1RBMA

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
total genus 61
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rbmA00
1RBYA 4ZZ0A 3TQRA 4YFYA 3AUFA 1RBQA 4QPCA 5J63A 4NV1A 2YWRA 1ZLXA 4Q12A 3R8XA 5CJJA 3TQQA 2BLNA 2CFIA 3LOUA 1C3EA 1MEJA 1JKXA 3P9XA 4ZYWA 4ZYXA 4ZZ3A 1RC0A 1CDEA 3DA8A 4ZZ1A 4DS3A 4ZYUA 1FMTA 1ZLYA 4EW3A 3GARA 1MEOA 1MENA 4ZYVA 4EW1A 3Q0IA 4YFVA 4R8VA 4TT8A 3NRBA 4ZYTA 4EW2A 1GARA 4TS4A 4ZYZA 2BW0A 1C2TA 1RBMA 1RC1A 1NJSA 1ZGHA 1S3IA 4ZYYA 1GRCA 2GARA 1CDDA 3KCQA 4S1NA 5J9FA 4QPDA 2FMTA 4PZUA 1RBZA 1YRWA 4IQFA 4TTSA 3DCJA 3N0VA 3AV3A 3O1LA 4ZZ2A 3W7BA 3OBIA
chains in the Genus database with same CATH superfamily
2P6MA 2P0AA 4MQUA 1QFYA 1FNMA 5C5DA 3KCNA 2QNRA 4PLHA 4TL6A 3GUZA 1TCBA 1J0DA 3THYB 1B73A 3PPVA 4WZAA 5FCDA 5FFNA 2JFNA 4E1AA 4RGVA 4HI0E 2A14A 2PMFA 1OFVA 1J2UA 3RHFA 1A8HA 1JG6A 4RL6A 1AK1A 1D2RA 1H65A 3PL5A 5DI9A 3T3EA 3O8RA 3NHYA 4NFHA 2MSNA 2OXFA 1XC7A 1DB3A 2GZDA 1JV2B 2B4TO 3ZJ4A 4B6QA 3E7XA 5HXAA 1A96A 1Q0TA 2O20A 2J6CA 2XZPA 3NONA 1HV8A 4R2WA 1XNRB 4MVCA 2JVIA 3KOYA 4RK5A 4BZZA 2DPYA 2OAQ1 2QSYA 2RSLA 1Z13A 3P1JA 1PT6A 4IX9A 2OUKA 2C58A 3KZCA 3OZUA 2Q4EA 3PZRA 4FHEA 4JVOA 5CJ2A 1KAQA 3NTLA 3I62A 3B82A 4IDGA 3KB1A 1UKVY 1X9HA 2BCGY 1MPXA 3DO6A 4JBGA 3RQIA 3V97A 2ZYHA 4DCOA 4QLBA 1ZVJA 1D2GA 4IXNA 4QYWA 3QOFA 1U1DA 2V54A 5C8DA 2DERA 2D7JA 3O3OB 2PEZA 3SYLA 1B6TA 1CQJA 4XW2A 2QW8A 4Q4LA 5G0TA 3H0CA 3CMMA 1ODTC 2BUCA 2HLNA 2QRVA 3IH5A 5MGBA 4KR2A 2H8GA 1LGYA 4L6IA 2P30A 1QG2A 1YL5A 1D1TA 2ZR8A 3FI9A 4NABA 4YR7A 3WLJA 2IDJA 4LJLA 2HSZA 3JQ8A 3RSSA 2REXB 4DDTA 1QQ5A 3VU0A 3QXSA 4KVZA 3ZGLA 3KJZA 2QROA 3QNWA 5AOAA 3H75A 2PJZA 3Q87B 2XITA 3KSRA 2UVQA 2VZ8A 2P9HA 1YR1A 3RSHA 3UKJA 4Z4GA 4I7EA 1T0JB 3PXEA 5K3SA 3ZZUA 3OVMA 1E4EA 4OHFA 3A9WA 1Z5OA 4PC2A 4XQ9A 1OB5A 3COSA 2XA2A 4BLUA 4MW6A 3CZCA 4OFBA 2OZPA 1HFWA 4IIBA 2R66A 4KKXB 2CBXA 4FE4A 4FMDB 4IUCS 3DLCA 4NWIA 3R7DA 1X7WA 2QTVB 1N1DA 4ZV9A 4QYMA 1GA1A 3PXDA 2MTBA 1RRFA 5B53A 2IYXA 5P8WA 3THOA 1R0LA 4G41A 4C0BA 2H7VA 2PK3A 4G4SP 4RHTA 1H5UA 2OWDA 1UP6A 4KIGA 4RY8A 1H2AS 5EPEA 3A8TA 2GO1A 3AY6A 5EXPA 2DGDA 1NTRA 2YWFA 2TYSB 5TQ2A 5HHTA 1I3MA 3I39X 3N5CA 2ONJA 3N0WA 5REQA 2GCNA 4B7CA 1A9SA 4BATA 3HCAA 2HMTA 4H4CA 4CLHA 2P2ZA 2EG9A 4W5JA 3FR7A 4KXNA 1B26A 6YASA 4INOA 4DIMA 4DRZA 2HSGA 3EA4A 3FN4A 2PUFA 4N8DA 3LCRA 1EXVA 3BTOA 4LOHA 1G5PA 1WOYA 2Z5LA 3GRPA 3PYXA 2PH7A 3LVFO 5DVZA 4ANFA 4CW7A 3AHGA 2VDKB 1EXMA 1UXOA 1AZTA 3COZA 3TEFA 3WAJA 5HRUA 3CVWA 2C9CA 2NTNA 4MQFB 2I2FA 2DKFA 4B8ZA 2P67A 4O08A 4OLFA 1Z6TA 3CFYA 1SBYA 1ZNQO 2AOXA 2MMCA 4MVWA 4RHUA 5ARDA 5DHUA 2CLOB 1OI4A 1RMYA 5IC5A 1WKBA 2VRCD 1XZJA 2X14A 3K73O 2WJJA 3I30X 3OM1A 4RJIA 5IXSA 2ZAMA 3OEEA 2Q07A 4W9NA 4LF6B 1AMOA 3RIEA 4CODB 3ZUPA 1YBVA 5CXXA 1UPBA 1QE0A 3DP9A 3FPKA 3LQRA 3D6MA 5TQ0B 1GRVA 4FDTA 3FKSD 4YVFA 5EFZA 4JGBA 1GNLA 1SO8A 3CA8A 2IWHA 4MLCA 3IUYA 4LF4B 1LPSA 1HFJA 2AA3A 3FMIA 1F0NA 4OUKX 4YJ3F 3PWZA 4MRMB 2SCUB 4YJ3A 1A8SA 3LQ1A 2HPVA 4OXRA 4XOUA 1RQLA 4AQYB 4EG1A 5LLTA 1Z2OX 1I6WA 1WDTA 3PUHA 1R0ZA 3SEAA 1BKYA 1Y8CA 1Z0UA 2F9FA 2J1LA 1PV1A 2W2TA 1CJVC 1QK3A 4PE5B 3FOEC 1HKHA 1C3XA 1FXUA 3TLAA 2TS1A 1DRJA 1H6AA 5CCEA 3EMKA 3BILA 1QCCA 1RYFA 3CF0A 1VIVA 4CE6A 1GGNA 5HF8A 1CUXA 4BWYA 1VLLA 2G0TA 3N2LA 3Q7IA 4EI9A 1V7QA 1H9CA 4B35A 1AB6A 4MX8A 2L2QA 3DDZX 3O91A 1ZIOA 2QJTA 2B1IA 2X9QA 3LQYA 3WBFA 4NH0A 4DXHA 5LD2B 1EWQA 2ZYIA 2H1LA 3SS9X 1R4AA 2RONA 5K51A 3NXKA 3C3EA 4XXHA 4Q05A 4B3FX 3BRQA 4KO4S 3EHDA 4RPJA 5AW5A 2IPMA 1V9LA 3NOQA 3K32A 3PDUA 1A4XA 2O2IA 2B7CA 1PLJA 1QVRA 1X8XA 2IYRA 2JDID 4PTLA 5KAPA 5JROA 2O5VA 1C4WA 2ZETA 3EDYA 2DETA 5BPHA 5FA6A 5F1YA 3EG9A 1Z16A 3EIFA 4D3SA 3EF0A 2TMYA 3DGEC 3JYQA 3KVNA 2G6TA 3PFKA 2BCJQ 3QWHA 1P5ZB 2VF2A 2WWIA 3PENA 4L6AA 5E9WA 4BO3A 3DBLB 5E6UA 4E4YA 1NQOA 1NXWA 5BY2A 3RVMA 4BNTA 4HVTA 4KRXA 3WQSB 4YR9A 1XOIA 3LOPA 1DCFA 2B4RO 1EUZA 3AI1A 3PVSA 4J7UA 4JLKA 4QOGA 3RFUA 2CUTA 3KLMX 4X7MA 2E49A 2XNKA 1QGDA 4LXIA 1U94A 1VOTA 1UAAA 4YCDA 4DQ0A 4NC9A 4LFAB 1LV8A 3LT5A 2EYQA 2IHVA 3E3AA 3JS5A 3TXAA 3HO1A 2Q2QA 2DBVO 4XCQA 3NWBA 4H1HA 4DLLA 1W48A 2QKYA 2WUWE 3F67A 2W48A 2JANA 2G70A 3DV9A 4MW9A 4HH3C 4F71A 4F11A 2NUPA 2G08A 4X84A 4DT1A 2NIPA 1KP3A 1SUFA 5D8DA 4EMTA 2N1MA 1PEKE 3E9EA 4OGGA 4JNKA 2GJ8A 4KX5A 1PR1A 3M4XA 3OJLA 4L2IB 1OAOA 3E9RA 3SBDA 1E18A 4DCUA 4DQDA 3TQOA 4F3RA 1NBMD 2D54A 2QP9X 5JO9A 4CU5A 4NX2A 3WL8A 1Q7TA 3TQRA 1D2CA 2V96A 2NNWB 3LIPA 4L8LA 4UM9D 2ENUA 1YD7A 5CRIA 1IFXA 2VBCA 5DGTA 1A8IA 1L5NA 1VMDA 3R24A 4AZ3A 3TIFA 3FPFA 2B5OA 3V4SA 1X9GA 3ZV6A 2AG6A 2ODTX 2RGNC 2ZB3A 3IR5A 4HNAA 1UXGA 3OE7D 3KB2A 2H85A 1XU9A 4EX7A 4TL7A 4I1PA 3H8VA 3AGPA 1NVWQ 3TCNA 1P61B 2VAPA 4YLYA 2WZQA 5EVCA 5BQ5A 1OZGA 3QWAA 4R8SA 5A7HA 1JFSA 4ARBA 1H3FA 1E1KA 3AQ4A 3LC1O 1JFFB 1AMUA 4P54A 4J16A 3THSA 5E2BA 4H0NA 1X6VA 4N01A 1E9FA 1POWA 1TIPA 1GPNA 3VA7A 3SDSA 1IJEA 1I32A 1WCXA 4L4RA 4WACA 4Q9IA 1BWQA 1KU0A 1P4SA 1IN7A 1GDHA 1QH0A 3C3MA 3GLKA 2D7DA 1XD9A 2XWSA 4KPEC 1Z8NA 3TM5A 4HZUB 3BWEA 5AKZA 