1RBMA

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rbmA00
5CJJA 2CFIA 4TS4A 2BLNA 1C2TA 3NRBA 4DS3A 4ZYUA 4IQFA 3R8XA 3DCJA 4TT8A 3AUFA 1ZGHA 4ZZ2A 1GARA 1RBQA 1JKXA 4Q12A 4ZZ3A 3DA8A 3P9XA 4YFVA 1YRWA 1S3IA 2BW0A 4S1NA 3GARA 1RC1A 4ZZ1A 2FMTA 3W7BA 4ZYTA 1NJSA 1C3EA 1RBZA 4TTSA 3OBIA 4ZYXA 1MENA 1GRCA 2GARA 4ZYWA 4EW1A 3TQRA 1MEOA 1RBYA 1CDEA 4PZUA 1RC0A 4ZYVA 5J9FA 4QPDA 4ZYYA 1MEJA 3N0VA 3Q0IA 3KCQA 1CDDA 4ZZ0A 1ZLXA 3LOUA 4R8VA 2YWRA 1FMTA 4EW3A 4NV1A 1RBMA 4EW2A 4QPCA 3TQQA 5J63A 3O1LA 4YFYA 4ZYZA 1ZLYA 3AV3A
chains in the Genus database with same CATH superfamily
4Z4GA 3V7UA 2XNSA 5CJJA 5L4SA 1CZHA 3VC2A 3D3JA 5BT9A 4A6DA 4GI3A 1UMBB 1IZYA 1ESMA 4DV3B 1U28C 4CG2A 2FJUA 1PE0A 1IY2A 4F97A 1IHDA 1R12A 4KZKA 2ID9A 3C87A 3IAUA 4MW7A 1N5KA 4PO9A 3W4JA 2C4MA 3T1YB 3VTKA 1FFXB 2INGX 3FM9A 5FO0A 4TZTA 4KN6A 1CT9A 4ZMSA 4UW9A 3PG5A 2FMXA 4KNVA 2FEPA 4XYEA 2O8VA 2ZIXA 3SF0A 5JZVA 5LLTA 4LXQA 1RVDA 1Q22A 3ZN2A 4PM4A 3MXOA 3K9CA 1YZYA 3O8OA 4YRRA 3S1LA 2Q4OA 5HKBA 3VR2D 1RKXA 4ZP1A 1IZ7A 4BV8A 2YDXA 1H6CA 2AIRA 4TSFD 2BEKA 4DWOA 4F45A 5MFZA 4QO7A 5DBGA 4MKGA 3PUVA 4YTEA 2FSVA 4KN9S 3HXPA 5KQLA 2CF5A 2I9PA 2H8KA 3CKMA 2ACWA 2V5UA 3FJOA 1KNQA 3MPUA 3PQDA 4X1IB 3S2IA 5KYWA 1AGYA 2PK3A 5LN1A 1Z39A 2YNMC 1K0FA 1PUIA 2O7SA 1ML3A 2C57A 1H4VB 1KTIA 2V98A 4RLHA 3TIVA 1KO8A 2B69A 3URMA 4Q16A 4US0R 5IYZB 2AZXA 5DX8A 1JVBA 2H7VA 1WW8A 4H27A 5G4KB 2ZM5A 2VRCA 2OFOA 4YO8A 1KE2A 1AIPA 1VYUA 4AJLA 3N59A 1E2JA 5IZCC 1CFJA 3O6VA 3PGJA 2HPVA 4RK1A 4H6PA 3P45A 2EFCB 4MA0A 2DT8A 3PFCA 4YDRA 2ZSEA 1JHUA 2OBBA 4N82A 3ZDAA 4N4AA 2EJVA 2QD3A 4O5AA 1O97D 2DUNA 1VMIA 1PGOA 1P0PA 2VTBA 4U6NA 3WWZA 1K8RA 1WUTA 1XTZA 5EINA 4CI9A 4CM3A 3QLUA 5K0ZA 1QFSA 5FTNA 1AUQA 4JI6B 2P30A 2SCUA 1OAOC 3A9WA 2REBA 3UXHA 4M1TA 4BVKA 2C5SA 4UJ5A 1G2OA 1TZCA 4R16A 4M6WA 1E60A 1P2FA 3C7CB 3AUXA 2NX2A 3ESRA 1F1BA 4TLLB 3ZEIA 4F4CA 2B25A 3KOUA 3HHPA 1X8JA 2VUUA 3GDOA 3LLSA 3PEUA 1VL2A 3EGIA 4AZWA 4KBGA 4CDNA 3T7RA 4MJ3A 2B1RA 2AJ8A 4TKMA 4MWGA 1FK8A 1PZHA 1ZL0A 2OHGA 2O8FB 3HXQA 1KFEB 5AM0A 1FC0A 1U4NA 3WNQA 5KYXA 1EXWA 4NG5A 1B8PA 2ONZA 1JAYA 1Z33A 4E70A 3TKLA 4HNTA 4WVLA 2DXIA 2QB5A 5KAMA 3WAGA 4KO2S 1I6WA 4C0KA 2NAFA 5ITSA 3ZWKA 2AD1A 2FKAA 1AKEA 2GNAA 3ZJYA 5CCEA 4UEKA 2HBZA 2ZUDA 3EQ7A 2IHKA 5JMOA 2HLDD 3ZDRA 4BAUA 2ZSBA 3GHYA 2PQ6A 2IYRA 5ALYA 1LX6A 3DP9A 3TTVA 4TMKA 1A1VA 5T64A 3HCWA 2R6GA 5FV7A 2CMHA 2XRMA 1AQ6A 4KLZA 4ASUD 1M33A 1BEEA 3FOEC 3VZPA 3H11B 2VP0A 1OI7A 4J0QA 1Y4AE 3RT1A 2FEKA 1FZQA 4BLRA 2AQIA 2IFTA 1R0KA 1O58A 3A3NA 3HPQA 1TD1A 3FZYA 5LOVF 5JPCA 1R4MB 2FP4A 4NJEA 1NN0A 3HKBB 2VDPB 3JD0A 3HXMA 2AH5A 1J1IA 2YY7A 2FW0A 3TTYA 1VA4A 1QSGA 4HNGA 1GNPA 3QGMA 3NBAA 1NOKA 4ZI7A 4OMDA 4KRYA 2Z3ZA 4MUXA 1AXRA 4IJQA 2UUBB 4H7EA 1EMDA 3B53X 1M34A 2PS9A 5DHSA 1BG6A 2QYTA 1ZL2A 3KETA 1VJTA 5K3SA 3UAGA 3GQVA 2FPPB 4BNXA 4BWFB 4DPKA 4EYEA 1UK9A 2G83A 5LP6C 3QU4A 4AKHA 1KVTA 3GFFA 4X66B 4KV9A 4FM9A 3G3EA 1WDLA 1R1DA 4HAWA 1COZA 1O1YA 2XKJE 2DUWA 2PU5A 1QO0A 3U7QB 4DCPA 4DR1B 3WY9A 2VRWA 1A4XA 4HLQB 5EZ6B 4BMNA 2Q45A 1M7GA 1T5LA 4D9MA 3RR2A 1L7XA 1VE6A 1YZFA 3D3WB 4X9XA 4DLSA 1PS8A 5SYNA 2E5LB 4TZKA 4H1TA 4KPGA 4GWLA 3QYPA 5CXUA 3B51X 1I7PA 1DNPA 2C03A 4QXPA 4TMZA 1KJ8A 5ER9A 5F9MA 5M34A 5H8WA 1QZZA 2J33A 3SHTA 5CD1A 4KC0A 3IB3A 2C98A 4HS9A 4B2LA 1XCOA 3IO5A 4W1QA 1M1YA 1OVGA 3NO4A 4JC8A 4D25A 2HA6A 1UK6A 3PPVA 4D8WA 3FFBA 1R50A 4AO6A 1Y7IA 4LRTB 5D2CA 3PRYA 4F5WA 4URHA 3RTDA 3PYXA 2PFSA 4MV7A 3QTLA 1C1DA 4L7QA 3QY0A 3AUJB 5K03A 2IPNA 3GLKA 3JYHA 2C5LA 2C4TA 2XD4A 1QIMA 1REQB 4R3UC 4MW6A 3I8XA 3RJZA 2JJYA 4TQAA 3DE2X 1QONA 1CIJA 1RHUA 1NYRA 2ZREA 3CB2A 3ZV5A 1W7AA 5CTJA 2G0TA 3CN9A 4DCUA 3GGGA 1P60A 3P5BA 2VO1A 5AIAA 2GM4A 1QUEA 2C0QA 5TS2A 4CV3A 2ERCA 1X15A 2AX3A 1JIJA 3FTNA 4FHFA 4HTFA 2R00A 3TLCA 4C0BA 3HVJA 3H04A 5IAJA 1PG5A 1T0HB 4DM7A 2CKMA 2P4UA 4GP7A 4OJTA 1KDRA 2EX0A 4CDRA 1B1CA 1OSNA 4DDUA 4UUPA 1QNLA 3DV0A 3K7EA 4KJXA 1CRPA 1DO8A 3QKTA 1DBSA 2CXSA 1NRXA 1YHZA 3VM6A 3O26A 4JI4B 2GLTA 4HDMA 5BR8B 2X0IA 3ZKWA 2QQEA 3IUQA 2WHEA 1U98A 4CT5A 4XCVA 3R7AA 4PW0A 2ZDQA 3IIMA 2Y6UA 1N5JA 3I04M 1GV1A 4ESEA 4QOFA 4ETWA 5L3SA 1RP1A 2FQXA 2IEBA 2E2WA 1V7QA 5CAEB 3ST7A 3TE7A 3WNDA 4BNDA 5A5VA 1BCSB 4JC0A 4FDVA 1GKKA 4H6XA 5EIWA 4EW2A 4B0OA 2V97A 4CR6A 3COYA 1IQRA 5LD2B 7ABPA 1BYIA 4RF4A 5HJ7A 1EP2B 2CXTA 3GLUA 3O83A 3VAYA 4YJ2F 3HKCB 4LQCA 4GGOA 4M8LA 3NBXX 2O8NA 4X0EA 3BMCA 1EFLA 1MHPA 1SUFA 3KEQA 2ZT7A 4H3HB 1GVHA 4Q4HB 4ZU3A 4DY6A 5KNCH 2J6BA 2JHCA 2EQBA 3QMVA 4R7ZA 2NYRA 2NAPA 3HI4A 2ZBFA 3Q11A 5JHGB 3E7FA 2WG1A 1GDDA 4CIYA 1W0CA 4AD8A 4B40A 2BV3A 1P0FA 1WB9A 4CCYB 2FK8A 4L50A 3GP3A 3VV3A 5M29A 3NXKA 2WDZA 5JWHA 5C7OO 5D6OA 4IRUB 5DGDA 1ODJA 4D1YA 2XGSA 2DERA 3NRCA 5BO5A 1U5BA 2WJVA 3MGCA 4RA9B 2HYDA 3OPQA 4ZT3A 1FP6A 1Y5NA 4BNNA 3I5YA 1Y82A 2PGNA 1QGED 2ONYA 4CEJB 2X19A 3EF3A 5AM1A 1MA3A 2JKYA 1WTCA 1MT3A 2EC5A 2VHEA 3V80A 3M7IA 4J0GA 2P1RA 3T8YA 1JHMA 2BL4A 2L0XA 1NKSA 1ZD3A 1IIRA 1M2OB 1JSLA 2DQZA 1VE7A 2HHAA 3DMHA 