A 1TYDE 2E18A 3SDBA 4JXZA 2YWBA 3CLSC 5H7XA 3RFFA 1O97D 1OD6A 3GLVA 3L92A 1M8JA 3H9CA 1N3LA 1J20A 3ZUGA 1IQUA 1MB9A 2PG3A 3FETA 2HZ7A 4JZYA 2CFOA 3CLUD 1B6TA 2WSIA 5DEOA 4ZT6A 4R2LA 1OWMA 2IELA 3Q4GA 2E0IA 1PG2A 2CYAA 4GU5A 4ARIA 2X3FA 3IMCA 2CSXA 2AKEA 3RK0A 1KQNA 2TS1A 1KQOA 1MJHA 3DPIA 4MWEA 5HUJA 3A4IA 1K4MA 4NX2A 5DASA 1PFVA 1ZUNA 3UMVA 1P7PA 3SEZA 1WXIA 4MUIA 2RD2A 5H16A 1O95D 1N77A 3H97A 3GUZA 4KR9A 3AIIA 3C8ZA 1GTRA 4R2MA 4ZT3A 3QTBA 2ZP1A 2J07A 4NZPA 1XNJA 1JGTA 2PZ8A 3E27A 1Q11A 2A84A 3ND7A 2QUKA 3CLRC 4KR6A 4AS1A 3N05A 2NZ2A 1O94D 3HFJA 1X6VA 3IODA 5AHWA 3IOEA 1WZ2A 1KAMA 1IQRA 1TYAE 4EF6A 1N2BA 5LM3A 1WXEA 1QJCA 5F23A 4EGAA 1WQ3A 3FG9A 1H3FA 1O6BA 3OTWA 2CUZA 3HL4A 1LI5A 1O97C 5JBNA 3CA8A 3FHJA 3P0IA 3HGMA 3P52A 4A91A 5J5AA 3G5AA 5K0TA 3CLSD 2X0KA 3ELBA 1KP3A 3COVA 3CLUC 1JIJA 2AZXA 4PY2A 2A1TR 3VGJA 5LFAA 1PFWA 1D2RA 4MVXA 3M5WA 4ARCA 1MC1A 4ZCPA 2GOYA 1CT9A 1JZSA 2CV2A 4I6EA 1GLNA 3KT6A 4E1AA 1O5TA 1M8PA 1MAWA 1NP7A 3SYTA 1QQTA 1ZH0A 5DB4A 1NUQA 3ND6A 4ZT4A 1EE1A 3COWA 2WB2A 4JXXA 4WNYA 4DDKA 1I6LA 1NUUA 4KPUB 1N2JA 1M8GA 4ZT2A 4MUHA 2NSYA 4MAFA 2QJFA 3P0JA 5FO1A 2I1LA 1TYBE 1G8FA 4PBRA 1T6ZA 1KH3A 1O96B 4MUFA 4MW7A 2G36A 3DV2A 1Q19A 2CYBA 4FZJA 2J09A 3RK1A 1MBZA 4PBTA 1VBNA 2Z3VA 2YWCA 3K32A 1G8GA 3OP1A 1TFUA 4UZEA 2XRYA 1OWLA 2PZAA 3COYA 2O8VA 3QE4A 3A05A 4XSVA 1GZUA 1N75A 4KPUA 3UY4A 4MVCA 5FNZA 1N2EA 2PZBA 2Z09A 3FH0A 5LLTA 3N8HA 3TQOA 4CT0A 3UC5A 4MUKA 2Z08A 3SZGA 4EG1A 5TEVA 1O96A 4NATA 3G59A 5KHAA 4NAUA 4ZCTA 4U63A 4MW2A 1TQ8A 1Q77A 1JEEA 4U8HA 1J21A 4ZCRA 2D13A 2QTNA 4I6JA 1M1ZA 2QUJA 4DE5A 2JA2A 1J70A 1DNPA 1JECA 3IVXA 1WXGA 1QTQA 1T9GS 3JXEA 2ZUFA 2CV0A 3H9BA 1EFVB 1JEDA 3N2YA 1EXDA 1HYBA 1H3EA 2DXIA 4G5YA 1R6TA 4MULA 3ISJA 1EFPB 3IOBA 1XJQA 1T6YA 1T6XA 3ZJUA 3IMGA 4QRDA 3AKZA 2C5SA 3ZGZA 2CYCA 3HV0A 2CT8A 3D6UA 1IHOA 1U3CA 3D6VA 4QBTA 4NAHA 1G8HA 4ZCQA 4F3RA 2JAXA 1H3NA 4X0EA 4JFAA 3PNYA 1JMVA 1YUMA 4ND6A 1VL2A 4R0NA 4QREA 1EFVA 4ND7A 3FI0A 3FWKA 1H1TA
chains in the Genus database with same CATH superfamily
1WSAA 1KPIA 1Q14A 2FFBA 4YV0A 3KOOA 2H29A 1QMGA 3JQAA 4MGZR 3M82A 3B5JA 3BH6A 4GWKA 4BNTA 3REQB 2O8CA 4G97A 4B71A 4D96A 3M8KA 4EL0A 5JNRA 3CGWA 1XAHA 3I72A 3NYIA 1SVLA 4TSFD 1L1QA 2O8BA 2HQBA 3A58B 3KM0A 4YCDA 2VWHA 4PSCA 3IB6A 3GNSA 5KUTA 4TV8F 4XX0B 3WLPA 3V55A 4HYTA 1GDTA 1EXWA 1P1HA 3KKQA 1K5GA 3DT6A 3AOGA 3Q1KA 3QQ5A 2WSYB 3AI3A 3KJNA 2BGLA 1XYVA 2QVLA 5EEHA 1ZH4A 1UXHA 2AKAB 3A6EA 1PNTA 3AR3A 3OLVA 1BS9A 3UOGA 2R11A 2C2WA 2GERA 3A04A 1U04A 2YS6A 3KXPA 4GZMA 4LJ6A 1FSSA 2RBKA 1JMKC 1PT6A 3PHJA 3E2IA 4ZD6A 4MIYA 2PT7A 4S35A 1ZU4A 4Q15A 3LPNA 2CVZA 5ALWA 3UV6A 3WLJA 5I7VA 4EARA 1DU4A 4C0JA 3QFSA 1VDZA 2TMGA 1AUVA 1L5RA 1OAAA 1L3CA 1RXUA 1SHUX 2FPMA 2NVOA 1P0MA 2YBEA 4OFZA 1MNQA 1DFIA 2GPWA 3B89A 1MX9A 2DECA 3HY6A 3PWKA 2H3EA 3NT2A 1B76A 4Z51A 3IAS1 1DARA 2HQRA 3B2EA 4PSAA 3N76A 4FFLA 2IH4A 1SQ6A 4XPIA 1QWSA 1WVGA 3UMYA 3G6KA 2PX8A 2CDCA 2VUUA 1JAYA 3IOYA 2B9VA 4Z8XA 4TT8A 1XDUA 4XVHA 3QPCA 1DBIA 3A1UA 3A8TA 4FEAA 2VWQA 4I14A 4NFHA 1T3GA 2BBOA 4RTQA 1JE0A 4ZHQF 5T4HA 3MRXA 4MW1A 4RWEA 5AHOA 3H13A 2QUIA 1SURA 1TM3E 3CM0A 4KREA 1LI7A 1VKRA 3TH5A 2GNAA 1H8HD 3MYRA 2UZ4A 3KB6A 4F2DA 2W22A 3B1XA 3S2UA 2Z43A 2ZYGA 3FDFA 2EZ9A 2BM1A 3VZPA 5CDUA 4A8PA 4DLTA 4BIIA 5LZ4A 2OCXA 1GCAA 4B4KA 1E20A 2W6PA 1RKQA 4M8NE 4RPKA 4DL9A 2I2AA 1ZJ5A 1EHYA 4FLEA 3SC2A 4AZWA 2O2HA 3U31A 5M5BA 2YV2A 3CX3A 5M04A 4DCNA 2QRZA 5J59A 5FTWA 4F2GA 3LKZA 5KKNB 4AYTA 4HWGA 1F8FA 1R0YA 3QFHA 4E5MA 3PL1A 4XEHA 1AHHA 1LWNA 3P0RA 4GD3Q 4GM4A 4YJ3A 5CT5A 4CKXA 4B40A 2GMWA 4GLJA 1G4AE 5IAGA 4WY8A 3ZWVA 1D0VA 4BLQA 1E5XA 4YMIA 3KYDA 4KW7A 2FPKA 5SZKB 3V4ZA 1G21A 1MU0A 1QM5A 2PKEA 5E2AA 5LJLA 4KPYA 3EDYA 4PGMA 1RBQA 3PIDA 3TZKA 3I61A 1IVNA 5F3DA 5FBWB 2HMYB 3PDIB 3RHSA 4GAEA 5JYEA 1T25A 4YLEA 1OX4B 3ZHZA 5JAZA 1UBLS 5J2TB 2JJ2D 1TO1E 4XIFA 1QK4A 2NAFA 1M76A 3U7IA 3U39A 1SHJA 2AHRA 2I2XB 4N8SA 2ZJBA 4AF6A 2P0YA 4TUYB 4UAGA 1OPXA 4F85A 1E3SA 2QIPA 2QJWA 1THGA 3LQ1A 2H17A 1J39A 1T6NA 1CJBA 1Z75A 5JVDF 4CFZA 2BFDA 3DOUA 4PX2A 4B79A 1X7ZB 2ZIXB 2NSHA 4K6GA 2IEDA 5B2EA 2BDTA 1EI9A 2BGIA 1SZDA 2FPWA 4JCOA 2OCLA 5AOBA 4ZJUA 1U8XX 3LLUA 2OCGA 4NR0A 1ESCA 5BWNA 3K6SB 1G64A 1I14A 3GT4A 1WCIB 4KXFB 3UAOA 4BNJA 5H1YA 4LW8A 2XMGA 1NYTA 5I4BA 1ICIA 1S2IA 1KWKA 5BQ5A 4RTOA 2IEZA 1VG0B 2X1MA 5ESXA 4KWTA 3S2IA 1YGPA 5I7UA 4QJ3A 2JLYA 1A9PA 1YL7A 4MJXA 2O3TA 3C7CB 3ZVKA 4ZEVA 3WWPA 2Y71A 5JCJA 4AG6A 5K8JB 2ZB4A 1XFAA 5B6PA 4P1ZA 4ZO9A 3MWGA 3AGPA 4KEAA 3TKYA 5I9LA 3ENKA 4RA9A 1IXZA 3BFJA 4JGBA 2TRSB 3ABQB 4RD2A 3NPMA 5CLLA 3KV1A 3A4YA 4YRDA 2E55A 3LUBA 3F6RA 4DF3A 5A6VA 4Q3NA 1WXDA 2QM8A 3F6CA 3QE0A 2OCIA 1PR0A 2EBUA 