1RBMA

Human gar tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
200
structure length
200
Chain Sequence
b'ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rbmA00
1CDEA 1MEJA 3KCQA 4ZYXA 1C3EA 2FMTA 1RC1A 1RC0A 4TS4A 3TQQA 3GARA 1S3IA 4ZYZA 4YFYA 4ZZ0A 4Q12A 1RBMA 3W7BA 1RBQA 1NJSA 3N0VA 3P9XA 1YRWA 4ZYUA 2GARA 1ZGHA 4TTSA 4IQFA 5CJJA 4EW1A 3Q0IA 2BW0A 3R8XA 3NRBA 2BLNA 1C2TA 1MEOA 1RBZA 4EW3A 2YWRA 5J63A 4ZZ1A 5J9FA 3AV3A 1GARA 4ZYYA 4YFVA 4QPDA 1ZLXA 4R8VA 1GRCA 4DS3A 1JKXA 1CDDA 4ZYVA 3DCJA 4NV1A 3DA8A 1RBYA 4PZUA 3AUFA 3O1LA 1ZLYA 2CFIA 4ZYTA 3OBIA 4ZZ2A 4EW2A 4S1NA 3TQRA 4ZZ3A 1MENA 1FMTA 3LOUA 4TT8A 4QPCA 4ZYWA
chains in the Genus database with same CATH superfamily
1SRQA 1PJBA 3V4VB 3O4IA 3C7KA 2WB2A 3NXKA 4H3VA 4HAVA 3IIJA 2WHEA 2R60A 2B6NA 3R7LA 4MI3A 5IANA 3M5WA 4RIEA 4DCUA 5H83A 4B6QA 4MGEA 5BUZA 3SXUB 4ENQA 2CKDA 3D1JA 3VVCA 3TTVA 4CF4A 2J07A 5JD5A 2QIOA 3GT3A 4FQ8A 2DBQA 2RGEA 2WNSA 2VNJA 3MVEA 1GGMA 3MJDA 3Q4GA 2OOSA 3DDCA 4IV5A 5E6SA 5LWHA 1P1FA 4TWJA 1V4NA 1TC1A 2B1IA 2QM7A 3PQ5A 3WJ1A 1U9IA 4FZJA 1M54A 3RW9A 4RZSA 3K09C 4Y1FA 3RWMB 4B6OA 2VDVE 2C0CA 2IUFA 1FS6A 5K8CA 2RKWA 1Y5IA 1XTVA 3NDBB 4IHQA 4EKGA 3X1YA 3EH1A 4XB2A 1W8DA 1VB3A 3OE1A 2ADOA 1IXRC 2Q9CA 2R7MA 3E03A 3Q3EA 4KC0A 3RG8A 4EB6A 4AW9A 2VP4A 4MPRA 2E5LB 2WTEA 1U3DA 4KBYA 3LQ4A 2PX6A 2HDWA 2AN5A 3DVAA 1C0PA 3HZRA 1X3LA 3NM5A 3QUTA 2X1VA 4GYKA 4WUVA 4XM0A 2OGWA 2AMLA 3C6QA 4FLMA 4IQ0A 4O2RA 2QORA 5EESA 4EITA 1UAGA 1R9MA 1RCUA 2BEJA 4KVAA 5ALKA 3A31A 4UTZA 5ALMA 4UVIA 3SU8A 1OB2A 4NBRA 2VVTA 2JC3A 4RPHA 2H4HA 1RLTA 1KY5A 4CNBA 3OPVA 5L8VA 2WA1A 3LQYA 2WWGA 3NWJA 2BV3A 4QPDA 5DBOA 5BRJA 3GPBA 4KFRA 3SJCA 2P1DA 1R50A 4Z9AA 1YJAA 3VZSA 3OFSA 1Z2CA 3T61A 2O5EA 4JUDX 4XM2A 4S04A 2QNIA 4PPNA 3ZD8A 5B7QA 3DDUA 1WV1A 1YRYE 2WZQA 5B1EA 3LC1O 3P0IA 1PHRA 4FT4A 4WFQA 1PI3A 1FP4A 3RUPA 2REQB 4B5LA 3N3AC 2OV3A 1WETA 1VLZA 3L6UA 3W6UA 2XUOA 4C7BA 1JW9B 4WKCA 1RRCA 2RI1A 1DG9A 4S05A 4N5MA 1SKAA 4H0FA 2F3TA 4YJFB 1EVJA 4Z7OB 2BAGA 1JT2A 1UM9A 3ICOA 3MT8A 4ENPA 1AQ6A 2WJWA 4RL4A 1MFPA 1E4OA 4EG6A 4EB8A 1FRQA 3R6LA 5KEIA 5KX5B 3N6XA 2AZ4A 1EHCA 1J7JA 1UMCA 1QZXA 4RANA 2NWQA 5EVJA 3DBHB 5L7YA 3B2NA 2OG1A 3TSCA 4W5OA 1I6LA 4RNCA 4WSOA 4AK9A 1NASA 4ENTA 1CUSA 5ECWA 4X94A 3ZBQA 5IDWA 1W52X 1LFDB 4XUDA 4GG1A 4LHXA 4C22A 2GPTA 4LRWA 4GYWA 1T8PA 1TQ2A 1TK3A 3QFHA 1WZIA 2H4JA 1HE4A 1SRRA 3WKCA 3T5TA 1TJNA 2BTEA 5HFNA 1GNQA 3R5TA 4XQGA 3CCBA 1FFWA 1FRFS 4FD2A 2PWPA 4QQ8A 2O8DB 1N5MA 4N7MA 3UAVA 3FWHA 3G9TA 3K16A 5EIHA 2FPGA 2HCFA 3VR2A 1SKBA 4RABA 4A4DA 3FTCA 2UZ4A 2HRCA 3HJCA 4UD6A 3A3PA 1KHHA 2VHWA 3GRAA 3RV3A 4XWKA 1JALA 3SC6A 1YVEI 3WLHA 3FPCA 2XMDA 1KP2A 3IILA 2PH5A 1GN9A 3DZHA 2ZQZA 4YO7A 4O1MA 3W9SA 3SK0A 4HY3A 5FWXB 4GM1A 1SKMA 1TIPA 5FUBA 1WPRA 5K4AA 1QFZA 3GA0A 2X9LA 4PRYA 2RGGA 1PR9A 2ZJ3A 1MA0A 1Z4MA 4QRHA 3ZCUA 1HRDA 3ED5A 4R2MA 3BMOB 1NRJB 4L9WA 1S1MA 3FLEA 4BP8A 1MB4A 3UJDA 5ADWA 2ZJ0A 3DGFC 1VHLA 1GNPA 1DTWB 1PUJA 2JGIA 1J5PA 3ESAA 3FSJX 4I55A 4R83A 3QVXA 1UQUA 5LCXA 4BNJA 4F6RA 2WTNA 4ZVQA 4F91B 5K01A 1BXKA 3GJRA 2FX2A 3CX4A 5J2UF 3N74A 2BHSA 3CWQA 1E9CA 1NDQA 1EQAA 3FDZB 3PEEA 1B93A 2REXB 4AMYA 4UXJA 4ED9A 5K8JB 3CNHA 3RYIA 1NI4B 1DVRA 1O3YA 3IP3A 3I1YA 4H77A 4QATA 