3L93A

Phosphopantetheine adenylyltransferase from yersinia pestis.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
NAMITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMFTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of phosphopantetheine adenylyltransferase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 53
structure length 161
sequence length 161
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3l93A00
2DXIA 1NYLA 1PFVA 1TYDE 2V0GA 1A8HA 1IH8A 2RE8A 1O94C 1N77A 1J21A 4P2BA 4KR6A 1P7PA 4XFJA 2QUKA 3QTTA 2AZXA 1F9AA 3IMEA 1T9GR 1KP3A 2PG3A 3IUEA 4MVCA 1O0CA 1G59A 3HMQA 1H3EA 2QUJA 3UOWA 1MOPA 4OJMX 1MRZA 1NZJA 4GU5A 1QTQA 3IH5A 1EFVB 3H9BA 1K4MA 2QJTA 4DDMA 2QTNA 5KWVA 2YWBA 2IP1A 4YP5A 1O6BA 1O97C 3IOEA 1PFYA 3GLVA 2GOYA 3S3TA 5FO1A 3P0HA 3IVXA 1XJQA 3A05A 2A1TR 3MMXA 3CR8A 5LM3A 3Q4GA 1EFPA 3IDFA 5TS2A 2QTMA 5IHXA 2O8VA 5KHAA 3SP1A 1PFUA 4QRDA 1GAXA 1OBHA 1ILEA 1MC1A 1F7UA 1WZ2A 1O5TA 1JEEA 2NZ2A 3A04A 5TGTA 2AG6A 4EG7A 4MUHA 2RD2A 1XNGA 1O96A 4MWDA 4MUFA 1QJCA 4XSVA 5DB4A 1T6ZA 3RHSA 3AL0C 1JIKA 5AHWA 3FNRA 1HYBA 5LFAA 2QJOA 1IVSA 2CYCA 2YY5A 4MULA 1D2RA 4EG5A 1OD6A 3MXTA 2J07A 5DASA 3RFFA 1N2GA 3SDBA 3TZLA 2D13A 1TEZA 1N78A 4Q16A 2VTBA 1FYDA 3E27A 3DPIA 3KT0A 2E0IA 1T6YA 3VRHA 3ZIUA 1O95D 4ZT7A 4YMIA 4ZT3A 3Q10A 3SEZA 1N2HA 3CLSD 2DERA 3CA8A 1N2IA 3HL4A 2DUMA 1K92A 1ZUNA 4JXXA 1X8XA 1X6VA 3M5WA 3FY4A 4ZT2A 2J09A 4MVXA 1NP7A 3HV0A 4HJXA 1H1TA 3D6UA 3CLUC 2X1LA 1JEDA 3ND7A 4BWVA 2HZ7A 3MLAA 3ZGZA 1O96B 1ZH6A 3AIIA 4MUEA 4PY2A 3COVA 2A7XA 1IHOA 3ZXSA 4JXZA 1R6XA 3N9IA 2HGZA 2QJFA 1I6KA 1JZQA 4MUNA 1MAUA 3BL5A 4G6ZA 3FOCA 1MBZA 3G6KA 1LW7A 1QQTA 2PZAA 5HUHA 3UY4A 3H97A 3Q12A 2OQ2A 3ZJTA 2IELA 1TYAE 2GM3A 1R6TA 4U63A 1VBMA 3OTWA 2A4MA 4WSOA 1I6MA 3L93A 1MB2A 3DLAA 1EUYA 1GTRA 4XFDA 3K9WA 3FG9A 2WQ7A 2QUHA 4MW1A 2H2AA 3OP1A 3IUBA 1ZH0A 4E1AA 1TYCA 4ZCSA 5FO0A 2CYBA 1U3DA 1QRTA 2ZUFA 2XRZA 1O95C 1Q77A 2CT8A 1KR2A 3ND6A 4MWCA 2X3FA 3SYTA 5HUJA 1NURA 2DLCX 2VXOA 3SZGA 4L2IB 1J09A 4MW4A 3P0JA 3AFHA 5F23A 4ARCA 2X1MA 3COYA 3SEQA 1IQRA 1XNHA 1JMVA 2D5BA 1KP2A 1O97D 1T6XA 3COWA 5IJXA 1QRUA 1KQPA 2R5WA 1OWLA 4MW9A 1N2OA 2DETA 4U8HA 1JHDA 1WY5A 3HZRA 1T9GS 4YBRA 1KORA 3UMVA 3TNJA 1QU3A 4RUKA 3ZUGA 5J5AA 3KFLA 3G59A 4G5FA 4ZT4A 1N1DA 1EE1A 5K0TA 1OBCA 3CLTD 3N8HA 4PBTA 5H16A 4K03A 3RK1A 4WNYA 3CVVA 1O0BA 4NZPA 4MW0A 4OUDB 2J08A 3TQOA 1KQOA 1H3FA 3SZ3A 1KKUA 4MLPA 3CVWA 1TYBE 3AKZA 4JYZA 3IVCA 3H99A 1N2BA 4EG4A 4I6GA 4J76A 1DNPA 3IOBA 3CVXA 4YP7A 3P52A 3LOQA 5KCMA 4ZCTA 3FI0A 1M1ZA 1B6TA 4KPUA 1QNFA 4KR7A 3TQIA 3ZJUA 5FNZA 2A1UB 2E18A 2H29A 1JILA 3G5AA 1I6LA 3A4IA 4MUJA 4MWEA 3UK2A 1GTSA 2X0KA 3TZEA 1GPMA 4EG3A 1MB9A 2E89A 3CVUA 1J1UA 4DDKA 3TS1A 4ND7A 1YIAA 2JANA 2JA2A 4ZCQA 3RBAA 1YIDA 4NATA 4S1OA 4CDMA 1MJHA 3CVYA 4ND6A 2YXNA 4CT0A 3IODA 3IOCA 3JXEA 5TEWA 2BTEA 3CLRC 3MLBA 3PNYA 2GKSA 3RK0A 1J20A 3IMGA 4ZT5A 4MW5A 1JECA 1KH2A 4MVYA 3KT3A 1M83A 2CV0A 3A2KA 1U3CA 1WQ4A 1WXGA 1M8JA 4KKVA 3VGJA 1ULHA 4FZJA 2NSYA 4EG1A 4MUKA 5EKDA 4G5YA 1I2DA 3U1VA 4HJRA 4QREA 4NAUA 4ZCPA 1K4KA 2WB2A 2HMAA 3QE4A 3HGMA 1KAQA 2QTRA 1EUQA 1N2JA 1WXEA 1F7VA 1LI7A 3AG6A 4ZCRA 4MUIA 1TQ8A 1VLHA 4RPIA 3CLUD 3NBKA 2O5RA 4Q93A 4HK4A 4I6EA 3DO8A 5J58A 1EFPB 1WXIA 2A1UA 1U7DA 1YI8A 3H05A 4EF6A 3X1KA 3QTBA 1IQUA 3PNVA 4EFKA 5DEOA 2ZP1A 1OWPA 1KH1A 2G36A 4I6JA 5JBNA 1PG2A 4F4HA 2CV2A 1N3LA 1M8GA 1NI5A 1IFXA 3ND5A 1BS2A 2C5SA 4R0NA 4A91A 2A1TS 1OWOA 4EGAA 4R2LA 1WKBA 1ZJWA 5TEVA 2PXHA 3ZJVA 1G8GA 3FH0A 2CYAA 3PNBA 1H3NA 1V8FA 2DPLA 2PZ8A 4AQ7A 4UZEA 4DDHA 3N2YA 1EJ2A 2EL7A 2WSIA 3K32A 3D6VA 4F3RA 2XRYA 3KT6A 4DE5A 1GLNA 2J4DA 3ELBA 3FWKA 1UFVA 1J70A 3GUZA 3PXUA 1KH3A 3H9CA 2AKEA 3INNA 5BNZA 3I05A 4R2MA 2JAXA 1VL2A 4H3SA 4MQ6A 1YUNA 3NV7A 2DR2A 1NSYA 4NX2A 3NBAA 3CLRD 1EXDA 4MWBA 4U7JA 4AS1A 4MW2A 2I1LA 3N05A 1YULA 3ISJA 4EG8A 4ARIA 1G8FA 1OWMA 1Y42X 1G8HA 1JZSA 1O94D 2IJGX 3COZA 4JFAA 4MW6A 4DNXA 5LLTA 2A86A 3MUEA 2EJCA 1JIJA 1M8KA 1XNJA 1OWNA 3F3MA 5HG0A 4OUDA 1PG0A 2Z08A 1JIIA 1NUUA 2E21A 3P0IA 3KT8A 1KQNA 1WQ3A 4MW7A 1LI5A 1PFWA 1IQ0A 4X0EA 1VBKA 3CLTC 1F4LA 4JZYA 3CLSC 4DJAA 1NUSA 1Q11A 1M8PA 4QBTA 3IMCA 1N2EA 2B7LA 1COZA 2CSXA 1JGTA 4MUGA 2WQ6A 2ZUEA 1RQGA 1KAMA 3RJZA 1NUQA 4CQNA 2QUIA 2TS1A 1GZUA 2YWCA 2BYTA 3GMIA 3FHJA 2DEUA 1U0BB 4CDNA 3LE8A 2Z3VA 3PRHA 4MAFA 1J1ZA 2PFSA 5K0SA 1QU2A 1S4MA 2V0CA 1WJGA 1SURA 2Z09A 3X1MA 1TFUA 4NAHA 4PBSA 3IVGA 5DK4A 4NDAA 5J59A 1M8FA 1WOYA 3AG5A 4KR9A 3X1JA 1CT9A 3C8ZA 1WXHA 4PBRA 4EG6A 1K97A 2VTBB 1FFYA 2CV1A 1GN8A 3L92A 4TS1A 3FETA 4YP6A 4HPWA 3FIUA 1V47A 3VU8A 3LCJA 1NUPA 2CUZA 4DLPA 4GRIA 1Q15A 4MVWA 5H7XA 2A84A 1MAWA 3HFJA 3UC5A 1N75A 1EFVA 2J5BA 1Q19A 1R6UA 1VBNA 4K0RA 1QRSA 4L2IA 2A88A 2CFOA 3ILVA 4KPUB 1IRXA 2PIDA 4J75A 4ZT6A 4UZFA 1WXFA 2D54A 1YUMA 2PZBA 2OV4A 3FDXA 3DV2A 1U7XA 1NUTA 3ZXIA
chains in the Genus database with same CATH superfamily