5H80A 4JT8A 1P0QA 2IDJA 1WD5A 5G40A 1L5KA 2O1EA 4YO8A 4WZAE 5KIAA 1W1IA 2C5HA 1IOWA 3W06A 3E53A 3OFSA 1TPZA 3JRNA 2Z8YM 3CT6A 4MYDA 5IUNC 3MQ2A 3WK8A 1GDHA 4AJ4A 2XGJA 1U3WA 3OT5A 2RIPA 1I0ZA 4KQGA 1XQ1A 1XEWY 2I3AA 1R88A 2BEJA 1E3TA 2VNSA 1HEIA 3LU1A 4C3VA 5HIKA 2F8SA 1NN3A 1P8AA 4BFXA 2Q7OE 1W0JA 3DJYA 3SS8A 2GA8A 4CT4B 5B4VA 1ZUIA 3JQGA 4GE3A 2IUFA 2BGNA 3DFMA 3QVKA 5EXTA 3G1WA 1VE6A 5LDGA 2QE6A 2QE7A 3DDNA 4RJKA 1LUAA 3MXTA 4WW0A 3SJZA 3B2NA 3WOHA 3WLLA 3VU8A 1K1EA 1Z8DA 2PZEA 3H84A 1DHRA 1FVOA 2QN9A 3A7DA 3JSAA 1PVVA 5MGBA 4HAIA 3DE1X 4J29A 5EP2A 2VTVA 3EBPA 3DC7A 4G4SO 4UNNA 4BXOB 4LHEA 1OFUX 4H7HA 4ZYUA 1C8LA 3IH5A 1H93A 1GSIA 1ZD8A 4OMUA 3U1TA 1E61A 3W2HA 4QDUA 6Q21A 4IUCS 1MG0A 2OO3A 3L77A 4YCSA 4DV7B 3L6OO 1VC2A 2PZMA 1ORDA 2HSGA 3OURA 4NY1A 5EUBA 1YKGA 1FTNA 2WJ3A 1WF6A 4WLFA 4ZVUA 4UZFA 4DCCA 1L4LA 4ZZ1A 1C1HA 2ZSHA 4FDMA 1SVKA 2V4MA 4RK1A 5KTTA 1XTSA 4YLGA 4HFMA 1Z2DA 4LXHA 1CUHA 3GIDA 3E5MA 3MUNA 4GQBA 2V1XA 4I8IA 4HQ0A 4C7BA 4EPWA 1XMQB 4IJUA 3VSBA 3MT9A 1PCXA 2V97A 4TT3D 1FDTA 2WYUA 4UCWA 3VJLA 2ZS7A 1GQFA 2Q21A 3CFYA 5K05A 4JJZA 4CQMB 4MV0A 4HMQA 1UEJA 2XT0A 3CE6A 4FFMA 5ESDA 3JTEA 2IHZA 3FSGD 4R3WA 4TL7A 5HJ2A 5BT8A 5C8YB 1VE7A 2ZR8A 2QNIA 1VE3A 5HBGA 3R0IA 3MTDA 4DCUA 4D8UA 2CK3D 2WTEA 1JIKA 5EIBC 5JAHA 3KUXA 1WZCA 1U2ZA 1IBLB 4GMGA 1Z0KA 2KM1A 2PGOA 5THXA 1NLUA 3PNBA 1QS0A 1E6WA 3IAUA 3Q6IA 4UULA 4QPNA 1YZLA 4B3DA 2VRCA 3JYOA 2X4LA 4CKWA 2P9GA 1SBQA 1BCRB 4EJFA 4GYWA 4JIGA 4N0PA 3NLLA 1T2NA 4PONA 1JA0A 4J0IA 4PWZA 4WJLA 5KNDA 5B7PA 3UAGA 1CB0A 2O1SA 3HLKA 1D5WA 2E7ZA 3NP7A 1W6UA 5U9CA 3ZWYA 2K7FA 2QUAA 1XVVA 1W44A 3ND9A 1KJNA 2CFOA 4PC7A 1FS4A 4LSGA 2UYQA 1B6TA 5DEOA 221PA 3DR5A 3GGOA 1RWVA 1VI2A 2E2WA 5I9BA 1GAEO 1EWYA 2ZWAA 2QMQA 4IH9A 1YVPA 1BX0A 1UF9A 5SZIA 2WM2A 3WYFA 4NHEA 3B3AA 5CDSA 3EIWA 2Z3ZA 3EVFA 2P9YA 1M2JA 2TS1A 3DMRA 1MJHA 4JI2B 2BW0A 1UT5A 1YVRA 1Z2OX 3B52X 3D2LA 4TMFA 5NLLA 3WP1B 2FFRA 2IPLA 1PFVA 3DPUA 4LRTB 2VYCA 4YAFA 1P7PA 2G0TA 3ETJA 2C4MA 3I64A 1NX9A 3GRPA 4UEWA 1KIFA 4LXYA 1ACMA 2BIFA 2BVNA 3OQ1A 1SWVA 4GHWA 2WPNA 2FOLA 2ZYSA 4MVJH 3C8ZA 1CU1A 3KHTA 2W6ZA 2Y1FA 2ZT5A 4JENA 5KSPA 1KFBB 1R4NA 1USKA 3E23A 2QRHA 4ZA2A 4D97A 4KGXA 1MMFB 1L5SA 8OHMA 5FLXA 3DMGA 1VG1A 1XDSA 2COKA 2BN4A 4G1FA 4TTSA 1C7ZA 2IKSA 1CUYA 1TQHA 2BKLA 2NO5A 3AV0B 5CUQA 3C6MA 5AHWA 5LOVF 2YXBA 3GT0A 4PZUA 4FFVA 4H1TA 5JSZB 2MCFA 3EFOB 1ZO8A 5TJHA 1N2BA 3QZUA 1X1RA 1WXEA 4QA9A 4F84A 1YFKA 2FVXA 3RHTA 2BKEA 5IVIA 1AG9A 3LBYA 5AM3A 2GLUA 4C2TA 3FUCA 1CUSA 4PFQA 1OX6A 1LQUA 1V25A 2W6JA 5H83A 5C31A 1XZ8A 1HH4A 5FTLA 4DA4A 3RW9A 3QKIA 3WDKA 3HB1A 2H00A 2PBZA 3PENA 1UBTS 1N3IA 4UD2A 1EQ2A 3CF2A 1VMAA 4KHZA 5IM4A 2FFAA 4Z9BA 1SCAA 1LK0A 2X0KA 1EVIA 3AJ8A 3D7KA 3JQBC 1EK6A 1ZXLA 3GFTA 4HDQB 1E94E 1VHJA 2A5GA 2BF7A 2HFJA 2OXEA 2H4JA 2RHBA 3BE8A 1DIRA 3R5JA 4HWPA 4MI1A 5E4TA 1SPBS 5CVJA 4UPVA 2WB4A 2NXNA 1N2XA 2BFAA 3FPGA 4QUKA 3VDMA 5BR1A 2GXSA 1QIHA 1FDRA 4G37A 1CZHA 1AZTA 3KT6A 2YN2A 1EIWA 4D4HA 1S7GA 1HQDA 4M37A 2YWXA 2RHWA 4X8OA 5EXXA 2R62A 2HK8A 1I9GA 2AN1A 2CWDA 3IOMA 3LCMA 3C70A 5I8ZA 3UOAB 4JL5A 3DNFA 3V8QA 4LCBA 4MWTA 1QZUA 1ZIDA 1FUIA 3ZU4A 5A4IS 2PX2A 1BXRB 2VDOB 4KFTA 2IY9A 4OJQA 4BKUA 1NAHA 1T8TA 3G0GA 1ZOSA 5JCOC 1YBAA 2IOYA 1Z4OA 1QIIA 2QTGA 1DJLA 4YC7A 2B5VA 4D82A 5FLKA 2Y0CA 3RK1A 4E6PA 4D9EA 4C7VA 2NW6A 2WWGA 4YH1A 2FUKA 5KYWA 1YA6A 4JP8A 4IDOA 3FR7A 1Q57A 1LLCA 3OP1A 4LJ5A 2H4WA 2WD9A 4JC0A 2PQMA 2OBLA 3RGGA 3TSAA 3VJMA 4OV6B 1OPRA 3BTSA 1V4VA 3T0IA 5FUXA 2PGDA 3MCTA 4LE0A 5BUSA 1Z2NX 2B83A 2RG7A 3G8YA 4WE3A 4P0PB 3GLGA 4QJIA 1FX0B 2D3TA 3G5MA 5LUAA 2BE7A 3H3FA 2IYPA 4KQEA 5AM5A 2IPAB 4O5AA 2HLHA 3KQVA 2I2DA 4IG9A 5C1OA 5JCOA 3LWNA 1L6IA 4HNQA 4ETWA 2VFAA 2QZPA 1GKUB 4MTLA 3UC5A 3D8TA 5TEVA 2CL5A 1XEWX 1ZRSA 4GLOA 2NU9A 4DBLC 3MS4A 2OZLB 1FQOA 4EPRA 1JEEA 1T9AA 1BW9B 2IY7A 2Q3LA 3D3NA 1SVNA 2AOUA 3RTAA 1M1ZA 4JYPA 1YD7A 1SOVA 3LL4A 3K20A 5T4EA 3UMJA 2V45A 1DRUA 2IZZA 3IVXA 3GEEA 3B1ZA 2BCJQ 3H5NA 4C03A 5L95A 4BQFA 4AKTA 1OVGA 2JIQA 3E3AA 2GGSA 4X41A 2XYPA 4C0XA 3T1OA 5LN1A 3K8ZA 3CW9A 1H3EA 3BRWD 1GRVA 1E6LA 2WVHA 4PRLA 4X65B 2QLTA 1VL0A 3ETDA 2PK3A 4CKEB 2HL6A 1YONA 2VJNA 3CO0S 4MIKA 4XWOA 3R8FA 1Y5LA 3HP4A 3B13B 1QF9A 1SC3A 5CA1B 1E60A 4M1OA 2HNKA 3AEQA 1T2EA 3VV2A 1MR3F 1S5PA 1S8AA 1WCXA 4JXJA 4TMTA 4EVRA 2CUTA 4NYJR 1ABBA 1Q7EA 1UJMA 3SN6A 3X44A 5FOVA 1NGSA 1A4UA 5CNMA 5CR9A 2JAXA 4IX9A 4XAQA 2VHTA 4ZYLA 3DBLB 3FOEC 1XMOB 1O6ZA 2B8EA 2I3GA 3PNYA 1I0IA 1Z0FA 2QN2A 2WZQA 4RPJA 3RKUA 2RJ3A 3C4QA 5AI9A 4K5QA 2FSPA 1CKEA 4DV5B 1W36D 1D2HA 3HRIA 3L7AA 2QPTA 2B1IA 3AP3A 3AU8A 3PX3A 4P31A 4DILA 2EX0A 2FHPA 2PH1A 3IBFA 2HA0A 3NUGA 3KZXA 4RLHA 3O6VA 4Q9HA 3R3SA 4PVDA 3CH6A 