3F9IA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase rickettsia prowazekii
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
241
structure length
220
Chain Sequence
b'MIDLTGKTSLITGASSGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNALKDNYTIEVCNLANKEECSNLISKTSNLDILVCNAGDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVGGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKLNEKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLMV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
molecule tags Oxidoreductase
source organism Rickettsia prowazekii
publication title Structure of 3-ketoacyl-(acyl-carrier-protein) reductase from Rickettsia prowazekii at 2.25 A resolution.
pubmed doi rcsb
total genus 78
structure length 220
sequence length 241
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3f9iA00
2E4AA 1H6DA 5JLAA 4AJKA 3SC4A 3L6OO 4XB1A 4QSMA 1EDOA 4WGGA 4R9RA 3PJDA 1IB6A 3VPGA 3X2EA 5DBFA 5EJ2A 4XYMA 1GZ4A 1PJTA 2UYYA 4BNJA 3K30A 4DLLA 1C0LA 5EN4A 1ZJZA 1A27A 4H7PA 4ITUA 2FR8A 1MLDA 4I5FA 1LX6A 4G2NA 4J1NA 3WQRA 5B1YA 5F1PA 2X9NA 2X23A 3KYCB 5EMHA 1CWUA 1WZEA 5JO9A 2HKIA 3VVCA 1IOLA 3GVPA 1KVUA 1ONPA 4UULA 2YDXA 4F46A 4QQRA 1YWGO 1B3BA 1HDRA 4J2HA 4GLOA 2DBZA 4JN6B 4MVJP 4TWRA 2PKQP 4QX6A 3K31A 3PGJA 3WX0A 4F45A 3GNSA 2BRUA 4LRTB 1HSZA 2FHSA 3KB6A 3C85A 4OO3A 2HMTA 2Q2WA 1H93A 3B70A 2E48A 4X54A 2ZB8A 4EW6A 4BQPA 3O26A 4PG4A 4YJGB 4BO8A 3AU8A 4LRSB 1PU2A 2X58A 2A94A 5BSGA 5EINA 1HF3A 5G0SA 2PGLA 4H16A 3KHUA 1PS8A 4L8VA 4TRNA 4YPOA 2D0IA 4CV2A 5ICMA 3Q11A 4FFOA 3TJRA 1HT0A 4PZCA 3T4EA 2DUUA 1NBOA 3I4FA 4B8ZA 3KBOA 3W6ZA 4W7HA 3IIEA 2W90A 3AW9A 2OL4A 1MC5A 4HKTA 4B3IA 2J5KA 4DIOA 4QTZA 2WYWA 1MA0A 4D41A 1GY8A 4YAKA 2W98A 1A7AA 4NG5A 3OQ1A 1Y9EA 4TMFA 3UH1A 3L0DA 4CUJA 3GT0A 2Q99A 2LDBA 4R5HA 1K6JA 1WLYA 4HUJA 3W8EA 3PPIA 2BGMA 3BMQB 4XQEA 2GDZA 1PZFA 3GHHA 4H15A 1HDXA 3QVOA 5GZ3A 2P91A 3I83A 4J1SA 1PJ3A 4FOOA 4NFSA 2Y66A 4CLXA 2PLAA 2Y1EA 1UP7A 1DJQA 3QWBA 1ADBA 1J49A 5TS3A 3H3FA 1PTJA 1T2AA 3KO8A 2Y1CA 2IEDA 4PIVA 4J0FA 3GEDA 1LDMA 1LUAA 1ZEJA 1UXJA 3ZWVA 2PTGA 4JBGA 4UUNA 4WCFC 1U1IA 1YL6A 2ZKLA 4PLTA 1CQJA 2QYSA 5TJ9A 4BKUA 2B5VA 1VSUA 3BMQA 1AHHA 1ZSYA 3G49A 2ZYDA 5TQVA 4EJ0A 1TLTA 1N2SA 1BRMA 1XR3A 1YS4A 4B4OA 2OORA 4K6CA 1E3SA 4QUKA 1E0DA 1HDYA 3TNLA 1DC6A 4NH4A 2QQ5A 5DP2A 1TEHA 4MKRA 3GEGA 5JBIA 1EE9A 4ND4A 5A04A 4QFDA 1NVTA 3ITDA 2I65A 1OC4A 4M1QA 4FPXA 4TROA 3GUYA 3INRA 3UF0A 4NJOA 5A9TA 1F12A 3IQDB 3LT0A 3CE6A 3WDSA 3ETDA 1Q2XA 2OGUA 1A9ZA 4E5YA 2J6IA 4CUZA 2DQ4A 4J4TA 2AXQA 4YQYA 4GBJA 3H3JA 3JQFC 3I9KA 2QRJA 5TIIA 2J8ZA 4D79A 4Z9FA 2D2IA 2GUGA 3ROMA 3G17A 3HQ4O 4II3A 3E03A 4RZHA 2ZB4A 1KC3A 4CLEA 3PYMA 4NQZA 3RQSA 3ETGA 2YV3A 4C7JA 5ITVA 3GVCA 4YA6A 1XA0A 2Y99A 4O5OA 1D1TA 3VOSA 1DC5A 2X9VA 4DA9A 4IS3A 1I2ZA 4IDFA 1D7OA 4OIMA 3PHLA 1H9AA 2WYUA 2QX7A 4AJOA 3NDRA 1NAIA 3FD8A 1QMGA 4XYBA 6LDHA 4WNCA 4MIOA 1E3IA 4BKQA 4NBUA 1HE4A 4U0KA 3ZU3A 2Q1TA 4WEOA 2NTJA 4DGSA 3HB5X 5A3JA 1UAYA 1LDYA 3IP1A 2P4QA 3FBGA 3OEYA 3RFXA 1IZ0A 3RASA 3CH6A 5KJFA 3I3OA 1RYDA 2IEBA 1V35A 1C3VA 2PGDA 4N7RA 3DONA 3LLVA 2BLLA 3LU1A 3WGGA 4P38A 4RVUA 4AJEA 3GNQA 3GMSA 1Y6JA 4IDGA 4YT8A 3F1KA 4GKBA 2FY8A 1DIBA 1Z6ZA 4D0SA 3C8MA 1EVYA 3ADPA 4Z9YA 1N9GB 3AFMA 5KJ1A 5ES3A 4RJTA 3RJ9A 4NNJA 1IE3A 2JHFA 3FNGA 1W0CA 4CMIA 4DXHA 1VPDA 4XQGA 4R1NA 1ADFA 3UOGA 5L7WA 1I3LA 5F1OA 4A26A 1PZHA 3N7UA 4TSKA 5EQDA 1PIWA 4PFJA 4KP7A 4XA8A 3GZ4A 1KIFA 4XKJA 3MJEA 3UFXA 2UV8A 3KSDO 5JE8A 1KY5A 4NJMA 4R3WA 4WPGA 4UAGA 3R6DA 4KZPA 3E5MA 4YJHA 3DEYX 5FF9A 3H9EO 3LF1A 4YAGA 3KLPX 1A5ZA 3FWNA 4IJVA 2C2YA 1V3VA 3H9GA 2C82A 3WFJA 1TVEA 3VH4A 3CINA 2EHDA 1YB4A 1E6UA 3MOIA 1IUKA 1EDZA 1LRJA 5F5LA 3I5MA 2GN8A 3IS3A 3BMOA 3RUIA 3OJOA 4O59O 3TZQA 1EEHA 1BXGB 2FPPA 2WE8A 2FN7A 3ZWMA 1NPYA 4CM8B 2Q46A 2YYYA 2A92A 3IJRA 3A4VA 1KEUA 3WGYA 5J23A 4BO4A 1KBZA 2UUOA 5JPIA 1IZ9A 2ET6A 1JQBA 1X1TA 3D5QA 3L9XA 3QIVA 4NZ9A 2ZB7A 1QG6A 1OI7A 1AHIA 1B16A 3OIDA 4K6FA 3KYCA 3HN2A 1QKIA 4LVCA 4B79A 1S7CA 3VH3A 4BMNA 3IKTA 4BGVA 3HWRA 4FC6A 3KYBA 1P9LA 3AJRA 1DXYA 3FPCA 2VQ3A 3PHGA 1Y5MA 3ZWXA 4BB6A 2Q1UA 3BZUA 4A73A 1WDMA 3WGOA 1GZ6A 3QP9A 3WMWA 1EVJA 2WM3A 3L07A 3CMCO 2D1YA 3F4LA 3UUWA 2X5JO 1NHWA 3D7LA 4RQTA 1JAXA 2Y1OA 3TZKA 4LGVA 4CLOA 8ADHA 1DIAA 1GUFA 3GN1A 1T2DA 2V65A 1XLTA 5B37A 4ZRNA 1YOVB 1W4ZA 4DIFA 1R4MB 3AUTA 1XDWA 2QRKA 3FPLA 1UXKA 4KOAA 2OFPA 1YOVA 1RYEA 4BNIA 5EQFA 3KETA 5IG2A 1GYPA 3E9NA 3UW3A 3K2BA 2Y1FA 3OBBA 3A06A 3OEWA 1LSOA 4NBRA 3VKUA 4AJJA 1Q7GA 1P3DA 5JXWA 3JQAD 1ZK4A 3C7DB 3GUCA 3QLJA 4CQMB 4EEZA 4BNMA 1E1KA 1B8PA 1X7GA 3ZV3A 5G0WA 3HSKA 4JXKA 4M55A 1WVGA 4HFNA 1IYZA 2VWGA 3DAGA 5KVQA 4URFA 4EUHA 2V6FA 3AUAA 3T7CA 5F5NA 2Z1MA 3IP3A 5JCJD 4FCCA 5G0UA 2AEJA 4R16A 3K96A 4LN1A 2GYYA 2JFHA 1HZJA 4YYZA 4D46A 1PGOA 1Y5RA 5T57A 4YT4A 5K6AA 1EQUA 5DT9A 1H6BA 2CY0A 4BO7A 1OBFO 2JD2A 2VWPA 3H4VA 4EGFA 4AJ4A 1LRKA 4RF2A 4DC1A 2X7HA 1K6XA 4CQMA 2O48X 2YUTA 2EIHA 3QWAA 3PHIA 4OAQA 3S2GA 1L7EA 3FTPA 1UXIA 2GCGA 2X0JA 1LJ8A 2D8AA 3EZLA 1ZO8A 2EKLA 4QT0A 3EC7A 2C59A 5C5IA 3DAPA 1TT5B 5KNLA 