3F9IA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase rickettsia prowazekii
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
241
structure length
220
Chain Sequence
MIDLTGKTSLITGASSGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNALKDNYTIEVCNLANKEECSNLISKTSNLDILVCNAGDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVGGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKLNEKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
publication title Structure of 3-ketoacyl-(acyl-carrier-protein) reductase from Rickettsia prowazekii at 2.25 A resolution.
pubmed doi rcsb
source organism Rickettsia prowazekii
total genus 78
structure length 220
sequence length 241
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3f9iA00
2ZYDA 3WGGA 3KYDA 4IMPA 2FZWA 3ZWYA 2DT5A 1PL8A 3LT2A 3PP8A 4JCOA 3Q0EA 4W9NA 5THKA 4BNNA 2FSSA 2BGLA 3KSZO 3WBFA 2AG5A 2O4UX 2VUSA 5IDQA 1B16A 2DM6A 1MV8A 1FDSA 3SBOA 1KY5A 4BKUA 5L9AA 2X9VA 4YEDA 4J6FA 4BGVA 5F1KA 1LI4A 2DAPA 1VL8A 5L45A 3AI3A 1ZEMA 1D7OA 4UEJA 4XCVA 1T2AA 1H2HA 1ISJA 1UZNA 3QW2A 4H15A 1ONNA 3ZNQA 3ZU4A 2V7PA 1K5HA 3WSWA 1SB8A 3ITDA 4RF5A 3EUWA 5EN4A 1HZZA 5AQ1A 2CD9A 1XG5A 5JYEA 4BKOA 3OA2A 3DOCA 3ROMA 1W0CA 3UOGA 2P91A 1I3KA 4PG6A 4PLYA 4D0SA 5CFZA 2P5UA 1B2LA 3KTDA 3LLVA 1GPDG 5ICMA 3WICA 4UEKA 1DLIA 2NNLD 3FWZA 4PFJA 1PS0A 3BXXA 3KLMX 3W6ZA 1XIVA 3FNFA 4M8SA 1HEUA 7ADHA 4YT5A 1Y81A 4YXFA 1I3LA 4RO0A 3H65A 2JHGA 3CIFA 4M54A 1ZK0A 1R15A 3BTSA 1YL7A 2HMUA 3SJ7A 4DMLA 1ZVMA 4AJOA 5IDWA 2ZYGA 4XR4A 4DC0A 4DWVA 1FK8A 1LDGA 3TZ6A 1A4IA 4PLGA 4YYZA 4BNHA 2ZQZA 3O38A 3E03A 5IDXA 2J8ZA 3DHYA 4UVEA 4DTIA 2V6BA 3ANNA 1HDGO 2C07A 4R68A 1BXGA 4B3HA 4R9RA 3TFOA 4J2OA 4DXHA 4CODB 4XQEA 1CRWG 1V0JA 2ZCUA 3JQBA 3QJ5A 4RQTA 1E7SA 3NEPX 5CAEA 1DO8A 2CNBA 5DCYA 3RC2A 4NBRA 3WFJA 4R1TA 2SCUA 5CDTA 1LRJA 4DRYA 2P5YA 5KVCA 4B3IA 3AUUA 4BVAA 4CM9D 4RF3A 4E5NA 2Q50A 4Z0TA 1IOLA 4E5MA 3OJOA 2XAAA 4G81A 1ZK1A 4M89A 3SLKA 1ZW1A 1YB1A 3VPHA 3C24A 4XQ9A 5IG2A 2FP4A 1I8TA 2F00A 5LDGA 3OA0A 3NTOA 2Y1GA 4OIMA 3DB2A 3HG7A 4ZVVA 5K6AC 4TMFA 3VVBA 3ZNOA 3I6QA 2WWRA 3VZPA 4S3MA 4GMGA 2O2YA 3K2EA 2Q2VA 4BB5A 5ICSA 4NPCA 3H9JA 5LDHA 3ETDA 1OAAA 2WTBA 3LQFA 2B5VA 4E4YA 3KXDA 1DFIA 3U4HA 4EW6A 4IXTA 3DZHA 5TF4A 5TJHA 2HMWA 1KERA 4Z0HO 1BG6A 3GDGA 1FDUA 1UUFA 4J7CA 1GUFA 4K28A 4ZQHA 4BKPA 4YAKA 1MGOA 2GZ3A 3RUAA 4GKBA 4A7PA 5C7IO 2NM0A 4F6CA 3UVEA 1RWBA 3C7AA 1T1SA 3CEAA 3JD1A 3RUFA 3GGOA 3LT1A 3RAJA 3RASA 4E2XA 3M1LA 2DTDA 3ZWBA 4L4XA 1ENZA 3FHLA 4YB8A 1LEHA 5A06A 4IQ8A 4YJHA 3D7LA 4ALMA 4J1QA 4DPMA 1NP3A 1Q7GA 3JQFC 1ZO8A 4FOSA 5H82A 4BNTA 4Z6KA 5A03A 3JTMA 1H6DA 3V2HA 5C3MA 3MJSA 5ITWA 4BO6A 3AJRA 1RM5A 1YWGO 3KYBA 3PYXA 3V1TC 3ZU2A 1V3UA 2AE2A 2UVDA 3ASUA 2J3JA 4PZCA 5KCZA 1A7AA 1NVMB 4ESOA 2NLOA 3EW7A 4BNWA 2PD4A 3U09A 2B35A 1IPEA 3ZU3A 4OKNA 3KHUA 1SC6A 4PG5A 4RZIA 4A10A 4LGVA 3AM3A 3EVNA 4MPDA 4HNGA 2J3HA 1A72A 4B7XA 2VHYA 3S55A 3GNTA 3H9GA 1NXQA 2IZ0A 3ZW8A 4XYLA 2Q1WA 5CEJA 1DPGA 5JE8A 5JMPA 4FJ0A 1BMDA 5K6AA 2YJZA 4YAJA 4WOKA 2Q4EA 3WNVA 3NGLA 4DIFA 1TB4A 2VUTA 3ZV3A 3GG2A 1E1NA 1NR1A 4DBVO 5KJFA 4OOFA 5FYDA 2RIRA 3IIEA 2WYUA 2A9FA 4ZQFA 3HDQA 1GY8A 1SMKA 4BB6A 1Y8RB 2FPIA 5ILGA 1I2BA 1N1GA 4TRRA 3ZWXA 2IRWA 5I8WA 5CHEA 3ZCXA 1Q2XA 4E5YA 3E48A 2Q45A 1EE9A 4RF4A 4NQZA 4JJGA 3JQ8B 1GADO 3QWIA 4XR9A 3ETEA 2ZQYA 3FTPA 1WDLA 1PWXA 3GVCA 1IL0A 4GWKA 3F46A 4TZKA 3S2GA 4B7UA 3OETA 1P1RA 3H7AA 3PZRA 1P1IA 1QYXA 1N2SA 1GUZA 3DBRA 1PJLA 2GPTA 2VHZA 3CUKA 3Q6IA 4PIVA 5I7EA 2ZTVA 1V3TA 4AJKA 5TJ9A 3AY6A 4WCFC 1GZ4A 4KMSA 2VRBA 5CEEA 3OHSX 5L53A 5EPOA 2Z5LA 5A5EA 3GDOA 3JQFA 2YV3A 4HX5A 3CMCO 4N5NA 1PJ3A 4PG7A 4BQPA 3WOHA 2O3QA 2NTNA 3QWFA 4ZQGA 4FIZA 5LC1A 1YJQA 5I8ZA 4PLPA 4FW8A 5F5NA 3INGA 4IS3A 3DFZA 1ZJYA 3MWEB 4WE3A 4PCVA 4UVIA 3TL3A 3TOZA 4HKTA 4BGEA 4FJ2A 1VL0A 4OOEA 4UAGA 5KJCA 3VZRA 3LT0A 1ZUD1 3E6AA 3TZKA 3WSVA 4BO3A 1UXGA 2FR0A 2CDAA 2VZ8A 2A94A 2G0TA 3D4NA 1NQAO 1GYQA 4WASA 3GHYA 3V2GA 1QV6A 2DQ4A 3VC7A 2OL4A 1WAMA 5EINA 3QVSA 1P0FA 1UDAA 1UZMA 1N92A 1TT5B 2D5AA 4CM9A 1W73A 5U1PA 2J3KA 1QYVA 1E3LA 3JV7A 1MG5A 4R01A 4Y6PA 3MJ4A 3AFNA 3ASVA 3WGIA 1NQ5A 1GTMA 1ULUA 2OBYA 5B1YA 3BZUA 3OQBA 3D4PA 1PIWA 2HK9A 4YJDA 4NI5A 5GZ1A 1DRUA 1T4BA 4BV8A 1ZIDA 3QE3A 3WG9A 1TXGA 2FMUA 4GSLA 3IP1A 2E82A 2GN9A 4HFJA 4YDRA 1SAYA 4CLRA 3AY7A 2Y1FA 3PWKA 3F3SA 4OKIA 4RPHA 4NDNE 4WPGA 1O8CA 5G0SA 3HDHA 1MB4A 1L7DA 1DJNA 1TLTA 3GDFA 4CLOB 1K3TA 5BSEA 5ER6A 2JD1A 2AXQA 5EMHA 4BS9A 3T7CA 4YRAA 2VT2A 3JQEA 1GDHA 1KEPA 3BIOA 3JQ6A 1PJ4A 1GCUA 4A5OA 4LW8A 4HP8A 4WCFA 2ZTUA 5JBIA 1J5PA 5COQA 3E8XA 5ES3A 4DL9A 4EJMA 2B37A 1YOVB 1DRVA 3FBGA 3OM9A 1WPQA 3HE3A 2D4AA 4FPXA 5MGBA 3PGXA 2YDXA 9LDTA 4FGWA 1NPYA 3B70A 4PG8A 1F12A 4DPLA 4B7CA 2GSDA 2X5KO 1DJQA 5B4VA 4IIVA 4WEOA 1M66A 4Y98A 3FTNA 1R0LA 4NJOA 3U4IA 4GLOA 3Q2IA 3C1AA 3RVDA 4IJWA 4CR6A 5JCXA 1WVGA 4EGFA 1HXHA 3LDHA 4DVJA 4XA8A 1DC3A 3AUAA 1IE3A 3D64A 1HDZA 1ADBA 1HRDA 1I0ZA 1FDWA 3WTBA 2EKPA 3DR3A 3EMKA 2OFPA 3K8ZA 2Y1EA 2Q1SA 2V6MA 5JDCC 3MJCA 1Y8QB 2UUPA 4QX6A 1U3UA 1GFSA 3EK2A 3GT0A 1X0VA 1LRKA 5KKAA 