1GXSA 3AP3A 1EUCB 2B6HA 2QMYA 4OMCA 1L5FA 1IDN1 1ZLYA 4W9MC 1YASA 1DQNA 1VMAA 3GWZA 5ICSA 2F7SA 1KPHA 2VXBA 2V3CC 2B1RA 4QUDA 4XFKA 1AXRA 2XI4A 5JPDA 3ZTTA 3KETA 3BXGA 2UXCB 1YVEI 2P40A 4CR6A 2XE4A 2WJ3A 4RH1A 3TGWA 3GLIB 4XJXA 3U4QA 1OWMA 1DMRA 4XPZA 2VT3A 3OKAA 1L1RA 1YQ9A 3EXHB 2ZJ8A 4RORA 4U39A 1LW7A 3TCXB 1JNYA 3OZTA 4QD3A 4U6QA 3SICE 5BN3B 2VJBA 1I33A 5AW7A 1I7NA 4MUEA 1DBRA 1WPXA 2CHFA 1Y8QB 4X93A 4YPFA 1Y1SA 2QQFA 1GM5A 1E6UA 1FQOA 3PUIA 2OECA 2G8LA 4NFSA 3KAPA 4KQIA 3DFUA 3RT9A 2GR9A 3Q5EA 3SEQA 1HDYA 1ND5A 3V8MA 4JUCA 4B1FA 1QIHA 3F7NA 3GJXC 2CZGA 1XU4A 2R8ZA 3KR0A 4QUAA 4XB6B 1O0CA 1J07A 5EZYB 2I4NA 4ZKEA 1J23A 3A6FA 1N2IA 1WUTA 2ZWOA 1NUTA 4CGZA 3KYCA 3TMYA 1OTHA 4CIYA 5LDDC 5TY0A 5K6TA 3OF2A 2WYOA 5MFPA 1Z4MA 1VFNA 2FUG6 4HAIA 5J43A 1DCMA 2PUCA 1N8KA 1YBAA 2C2YA 3SC4A 4R2LA 1I2MA 3H3XA 1T3LA 2CHUA 3ZNQA 4D8UA 4F8EA 4GE3A 4YB8A 4JI7B 1Q0PA 5EXDA 4G36A 1WMAA 1VCIA 3FGNA 5FTNA 3O83A 1PYGA 3DBHA 1T0PA 2IEYA 3PK0A 4MARA 5JQWA 1DC6A 2R97A 4HGZA 4KNWA 2IZZA 5CHYA 5FHRA 4RTRA 4GH5A 4ZAGA 3AXSA 2PNJA 3INRA 5BV7A 5K3FB 3H7IA 3I52A 4U0JA 1TUGA 3L7LA 3A3PA 1YOBA 3DUFA 1CIJA 3BYZA 3KPUA 1GWNA 3PXCX 4IUDS 3V46A 4WZBE 4D9EA 2P2SA 5KNBH 5T8KA 2J8ZA 2AOUB 1UKYA 3AF3A 3FF4A 1QE5A 2XIQA 4FHZA 2I67A 1ZSNA 4CDNA 1QF9A 4WBXC 1NRIA 1MB2A 3GFPA 1E63A 4LMRA 1K2WA 3OJOA 4J43A 2IH2A 5ETJA 1K6JA 4FMCF 1XTZA 1GAWA 4QUGA 2UYOA 1KI8A 3P2OA 5ERGB 5KC8A 3MTBA 2W2PA 3EXIA 1NMYA 3NB0A 5CITA 5THKA 3B1VA 1Z36A 3AKZA 4IICA 5EGNA 3TI9A 4E2WA 4FYIA 4I55B 2AF3C 1N2JA 5D5HA 3FVVA 3SLGA 4XUGB 3RWOA 1G42A 3WNQA 3I53A 2WTUA 3KEMA 1VB3A 1JDVA 2B37A 3L1HA 2H29A 2IW1A 2Q62A 4IQ0A 4U1RA 2F3SA 4OK3A 3AU8A 3ND9A 4PZZA 1DFGA 3WLPA 2OV1A 4TM8A 2ZYDA 3HBMA 3ZOZA 4E08A 1ONNA 1RAIA 2CHEA 2P8SA 3JQPA 3MOIA 4JLWA 5JAHA 2XB2A 2HBQA 3M83A 2I33A 1N4DA 3OZGA 4DMLA 3S7ZA 1BWSA 2QRGA 2IPNA 3OAAD 4IZIA 3L92A 1NVXQ 4DSZA 4WWHA 2IUTA 4BS9A 3I05A 4AROA 1RXUA 3KYDB 1WDLA 1ODLA 1YZTA 1TADA 3H3FA 4OU5A 3BVPA 3QLJA 5GJVC 2DFDA 5HGJA 2RGCA 1TGYA 1F9AA 3G2HA 1XDWA 2AKYA 1GL6A 2D0PB 4ITVA 4J49A 4K9PA 4PLZA 2WJZB 5IF9A 2I78A 1S7GA 3FA2A 3GY0A 3AF1A 5EQTA 4ZVNA 3M9WA 4HNQA 4PBSA 3DLIA 4B7ZA 4ZO7A 3RVPA 4YYEA 2C3UA 3ZE2B 1QPGA 3C5WP 4RHYA 2NQ2C 4RF5A 3LUGA 4YCNA 1SUPA 2BBSA 1ECJA 5L4NA 2X4GA 4CKXA 3KSUA 4YMLA 4FWIB 4NMXB 1RQXA 4QUBA 1UJCA 1ZGGA 3K0HA 4S3MA 1FP2A 2RFLA 1FPMA 1DUSA 1J2YA 2FUG1 1RKVA 2OESA 5LKRA 1C9NA 2Q2VA 4N7MA 1GP2A 3ENQA 3PC4A 2ASEA 2BI7A 3CEMA 4N5IX 4YJKA 5BR7A 2B61A 1RJWA 1DE0A 1HY3A 2I66A 1ORRA 4OKIA 3ZQKA 4B33A 3D5TA 1SOUA 2OZVA 2XD9A 3EXAA 4GVXA 2ORYA 5FO0A 5G2OA 3SXUA 3V8EA 5BOSA 4Z4IA 2QRNA 2J3HA 4FCTA 2N46A 3QEAZ 2PD4A 3BERA 4IJVA 2AYYA 4R1OA 3BSFA 3GUVA 3EC1A 1M6NA 1RPTA 2L42A 2JG3A 2OCAA 3RS3A 1FX1A 2XQIA 3LG2A 1QHFA 4MYDA 1YE5A 2AWNA 5LQCA 2PTHA 1N4AA 3W04A 2DOKA 5FP0A 1RW4A 1WTCA 3L8MA 3FZGA 1UZNA 2R1UA 2IJGX 5FH9A 1Q1QA 3B3GA 4M1EA 4YTEA 1GTG1 3WE7A 3BMXA 3HRKA 3WJ2A 1DQZA 1FFCA 4BRSA 5F7XA 1M34B 2BFDA 3S6JA 5GMOA 1ZUHA 5K4AA 1D4FA 1OPXA 3L07A 3HADA 4L08A 2Y9PB 1P0MA 3VR1A 1NI3A 2CLLB 2PX2A 3VVCA 2IA5A 4DHWA 5AHXA 5JPCA 3FWYA 4OHXA 1ODSA 3LHFA 3BMOA 4YALA 3W5JA 1CQXA 3B89A 3W8FA 1ISSA 1T1JA 1GZ3A 4AYWA 4GP9A 2DWOA 1VBFA 1E64A 2VHXA 1QRRA 3ZXXA 1L5HA 1KAOA 3KVVA 3ONFA 4UHJA 1BHSA 1LJLA 1KDYA 4EJSC 5IT4A 3O82A 1F6BA 3MF4A 3VGPA 3SC2A 1AQLA 2Q6IA 4EHDA 1LB1B 1UC8A 2GM3A 1RIIA 4QELA 4P7GA 2QM8A 1L8XA 1XLUA 3CJQA 4NATA 3TOVA 4F12A 4GMHA 4M22A 2VFAA 2JJ2D 4OTZA 2FWNA 5L9AA 5KQGA 2VK8A 1HZZC 1UT6A 5IKPA 5JSYA 4HGPA 2G9UA 1CJKC 2AJCA 4YWJA 1W36D 1N5DA 1JKXA 3AHFA 3DMHA 3E22A 2QW0X 5GJCA 3CBQA 5A0VA 1ULUA 3FB1A 4MS4A 4F4JA 5J5VA 4JBXA 1RXVA 2Q6KA 1W47A 1YDEA 3AL3A 1CUUA 4WCFC 5IK2A 4EL0A 4DS3A 2VZLA 5DTRA 3B5EA 2HK6A 4RDXA 4ZGWA 3F4BA 3GRRA 2J59A 2H1SA 4IILA 2IEZA 1OW3B 4FSXA 2OQRA 4HBGA 4PC7A 3TTYA 3ZLTA 4NOKA 3L7YA 4MV7A 1XAIA 3JZIA 4OD0A 3OJFA 2ZXUA 1RQ2A 2G4LA 3FKJA 4IR7A 3CR8A 2NPFA 4EY7A 4Z9BA 3L02A 4LAFA 1PSZA 2PGAA 4J1QA 5IUKC 3LTEA 4GLFA 2ZANA 1S02A 2FR8C 1EP1B 1QKKA 4L76A 5ELMA 2IYZA 4EYSA 3QPBA 5BSKA 1A5BB 1XCPA 4Q1FA 2CK3A 3TINA 4QFBA 3ZJ5A 1Z3CA 2DUMA 3FVRA 3U19A 1JBKA 4DWVA 2Z3VA 4D5EA 1BOOA 2PMBA 3KTDA 1QTNA 5DYGA 2ZI9A 4O4HF 3ZWXA 1HTTA 2P6NA 4PBRA 4YMUA 1ZRHA 2E2WA 3ANMA 3IQDB 2EIHA 4O4HA 3BSSA 1M2FA 1W5BA 2NT4A 2E0IA 2J3JA 3ANYB 4GX5A 4JEHA 5AM5A 2AK3A 4BN4A 1O54A 5BPFA 4CL8A 4YUXA 3WOVA 2B69A 1H4VB 2HHLA 5FUQA 2A92A 4M9ZA 1P44A 4C29A 2CKDA 2VYFA 2I22A 2JFQA 2H11A 3OWHA 4KL8S 4YC7A 1JEDA 1XCBA 2VF4X 3WLFA 5BWCA 1M8GA 1GLGA 2IBMA 3VI3B 5K6AC 2J4FA 3DVSX 2ZTUA 4RFSB 4JYCA 3UXYA 4IINA 1BE6A 2CVZA 3F8WA 4YA6A 3VU8A 1KMHB 1TC1A 4Y9RA 2P79A 4BIIA 3RASA 3L43A 3K8YA 3VV2A 5B1YA 4BXOB 1GAXA 3B48A 2Q4BA 3ZX4A 1SMKA 4WJLA 2OP1A 3TSWA 2VZ0A 5K3AA 3ZQ6A 5AJUA 5L3SB 1PS9A 1Z0JA 3EMBA 3JW8A 2B1QA 1JEOA 2FP4B 2A4KA 1AZSC 5DRTA 1W88B 2ZUBA 4OKSA 5SZIA 1QB7A 4DIFA 3BREA 5CIQA 3SKYA 4QPNA 4FX2A 3CINA 4N49A 1JKFA 1ZIDA 2P3OA 1A8UA 2XRYA 2RH8A 4OQEA 2NNLD 5JS2A 3K6SB 4FR0A 2YRWA 1GPUA 2OMEA 2JFPA 3QWIA 2QR5A 3NHMA 3CTPA 