1RBMA

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rbmA00
4Q12A 1RBMA 4ZYUA 1GRCA 4ZYZA 1RBQA 4NV1A 1RBZA 3DCJA 4YFYA 2FMTA 4ZZ3A 4DS3A 3DA8A 3N0VA 4EW2A 3W7BA 1CDDA 1C2TA 4ZYYA 4ZZ2A 3GARA 4S1NA 3R8XA 3OBIA 3O1LA 1YRWA 3TQQA 1NJSA 3AV3A 4QPCA 4IQFA 5J9FA 3AUFA 3LOUA 1MEJA 1ZLXA 1GARA 2YWRA 4TTSA 4YFVA 4ZZ0A 4ZZ1A 1RC0A 4EW1A 1MENA 1C3EA 2BW0A 5CJJA 4ZYWA 1RBYA 2CFIA 1RC1A 1S3IA 1ZGHA 2BLNA 2GARA 3P9XA 3KCQA 1JKXA 4PZUA 4ZYTA 3NRBA 4TS4A 4EW3A 1FMTA 1ZLYA 3Q0IA 5J63A 4R8VA 4QPDA 4ZYVA 1MEOA 4ZYXA 1CDEA 4TT8A 3TQRA
chains in the Genus database with same CATH superfamily
3AR8A 1UJMA 2JZNA 2N0SA 4J03A 5JCZA 5A0FA 1PJCA 2Y76A 3AR4A 3E2MA 3G88A 5EUCA 4ZVVA 2NYUA 1TGYA 1LJ8A 3CZMA 3K5HA 4I4NA 4N8DA 3VPXA 4FD2A 4PX9A 4I1UA 2Y92A 3RVRA 4EMTA 4Y7DA 1RM0A 2YNMC 4LZLA 4J29A 2WZCA 4QOFA 1WUTA 5FKJA 3T95A 4C06A 4F5EA 1M6NA 4YRIA 4V0SA 2XUJA 1DCTA 4TKZA 1PJSA 3KSZO 5SYNA 4EL0A 4N48A 4UU7A 3GV0A 3I3SR 3WLFA 1IUPA 1SVSA 4LRXA 3RIMA 1IXKA 2PBRA 1ABFA 2J3LA 1THMA 2XZDA 3IT0A 1O6GA 3I2YX 4JT2A 4KQMA 4R51A 4UUMA 4E5KA 4CWAA 5IT0A 3TBKA 3GVHA 3PPYA 4D9MA 1SQGA 4NCXA 4Z6KA 4LX0A 5KTKA 3KXIA 4E6EA 1N77A 2B5VA 4KO8A 5LMZA 2RHOA 3A4MA 2CEAA 3DMPA 2SICE 4FUTA 2E4VA 3PR3A 3DPIA 1OZ0A 4DLRA 3MAAC 1DBWA 4IG4A 2WZBA 2EYQA 2IS2A 2DERA 4C05A 1UL1X 1W93A 2X0IA 3D31A 4V2UA 4CUZA 1H6CA 1GITA 3GB9A 4WNAB 4ER5A 2XQGA 3IIIA 5EA2A 4L6AA 5CPFA 1NVVQ 4QRHA 5J2UF 1JEDA 4J1SA 8ADHA 3R24A 1WDTA 4YMUA 1N1DA 3AL3A 4BNGA 4XIIA 2WA2A 1SUIA 1K3UB 2B6NA 2G7ZA 3NFRA 2HV8A 3UMGA 3O2QB 3HCRA 1X1RA 5C31A 4Q37A 4P3NA 2FZ4A 2IZ7A 1C7ZA 4HAYA 1Z28A 3PXXA 4AX8A 1KMCA 1YZNA 1RM3A 1XVIA 3AI1A 2DHEA 3OSZA 4HDMB 3THRA 1H2FA 3PJRA 4MKRA 2JLWA 1QR2A 3N07A 3IQFA 3IR7A 3CZ4A 4IWXA 5C2JB 4K8OA 2CT8A 4MR7A 1WD5A 1CE8B 4HRYA 2CL0X 2DKNA 2VXOA 3RD5A 3ZWVA 2C58A 4HNRA 1KC3A 1FJ2A 1RPAA 2MR6A 1SRRA 2ZR7A 3KR9A 2DPMA 4M1WA 1MAAA 4W7SA 1XTBA 2QRHA 3TZKA 2AHOA 2AG6A 3L8CA 3H5RA 3U7GA 4Z0HO 4E12A 3BICA 4TWRA 3HGQA 4TGLA 3E53A 1AOXA 1UFQA 2C88A 1P62B 1T9GR 4J43A 4Q05A 1GRVA 2CFRA 1X1TA 2ZQZA 2P9FA 3GC6A 4WV3A 3SR4A 1PWEA 4QJ4A 1KFJB 3V2UA 3ZDAA 2WIAA 2ZYVX 4NONA 5KSPA 3WZ2A 4ZGWA 5HFJA 1LZKA 2ZB7A 3H1PA 2NU9B 5KSOA 2G67A 2DEUA 5J40A 4GX0A 1L7NA 3AEQA 5K01A 4A23A 2YNMA 4F6RB 3AVTA 4RK7A 1GP2A 5AI8A 3PQ6A 3AHDA 1KNQA 5B2ZA 1ZH0A 5KJEA 3VU3A 2Q4EA 3IPCA 1IK4A 3REOA 4AJ1A 4EW3A 1FQWA 2QNRA 1CEYA 1X80B 3TUJC 4E15A 2ZJ7A 4IOJA 5DO9A 5JMOA 3AILA 3JTMA 1N8NA 1Z4KA 1CJVC 4LF6B 1LPPA 4L9SA 3H19A 4RTQA 5K4AA 4O5OA 2IBSA 1YKGA 2HHJA 4KPGA 4P5DA 4L28A 2POQX 5DXAA 3F67A 4TSRA 3DS8A 1UBLS 2AOTB 4AZ3A 4YP6A 1VM6A 1VMIA 4N6OA 1V7CA 3F4BA 4GMFA 3TPCA 3RM3A 1C3JA 1CS0A 5C1IA 4YHHB 2EX4A 5E9AA 5EL0A 1MNQA 3T0FA 1E1CB 1RR6A 3FG9A 3IALA 3ISJA 3OO1A 2SKEA 5B1SA 5ICFA 2I71A 5L6LB 3R5FA 5FJJA 4GWLA 1GUZA 3MG9A 1UZMA 4OAPA 3ZWQA 3AJEA 5I4IA 1T6BY 5GQSA 5J5VA 3W9UA 1CRQA 2GZRA 3SZRA 1YUNA 1KBZA 3EXIB 3DA8A 4QO7A 3DT9A 3KQQA 2YJ3A 2Y1CA 2CMKA 2YZ2A 2WM8A 3DE6X 4JA2A 5F64A 1HE3A 3L46A 4YQEA 4F21A 3D7SA 2WJWA 2FW7A 4ZOAA 1XXHA 5ALHA 2G8NA 4YV1A 3WRYC 4BFYA 2YX1A 1FIUA 1LV8A 4XOIA 4TM8A 2RFLA 1CR2A 1JALA 4F4HA 3H0EA 1XCBA 1MB2A 2WYHA 2W2KA 4I5DA 1ZK3A 3D3QA 3OZBA 2PR2A 5KDOA 3IIJA 4WY5A 5ALIA 4LY9A 4R1SA 1R0WA 1YCHA 2OCDA 2ST1A 5H82A 2OMKA 1BG6A 2ADOA 4WESB 3TW8B 4RTKA 2VDNB 1P7ZA 4HWRA 1ORDA 1WQ3A 3VSBA 4ZK6A 2VP5A 4MVJG 3G23A 3FCUB 4TXMA 4DR4B 4LZJA 3DZDA 4U0KA 4HMQA 1VJGA 3ILVA 1I1HA 4QVIA 3QF7A 4BNYA 2BJHA 2EFDB 3OA2A 4KI7A 3UFXB 4S04A 1LNSA 1I30A 2HMTA 1E3IA 4Q7QA 2B36A 2E4YA 2WAAA 1P45A 2Q1XA 2XDQA 3TAHA 5T4FA 1KQFA 3R5KA 3HYRA 4UXHA 2GILA 3GU3A 3KHUA 4PNZA 3OI7A 2ORVA 3W6ZA 4PX5A 2A2ZA 3IB3A 4BGVA 2VYVD 1G55A 7GPBA 1ICEA 5C5EA 1BXKA 3AR3A 1XLUA 4JLSA 4C14A 2YR0A 3RRMA 5B36A 3TRIA 1IM8A 4FPXA 4ZKDA 5AH0A 1XCLA 1P2UA 1RRMA 3EEFA 4GH5A 4GZMA 4ESVA 4Y2XA 2HSEA 2IU0A 3BXPA 3D6JA 4LJ5A 4M0PA 3EPRA 2FSSA 1OA1A 1KRXA 1N9ZA 2GFQA 3LO8A 4LYHA 1NFRA 2IYQA 1FYDA 1E7WA 2PZGA 3I83A 1PP4A 1FP4A 1GQQA 4POOA 4NCHA 4QUBA 5DMXA 3FYDA 2FY8A 2B8TA 5GGXA 3RVBA 5HKLA 3IEIA 3AWDA 2PX3A 2ZQ5A 3E9DA 2XCSB 2ZYGA 3AF6A 2JANA 2NZ8A 2OSBA 2OLJA 1WVMA 2OM6A 3P0HA 3FUVA 5FLKA 4MTCA 1R3DA 2QD5A 2XB2A 3L1HA 2VLBA 3KVNA 2WB2A 3WRYA 5LQCA 3TLGA 1YZYA 3S2ZA 3NKFA 3H7AA 4JQOA 5FPHA 3FLBA 3RHTA 4EATA 3AEKB 5I6DA 5KNDA 5MFZA 4I4TA 1ECCA 2ZIXB 1PR9A 2C4MA 3OPQA 3UUGA 1ZJJA 1U0SY 2O4CA 1XTKA 2Q29A 3A4NA 3HFRA 4KXQA 2MINA 5TS3A 2BMAA 4MUAA 2BJVA 2WICA 1W88A 3WISA 3U7IA 3LP6A 5DW3A 3PUZA 5B2FA 4JL8A 3TX2A 3E27A 1DI0A 3G5AA 2Z2KA 3ZD6A 5TC4A 1MQ9A 2C78A 5FL3A 4N3BA 2C2ZA 5IWCA 1Q12A 2DTEA 1B7GO 4GNRA 4R1LA 1GPAA 3PIIA 4RHXA 4ZXPA 5EZYF 1JJVA 3JD0A 2PKCA 3GYBA 1P2GA 1VE7A 4Q5IA 1FSFA 1Q6YA 2BFWA 2X2OA 1I2ZA 4UEQA 4C7JA 1UM8A 3WSWA 2FOLA 2O1XA 4RVDA 1JHVA 3GD7A 4DG9A 5HRCA 5DM1A 3P71T 2QTHA 2JASA 1NOIA 3DOFA 1X9IA 3BH7A 4JHLA 4QOSA 1QHNA 4ESEA 1TCUA 1KI6A 1RM5A 4KN9S 5B3AA 3RUPA 3NP9A 3KT0A 1WKCA 2FEXA 1OASA 2DB3A 2AZMA 3HLYA 3EVNA 3K09C 1NJSA 3QFHA 2VC2B 1A9RA 1N5KA 4I6EA 3TGWA 4EHNA 4EG5A 2PX5A 1W4AA 2GB4A 