3WQSB 5B12A 2GASA 3U4IA 4EI2A 5CEFA 1QYXA 1PQPA 2EP7A 4NMHA 4CMHA 2VUTA 3FI9A 1WW8A 1HYEA 4BV8A 1VI2A 2NQTA 3HHPA 3U62A 2NU6A 2VT2A 1T2FA 1PL7A 4BGEA 4TRMA 5A4DA 4YJFA 4IZIA 2C54A 3B20A 2G0TA 3GNTA 3E82A 1HWYA 1ZNQO 3IUSA 3OIGA 4MIEA 3GZNB 3LF2A 2AG5A 3VPFA 3ZHYA 3PFFA 3DMTA 5AQ1A 3QJ5A 2PD4A 4YQZA 4YB8A 3DBHA 5KVSA 2W4QA 1B15A 3H9JA 2EGGA 3W6UA 4CMEC 4YAJA 2VHZA 1SCUA 4CM4B 4YT5A 1G0NA 4Y67A 3WMXA 4NBWA 1B0AA 1RM3A 4TKMA 3UXYA 2Q1SA 4F6CA 1K0UA 1R37A 1EUCA 2DKNA 2HSDA 4GWKA 3RSHA 5L45A 4TQGA 3C7CB 3DL2A 4NU5A 3ROPA 1ZK0A 5JCXA 1H94A 2J5RA 4BO3A 3BMNB 4ZGWA 1ISMA 5ICSA 2AQHA 2J3KA 1C0KA 1BXGA 1VJ0A 3GFGA 3WIDA 3R0IA 3OFSA 3HDJA 1DAOA 4BNXA 5BSFA 5IXSA 1ZXBA 3RUEA 1LSJA 4RVHA 1J0XO 4BVAA 1SEVA 3GDOA 1XQ1A 3VDRA 1LSSA 2X0RA 4AJLA 5C3MA 3ABIA 1GPDG 4JP3A 4EJ6A 2CMDA 3MJCA 1PWZA 1DC3A 3ZWYA 2P2SA 4F6LA 4BNNA 3JSAA 3NDIA 5JY1A 4WKGA 3EVTA 3W4JA 4XCVA 2XOXA 3BYZA 5I7SA 1QSGA 2WD7A 1XQ6A 1Y7TA 5HA5A 1D3AA 2CF5A 3UCXA 1TXGA 5COAA 1NM5A 2Q45A 4TVOA 3TL2A 3GG9A 1Q1NA 5CFZA 5AXDA 5A3VA 1JKIA 4A7PA 3LLSA 1B8VA 2ZTMA 4CMIB 4ZQBA 2PR2A 1S6YA 3IAHA 5I7FA 4FQ8A 4D3FA 2SCUA 3PYXA 3WGHA 4M87A 4EJMA 2WSBA 4HNHA 3Q2IA 3HN7A 3U3XA 3ZU5A 1A7KA 1SAYA 1GAEO 2VT3A 2VZ8A 1ULSA 1JN0A 2FR0A 2ZQZA 3S2FA 5MDHA 1HDOA 2WE7A 2Z95A 4BMSA 4DPLA 4J3FA 1LSUA 1NWCA 1PL8A 2X9GA 4IQ0A 4OXYA 4XZ3A 4AL4A 1HYGA 3MJVA 3QHAA 1KEPA 3AI2A 3JD4A 2GNAA 4K1LA 4BO1A 3AI3A 4MVJM 5JMPA 3FBTA 3H2SA 3INTA 4B4VA 4E3ZA 1E6EA 4XX0A 1RWBA 5IXYA 4JQCA 1VL0A 3ITKA 2PKRA 2VOEA 4D7AA 1MFPA 1X0VA 1U3VA 4N5MA 3GAFA 4GX0A 5DULA 2VZ0A 1UXGA 3VPXA 4CM3A 5A02A 3DZIA 4WLNA 3D5TA 1ULUA 4JP2A 3AI1A 3PYLA 2OUIA 4GI2A 1DIHA 4RPHA 5AXCA 1E7SA 1SB9A 2DFDA 4FS3A 3WGTA 1E7QA 5IZCC 1LA2A 2PH5A 3TOXA 3QWIA 4GLLA 1FF9A 4PLVA 4BS9A 2O4CA 1PJLA 4DBZA 2QYTA 3RI3A 1DRVA 2JFFA 1E1NA 1I01A 4P22A 4R3NA 1HRDA 5IDYA 5C7IO 4UVGA 3RD5A 1D1SA 5B4TA 1J6UA 1GEEA 1JTVA 5I9NA 3EDMA 4ALMA 1ZK1A 2JFGA 1YL7A 4YBZA 4R5MA 1I24A 1DFHA 1VJTA 3VZSA 1KVTA 2C20A 4JIGA 5H82A 1R15A 4TVBA 4BO5A 3BMOB 3JV7A 2ZTVA 3PP8A 4FD3A 3EW7A 3RC7A 4A10A 4RV9A 1Y8RA 4GX5A 1TT7A 4CR6A 2VYVD 1R16A 1FMCA 3NGLA 2UUPA 4FGWA 1DHRA 2NU7A 3WQQA 5L9AA 4U5QA 3M2TA 3SJUA 1A4IA 1XELA 1F06A 2C7VA 4J4BA 1P0FA 3JQBC 2DVMA 1C1XB 1HLDA 1W8DA 2D3TA 1V3TA 2W8ZA 1QYDA 1DPGA 4IXTA 4TRRA 3BA1A 2GERA 4LSWA 1TA4A 4Q3AA 4B4UA 1U2DA 1KETA 2C5AA 3N74A 3AY7A 3HUDA 4ALNA 3ZHBA 1PEDA 2JAPA 3R3SA 3G0OA 4FDAA 5G4KB 5L4SA 5IF3A 2VRCA 1EZ4A 3H5NA 1M66A 1I30A 1RM0A 2NVBA 4XEHA 1QV7A 5FFFA 4UUMA 4P4GA 3ZW9A 1UZMA 3ZN2A 5BQFA 8LDHA 4RPGA 1WXDA 4R1SA 4K28A 3S55A 4BKPA 3FRJA 2X22A 4EZBA 1XKQA 3VHRA 1H5QA 3A9WA 4IJKA 3WBFA 4NIMA 1SC6A 3ZV4A 2HMVA 2D4AA 3TQHA 4I5EA 3IKVA 3JQDA 3OJLA 2Y93A 1PGJA 3ENKA 3QRWA 1WZIA 3SVTA 3KTDA 4R41A 3L4SO 4P4NA 3D3EA 2B35A 3AWDA 1DFIA 2EJVA 1LLQA 1OOEA 2WTBA 5AYVA 5JNLA 3IJPA 2RH8A 1Y81A 4IXWA 5HS4A 5IN4A 3DO5A 2O3SA 1DEHA 2TMDA 3CUKA 4YVFA 3WICA 1K2WA 3HZZA 1Z75A 1E77A 2BELA 2G5CA 2H9IA 2ZYGA 2CF6A 3JQFA 1ZMOA 3C24A 3NYWA 5A5FA 1O94A 2D5AA 3WLEA 1MB4A 3KYDA 1IULA 3CZMA 1ONNA 3GDFA 3JQ7A 1BDBA 3EAGA 2VWHA 3ZNOA 5KJ6A 2C07A 3B1JA 1DRWA 2Q49A 4ZVVA 4GX2A 1P1RA 2X0IA 4RDIA 4RLSA 4NPCA 4YDRA 1NWHA 4O1MA 1XWFA 3NEPX 5KTKA 2I76A 4AJIA 4DMMA 4E32A 4M8SA 5KWEA 3EUWA 1HETA 3VPHA 3VTZA 3I9OA 5T8KC 4XRGA 2CVOA 4K9DA 4IGFA 2Y68A 2HRBA 3H9QA 4WJZA 1MXFA 5BNFA 4E2WA 5A9SB 1W73A 2I3GA 3D4PA 3O8QA 1DBVO 4LCEA 3GF4A 1VJ1A 4GGOA 2VHXA 3VC7A 1E6WA 3MTJA 2Z5LA 4FJ0A 2WD7B 1I2BA 4JCOA 4BGIA 2JCYA 1BVUA 4OH1A 4EUFA 3JD3A 4WASA 2JL1A 3BHJA 3AM3A 3E1KA 4Z0PA 3E9MA 1X7DA 2X4GA 2OXIA 5B4VA 1JVSA 4RCVA 5DCUA 4IIUA 4CM9A 2Q1WA 1R6DA 3ENNA 5AXAA 5BR7A 3PRJA 2R00A 3JTMA 1LLCA 4B8WA 5IFLA 1EVIA 4FC7A 5GZ1A 4Q3EA 4OSOA 3LYLA 4MJLA 2QZ9A 4GX1A 4XJTA 2QHXA 3EHEA 1IPEA 4YAIA 3FCOA 3FNHA 1JA9A 5CP8A 1U5AA 4LMPA 5FEUA 1C1DA 4Y6RA 3TZHA 1E1MA 1M75A 3KZVA 5BNIA 4M54A 1T1SA 1B3RA 5IZ4A 3LT1A 5DZSA 3IDSA 1ONOA 1U7TA 1B8UA 1ZUD1 3ONEA 3HB4X 5G0VA 1I36A 2Y0DA 3WJ7A 4E21A 3OHSX 2ZJ0A 5CHEA 2AEFA 4LSMA 4OM8A 4GVLA 5EERA 3SEFA 3STHA 3TFOA 2HK8A 3CEAA 3UGKA 1EVZA 4Y98A 1Y8RB 4L0QA 3IUPA 2GN4A 3PEFA 4ALKA 2Q2VA 3WXBA 3ZHZA 2AA3A 4RF4A 4L73A 4R01A 1JAYA 3OQBA 4AFNA 2ZQYA 5JC1A 1I0ZA 4KTTE 1EBUA 2TMGA 3OIFA 1DIGA 1TB4A 1ZKMA 3HFGA 4GMFA 1N5DA 5JAQA 1F8GA 4BNTA 3AUSA 2P9CA 3PIDA 4W9NC 3JYOA 1NVMB 4A2CA 3SXPA 1E3WA 3PJFA 4XGIA 4TKLA 1T26A 1E92A 2JAHA 3HJAA 4RVGA 4PGFA 4YRDA 4CM8A 3JQ9C 5T64A 4RPJA 1P45A 3OJ0A 2HUNA 2I99A 3E6AA 2OBYA 3ZU4A 2X6TA 3QSGA 4DYDA 4GMGA 2HQ1A 2ZTUA 3QE3A 5DN9A 1R4NB 3D1LA 2VZ9A 3RU9A 3A14A 3KUXA 1LLDA 4OJNA 4E5PA 1QRRA 1QLJA 3OECA 3JQEA 3PJEA 5JS6A 3RU7A 3DWFA 4FFRA 2X0NA 2J5QA 3KEOA 1DLJA 1GEGA 1I3MA 2OO5A 3VKVA 3B6ZA 3JQGB 4DPMA 1PZGA 3RCBA 2J3HA 4PZEA 2VUUA 1SOWA 3UCEA 4HBGA 5JYDA 2HRZA 2I3AA 2PFGA 5DNAA 3P19A 1CRWG 1HL3A 2VRCD 4OYRA 4G5HA 1O6ZA 1EMDA 4UVHA 2RHRA 4AG3A 3QWFA 3ANMA 4RVFA 5IJZA 3KEQA 3M2PA 7MDHA 2GF2A 1RPNA 4JGBA 4XJSA 2JJYA 2WYVA 2YQ5A 2DFVA 1Q0LA 2OOSA 2LDXA 2DBQA 1YB1A 5C7OO 4PVDA 4J1TA 2VYND 3P2OA 2HO5A 1FDWA 1O89A 3GC6A 4MKZA 1M6WA 1WPQA 1P1HA 5CEJA 1X1EA 3X2FA 3LVFO 2ZIZA 1GUZA 3O9ZA 4XR9A 4FSHA 