3JPYA 3U4MA 5JY1A 1K97A 4I81A 4YGYA 1H2BA 2PLWA 3O4JA 2XOEA 1VGVA 4FXPA 4H3SA 3UJ3X 3B6JA 2RH4A 2ID4A 5L4SA 2BFBA 3FUTA 3AZOA 3U6KA 3CJQA 1HDXA 1NXSA 1J25A 3LE8A 3SXJA 4C22A 2HRCA 2F43A 2K87A 5CT9A 4Q9LA 3LV8A 5B55A 2W42A 1ORRA 4MVWA 3GA7A 5EVCA 3WL4A 3CBGA 1UDWA 4XQCA 4LHVA 3C6ZA 3BDVA 4C3OB 4NCIA 1I5OA 1YKSA 3R3WA 1W8IA 3IC5A 5HIMA 3NT5A 3TW0A 4YRQA 4ZYVA 3TQCA 2XAAA 3OPYB 5DM4A 4ZVMA 3K9FC 4C0HA 3DHVA 4JOCA 3QG5A 1T2AA 3ZQUA 3KXLA 4TV8B 2C4WA 3VKHA 4PRZA 4XYBA 1QDLB 3PUIA 1PR1A 1T4GA 2J0EA 1NW4A 2Q4TA 1LQ2A 1XTUA 3ETHA 5IW8A 2AOVA 4IDBA 3FM9A 3WAGA 1H6BA 2XQIA 2JHAA 3MOSA 1GPNA 1Z6YA 4AKEA 1TCCA 2YKGA 4TKMA 4OOFA 1JWBB 1H23A 4Y2PA 1DCMA 2QI9C 1QE5A 3CLTC 3NGXA 4GXNA 1UK7A 3PIIA 1SG9A 1GKIA 1J97A 1GD1O 3LBNA 2DSNA 3DOCA 1Z26A 2FEXA 3I5MA 4M0LA 4R54A 5AKEA 3UMFA 4BWGA 3EGDA 4UBOA 4Z7QB 4M4SA 3AL0C 5CGQB 3T4XA 4TLLB 1Z5GA 3WXMA 1DEXA 1BJKA 3D5EA 3F47A 5JYCA 1C9DB 2D4HA 2H0QA 1CLEA 2B98A 4LGMA 4LY3A 4RWZA 4O4JA 1G38A 4QXAA 3L9XA 5IEJA 4OU5A 3A0RB 1S3IA 5LQUA 2WA1A 5K3SA 1RRVA 4UQPA 1G3UA 3TOCA 1BVUA 2Z1MA 5TF4A 1T5TA 5CURA 2QZZA 3A1VA 2FG5A 3LECA 4ZOLA 2YZKA 5AKXA 4Q1CA 5GTDA 3U5ZB 3DAFA 4RA6A 3E1KA 1H1LA 3TTSA 2KPOA 4Q3CA 4CDMA 4ZHQB 4G1VA 3LZCA 4YRGA 5BVGA 2QN3A 1C8BA 2WF6A 2X6TA 3TE6A 4PQRA 1E8DA 2XHEA 2IHUA 4RHYA 1JP7A 1PKEA 4YYZA 1CDOA 1PLLA 5CLJA 2WKPA 2A5YB 4D4LA 3A2KA 3R8XA 4M89A 1MX5A 3OE4A 3IDFA 4RFLA 2VAMA 4TLEA 3BF8A 2N42A 4CCWA 1TZJA 3D3EA 4MKRA 2E4WA 3CG4A 421PA 3BHJA 1GZ5A 5LNK1 4HGOA 3RYFB 5K2MA 1JLSA 3EXG1 2EG5A 4YPFA 2C9ZA 4JYAB 1BXGA 4R2IA 2GBPA 3TTVA 2BGGA 1SQFA 1IC6A 2JFBA 1YNSA 3AY6A 4AWBA 1NOIA 1E6EA 2WKRA 3U4CA 3MTJA 1EGHA 5AXBA 5JYBA 5E4YA 1OI4A 4P81A 2JCGA 1C9NA 1DAEA 2JC3A 2ZLBA 2IK8A 3QKSB 4XJTA 2R48A 4UM8B 2DUWA 4YB8A 3TTYA 1E1CA 1JG7A 3KSRA 4G2TA 4HUQA 4A4DA 4CV1A 5JNVA 3UG7A 4Y2QA 1KI1A 5F76A 2VRWA 5FWAA 5JJLA 1RLTA 3PGMA 3W7BA 5AICA 4F72A 1GEGA 3AF6A 4C1NA 4TXJA 2QU8A 1LU9A 1YZNA 2ATEA 2YYYA 4V0MA 3GOHA 2DYKA 5EP1A 3GZNB 5D6NA 1G8KA 1NJFA 2WIFA 2ZRKA 3DW3X 4IVRA 2DKOA 3ESRA 3TZQA 4AJPA 5JQGA 3THYA 1ZVVA 1NY6A 4CM6A 1S0UA 4KN5A 4KYVA 1LSOA 1YULA 4PN3A 2QZSA 1YCGA 1Y63A 3HJTA 4R68A 1QIDA 1T2CA 1ZJJA 4JDPA 5FH9A 1R10A 1N2SA 4IZIA 4O2BF 4KZPA 4X91A 3KSZO 1U7OA 1ULAA 1V95A 2F6RA 5DCUA 4R1PA 4WX2B 4XCQA 2P2DA 2ALJA 1CB7A 2C1EA 1YDHA 1GTL1 5DBIA 1V1RB 4E08A 1SCDA 5J2UF 2XGGA 3H05A 4V0SA 1DO8A 5ALVA 4C4XA 5AW8A 1OCEA 2P40A 3MCZA 3KQOA 4LNUA 1JV2B 1DAGA 1V26A 2V6MA 1EFTA 1KK2A 3E9NA 3EZNA 3WY9A 3S81A 2JEYA 1NQ5A 3R6WA 4XDYA 2QBYA 1T91A 2M6KA 1NMQA 3ETLA 3V4LA 2ENUA 3HLTA 3IL2A 3Q0EA 5LD2C 2C9BA 1BWQA 1XGKA 3JX9A 2RGAA 5E95A 3TZLA 4K0KB 1VIVA 4ZGGA 2CXUA 2I2WA 1SCKA 2Y1OA 4K05A 3OEHA 2ATXA 2HRDA 2FPXA 3BM5A 4LRYA 4RNDB 4E51A 4TYYA 2FKAA 1SD5A 1UBUS 5EHGA 3P96A 3RU9A 1GQYA 4KMMA 4QOHA 4QVGA 4FIZA 3SBEA 4P9NA 4YDRA 1ZW6A 1Z4PX 2QSZA 4JI4B 3PEVA 1O03A 1F4LA 3CR8A 4CMJA 1EEXB 1KZYC 2JFUA 1PJ3A 2PGLA 2WMYA 3A10A 3KWJA 4WZAB 4I36A 5IH3A 2X8BA 1JA1A 1Y34E 3H5TA 5BN4B 2IL1A 5ALPA 3ZHUA 5CLQA 2PVSA 4KNYA 2PL3A 1M7HA 4HNUA 3A9TA 4JR2A 1SCIA 3CR7A 1I6MA 3QU7A 4A0RA 3KAJA 1HXHA 2L42A 1X1AA 3K2IA 2C9DA 5L6MB 2HYDA 4TVSA 1XPRA 2L18A 4Q37A 4QDKA 5F4BA 1NFRA 1C3OB 3D0RA 2GBCA 1YRYE 3DOOA 4IHAA 1HT2E 4OGLA 3MT0A 1P7CA 2V8BA 2A9RA 3OCUA 1AQIA 4PTZA 3E9EA 4TRMA 5GOTA 3VJRA 3DMTC 2VZLA 3ZWQA 3UT5B 4V0NA 1SU7A 4E5SA 2VNKA 5AKYA 5FORA 4YJ2A 4FFRA 1QHGA 2LBPA 3DV0A 2O3RA 4YRSA 2H6EA 5LUBA 2DLCX 2Q6IA 3KT8A 4ZTBA 1QO9A 1L4BA 1T35A 1E7SA 4FMBB 4QJ4A 1SB8A 3VPHA 4LWPA 1EXMA 3B9RA 3NDIA 2J7KA 3K9NA 4TV9F 1KMQA 3L04A 1YDFA 3MTBA 4E11A 3Q12A 2R1TB 3ANXA 3MTGA 2O7RA 4XUCA 4P4SA 4CTNA 3IUSA 4ZIRA 6CHYA 5B6IA 1MF7A 2R8XA 3COSA 4HD8A 3IFSA 5HKLA 3GLFA 1R8JA 2Q8QA 4A7PA 3D8BA 4S1OA 4DVJA 1A2QA 4I55B 4C5BA 1XVAA 1K4KA 2GPAA 3H2HA 4Y0AA 4GKJB 4JN6B 2DBZA 4BAUA 1XAGA 1NBWB 3QVGA 5B1SA 1WSBA 1PNVA 2ZDGA 2P4UA 1H8ED 4OIFA 1O94C 4LJSA 3A4NA 4L9WA 1WOMA 5IAOA 4TYQA 1VL1A 2IYVA 4U8GA 1SCQA 3SR4A 3PPYA 1KO8A 3DO8A 3ZE2B 5KOHA 2B1GA 4Q1DA 2PV0A 5K4HA 1A4IA 3KT0A 4X54A 1AZWA 4AS2A 3UMRA 1USVA 4FOPA 2ECFA 3FAZA 2R6DA 3OETA 1YS9A 3G88A 4FB4A 3A6KA 2JGMA 3H17A 1GEEA 1K27A 2A86A 2R5FA 4OHUA 5DLDA 1X1EA 3SHQA 1L5HB 2JA1A 3QE3A 5FUVA 2ZUVA 4HLNA 1MOSA 1GNPA 3ZWNA 5I47A 1DIAA 1TGVA 1RWNA 2EQAA 3NEPX 3OZ7A 5AJYA 4DIFA 1XMVA 5LBUA 2B5WA 4Q02A 4JXZA 2PKXA 4G0ZA 1Z15A 1O94A 1VLJA 1XJWA 3LT5A 4QUBA 1WDKA 4TL9A 4I9GA 5FWYB 3EEYA 5CYGA 4D0GA 4A26A 4U02A 3T3GA 3HA2A 4UTZA 1YR9A 2XH8A 3G9TA 3D9QX 3ADPA 3GQBA 3PQ4A 3S8MA 3RDPA 3KSBC 4K6MA 2VHZA 4YA6A 1A76A 2XMZA 4EDHA 2C2BA 5LCXA 1CUJA 3GMDA 3DM5A 3KP1A 5BWLA 3BTVA 1SC6A 2NG1A 3ZBTA 3K2EA 1BRTA 2FP3A 4FR2A 1J56A 3TW6A 4DQXA 9GPBA 2EDAA 1P4HA 1QOPB 4FCVA 4E5KA 1XZCA 2XW6A 4L22A 5AOAA 