4FZJA 1VA5A 2DZDA 2PUEA 1E7MA 3BD8A 2I99A 2V6JA 2WDPA 4MWGA 1JXAA 1UBUS 2CXXA 1NUQA 3II6X 4AJHA 1WRBA 4QNNA 4MDFA 2JGLA 5GIPE 1FP7A 3DEHA 3NKLA 2WD8A 1KRHA 4OLAA 2VQDA 3AR3A 5BORA 1L3BA 3ZDZB 3JQFA 1FFSA 1N6IA 3A6GA 4R1SA 1KEUA 2P62A 4HDKB 3ADDA 1HYBA 3HJCA 3GUHA 1LPOA 3ZLUA 2G77B 1GG8A 4YJGA 4EO7A 3UOWA 3OKCA 5ALOA 2ID7A 1IHDA 3B51X 5DXJA 2WE7A 2OSBA 1EDEA 3IMGA 3JQ8B 4Y67A 5BSUA 2WSYB 4U6NA 1I10A 4MVJH 3TJZA 2JLYA 3AF5A 4XIFA 3ND8A 2I6TA 1PSWA 4YP6A 5JNUA 5JJKA 3RQSA 1C7FA 4W5TA 1SELA 1HKUA 5FUWA 2Q2NA 2VWGA 3GJ4A 4IGKA 3N87A 1AGRA 2QTTA 3UGJA 1FFYA 2V7BA 4INZA 4ND4A 1HSZA 2O2YA 3OZEA 1OILA 1RMQA 4NEHB 3RTCA 5D3QA 3TAUA 4A03A 4ADSG 4B76A 1GCGA 2O8VA 3T0GA 1DNPA 4MV0A 4L78A 1TO2E 3W9BA 3WDKA 4GI7A 3KSAC 1OJLA 2GVDC 3DYIA 2BMJA 3C24A 3AUAA 2AMYA 2IL1A 3LKBA 4WEOA 4BEJA 4C78A 3LGXA 2XA9A 3NGLA 3REQA 4OEHA 2RC6A 5DXFA 4BEWA 3ABQB 3B78A 2RHBA 5AKIA 3ZIAD 1L7AA 2DTEA 2J07A 3AY3A 3C3CA 5JFTA 5KQLA 4S04A 2GK4A 4AIRA 1WF6A 1SUCA 2Z1DA 3G0DA 3IILA 1U0SY 5ALNA 1H5NA 3H1BA 2C5FA 1G16A 1P62B 3BGSA 3QEKA 2O2GA 2O7QA 5K0BA 3NHAA 4ZO4A 5B1SA 4CMJA 1PS0A 5E8JA 3TW6A 2OAP1 1KZ1A 2DUNA 3DPUA 4KWCA 5KB3A 2A4MA 1NIJA 3WMRA 1RZ3A 5KYUA 4BFSA 3VBEA 4AMBA 3VR6A 1GCUA 2WR8A 1DBIA 3IXQA 4MMXB 3SR0A 3QFCA 4LWQA 3ROMA 4EKGA 5F64A 3ETHA 2IK8A 3OQPA 1ZHHA 2R1ZA 3KALA 4K88A 2BKXA 2O07A 3QVXA 3T5TA 1GUAA 2NSHA 2M9MA 3EF3A 4NBRA 2JFXA 2H0QA 2Q5QA 3MTIA 1HL7A 4IRXA 4R9NA 4AF8A 2V1UA 5CVVA 2GEJA 4G97A 5AH0A 2FZGA 3UFXA 4D9KA 2XA1A 3VX4A 3HY4A 4HNTA 4I14A 4C2TA 4JC5A 2MSLA 2D0DA 1EWVA 3DVAA 1NP7A 3HCEA 1GZ5A 1WMDA 2W90A 3A0UA 1P0PA 1OWOA 2FW0A 2Z0MA 3D6NB 1VYUA 2P2LA 1DLIA 2H4FA 3FUUA 5E2AA 2WTXA 5IM4F 5K2OA 5CDGA 5D5PA 5IM4A 3R9XA 1Q6ZA 1LW6E 3Q7EA 5G40A 2Q3MA 3H05A 1OI2A 2IX3A 1K5DA 1T5TA 3IP7A 2H1WA 3VNUA 4ZP1A 3CPHA 2OO5C 4HTFA 4ENTA 4MYTA 3KUCA 3PTLA 4Z2YA 2PA3A 1TM4E 3OCUA 4YFYA 5JDCC 1V71A 2W6NA 1KKMA 3DV0B 2PX4A 3GX1A 4E32A 1Z3IX 3A3KA 3DBRB 1E3JA 5B12A 1FNSA 1M8FA 4MI6A 1GTSA 4BNJA 1NBHA 1K27A 1HYEA 3R3XA 2W2KB 3PUYA 4NQZA 5H3HA 1ILEA 821PA 4Q3KA 3WGNA 2ABWA 2QYOA 4EITA 2FJUA 5EP2A 4UNNA 2H1IA 4TGLA 3ZY3A 3A11A 3LQFA 1CTQA 2A0WA 4L5AA 3IP3A 1HPLA 3RSCA 4F4CA 3FD8A 4Y2QA 3DZFA 1M1YE 4J0JA 2XKJE 3I28A 2ECFA 3SQOA 3HVIA 2JCBA 1XQVA 1FTYA 5FIUA 4PG8A 1RFGE 3JR3A 5I9BA 4C06A 5G4LA 4YAEA 4CWAA 2OOSA 4IEIA 3GBPA 2GM5A 3KG2A 4JJKA 1VC2A 3PD7A 4O1MA 2XBLA 2E37A 4ZPJA 1U8XX 4IDCA 4DSTA 1I4WA 4EHHA 1Z9BA 5JYCA 2WMOB 1GRQA 4TYYA 2G0NA 4GUDA 5GJBA 1QG6A 1PJ3A 4WL0A 3JZAA 4EW3A 4BKMA 2GZMA 2QE6A 3VPHA 5E9AA 4B7XA 5BWOA 5LOVB 2OSVA 3WKDA 2CLSA 1ZUNA 3PQ2A 3ZLJA 2G5GX 4RVDA 2OXIA 3H5OA 2HXSA 1SKBA 1CY4A 2WJPA 4J0GA 4D4GA 1U7ZA 1ZMOA 1E3EA 1DPFA 1J9ZA 3CLSD 3KQOA 4K2AA 4RVFA 4MV1A 5A6SB 1V3TA 3N3BC 4QDKA 5KZMB 3HB5X 1GARA 5JVDB 4F2DA 5JSZA 3AONB 2V65A 3R23A 2XZLA 3TIXB 5D00A 4J94A 1YMUA 2Z9DA 5IKOA 3VKWA 4BO2A 5I7SA 3NAGA 4F60A 1XMIA 4RKRA 1J25A 2H2GA 2VH2A 4EUNA 3ICOA 2RIPA 2G5PA 2HWYA 5G3ZA 4A0GA 2C7PA 3T41A 1DX6A 1CUHA 1YK0A 4PVDA 3TAXA 1YA8A 1E66A 2C8JA 4M0LA 4WZ6A 1KSJA 4IMRA 2XUFA 3B53X 1SRRA 1Y1KE 4D98A 4HAXA 4YV2A 1SXJC 2CXUA 4RW0A 621PA 4J9VA 4BN5A 2ZYUX 1VZ2A 3NHWA 1SC9A 1XMSA 2EX0A 1BMFA 4FYXA 3QBEA 2Y1GA 3RSGA 1J00A 4RQTA 4B46A 4YAWA 1PR3A 1V39A 5KSWB 2ZZMA 1DZIA 1DIAA 1RM4A 5JFOA 3IFSA 2BZSA 2N0SA 3SJ7A 1SKQA 1UQRA 2ZTMA 4HDRA 4CLEA 2BGIA 1BD3A 3IEVA 3GVXA 1W96A 3B1YA 5AYVA 5K0TA 2B25A 3U2QA 4OK5A 3EEYA 3P9RA 3EULA 2HCJB 3G2JA 3IPAA 4M21A 4JJ8A 3LT2A 4OMDA 4RAOA 4RYDA 2AGVA 3GMDA 3NBQA 3T4EA 1IBRA 2JCVA 3R0ZA 3MYYA 5F5LA 3EDMA 2YFQA 3W05A 3ZWBA 4P93A 1QYXA 1QB8A 4LMPA 1E79A 2O7SA 1YQDA 3INGA 5A7FA 1KHTA 5JC1A 1Z22A 1EP9A 4Z49A 2PX5A 3G9TA 3R5SA 2ODNA 2C3PA 3D43A 3IJEB 3V1YA 1FLNA 2HMUA 2ZOSA 3C6YA 2CDAA 3B3AA 1J56A 2Z8ZA 3MTEA 2V9ZA 5AW2A 2X58A 1KOJA 1SU8A 4A9AA 4MA5A 5KMGB 2OLJA 3WKEA 1EXDA 2O23A 4J1TC 5E3JA 4RPLA 3GMIA 1Q3HA 2PZJA 2HWWA 3KAJA 4NBKA 4C3VA 1AKYA 3ZHOA 4DRXA 2POQX 1KEKA 5GINE 3T3HA 2TMKA 2BMAA 3AB7A 1WZ2A 1QO0D 2EF0A 1VLMA 2V1XA 5DGCA 3TEMA 5IEJA 5CCXA 5AVTA 3V1NA 5M2QA 3QUAA 4XYLA 2BM1A 3G2NA 3H9QA 4P3YA 1DTEA 3KT0A 2XMDA 3GRZA 3WRYA 2XUQA 3TH5A 3MJ4A 3QSGA 3H04A 5KUTA 1NY6A 1J5EB 2CHVA 4YP1A 4O2BB 5JH7A 1OC4A 3NO4A 4RD4A 5MN4A 1W0KA 5K6RA 1NBOA 5CXUA 3ZU4A 2R7AA 5LZ7A 2EW1A 3WLTA 3LI2A 5FLYA 1TX4B 2AK2A 4DY6A 4RVUA 2G40A 1HC7A 2QTNA 3GT4A 4L50A 4PX9A 5EMJA 3NM6B 4OSEA 3WADA 4PCUA 3D8TA 4I0WB 5ILQA 1XTSA 4QZVA 2C99A 3MEQA 4L8WB 4X1KB 3W4KA 4ZYLA 3FDZA 1PZEA 4JQSA 1FJXA 2X3UA 4D25A 3RYFB 4HKTA 3EZXA 1CR2A 1L0BA 3V00A 1WZUA 4PLPA 3W5SA 2QG9A 8GPBA 2PZ8A 1U63A 4WY8A 1I01A 4C0AC 2PWYA 3WL7A 3ISVA 1RHKA 4GMDA 1HDIA 1IWBB 1Y8RB 2ZUDA 4DGSA 4MI9A 1B42A 1R5OA 5BVGA 5KQPA 1KJWA 4JITA 3QYJA 4DQXA 2ZWPA 2MJLA 4YMTA 2IDKA 4EL5A 1Q11A 3JQ9A 1LRKA 3TTXA 3TNLA 4I9GA 1VJ1A 4L51A 2ZSFA 3FTPA 3RFFA 4H3SA 1U04A 2AXQA 1V8DA 5DHTA 3SLRA 2FSVA 3F3MA 5BT9A 4YMGA 5I7FA 4OVKA 4Y2HA 1XXHE 1SHLA 4CCYB 5BNWA 1GQRA 1NX6A 3FYCA 2DM6A 5ADWA 1NXVA 2HRBA 2IYUA 3KC2A 1WP4A 3AU9A 1RJ9A 1EWTA 1DO0A 1R9GA 2OGWA 4KXWA 4OGFA 2BOVA 