2I6TA 4YJDA 5KCZA 3CSDA 2RBEA 1SPXA 1RJWA 3D64A 1UP4A 4CM1A 5BSEA 1N8KA 1U4OA 1H9BA 3TZ6A 2C5EA 4J4HA 3IOYA 3K5PA 1ZSNA 3K2EA 4I1IA 2P4HX 4PG7A 3PWSA 4J7UA 4OKIA 3BMCB 4NK5A 3WJAA 3BHIA 1U7HA 1BGVA 4QO8A 3PJGA 2BGKA 1YL5A 4ILKA 3RFTA 3GVIA 2PZMA 5G2OA 1QP8A 3NUGA 4KMSA 5GY7A 4CM7A 5ENVA 2AQ8A 1I8TA 2YHUA 3E18A 3GZNA 1YQGA 3RJ5A 2G17A 3JQ9A 2GZ1A 2EEZA 1ZH8A 2VNSA 2CSUA 4ROSA 5CDYA 5U9CA 4PLHA 1ORRA 4B3HA 4R1UA 1JDJA 2D59A 2V6GA 3BIOA 4DL9A 2RAFA 3RAJA 2NU9A 4EITA 3FF4A 1M67A 3F3SA 4XR4A 1F8FA 1TI7A 2GO1A 1LDEA 5JW6A 5I9MA 3VPSA 1ID1A 1XHLA 4B4WA 1NQOA 2B69A 1T2CA 3U9LA 3F9IA 4RO0A 3QW2A 1D4FA 1CJCA 4Q9NA 3MCVA 4HFJA 4YCAA 2ZJ1A 2DPHA 4MVJH 3T4XA 4BNWA 3WNQA 5HBRA 3I9MA 3PDJA 3F4BA 2G76A 3L6DA 4BNVA 1H0KA 1PQWA 1DAPA 4J49A 4A5OA 1YE3A 1E3LA 4JX8A 4FFNA 3GGGA 4HX5A 3ONDA 4BNLA 3BAZA 4DBVO 5A5EA 5T67A 4U0JA 3MWEB 3H5RA 1MXHA 5JAMA 2PK3A 3WNVA 2DT5A 3HADA 2VTDA 4PLPA 5HWSA 3D3WB 3RUDA 2BGLA 4NJMB 2BI7A 4FIZA 1GD1O 3P7MA 2EF1A 2GSDA 2EG9A 1C1DB 3K8ZA 2CDAA 3ONFA 3DBVO 1C0IA 4D44A 3HG7A 4Y9DA 1NP3A 1GQYA 1A4UA 1CF2O 2XXBA 3RKUA 3NDJA 1VL8A 1DJNA 3JQ7B 4R1TA 3NT5A 4XIJA 4IQ8A 3V2GA 3DXFA 3GK3A 1B7GO 4FB5A 1C0PA 2DBRA 3TWOA 3LDHA 4N54A 4PLCA 5K6AC 1NQ5A 4R68A 3HDYA 4IQGA 2QG4A 3PWKA 4WEQA 4IZHA 5ITWA 4RVDA 1BW9A 1PJSA 2NWQA 1QR6A 4OKNA 3DDNA 1B14A 3Q1LA 3BTUA 4ND5A 4BIIA 3CMMA 4WOKA 5JC8A 4WLUA 4YJHB 3S1LA 1U5CA 2X8LA 3ANLA 3INGA 4FJ2A 5I9LA 1UP6A 3AOEA 2EKPA 4EYEA 5JMWA 1E3EA 5CDTA 5I7EA 3LC2O 3LT2A 3QVTA 1NAHA 4J90A 1K6IA 4HFMA 1GADO 2B36A 4FR5A 4JROA 4WLOA 1SMKA 3BHMA 3U09A 1JKJA 2Q3EA 3MOGA 4FN4A 5AOVA 3WWYA 4P4LA 5T6BA 4M89A 4CMGA 4FW8A 5I8WA 3PLRA 1Z73A 1WP4A 2OZPA 3MTGA 4PVCA 3OF2A 3PWZA 3Q6IA 4L4XA 1Y9AA 3KRTA 2F00A 3ZZNA 1P33A 2Q4EA 1PS0A 1GYRA 5F1KA 4PRKA 1UDBA 1R66A 3L77A 1FDUA 1KVRA 3G79A 3LQFA 3Q3CA 1U9JA 4KTVE 5GMOA 4G81A 4A27A 1ENYA 4XDZA 5KOIA 1HE3A 2CDCA 4IS2A 4N5NA 1ML3A 1DHTA 3AFNA 4NR0A 5KJCA 4L4RA 1YB5A 2NM0A 2OHXA 1CYDA 4MVJF 4MKXA 3CTMA 2FSVA 2EGHA 1A72A 3SJ7A 1J5PA 3WIEA 5TT0A 5L7TA 4KWIA 4DWVA 5ILOA 1PR3A 1O0SA 4IM7A 1FDTA 1XYGA 2AHRA 1PSDA 1Z45A 4I9NA 2Y0CA 4CV0A 1EQ2A 1GU7A 3FNFA 4CL8A 2CNBA 2O3RA 3ST7A 1NNUA 2VHYA 1C1XA 3PXXA 3JQ8B 1UAGA 3NT4A 4ND1A 1WWKA 4CQMD 3EZYA 3MZ0A 2PGJA 4CM5A 1OFGA 1T24A 2IDZA 2PV7A 3QWHA 3RROA 3C1OA 5L51A 1YDWA 3U0BA 3GMDA 1VC2A 3PHHA 1U8FO 3UCFA 4JBIA 5IDQA 3GRPA 1UUFA 5G4LA 3VH1A 5I7VA 4BB5A 4ALIA 1ISJA 5CG2A 2NACA 2GD1O 1T4BA 2ZCUA 1R12A 4J6FA 5JO0A 1XGKA 3G1TA 4EEXA 3QA9A 4BKRA 5EPOA 1R4MA 4IPTA 3E48A 4BNYA 2YHIA 5U4QA 4IUYA 5IDXA 4OXKA 4WECA 4A0SA 4U8GA 2EP5A 2EW8A 1IY8A 4NK4A 4GWGA 3WG9A 5L4LA 2ZYAA 4CMJA 4DUPA 1QYCA 2YJZA 4R51A 1ISHA 1BSVA 4NHEA 3MEQA 5CDUA 2Q4BA 5I8ZA 3RUHA 1NHGA 3NJ8A 3ULKA 1NPTO 3KLMX 4GH5A 3Q2KA 5TX7A 4I5DA 4CR7A 4L4SA 1ISIA 5ILGA 4AJ2A 1NVGA 3F5SA 4J91A 2O23A 1PJ2A 4CQLB 1N92A 4RF5A 3GN2A 4CMAA 3NT2A 4Q3CA 2FPIA 5T8KA 2PD6A 2V6MA 5HS6A 2WDZA 3DZJA 3GFBA 3DZGA 4DC0A 3WYEA 4BOYA 4DVJA 1FDVA 3NV9A 3QVWA 4FOSA 2VOJA 3O4RA 5L3ZA 3KOUA 5K9ZA 4RZIA 3DR3A 3F46A 3GH3A 3DMYA 4HADA 1SEPA 3RC1A 3JYPA 5TLSA 5EL0A 3GPIA 2IZZA 1LBEA 1AXEA 3JQ6A 3PFWO 5TT1A 4E5KA 3I6QA 4W82A 1UZLA 3ON5A 2O3JA 2JKVA 4J16A 3MJSA 5FI3A 4AVYA 4B3JA 1LC0A 5A9SA 5G0TA 4MVJE 3E9QA 1W6UA 1PS9A 3D3WA 3OM9A 4XWYA 4ONEA 5BT9A 4N18A 4RPLA 1E3JA 4ALJA 5DCYA 1LNQA 1PJQA 1VSVA 2O2YA 4JJFA 1P1KA 4MO2A 1BXZA 3KXDA 3DFUA 1ENZA 4NBTA 1PX0A 3OH8A 3V2HA 1ENOA 1LXCA 4MOWA 5IN5A 1HDCA 2P68A 1DO8A 5KKAA 4BHTA 4L74A 3M1LA 1JVBA 4OSPA 5H81A 5HRUA 1U3TA 3JD2A 4YACA 5ER6A 4AJ1A 4IIVA 1ZCJA 1X0XA 4CM6A 4IDBA 4AICA 2VWQA 2B83A 2NUAA 3ZI0A 2J3JA 4Q3DA 1VRWA 1E5QA 3ORFA 4F3YA 3LK7A 5KVVA 4W9NA 1MC4A 2V6BA 3JD0A 2WMDA 2JHGA 4HFRA 4WLEA 3FR8A 1VLLA 2WWRA 4XIYA 3UKOA 4BL5A 2PD3A 1GCUA 1YBAA 5THKA 3ZNNA 2HCTA 4XYLA 3BTOA 4FFPA 4J9UE 4CLRB 2VUSA 2DU8A 2BD0A 4Z3DA 1HXHA 1L7DA 3ZWCA 4CLRA 2WEKA 4WCFB 5JAIA 1T4DA 4IJUA 2XPCA 1ADGA 2DLDA 2PA3A 3MJTA 4XYGA 1XEAA 3L4BA 1XIVA 4RORA 4DRYA 3LT4A 3O03A 4U7WA 2VHVA 4EDFA 1N7HA 1YKFA 4DQUA 4E5MA 4H3VA 3DAFA 3W1VA 2Y05A 3DB2A 3FWZA 4DMLA 2AEMA 4EBFA 4AJHA 5F3RA 1QLHA 1P77A 1YJ8A 5DOZA 1IPFA 1O95A 4DQVA 1GL3A 4UREA 3JCZA 3JQ8A 4R69A 4ZQFA 1DDOA 2EXXA 3P2YA 4BNFA 2UDPA 2NU8A 1I10A 4INAA 4MP8A 4WLVA 3COSA 5JSFA 1BG6A 4ID9A 2BFMA 2G1UA 2XAAA 1Q7BA 1WMBA 4BO9A 3LZ6A 1Z82A 3PVZA 2PNFA 3JQCA 1V6AA 3I9LA 1JKFA 4ND3A 3WGZA 3L6EA 1E3WB 5FYDA 1HDGO 4I8XA 2V7PA 1EBFA 4MPDA 2NTVA 3G1UA 4PRLA 2NTNA 3HDHA 4QXMA 3KVOA 4Y6PA 4XGKA 2PZLA 3VZQA 3ICCA 3RVDA 3ZDFA 2DBVO 3ZV6A 1LDNA 1NFQA 1OZAA 3PTZA 2P9GA 2X86A 3RIHA 3VTFA 3WFIA 2HMUA 2GR9A 3CPSA 3DHEA 2I9PA 4YXFA 2IYPA 4RVSA 3FR7A 2B4RO 4MIYA 1YH3A 3GVXA 5EESA 4E31A 1E7YA 1ZVMA 2WD8A 5TRTA 4EUEA 4I9HA 5K0ZA 4YRAA 3W8DA 1F14A 4LVUA 2I67A 1X14A 1LRLA 3ASUA 4Q3BA 4W4TA 1EFLA 4ZQGA 4YT2A 1YO6A 3H2ZA 5DP1A 6ADHA 4R4JA 5CG1A 1P1FA 2P5UA 3IC5A 5C37A 1NXQA 3L4BC 1M6HA 2Q50A 5LDGA 2BFPA 1MGOA 4CLDA 4HP8A 5ENDA 4CLOB 3AY6A 2FZWA 3I4CA 1FK8A 4O63O 3V2UA 4E2XA 1MUUA 2BH9A 4E30A 4J9VA 3WTCA 4TRJA 1I2CA 1WAMA 2POQX 4ZU3A 4RDHA 4NFHA 4IDAA 2ZB3A 1JU9A 1WDKA 3B1KA 4TZKA 4I5GA 5LDHA 4DTIA 3G3EA 2Y1GA 4GL4A 