3MPOA 4DZZA 4AB1A 1JFFB 4FSDA 1QCZA 1HDOA 3CXRA 4IIJF 2ZAIA 4OX9B 3N8KA 1B15A 2JJ8A 3JQPA 5DASA 2O2IA 4YJFA 2Z2IA 1ZZGA 4BYGA 2XUFA 3FTPA 3UMVA 1F8XA 3GLRA 3Q3HA 3KVOA 2PKWA 4E33A 3OO1A 3IEMA 1M54A 1U2TA 2LDXA 3A70A 3IAXA 1HNNA 2CNBA 1P3Y1 1O5IA 1XHEA 4BB9A 3QTBA 3RU7A 5IPFA 1E3WA 2J3IA 5M3BA 5E6SA 4QASA 1IU9A 3GRRA 2O20A 5AW0A 4KE6A 4MEAA 4QECA 3E58A 4AI6A 4C05A 3B7WA 1OC2A 5TMPA 2F55A 2V03A 3ZV3A 4D9GA 1MW9X 4PGHA 3F49S 1QQ6A 2JI8A 4O6VA 3ZY3A 5CITA 1NF9A 3TLKA 5CNIA 1XX6A 2XZOA 1V3VA 3DYVA 5T4FA 4PRKA 3QWFA 5AH0A 5F23A 2YMPA 1PTJA 3ZEIA 1NR5A 4IJVA 5JVDA 3EZLA 1ZK4A 1LC3A 4IOLA 3G23A 3ROGA 2YRFA 1W19A 3TR5A 4AYWA 1KY2A 2FJ0A 4DIDA 5IM5A 2JFGA 2YVKA 3BICA 3LWBA 4BNLA 4ZMSA 2ZCJA 3T9CA 1MGOA 4FJ2A 3HGMA 4LC0A 3KKEA 1JIQA 1ZNZA 3NT4A 3TF5A 1OQAA 3VTZA 5LOVB 4HRYA 3FYDA 3EQ2A 4J03A 4MGEA 2H5EA 5EMKA 5LYJB 3HVHA 5FBKA 3QELB 3ROMA 2NNLD 5JAPA 5LVAA 1ZU5A 4G1BA 2GBLA 1KOGA 3AI2A 4JYCA 1VE1A 3EPHA 3C15C 1CEQA 1I36A 3KZMA 3NUZA 1L1EA 2GVNA 4ALNA 4B87A 1MIOB 3NMUF 4OHOA 1B8NA 1KOLA 2BGWA 1BD3A 3Q7QA 1RYBA 4IEIA 1SVWA 1F4VA 2HWYA 3UK6A 4JXXA 1BFKA 1UM9A 3LY8A 1YIOA 3PTZA 4I2NA 4F7WA 3GCGA 2ZRMA 2PSDA 4KN9S 3A37A 1CDEA 3ITEA 5BSRA 4WL0A 1OU0A 5JZ9A 4AN1A 1V9LA 2Q0QA 3LFHA 2UVDA 5JUWA 1N6HA 1MOQA 5IP5A 2OV3A 1MABB 1G8FA 2F8LA 4LRQA 1MA0A 5K8CA 1NVXQ 1C3OA 16PKA 3MYYA 1UPCA 1DQNA 3K6RA 3UA4A 1J9GA 2FSUA 1YASA 2PSEA 1Q19A 1NJSA 2AZMA 3Q0TA 1H0RA 4E09A 1NG9A 1U3UA 4F86A 4F4UA 2GXUA 5CB4F 4CQJA 1I2AA 2CNOA 1FFEA 5KDOA 1PL6A 1TU3A 1KVQA 2OE2A 4NE9A 3T9DA 4QG3A 1ST2A 1A2OA 1R18A 2J3DA 3CGGA 3COYA 4V0RA 3VPAA 1H22A 4WZBE 4C3ZA 1WB9A 2PO7A 4R51A 4LMPA 1EZ4A 1P3JA 3K30A 3S2FA 4AW9A 4AX8A 3LF1A 3RYIA 1EB9A 3D3KA 1HDRA 2QL7A 3G2IA 5COQA 3H2SA 1N2EA 3I9V1 3W2GA 3DWFA 1LTHR 2EVWX 3EXEA 1MPXA 3NHUA 5FT9A 1XA3A 1A5ZA 1RPAA 2SKDA 3LQ4A 5D84A 1KI6B 3V8NA 4XIJA 4NCBA 2IF2A 4ZO8A 3TQOA 4B31A 1THTA 2H5JA 1EX9A 1AGXA 1CY0A 2ZI3A 5F9MA 4OLFA 5FOQA 4L0QA 2K4MA 2A0KA 2QORA 2QNRA 3LP8A 2ADMA 2JGLA 4GP9A 3CX4A 4M0PA 1KSFX 4QTZA 4CLDA 4CLHA 5ICGA 1U0JA 1RZRA 1T0UA 1VIYA 1L1FA 3ZGYA 1TA4A 4HUTA 4JMPA 2PZLA 3DNMA 3H5VA 2WSSD 3VU9B 3ZJYA 4G25A 4I0WB 4X8HA 2YJ3A 1YBMA 2X77A 3BZUA 3OFJA 4RZXA 2L17A 4RIFA 4JVOA 2QPOA 4HB3A 5JHHB 3DTVD 4LRWA 4A2PA 1F0YA 1JHPA 1TJPB 1R4MB 3HADA 1QH8B 4YLYA 1P0IA 1OVMA 1U8UA 3EXG2 4U4AA 1A8IA 4IWYA 3FMFA 4U2DA 3ZD8A 4IEEA 4Z2AA 3J80A 3ILXA 4YJDA 3QBJA 4C4ZA 4TKVA 2VS1A 4GZLA 3TBFA 1KSGA 3TNDA 4EM6A 1KYYA 2IXAA 1INLA 1Z47A 4G1CA 1H69A 3P2JA 3P9ZA 3PPXA 4NQZA 4F6RB 1HPLA 4GG1A 3G2MA 5F3WB 3PNSA 1P45A 3EMBA 2G9QA 2W6CX 3AMVA 1W36B 4OQPA 2CKMA 5FAXA 2CNNA 3QSYA 1Y5NA 3EEQA 3M1IA 2QN7A 5HCNA 3BKXA 3C3JA 3U61B 1JMVA 1KDVA 4R9NA 5TIIA 3HDYA 5FTNA 5KAPA 5DVZA 4D9IA 3ROFA 5H9VA 3QX8A 4CM8A 1EG2A 3ETGA 2AS0A 1JT2A 4XYLA 2BH2A 3DKIA 3K96A 3T1VA 1X7HA 2W00A 4Q4CA 1XNGA 1RAFA 1I6KA 1L7MA 4RHUA 4BJ6A 4KG7A 2J5QA 4RY9A 3BXPA 3UK2A 1O4VA 2EERA 2ZE7A 2XXBA 1RE0A 1U8CB 1Y8CA 2NM0A 3MINB 4FGSA 4ISCA 4LZJA 4N7RA 2ZWIA 4MQEA 4PFSA 2NADA 4TOIA 4FMPA 1L4GA 2VP6A 4TTTS 3C1UA 1IIBA 2VYVA 2CV1A 3EGOA 1YRWA 2Q3EA 1BGVA 2HA2A 1T9BA 4JBXA 3WE7A 4DJJA 5LMUB 3L6DA 4RQBA 3C1OA 3R2JA 2C9CA 4D9FA 3RASA 2DPLA 1DBQA 2HSWA 2QKYA 3BK7A 2RKWA 4W9RA 3P2MA 1POXA 5IRCD 2ZGVA 3VZQA 4QJ5A 3EY4A 1R0CA 2C7QA 1T2VA 1J5EB 1IATA 2ZIAA 3NHRA 2AR0A 3ZV5A 5JLJA 3TS1A 2GUGA 2XQVA 3H2YA 4RKRA 5FOTA 4Y7DA 3VO1A 4BMDA 1W4AA 2W43A 3Q98A 2C4HA 3OLXA 1TRKA 3AM5A 4MA4A 5TS3A 4A3SA 3PC7A 3RS9A 4BTEA 4C78A 2C7OA 1QUFA 3FFAA 5DWDA 5EMHA 1ORWA 5DMXA 2Z8ZA 2AVDA 1DE0A 1I2BA 2AD1A 2Z6VA 4HSGA 4QQRA 4NWIA 3C87A 1JHYA 1NMYA 2JI9A 2ZT7A 3OF2A 1P2FA 1BKDR 2ZWOA 1TUIA 4WLVA 2K6GA 3IJRA 4OYYA 4YAWA 1VP9A 3RVNA 1R3DA 2HLDA 4B45A 2EX4A 1GADO 3X1MA 1QBGA 1MENA 5CLIA 4MCIA 4KR2A 2WABA 3FUXA 3GUVA 1VRWA 3HS3A 3WL8A 4CL0A 3A1EA 2IZ0A 5TX7A 2QRMA 1Y7PA 3LHSA 1AT1A 2RKOA 3RFTA 4D8TA 4EB6A 2PLNA 1Q0ZA 3PDUA 3V9PA 1WDTA 2Y93A 4CTKA 3B82A 4MQMA 3TTXA 3FNBA 3PT5A 5ERYA 3R8CA 3I6ZA 1IN4A 3NJ8A 3KOMA 3VVCA 2WG1A 4RVHA 4W8GA 4YXWD 3PD1A 3W5UA 2JGRA 3WJAA 4QTUB 4UE6A 2W2KA 5B30A 3W79A 3UMSA 3HTXA 2VPWA 4NCNA 1HE1C 1UDRA 3MTQA 1R6XA 5ECYA 2FUCA 2OAEA 3UFXA 2LPMA 3FNHA 2EFGA 2YFHA 3WX0A 1G9XA 1C14A 3GD7A 5DF1A 4A92A 1QU3A 4RD6A 3CLKA 1G3IA 5DN6A 2ZUBA 4H6WA 3GRVA 3PT9A 1VXOA 4PLZA 3T3IA 2BDEA 3MUEA 2G1PA 1FDUA 3OAAD 3VXKA 5DM0A 2YH2A 4Q3BA 4Q3EA 5KOYA 3NYRA 3PWSA 1TZBA 4HTAA 2JH3A 1D2CA 2BHNA 2LRHA 1R8XA 1TA0A 3B1YA 2VZEA 4M1EA 4Y1FA 4YDHB 3TRDA 3E7XA 3LK6A 4I9NA 1Y5MA 4BJHB 1TEXA 4MRPA 3BMQB 4JI1B 2OXCA 5HKBA 4HXFB 1U7ZA 4MW6A 1P1FA 3AV3A 4DJEC 3Q8MA 4X1KB 2C77A 5FADA 2ONCA 5TGTA 5U4QA 4CWAA 4I3FA 4FFWA 1X38A 4UHJA 4H3HB 5DT2A 1UPFA 4OAOA 2VTBA 1B4DA 1JDBB 1VLZA 2CXOA 5C7YA 1MQSA 2J4FA 