2H0AA 4FDVA 1D2GA 3JD4A 1X38A 1QVVA 5F52A 4BO7A 1HO3A 3ONWA 1O1YA 1IWPB 4XGKA 4ZJYA 3AVTA 1GSHA 1Z2AA 2QTLA 3GV0A 3WGNA 2CZCA 5KWIA 4UBNA 3ZHUA 4ZVTA 3AOEA 3QTTA 1IN6A 3E9YA 4YXWA 4UHBA 5IVIA 2R1TA 3ANYB 1WF3A 2CB0A 2GYVA 4LKOA 1GARA 3B3JA 2WUVA 1OYOA 2IODA 3G1UA 3PRYA 4RZXA 1P4AA 1NVUQ 2AW3A 3THXA 2JFYA 1BX1A 4P7GA 3DLHA 2PU7A 4C0HA 1C30A 1D4ZA 1U0EA 4ZK2A 5JRJA 3BMOB 2ZIGA 4LYDA 4IXDA 2ZSFA 1LPBB 1LVHA 1TJ5A 3DZJA 3EVTA 3ZVNA 3KB8A 2VXBA 2PUGA 1EFVB 1N5IA 3IHKA 4YA6A 4YUWA 1OFVA 1UXIA 3HY3A 2PH3A 1H1LB 3ZDAA 3LY7A 1W2HA 2C4NA 3LW8A 1MPTA 2ZE8A 2O2YA 2Z2IA 2BR5A 4GYJA 4EUEA 3IPRA 3KTAB 4I3FA 1N6NA 1RYZA 1XRNA 5KYKA 3M2TA 2CWDA 4GRDA 3AR3A 4O2AB 3ESCA 5F7ZA 4C6TA 1M2VA 3DZIA 3H42B 4U0JA 4BXOB 1XLVA 1D0IA 1EFPA 2OG1A 3PJRA 3N0TA 1RNLA 2DY1A 2DQ4A 2JJ8A 2QVCA 2XX3A 1JG3A 1ORRA 4XVRA 2C9DA 1J06A 1KI7A 3ROZA 2R6ZA 3AF0A 4Q3NA 3H5TA 5JDCA 1B26A 2IYQA 4E4YA 3QNWA 2DFNA 2NZ2A 3IV6A 4BMNA 2AG6A 1QFZA 3QBJA 3EFEA 3QY9A 4W1QA 3GOHA 3RHSA 1TM7E 5DNEA 1GNSA 3K9LA 1M75A 1F2TA 1HYBA 5ULLA 3HYCA 4E12A 4BUCA 5K3OA 3N8DA 2CE7A 4RPLA 4AF6A 4CHGA 3FGOA 4G36A 1XTTA 4WXHA 1OH7A 3L1UA 4JNCA 3PP8A 4AN0A 1NVDA 2OESA 2OLJA 3BC1A 3M6UA 3ZVRA 2NO4A 3ERCA 1T29A 1PJCA 3ORQA 1FUEA 2UUOA 1JIVA 4JBHA 3STVA 2PT6A 1OZAA 3DZBA 3V1MA 3OIGA 5B7GA 1MT3A 3EX7C 1KU0A 3WQRA 1TXGA 2I62A 4KN9S 2M1ZA 4GD3Q 5AJVB 3N8KA 2OXRA 3WISA 4D26A 1P44A 1QBKC 2ZSAA 5HF6A 3RPEA 5E7IA 1WCV1 4COKA 3JZAA 4ASUD 4KQIA 4TYMA 5IXYA 4AMVA 3HK2A 1YBVA 1QHSA 3EUEA 3WXBA 3LDUA 3WNDA 3OZGA 5IWCA 3ZE2B 4DLUA 4KQKA 4TPKA 2PUHA 2VAVA 4JH0A 5IJ0B 4MKGA 1GZ3A 5J40A 4TL9A 4J6EA 3BTVA 1AQIA 3WK4A 3JVVA 3NOVA 4ZZ0A 2J09A 3HI4A 1FTGA 1J2JA 1RABA 2AQKA 2I80A 2JIOA 4TV9F 4YJFA 4DUZB 1H1TA 1MMFB 3H18A 3A1FA 3SHVA 1DQRA 2WZCA 1PR5A 2HIGA 4M98A 3L7YA 4QYIA 1ZH6A 2HT6A 3QHPA 4C06A 3A25A 3I32A 5FBHA 4C29A 4HDRB 1IHOA 1NHWA 3V46A 1W4LA 1WXDA 4QFMA 2FR8C 3S2GA 4RZQA 1Y3HA 4LFAB 4R2KA 4YMGA 1Z5UA 1SKUA 3IDOA 1DC6A 1MAUA 1DAFA 2G8LA 4N5MA 1R6VA 2JI4A 3RIEA 5FLXA 2VQ6A 3KAQA 2FSIA 4L95C 5DT2A 2BBSA 2XOKA 4MQUA 5L4NA 5EJMA 1XMQB 2V5VA 4WBNB 5ESDA 1JJ7A 1CUHA 2IELA 3GPBA 3ZDEA 5KS2A 3G2HA 2GCNA 2P40A 4HRXA 4F9FA 2CE2X 4I4CA 3TIGA 4HG2A 3ESDA 2XAAA 3OC6A 1I6MA 4BE7B 1UCFA 3L93A 3NIWA 4X65B 3WMRA 1SCKA 3MWKA 1I1QB 1NMYA 3HDJA 3CBGA 4Q7EA 4OB6A 3AJDA 2IZOA 4RJKA 5JVDF 5HKOA 4XFDA 4YI5A 4JP2A 5D86A 2PVSA 1S2IA 2A9OA 3BG5A 3ES9A 2OZKA 1QANA 1CR2A 2DF8A 4GFDA 2Y1GA 1NMZA 4Z9BA 2UVDA 2YC4C 2VIIA 1QHGA 3OOHA 4A2PA 1P7YA 1NV8A 4N0DA 1GPJA 1PQ4A 1U6IA 5AXBA 3JARA 3NUQA 1TKBA 4WIAA 1KR5A 1LB1B 2CMDA 5UKDA 3FWYA 3SYTA 3AJAA 2B30A 4P3OA 3JQPA 3IX7A 4JVOA 4ZAXA 4DSAA 1P73A 2J1LA 3QUQA 5KQLA 3I5YA 3U7RA 4GSLA 4IDNA 3FWHA 2C8VA 3WK8A 4C5AA 3GF4A 3QY0A 2QSYA 3AEYA 4CF7A 4PPNA 2WBLC 3ZNOA 1HMPA 4L57A 4TS3A 1QF6A 2QAJA 4CEIA 1QTRA 2OY0A 2TMDA 2BEVA 1PR6A 3IIJA 4LTMA 4M7WA 3QP9A 1UBGA 5CUQA 4RLHA 2DMRA 3ZXUB 4ARZB 3ETLA 2Z6VA 1BKDR 3CR3C 5EXXA 5F73A 1ZRHA 2RGBA 1ZI9A 3EHDA 4EI2A 2CXRA 1Z2CA 2WAYA 2JLSA 1KZYC 2B8TA 4U7HA 2C5FA 2LPMA 3PUIA 3I64A 4L4UA 3K5IA 4LSMA 4BFYA 4D46A 5IT4A 4CQMA 1C3JA 1T4BA 4FR5A 2I29A 3OJLA 2O52A 4IJ6A 4FGKA 4OBBA 4F11A 5TB5A 3V1TC 1B6GA 1HA3A 1JDVA 2Q5QA 4NONA 5DHTA 2G9NA 4BO3A 2X14A 3PDCA 3V8NA 3WR5A 3QHAA 2HA4A 1FW8A 1P2UA 2Q1TA 4NMMA 4RTQA 2BFPA 2O8BA 5ALDA 3R7LA 4JASB 3HJCA 3Q3IA 4QJ5A 5A6VA 2RHGB 4E5UA 5IMSA 1V5FA 2Y27A 1QS0B 4M7OA 4EB0A 5KNDA 5F9HA 1E9EA 4WNAA 4OREX 1X7YA 3K1JA 1KY2A 2GN1A 4X24A 1J56A 4HYQA 1USKA 4PAGA 1O5OA 1VKJA 5KCMA 5C1OA 3BQ9A 3DYBA 4GEKA 2FZWA 3LP5A 4OQMA 4KMMA 4DLTA 1UT8A 3G89A 4M9CA 2QDKA 3W5SA 4Z7QB 2F64A 5HKAA 1U0FA 2XTJA 2Q0QA 1F48A 2YXBA 4I36A 4E6EA 1RHUA 5IVPA 4B3RB 4JR1A 4YAIA 4WV3A 2FEOA 4KKXB 4OHUA 4V0KA 3OOSA 2NN3C 2K2WA 2Q3JA 2YWFA 2HF7A 1SKYB 4DCPA 4WZBA 5HX7A 2VAWA 3CW9A 4IGKA 4LVNA 4UBKA 5EC8A 4B6FA 3EWAA 2QX9A 4CT0A 1NT2A 3K15A 1GNPA 1NBIA 1W9MA 1BS9A 1VCIA 1IY1A 2O6LA 3E9NA 4QXPA 4TT8A 3WQSB 4LJ8A 2QE7D 5A5VA 4B7ZA 1J20A 4ZT5A 4N5IX 4F6CA 2WG2A 5JNUA 3MFYA 4GMDA 2UZAA 3IT1A 4ZQBA 4EB6A 3ZY4A 5JAUA 1RJEA 2ODEA 4LF6B 3L9XA 3ORYA 3TQSA 1FZTA 1LRJA 4YMLA 2DPGA 3I5AA 4XAQA 1NG9A 2G82A 3CV3A 1XSEA 5C9ZA 2P2YA 2CLCX 5CGZA 3EA5A 2I0FA 3OM9A 1PS0A 1R9NA 3TRJA 5EE3A 2CJFA 4REQB 1P7VA 4W8HA 2HMAA 1YAJA 2W37A 1QFSA 2QTRA 4MUMA 4OXYA 3U3MA 2X13A 3MW8A 4HWSA 4TQ9A 1F7VA 4QRHA 3OZRA 1YI0A 2J6BA 3AV0B 3CSUA 1XQYA 1V6CA 3CUYA 1A5SB 3KOUA 4P5DA 4UVIA 4X41A 5EYPA 4ZVRA 1E1RD 6GPBA 3ZR4B 3MT7A 1FVXA 2CLMB 3HCWA 4LJSA 5AJYA 2N3ZA 2CJWB 2J6HA 3D4PA 3QW4B 5EL0A 3RSHA 3QVOA 1JU3A 4MB2A 5ALIA 5C32A 5ITWA 3I5XA 1DKQA 1G1AA 2PR7A 2Y99A 1YT5A 2HL6A 1A7AA 4H0CA 1EAYA 4I6EA 1EFPB 2VAXA 4NE9A 5LP1A 1Z29A 3WSWA 2WW8A 4GKJB 2JS7A 3P2MA 2DCUA 3DP7A 3AWIA 3IAS6 1TUBB 2PX0A 3S2UA 3OICA 3EAFA 4B6PA 4GKBA 4WCFA 2PHZA 2VDWA 3R6WA 4IOMA 3UB2A 5GJVC 5EXEA 4XX0B 5SV2A 4DCGA 2HO5A 4EFKA 2C4MA 4D56A 2IDKA 1KH1A 4D74A 2D0IA 3D81A 1P75A 4CQJA 2PGLA 4MIKA 3OE7A 4ZHQB 1P81A 2QW1A 2QDXA 2I6FA 4CQMB 2C5SA 2X3YA 1U7TA 1S2NA 2R62A 5K2MA 1V4BA 3TR0A 4AG5A 2RBGA 2RKBA 3PC3A 5IKXA 2WV7A 2PXHA 9ABPA 3DXYA 3EF3A 5DP1A 4N18A 5TS3A 3ZCRA 4RVGA 4W6QA 2LUOA 2QZSA 5BMVB 2N9UA 4AJIA 2ZUDA 2YMMA 3NH9A 4RQAA 2RGGA 3BTSA 1CZUA 1QS0A 3I9KA 2GRAA 1JN0A 3BICA 3I2IA 4MGYR 