4E12A 2NVUA 5L4NA 3UICA 3D0OA 1U8FO 2ZATA 3L6OO 1RPNA 1GQ2A 2A35A 2PFGA 2RHCA 2NU6A 1ZCJA 2H63A 4GX0A 4OL9A 1XLTA 4RDIA 4YVFA 1JKJA 2JJYA 4RF2A 2FWMX 2HJRA 2OBNA 3VH3A 3WMWA 5ENVA 2BKAA 3OFSA 2X0NA 3DEYX 2QZZA 3Q9UA 2JFHA 3E18A 4JXKA 4L0QA 5G4KA 4OSPA 4R5MA 4BKRA 1NQOA 4QT0A 4NBVA 1HT0A 3WGQA 2FR8A 4B8WA 1DOHA 1P1JA 1PZFA 4MP3A 5A1TA 3I9KA 2B36A 4ZN6A 1P1HA 3COSA 3TZQA 1V3VA 1J4AA 4O5OA 2PKQO 2YQ4A 3UGKA 1A7KA 3B6ZA 3IUPA 1ULSA 3AWDA 3RIHA 1NVGA 5JNLA 4M49A 3JQGB 4O63O 3TNLA 2WM3A 5C7OO 3HFGA 1T25A 3BMOB 3RFTA 3EAGA 4TROA 1XU9A 1Z6ZA 2Q49A 4XWYA 1LJ8A 2ZB8A 1ZNQO 1I10A 3FWNA 3GQVA 1Q0LA 1NM5A 1UAGA 3IS3A 1GV1A 3OF2A 1Z82A 3H6KA 1E6EA 2O7SA 4XB1A 4L8VA 1B3BA 1Y5MA 4U6SA 3Q3CA 2O3RA 3GA0A 3OIFA 1KS9A 5DBFA 3UHAA 4LVCA 4PRLA 5CPFA 1ENOA 3P2OA 4KTTE 3H2SA 3A06A 5BNIA 3NDIA 2O3SA 4A0SA 4E21A 1T26A 4CMIA 3INTA 4XQGA 2PK3A 2EV9A 1QLJA 2C5EA 3IJPA 4YACA 1LDNA 2V65A 3PQEA 5MDHA 5JDCA 5JS6A 1NHWA 1WNTA 4W82A 3ZWPA 4EUFA 2Y1OA 3ADOA 3I23A 3ONEA 1YH3A 1O6ZA 5AYVA 3L6EA 1JN0A 5B4UA 1U4SA 1YRLA 4ITUA 5F1OA 3CXRA 3WLFA 3WYCA 1HSZA 5A3JA 4D0RA 5IAAA 4LCJA 4FD3A 2OP0A 4RVHA 2Q2WA 1Y7TA 5DCUA 3AU8A 3KYCA 5DN9A 5G0TA 4RPLA 4Z0PA 4ND4A 1ZSNA 3K31A 4CLHA 2O50A 2R6JA 2GUGA 4NFYA 3RUEA 3I9OA 4B4WA 5K9ZA 2PGLA 1BDBA 3JD4A 4CMGA 3OMLA 3PHIA 4ZHSA 4TQGA 4Z3DA 3ULKA 2VHWA 1RKXA 5AXAA 3SXPA 4NJMA 1E7QA 5I9NA 3ON5A 1JWBB 1GL3A 2LDXA 5TS3A 3EVTA 3DDNA 2CMDA 4A26A 1Z7BA 3NT4A 4A03A 2CZCA 1OZAA 4G2NA 5EESA 3KB6A 5I7SA 4QXMA 1EVYA 4U0KA 2PGDA 1TVEA 4P22A 3JD3A 1WLYA 4D42A 4YRBA 3F4LA 4N54A 4J3FA 2VN8A 4RDHA 2DLDA 3PQDA 2YY7A 1IHXA 1E1MA 1F06A 1Z45A 2DPHA 3OQ6A 1E77A 4JN6B 4NNJA 2OUIA 3DMTC 2QYTA 2VNSA 1E3EA 1XEAA 3PDJA 4ZU3A 2IYPA 4ZRNA 3ZNPA 4PLTA 4RJTA 1HE4A 3HQ4O 1XA0A 3CZMA 1VSVA 1C3VA 4FDAA 4OO3A 3LYLA 4FGSA 3MJVA 1KVUA 2W2KA 3UH1A 2JD0A 2E37A 5KOIA 4R1NA 4YAEA 3S2FA 1LNQA 1KOLA 1YBVA 4OJNA 1H9BA 1LBEA 2B69A 2X58A 2UUOA 1F0YA 4WOJA 1GZ6A 2PH5A 1V8BA 2OO5A 1I33A 1KETA 3GHHA 4RPGA 3G0OA 4GMFA 2X0JA 1ML3A 3H5AA 4IQ0A 4OHUA 1Y9EA 3MCVA 4I5FA 4II3A 5DZSA 2GLXA 3EZYA 2BH9A 4IY1A 1DLJA 2AEMA 5IJZA 5IN5A 1EBUA 4Y9DA 1P0CA 4LCEA 5ILOA 2PA3A 4YQYA 3LVFO 3OSUA 3MTJA 3ZGYA 3ZWWA 4IDAA 5C37A 4A27A 2GASA 5TT0A 2X9NA 2PKQP 2NU9A 5ITVA 3VVCA 3EHEA 2OXIA 1E5QA 1SEVA 4PLWA 4UVGA 4ZICA 2X1HA 1YL6A 2GERA 3FPCA 1LTHR 3IOYA 4AL4A 1O94A 1Y9AA 1VI2A 4YJFA 5A9SB 3ZHYA 1NPTO 2FRDA 4I9HA 4NZ9A 4TVOA 3IQDB 1OC2A 4GPD1 1GR0A 3WDSA 3HHPA 3LK7A 2J5QA 1H6CA 2VWQA 4R9SA 4TZTA 4OXKA 1PJBA 3DMTA 4L74A 3LSYA 3AU9A 2C7GA 3H9EO 2D1YA 1NAIA 3DBLB 2CF6A 2HCTA 3K5PA 3QVTA 2F1KA 1WWKA 3UAGA 1QV7A 4JBGA 1NWHA 3R0IA 1CERA 1WDMA 1E1LA 5L7TA 1PGQA 2O48X 3EC7A 2VYVD 2C2YA 4CV2A 1ADGA 3WGOA 5L4LA 1B8VA 2D59A 4BNIA 1LLCA 4XZ3A 4EYEA 3SLGA 1JKFA 4E2WA 2P9CA 2HMSA 2HRBA 2Z1NA 1LLUA 2GZ2A 1VC2A 1R0KA 1HLPA 4AG3A 1WXDA 5CDUA 1U4OA 4DBZA 4BO2A 4QTZA 4YAIA 2C59A 2AEJA 1IZ9A 3A14A 4Z9FA 5A9TA 4INAA 3QSGA 1SBYA 1WW8A 1YXMA 1LA2A 5AXCA 3D1LA 1Z7EA 2B5WA 2W2LD 3RC7A 1HYEA 3DTYA 3MOGA 1KIFA 4BIIA 4CLXA 1B7GO 1IB6A 1PZGA 4FFLA 4WLFA 2JHFA 3UN1A 4W7IA 2GN8A 3O8QA 1EVIA 1M67A 2IEDA 1VRWA 4KUGA 1D3AA 1FJHA 3DZJA 4ALLA 9LDBA 5FI3A 3ENNA 5JY6A 1L7EA 3QP9A 4TKMA 3NT2A 2Y1CA 5IF3A 3PHLA 2VQ3A 3K92A 4CM8B 1CEQA 4BGUA 4II2A 1LQUA 2E49A 1DBVO 1DIGA 2UAGA 1P33A 3EZLA 4O59O 3DZFA 4OQZA 4JX8A 3PEFA 1CWUA 3TSCA 5JXWA 1J49A 3FCOA 4NFSA 3HDYA 3L9WA 4MP8A 1EDOA 3PTZA 2WYVA 5T67A 3PJDA 4KP7A 4E13A 2NWQA 3DC2A 1XR3A 1VKNA 5BNFA 1HZJA 4JK3A 3P19A 4UVHA 4CQLB 3CINA 4PGFA 1SO8A 1M6HA 4PVCA 1N7GA 3ZHXA 1HDRA 5HRUA 2VHXA 1JAXA 5JC1A 1AXGA 3BHMA 1VM6A 1LXCA 3AI2A 2YHUA 3ONFA 5IFLA 3M6IA 2IYOA 3RWBA 4CMBA 5GZ6A 3TZCA 4KWIA 1UXIA 2GRAA 4CQMB 4DC1A 4J4HA 1U9JA 4TWRA 4R51A 1ISIA 1Y8RA 3VHRA 5G4LA 3PZBA 4NK5A 3N58A 2X23A 5GY7A 1E1KA 1I32A 4RPJA 3TL2A 4BO4A 4ZA2A 2G5CA 2Z1MA 1UR5A 1D1SA 5THQA 3WXBA 4BQRA 4YT4A 4DPKA 3JQ8A 3ROQA 3N74A 4TRMA 2P4QA 2AQKA 3G79A 4UREA 1YGYA 2AMFA 3CSDA 2G1UA 1BRMA 4R16A 5CDYA 4CMKA 4P38A 2VOJA 1EBFA 2PZJA 2W90A 1DFHA 2ZB4A 4S1VA 3I3OA 1EVZA 3SVTA 2CFCA 2I65A 4E2ZA 1M2WA 2JKVA 3PHGA 1E7YA 1CQIA 5BT9A 4MVJA 1WDKA 4FFOA 4J2HA 1XYGA 4ND2A 1DAPA 2RHRA 3E9NA 3WB9A 5KVSA 1HL3A 1F17A 2P4HX 1PGPA 3SC6A 5I7FA 3RFXA 3EYWA 1UP7A 4F3YA 1I2CA 2DTEA 1DIHA 4BNFA 3S2EA 5DP1A 3OJFA 3RBVA 1J6UA 3GEMA 2D0IA 5KKCA 4EUHA 1DSSG 1O5IA 1PX0A 4BV9A 4XB2A 4WK6A 1TT5A 2UYYA 1PQPA 1NYTA 5HS4A 2EJWA 3PGJA 2Y67A 1N9GB 2VWPA 3TRIA 3VTFA 2QX7A 2YHIA 1E6UA 2CDBA 4KDFA 3U0BA 2O4CA 3X2EA 4GQAA 3NYWA 4MP6A 3UW3A 1A9ZA 1P74A 1SCUA 3MZ0A 5T5QA 4C7KA 4E3ZA 5A02A 2WMDA 1UAYA 2X86A 4PLVA 4E6PA 8ADHA 3ETGA 2VYVA 3G1UA 4XEHA 3S2IA 1KYQA 2AA3A 1X7DA 4IJKA 5FF9A 4ND1A 4I9NA 3DZBA 1TT7A 1M76A 3KSDO 4IUYA 1MXHA 2EEZA 4NU6A 4WGGA 3NV9A 3RKUA 5CDGA 2PD6A 2FPPA 2D2IA 3ZWAA 3JCZA 1U28A 3WMXA 2A4KA 2ZIZA 4IDFA 1R4NB 4MVJI 2WD7B 5CG2A 2Q4BA 3OQ1A 3NKLA 1MG0A 2W2LA 3JYNA 4KUEA 2GO1A 2PGJA 1U5AA 2WJPA 4J91A 5A3VA 1YOVA 1P77A 2P9GA 1EUDA 3BMQA 3DHNA 3DHEA 4K6CA 3A1NA 3VKVA 1T1RA 2DKNA 3NTQA 4UUMA 1VLLA 3ZV5A 2G76A 4DYDA 1I3NA 3O9ZA 3DQPA 3GK3A 1ZK3A 1C0PA 1WZEA 4WCDA 3ORFA 3O4RA 4GH5A 3QVOA 5JAIA 