3R9WA 1JN0A 3NDJA 3DFIA 1UR5A 4HWKA 5J1SB 2WU4A 2DWUA 2WEKA 4M9ZA 3N6VA 1TTQB 2C3MA 4JHXA 4B5KA 1CZNA 1IVSA 4ZAXA 2FSIA 3JD4A 2DE0X 2V8OA 5BSWA 4FR0A 1Z8NA 2ZRQA 1JAHA 4BB5A 2QHXA 4N54A 3MEQA 4BN4A 4MW5A 1SUWA 2M2IA 1E9VA 4UATA 4NMXB 3VU9A 1DKPA 1WNTA 2EWVA 4KC0A 2BKUA 2WYWA 2Q41A 5E7JA 1VZ2A 1W36C 1ULBA 3T4EA 4B8WA 4AMVA 1R3UA 3IKTA 2BFOA 3FOBA 3L43A 3MLEA 1X7YB 1T8SA 1CDDA 4XM1A 2LCQA 1V47A 1TPYA 4IV8A 3ESZA 4NBKA 2OVBA 3D5QA 4XJSA 5KTNA 3MMXA 5AWFC 4XOUA 3GC6A 4XWGA 4TMXA 5FPQA 4EQZA 5IWAB 4NCAA 1XFDA 2YWRA 4OA8A 1E9AA 3E4DA 2HJ9A 1IG0A 1JIIA 2WILA 4FKZA 1QVZA 3HBMA 3BHNA 2O5VA 5HRCA 2O9JA 4MTCA 3Q8KA 1W4ZA 4YFYA 4G0YA 2VVTA 3IESA 2JKVA 3P71T 4JP3A 1R9JA 3FDIA 4U7TB 2YQ5A 3G1UA 3CH4B 1UL1X 4U0JA 1E3LA 1G5IA 1XXHE 3X43A 5EWJB 5C35A 2BPOA 2PR2A 2QTMA 2RSLA 4GRAA 1N2CE 1CQZA 4GLBA 2Q6KA 4IH4A 4QO8A 1COZA 8MHTA 1GG9A 2GHQA 3ESXA 4FYKA 1L8LA 1CR2A 2RGXA 5J2UB 5JCZA 3AUXA 3PQ3A 4TSRA 4P53A 3L84A 1T36B 4AZ0B 2AF3C 3CZQA 3KAPA 1IBCA 3K2QA 4CXMA 2ZSUA 4BMZA 2FJUA 3BWXA 3T34A 4OSPA 1XZJA 3ITDA 3PE6A 3ROQA 5FAKA 5EIEA 5HHTA 3VUEA 4PR3A 1QYWA 2I4NA 3LZDA 1HETA 2B6HA 2PX5A 2YNMD 2EGGA 3LHFA 3KKZA 4YRZA 2V4UA 3CSUA 2CBZA 2MYUA 1OWOA 4NK5A 1RLOA 4IIDA 3H1BA 3VPBA 9MHTA 3MMNA 1FEZA 1GZVA 4X61A 1H2AS 4ZV4A 2WUEA 1K98A 1UXIA 1PR3A 2J59A 3PC8A 3PVSA 2FDRA 3FIUA 3VFDA 4GUAA 5CFRA 3FCCA 5HK9A 1Z2PX 2HIGA 2Z1NA 3ANLA 4ND5A 3CVJA 5T3YA 2IEYA 1XQ6A 2C7VA 2I4RA 3GF4A 5A7HA 1GN8A 1BE0A 2YUIA 1DXYA 3Q15C 3GEGA 3AM1A 3JQ9C 3NRJA 1ZS9A 4RXTA 3OPMA 1KETA 2DT5A 2X58A 2XUGA 9ATCA 4Z3KA 4ZI7F 1GAXA 1HNXB 2DY0A 2GK7A 1JU4A 2RAPA 3CVXA 3H04A 3MJEA 3KJIA 1LLFA 2ZWPA 4A6EA 1WO8A 1FFCA 4GLFA 4HAVA 1P4SA 1U28A 2P0AA 1NXPA 5TGZA 1YDMA 2QTCA 5SZJA 4CCYB 1LLDA 1JDTA 1PR4A 3FB4A 4KODA 4LX8A 5EUCA 4EF4A 4F8JA 3TAXA 2IFTA 5BO5A 3N2GA 3KCQA 2G70A 2YIMA 4RDXA 5HKKA 3QFFA 3MG9A 2XNDA 1HDGO 2FA9A 2QD4A 5CW1A 2FSSA 4HK4A 4YK7A 4UUAA 5G41A 2OK8A 4A6XA 3ZI0A 3HVKA 3TVDA 4O63O 4F9TA 4JJIA 1XZKA 2B3TA 3ZXYA 4YFVA 4TV9B 2VF7A 1F7UA 2ILTA 2P6OA 3ZS9A 3RTEA 3THOA 3FXAA 1UK6A 2WDPA 4LHSA 4DEVA 3QLTA 4J1TA 1IPFA 2Z1DA 4JT2A 1UWCA 1V8DA 4G09A 4QTTB 5B4UA 2PUEA 3GA0A 4UNQA 3IP3A 4FFBA 5C53B 4X3PA 1ZGGA 4Y6LA 1IOVA 1PJ4A 5REQA 3WB1A 4E22A 3GY0A 4D0SA 4HF7A 1CR0A 1N5KA 2AFIA 2C99A 1F6WA 2Q3DA 3IPRA 2V7QD 3CF4G 3JSXA 1DOAA 4ZPXA 2V5VA 1ADYA 2X5JO 4DLNA 5BSEA 1LKZA 2OAGA 3EUAA 2YWBA 3DO5A 1Y80A 3HYCA 3M4YA 1Y3CE 3SK0A 4MV8A 5LSAA 1W4CA 4AIRA 3SR0A 3AJEA 3H19A 1KY3A 2H4ZA 1Q21A 3CLUD 4FKMA 1C8KA 5JR3A 2NTNA 1QQ7A 4KXVA 3GRFA 3TE7A 3GH3A 4IW3B 3TOZA 5BQPA 5F12A 5KYGA 5LQJA 1VJ5A 3WNBA 3BXOA 2ZJ4A 3NUQA 4R5HA 4EITA 4EZIA 4EUKA 4ARIA 2UVPB 4QEDA 5F7OA 2GH1A 2GN6A 3ON5A 2ZAYA 3LKVA 1Y3AA 4L8FA 4RVFA 2IITA 1JUDA 2PRKA 4S1NA 3SKVA 1KO5A 5CVUA 1GL9B 2FAXA 2A33A 2Q7XA 4PIMA 4DT1A 1E2QA 2FETA 4B3XA 3AZPA 1ZGAA 3PYXA 4V1CB 2QZ4A 3JU3A 1VRVA 2D5LA 3KYCB 1SULA 1SCUB 2Q1XA 3M7IA 3OJWA 4J90A 5CA0F 4PXSA 4V0LA 3RTCA 3T4UA 5TQVA 3F5SA 2I6QA 2O2JA 3OWXA 3OUZA 3KPJA 3V46A 2WWIA 1IYZA 4QARA 1U8ZA 4XR9A 5ENDA 1O95D 5CAEB 3E15A 4PG5A 4JJGA 1KDTA 1S4QA 2GAJA 1X7WA 2WUDA 3DUFA 3O1HB 4IVQA 4JGIA 4P58A 3W6OA 1FLAA 5FUMA 3TINA 1JGTA 1HMPA 2R6FA 1IY9A 1KBZA 3HUTA 2A84A 4EHHA 3TXYA 2HMUA 4N3NA 5A02A 3WNZA 2OSVA 1RE1A 2XD9A 1J42A 4XIGS 4QT4A 1SC4A 3UCEA 3L7KA 4II7A 2IZ5A 3Q1LA 3T1HB 1FC0A 1YB4A 4HEA1 2BTQB 2UUBB 4NU0A 3P0EA 1NIPA 4K2HA 4G9GA 4KXQA 5CDTA 2H16A 1THZA 4EGAA 2ODPA 4UHCA 4GM1A 1TDJA 3FVQA 2O3SA 4HYYA 2QG6A 2RK4A 1J22A 1GGEA 3DFZA 3U56A 1WD7A 1YZVA 1K6XA 3JATA 3ZE1B 4BE7B 4YXFA 1DX4A 5EFOA 5D3QA 2Q8PA 2MSWA 3AVVA 1DEKA 3DD1A 4O2BA 4FR5A 1RJEA 4Z0TA 4C04A 4UNPA 5TLSA 3WVNA 1MORA 1H1DA 1TKRA 1IUKA 4NBWA 4GC9A 1KYWA 4H35A 1E5QA 3OU7A 2AHOA 3G0BA 4YAIA 2AZXA 4CZ2A 5HKKD 5A7FA 1E7WA 1PSDA 2Q29A 2ZFUA 3L7JA 1P1KA 4M9SA 1GLNA 3CKYA 5BT9A 4BL5A 3VSAA 2NO6A 3AFIA 4GP6A 4W5TA 1ZH0A 3D6TB 2HT6A 4L3VA 4JX9A 5EG5A 3C6KA 3ZD7A 2ZRAA 3EUWA 5B12A 1OXTA 2HMTA 3DE3X 3DYBA 4JOQA 5F21A 3AOEA 4ZT2A 1II8B 3JQDA 4MUHA 5IZCC 1H4SA 1DBVO 1NU6A 4M9RA 3F5QA 4HBGA 1XTRA 2JAOA 3RRYA 1F38A 2G08A 3QBTA 3VR6A 4Z6KA 1XZPA 2X7JA 4E88A 4NMHA 4YRMA 3DV2A 4OAPA 2GZAA 2J3JA 2JJ2A 3EQ7A 3W5JA 2NYAA 1SCBA 4PCUA 1M1NB 2N0SA 3SQLA 2XLBA 4G01B 1QQBA 1YMQA 1SZJG 3LSTA 5DLQC 3SQMA 4Y6PA 2GZ3A 4MNTA 4FFDA 5CYPA 5AHKA 1JHUA 2OCYC 4RK7A 4RTKA 3VKGA 1Z0AA 4B17A 1WUYA 3IAM6 3H3XA 1PWHA 1Z6TA 4U7FA 4M8SA 4R8MA 3DKPA 1X8JA 3OP4A 5GMOA 3UATA 2AW3A 4COOA 2WT8A 3LQKA 2P9FA 3CX8A 3D0QA 4A0HA 4DHEA 2C58A 4WZBB 1NJ1A 4CRWB 3GDHA 3U4AA 4XSHA 4K8RB 1CUBA 2NGRA 3E03A 3NVAA 4M6WA 3WR5A 5CB4B 2H2DA 3PE4A 3QW2A 2AV6A 4Y2VA 1Q7BA 3VR4A 4OGFA 2PGJA 4V3CA 2BJVA 3MCWA 4I4TB 2VDMB 5KZMB 3AB3A 5JSQA 2J32A 5IAKA 1WUKS 2IHVA 2PKQP 1A95A 