1YZGA 3GUUA 2GBPA 5DWQA 4M76B 4PHFA 2RKOA 5CDTA 5JO0A 2W2LD 2BT4A 3IIIA 4HDQB 4CKYA 4JIMA 5TMPA 4QM7A 3H87A 1E8DA 3OTHA 2YUTA 5E6SB 4DJFC 1XQ6A 2Q46A 2YNMD 2Q41A 1ZUWA 1A7UA 1Z6GA 1PVVA 2WB4A 3OMLA 1FYFA 2CMHA 5KKNB 4QYIA 1U4OA 3HKCB 1GTZA 1XVIA 4Y2JA 3U3RA 5IHXA 2JI8A 2V5VA 5CURA 4MRRA 2EFGA 3GJ8A 3ZIDA 4DSOA 3SS7X 1AQUA 1SZPA 1YS1X 2NYRA 4IEFB 3RAPR 5C2JB 4FMCB 5ALTA 3CR3C 5ALZA 1PJSA 4HUQA 3I9KA 1A4UA 3KOUA 4DLNA 2Y1OA 1X19A 3PQ8A 1PZFA 5EWMB 4A91A 4YHHB 1XSEA 3U3JA 3ZHVA 4YUYA 4C0QC 3AW9A 1AV7A 1W52X 2PXAA 5IP5A 4CIXA 2CGEA 3WQHA 1ZZEA 1CD5A 3AIIA 1U2QA 1V16A 4NBNA 2IU6A 4L6CA 1U2PA 1BJKA 4M9QA 4YRIA 4L4YA 4AS3A 2K5UA 3JYNA 3IUSA 3NOXA 4EFDA 5KJCA 3UPTA 2RGEA 2BSXA 3ANSA 3W5HA 5MGNA 3LWBA 3F4LA 1CUBA 2IHYA 1ZL2A 3CLUC 1PUXA 1XFDA 4DCCA 7MHTA 3VZRA 1JTEA 4UBOA 3OJCA 3GGGA 3L6OO 5TXGA 2QIOA 1Q0UA 4Y1RB 3JWJA 5EMMA 2Z3ZA 3VV3A 3E58A 1Y5RA 4D96A 1G4AE 5I01A 2GZSA 3O95A 4KPFC 3NV7A 1KPGA 2F8LA 3B6MA 3LBHA 3NEPX 4AO6A 5I5GA 3K71B 1KOFA 2ZT5A 3PD0A 2IOFA 4TVKA 2JVKA 3ACBA 2GZ1A 2JFYA 2VEDA 1E77A 1VL8A 2JB9A 3JD4A 4K5QA 3TQQA 4KZPA 4UXIA 3WYNA 5A4DA 5KSOA 1KAHA 3ED5A 4EYQA 5LMUB 3M33A 3NUGA 1RXIA 3F98A 3EZ6A 4G23A 3T34A 5B7QA 1S2LA 2NYVA 3FMVA 1B4DA 1DWOA 4XVQA 4RWEA 3PNKA 1ZU4A 4H27A 2F3UA 5KYWA 4WESA 5HS6A 4C0SA 1FDOA 3KEFA 4ZZ3A 1TZBA 2QMHA 4W6ZA 4N3BA 1HQCA 1U02A 4TVSA 4DC0A 1SVNA 4LE2A 2FSGA 2O7RA 3GK3A 4OHVA 3WYFA 1RAGA 1DAGA 4BO7A 2HR1A 3KTFA 1RZUA 3SHQA 6REQA 4HXGA 4HADA 4FC7A 4EW1A 4TLEA 1ISHA 1VLZA 2VWPA 5JWRA 3THWB 2O06A 3UMJA 2C2GA 5IAEA 1Z82A 1RLMA 4L5JA 4UDYX 4UFPA 5JZMA 2O57A 4DTIA 1SBTA 1BC5A 2O2ZA 1VMKA 1X9IA 2ZBQA 3IIKA 1S3GA 3D8HA 3GLVA 4U02A 2V7WA 2IU0A 3IKVA 5HRCA 3ITKA 4W8OA 5IX8A 5I4CA 3LT1A 3SAJA 4C4XA 1B1AA 1EZ1A 3HRHA 3RGGA 2XTAA 2DUWA 1BX0A 1C0EA 4HAUA 4JYPA 4UHFA 2H4JA 1G5IA 3EQ2A 3LLVA 1P7WA 3ESBA 4LWOA 2QAGA 2ZSEA 4IDOA 4U3JB 3RRBA 1FYDA 4GZLA 4EZBA 3BSYA 1EKXA 1NE7A 3RYHA 4PHHA 3IAS1 4D3YA 4C5AA 4YDRA 2KBFA 3MM4A 3EOZA 3R7BA 3WFIA 1L4HA 1U5CA 3N0RA 3TRFA 4BRUA 5GADl 1ZSVA 1K3TA 3HBNA 1UC4B 2KM1A 2VZ9A 4E4TA 2ZRKA 5ULLA 1V25A 2ANCA 1P0CA 1RQRA 2PO7A 4KDFA 4DXAA 4NYMQ 4MPTA 2ORVA 3LXUX 5C4IA 4JY7A 1F06A 4KVAA 4G0VA 1I13A 3EPRA 4KW7A 1L7XA 3AOEA 5TF4A 5DTQA 3NYRA 2X2FA 4YRGA 3BDIA 3JWPA 1C8BA 4M2LA 1YGYA 3RU7A 4JLOA 3LPCA 5DXAA 1MC8A 5EPUA 3RARA 1NOKA 1JHXA 2H00A 1JDZA 2FG6C 1PL7A 3LUHA 2X40A 4F0JA 4GSLA 1U6JA 4CV0A 2VJCA 1CJUC 5JCJA 4AKHA 5DTEA 2X42A 1KKUA 3CO0S 4JL6A 5KCMA 2D8AA 5BNTA 4A8PA 1K75A 5G41A 1U0JA 4JLNA 5E3IA 1GHTA 3BQ9A 3WNBA 3DMYA 4Z4EA 5J5AA 3UPDA 1JIXA 1KFCB 1A2QA 1TQHA 1V48A 2YVUA 3GLHB 1O9HA 4H3HB 2AXPA 2R25B 3AZPA 2V7UA 2YMPA 3FMGA 4MLPA 3RH0A 3RM3A 5FPKA 4QQNA 5JNRA 1Y8AA 3A6DA 1UBSB 1H42A 2GCEA 3GGJA 3W79A 2BGMA 1VP3A 2G1JA 4CLOB 4HQ6A 5IBQA 3R3JA 1EVZA 2R6GA 2WU0A 3GUCA 4LN1A 5F3RA 4XX0A 1OXVA 3VHRA 3HSKA 2UKDA 3DTYA 3F78A 3DKRA 5IAOA 1MOPA 4ZRDA 3CN9A 4IX1A 4KMSA 1GYRA 3ZVNA 3IUEA 3L8FA 3OLXA 1BW9B 1JPJA 1DC5A 3JD1A 2Y0PA 5KNCA 4BDTA 4IV5A 5DZSA 3ECAA 1EQUA 4G09A 4Z0HO 1WKVA 2Z95A 4RIIA 1ADFA 3NM4A 3CUTA 2XEXA 2JAUA 2CJXA 2XJ9A 4ERXA 3HU2A 2V6BA 4PNPA 2PS1A 3LVBA 1PT9A 3T7EA 5H02A 4FLFA 3W8EA 2FFAA 4I19A 3AL2A 4E2XA 4TUYF 5JNTA 4U0KA 3Q7RA 4IDBA 4JU9A 4CN9A 1XPJA 2RARA 4TUYA 4UHCA 4B43A 4F8YA 2Z9CA 2LIVA 2DQKA 4K9MA 3F96A 3VC2A 5FL7A 4R8LA 2YL2A 4GKAA 5ENZA 4G9EA 2W11A 3FIUA 4G1FA 3RSQA 5A4AA 3F6EX 3FJOA 3KJGA 1T10A 4GM1A 4O4JB 4P8RA 2W0MA 5GPBA 3R7NA 4TTAA 3BRWA 1KFBB 3VTKA 3NHSA 1GUDA 3H4VA 1AF7A 1XZIA 2OBMA 5A3VA 5L3ZA 1GPLA 1L5ZA 2LNDA 2IU4A 2NQ8A 4G0QA 5IT0A 1OU0A 1CUYA 1Z12A 2DLDA 2EKLA 2PVPA 2Q1YA 3T5DA 4A1FA 5IJ0A 4DA4A 3N39C 3VYVA 3PVZA 3NHLA 1EFHA 4DDVA 4G5RA 2CYBA 1V6SA 3A4LA 4D26A 4MS3A 4ZARA 1JU3A 3UK0A 2GBIA 3VKUA 1VCMA 2K2QB 1CWUA 2A5FA 4Z8YA 5BNIA 2ZUWA 1O57A 2WLTA 1UBTS 1Q92A 2GEKA 3WZ2A 4D81A 4YP7A 2C29D 1QKIA 3D54D 4EY8A 2CSUA 3O0DA 1Q12A 2GBGA 4EPVA 2POCA 2FQQA 4JZKA 3JZMA 1GAEO 2DPHA 4B2IA 3K9QO 4GLJA 3UW1A 2LIPA 3NV9A 3WK9A 1U80A 4A16A 5HX7A 3S1SA 2FPUA 5G4KB 3VR4D 2JCXA 3K0BA 3HI4A 4JJ6A 2WU1A 5FWYA 1B23P 4UEOA 2E5LB 1NA5A 2ID8A 4LXQA 1G3IA 3RVNA 1NPDA 1ZCZA 2RAFA 3QLEA 4HEJA 4OXKA 4YP0A 2EG5A 4Q4DA 5A05A 1AKNA 2QQEA 2YVLA 2XV1A 4YRLA 4J4HA 2MSEB 4H7DA 1R27A 2XNDD 3IT3A 2JEZA 3L9WA 4MHOA 3CT4A 2C4MA 3D0KA 1RYBA 3R09A 4CTMA 4YRSA 3HM2A 3CJRA 2Z4RA 3QBVA 3GJ6A 3L05A 4P35A 3WK5A 2R44A 2I4RA 4IOKA 3CV3A 1Y33E 3DVQX 1LX7A 3QGMA 1SK9A 5LUBA 1NVFA 2YH2A 3PL1A 4UEJA 1ITZA 2AN1A 1N6PA 2FUEA 5CJPA 2FPGB 3FKSA 4ECEA 2VJPA 1Z7GA 4YT2A 3K9GA 4MP8A 4HN4B 3GOQA 2QGFA 2YY7A 3A6HA 1WUIS 4P3PA 2JGNA 1E2IA 3K7EA 4Z1MA 1AKEA 3DF7A 3EGDA 1DAMA 2HAEA 4PV7A 4XVHA 3ZWOA 4DWWA 3V1UA 2I76A 1I14A 3RK0A 4NTZA 2I6UA 4WNCA 4LZPA 3QW4B 2UAGA 2JGMA 2WWHA 3AR6A 3TZHA 2BM9A 3VH3A 5IANA 1FIUA 2WM9B 3O8QB 3T15A 3ZPXA 4ZO9A 1TDJA 2EDAA 5TT0A 3GGOA 1FSGA 3WIOA 3ETDA 4I8DA 4KQGA 4R8KA 1AUPA 2CL7X 5G53C 4EKEA 1PQWA 3EWSA 3R20A 4CNBA 1Q1NA 1C9JA 3V4OA 5BWMA 3COWA 4AX4A 4TRJA 3VAYA 4IHKA 4R9RA 3ET5A 1A9OA 2D5CA 3QE4A 4FBLA 2AJDA 4IIFA 3UAWA 3X43A 