3E82A 3RU9A 1QYWA 3ZZNA 2YV1A 1X7HA 4JNKA 3VTZA 3UCEA 1GU7A 3ZHBA 3LU1A 1AXEA 4I08A 3FPLA 4KWHA 4RVDA 4PLFA 3DAFA 3RC1A 1BW9A 1JTVA 4XYBA 2B83A 1OOEA 3D4OA 4YR9A 3ST7A 3RI3A 4LN1A 1PWZA 2C82A 1BDMA 3WGTA 3VDRA 1QXSA 1H6BA 4WNCA 1DFGA 3AM5A 5KJ1A 1Y8QA 3PWZA 1Z74A 2HDHA 1SPXA 3JQ7B 1LDMA 1SOVA 2BGMA 2DFVA 3LC2O 1KEUA 4PLZA 5KVQA 2I9PA 3ANMA 3OJEA 2HK8A 3H2ZA 4IZHA 4ILKA 4MDHA 2Y99A 4Q39A 1XKQA 1EZ4A 4BO1A 1UJMA 4MVJF 4DA9A 3RUHA 3AOEA 3U3XA 2JFGA 2D5CA 1MP0A 1JW9B 4MVJM 3ZN2A 4YT2A 2OOSA 1R4MB 3HB4X 3UUWA 4AVYA 1V35A 4I1IA 4CMAA 3I9NA 5JYDA 5TLSA 3DOJA 4BNYA 3NAQA 2D8AA 2QHXA 3D3WA 1X0XA 5F1PA 3GRPA 3A9WA 3LC7O 3WIEA 2BFAA 4KOAA 1U5CA 2I67A 4IMRA 5B37A 3JYQA 4KQXA 1NASA 1XCBA 1K6XA 4D79A 5EQDA 1NPDA 1NAHA 2VCYA 3KRTA 4OGWA 1H0KA 1D4FA 4Z9YA 2ZB7A 2ZK7A 1XHLA 3AFMA 3R1IA 1SOWA 1VE9A 2UDPA 3QWAA 4ALKA 1A5ZA 3HN7A 2Q46A 4MJLA 1DC4A 4BGIA 4IDCA 3L4SO 4WLOA 3QWHA 3U9LA 4ZQBA 5JAQA 3BMOA 1G1AA 5KJEA 1Q1NA 3RFVA 2NUAA 3P2YA 1ZSYA 3K73O 5AVOA 5TQVA 3V2UA 1J0XO 1B0AA 5EQFA 3AY3A 2FSVA 3ZWCA 1VPDA 3QIVA 1E7WA 1Q7CA 4CMCA 3DWFA 1PSDA 4XDZA 1E3SA 3JSAA 1LDYA 4RZHA 4O0LA 1PJSA 3T4EA 3ZI0A 3KEQA 3NX4A 5U9CA 3I9LA 4P4NA 4BNXA 4IDDA 1ID1A 1KVSA 4RQUA 4NH4A 2IODA 3IDSA 2HSDA 4XJTA 1P3DA 1ONPA 1T2DA 3H8VA 3OJ0A 4LK3A 1KC3A 3C1TA 4I8XA 4A73A 1C1XB 2FOIA 4NR0A 1MFPA 1K89A 5DT9A 3WWYA 1ISGA 2WE7A 3FRJA 2DBZA 3GMDA 3HFSA 4BOYA 1U3WA 4GKVA 3DZKA 2AW5A 4BKQA 3GVHA 5IXSA 5CEFA 2BGKA 4LRSB 3KZVA 1BGVA 2C0CA 1TA4A 4JQCA 4IBOA 4QECA 3LZ6A 1WP4A 3C85A 2O23A 3GGPA 1U2DA 1ZK2A 3KUXA 1BVUA 1NTOA 4Q3CA 1FDVA 1AN9A 3NDRA 3NGXA 2GYYA 5JLAA 3MJTA 4CUJA 5BSGA 2Q1UA 4QEDA 5DOZA 2B4TO 2XXJA 2X4GA 2IXAA 1YE3A 4CL8A 4PRKA 3ZWOA 1HE3A 1YS4A 4IJUA 1EFKA 2NU8A 3S8MA 3WIDA 2DFDA 2GNAA 3I1JA 1QMGA 4AJ2A 1W4ZA 3IMFA 4CMJA 5JAMA 3M2TA 3NRCA 4XIJA 4C7JA 1IZ0A 4N5MA 3OP4A 4FFPA 3GG9A 2NV6A 1QKIA 4RVFA 3TPCA 1AHIA 2QRLA 4YTEA 2GF2A 2R00A 1NX6A 3ADPA 3GZNB 4H3VA 4LMRA 3X2FA 1UXJA 2B4QA 1AE1A 5F21A 4CM1A 4CR8A 5H83A 1P1FA 4CM4B 2E4AA 4EEXA 4P4GA 4BUCA 3OIGA 4OMUA 4HY3A 4XGIA 3FBTA 1ZXLA 4D3DA 2PKRA 4N7RA 3WQSB 4D3SA 4IJVA 3B1KA 4W99A 2W4QA 1GYPA 3FF4A 2H6EA 2VUUA 4DQVA 1YDWA 4FC6A 1XWFA 4CM6A 4D41A 4EJ0A 4HNHA 3RBXA 4LRTB 1F8FA 1V9LA 1PZEA 3RU7A 1I3MA 4UVDA 4DQXA 1Y1PA 4FQ8A 5TIIA 1YQXA 3K2BA 4IXWA 1Q0HA 6LDHA 2FY8A 2UV8A 3GR6A 2VWHA 2NQ8A 3Q2KA 4LSMA 1YL5A 4FC7A 4XJSA 4PZDA 4FFMA 1ZMOA 4F46A 1I5RA 3D5TA 4Y6RA 2BF7A 2PY6A 4JBIA 4RLHA 1FXSA 4I5GA 4LSWA 4BO7A 5HWSA 2Q99A 3GN1A 1X14A 1U2GA 1ARZA 1ISHA 1O89A 3NJ8A 2VHVA 4OXYA 5JPIA 1W6UA 5TT1A 4DLAA 4XD2A 3KETA 1ENYA 2AQIA 3ZNNA 4PZEA 4E32A 3QY9A 1Y6JA 2J6IA 3C3XA 3HSKA 5ENDA 2VZ0A 1EUCA 1AGNA 4BL5A 3F9IA 2AEFA 5IZCC 4B4VA 1P45A 2VRCA 1HDYA 1X1TA 4J7UA 1JKIA 1MX3A 3GPIA 2I5PO 2QRKA 3BMCA 1V6AA 3QQPA 1DC5A 3RCBA 1JQBA 1HE5A 3M1AA 4ALNA 1X13A 3AUTA 4Q9NA 3W4JA 2DBVO 4EI2A 3L4BC 2Y66A 1LSSA 3UKOA 2BI7A 1VJTA 4BNVA 5KJ6A 1X7GA 1BXZA 4CMHA 4AJEA 3Q11A 4AJNA 2RH8A 2H1SA 2RAFA 3CTMA 3P5SA 3VZSA 3LF2A 3G3EA 3L07A 3DL2A 4GX2A 1OBFO 4CL3A 3EGOA 2GD1O 2X0IA 4BHTA 5EL0A 2PLAA 3L9XA 2I99A 1U3TA 3L6DA 4ZRMA 5HA5A 2W8ZA 4BNKA 5DBGA 4FBGA 1GYRA 3JD0A 5CP8A 4BO0A 1QLHA 1U7TA 2HO5A 5HBRA 4E5KA 4DYVA 3U5TA 3W4IA 2J5KA 4GWGA 4MO2A 4NIMA 3GRKA 3AI1A 4RCVA 4WNIA 3RC9A 3N7UA 1H93A 3RJ9A 1HETA 4GL4A 1YO6A 3HJAA 1UXHA 5BQFA 4D3FA 1A71A 4YJGB 1YQDA 4XYGA 3GUYA 3GNQA 3WBBA 1FF9A 2X8LA 2Q2QA 3QRWA 2CVQA 3WJ7A 1JLLA 1XU7A 4ZJUA 4J1SA 1HDOA 1HKUA 1O9BA 1PU2A 5T8KC 1LC3A 3VH1A 4YQZA 5AXBA 1HYGA 4YBZA 5L3ZA 4CM8A 1E3IA 2JD2A 4RORA 5FEUA 4EBFA 3OBBA 4MVJD 5T57A 3JYLA 3U4DA 1P44A 1EDZA 2I76A 2DBQA 2EIHA 1C0LA 3NT5A 4WLEA 5IZCA 3C7CB 1JU9A 3BYZA 4Z9XA 1WMAA 3DBHB 2WYWA 3PFFA 2IZZA 3HWRA 2PV7A 3GPDG 2X5OA 3MWDB 1E3WB 3FD8A 3VDQA 4JP2A 1BVRA 3V1YA 1UP4A 1P31A 2A92A 3GGGA 3L4BA 1C14A 2NVBA 4R54A 1E92A 4RV9A 1P9LA 1PJCA 4FOOA 4IS2A 4KQWA 4GLLA 2BFPA 1ZSVA 1T2CA 3CPSA 4YRDA 3TFQA 1DHTA 4EEZA 4NK4A 4PLCA 1JWAB 4YT8A 4UEOA 3KYCB 4L73A 1MXFA 1C1DB 1DHRA 1UDBA 3AOGA 1NQTA 4R3NA 3TZHA 2DTXA 5IN4A 3JQCA 4H16A 1OC4A 3R6DA 3ZH2A 2CVZA 1L1FA 3OECA 1T24A 2JFFA 4FN4A 4Y67A 5G0VA 1G0OA 1KC1A 4NBUA 3QWBA 4G5HA 4ONEA 2GDZA 5F3RA 1ZEJA 5ADHA 4A2CA 3DBVO 1PS8A 2C5AA 3IUSA 4AJPA 3PYLA 1TI7A 1T2EA 8LDHA 5KVVA 4IM7A 5BSHA 3ICCA 2VOEA 2XPCA 2XF8A 1RM0A 4J9VA 3LC1O 2NVWA 3HADA 3O26A 4J7XA 4ROSA 5TSDA 3GF4A 1MC4A 3DTTA 2CY0A 3MOIA 2P2SA 3S1LA 3W8DA 3NUGA 5T8KA 3GY0A 1GQQA 4BNGA 4AJ4A 1S7CA 4J1NA 4J49A 4WKGA 4B4UA 1ISMA 4ALIA 1ADFA 3AW9A 3GN2A 1D1TA 3Q1LA 1LDBA 2VTEA 3DXFA 3PI7A 1EUZA 1Z73A 1GCOA 5H81A 2DBRA 4Z3KA 2GZ1A 2W2KB 5I7VA 3K96A 1H9AA 1PTJA 4OSOA 2OP1A 1BXKA 4L76A 2BI8A 3SJUA 1R37A 4YPOA 5JMWA 4CLEA 5BR7A 3IKTA 5C5IA 1XQ6A 3VH4A 1EEHA 3KVOA 1S6YA 3F4BA 1YDEA 3IKVA 3AK4A 1N9GA 1GEGA 1PR3A 3G1TA 4KTVE 3TN7A 1TEHA 1LQTA 1VL6A 3ENKA 3HZZA 4AJJA 1SB9A 4FFNA 4JBHA 3GMSA 5L51A 1KEVA 3JQAB 4B79A 4BNJA 4RLSA 4FFRA 1GUYA 1YB5A 3HN2A 1LSJA 1PEDA 1ZMTA 1GAEO 4JGBA 3JQ9C 1KEWA 3BMNB 1HSOA 1B8UA 4D44A 4B3JA 3GVPA 2BELA 4XIYA 4AJIA 3GVIA 1FMCA 2EWMA 2NQTA 2EKLA 3IAHA 4IDBA 4J1TA 4MVJH 1YKFA 1HLDA 5JFOA 3GLQA 2QQ5A 2QW8A 4J9UE 