4LMRA 2AE1A 2NADA 4WUVA 1VKOA 3DBRB 3CXRA 2AQIA 5C7LO 3NTRA 1YQDA 4FFLA 1NQAO 1UJMA 2O3UA 3DZFA 4Y8VA 5TC4A 1NR7A 3F6YA 4GAEA 3ZWBA 4WOJA 4KUGA 4L76A 2IODA 2RH4A 2P5YA 2FOIA 2B4TO 3PQDA 4UVEA 1PJCA 2C29D 3SLKA 4YJFB 5B4UA 4PLGA 3RUFA 3H65A 4UUOA 3SX2A 1O8CA 3DOOA 4HNGA 3NKLA 2OP1A 1ZBQA 4FGSA 4ZA2A 2VCYA 4II2A 4BNGA 3H6KA 1EK6A 1GCOA 4CV3A 2XF8A 4OL9A 1ADCA 1QYWA 2B0JA 3Q9NA 4I9UA 1GFSA 1G1AA 3OP4A 3NGXA 3GQVA 1EUDA 3GOHA 3GHYA 3BTSA 1DB3A 1KERA 3ZU2A 4UUPA 4QFCA 2O50A 2JD1A 1I32A 3VH2A 1NQTA 3LC1O 4PG5A 1DIRA 3AY3A 2NLOA 1O5IA 3I23A 2O7QA 2CZCA 1F0YA 4ZN6A 4B7XA 4Q39A 3QQPA 4E2YA 1OC2A 4GVXA 5JAZA 3V5NA 2NV6A 3UICA 3DOJA 5BSHA 3E5RA 2H6EA 3AUUA 1PWXA 4CODB 3GAZA 3A28A 4GGPA 3ZWPA 3PQEA 4UEJA 3NRCA 1FJHA 2Q2QA 3GR6A 5DCWA 1Q0HA 3WR5A 1YBMA 4BKOA 1I33A 5ER9A 5KIAA 2O2SA 3AOGA 2R00C 1R0KA 3ZWOA 4KWHA 4OQZA 1V8BA 3QV1A 4CQLA 1XG5A 3AM4A 1K89A 1YQXA 2D5CA 4IINA 3DOCA 2B37A 5IDWA 4Z3KA 1HDZA 1D8AA 1YBVA 2F1KA 4RL6A 5A05A 1VL6A 3OMLA 2FSSA 4XQ9A 2BFOA 2X1HA 1BDMA 1N7GA 3ZV5A 4WK6A 3GGPA 2IZ0A 3ZGYA 1GQQA 1T2EA 3OETA 3H5AA 1GV0A 2YV2A 3FSRA 1JLLA 2BFAA 5JY6A 1CQIA 1HEUA 3HFSA 1AN9A 1LQTA 3MWDB 4WCDA 4BQRA 4Z0HO 3GGOA 1PR9A 2O7SA 3PGXA 2FR1A 3WSVA 1U3UA 1EK5A 2P9EA 3A1NA 1UZNA 1JWBB 3WB9A 1ISGA 4D42A 1A71A 1M2WA 1H2BA 1WMAA 3DZHA 3K92A 4FJ1A 4TZTA 2DUWA 3VVBA 1XU7A 2UAGA 1KVSA 4RQUA 3JQBA 3ADOA 2H1SA 3C1AA 3V1TC 3Q9UA 4GSLA 2AW5A 1AE1A 4JNKA 1P74A 4C7KA 1CERA 3DTTA 1I3NA 4KUHA 3RBZA 1QORA 4PLZA 4HY3A 3WS7A 3VDQA 2PH3A 1CDOA 1LQUA 3GVHA 4KDFA 1E7WA 2YZ7A 3JYLA 2HK9A 2IXBA 1AGNA 4E6PA 4LW8A 4E4YA 4WLFA 5LCXA 4BO0A 1BMDA 3RFVA 4YTEA 1E7RA 1HKUA 1P31A 3PI7A 2CVQA 2H5LA 3DHNA 4KDEA 1T1RA 1Y8QB 3MJ4A 1O9BA 1C14A 1QYVA 1EUZA 2NQ8A 1HYHA 1NPDA 2O3QA 3N58A 4WE3A 2BI8A 5A06A 4W6ZA 5DDIP 3PLNA 2IYOA 1KS9A 2IRWA 5T5QA 4NBVA 4GPD1 2ILTA 2OP0A 3S2IA 4IGEA 3SBOA 5G4KA 3ZW8A 3I9NA 4E33A 2E6UX 3OA0A 3ROKA 3PK0A 1GQ2A 3TSCA 4DIBA 1NFFA 4YEDA 3DBLA 3TDKA 3UVEA 4YR9A 3IMFA 1R4NA 3GY0A 1LDBA 5JCJA 4BNUA 5KJEA 1SB8A 3ETEA 3EGOA 1F17A 1MG0A 2FZEA 5LC1A 1E5LA 4D3SA 5JFOA 1ZSVA 2ZTLA 3U4DA 2R2GA 2W2LA 2B4QA 4P8RA 1B26A 4MVJG 3LSYA 3ROQA 3ZNPA 2CDBA 3FHLA 2YFHA 1PQUA 1BWSA 1GUYA 4S3MA 4CM4A 4Z6KA 3D4OA 2NSDA 3ZH2A 3ICPA 3JQAA 3ZHXA 3CIFA 4J7CA 4RPKA 1X7HA 5JDCC 2FPGA 3DC2A 4J2OA 1M76A 2DC1A 4BO6A 4DYVA 3ZCXA 3F1LA 2C2XA 3HDQA 4HV4A 1OAAA 4DPKA 1NASA 5TJHA 3TL3A 3ANNA 3EK2A 1EE2A 2A9FA 3PHJA 3RBXA 5EIOA 1ZZEA 2O3TA 3NJ4A 3T7EA 3UHAA 2Z1NA 2HU2A 5CEEA 1N1GA 3BXXA 4IJWA 1DFGA 4XYEA 1KY4A 2GLXA 2W2KB 3S2EA 7ADHA 2DTDA 1U8XX 4UEOA 2JCVA 4FBGA 1X13A 5DBIA 4S1VA 4HXYA 5ADHA 2VRBA 3DBHB 4MP6A 3FTNA 2HDHA 1ZW1A 2DTXA 3BTVA 1G0OA 2Y67A 3SLGA 4CJXA 4JJGA 4E12A 1LC3A 3EY4A 1SBYA 1HE2A 3JD1A 4KUEA 1MV8A 4PLFA 1NTOA 4GSKA 1YRLA 3GG2A 4CMKA 1ENPA 1ZK2A 1YONA 3FN4A 4QECA 4CPDA 3Q0EA 3RUCA 1PGPA 2YV1A 2PZKA 2FP4A 2HJSA 5AXBA 3WGQA 5AVOA 2QW8A 3B1FA 4DLBA 4NI5A 4PZDA 1Q0QA 1YDEA 1EFKA 2GRAA 2YHIB 3DQPA 4XD2A 5L53A 4E0BA 1ZFNA 1LU9A 4U6SA 4Z0TA 4PLYA 4XRRA 1VM6A 4M86A 2BF7A 3C1TA 2VTEA 1V0JA 1JWAB 4OGWA 4BO2A 2VNAA 1BTOA 5BNTA 3FNEA 3QVSA 5CPBA 1BXKA 3DBRA 4ALLA 4AJNA 1P0CA 3C3XA 4BMVA 3O38A 3O8QB 1Z7EA 3HE3A 1KC1A 1SOVA 2OBNA 3GPDG 2J3IA 2HMSA 9LDBA 4IDDA 2ZCVA 3WLFA 2PWZA 2GZ2A 1YJQA 2YY7A 3S8MA 1GYQA 2BKAA 1NFRA 3KYDB 1N9GA 1CETA 3TN7A 3BMCA 1LI4A 2A4KA 2JD0A 2HMWA 3IL2A 1U3WA 5COQA 3RC2A 3NAQA 2YW9A 4E13A 2DM6A 1X15A 5JDCA 2QRLA 1E7MA 1U28A 4JJIA 4ZQHA 2VN8A 5TF4A 1FXSA 3W4KA 3DZKA 3HNPA 2R6JA 2VYVA 5DBGA 2IXAA 1BW9B 3ZWNA 1T25A 1A9YA 3TPCA 3RUAA 3K73O 1HTBA 1VE9A 3D4NA 5COBA 1RM4A 1P1IA 4AJPA 4LK3A 1LLUA 3K6JA 4CMBA 1HSOA 2DPGA 4CL3A 1DC4A 1UH5A 4WNIA 4GQAA 3ASVA 1ZIDA 4OOEA 1KEVA 5HTOA 3RKRA 4RF3A 3TFQA 3WYBA 2G82A 1KYQA 2Y0EA 3I6IA 1NX6A 4WCFA 3SC6A 3ZNQA 4YRBA 2GGSA 5TGDA 4R9SA 3WWZA 5A1TA 4CV1A 1PL6A 2AQKA 2CVZA 4B7CA 3DBLB 4IDCA 1GDHA 3E8XA 4CUKA 4DREA 4CLHA 1MP0A 1K3TA 1IL0A 1HLPA 1MFZA 1Z7BA 2FWMX 4UEKA 4M49A 3V8BA 1SNYA 3NTOA 2QZZA 4ZRMA 2GN9A 1UDCA 1ZMTA 3LC7O 1IHXA 1YGYA 2E82A 1P1JA 2HK7A 3OJEA 4PN3A 4PG8A 4BV9A 4Y6SA 1R0LA 2PKQO 1KVQA 3GLQA 3C7AA 1HZZA 4OOFA 5L7YA 1ISFA 4J7XA 2NVWA 2X5OA 2X5KO 3DFZA 1Y8QA 3TZCA 3VZRA 3DHYA 2AG8A 4GKVA 3GRKA 1MX3A 4J1QA 4ZD6A 1CIVA 3RWBA 5IAAA 1Y1PA 1BHSA 4ZJUA 2EV9A 3M1AA 2PZJA 1YXMA 2PY6A 3ZWWA 3OJFA 5CPFA 4D3DA 3WSWA 5JDIC 3I52A 3GEMA 4G65A 1PZEA 1WNTA 2CD9A 2ZATA 5CDGA 1LTHR 1FDSA 3PIIA 3OA2A 1XU9A 1PJ4A 2EW2A 5FI5A 5F21A 4HWKA 3R1IA 1MG5A 1QV6A 3QY9A 1XCBA 1V9LA 1H2HA 1GTMA 1LDGA 3OQ6A 4O6VA 4I08A 1YVEI 4ZQEA 2VYNA 2XXJA 2EERA 3WYCA 1AXGA 2FRDA 2H63A 4XGNA 3EYWA 4LCJA 5H83A 5KKCA 2CFCA 1QXSA 2GN6A 4A03A 3JQGA 2EKQA 3F5QA 5CDSA 4IMPA 1KEWA 2QIOA 3RBVA 4MP3A 2HJRA 2HLPA 2A35A 3M6IA 1BVRA 3JQAB 3OICA 2YFQA 4E5NA 1K5HA 3U5TA 3GDGA 1U2GA 4UVDA 1I5RA 2I66A 1CEQA 5FWNA 3V1UA 4D45A 4NFYA 4RGBA 1ARZA 1ZJYA 4J0EA 4YJGA 3VZPA 3ZWAA 3PZBA 3QVXA 5DOVA 2E49A 5THQA 4IDEA 4J43A 1Z74A 2ZK7A 1DSSG 3L9WA 4UVIA 5A03A 2GPTA 3WBBA 3CKYA 4RLHA 4BNKA 1SO8A 2Y1DA 1R0SA 4W7IA 3WGIA 1E1LA 5MGBA 3R3JA 3I9JA 4PCVA 3WTBA 2W2LD 3H8VA 3PDUA 1UXHA 4CMCA 1PJBA 1HE5A 4W99A 5DF1A 4OQYA 4QO7A 