1E9CA 3PNMA 1VCHA 2YWGA 4OG2A 2BKAA 3CZQA 3PC7A 3SBEA 2QLTA 4KRFA 4LYDA 4KDEA 4B6FA 2Q6VA 3EVDA 1AGNA 3H2GA 4RZUA 5J5CA 1XRSB 1FNDA 1T36A 3DDWA 1M8PA 3KWMA 4HWTA 4UM7A 1SU6A 3I6MA 4NFYA 3O3MB 3TG2A 4GDMA 1M8KA 3GG2A 2VJAA 3CZRA 3LWNA 1L7PA 2JDIA 4URZR 1XXLA 1J4AA 1FDIA 4O59O 4UPVA 1SUEA 2HH9A 3GEEA 5FB3A 3IOBA 2ECOA 1KE2A 2LDBA 2YMQA 3A3OA 4DEXA 1V0JA 3NNDA 4MWZA 4FMBB 2Q3LA 2XTZA 4JJGA 3WV4A 3ZKWB 4BKOA 3FW1A 1F9EA 3DVAB 4ND1A 2EL7A 4LDNA 1H2BA 2QMEA 4O33A 3UYLA 4BBJA 3NPMA 3GC6A 1U8UA 2NZ8A 3DQZA 4MCAA 4TTRA 1HYGA 2IRWA 2P65A 3V7NA 4BQNA 1Q14A 2JH9A 1K6XA 2VDWB 5E1MA 5D5QA 2AD1A 4OLBA 3WGMA 2QZZA 4UUBA 3GP5A 3RABA 1Y4SA 2RGAA 1DBPA 2YQZA 1H6DA 2ICAA 4II2A 3WWYA 1EFCA 4YPVA 2Q28A 5KCZA 1ISFA 3KQWA 4CKCB 4D9CA 5LQUA 2GKGA 3PEWA 3SF0A 1HH4A 2YVQA 4B0PA 4W5WA 3LQ2A 1KVRA 2I1LA 2QWXA 2FEPA 2VAVA 2NX2A 2IZ1A 3K9HA 5D87A 4NU0A 2E4WA 3SK0A 4DV6B 2PTGA 2BTQA 1U2EA 2OM6A 3BFKA 1GJRA 3DMRA 1LBIA 2IS1A 1KS9A 1XLVA 5BRAA 3IKMB 1KI4A 2VSNA 4ZQHA 4LZWA 1UEIA 3IP9A 5B3JC 4TWIA 4DBZA 1GGJA 4BCCA 1YBMA 4QDTA 3JASA 4MJLA 3NASA 4O63O 4BIMA 4DLSA 1OA1A 2PUDA 1SCQA 4Y9SA 1N5IA 3Q40A 3RI3A 4TKZA 3WL4A 1V4NA 3IVGA 4RSRA 1WOMA 2PV7A 2CXNA 2HLDA 3L0BA 2QSUA 4X20B 3OIVA 1COWD 2E55A 5AWFC 2DG2A 3DKIA 3TSYA 1C0LA 1RLUA 4ZHQA 2O8FA 2HMYB 3I2IA 4GZ3A 3C3KA 1WU7A 1TCAA 3QVKA 1MX5A 5LZ5A 5FUMA 4FQ5A 4MGIR 4IDFA 3KDSE 5FV7A 1NV8A 4LFCB 4ACAA 5J63A 1TEHA 3GJ0A 1M6YA 1P2DA 2C78A 2FW8A 2OFOA 5AXBA 2BHSA 1TVCA 5K45A 3G2OA 2ZYSA 1BSVA 2XWQA 4MQEB 1T8UA 4JEIA 5HQ3B 2CNOA 2WFAA 4BFLA 1E1RA 4NOJA 5IUJC 3D3WB 4EHBA 1S2IA 2BH2A 4DCSA 1GO2A 5HQTA 1XFAA 4QBIA 5CFQA 2C5SA 3FETA 1A3CA 1OKKA 2EL9A 2A9JA 4KCGA 4KQWA 2HF9A 1QPBA 3K9NA 3ND5A 4KE7A 1WABA 3H83A 3BMQA 1D2HA 1XU7A 5AVXA 3CRZA 2VK4A 4N6NA 1ZM9A 5KX5F 2CZQA 5M04A 5YASA 1SCNE 1P6UA 1PR9A 1CDOA 1QYWA 3H2HA 3NOOA 3ELYA 3UTCA 1X38A 2JKZA 5KX5A 1NKSA 1LSJA 1M6WA 2R8PA 4X6XA 4FGWA 4ZJPA 4HG2A 1E3SA 5EP3A 2WSLA 4ZYVA 2WIGA 5CAEA 1LZKA 1R5BA 1Y5MA 1KJZA 4NHEA 1QVZA 1GUYA 1H2HA 1Q1AA 1Z33A 3JQQA 1F2TA 1CZRA 1MTZA 3K0AB 4NCNA 3RYIB 4BLWA 4DNFA 5BSHA 3RODA 5BQFA 4ZOAA 1N3IA 3E9NA 4XLZA 3IT0A 3NVDA 4EDFA 3AF2A 1DRKA 3VJKA 1KI9A 1MT3A 3TKYA 4BO4A 2FJPA 1O6BA 5J4LA 2CNWA 1VYVA 3BWMA 5BV2P 1W9HA 2CVPA 2ZSDA 1W1WA 3RHSA 3QPVA 4YPOA 1MA3A 1RYHA 3DC7A 2H92A 2BJVA 1MTOA 1WW2A 2CNNA 2VP2A 4FIZA 1N9KA 3CNHA 2GAAA 5BN4A 2BR3A 3W3AA 4AY6A 2PG3A 3EPJA 4NENB 3MAJA 1HOXA 3ASYA 4OB8A 4OQFA 5FWXA 1THTA 2JRLA 2FX3A 2VWHA 1T26A 4PRYA 3TB4A 2UZ1A 2PGLA 1IXKA 4DAEA 3SYTA 5KTRA 5FYQA 3HJFA 2X8JB 2F1OA 2OLKA 5IZCA 2IGTA 4WK4B 2VHCA 3AKEA 1MABB 3HA5A 4G24A 4PSCA 5BNZA 4CEHA 1WPQA 1QUFA 1JLMA 4BX3A 2PMKA 2Y1LA 2V3WA 4E07A 4S1WA 1EK0A 1XVLA 2IYPA 3GJRA 3IVXA 2PBLA 3E0XA 2IY8A 4HNUA 4V1CB 3ILSA 3WNCA 3QXGA 1I4EB 3D7MA 2CFOA 3MIIA 1GL9B 3P9IA 2Z4SA 3LBNA 2ZR7A 3CGGA 1G21E 3MBIA 4KMRA 3SZ3A 3WICA 1H4SA 1RZVA 4KHZA 3GAZA 1X13A 4NEQA 1QHHB 3AEQB 4BO9A 3LY7A 5HZGA 3B36A 4YAOA 4FCVA 2VPPA 1NZDA 2X9NA 3AVWA 1MAVA 4ZVSA 2VWQA 2WVHA 4DWJA 5D3MA 5GGYA 3R75A 3G0HA 1DGQA 1IBLB 3L6EA 2FLKA 4MGYR 2COUA 4LJ5A 3OLVA 1Z17A 2Z04A 4HQFA 5FADA 3AB3A 3G5TA 5KSPA 5C34B 3CPEA 1EJBA 3P0EA 3IA2A 1JVNA 1RZRD 4QPZA 2R6FA 3AR8A 3GIDA 1AKQA 2GN0A 2XT9A 3RSOA 2HV8A 5I7WA 3GJTA 3AEZA 3VDXA 4X00A 1K4MA 5F78A 4D8VA 3DDNA 5KI6A 1J8VA 4RULA 1IWOA 1VPEA 1Y1QA 3MJFA 1SB8A 3Q5DA 4MR8A 3OAAA 5TQJA 1H1LB 4TQ9A 3B1XA 2PS3A 2VT6A 5C7LO 2O8EB 2BEWB 4EJMA 4HMOA 3S28A 1FBTA 1NAHA 1FMCA 2WJWA 2DB3A 2G9NA 4C4PA 3FOZA 3UWOA 1YR6A 3MB5A 3RNOA 3MGBA 3KNZA 3RK1A 3SCZA 2O8NA 3ZCVA 1AQJA 2UYQA 1NBIA 1R50A 3HV0A 3OZFA 3FGPA 1YDMA 2GUGA 4N5HX 3UG7A 1QF6A 1IH8A 1Z5UA 1TZMA 2H0RA 3C8DA 3MRSA 5DCUA 4IKOA 5EXEA 4ETMA 4A8JC 1X39A 3VR5H 3ZJVA 5I9SA 1R74A 1ZNZA 4OQLA 4ZI7B 4DV4B 2ILTA 5EZQA 1PO7A 1UOEA 1RAFA 1DOAA 1JT9A 2C9DA 4QNRA 4GWGA 1HR0B 4CF7A 1ML3A 1CY0A 3PEYA 1QGED 3HKBB 3KHKA 4L4SA 5F9FA 1IXZA 4NCKA 4R1LA 5HKLA 2AUTA 4MMZB 1IPFA 3PFFA 2QRKA 3EY9A 1BCRB 1NW5A 1QRUA 1N7JA 4HQ0A 4Y2GA 2JC3A 1H1TA 4PIPA 2ZUCA 1RPZA 4HLDA 3U7EB 1JT2A 1J6UA 1QX3A 1PGQA 1G17A 1L4LA 5CT9A 4EX6A 4KAFA 1NUAA 1ZAYA 1XRRA 2VHWA 3EUAA 4K3VA 4M46A 1FCJA 3W6NA 1A9YA 5DP1A 1EA5A 4D4IA 1TI7A 4NNPA 3UT5B 1ABFA 3ELBA 3F4KA 4XH9B 5H4GA 4BOYA 3AVTA 1QH8A 3DUWA 4ZV7A 3W2GA 4AI6A 2PFKA 3RRXA 5AW4A 1QDEA 3HSYA 3P5SA 4M1OA 2FVXA 3DL7A 3HBAA 4JMPA 3LJKA 1S2GA 4AUMA 4EBBA 1BA2A 1FVXA 2WMDA 3IESA 3QX3A 4N0DA 3G5LA 3KL4A 1XQWA 4F3KA 4MYCA 3VKHA 1J5XA 5E38A 3WKAA 2KHZA 4RVCA 2VPXA 3AF6A 2AC4A 1KWGA 1QQBA 4RM3A 1E9EA 1SU4A 2Q6LA 1AC5A 3B1WA 3WY9A 3D8SA 4IIXA 1PL6A 5KC9A 3M4ZA 4YXFA 3C3WA 2PIDA 3HUFA 1NT4A 1SZCA 4UEKA 3STXA 5JJIA 5KTMA 4FEGA 1FLDA 2WSMA 3U7IA 3WXMA 2B7LA 2B2CA 3C43A 1J0CA 3MAGA 4MV9A 5ESRA 1C0IA 1MG5A 1UDXA 5HG0A 3VTZA 1PR4A 2NZWA 1GQ2A 1RACA 1ZMBA 2HREA 2OZLB 2R96A 1P8AA 3O38A 2HRCA 5AJWA 1HBJA 3C48A 1XAHA 1BCSB 3KAQA 4FFOA 2BMFA 4IZOA 1JHPA 5EJ2A 3CX8A 2R7MA 5KOYA 4QGSA 4PG7A 4PIMA 1T5OA 1X74A 4F7DA 1KNQA 3OJXA 3GQVA 3RVBA 3FBGA 1ZKMA 3QPUA 4NHOA 4M9SA 1KH2A 3I3SR 2ZDGA 2ENWA 2RI0A 1O87A 