3H8VA 3RIHA 4J0QA 3E61A 4QDKA 2I7VA 2W2PA 2EYQA 2WIKA 2FFJA 3I2FA 4MMYB 4BL5A 1FB5A 2AD5A 2E9SA 2A1TS 2PX4A 2WPDA 3G23A 3AI2A 3R9IA 1C3VA 3FYUB 4W99A 2Q2QA 4D9JA 3IE0A 4YV7A 4JUBA 4YFVA 4PYJA 4UATA 5H3HA 4Z86A 2X7HA 4L50A 1AKUA 2Q3DA 3CEAA 1QYXA 4HPWA 2BISA 3PV0A 5IH3A 4BFSA 1GTRA 3RI3A 1MPTA 5M3BA 1NW6A 2JIZD 5E4TA 3UC5A 4D97A 3ORSA 3I37X 3INRA 4Q9HA 1G19A 1XQVA 2OV6A 3T99A 4CR6A 2DG2A 2BE7A 4WXMA 4RD6A 3GHYA 2BKUA 4HDKA 4IF6A 4L28A 3K0HA 4KQGA 1SUPA 1T1SA 4NMLA 4PNHA 5BQPA 4MYUA 1N1GA 3NAGA 1J24A 4ZEMA 3L43A 1UEXC 4KQEA 3I6QA 1RXUA 4R0VA 3BZWA 5KWIA 1T0HB 1IFXA 2AZDA 4P4LA 3U4IA 3VAAA 1OPRA 2WP8J 3AF5A 1HRKA 5K5EA 4LRQA 4D3DA 1QCCA 1WWKA 5G4KA 3WJ2A 4E13A 4HDNA 2JGAA 4NYMQ 1H6DA 3OF3A 1HYEA 2HXGA 1VP9A 4AS3A 2XGMA 1XB2A 2XUKA 4IDAA 3UK6A 5K99A 1CY0A 4PANA 2C9BA 5KAPA 1CR6A 1VBKA 3EZYA 4J94A 1WX1A 5A71A 1JKFA 1J70A 1P1KA 2PRIA 4BKRA 3ER9A 1R8QA 1RU3A 1TF7A 4LCEA 1MIOA 4PYMA 1JGTA 1KOFA 4QGAA 3JATA 1RPTA 1NAIA 4B3IA 1UEJA 2NU6A 3QFTA 3OT5A 1P8JA 2Z95A 4JR0A 3W1EA 3TI7A 5EZQA 3S1AB 3ZV3A 3HVKA 1U1IA 3L8YA 4S0XA 5HFJA 2IKQA 3WLFA 4UM7A 4QGHA 1U1CA 4GWLA 4WACA 3BX1A 3ZGOA 3FR7A 3VBEA 3VRHA 4ER3A 5KOJB 3OC6A 4TTVA 2NZWA 1Z6GA 2HA6A 3ZWWA 4AO6A 1M1XB 3VX3A 3AJAA 4MEJA 3ZE7A 1FU8A 4M7WA 4YMLA 4ND7A 4WTOA 1UQRA 2ETXA 3BCSA 1UFVA 4B7CA 2A9KA 4B81A 1X1TA 3ETGA 2KE5A 1TM7E 1CUIA 1GP2A 1K6MA 1LLDA 1ZITA 2R6DA 3K0AB 3FUVA 2ZU6A 4RZXA 3N0WA 1IBSA 4INPA 4PRKA 5CJ2A 3L4KA 1OIXA 3SKVA 1KO5A 3TPZA 3UTCA 3T95A 4OI0A 3EK2A 4PU0A 3PPXA 3KTOA 1JPNA 1ULZA 3BL8A 4GX0A 3QX9A 1RXSA 1DS6A 5B64A 1G20A 3FDXA 1D2CA 2LP4Y 4ZAVA 2PSEA 4YPFA 3W06A 3PICA 1HR0B 1JFVA 2F1RA 3HBMA 3DFFA 3H2IA 3KSMA 4FZ3A 4OATA 1XWWA 3R0JA 5JWOA 2FEKA 2K2QB 2NUAA 2XYPA 4ITRC 3TQOA 3T06B 1DLIA 1UJMA 2XECA 4Q4HA 5ALGA 3QKWA 1W5FA 3RC7A 4A0SA 5ETJA 4AWBA 3THWA 3R6WA 1PT5A 2BBWA 3HM9A 2DR3A 1B8PA 5HWSA 1OZGA 1DOZA 1JT9A 2EZUA 2HHAA 4FS8A 4M0MA 3UK2A 2Q5LA 5L51A 2HMVA 1ECFA 1R0YA 4FYHA 1JFSA 1R5BA 4D4JA 1T43A 3X44A 3R20A 2AYXA 2PGDA 3PF8A 3HRIA 1IK4A 1KH2A 1ZESA 2I2AA 3PITA 5AM2A 1T4BA 3GIWA 1XZHA 4EPXA 1UDWA 2CZGA 3CR3C 4IV0A 2NO6A 3H5VA 4CIBA 3Q8KA 1HOXA 5AKIA 3GPIA 3RKSA 5BW5A 2R6HA 4NBKA 1HFJA 3V1MA 2O3TA 3L0YA 4BNNA 4GKBA 4JYMA 1JI3A 3KR0A 1GTJ1 4CLXA 3NFRA 4PN3A 1PZMA 3SQOA 3HDVA 3VO8A 3OP4A 2ZULA 3TKYA 2GCOA 3N75A 4BFTA 1VGVA 4X6UA 2LIPA 3MMNA 4G67A 1K68A 2QA5A 2ZR0A 2KM1A 3BEOA 1K8RA 4MSUA 3DP9A 5MGNA 2MINB 2D5AA 3UQZA 2Q4BA 3KXDA 4YDHB 1RQXA 1IDOA 4FCVA 3NPMA 1KHTA 4WBNB 3WK9A 1WPGA 4G5GA 3AO0B 2GWRA 3WZMA 3EODA 2OGTA 3LQFA 3QEMA 4GZ5A 1WPQA 2H00A 4E6EA 1DKNA 2J9XB 3F2VA 1IG0A 2W58A 1KZ6A 1NC3A 4LI0A 1ESNA 2R8XA 3Q7QA 4XPIA 4BYGA 4QYXA 4JBNA 1U99A 1XZ8A 2JAOA 4IZHA 1EXMA 2HBYA 4W6ZA 5IAKA 2P9ZA 3T5GA 2VUTA 2WDZA 5LLTA 4R6WA 4BNWA 4IP0A 3MBKA 3WL5A 2COEA 5BOVA 5FBZA 3FSGD 3ZPXA 4HNUA 3KK0A 4IH9A 5FBRB 3V6LA 2W11A 5KJFA 4PX2A 1CCWA 3GJSA 3GNSA 3HH8A 3RFVA 1Z4JA 3AI1A 4F4UA 3FPLA 3KYCA 4FHCA 4PM4A 3SX4A 4MPTA 1I3MA 1PQUA 3EZGA 3QA3E 2X5NA 4RVNA 3VC1A 3QU7A 3HJAA 4DHEA 3U6KA 1O4VA 1R0SA 1TM4E 3KZVA 2F2TA 2GFHA 2VH1A 3PEWA 5KWJA 3M34A 1XQ1A 4GIBA 4UM9D 3FF4A 2I4IA 1XELA 3B20A 3PR1A 4GYYA 4XVHA 4PHHA 4GXRA 4HK4A 1USUA 1EESA 3OCCA 3BIOA 4KGZA 1GY8A 4TXJA 5C9ZA 4RWZA 3BGWA 4O25A 4W9RA 2CJYA 2R87A 4DBLE 