3VPHA 4P0TA 2HK8A 2UZIR 3K9NA 3WMWA 2QWXA 1B6SA 3CRNA 3ELBA 3GEMA 4L73A 2JDIA 1M3SA 4KYIB 3PKJA 1K0FA 4HDMB 3S70A 1PGPA 4HAOA 4OHCA 4F4UA 1FVHA 3ZDXB 4TXMA 3H9CA 2FH5B 5IDXA 3NHPA 4HGOA 1U0LA 2CLDX 2GBLC 5IBCA 3CEHA 3QXXA 3TZBA 4IINA 4CTJA 5BW8A 4L6CA 2KJQA 4Y9UA 5FL7A 3UAYA 1ZG3A 2WF7A 1WU8A 1P2VA 1OFIA 5C3UA 5WRFA 3TL3A 1C4WA 5HF8A 1Z39A 1XDZA 1AMNA 1KWKA 2OGUA 4CUZA 4B3GA 3VV3A 2O3TA 5JDIC 4FHEA 1NN5A 3UPDA 4DCMA 4ALNA 3FUXA 2I2AA 3FMVA 3NC1C 3PKZA 4B7UA 4NV1A 4LF9B 3K8ZA 2OC4A 2ORYA 1IHXA 1VDMA 4MWTA 3RAJA 1J5EB 3FOAA 1PKXA 5HG0A 3C45A 1PSWA 1QVWA 3NNNA 2QRJA 3K1TA 4DWWA 5EJ7A 3IAHA 4HWGA 4AJNA 1P9OA 2F8MA 1UC5B 1UJ2A 3CIFA 3QE2A 5GONB 1S3IA 4DWVA 3HJFA 4MV3A 1BXGB 2JBAB 3OZDA 1UP7A 3AI3A 1JI3A 2H00A 1E7WA 1GCOA 2DFPA 3HJAA 3NYRA 1KIFA 1ORHA 1DXQA 1CLUA 1ISRA 1VBKA 3VNQA 3ZE1B 1K6MA 1QG4A 1UBOS 2FPWA 5EHGA 5LMCA 3SX0A 5EJ9A 3DJFA 4HD8A 2MSNA 3WICA 4KQHA 4GXRA 5JXGA 2QTVB 1M8PA 2H6EA 4WWHA 3AI2A 2CK3A 4P5EA 2XD4A 3GLHB 2EFDB 5AICA 4DCOA 2PANA 4OXQA 1QP8A 2R8PA 4LOLA 2IFTA 4RO0A 1RQGA 4AJ9A 1BC5A 1Q14A 2QUIA 2HXSA 2HSEA 2I4IA 1TIKA 2ZRMA 2POQX 3EDRA 2XBLA 1MQAA 3ESAA 3IKJA 3VFDA 4IDPA 2C00A 1T8RA 3R3JA 2GD6A 4PAQA 5D51S 1KZ7B 3KD2A 4B09A 3EPKA 3OWOA 5LQKA 3GIWA 3L7AA 3LYAA 4H16A 4BO0A 5K6AA 2DUUA 2YQ4A 4HGNA 1CUYA 1GT91 2VNKA 1QU2A 2HN9A 4O4JF 2X9GA 3LD9A 5L40A 2V58A 4A15A 4XEHA 2PXCA 2FZ4A 2YZKA 3I0NA 3PGMA 4MV8A 4U6NA 4A8JB 4G56A 4PZPA 4TKLA 3TE7A 4HDKB 3IB3A 4YHBA 4PZLA 1PR2A 3NRJA 1ZN7A 3OU7A 1T3SA 1YZTA 2X8WA 2BKEA 4HDSB 5J59A 5LXTB 2QLMA 3AG5A 2PQMA 3RSFA 1NZDA 3N6VA 1CT9A 1W44A 2REOA 2R1VB 4DCJA 1W4ZA 2ZG6A 3LIIA 1WIWA 1FSSA 1IOWA 1LF0A 3DXZA 3GVIA 1RYBA 5GVSA 1V9CA 2JFZA 2K7FA 3GWZA 1F0NA 1EK5A 1Z4IA 3NWEA 3A3NA 3HVJA 2QPOA 1X0VA 1D5WA 3O91A 4K9QA 3V1LA 3PBKA 3WYCA 4ESOA 1J0DA 2A84A 4EX6A 4M86A 1MAWA 6REQB 3EXG1 3WGYA 1VP3A 1N75A 3FNFA 3J7TA 1NWCA 1Q19A 2C7QA 1V3UA 3DVAB 2WWHA 4IDDA 3JATA 4CG3A 3T3EA 4S1VA 3T3DA 2IH5A 4ZQEA 3FCCA 3CIOA 2EF1A 3LP6A 4F2PA 1TGVA 2J5XA 3WGUA 4D9KA 1DT3A 2G0AA 4U39A 3CZMA 3ZGYA 3DJYA 5J4KA 3WHPA 4ABYA 5AM3A 3D6JA 3DV2A 2H9YA 5EESA 1WF6A 3ZXIA 1AXEA 1EK1A 2GF9A 4KH0A 5KQPA 1OBVA 4ZYXA 1AG9A 1K7XB 3H5NA 3GG2A 3PGVA 3QGMA 2V0GA 1ZIXA 3FWZA 3CWCA 3VR6H 4W5RA 1TZBA 1NF9A 1PT8A 2EGGA 4J29A 4Q3AA 1YTUA 1V9SA 4DR6B 4JEUA 3NIFB 4NDZA 1YI1A 5DLQC 3ELWA 2Q2VA 5DTIA 2CUNA 5FBVB 2VBIA 1U5CA 4KLZA 3WBKA 1GNVA 5KJFA 1N5MA 3EOAI 4C7OB 5SZHB 3IUEA 2DPYA 3ZBTA 3TJMA 4LVCA 1DKPA 1GGNA 4US1R 4CKEB 4KQ2A 4ZVLA 1UXKA 3IP8A 3GG9A 4L15A 4OEHA 1EU1A 4DWJA 1NZJA 3MTGA 3ODGA 4MP6A 5JCXA 4L51A 3L05A 1UWLA 2B78A 5HZHA 2GQ0A 1H2HA 2ZRBA 1KFCB 3GFQA 3NHRA 1KO4A 1DEKA 2XDYA 4GQAA 2O54A 2QQ0A 2D4HA 3HEMA 4MGKR 2EZ8A 5E0OA 1D2CA 2I66A 3HYTA 5JOQA 1W2WB 1GL9B 2Z1DA 3VR3D 2IP1A 3P71T 5KIAA 1VL8A 2VK8A 3CPHA 1T13A 2ETVA 1ZK3A 3EPLA 3ACBA 2P6PA 3S3TA 1HM5A 4FZ5A 2H8GA 3A05A 3JQRA 5LM3A 4MB0A 3Q4GA 4ECAA 4KHZA 4QOEA 4P58A 1UQUA 2VYCA 2AEJA 3SKVA 3UCEA 4CUJA 5TS2A 4BKUA 2NUTB 1XR3A 1RM5A 5E1MA 3IR6A 3OEHA 4OXNA 5KHAA 4K6GA 3SP1A 1IJEA 5B4UA 1ZI6A 3OQPA 5J2TB 1LWNA 2OPBA 1NVVR 3DHEA 3GZ4A 1GRQA 3IPLA 1L7DA 1T0BA 3K7EA 3MB5A 1PNRA 1FK8A 3H11B 1UT6A 2EBWA 4JP5A 2G83A 1TA4A 2PKYX 5BV2P 1WCIB 3OWHA 3QVVA 2ZSJA 3JD3A 3MBKA 3LYLA 4PLZA 4RWEA 4C03A 3FDIA 4IFTA 1N2SA 5K4AA 1CQPA 2KW5A 1E0JA 2OK7A 2ZAGA 2ZI6A 4L85A 5FPTA 4Z4FA 3KTFA 1SNYA 4KVZA 3DVSX 5KUTA 5EJ4A 3SMVA 4BX3A 5I4KA 3TM4A 1E7RA 1JHYA 1XWWA 1FX0B 3A4NA 3TLYA 4YV7A 5KJEA 1WETA 2GN4A 1WDLA 1MH1A 2IYYA 1L4NA 4PLFA 5EE5B 4KPFC 3R0XA 5DRTA 4G0PA 1K89A 2F8TA 1P6QA 3SVLA 1XJ0A 4JLPA 1YDMA 2O7VA 2VDRB 2VHXA 3DPIA 4C89A 2O3QA 1T6YA 3TSYA 1DTWB 3HPQA 1XU7A 4ZT7A 4RSMA 3ENQA 5T8KC 4ZI7B 5MHTA 3BT7A 2WM3A 4PIMA 4Z0PA 3TNLA 4LBZA 3A6LA 5K0JA 1C3EA 1LDYA 2Z1MA 1NM5A 1K92A 5B4TA 4JXXA 1J00A 2FMIA 4Z8YA 1VJDA 5H0IA 1QH1B 4HL6A 2PS3A 5JASA 5ALNA 2R97A 2FK8A 3DQZA 3S27A 2XECA 3ER8A 1T8UA 2Z2ZA 2IXEA 4EVIA 1Z83A 3GFPA 3VR1A 1ZD2P 3I72A 3V8PA 2ZYWX 3FVQA 1QVAA 3O2JA 1XZMA 4WTOA 1XKLA 3HXOA 2P9CA 1KOGA 1IBRA 2YHIA 2YIDA 1LDEA 3D4BA 2ZIEA 5LNK6 3ZXSA 3P4YA 4K9OA 4N3GA 4G9GA 2G5CA 4KNYA 4Y6RA 2QW0X 4LGVA 2Q5IA 3AR2A 3ICPA 4NRDA 4OQYA 4QO7A 2QJFA 2X0DA 4JLMA 3DBRB 5CD1A 3MERA 2FFJA 5HRAA 4FYPA 1KFJB 1Z7GA 2GBLA 1FX0A 3MLEA 2P8JA 3BL5A 1DV2A 2W2KA 4IUBS 3N70A 5J3JA 3FOCA 4BVJA 1S5PA 4XLLA 1MBZA 3DDHA 3BAFA 1LW7A 2PGOA 4EHNA 4IIJB 3JQ7B 2HU5A 3A9UA 4S35A 2XXAB 1KSJA 2X1HA 3I9FA 3R7WB 4FYYA 5F7JA 2XEDA 1HQKA 5TQVA 4QKQA 3ZJTA 2DZDA 2QRQA 4K9RA 2QE7A 3PNLA 3IAAA 9MHTA 1DB3A 2ZKLA 4WPGA 4JR0A 3AFGA 1Y4UA 4G0QA 1QHHB 3M6XA 2Z98A 3STYA 1AQUA 5HVNA 4J3JA 1TMGE 2FZEA 2O2HA 4O1MA 2IF0A 1N6HA 1UPAA 2EKDA 2F00A 2V3VA 3FSGA 2ZT6A 1XE3A 4MEJA 4L5YA 5FWDA 3WFJA 4ZFNA 2HJWA 1Z17A 3FG9A 3OURA 4JITA 2BFDA 4UNNA 2CJXA 4UNPA 1IZ7A 5IF9A 5ALFA 4E1AA 1MC5A 4CVNA 2CYBA 4OHRA 3V42A 3PLNA 4TGLA 1H4QA 1T0IA 1GZ4A 3ESXA 4XWOA 2HQ1A 3ND6A 5FJJA 4YAJA 1HTBA 4IVPA 5L3ZA 5AW1A 2IUSA 1Y98A 1A8PA 1JQLB 2OORA 4BMPB 5JCZA 3UXMA 4RLFA 4S1TA 2XNSA 1J09A 3HCCA 4LXHA 2Q4TA 4JA2A 2XW6A 1IXZA 1GVNB 3OPNA 1K27A 4CF3A 4BV8A 5LP6C 