3IAEA 3MSXA 3EXAA 2J7KA 3MUOA 3P7MA 5ECYA 4PVCA 4YHBA 1W5FA 3WKBA 2PKQO 4R41A 3GGSA 4K05A 3T15A 1BVRA 4DQ0A 5KTOA 4OJNA 1OCEA 1R2QA 4HEJA 3M2TA 3GJXC 4OK5A 5DWVA 2MYPA 4Z99A 1MIOA 4LDRA 3UK2A 4OV6B 1DQSA 4OJQA 4AVYA 4LF4B 2HNBA 4TT3A 5L8VA 3M5CA 3QH4A 2P67A 3A2LA 1LDNA 4F4IA 3HB0A 2HU2A 1CTQA 5LM3A 1XEAA 2QD2A 4JD5A 5JD6A 1XCBA 4L5CA 4WK6A 3REQA 1Z6TA 5CVVA 2IYSA 1FW6A 4EH1A 1ZWKA 1S2NA 2NOAA 1N1GA 2J3JA 2VWPA 4J0CA 3TDNA 2GILA 3R0XA 5IC6A 3CB4A 4EKGA 1KI1A 3M9LA 1S5PA 3GPBA 5KO2A 3QMPA 1JHVA 2FOLA 3QHQA 4PXAA 1W49A 1WQ4A 2JCGA 2ZQYA 4G4IA 3MJFA 5CT5A 2ZJYA 1SZJG 3JZFA 4OXQA 3PNYA 2RGYA 3ORFA 4G5SA 1M83A 3WJ7A 5I9TA 3H5RA 2HA7A 2ORED 1VP9A 5B4TA 3GFVA 1N5RA 3UMYA 1X1CA 4MQEB 5ISMA 4A82A 1KPGA 3CVJA 4DIMA 2FX3A 5JJCA 2L19A 2ZTLA 3ANTA 3HCRA 2OL4A 4UEQA 5DM4A 3S4YA 5CFNA 4WOCA 2QV7A 1TA0A 1G66A 5BN4B 1U2SA 4LY3A 2BIFA 3SX0A 3F7NA 3HU5A 3LC1O 4FFDA 3ROXA 2ZR9A 4H31A 4IOJA 3SZOA 4QXRA 5LWQA 1Z6GA 3IKTA 1PYDA 3SS7X 4ZO9A 4Z1MA 2D0PB 1AZWA 5ELMA 4TX1A 5KNDD 1H2AS 1TM4E 3QKIA 4CV0A 5KTPA 4W1SA 1EB8A 2AXQA 2RGGA 1JL3A 1OXSC 1WA5A 3MD0A 5C7LO 3B6JA 5CR9A 1S3GA 1XSEA 1HYGA 5EZ5A 4F2HA 4YJGA 5HZKA 1YZLA 3GVCA 4BO7A 3GYBA 3TQQA 3V1TC 3CPSA 3HU3A 2A4MA 3KHUA 1UBEA 4KSBA 4TN1A 3SSAA 4A0FA 1L1RA 1OBOA 1Y5RA 5AQ1A 1IM2A 2NZXA 2CYAA 3R3JA 1AHNA 4AULA 1TEXA 2GBLC 4BAGA 1SHJA 2HXGA 3I9NA 3E9NA 2CFIA 2I3ZA 2BHRA 4UNSA 4UD6A 1KYTA 4WKCA 2X41A 1I7NA 3C6BA 3HE3A 5CBKA 1A5AB 1Z29A 4NF2A 1IOVA 3B82A 5FEMA 1PP4A 3BMNB 5SYAA 3TVYA 4BNGA 5EJ4A 3M3DA 4XGNA 3WLTA 2GHTA 2YJGA 2Q0SA 4HBGA 3T7JA 3AY6A 4IINA 4V0MA 4N49A 3RK4A 3DUWA 1GL7A 4BMVA 2ORIA 3WGKA 4JGIA 5CLGA 1QWSA 1VHDA 2FQ1A 3HU1A 3MQ2A 2NVWA 4X3CA 5FOVA 1O5IA 3ZU4A 4BKUA 3C39A 3S68A 1SNYA 3BA6A 5IVIA 1M6NA 2AQKA 3QF7A 4J6FA 1K86A 1DTWA 2G72A 4S1PA 5CK4A 2R79A 2QRPA 2RHMA 3C3BA 2G08A 4BGEA 4L85A 4NZYA 1PYOA 3PA8A 3Q3JB 4L72A 4QPNA 4BFSA 2Z95A 4OPMA 2JIZA 4JQCA 2O9JA 4Q37A 2EKLA 3DLPX 3LUFA 1LDGA 1B16A 1O7JA 4OHRA 4YAJA 3TMAA 4CMCA 1AE1A 3SZ3A 1QIIA 3HP7A 3OPYA 1MC5A 5JHHB 1QCYA 2D4HA 4JXKA 2GKOA 4A6EA 5KVCA 1E6KA 2WE7A 4A1FA 5K2OA 2HI0A 3D4LA 1J2UA 2FPKA 3CUSA 4AKSA 4D4LA 3G1WA 5KVSA 5KJEA 4TQ9A 3MGGA 4OX9B 4CVNA 4F96A 1UC5B 1NMYA 1WSDA 3NG1A 4FZVA 4Z4QA 1Z6AA 1HLPA 2PZLA 2QZ4A 1H94A 1IIBA 3PNOA 5T4EA 5MGNA 3MJSA 3PD7A 3VR0A 4C7MA 3KQHA 1Z34A 4GFDA 1EWKA 1NW3A 3A4LA 1JGTA 2O7VA 3DTTA 1TM7E 3MTAA 4C0LA 4MQUA 1KEPA 5I9IA 5FLYA 3T7EA 2OBYA 2G1JA 1U65A 1I14A 5E9QA 4ZANA 4M21A 5CCBA 3NUQA 4P7BA 2FPLA 4YMIA 1X70A 4CHGA 4I46A 3G0HA 3AFGA 4HWGA 2Z1DA 3LP8A 5CYFA 2I7TA 4ARZB 3IP1A 4QTZA 5DIZA 1UJBA 3AUYA 3N2NA 5K3FB 1XVUA 5J4KA 1G19A 4Q3EA 2B9VA 1LLUA 3LUHA 4BVLA 1BJRE 4GLOA 4ZYVA 5KWJA 3C16C 2G1PA 1XZBA 2BF7A 1P2VA 1P74A 4M0LA 4GX0A 1N6IA 3I4LA 4LZAA 4RKWA 2QRHA 1AO3A 3V8EA 5IDWA 4R69A 1J5EB 4N3BA 3E0XA 1NJ5A 1TT7A 3UMCA 4ZPXA 4QHTA 3O2NA 2UXCB 3U3ZA 4N8EA 3LT2A 7AT1A 4UQPA 5LUAA 1MJHA 3CVYA 3W6ZA 4MUFA 1J2EA 1W4RA 3DMTC 4P34A 3TB6A 5MN6A 4JL8A 3FYTA 1XMOB 1NRJB 4OIMA 3PQCA 1Q0TA 3BIOA 3AL2A 1S6YA 4E5NA 5LQKA 1SZCA 3T7SA 3R5XA 4EUSA 3THYA 4EKEA 2VEOA 4G0UA 1ORTA 4WDRA 5TY0A 1GM5A 4O4HB 4GMDA 4PLWA 1E20A 5CNIA 3VOBA 3QPAA 5KNBH 4DUYB 1JG4A 5B2FA 5WRFA 3LT0A 4MMZB 3TL2A 3W9YA 1ZHHA 4BE4A 5CJPA 3JD4A 5IKMA 1XGKA 2FUG1 1TJ5A 3MJDA 1QP4A 4DYHA 4HVLA 3MLAA 1BS9A 2VXYA 2X23A 4UFOA 5J47A 2ZKLA 3BD7A 3QU2A 3DEYX 4C7VA 1TLTA 1NVWQ 4GKAA 3KKMA 2GESA 2HSZA 3ETCA 4RSHA 3R75A 3UMJA 2PAFA 2DWQA 1D09A 4OHMA 4UZFA 4WBSA 1JQ3A 2JFFA 4R9VA 4Y6SA 4K81B 1KBQA 3GJ3A 1N5OX 1U0HC 2X14A 1H42A 4IWYA 1KYQA 1V1RB 4LY6A 4KXWA 4AMVA 3GF4A 3QUCA 4HGRA 4Z9YA 1GN9A 2FN7A 4RELA 2FLKA 3L8YA 2UU9B 3IYLW 4DWJA 2GHQA 4N9WA 1UDBA 5TJHA 2IEIA 4HB0A 3WLKX 3ZX5A 3SE0A 4BATA 1UZUA 1H0HA 2AUTA 4MVJF 2FGJA 3GAFA 4KUEA 4YQYA 3JYLA 5HOQA 3L82B 3RSGA 3TNDA 5AUOB 2XQJA 2AI3A 1YBMA 3NBUA 3LVFO 1J33A 3KJNA 4EB3A 3O31A 1U2GA 5JS8A 4XUCA 1QLWA 5A3SA 3ZIAA 1XWFA 2H1FA 3GBPA 5TPZA 3PVCA 4OYRA 5BN5A 1R3UA 3HQ4O 2PZEA 1Z8FA 4JDPA 5CW2A 3L02A 4DDMA 2A9QA 1ADBA 2DP4E 3DKRA 3OX2A 1JTFA 4FX2A 1D7AA 1JW9B 4MS3B 3TJZA 5HZMA 2PNFA 2QG4A 1KS2A 4MITA 4DKJA 3SKVA 1X8LA 4U7TB 5FLXA 1GR0A 3HCBA 2AK2A 3KSBC 2PXXA 1DJMA 3L0BA 3ZUGA 1Z35A 4OYYA 4HNHA 1QYRA 2I5PO 4FC6A 4O63O 3SJAA 5MDHA 3MYYA 3JPWA 1H23A 1LBIA 1Z2CA 3NJRA 4FI3C 3RIEA 1IC6A 5LDGA 3CX8A 3M4NA 3A05A 1JDBB 1P1RA 1L5HA 4L4YA 3UWDA 3KQYA 1CDEA 2Z56A 3NDRA 5AKYA 4ZEOA 4LJAA 4JLDA 2ZR8A 1W5BA 4TM8A 3SKXA 1PZGA 3L0YA 2CHQA 3LYLA 4H4CA 4PZEA 4X1KA 3OBBA 4OUDA 5ERGB 5GQSA 4IOMA 1G20B 4PHTA 4EX7A 1ZBDA 4Z7QB 521PA 1M76A 3AYXB 4I14A 1DXQA 4PSKA 1Q0PA 3P5SA 3EBPA 4X54A 4LF9B 4HDQB 1CQJB 5CFLA 3O4HA 1WTAA 1V45E 1LVUA 1FX1A 1AH2A 1LLDA 5DH9A 4BE9A 5CPFA 1EFVA 2IBSA 4PYIA 4HNAA 1A72A 5DTJA 4KXUA 4W4TA 3WNZA 5JNUA 4FMDF 1GKYA 1Y63A 2CDAA 2I7CA 3I6IA 3KYBA 3MWDA 5TJ9A 4Y9DA 4PAGA 2GZSA 2XW6A 4BWYA 1ECGA 2Q9BA 3KKLA 1C9DB 1E9VA 3EODA 5DISB 1Y7PA 1LH0A 8GPBA 1AHPA 4RTMA 2GJ8A 2HK7A 2JLCA 1AKVA 3STXA 1U3CA 5LMCA 2VJYA 1ETHA 2PTGA 4ZCTA 3CRVA 3SDZA 5JDIA 4B73A 1MO6A 2NU6A 5K8IA 