1T91A 5DOVA 4Q9NA 1QIIA 5H0IA 3JX9A 3GLFB 3DR5A 1X6VA 3E22B 3AVWA 5EOVA 2NLOA 1Q11A 1OXKB 3NV7A 2WOOA 2C31A 3OQ6A 1OD6A 3KHUA 4MCJA 4D02A 5B6PA 3JAMA 4B3MB 2I3AA 1G8AA 4XJTA 4OQYA 4PONA 2JEOA 5H02A 2EJTA 4RE6A 5HTKA 5K0ZA 1UWVA 3OQVA 4PFSA 1GJRA 1G7SA 1IY2A 3C24A 3FH0A 3TZQA 1GTVA 1D8AA 4RK6A 3UOGA 2X0IA 2R4TA 1SXJC 2DWQA 4KZPA 1BEEA 5B1HA 3OE5A 1OWNA 5LN1A 4WY2A 3EVTA 2CVOA 4FT2A 1AHNA 4MYTA 3EW9A 1PTJC 3EPLA 1BSVA 1SXJA 4I9NA 5HX7A 4O4HB 3EUAA 3NH6A 3GCDA 2PX2A 3G8DA 2X5OA 3AVQA 3E9EA 3GWGA 3IOEA 1GUAA 3MC1A 4K28A 3WGKA 3IYLW 3TM5A 3A9VA 2AR0A 1XMOB 3RRMA 3T1HB 1HGXA 4NONA 3O5AA 4MRMA 3DKVA 2QPLA 4ZDKA 2RB5A 1N6KA 1OI2A 2D3WA 5BSMA 3IV6A 4CGYA 1CFJA 3BD7A 3LRPA 4MYRA 4QUJA 4LFAB 1FDSA 3HVUA 4UMDA 3A1EA 2PUBA 4WZ6A 1WULS 4DG5A 1J1UA 4LGVA 4WOCA 5BWCA 3EZ9A 3I6YA 2QD3A 4AYXA 3KQVA 5IT9A 1GITA 4DDTA 1K92A 1OBCA 1UBFA 4NH0A 3ZV5A 3TRKA 3R3UA 2NZVG 1YZQA 4ZOLF 3FHJA 5I7UA 4P54A 3VYRB 1E6UA 1LRJA 2C88A 4YAJA 5AT1A 3RHZA 2OGUA 2A88A 2C82A 3P0RA 4G9BA 3I5XA 1CQXA 4ONEA 1JU3A 1RSZA 3F6CA 4KEAA 5J5CA 1EG2A 2JFXA 5JJ5A 5KNCD 2A7QA 3Q0EA 1IULA 1BX0A 3E9MA 3SP1A 3T3DA 1U28C 2C77A 4FNGA 4WY8A 2HK8A 3TCNA 3DOCA 2IIQA 4LRTB 3AY6A 3GLFE 3LY7A 5LMUB 3HL4A 3FOWA 4DIFA 1OPXA 1UBUS 2BGKA 2EJUA 4IR7A 4JEUA 5E6SB 1KRWA 4LF6B 4EJ0A 4LZAA 1MTZA 1PYDA 3G9QA 3ER6A 3H9QA 2I1LA 3RBZA 4C0KA 3RC8A 5AJXA 1E2IA 2CHQA 2AHRA 3DEIA 4G8BA 3D8SA 4AN0A 4JI0B 3U61B 1JHXA 3QVUA 3G79A 2O59A 8LDHA 1A72A 1DC6A 2CHVA 2EGHA 4H16A 1ZGAA 2IXDA 4KN9S 4OGFA 3D8NA 2IZOA 2GSDA 4MA4A 3GFVA 4D9KA 4EB6B 3ZBPA 4EBFA 1G38A 5BORA 4PYNA 4XDZA 2EEPA 1VL8A 4FYXA 2QMUA 3KQMA 3DVAB 4QDZA 5EL0A 5AVUA 4EGJA 1JLLA 5IRCD 3D6HA 2ZEJA 3AVYA 5KPJA 1Z06A 1PFKA 3E53A 5BOSA 2XB2A 3KFXA 1FYDA 2CNDA 4TKZA 4CFSA 3VDNB 4J1TC 1E2FA 2YIJA 1XLTC 3DQPA 3HACA 5DHUA 1PKEA 4I4TF 1E89A 4CKYA 4JLUA 1YZ3A 4LE2A 5D3MA 5FPQA 4J1TA 1W35A 4C5AA 1QO0A 2X7XA 3HA2A 3TD9A 1N4AA 4JITA 2YNMA 4GOJA 3TLKA 2AA3A 1GT6A 2J6IA 3H0EA 4GNKA 4J90A 1IHXA 1PJCA 5F7JA 4ZO7A 4AROA 3ZCQA 3ZHTA 3PNMA 4ZCLA 4D8UA 5E7JA 4ES6A 1L7PA 1C5KA 2AF3C 1HYGA 4JLBA 1FP4B 3DZIA 2DFLA 3K0FA 4HMPA 4QLOA 3UAZA 5L40A 1WMSA 4CEIA 4PINA 3EVEA 3DV9A 3Q7IA 4MW0A 5E95A 4RHXA 2VJDA 2HK9A 2Z6VA 2VK8A 1PL6A 3T4XA 5LQAA 2LVBA 1UM9B 2NN3C 1G8YA 1I4EB 4M8LA 1LWNA 5KHLB 1H2XA 1GPH1 3KTAA 4C0SA 1SXQA 3U4MA 5IKEA 1W4BA 3F7MA 1JTFA 2GWHA 1EZ1A 3H0CA 1UMCB 2BD0A 2UV8A 3L4BC 3MPOA 4IQFA 3RF6A 3ZY5A 4Z3OA 1CZLA 5EQFA 3R7FA 4JSTA 4LJAA 2HLPA 1SELA 3HO8A 4IQ4A 1YR7A 4BNIA 2XZTA 4ZO9A 1BGXT 1TKRA 2D06A 2JAWA 3L4BA 4F4HA 2CLEB 2E21A 4PSDA 1CUZA 4LUCA 4XGQA 3FRIA 1QQTA 4KFSA 4AJ2A 5LYJA 3E35A 3OX3A 4U5QA 2YWRA 4FCCA 3SYMA 4NWIA 5CM2Z 2A5FA 2F3QA 2HL6A 4F7DA 2C4HA 4JC5A 3MWGA 4KXMA 3OKFA 3ZZNA 1YQWA 2VI5A 1AH2A 1E9FA 2NVOA 2Q2OA 4ARCA 4J1QA 1FSSA 1W44A 2ZRQA 3SM9A 3ZZ1A 2PS3A 4BO2A 2BFDA 3AHHA 4UU1A 3OEHA 4CKWB 3TZHA 1TVEA 2ZYRA 1WW8A 1K4KA 3FUXA 1YOBA 1GRCA 1NOKA 1ZS9A 1PKXA 2Z2JA 3HDJA 5T5QA 4J3FA 5LZ8A 3PF9A 3QY0A 1CY4A 4QWWA 2Q6LA 3TJZA 3CEHA 4JB3A 3VOSA 2BM9A 2P2DA 2C92A 4IPTA 3MQ2A 4Q7EA 4YVFA 4OIFA 5I7HA 2R25B 1Z4IA 5I4IA 3FCYA 4RY9A 4ZIRA 2C4VA 2P2SA 4EJMA 5M04A 1C8LA 3FETA 3QE4A 5EFZA 3TFWA 4I55B 4BIMA 4F6RB 4OX9Y 4GQBA 4YRQA 3WDKA 2R97A 4M0CA 1BMFA 4G23A 2G40A 1E9BA 1JP7A 2VTDA 