1JMKC 3R3VA 2R87A 2YW9A 3I58A 3OLXA 4AG6A 3QUBA 1D0SA 4CR8A 2G9UA 3HU1A 4FK8A 4DARA 1QBGA 7REQB 1NI4A 4JLBA 3ZEAA 4C6HA 3G8AA 4F1WA 1RRGA 1WY5A 5G1PA 4A8JC 3I04A 3JRXA 3UMVA 4CQLB 2YICA 2XUJA 3UT0A 2CXHA 1TD1A 5FPPA 4HDSA 1S7CA 3EOBI 1ZGAA 3NHYA 4UZSA 5CBPA 4PN3A 2C20A 3CLTD 3D59A 4WJZA 4TZ0A 4K03A 3FBWA 4ZAYA 1TO2E 4KIGA 4RKYA 2P3SA 3AY6A 3QVGB 1LVGA 1XZBA 3KBOA 3JPYA 1H94A 2PMBA 2RG1A 3C4JA 3LHIA 1M34E 1U65A 3VSEA 3KDSE 2Q3BA 3RGGA 5CEEA 1KY4A 3H87A 3P9XA 1TTHA 3KX2A 5ARDA 1RQNA 2GFIA 1OF1A 5ES4B 2RGXA 1XAJA 1F12A 2OM6A 3B6IA 3O0DA 4BJ3A 3EMDA 3NHBA 5C8ZA 3CVXA 4XPZA 5JU6A 5CX4A 1E60A 1SH7A 2J0SA 5CMLA 1Z4QA 2G1JA 1G0OA 2OC9A 4QUBA 4RF4A 1O9HA 1PW5A 2IPAB 1P5FA 2DR3A 2ZTVA 3FPFA 5KQRA 2X0RA 4EUKA 2XCSB 2YV3A 1R1DA 1RKVA 5HXAA 3CBQA 3PFKA 3FBTA 1DQYA 4LOIA 4I5DA 1SUDA 1U3FA 3IQDB 4LWOA 2QSZA 5T6MA 2YWGA 3HTXA 1VSQA 3O4FA 1QQ6A 4DMHA 2Y93A 2WJPA 3KJEA 3RO7A 1YVRA 1VRWA 3ZZNA 4Z6KA 2X0NA 4Y2TA 2BHNA 2HO4A 2R60A 2BH9A 4D6XA 4FOTA 4DSZA 5HPYB 1XK6A 3IMGA 5JJLA 3AU8A 3DWEX 4C0SA 4UNIA 4MYHA 4W5JA 2QYOA 4OGLA 1NXVA 3PQCA 1Q16A 2AX3A 3AOEC 1NAIA 1KXZA 1U3CA 3F6EX 4KKVA 1M8JA 4PWYA 2AD1A 5A3SA 1IN5A 4PZ9A 3QK7A 5G0SA 2PKCA 5FPHA 2NZYA 4X6XA 2PMDA 3FOBA 5TQJA 2WB4A 4PCUA 4WK2B 5EKDA 4QM7A 1EUCB 4OHOA 5KAMA 1TYZA 3DC2A 4NIMA 5BRNA 5LZ8A 1UKBA 1EFTA 2YWJA 3CSDA 1P5RA 5IDWA 4HDMA 3EVZA 1Z0JA 1T9KA 1DSSG 1Q91A 1Z0SA 1U8EA 1GAQA 1J33A 2BI4A 5AK5A 5DW3A 3WKEA 3DR5A 4QODA 4BCBA 4BQIA 1PIWA 1V96A 3N74A 1JIUA 3HWSA 3SF8A 2J6CA 3G17A 3MCTA 4INJA 2OORC 4W5TA 1AZWA 1UOPA 3V1NA 4D4GA 4CGYA 3UNXA 5M34A 1NGSA 1DUIA 1F06A 1LV8A 1P7WA 2Y1WA 3DO8A 3HB5X 4L9WA 1YV9A 4D9CA 2A8YA 4ZQCB 1PU2A 3VNSA 4MITA 3FTCA 3O8OB 1NFQA 2FPUA 1LZLA 1N6OA 2OGWA 3BD7A 2Q0XA 4LSWA 5B53A 3TW6A 4BVBA 1BMTA 2NXWA 2P8SA 2F3PA 2IEAA 4MR9B 5T7BA 4WFJA 2FG6C 2AQ8A 2QM7A 1TL7C 1JDSA 2FA9A 2VJBA 3FAKA 1L5MA 2P9GA 1U2GA 3KEMA 3TPCA 4MQ5A 5A3QA 5BWBA 4H6WA 1MZPA 3FTFA 2V74B 4GGMX 2B25A 4ZZ2A 5CVEA 3RHFA 4ZTUB 3UW3A 5TDHA 1K7EB 3NM5A 3EDOA 2XE8A 3FI9A 4D0RA 2R96A 1XJWA 4R0NA 2I4OA 5DWQA 3M8KA 4TL8A 1CJVC 3LT1A 1GPUA 4TKMA 3W7BA 5BMOA 3KXKA 1XTPA 1KMMA 5AVTA 3L49A 4INZA 5TPZA 1WD7A 1N2CE 1KVRA 2X7XA 1JG6A 2PRYA 3MINB 2CYAA 1QK4A 4YCJA 1R8XA 3EGXA 2FPPB 3M0EA 4UCXA 1RT9A 5BRAA 1ID8A 4EM6A 1G5TA 2RGEA 4GH5A 3WGVA 4Q9LA 1ZVMA 1Z8NA 2FCAA 2A59A 3WGMA 3IDSA 1BHJA 1GTMA 3TSOA 3DOCA 4LE1A 4S0ZA 1WEHA 1J8QA 1X1DA 3DHNA 3E3NA 1V45E 2JZCA 3DKVA 1BYIA 5DDIP 2XZLA 1YZUA 5P8WA 3ZNPA 1BROA 2BFFA 3FNGA 5KWSA 2RJOA 4JGGA 2Q4OA 1FSZA 4TLAA 4A23A 3DM5A 1BE1A 1UAAA 1PX2A 4H1TA 1F0YA 4KO1S 4MPRA 5HCUA 4EPWA 2CL5A 2R25B 5EMLA 1NSYA 4KUHA 1DWPA 4F3TA 3BB3A 1D07A 4DJEC 4HNSA 5J2TF 1SIOA 5KTOA 1N2CA 3EFOA 2WPNA 2YIMA 2C2BA 1YULA 3LSTA 4DCVA 1VPWA 2P0EA 4BNMA 3T99A 4YRKA 1I5RA 2XMDA 1Y42X 4BBAA 1G8HA 1CF9A 3HLKA 1O94D 2Z8YM 3JWPA 4CF4A 3PB3A 4DNXA 3ETHA 1GG8A 2A86A 2B20A 4XB2A 1YJQA 1EMDA 3ONVA 3T1OA 3C48A 1H2RS 1DRKA 2P9HA 2HH9A 4GI5A 3E5NA 2Z6AA 3THWA 1JTEA 4JVNA 5B3AA 2Z08A 1Y8CA 1PG5A 4BX0A 2WIBA 3PPYA 4URFA 3S1SA 1II0A 5KDDA 2SKEA 3L7DA 2Z9BA 1Z5PA 4RZ2A 5CT9A 3TL6A 4YBZA 5JZBA 1V8BA 2GXSA 3H8WA 2ZS8A 4XR9A 1HDIA 4BQNA 4P7JA 1YB7A 5JRDS 4ALJA 1ZIOA 2CNWD 2V97A 2WV9A 1PV4A 4IFBA 3EXFB 2AK2A 2ZYRA 3E81A 5DWDA 4L0QA 1XRPA 3LTEA 1ZCFA 1NFFA 3EMKA 4X97A 5FDFA 1TQHA 2QORA 4M0UA 4BMOB 3OY7A 4RZHA 4REQA 4GXTA 4DM4A 4L5JA 2AD5A 3AYZB 4CGZA 1DTWA 3ZWBA 2HM7A 3DE4X 3E5RA 4LISA 4X1KB 4I81A 3E03A 2B7LA 1J90A 2COUA 4V3BA 2O8BB 4AMZA 3LBYA 2ZIXA 3BREA 3USZA 2RHTA 4YALA 7AT1A 1SBQA 1ODCA 2JCGA 2XB9A 4FYIA 4RD6A 4H7PA 5CNJA 2OV6A 5F77A 3JQ9C 3MGGA 4HNUA 1UK9A 1DX9A 5JS1A 3NBXX 1UMCB 3DD5A 1SEVA 3ZBUA 5C8VA 2TS1A 3BJRA 3PC2A 1YVPA 1BXZA 1HT0A 4F2GA 2HRQA 4FGJA 4ACBA 4PNEA 5K0CA 3NDPA 1Z88A 4ARAA 2NADA 1CY6A 4YAKA 1ZC3A 1T36B 2XMRA 3D4IA 4QQFA 1B2RA 1JDUA 4GVXA 1XZHA 2P3LA 4A8PA 3PRHA 5CDTA 3AJEA 4J7CA 2CHUA 3C4VA 3ECAA 4N8EA 2YHIB 3P20A 3U2QA 1TJNA 3P2OA 4EJSA 2QNRA 2NVWA 4OM7A 3RU3A 3R0ZA 1P3DA 4CKEA 1TFUA 5K9ZA 1YC2A 3H19A 1QCCA 1YA4A 2E1PA 3TR6A 4FZRA 2QA5A 3S2IA 2WI8A 4L7QA 4E5MA 3GGCA 5FQNA 4DQ0A 3VDXA 2XEXA 1RCTE 3ZLUA 5BP7A 4C0KA 2ZIZA 5TQ2A 3EGXB 3KUXA 4U9IS 2CV1A 4H59A 5FBWB 1U0SY 2ZUWA 4HPJB 4RGQA 4YREA 4W1SA 4YX9A 3PQ2A 4DA4A 4QXOA 4YP6A 4B2IA 1Q1GA 1QIDA 4ZAGA 5C1PA 3NWPA 2FFBA 2VDLB 2RHOA 3CE9A 3MGCA 3VU8A 3LCJA 2CUZA 5E4FA 3SICE 5GADl 3S29A 2I8LA 5IAGA 1E20A 1Q15A 2MMCA 2W2TA 4FKZA 2X0EA 4ZV9A 3W8EA 1KI9A 5DGHA 2ADFA 2FX3A 4CW7A 1GAWA 2QD1A 5LLSA 1JG4A 2B7CA 5HW0A 5CCDA 3GRUA 2FP4B 4P3NA 2RKOA 1W4RA 3CEMA 4K0RA 2PEYA 3UGTA 3VBEA 1F17A 3M82A 1QRSA 3JZIA 3L6DA 3DOJA 1FNCA 2HA0A 2QZ9A 3HGQA 3ILVA 2A9VA 1X3SA 5A7HA 4CKYA 4DMMA 3FOEC 1VFNA 4DIEA 4DRYA 4FB4A 1CEEA 4O4JB 1MHPA 1N9ZA 4WQMA 4WRRA 1L4LA 3ANLA 3LC1O 4R9UC 1KMHB 1GL6A 1S6YA 1CR6A 1N2CB 4Q39A 2D7CA 4G0WA 2FUKA 3EG9A 3S1AA 1ODKA 4MV5A 4ZV4A 3ZE6A 2A94A 1W52X 3QU7A 2IH2A 3MJHA 5ALWA 1V5GA 1HDXA 3AY3A 2GLTA 4LV6A 4ALMA 3RRZA 2O57A 3BBPA 1KEEB 5KOIA 1GTVA 1XAHA 3KZKA 3P9SA 4R69A 2BUAA 5E8JA 2G76A 1BEZA 2CFSA 4QWMA 2BL4A 1N4AA 4BCCA 3WADA 2R4TA 4MLZA 