2JJMA 1R74A 3A9CA 3LAWA 1T5DX 4YRPA 5C8YB 5TT1A 4PGAA 3IP8A 2NXCA 2H07A 2SHKA 4YJ3A 4E4TA 1YIAA 3DC7A 4HB2A 1P39A 3F49S 1ZXXA 5FO1A 4R1UA 3WDSA 3VO1A 5CA1A 2ZB4A 1WZUA 2YMMA 3UQYS 2A9RA 3E9QA 3NUZA 2R5NA 5TMPA 3PX7A 1WXQA 1GHTA 2G5CA 3DC2A 4XQEA 4C5BA 3AR7A 1SJ9A 2QXYA 2JAXA 2SKDA 1GA1A 1KBOA 2ZPUA 2JFOA 4NP6A 3TX2A 3M5DA 1GA4A 1Y4DE 2DC1A 2OTCA 1U2DA 5E1MA 4AUEA 4F9TA 2IH2A 1FMFA 2D59A 3A14A 3D6UA 1BMQA 3H97A 4MGYR 1NTOA 1UP4A 4XIJA 4DB2A 1Q17A 5JU6A 3FMVA 2OXFA 5CH3A 1G64A 1NR7A 2QUJA 4NCHA 4XAQA 4DUPA 2QN8A 3AC0A 4YIHA 4IIEA 4R0VA 5IM5A 1JIQA 4OL9A 1WVIA 1X7YA 4ER0A 2OFPA 2E1RA 5G53C 3CGGA 4HLUA 2EJBA 3KELA 4L15A 2GZRA 1GZHB 2CNLA 2FRDA 3PDIA 4N5MA 3SHWA 1XQ9A 1L7MA 1PG0A 3GEDA 1JT2A 4EMBA 1RC1A 4KWCA 1NVAA 2X0NA 4AKGA 2ZAYA 1QOPB 5LZ4A 4Y9RA 4P4GA 1SU7A 3GCWA 5KTMA 2G70A 3MINA 2Q3HA 4MYUA 2G71A 5GP1A 1QANA 2VRCD 4PC2A 5AW9A 3ZDZB 4AS3A 2O8CA 5JSZA 1OX6A 2Z30A 4YO7A 4W99A 2EX4A 1QHNA 2M6SA 2GUWA 1U8EA 3KUDA 2P6RA 4IDAA 3RJ5A 2HL6A 2WNHA 5AJVB 4PLFA 3HXOA 2ZJAA 4LJYA 4A5SA 3NVDA 4ZZIA 1QF7A 1NURA 3D5TA 1YQWA 4RCZA 5HMMA 3AHDA 3BN3A 1YDFA 5BRAA 1NLMA 5DPMA 1I1NA 1SCKA 2ORVA 1BAPA 1E1CA 1O9HA 2XWSA 3GGDA 1J56A 3BEDA 5HF6A 1WETA 3OTGA 4IQ8A 4LGMA 1EDOA 4LQ4A 2Z1NA 3PZBA 3C85A 3KDPA 1VSTA 2RONA 5FB3A 2ZEJA 2BTQA 1G7SA 1XQ1A 1SUWA 1VL1A 1NPYA 1YJ5A 3S2ZA 5AW6A 3TH5A 1CEXA 4P38A 1TUIA 5DXJA 1QH1A 1SKYE 3ILVA 3FRIA 3LPCA 1UPTA 3U4QB 2VEDA 1IRXA 1ADJA 5DOVA 1UJ2A 3WLAA 2ISCA 1IZ8A 4Z9XA 4DLRA 3VH3A 1EHYA 4KREA 4WRRA 2JCVA 1RAGA 3OC6A 4KDEA 4EZEA 1NVXQ 1VJRA 2DKFA 2V7QA 2ZSIA 2EIXA 3EIHA 1YIOA 3ORSA 3QKRA 2OD7A 2UZ1A 5IAEA 2CCJA 4CV2A 2YYZA 2QNRA 2JJ1D 4EECA 1CUEA 1AKWA 1RCUA 2HTEA 2WYWA 3SMVA 1DKMA 2H4JA 2OUKA 2CLIB 3QYAA 4DILA 1S96A 4DIOA 2EKBA 3FCSB 4DCCA 1J49A 4Y2SA 1SKBA 4X84A 2H1VA 3CNOA 4CTJA 2BM1A 1Q0SA 3BRCA 3H5OA 4OQNA 4BUJA 4DL9A 1BMFD 1MAWA 3QTTA 2EZ9A 3AJDA 4UMFA 4AZ3A 4Y3UA 3FIUA 4YMGA 5KDDA 4LJ9A 5C3MA 3O84A 1T0JB 4CPDA 5JH7B 5CLIA 3EFEA 2QL7A 3PSHA 2IITA 4NYJR 4F1WA 4TZ6A 1Z16A 2CNOA 4QUDA 5K99A 1FXUA 3IPLA 4ZAGA 4OFWA 2VHWA 4KMMA 1TYAE 7YASA 2HT1A 2FEXA 4K86A 3FF4A 5KCZA 2IPMA 1YGYA 3HWRA 4MSUA 3N8KA 5LOVA 1PGJA 3DDHA 3QE0A 3BRWA 4HAZA 3AEZA 3ZEAA 1WXEA 2GF9A 1CUJA 2RKBA 5F3DA 1I4TD 2XZPA 1HUQA 4Q9DA 3ILYA 1ZSNA 4JVOA 2FDCA 3FG9A 3P0JA 2FTKE 2AB0A 1VJ0A 3RVLA 3OM1A 4UUOA 2JGNA 4C6SA 3VR1A 4JMLA 4D41A 2HFJA 2YFQA 4YV1A 1H69A 3OQBA 2HU5A 3TLMA 1WEHA 4MQMA 3CY6A 5CFQA 3ASVA 2GKSA 4B7ZA 1BA2A 2NN3C 4J2OA 2C2MA 1IUOA 2OV2A 1E98A 2BW0A 3UK7A 2NU9A 3A04A 1Y3CE 2OC4A 1GP2A 5DBOA 5T3YA 5LQAA 3G13A 3U3DA 2WJJA 4WY8A 2CHUA 2H17A 3ELBA 3OFSA 3P9SA 4PQFA 4U63A 3NALA 1FFAA 1ETUA 1KVSA 3F8TA 3GD5A 3P0RA 5DI9A 4J0KA 2JIMA 1XTBA 2OP0A 4IIFA 3VZQA 4ZHQB 5GY7A 1I7DA 1M1XB 3HNRA 2XB2A 1LRLA 3LW8A 1P73A 1WBJB 2CHEA 3RYIA 2FLWA 3JALB 2XF8A 2D7JA 3CF0A 3JS5A 2PVPA 3QWBA 5A4MS 4BN0A 2PUWA 3FWYA 4PYJA 2ZZMA 3KVOA 4ROTA 4UXIA 4RZIA 3W8NA 3SC2A 1J39A 3OEYA 4TL9A 1IBRA 4DXHA 1T3LA 3DVRX 5CT8A 1DI0A 3SEAA 5JWRA 1XZQA 3QUQA 3JVVA 6PFKA 2V6JA 1Y6ZA 3PFWO 5INTA 2K4MA 3KXLA 2BM0A 1CDOA 3P2MA 3HB4X 2ZI3A 2C7BA 3ESYA 4JJ8A 1SD1A 4TUYF 1J9GA 5ITWA 3IAS1 1VLHA 3ENQA 1V71A 3JQGB 5JCOA 1SB8A 3BWEA 1CUHA 2O2DA 2AV6A 2FF7A 1KXJA 2JFUA 3IQWA 3TNLA 3USES 4BWVA 3AQIA 3CPJB 2TSYB 3DM5A 3HBFA 5KQGA 1GTG1 4L9WA 4Y1RB 3RREA 5B12A 5BNWA 2BBWA 2Y4OA 2YZNA 3ABQB 3F5DA 3IAXA 1CQPA 4JASB 3GEIA 2B1IA 4BB5A 4S3MA 1AN9A 5FF9A 1P3DA 1EKXA 3D4BA 3RHZA 4JL5A 3EVCA 2OAQ1 1XTTA 2W8BA 4FOSA 3SLGA 2QT0A 4KJZA 2FWAA 2VUIB 2XE7A 1Y4ZA 4KH0A 2NU7B 3I2GA 4PLCA 4AF6A 4DNXA 3CRRA 5EQFA 3WE7A 3VDQA 1KOGA 4QRIA 3S2GA 2WSIA 3B9PA 1F3LA 4URWR 1IB0A 4YQZA 1QHIA 1C8LA 2C2OA 2LKDA 4WCFC 2CVZA 2CXXA 4JUAA 3WDLA 5EHIA 3EVBA 3V3TA 1RI5A 2A4KA 4B46A 2EP5A 1W47A 5LQSA 2W2PA 3BMQA 5LYJA 4F46A 5A2GA 3IBYA 1TQ2A 4NYMR 3TQCA 4OOFA 3RM3A 4OLJA 4EDFA 4TWBA 3GRPA 3PHBE 4GWGA 3A2NA 3AGQA 5HXAA 5JAQA 2GD0A 4Q9IA 1E0SA 5NLLA 5DP2A 3K9FC 3GNSA 1W35A 2HADA 2OORA 4TL7A 1A9TA 4Y7DA 1C50A 3FPCA 3KZOA 1M8FA 4RKEA 1OHHD 3ADKA 4DCJA 4DQUA 4EHKA 5AW2A 5JNVA 5LQDA 2CSUA 4H0FA 1TW3A 1UANA 1DX9A 2PQMA 2A0WA 2A1TR 3BWVA 1B8NA 4DCSA 2P5UA 1DVRA 1L7RA 1PJBA 4QQFA 1KTVA 1YU6A 4HTAA 1GCUA 1UFOA 2ETXA 3CZCA 3MYRA 4J0FA 3QMMA 4MCJA 3ZV7A 5BWNA 3EC2A 4B81A 1FQJA 3KLBA 3D64A 5JSYA 3HA3A 3WYAA 1V5IA 2B21A 4TLBA 5TQ2A 3SSNA 3ESAA 3S1AA 1A3CA 4JOQA 1DRUA 1N7JA 4I8DA 1FFEA 2GN0A 3NHLA 1E0DA 4ZEXA 1U7TA 5B53A 3H9QA 4INPA 4IVPA 4LRQA 3MWGA 1RFLA 2PZBA 5T67A 4TT3D 4G5XA 2P9JA 1P5ZB 4NBNA 1V95A 1Y7TA 3HFSA 5A3JA 4RIEA 1RJFA 3PCXA 3OQ6A 4JJEA 2YTZA 2G9NA 4E5MA 1CUAA 1JYSA 1Y81A 3MRTA 4NH4A 2B6NA 2ZS7A 1KI7A 4OOEA 2IJGX 3UCEA 1SCNE 2VTDA 3BFXA 1Z5VA 1JKFA 1EEHA 1IWOA 1HPLA 1LX7A 1YFZA 1YJ8A 1YQTA 2B1JA 3R0QA 4KPFC 1X7DA 1Y7HA 3GD7A 2AMYA 4ZXFA 4DCNA 4D9KA 4MCHA 5D51S 1Z75A 4CUZA 4NXNB 1XZGA 2AJBA 2E55A 3L6UA 4XVRA 1H0RA 1NTRA 3OURA 3GR6A 3GRFA 5J58A 5E3HA 4CEHA 5JCJD 3V8BA 3OLWA 3OZRA 3K20A 1L7PA 4NFHA 1HZZA 3C7AA 3AI2A 3T1VA 5I8WA 4PSCA 5JMWA 4QECA 3MA0A 1D8AA 3KVYA 3LX5A 1Y9AA 