1XEFA 3NXSA 4M8NE 5FI3A 1NJGA 4N0PA 4ARUA 1N5DA 1QX3A 5CK4A 3RYIB 1PDVA 3MTJA 4R5HA 4GC9A 2PD3A 4WKPA 1CULC 2H06A 3KVYA 2V59A 3BHNA 3QVGA 5KOIA 2DWUA 3V6MA 2D5LA 3QBDA 4P38A 3RJTA 1I14A 1ZN7A 2V6JA 1VJ1A 3TD2A 2FSVA 2A58A 2W2VA 2GBFA 4A1FA 4BMDA 1Y81A 2JH8A 3VC3A 3ULKA 3WRYC 1U1DA 3AHJA 2VDNB 4HJXA 1L7OA 1QWSA 3W78A 4NBNA 5HUJA 3OWOA 4CLDA 1H9BA 1ZUWA 3Q6MA 2IOQA 2EARA 4JGBA 4CT0A 2O8CA 1DAKA 3WRYA 3ROZA 2B82A 2ZI3A 4BRUA 2I1QA 2J3KA 1DQNA 2P2GA 3DEZA 2HWUA 1P17A 3EISA 3CW2A 1QPGA 3FDJA 3R0ZA 4HDKB 3RNOA 3BGDA 5BV7A 3DV0A 3N58A 3GNQA 2V6BA 1AE1A 3F47A 4UBJA 2B34A 1NVAA 3BXHA 2DXIA 2JGNA 4D57A 3VPFA 3EQZA 1PJ4A 2YASA 2YN4A 2C94A 1WD5A 4Q03A 3VH4A 4JY7A 4Y7DA 1FP2A 4HH1A 1R9GA 1OIWA 2FJUA 1NFQA 2DSTA 2X76A 5G4KB 1O0SA 4HDNB 4LJ7A 4KO2S 4Y9UA 5KJ6A 3IEPA 1JJIA 4G65A 2IF0A 3AC0A 4Z9XA 4G9EA 4F7WA 2HMUA 4LE1A 5TT0A 1YHZA 3IJEB 1VL6A 1L3CA 3T5MA 1O94D 1GCIA 3VOBA 2ZUTA 2QDKA 3M89A 3RBVA 4IJKA 4XYBA 2QG6A 2OSBA 2HSEA 2WFLA 4YCAA 3SE7A 1MIOB 4KN6A 5EQJB 3ZWPA 3JATB 1CUYA 1DWQA 4E5UA 1X7XA 3SICE 4LBWA 1QU2A 1Z12A 2NU6B 4Y98A 1RYYA 4CTJA 5ITWA 3AFMA 2I2CA 3ZJ5A 2AYZA 3BICA 3IBSA 2OM2A 3NANA 3QVMA 1L5QA 1E99A 2V6IA 1GKLA 4M0LA 4TZTA 4MB0A 4YR7A 3EIFA 4YB8A 2F00A 3UM9A 2V6FA 2ZIUB 1A9OA 2I03A 4K03A 4MXDA 2IS6A 1KZ1A 3OE7A 1J2EA 3GRUA 1ZJZA 2C3PA 4ARBA 5E6RA 3I83A 3L7DA 3IAS1 4QXOA 3LYHA 1KDPA 2UYOA 2ZI6A 4G1UC 3EB9A 3AK4A 1XNQB 4PVCA 4DV4B 3K9LA 5K8IA 4OHFA 4H35A 4PAGA 3GPLA 2XNDD 1KJWA 3A6LA 1WABA 5CU7A 5INTA 4YDSA 2VWHA 3DE0X 3BWEA 1HL3A 3DCJA 4PZ0A 3INYA 4B0OA 4OK3A 2HTFA 1DIOB 2KLHA 4JOBA 2DF8A 1G20B 3HZZA 2H54A 3WKEA 2F1IA 2IX9A 1RRVA 1XK6A 3ISVA 1LC3A 2OILA 3PQ4A 1Y4AE 3I2JA 3JYQA 2ZRAA 2A35A 1WSWA 2HRQA 2VP9A 1U2SA 4R51A 4XD7D 2MYUA 1C1YA 1XMSA 4Q4HB 3KVOA 5BMVA 1P72A 1YF3A 4D0NA 3THWB 2CJFA 1E8NA 2X3FA 2E55A 3N59A 3OCVA 5KO2A 3KPWA 5DGTA 3E9DA 2FXIA 3EQ7A 3LLCA 5CEJA 4QYIA 4NZMA 4BE9A 1QS0A 3WX0A 2H7XA 1A95A 5JAQA 4YCMA 4LF7B 4CKCB 5D2CA 4I4CA 1T6NA 3BL5A 1SQ0A 5LZ5A 3WBFA 3K6JA 3TIVA 3TG8A 1CK4A 1X15A 5EXSA 3W9UA 2P7HA 4KACA 4PYOA 3FCUB 2Q8QA 2C97A 4NULA 1LQUA 5B1IA 4B3TB 5AM5A 4R6XA 1I0LA 2PSDA 1UAAA 3FUTA 3UV7A 3HTXA 5FX2A 2JKYA 3UA3A 2C3OA 4JI6B 2QB5A 5PNTA 4ZCRA 4CM7A 1DBWA 1R8JA 1R10A 1NPYA 4JLPA 4YMGA 4JYBA 4MVJF 3GY0A 3JALA 4BO8A 2WSSD 2P4HX 2VA9A 3D6AA 1FDTA 3G5LA 3KAKA 2GCOB 1IJFA 2Q3JA 1T2FA 2YHBA 3OF2A 1KP9A 3DBLA 1U7UA 4K3UA 2BFEA 1PR4A 1PLJA 2YW9A 3FJOA 4MIKA 3DBRA 5TF4A 3S2UA 3H16A 3WADA 2AVDA 3NP9A 4JIMA 1TNDA 5AVRA 2AJLI 1L7VC 1DAOA 1RC1A 5DI9A 1XKTA 3WE7A 5AIBA 3U1VA 2OAGA 3FSEA 2W6JA 4Q7KA 3RNLA 3W5DA 3OZVA 2JLWA 4OAPA 2EIHA 4ZZ0A 3G68A 1QZTA 1UOPA 3QEMB 3QOYA 2C03A 3CPJB 3ZWDA 1EWTA 3LZ6A 1ZG3A 2FLKA 4CI0B 3DLHA 4XPIB 4ZARA 4OQXA 2FMKA 2VRBA 5FIUA 5IAGA 4D6PA 4X9XA 4W1RA 4GX2A 3V33A 3LD9A 1C9MA 1GL7A 3BHMA 4D0RA 4BQFA 1RRPA 3ZWBA 1YQEA 1E3WA 5C37A 5HYVA 2BM0A 5A2GA 2ENWA 3VUFA 2OBNA 3MZ0A 4I4IA 1NVFA 2FSGA 4S1VA 3TE6A 3FOZA 4AF8A 1FDWA 2VQ3A 1QP4A 1L1FA 1T0PA 3T52A 3IUNA 2A86A 1QYDA 3KYCB 4MGHA 1G20E 1QYVA 5IAOA 4LG1A 2G9RA 1BZYA 3H86A 3IULA 2I4LA 3C5EA 2X1LA 3ZHOA 5CIYA 1K7EB 1U02A 4CEHA 2P2YA 2Q7XA 7AT1A 4L0CA 3QLJA 4MKFA 1EB9A 4I9FA 2QSZA 5CLJA 1Z2OX 3PUWA 3CWZA 2Y6VA 3SJUA 2X19A 4JLMA 4HWGA 4NP6A 3HGQA 1QUEA 3QPBA 5AXAA 