3K9QO 2HAEA 1RKXA 1RM5A 1G6KA 1B2LA 1TT5A 2CUKA 3NTQA 4Q3NA 4O0LA 2YQ4A 1GR0A 3H9UA 1DOHA 5L95A 3TOZA 4D43A 1PGQA 3DTYA 5JDIA 1XSEA 3RC9A 1GPJA 4KQWA 1J4AA 4CMEA 1V3UA 1Q7CA 2B5WA 3TRIA 4K26A 5TNXA 4BGUA 1H6AA 2NNLD 3BMNA 1KOLA 4YAEA 2GZ3A 1L1FA 1NYTA 2OMEA 4CR8A 1P44A 1U4SA 4B7UA 2BHLA 5IZCA 5L4NA 4IMRA 4MVJA 4DLAA 4OHUA 3EVNA 3H7AA 1ZXLA 2W2KA 3EMKA 2O4UX 4PG6A 5L40A 3GA0A 1IHYA 1ZEMA 4IY1A 2RCYA 3DZBA 5TSDA 3PZRA 4MDHA 2E37A 3P5SA 5KVCA 4JK3A 2EWMA 3VAZA 3TF5A 4QEDA 3I1JA 4XDYA 2AMFA 3AOEC 3V1YA 3KV3O 3UN1A 3KSZO 3PQFA 1SZJG 4DQXA 2AE2A 4ESOA 3KSUA 4ZHSA 4OMUA 4NU6A 3DMTC 5JYEA 3AM5A 4JBHA 4OXNA 4BUCA 1GV1A 1JW9B 5HM8A 3U49A 2BMAA 2I5PO 3KM0A 4MVJD 2UVDA 4U6QA 3D0OA 4ND2A 3AU9A 3NX4A 5GZ6A 1VKNA 1NR1A 4XQCA 3U4CA 1GZ3A 2DTEA 3JYQA 4L9RA 4KQXA 1DRUA 4IBOA 4NDNE 1DLIA 5CAEA 4BNZA 1H6CA 3CZRA 1OMOA 4MVJI 4PLWA 2NVUB 3WOHA 9LDTA 1UR5A 4Z9XA 2NVUA 1LEHA 2C7GA 4FFMA 5U1PA 2EJWA 2YDYA 1I3KA 3F47A 4MINA 5A9RA 4CM9D 1N1EA 2DAPA 4L75A 2RHCA 4LISA 4R54A 4E2ZA 1PGNA 4YWJA 4BNHA 4C4OA 4D0RA 4ZICA 2VHWA 3W4IA 1ZK3A 1UDAA 3AK4A 2C0CA 3U4HA 3JYNA 3W8FA 1AUPA 2FMUA 3OSUA 4JLWA 3UAGA 2JCXA 2IE0A 4XB2A 2RIRA 2WJPA 2IZ1A 4N5LA 1WDLA
chains in the Genus database with same CATH superfamily
1QZUA 1P39A 2BONA 4AF6A 4B7ZA 5JLAA 4RCZA 1K7EB 1IBMB 2I2AA 2OPHA 3K15A 4XB1A 1C9KA 1GTVA 1EDOA 1GN9A 2H1IA 3TI7A 3WP0A 3X44A 2IL1A 3PJDA 5LZ7A 4EIWA 3X2EA 3T3GA 2VQEB 3JZFA 4G9BA 3FIJA 3X43A 3EZXA 4DLLA 4KPUA 3FTFA 5EN4A 5FULA 4P7BA 1C80A 4HUTA 2FR8A 1KNXA 2CWDA 1LX6A 1SBQA 2H92A 4GF5A 1IHDA 5BSVA 2XE6A 2X23A 3KYCB 3TMKA 1X1BA 3S3TA 1CWUA 1WZEA 3L0SA 3EXHA 3NTUA 5CLIA 1IY0A 3SQMA 2PJDA 1ONPA 2XB8A 1BE8A 1NZFA 2YDXA 3IXLA 4BP3A 3W7AA 4FE3A 5DFAA 5SICE 2P6RA 2Z04A 5DI9A 2VSFA 4RTOA 2FQXA 4IIXA 3FB4A 4U7HA 3K31A 2O5RA 1AQ6A 3O1HB 3RS5A 2GUWA 1PTJC 3DKPA 3KFXA 4FYMA 3WX0A 4F45A 1VP3A 5HEKA 3RHSA 4D9IA 4OQMA 4OO3A 4C21A 5CBPB 2DP4E 1W0JA 2WDPA 2Q2WA 4EB3A 2E48A 2OM2A 2ZB8A 3QEMB 1DWOA 5E2IA 1JJAA 4KPFC 2HU8A 3EIOA 3GT4A 4PQYA 4D0LB 2X58A 1XHEA 1Z2AA 5EINA 2PYIA 2BP7A 1SOAA 2GDJA 2H7YA 3JPYA 3KHUA 2ZCJA 3DV0A 4KGZA 1E60A 1DDIA 3Q11A 4YPVA 3PVSA 4IKEA 4AQ7A 4B8ZA 3KBOA 4QVKA 1J0BA 5AHWA 4W7HA 4PS1A 4NCXA 2ZSUA 3N5KA 4QUAA 3K70C 3A7DA 1ZX1A 1K88A 2JFPA 3IEMA 4D41A 1GY8A 2XMBA 3D4BA 2AXPA 4IIJB 1Y9EA 2FGKA 1VZ2A 2DSNA 2Q99A 3CLUC 3FNIA 3UAVA 3DDUA 1WLYA 4HUJA 4R5HA 5CYFA 2GFQA 5LM3A 4WQMA 1ZNWA 4EJSC 5LU9A 5LZ5A 4BFSA 1KMMA 5I47A 3MD9A 2JGRA 1NOIA 4XQEA 1SZPA 2GDZA 2JGEA 2QY9A 3H5WA 5GGYA 1HDXA 3F7NA 3NBUA 1PLJA 3SZGA 3ZVMA 3EG9A 2II6A 3W04A 4ECAA 4ZKDA 1VRVA 4J1SA 4FOOA 4X84A 2LIPA 1OKKA 3TLXA 2CYCA 2R1TA 4PHTA 3UK0A 2WHQA 2PLAA 3KPJA 4IV8A 4WBXC 2DLCX 1S96A 2WI8A 2HHJA 2WZQA 4AZ0A 1BX3A 1SD2A 1NXPA 3QVGB 4G8JA 1PTJA 2ZI3A 3ESCA 3AJEA 4MIKA 5T6MA 1GZDA 4N9WA 4RK6A 2GRUA 3QPDA 4B46A 4LJKA 3OZGA 2ESRA 3C3CA 1DKPA 1RRVA 1EINA 1JJVA 1DRKA 2IF0A 1OXBB 3ZWVA 4QKQA 4JBGA 4P4SB 1JWLA 4NCKA 1RKUA 2OSVA 1D09A 2ZSFA 3ND6A 3DD5A 5F3DA 5TJ9A 2H5EA 4BKUA 4EFMA 4I6GA 3UHPA 3T4PA 1Z4PX 5EQJB 4I4IA 3TIIA 4FHCA 1AGPA 1JQLB 4I4TB 2Q62A 4JA0A 3ZZTA 4BCCA 1N2SA 3BERA 1YS4A 4X66B 2OORA 4RVOA 3VHLB 3V97A 1LBIA 1AKTA 1E0DA 4QUKA 2CEKA 1B8NA 3LXXA 4I7EA 2GB4A 1DC6A 5TVKA 1BWRA 1J8DA 2D0OB 2OZLA 2QQ5A 4XPIA 5DP2A 5FAXA 1YKSA 2J9FA 5IU6A 1FS5A 4ND4A 2QRHA 2DT8A 2V7XA 2I65A 1ZU5A 2PLWA 4FPXA 3GUYA 4ER6A 4TYYA 2LXNA 1VQ1A 3A2LA 2AG1A 3G9UA 3V48A 5B36A 1F12A 5JZVA 3EIQA 1NJ1A 4H3KB 3NBKA 4O2AF 3R7WB 4CTMA 3FFAA 4MW2A 1D6JA 3EEOA 3NOOA 4E5YA 4CUZA 1E79A 4RQBA 4G89A 1PEKE 5H16A 2AXQA 2V7UA 2GO7A 1W1IA 2XDYA 5KC8A 4XARA 1XNHA 5IASA 3IRVA 4K7JA 4N3CA 1A2OA 1H5UA 1QNLA 4LXYA 5KU1A 2AKEA 2D2IA 2GUGA 4QGSA 3MN1A 2MINB 3G17A 3HQ4O 4II3A 5JI2E 3E03A 5K4HA 2AUNA 4GM4A 1JFVA 3QUQA 1VLMA 1BGXT 1WF3A 1UQTA 1VPVA 2YV3A 3RJZA 3GVCA 4YS6A 2OVFA 3T5BA 3VTKA 1D1TA 3VOSA 3WB1A 4DANA 3CLRD 2A9PA 2IVFA 1AT1A 1D5CA 5ALIA 1L1RA 4RAQA 3UK2A 2FZCA 2IJGX 1D7OA 4OIMA 3IO3A 2MJLA 3M1IA 4FFDA 4ZYLA 3FD8A 3OQHA 1QMGA 2C5HA 4K9MA 1H1LB 4E08A 2WIKA 4WNCA 5G3ZA 4OHVA 4NBUA 4U0KA 3ZU3A 2Q1TA 3P0EA 4P80A 2GA8A 3K09C 5HF8A 1KI6A 2G88A 5DB4A 4D4GA 5A3JA 4WWHA 4JUDX 1DEOA 2OORC 5AJVB 5SZKB 1DARA 1LDYA 5DBHX 1H65A 1CRPA 1UANA 3OEYA 1J1ZA 3CKLA 4LY0A 2ZAIA 4WD3A 5HKKA 2X13A 2YWDA 3GFPA 5JH7A 4L7QA 3T7IA 5KJFA 1YMVA 5BWNA 2IEBA 2PGDA 1C3VA 2XRYA 3FPSA 3DONA 1FL9A 4BKMA 4KLNA 1PJZA 2CFRA 4RVUA 1CE8B 4AJEA 1Y6JA 3ZYCA 1C5KA 1QX4A 4YT8A 1CUXA 5B1DA 5J5CA 4R0VA 5A5GA 1J5EB 3UMRA 4GKBA 2FY8A 3PR1A 4RUKA 3GA5A 3BIJA 1Z4MA 1TEVA 3NBXX 3LRPA 2V8BA 3ADPA 1DE0A 1G60A 3C8MA 5ANRB 4ZMBA 5KJ1A 2HWKA 3PRYA 4RJTA 1M73E 4IVPA 5EHQA 5K3OA 1ZXXA 4NNJA 1G1MA 1IE3A 1NRIA 2JHFA 3D6UA 4MUYA 4NV1A 4DXHA 2YY5A 5AM1A 1PK9A 1CLUA 1FQWA 3ND8A 1UMKA 1Z5WA 1Q3TA 2EYQA 4MV1A 3EPPA 3JARB 3UJ7A 3WSTA 5J43A 4V0KA 3FX2A 4I19A 2WNHA 3EXG2 4PXSA 1EJBA 5F1OA 5EQDA 5HDBB 4PFJA 2HX1A 2VF5X 4KP7A 3DFFA 5AKEA 1FVXA 3TB6A 1LS1A 4X0EA 5C80A 5F2NA 5AVUA 5DGTA 3L7CA 2IOFA 3WZMA 3GFOA 5JE8A 1UBHS 1CJKC 3K4PA 2CUZA 3VUEA 3ZYZA 4KZPA 3ZKAA 4YJHA 2EDAA 1U04A 1MZVA 1BVHA 4J6EA 1YCFA 2Y2VA 5JRDS 1XXLA 4HRYA 1EUCB 2FZVA 2C2YA 