1A8PA 4Z7OB 4FS8A 3A0RB 1W25A 2G9ZA 2IHZA 3L4EA 3QV2A 2IKQA 4I4CA 4WFQA 3E8SA 3PUXA 5FCDA 1K08A 1EP1B 2XI4A 1JB9A 3C5EA 4KB5A 1E2DA 2A5LA 2IRWA 4YCBA 3NHMA 3PTLA 4Z1MD 3OF3A 5A71A 2BP7A 1V4VA 1N1MA 2L2QA 3U0VA 3PLNA 2HC9A 4IS2A 2P3OA 3H0KA 3EE6A 2WSYB 3DBHB 4PN3A 1PBNA 5HZHA 3FWZA 5THQA 4C3ZA 2E21A 5EJ5A 3EA4A 3ZQ6A 2AR9A 4RQUA 2G77B 1NLZA 2E4YA 4ICIA 4PC7A 5CK5A 1TKRA 2RAVA 4HUTA 4Q5IA 1OE0A 1B6GA 4HGYA 4EI8A 3GFTA 1N0IA 3MIZA 2CJPA 4RK6A 3AF4A 1E4EA 1ICIA 3TW8A 4LK3A 1DMRA 1V5WA 1T3HA 2V9ZA 3O1LA 2PH5A 4PAQA 2WFZA 1L1QA 1U81A 1XRJA 2QMZA 3ES9A 4QT0A 3UVEA 2GXAA 2A0XA 2DLDA 3QBTA 4X95A 4BO4A 1TI7A 1PT9A 3ZQJA 4BX3A 4F8EA 1WDKA 1NBMA 3RVBA 3OLYA 4JI2B 2JFGA 4FLFA 4IIJA 4IP0A 4TS4A 1CYEA 5DT9A 4GMXA 4M8IA 5AI6A 3GYGA 1AQYA 2Z0MA 6AT1A 1J0EA 2BZGA 2VDJA 4XM1A 1PKXA 1YFJA 1QZXA 4LSWA 4TLAA 4BBJA 2IS4A 3AEUB 2B98A 3UHJA 4DEVA 2JLBA 2BSXA 4MVWA 1S8OA 2PMKA 1PLLA 3LSYA 4L4SA 4P4UA 2J3QA 3THWB 1IXYA 3EISA 3OQIB 3UPDA 2V7WA 2VJMA 3CUKA 4YJFA 4TV9A 2HCTA 2D7CA 4DLUA 5HZGA 1IJFA 1ZN8A 1AVTA 1JBQA 3AP2A 1YZUA 3M6FA 2QA5A 2IZ6A 4M1OA 4QJ4A 4K1XA 2JIZD 3L8MA 1GAWA 2J9RA 3ZHUA 1A5TA 1ADCA 1HEYA 3K70D 1R5OA 1W2HA 2XE4A 2WINI 2FQYA 3CEHA 3ZCRA 3ANMA 4AJNA 3AM1A 4Q3AA 1A82A 5HTOA 3OJWA 1JEQB 2FR8C 4IBOA 3ASUA 4GZMA 1A95A 4MVJG 3IDAA 3LBYA 2IPLA 3NDPA 4QGHA 2C2XA 4MW2A 1F14A 4RY9A 3OFJA 3DPIA 4TRRA 3ZCUA 2CVHA 3BDIA 3IULA 1RMTA 2HHJA 3F3KA 4WT7A 1G3RA 1IUNA 1ZJ5A 2PSEA 2QIOA 2FQQA 3LDHA 2Y1FA 3EVTA 3E2IA 1Z8HA 3QELB 4FOTA 2ONJA 5CG1A 4EB6A 5L7TA 2X5KO 2HA5A 3I1YA 4RVDA 1XMQB 4HY3A 4URYR 2QWXA 2QPAA 1V8FA 1FLDA 2DQYA 1O6FA 2IQ5A 4RTOA 1PYGA 1TD9A 1RLJA 1UKZA 2H4WA 2IEZA 3OIGA 4KQHA 1G9SA 2B4AA 2C4HA 4XGRA 4G8DA 5TB5A 3WO0A 2O8BA 2X1VA 3OZSA 4Q1AA 4V3CA 5JAIA 5EP2A 3THRA 1R0RE 4KFCA 1AV6A 2OD9A 4LNUA 1BX3A 4PV7A 4UMVA 1L5OA 2IYYA 2X8JA 3GCXA 3JQ8B 3KJEA 3L7DA 2GPBA 1DC5A 4TYWA 5JSQA 3EEYA 3I2HA 3DJFA 2I6UA 3N2YA 5E6SA 1XZNA 1YAHA 3L7MA 3R0VA 5FQNA 2NYUA 2Z8YA 3ZWVA 4DXAA 4COOA 3HCPA 4EDHA 2WR8A 2WJAA 2C1ZA 3IEIA 2P91A 3NHAA 4Q93A 1I4WA 4I0WB 4MIOA 5LB4A 4B3IA 1F48A 5E6UB 1RHRA 4HFRA 2PXAA 3WWPA 4OXKA 1PR1A 5D3ZA 4OQQA 1NI3A 1G2QA 2DSTA 3ITDA 4EHJA 1GADO 4FUTA 3C1TA 2XTMA 5I7FA 2ATEA 5TARA 4IKOA 1KAGA 5E1DA 2H92A 1EDDA 1C0LA 2ZS8A 3UMMA 1F9AA 4V02A 4E94A 3V4RA 4M38A 3MXTA 3K09A 4NU6A 4UUNA 3VNRA 3WK6A 4PTLA 5FPKA 3WWOA 1GUZA 4WKGA 2AMLA 2XT9A 2V7PA 1B8OA 3SI7A 2OVFA 4BV9A 2IQIA 1T5BA 4PGMA 4N7RA 4K8OA 1G6HA 1Z0ZA 1ZICA 2QKYA 3CZQA 3GLSA 3T4EA 3G9XA 5L6LB 3E8MA 3VPHA 1Z63A 1IAQA 1YK1A 2BISA 4ISBA 1S2LA 3IESA 4OQ4A 4KP7A 4QC2A 3KC2A 5ALKA 3IURA 3PR3A 3SS9X 1DFIA 1DQZA 1U0FA 4JB0A 2I3DA 2W93A 1PSZA 5M7EA 3LECA 2XYHA 4B3TB 1BE6A 1KEUA 3SM3A 3M33A 3OZ7A 5HIAA 2JGEA 3GFGA 1EVYA 3NEPX 1TMKA 1BOOA 5A03A 1RPZA 1YE3A 1OBCA 1I32A 1RW4A 3QFFA 1MCZA 1C30A 4WDQA 3SNKA 1OOEA 3ZDYB 1XU4A 3TOCA 4YCLA 3IV6A 3L41A 2EKZA 3Q6MA 3Q3VA 4P7KA 5CX1B 4BNKA 2IXBA 1OPXA 1QX4A 3HUEA 5E7IA 1XBTA 4FFBB 1ENPA 1NFFA 2DH5A 1XHEA 3EIFA 3COSA 1J20A 1HDEA 2RGBA 3BSFA 3QG5A 5K51A 3ZIAD 4IQ4A 1XPOA 4O2BB 4HQ0A 5JSKA 4C0QC 2HCRA 4QIHA 5J2TF 3I0ZA 2J31A 1NM5A 1B15A 4GL4A 3TFWA 3KWLA 4X3OA 3M3PA 3KYCB 1JU3A 4GLBA 2C7OA 1CJMA 4F5DA 2XGJA 3NTLA 3O3OB 1HMYA 3IAFA 1GZVA 3UT0A 2JGFA 121PA 2FFAA 1KSGA 3U39A 4B4UA 4D96A 2ATIA 5FDFA 4D74A 2PSHA 3Q2IA 1NVFA 5KYUA 3KOYA 4D8XA 1YZKA 1N3BA 2VDOB 3NPMA 1PK7A 4ENVA 3HLYA 2YBEA 1YA6A 1UAAA 1BROA 3GDGA 2XZOA 3KT3A 3U3JA 4R0MA 3KQMA 1VLVA 2W37A 3PFKA 2QRZA 2OHOA 4HUQB 4JLKA 1WMEA 1WVMA 3LJKA 2BBOA 2QL9A 3INRA 4R5MA 3WHLA 3S2FA 2PH3A 1MENA 4CG3A 3GU3A 1P7PA 4FWBA 3T5MA 2WHPB 3WK8A 1JPUA 1SH7A 2BEVA 3QPCA 5I9BA 1GV0A 4MV0A 4N65A 5AK5A 4JEHA 4NDZA 3X1XA 5HM6A 3WGNA 2GEDA 4O2LA 3QY9A 2BGMA 2GRAA 3ZWWA 3MNFA 4BZZA 2LPMA 2OPBA 3QPBA 2Q46A 1IPFA 1FYXA 1U9IA 4CQLA 5AW4A 1E5QA 2ZSUA 5MN5A 2CDBA 4ZV4A 1ZR2A 4IW3B 1D4OA 1RXEA 5G3ZA 2PMCA 3TLKA 1TIPA 2P0AA 3UJHA 1KNXA 2UYGA 3MZ0A 1RRCA 3IKLA 2PRSA 2OCIA 3KB1A 5KVQA 4NZNA 4IF6A 5HFJA 4AN4A 4KHPB 3EQ9A 2QTNA 4RVOA 3SSOA 2OWDA 1CDDA 1K68A 2C8VA 4EHDA 1YOVA 1T6NA 1I80A 3RBZA 3DL7A 2UYHA 2I22A 3R7BA 1J2YA 1A4IA 4R8VA 3TX6A 4DRXB 1ZOLA 3DEHA 3N0TA 4F2PA 1QTRA 4CE6A 2X15A 3NBZC 1JPVA 3A25A 5KQSA 4UEWA 1JYFA 1WSBA 1C7ZA 4PRLA 2JKVA 2R44A 4JLUA 1SEPA 2M32A 3HB1A 1PNRA 1GNQA 3F6RA 3QA9A 3WGGA 4FE4A 2Y2VA 4EA9A 1KFJB 1TUBB 1GXSB 3ZPXA 2HIMA 1XVVA 1NULA 4P82A 4PE5B 2YWHA 3RUIA 4D4KA 4DADA 3W5AA 2XMDA 4TKZA 4NV0A 1OROA 1HTWA 1XOIA 1R6UA 1YDGA 1F1JA 1XMSA 2FDXA 2C3UA 3D4OA 3WLIA 5CA1B 1L4EA 5G1NA 2HH9A 3FZGA 2ZBGA 4HZUA 4EOGA 3CFYA 1NY6A 3EUWA 3ESDA 4HSEA 4AM8A 1NSYA 4NL4H 4G5HA 4Q03A 4YP5A 4MX8A 4MAFA 4ES6A 4Z1OA 3FJYA 3GPDG 3HL4A 3REFA 3LPDA 4YUXA 3OJLA 3GIDA 2N1MA 1E66A 1JXMA 3IAHA 1VHTA 1WPQA 2AJDA 2R2GA 3NHKA 1M2EA 3BD6A 4ZVTA 3BE8A 1UZMA 1NXVA 4CDMA 3GXBA 3DEIA 4JOCA 2R3SA 2C00A 5FL7D 4RW0A 3ANXA 3THXA 1GARA 2BKEA 1PJSA 3NWPA 2ABWA 4KI0A 4XLLA 4COKA 2IKSA 1ZOPA 3F5MA 4LHYA 3B8EA 3TW6A 3ICQB 2V6FA 1KE1A 4Z4IA 2FPGB 3IVMA 5LA6B 1KXZA 5BPFA 4X1YA 3VSBA 2HXSA 4OHWA 3EXG2 