3F5DA 4AMBA 3G5UA 2UDPA 5CDFA 4Q9DA 1CRQA 3BJIC 5G1PA 1ENOA 4KLCA 4E32A 1VCMA 2Z5LA 3QM1A 4G5GA 2WAMA 3LUJA 3GT3A 4AS3A 4Z7JA 1OFTA 1SOWA 1AURA 1VHDA 2VJMA 4LDPA 3LGSA 4J7UA 1QG2A 3RIMA 4N7MA 1F17A 3K0KA 1AK1A 3H9EO 2YWDA 4N0QA 3O21A 3SJCA 2O8DB 5JNTA 2AG0A 3NOQA 1AK9A 3NU1A 1AH2A 5T5QA 4KFSA 2J9FA 2YXEA 3KO8A 3LPMA 4MULA 5F1OA 4BDTA 1GVNB 2YS7A 3KJGA 1F2UA 4C07A 1MN6A 3SXUB 3PZRA 1I6WA 3AUSA 5G0TA 5B3LA 4WBNF 2CLMB 3IMGA 4CIYA 4U7DA 5B7QA 4HVLA 3RVOA 2ZATA 3AKZA 2GBIA 2X7HA 4PYOA 4KITB 4JASB 2QM7A 4QE3A 3I9JA 2MHCA 4QGHA 4AY5A 1EFAA 1WP4A 1E69A 3VZSA 4YRRA 2PS0A 3NC1C 2PRZA 5EMNA 4ZCQA 1IMJA 2IU3A 2J6BA 3K1AB 1E0SA 1MXHA 2R6HA 1ND6A 3HWSA 2R8EA 4JI0B 2CDNA 2OFOA 4R1OA 1V5GA 1XQVA 3FYUB 5DWVA 5F9FA 1N92A 4E07A 1SB9A 3O3MB 3UK7A 4F1WA 2OV6A 3S68A 2VG8A 2GCGA 1JQDA 5ALJA 1UOEA 4M99A 5IKMA 3FNRA 2FHSA 4LKRA 3M5CA 3AEKB 4YREA 1DTEA 3C74A 3H2KA 2XCRB 4AURA 1F2TB 3U7GA 1XZLA 2UV8A 2G9ZA 3E22A 3HVIA 3GFGA 4RX1A 3ES9A 1GFSA 4WNAB 4GPTA 5FWNA 3G0OA 4HH1A 2ZBQA 3PU6A 1JDUA 4H17A 2RB4A 4QUHA 2Z04A 2H31A 1CUCA 1R0SA 3RWOA 1YQGA 2HF8A 3F3KA 2FZCA 4TRNA 4IDAA 3T9EA 2KI5A 1VKNA 2FWAA 4HEJA 1AKYA 1EK1A 5DW3A 4OMDA 1XL0A 1WTCA 5FLEX 3PRJA 3TTWA 1Z5OA 2AI1A 2IW3A 1G19A 4OQEA 2VT2A 4Y6QA 4Y67A 4FW8A 6YASA 4FN5A 1KZ6A 2DF8A 4IIJA 2ISQA 4WGFA 3TJMA 5DXAA 2P2YA 1W0KA 3C8HA 4QDOA 2CLOB 3PFIA 4R69A 3VUFA 4RKYA 4CMCA 1Q16A 3PKIA 1IL0A 2REBA 1USIA 3AGQA 3C6BA 3GGDA 5E38A 1C0EA 1ZJYA 1ZOOA 1QK5A 2WIJA 4CPDA 1MTOA 2FX3A 2RBGA 3NTVA 5KPDA 3SIRA 3OI7A 4JLNA 2QRGA 2VHXA 3AKDA 3OEWA 4US1R 4IHJB 1R2QA 3UAVA 1N4DA 3RAJA 3P45A 1T43A 1RQ2A 4XGQA 3PVCA 4TT3A 1QFJA 3KPWA 3OKAA 3AEZA 4K0RA 4DWJA 1OW3B 2A1UB 1NJ8A 3KG2A 4H7FA 2YXLA 3FSGA 4ENRA 4EY5A 3D5TA 2XECA 3ZHTA 5FV4A 1LRJA 2QAGB 5J3JA 4RJIA 1IAQA 4MR9B 4UHFA 2ZIUB 4INAA 1XALA 2J4DA 1UBNA 2RI0A 4QBKA 4URFA 1JXMA 5K6TA 4KRFA 1IM8A 4LRSB 4G5SA 2CVOA 2EG9A 2ZBRA 2YRXA 3NTRA 2L2QA 1QKKA 3JAKB 4YJHB 2C4UA 1ID1A 3LNCA 4JNCA 5C7OO 1QVWA 2PH7A 4J2TA 2C7PA 1NQTA 5DYTA 2J3EA 4M9UA 5ITVA 2QB5A 4POOA 4MI3A 1B1AA 2D00A 2VOEA 1B16A 4G5HA 4FZRA 3T9BA 4L8WB 4Q4HA 4BO3A 4NF2A 3AVWA 3AUJB 3EF0A 4XD7D 2CDRA 4BBZA 1J8MF 2CW5A 4BGUA 4E70A 2WTXA 2N9UA 2OV2A 4UCFA 4BATA 3RYCA 1ETHA 1RI3A 2V6IA 3LDAA 3WO1A 1LD3A 1QOZA 1NBME 1V6CA 3ZHSA 3L8FA 3PLAE 2LR0A 4LE2A 2P2NA 2WJAA 5CLGA 2MT9A 3QYFA 5MFPA 1TNDA 4UZSA 1WMAA 3MS7A 2V7BA 4UREA 1YVEI 2HTFA 3OTOB 1NPTO 3JCZA 1CR6A 2W6MA 2JF0A 3BGIA 4J3JA 4RORA 1I3MA 4DCPA 1PT5A 2AWNA 4X60A 4YMSA 1X92A 2P11A 4FQ5A 2DHEA 5KAMA 4UTRA 1ZJWA 3N3AC 1G5TA 1IJEA 2OV8A 2ZRHA 1GAQA 4KPFC 3OIDA 1DC4A 3CN7A 3K9LA 1VQ1A 3PR2B 4G5OA 4AMZA 7GPBA 3IE2A 2JG3A 3TEMA 3WHIA 1UBOS 1LDBA 1ZC3A 2BMFA 4OLJA 4CYMA 2ZS8A 5DP1A 1GCOA 2A78A 1FSZA 4I1SA 4P3OA 5F1KA 4BNIA 3C41J 4PANA 2HTEA 5AVOA 2Q62A 4EVQA 4Z4HA 1DG9A 4CIVA 2DFVA 2JI6A 2JFPA 4HNAA 1U5CA 1WEHA 2POQX 4L8GA 3ROTA 3N9IA 3BMXA 3PFKA 4J0JA 4GGMX 5JS1A 3TNLA 1RQGA 5E7QA 3KQNA 1JIUA 2AJ8A 1MJ5A 5AW2A 3F6EX 3LW7A 2R2GA 4AZ3A 1A3CA 2Z8YA 1Y81A 2FKNA 3S28A 3PRHA 1SM4A 1OILA 1U0NA 3DLTA 2NVWA 3HI4A 3INYA 3OT1A 4YTEA 4Z0NA 4B75A 2OPHA 4V0OA 1TO2E 3P7MA 5FRDA 1V8PA 2FW9A 1HOXA 3BL5A 3BS4A 3HI6A 4NPCA 4Q1VA 4KDRA 4OSOA 5B58T 2OBMA 1DRKA 3EMKA 4QXRA 1T5DX 3WO0A 5K3EA 4G5QA 5ALFA 1J2TA 1R50A 2LCIA 3AY7A 4UNIA 1AKEA 1LX6A 2F1HA 3DNPA 1XTTA 3TDNA 3OCJA 1JE1A 1OV4A 3L1JA 3ILVA 3JZDA 2FP4B 1ZSVA 5JOQA 4IR7A 3RBVA 3GPIA 2RGCA 2NX2A 9ABPA 2FXVA 1JAZA 3V4VB 5EJ4A 1QNFA 1U3GA 3KHUA 3RSLA 1WABA 2P9EA 3BWMA 3K0FA 3MWJA 1NA5A 3KZOA 5FKJA 2QTRA 2XR1A 2DWPA 4WFIA 1JR2A 1CQIA 3I2KA 4DC0A 1Z68A 5F1PA 1FXWA 2GK6A 1YIAA 1XA0A 3KPVA 3MIIA 1ODLA 2WZCA 2XQFA 3BMCB 4RZSA 3TIIA 3LQYA 3AC0A 4UBJA 3EMVA 4BMOB 4D3DA 2Z9CA 2Q9UA 1T1GA 3KWMA 4QUIA 3GJZA 5K0LA 3UWKA 4AG5A 2ZB7A 4FDTA 1U8AA 3GP5A 3I5YA 2ZXFA 5ABPA 3AVTA 3QWHA 4LK3A 1XE3A 2L19A 1JQJC 2ZTLA 1X1TA 3NWJA 1PJCA 4IL5A 1XCBA 2A9QA 4R41A 5JROA 4WKPA 2AFRA 5CDHA 1SC9A 2IS2A 3WNVA 3CBQA 3OM8A 2KLHA 4TWJA 5HM8A 3L8HA 4Y9RA 4F7DA 2D5CA 2O05A 5FYQA 3I5XA 1V3UA 3LDHA 4PTLA 3V8MA 4DV1B 2INGX 2Q3JA 2FB9A 2WNSA 4Q1AA 3ONWA 4LXQA 1JNYA 4PS1A 4YALA 1ZI9A 1KY4A 2QMZA 2GJAA 5T64A 4C29A 2Z6AA 3IIJA 1Y8ZA 4MS1B 2B5OA 1D2MA 2R8BA 3KOYA 3WQQA 3DBIA 4BVGA 2R8OA 1N7JA 3IOCA 3U4QA 3GVXA 2Q1TA 3ONNA 5AM0A 4RTRA 4BEJA 3U0BA 2HD4A 2XMBA 1YI0A 1GV0A 1QPBA 1ZICA 1F5SA 2VP2A 3RSGA 3ZCTA 4ER7A 2H06A 1VJ1A 1LJ8A 1OHHD 3ZVRA 5KWEA 4KQXA 3W78A 4IKPA 1LC0A 1T3LA 5KU7A 5KJ6A 1QH1A 3CUSA 4RPLA 5HF9A 5K5EA 3TXXA 5EJMA 4RH0A 2OOKA 4NU5A 3EMDA 3JWJA 4OG2A 1UOQA 3FTNA 2NZJA 3RUAA 3ZC3A 3HCNA 3B6MA 3EIEA 1FP7A 4JC4A 3H1EA 1WVMA 1PX2A 4TTAA 2FPPB 4RAOA 3FCYA 2LNDA 3ZQJA 4E46A 1IB0A 4ZI3A 1KEEA 1CR1A 1P2GA 3HMQA 3ACDA 4IIXA 4P54A 5IBPA 1US8A 5KDDA 