1XFAA 5EQDA 1S5PA 1LNZA 4RLQA 2ZK7A 3TCKA 4ZKEA 5IARA 1N5LA 1ZQ9A 2HJWA 3TAUA 4BNYA 3RSCA 4H59A 2DUUA 3M3DA 3WLRA 4E4YA 2ZS8A 4BAZA 1W6RA 3U3ZA 1FJGB 3KE9A 1YR8A 2B4QA 2WFMA 2PMCA 4OUDA 2XTNA 1F9EA 2WU0A 3KKKA 5CX1A 4UFOA 4YQYA 2IV3A 3LUFA 2X0FA 4H17A 1E20A 2QYSA 5LLSA 4LVCA 1JLKA 5F76A 5CFNA 1V25A 3MIIA 4LS3A 1NW8A 2C61A 4O8CA 1AN0A 1KI2A 2GOYA 3FBTA 1SXJB 1CT9A 3KP1A 5ITVA 2XZOA 4QNMA 4IGKA 5IHPA 3REOA 3WWCA 3ABZA 2PR2A 2LPMA 4QRIA 2CHUA 3X1WA 2HC9A 4MRMB 3IQZA 3DOOA 1VPLA 3KZKA 2PD6A 3HC7A 4GF5A 4EUNA 1UBEA 1SEVA 2FJ0A 5CHEA 3VDMA 1YONA 4K46A 2LKDA 2M1ZA 2HD4A 4KIGA 1T6ZA 3O1LA 3L7KA 4MGKR 3UFBA 4M1ZA 2C5AA 2FG6C 1IHUA 2IU0A 1ZMBA 4EABA 1IUKA 3FCXA 4HFJA 1EVQA 2EJBA 3HS3A 4LOAA 4F12A 5A3SA 4LYJA 1XCBA 2BEUB 1L4HA 1FK8A 5FRDA 2YXNA 3V4ZA 3BWVA 3VR5D 2DY1A 1R6VA 4N18A 3PC7A 4PW0A 5BSVA 4AL4A 4QOHA 1KKUA 4JB8A 2GAAA 4Q9AA 3AVPA 3F49S 4M1WA 5CG1A 4RTRA 2OCYC 1CDEA 1V0JA 1ZIDA 3IE1A 3MINA 3NWBA 1M73E 4ZT5A 2PIDA 5AKGA 2WKQA 2Y67A 3TECE 1C1DA 3RYTC 4MW9A 2F59A 2RK4A 4MS4A 2NPFA 5CLLA 4D46A 4O3MA 1SBTA 5AM3A 3STHA 4PTZA 3I5UA 2WT9A 4RZUA 1F60A 1W30A 2JFVA 2ET6A 1F8YA 5JC8A 3HCOA 3PUXA 1D2HA 1KPHA 4BFLA 3TBHA 1RBQA 1ZHFA 4DUZB 4MJ7A 2IV7A 3TFOA 2A1UA 4MP6A 1HZZC 3KYJB 4Q9DA 4BQIA 3EPJA 4WLFA 5K09A 1H2FA 4B3FX 2BGGA 1AQJA 2OC9A 4JLVA 5BMOA 1KVSA 4PX9A 1HZZA 3TTYA 2VPPA 1KQPA 3K1ZA 3U13A 3EEFA 4EJ2A 3S40A 1EDOA 1SXJE 1ZJYA 1ZWLA 1KQ3A 3BJEA 5AM1A 4XUCA 1U2ZA 2GUGA 4K9DA 1RRFA 1VG1A 3OA0A 4A5OA 1OX6A 1SGWA 1Z74A 3O0DA 1Z5PA 1T5IA 4LE0A 1EKXA 1WHTA 1TI7A 3PKZA 4FYVA 1JLLB 5AXCA 5GZ1A 4OB6A 2I6SA 3O82A 3V7YA 5C2JB 4D4GA 1XCMA 2PYDA 1E3EA 3BJZA 3W8RA 5BOSB 5LJLA 4WCVA 1QE3A 2AQ8A 4DR7B 3AX6A 4HHEA 2ZATA 3C1AA 2OD7A 3H5RA 5C35A 3VR3D 3ORRA 3CZMA 3OQ1A 4ZJPA 1YFZA 1ZXXA 1N9ZA 5CXSA 5D3MB 1XJ5A 4Q3CA 4JJIA 4RA9A 1KRXA 1J09A 2G76A 2QUKA 1YC5A 3FSRA 3D7KA 3NBMA 1W29A 4LN1A 4QUGA 4BEBA 1GCOA 2GN9A 2QGNA 3RANA 2HY7A 3OAAD 1IN5A 2GXQA 4V0QA 5AUPB 2KBFA 3FFAA 2GQ0A 4ZC1A 4D80A 3D3WA 1E66A 1JIXA 1O96A 3HVJA 3I92A 5CLFA 4JVMA 3K0FB 2BFCA 2R00C 4H6XA 4CEIB 5E6UA 1S01A 4A8PA 4QWMA 4YRIA 3C4VA 3O47A 3QPDA 3AIIA 3O4FA 2DTDA 4LCJA 4FJ0A 3W8FA 2R00A 4P82A 3E5HA 5ALWA 2AIRA 1DTSA 2EZ4A 1H3EA 1NFFA 3H42B 1TMOA 2QRPA 4CLOA 1NW5A 3KTAB 1FP6A 4BRSA 1CS4C 3CGGA 3ZQUA 3O9MA 1AUVA 1Z29A 2FPLA 3R74A 1FS4A 3U3RA 1QB7A 3CPEA 3MJCA 2JLQA 4TQ9A 4IHJA 1NIJA 3O4JA 3BK1A 3S2YA 3U9TA 1ZU4A 3KT0A 2G17A 4HGNA 5ALIA 1VYVA 1IBKB 3B1JA 2XZLA 4YP7A 1ICIA 4XWYA 5LYJB 3N7AA 2O4CA 3UPTA 3BC1A 2AX3A 3ETLA 3GFSA 5JCOA 3V80A 4EGFA 1I1QB 1DUSA 1C3JA 3LW7A 4YJ2A 3WAKA 1FL9A 4BV8A 1EJBA 3OMLA 1UWLA 4MYCA 2P6PA 4F3TA 4TMYA 3CLTC 1T6XA 2H0RA 2ZANA 1YQ9A 3GEIA 4OLJA 4OPMA 4FB4A 2DZDA 4EK9A 1NG1A 1DXHA 1S8OA 3AKDA 3HRHA 4D9IA 2BTQA 2H1RA 1A2BA 2JA2A 1E6EA 1ZICA 1PV2A 4IILA 4RF3A 3VI3B 4UQLA 1EP3B 3IDSA 2PZAA 3VU8A 3R5SA 2PMFA 2FZGA 2PKQP 5GY7A 5JVDA 4IVRA 3O83A 3OPQA 4EW6A 5I7VA 4AQYB 2GZHA 1XF1A 2CFSA 3NHMA 4OBBA 4F2GA 2GA9A 3LHSA 3RVMA 5JI2E 5EGNA 1OJ7A 1Y98A 2IYAA 2PGXA 3G89A 2A1IA 3A9WA 4HZIA 5ENDA 1Q57A 3H1BA 4ZIRB 4MJXA 2ZSEA 4Q66C 1ZOPA 4HWKA 1GM5A 2VPXA 1LSOA 4YBRA 1YRWA 5FT9A 3WHPA 1UKAA 3RT7A 4HGRA 5ITZA 1H0HA 3BFXA 3RPEA 2HYIC 4I50F 2YXLA 1XVLA 3I04A 4XYMA 3RB8A 3ZHZA 4RU1A 3HA5A 1N6RA 4YMWA 1NWCA 