3PUVA 5IN4A 3DOIA 1X7GA 1LDMA 3PFNA 2OBFA 1X1DA 2EDCA 3FZNA 4LJLA 1D0VA 3DB1A 3QFRA 4N3NA 2Y1EA 3I5XA 3DEKA 5K51A 2XQIA 1G1AA 3GDFA 2AXQA 3GJ6A 4EG8A 4DMUB 1FP6A 1KKMA 2RCYA 3ANSA 3TNLA 4HXFB 3RSHA 8ATCA 2Y77A 1QHHB 3R6WA 1A71A 4H0CA 3M4JA 3TLKA 4ENVA 3U3ZA 3OZRA 2QPTA 2AVNA 4R84A 2I1QA 2F3TA 2PVSA 2NW6A 3VJMA 2AE2A 4XD7A 2G5CA 4ZGBA 4C0AC 1N2JA 3GDOA 2K87A 5D1HA 5JD4A 2HSJA 5DCYA 2I5PO 2BKAA 5JWHA 1OE0A 4ERXA 2F4VB 3BF8A 1E5TA 2RBEA 2WWIA 1D6JA 2QM0A 3N8NA 1V41E 2V6MA 1J7JA 3DFZA 3DYIA 2QE7D 3WGTA 3ZI7A 4BQPA 4E30A 2VJQA 3R0JA 4BB5A 1U8EA 3AB7A 3A3PA 1RAGA 5DLDA 2HQBA 4M9XA 2BTEA 4G5HA 4BAUA 3FHJA 3DLIA 1GCIA 2C9ZA 4D8UA 5E1MA 4DDKA 1U3FA 3HWSA 4OQXA 5IKOA 3THSA 1ZD2P 3A05A 2A5JA 2NNLD 2IDJA 3OLCX 4IGKA 3TZQA 2H18A 2D0PB 3SBOA 3FCCA 3VZQA 1BVHA 1PJLA 1PJ2A 1QV9A 1M2KA 2B69A 5JC1A 4N3CA 2Y0DA 2LIPA 2AMFA 1XELA 1XHFA 4KQCA 4MRNA 5LDGA 4QDTA 2XTAA 5BSGA 3NM5A 2OHGA 2WTEA 4R1NA 2P30A 16PKA 2DQSA 3LQQA 1JU9A 4XX0B 2D00A 1SIOA 2LZ0A 2R6FA 2XAUA 2JIMA 1T3GA 3ANYB 4L5IA 3SXUB 4N76A 1BYIA 3QVXA 3G2NA 2C04A 3UUFA 4F5ZA 4FZVA 5HJEA 3AHFA 1RCUA 1IUKA 1TD1A 3G0DA 4UAUA 4YLEA 1UBOS 2EZ8A 4BX3A 4JP5A 1ZH2A 1Q7GA 1HG0A 4GZLA 4ID3A 4MKZA 4QLAA 3ZCXA 3O26A 3IILA 3NHAA 1DEOA 1GM5A 1K88A 4KO1S 3DKIA 3F5MA 4YJGB 2ZULA 2EL7A 3FWNA 2Q5JA 3K09A 2B0JA 1KIMA 2N46A 3H1GA 2H1LA 3PQ8A 2Q5IA 2R6CA 3VBCA 4J49A 4NZZA 3F3YA 1Q1NA 1Y4SA 1ZXBA 2WINI 3QM1A 5AIAA 1FU7A 3GLGB 2WDZA 2VCYA 4M7PA 1NW8A 1C3OB 1JLLB 5KCZA 5AVSA 5IFKA 3AF2A 4W5OA 4YUYA 1YF3A 5F98A 4IZ6A 4BLOA 1ELOA 4IIJF 1KFCB 2BEWB 2QORA 2Y71A 3E5NA 2B99A 4UHCA 2DU8A 3NX4A 2H06A 3A8TA 2JFUA 2D8AA 5GIOE 4QRIA 4XASA 4P3PA 2XVZA 3CGGA 2VSOA 4IFTA 3A11A 5ARDA 3R9KA 4BZPA 2HJHA 3R3HA 3M2TA 1AVTA 3U09A 1O97D 4JI1B 1PU2A 2P3OA 3DVAB 3OOJA 4FDAA 4LJKA 5SICE 3W2TA 5HJ5A 1J1IA 4G86A 1KZ4A 4CDMA 3RU2A 1Q83A 2ZUSA 2VCHA 2HO5A 2WJZB 5BV0A 1OBFO 3RQSA 1M8GA 2AI2A 3PXBA 3QBTA 1I3LA 3UYKA 1QP4A 1K7YA 3ABIA 3CV3A 4BB0A 3UV3A 2F1JA 2PSEA 5DWQA 3JR7A 2WVAA 1WEHA 3L1UA 3O9VA 3TJRA 4IX1A 4QARA 3WHLA 4ZAVA 3KKZA 3CO5A 1EFTA 5TMBA 5C8YF 1R15A 3J80A 2YRWA 5D3QA 2JJ1D 4EM6A 2O7QA 3THWA 2I34A 4GI2A 4GX5A 3WKCA 1QF7A 4EJ6A 5EJ5A 3V8RA 3EWSA 3CNHA 5JU6A 2IZ1A 1BOFA 2J3EA 2XRMA 3B85A 3NAZA 2OTCA 4PO8A 3DGEC 5BYAA 1B76A 2ZJ0A 4KV7A 4UULA 1GQ2A 5GY7A 1A9PA 3KQTA 5BQ3A 2A1UA 2B5WA 1QGDA 4HYTA 2C7OA 3H11A 3TOCA 1AS3A 2OBMA 4Q3AA 1IL0A 4BCDA 5JCOC 5IDQA 4MWBA 3T1HB 3E0QA 2GEDA 3DP9A 4YUWA 5A5DA 4QEDA 5JIBA 4MVCA 2ZIWB 2R8YA 2CXOA 1IEXA 2H1CA 2Z9CA 4K46A 3PE3A 3WB9A 1NRJB 5CNKA 4JGGA 4ETNA 3O0TA 2ZK7A 2FE1A 3IKVA 3OZIA 5ALSA 4DFDA 1ADBA 1PO7A 2KE5A 3E18A 3W8DA 4BIMA 4DM4A 2FJUA 1I7QB 4K0KB 5DE3A 1XZKA 4KUEA 2F9LA 4RZXA 2CXHA 1N5IA 2EC5A 1GTL1 1ZUWA 2WJGA 1YOBA 2WWXA 4GM0A 4BL5A 1U3GA 4V0OA 1U1EA 1X9HA 4FOTA 2VYCA 3WLLA 1W4ZA 1CUAA 2V7QD 1JX6A 1TZBA 4YT5A 5IBQA 2SNIE 4DM7A 5IK2A 1UWLA 2P3QA 1F51E 2FX2A 2N3ZA 4P9NA 1TPZA 1YDWA 4G63A 1RADA 2C9CA 2YICA 1IONA 4EY4A 4TKVA 2ZM5A 2LW7A 2Y1KA 4L7QA 4KE6A 3Q6MA 5ECYA 1ARZA 1T5OA 3R7NA 1KDZA 3U9LA 1N2XA 5K0CA 1XUOA 5TVKA 1G4UR 3LKZA 1DV1A 3UC9A 5EE9A 3IPYA 3BGOS 3ETNA 4MPRA 4KRYA 4NG4A 4LCEA 5CX4A 1BAPA 4YCSA 1EP2B 5BSHA 3MF4A 2V74B 3QY9A 5EIEA 1AH2A 2GDZA 3URKA 1HR0B 1P2VA 5K3AA 1JQDA 2I54A 1OI3A 5FI1B 1Z2NX 1Z4PX 4RTSA 2BELA 5C3MA 2HLDA 3KJGA 3NBFA 4JC4A 2H5JA 1MA0A 1JQJC 4XYGA 1SK9A 1MDBA 2EAUA 2FOXA 2TRSB 4YXWD 2J7PA 3P7MA 3WL8A 3ZPXA 4MUKA 4X6XA 2QQ0A 2LE0A 3PWZA 3TO5A 1EXMA 4NPHA 1PNVA 1UDAA 2JAWA 2JI9A 3D1VA 4QNRA 2JI7A 3F7MA 4PG4A 3MWLA 4LRUA 3TEFA 1KMHB 2CDNA 3LNCA 3A4LA 3T3GA 3ZE9A 4DMFA 5BNWA 3OG9A 1Z22A 3JZDA 3ND5A 2PGOA 1B6RA 1BDHA 3OZGA 4IJVA 4P6VF 4CCSA 3KLPX 2IUTA 3IVAA 2GEKA 1U7DA 2OBYA 4ZC1A 1LDGA 2I2AA 3KEOA 4UUQA 4AP9A 1MW8X 3OZSA 4JBXA 4ZDKA 4ARUA 1T5DX 3HO8A 5CM8B 3S5JA 2JPDA 5HF8A 4DIBA 1B0ZA 3KELA 2W6ID 4DMLA 5JCOA 1D7AA 1RJ9B 1V43A 3F7TA 3VDMA 2C5LA 4YK7A 2DCUA 2RG1A 3LHSA 2R6GA 1LVGA 3PWKA 4H35A 1L6IA 1N6PA 3BK2A 4LZAA 5LYYA 3WS7A 4RY0A 4BECA 5IKMA 4HLNA 4M9CA 1GNPA 2QDKA 1MRNA 1FNCA 1K3TA 4Y67A 3WGGA 4ENWA 2C7QA 3CQ9A 2CFSA 2APJA 3JQAA 3BB3A 3TLYA 1AJEA 5CMLA 3U56A 3KT6A 2IUSA 1EK2A 1S8NA 1Y5NA 1Y1SA 1NAIA 2DULA 1IOWA 4ZQFA 2ACWA 1WY5A 1UJNA 3HPQA 4CKWB 3H5NA 1F2UA 3D5QA 4IDAA 3SYNA 2HADA 2WWYA 3RHSA 2HF8A 3T35A 4ONEA 1UT6A 1YR1A 1J1UA 2ZAYA 1OTXA 2ZR8A 5E6RA 3UATA 4FB5A 4PHHA 4NESA 2O7RA 4V0QA 1S6YA 4DCOA 4OQMA 1L1FA 2OZPA 5JQGF 1PW5A 4R01A 3ITDA 4F3RA 2O2SA 1XVTA 3N6VA 5KCMA 4P3XA 3WP0A 1J0DA 4A5OA 4DUZB 2BT4A 5FPKA 2DE0X 1UJ2A 1H1LB 2HXSA 2YXPX 3OX3A 5AXAA 3SIWA 3ZXXA 1VMEA 4GAEA 3RYCB 1T91A 2JAUA 3KTDA 3PEVA 2NTVA 1RZRD 1NWCA 3UHOA 2AK2A 2MSNA 2VRBA 1K4KA 4IHJB 1IYZA 2OOSA 5FYDA 5FQNA 3RABA 3TOZA 3DE3X 3K9HA 4B6RA 3WRWA 3WLJA 2P2LA 2HKIA 3H16A 3ZUGA 4IDCA 2BLLA 1YR6A 4IDHA 1K5DA 4ILKA 5E1BA 5TS2A 4WGGA 1KO5A 1F6WA 3KVRA 4RVGA 1RJDA 4AF8A 4KGXA 1NVKA 4NBKA 4XSGA 3OICA 3UENA 2EWWA 5HE8A 1ZSVA 1OX4A 1N1EA 1QC5A 5AFSA 5K3FA 1MW9X 1TM4E 4KVGA 4RVHA 4JL6A 2QJOA 3JPWA 4H1WA 3VPSA 1NVUQ 3FGPA 5TARA 1ABEA 2ZVJA 5FWXA 