4HGZA 4OBBA 4C22A 5L3QA 3WGMA 1JZSA 5IUNC 2GNPA 5M5BA 5B1HA 4NOKA 4NJMB 2ZYRA 4UNRA 1HE4A 1PL7A 4MVJH 2JGMA 2H1LA 3DEZA 3OO1A 4C7XA 3WNCA 2PCJA 1GPKA 1BS2A 3NV7A 2RH4A 2ZZNA 2WHXA 4LTMA 4Q4CA 3OX4A 4WA8A 4IJWA 2Z4RA 4F11A 3WLEA 1V9CA 1P9NA 2O5EA 2G8NA 2IUEA 2ODQA 2VF5X 4RTPA 1QGUB 2HJSA 3PE4A 1GEGA 3DHVA 5ADVA 2OUIA 4MUMA 1PVDA 4N3GA 3PK0A 3BH0A 2K5UA 4JJKA 3LT1A 5K0BA 1F6DA 3ZWDA 1Q84A 4EB8A 3BERA 2WWYA 1B6TA 3U4DA 3PB3A 2XMCA 3QLVA 4FK8A 4PPGA 3WS7A 2XYRA 1UADA 2OCPA 3VNAA 4FFMA 1UPCA 4LJRA 2Q3EA 1G38A 4PLZA 1V11B 2I4LA 2DLCX 4JN6B 3WK9A 1V5GA 2IXGA 1T8RA 1SUBA 2ZRMA 3AFNA 2A9JA 2PWYA 3GLTA 3R7WB 4CM4B 5HQ3A 4WNAA 2C2YA 1HG0A 3AY3A 3G82C 1A5SB 3RSZA 1W34A 5TF0A 2C3PA 3EZ7A 1L7QA 3ZVLA 4IDGA 3DZFA 3LYHA 4OB7A 2Z2JA 2C77A 3B85A 1C8BA 2FUCA 4PGHA 4WK2B 2WDPA 1C0IA 3KP1A 3HRIA 2QGZA 1GVNB 2IIBA 5DLDA 1JHRA 1PJ4A 3Q3HA 4S24A 4U8GA 5EE0A 1IVNA 4PHCA 3IRVA 5GV8A 2YN0A 1G6KA 4UBJA 2HQSA 1X9HA 5I5GA 5IRCD 3JX9A 3PQ7A 3K92A 5I3CA 2OYSA 2IYUA 3HUTA 2JIRA 2GZMA 5CDSA 2SBTA 3QNUA 1SOWA 3MTBA 3E3NA 2QD4A 2VDWA 3ZUPA 2ZJOA 2G9QA 2CFSA 1H2HA 1PEKE 4KITB 5JALA 3OH8A 4PBTA 2Q3LA 3R9XB 2I4IA 3JRWA 4RF2A 5FA5A 3KR2A 3CA8A 1ISIA 2BMDA 4NLLA 4B5LA 5CT4A 13PKA 3LNTA 4Q9HA 1JAXA 4YA6A 2GZDA 1TAGA 1RMYA 3FYUC 3ZCXA 3BRWD 3G2JA 1XLTA 1EGAA 2QVCA 5DGIA 1USUA 3ZLJA 5B4VA 3GB9A 4UEJA 3WYBA 4E22A 2EW2A 5HIMA 3WC4A 3ZK7A 4B7CA 3K70C 3RJ9A 2VJBA 3SBDA 3JQQA 3KR1A 4J1TA 3AIKA 5IJXA 3DMFA 4MQBA 5AKJA 4EF5A 1PNTA 1F60A 2H51A 3AVVA 2BEWA 3F71A 1WUKS 4AT1A 3HJBA 1NQTA 1BWRA 2VNSA 3L0SA 4DA4A 4BFZA 1HO3A 1ITZA 1FDRA 3NIBA 4JBLA 3L93A 3RAPR 4IV5A 4DRYA 1AD2A 3T34A 1AV7A 1LF5A 1N33B 3NTRA 1L5WA 3AVUA 1M7HA 2NW6A 2OO3A 3GXOA 1FMJA 4FN5A 4J7CA 3L0CA 3H2ZA 2MYTA 4TRJA 3MWFA 2BFEA 3FSJX 3VPFA 4RA6B 1MRNA 2IZ0A 1IDN1 4PTZA 7GPBA 2O8DB 5SY9A 2DH6A 4LISA 2JBAB 3COZA 4FX5A 1BEZA 4PC1A 4UBOA 2ZYHA 4LCBA 3H18A 1O08A 3L7OA 3VKVA 5BQPA 4HYYA 1T8UA 1ZISA 2C2KA 4YT8A 3DM9B 3V6MA 4EPYA 1LJLA 3ROKA 5HTKA 3E9YA 4FGWA 5EJGA 2IW3A 3S28A 4GR5A 2D5LA 2AA3A 4QUGA 1FPMA 4HNRA 2P6PA 4FS3A 4NEGA 4ON9A 1E2MA 5D5QA 3EXHA 2BEJA 3WRYA 4OXIA 2PJRA 4JA2A 1HDGO 3VR4H 4A5OA 2QTVA 3F0TA 5JD5A 1MO4A 1X13A 1YNOA 1IXSB 2ZT5A 1Z0SA 4YBRA 3TQRA 5AIBA 3PJRA 1NSFA 1PSDA 1GPMA 3OE7A 1NP7A 3ZJUA 2P69A 3ANYB 3TD9A 3HVHA 1BX1A 1PWHA 2CNBA 3FR7A 1UQUA 3I9JA 4RWEA 4HNUA 5CB0A 3JQRA 2XRZA 5IHPA 4JELA 1E0KA 5CRIA 5ENZA 2HQ1A 4G0PA 1NUHA 4HFJA 4DC1A 1MVLA 3GH3A 3HRHA 2QAGC 2XDYA 2CL5A 4G86A 3TNYA 4FILA 1Q74A 4KDRA 1OLSB 3I9V1 3ZTTA 1YACA 4LJ8A 4GW3A 2J46A 2CDCA 5E3JA 1CQXA 1G63A 3TRHA 4EFLA 4GZLA 1DXOA 1NDQA 1THZA 3A3PA 5I4CA 3P0IA 3R09A 5SICE 2HDHA 1EDEA 1UBFA 2NTJA 2Y1CA 4N18A 1KC3A 4MRMA 1VL5A 4NFYA 4Z0PA 3PEYA 3A36A 3H1PA 2XNCA 2C92A 4HQRA 5DI3B 4H1WA 3IVCA 1I6MA 3LI2A 4P2GA 2XKKA 2BSQA 4R2WA 1MB3A 4XD2A 4P92A 4WVFA 2O1SA 3ZJTA 4P2BA 2YY5A 1UMBA 1Y4SA 1OA0A 8LDHA 1E1RD 4NEQA 3HDGA 2AWOA 3KYIB 2LRHA 4J2HA 1IBMB 1MOZA 2QZJA 4MA4A 5ITZB 3S0JA 2OB2A 1YQQA 2VQDA 2IHJA 3TYXA 4FFNA 3TOZA 4I5GA 1XI2A 3EC7A 2Z2XA 1ZG3A 3A4YA 2VF8A 2HZBA 5KKCA 4Q1DA 2JCXA 4ARCA 2XZDA 3PQ6A 1L7BA 2V7VA 4TGLA 4HDKA 4PAMA 4FKMA 2OCBA 4EPWA 2QMHA 1GQFA 4FXOA 3T1TA 4QDZA 1I2ZA 1QE0A 2FZ5A 1UFVA 1L5YA 3MJ4A 4KV7A 1DUVG 2QMQA 3OT1A 4ZOAA 5IKXA 5KSYA 2WJWA 4OEHA 5FEUA 2B94A 3F1KA 5SY4A 2EZTA 5HJ5A 1E9AA 4MUIA 4NHOA 4X1IA 1JIVA 3NONA 1VGQA 4EJSA 4BMZA 1L2TA 4URUR 4OHKA 3S55A 5KOJB 2FW1A 5KX5B 3U1BA 1CUXA 5LNK1 3VZSA 3BD9A 2CBXA 1SD5A 1G4AE 4EGJA 3WLQA 3G2IA 2Q0QA 4IIUA 4LHWA 4R54A 1DFHA 4DV1B 2VDKB 1D5CA 1JZTA 4JAVC 4RMNA 3V4FA 4D4JA 2R1UA 4UQOA 1ILWA 3BULA 4UZEA 1GG5A 5LMNB 2KB0A 2IU4A 4C4PA 4CR7A 1RKVA 1CQWA 2GOYA 2IX3A 4LZOA 1F5NA 1Q3HA 5AI4A 3SBXA 9LDBA 4A15A 5JO0A 2Z6VA 2YZKA 3VVLA 1USKA 2FKNA 2QX7A 3NOVA 5K9ZA 1D2HA 1G8MA 2UZ0A 1E2PA 3C5VA 1ZYUA 3PHIA 4UM8B 3TR5A 2WLSA 4CM8B 3MTJA 3F9IA 4Y6LA 3ZV3A 4L08A 3H4TA 3KQOA 3PC3A 5I4KA 3LUKA 1UIMA 4YUAA 4A4DA 4E21A 5EY5B 8ATCA 3DLAA 1T0PA 1JFSA 2QEQA 3L4BA 1NT2A 3PQ3A 3QNMA 4KGXA 5DGTA 3U7JA 4R1OA 3AB8A 4IJVA 1ZGGA 4NBSA 5H68A 1O8BA 5C81A 5L3RA 1KSFX 1LTQA 3QBEA 1XYYA 4GR9A 1P9OA 2ECKA 4O25A 2CBZA 4U9UA 3ER8A 1EESA 1J99A 3C8HA 2UVPA 3KJXA 3EEFA 4ERXA 5CXQA 4RPIA 4TWRA 2D8AA 3A10A 4YYEA 2ZJZA 2EBWA 2BM8A 2XJ9A 3ZNQA 4X6UA 3GFBA 4LYDA 1ZCJA 2VA9A 2C61A 3NHZA 5A04A 1BXGA 1B26A 3N75A 3UHPA 5TQJA 4JWTA 1KYWA 5TSDA 1FS6A 4O4IF 5TPWA 1G4HA 2IXTA 4PRZA 5D00A 3NATA 2FMKA 8ADHA 3DFIA 4X7RA 2XAAA 1U1GA 2E1PA 2X0KA 3EZ2A 4JJIA 3S27A 1P72A 2B9EA 3RKRA 1NF9A 2NT3A 5KYVA 3A9SA 2RIPA 1DC6A 4XYMA 4DCMA 2VNKA 5KJFA 1GA6A 4YC7A 3NJ4A 5FUBA 2F55A 1XDSA 3G79A 4R7TA 2O6LA 1K6EA 2TMKA 4Y1EA 5G1PA 1OZGA 2Z9BA 4H3VA 4YUWA 3SQNA 4YJ2B 3GLFA 4YREA 2Y1XA 2A5GA 3IVRA 1IG3A 5G3YA 4B43A 1LV7A 2B1QA 2AZDA 1FNMA 2BHSA 1E2IA 3FGZA 3UPUA 4FINA 1ZAYA 2ZUWA 1WBDA 1L5LA 3C6XA 1PQ4A 4GP6A 2JDID 3TRJA 4EJMA 3Q8XB 3MCUA 4WI1A 2IV7A 1EDBA 3OCUA 4NULA 5BNZA 1VKZA 1Q1EA 5AVQA 1JHYA 1USVA 3TOXA 1NBMD 2WM8A 2WWWA 5GZ1A 2DCMA 4YRQA 4EI9A 4ISCA 4ZWNA 2P2NA 2W7TA 3HKDA 2DFDA 3AUUA 3U40A 4EKYA 