3BFKA 4H60A 1E5LA 1MMFB 1ISHA 2OP1A 1P45A 1YS4A 3BH0A 2R8EA 1ZYUA 4BJ6A 3OURA 4HQKA 3SS9X 4CFYA 1YVUA 2C98A 1LDEA 3PFBA 4R16A 3ZWKA 5IHXA 4FMCB 3Q7TA 5U1PA 5CVCA 3QVGB 4EW3A 4JQZA 2GERA 2Q4TA 3EC7A 4PLZA 3EMVA 5JG7A 1A5ZA 4DGSA 1XX6A 4HEJA 2ZZMA 1UXJA 3QJ5A 1MXFA 5EAIA 1Y4UA 1VHTA 2PK3A 4MVJD 5E4JA 3UHOA 2E6KA 3H5WA 1CC1S 2QE7D 2GD1O 5IT5A 2R9VA 4TUYF 1M8KA 2O7VA 4J7CA 1R4NA 2H3HA 2QAIA 3WB0A 3AFHA 3TMKA 1M10A 2R1VA 3BD9A 3IUJA 4HSGA 2OQIA 1ENZA 4JOSA 5I4CA 2HV9A 3JQDA 2GNPA 1SN7A 3UF0A 2MSKA 1JIJA 1W85A 1E9EA 2CXNA 1B0UA 1XZDA 2O8NA 2ZIZA 1ZN2A 2ZBPA 2GF2A 4G5YA 1I4DD 2BUCA 3EIOA 5ENVA 3DV0B 2R2GA 1U0HC 1IN8A 1HLPA 1MJHA 4IIXA 3U0VA 1LDGA 2JIZA 3CT6A 4MQLA 1J5EB 5ALYA 2XKBA 2FUKA 3W5SA 3ZU4A 3MRVA 1FFDA 2CNLA 3TIXB 3GH1A 3JQFC 4RE5A 3OP1A 2H2HA 1EQ2A 4E7PA 3W0LB 1TUEA 4AYTA 4NIMA 1B8NA 5CW2A 4Y3UA 1PRYA 2YTZA 4LQ4A 2NGRA 2CKMA 3JQFA 1N8TA 2CV1A 1X1AA 3CF2A 4EG4A 1QLWA 1Y1PA 5FPSA 3GPDG 2JHAA 2W90A 3LOQA 3Q10A 4RV4A 3GRVA 5EXDA 3QVVA 3BORA 5FI1B 2HQ1A 4FFNA 5WRFA 4ASUD 5BSEA 1NW3A 1WTAA 3TD6A 4LWOA 1EDZA 2AYYA 4GI3A 3BA6A 2WFLB 3OZSA 4A3SA 3GROA 3EIXA 4TTIA 3DYVA 4D9GA 4E88A 1NN5A 4IJ5A 1T0UA 3VNBA 1C3OA 3HXTA 4NAHA 1UPUA 2AZMA 5JYBA 3DVSX 1NYRA 3KZOA 2WTMA 1C7EA 4DMUB 3HWRA 4MV9A 5FFFA 1G7CA 2GAOA 5G3ZA 5CFZA 1XRRA 2FOXA 5BSUA 5JXJA 3PRHA 5KYNA 1LU9A 1Z2PX 2BP7A 2NZYA 2VEDA 1UZUA 2G7ZA 3ILVA 2WSLA 3QA9A 4CL3A 5IJXA 5E6RB 3LWBA 2EP5A 4IMPA 2RC5A 3BFJA 5F5LA 3TSAA 1ZM2A 2Y4NA 1RWQA 1TD9A 3ROKA 2FWRA 4OTZA 1C3EA 2G0NA 4DHWA 2CV2A 1GVNB 1MG0A 3GC6A 5ALOA 2PQ2A 2OECA 2VN8A 1CF2O 2PT6A 2VCHA 3OOJA 1UPFA 1K4YA 4CLHA 4JXXA 2DTXA 4L8LA 3PC3A 1COWD 2WV7A 3PXDA 1CJMA 5CA0F 2IDMA 1PGNA 2ECKA 5K05A 4PIPA 1KK1A 1HDZA 4NMMA 4CMGA 2B94A 3HLKA 5JHGB 1RYBA 1SK8A 2PRSA 1KGSA 1RPAA 1DQRA 3H3FA 1Q5PA 2M6LA 4B87A 4E5MA 5BMVB 2R6FA 1YOVA 2ZW9A 1U4SA 4O2AF 4WV3A 1Y6RA 4P35A 3UV3A 2B8TA 2R79A 4JJKA 1PR6A 1KYIA 2WJJA 4KBFA 4KFTA 3UUWA 1HNZB 4O33A 3I23A 5GJWC 1QIJA 1AXGA 1CZNA 2BLNA 1UC4B 3K2EA 4QYIB 1QS0B 1R3DA 1IG3A 2I54A 3U6BA 1JU4A 1M2WA 1MNQA 2ODNA 3A9TA 2BMJA 2O0HA 1RAEA 1P3Y1 1CJBA 2OO5C 1RBZA 1HA3A 2WILA 4LDQA 4L1KA 2WY2D 5F23A 4NC9A 3DOIA 2V7VA 2GLTA 4Q3BA 4UZEA 1ZRMA 1MRNA 5JUWA 2Z1DA 1WEKA 1GUBA 2JFHA 1DKUA 2Y6UA 2YFHA 5FQOA 4QQFA 3R5XA 3TIGA 1YZHA 3EZNA 1A9TA 4R9UC 2I22A 4IYJA 4QXQA 6LDHA 3GFOA 1C9DB 1USIA 3JALB 3L02A 5AK4A 3FYDA 4DV5B 1PV1A 1R0KA 3R23A 3SQMA 1XZCA 2ZBVA 3DBLB 2BFEB 3TKLA 1HT3A 3ZU3A 4PS1A 4IRMA 4OO3A 2VF7A 1VYHA 1UBOS 4NK5A 1IM2A 1GDHA 2Q2WA 2DLDA 1V8PA 4Q02A 3Q8MA 1BS1A 4IF4A 4BZPA 2Z2XA 1P3DA 1QHNA 2H1LA 5C5DA 1BH2A 1DFHA 4UPVA 2GZAA 3LTEA 3HSYA 5I9SA 1CBUA 1QUFA 3TTXA 2K4MA 3OF5A 1YJ8A 3ZNNA 1OYOA 4EIWA 3DA8A 2VQEB 3BGIA 4QAQA 3ZK9A 4BU0A 1DUIA 4K05A 4TXHA 4DEXA 4YP6A 1E3WB 1UDCA 1CUCA 3IH5A 5I8ZA 1UK6A 4FIZA 1O95D 2RMKA 1CPYA 2VRWA 2ZB3A 3FOAA 5K9ZA 5EUBA 2OBBA 2WWYA 1JG6A 5IEJA 3ZLJA 4F4JA 5F51A 2RGRA 1TQ8A 3ZCTA 5L4NA 1ABFA 2HSGA 4KPEC 2RKOA 1RDFA 1WU7A 1NMEA 1F1BA 1TYDE 2VYQA 3KLBA 4M0KA 9LDBA 3PKIA 4CEHB 2LDXA 5ADVA 4M8KA 2O2GA 5EP1A 1KDZA 2CLOB 1NN3A 1N7JA 2R8RA 1YKSA 2DR0A 2VSFA 3RTBA 3TQFA 4WCFA 1W75A 4EFLA 5GVRA 1FBTA 4UE3S 1A8IA 3CLUC 1VI6A 3HP4A 1W19A 5KS2A 2HLDD 2ZJOA 4FFRA 2PNFA 2W7TA 2XF8A 3T1OA 2BFPA 3CPSA 2H4XA 4PLWA 