4ZI7B 2I6GA 4L5BA 2BKXA 1EYZA 1NYLA 2FX5A 3NS7A 4JH0A 1K9SA 4EDFA 3OFND 1AA6A 2C83A 4HPXB 1N0VC 1P5HA 4AAYA 2ZYRA 3K35A 2OD2A 4NU8X 3FOCA 1ZLXA 1FFDA 4HC4A 3NHSA 4BLPA 1OLSA 5JMOA 2DKNA 1V45E 2BONA 2QA5A 2G9VA 3IT0A 5TVGA 3IUQA 2R4QA 3W4IA 1T5OA 4QSHA 1A9XA 2VT3A 3OIYA 1M0TA 3LTNC 1RWPA 2WWTA 4P4NA 4WOBA 2Y1GA 3IELA 1HSZA 4Y2HA 3EAGA 2IYEA 4R1MA 2GEFA 4JI8B 4INPA 1COWA 2JCSA 2ZPTX 4Q16A 4Z99A 3WXBA 1A5SB 4RK0A 2MINB 1T8RA 3QUCA 4JU9A 4YQEA 3DLBA 4V0QA 2ZRBA 3UJHA 1K9VF 3AESB 2FNAA 3RC9A 5EHZA 1E99A 3CUTA 2CLHB 1NWHA 1RC0A 2VPYA 4LCJA 2PG3A 5CPBA 3VDXA 3RIYA 3M4ZA 2AEMA 5F2KA 4GGOA 4LISA 4WACA 4JP5A 2YXDA 4JZYA 5CTJA 4CDRA 5AXAA 1YHYA 4AU1A 4W5NA 4JLVA 4FGKA 3T3NA 2WNHA 3L6BA 4P3YA 4R1QA 3VHXA 1MO2A 1SWWA 3WGYA 3FTFA 1DPGA 5BY2A 2Y9MB 3H5RA 2W2NA 3WGLA 5FL3A 4YX9A 5ED4A 1AM4D 1F12A 1KIAA 2RK6A 3N5KA 2A67A 3UHJA 3NVKI 2X6QA 3LT4A 1JIVA 2GLXA 5CEFA 1OIWA 3M4JA 1G66A 3CG0A 4PLWA 7MDHA 1HKUA 3MAJA 3EPKA 3PGKA 2B9EA 2C2KA 2GCIA 2Q3FA 2WT9A 3IQIX 3VYRB 4KU4A 2RGGA 4MUIA 2WJIA 4QLAA 4WK4B 5EQDA 5H16A 4ENUA 2XUHA 3ROXA 3WNCA 3OTGA 2XUQA 4XIIA 2VA9A 1G8PA 4KR9A 4PSKA 2GFHA 1GTRA 1UWKA 2GFIA 3MM4A 2W2LD 2MMGA 1AKNA 3OE7D 2Z2YA 4UMEA 5I9SA 3ZY6A 3C4VA 4DR6B 2ZVQX 4DANA 3VSCA 3E27A 1MB3A 3AQ4A 2VIIA 3Q9UA 4OXXA 1EZZA 1BJTA 1V2HE 3HG7A 2YHBA 4JT4A 4UVDA 2JLWA 2O4CA 1U02A 2QUKA 3CLRC 3L41A 3ELDA 1HYGA 3QEOA 1YU6A 2HA3A 2LXNA 1EAYA 1X6VA 2PTGA 4II3A 3V8BA 5J63A 4EJMA 3OE1A 1GCIA 1CJMA 3ZZ1A 3GCWA 3RM3A 3NNSA 5ARBA 6REQA 3ODPA 3BIJA 3HBFA 3BOSA 3T41A 3OT4A 3TLXA 1OI2A 2VLIA 2JDIA 1MO4A 4UEJA 3W3AH 3N70A 4I2VA 1T13A 2EKBA 2QW0X 4B6QA 1QZXA 2DBQA 3I2IA 4NBLA 4UHBA 3N07A 5ALUA 3U3DA 3V7YA 1M2VA 1M2OA 2P65A 2WG0A 3IQDB 3W5IA 2H7CA 4M55A 2IHBA 2QTVB 1Z38A 3KZNA 5I7RA 3AEYA 4W8HA 3RRXA 1A50B 2X4DA 4B6GA 4U6QA 5EJIA 4I5GA 4O3FA 1XXHA 1OXVA 1UJNA 1GNSA 2LE0A 2VH1A 5CEEA 1FFAA 4DA9A 5ICSA 4FTWA 1N2CA 1EINA 5HJ7A 3E9CA 4NBVA 3MWEB 1U1GA 3IULA 3O8OB 2AI2A 4OQZA 5DXFA 3WJ7A 4M0KA 2HIMA 1L4EA 4YMLA 1R4ZA 4BMVA 3IR7A 5BOSA 1NVVQ 4WH0A 2O0KA 2RGRA 4EO9A 5A4DA 2E87A 2VTKA 3VYSB 2XCOA 3S8EA 2GZ1A 2WB2A 3S2GA 5CVDA 5EZYA 2VPIA 2F17A 4DQKA 4Q4LA 4QUJA 1FY2A 4PC2A 5TARA 4EAAA 1N2JA 4MMZB 1M8GA 2P2LA 3MJHA 5ECGC 5TSDA 3QOWA 2HJSA 5EPEA 3ZPXA 2VQEB 3U7JA 4DDUA 1PQYA 4GR5A 3G6WA 4KR3A 2OORC 3VTAA 3DTTA 1TGYA 3TTTA 3EEBA 3NRBA 4A9AA 5E7IA 4CU5A 1PV1A 2XWPA 5B3AA 3TR0A 4GMFA 2WWWA 5PNTA 3OZTA 1Z74A 3KTAB 4N8EA 4RH3A 4KIGA 1P7VA 4LPKA 1OZAA 3MTEA 1D4FA 1EDOA 2Q6VA 1H4QA 2BMDA 2H1VA 5FUYA 4KQWA 4NH4A 1IZ7A 2E49A 4TMZA 3ZKWB 1FQKA 1S01A 3QE4A 2BFCA 1JALA 4FJ0A 4GNKA 2IXGA 5HA5A 3ZIAA 4BX3A 4ER6A 1N75A 5IT5A 1GLGA 1BRMA 4RJTA 4KQKA 1RZUA 3ZLJA 3RVLA 2QMUA 3I04M 2W83A 1WB5A 3PRYA 4KWHA 5A3SA 3FH0A 1R0BA 5WRFA 1YZ3A 1SIUA 1C7IA 4RD0A 4OKNA 3TXAA 3CPSA 3LH5A 4IJWA 4M7WA 4C06A 1HDEA 4R9RA 3AVOA 3EJ6A 2VDJA 1EG7A 1QORA 2V7XA 2ZYVX 5TR9A 2R97A 4NAUA 2ZJ8A 5KJEA 4F38A 1WXXA 1W85B 2IS6A 2HRRA 2JIRA 1J21A 2HU8A 2X8JA 4NEHB 4QXMA 3W77A 3DVAB 4Y2RA 1GUDA 3GVIA 4BQOA 3P2YA 4KR0A 3FRJA 3DFFA 3PGA1 3SIXA 5K0NA 3RARA 1CQWA 2R6JA 1J70A 3BXHA 3MRVA 4RSMA 3S1SA 1MDBA 4RQTA 5EOVA 3WISA 1KNXA 1SG6A 2HSDA 3EXIB 2HUPA 2V7EA 4KQIA 3PNOA 3UHFA 2BSXA 2DWOA 2HWXA 2JBAA 2WFZA 4KI0A 1UPUA 1TCUA 4FNMA 4IBOA 2WFMA 1GYRA 2H4YA 1YVUA 2JKZA 5H3HA 4D4MA 3F2IA 2P69A 3DF7A 3R5FA 3V4FA 4DSOA 1YBVA 3TW8B 4DFDA 2ANCA 3UJDA 3BULA 3LD9A 5CFOA 2I6SA 3UK1A 3AP2A 2ZSIA 4IQGA 5AK3A 4KFRA 4BQIA 1CQJA 2QD1A 3C43A 3LFTA 4ZANA 3H87A 4EYGA 5J1TB 1XTQA 2FWIA 4MEBA 2H8KA 2CT8A 3GFQA 3SZUA 1W4BA 3RS2A 3UJ6A 1WPGA 3BXEA 1DMSA 4L3WA 2FI1A 3IAHA 4X90A 4J3FA 2QT1A 1H3NA 3KXDA 3RR2A 2UYHA 2AWOA 3JYHA 3GUYA 3LX6A 4B5LA 2OKGA 3K0HA 2AQ8A 3L8ZA 4L0CA 5ALQA 4YP1A 5G0SA 3LT1A 1UJ5A 2ZJ0A 1EFDN 4P08A 5A5GA 3PEYA 2V5AA 1Q12A 1OYWA 3FI0A 3IP7A 4ITVA 4U3JA 4F5ZA 3ESBA 3HCPA 1E59A 4FYXA 5T8KC 4BNYA 1X74A 4KVAA 1ZM3A 4L8LA 4BAZA 3ROKA 4QYWA 3R4VA 2G77B 1UBRS 1EVQA 4G5RA 2X1HA 1NYRA 4CMGA 2VYFA 3Q5DA 1F4PA 5GOZA 1AV7A 1DL5A 2PY6A 5FCDA 4FX2A 3G2OA 4EPXA 5I6DA 3R0ZA 1TO6A 1O9GA 4NJMB 1R0ZA 3LGXA 4Q01A 4M1QA 3H6HA 5K0JA 2REQA 1I2CA 1Z28A 2IQIA 1DDOA 4QKQA 4GX5A 1FMLA 1OFGA 1KQFA 4DEYA 5K6RA 5ILOA 3A9CA 1SXQA 1VM6A 3ENNA 3GLHA 3W5BA 2WAOA 3W3AD 2XMCA 3G13A 3RRFA 3R20A 1WB6A 1V7CA 1KZHA 3ZCSA 4EF5A 3TGLA 5HTOA 3WZLA 4LAFA 1JHRA 2ZVDA 3JQCA 1OAOC 4GEGA 5CA0A 2J6HA 5JECA 2HDHA 3X1DA 2IY8A 4MYCA 1E9BA 2GF2A 4FYMA 3Q2OA 2KSQA 1OY1A 4JBWA 2EKZA 4PLTA 3VX4A 2HV8A 3DD5A 5CFLA 1EWVA 3MRTA 2I71A 4IG4A 1DJMA 1U2RA 3ICCA 4UBLA 3ZQ6A 2MYNA 4ENSA 5BNTA 5FWXA 4E3ZA 1Y1KE 3GD5A 2H0AA 3JQRA 1NXTA 1TL7C 3INTA 1U2EA 1KMHA 1UP7A 3AR6A 2A0WA 4H1UA 4K6OA 3OOJA 2Q5CA 1D9ZA 2HO4A 2UZIR 2V6FA 3QI2A 4C30A 3B6EA 1KAEA 2I62A 3WDLA 