5EZYA 3RC7A 3EXEB 4WNAA 2HRCA 4GGOA 4AYTA 5LP6C 5JISA 1CZUA 1QBGA 1NBAA 3EOZA 4DXDA 1PT9A 1T4DA 3D3WB 1QIGA 1DFIA 4ZALA 1GZDA 4PIVA 3T7TA 4EP1A 5CDSA 3GLFB 4Q19A 1KPHA 4HADA 2YRFA 1C50A 4DE5A 2JGFA 2JBWA 1SVKA 2TS1A 3KL2A 4WD3A 3CVVA 1GYQA 1CUYA 3IDOA 2QZPA 4OSEA 2AOWA 3WTBA 1KY4A 3CO0S 1UKVY 5G0WA 1A8SA 1I4WA 1JPNA 1FFBA 2JH3A 1RYDA 3NW9A 1R37A 1VL0A 1TO6A 2B7LA 2FEOA 3CNBA 3ICCA 3E8MA 1IBCA 2CHUA 4Q4AA 4TMWA 4U63A 3UWPA 4BPRA 2MYUA 2GETA 4Q18A 2JLYA 3ZE2B 3B7PA 2YBDA 1R8JA 3DDCA 1OGYA 4G5GA 3GARA 4EIWA 4MR8A 1V5FA 2HJ9A 1GUBA 3EARA 1CETA 1RW4A 1G8HA 1XZIA 1YJAA 2H4HA 3AP1A 3R3XA 4HNAA 3KB1A 1TAQA 1SHTX 4XLZA 3U3OA 1UH5A 3IMCA 3C3AA 3R7AA 1YRWA 1E69A 4Z3OA 4LRWA 4CF6A 1USKA 1IG0A 2WYWA 4EUEA 1Z3IX 2XZOA 5DT9A 3NV7A 2FETA 2Z2IA 5ULLA 3OUUA 1Y9ZA 3FE2A 3QXXA 3M1AA 4GC5A 2XA9A 3OOEA 2CNWD 1K4YA 3O2NA 3WMWA 1HC7A 2IC5A 4RIEA 1NUAA 2B20A 3FI9A 4HC4A 4MRPA 4B4DA 4Z4HA 3U7JA 3VA7A 2O1SA 3TIXB 3TTTA 1SPBS 4FIZA 3DV0B 4UHJA 1SHKA 3IP7A 3ML1A 2AUMA 2Q5CA 2WWTA 2BR4A 1K9SA 3DE7X 5CU7A 2F9FA 5EIAA 1RPNA 1TIKA 4F8EA 1QMGA 3HMQA 4M0CA 1GN9A 5CCDA 1D0SA 4BQIA 4EZBA 4RGVA 2P1RA 2FMKA 4LZZA 2EP5A 1PD1A 4EQ6B 1OB5A 1RYMA 2BFMA 2X9GA 4IDDA 3GF4A 4YCJA 1FXWF 1JU3A 1V71A 2SHKA 1S8AA 1QGUA 1NXTA 1H3NA 2XD4A 1L4BA 3B3JA 2Q99A 4FFNA 2CF6A 4IH4A 1VYTA 1WB5A 4LWPA 4QDZA 3ANMA 2EIXA 2H4ZA 4IINA 1CS4C 4FWIB 4YCBA 1UR5A 3WB1A 1K5GA 4KODA 1JS1X 1S8FA 4J4TA 1NJ1A 1R6VA 3C0KA 5LU9A 3NALA 4MB6A 3LWBA 3D3JA 3I45A 4AC9A 4DDWA 3CZ9A 4QGSA 3GNQA 2WWHA 1K6EA 2V7WA 2ZBFA 3RGWS 1V8DA 3F90A 1OBVA 3T5GA 4BMXA 1JG2A 2AMJA 1M2HA 4G0UA 3DZIA 4KREA 3QNWA 4HLUC 1GDDA 1XU7A 2Z58A 3I5MA 4OQDA 4FFPA 3FRIA 3H13A 1QH0A 2NO5A 3ZBPA 4RV9A 1IBKB 1GFZA 5I7FA 2EU8A 1PL6A 3KZNA 3T9AA 1LRLA 1QFZA 3GMIA 3I62A 1DCFA 3TZCA 5L45A 2FPIA 3N2GB 1C8BA 2PX2A 4PLPA 4XW2A 4M46A 1CY8A 5DIZA 4EFKA 4C20A 4RTNA 2PY6A 1IWBB 2AVDA 3PWSA 4Z2YA 3T5PA 3OBBA 4UE2A 4UTOA 4YH1A 2IP1A 4IIJA 2VDJA 2WV9A 3GPDG 1GGMA 2XUDA 4Q3EA 2WJIA 2RAVA 4AVYA 1Z16A 3T54A 3T9CA 1FFSA 4TMZA 1VIAA 3T99A 1APBA 1YTLA 4TQUS 3DL0A 3SN6A 1GQSA 1EWKA 3GAZA 3ZNOA 3W79A 3H2KA 4Z7JA 4NENA 1WKBA 2GBIA 4XUGB 3I2GA 1T6ZA 3P9CA 3Q2OA 3H6KA 2W70A 4AKIA 2WMOB 4MR7B 4ES6A 1C2TA 4JWTA 2DR0A 3O91A 4U7HA 1TUGA 3BEOA 1XK7A 4TRMA 4CUKA 1LCIA 3PSAA 1JPJA 1WUYA 1AXEA 1E2NA 2XMBA 3ILHA 4J6FA 5C8YA 3UJ6A 2PEZA 4GP9A 5KI6A 3AOGA 3OKPA 2A9OA 4U2KA 2O1EA 3VKUA 3DH0A 2BKUA 3CMCO 3GLFA 3RYIB 1J56A 3OWXA 1SUEA 1AD2A 1KHHA 3AZOA 5HJ2A 3R7FA 1ZJWA 1C7FA 3ZJUA 4C78A 2IYTA 5ALGA 2ZATA 4MX8A 1ESEA 4OA5A 1RLMA 3SC6A 2GBPA 1JE1A 3BHNA 1U8ZA 1YQXA 1RFLA 1AK1A 1VB3A 3IB6A 4NCKA 3WY9A 1KU6A 4CKCB 3WV5A 1YS2X 2F55A 2Y93A 1SHJA 1X7YA 3ZH9B 1Q1AA 4AURA 2G0NA 2IJGX 5IVDA 3HJNA 2CJWA 1PFYA 1CXZA 4II2A 1R8QA 3TXAA 2GO7A 4B35A 4PPQA 3LTNC 4RVSA 4FVTA 1G8JA 3JQ6A 5E3HA 1M1YB 2VPQA 4B84A 2HPZA 1M34B 4AICA 5JSZB 4MJLA 3EZLA 5F52A 3OECA 4JQSA 2H31A 2DXIA 4JC5A 3RTAA 2HREA 3N2KA 4QUKA 4UOQA 1GPMA 3RC8A 1I1OA 4CEJB 5KU7A 1QUEA 3G49A 5GZ3A 1Y42X 4X1IB 1SA0A 4ML3A 3TIVA 4B31A 3P9ZA 4AZ3B 2XF8A 3E22A 1I6KA 3L0PA 4RQBA 3ZDQA 4G4JA 3EG9A 3HE3A 3HJHA 4NV3A 4LSWA 4OQEA 4RUKA 3NXSA 1YS6A 2E0IA 1CS0B 3D4LA 3QELA 3V1LA 4P22A 1E2BA 1DQPA 1LK0A 2V55B 4XUCA 3VHQA 4DA6A 1SVMA 1T34A 3E5RA 1XL1A 5D01A 6PFKA 3PNKA 3BTSA 5K6TA 1EZ1A 3QVGB 3IEMA 1UBHS 1OV4A 1YRHA 2A94A 2C2WA 1PL8A 3HCWA 3OPXA 1GILA 1X7HA 1L5GB 1A4UA 1J25A 3S44A 3FOEC 3WWEA 2YVKA 5FPSA 5BVGB 2PNFA 2D8MA 4YUVA 1KJYA 1XDSA 2OA0A 1QDLB 2A0XA 4W5RA 1MJ5A 3K5WA 3DUWA 5EMKA 1E2IA 4X94A 3WA6A 2HW8A 3TRJA 4CG1A 1UMDB 4P4NA 2QENA 4TROA 3DQQA 3OPYB 4YI5A 1Q1BA 2QRZA 2W2KB 4IOLA 4J94A 4AYXA 3NNDA 4W8GA 4GE0A 3UICA 4IY1A 3GAFA 1OIVA 5F2KA 1IQ0A 3IKJA 2ZVDA 4JCOA 3G0GA 1J2RA 2EJWA 1QZUA 1L5OA 4NFLA 1QO0A 2R85A 1AZSC 1NI4A 4FDLA 1A0OA 2FWRA 3W3AH 4A2QA 1VBKA 4B3BA 4F71A 4ME6A 2C7GA 3EPJA 2YINC 5EMHA 3GT3A 4Q4DA 4MB0A 3FA2A 1I6MA 4JSTA 1UC5B 2XNDA 5JROA 1N5LA 2UZ1A 3EUEA 1F0NA 3PV0A 5JBIA 2ZJ3A 3W7VA 5MHTA 2R5NA 3KDAA 1L5HA 2IH4A 1UPXA 1NQXA 3JS5A 2JD2A 1SGWA 5DSZA 3Q7IA 1QFXA 2C0QA 1V7QA 2V7PA 1FTNA 1T29A 3LUKA 1KWGA 3TG2A 1RQ2A 2QA5A 1EG2A 2ABWA 4QTTB 1S3SA 5DI3B 4CCAA 4G37A 5BOSA 2GESA 4ZTBA 4PZ9A 5AM3A 1SKYE 1CUVA 5JH7F 2Y1GA 3VFDA 4NYJQ 4AM8A 1XRPA 4XLLA 4J3NA 4RSHA 1L4MA 2WU3A 3T9BA 4IFEA 4F9FA 2H8KA 3KZVA 3SSMA 4HVCA 4CJXA 2IYNA 4E51A 1L7PA 4A9AA 1RJWA 4CODB 1QYRA 10MHA 2PSHA 1E1YA 2XB8A 1MTOA 2DR3A 3RAGA 2RKWA 1NN3A 2IZ6A 2PZKA 4J0DA 5LNK6 3F5QA 3LUHA 2WIJA 1NONA 1B0AA 3I1JA 4GYYA 5DDIP 1LLDA 5LXTF 3RUHA 2QTZA 2OHXA 1TA9A 3LUGA 3D8NA 4ND1A 1V2HE 4Q24A 5THQA 5FLXA 2ZUTA 1L3BA 1PEYA 2ACVA 2CLKB 2OVBA 3QOFA 2Y1DA 4IRXA 3VZCA 7ABPA 3CUWA 2IY9A 2ODAA 3TW4A 2B78A 1ZGBA 521PA 4KTVE 1FP4B 5CCEA 1YDEA 4UBOA 1UBGA 4X7BA 3W90A 1J8YF 1ZD4A 1E3SA 1S2LA 1L4FA 1P5FA 1SG6A 1WY7A 2BTOA 3BCRA 3LZ6A 4IJ6A 2VZ8A 4D3FA 4YHBA 1U81A 4Q39A 1RHUA 2X15A 1TF5A 1FZQA 4R05A 4U7JA 4G0OA 1KFEB 4B3JA 1GPJA 1UK7A 2BFNA 2QX6A 2QW1A 3BYZA 3KDPA 5JQGA 4EMUA 1MT0A 2QJRA 3Q3VA 5AM1A 4Z3KA 2V3WA 1GUAA 2FN9A 3SWWA 5HSGA 