4Q3NA 4XDYA 5A04A 5TRTA 4E0BA 1LX6A 4U7WA 3WJAA 4DIBA 2Y68A 4UULA 3PLRA 4H7PA 1A4UA 4ID9A 2Q1TA 1EE2A 2FHSA 4ALJA 1UP6A 4YJFB 1DDOA 2PR2A 1EK5A 4CR7A 5J23A 2PTGA 3GAFA 1E6WA 1PJQA 2NSDA 4MKZA 3U49A 1QYCA 1YB4A 3ANLA 2DPGA 1R4NA 2X7HA 5KTKA 2WD7A 2VYND 2HUNA 2YQ5A 3D5QA 3UCXA 3EY4A 4M55A 1N8KA 3KLPX 3PIIA 4ZQEA 1D8AA 3ZW9A 2EP7A 2IE0A 1QRRA 3I5MA 1C0KA 4TRNA 3P7MA 5G0WA 5DP2A 4PVDA 3RD5A 4HV4A 2O2SA 4J43A 3KYDB 2GR9A 2Z95A 2Y1DA 4MVJG 2EHDA 1PJTA 1GD1O 5I9LA 1KY4A 3KM0A 2QYSA 1B8PA 4FB5A 3VZQA 4HXYA 4EZBA 1XELA 3VPXA 4YCAA 2ZB3A 1UXKA 3BHIA 2XXBA 1HDCA 2DU8A 1CYDA 3B1JA 4UUOA 5JSFA 3I9JA 1EMDA 3QVWA 4OM8A 2HLPA 3OIDA 4GBJA 2PZLA 4BNLA 3RUDA 2IXBA 2G82A 1ISFA 2HAEA 2WDZA 5KWEA 2O3JA 1PGNA 1ZH8A 2X22A 2X9GA 1KVRA 4BMNA 5C7LO 1A27A 1I2ZA 4NG5A 3SX2A 3BTVA 4JJFA 4L4SA 4E33A 3I4FA 1E0DA 3NDJA 4K9DA 2TMGA 4XGNA 4O6VA 3H3JA 4J16A 3JQ7A 1DEHA 4Y6SA 1T2FA 2WD8A 1ORRA 2IZ1A 2XOXA 1SZJG 2ILTA 1IULA 4XKJA 4L4RA 4QO7A 4RVGA 2JCXA 3JQ9A 3KSUA 5KIAA 1ZZEA 3MEQA 3VKUA 3ZHZA 4IGFA 1Y5RA 3O8QB 1I30A 4IZIA 2B4RO 3KO8A 1PQWA 1JDJA 1R4MA 2EW8A 5DCWA 3T4XA 4F6LA 2WE8A 3ZWMA 2ZKLA 1RYDA 3C1OA 4OXNA 4XYEA 4CPDA 4BMVA 4EITA 5G2OA 3AOEC 4DIOA 4DLBA 2CDCA 4WEQA 5JCJD 5G0UA 1NHGA 4IDEA 4YA6A 2CVOA 4R69A 3IL2A 4MKRA 4U5QA 2V6GA 3E5RA 1U3VA 1BXGB 2AG8A 4E5PA 2P68A 4AJ1A 4CLOA 3PVZA 4GVLA 3ZWVA 1B14A 1EQUA 2H9IA 3GFGA 2EKQA 3CZRA 4J0EA 4BO9A 4K1LA 4AICA 4OAQA 3GC6A 3GNSA 2BRUA 1ENPA 3RSHA 3STHA 1NFRA 2TMDA 4HBGA 1RM3A 3A28A 3DZGA 1IHYA 2OZPA 4IINA 3BA1A 4F45A 3KBOA 2ZTLA 3VOSA 5FI5A 3WGZA 1Q0QA 2DVMA 1MFZA 1SNYA 3GEGA 4M86A 2W98A 2Y93A 2FZEA 1K0UA 1NBOA 3SC4A 3V8BA 3G49A 4KDEA 4R1UA 2BFOA 1AUPA 1ZJZA 4Q3BA 3H9UA 3PFWO 2VWGA 1RJWA 3BHJA 1E7RA 5HS6A 2PH3A 3WQRA 4GI2A 3QHAA 1F8GA 2O7QA 4MINA 1PL6A 3V1UA 5CDSA 2EGHA 2BLLA 5EIOA 3VPSA 4TRJA 5B4TA 3PIDA 1NFQA 1N5DA 2YDYA 4QSMA 3KV3O 3DMYA 1M75A 3LT4A 1C1XA 1A9YA 1DB3A 4CUZA 2R2GA 5CG1A 3MJEA 2I66A 4CV1A 4E2YA 3I4CA 3AUSA 3PQFA 4XX0A 5DF1A 3UFXA 3PYMA 3PK0A 2YFQA 3W4KA 4DGSA 2BD0A 3K9QO 4IIUA 1IPFA 3ITKA 4OYRA 1XSEA 1H2BA 5DBIA 4XYMA 5JAZA 1MA0A 2CSUA 3W8EA 5GZ3A 3WNQA 1ZBQA 5EERA 1NFFA 2ZJ1A 4N18A 4XRGA 1HE2A 1ZKMA 4OH1A 4YJHB 1P1KA 2DC1A 2JL1A 3K30A 3FR8A 1NR7A 2YZ7A 1WZIA 3PDUA 4HFMA 4CMEC 2D3TA 3QLJA 3BTOA 1VKOA 3K6JA 1ZXBA 5HM8A 3L0DA 1PL7A 1OFGA 1JVSA 2HMVA 4R5HA 2VYNA 1JAYA 2CF5A 3ZV4A 4IGEA 4WLUA 4RGBA 4E30A 3BTUA 4U0JA 5A4DA 2OORA 2ET6A 2VRCD 5A05A 1HTBA 4BO5A 1W8DA 1B3RA 3GZNA 2YHIB 4K6FA 2X0RA 4MVJP 3TWOA 3NJ4A 1N1EA 2P9EA 4CM4A 4FR5A 4M1QA 3V5NA 3ABIA 2X6TA 4WUVA 2GN4A 2NU7A 4QFDA 1ZFNA 2RBEA 4GVXA 5JO9A 5BNTA 4KZPA 3GUCA 3JQGA 3DONA 1KVQA 1QG6A 2O3TA 3DAGA 3WR5A 4HFNA 2VZ9A 5KNLA 2R00C 4W4TA 3UCFA 4FS3A 1H94A 3U4CA 1YONA 4BO8A 4HWKA 5CPBA 5IXYA 5HTOA 3UXYA 2QIOA 4PG4A 3WGYA 4Q3AA 3INRA 5A9RA 2YYYA 3PJFA 1HF3A 2EJVA 2Y0CA 1VJ0A 1U1IA 3DOOA 4LISA 3VAZA 2NTJA 2POQX 4CM7A 3DAPA 2PZKA 4J4BA 4URFA 3BAZA 2Y0EA 3SEFA 1G6KA 4W6ZA 3HDJA 3PLNA 3RKRA 3E9MA 4DREA 4ZGWA 3OICA 5FWNA 1CDOA 1E3JA 2RH4A 2VT3A 3PWSA 5GMOA 3BMQB 1AHHA 1BTOA 3I52A 3R3JA 3WTCA 1E7MA 2C7VA 3TQHA 3LF1A 4K26A 1GV0A 2EG9A 5JW6A 2C29D 5DOVA 3I6IA 1DXYA 3WLEA 1PGJA 1NWCA 2PD3A 3DBRB 3DO5A 1MUUA 4DLLA 2HQ1A 2Y0DA 3TDKA 1T4DA 2JCVA 3E9QA 4WLVA 4XGKA 3F1LA 4ZD6A 4CLDA 1H6AA 1EK6A 5I9MA 3F5QA 1IUKA 4FCCA 3FNEA 3L77A 4RPKA 1C0IA 1PR9A 2E6UX 5COBA 4CMEA 4NBTA 2YV2A 1BW9B 4JP3A 5JCJA 4QFCA 1DAOA 4BNZA 1YVEI 2I3GA 4YWJA 1OMOA 3FR7A 2YUTA 4AFNA 5EJ2A 1PZHA 5L95A 2OGUA 1YJ8A 2DUUA 5DDIP 1B26A 4QUKA 1UZLA 4J0FA 3DFUA 1Z75A 4UUNA 1BSVA 2NADA 4XQCA 4DMMA 3JQAD 2AHRA 3ZV6A 3PHHA 3PJEA 2VNAA 3W6UA 4MKXA 2AE1A 1LRLA 2CUKA 4TKLA 1B15A 1QR6A 1YBMA 2E48A 2JCYA 1CF2O 4Y8VA 3VH2A 3H5NA 2Y05A 1O95A 2HMTA 3TF5A 2C54A 5ER9A 4O1MA 5DNAA 4EUEA 2HJSA 3OEWA 4CUKA 1JA9A 1I24A 5L7WA 4D43A 7MDHA 1R16A 3G17A 3IC5A 4C4OA 4D45A 2QZ9A 1RM4A 3HUDA 5IZ4A 4CQMD 4I5DA 2PNFA 3D3WB 1BHSA 4GGPA 5JDIC 1CJCA 1CIVA 1K2WA 2QRJA 2V6FA 4JJIA 4CLRB 1GEEA 2EXXA 4HUJA 4I5EA 4YAGA 4NHEA 1SEPA 3VPFA 1QYDA 4GGOA 4RVUA 1E5LA 1I01A 4NBWA 1ONOA 2G17A 3E1KA 4YJGA 1R0SA 3OH8A 1LDEA 1M6WA 3ROKA 1DC6A 1XDWA 1O0SA 2ZTMA 3M2PA 4BNMA 5TGDA 4WCFB 3F5SA 2YW9A 4B4OA 1U8XX 3WGHA 3GH3A 3Q9NA 4B8ZA 3W1VA 5L4SA 4ND3A 2HK7A 6ADHA 4P4LA 3UF0A 1X15A 4BMSA 4W7HA 3DBHA 3I9MA 3B1FA 3E5MA 2OHXA 5T6BA 5A5FA 3WS7A 1BWSA 1E3WA 4I9UA 3PPIA 4MVJE 4E31A 1FDTA 1LC0A 5JO0A 4GX1A 4MIEA 5L7YA 2NTVA 2B0JA 2J5RA 5JY1A 1CQJA 3MTGA 3JQDA 4MIOA 1CETA 1YQGA 1QORA 3GOHA 4J90A 4FSHA 3RBZA 4CV3A 4D46A 5A9SA 1DIAA 3WWZA 2GCGA 3F6YA 2FR1A 1U7HA 1MC5A 1ZK4A 3DZIA 4RL6A 1PS9A 2GGSA 2VTDA 4QQRA 5AXDA 4CM5A 3FNGA 3CKYA 3TOXA 1GPJA 3KEOA 3ZWNA 3WX0A 3H9QA 3JD2A 5BSFA 4NFHA 2YFHA 4R41A 1C1DA 3DBLA 5COAA 3EDMA 4CM3A 4IDGA 2EGGA 1XQ1A 2NVUB 2I6TA 3ZDFA 3JYPA 2PWZA 1NVTA 3PRJA 5JDIA 3ZU5A 3GAZA 3ICPA 2I3AA 2RCYA 4HADA 3TJRA 3O03A 1LUAA 1IYZA 4JLWA 5L40A 1PJ2A 3ROPA 1KBZA 2FPGA 4R4JA 5TNXA 3H4VA 1H5QA 3WFIA 3W8FA 2AQHA 3C8MA 1K6IA 4P8RA 2BFMA 1EVJA 3WYBA 4L75A 1DIBA 4MIYA 4OQYA 1LLDA 4NMHA 1GQYA 3RUCA 2NACA 3WYEA 3RQSA 2DUWA 5G4KB 4JIGA 4X54A 1DIRA 4GSKA 2EF1A 4QO8A 3B20A 1DRWA 