4F71A 2ZUSA 4L7VA 2CMKA 4OQDA 1GKYA 1PKEA 2B83A 3NRBA 3VTFA 4URHA 3WDKA 3WAKA 5AJHA 4MS3B 1J0AA 3MS4A 5IUNC 3GQVA 1FX1A 1GLGA 3L1IA 4C05A 2QIPA 3T3GA 1PQUA 1ZK2A 2MINA 1KY5A 3FLBA 4G37A 4JKYA 2GJ9A 5DHSA 1SKQA 3F67A 3KAJA 1OXTA 4DSNA 4DANA 4TXLA 2YZ2A 3WMFA 4U5QA 4E2WA 1ISFA 3IOEA 4IIVA 2XMPA 4M8NE 4H6XA 2EW1A 1M5RA 4Y2UA 2Z3ZA 4W5HA 5CU7A 1XJQA 2I2CA 2H1CA 3SPXA 4HGYA 4D43A 3BWEA 3RRJA 2ZSIA 4CXMA 1Z9BA 3AW9A 3DMYA 3GJ3A 4KO4S 2VWGA 2QTMA 3VJRA 4NK5A 1HE4A 2P6MA 5AKJA 3PR2B 1W8DA 2OCKA 2WHXA 2IUFA 3O95A 1X1EA 4PPQA 5ALSA 1ILEA 4C3OB 2L82A 3KE9A 5B1DA 5LQUA 5F78A 1IVYA 3PFFA 3UVEA 2XQJA 2R6GA 1N5RA 3OJOA 4WE3A 2RD2A 4KWEA 4OB8A 2JGRA 5LMUB 3TDNA 1NUHA 2CZQA 5EPEA 2B82A 3QOYA 5CTAA 3C7AA 2G25A 1XYGA 1GDHA 1TK2A 2RCNA 2YY5A 4IF6A 3K5HA 3SJUA 3V6MA 1DRJA 1EVYA 5ERGB 2XMCA 1ZNYA 2DQZA 2XQIA 4G5HA 4Q4HA 1L5HA 2KB0A 3UA3A 3A1TA 4KXNA 3EHEA 1TEZA 4FDAA 1YJ5A 2TMGA 1G7CA 4XM1A 4NYIR 2EKBA 2JFBA 4YCDA 2QTTA 2ZS7A 3BWYA 1P4RA 1W0KD 2Q3DA 1YFJA 1O95D 2C57A 3T38A 3R8FA 2OZPA 2M9MA 1I2ZA 1PLLA 2A5DA 4MRMA 4OFXA 1D2MA 1S8FA 3KS9A 3A0RB 1R27A 4NYMQ 3F1KA 4KMOA 4WLVA 3SEZA 1V6SA 3V1KA 1VFPA 1JQKA 2I1QA 4FWBA 4I1VA 5JNLA 1NFRA 1EFKA 1NXSA 2JIRA 3MOGA 4EW3A 1OLSB 2ZATA 2ZAYA 1U98A 1YH3A 3FYHA 5K3FA 4GUDA 2PSDA 2VP4A 2O5EA 2ZJZA 3NDIA 4L07A 1WW8A 1FPMA 2DUNA 1VLQA 2P0YA 5FLKA 1PTKA 2X1LA 3GBSA 1RXVA 1X7WA 4N4AA 4AO6A 2DSTA 1NLFA 1VJCA 3NKLA 4V24A 3QW2A 3SEFA 1OU4A 2K2QB 2O2DA 1SUAA 3AIIA 1OAKA 1AKUA 3COVA 4YRQA 4JUBA 1XYYA 5GIOE 4URVR 3MSXA 1DIRA 2HUPA 4PLVA 4YECA 5DTRA 1DAEA 1CFZA 2PSEA 3S2YA 2E37A 3UJCA 5IKPA 3RIXA 1RWMA 3NANA 4TRMA 2V3CC 4M9ZA 4Q9HA 4MUAA 2JJYA 3KL2A 4PCLA 5TXGA 2WWGA 1QLWA 3QEJA 4W8GA 1EX7A 5CDFA 2PGAA 3TAHA 3H97A 5BURA 1QCDA 4QSMA 3TTXA 3UWKA 4WA8A 1DPFA 4TXJA 2C9CA 1T34A 2Q7XA 2Y0CA 3L40A 2O8NA 4GKAA 4TQUS 1R6TA 1XL0A 2A6PA 2F1HA 2JGDA 2AFRA 4U63A 3A37A 4ID9A 1ZM2A 5FBZA 3ZYCA 5CAEB 5BN3B 4OFZA 4RH1A 4B3MB 5CT4A 3RARA 3HUUA 3R41A 3AOGA 4DCNA 3IDAA 5B2FA 4C0AC 2BGLA 3BCRA 2HSJA 1QORA 2YWRA 3IIMA 1EVJA 3KQVA 3URMA 2A1IA 1ATIA 1UBJS 2Q62A 4FSXA 1OI2A 1QP0A 3HY6A 4TROA 4Q05A 1UBSB 4OBXA 3WSTA 3F73A 1U6JA 2OCIA 3SHQA 1HL3A 4FI3C 5BXYA 4UTZA 5CLLA 3I1FA 1DEXA 1YL6A 3HFSA 4BN5A 4MRPA 5HFJA 4YMTA 1LLQA 1P2SA 4FOOA 4NE7A 4GMKA 1G8KA 1JQDA 1FP6A 3A9SA 3AIOA 2ISSD 3UMJA 2DLNA 4YUVA 4MS1B 3WGQA 5BNTA 5T64A 1SC1A 1C8KA 4EHIA 2GPSA 4BTVA 3ZQ6A 3GGDA 1W87A 4Q7QA 4ETIA 3P0EA 1KFEB 2A5YB 3HBMA 3V4FA 1M33A 1SBIA 2J9XB 3DOFA 2HGSA 4ZDIA 3PUKA 2HMWA 3DL7A 2IPOA 5I7SA 2RGAA 1DIHA 1RTTA 3PQ8A 4P31A 4W9NC 2CJYA 4YBRA 1RIIA 1PZXA 3T9EA 1U31A 5COAA 4MVJM 2JI7A 4P32A 3M2PA 4R1UA 2C58A 5BUCA 4EMUA 1SULA 3C3YA 5F2OA 3W4JA 3RUHA 1YKGA 5TPWA 1EE1A 4A6DA 2F43A 4FDTA 1OBCA 1VE9A 2H4ZA 3PQ6A 1ZITA 4PZEA 4RELA 1D4AA 3RK1A 4U1RA 9LDTA 4PRYA 2M1XA 4LWPA 3DEKA 2F48A 1FP4A 3ET4A 1C9YA 2AOUA 3OFKA 1WB9A 1H3FA 1H93A 2QMEA 4GIBA 1YOBA 1HDEA 3QNMA 2EFEB 2EP8A 1ETHA 2YH2A 5L95A 3MELA 1GP2A 2VJMA 2VT6A 4RVFA 3OMWA 3E7WA 3H99A 2JI9A 2I7TA 1DV1A 1SC3A 2RFLA 2YS6A 1GZ6A 2H63A 4RIEA 4TMFA 1G38A 3FMIA 5KYUA 1I2CA 5DCYA 4F12A 1B6TA 1PK9A 1YE5A 2P9FA 5LZ7A 3UJBA 2WP0A 3DAFA 1BQ4A 2V96A 3CMCO 2Q9CA 3MMPA 2CC2A 4P4LA 1Z4OA 2W2VA 2WRZA 1I80A 1P17A 2A0WA 3KKMA 3A1NA 3U3KA 2OYCA 1T4DA 3SQDA 5JNVA 3HMKA 4HV4A 3KYCB 3UXYA 4V03A 4YRAA 1Q20A 1J1UA 3NZEA 2PZMA 3TS1A 5ADVA 4Q1CA 4U3JA 4EDFA 3LFHA 2PH1A 2L69A 4RE5A 4F5WA 2UYYA 5U4QA 2E1RA 1Z5ZA 3R3HA 3EGEA 2NP7A 4A73A 4OB7A 3W6PA 2IY9A 3KV3O 3WDSA 4MVJD 1INLA 1E2LA 1FU4A 3KLPX 3KLOA 3DWIA 4QU0A 3SYRA 4EYSA 1LBQA 1ZISA 1ZD5A 2EBUA 5C3MA 5FH9A 4OLBA 1MB0A 3FPLA 2CNOA 2V8BA 2C5HA 2FPPA 3PQFA 4G8JA 1I4WA 2E4XA 1XXHB 1THZA 4KK4A 4RHUA 5CT8A 1T24A 4ER6A 4FZJA 4HQFA 1H0RA 5F2EA 2K5UA 3KJHA 1F8XA 1A8UA 1NJ1A 1I10A 3QVLA 4IYRA 4J1NA 3PX3A 2W6NA 3G0IA 2GX6A 2HA7A 2IHBA 5ETJA 1XZDA 3U1VA 3UJAA 4WFIA 4Y6PA 4Q3EA 2ODWA 2MCFA 1KJIA 3DEZA 4PE5B 3TQRA 3TW4A 1AUQA 2A67A 3FTDA 3A14A 4IFEA 5KYNA 5GVRA 3BXHA 5DYIA 4DRZA 4O3MA 1Z45A 2HUNA 1GCGA 1U9CA 1L5RA 1O54A 3E7XA 4GYWA 4IQFA 4RAQA 2HF9A 4GW3A 4DDTA 4ZAWA 4ZZ3A 3TGLA 1FIUA 4MMZB 4ZO6A 4BJ1A 2JCYA 3K96A 4EEKA 5AD1A 2WTBA 1IIRA 2HT1A 2ZE5A 3PC8C 4XUDA 2J9RA 2P7HA 1PNTA 2AYYA 3M4NA 1E7MA 2LIVA 2Y4NA 4G8CA 4JL8A 4C4ZA 1I0ZA 1F8UA 1QC5A 3ZHBA 4NMHA 1EDEA 1SU6A 3Q7QA 1BH6A 2WF8A 4MX8A 4RHEA 5K0NA 3R3ZA 4JELA 3PXDA 3FLAA 1U7DA 3HA2A 3N6XA 1YI8A 3UT6A 5FUQA 5CA0A 1IN7A 4G1VA 4LN1A 5FOSA 2JAQA 2WG1A 5TQ0B 1FCJA 1KKMA 3UJ7A 5BSVA 1M76A 2IF2A 3PF8A 5C80A 2BJHA 2VSXA 3AT1A 1RE1A 4J0KA 4JHXA 5KKAA 1NHGA 4LCJA 1BFUA 4TV9B 3R7SA 5I7EA 4ND8B 2QPTA 3C74A 3ZWAA 1Y6QA 1JU4A 2I1VB 4CL3A 2B4AA 2BGMA 1IFXA 3JV7A 1I24A 3D2CA 2C7PA 1E69A 1G21E 1SUSA 2IU4A 1KO5A 2NVUB 4IHJB 3WLPA 3JAMA 3LYUA 3UA4A 1A4RA 3ZZTA 4Q21A 2FN8A 1WSWA 4NOLA 4CMBA 4INAA 1RMYA 3H65A 2QT9A 4QUAA 1IWBB 3R7WA 1R5NA 2ZB4A 3NVKI 3ZI4A 1SU4A 3DFMA 4G0VA 1UM8A 2F1RA 4NC9A 4AQ7A 4DDHA 1X19A 2D59A 1P0CA 3KR0A 3Q7TA 4KDFA 3L1HA 1ZUNB 1TT7A 4WACA 4MRMB 5HTKA 5K8JB 2JEOA 3D6VA 2VNAA 5I47A 3KT6A 8ATCA 1AZTA 1C0LA 3SQWA 1EE9A 5KKCA 2OBMA 5B12A 1J70A 1D9ZA 