2C82A 1USWA 2HPVA 3S1AB 3ND5A 2V7BA 1V5GA 4HNVA 2F64A 4IOKA 3BHNA 1HE1C 1YB4A 1E6UA 2W6JA 5F5LA 3I01A 3CH4B 1T3ZA 4ZOLF 2GN8A 2NAPA 3OJOA 2FPPA 1TGVA 5BN1A 3ZWMA 5EJ7A 4QSHA 1KQOA 4G67A 2VQFB 4REOA 4DV0B 1FJGB 1U5BA 2IA5A 2BKEA 4DNQA 5KNDD 2YYYA 1MJHA 1W35A 3C3MA 1NULA 2WD9A 3DULA 4KRXA 1J56A 5BNWA 4DUGD 5J23A 5E1DA 1IZ9A 2ET6A 1M1ZA 1PR2A 3EVZA 1NVBA 5IHPA 4F4UA 4PO9A 5HTKA 2O1SA 3B9PA 1AD2A 4TLDA 4V2UA 5AI9A 1CUCA 1XL0A 1T1GA 1GRCA 4NZ9A 1CHDA 1K4MA 2ZB7A 1IJBA 1NP7A 1QG6A 3D6MA 1B16A 3OIDA 3RVSA 3EJWA 1GTZA 1QVZA 1F38A 4XW2A 4GUAA 2QQEA 3OZRA 4KBGA 4NEGA 1DXYA 4FFBB 2MT9A 5BQPA 3AJ8A 2CJXA 1SQSA 3ZGOA 4BB6A 3SIWA 1XWWA 3VU8A 1E32A 1RQXA 2VH5R 3M9XA 2QTMA 3BILA 1GLGA 4MUIA 2VUIB 1EK1A 3CQ9A 3OCXA 1BEEA 4CKBA 1GTSA 4CLOA 1ACJA 3BRCA 3GP3A 7YASA 4MA4A 1KA9H 2Q0SA 2HMAA 3LL7A 3OT4A 2V65A 1DBWA 1H4QA 2P9JA 3UWSA 4KIJA 2E9SA 2I6SA 4JEIA 3RGWS 4Y6OA 4DIFA 1ULZA 1M2FA 1R4MB 5KYWA 2C2GA 1TC2A 2BKUA 2OFPA 1STOA 1ZIXA 1RYEA 2YRXA 3OO1A 4BNIA 2G3YA 5IG2A 1XJQA 2PUFA 1GYPA 1VKZA 3E9NA 3JXEA 3K2BA 2VFAA 4NBRA 4N8DA 1LSOA 1GTL1 3KVRA 2B20A 3U3KA 3V4VB 3MCAA 5E8JA 2N0SA 4KH1A 3TQOA 2PIAA 4DR1B 5LJIA 1EHIA 5GJCA 3GLTA 3HYTA 3AEUB 4EEZA 2QTVB 3C98A 4LZPA 2OM6A 3R7DA 5AJYA 2C9BA 1SUPA 5IJAA 2A6PA 3QG1A 4M55A 1WQ4A 2VWGA 1TAGA 1DINA 1CY0A 1N2CE 2C7PA 1FYDA 1O8BA 3W3AA 5AOCA 4EF4A 3N2GB 4IMIB 4HVTA 4LGCA 1HG1A 4OU4A 4GMDA 1REQA 3ZW7A 1YJCA 1UPTA 1NVVR 2AEJA 3VZCA 1VGVA 4AIRA 4YRFA 2PVCA 4JC0A 4L0MA 4AKIA 4LN1A 3LCCA 3H8JA 4LDRA 4D46A 3HCDA 5FO1A 4OV6B 3MS7A 4YT4A 4WZBB 3NBFA 1XZBA 3R76A 5DT9A 2XSZD 4BO7A 5DM0A 3EOBI 4IIGA 4EGFA 4AJ4A 4XB6B 2XUIA 5LLTA 3FVWA 2BISA 4RF2A 1F2UA 2VDMB 3M83A 5J5VA 1RACA 3PEUA 5ES4B 3OUZA 5EP1A 3I5YA 5CDFA 4F4HA 2NZ8A 2BFEA 2YUTA 2E4YA 5ELMA 2ODAA 2EIHA 1AN0A 1FYEA 5HX7A 3PHIA 4OAQA 3NBYC 4MRMA 1L7EA 1NC3A 4U2KA 1UXIA 1IN1A 5LOVF 2C9YA 4LYHA 3D54D 1J21A 1LJ8A 2D8AA 3W2TA 2EKLA 5EA2A 2FEPA 3EC7A 1Q1AA 2C59A 5DHUA 4ABYA 5CEFA 1ZVJA 4URUR 2FSIA 3BMXA 4K81B 4R8MA 1IU9A 1K6MA 3H11A 1ZY2A 4K9SA 4JUFA 3HMKA 4QLAA 3T15A 3T54A 3V55A 4HYQA 3HJTA 3NRBA 2O1WA 2VUTA 3U56A 1LD3A 4BV8A 2NXEA 2W8BB 3EXEA 2NU6A 2VT2A 3J7TA 3U62A 1X1QA 4BTEA 4YJFA 3I73A 1KJZA 1HWYA 3OIGA 1KAHA 3NANA 3H04A 1T0JB 1VG1A 3GZNB 4ENWA 2AG5A 1CB7A 1JR3E 1OLXA 1WZUA 2FWIA 4FLEA 3VPFA 4Z4CA 1I51A 3PFFA 3CVXA 3DMTA 1VJ5A 1ZLXA 2JARA 3QJ5A 1C8VB 1SQGA 3RYHB 4YQZA 1OLSA 4CQNA 4I1SA 3DBHA 2OV8A 2W4QA 5KVSA 3EAQA 5E0OA 3W6UA 1J23A 3GJ8A 2Z57A 2GEBA 4BEWA 2YJ5A 2WP0A 1RM3A 1QE0A 3L7AA 4TKMA 3D4LA 1EUCA 3RSHA 4BVFA 4PZYA 3EZ7A 4TQGA 1KYZA 5J40A 4ENUA 2GT1A 2IUEA 4BX0A 3EEFA 3C74A 1Y8AA 1ZK0A 3JPWA 1H94A 3QVUA 4TWAA 3RANA 1UKBA 4BO3A 3JASA 4PFSA 1Z17A 4BFWA 4ZGWA 2JVIA 2AQHA 3LUHA 2FPPB 2J6BA 3E7DA 4HS9A 3WIDA 4LYGA 5I4BA 4HWTA 2V7VA 1DAOA 2C04A 4I4LA 4L7VA 1NLYA 2FPWA 4YC7A 2EATA 1LSJA 1GPNA 2QTWB 2XNKA 1RXIA 4BVAA 2QUBA 1NN1A 1SWVA 4S2EA 5BRAA 1KEEA 5EKDA 2Q0HA 3VDRA 5KSWB 2XNHA 1RVV1 4F5EA 3WAGA 5C3MA 2CV0A 1C7IA 1GPDG 3K0EA 3W6OA 3R4VA 5BN4B 1EVEA 3N0XA 2QUKA 1JR3A 2W58A 1PWZA 1FUEA 1TPZA 2N9UA 1E6CA 4K6HA 1KJJA 1NLUA 3DJFA 3K0BA 3SBDA 2XKKA 3VR5A 3BYZA 2L18A 5ADUS 2J31A 1L3IA 1BMFD 4F4FA 2WD7A 1XQ6A 1Y7TA 3GJXC 3L6CA 4LYDA 5JZMA 5TF0A 2CF5A 5COAA 5FJJA 3KJXA 2DY1A 3UHFA 5BN3A 2H18A 3G59A 4TM8A 2EZTA 1JKIA 3DT8A 4GRAA 5I5EA 4W9MC 4DA6A 1KFCB 1CUFA 2DFPA 4RWEA 5JUWA 1ZH6A 3DTVA 3KTAA 4YV2A 1UBCA 4CMIB 1ZHOA 2QTBA 3THYB 4ZQBA 1M5RA 4PAOA 4TUYA 4BE9A 1DJMA 3EMBA 1S6YA 1UBNA 1ZNZA 1TQ8A 3IAHA 1VG0B 4FQ8A 4PZZA 4R8SA 1XDGA 4U1RA 4D3FA 1BX1A 3UPUA 4KX5A 2WLSA 2WVGA 4EJMA 4GKAA 3O84A 4HNHA 1VBNA 3U3XA 2D1TA 1UF9A 3ZU5A 3N8NA 4Z99A 4KPEC 1Y1KE 2VT3A 2VZ8A 2ZQZA 1JN0A 1UC9A 5KINB 4OBXA 2FF7A 4DPLA 5IANA 1Z7WA 5FOUA 1LSUA 4YWHA 1LGYA 2Y0BA 1IUOA 1NWCA 2Q1XA 2X9GA 1Q19A 5AKJA 2D06A 1MENA 3EGDA 1XYYA 4NENA 4QU9A 3WYNA 2XGJA 3JD4A 2GNAA 3KOOA 1IFXA 2RHJA 4HRVA 1TF5A 2GEUA 4B31A 4DXAA 3INTA 3SN6A 4EHFA 4JQYA 4B4VA 4D74A 4E3ZA 5EWJB 1YQ9A 1JLMA 4A6DA 4ARUA 3QPVA 1ZISA 1XTVA 3GJRA 1KJ9A 5LYJF 1KJNA 4EVQA 2DH5A 3VRHA 4CM3A 1U3VA 2HWXA 3FCEA 2AMYA 3D5TA 1Q0TA 3EG5A 5KTPA 4YRSA 3NCTA 3Q6NA 5K05A 2OB1A 3IUBA 5JS2A 4IAOA 4RPHA 1JMKC 3AQ4A 3BULA 3OU2A 5IK2A 1P3Y1 2Q0QA 1RYFA 1SB9A 5GONA 2DFDA 4M1OA 1E7QA 1ZN9A 3PFBA 3QWIA 1LS6A 3NXSA 3K1AB 1FF9A 4GLLA 3UGTA 2JIDA 4M8IA 4UHEA 3ZIAD 4AZ0B 1KDVA 4BS9A 1WOMA 4EJSA 2PBLA 1VMEA 3J81A 1CQZA 1ZM7A 1ZONA 4D57A 1I01A 4P22A 5CB8A 1HRDA 1XFDA 3K2QA 3AONB 2D5BA 2BM8A 3RD5A 1D1SA 5K45A 2JZOA 2FFAA 4OQEA 1J00A 2PQ6A 2FCRA 3EDMA 3RJMA 4ALMA 4CG3A 2ARKA 1H8HA 2VJKA 1W59A 1L1EA 1R9MA 1FP4A 1NSTA 2NXNA 4YDSA 4QRIA 2DCUA 5BYKA 1CFJA 1R15A 2D1SA 1KXZA 3HBNA 4TVBA 3BMOB 5NLLA 5JVDB 3V3KA 10MHA 3IP5A 3Q3JB 1MABB 2ZTVA 3DCJA 3IDQA 3KVYA 3PP8A 3N59A 3QOWA 4RV5A 3EW7A 3RC7A 3U26A 1G98A 1SKYB 1VHJA 1CUJA 4P3NA 1JSLA 2VJYA 2BEWA 2Q4RA 2IPXA 2ZP1A 1Y8RA 3CLSD 1JV2B 4KE9A 3S0JA 1TT7A 2QN6A 4ZTUB 2VYVD 4XD7D 1BKDR 1FMCA 2PQMA 1OLUA 2CXRA 3TAXA 2BKLA 4FGWA 3WRWA 4E51A 4GD3Q 4N01A 3VV3A 5MFZA 3UHOA 2PLNA 3SJUA 3RO7A 1GRVA 2EP8A 1GCIA 3HKBA 3PEYA 1P0FA 5HSGA 2IVZA 3D9QX 2VDPB 1PTKA 1SURA 1E2GA 2KI5A 