2FSHA 4RLFA 3D7KA 4IMPA 4OTZA 2G63A 4ZT6A 2WHQA 1AUVA 1P72A 2H4JA 3TLGB 5IBCA 2GM3A 4ARVA 1NXXA 1NKVA 2FR1A 2WHYA 4KWCA 2GHRA 2IYSA 3DBHA 1WVGA 1Y9JA 3R9XA 1TUEA 1Q7BA 1O6BA 1UPFA 3IERA 1U3WA 3FYHA 3HSYA 4RA9B 4CMCA 1ZGAA 2RD2A 1NW6A 5CIYA 3BG5A 3VUFA 4CBVA 1A7JA 4JLJA 5HIJA 2RC5A 1AMUA 5H4HA 1XBTA 3ST7A 5KTSA 1I51A 5IS2A 2LKDA 3SQMA 1LSJA 2YJZA 2V65A 2FWNA 2W98A 3C43A 3FNFA 1LS6A 2WHEA 3GFFA 3O31A 5B3KA 4NI5A 3D6UA 3VO9A 1KXJA 3ACBA 4HGPA 2XI4A 4X97A 1SXJC 3QU7A 2AJ8A 3V80A 5DULA 3UT6A 2O59A 1XJCA 2IXEA 3E1KA 2C00A 4RKYA 2PSSA 2PEYA 2IEIA 2YDXA 4HQKA 1O5IA 2BMVA 3PHJA 4MYTA 4Y6GB 2W71A 3DEJA 1B4DA 3WNDA 3LVFO 2I87A 3BZWA 5HVNA 1C8VB 2EZTA 3BTUA 4QU5A 2DBRA 4QYWA 3RC1A 4DB4A 4NBSA 4E5NA 2W6ZA 4MRVA 5JI3E 5KJFA 1MB4A 2OQRA 1WPGA 3PZBA 3ZXUB 4R8RA 4RHCA 1KI6B 1S2IA 4J6EA 5F7XA 3CNQS 4KN6A 5HIAA 5COBA 1RBMA 1N33B 3P5SA 4NOKA 1Q16A 1Z56C 3I23A 4L6CA 5EWJA 4BEJA 1E1QD 3UA3A 4R3WA 2L82A 1MA3A 3K8OE 1K9VF 2F3UA 1KL7A 3LUPA 4N3GA 5FUXA 1QH9A 3K6KA 2UVDA 3QLVA 2GSDA 4IYRA 4RA6B 1XCGB 4Z0NA 1E5DA 1E3WA 1M0WA 3QEOA 2M6LA 2WV7A 5EXPA 3ZJ4A 5KHOC 3T9DA 4QM7A 1TGVA 2IY7A 3P94A 4TTIA 4F2PA 3AEXA 2P62A 5DLYA 3JASB 2P3LA 4BNJA 1KBOA 4FR2A 4IAOA 1GPWB 2X0JA 2UUAB 1OBHA 4MV3A 4PRLA 5AKEA 2VNIA 2XDYA 4QDXA 4FHCA 4YP0A 1RKBA 3ZU5A 4CHTA 2RGRA 4KYUA 1CJKC 3LE8A 4IP0A 2ZWPA 4F12A 5E2AA 4WOKA 1XA3A 4UVDA 1V8FA 2WUEA 3CX4A 4AZTA 2ZP1A 2WJVA 5EZQA 4OMUA 4JKIA 5ICEA 2CV1A 2CMGA 3G9ZA 3QXJA 2O2IA 3WGQA 3RRNA 2HA3A 3SZOA 3EZ2A 4XVQA 2PTGA 2O0MA 2C03A 4WXEA 4AS1A 4FYWA 1FQKA 2H4WA 3VZRA 1SIUA 4LYEA 4MVJH 3W4KA 1PTKA 2B34A 1XDDA 4KXYA 4MA0A 5ILGA 1MDFA 4KR2A 1RZVA 4BKUA 1U7PA 4G5YA 2VOJA 4UW9A 3SLKA 5CDHA 1FX0A 4JC0A 5L4SA 1STOA 3AERB 3AO0B 3SEQA 4RK4A 2GCOA 5T5QA 2JGNA 5K20A 2HA4A 1FXWA 1WPRA 2PXCA 1U5AA 2W0SA 4RU1A 5DEIA 2FZKA 3W6OA 2IXDA 1K8XB 1O1YA 3RRJA 3GNLA 4OOFA 1VKHA 2XT6A 3MTEA 2CVPA 3QVLA 3A6ZA 1IHUA 1ZD3A 4FHGA 4O8CA 3CVUA 1C9KA 2R6R1 1DQSA 4EYEA 4PC2A 5C8VA 2JFYA 4UUBA 1J97A 1FLDA 1DC8A 3LGAA 4BMPB 1Z0AA 4E7PA 4X20A 3RTCA 5KZMB 3SE0A 1JJBA 1R6UA 1PX0A 1S02A 2PT7A 3C6MA 3IJ5A 5A7FA 3R0XA 2UYCA 5DGIA 2WBLC 2PX8A 3O2JA 3ZZMA 2BZ0A 3ZHSA 3QEAZ 4DM3A 1J90A 1DBSA 3PP8A 4E46A 3OTOB 1BFKA 1PZFA 2D2XA 2ATEA 5EPUA 3EGIA 5I51A 2IS6A 1NKTA 1T1RA 4MROA 1ZRSA 5BRNA 5TR9A 3EGXA 2ADMA 3DOJA 3ZJ5A 1FNDA 2B21A 3CWQA 4CHGA 4CN8A 3D8UA 4PR0A 4DSZA 3CVXA 3WXBA 1SHUX 2PYIA 1H2YA 4X1KB 4MJ3A 4YO8A 1IN7A 1B3RA 4OJQA 4I19A 2FPUA 3E15A 3KD3A 3HSSA 1OC4A 1U8UA 2FUKA 1PCXA 1TQ4A 1GADO 1OXXK 4FFBB 3RFFA 3T61A 3TQHA 1TQ8A 4RK1A 5ERYA 3U26A 4F38A 5DBFA 3U0BA 2YV4A 1JAYA 3EWAA 3I6ZA 2F1OA 1FOEB 4LYGA 1Q92A 3R8FA 1KKLA 1FSGA 1HKHA 1XWFA 4EUKA 1PT8A 3CEHA 2C4UA 4HI0E 3UOAB 5BR1A 5K6AC 1TO1E 3KD2A 2AWOA 4OY3A 3G2MA 5JD6A 4P82A 1DDGA 2H1IA 4I4IA 4LECA 2R4UA 3Q3JB 4CKBB 2GTIA 4PG5A 3TAUA 3QPWA 4TV8B 1NQTA 1Y1TA 2NV2B 5TQ2B 4HVAA 1S9HA 3DGFC 1ZBDA 4QYXA 1HQDA 4QDKA 2ZRIA 4ENRA 4OQYA 3QP9A 1NR7A 3AHEA 2Q5EA 1JWAB 1XZFA 2E48A 3V2HA 1HDYA 1OVMA 4N9QA 3QOWA 2ZRLA 4S0ZA 3CW9A 3R3VA 4CTJA 1WX1A 2Q5OA 3GJZA 3ZD8A 5EHZA 3MJRA 3FPEA 2NQ8A 4MGZR 1ODJA 2KI5A 4ZARA 4CV1A 1RD4A 2P75A 2Z3ZA 2OM2A 3BKXA 1FFXA 1WR8A 2R1VB 3WBKA 5SY9A 3ZNQA 2VZLA 3WFZA 4BNDA 4DREA 2Q3MA 3B2NA 4CYMA 1K6JA 3CZPA 2BFPA 4YCDA 5A0VA 2XUAA 2CWWA 2ZB2A 4H7PA 4QLOA 1QMPA 2I78A 5BV8A 3I4FA 1P5ZB 4Q7LA 2IIPA 4BFUA 2ZM6B 1NVFA 3L7CA 3QKUA 3ZIAD 1N2OA 4PZ0A 3ZG6A 3GK3A 2BE9A 2ZE7A 4L27A 2DBVO 2AJBA 2QTMA 2KM1A 2VIIA 5LKRA 3SR0A 2OD7A 1O2DA 2X22A 5CAEB 4YDSA 1Y1QA 4HS4A 1FMJA 1ULUA 4TVOA 4FFSA 1P1CA 5DSTA 5J1TB 4EA7A 2TMDA 3KJFA 1YBAA 4ENSA 3SICE 4AAYA 1AUOA 2ZXUA 4PNHA 2ZAOA 2ZVQX 1RKQA 4QICA 4YXFA 3PGJA 5T3YA 2QRMA 1Z34A 4RE6A 1Y6JA 2LIVA 3UJDA 1ZN7A 1WXWA 4IZOA 5KQRA 1B6GA 2IIBA 4YUXA 2EHDA 2WILA 3C1UA 4L9WA 1EJ6A 3HZOA 1DAGA 3TIFA 2FPGB 3HEMA 3UFBA 1MJNA 5C34B 2ZPUA 3WYGA 4DNQA 4PFKA 1HT2E 2NVUA 3A9TA 3FVTA 3I01A 3CRW1 1CNEA 3JQDA 4JODA 4MEBA 4XWGA 2H59A 2XB4A 3HKEB 4BTLA 2NO6A 2H85A 4B9AA 1JSLA 1JVSA 3DE4X 4W6QA 3V6LA 3DONA 4KO3S 5K6AA 3MTBA 4ZI7B 1ZL0A 3BWXA 3KBBA 1RKVA 3CVYA 3Q72A 1E63A 4PXYA 4B76A 3S2UA 4AMBA 4R9RA 1K98A 2GO1A 3ZY5A 2NV6A 3JQBC 2PWAA 3INGA 2RH9B 1ULBA 1K2WA 3F3SA 3AYZB 3OTGA 1P7CA 1QONA 4JS0A 4MAFA 4PF1A 2LDBA 4UJ3A 4EPRA 5AJUA 3ED5A 3RVJA 1QRTA 3BWMA 3FPSA 4O2BF 3TSZA 4B45A 2DUWA 3DKRA 2PS0A 1EHYA 1SY7A 1T10A 1ZMBA 4O29A 4P32A 3KFVA 3PQ2A 3RS5A 1TDJA 4LBYA 2C4VA 2B7CA 1ZMXA 4GKJB 3KVVA 2FF7A 4DY4A 4Y8VA 1GHTA 2AC4A 1OFIA 1S5PA 5F77A 3WYCA 1SCAA 4RENA 3ETCA 1M3SA 1X74A 2F3RA 3BL5A 2GD0A 2ZUUA 3I53A 1EB8A 1T4MA 3PD7A 4M0MA 4ZVQA 1M0EA 2IBTA 3WBFA 3ABOB 4ZI5A 1GPH1 1R88A 5CA0B 5JH7A 1Q77A 3HB1A 5ALLA 2XKAA 2XMDA 3HL4A 2BGNA 3UW3A 2PZBA 4WZ6A 5PGMA 4HFMA 4WT7A 2ZSEA 1XZLA 3BC1A 1JR4A 3JRWA 5JE8A 3KQUA 2GM5A 1CYDA 2FFQA 3GVPA 3ZUPA 1UM9B 1GFIA 2CLSA 2IOFK 3UNXA 3VNBA 4AJLA 4CF4A 3DAOA 2YWXA 4KQ6A 2XKKA 1H6DA 2LTAA 3ZVNA 5ARBA 4J0QA 2EZUA 1YR8A 4IS3A 5LXTA 2JAPA 1KZ6A 3HA7A 5TMDA 1GNQA 4YJ2F 1T6YA 2A9PA 3I9NA 3UQYS 5KKAA 1NFFA 1H5UA 3EIHA 2WNIA 4QYIA 