1F6DA 1FNBA 4UCFA 3SFVA 1SPXA 2DTEA 4X61A 3CF0A 1Y3BE 1WSAA 4O4LA 1RZVA 1YS9A 3GXOA 1SG9A 4R2MA 1F8FA 3Q2OA 4X3PA 3T4UA 2ZRLA 1NR7A 2FQXA 2XYGA 3Q9LA 4FYWA 1ZVQA 5K0EA 3HBJA 3F4BA 1W30A 2YFYA 3MBIA 2PJDA 4OHKA 4AMGA 3HB9A 4C4RA 2FQQA 3WFZA 3QEKA 4QU8A 4M1QA 4PSCA 4RY2A 3S2EA 1FNDA 4RM2A 4LXGA 2RHDA 3UZUA 3RHZA 3KDPA 3BL6A 4LRWA 2VPYA 4K9SA 3CXRA 3WNCA 4IHJA 1QKJA 3N1UA 3L4EA 1CFJA 2G8NA 2MYTA 2WUFA 5GWXA 4BWGA 1L1FA 5KTKA 3UPUA 2XKJE 4HFNA 3BFVA 4PLHA 2OZLA 4KIFA 4UUPA 3PD0A 4QASA 5AR1A 1XO1A 1RRKA 4TM8A 3SLRA 4PYQA 4Z4IA 3F90A 4WW0A 1SQ6A 1P3Y1 2P5YA 3E22A 5IM4F 2C82A 3AKCA 3DE7X 4CWAA 2JJ1A 2EERA 3I01A 4KR2A 1CY8A 2MJLA 2X77A 5AKHA 5IJ0A 1QP7A 3A3PA 2OOSA 3F46A 5IARA 2X5NA 3FOFC 5H02A 3VBCA 3RJ5A 1LRKA 2PKWA 1UT5A 3OUZA 1XMPA 2NXEA 1NF2A 1P31A 4N5LA 1FDTA 3RSCA 5L45A 4O6VA 1QK3A 4WJKB 3L06A 1D7AA 4D99A 4YYZA 4G4GA 5H3CA 2VTDA 3V9AA 1I0IA 2CSXA 4BNYA 3CS3A 3TLEA 2BMFA 2QT0A 2NU8A 3O2QB 4C7JA 4Q03A 3SF8B 3EVAA 2YZMA 3NW9A 3R0IA 1M66A 3JAKB 2XTAA 3AR6A 2FN9A 1OE0A 1A71A 2P91A 3DE0X 3UFBA 1T3ZA 4AF7A 3GMIA 4XYBA 2XJ4A 3W2TA 4BMVA 1OCEA 5I7WA 3V2GA 2XCTB 1YKSA 3U26A 2AH5A 2PJUA 5CM2Z 4ERXA 3NAMA 4OHVA 1PWHA 3L4BA 4HB0A 4BN0A 2VA8A 5TV2A 4MRNA 1S4MA 5K0SA 1DCKA 4LZAA 3DYIA 1LBHA 1JUDA 1ZD3A 3O8DA 2WYVA 2ZSKA 3O47A 4LQCA 3WMGA 2ZWOA 1YC5A 5JSZB 1TIBA 1CVRA 2NV6A 4NAHA 2NU7A 5CB4F 3H6KA 1ZINA 2OPHA 5DK4A 4U9HS 5DNCA 4YJ3A 4LJ7A 2WKPA 3UTDA 5G53C 2R8XA 4ZOLA 4W5OA 4I7EA 4AB1A 1CUIA 4H0FA 4ZOEA 2AR0A 1KI6A 1R0KA 1U7UA 1W46A 2HHJA 3CX3A 1XKXA 3GJ4A 3KQSA 3ND8A 4K88A 4EG6A 4HLQB 5B7QA 3WLIA 2O2JA 5ABPA 1XALA 3BD8A 4NEQA 1PWXA 1VKZA 2I6XA 4DNQA 4IH4A 1SUCA 4GSYA 4DYHA 3BH6A 2JFWA 3GYGA 3H6HA 5K8TA 1BWPA 1VMDA 3BWMA 3O8QB 1KEWA 3IE0A 1JVBA 3TIVA 1DG3A 5TRTA 5CFNA 3H0EA 4L02A 2NUPA 2QSUA 4N6OA 1XQXA 2VYVD 3JQFC 3DW3X 2HFKA 4HVCA 3MF4A 1XEWY 3LK7A 4EYEA 5KTNA 1K2WA 3VUFA 6ADHA 4EKYA 2OBLA 2X8AA 2AGVA 5BSFA 5DNDA 4B43A 1L7PA 1UBMS 5L3QB 2CFOA 4NCKA 2HBRA 2JJ2D 3GR6A 4KPUB 1R3DA 1QLJA 4URZR 1WS6A 2IIBA 4DHEA 2GAJA 2PTHA 1QYXA 3A6FA 4Q1VA 5G0WA 4BAUA 3G68A 2JK0A 1YBMA 4I9NA 3CFYA 1KAEA 3BMXA 3LBIA 1X70A 3RTGA 3WRVA 3FFBA 1E2PA 3ZGXA 4UDYX 4E1BA 2ERXA 1X74A 5JDIA 1DLJA 3VTZA 1VSVA 3L3BA 2BMVA 3CC8A 5AJWA 1UBLS 1T2DA 1MO3A 3VAZA 5CGQB 3JVIA 1O94C 3FPBA 1J21A 3I5MA 2P90A 3X43A 4IRUB 5LIPA 4J1TC 4P2BA 1MZVA 1L7MA 4BQSA 4R1OA 2QJWA 1AO3A 2VXYA 4W63A 3ZCUA 4Q3BA 4D3ZA 5GTDA 4PHGA 4RTJA 2WWYA 4MGHA 3KB2A 4MR9A 3RFUA 2BPOA 4DEYA 1KP3A 5ICCA 2XDWA 3AJ9A 2BKLA 2Q3EA 1MOSA 5BYAA 3DMNA 4BO5A 4BE9A 5JFGA 3COSA 1QH8A 3IKLA 4J4TA 2I3ZA 3B53X 3EWIA 3U7QB 2PLAA 1E89A 2IDMA 3VOSA 1ZFNA 5LYJF 3BCSA 2Y1KA 4GMXA 4C30A 3BFPA 2ODAA 2O19A 3LLMA 3OT1B 5DIFA 2E85A 4RY8A 1X7YB 1LPNA 3MAJA 1F4PA 1ZHFA 2XUQA 5CCEA 2PKEA 3IO5A 5K3FB 4IG4A 3S2ZA 3NOOA 3IP9A 3VVLA 4KXQA 3CINA 2OAEA 2ZW9A 3ETCA 1O97C 4PTYA 1P7ZA 4MZDA 4DXHA 1AHHA 5FUBA 2OFFA 3VR2D 2DFTA 1A2BA 1O5IA 4HEA6 1FMCA 2ZI9A 4CCAA 3IVXA 5AJXA 1N7HA 2P11A 2OXCA 3RJTA 4D0GA 2ZRGA 3PC7A 4YMUA 4HUTA 3F3YA 4OQPA 3AM4A 4E31A 3MJ4A 4FNAA 5H9WA 4OHBA 3G0GA 3GELA 1ZXXA 3OJFA 4HRYA 4X3CA 2XTNA 1OA0A 3FB4A 2ZEJA 5K6AC 4P4TA 2YFKA 5HF5A 1GAXA 4EY8A 4V38A 1TW3A 4U2BA 5FPKA 3L4BC 3CUUA 2NTYC 3JWEA 1A97A 2HCRA 3QBDA 1CX9B 3LUAA 2GUWA 4JJZA 4L9AA 2B8EA 3CTMA 3GGPA 1IB6A 1QJCA 4MUFA 2O5CA 2WVAA 3LNCA 1Z8HA 4UTNA 1H5NA 2PBLA 3F74A 1VPVA 1L6RA 4G5GA 3T7IA 2GD1O 4B40A 2RI0A 4UFPA 2CYCA 4HNVA 3VH2A 4KTVE 4UULA 3PC6A 1Q83A 4PGGA 3OSUA 3UT5B 1KEZA 1M0SA 4D8VA 4EYOA 4A4DA 4J3NA 1IE3A 1XMVA 3AEXA 3IIKA 3DWFA 5MFPA 3G2OA 4L8LA 2VPIA 4Y2HA 5CYOA 2PZJA 4HXYA 3TOZA 4D8TA 2ANCA 5KTMA 4OHZA 1UM9A 1H5UA 4IIUA 4RS4A 2DBQA 3CGWA 1WMSA 5ER6A 3PXCX 1NVBA 4N5HX 1YRWA 5E4YA 4UQOA 3FCEA 2Y9PB 4LGCA 1JDNA 1XROA 2Q9UA 5FL7D 1M0TA 1F1BA 2DFDA 1CZOA 1PE0A 2ANBA 2Y6UA 3CKYA 3FYUB 4QNNA 3VPDA 2MYPA 2NO9A 3GP3A 4QG3A 5CRIA 4NBKA 4BIMA 5AW3A 1QIEA 3DOHA 4BRWA 5L3SA 5JMPA 3V2IA 3TOVA 4U7FA 1NP7A 1JLLB 3HB7A 3LUHA 4HJXA 2ZR0A 2Q2WA 2P9JA 2SICE 1BZYA 1SZPA 2Z9CA 5LA6A 2LE0A 5EFOA 4WADA 3SR4A 2HZ7A 1W36C 4R2WA 3B6JA 3RVPA 4DSOA 2G9VA 3N53A 1VJ5A 2AZ4A 1OFGA 3MEQA 4PY2A 1EYZA 4E4TA 1UOOA 1GQ2A 3DC7A 3PPXA 4O8ZA 4NABA 3AIMA 4HX9A 1A9XA 2BM0A 3PQ7A 4NYIQ 3LVRE 3RKSA 3T0GA 4EI8A 1RRPA 1RC8A 2HGZA 4LK3A 2GEUA 2WJZB 4CMCA 2JJ1D 2DKOA 1JZQA 1JLSA 4IDFA 1RBQA 4A0RA 5AXCA 1A9QA 3KTDA 1A77A 3SLKA 5JNWA 1GGJA 2WPDD 4ND1A 4RNDB 1JJIA 3EZNA 2V45A 1XB2A 3BFXA 3HS3A 3PVCA 1JQBA 1YRYE 1JQAA 4M36A 4WY5A 4XVUA 1NJFA 1UIMA 3ZPXA 1G9SA 1GEEA 1NBMD 2QNIA 3PNKA 4XA8A 4IX1A 3L8EA 3L77A 1KFKB 1Q92A 3WGTA 1LXCA 4IIYA 1N5JA 1WZIA 3BF8A 4JJ6A 5ITSA 1CUFA 3ABIA 3HVHA 1BCRB 1IRIA 2X15A 1OVGA 4QX6A 3P97A 3CH6A 3SNHA 5K20A 2FRDA 4J43A 1LK0A 2BCJQ 4LDZA 4W4TA 4RH3A 2QZJA 1ILWA 3B5JA 4F3NA 1WKVA 5MGNA 4NU6A 4YRIA 4I9UA 1CUUA 1GTRA 1G98A 2GXAA 4D81A 4I46A 2WQ7A 3OPXA 1SUIA 2YOGA 3H9JA 2R5FA 3DMRA 5FTLA 2NYVA 2Z0MA 4XTRA 5EP2A 4CIBA 2IU3A 5F21A 4BGIA 2QZ4A 2IYUA 5FFMA 1JHUA 3HHPA 1ABBA 3VZRA 1NXWA 1C5KA 1JQJC 3SHOA 4AF8A 3L8FA 4TZ6A 2VC2B 2GEDA 2XBUA 1LNSA 4KLRA 3KIPA 3QSGA 3WL8A 4PQGA 1XLWA 