1HWYA 1XGKA 5IDYA 2X5JO 1VSUA 1K6JA 4JROA 4TSKA 2LDBA 5T64A 4BNUA 4DUPA 3CMMA 3OJLA 4LMPA 1GZ3A 4HFRA 4ND5A 5AOVA 3PXXA 3QA9A 5JC8A 3CH6A 3GVXA 1LSOA 3FSRA 1EFLA 2QG4A 4W9NC 4DQUA 2BMAA 1PGOA 2HU2A 3FNHA 3LLSA 3RROA 4CV0A 3ONDA 3FI9A 3D3EA 2EERA 2O3UA 4M87A 5TX7A 3VPGA 1UDCA 2WSBA 2GN6A 2H5LA 1MLDA 1VJ1A 4KUHA 2WEKA 5K0ZA 4CJXA 2HKIA 4MOWA 1G0NA 3NTRA 4IPTA 4J4TA 4R1SA 3H3FA 4PN3A 1HYHA 3JYOA 2PZMA 4WECA 4EJ6A 1YBAA 5TC4A 1IY8A 3AM4A 4UUPA 3RJ5A 2IEBA 3RUIA 5LCXA 1R66A 3F1KA 4CMIB 1QP8A 4IQGA 2OMEA 2IDZA 4U6QA 3JQAA 4WJZA 2FN7A 1N7HA 3IP3A 3I83A 4Q3EA 5U4QA 1LLQA 4CQLA 3QVXA 2AQ8A 4WLNA 3IJRA 1QSGA 3PJGA 4FJ1A 1HDXA 2ZYAA 3BMNA 1X1EA 1OI7A 3CE6A 4PLHA 4TVBA 3WQQA 4G65A 5DULA 1Q7BA 2C2XA 4XRRA 3QV1A 3F47A 1RYEA 5F5LA 3H5RA 4GX5A 3T7EA 2J3IA 4AJHA 4RVSA 3A4VA 3HB5X 3HNPA 4CQMA 1LSUA 3C7DB 4L9RA 4NU5A 1WMBA 1JVBA 4LVUA 3U62A 2JAPA 2Q3EA 4EDFA 1I36A 3GZ4A 1UH5A 1R12A 1R6DA 2JAHA 3GFBA 3KOUA 1ADCA 3PHJA 4Q3DA 4R3WA 4N5LA 1KVTA 3OEYA 4GAEA 4U8GA 2HRZA 2EW2A 4NJMB 1LU9A 3R3SA 3FN4A 5FFFA 4AJLA 2BHLA 3BMCB 1NNUA 5B12A 1PQUA 2C20A 4D7AA 2ZJ0A 3JQBC 1EQ2A 1F14A 3GEDA 2ZCVA 2EP5A
chains in the Genus database with same CATH superfamily
3S40A 4Y0NA 5A0TA 5FJIA 3W9YA 2OV4A 4JCOA 4W9NA 1XP8A 3Q0EA 3UK1A 3I2JA 3FIJA 5G3ZA 3WBFA 5TDHA 5C9ZA 2AG5A 1ZJ5A 3D8UA 1SHKA 1W9HA 3U3MA 1MV8A 3FE2A 1G6Q1 2LGJA 821PA 5IT9A 5L9AA 3R4VA 5F1YA 3VPBA 5HUQA 1LI4A 4LOHA 3PXEA 5DHRA 3UMVA 3VPCA 5C53B 3QNWA 4ATNA 4EJFA 3LLUA 4DARA 4RPIA 1NI3A 1ZEMA 3UUFA 1INLA 4TM8A 2W2NA 2ECKA 4OI1A 5FO0A 4H15A 5JNSA 3QW2A 1BQEA 4KI0A 4KXMA 5JS7A 3ZNQA 1QQ6A 3EGXA 5IMBA 1K5HA 1U9ZA 3KJHA 3MVEA 1MJFA 1SB8A 1EFTA 4RF5A 2HMYB 5TXGA 4BVHA 2CD9A 4ABYA 4CKCB 1KMQA 3ROMA 1IJKA 3BM5A 4Y2TA 2P91A 1G55A 3GJ0A 1I9CA 1UJNA 2FWBA 2PFKA 1GPDG 3LLVA 5GVRA 4DXAA 4F2PA 2GB4A 3SG0A 4AB1A 1HE1C 1LNSA 3GJRA 3GPCA 3HSYA 3MK31 1HR0B 1DLIA 1ZD3A 2WIBA 1EFRD 3GD7A 4P2BA 4EHKA 4S1TA 4JUFA 1JHZA 1TC1A 2FLWA 1JLLB 1P9OA 4R2XA 3RADC 1JIKA 1WVIA 4GL2A 1Y81A 4HNTA 1EB8A 1E9CA 1GPUA 1DKUA 1MOPA 1QB8A 3EDQA 3H65A 4ZK2A 1IN1A 4M54A 4MPJA 4K9MA 2A59A 3A9CA 1IBMB 4AZTA 3BTSA 1KHTA 3STUA 3ETLA 1ZVMA 3SFZA 5IDWA 1O6CA 2BGTA 3RK0A 4RL4A 4XR4A 3R3HA 1FK8A 4BFVA 1LDGA 1A4IA 1QZ3A 1TCAA 1U7OA 2UVQA 1BO6A 2Z9BA 2I2BA 5D85A 2XODA 3E03A 1A1SA 2J8ZA 3DHYA 4KIWA 5HTKA 4FSDA 1SUCA 3R40A 2VLBA 4CKXA 4DFDA 1HDGO 4B3HA 3SICE 4R9RA 3O8LA 1J06A 4KREA 2DRIA 2A5YB 3U9TA 1VLVA 4H3SA 4XQEA 4CODB 4EJ2A 3EMBA 1U98A 1V0JA 2ZCUA 4OU4A 3GAMA 4C0LA 5FPKA 5KWJA 2DPMA 2H2DA 1JXOA 4QJ4A 4IKOA 3ROTA 2YRXA 5C32A 2F3SA 1Z7GA 5DEIA 5LMUB 2G1AA 3JQRA 2IX3A 4I9GA 3KHKA 4IP0A 4K5QA 1K98A 3UXEA 4WMLA 3FB4A 4GOMD 3IDQA 5IH7A 4RF3A 3G0CA 4FT4A 1O1YA 4YI5A 2WJHA 4LMBA 3IAUA 1AF7A 1S2LA 2XAAA 2J3DA 4M89A 2QI9F 2O1XA 5LLSA 1SQ5A 4I50B 1YB1A 1GPWB 5DX0A 2REOA 1ZONA 3VPHA 4FDLA 1RKUA 3BMXA 3C24A 4B44A 5IG2A 1I6KA 4CF5A 4BEJA 4I4TB 3ZLTA 4V0QA 1AGPA 1XZEA 3GJ7A 1RXWA 4MROA 3H2IA 3OA0A 1RAFA 3KV1A 2D0DA 1RAIA 3WMRA 2G5TA 1A76A 2I4MA 2YXLA 5JH7F 2R4TA 3FWPA 4GC5A 4B17A 4ZVVA 4TMFA 3VVBA 5LOVF 3I6QA 1M6VB 2NOAA 4WKPA 4ZGBA 3EH1A 5C1PA 4LNAA 1YRWA 4GMGA 4DY6A 2O2YA 1O6FA 3D3QA 3A70A 5IP5A 4KV7A 4BB5A 2PGXA 5ICSA 1RXVA 3MG9A 1R9GA 1S8AA 5CVTA 2R3SA 3TQCA 1JJFA 1XZ8A 3K72B 4OBXA 2WWVD 2WFAA 5DYTA 1ULZA 2VP9A 2VXOA 5KYUA 5C4GB 4E4YA 4EH1A 5HHTA 4NEHB 1SVIA 4IXTA 3SBXA 1RQ7A 2PV0A 2HMWA 1PQYA 1YR3A 1KYWA 2GKSA 2PSFA 2OHFA 3P96A 4YUWA 5BSWA 1FDUA 5CA0F 2BFCA 4C7VA 1UUFA 2HCJB 1GUFA 4JMLA 3QHQA 1TK2A 3UMMA 1FOEB 1MGOA 3RUAA 1M1NB 2ZYRA 4A7PA 1MH9A 1Y1LA 3UVEA 2BGUA 3JWIA 3K6SB 2ZWVA 1Z9BA 3H04A 3JD1A 2OBMA 4YUYA 3NHLA 3VR5A 3RAJA 4XFKA 3RASA 7YASA 2DTDA 3T94A 3ZWBA 2J5BA 3IAS6 2ADMA 2OCYC 2YQZA 4H7FA 4RV4A 3FHLA 5DM1A 3G2OA 1YHYA 3UEOA 3WHIA 4AKEA 4YB8A 1NDQA 5GJBA 5H59A 1HRKA 3DA8A 5D1HA 2CHGA 4YJHA 4B2LA 3T7JA 3IH5A 4YGXB 1XJCA 2WUFA 4FOSA 5K8TA 3LQ4A 3SS9X 4BNTA 2GEFA 1NJGA 3A9TA 3L7CA 1AOXA 3AT1A 4BMYA 4GPZA 3OOJA 3RSSA 2XRMA 5GV7A 1G3IA 3DF7A 4N5HX 3WZMA 4KFSA 4BO6A 2XH8A 4P31A 5KAPA 4B09A 5MF6A 1TKBA 5J43A 1RWKA 4XE5A 4JEMA 4NFLA 1P2GA 3P2IA 4IQ4A 4N5IX 1TVCA 2QG9A 4X7PA 5G1OA 1CC1S 3ROFA 3UC9A 3A7DA 2IFTA 3KQOA 4BNWA 1F60A 3U09A 1IPEA 1M3SA 4YLGA 4UE2A 2GHRA 1XEWY 3PG5A 4OKNA 5IKOA 4PG5A 3IOCA 3FDFA 3PBKA 4KYUA 4OQFA 4QSHA 4D8UA 1C1YA 1ZNZA 3EVNA 5AVZA 3WLRA 2J3HA 4HYQA 4BRZA 4D5GA 5ABPA 3NOXA 4OBEA 1X7XB 4FMPA 4QQNA 1V43A 2EJBA 5LMNB 2Q1WA 2QR2A 3TIXB 5K0TA 5JMPA 2CHFA 4FU0A 2MSLA 2YZGA 1BMDA 4HGRA 4NCHA 4YAJA 1YS7A 2GBGA 2Q4EA 4IGIA 3WNVA 3NGLA 4Z7OB 4MDFA 1TB4A 2VUTA 3QXCA 1NRJB 1PQ4A 4OHPA 3GG2A 1PUIA 1JR3E 1MB3A 1NR1A 2LCIA 2Y9MB 2WOJA 5KJFA 4PYNA 1T0IA 2FSGA 2WU8A 5FYDA 2JHCA 5KTPA 1MQ8B 2A9FA 3GFPA 2VHQA 1G9SA 3ZOZA 2UUBB 1NLYA 2PWBA 3DXYA 1SMKA 4N49A 2OAQ1 4NECA 3U7IA 3IRVA 2JG3A 4HRVA 1I2BA 3E2MA 1BZYA 1V4BA 2EQBA 2I2WA 3DMPA 1CJBA 3I12A 3PFIA 4C4RA 3TRHA 3ZCXA 3KD3A 1P61B 3RNOA 4E5YA 1MC8A 1HK7A 1L7VC 4RS3A 1G38A 4F7WA 4NQZA 1FFBA 3JQ8B 3DVRX 4X64B 1TIBA 1OIWA 1QHHA 2JLQA 4ZI3A 3QWIA 2QL5A 5LYJB 3FTPA 1E2QA 5BWOA 3WLQA 1PWXA 3BUSA 1QDEA 3GBSA 4K88A 4TZKA 4HN9A 3LKDA 3GIDA 