1N3LA 4ZIRB 1BQ3A 1R6BX 2Z2KA 4RZSA 2ZSAA 1PJLA 5DLYA 1AO0A 2HJHA 1J1ZA 1YVUA 3P8ZA 3DUFB 1HMPA 1ZUWA 2NO1A 1ZSYA 4PO3X 2JL1A 3VGPA 1M2NA 1ORDA 4RXTA 4Y9SA 2H5LA 4M87A 1Z5NA 1UDRA 5KREA 2ZITA 1NJFA 3INYA 4JSRA 3AG6A 1JI0A 1R0SA 2FW6A 7MHTA 1GG9A 2OLKA 5H82A 4C0XA 4CKWB 5KUTA 3GVHA 1NQWA 1JVSA 4C4AA 1DXHA 1OU4A 2C4UA 3DV2A 3ZLVA 1QK5A 5IK2A 1ZMOA 3FH0A 2WF9A 1Q1AA 4MDYA 4C4RA 1KP3A 4JOSA 4JKOA 5D1HA 1ZCZA 2D5IA 1B2LA 1ZP6A 4LZNA 3EZXA 3M6XA 4FFOA 4M37A 4OLHA 4AO7A 1QX3A 3M6IA 1NXWA 1DTSA 2H6EA 2L17A 2OY0A 2CXNA 2VQ6A 2WNSA 4LTNA 4BUCA 5LNK6 4X60A 2D7DA 2PV0A 1OREA 3IODA 2Q3MA 3RI3A 3EUFA 5EC8A 1SHTX 3QVTA 2W71A 5AVXA 2FMHA 3JRNA 5GZ3A 5E0OA 1C9EA 1DC8A 3ORQA 2JGDB 3PD1A 1E96A 2I0FA 3CLTD 4ZAFA 2PMFA 5HKKA 4IUYA 3B9BA 4FZ5A 4E7OA 1SOUA 4RV4A 3FYDA 4KI7A 1KJWA 4MIKA 5HQJA 2WYIA 1S02A 5LC1A 1II8B 1QP8A 1MQSA 3GJ6A 1DT5A 4E1AA 3QX7A 4BP1A 1NN3A 4U2FA 1KEKA 3OE5A 5B1EA 4OREX 4E4RA 5JVDF 3KVRA 2XUQA 5CB4B 3K9QO 1RKQA 4HEA1 1U8AA 4G8BA 4OGGA 3Q3GE 5IP5A 1MU0A 1SUPA 4WGFA 4L9SA 4NYIR 2TECE 3H9BA 1O03A 1KS9A 4I9HA 2YV3A 4Q1EA 1EX1A 5KTKA 5GJWC 4DMGA 3U13A 2ON6A 3NU1A 2OBXA 1DWQA 1AC5A 5I4IA 1JI3A 2EW8A 2O0HA 3F4LA 1NQAO 1PL8A 4OU5A 2NQ2C 3JAKB 3TR6A 3Q8WA 5EGNA 3DAPA 1F4PA 2WAYA 3G8AA 1WCIB 3TXYA 5C35A 1YTLA 1F6WA 2BZ1A 4B8ZA 3K0BA 3RS5A 1WLYA 1ZM7A 2XUIA 3C0KA 3DDWA 3OU7A 4WKNA 4U3JB 2DWOA 4XM0A 4K5QA 3TIFA 3FHOA 1JH9A 1WOYA 1Y1KE 4LOLA 5HPYB 3E48A 4AUNA 3EC1A 2FPWA 5BVHB 1TO2E 3OFND 4R84A 4CL0A 1NMZA 3HKCA 2QTRA 2JEOA 1DELA 2R6AA 1Z0DA 2RGXA 1LY1A 4UNIA 3EDQA 5FIUA 5ITVA 1KF0A 2RSLA 3EXIA 4L2IB 4N8SA 3W9SA 3ZZ0A 2J9XB 2CJFA 2WKPA 1H3FA 4EM6A 1DWOA 2XMQA 4NPAA 3RG2A 1V9SA 1OUMA 1I3KA 2QRVB 3R1IA 5DASA 4CIXA 1Y3IA 4JZKA 1W0KA 5EIEA 2YOHA 4KQCA 3ED5A 4LW8A 1AZTA 2YXNA 4QXAA 4B3FX 5AVSA 1JIIA 2QRMA 4QPCA 3MMPA 1YDWA 5IKOA 3JWHA 3FKQA 1N9KA 3VR3A 1CJCA 2QX4A 2YHIA 4MIYA 1M1UA 1XROA 1EWRA 2YZ7A 3L0ZA 4H7IA 1TGVA 4W9RA 1WDTA 2AYYA 5DCUA 3FWNA 5FBWB 4AWXA 1Z18A 2V7EA 4FEYA 1OYWA 3EFOA 1DJQA 3TLGA 5FWYB 2JLAA 3BZUA 1MHTA 5GJBA 1PT5A 4L8VA 1Z73A 2VOJA 4X63A 1E9EA 1WXIA 3Q9UA 3ONFA 3SQXA 1JG6A 1MV8A 1V2GA 2DVMA 2VJDA 1B2RA 1U90A 2RGNA 4U5QA 3VU0A 1T5OA 2P4SA 4RK4A 1Q91A 3NHPA 2DGDA 1U99A 3DAOA 5GONA 5CW1A 3T0IA 3B48A 1UZNA 2J6IA 2FRXA 3DOFA 3HR4A 3JZDA 3HBAA 1TQDA 3TQFA 4DJAA 5CDTA 3T9AA 1K7FB 1RE1A 3QIVA 4RS3A 4MGZR 3R20A 1YZGA 4MUEA 2B34A 4E6EA 5HRUA 1IJKA 1WP9A 1XQ6A 4TXJA 4ENQA 4ZZ3A 4JT8A 3PL5A 1WM1A 4D57A 5EWJB 2FHSA 1VDZA 1W29A 3NVMB 4NBWA 1CG6A 2XCIA 3MJRA 4FYPA 2GN8A 2H31A 4FVTA 4HDRB 3ACDA 5FQOA 5FOSA 1CZOA 1NDUA 1FB5A 4JBXA 5J2TA 1UT8A 1PNQA 4TLCA 4Q7QA 4L0DA 4MS4B 1XJ5A 4MICA 1DEOA 1PVOA 1HLFA 2WD9A 3KKPA 4TMYA 4O1HA 2FZCA 5DM2A 3SZGA 1Q19A 5KEIA 2OGSA 3BUSA 3FVWA 4O4LF 3IILA 3N0XA 4Z8XA 2ZQZA 5DSZA 2X8AA 5HF8A 4JYBA 4D6XA 1ESDA 1EU1A 2EDCA 1T4CB 2KSQA 2OCXA 2HSEA 5FPYA 1TGYA 2GO1A 2C5EA 2IP2A 3ZWNA 4N0PA 4BMCA 3O21A 4XDGA 1PU2A 2HQBA 2ZI7A 4DMLA 3MAGA 5EAIA 2V0CA 3SVLA 1K27A 2YWFA 4DDHA 1NIJA 3TOSA 4C4XA 1XRRA 3EZFA 3LQYA 3NLLA 5HEKA 1GPYA 3G5AA 1GLNA 2CLOB 1MGOA 2ESRA 2XEDA 1G0NA 2XGOA 2VAPA 3EGXA 3LQ4A 3QWAA 4FSHA 4RNCA 2A86A 2PBZA 4M55A 4XPIA 3Q1KA 3P2EA 3TDKA 2I2FA 2ZYAA 3I2JA 1T2CA 2AKEA 3LP5A 4ZC8A 3GCDA 3LGSA 4XA8A 3ICVA 3RQSA 1T2VA 4D7AA 3MC1A 3QXXA 1KAEA 4IIXA 4KE6A 4LJ6A 1WB6A 1GSOA 2JHGA 2M98A 1WNTA 2ZRKA 3AIIA 3K8ZA 4D4MA 4JK3A 2GVZC 1YUNA 3UMGA 1HH4A 1CYDA 3V32A 1AX9A 1XVTA 1VLLA 1Q12A 2IYWA 2VPWA 3Q0IA 1U0LA 1X1TA 5AYVA 2GJ9A 4RFSB 3P32A 4F21A 5JD4A 1ODFA 3IXMA 4R8RA 3ICEA 1JAIA 4FONA 2H4XA 4P33A 1N6RA 1XCGB 1ZI8A 3AERA 4ZT5A 1I3MA 1C8VB 2JKZA 1RZRA 1YJQA 4QU0A 2JD1A 2YOFA 2CN1A 1EINA 4RPJA 1JH8A 1RHQA 3C5HA 3R5KA 3CINA 1Q11A 4TMTA 3X2FA 5B3LA 5KMGA 4KMOA 4OGLA 3GK3A 1KQ3A 4Q1CA 5EEHA 4J3JA 2DBZA 4WXYB 5CA0B 2BMVA 5L51A 1KKUA 1WW2A 3GC6A 2ANCA 3AF2A 2ZDHA 4GNKA 4IZ6A 4XWGA 4AS2A 3CRNA 1QXSA 1Z0JA 2OHIA 3CIOA 3K5PA 2DG2A 2M6RA 2VYNA 3H2JA 3PRJA 4GECA 4DCTA 3ROFA 1SQSA 1MOPA 2I76A 3I0MA 2VJLA 3AV3A 3PQ8A 1KIMA 3WKDA 5H4HA 5KSOA 3PUJA 1AA9A 1OBVA 3C3EA 1RM3A 3DYVA 4L5JA 4US2R 4E11A 3BCRA 1E1YA 2QZZA 2UDPA 3FKSA 4PHFA 3ECCA 2AG8A 3NRBA 4DC0A 5FBVB 5T41A 2IOYA 1H5NA 3JZIA 1PDVA 2RHWA 1HM5A 3I5UA 4ZQIA 4BO1A 4WTOA 4ZGBA 4YMWA 3RB8A 2ZIXB 3MCAA 2CLKB 2GH1A 1H85A 4QX6A 5GM2A 2YXPX 2XUJA 3O8OB 6LDHA 3P9CA 4LXTA 4TROA 1VIVA 5F98A 5JJKA 1R5JA 3ELUA 5CH5A 4MUBA 1P1IA 1KH1A 5AJZA 1HDRA 1L8QA 2RJOA 4ZEMA 5DTIA 3LQQA 5BRNA 2BFOA 3W5VA 5K6AA 2YS6A 3BTUA 3EZYA 1T9GS 1E94E 2QLBA 5KYWB 1YT5A 3IS3A 4YI5A 2R65A 4DB4A 1Z4PX 4F2DA 4FB5A 3GA7A 4EAAA 3BXGA 2XXJA 1D2MA 3KAPA 3E84A 2TMYA 4KGDA 3T95A 3NOXA 2QF7A 4MXDA 3W7BA 1EFPA 1HY3A 1O57A 5DYYA 2WA2A 1M8KA 1G5IA 1NLUA 1VZ2A 1N3YA 2H1SA 3HL0A 4AN0A 4JLOA 4C2BA 4YV7A 3EH1A 2JIPA 1H5UA 3GQBA 3UCFA 1D0SA 4FGJA 2XYQA 3H19A 5COBA 4BL5A 4ZYTA 5IBCA 4MWZA 3W5IA 4LC0A 1UINA 2V96A 4WOKA 3OCZA 1G21A 4HGQA 3EPJA 2I8CA 3DHWC 1PJZA 2X8LA 4LY0A 2VTBB 3B2NA 4LOAA 1SELA 4R1PA 3UXYA 2YKGA 4RGVA 2KI5A 2X2OA 5CB8A 4RY0A 2J0SA 3PYMA 2SCUB 4NCJA 4GKKB 4GEKA 