3G5TA 2QX9A 4N12A 4KDEA 1JQJC 1P80A 3LU1A 1RZUA 4DW8A 5JISA 3LT1A 4RF4A 3WGIA 1TECE 1NAHA 1M1YA 1R6DA 3PD0A 2XVZA 2ZSJA 3FHOA 1X1EA 1R0CA 4OUDB 2AMVA 2GAJA 3ENWA 4G8JA 1ZNQO 3H9UA 1PJTA 3OOYA 4DJDC 4YLYA 1GUYA 2PKWA 2R11A 3EE6A 3JWGA 2H0AA 2AKAB 3A8TA 4GMGA 4LY6A 5CX1B 1T2AA 3RLIA 3TO5A 3F96A 1SUWA 1IBCA 3VH2A 5CH5A 2DQKA 3JRWA 4C05A 1A7AA 1L4BA 2ZR8A 4RZ3A 2Z08A 3EWNA 1KFJB 3BD6A 3NHSA 3RG2A 4EUHA 4NK4A 2NT3A 4HRAA 1ZA1A 3SZMA 3MYYA 2XITA 1LPNA 1HTWA 4BMOB 4G0MA 1XZQA 1Z15A 3B89A 1FE8A 1Q83A 5HW0A 4FFPA 4H7DA 3T3MB 2II6A 4WIAA 3OIVA 4TQGA 2QN1A 1OWPA 1JLSA 4L07A 1I2MA 4CN8A 2QAJA 3R6TA 5BO5A 5DN6D 4UDOA 1C2YA 5MN5A 1KZ4A 4HPXB 4Z4FA 1IN1A 3MUEA 4HAIA 4RIGA 4YR9A 2FCAA 1O5OA 2ZITA 4RZQA 1T34A 1TLTA 2XCIA 1EHIA 1DX4A 4TTSA 2IEAA 3EZ7A 4EHBA 4E21A 3Q0IA 4JT9A 4XE5A 4CHTA 1OVMA 2NTEA 4EQ6B 1U2DA 2CD9A 3VZQA 1JR6A 1HDYA 3ZYCA 4QNRA 1X74A 3FJYA 3S7ZA 3NEYA 1RPNA 4OLFA 2WFZA 1VQ1A 1G9TA 1V5WA 3VKHA 3EF0A 2FPRA 3Q3HA 3DTVD 1WUTA 2JIBA 3PCXA 4PZAA 5FULA 3CE6A 4PLCA 1RNLA 4I1YA 4WQMA 3TR0A 5LU9A 4E5PA 2V9PA 1YIOA 4DUYB 1BDIA 5KMGA 2ZYTX 3A10A 4UC0A 1HWYA 3FNQA 2X0KA 1JHAA 3ITKA 4R69A 2QGZA 5EWMA 4CF5A 5DLDA 1XZMA 3MINB 1A2KC 1ONBA 1XHEA 2HGSA 2XDQA 4FDLA 4KIWA 1A82A 4RSGA 4OJTA 1C1DB 4L4ZA 5EJ9A 1CDDA 4HB3A 1I3OA 4MS4B 1G7TA 2E5FA 2EQAA 2XI4A 3E7WA 2WT4A 3ANNA 1Y7LA 3GQBA 5KAMA 5ITSA 3TUJC 1DDIA 2I7CA 2XMCA 2C84A 5DH9A 4POOA 1E58A 1ZEJA 4IVQA 3N7UA 3WWYA 2X5KO 3ZXUB 1C41A 1DU4A 3RSQA 2GF9A 4IJQA 3NOXA 4BO1A 2IX3A 2A1UB 2QJWA 3AF4A 1W87A 1EX9A 2ZJ8A 4BBPA 1FW6A 5CDYA 1LBQA 1H4TA 2V7GA 2H5JA 4JLWA 4DCCA 1SUIA 1X80A 4F9TA 2F6RA 3EXIB 3ZIDA 1NR7A 4GOXA 6PFKA 1NQWA 2BHTA 3FNBA 3TLJA 2P6MA 4EFNA 4D25A 2GDZA 1Y3AA 2X42A 3MNFA 3CZPA 1RAAA 4ABYA 4OMCA 3RFXA 5JEDA 3O3NB 1KO7A 2ZUBA 5J2UA 1TEZA 2HWXA 3MTGA 421PA 4FMBB 4A73A 2XDYA 4BBAA 3W5VA 1IEQA 2AJCA 1C80A 5T4FA 3B1FA 5A5EA 3X2EA 1WHTB 3OU2A 3KL2A 2XW6A 3C6XA 5FLKA 4OHMA 4BVJA 2H63A 2CLCX 5I7SA 2VT7A 2J9GA 3NBQA 3SCZA 5F4ZA 1H93A 4ND1A 3HB9A 2XNJA 4J0GA 4MOWA 1CY7A 1NVVQ 2YY5A 2GFQA 4KK3A 1OI4A 4N0EA 3EEIA 1OXXK 3QMMA 4PCLA 1XWFA 3GNLA 2IYOA 2OEPA 2XHZA 4HB2A 4TSRA 4FGKA 4ZVKA 4RA9B 4AJEA 2NXCA 4MV4A 3T54A 2Y1FA 3PJFA 5BV1A 1EUQA 2L42A 1DQZA 2X8LA 4XJVA 2FETA 4IL5A 4IOMA 1UBRS 2NV6A 4FHDA 3I39X 5FPPA 3D3WB 2VH2A 1O96B 4UARA 5DGIA 1FSZA 3D9QX 1BN6A 2BFCB 3JASA 4JI3B 4DJ5X 3LP6A 4RV5A 5E6UB 3PPIA 4RK1A 5FOWA 2VP2A 3K2QA 3RQIA 3R5JA 1LLFA 4B33A 3OTOB 1XZEA 2B3DA 1A9ZA 5TEVA 1VRCA 3U5TA 1RQGA 2HU8A 2EJWA 1J2RA 3DUWA 4RESA 4LWQA 4CLOB 1NR5A 3RS4A 2YWHA 2V4MA 1PG5A 5CFOA 2PU7A 3VKUA 1F17A 5AW4A 4LYHA 4MW5A 2VAXA 4M7OA 4GM0A 3LJKA 3I9V1 4INAA 4UKDA 1K9SA 1QH1A 4IHJB 2IZZA 3TSZA 4XQCA 4C1BA 4HGPA 4HF7A 4NBWA 4LGYA 2GK6A 3K8OE 5CLHA 5CIWA 1L5GB 2P9BA 4YXFA 2OUIA 3EMBA 8GPBA 2V7QD 3IL2A 4YJ2B 5EIWA 1XZBA 2CGEA 1VL5A 1MO5A 2P3OA 3HUDA 4YCCA 2QL5A 2O14A 4QE3A 3BRWA 5LB2A 5GIOE 3UFXA 3ZZMA 3CVJA 2AI3A 3ACBA 5EJGA 1CWUA 2BUBA 3VYTB 1CW2B 2XRYA 2C2WA 3T15A 2YXEA 3VGPA 2XXAA 4QHSA 1X7ZA 3LVQE 1FFBA 1EUDA 2VQ6A 4YIKA 4BLQA 5T6MA 1WB4A 3T41A 2I4NA 2Z2IA 3JVIA 5JVDB 3WSVA 1HZJA 4GWKA 5ALJA 1Y48E 3NO4A 3K0BA 5KWSA 1I94B 2YZMA 1MB9A 2H1OA 3PK0A 5ER6A 3H8WA 3B3AA 3DGEC 2WWFA 2JFZA 3AL3A 3WKBA 4EHIA 5KOHA 2VDLB 3JARA 3O38A 1YFKA 5IUNC 