4NLLA 1ISPA 3H42B 1P1IA 4L22A 2X9LA 1GUZA 2GPTA 5I7EA 3CVUA 1L4YA 2DQZA 2O8DB 2ZTVA 1U0BB 2PJUA 3AJDA 4WCFC 3TLGA 2JJ1D 1DQRA 2FX3A 4IGKA 4KMSA 4M98A 4GMXA 4NYMR 2R1TB 4YN3A 5L53A 3AKCA 1KIAA 4TV9B 4P2GA 5EPOA 4A0GA 1KFJB 4HHEA 3EWAA 1CQIB 2SKCA 1X1SA 1PJ3A 2BZSA 3KDPA 4OKSA 3L8FA 2XMCA 4XTRA 3CWCA 5EIFA 2QPLA 1CIPA 1RACA 4FW8A 4MPTA 4RTJA 1NYRA 3LGAA 2Q5IA 3DFZA 3I04M 1N25A 1ZJYA 2AHOA 3LOUA 2HADA 1TUBB 4UVIA 3NYIA 4WE3A 4D6YA 2P78A 3TOZA 4Z8YA 1FNBA 3SYLA 4BGEA 2XB8A 3U1BA 3B3JA 4JKOA 1UJ6A 3ZH9B 4NZOA 1QDLB 4FWBA 2INGX 4L50A 5K3FB 3NPMA 2EGUA 2D1SA 5HSGA 4D6XA 4DRXB 2X42A 3I1YA 4R84A 4MI9A 1KO4A 1TQ2A 4X92A 1V3QE 4TSRA 3C3BA 2Z0MA 2ZUVA 3G82C 4YP1A 1K5PA 1CUAA 3D4NA 1NQAO 1QZZA 1U8UA 3GHYA 3NWBA 4MB0A 4N5DA 4NBNA 2JI7A 4UD6A 3V7NA 3X43A 5F52A 4CKZA 3O3OB 2VIIA 4RESA 1UZMA 3CVJA 5D3MA 4CM9A 2A1TS 2XVAA 1W73A 3GL9A 3Q8WA 3SKXA 3WMGA 2O2ZA 3DFFA 4DSTA 4XXHA 2PL3A 1EXVA 4QM6A 4LWQA 2AG0A 2IU6A 3CT4A 2NZJA 1E3LA 1Q0ZA 4L5AA 4R01A 4Y1FA 2GN1A 3MJ4A 1SBZA 2QE6A 1GTMA 3JVEA 1IQPA 2FSFA 2OBYA 3FHCB 4H6VA 5B1YA 1SGWA 3BZUA 2IOFA 3D4PA 1TF7A 4GYKA 5HJ7A 3K70C 1WQ4A 2I4IA 2MYNA 4RNDB 5JZMA 4YJDA 4QFBA 3S5JA 4NI5A 1KE2A 1S4QA 1T4BA 3L8MA 1ZIDA 2OXEA 4QICA 3WG9A 1KYZA 3UJ8A 5JI3E 3W5CA 3JXEA 1E4YA 3AWIA 4AKSA 2RHHA 4F84A 3MUEA 4QBKA 4BQOA 4YCCA 2DSNA 5IJ9B 3P2KA 1AQYA 3AY7A 3PWKA 2KBEA 2ACEA 4P93A 4WPGA 1ECFA 4NDNE 4UEQA 5C51B 1TAGA 4DY4A 3HDHA 4RZXA 5IC6A 2P6NA 3EPPA 2X3YA 2XNSA 4A6DA 3ZUGA 3K5WA 2AXQA 2V9CA 3C3PA 4KR6A 1M6NA 1Z37A 2A78A 2I6QA 2XZOA 1C9YA 1QIJA 2WKRA 3K9GA 1I4DD 1NE2A 4H0FA 3KNZA 5DXFA 2YN4A 1Y33E 1KEPA 1DNPA 1PJ4A 1XHFA 4B3BA 1V6SA 4M7WA 4WZZA 3DLIA 1UBMS 4WCFA 4AZ0B 1KH1A 1VMDA 1W75A 4G07A 5AK0A 3ND7A 5AJXA 5DIZA 2FR8C 1E18A 2WAOA 1CUYA 1C9MA 3I58A 4OU5A 3OCUA 4OHMA 1DRVA 2VDWB 1F6DA 3HE3A 3HU3A 1B74A 3IGFA 1JSRA 1JLKA 3PGXA 2YDXA 1WOYA 4UM5A 3VR6D 1PVVA 5A3QA 4B7CA 4OQNA 2GSDA 4A5SA 1AQUA 4EQ6A 1DJQA 3N2GA 4Q21A 4U7JA 4LZAA 5B4VA 4HTFB 1C9KA 2G70A 3JU3A 4FYHA 3M3DA 4IIVA 4DJJA 1LQ2A 1HL7A 4LGYA 3P2JA 1R0LA 1R6TA 5C0OE 5KNBA 2XUHA 1ZD1A 3QENA 4MW5A 4EW3A 5AVSA 3C1AA 4RTLA 1J97A 4N47A 3S7TA 1DUIA 4QDZA 1H2FA 1VPVA 3FJOA 4C87A 4W8HA 1MJ5A 2C2KA 2QP4A 3B13B 3W9BA 1QHXA 4DVJA 5D01A 2YBDA 1DC3A 1ZJ4A 2Q2OA 2PS9A 3OU6A 3IPRA 5AVRA 1IE3A 3D64A 4YLEA 5AM1A 4DZZA 1ADBA 3UGJA 1IY0A 2QU8A 3HKCB 3THWA 1H69A 1K5DA 2P0AA 3EMKA 2OFPA 3PUYA 1VBMA 3WE7A 1HYBA 2FA9A 1E6LA 1VGRA 3UWSA 3MQ2A 4Y2QA 4X44A 3W2TA 1WPGA 2ZBUA 2B92A 1PWHA 1X0VA 2L18A 4GNRA 5HIMA 2NVUA 5A2QA 4N65A 3ZY6A 2IWRA 3M3HA 1EX1A 2E9SA 1LGYA 3L6OO 3MYRA 1NW7A 4MHSA 4QYIA 1DINA 1IN4A 3PUKA 5HJ2A 3QPAA 1WM1A 4N01A 4F9EA 1ZCJA 3LKZA 3UPUA 4NV3A 2Z56A 3BH7A 1JKJA 2W6ID 3RU3A 2FWMX 4J8PA 1RS0A 3ACCA 2Q7XA 4DLTA 5FOVA 2GCOA 3NB0A 4E11A 3L0IB 2OM2A 4QA9A 3WLKX 4KXYA 2J7PA 3CLUD 5T4HA 3EXFB 1OTYA 1LJUA 3CF2A 4S1OA 1NF3A 1YNSA 1H1LA 3DWGA 1Q1BA 1MN6A 4ES6A 5E4JA 4BKRA 2VSYA 3IB6A 3MLEA 1HT0A 4FZ3A 2FE1A 3UGQA 4YX9A 4HH1A 2FR8A 4ZHQF 4LZOA 1P1JA 1PZFA 1GFIA 2WT8A 1FNCA 4P3OA 1SXQA 3TXAA 2ZBRA 2FP3A 3TZQA 3HMKA 1V3VA 4B4DA 1KH2A 4A8JC 2REXB 1S2IA 3LXRA 4N9QA 4JC0A 3KOXA 2ODPA 2HSJA 3H5LA 1ULSA 3RIEA 3D6NB 1KYVA 5JNLA 3JQGB 4NPHA 3DULA 4FFBA 3RJMA 2O9JA 1T25A 3RFTA 2NO9A 1EB9A 1P2UA 1E8MA 1PR1A 3B8EA 5JHGB 4BMXA 3HCWA 3KOOA 2ZB8A 3MUOA 2YHSA 3KJEA 4L7VA 1XRNA 3R3YA 5ALHA 2VNJA 4CKEA 3LUHA 1I10A 1LB1B 2GM3A 3IS3A 1UAGA 4ZICA 3WA7A 2XUPA 1KI7A 2C9CA 3OJXA 5FI1B 3KQVA 3S99A 3ZE6A 2XA1A 4M1SA 3QYPA 4KSBA 2X6QA 2BBWA 4C03A 2JBAB 2UZ4A 5E7IA 3UHAA 4ZJPA 5FHQA 1M6EX 4LE1A 4CT0A 3H2SA 4YCJA 1U80A 4QELA 5DK6A 5DTQA 3S44A 3MWDA 5JSYA 4E21A 5BNIA 1PL0A 1OH7A 4JDPA 2X9QA 2EV9A 5MDHA 3IJPA 1Q0TA 3AHDA 3QU2A 5JATA 4ID3A 4US0R 4X71A 3C45A 1JDNA 4H60A 3L8DA 2IY9A 3ADOA 3ONEA 1O6ZA 2PT6A 4YRQA 3L6EA 3OIUA 2OO5C 1NC3A 2F9MA 1CSEE 3PQ4A 1RQRA 4WNAA 3ZHQA 3C6KA 5E9JA 2C7OA 2IUYA 3CXRA 1HSZA 3U44A 1MX1A 4NAHA 5JSKA 2B6HA 3R9IA 3J7TA 4LXTA 2AC4A 2GYVA 2JNWA 2PPVA 2FKNA 3QBVA 3AUFA 3KYCA 4DN6A 4B6EA 3IA2A 1SPBS 2GM5A 4YJ3F 2YXDA 4CLHA 2R6JA 3T9CA 2VSNA 5LU8A 1U0OC 4YMGA 2A1UA 1NVFA 3THRA 3JD4A 3A9UA 4CMGA 4V02A 1M2VB 3PHIA 1M1XB 4ZHSA 1OROA 3K0FB 1ZL0A 2QLJA 1XTPA 1ZZGA 3B5IA 3R6TA 4TQGA 1X9HA 2N75A 2W6ZA 4N1AA 4F2HA 2VHWA 1I4TD 8GPBA 3I3SR 1U65A 3IMCA 3DBIA 3T52A 2RGEA 2RD2A 1OFUA 2Z2YA 3EBOA 2QTHA 5TS3A 1PD1A 3VSAA 4QYXA 1BXRA 2CMDA 4Q4HA 2R25B 2CZCA 2NU8B 5F3DA 2BGNA 4TLEA 2AJBA 3D6UA 1EGMB 2N9UA 4GP7A 1QF9A 1AZTA 4IHJB 3V46A 2CMGA 4XWAA 3JD3A 1DKMA 1WLYA 4D42A 2F4NA 1W1UA 1A0OA 4Q15A 4S04A 2DLDA 3K5HA 2UXDB 5JFTA 4OD0A 2B8JA 4C4AA 4JB0A 1NN1A 5K2MA 4FMBB 1IQUA 4X7MA 3OQ6A 4L07A 4NNJA 5KMGB 4IKEA 4C0AC 2XEDA 2VP0A 2UZ3A 4QAJA 2DPYA 2R62A 1Q17A 3P27A 1N2EA 3HPQA 4UEWA 1E3EA 3M81A 3N8KA 1LBTA 1PJRA 1JFFB 2J59A 4ZRNA 4QM7A 2G5PA 2H08A 1GHTA 3BWXA 1ORIA 1GZ7A 3AVPA 3FMIA 4GHWA 4QPPA 1ZH6A 4ASUA 2QW1A 1I2MA 1WUKS 2B8EA 3UUEA 5HIAA 1IHDA 4RQBA 4YGYA 3HEMA 2B21A 4D1YA 1KVUA 3UH1A 4HLCA 2PUEA 3LQRA 4YAEA 3S2FA 1YBVA 2H16A 1YQ9A 4KFRA 2UUOA 3LX4A 1J9ZA 3MYYA 2A2ZA 3R5KA 4BRSA 3LKVA 1H8EA 4D0LB 2ONJA 2OO5A 2XTNA 3WWDA 1I33A 4R0MA 2TS1A 