2HA6A 3BIJA 3KZNA 1T0UA 1XZKA 3IV9A 2VOEA 1SVOA 2IHKA 3OM8A 3PFCA 1H2BA 3FNEA 1L4UA 4NBVA 5EZ5A 4LHVA 3DS8A 1FFCA 3LP8A 5FA5A 3NWJA 5HFNA 5JH7B 2F62A 3SEQA 2VKTA 2YASA 2DE0X 4LYEA 2GO7A 3LM8A 3CM0A 3QUAA 3TKLA 2J3IA 1DC3A 2FRDC 3TKYA 8ABPA 3NJ4A 3VGPA 4W7HA 1BGWA 5L8VA 1ZZEA 2XT9A 4GDFA 2QG4A 3F6CA 2J33A 1GU1A 2GA9A 3IYLW 4D45A 2X0FA 1R50A 3GN2A 3O3OB 1U3TA 4Z51A 3LTNC 4CMIA 1NULA 2OKGA 2PXXA 1E5XA 3TUIC 4E11A 2VYVA 4AURA 5HOQA 2CVOA 3FGPA 3D6MA 2O8DB 2APJA 4LZLA 2R751 4ASUA 4V1CB 2O1EA 4MO2A 3NTUA 1QGUB 3IUQA 1O0BA 5ANRB 3RKUA 4HBZA 4Z86A 1QGED 2HA2A 1L7AA 3IOYA 4D7AA 4DLBA 5JSFA 1VL0A 4PCVA 5AKXA 3MJSA 5EUCA 4I3HA 1KKUA 2QOEA 5H80A 4RL4A 5A71A 2H7VA 1VG8A 3KNZA 3SZRA 1HDYA 3KYIB 2M32A 4Q3DA 4TQGA 5EWJB 5IT9A 3FYSA 5BV8A 2R0QC 4PZ0A 5H82A 1DNPA 3HEAA 2B94A 4FCTA 3OQJA 3BK7A 4L0CA 4NZNA 2DT8A 2DKFA 4P6VF 1QNFA 2HCTA 3JR3A 1K6JA 5JWHA 3WLHA 4TLEA 1JLRA 3TQIA 3H1FA 3UK2A 1Q17A 1UJ4A 3MGAA 3PEWA 2XGJA 1SUEA 2H2DA 2QZPA 2XGOA 4WCDA 3RFXA 1Z7EA 4PXAA 4WVFA 1H8HA 2QR2A 2HSGA 4P53A 3TEMA 3AGPA 2G5TA 3AWDA 4Q24A 3WQQA 1M9NA 2ZR8A 1J42A 2YDYA 2ZSHA 4IIEA 3ORHA 2A4KA 3QYJA 1U5AA 3EDYA 1M6YA 3FPKA 3MN1A 4B6EA 4EKNB 1LSJA 4N0PA 3VI3B 1PK7A 3QUTA 4M1SA 3WBBA 4CETA 5E7JA 2W6QA 1Q1EA 5HZGA 3PDWA 2J3KA 4FFDA 1YWGO 3LUPA 2IPNA 2VNSA 2JLWA 1R4MA 4WXMA 1KH2A 3RC8A 3UQYS 2VK1A 2WJYA 3E4CA 4DR7B 1J9GA 5H1YA 3CLVA 3T8YA 3OJXA 3KEOA 3CWQA 1UH5A 3FW1A 4XB1A 4TKUA 4LC9A 1R74A 3NTLA 2JI8A 1D1PA 5AW7A 3QKSB 2YJ6A 3PL5A 4UEOA 5KYGA 3K9FC 3KPWA 4MUKA 2D2IA 2O2ZA 3M4JA 4TWBA 2ZRIA 4JLWA 4KMSA 4PAOA 4YMWA 1OKKD 1GSAA 1PFKA 3EIHA 1I2DA 4H1UA 4DW8A 4CLHA 3LXUX 6YASA 2EL9A 4I4TB 3T9CA 1WO8A 4PRLA 3TAXA 5K0FA 2WZBA 4D4HA 1DX6A 1N57A 4H9GA 4K6KA 4K3UA 4LJKA 1SO8A 4MQMA 4RJLA 3VYRB 4YV1A 4O0LA 5IYZA 1DP4A 4FGZA 2IXBA 4OAQA 2FEMA 1T3GA 5I7RA 1Z18A 1B00A 5GY7A 1OZ0A 1YGYA 3EGCA 3KZVA 1HWYA 2WD8A 4QELA 3F8TA 4MDHA 4IVQA 3GHHA 4PPGA 1R9JA 1ZEMA 3QPWA 5SICE 5CX1B 3UHOA 4AYXA 4HY3A 1T2CA 3FRIA 1L2TA 4PX2A 2AOWA 5A4IS 821PA 3GGGA 1Y1LA 3ZGLA 3QKIA 4XGQA 1N8TA 2PTGA 1THGA 3FZNA 1NJGA 4KYVA 1V5WA 2P5TB 2W9XA 3UH0A 1RQRA 3R44A 2C7GA 4XOUA 1UBHS 1RJ9A 4GR4A 2FOLA 1OWPA 1B74A 3PIIA 4RKRA 1XCMA 1SBNE 4UBIA 3UXHA 5F7OA 3DDZX 1GVHA 1LFAA 2I34A 1JDBC 3M5DA 2ZBEA 2CV2A 3L82B 2BSXA 3DFKA 4GP9A 4RVOA 4MQFB 2DBRA 2DQSA 2NYAA 2D5IA 4UOZA 1S02A 3NJ8A 4D9JA 5BNWA 1K3TA 1DPGA 3RC1A 1PRYA 1SXJA 3GRPA 4HXFB 3DL2A 3QE9Y 1RXEA 1QVRA 2KLHA 3EEIA 4LGMA 2ZRQA 3I12A 3ETNA 4MAMA 1PD1A 5P21A 1S3SA 2NT4A 2VHEA 3FJ1A 5CH5A 4OXXA 4RJJA 1DOHA 2C4WA 2QMUA 4UZEA 1R4AA 5CLIA 1QOPB 3HP4A 1OFUX 2JD2A 4L74A 4B8YA 1RHKA 3O26A 4HYYA 2UDPA 4POAA 5BYBA 1OH6A 3LGXA 3U56A 2PKXA 4LFCB 3T61A 1ISPA 1ZSNA 2G67A 3F96A 1J8VA 3W7VA 1CZKA 4Z4CA 3DR3A 4HWPA 2XUIA 1TK3A 4L8FA 4LE0A 1KH3A 4XSGA 4Z49A 2X9VA 1KVQA 5E9QA 4IUYA 3BE6A 1W4AA 2C92A 4ZA2A 3KKKA 4GBJA 3VPCA 2ZXEA 3DKIA 1GXSA 1WZNA 2L42A 1KTVA 3A1DA 2ONYA 3VC2A 1SHZA 4NX2A 4Q1FA 5GIPE 4X84A 1OAOC 3G02A 4ENQA 3BGWA 3OIVA 3O31A 2XYQA 2W43A 1OXKB 3AVYA 4UU1A 2EFHB 1X1AA 3EC7A 4WOCA 5CFQA 4UEKA 2OD9A 2G28A 3EPPA 5JE8A 2VJDA 4O4HA 1GY8A 1II8A 1IEXA 1MO6A 1IPHA 1DE0A 4LW8A 4PFQA 5KNCA 5LLTA 2VZEA 3HBAA 4C3ZA 1HDOA 1C0EA 1NW4A 2VP9A 2EJCA 3FSRA 5KOJA 2PS9A 1DUSA 3I9MA 3LQQA 3AUXA 5AW4A 4WNCA 3RVMA 2XQVA 5AK6A 3PHCA 4FVTA 4JI5B 3AERB 5EUMA 4WOBA 3PTZA 5DISB 1OFHA 4JZKA 3H7AA 4PYOA 3P0IA 3I6IA 4RWZA 4DVGA 4N48A 4DJDC 5C2JB 5CB8A 1WM1A 1NDUA 4NNOA 5K09A 1IMOA 4PSVA 4ZJZA 4AWXA 4GWLA 1AQNA 1BGXT 2QVYX 2PLFA 3G2KA 5LZ4A 1XU4A 2E4ZA 3NCTA 3QE0A 4G5SA 3QENA 5IG2A 1JAXA 1N6RA 3A36A 5EPOA 3OX3A 2DBVO 3LQRA 3FFXA 3TPZA 1YS7A 4FGWA 1FNNA 3TTVA 1Z7YA 3WZMA 5JBIA 4TRRA 1ONOA 3R77A 4MLCA 5BSWA 1Q11A 4IHJF 2ONCA 4BS9A 3GEBA 4ER3A 4ALLA 1LPAB 3WSVA 2BBTA 2D4AA 4ZDWA 2P9YA 2CBXA 3WMXA 4D4IA 3VV2A 1EBFA 5KHLB 3RTAA 2WQ6A 3KXDA 5LL6P 4RIGA 5C8YA 1FW6A 3A1SA 4ESHA 3MCVA 5DLPA 4H18A 1LBEA 2O9JA 3I4CA 4M8SA 4XRRA 1R4ZA 4DWOA 3ADBA 2EG5A 3LE8A 5FUYA 1E0SA 1RE0A 5HA5A 3R76A 4DBZA 2PUCA 1BIFA 1P1CA 3OPYB 2PUJA 1B93A 4KZKA 1NLUA 1WJGA 4KDEA 2G6BA 4GOMD 4JS0A 4IIDA 1XGKA 4YDSA 2XB4A 5KO2A 2WU1A 4KXFB 3TD2A 2UXBB 4C07A 4YCMA 1K5GA 1KBQA 1QG2A 3EA0A 3IPAA 3GUUA 2ID8A 4M0EA 4RDHA 1YD7A 3KCNA 1TQDA 3K0SA 5IDQA 1ODFA 3RW9A 1Y1PA 4D92A 2PBRA 5IANA 2Y67A 3RK4A 3KQOA 3IAS1 1ZH2A 3TX2A 2CNNA 1ZW1A 2YIJA 4I14A 3RYHA 4DN6A 1O6CA 3EVCA 4R1SA 1QXSA 5JJBA 1NJ2A 4KP7A 2KHZA 3ZK8A 3EY9A 4R51A 3KJNA 3WLAA 1H8EA 3DMTC 2ZUTA 4L5AA 5DF1A 1CEYA 3WRYA 4MQ4A 5D85A 3GLIA 2Q2NA 3UC5A 3IQEA 3GJ8A 2RK4A 2AN9A 3R1IA 1Y5NA 4PZCA 4RDCA 3I37X 2YXLA 3FF4A 2DJIA 4RK5A 1BDIA 4YUZA 2VYQA 1QX3A 1MQ8B 4L2IA 2D2FA 2G08A 4HB3A 5F1YA 1XPJA 1R6DA 3CWZA 1SCQA 3EZGA 1ODLA 4EBBA 2C61A 4KQ9A 3OLQA 4YUAA 3N0RA 3IEMA 1IZYA 2H4XA 5K3DA 5JYBA 3B70A 3DEHA 4WZAA 2ZIUB 3OKAA 4IHQA 4AIIA 2P3QA 3F9IA 3UG7A 1YR7A 4LXXA 3SM3A 3AF1A 2GVZC 2YTZA 1PFVA 2QVLA 2O3RA 1N8SA 4B35A 4EJMA 4G1EB 1PZGA 4BB0A 1MABA 2FUNB 1PX0A 5HE9A 4JLNA 5L3RA 3UMSA 1ZAYA 4BRSA 2B7BA 4KNVA 1AZLA 2QNBA 5GJWC 2GCOA 1S8NA 1F9AA 1H0HA 3U3JA 3I3SR 4C87A 4ESEA 1YRBA 4MYUA 3Q8KA 4WLEA 