5J2TF 4D9KA 4PLZA 2ZBPA 2AD1A 2JDIA 4QO8A 2HLPA 4B71A 2AOVA 3H05A 3R75A 1TYBE 4FC7A 2QPAA 1YIDA 4J7XA 4L5AA 4G0MA 2V7TA 2GJ9A 1P44A 4A82A 4PN7A 2EYUA 2VHCA 2EGUA 1QF6A 4GRDA 4R69A 1EESA 3DB2A 2OCAA 4NSNA 4C4SA 1E8NA 4GIBA 3MERA 1RRGA 3M9LA 4RVOA 2IWRA 3JX9A 1Z15A 3S4YA 4ZTZB 1SCQA 4DRXB 3M89A 2WSIA 2R8RA 1ESCA 3GJ0A 1H8HD 5C46F 2RH5A 1UBUS 3EXFB 1EVZA 2VNKA 4I9FA 1HA3A 2YFKA 5FBKA 3THYA 2HEGA 3DL2A 4JI4B 5K6RA 1W76A 1TE2A 2P27A 2CGEA 3PNYA 1DJLA 2B30A 2JI8A 1G21B 5FO0A 3TWOA 3B6EA 3K9QO 3C70A 1LF0A 1CP3A 2VRCA 5ALPA 2ZQYA 1EWTA 3RVLA 3W2HA 4O4IF 3SYLA 1FMFA 1CUZA 3OCWA 3VZDA 1DJQA 2W2LD 4H59A 1U0GA 7REQB 3JQBA 1QK4A 2BV3A 3H0KA 4NMLA 2CEKA 2GCGA 2CLOB 4EG4A 1H2HA 1OKKA 4PSCA 5JPCA 2ENWA 3MS4A 3PC3A 4P3OA 2I2FA 4LQCA 3ADDA 2DFKB 3HYNA 6Q21A 3EDRA 3L04A 4UNSA 4EYOA 1EX1A 1OIXA 2IT1A 4JSRA 2FQXA 1OX4B 2WFAA 3O84A 1QC5B 1I4LD 3NB0A 4OUKX 5I7AA 3UMBA 5C5IA 5IJ0A 3EPLA 4XTRA 3B1WA 5KVCA 4RPIA 4YRAA 3AM3A 3QUSA 4HXYA 4LDPA 1Q19A 2ZJ4A 3G0CA 3WWDA 2ZIZA 2OV2A 2E4ZA 1KQPA 1E0JA 2ZTVA 3PI6A 1Y4AE 4KSYA 5JMWA 2VP6A 5E6UA 3D6TB 2XDWA 4KGDA 2XF2A 2GARA 3NT4A 4RHYA 1ZI6A 3GLTA 3R3UA 1HEIA 2WG1A 3Q87B 2Q28A 3SQOA 3A4IA 2DHQA 1ENPA 3P27A 3HKCB 4OCZA 2GS9A 2VJBA 1TKAA 3ZVRA 3C16C 3NRBA 4JNCA 4O1MA 2A35A 3ZDRA 3ZLVA 3DHNA 4ND6A 1E2KA 4QIHA 1ZCJA 4REQB 1UAYA 1UP6A 4ZANA 4V1CB 1XD8A 4EENA 3Q0IA 4Q4AB 2XGSA 1U1GA 4XR9A 5SV2A 4S1TA 1X3LA 2WSLA 1NBEA 3MTJA 4CKYA 1M2WA 1WMEA 1PJ8A 2R6HA 4FKBA 5CVUA 3T5BA 2OMEA 1CUXA 1ZVKA 4XD7D 3U9TA 3UO8B 4BNVA 1TMKA 3MLAA 1B8NA 1OJLA 1Q3TA 1T8SA 3GR6A 1Y37A 3I6IA 3M6MD 2YTZA 5E1OA 1W47A 4KPUB 2UU9B 2XYPA 4J7CA 1DC6A 1PZXA 4YRLA 3IBYA 1KY5A 3LFUA 2AG1A 3NO4A 1QTRA 2R751 2OCXA 3IUBA 3NYQA 2AMLA 4HRAA 2JLBA 5CYOA 4Y0VA 3WYBA 5I01A 1FSSA 1SQ6A 2FN7A 4NEHB 4UVHA 4NJEA 2MJLA 3QWIA 4O5AA 1LDYA 2VEOA 5T4EA 2UZAA 3X1XA 3FETA 1LPMA 1QHXA 4BMDA 2B5OA 2H9AA 2QZ4A 4KX3A 3RKSA 1MVOA 3ZYZA 2HGSA 2FG5A 2M2IA 2J3DA 1PQWA 3QGMA 5HQ3A 2IZ5A 4DR2B 2HCTA 2DUNA 4G9EA 2HQOA 2JVIA 3D4OA 4ZT3A 3VO1A 5E6SB 3O1IC 3WWCA 4AQDA 1P2TA 4G9GA 2IV2X 4CLHA 4F8YA 1B93A 2ID4A 1KS2A 4D81A 4EJSA 4EO9A 5LQUA 1U3TA 4C6SA 1JHRA 4XJXA 4GZ3A 4KAFA 3AXTA 3R09A 3HLTA 4PTZA 4UQPA 1P1HA 1UXJA 1XEXA 4MEAA 4LDRA 2NU7B 3OP4A 3F96A 3PBKA 4MKFA 3WKEA 4U2BA 3F0TA 4RIIA 4ZVOA 4AL4A 5JNWA 3QUCA 4JXXA 1C1XA 3R3WA 3Q40A 5K3BA 3G9QA 5DXJA 1NRXA 4QU9A 3C3JA 3SXPA 1XYYA 2QR5A 2V0NA 3K2IA 4ETIA 3VYUB 1PWHA 3FZQA 4QXRA 3EC1A 3TJMA 4LRQA 5CB4F 1E96A 3HI6A 1BH2A 5HUJA 3R3ZA 4TUYF 2Z2XA 2HLNA 3LUBA 2SECE 2GLUA 4IZHA 2HY7A 4AWXA 4TMKA 4DANA 5LP6B 2WTMA 5DNCA 5BW6B 2CMHA 3F3MA 3ENZA 4BO0A 3DZHA 3EQ2A 3LQ1A 3O4VA 1M1XB 1U3CA 4IKOA 2G5PA 4MRMA 4BMCA 3PGLA 3KETA 5I7OA 1II9A 1X1BA 2CL6X 5ALDA 3OCCA 3WKBA 4U4AA 3C8ZA 1SU6A 5ANRB 5EHQA 4CKEA 1JGTA 1TYZA 4NJMB 1CJTC 5F1OA 3LS2A 1JR3D 2WJPA 1OH8A 4TWJA 1KI2A 1AKTA 1UPAA 1EE1A 2BEVB 3QFSA 3GRRA 3IUJA 3BM5A 2GKSA 1ZNWA 4I5FA 4J8PA 4MUFA 4DCCA 1DRUA 2CE2X 3QOXA 2CD7A 1UANA 3L7LA 2GI4A 3U3RA 3P2MA 4U6NA 5KJ1A 4FFRA 2VHJA 5L3QA 5BR7A 1Z5ZA 2VTKA 4IIJB 1DDOA 4OMCA 5CP8A 1TVCA 4LI0A 1QYCA 4MW4A 1JLKA 1KK3A 2C5HA 3LT0A 3QFTA 4MW7A 1NMZA 2H51A 3B9QA 1DBIA 4BQEA 4L73A 4LZWA 4BFCA 2EWVA 1BQ3A 3FFBA 4DMHA 4IMJB 3F2VA 3OE7A 5TMPA 4CIWA 1YZGA 1D4ZA 1A2QA 2WC1A 3EQ6A 4JCCA 4LGMA 1KGDA 4WN9A 4EY7A 2WNSA 4AU1A 2FPPA 5LB4A 2KBEA 5JD3A 1QFMA 1AMNA 1ZI9A 1U3UA 3I2KA 4LHZA 4XEHA 1WHSA 4J07A 3VSCA 1DINA 3WYEA 1Z25A 2BUAA 4UU8A 1TCAA 2JGEA 3MSXA 2EP7A 3F8SA 4ZO7A 1SVNA 5C8YB 1G6KA 3QQPA 5A4FS 5AHXA 1EFLA 1JEAA 1Y80A 2XXJA 3GDWA 2UVPA 3LLCA 3GAAA 1DIRA 1J8QA 1ZUD1 3LA6A 4Z4CA 4FNOA 1JKJB 4CM4B 2GPAA 2V5VA 5EJ7A 2C2MA 4G97A 3PLRA 1A9XA 4TZ0A 3MCAA 1NSYA 1ZGZA 2Z5VA 1DX4A 4NCIA 3PVZA 1TX4B 4EEZA 2R3SA 3OE1A 2QJWA 3HK2A 2ASVA 3FDZA 5JS6A 2O2HA 4OAQA 4RXMA 4O1IA 1U8TA 2ZRMA 3GJXC 1PFWA 4LC9A 1XTSA 4XQEA 3IAS1 2QMZA 3TG8A 2FEKA 5LQJA 5EHXA 4DV1B 3QH4A 2QLJA 3U40A 1IN5A 3CF4G 4DVGA 1WEKA 1ZMOA 1X9GA 3GG9A 4OXIA 3FSGD 4JUFA 4QGFA 4Q4JB 4DC1A 2CDBA 2BFAA 1YSCA 1QWOA 3E48A 3LBAA 4LGCA 1YR7A 3W7BA 2W11A 3EBLA 2O8FA 2SKDA 4AFNA 1EUZA 3CKMA 2D1SA 3N2KB 4RX1A 3GMDA 1W5TA 1XNRB 2C2YA 2PGIA 1OA0A 2Z2YA 3CM0A 1HE5A 2X3UA 3R1IA 1GTG1 1WD7A 4C3OB 4OGFA 3BWBA 5HM8A 1JDZA 2O3TA 1SA0B 2V8BA 3QW2A 2DKOA 3E22B 3A3OA 3VOTA 3K6RA 3IAEA 2B4AA 3DXFA 4XFKA 4F45A 1LF5A 5JEEA 1WPXA 3UKOA 2I6XA 2GM9A 3AV3A 1LDNA 2WYIA 4BFTA 5AT1A 4N8EA 2FEPA 3ZV7A 2W8BB 1A2KC 3P9QA 3X1YA 1ULZA 1DPFA 3EAGA 5I7SA 3ABZA 4CXMA 1XU9A 4U5QA 4YP7A 2FEMA 1DTSA 3LTEA 4UHDA 2YWEA 4KPYA 1I4TD 1LRJA 1N5MA 1H1TA 3D5TA 3GFVA 3MRSA 1HNWB 4CW7A 3KJIA 4GPIB 1SQ0A 4C5BA 4UFOA 3JQQA 1SD2A 2WYUA 5D5HA 1KZHA 1ZR4A 2QAIA 4MQEB 3RIYA 1N2SA 3JU3A 1G17A 2WTUA 3H1TA 2BCEA 3JQ7A 1W4CA 1FMCA 3DHYA 4WKBA 3IVRA 2P0AA 3ZV6A 4POAA 3Q15C 2J0QA 1XLTC 1NR1A 3CT6A 3KJHA 5GOTA 1YKSA 1O9GA 1KI3A 4DKJA 4BZZA 1IY1A 5ER9A 3J81k 1SHLA 4FMCF 5KO2A 3NVMB 4PYMA 3IBGA 3T4PA 1OVGA 4DV6B 5JJIA 3GPBA 2JZOA 4X62B 1HF3A 2BDEA 2QMQA 4UDNA 3LVQE 3VU9B 2D1TA 2H48A 3R8CA 4IDGA 2BGJA 4O2BA 5KQPA 2YJTD 1WCYA 4WZAA 