3ED1A 1Z2DA 3G0OA 3KUUA 4LOIA 3H5AA 1CJUC 3RAEC 1Y9EA 2XCLA 3PRKE 4G24A 5DZSA 2O8EB 2OENG 2WHQA 3TYXA 1DLJA 3SF0A 5HFAA 1KJ8A 1J1ZA 2ZR7A 1SCAA 1T0UA 4M0PA 4B3FX 1EBUA 3MSXA 3CF4G 1P0CA 3HXTA 3PNQA 1TQDA 5FORA 3KQQA 1O58A 4EPYA 4FVTA 2XRZA 1I1NA 4OK3A 2RAUA 3KAQA 2PA3A 4LXHA 3V6LA 1CK4A 3PHCA 4R6WA 5FL3A 5C8YF 2XY4A 3ZGYA 4HZGA 3A6PC 3CH4B 3ZWWA 4I1SA 5CITA 4KRYA 1KFKB 4KXXA 2EEPA 4YHBA 1ZOSA 5KB3A 3OM0A 1QG4A 5TT0A 1IN7A 1U2QA 3E5HA 4LFAB 4EMBA 1E79A 2XMRA 3A6HA 1G2QA 4RE6A 1A8UA 2FQYA 2H00A 2X1HA 4LY0A 4LBYA 4RHTA 5AHRA 5TF0A 5LD2B 3A1FA 3FPCA 3MINA 4AL4A 5JH7A 3OQMA 4ARUA 1OWMA 5EWLA 3O83A 4IXNA 4ERXA 3I9V6 5LOVA 1XZCA 3LVBA 4DMGA 2I0FA 2HEGA 3OE4A 4I9HA 4TVOA 3NHRA 4GPD1 2C77A 4MW1A 1GR0A 3M4ZA 3C5WP 2I4RA 3HHPA 3X1WA 2QRVA 2WPDA 3SYRA 4TMXA 4JV5B 3AUJB 3OPYB 3DV9A 1EFAA 4OXKA 1P2DA 1PJBA 5D1NA 5CBPA 3CLHA 5KOHB 1SD5A 1GCAA 1UT6A 1W4CA 1XTUA 3R77A 4JD5A 4FHFA 1Q1GA 1IQ0A 1YUMA 2C7GA 4L74A 5CA0A 2D1YA 2DY0A 4CN9A 1P7PA 1T0PA 3N1UA 3QVTA 1RBQA 2J0UA 3CU5A 1R64A 2AOTB 4DNXA 2QA5A 5KYXB 1R8YA 1E4EA 2VTVA 1NWHA 3ORSA 1MKYA 3R0IA 3AB3A 4WL0A 1PGQA 1W44A 2O48X 3EC7A 1MNQA 1QTQA 3HJFA 2VYVD 2XKAA 4U7DA 2R8RA 3DGEC 3AP3A 1MEJA 4YXWA 5L4LA 1B8VA 1HT2E 3H2BA 4RD1A 4XZ3A 1XAGA 3BAFA 1EJBA 1IBRA 3JVIA 2Z8YA 3KTAB 4S1NA 4ND6A 3R20A 2IZ7A 1U5BB 1B8OA 4OFBA 1R0KA 1WXDA 2OPBA 1XMVA 4O2BF 4TZ6A 3F67A 4W8OA 4DBZA 3P9SA 4HPWA 5ARBA 2Q9CA 2WC1A 2EIXA 2XB6A 3A14A 3NQ41 5F7XA 3FWHA 4P3PA 2ISCA 1FA9A 4QHTA 3T3HA 4DCPA 3C5VA 3QFTA 1Z5UA 2AIRA 2DFLA 2N46A 2GHQA 3D1LA 1XWIA 1Z7EA 3FNRA 1IFXA 1ZOIA 2W2LD 1N5OX 3RC7A 2XMZA 1A97A 2GPNA 4CIDA 3JRNA 1U6KA 4CLXA 1VI5A 1B7GO 3AEQB 5D51S 3TUIC 1MO5A 2COKA 1SHZA 3IXMA 1MO4A 4W7IA 2GN8A 4IYRA 4YASA 1EDEA 1EVIA 2GK4A 2IEDA 1KAMA 4N7MA 4Y2UA 1OX4B 4F1KA 3QNMA 1DQYA 2KM1A 1FJHA 4KUGA 1PFUA 2HPAA 3BE8A 1G3RA 2DCUA 3ENNA 4FDTA 4NCXA 4A91A 2JKZA 4RHYA 5D7BA 3ZHVA 3HGMA 5FD8A 1AM4D 3K92A 1CIJA 3UJ9A 4F9TA 2FPRA 4FYMA 2E49A 1DIGA 1G8GA 1T3TA 2CCGA 2OD9A 3DZFA 4O59O 1SKMA 3I72A 4JX8A 4X6UA 1CWUA 3TSCA 3U39A 3QMWA 1NLFA 5CB8A 1IVYA 3FOEC 2BDUA 2BHRA 3L9WA 4LJKA 4MQEA 5HIJA 4ZZ2A 2WJWA 4E15A 1ZRMA 4F3TA 4ER0A 1QJ4A 2WYVA 5T67A 1PKXA 3PJDA 3Q3GE 3CVWA 2B78A 2YZNA 2ZS7A 3DC2A 1E6KA 3UAVA 3DDUA 2JGRA 3R9WA 1VKNA 3FPAA 3HJRA 3EZ7A 1W36C 1AY0A 2J0VA 2YS6A 3IVGA 4RH1A 5FWDA 1O4VA 3ZD8A 2VJDA 3P19A 4NMMA 3V4LA 4DJDC 1PJ8A 4O2RA 5CUQA 3UJ6A 2R96A 3CRQA 1RYFA 2R5FA 4WXRA 1SO8A 4OJKA 1M6HA 4GPAA 1N7GA 1ULHA 3ZHXA 1HDRA 3BWCA 3KHSA 4G5OA 3WGKA 5HRUA 3GLIA 4RACA 2HA4A 3KKNA 3TFWA 5DI9A 1VM6A 2FN9A 3E15A 2BTQA 4JT2A 5AUNB 3ONFA 1VFNA 5BV2P 3M6IA 3MGAA 5LA6F 1YBFA 1EFVA 2YWGA 4HDRB 3RS8A 4QTYA 2W6PA 2G80A 2WWFA 4KPFC 4B0PA 4CMBA 4JJZA 1OT5A 2FZCA 3U61B 1NVBA 2IK8A 1GRVA 3K9HA 3MHTA 3H0EA 1Y1KE 1UXIA 1AB6A 4IVQA 4B81A 4J4HA 4CQMB 1FB5A 4R51A 2FFBA 2WTNA 4HS4A 1ISIA 1UEXC 4PX3A 2P7IA 4KLCA 4PQEA 2C98A 3OX3A 5AJVB 3VHRA 5G4LA 3HZOA 2B61A 5FI0B 5BN1A 1X2BA 2VPPA 4C21A 5GY7A 5HILA 4YECA 1PR5A 2V98A 1ZUNA 2Z1MA 1D1SA 1AZSC 1L6RA 1P17A 4X5OA 3R2JA 5THQA 2OAP1 3WXBA 5JJ5A 3PD0A 1F38A 4GZLA 5LIRA 3H18A 1DXOA 1VB5A 3BB3A 1TDJA 2P4QA 2OPHA 4QNMA 4HXGA 4UREA 1YGYA 4PR3A 4DSZA 4I5IA 2G1UA 1YHZA 1D1QA 1NBAA 2ODAA 3AEKB 2AKYA 4HR7A 4R16A 2BUAA 1KF0A 3MS2A 2W90A 1DFHA 2WIJA 2RGXA 4BXOB 4MV6A 5DLQC 1EVZA 2CFCA 1TEZA 3K6KA 3ANYB 1E3MA 1Z4MA 2AMLA 3PCTA 1W76A 3W7AA 3RVPA 1Y1SA 1V5FA 2JKVA 3PHGA 5BT9A 1PUJA 2YW2A 1ODCA 4L2IA 5B55A 5DNUA 1WHTB 1MABA 3C5HA 4D3ZA 2OESA 2VA8A 3JWHA 2XUKA 4OB8A 2P4UA 3E9NA 3WB9A 4B33A 3EXIA 4RTNA 3MLAA 4YO7A 2P62A 3SC6A 4F93B 2M32A 1R6XA 4GMHA 3AB8A 1N0HA 3SC3A 1FX1A 1I2CA 2GM9A 2NN3C 2YINC 3DL0A 3EVAA 3OZFA 4RZUA 3WLIA 3EFBA 4L27A 1NURA 3S2EA 1KARA 5LB2A 3V4ZA 5EUMA 3OJFA 3QI7A 4F3CA 3O93A 5KDDA 1FU7A 1O5IA 3H8WA 5D3QA 4U9IS 3IMKA 4WK6A 3HA7A 1E1DA 4G25A 2IV3A 4DA6A 1PQPA 4EF6A 2QAGB 2O2GA 4M53A 1A5AB 2I3BA 3WIVA 5IRCD 3IEUA 3GT4A 1XVIA 4QUDA 1V8DA 2QX7A 4QL3A 5FT9A 1R5BA 2PMDA 3HRHA 3FZEA 3PENA 4K8OA 3U0BA 1R4AA 3DCJA 3IX7A 3QTTA 3ZEAA 4B7ZA 3GUZA 3GLKA 3NYWA 4JYCA 4ZQCB 4FX5A 1A9ZA 1ZA1A 3FMOB 4BKMA 4IJ6A 4C7KA 3I32A 5PGMA 4PLVA 5A4FS 8ADHA 3EC1A 1KA9H 1SELA 2EARA 4PAMA 4UNIA 2PS0A 3I2KA 3WL7A 1SRQA 4B71A 3WXMA 1KYQA 1MQAA 1X7DA 4IJKA 4B84A 1P19A 3M6AA 5FF9A 1H2AS 2H2GA 4I9NA 4Z9AA 2V0CA 1RVDA 4FTWA 3G9UA 4BQEA 1M76A 4IUYA 4JHXA 1IDOA 1E64A 1X8JA 3EZ2A 4NU6A 4WGGA 3BKWA 3S3TA 3Q8KA 2PD6A 3BXZA 3IQFA 3KOYA 4IEEA 3JCZA 1RYYA 3NM4A 2RI1A 1IATA 1PJZA 1SOMA 2H5JA 3WMXA 2XDAA 1B0UA 4GOLD 4N3BA 1KBOA 2XCIA 1MU0A 2XYQA 1QIEA 1ZVQA 3A7EA 2DQYA 3MBKA 4TT3D 3M6MD 1A8SA 4MRNA 1R4NB 1QRDA 5DBEX 1QH8B 2WD7B 3I53A 5A0FA 4BV2A 4KUEA 1MG0A 4D5EA 2BSQA 5HDQA 1Q44A 3G7NA 4UHKA 1YOVA 1SCKA 2P9GA 1EUDA 1YCFA 3WY9A 2QL7A 2ASEA 3VKVA 4BAZA 3W3ZB 2A86A 2JVKA 3HYTA 1CUXA 4LQDA 2P1DA 4MVXA 5ALKA 2CC2A 1JPUA 3DEAA 3GGSA 3JW8A 3QVOA 4F7DA 5JAIA 4JBWA 2Y3IA 1S9DA 1X7HA 2YV1A 3IE2A 4W1PA 2XGSA 1WW3A 4NMLA 1KXZA 3ZHBA 5JQGF 1LVGA 4JC4A 1SQGA 3FPLA 3W90A 2GFQA 1TOAA 1YVUA 5CDSA 2XLCA 2IQIA 2R7LA 4GM4A 1R9JA 2XIJA 1OHHA 2XWBF 2JK1A 4XYBA 1OOEA 2PU7A 2B4KA 4JL8A 4GXTA 2H0AA 1JG4A 