3DMPA 1IDN1 3GK3A 4XVQA 5ALRA 2FAXA 4FDUA 3M1YA 1Q0PA 3RVLA 3LBAA 2RHMA 2QUJA 1KDOA 5SY4A 3ZHXA 4TLCA 1X9GA 3PKIA 4AWAA 1VE7A 4PLPA 1U0TA 3VPAA 2J6IA 1OZFA 4LDPA 5DX0A 3D0OA 3FYUA 3K0KA 4AKTA 4HCJA 4YWJA 3H9BA 1UBRS 3AEKA 4Z9FA 1DTEA 5T4HA 4II3A 2MT9A 3OMXA 3PQ3A 2FPIB 1GPLA 1JJAA 4DDMA 1G20B 1JLLA 1VPTA 4NSNA 3TLZA 4YP5A 3OZWA 1NP6A 1XIVA 4MOWA 1D04A 1N3BA 5TJ9A 1ZRMA 2RH5A 3IUJA 3PD1A 4QOSA 4URYR 3UAXA 2GOYA 2B2CA 2QBYB 1CIPA 1EESA 2CL6X 1JFFB 2C7BA 2ECKA 2A1TR 3VZDA 2OWEA 3ZJUA 4GRAA 3AHEA 4IJQA 1JYFA 3OJ0A 1K8ZB 4Y6SA 2IIPA 5EFZA 3REOA 4EKIA 5IHXA 3ODPA 4AAYA 1P62B 2V7BA 4QOJA 1QRRA 1TZMA 3LF2A 2FMKA 1RFLA 1WP9A 1T8PA 1F7UA 3K05A 4BVHA 2MSCB 4NR0A 5D3KA 1W5SA 1X80A 1GQFA 4L6AA 4ZI7F 4RHTA 3PJGA 5FRDA 3CX6A 1DBSA 5IZ4A 3ZE7A 3AXTA 3QPBA 3MC1A 4LYFA 4KL8S 2PL1A 4EITA 2ZRCA 4QDOA 1PK8A 2IYEA 1ZKDA 2P27A 4DG5A 3KK0A 1CNMA 5SYMA 4TUYA 4LC1A 2ACKA 2G77B 4EG5A 4JGBA 1GQOA 4Q1EA 1C7QA 2D8MA 3Q3JB 2CMHA 1N2GA 3CVOA 3VYWA 4XJVA 4DR2B 3BEDA 4TKVB 1H85A 3U4CA 2D2VA 3A4MA 4CFSA 2CDBA 2SKCA 1NBWB 3I0MA 4C0WA 3VRHA 4BFLA 2H06A 1HYHA 4H6VA 1HORA 3LW7A 5T4BA 4B5LA 2BHSA 1JSCA 4AY6A 4DLYA 5CIWA 4DXDA 3M81A 1A50B 1KK3A 2PYZA 3GNTA 4RBNA 1YZFA 1PS9A 4EHLA 4DZRA 1O0SA 1DG1G 1SBYA 4KEAA 5G1OA 1XQ9A 1OLOA 3GUYA 3N0XA 1Y81A 1XZLA 4EECA 4EQ6B 5JSHA 1YRAA 3QNUA 4MDFA 1I3KA 3BTUA 4AZ0B 3OKPA 3C8UA 2ZJ1A 4RKFA 2HSZA 4MYRA 4BKRA 3H8VA 4CM3A 2BTQB 3KUCA 4EF5A 2VJCA 1U7OA 1AUXA 3GBVA 1EHYA 1V41E 2BKXA 2F1JA 3HC7A 1VYHA 2A7XA 1QQAA 3ZXXA 1YS2X 2R6R1 621PA 4MKZA 2H4HA 2WAAA 5ITVA 5KMGB 2YFQA 2X0JA 1FMJA 3FPJA 4I5FA 3M6IA 4MV0A 4CM9D 1X92A 1UWVA 3NWBA 2PGDA 3OFJA 3QYFA 2GYYA 2OXEA 4FFPA 3FKJA 4F84A 1OIWA 1EVQA 3DLPX 4IR7A 3SHWA 5K8LA 4BLVA 2I6TA 1IHUA 1PJ8A 4LJ9A 1DHRA 4OQ4A 4AYWA 5IX8A 3SSAA 1EDZA 3HADA 3FB1A 1BG6A 1X86B 3GZTB 4LDAA 4OK3A 1EEHA 4QBKA 1DC5A 3VX3A 5EJFA 1QRDA 4NMWA 1C7RA 5EP3A 3B6EA 2VA9A 4RTKA 3KU1A 1QR2A 3AZOA 1JAHA 8AT1A 1Y7HA 4FIDA 1K0UA 4HTFA 5FR1A 4ZU1X 3JATB 1TJ4A 5DM1A 1AHNA 3HCFA 1JT2A 3L8ZA 2H5EA 3TTYA 3JD1A 4IV8A 4MW1A 5AJTA 2VUTA 2IGBA 3CHYA 4PRZA 4DBVO 2BKUA 2Z3WA 4MQEA 2PUFA 4UTOA 3T1QA 1N7IA 2AXQA 5AW2A 4S05A 2ZJBA 2WJ4A 4UAGA 1JE1A 3QXHA 5J63A 3TMKA 4Q9JA 1A98A 1CUEA 3Q9UA 4AKGA 1BWSA 1HNXB 1FMFA 2C4HA 1NURA 4EHBA 1Z38A 3PQEA 3UF0A 3I04M 3RBZA 3F9RA 1S2MA 1P5HA 3GPIA 1TTTA 2GCPA 2ZBFA 1YQXA 2JLXA 3NEJA 3MTBA 4K2HA 4EZEA 2H1LA 2LKCA 1NPTO 4P82A 2CK3D 3U13A 1ZX1A 3USES 4A10A 4FINA 4BZZA 2EFGA 1I7PA 3DPUA 3EGDA 3EVBA 3Q0IA 5GPBA 1OWLA 4FFNA 1N2OA 2Y0PA 3DUWA 1ONNA 3JWHA 4JBGA 2CBGA 4MW9A 1WCXA 4XLZA 4DA8A 1T9GS 3JQ8B 2EQBA 3OZ7A 3DO5A 2OWDA 3DT8A 3A6JA 4TMZA 2IUEA 4RVNA 3RT9A 3G9TA 4H0NA 1KPGA 1ZICA 1OFUA 1YQEA 1U99A 4WLUA 1G0NA 3JQGA 1TT5B 3V6LA 4DDVA 4LHSA 2JIBA 3R7FA 5K0TA 5BOSA 2H11A 3I4LA 1B76A 1VGQA 1XF9A 5H16A 3UBMA 1GR0A 4I4TF 2ZTLA 5LOVB 1NATA 5CCXA 2M2IA 2QTFA 3R3SA 4GC9A 2Y6VA 4FYXA 4M1EA 2EFCB 4NU8X 1UZAA 2R8RA 5CTJA 4DIKA 3CVWA 2M6SA 4C20A 4R2XA 4Z0HO 2BM1A 3RVDA 1I3NA 3TTTA 3B85A 1Z6YA 5DBEX 3ORSA 4J76A 721PA 1K7FB 1CUAA 1OROA 1ZSYA 4E32A 3IOBA 2UYQA 3ZXYA 1Y6RA 2O8FA 4YC7A 4C78A 1KHHA 4LJ6A 1HDZA 4RPHA 1XCOA 4AX8A 4WGGA 1KQ3A 1G4UR 2C3MA 3GD5A 3S1LA 1XTRA 4KR7A 1DGQA 5D01A 3ZVLA 2ZPTX 3O2SB 1P2GA 2YJZA 1Y37A 3E70C 3UV3A 3NMUF 4YRPA 3D0KA 4ZXFA 3QG1A 5FWXB 1HC7A 3F6YA 4FIZA 4B4UA 3JYLA 4CIDA 1BFKA 2B8JA 1C81A 2C9BA 2HB6A 3CG0A 1PI3A 3FAZA 4FLEA 2HQOA 1H6BA 3GUHA 4ND7A 2PWBA 1EG7A 2AE2A 4ZCQA 3GD7A 4P8RA 5JIBA 3KKEA 2L0XA 1X7ZA 1LK7A 3NAGA 4NPCA 5G0TA 2X8JB 3O75A 3GFRA 1CJUC 4YEDA 3KC2A 1HE8B 2ZRKA 3UHJA 3ZH9B 4E5VA 1J2EA 5J47A 5LIRA 3VPBA 1ZI8A 2GKSA 1OXMA 4L1KA 1EWKA 2AFHE 1ARZA 2G71A 3MS2A 3VQTA 1UWKA 4ZOQI 2OQRA 3WGGA 4FEEA 4MQBA 4OMCA 1X7XB 1PR0A 4M7RA 3VZPA 1Q0SA 4D6YA 3B6ZA 4H1HA 1M83A 2AF4C 3LPCA 1WQ4A 1WXGA 5KEIA 1M6VA 1Z7BA 1HQYE 2YZ7A 4H7DA 2PWYA 3U16A 4TT3D 2FKNA 1ICIA 4HTFB 4ZO8A 3ZHCA 4OQXA 4UU8A 2OBYA 3I6QA 3JQAA 4KK3A 2AJTA 3G1WA 4B79A 4FBGA 5JW6A 4FYKA 2BRUC 1VSBA 3U6BA 4FBMA 2BCGY 3QELB 4O29A 5L7TA 1K7CA 3RB8A 3PYLA 2BUCA 2CHGA 2Z58A 3LFUA 4M0MA 4O1IA 5A1JA 2I7DA 4IZOA 3C3DA 2VAMA 4JUCA 3NT2A 5K99A 2W83A 3QLUA 4JUIA 2QRZA 3P9CA 4W99A 4JLAA 4Y0NA 5GQSA 3EPRA 2X8JA 1PYOA 4IFIA 1NSFA 2EFYA 3E3MA 3OLYA 4LC0A 2OHXA 3TK1A 5JS6A 2FEAA 3G8CA 1XZGA 3BTOA 1MJGM 3U6KA 5DM70 4DV5B 3GLSA 4C3VA 1MDBA 2HNAA 2C07A 1W0JD 4GOND 3WC4A 4PG6A 3SZUA 4IJKA 1ZXLA 2W8BA 2ZJAA 3JU3A 4FQ7A 3PNVA 4V0ME 4KUEA 2HIHA 2VP0A 3R23A 4O5OA 3VR4D 4RTLA 3D43A 3NTQA 2QQGA 4TV9A 5HF9A 4BEVA 1M1YA 2YVLA 4KQ6A 2NGRA 3QJGA 3STHA 1KYTA 1T3TA 4GLBA 1Q7GA 4B3TB 2HPHA 4QQKA 4DB4A 1EUZA 2GUGA 3EIXA 3K16A 4OI2A 5BN4B 1UXGA 1YGPA 3RSSA 1YR2A 3CLKA 2WIFA 1I30A 2X3UA 3S6JA 5ISMA 4WHMA 3O6VA 4NXNB 1C30B 2XYHA 2FZGA 4UUOA 1AGRA 2B36A 3SXUB 3FDZA 4HI0E 3SI7A 3RS9A 5DNUA 2FI1A 3R3UA 5JPDA 4RMNA 3IUPA 1QIKA 1WVGA 1XEWX 1E8DA 2OSBA 3BA1A 3NQ41 4QBHA 3L7OA 5INTA 2HHAA 3MRSA 2CMFA 1W9HA 2I2WA 2MOKA 3U44B 1K2VN 3PE3A 5EKTA 1OZGA 4I1UA 1T8SA 2VG8A 4PTLA 1ONBA 5EUBA 3VR6D 2AKYA 2PGIA 1KE2A 4E22A 1E1CB 2JAXA 4JR2A 1S96A 4MUYA 3JAWB 2IXFA 2B0CA 2R7LA