4HDSB 4YY3B 1I6LA 4QTUB 5IBRA 1RXUA 3K0BA 4XIFA 3W8FA 2UZ1B 2VXCA 5TX7A 1LI7A 1Y48E 3GGSA 2ZLBA 2HBRA 4MRRA 1HQCA 1CF2O 2I03A 2JA2A 5FOQA 1QH1A 1ECGA 3KCQA 1BMFA 2PD3A 3DAHA 3NGMA 3RDPA 3WSTA 1RYBA 2PFSA 1OAKA 2MSDB 2H5EA 1L0BA 1ZU4A 1QAQA 3HGMA 3HABA 4QGBA 1AHHA 1TXGA 1W6UA 1Q0LA 1DWOA 4IVPA 4JBHA 4KFUA 3SI7A 7ADHA 2XMPA 2JARA 2XXAB 3AJDA 1AF7A 1LFDB 3G82C 7MHTA 4G0PA 1DG3A 2D13A 4ZYVA 4YVFA 5DM0A 5LPNA 4C4TA 3AF3A 3E35A 1JDJA 2FPRA 3HR8A 3NEAA 4AD8A 4P92A 4YGYA 2D1YA 2K2QB 3E9CA 1NW9B 3DEZA 1J0CA 5FWYB 1MZVA 4HQNA 2MDTA 3RH0A 1AHNA 1IZ9A 4GLBA 1FLAA 1YDGA 5JDIC 1R10A 2V0GA 1EWQA 4Y18A 3ZTYA 1XZGA 1CY0A 4COKA 3TTXA 5I48A 4YJ2A 3OJFA 2GGSA 5BT9A 1OI7A 2J9ZB 5J2TA 3T1NA 1CUFA 3ZVLA 1M76A 3L06A 4H60A 3RS8A 3QHAA 4IDOA 1E64A 2PX0A 3VR4H 1VHLA 2VWQA 3WL5A 4LVCA 1Q57A 2OLEA 2GNOA 3LCVB 4U9HS 2BDUA 3RF6A 4CLDA 3QE9Y 3N76A 2TMGA 2QDXA 3LQFA 5KYWB 5A2GA 5IXJA 1UINA 3L8GA 3KKLA 1B8VA 4M8NE 4BP3A 3L0OA 4I8DA 5I8PA 5E4YA 3C15C 4G5XA 4GUAA 1KYXA 1ONBA 4NABA 3W6UA 5FOVA 1RWVA 2R7NA 3DTTA 4P98A 5FLEX 1GTMA 3L8FA 2NPIA 3N6XA 2DLDA 5KU1A 2UUCB 4G8CA 3HVRA 4ZI3A 2JZCA 3ROZA 2TYSB 3AFNA 2A0KA 5FULA 1X6VA 2VL7A 4OUDA 4O4IA 5K7SA 2ZIAA 1XLTA 1FVFA 4K88A 4KQEA 2DLCX 1DXYA 3KKMA 4YYEA 5JNVA 4D4GA 3ASUA 1EFPA 5A7GA 4C3VA 3T7DA 1GT6A 1Q3HA 4QXQA 5A04A 4O8ZA 4XX1A 3R5JA 5IKXA 3B5IA 4MA5A 1R4NA 4L3OA 2COUA 4L08A 3NTQA 3C1AA 3QUAA 1FCJA 3W77A 4YMLA 2ZYSA 1F4PA 1VBFA 3KJXA 3HPRA 3UJPA 2R7MA 4B09A 2EHJA 2W00A 2ERYA 4OFWA 9MHTA 2IYXA 2Q1YA 5D3KA 3GEDA 5D86A 5BUZA 3M49A 2D0OB 2J09A 3G2KA 1TJ4A 1VMAA 4KIJA 4RYLA 3E82A 1N2GA 4IKEA 3HB7A 2I7TA 1KVTA 1R12A 3IKLA 4RVUA 4LV8B 3T7JA 1ZH8A 3AVPA 4IH9A 3NM4A 2VSXA 2ZROA 3UMJA 3V5NA 1N7IA 2DT8A 3KJNA 5HILA 4JJFA 3AHGA 1C1DA 3FDIA 5EWJB 1EGHA 3Q4GA 3ZBTA 3G8AA 4GP6A 4AN4A 5BUQA 3KQOA 4Z0PA 4V3BA 4ZHQA 2XIQA 5JDIA 1WTAA 2JGMA 3AFHA 4FIDA 5LZ7A 1CDZA 1E3WB 4D43A 1OU4A 5BW4A 5HK9A 1Y89A 2UYOA 4BMZA 1GLVA 2JK1A 4WNYA 3RLFA 1TTPB 5AW8A 1N2CA 4WDQA 2OCBA 2ZWVA 1XZMA 2I3DA 4E2WA 2Y67A 4WXMA 3O1JC 1L7EA 3AONB 4LHWA 3L6CA 5DNWA 3AVUA 1M6EX 1SRQA 1TT5B 1T0HB 2PPVA 1USGA 4RK5A 1IB6A 4WERA 1QFYA 2BGTA 2F4NA 2PBLA 4ZU6X 1K7EB 2G17A 3ZE1B 1V6CA 4DV4B 5AO9A 4IW3B 4N82A 1G6Q1 2AR9A 4ZU3A 2GPSA 2JIBA 3I01M 3MJEA 5F4BA 1C8KA 5CLLA 2HTFA 4PV7A 3S6JA 3BK1A 1EFVA 3LXRA 1JJAA 2CSXA 4R7TA 1H9BA 1HFKA 2HUPA 3JYPA 2EFYA 3HBLA 4FNGA 4WBXC 3BDAA 3V1TC 2E55A 2IHVA 1XCMA 3KLOA 2X41A 3LDUA 4B47A 4Y9SA 1QUFA 2HC9A 3VR2D 1CC1S 2ZTLA 4H3HB 1GRNA 3R9XB 1BN6A 3JW8A 3HJAA 1G60A 3A9WA 3LKBA 4YQFA 3G2QA 4EO7A 2QN3A 3PFKA 5FBWB 5BWCA 2PSDA 2FPLA 1S3FA 1CZOA 4NICA 2ZUEA 2CY0A 3A4VA 2JFWA 2CHQA 4EVRA 1W9HA 1OXSC 3KQYA 1M66A 1BE1A 1PJ4A 1RQNA 2A6PA 3PGMA 4ISBA 2HDHA 4R8SA 4JUIA 2X0RA 2JGLA 2IDMA 2QL6A 5IM5A 2ZR9A 1TW3A 3OUTA 4MH0R 1YR2A 1BQ4A 3QWAA 4PZLA 2DUJA 5TMEA 3CUTA 4TRNA 2VQSA 1V1MB 4QYMA 1EEXB 1NP6A 4RFSA 5CB4A 1W5BA 3CKLA 4TUYA 3B89A 4TKUA 1SXJB 5HHTA 4DV0B 3ZHXA 4U2GA 2X2FA 3CE9A 3GT0A 2X0KA 1ISGA 4HUJA 2W6JA 1HYGA 4LJSA 5C52B 1VRVA 3EAQA 3JCZA 3FPGA 1P1KA 5IHXA 2B1JA 3S81A 4BNLA 3PZRA 1RC8A 2G9ZA 1PWYE 2VN8A 2JLCA 3G8CA 1PJ3A 3T6KA 4BXOA 1KNXA 1QHFA 3INYA 3KR2A 4PTLA 4IM7A 4ZD6A 2XVXA 1TYDE 2PV0A 2XT9A 1T8RA 3P2YA 3RHFA 3TL6A 3VU8A 4F8JA 3KEGA 4D9BA 4NMXB 3OCUA 3SSNA 4JJGA 5E4TA 3EGDB 3HP4A 4ZCPA 3NUQA 2I6UA 4CDRA 3UWDA 3JQCA 2AFVA 3VC2A 1JJ7A 4LS3A 4XUDA 1VLMA 1VPWA 1RU3A 2I8CA 2RAFA 1Y8QB 2ZVPX 3ORYA 5B7PA 4KMMA 2JLVA 3VR6A 1FS6A 3GH3A 1E1DA 3EBPA 3G9TA 4JP8A 3ZLBA 4YCNA 1E3TA 4RDXA 1GPNA 3IX7A 3R7WB 1SC1A 5F23A 3KQWA 5BMVF 2XGOA 1T1EA 5CIQA 3WIEA 3DT6A 2FWAA 2I3BA 2VPYA 3PHIA 2IY8A 4DBLC 4F2WA 1J9ZA 2P5YA 4B6EA 1OLUB 4S35A 5CK5A 5EIWA 1RE1A 2GBFA 2DQ4A 1CG6A 5AQEA 3NHMA 3LWDA 2QV7A 4CEHB 3MJTA 4R31A 4DUGA 1AGNA 3R9IA 3IIKA 1P5HA 1XOIA 2I1LA 2PL9A 1UFOA 3PDUA 4LXIA 3CNNA 4QASA 3JD2A 1Z6ZA 4GEGA 1XMIA 3LL4A 4IR7A 4AZSA 1MRSA 4OYYA 5FBQB 1NURA 3VJRA 3DEYX 2PR7A 3VI3B 3JWJA 4U39A 2DOKA 1P0IA 3A3YA 5EJEA 2H17A 1K97A 4WZBA 1AUXA 4JLWA 1S89A 1LQ2A 4X95A 2D4HA 4CTOA 1MXHA 2QL5A 4AY6A 2IHNA 3S8MA 1U4SA 2EW2A 2ZRCA 3BWVA 5KYUA 2J30A 3S2EA 2PS3A 3EUFA 3VHRA 5KTTA 2HU2A 3LECA 2P8JA 1G21E 3RK1A 3V9AA 4HGZA 3ZWMA 3OC0A 4G0WA 2EJCA 2VJPA 1ZK0A 2VUTA 3A6LA 3PRJA 1WIWA 4INOA 3V46A 1R0SA 2I6GA 3FWZA 4BNDB 2ONZA 4EFLA 4JX9A 2E6UX 3ZWXA 2WIKA 1EEHA 3AVQA 5JXJA 3OY2A 2D6FA 1KEPA 2RAPA 4XD2A 3DLAA 4EEXA 1EXDA 1I9CA 1RI4A 3ND6A 5GV8A 5A4MS 3ZY6A 3MD0A 3UKDA 3M2PA 3K1TA 4LF5B 3C4JA 2RGNC 4NE7A 4UQOA 2QQEA 4NC9A 5GTDA 2YMPA 1WABA 2WD8A 1V0JA 2RB4A 4G5RA 1ESDA 1LC0A 3MFYA 4OQZA 1VKOA 4MQLA 3A6GA 4GR4A 2AOXA 4IMRA 3HZHA 5D2CA 2VTBB 1B6SA 1OUMA 4MITA 1T25A 4YT8A 2REQA 4JLKA 3ZU3A 1GGNA 4U7GA 1KQGA 4Q3DA 4XCVA 3ESCA 4EHDA 1T2AA 4A6DA 4RTLA 4ND4A 2YFHA 3WDKA 2ZI4A 1TCCA 4DMMA 4IXNA 2VYQA 3ZE0B 4D9EA 5BN5A 3N8KA 2CV2A 2HRZA 1VGRA 3DMNA 2QE6A 4BO6A 3AJ8A 2RBGA 1RAIA 3F7OA 1U7ZA 3KL4A 1YZFA 4OL0A 1H2BA 4R41A 1IVYA 1I3NA 1I80A 3DAFA 3FPKA 5EQDA 2AJLI 3SX4A 2W0MA 4AG5A 5AVJA 4BX2A 1KK0A 4ZCTA 3ZZUA 4BASA 1JEYA 3TLCA 1Z4IA 