3U3JA 4EFNA 2I1QA 4RGVA 4AROA 5LB4A 2F4NA 4S04A 3WGVA 1QYDA 3QFSA 4HDNB 4TRRA 1E63A 3BA1A 3DHVA 3QMVA 4LSWA 4C4AA 2J9XB 4KHPB 3FNBA 2F43A 4HOYA 1KETA 1BU8A 5E7QA 1F8XA 4Q1DA 3MPUA 1BCRB 4B3XA 3IT1A 3HUDA 4DV2B 1WHSA 4ALNA 1PEDA 4Z4GA 4C4ZA 1KJWA 3R3SA 3CSSA 3TQSA 3B53X 3G0OA 1B0PA 1QTNA 1V47A 3IR5A 5FT9A 1WKCA 3H5NA 3KQPA 3OOEA 4OATA 2QE7D 1R5BA 3M5WA 2QV0A 1DT5A 4NZMA 1W36B 4B9AA 5FFFA 1IXZA 4B6SA 1OUMA 2UXDB 2B7CA 1HG0A 1UZMA 2QAGB 3ZN2A 5BQFA 4RPGA 4R1SA 2VSQA 3ZBUA 1Z5GA 4JEMA 4ZT6A 4CTKA 5BQ5A 4XFDA 3ANXA 2HWUA 1K06A 4IJKA 2O7RA 2BDTA 3UT6A 3WBFA 2AX3A 4GOMD 2B3TA 4CNQA 2BTEA 1TLFA 3MQFA 4I5EA 3OJLA 2G1PA 1B23P 2R8BA 2HIMA 1RMTA 1UPUA 4PQEA 2Y93A 3ENKA 3DLTA 1CEYA 2P1ZA 4RZQA 4ZYVA 3L4SO 1DEKA 3OIVA 3D3EA 2B25A 4LDPA 2XT6A 3B3AA 3ZGLA 1QO0A 2ONYA 1BEZA 2WTBA 4ZHQF 1GSOA 2EJBA 1JJIA 2ZROA 3Q3IA 1E8MA 4IXWA 4MI6A 5IN4A 2O3SA 4KMMA 3FHTA 4K9LA 4V24A 2C7RA 1OFHA 3HZZA 2BELA 2G5CA 2CF6A 4DTCA 3D0KA 3QBVA 1Q77A 1MB4A 1IULA 3M33A 4TMVA 5JEDA 2OBXA 2AKYA 3GDFA 3H9BA 3M34A 1W76A 1BDBA 2IY7A 3KSRA 4J0IA 1G5IA 1RCTE 2C07A 3E53A 3KAQA 3PNMA 4IF6A 4OYHA 4ZVVA 3TTUA 4GX2A 1DQNA 4F84A 2IBMA 2PUJA 2X0IA 5EY5B 5EE1A 3DP9A 4JI4B 4YDRA 4X91A 2PGIA 1GKKA 1NWHA 4O1MA 4E7OA 2AYYA 4AY5A 2YZ2A 4XGQA 2I76A 5BSMA 4LNUA 1G38A 1S89A 1TIKA 4N39A 3UPDA 1PEAA 1KRXA 1HETA 2I8CA 1JFTA 1XMXA 5BVHA 2AOUA 1OGJA 5T8KC 2NXCA 4JB3A 1GGFA 3AEQA 3ZI4A 4XRGA 3AF5A 4MEBA 2XUOA 3MS4A 4AG5A 3CNBA 4K9DA 5HG0A 1EFAA 4BDSA 1UBEA 1XVAA 4EX6A 3H9QA 5BNFA 1MIOA 2FUCA 1S8OA 2GM3A 1P0PA 3SJZA 1DBVO 2ZIXB 3T7RA 3GF4A 4IZ6A 1JEJA 5DT2A 4B48A 5EUQB 2XX3A 2ZM5A 1NMXA 2VHXA 3CYFA 1E6WA 3VC7A 4ENTA 4JDPA 1L4UA 4J94A 3EEBA 4BGIA 2VPWA 2R7NA 4QM7A 2QM7A 3LI2A 3CZQA 5IAEA 2J87A 3RSQA 1YULA 3WWDA 2B1RA 4Q4JB 4OI1A 3E1KA 4GUDA 3HBAA 4JYAB 4YCNA 2OXIA 1E98A 1LVGA 1NATA 4DNOA 8GPBA 2OLEA 1JECA 4IIUA 1M8KA 2P6UA 5DHFA 1R6DA 3EF3A 3ENNA 5BR7A 5CBKA 5UKDA 3JTMA 5E1OA 2UXBB 2C8LA 2MDTA 3IT2A 4ZU1X 4EF5A 5FDFA 4O2RA 3K1AA 3NP9A 4BBZA 4XJTA 3BCSA 3NM5A 4EABA 4MYRA 1L5VA 3EHEA 1X94A 3FHCB 4EJSB 5JAUA 4FDMA 1M0TA 3KQNA 1USIA 1G8PA 2VJOA 3HS3A 3LHSA 5JS8A 2J0QA 1CZNA 3SR3A 3SR4A 1C1DA 4Y6RA 1YZQA 2VJMB 2I33A 3B89A 1Z0KA 4M54A 3AG5A 3RUPA 1T1SA 1FPQA 4BZZA 1B3RA 3AUYA 3GP8A 5A2QA 2H1CA 3GEPA 3F6SA 1QHGA 2BOVA 2B61A 4L28A 2FFBA 2WVJA 3I4LA 3KLNA 3LT1A 1U7TA 4X1YB 3RLIA 5M04A 1YQUA 2HPZA 3KAJA 3HB4X 4FYIA 1E18A 1N6PA 3A3KA 4H9GA 2IW1A 4MTLA 5CA1A 1AKYA 2I7DA 2I7VA 3OHSX 3ZY6A 1JB9A 2Q3FA 2ZJ0A 5JPDA 1N6IA 1P80A 2AEFA 1GILA 2OLJA 1PUIA 3E58A 4LSMA 5CHEA 5FBWB 3SEFA 3GL9A 3ITNA 4YMWA 4AULA 2FQQA 2QD1A 3DOUA 4Y98A 1JVNA 1DJPA 1Y8RB 2NGRA 3IUPA 3LGAA 2GN4A 5FPHA 3WJ1A 4D92A 5I6DA 2H4HA 3IHLA 4WL0A 1PZMA 1TZKA 2QUHA 3IMCA 3HJFA 3SF8A 5L3QB 5CW2A 2X6QA 2ZQYA 3SHWA 2QJFA 4GLJA 5FEMA 3BVPA 3WQBA 2HCJB 3I01M 3I37X 1VBKA 2Q5OA 2OWDA 4YCCA 4KFCA 1SK8A 3R0ZA 1ZZGA 2OWEA 1SHKA 3FCYA 3OIFA 1RP1A 2WTEA 4GMFA 4M7OA 4OX9Y 1N5DA 3LG2A 3TO5A 3H1FA 4HGZA 1OZGA 3PIDA 3A6FA 4KX3A 2XODA 1U0NA 5BURA 1NVMB 4WBNA 1NU8A 4S12A 1E3WA 1BZYA 2AR9A 4AZ3B 2MSWA 3PIRA 4TKLA 1J2RA 1FA9A 3NIFB 4C2UA 2XCRB 3OWHA 4IICA 2IHUA 1Z13A 2XIJA 5ITZB 2CE7A 4CM8A 1BDJA 3JQ9C 4RPJA 1P45A 1TW2A 2JVKA 4CN9A 3DO6A 5I4KA 1K3UB 1WJGA 3QSGA 4RELA 5JOQA 4DYDA 821PA 2ZTUA 4EGQA 5LZ9A 1GTRA 1G7TA 3SY8A 1R3DA 3EIXA 1R4NB 2VZ9A 1ZJ5A 4NESA 3RU9A 1Y3AA 2VXYA 2GZRA 2XQGA 4OJNA 5D01A 4WFKA 5HXAA 1QRRA 3DOEA 4P33A 5KNDA 2J9GA 4B4KA 3D8BA 2CL7X 1ZGGA 2JFUA 2X0NA 4PRZA 2ORYA 4XM2A 2OO5A 4E2FA 1OPXA 2R6CA 2RJNA 4JXXA 3FB1A 1XO1A 2BHTA 1PZGA 4B5KA 3NM4A 3RCBA 1V71A 2J3HA 2WF9A 1ZJWA 1B43A 1G8GA 3BJIC 3M9LA 4UDNA 5JYDA 4A8TA 1QOZA 1AKRA 2QTAA 1EAYA 2I3AA 3C5HA 2AYXA 3G5MA 3PRKE 5DNAA 4QLBA 4PCUA 4R8LA 2BI4A 4XOIA 5LD2B 3P19A 1CRWG 5KI6A 1Q1GA 4JI6B 4UVHA 1DGQA 3QWFA 4HD8A 4LMBA 3ANMA 4RVFA 3RTEA 2WF6A 1EA5A 3M2PA 3MVEA 4I4TA 4B80A 1RPNA 3EXEB 4OGGA 2F67A 1V5FA 3GCGA 5JAOA 2OOSA 1V1RA 4FN5A 3BCHA 5IKOA 2DBQA 4DR6B 1MW8X 2VYND 3IUQA 2XZPA 3P2OA 3OQPA 4BZWA 3SSMA 1O89A 3NHKA 1DMRA 2G4LA 5CEJA 1X1EA 1X1RA 3IB6A 3OESA 4KKXB 3PC7A 3DLIA 2ZIZA 3NW9A 2XCUA 4UAJA 4WERA 3TW8B 5EE0A 1MDFA 1GUZA 2O0KA 1O7JA 2RHGB 2XWQA 3O9ZA 2NO5A 1Y1LA 3JW8A 3P9RA 3UA4A 5C1PA 2K87A 4U00A 1SPXA 3A1VA 3ZZUA 3DEKA 1U8EA 3D64A 5BSEA 3MTIA 3U3MA 3M1YA 1IQUA 3TZ6A 3JQQA 3ADDA 4J4HA 3QU4A 4YREA 3X1DA 4PF1A 1DEXA 2DBYA 3HSSA 2FSUA 3V1KA 2XVYA 1NVAA 1Q57A 2P4HX 3GZJA 5SY9A 3U19A 4OKIA 4NK5A 3K9HA 3WJAA 5EXEA 1IN4A 2HLHA 1JSZA 1U7HA 1BGVA 2FN9A 3BHIA 3TRFA 3AC0A 2YVLA 1DNPA 3ENVA 2JIZD 1TECE 1YL5A 1GPWB 5EYPB 3GVIA 1MDBA 2PZMA 1EH5A 3BK1A 3RFTA 1OWOA 3T9FA 1VB3A 5G2OA 1QP8A 4TL6A 3ZXYA 5LQMA 4MUBA 3NIWA 3RKSA 3U2QA 5DNUA 2OAP1 2OUKA 3RC8A 2ZTSA 2G17A 2DJIA 2ETVA 3GJ5A 4JZKA 5U9CA 2JGLA 2O0JA 4Y1FA 2CDNA 2EFDB 2GJKA 3HBFA 2A5YB 4ZKEA 1V8DA 3QFTA 5HIMA 1UM9A 4B2IA 3C8HA 4QOEA 2P8SA 1M67A 3F3SA 1XAGA 2QJWA 4PYNA 2WBLC 4XIFA 4ZYZA 5JW6A 1GSAA 1TAQA 1IHUA 1X38A 1XHLA 1NQOA 2B69A 3H2YA 5CLLA 1WSBA 1C7ZA 5IT9A 4B3DA 3LD9A 4LUCA 2IH2A 4A36A 4D4JA 2QRGA 1K3FA 4Q9NA 4MEJA 2PX6A 3MCVA 2ZJ1A 2BKVA 2ZJAA 2PRSA 3E84A 4RGYA 4K9NA 3I58A 4AUEA 1T29A 5AW5A 