4F0JA 5EJ7A 4RCYA 1QIJA 3E9MA 4DM4A 3U3MA 1OAOA 3H2ZA 3CJRA 3O91A 1Z56C 4GC5A 4P84A 2GXQA 1GQSA 4NRDA 1NVDA 3HN7A 2H52A 2P9TA 3PHHA 4ARBA 5DHPA 3HM9A 1S3SA 3VZRA 4B09A 4C6TB 1NBAA 2J8ZA 2XRZA 5MN5A 2FK8A 3TR6A 3O8OA 3P9CA 1WZIA 5AM4A 4ZVKA 2GF0A 4AJLA 2ETXA 2X3YA 4NI5A 1HT3A 1QFSA 4BRSA 4KVFA 3RROA 5ICFA 5FI3A 2VJQA 3C8MA 4I50F 2GNPA 4I6GA 1Q0RA 2C00A 1EXNA 1G8YA 2GBFA 2YJ5A 3NHWA 5KHOC 2WHQA 1GFIA 3CRQA 1B0AA 1Z5NA 4W82A 4RENA 3SSNA 2NU6A 4KQMA 1KPHA 1TEZA 3JS5A 3C2QA 1W2WB 1AY0A 4KACA 1TD1A 1UADA 1M8KA 5E3HA 2JBWA 1A7KA 1JHDA 2IP2A 4ZU3A 3PDCA 3OQPA 3A3YA 4KQ1A 4MW4A 2R60A 4NYMR 2IIQA 5AVWA 5JJBA 4CEIB 2P3SA 4IWNA 4LBYA 2EAUA 3M9LA 1JSRA 4NK4A 4PYKA 4GL2A 4DUPA 2Z83A 4R05A 1UMDB 4MKHA 4Q4AA 3HJFA 5KVVA 2FMTA 3PA8A 1JHMA 1JKMA 4AZVA 4E21A 3E9ZA 4IDGA 4PXAA 1KAQA 5JAUA 5BSGA 3SJBA 2QX7A 2GHIA 4K9MA 4UM9B 1QUEA 3COJA 3K0SA 1VHQA 3PC6A 1UPTA 4LQCA 4PFJA 3MHTA 1GZDA 2VKQA 5IABA 3WLRA 3M6XA 1N6IA 3WGKA 3L7DA 1LVGA 4LEIA 3UB4A 2FN3A 1SH7A 3FWPA 3NDBB 5TV2A 3UJAA 3VVLA 3IP1A 1AD2A 2X76A 3OCCA 2HH9A 2HMAA 2X40A 1ZXXA 3L46A 2EOAA 1N7HA 2FUNB 2VJPA 3GRYA 4JODA 3WB0A 1HG1A 4Z0PA 2GZHA 4FNAA 4GR9A 1OBOA 1ORTA 1WP9A 2C98A 2V0NA 2XUZA 1FYXA 2BM8A 1HO3A 1SRQA 3B3JA 3LX5A 5KO2A 1OZFA 3OPYI 2V0CA 3GRZA 3TQIA 5CB0A 1E6KA 3FGZA 1VL5A 4R81A 3F98A 2WMDA 4HGYA 2J5KA 3FMPB 4TX1A 2PWAA 3HSYA 3SYLA 3NHLA 1EH5A 1S8OA 1Z0UA 3A6DA 1OAKA 3PNQA 1RHMA 1YT5A 3EG9A 1ML4A 3LCJA 4UEKA 4WECA 4X7RA 4XPZA 5JS8A 4NENA 1R5OA 4K9DA 3HB4X 1SJ9A 4Q03A 5FDFA 1GQOA 3PXUA 4XASA 1NHWA 2I65A 2ZRLA 4YGXB 3W8DA 4CUKA 4D6PA 1OLUB 3TW8A 2QXUA 2DKFA 3OJCA 5J4VA 4HRVA 4MDYA 2X8LA 1E6CA 4CIWA 2ZCVA 3IT2A 3TUIC 4LA4A 2XUOA 4ZOEA 1FP4B 1PGJA 3T7AA 4ALIA 1BXZA 1Y82A 5TVKA 2VXBA 4S1PA 2P7IA 2VNJA 3L0SA 4QQKA 5I7WA 5KNDH 2B1JA 4P38A 5JANA 1N8SA 5A62A 1XTKA 3M33A 4KQ6A 1QVVA 2Q1SA 2UVQA 4QULA 4DB4A 2E4YA 4AY2A 7AT1A 4X8MA 4ZCSA 1QGAA 4XGIA 2W5UA 3KD2A 1Q1AA 1LNZA 2ORVA 4E4TA 1JZQA 3L18A 4EG7A 1D1QA 3A6HA 3H42B 3LO8A 2JGEA 4NJEB 4WBNA 2EHDA 3ND5A 4O4LF 1FYFA 1P9NA 4N4AA 1PFKA 5AOCA 3C6YA 1QXSA 1CFJA 3M6LA 5EYPA 4YV7A 5MN6A 4MKZA 1OOEA 1WM1A 4MEJA 4HLUC 1ENZA 3JZAA 3O4GA 5EP3A 3W3ZB 1JSLA 3NGMA 3WK9A 3K94A 3Q3JB 2RI1A 1DKMA 2L69A 4Z53A 3ZHXA 1N3BA 4BWVA 1V96A 1Z4JA 4R01A 1R0XA 4QDZA 5G1NA 1SKQA 2WF5A 3BL6A 3QF4A 2I33A 2CDAA 2DFKB 1CTQA 2YC4C 3HABA 3KE9A 3N0VA 2OUIA 4L28A 3ADKA 4NL4H 3WWOA 4ETIA 1FFYA 4FEYA 3KEOA 3QG1A 3AO0B 2OFXA 3G5LA 4HH3C 5L6LB 4O4IF 4XJXA 2Z6UA 2BSAA 3AEXA 1RJ9A 2FWRA 1JWLA 3H3JA 3PC2A 4QUAA 4R83A 1FNSA 4EHJA 3HM2A 4W5RA 2JI7A 4RPIA 3ZHRA 1ECBA 4Q39A 2WU8A 5JCJD 1C3JA 2HPZA 3EHEA 5TEWA 1TM5E 3R5SA 4F91B 1G8MA 4PZDA 1QFMA 2H1IA 2PBFA 3QXXA 1TMOA 5K9ZA 2CXQA 1AS3A 1EJ0A 4DRXA 3SDZA 4A1FA 3FA2A 3TNFA 3CEMA 4DEXA 1ONBA 3SX2A 1M34E 3UGQA 3KU1A 3IEPA 3KVRA 3QQPA 5EWLA 3TZEA 4YYEA 4HN4B 1A96A 1ZD3A 3JWHA 3DTVA 3EW9A 2XDQA 4MVYA 4ZT5A 4OUDA 1PVDA 2JFWA 3PQ2A 4GX0A 5CX1A 5BNFA 4QODA 4ZDWA 1GGFA 3ZUPA 4CR8A 4UCQA 1SBTA 1YQ9A 5IXYA 2WKWA 3DTYA 1R9GA 5JRZA 1U3FA 5JFTA 2HXGA 4ZRMA 1PSZA 2FX2A 1LF0A 3BIOA 1KOFA 1QBKC 3GELA 1N1EA 1JQEA 2ES4A 5BNWA 2QRVB 4RIIA 1LBIA 1QGUB 1DAFA 1VJTA 2FLWA 1SFRA 2UU9B 1J0CA 2B94A 2IBTA 3OQHA 4UDOA 4CLOB 3AUTA 1NVBA 1DBPA 3DDOA 1XCLA 2IS1A 1YOVA 1ZUD1 4S24A 4N1AA 4A5OA 5H81A 2VHQA 1NQVA 1I2ZA 1LWOA 4I9FA 5M29A 2ZT6A 3DBRB 1KC3A 2QE7D 3P9XA 5TQ0A 5DW0A 1R6UA 3B2QA 5KVQA 1LZLA 1XTPA 4LZAA 3A6FA 4DDVA 1VA4A 4HDNB 5AUOB 1IE3A 3SQWA 3U81A 3AEUA 1ADGA 2C3OA 2HPHA 1TYDE 2EC5A 3RTBA 4BKQA 3OA0A 5GGXA 3SVLA 1OD6A 3FTCA 1C1XB 4Y2JA 4MDFA 4PPYA 1X94A 4FMDF 3H16A 3LX4A 3SWWA 3LG2A 1UDCA 3HKCB 4NZ9A 1ZCBA 2VO1A 4QXQA 3VR3D 3WJ2A 4BBAA 4Y2TA 5H4GA 4P7BA 1GGMA 1PEAA 2HZ7A 3N59A 3U40A 3VKWA 3A25A 4HNSA 3P19A 1G8JA 3RU3A 4C4OA 2J6CA 2W90A 2C07A 1PG2A 1U8EA 4U6NA 5SYNA 1YR8A 1DTWA 4UKDA 1GG5A 3WIVA 2P41A 3P20A 5DHSA 5ILQA 4DRZA 1HWYA 3FLMA 3ZBPA 3R0JA 4TS4A 4MHTA 1U11A 1LNSA 2QYOA 2EJVA 4GMXA 1C9JA 2CN1A 1I0LA 3DAHA 1WS6A 3VH1A 2P2ZA 2G67A 2NZUG 1CK4A 3SEZA 1WXIA 4DIBA 1D5CA 4PZAA 1C7EA 2ZYAA 2AG8A 1EEHA 3FOAA 1MRNA 3VR5A 2RGEA 1EBBA 7YASA 4KXNA 5DHUA 5CFZA 2H1LA 3MUOA 4JOBA 1QGDA 3JAWB 3QKTA 2OHFA 2BEVB 3U4HA 1V3QE 2CB0A 3DHEA 4KYUA 2D2VA 2IKQA 3IKLA 3KUUA 4ESOA 2CXXA 1O0SA 3HXLA 4Q3DA 1UJ4A 2VRCD 3I6QA 3T0GA 3TFQA 3U62A 1MEOA 2FSFA 3V7FA 3KQYA 2A5FA 1ZN7A 2VK8A 4HS9A 3G8DA 5T3UA 4Z3DA 1NJ2A 3SHTA 1YTUA 1XLUA 1GKYA 3LP5A 3V2IA 1T1IA 5KNDD 4PO9A 2ZK7A 4L0DA 4XUDA 3KUCA 5EMMA 2EKQA 4AWXA 4KXUA 2XKAA 3G02A 1X9HA 3GPCA 4P98A 3WICA 3ZJ5A 2RDMA 5ENVA 5EIBD 3A2NA 1OFUA 2BLNA 5CVTA 3ZWMA 2D1YA 4YXWA 2WE8A 1JKJA 1Z0SA 2UUAB 2QAJA 5C1PA 2AE1A 1T2UA 3JD2A 3K9CA 1OH6A 4BNNA 2R5NA 3CA8A 1RWWA 4N3GA 1AO0A 1H2HA 2HV9A 3F2VA 1IG3A 2HIAA 4JB3A