1VIYA 4WFKA 1TF7A 1QTNA 3H17A 2PA3A 3QQ5A 4JR2A 3DFUA 4WZBA 5IDVA 5COAA 4M6WB 3EW7A 1D0VA 4MKRA 4JFAA 4MVCA 2IDKA 3DVLA 5FJIA 4BZQA 4RTQA 1W9HA 1FX0A 2FE4A 2M6KA 2HFKA 1E32A 1YR3A 1TM2A 1GGKA 2VWGA 2XR1A 1MQ8B 1LVHA 1MD9A 4HAUA 5KYXB 1NJ1A 1YQXA 1D3AA 1KEZA 1IOZA 4TLDA 4LVNA 3KQSA 2LCQA 2Q27A 5FORA 1V9LA 2QT9A 3KZVA 4B47A 5EWLA 3RKSA 4BZPA 1QM5A 4C4YA 4RTJA 3ZD8A 3RVKA 1DDIA 1KVUA 3V1UA 3QUAA 3HJGA 4IFTA 1GAQA 3D0RA 4KQMA 4AAYA 2ZAMA 4GD3Q 4AJJA 5K5EA 2OK7A 3IMKA 5SZKB 2C04A 2GJKA 2EG9A 3PE3A 1JR3E 3KWJA 5JXHA 4S05A 3KOZA 3A2MA 4QA9A 1CP3A 3FFWA 1Z0FA 1MX5A 4KIGA 4K87A 4OQXA 1B4DA 2X5XA 3DWEX 2APJA 1QNFA 4GOLD 5I9MA 3EIXA 2FP4B 3I8OA 2A9PA 1MV5A 3HO6A 1NVDA 3L49A 3MT7A 3OLXA 3O8DA 4IDBA 1GSAA 5A0TA 1TIBA 3Q7RA 3T5GA 4DA8A 1C7EA 5JSHA 1FJXA 2C07A 5DM0A 1V48A 4FC7A 3UAZA 2A0YA 3R3XA 1M34B 1QG6A 1Y0BA 4L6CA 3W78A 1XXHA 2JPDA 2V6GA 5TQ0A 1SC4A 2GEVA 3WB2A 1HOXA 3LZ6A 2ZULA 1VG9B 1K6XA 2BBTA 2H2FA 2WZCA 3ACBA 1V8DA 3QEOA 3QOFA 2W2LD 4RLFA 4C05A 2O5RA 1Y33E 4N7BA 3OHMA 4Q6BA 1DAFA 3I32A 1H3EA 2MTBA 3EIEA 2WJGA 1KO7A 4XR9A 4Z4HA 1EHCA 1AG9A 1I30A 1U0EA 2GZ2A 3OTQA 5CM2Z 2PX0A 1TECE 2R7KA 2OB1A 1M1YB 2YIVX 4DCOA 2C7GA 1SUSA 3NASA 1DBRA 5DK4A 3VPSA 3AXSA 3GEBA 4S1OA 5CHEA 3UTCA 4HN2A 1QBGA 4NV3A 3IP9A 3H1EA 4BKMA 2VRBA 3SGLA 3IT3A 1C1DB 2QQGA 4RKRA 3OQVA 3I61A 3PHLA 2A57A 3E15A 3RGWS 4HYEA 4NDNE 4Q4LA 5CVUA 4OSPA 3BK1A 2I34A 4KE8A 2YV2A 2HXYA 2DWUA 2D5AA 2J6CA 1I6KA 3R40A 1XKQA 4HQFA 5DLQC 5ILGA 3K15A 2VXBA 2XCUA 4R81A 2O2CA 4XE5A 3VH4A 4OFBA 2QHXA 4Q4AA 4R8LA 3UAVA 4BTEA 4IMJB 1IFXA 1LI4A 1QAMA 2O0JA 4K40A 4IIGA 2OXRA 2A3NA 2LDXA 3I04A 4B4DA 4NG4A 4C87A 1CULC 3QITA 4R1NA 4WQMA 4OY3A 4YRLA 4JENA 2X0FA 1DEHA 2GNOA 1U4OA 4JC5A 4R1TA 4FQ5A 5F7XA 2LUOA 2WUVA 3ZBUA 1G20E 2DU8A 1P1BA 2R84A 3MLEA 5JD3A 3DV0B 4Q9AA 2PXHA 3IC5A 1E1KA 1ZD5A 4KG7A 2GYWA 1ZWLA 2IZ1A 1HDXA 3SHQA 4YPVA 4B3GA 3R24A 4LVCA 1LPBB 3F7TA 3P71T 4HDMB 3ZKWB 4FNOA 2DJ5A 4L0MA 2X2FA 3FCUB 3ELDA 4XWYA 3U19A 4MV4A 3BRQA 1H6BA 3BWBA 2FR0A 1CZLA 1DBPA 5L3SB 1XQXA 5BW6B 2VA8A 1OH7A 4BNDB 3ZU2A 4YCCA 4Q82A 3OZAA 1QH8A 3WJ1A 3A31A 1L1EA 3BE5A 4Y1FA 1M0EA 4BWGA 1U6IA 1VBNA 3DF7A 1G5FA 4JQYA 1J9EA 3ADDA 1OTHA 4LXYA 1KIAA 4NKRA 3C1AA 3DH0A 2HJRA 3RS7A 4EABA 10MHA 1CUWA 1HC7A 1Q7GA 2HDNB 1NXPA 4A36A 5F1KA 2PKQP 2Y1OA 4X94A 2E4VA 3BMCB 2QX6A 4R2KA 1E6LA 1RADA 3VC1A 4DG8A 1ZW1A 2XUAA 1P0QA 3GI1A 3ZD6A 1A71A 1QVAA 2BTEA 4IJ6A 1X2EA 2EL7A 3T3IA 1C4XA 2B30A 5L3VA 3ORHA 4ARVA 1KK2A 1D5WA 4X97A 5B6IA 4IDEA 3I92A 3CS3A 3CZ5A 2VK1A 5KNLA 1K8XB 1N5DA 1T4DA 1P2SA 3K0FA 4FMCF 1I1QB 3ADCA 3EEOA 1NM5C 2W2KA 1LLQA 3CUVA 3ZW9A 4YP6A 3IBCA 1D4AA 3EJWA 1SXJC 2G1KA 2GBGA 1U5BB 1U8YA 1QQ5A 1ZN9A 2NSJA 4NRDA 2WILA 2AKAB 4OQYA 3RIGA 1L6IA 4GUAA 4B4WA 5CLFA 1A7JA 5AXDA 1H2EA 1H93A 1VSVA 2FG6C 1UOOA 2V5VA 1XYGA 4C89A 4QBKA 4X3PA 4CQJA 1F38A 1O5TA 5ABPA 2CXUA 3PC8A 3AW9A 5EUBA 5FUMA 4UZSA 2B7CA 4CBVA 4MR8B 1X1SA 4ZV9A 3AVXA 1VHLA 1ZZGA 5H83A 4BS9A 4CGYA 4C0AC 3BWDD 4IDDA 2A8YA 5ALFA 3K1ZA 1RWVA 4C01A 4DBZA 3FPGA 3DDCA 1MO2A 3RSCA 1LJUA 2CV0A 2H4YA 2XDQA 2BGWA 1YJXA 3CVXA 4E51A 4ZO6A 1MIOB 3BWYA 1WXWA 1XCLA 3CVOA 3L6CA 2BMAA 5IT5A 2YWJA 1N6HA 1O94A 1TCBA 2VHYA 2XUGA 4DSAA 2ILTA 3NOOA 4Z0HO 1DC3A 5EKSA 5D3MA 1NWHA 2ZUBA 4YDSA 3GRKA 3K05A 3R9KA 3REQB 2KBFA 3MFQA 1L3CA 3TBKA 2E6UX 1D04A 1OV6A 5JMTA 2UVDA 3D5EA 1OAAA 2QL6A 2QN1A 3SKYA 1RI3A 1X0VA 1NV9A 1PTJA 3G5TA 2PGAA 3HR7A 4RMHA 1FTWA 4ROSA 4D0SA 1E89A 3ELWA 2WF7A 3ND7A 2ZUEA 3PFNA 3RC3A 4GX1A 3QM1A 3HTXA 4R3WA 2EKDA 1VHJA 5IVPA 1X94A 2WAOA 4GM1A 1LBSA 2XY4A 2F1OA 4WN3A 3QF4A 3T38A 4AZ0A 3GMSA 3VH2A 2PD3A 1XJWA 2I7XA 4ACBA 1CUIA 4BLVA 3OLCX 1KOJA 3LFUA 2XNHA 2YUIA 1H4QA 2GD1O 1JSZA 2FPRA 3O4RA 2X22A 2YWEA 2B6HA 5EPEA 3HADA 3S3TA 2AZTA 5B7QA 5C7IO 2QN2A 3GUCA 3DULA 4G85A 3IE1A 4HR7A 4IVNA 2G17A 2ZWOA 1BTOA 4AJ2A 5L9AA 5IYZF 2QGFA 1LS6A 1UXIA 4RK0A 5A3QA 2KYRA 2IZZA 2A9VA 2MMCA 3ENNA 2A59A 2XMSA 4LA4A 4TRNA 3ZD7A 3NV9A 3FCEA 3MN1A 5IUKC 2HWWA 5A5FA 2CBGA 2HOQA 2XYGA 2J5KA 3ISTA 1RVV1 4Z9BA 2WQ7A 3AHJA 4PO8A 4TKLA 2QG9A 4K8RB 3N1UA 1MX3A 3HWX1 4JODA 4YJGB 1UOEA 4P5PA 5H0IA 5CG2A 4X93A 1EFAA 4R40A 2QSJA 5IBQA 1PDOA 4CN9A 4CMAA 4GLLA 5HS6A 3HHEA 3Q12A 4YV2A 1MOSA 1QCDA 2F9MA 3NGMA 4WLVA 5HILA 4MHTA 3V4VB 1GITA 3X44A 1RYFA 2LXNA 2AOUA 3OC0A 5BWLA 3IMCA 4Q34A 4JCCA 2F43A 1OJLA 2CEKA 2YZ2A 4I1YA 1KKLA 2IBMA 4LRYA 4QLOA 3R5HA 3RADC 1A2BA 3SLKA 4DARA 3WAJA 4L27A 4ZOLF 3KT6A 8MHTA 5F2OA 4XIGS 5JAZA 3Q7IA 5B3JC 1GZ5A 5JZOA 3DZBA 4P35A 1KU6A 3RK1A 4B35A 2QSYA 1MAVA 3ON5A 5IF9A 3UPTA 3B3AA 1EVZA 4E3ZA 3B1FA 1COWD 1H1DA 4RL4A 3O4GA 4MRAA 4O2AF 4AJHA 5KDLA 5K0FA 3TZHA 2Z2YA 3CXUA 1KOFA 2PH7A 1DTWB 1T43A 2X6RA 4WK0B 2W6JA 1JEJA 2PZAA 3CRQA 4N39A 5FXMA 3WVNA 3BBLA 2WTNA 5TX7A 3O75A 1IN8A 1QFJA 3WP1B 5GAJA 3H42B 1D2CA 2HQRA 5EXEA 4TYNA 1KH2A 4W7IA 1GUBA 2LZ0A 4GOND 2XAUA 4MI3A 3HYNA 4ZHQA 1SC9A 1SG9A 1K5GA 3OPYB 5FADA 1RRGA 4ZC1A 4EP1A 4W5RA 3BD8A 3ET4A 5C53B 4RXUA 2M6LA 4BO6A 1IJBA 1D0IA 2QTHA 2OG1A 2CVQA 2G36A 3FUXA 4QASA 