2FSVA 2NVUB 4ON9A 3TLMA 4RPLA 1WZCA 1DUVG 3NASA 2NLOA 1KJ9A 4JOBA 2IHTA 1DB3A 4GG1A 1ZPDA 4RZSA 421PA 2HMUA 4KAJA 2O8BB 2CCJA 4IGIA 3J7AC 4JFAA 1N0WA 3OM9A 3GJSA 2BMFA 5KUTA 5A5FA 2YKGA 1H2XA 4MI1A 3M4XA 4Q3OA 1X7WA 2Q21A 2RGYA 1Y3IA 1NLUA 1Y6FA 1CK4A 5INTA 1VPLA 5PNTA 2W4QA 5I8ZA 5J59A 4KXFB 4FS8A 3RKUA 3CKYA 1JPVA 3LL7A 2DFVA 3WOHA 4K26A 4OHBA 3FZGA 2XAAA 4PNEA 3HXMA 1L8QA 1SCKA 5A5GA 2YW9A 2QT9A 4ND7A 2WPNA 2XNSA 4FU0A 4G67A 4R71A 2R8PA 5KWSA 4GDFA 4QBIA 3ZQ6A 3GLIA 1N92A 2UUOA 3CE6A 2ANBA 2GTPA 3TE6A 3FXAA 4J0JA 3RW9A 4YLYA 1K2VN 3LZCA 4IXWA 4EW1A 1YU9A 2MWMA 2WE8A 1W0JA 1M73E 1D09A 3FSRA 1WCXA 5AHWA 5EY5B 5TQJA 3T1OA 4JUDX 1XQ9A 1H5QA 5ALYA 2ZTSA 1E0SA 5EIOA 4JVOA 1PDOA 1ZITA 3IQEA 4KU4A 5BSKA 3UBMA 3CH7A 5FBZA 3H9QA 3LW7A 3OJOA 4JQYA 1IHOA 3QTTA 3QXHA 4A3SA 2GXQA 2RGNA 4ZA2A 5HGXA 2GLXA 2E18A 4FE7A 3DDNA 4MJXA 3EWNA 5DPMA 2RHWA 3UC5A 2DUMA 3T9FA 3AB8A 1RRPA 5EJMA 1EJBA 3AF5A 4RJ2A 1P3DA 2QL7A 4MYDA 1KYQA 2IXTA 4GO1A 2JIOA 4PLVA 5GPBA 1XAGA 5CXUA 3E84A 3HBMA 4FGZA 4QYIB 4C4PA 2FYTA 2JGJA 1N6NA 1OBOA 2WMNB 3SD7A 4DZTA 4ZO9A 3ZS9A 4DWWA 1BTOA 2HLHA 2VHXA 3OJCA 3P2EA 1XFAA 1LNZA 1SUSA 2CLHB 3QE4A 3U7EB 4MYSA 4BLQA 4F85A 5JHHB 4O2RA 1W48A 4ITRC 3MMXA 4E1BA 3AL0C 2A5YB 4MS4B 1ISPA 1SKAA 2Q3HA 1LVHA 3AX6A 4PHCA 2Q3FA 2D62A 1KXZA 1FFHA 4C7BA 4E70A 1D03A 4KDFA 4EF4A 1CFJA 1A4IA 3BQNB 5REQB 3RSLA 3TSAA 1CW2B 3HJFA 2V3VA 3TQIA 1D4AA 1WCIA 4UNRA 3GQVA 3HU1A 3JPYA 2GR9A 2H54A 3EH1A 3JQ8A 4OHXA 4RCVA 1PG0A 4V03A 2VPPA 3F73A 2C3MA 3SBXA 3E81A 3OKFA 1U90A 2X4LA 5H3CA 3HKDB 4QQFA 4HNVA 3C48A 4DGSA 3F78A 1O5TA 5I7HA 4UMEA 2NU8A 2J3KA 4CDNA 5EIBC 4GS5A 3I0MA 1KEEB 5JFGA 2EG5A 4QG3A 4II3A 5NLLA 3Q1KA 2VSFA 3WQHA 3N8GA 4REMA 1L1RA 1VBMA 2IYVA 4FQ5A 5AM5A 2XHZA 4NOJA 4GOLD 4YRZA 5CYPA 3ETGA 1Q22A 3PITA 1GKUB 4H4CA 4OH7A 4WINA 2OGZA 4Q4HB 2GASA 1HE1C 1ZESA 1XPJA 4W63A 2NU6A 4NAUA 3HU5A 1V3VA 2QZZA 1DAIA 1C4WA 2PDAA 5IJ0B 5K8UA 2Y1OA 4DB2A 3NIBA 1QO7A 1YE3A 5U1PA 2PUVA 4ZVPA 2VWPA 5KAMA 3N7UA 5J4VA 4YRRA 2XXBA 3EF0A 4NMHA 1O5OA 2JIDA 2XCUA 3OU2A 3SX0A 2NOAA 1XCJA 2CKMA 2VHTA 4I1OA 3T7EA 4CL3A 4WOPA 3QX9A 3AR9A 4JBYA 4MV0A 5DLEA 2FDCA 3AEUB 3RUIA 1X77A 5A6SA 2IOFA 1J2EA 3TM4A 1H42A 4OQLA 5EMMA 3V4SA 5AW7A 1I2AA 3NAMA 4KN8A 5JV5A 4I14A 2WMDA 2R11A 1E9RA 2PO7A 4JGBA 3L49A 4KIUA 1IC6A 3H8JA 4URFA 4AF6A 5LYJF 1ZLXA 2YWDA 4CM8A 1MQAA 3TK1A 4ZIRA 1HFWA 4KEAA 4NEGA 7AT1A 4LFAB 4Q9KA 4JOCA 5T8KC 3WOVA 3WX0A 4U3JB 5D3ZA 1KAGA 3S99A 4W5TA 5CVJA 1FRZA 3RS2A 1KARA 4XVCA 2ZSFA 2ZTMA 5DOVA 1SH7A 3KS9A 4D74A 2K2WA 5LOVB 3RODA 3UMVA 5HFAA 5FNVF 4FDVA 4GD3Q 1XR3A 1U63A 1RIIA 4NZNA 4BKMA 3WQRA 3PQ3A 1R4ZA 1VP9A 3B6JA 2G28A 3LG2A 3V2IA 3R4VA 1SZDA 3H87A 3OJ0A 5EJ6A 1S4MA 2HBYA 2X7HA 4NJEB 1KH2A 3QF4B 4RTOA 3ER8A 3FHOA 1USUA 1BEZA 2PQMA 3K5PA 4FJ1A 4KE8A 4B83A 2R0QC 4XGKA 1UOEA 3HVIA 1USIA 4MGKR 1OILA 3DR5A 1OX5A 3GLRA 2IVFA 5JS8A 1V45E 2IOHA 4XM2A 2VHUA 5AVRA 1PYDA 1YVEI 4QOGA 4DYDA 4EJMA 3H9UA 5ICCA 2YOFA 2A9KA 4TWAA 2OORC 5HZGA 3N39C 1O95C 4N4AA 1KEWA 1U8YA 3QTLA 2FDRA 2GXAA 5K2MA 3GJ5A 1XEXB 2JF0A 5DT2A 1SXJD 3MWEB 4PGMA 5IN5A 4DTIA 1C30B 2FJPA 2ORED 2WAXA 3B9PA 5JW6A 5FOWA 4MUEA 4PGFA 3SG0A 4ZI2A 3LGSA 1TFRA 3IAFA 3L92A 2X8WA 2EEPA 2VUHB 2O5EA 3KYCA 4B3HA 5LZ5A 4F2DA 2XMRA 4DHWA 3HKBA 3GIDA 3QYAA 2F7SA 3OCVA 3C6XA 3KOZA 4MMYB 1TF7A 4G5FA 2GF2A 3FSJX 4QEKA 2FN8A 2VAVA 1MG5A 5IWAB 1QE0A 1YOVB 2AZTA 4PZZA 4E94A 4RIGA 3IOBA 1FFCA 1FYXA 1U9IC 1RAHA 4LUCA 4NRDA 3C39A 3IQHX 1OT3A 3IUPA 3K9BA 2P1ZA 1UOQA 1V5WA 2PGLA 3IOMA 2YCBA 2JCXA 3H18A 3U1BA 1PVOA 1EWVA 2HEIA 1EFCA 4KO2S 1GTJ1 5I4CA 5KYYB 2C5FA 3FCEA 4CKEB 3AEZA 3QVOA 4I3HA 5CH8A 3WLEA 2PKQP 5CX1A 1WBBA 1I3KA 1QHGA 3D7RA 1A8PA 3CLSC 3JQFC 3FRJA 1DHRA 5CA1B 4LYDA 2J9GA 3D3NA 1U2SA 4I9UA 2Y8EA 3U62A 4FSDA 3MCWA 5E2IA 5T8KA 4DUPA 3B13B 3IKMB 1T9HA 3I39X 5I9IA 2A1IA 1NJ8A 2FFJA 3R6TA 4W99A 5BMVA 1G59A 3GCZA 2NO1A 2PRSA 1YMVA 4LNUA 4KACA 4ZAFA 1P6QA 4F93B 2QBYA 2P67A 3U4DA 2A8YA 3R76A 4MUYA 3C6ZA 3MAJA 4WLFA 4RPHA 3HY4A 1JAIA 1BJRE 1JKFA 3NYRA 4OJTA 3SSAA 3L8MA 3OQMA 1VP3A 1NW5A 3PQ4A 2Q5QA 2QQFA 4GZ6A 4DABA 3MLEA 5C81A 4TTQA 5IANA 1YA8A 2Z8XA 4MW9A 3PQFA 4HS9A 3DQZA 4YRJA 3EIWA 4I1SA 4R8KA 2RHMA 3QU5A 1C3LA 4LFCB 4DADA 4YCMA 4B1FA 2IFTA 1CVLA 4AG6A 2C9BA 3WLNA 3FNEA 3OMXA 4OHCA 2BM1A 3H5IA 1G2IA 2FPPB 2Q49A 1MP0A 3ZOZA 1KGSA 4F3YA 1FTWA 1ZA1A 4ZK2A 1YFJA 1O95A 3LFTA 2BISA 5F51A 2QMHA 3HQ4O 4LK3A 3SHWA 3TE7A 3EN0A 1VRWA 4AKHA 4I55F 2ZJ2A 1DT5A 2YFYA 4QELA 2BM8A 2W43A 4RE5A 3RNLA 3BILA 4PSVA 1DWQA 4ZT5A 4YWJA 2FVXA 4UCFA 3RT7A 5B4VA 1RWXA 2VQ6A 3DAYA 5AKGA 3UMSA 3ZHYA 3M6VA 4NZMA 1JH9A 5CITA 1UKCA 2Z8ZA 3OMWA 5DFAA 2ZSBA 4ZICA 3VR5D 5EZ6B 4M22A 2TECE 1X1AA 5IYZB 2CB0A 2FCRA 2IL1A 4GQBA 4MR9A 1E60A 1OW3B 2Q2QA 1OV6A 1ESNA 3IQIX 3BTVA 3Q7PA 5BW5A 2YHUA 4K9KA 3KSMA 1RQXA 1U9IA 4RABA 1H8EA 1HY3A 3WWZA 3ACCA 5DCLA 1QVZA 4E88A 3IRUA 3U3KA 4QKQA 4ZGGA 3AHCA 3PRHA 1ZCFA 1MORA 4DCSA 4ETWA 4FOSA 4PC3A 5DNEA 4G0VA 2O8FB 2OZEA 1NMQA 3C3EA 1PVVA 1MOPA 2Z0MA 2ZS8A 1GSAA 2J9YB 