1PGPA 2ZWIA 1D6NA 3AUFA 5FXMA 3RG2A 1EVYA 1SC1A 4FEEA 4AKTA 2VF8A 1IZZA 5G1PA 5IS2A 3W5CA 3HJBA 4X0EA 3WMXA 2CNBA 2FF7A 1YZKA 3OQBA 5FOXA 2BGLA 4KV7A 4AZVA 2BEJA 5ADHA 3NRJA 5JDIC 3N8IA 2P9QA 1XJQA 3ZZNA 5HM8A 2QSJA 1UDAA 3T12A 4B79A 1RSZA 4FFBB 3TL6A 3EPLA 5T5QA 1Y3DE 3LDGA 3WWPA 1YVPA 2H2IA 3IKJA 1L4GA 3BWYA 3I4FA 4HAOA 4PSAA 4F2HA 1AD2A 3M3PA 4ZO6A 2ATIA 4QUIA 1UMCB 3OQIB 3S2SA 2WU4A 3T9DA 4E30A 1XHLA 2RHTA 2GN1A 2I54A 2DR2A 4U9HS 2QJWA 1JYSA 3BHNA 1U0OC 1Q95A 5HE8A 3VU9A 2LXNA 3ZR4B 4CUJA 1PBNA 1F3OA 3DAYA 1PNQA 3B2QA 2X76A 4ZYWA 2OCBA 5EJ4A 2NMVA 1MJNA 3ZTYA 2ASVA 1XEFA 2JFHA 3BDVA 3EXFA 4FFPA 4C2BA 2PBFA 4E03A 1J09A 3M81A 1NOIA 3OEWA 4EABA 3DHWC 3RJ5A 1C4OA 1I0LA 3DD5A 1QFMA 1DUVG 2MYUA 2ZYWX 1W4AA 1V4BA 4FLMA 1XP8A 3Q0IA 1J20A 1YR8A 4IVRA 4D41A 4BRWA 4NCAA 4G1VA 2VI5A 4JS0A 2KX7A 5A4MS 1C0PA 1V8BA 1PG2A 4WJZA 5LDHA 2HKIA 5F4BA 2KLHA 4GXNA 4O6VA 1TRHA 3PA6A 2ZTSA 3DGFC 1CJTC 3ESZA 4JQYA 5DHSA 3HWX1 2CWWA 2UYYA 1T2AA 2PQ2A 3RRFA 3ROPA 4BJ6A 4QUKA 1ZH2A 1EBUA 1VBMA 4EP1A 2IZ0A 2ZKIA 4DL9A 5JU6A 1N2ZA 2I71A 3RU3A 1PDOA 3QYPA 3IHWA 2OXRA 4DDUA 1WMFA 5A5VA 1UJ6A 1CULC 1DHRA 5C3MA 1NWHA 2FRDC 3B20A 5EXSA 1JEYA 3GDFA 4KACA 1ZGBA 2PM8A 5IASA 5J2TB 1C8VB 4Z7NB 2VS1A 3B6KA 4OYLA 3F6PA 3IBYA 4GGOA 4ZOBA 2XYHA 3R7WA 3SIWA 4UNQA 4X6YA 2QENA 1Y6RA 1JAXA 1E61A 1JHMA 3QI7A 2C0PA 1GZHB 3BTSA 1U2GA 1XCMA 4QXQA 2X5NA 1WUKS 2XEDA 4BNIA 3M8KA 4M8LA 1KS2A 2P5TB 3ZWPA 2A2ZA 1A2BA 1VHLA 2E1RA 3EG5A 1Q20A 2HBRA 1O6FA 4K9LA 5AKYA 4B3XA 5KOHB 1M10A 2DWQA 1FX0A 1G5HA 4OP1A 4ZAXA 2O8BA 4ARSA 4ME6A 2B8EA 4YONB 3CRMA 4MKZA 2RHHA 3AR2A 1X15A 3K6KA 3PQ7A 2BHNA 4BQSA 4FBMA 2K2WA 3CG0A 5LIPA 3BFVA 1YKGA 4LPSA 2B0CA 5ELXA 2ALJA 2DHDA 4ALLA 2WYHA 3FVWA 3KQSA 5EIWA 4M7RA 3VH4A 4J0KA 3ZVRA 4JYMA 3R5XA 1RYYA 1N3LA 1O4WA 1W73A 4K9NA 3T0IA 2ZSIA 1R18A 2FK8A 4JFRA 1HT1E 3CVOA 4N82A 4WLOA 2VYVD 3TVYA 4BFYA 3GLGB 1MBZA 3DL2A 3ND7A 1XKQA 1KI6A 1UJ4A 1DBSA 2FDRA 1KR2A 5BV8A 1G66A 1EINA 4HRYA 4IO1A 4EARA 3K05A 2O54A 3TPFA 3QITA 1CUZA 2HQRA 3C4VA 2OKGA 3MPUA 3HCWA 5J47A 1OH6A 4I36A 4KXMA 1FRNA 3QXHA 3ZX5A 1CQWA 3RSFA 1TB4A 2QNIA 4MR7B 2PZGA 4BASA 4DYVA 3D0OA 1VIAA 2FMUA 1E94E 5CFNA 5DNVA 2NM0A 2FPMA 1Q22A 3R9KA 2WF6A 3G0BA 3JY6A 3LUAA 4HZIA 1JUDA 2E4XA 2PBZA 3E5NA 5A3SA 3T9CA 4BC1A 2WHQA 5EE9A 4JEMA 5IDQA 4QOIA 1U28A 3G2QA 2B4AA 2EZ9A 1G59A 1JSRA 1A7JA 1FTQA 2Y27A 2P27A 2D00A 1WU8A 3P9XA 3U40A 1UODA 1J99A 4DA8A 5CT5A 1NR5A 3EH1A 1U1EA 4LEIA 5T67A 2N42A 2LV8A 1QGOA 2IOFK 3RVKA 3U3ZA 3S8EA 1HRKA 3E9QA 1NXPA 5FBQB 1TLFA 2A1IA 2WP0A 2HCFA 1P31A 3KUDA 1NI5A 4BE4A 2NP7A 1L6IA 1LK5A 5IYZB 2A9KA 5TVGA 3AXTA 4OAOA 5CDHA 4TKVB 2CL0X 5HA5A 2BTOA 4JJAA 3IVMA 4IJWA 3TZBA 4HXFB 3ZDRA 4B4KA 4TKUB 4TT8A 1RVV1 1SKYE 3DQQA 3DZIA 3MQ2A 5F9MA 3RLFA 3NRBA 2GHIA 5FBKA 4D9HA 5LPNA 1Y6FA 3NVKI 5BW6B 3BUSA 3A9SA 3DTTA 3GGDA 1H8EA 2DFTA 5FWYB 3MWYW 1U2DC 5DMHA 3VOTA 1T15A 1XGKA 2WA2A 1ICEA 2HPAA 4KO3S 4Z9XA 4NLLA 1EWKA 5CB8A 4B0OA 1JEAA 1XRJA 2FWRA 3IB6A 3U5TA 1P29A 3DXYA 3PC2A 2VDOB 2CD7A 3BJRA 4KQMA 3GEMA 1UM9B 1URPA 4LI3X 4FJ2A 3D7LA 2IEGA 4JOBA 4H1VA 5EP1A 2I2AA 1TUEA 2VJDA 1B7GO 4RX1A 1OYOA 1U3CA 3BN3A 3E3NA 3OTQA 3LL4A 4JA0A 3I12A 1P6XA 3NUQA 4RIGA 3LLSA 3KJNA 4D9FA 2J9ZB 2WJVA 5AJVB 3S5JA 5L7TA 4FQ8A 4WLNA 1HDOA 1TZCA 1FFBA 1XZBA 1ZOPA 2JAPA 2ZREA 5ESDA 1YUMA 3QEMB 3VTFA 5DE3A 4U8HA 1PG0A 2GA8A 4OH1A 2VBFA 4X3OA 4QDOA 5EKXA 3U3KA 3DLAA 1WP9A 4CR7A 1YAHA 3LKZA 2VTBB 3FUXA 2G1UA 1YCHA 2WDZA 3DTVD 4F97A 4B3SB 3UV7A 2B34A 1XEAA 1P9RA 1LNSA 3AV3A 5CM2Z 3STHA 3UUFA 4IUYA 5FV4A 5IWCA 3VC1A 1XMVA 1E89A 2JBWA 2OHXA 2CBGA 4LC9A 1U6IA 2ONYA 4LSMA 1ZS9A 3TL3A 3V80A 4AO7A 1DKMA 3DV2A 4IGAA 1ML4A 1N32B 1YBFA 2F43B 5CEFA 3NC0C 2FN4A 5SY9A 2WOOA 3V8NA 1OAKA 2W4QA 2DAPA 1RBYA 4Q3DA 4AZSA 2P0EA 3WLEA 3RSZA 1RKBA 3GLUA 4RKEA 2CLHB 4KHPB 1CRWG 3AESA 2YXBA 3ZW8A 1O0BA 2C9BA 2DUJA 3FYHA 3IXLA 3JCZA 4OM7A 5GONF 1Z6ZA 3JARB 1HLDA 5F1KA 5GONA 4GAEA 1K3FA 2ZUFA 1KAGA 4WK0B 3UJPA 4H1UA 3PTAA 2WUGA 1DKNA 5AI0A 1ZNYA 5FUVA 3D2LA 1M7BA 1RYNA 4OB6A 2VBGA 2IQ5A 3SD7A 2O1WA 4FDUA 2B3DA 1XALA 3E61A 4J8PA 4L0CA 4KG7A 1T8WA 1G8SA 1A82A 3EA0A 2Y0BA 4AL4A 2DHCA 2G88A 2JKYA 3JD0A 2ETVA 1BO6A 4KE8A 4KLRA 3MVEA 3IBSA 2D2EA 3IT2A 4M8KA 4Q3CA 1M6VA 5JLAA 1ZRSA 4FGUA 3QG1A 2CFIA 4ES6A 1ZX1A 1VLVA 4H1WA 2IP4A 5I3ZA 5GZ6A 2MHCA 3A1UA 5E7QA 2BMDA 2HFJA 4GX2A 4UHHA 1IZ9A 2EFDB 4IHJB 3ZXYA 2H9YA 5IT9A 3UJHA 4IJMA 4A27A 4II7A 5C51B 4FZVA 1E6LA 4UQLA 4UDNA 4DIBA 4PLCA 4IIHA 5CMLA 2P9YA 4IJUA 3F3SA 3JYLA 3CX6A 4R1PA 2CLEB 4P81A 4C14A 4H4DA 4QIHA 4NBTA 5DM60 3SKXA 4DNQA 2XT6A 4RANA 3UMSA 4DUGA 1Z4OA 1K6MA 3OFND 4N6OA 3VVBA 4DMFA 4DLTA 4FGKA 2VPQA 4M98A 4MRNA 3RE1A 1OR8A 4YT5A 1E59A 3FCUB 3QU5A 5C4MA 4G07A 5I4IA 4I3GA 1POXA 1GU0A 1Z75A 2ZYVX 3LFTA 2V7XA 1LPNA 1KEPA 3GLFE 1PZNA 3D3QA 4RPGA 1P2GA 1K7YA 3H8JA 2G4CA 1XDBA 2XXAA 5FR2A 3I2GA 1UKZA 4F6CA 1Z74A 4KBYA 4UM9B 1PJCA 2ATEA 2H1VA 3NC4A 3WOHA 4AULA 1PGJA 1S6YA 2DC1A 2ZJ5A 1N5RA 3AEUB 1IHYA 1J8MF 5FRDA 3RGWS 4R8RA 4OPMA 5LIRA 1F51E 1MX3A 