1RLIA 4IQ0A 5EP3A 3EEBA 5HKKD 1JLSA 4F5EA 1CUYA 3B7GA 3PL1A 4X00A 1YRHA 5B30A 2F3QA 2I1WA 2C3YA 2IV2X 1T0IA 4WWHA 1WKCA 1KDPA 1N2CA 3O1HB 4M3NA 4EAQA 4IVQA 5AW0A 4F4HA 3JYQA 1NW5A 4YLEA 2VH5R 2QRJA 4LMAA 1UZAA 3X1DA 4IO1A 3NVKI 5LKAA 2R6R1 2O6HA 2IXEA 3KPVA 3GEMA 1E69A 3IHTA 2G5PA 4N54A 1CIVA 1IATA 3JQGA 4EUKA 5HGXA 4K0KB 2G6BA 1WPRA 1P45A 3PIIA 3DXYA 2XTAA 2H3EA 4J4HA 4KR6A 3NJ8A 1XPRA 2JZCA 2PUEA 3KKQA 4N6OA 1FE8A 1OGIA 3W5CA 2Q2WA 3PJFA 4RBNA 4Y1RA 4EA6A 4IGFA 2CUNA 3W5HA 5ED4A 1CY7A 1SOVA 1Z17A 4JFRA 4ZQBA 1CRQA 1PFUA 4J9VA 2JGAA 2NO0A 3LHSA 4PPQA 2C97A 1NASA 4LBZA 3VYSB 5IT0A 4M86A 1ZEMA 4X20A 2NU7A 1H0KA 5I7AA 4A23A 5HCIA 1N2OA 3D8SA 1TJ4A 5FPHA 3W6NA 5KINB 1OGJA 1QAQA 2I7VA 5CFOA 3NHJA 2AE2A 3EAGA 3LPLA 3I42A 1E6UA 2QTBA 3WLSA 2CFTA 4Q24A 5LXTB 1PZNA 1WSAA 5AOVA 2B0CA 2NXJA 3EDYA 3W6UA 2V6IA 1CWUA 1W0KD 2ZU6A 1ODCA 3V2HA 1XEFA 4KQ2A 4OJKA 3HDYA 2M1XA 4ZEVA 1QQ6A 1DG3A 3M4ZA 3D6TB 1XB2A 3F8SA 3LGXA 1RPAA 4ZVKA 3V7NA 2VLIA 2KS6A 4UCXA 1LTKA 2O05A 1YMQA 1FP4A 4OM7A 3Q2OA 4C5AA 3SICE 2IHBA 5E1OA 1QVRA 4NMLA 2WSSA 3MB5A 5P8WA 4JB2A 3WXBA 3RDPA 1UOQA 3ZE9A 2JLQA 3U6KA 2PUAA 1USIA 4CMGA 3SQMA 3N53A 4FDUA 4JEMA 3ZLTA 2WA1A 1U0RA 3CWZA 4DCVA 1KZ6A 1VMDA 1C7JA 3EDRA 4BASA 4HXFB 3OD1A 2MSWA 3E7PA 3ENZA 4N0DA 2NQTA 4X7BA 1LW7A 4A03A 5J2UF 1C2TA 1FYFA 3RC8A 1U28A 1RZ3A 5HE9A 5C8DA 1MR3F 1QB8A 1W6UA 2QTAA 1XZEA 3LGAA 2EBUA 4V0SA 1VI6A 3LC0A 1AT1A 2ID4A 2UUOA 1A88A 3C6YA 3SY8A 4XRGA 1E0JA 4NCXA 4DQLA 2PPVA 5JY6A 2HSJA 5FPTA 2JHFA 3LDAA 3PUIA 3FRHA 4HUJA 4ECAA 3CU5A 2WP0A 2JAOA 5EJ8A 1OKKD 3AXTA 4KQ1A 4Q18A 1GCAA 2QZ9A 4G26A 1CX9B 5BW4A 4WFJA 4JI1B 3HDJA 1GLGA 1OZFA 3DA8A 5BN5B 1N6LA 3HB5X 4G5GA 1U8UA 3WRYC 4BO0A 5JSFA 1U63A 2XA9A 2PX8A 1EIZA 3OZTA 4YQFA 5AM5A 1VCIA 2GM9A 2R1TA 3QYJA 3ESCA 5DN6A 1YIDA 4F12A 4QFDA 2YNMA 3ZDCA 4DIDA 5IAAA 2OXCA 3EIWA 4LV6A 1SUAA 5L3ZA 5DRYA 1AZSC 1LSSA 4CODB 3G0IA 2RI0A 2QYOA 2XT6A 3A6FA 2B8NA 1TA9A 1XFDA 3BSWA 3DNFA 4X7MA 5AHKA 2JLWA 5GZ6A 3QA3E 4KVGA 3EG9A 2X1LA 4O4LA 1N34B 4IQGA 2YOGA 1NJSA 5EG5A 5IZCA 3A4NA 3FFAA 3GW8A 5LIPA 4N9QA 1RWOA 2BMWA 3G6KA 1S4QA 4O59O 3ASYA 3OSZA 5EMKA 3B3JA 3BGDA 3N7UA 3L5OA 1L5HB 1OTYA 4EI2A 3I45A 1WCYA 1JKJB 1G8HA 3KTAA 4R3NA 4RZXA 4WADA 1UMKA 5CT6A 3DEAA 4ZODA 4CTKA 1IM5A 4X1KB 1U4SA 1C0KA 1HURA 1TJ3A 4OUDB 3OO0A 1B8VA 1FDIA 3P2OA 3E18A 3UMVA 3AR6A 2XUKA 4PCUA 3PWSA 2XB6A 1OAOA 1JDVA 5C34B 1N6PA 1VI5A 1WV1A 3NTUA 3PXUA 3K6SA 5HM8A 3JD3A 3C1UA 4IL5A 3FCOA 4RZ2A 1W4AA 1FA9A 2HIHA 1K9SA 1QKKA 2H0AA 1EFVB 1LV8A 1XA0A 4UAGA 4HNAB 1KY3A 5CDUA 2PKRA 2PE5A 2REXB 4C5CA 2ZRDA 2I2BA 1UBTS 2K2QB 3V9PA 3I62A 1X3LA 2ZAIA 2PLWA 1KQOA 1JX6A 3DKIA 4II7A 2VF2A 1GNTA 1E7WA 2ODWA 4Q19A 3S2UA 2C2ZA 3USZA 1OFUA 2A84A 3D8BA 3G9ZA 3MWDB 3QVJA 2B7BA 1V6SA 2JVIA 2RGWA 4FCVA 5A7HA 5BUZA 2FPXA 3I6ZA 4HQKA 3S2YA 3WGLA 2VQSA 1V6AA 1JQLB 1W9MA 2IT1A 1H4SA 1SOAA 5DU2A 3MRXA 1ECCA 4HS4A 2HCBA 3ESQA 4RPKA 3KZMA 1KRHA 2AG6A 2B83A 1VKRA 1ZZEA 3AEKA 4Z7NB 2NU6B 1TIKA 2VYND 2ZB2A 3QHAA 4EJSC 3AEUA 3JPYA 1OR8A 2GR9A 1P29A 1RLOA 3NHRA 1R6XA 1LCIA 1SA0A 1L6RA 1XTRA 2YMLA 3DPSA 4EGCB 1E5XA 3QRWA 3THWA 4AZTA 4UNPA 4I4TA 3O8CA 1UK7A 4KSYA 2ZUSA 5I9SA 4OM8A 1J8QA 3FKSD 1WULS 1VSUA 2XV1A 4HDSA 4XCQA 3CSDA 5I3ZA 4L0CA 4CR8A 1RJ9A 5NULA 4OI0A 3LZDA 3AEQA 5BMVF 2VDLB 2BLNA 1ZD8A 4GP9A 1TA4A 2YC2C 4YS6A 3ZHSA 1ZO8A 1E3LA 4O2RA 4FZJA 3NEJA 2QY6A 2H57A 1LFAA 2PANA 3H1TA 3HUUA 5E2BA 4OLFA 4ALIA 3UGTA 1SCUB 3GROA 3SEFA 3WWDA 3GLIA 3BT7A 4BNYA 1P4HA 4JU9A 1W1WA 3HZHA 1SBNE 4JSTA 1NVGA 1PL6A 1BE1A 2XRYA 4MB6A 3RYFA 3K2BA 1Z6ZA 3N0RA 3EB9A 4WX2B 3L01A 1JEQA 3R7LA 1O0BA 4I55F 4F3RA 1VPLA 3FZQA 4J6EA 1JQBA 5LP6A 1WHTA 4OBWA 1X7YB 2P1ZA 1A9RA 2VAMA 3L8CA 4HN9A 2I4OA 1KZ4A 3QXSA 1T15A 3PDIB 3REOA 3LCRA 5HR5A 1XTIA 4LSZA 4RH1A 1QE3A 4TOIA 3RUFA 2Z2IA 3O90A 1NKVA 2FXVA 3MINB 4HYQA 3Q7SA 3FOCA 3DG9A 1F5SA 3QELA 3IQIX 5JSZB 3WZ2A 3RFFA 4IZHA 4XUDA 1QAOA 4KVFA 3UM9A 3M3HA 5I7SA 4B2IA 5JJBA 1JS1X 1SVIA 2X5JO 1MQAA 3W8FA 1JFRA 2AFVA 3UK1A 4K6OA 3LMKA 1JQDA 5K0SA 1EXMA 4ALKA 1LLFA 1OI4A 2B4RO 4JP5A 1P7CA 1JQ5A 2W43A 3JR3A 4J0DA 3BIJA 4UFPA 4NC9A 1MOQA 1E1CB 1RMQA 4WGGA 4S04A 3WTCA 1QR2A 3NAMA 2MWMA 2LR0A 5G4LA 2YXLA 4LQDA 3P4YA 3NS7A 4HWSA 1G8YA 4MI1A 1MRZA 1DBWA 2DM6A 2BTQB 4JP1A 3OJXA 2C5FA 4PANA 1OWMA 1MGPA 1UEJA 2FEWB 1LNZA 2R6HA 3HCOA 3PXDA 5BUQA 1CY2A 2FJPA 2JLXA 3WB9A 2D2XA 1QH1B 2B4QA 2ZBEA 1Q7TA 4HX5A 2QT1A 3GMIA 4JGBA 3ZHXA 2DOKA 4V1CA 4ND3A 4O33A 4P5DA 4MROA 4HVAA 1JDPA 4GC9A 4U8HA 2GXUA 2Z6UA 4B5KA 4F1KA 5IKEA 1P2TA 5AVOA 5CVTA 1QHEA 1GL3A 2EW1A 3P2KA 5DDIP 1DRKA 3KAQA 1YCDA 3MRSA 2BSAA 3X1YA 4EVRA 3D0QA 1GRQA 3QKRB 5FRDA 3OPYI 4D9HA 4LF6B 1WR8A 5E2AA 4UE6A 2UZ1B 3IR5A 1QVZA 3TSOA 1Q57A 2PKCA 1SHUX 2AG0A 3OICA 4M1MA 5MF6A 1BCRA 1SHLA 2LD4A 2QW0X 5LU9A 2DY1A 4G5RA 1E3EA 3CLRD 1CF4A 1G2IA 1JXOA 3V2IA 3SK0A 3ZQUA 5ARCA 3EHDA 1Z22A 1UL1X 3B9QA 3PC4A 4QXQA 2LE0A 3DS8A 4Z86A 3L8EA 1YE8A 2GF2A 3HJUA 3KIPA 1K63A 3MQFA 3EXEA 5CYGA 3D54D 1K7YA 1M6VA 2PMWB 3OUZA 1G1MA 2ZRAA 2YJ6A</