1USWA 3GZJA 3HGTA 4GSLA 5U4QA 1U0TA 1FDWA 3PSHA 2W8ZA 1TMYA 3BDIA 1V95A 2L0XA 5CH5A 5C7OO 2YZNA 2FQYA 2B0CA 1WZUA 3F6SA 4HGYA 2X42A 5KX5B 1HX7A 4CG0A 5EZSA 1RXYA 4G07A 3VSAA 2XTJA 3ODGA 3SNHA 1CVRA 2H0AA 3CX8A 2FV8A 1D2GA 3FM9A 2VQ3A 1OIWA 4KVFA 5CCBA 3LHFA 3BD7A 3OE4A 5SYAA 3O3NB 4CIYA 1DAOA 2FGJA 3F2IA 3FUCA 3TSWA 1JKMA 3N8DA 1MX1A 1YR3A 3WNCA 4DMKA 3GN1A 4M21A 3SIRA 1K27A 2G5TA 3LAWA 3EIFA 1EZ4A 1PUJA 4H0FA 4LOLA 4BMYA 1BS2A 1TQ6A 1QP0A 1Z17A 2FZCA 4FMPA 1MC8A 2HA5A 1EIWA 2P41A 2R60A 4W9MC 2C8KA 4DQKA 1QOQB 5BSEA 1YT5A 1GEGA 3LDGA 3FVVA 1UDRA 2VH5R 1RI3A 4D8YA 1FYWA 1IN8A 3UXYA 3PU6A 4V0KA 3VISA 3R8XA 3LXMA 1PJAA 4RPJA 5ES4B 1RXIA 2CXQA 1DKPA 1Q17A 2C98A 5F4ZA 2VP9A 2YWBA 3IMEA 4GKAA 4O2BB 3WLTA 4WZAB 3O03A 3ZZTA 2ZPAA 3ENNA 1BWRA 1E6EA 4D0SA 3P9PA 4N3AA 3DYBA 1BOOA 1T3SA 3NDRA 1I2CA 4RZQA 3LP8A 1ABBA 4C0HA 3VDNB 4JXZA 1R0BA 1LW6E 1SUPA 3CUYA 4ZAXA 2RHTA 3MT9A 4Q48A 4L76A 1WU8A 1VFPA 3M1YA 3BQMB 5JXIA 1P61B 3IP5A 5DGTA 2CXNA 2J45A 3R5TA 4FYHA 3A1SA 2WTBA 5D84A 3VJKA 2Z30A 2O8EA 4TMVA 5DHRA 5T4BA 1E9DA 3RADC 1BW9A 1KRHA 4Y9TA 1ZH4A 4MQBA 2JDID 2G88A 5BYBA 1QP7A 3JQ9C 2A5LA 1XL0A 2I1VB 3UK0A 2HU8A 3ZU2A 5JAMA 1AQJA 2NZUG 3CZQA 1Y5LA 5HOEA 1Y9DA 3Q8KA 2FZEA 1N3BA 7YASA 2CV0A 4YQYA 1M2EA 3V97A 1MRZA 3K20A 4K9DA 4X54A 4DWVA 3AHJA 2IDKA 4E3ZA 1EK5A 1Z75A 4GMHA 3H83A 2MYTA 3N7AA 5CM2Z 1HXHA 5J47A 2YJGA 1LBTA 2OC9A 2GM4A 1TZ2A 2GFIA 2WUVA 3ZZ0A 4D4JA 2HT6A 1IY2A 2ODQA 1OROA 1ZIYA 1T43A 2RJ3A 2V9PA 3ELWA 3PC8C 4G0ZA 2ADFA 1RWBA 1IOLA 4I08A 4M8LA 2OGTA 5FUWA 5IVPA 2WP0A 4Q1CA 1AQLA 2IEZA 3DE1X 2FZVA 1DQYA 3NU1A 5EKSA 3W9SA 1XRLA 2NUAB 1NVTA 2OK7A 2RB5A 2RGXA 3HCFA 3IURA 4I8XA 1ES9A 4CQLA 3TUZC 1RTKA 3DDUA 4HX9A 3R3YA 3KK0A 4EF6A 2WHRA 1QAMA 2PU5A 6ADHA 3S1SA 1TQ2A 3HUTA 2HXYA 2EQAA 2HD4A 3BA1A 4BKQA 1D3AA 1A8IA 4XRRA 2WF7A 5JNSA 3H2HA 5IM4F 4QHTA 4UEWA 2PIAA 1H69A 1UXKA 2WFLB 4MZXA 3U4IA 4Q12A 3STTA 1YAJA 4XWOA 1NYRA 4JNKA 4PU0A 3SXJA 1BNCA 1KPGA 4D25A 1D6SA 3TOSA 3EOBI 1EFPB 3M9XA 2YOHA 1UXHA 4RSGA 3DE0X 4OKNA 1F6DA 4M87A 5EGSA 3VKGA 4GOND 2PM8A 3P9IA 4PBSA 3QEBZ 4JT4A 3JZMA 3MPOA 1EMDA 4JIMA 3QIVA 2N42A 4Q9AA 5HGJA 3QRWA 1TM3E 4M89A 3ONWA 3C8HA 2M1ZA 1XJWA 1BWPA 1LWOA 4MVXA 3G0HA 1QLJA 2OXFA 1NJ2A 2PLFA 1P2DA 1PQYA 3AI3A 2ENUA 2X8BA 3MWGA 2VHYA 4M83A 1ECLA 4Y30A 3U44A 4J0HA 1QANA 3E1GA 3VAZA 1A97A 1A98A 2OFXA 2DFPA 3A28A 3PDJA 4JLPA 3QEJA 1FNMA 2X9LA 8LDHA 1J39A 3ABQB 4HDRB 1XTUA 1ATIA 2M9MA 2AG5A 1VPDA 5TLSA 3BFVA 2BZGA 3IPRA 4ZZ2A 2Z4RA 4XAQA 4DDUA 5A9TA 1R4AA 5H4GA 2JW5A 2ZR0A 4PFJA 5JVDB 1EDZA 3JQ9A 3WLSA 5LYJA 4PHGA 1BKSB 4XB1A 1O9BA 1U9ZA 4QATA 3TRKA 6YASA 5DBGA 4QJ3A 3U2QA 1A5AB 3L0SA 5EHNA 3FYTA 4ZJYA 2AX4A 3H9BA 2VS1A 3I1YA 4RM2A 1HLDA 4WRRA 3CF2A 1E89A 1EDDA 1GU1A 4GYJA 4Q82A 4L95C 3ZEIA 1V9LA 2HUNA 3KOYA 2I76A 5FNVA 2QK4A 1AO0A 1R7RA 1HNNA 3BRCA 3LOUA 1N75A 4FXOA 4Y2YA 3T7RA 4DV5B 2R44A 3PC8A 2W2VA 2EBFX 4MS3B 3U81A 1EUQA 1H3FA 3UJ9A 4DIOA 2V1XA 2XWBF 3QV1A 4IVRA 4YRMA 2WR8A 2Q0QA 4Q1DA 3W04A 4HN2A 4LVNA 5IH7A 3GXBA 2DPXA 3NVDA 4LZNA 3U31A 3VMFA 1GUFA 4B4UA 2ZI7A 2OFPA 3X2EA 5CFQA 2VTEA 3UHJA 4RIHA 3WYFA 3BSSA 4ACBA 5KKCA 1FDIA 2H8GA 2PIDA 1DEAA 3IOYA 4IGEA 3AUXA 4YV2A 1YJBA 4RJTA 3M5WA 4KFTA 2OV1A 2P9BA 3M1LA 5JALA 3OJXA 3QK7A 1EP3B 2V45A 4YV7A 2O2GA 3SSOA 4X41A 2X5XA 1DGQA 3SVLA 3DDSA 3R41A 2XYQA 5FIUA 5I9NA 1GCUA 3SFZA 1KY2A 2GAAA 1C0IA 1P9RA 3IAHA 2ZYWX 3G7SA 4FI3F 4PLCA 1G3MA 3FWYA 3ZGZA 1Q7CA 1UWVA 2VA8A 3K9GA 2BFBB 2XUQA 1SCUB 1ISSA 3CIFA 3JV7A 1NF9A 3AQ4A 3O93A 1XRNA 3EISA 3IL2A 1HYHA 3AI7A 1GPYA 4G09A 1ZNZA 3C3DA 4PPNA 3HBJA 4B3CA 2H16A 2JAHA 4CMIA 2J59A 3MTGA 4TUYB 4KC0A 4U02A 4EWLA 3GLHE 5F5XA 3IBSA 1D2HA 1VA4A 3WBJA 3ZHCA 5LA6B 5IJ9B 4PLHA 2VH1A 4LYFA 5KTYA 3D0RA 1RI1A 3A4TA 4QJBA 1LVUA 4QYTA 3S70A 4BFLA 5ITSA 3DDWA 2G82A 3DM9B 4TL9A 2QXYA 4MHTA 1GRCA 3DM5A 3ANXA 2VH2A 3VSEA 3KAJA 4PAQA 4WSOA 1T0JB 4HPXB 5K3SA 6REQA 1F7VA 1E58A 4Y2TA 1YXMA 3DTVA 5K3DA 3K9FC 4UC0A 4PG8A 5JCJA 3TZEA 2MMCA 3PNBA 1ZQ1A 4CN9A 2WYOA 1QU2A 2JFQA 1MB3A 4B7CA 2WOJA 4J16C 4OHYA 4GPAA 1PFQA 4ZEMA 3HBNA 2IEYA 4CT5A 4TS1A 5IAEA 1NT2A 3B48A 4L0DA 3PNPA 5IBPA 1IVNA 2CLLB 3WGUA 5SZIA 1JEEA 1DBRA 1HOTA 3CZRA 1U80A 4F1JA 3LZDA 4PG7A 4W8HA 4WBSA 1MJHA 5FB3A 1U0BB 3CEMA 3PTAA 3SZLA 4YRGA 2ONJA 4OD0A 1W59A 3PNQA 2VJDA 3EEBA 4TMTA 5CBPA 1V4NA 2DVMA 1NVEA 2V0CA 4DR5B 2Y2UA 1YQGA 3ADPA 1XALA 1FDRA 3CMMA 4B40A 2H0RA 2QTFA 4U6QA 3TNDA 2DWOA 5IZ4A 3F9IA 1W96A 2C3YA 2P5SA 2Q9UA 4IOKA 1N3IA 1Z62A 4PXSA 3SVTA 2H5IA 1C0LA 3OTIA 1GZ4A 5G02A 1RXEA 2QEQA 2HA7A 3SDSA 5C80A 4YBRA 4WZBB 2X2EA 3CH5A 1GG2A 3W4IA 2NMVA 1CX9B 5KYUB 2I6TA 1FK8A 4ECAA 3OT1A 5AUPB 2NSLA 5H9VA 2X19A 4I55A 1ENOA 1KAHA 4W1SA 3D0KA 4LVOA 1FTQA 4TV9B 1ULAA 2NZ2A 4C21A 1WHTA 2GXSA 1JDSA 3VOSA 1ZKMA 1NPTO 3F6EX 5G4LA 2ZUFA 1YHYA 2P1DA 5DHUA 3NJ8A 1J00A 5GIPE 5KTMA 5K9ZA 2E6KA 4IX9A 2R65A 1P39A 3OFJA 1NP3A 1M7HA 1TAHA 2WF5A 3ZHZA 2BEUA 2PUTA 4S3MA 2DHRA 4KSCA 4WL0A 4YALA 1PR3A 1Z0SA 3ZXIA 3IA7A 2ID8A 1Q7TA 4NH0A 4JYPA 5TF4A 1ZIDA 3SC2A</