1USWA 3RS4A 1QV6A 3KR1A 3TRJA 4WXEA 3AH8A 2ONCA 4AYXA 4EHIA 2YJ3A 2WQ7A 4DWOA 1JIQA 1G5RA 4AIIA 2QBYB 1UKEA 2AXEA 4YNBA 2EFCB 1WM1A 4LXHA 3WDMA 4CT4B 4CKBB 3KQLA 4I4LA 4Q3NA 3WLLA 2ROQA 1ENOA 4JNCA 4BQFA 3ETLA 5TNXA 3GPIA 3NFRA 3HYTA 4OL0A 3HB1A 4WZBA 2ZSBA 4HYTA 1G0OA 1ZQ9A 1E0KA 2Q49A 3F90A 1JJVA 1O96A 1WTAA 2VTVA 4PANA 2JD0A 3ZV7A 5HIKA 4X5OA 1IQRA 1GGVA 4YO8A 3KHTA 5FPTA 3BZWA 2PGIA 1W76A 3OCWA 3O6VA 3KUKA 3OA2A 4V0KA 1C9MA 1YHYA 4O8ZA 2C5AA 2VA9A 2YZ2A 1XO1A 1KMMA 2DU8A 3LZ6A 4OUDA 5B64A 3R6DA 1M0WA 2AR0A 2CLMB 3OIGA 4IKEA 4UMVA 4XA8A 3L8ZA 3RS9A 2GN6A 3RR2A 3COYA 5LMNB 2JJQA 1OUMA 5JALA 4FOSA 1KNXA 1QO0A 5DHQA 2PU5A 2YFHA 3R3VA 4YIHA 3FMFA 2VPWA 4P3NA 1NMXA 1TVEA 1MZVA 2CFCA 1NPTO 1ESDA 3CGWA 4GLBA 4MB0A 2IHBA 2O3QA 2ZUSA 3B38A 2BR4A 4KYIB 4PO8A 1CRQA 4XCVA 4Z9FA 1Q3KA 1CQZA 1SUDA 2P41A 3CYFA 5KX5B 4LJKA 3GGSA 1Q0HA 3FOCA 4WEQA 5MDHA 1Y7HA 3MTGA 5JRJA 3NIGB 3R3HA 1Q84A 3JAMA 3I4CA 5EUMA 5CAEB 4B3IA 3BD7A 1DFIA 4CGYA 2AJLI 4ENSA 1E5DA 4UJ5A 1P18A 1EUDA 1HEYA 4L57A 2R8OA 3H4TA 2X4LA 4B80A 2HMAA 1Z63A 4IH4A 3G7UA 2PLWA 4ZCIA 2XKAA 3L3BA 1TT5A 2OV8A 4CCYA 3FOBA 1LRLA 4LHWA 3D8RA 2C61A 1IN6A 2WWTA 1Z0KA 2ZAIA 3O5AA 4TWJA 4ZEOA 1PTKA 3EUFA 4NCHA 1OAOC 5DH9A 3VJLA 4D8WA 3K9BA 3OOHA 1YACA 1H3NA 4TLMB 1U0RA 1PDVA 3TUZC 1E3MA 3CZPA 2X13A 3H11B 2J9FB 3R1IA 4ZJYA 2IDMA 1TZJA 4C4YA 3IMCA 4YFVA 2ZSHA 5FPSA 1Z0SA 4OQXA 3AT1A 2OO3A 2DWUA 2LP4Y 5CTJA 3RS8A 4XQ0A 8OHMA 3N2YA 4JUIA 4QQRA 2PUTA 1FVOA 1U8EA 3S3TA 5IXJA 4ETIA 3IAUA 4CKWA 3O7WA 4HD8A 3Q9LA 1B74A 4UKDA 4J16C 5A5GA 4IRMA 3ENZA 2J5RA 3MOSA 2GQ0A 2MT9A 5E7JA 4C3ZA 2ECPA 4C7OB 5JD3A 4QDZA 3JQAD 2J0VA 4AG6A 4IGIA 2QVGA 4ZMBA 3KOXA 4AM8A 3EMDA 5H8WA 4LSGA 4JI2B 1CR1A 5ALUA 4X8OA 3RUHA 4B48A 4KWHA 4HT3B 4IDEA 2D1FA 7GPBA 1BZYA 1XTJA 3A4YA 2C2WA 1SXJE 3GH1A 4ML3A 2O0HA 2M6RA 4RVHA 2IF0A 2Z56A 1JMKC 2GLXA 3CUWA 1KDVA 2CDNA 5KAMA 1OZFA 2KS6A 4ALIA 2FG7C 1LJ8A 1MH9A 3GA0A 2R3SA 3VHQA 3Q3GE 2Z5VA 5E1BA 4D9NA 1LNQA 1U5BA 1FFDA 2G7ZA 2Q5OA 3AP1A 2Y92A 1SXGA 3DL4A 1W35A 3PXUA 1TMKA 4WOBA 1YRYE 1Z2AA 2JI7A 3M6AA 1FYVA 3UO8B 3DE2X 4J90A 1SQGA 2BDUA 4HB0A 1HE8B 2OCPA 3P2KA 3OZSA 1DTWA 3A4NA 4BB6A 4I5FA 1A9XA 1WCYA 2XCOA 1QDLB 1WEKA 4JROA 1JQEA 5DSZA 4NMMA 3WWCA 3VKVA 2I2CA 4CIVA 4EG7A 5BSWA 3B3JA 2AHRA 4OKNA 1KXZA 2R9VA 5EJIA 3KRTA 3F46A 5DYYA 4TTJA 1PCXA 4ZOCA 4PRKA 3TTWA 3WLIA 3W5AA 1JSLA 2HNAA 4Y6SA 2O19A 5LBUA 4M89A 4LYJA 2NU7A 1RAHA 5I9LA 1Y9EA 3JVEA 3UY4A 1X87A 2JIMA 3M4NA 4X7RA 1EFUA 3ACDA 3R74A 1F8UA 5SY4A 1U2ZA 1H5QA 2NU6A 4KLNA 2KBEA 3TJRA 1UFOA 1R0WA 5K01A 5K8JB 1ISRA 3AYXB 1Y81A 4LF8B 5DFAA 1V37A 1XD2B 4ENQA 1SM4A 1F8GA 1WPRA 2HF8A 3M9LA 4TROA 2PCLA 2LPMA 5ADUS 1ISIA 5CM9C 2RG1A 3ROKA 5A9SA 5D01A 5KTKA 4DR6B 1NN5A 1KYVA 2D5AA 4FW8A 1UMDB 4TV8F 1LBHA 3CT6A 4OBBA 1S8OA 2NO6A 4TV8A 4DBLC 2YJZA 5E1DA 3HCBA 3R44A 4YASA 1XMOB 2EC5A 2JATA 2FX5A 3ZI0A 5JAUA 1PQUA 3H97A 1B0UA 1KOLA 4CL0A 3CH7A 2EQ5A 3IQIX 1XCLA 4LWZA 5ALRA 1C2YA 1UQUA 2HRDA 1V4VA 2EEPA 1KORA 2DCMA 3ORYA 3OZ7A 4MYRA 2HHHB 2NUTA 3OI7A 1IBSA 4KGVA 4PU0A 4PX3A 1MT0A 2X9GA 3H6HA 3OQNA 4KH1A 5T8KC 2B1GA 5JD5A 4L0QA 1RAAA 1SC6A 3CVYA 4PX5A 2B9EA 1KDPA 3R7AA 4KPGA 2W22A 1XEWY 4JLAA 1WB4A 3BE5A 2NO1A 1O4VA 1NVVR 2E3JA 3DHNA 3JPYA 2GXSA 4V0OA 2Z09A 3IAM6 1QXSA 3M6UA 4R9VA 4OGWA 4KK4A 4J0CA 1RLIA 4YJFB 5AHKA 4MHTA 5JSFA 1AGYA 1RJGA 2D1SA 1FVFA 4XFDA 1PYDA 2HZ7A 8ATCA 3EIQA 1UFVA 2AZXA 1J22A 1QHGA 2VEOA 1L7QA 3IUBA 4F38A 1ZK0A 1O94A 1W44A 3VZSA 1M66A 2FOIA 3ELUA 1NLUA 3C6BA 3HSSA 1SY7A 3SE0A 1F2DA 1NDUA 4YBRA 4ZQEA 3OPNA 5LMCA 3GQBB 2W2NA 2BHRA 1LJUA 3UENA 3FSJX 4RADA 3EIEA 3U7RA 1AUOA 3LL7A 3O4GA 4IQGA 3W77A 3BL6A 3ETEA 4JLDA 2YWXA 5JYEA 2HO4A 3ZDAA 2Q0HA 2YRXA 3LVQE 3A9CA 3L06A 3HJTA 1J24A 2YOHA 3FYUB 3I01A 5JZOA 3OZRA 3TNYA 1UBHS 3L6UA 1PVDA 1AVTA 1J33A 2C2XA 3K5HA 4HQLA 4NAUA 4YRQA 1R66A 3UHOA 4KSYA 5C7IO 2RMKA 1F0PA 2VLIA 3H1FA 4NPCA 5ARBA 3HTXA 4P7FA 3FNBA 4F3TA 3K94A 3FGZA 4DUYB 1W36B 3W06A 2GTIA 1K6IA 3GRKA 3EY4A 4YRAA 4U5XA 1MMFB 5H70A 1W85B 5IF3A 2XECA 2JFFA 1YB7A 3KVOA 4GOLD 2PU7A 2PS0A 3AO0B 1WHTB 2I29A 3CF6R 3ZZ1A 2H3HA 5F77A 3MJEA 1F4LA 2NTJA 4E15A 4K86A 1AKMA 1XYGA 3CRRA 2LKCA 4QJIA 2WE8A 4B6EA 3K9CA 4YRMA 2CJWA 3HXQA 2H2WA 4LGMA 1MA0A 3PEUA 4MULA 3MWKA 1UKAA 3MD9A 3V4FA 5ALFA 1GZDA 3UWMA 1NYRA 1P80A 1BGWA 4ZAYA 1XCOA 4O1HA 4H2DA 3E18A 2IV2X 1NQ5A 3W3ZB 2XVXA 3UOAB 2Y4OA 3JQ7B 1UUFA 1ZQ1A 1IJFA 2R4UA 4TT3D 4EPWA 3LDAA 1ODKA 1GFWA 3RAJA 4Q4AB 2IEIA 5JAOA 2D06A 3HVUA 4LKOA 1NW8A 1K9SA 4G01B 4YUWA 3OQMA 4JHLA 1OXXK 3K4PA 2P1ZA 4RQUA 5AKEA 2NO7A 1RYDA 1TC2A 1OV4A 3FM9A 4AYTA 1Q77A 2G06A 3ZW9A 1U9ZA 4UTZA 4B6OA 2A35A 4BZPA 4LX8A 4CG1A 1BRMA 1U3DA 1UFKA 4ND7A 4YI5A 4K9RA 4MITA 1XRPA 3TB6A 4AJPA 2OCKA 3ZWWA 4PWZA 1IN4A 3E7PA 1WLSA 3L18A 2EBWA 4BDSA 5LA6F 3U5ZB 4FFNA 3DLPX 4EATA 3RIGA 1WZNA 4B5KA 2JIOA 3BFJA 2B20A 3IAM1 4LHZA 5ANRB 2QN2A 1OX6A 5C0OE 3TDNA 3WB1A 1TAUA 3C97A 5BUZA 2A5LA 4OYHA 2F1JA 3WL3A 3P2YA 4K46A 2CCKA 1UZLA 2C5LA 4X60A 1JBEA 1LU9A 2PGXA 3ZBUA 3EWAA 2GTPA 3MCTA 1HFEL 