2G25A 5DXAA 2WHYA 2C82A 3Q0TA 4ZYWA 3R5JA 3WGTA 3I8XA 3D3NA 3LX6A 1U1EA 3QPBA 2DFTA 2JGDA 2WLTA 2I6XA 4L5YA 4OAOA 4IFIA 1FFXA 1XTQA 1NV9A 1T9DA 3PWZA 4N40A 5DKFA 4IUDS 1SPXA 3JQ7B 1OI4A 4MI3A 1LDMA 5HKKD 2W4MA 4RLFA 4ZOBA 5BN4A 1SOVA 1HFEL 1W8IA 2AOWA 2DFVA 1KEUA 3M9LA 4CL0A 3MRVA 2JLSA 2HK8A 2ZWAA 3OJEA 5DSZA 4A1FA 1H4TA 4IIXA 5CB4B 1EK2A 2Q0SA 2YZMA 1G3QA 3FDJA 5ARDA 5DM70 1GDDA 3BPSA 5NLLA 3VOTA 4ZHQA 2WP8J 1UJMA 4MVJF 4DA9A 2UZAA 5HGJA 3AOEA 4W1SA 4RJJA 3U3XA 2D5CA 4LG1A 3UT0A 1LH0A 3GLFA 4JUIA 4LF8B 1V1RB 1WB5A 1JWLA 1CQWA 2XWQA 3EDOA 3OLVA 3QFSA 4RIGA 3V97A 1L7PA 2JHPA 4I36A 4H3HB 4NE7A 1R4MB 3HB4X 3UUWA 3U19A 2CYCA 3I9NA 4M0EA 4RJLA 1NMXA 3OZTA 4TV8F 1NKSA 3THSA 5TLSA 4JB3A 2CZGA 3NAQA 2BFFB 1JNYA 2EZUA 3X1MA 3OTQA 2IIVA 1O96A 1FEZA 5F1PA 4Q34A 3WIEA 1F5NA 3LC7O 4KOAA 3BJRA 4MLCA 2QZSA 3E58A 1K7EB 2BM0A 4WI1A 3WK5A 1XCBA 2QENA 1PO7A 4D79A 3UWOA 3T1YB 2F59A 2R6CA 3ZJVA 2DHDA 3KG2A 2C2MA 1FSZA 1IAVA 2ZK7A 3AVXA 5BR8B 1X80B 1SOWA 4KO8A 1NQVA 2UDPA 4EHBA 3PCRB 1D2AA 3P0RA 5KNDA 4MDEA 4ESEA 2Q46A 1JR3D 3R3VA 4C6TB 5REQA 1G3MA 5HF5A 4CRWB 3SDSA 2QVLA 3QWHA 3GPLA 2DGDA 3PEVA 3L1VA 5FTLA 1JU3A 3LWBA 3RFVA 5H3HA 3P2YA 4CCSA 4ZYLA 2F17A 2FDCA 3MS7A 4WJKB 1IPHA 2FF7A 3LC0A 5IKXA 4CKWA 4GE3A 5B7GA 4KGZA 1V7QA 2K5UA 1LNZA 3L4EA 3WLJA 3AY3A 3AKYA 2MYTA 2FDXA 2SICE 2CXPA 1E7WA 1AUVA 2GTPA 1IXZA 5A7HA 3TDMA 5EXXA 1RSZA 1VJ5A 4V0LA 3DWFA 1I80A 3JASA 1TZ2A 2XNCA 3B7PA 1E3SA 4TLDA 1LDYA 1DS6A 5IARA 3GRVA 1L8XA 2C3PA 3HO1A 3ZJ5A 3DWEX 3KEQA 3QEOA 3I9LA 3W78A 3H8JA 4IDDA 1XKXA 5GPBA 1ID1A 1UPXA 3QV2A 4RQUA 2O2DA 2AZMA 1YRYE 3AEZA 4ZT6A 1I0LA 3PL1A 4TM7A 4US2R 1QHHB 3NH6A 2AFRA 3IDSA 5FUMA 3NALA 3C3YA 4XJTA 1E4OA 1ONPA 2WUDA 3GDWA 1T2DA 4TGLA 2ZI9A 3WYNA 5FA6A 2ADFA 2LWIA 5LUAA 3ENZA 2IYFA 1OY1A 1C1XB 3H5TA 2FPMA 2Q3BA 2OXFA 3HYRA 3L5OA 1H42A 3U6KA 1KEZA 3QE9Y 4BOYA 1X7YA 2IHYA 4K9SA 2G9NA 1TM3E 2A9OA 4KLNA 1AK9A 5H3CA 1UOPA 2ZITA 3IE1A 1G59A 1ZOOA 1SKQA 1KR2A 3OEEA 5IXSA 2ZM5A 1AN0A 3ORHA 3R7WA 3DOEA 4XX0B 3UFXB 1X1QA 3B1ZA 3CONA 4QECA 2OFOA 1N5JA 3GGPA 3VSCA 1OPRA 1UMKA 1NDUA 2JI9A 3WKBA 3R24A 2D1RA 2XA9A 2QTVB 4QOJA 5IK2D 3H5OA 3BOSA 1AN9A 1KL7A 5DTJA 1MB0A 3STVA 1D2RA 3E9CA 5JLAA 3EDRA 1QG0A 3L0BA 4FFVA 5EEGA 3PX3A 4QOSA 4DM3A 3N7TA 4PYJA 4QEDA 2B4TO 2OV8A 3N07A 3NAGA 421PA 4HDMA 5EJEA 2WQ6A 1YE3A 2GESA 5EY5B 1M0EA 3ZWOA 5GINE 1EFKA 1YTLA 2PGAA 3EYAA 3WIDA 2GNAA 1J8MF 1ZUIA 1UC8A 3AV0B 2ZB2A 1QMGA 1EFCA 4UM8B 2HSZA 2C9OA 3M2TA 1GGVA 3L8HA 4CIWA 2V55B 1KPIA 2F3TA 4R2JA 5I9IA 2O5CA 3PSAA 1XQ9A 4HAIA 1CDEA 2ZVPX 3NNDA 4FFPA 3UMGA 3ZUPA 1Y5IA 3BL5A 5DBOA 3N8HA 3GG9A 3LY7A 1QKIA 3DOUA 2OY0A 3KU1A 5EA2A 2FW6A 1YJAA 2P11A 4I8DA 1G21B 2H8KA 4LMRA 1PK9A 2DHRA 3X2FA 4ZZ1A 2B4QA 3TRFA 3IILA 1HURA 3DMDA 4R9UC 5H83A 1K75A 2X2EA 4XCQA 4CM4B 4MA5A 2E4AA 4E1AA 2YBEA 1C80A 1VIYA 2BN4A 2NU7B 4P4GA 5A2GA 2ORWA 4BUCA 1AA9A 1M2OB 3QUAA 4PSVA 3U48A 1KQ3A 1IM5A 1YZKA 2J9ZB 6ABPA 3WQSB 6GPBA 4IZ6A 2JGFA 5C8YA 3V3KA 4XPIA 5EIBD 1ECCA 4BVGA 4PPGA 4IJVA 4ZAZA 3SYMA 1NG1A 2BOVA 1JJAA 1JEJA 4Q3OA 3GEHA 3FF4A 2H6EA 1YCDA 2VUUA 3QU9A 5D7NA 4DT1B 4FC6A 4BIMA 4DQVA 1FJXA 5C7YA 2VK4A 3Q9LA 4EJ0A 1NBHA 1UFOA 1N8TA 1TIKA 2PZGA 3FYUC 4OI0A 1D0SA 3UT5B 1V9LA 2V58A 1PZEA 1CUCA 1I3MA 2YOGA 4OMFG 4UVDA 4FQ8A 3R5SA 2X4DA 4CHGA 5I7RA 3RSOA 4W5TA 4IXWA 2IBTA 2ZSJA 3EGCA 4IIFA 3QUTA 4R83A 3TRJA 2FY8A 2FQQA 2QJFA 2C58A 2UV8A 4GYWA 4UATA 4Y6LA 2R1VB 1KRXA 5IJ0A 3M82A 1ZN8A 4FC7A 2JZOA 4B75A 4FFMA 1DI0A 1JDPA 5DASA 1ZMOA 1Y9JA 3AHHA 1Q84A 2IYLD 1Z4QA 4LI0A 4F9GA 2PUBA 3T34A 3TUJC 4JBIA 4BO7A 4I5GA 5BWBA 4B32A 3DKKA 3MT0A 2JZCA 1FFHA 1RFLA 2V45A 2C5LA 3R7DA 4EQ6B 2ZP1A 4WZ6A 2VHVA 4MS4B 4OXYA 3BIJA 1W6UA 4TYMA 3NTUA 2QVGA 5F64A 3LDUA 2QEQA 2HV8A 3BG5A 1GARA 2XZDA 2NYRA 3DE7X 3C3XA 2BFDB 3CNBA 3UQYS 5ALJA 5AUOB 3I5YA 1OWPA 2B8WA 2AEFA 1Z35A 3OI7A 2B3DA 5ERXA 4B4VA 4BLVA 5KYVA 2HGZA 5CLJA 1Z25A 2ZDHA 5GM1A 3YASA 4AQ7A 2CXHA 3EA4A 1RABA 1SA0A 4RJIA 3T6KA 3BMCA 1V6AA 2NPOA 4LF4B 4ON9A 3VYSB 1KGDA 3B9BA 3WLMA 4C7MA 2QP9X 3DLBA 1FSFA 3JWEA 2ZRDA 5DHUA 5AUPB 1GRRA 3AKDA 3N0VA 3OIYA 3ZTWA 1A8PA 1Z2CA 2GF9A 3HDTA 4EI2A 1V39A 3TAUA 4MRMA 4AK9A 1UMBA 1VJTA 4I1PA 4IO0A 4O4LF 1FMLA 2IBSA 2RMKA 3Q11A 2BFWA 4AJNA 2RH8A 2H1SA 2ZROA 2BBTA 3K9FC 2F8TA 4RDCA 3G2JA 4TS3A 3V55A 3VZSA 3Q7SA 1O0CA 1RR6A 3V8NA 4OLFA 4CL3A 4DSNA 1JKJB 2PLAA 1SVUA 3FOBA 2PL9A 3OQIB 3VKHA 2I99A 3ESDA 3L6DA 4ZRMA 2YC4C 3CWQA 3RTEA 4MEAA 4KZKA 3PGVA 1VYVA 3SC2B 3LYHA 5DBGA 1GYRA 2RC6A 2Z2XA 3KLOA 1X38A 3STTA 3X1ZA 5M29A 2RIPA 4FP9A 5CVEA 1Z2OX 3JD0A 3FYUA 4FS8A 3USCS 1FRQA 2HO5A 3KALA 1EP1B 1T35A 3W4IA 4DV6B 1EJ0A 1SUPA 2J5KA 2XTJA 3NVKI 1XQXA 4N6NA 4RIEA 4KO3S 3X1DA 2JGIA 2AFHA 4WN9A 3BORA 4HI0E 1IK4A 4EYGA 1X7ZA 1W25A 1ZAKA 2PM8A 4ODIA 4BB9A 4GL4A 2B30A 2IHJA 4BYGA 4W5WA 1XCLA 4H4CA 4BJ3A 2DJIA 2JBHA 5EHGA 1Q1QA 1XAHA 3WBBA 1FF9A 2Q2QA 1KK0A 2RG7A 3OC6A 3T5CA 2HWUA 2ZBPA 2BAGA 3G9QA 3LHSA 5BQPA 4LF7B 1Z0SA 3KQKA 4J1SA 4TMZA 1HKUA 2WSYB 4US1R 5K7SA 1T3GA 2CL0X 3EWSA 3TCKA 1LC3A 1NLUA 2R1UA 3SD7A 2HNBA 4CM8A 5AXBA 4ZVTA 2V0NA 1XUOA 1E3IA 2ORIA 3FXAA 1C3JA