3DLCA 2FW6A 4YV0A 4RHCA 1YE5A 3L6DA 3CUSA 3HCPA 2H0RA 1XTSA 1DAEA 3VNUA 1DAPA 3PVCA 3ENWA 3LMKA 3LP8A 2B8TA 2I71A 3DOHA 2B8JA 4OJQA 4A5OA 4CKEA 5AVSA 4ER5A 1QP4A 3UG6A 3NVKI 1SWWA 2R8YA 3I8SA 2C4MA 1ACLA 1P6UA 4FFNA 3LCVB 4HX5A 4RTMA 1Z0FA 1XVIA 3OPXA 3TXAA 1OJLA 2DGDA 2H48A 3PDIA 1KQ3A 3BAZA 4BNLA 5A5EA 1DCFA 3OU7A 2OQIA 4RK7A 1SG0A 5E9QA 4LHEA 3H5RA 1BC5A 3TVTA 3BFVA 2Z3ZA 1XKLA 3AR4A 5FR2A 5K2OA 4P93A 1A9QA 2NXJA 1S7GA 2FG5A 3HADA 5HWSA 2F3UA 1TJ3A 3ONVA 5KQLA 1NBWB 2R5NA 3DA8A 2AOTA 4IHJB 2HPHA 3QXSA 1NMEA 1SKQA 4B81A 2QVBA 3ML1A 1GD1O 2GILA 3IAEA 1R88A 3DBVO 3ONFA 1C0IA 3U3RA 1YZTA 5CFRA 1CNMA 1JQ5A 5FCDA 2PT9A 1VB5A 3MPOA 1E5XA 4HJXA 2WJ4A 1CUGA 5BWLA 3SEAA 1NW8A 1Z5ZA 3DYIA 1A4UA 4PGAA 5K09A 4ZVOA 1DJNA 2N1MA 4R1TA 4XIJA 1J8VA 3V2GA 5HPYB 2ZI6A 4FB5A 2VSNA 4ZOCA 3LLMA 2W2MA 1C81A 4W5RA 3HGMA 1JILA 4JT9A 4GPTA 5K6AC 2C7OA 3FFBA 3GX1A 3DPUA 3HUUA 5EUMA 3VR3A 5KZMB 4IIEA 3DCNA 4XUGB 1K7FB 2IEZA 3WNCA 5ALHA 3TEJA 3H5IA 1ZPDA 3IR7A 5ITWA 4WTOA 1LI7A 1OKKD 4UZSA 2C2BA 1EVLA 1MBZA 1PJSA 1Y4UA 2NWQA 1QR6A 3I53A 3SSNA 4OXRA 3N8KA 4MS4B 2BR4A 1FUUA 1NBIA 4Q21A 4TS9A 4QUEA 2IH4A 1VTKA 3OTIA 4YJHB 2V0GA 5H9VA 3IKLA 2L0XA 4BNDA 1GIAA 1I6LA 1OJ7A 1W88B 1AH2A 1OHHD 1VCIA 2OAQ1 3INGA 3U7GA 1B1CA 1NF8A 3PCXA 3FCUB 2UU9B 1IHPA 1NJ2A 3HV2A 4P98A 1YR9A 4DR3B 2GAIA 4HTFA 1U2QA 3ZHSA 4EYEA 1W5EA 4EYSA 4U7FA 4CT4B 5LL6P 1JHXA 5CDTA 3PQCA 2C1ZA 4XX1A 3CBQA 3LT2A 2Z4RA 5TE9A 5LQJA 5TQ2B 4MS3A 1FP6A 2KS6A 1BNCA 1AZWA 1HFEL 2HXSA 4CIAA 2GAFA 3NGMA 4CKBB 1AHNA 1SU6A 3T0FA 1SMKA 5FNZA 4YCSA 1JKJA 3U09A 4YMVA 4C4RA 2D6FA 3LW8A 4R2IA 5AW8A 5AW9A 4FW8A 3FTQA 3TMAA 5I8WA 4DILA 3PUVA 4BPBA 2SNIE 3OF2A 1KO7A 4JLPA 4DLYA 3Q6IA 4QQNA 4L4XA 3LY5A 1CUIA 1RXSA 3TQIA 3V8PA 5I51A 4ASUD 1KZ6A 3DDOA 2F00A 4OQLA 4WA7A 3ZX5A 4EKEA 4HBZA 4MUJA 5F1KA 3KL4A 1R66A 1TUBA 2A7QA 3SD7A 3NHUA 1SXQA 1U9JA 4RBNA 5K0LA 1W5FA 8ABPA 2Q0XA 5KPJA 1XV5A 1RYZA 1Q7RA 4HLQB 1FS6A 4QPDA 4RACA 5DMHA 1QRTA 1SVMA 2XD9A 3DMNA 1CPYA 4KC0A 1SC3A 5BORA 3FJ1A 3NHWA 1T5TA 5G1NA 2QUIA 4N5NA 4LK2A 2J45A 4ARIA 1L5YA 4TN1A 3AFNA 5HCNA 3UJAA 4L4RA 1YB5A 3G88A 5EMMA 2WYHA 4I6EA 2JLAA 1QJCA 3WZLA 4CG1A 1N77A 1J06A 1H0HA 4ZC1A 3GLIB 4KI0A 1V43A 3AI7A 2QRVA 3TLMA 5L7TA 4DWVA 2RAVA 1RCUA 5IEBA 3FWKA 4ZOLA 3S2ZA 2QAGA 3IT3A 4U2BA 2AOWA 1XYGA 1PSDA 1NXOA 2ZYVX 5E4YA 4LXXA 5KBYA 5AK3A 3P9SA 3AT1A 1L4MA 5DLQC 2E4ZA 2PZFA 1Z34A 3NT4A 3RHFA 3AUFA 3IV7A 2UYCA 4ND1A 2CK3D 3JVEA 5LA6B 4CM5A 1XZCA 3URMA 3KUKA 4H3SA 4P7KA 5JR3A 5MFPA 5LXTA 4A91A 2FSHA 3HACA 3O3MB 3QTTA 1IC6A 3X1YA 1P6XA 1JYSA 4YYEA 1VCHA 1NX9A 1XCMA 3X1ZA 1W29A 3GMDA 3TCNA 1LW6E 1VC2A 1BCRA 2P11A 4K8RB 3U61B 1NF3A 3VO1A 3PHHA 2MR5A 3L0ZA 1U8FO 4RZXA 3A05A 5AM0A 3WLRA 2O5VA 5HQ3A 4KR7A 4XIGS 4UTZA 4GG1A 1XPRA 1UUFA 2GWHA 2FUG6 3VH1A 5HRAA 4L1KA 2WWYA 3KQUA 1L8QA 2ZCUA 4MW4A 1CJTC 3HLTA 3BORA 1D07A 3G1TA 4EEXA 3BCUA 2IPNA 2J0EA 4WZBA 3JX9A 4BKRA 5DHTA 3F6BX 3E48A 4YMLA 5KWVA 2WJVA 4MQ6A 3UOAB 1PFWA 4IUYA 4U6NA 4WECA 2IDKA 1ZD1A 3IERA 1ICIA 2EKZA 4A0SA 4U8GA 1F0KA 5ALTA 1EFPB 3W5JA 5JCOC 3TAUA 4CDRA 2B82A 4EHAA 4PS0A 4R51A 1CY2A 1OR8A 3HVKA 2FPXA 1OASA 3IVXA 3RUHA 4CF6A 3E8MA 4I5DA 4L4SA 4NYJR 1W5SA 2JFVA 4AJ2A 1NVGA 1YB2A 3WYFA 4J91A 4AXXA 1DAKA 2H1LA 2O23A 3C2QA 3FAKA 3H5LA 4OY3A 3FPAA 4ESHA 3ZHTA 1B6GA 1J7JA 4H0NA 4KO2S 4ZDIA 5JNTA 1ABFA 1T9HA 1HQCA 2Z6UA 3SFVA 1KDRA 2QX9A 1UMDA 3TZLA 1SY7A 1KPGA 4RQAA 3DZJA 4B47A 1WDTA 3DZGA 3KSMA 4B3FX 3WYEA 4DC0A 1DUVG 4N3GA 4DVJA 4WGFA 2JLXA 4U7TB 4LS3A 3DFKA 5IVDA 4RZIA 2QT1A 3I12A 4Q4JA 4HCJA 3IPYA 1XEFA 3GH3A 4G9EA 4HMOA 4JV5B 4QHSA 1G2OA 4LJ6A 4LSGA 3RC1A 4H6VA 5TLSA 1QC5B 4UAUA 2IZZA 3CUVA 3REQA 3GIDA 4KACA 5SZIA 4QBFA 2I9KA 1YACA 2ZJ4A 1NNI1 4V0LA 1HQKA 4UNRA 2O3JA 3MINB 2JKVA 4IDQA 5FI3A 4B3JA 4ENQA 1L8AA 1FFCA 1LC0A 2D74A 3DUFB 5G0TA 1Q50A 3KDSE 3VAAA 4ASUA 3TXYA 4YAOA 3OM9A 1M2VA 3ZC3A 5C8ZA 3KCNA 5CJJA 1FY2A 3C4QA 1J97A 3OD5A 3B9QA 2V3WA 5LOVB 3HNOA 1XXHA 3NR2A 4GPIB 3URKA 2WWGA 2XUZA 1J2JA 4ZOQI 1RXYA 3ES9A 1LNQA 3ZLBA 4TXHA 5TXGA 1M2OB 1VSVA 1ZD2P 1IZYA 2AN3A 2O2YA 3GJYA 2JC3A 3O74A 3T12A 3V8RA 2X9LA 2A58A 4CF7A 1IN6A 3A6ZA 4NBTA 3RVQA 4D9EA 4F2WA 3OH8A 1LXCA 1A9OA 2P68A 4KAAA 3FMPB 4MB2A 3M1LA 3CUTA 3RC3A 1M1UA 5HRUA 4NICA 1U3TA 3KQTA 3JD2A 3OQIB 4IEFB 4MEAA 1GL6A 4Y3UA 3JWGA 2PR7A 1X0XA 3VYSB 1BOOA 2VWQA 1QGUB 1E5TA 1ZWKA 2XGSA 2YHAA 1XZHA 1RP7A 2R5FA 4Q3DA 1VRWA 5BN4A 1IOVA 1NTRA 2R68A 4BPRA 4MQMA 3JQPA 1PR6A 3LK7A 5KVVA 2ZBQA 4W9NA 2CMHA 2V6BA 3G0DA 1P73A 3PNKA 2WMDA 4GP9A 4HFRA 2WMOB 4YIHA 2R5WA 3FMOB 4G9GA 4MJXA 3I45A 2WWRA 3HA2A 4KO4S 4XIYA 3QKRB 3L1JA 2W7TA 3IAAA 4CRWB 4WJLA 4DE5A 2PX5A 4LBWA 4QODA 3LX5A 3CBGA 1Z08A 2ENWA 3TNDA 3JQRA 4KAXA 4CTJA 3WLQA 2CXPA 2WEKA 1W581 3KQQA 3ZE7A 5KX5A 4YRIA 2DLDA 1J39A 4B75A 4GBMA 1ORIA 3DB1A 4DRYA 4EDFA 1GZHB 3UJ3X 3FPEA 2L69A 1YKFA 1KK0A 2GEJA 3DAFA 4MNTA 3HKDB 4OB6A 2L19A 1RCFA 2Y05A 3FWZA 2AEMA 2ORED 1ZICA 4EBFA 1Y33E 1I0IA 3C7TA 1SUCA 4AJHA 1E66A 5DHSA 1QLHA 1P77A 3A3NA 1E99A 1FDRA 3CF0A 1KFKB 3KZCA 4FOPA 2ID9A 4DQVA 4QXOA 2Q07A 3PQ6A 4UREA 4TKUA 1E64A 4QPZA 2BSAA 4YDQA 1DDOA 5I7HA 2UDPA