3QFTA 4FJ0A 1VFPA 4FZRA 1YS4A 2V8OA 2QLNA 4UBIA 3B85A 4NE9A 4BZXA 2Y77A 3NHKA 1PF7E 4GKKB 4OQDA 3IEPA 4XIYA 2GK3A 5ISMA 4YK7A 1BH6A 3RUIA 3BK7A 2ZJ7A 1QJ4A 3IXMA 4WNAA 1QIEA 3T7KA 1KYXA 4RFVA 4B2YA 5TJ9A 4E3ZA 2O5CA 3LGSA 4Y0NA 1G8PA 3E2IA 4DDMA 3S44A 1GT6A 1WLYA 1WV1A 3IAXA 4LYHA 1IN5A 2WHPB 1YZQA 2NTVA 2RHRA 5B2FA 2C57A 3CG4A 3A6LA 1Q2XA 3N2KB 3V2HA 1PTJA 4KP7A 4DFDA 3E35A 3DAHA 1F6WA 4CM9D 4O0MA 2UUBB 2XCUA 3HXTA 3E70C 5F5XA 2X2OA 1U1FA 3QX8A 2BYTA 1IOWA 1TE2A 2DT5A 2PPVA 5IBRA 1WXGA 5J40A 5U4XA 4S05A 2NPOA 3FFBA 2JFGA 3EBOA 4LQLA 5JXWA 4BMVA 1H6CA 4URYR 4UNSA 1U11A 2XDAA 4QARA 4B45A 1YFLA 1HM5A 5DM2A 1EM8A 1Z26A 3HDTA 5AHWA 4JI6B 3VH1A 3W6UA 1AB5A 2WSIA 4AJOA 4KYUA 1S3FA 3QZUA 1QX4A 3I1FA 2DBRA 3DVLA 4O5AA 4OBWA 1OX4A 5LLDA 1QFJA 5I47A 3K20A 4BVBA 4CQLA 2IYWA 2VP3A 1IATA 2HN9A 1CU1A 1EVQA 2VDJA 2WAOA 2XMQA 3FPSA 3JSAA 4RE6A 2MSDB 3EQ8A 3FVQA 2A94A 3D3NA 3GEDA 3L8HA 3MFQA 3OPXA 4J29A 4U9UA 4YMIA 4AN1A 2JASA 2F3TA 4RTJA 3F9CA 1LVUA 1EFRA 2PR7A 3DXZA 3EDOA 4R2KA 4AWAA 2HT1A 1QFZA 1KXJA 3TXXA 3FUWA 3Q3JB 4CXMA 1GTL1 2G09A 2DE0X 2OHGA 3OECA 3QPWA 3Q85A 1CY7A 2Q1WA 5DEOA 3ORQA 1YNOA 3FBTA 4EW6A 1YJBA 1UL1X 5AI5A 3ITEA 1P2UA 2Y1CA 2QX9A 1SKAA 2MYTA 1KAMA 3GT7A 3TDKA 4D3FA 3WA6A 3MW8A 2IU3A 1GV1A 3KPVA 4QDJA 1T9GS 4UAGA 1HLPA 2H7CA 4LOKA 4O4LF 4RY2A 1I2CA 1T0HB 4O4LA 4L74A 9LDTA 3WB2A 3P27A 2Z43A 5AVQA 4AN0A 1TFUA 2LE0A 1Q21A 3EGCA 3HFJA 4OXIA 3X3HA 1G7TA 1Q0QA 2HSDA 3B9RA 3L0SA 5FYDA 3TFWA 1AX9A 2OMKA 1HDEA 2QT1A 3FR8A 4P5DA 3WMGA 3P0JA 2PV0A 3KB8A 3MWEA 3P2EA 2D4AA 4LNUA 2C4TA 4JLSA 4K9KA 3ZCTA 4LKRA 2QMZA 4UVIA 5KNBA 2V7QA 4XM1A 3S2IA 1OGYA 1WULS 3T7IA 1DKPA 3WGOA 5HCNA 4BC0A 1JHYA 5AOVA 1QVAA 5FI1B 4GEKA 1MORA 3BB4A 2A59A 3S2FA 1T1IA 3TQTA 4AKSA 4C43A 2D13A 3H2SA 3SF8B 4L8GA 3IVRA 4BFWA 3AVYA 4QO7A 1VL6A 4L5CA 4LQCA 2H4HA 1SOWA 4LC0A 5JC8A 1SU7A 4GKVA 3QELB 2ZPAA 1PT5A 2ZBEA 3GLTA 4HCJA 4I50B 5DGHA 4K6HA 3TZLA 3CQ9A 5AQ1A 3FNQA 3G2IA 3JQFC 1OVMA 3K1AB 4BMOB 1OZAA 1ZH4A 1ZD4A 3E1GA 1QJCA 3U1TA 2A0UA 3EUWA 2BW0A 4QEZA 4RD6A 1HNZB 3D0QA 2AOWA 5CIYA 4UASA 1UKBA 3JTMA 3PLAE 3QKRB 2YCLA 3ZHRA 2ZRFA 3BXZA 2V0NA 1SA0A 4LY9A 2PRKA 4RNDB 3V32A 1II8B 3IOCA 3KU4A 4IJKA 2IPXA 4CEIA 4COKA 3DW3X 1ZD1A 1XN4A 2FEAA 4JJIA 5JEDA 3WZMA 4ND8B 1LKZA 5A9TA 4H16A 1UM8A 3BF7A 3UJ6A 1BDBA 7ABPA 3KSBC 4FQ7A 1MKYA 3X0DA 1SIBE 3RG8A 1D6MA 2FWMX 4IZ6A 2PO5A 1FSZA 2FV8A 3DYBA 4NBVA 4OQPA 4Y8VA 1FK8A 1SKMA 2QRUA 4Q3EA 4N41A 2ACWA 3AHEA 3PQEA 3QLUC 3TSOA 1CUCA 1Z29A 4PPGA 1P1KA 1EA7A 1RKUA 3OETA 1G5FA 4HDMA 4JKYA 1K89A 2BP7A 3QH4A 4CFZA 1IY0A 2M32A 2Y0EA 1QLHA 1SG9A 2V74B 4O4IF 4ARVA 1YDWA 4O4IA 3QE9Y 3IRUA 2FE4A 1FU8A 3P0HA 3PWSA 5FA5A 4FFMA 5LP6A 3ICQB 2OZEA 1JHRA 2UVPA 1XTVA 3KT6A 3WRXC 3M4JA 1YHNA 1ZR2A 1WD5A 4R01A 2EAUA 4Q1DA 5GOZA 3LYLA 3DMTA 1II0A 3M1YA 5PNTA 1UBOS 4RA6B 4QNMA 2YN2A 2GETA 4I1UA 4TLCA 3RWBA 1QZXA 4L02A 5JAQA 3H42B 4EG5A 2GEUA 3WA7A 4C21A 2PFGA 1UC5B 1WSDA 1K0UA 3EMVA 4D3ZA 3KQYA 5CYFA 4UCQA 5CB4B 1TLLA 1D3AA 2Q3HA 2WF9A 2WFMA 1QGUB 4BKPA 3TW0A 3CXUA 2H7XA 2MSWA 3X1KA 1Z2CA 4CCAA 2NYUA 4L95C 1Q74A 1EVLA 1ZMTA 4DIOA 4XUCA 4WGGA 1FNCA 1RAEA 1R88A 1HFKA 4OI4A 3PYMA 5KYTA 4W8GA 5KJEA 3WTCA 4E14A 3QBTA 2AEMA 2WUVA 1RLJA 5JIBA 1QS0A 2ZIXB 4I4NA 2YY5A 3PS9A 2H54A 4HDSA 3PIRA 4DZRA 1HORA 4QUEA 4JSRA 3RWMB 3AUUA 3LZCA 1M2GA 1OAAA 5BMVF 5GVRA 5ERYA 3G59A 5BMVA 4Q93A 1CYEA 4JLJA 1L5RA 2F48A 3R2JA 2FMFA 1D2MA 1SB9A 2X1MA 3KXPA 1XZLA 1TK2A 3HXLA 2JJMA 4ESHA 2P0YA 4UOQA 1V9SA 3W1VA 1BAPA 5IN4A 4YJ2B 1B3BA 4X1IB 3WWZA 3I0ZA 4RQBA 3I09A 3DH0A 3DA8A 4XSVA 4A2QA 4AQDA 4CMEA 1QU2A 4ZPXA 2KW5A 3QJYA 4PZLA 4D02A 1Z08A 4WSOA 3DOCA 2EFEB 4GBMA 1XXHA 1KY5A 1OBOA 2ZJBA 2GN9A 1J49A 1EHCA 1EJ0A 1WW8A 2DUUA 1R6DA 2C3YA 3FPEA 4HO1X 2QLFA 5I7VA 1XNHA 1GN9A 3P7MA 1BWPA 2C77A 4FKZA 3MS2A 4UTOA 3VO9A 3DNFA 2VHEA 4RF2A 5F73A 2EKDA 4EHNA 3D81A 3F0TA 3GLSA 1P2SA 4I4TA 5TPZA 1O89A 4Q9DA 1ZUIA 3GZNA 2DY1A 4J6FA 4V38A 4Y2UA 1A1VA 1IK4A 1Z18A 5DOVA 1SCBA 2NXJA 2VP4A 1UJ5A 2WKRA 3AQIA 4ZANA 4AF6A 9ATCA 4FZ3A 4R51A 1W1UA 4QVIA 3SFVA 3MFYA 4DPKA 2C04A 3Q9UA 2BFBA 5F2EA 3JQBA 3V8PA 4HAYA 1BOFA 2GCIA 4N5DA 2XNJA 3EAFA 3DXFA 3I9JA 1F14A 2ZSAA 1SXJD 3PRYA 3QPDA 4IF4A 2FMIA 1ZSYA 1D0IA 3OHSX 5BW8A 1FZTA 1E1DA 3HO8A 4BLSA 3K0KA 4PCVA 1R0XA 4GLLA 1GQSA 4Q9AA 3X2SA 1G2OA 2WT8A 4K6OA 3WYEA 3A10A 4EMSA 1IHXA 2BKLA 2V9PA 4XB2A 2EX4A 4RPKA 4YRTA 5F76A 5KYYB 3I64A 4V3BA 1GPYA 2AQHA 3KELA 1Z4QA 2PKYX 3WGIA 2JJ8A 3E9DA 3U4CA 1P73A 2HQOA 4FT4A 4YXWD 4NYJR 3ACCA 3L4BA 4TTSA 3SZUA 3MHTA 3A1CA 4UZFA 4BU1A 3T5CA 1XRMA 1PFKA 3E27A 4RVOA 4QXMA 1FUUA 1D04A 1NDQA 2DR3A 2KYRA 2ZJ2A 4OQQA 2NU9B 4BNWA 5IBCA 4BNNA 1RI4A 1M1ZA 2PZLA 3K96A 4QFMA 2VSXA 1XEXB 2BLLA 2P4EA 2VPZA 4LXYA 1RZRA 5CX1B 2FQWA 3P0RA 2H57A 2UZ3A 5JTUA 1J5PA 1DOZA 1L5OA 2LTAA 2V7GA 1MC1A 2OQ2A 4IF6A 4KE6A 4LCEA 2ZJ6A 4LDZA 3TR5A 1MVLA 4UBNA 3FLMA 5LXTF 1QK5A 4AMYA 3ML1A 3T0FA 4G1UC 3W9UA 5LXTA 1U7TA 4GQAA 4TXLA 3I2YX 2WAYA 1I3KA 2Y93A 4KO1S 5LYJA 4I8XA 2JHCA 5K09A 5KYNA 3C3BA 2NZUG 1EIZA </