2WYVA 4OH7A 1JHUA 4FFVA 1LPMA 3K94A 5ITZB 3NKFA 2QTGA 2JLUA 2IQ5A 4MAMA 5JYDA 4OFWA 2PO7A 4BLSA 1Z7WA 3NKVA 2VYCA 4JB0A 5DBGA 2VJKA 3WFZA 4NZZA 3JVEA 1M2GA 3W90A 4ESOA 3ZCVA 4MKZA 4JR2A 1XMVA 2XA9A 3UMSA 2I2WA 3EGEA 5JXWA 3H5OA 3INNA 1PYGA 1JR4A 2V0CA 2X2EA 3M6MD 3GRFA 5BPHA 1KDRA 3BTVA 1ESCA 1IWPB 1KYYA 1II0A 2CJPA 2ZVJA 4AT1A 3NCHA 1ZZEA 3ZHBA 1XLWA 1GN8A 2HRDA 2VT3A 3G2OA 4L4YA 1KYQA 1PVVA 3SSOA 1MHTA 3GLRA 1BAPA 4KNVA 3L40A 2PZGA 4J07A 4I2NA 4MAFA 3WC4A 4LYFA 1O6CA 1R4NB 4G1VA 4ROSA 3OMXA 2VK4A 4HQLA 4CUKA 2R1VB 3C8UA 4TQUS 3QRWA 1S7GA 4LDZA 4DZTA 1BX1A 1M2OA 5DISB 4LHYA 1BW9A 1W85B 4TWIA 2YVQA 4UEJA 5FD8A 1VBNA 1TGYA 4Y0VA 3G0CA 4RAQA 3WXMA 4LJ9A 3K8QA 2PAAA 2AOUA 2JD1A 4G0ZA 1JFTA 4MUYA 1T4CA 4NF2A 4BGIA 3KXLA 1N3LA 5ICEA 2BGUA 5A3QA 4AY2A 2I34A 3V3TA 2DMRA 1BMTA 2GESA 3ER8A 1ZRHA 1KIMA 1PL7A 4GHWA 5C4IA 1QQ7A 3C7TA 3GGJA 3IUSA 1NXVA 3PQ6A 3CYFA 1GL3A 1H3FA 3LM8A 1RWXA 1MPXA 1OIVA 1TYEB 4JBLA 3TMAA 4BVAA 3QEAZ 3DE2X 1JG4A 1O6FA 1ZKMA 4ZAXA 2P91A 3ZVKA 1NSTA 5J59A 2D2VA 2WICA 2MOKA 5A6VA 4E70A 4V3CA 2E37A 3U5ZB 1U31A 1J7KA 3U3JA 1SIUA 2W9XA 1QYCA 5HRAA 1E7YA 1C2TA 1C3OB 4ND8A 3W04A 3L6RA 3LRXA 4PTYA 3A2LA 3AB8A 1O94A 2D6FA 5JY1A 4OY3A 3A6KA 5J63A 3PE6A 3VO9A 2P75A 3Q5EA 2OHOA 2H57A 4I1SA 1KI8A 5FTMA 1DGQA 1NBAA 3UB3A 3DWFA 4JV5B 1PL8A 3P4XA 2BP7B 4K8RB 2FPOA 2V96A 2CFRA 5HRUA 4RMGA 5LQMA 2FN8A 4C6RA 3OPMA 4US1R 5FTLA 1XZLA 4YPOA 2MIIA 3WV5A 2V55B 1O89A 3DSRA 3AYZB 4CVNA 4YLEA 1RZRD 2C4TA 1D2EA 4NNPA 2ZYHA 1AQIA 1E2PA 2YHSA 1ISMA 1UJ5A 4OHXA 4TLEA 5DW0A 1ZINA 2F64A 4LA4A 2J08A 4X1OA 2O6HA 1HEYA 3UOAB 1IZ0A 1GFSA 1X14A 3K4HA 1JHPA 3G2PA 2IYUA 2PBRA 1WP9A 3RE1A 1P2VA 3ZLBA 2XNDA 4Q7QA 2WJYA 2GVNA 2HU2A 4HV4A 3VKGA 1GSAA 2DQYA 4CM4A 1B41A 1E1CA 3IUQA 3JQEA 4Z0NA 3GMIA 4PC7A 5BW6B 3BXOA 1YOVB 1NE2A 5EJ4A 4QVKA 2Q6KA 3ZIAA 2X58A 2DY0A 5AW7A 4ZI7F 3JCZA 4CW7A 2XCSB 1L3IA 1RYZA 4LYAA 4D3SA 2O2HA 1S9DA 4XVQA 2R6GA 4XD7A 2JH3A 3WSTA 1KR5A 1T1EA 3DO6A 2H9IA 1ZRNA 3BDIA 3LUHA 3LYAA 2RGWA 4OHBA 4KX5A 8AT1A 4WDQA 4ZZ3A 1F3LA 1CS0A 3ONFA 3RM3A 2XKKA 4DZZA 4JJ6A 4LFCB 3ELUA 1ZCZA 1UM8A 4BO5A 4LW8A 4KE8A 1N9GA 5DULA 3KQTA 5JQWA 2Y77A 4WHMA 4ZOLA 4NBVA 3B53X 1AY0A 5JAIA 1K63A 1EWYA 1P0IA 1R6UA 2AEEA 1TYBE 4BVGA 3SDBA 1BX3A 3UMYA 4MARA 3DZDA 5A4DA 1Q0RA 1LSUA 5GINE 4DDWA 3VNAA 2D54A 3GV0A 3TZCA 1W1UA 1I2DA 3CSSA 2X77A 3EXHC 1GQQA 5I7RA 2EL9A 3IQXA 2KJQA 1PZXA 3GF4A 3GZNA 4M88A 4R7TA 5GQSA 3N39C 1L5FA 1RLMA 1PZHA 4QYTA 1NP6A 4JUIA 3FFTA 3M6LA 3QYFA 4LXUA 4UOQA 5IZ4A 1EIWA 2QT1A 5DOZA 5LSAA 1LVGA 3RK0A 2YYYA 4Y2JA 1Y89A 3DULA 3QXGA 5DF1A 5EUMA 5AVYA 4RGVA 5DX1A 1HLFA 3VC7A 2A9VA 2JBAA 1D2MA 1FFSA 1YR9A 2DE0X 4KNWA 4JB2A 4RCZA 4RQBA 4UZFA 4CM9A 5B4TA 1BEZA 2FSPA 4FYMA 4ZQBA 4JXZA 4NTZA 1NNEA 1KMNA 2P8JA 2DR2A 3AEUA 4ZPXA 2E4AA 2V9ZA 3MS7A 4JQCA 1V9SA 2R7NA 4B0PA 3KZMA 2ADMA 2M6KA 1G2QA 2YJ5A 2AXNA 1A1VA 5CB4F 1DXOA 1QDLB 1SKQA 1Z33A 3UHJA 2V7EA 4COOA 3IPCA 3CKMA 5B37A 1ZJWA 4WCFB 4YO8A 2Q50A 5BNZA 1L5WA 4IINA 3PI7A 1N2SA 4TXNA 3IT0A 2F90A 2OO7A 5THXA 4X95A 5I7FA 1Q12A 4XYEA 3T7KA 1GTSA 2RARA 3CKLA 3IQEA 1CZUA 4UM9B 4NAVA 3PFGA 3BERA 5L53A 3PZRA 1MVNA 1QCZA 2FU5C 1GKUB 3DAGA 2DHCA 1M1YB 1C1HA 3B1KA 3JV7A 1PP4A 3AM4A 3QVTA 4CIDA 3IAAA 3HWX1 1BWPA 1DP4A 2RH5A 1TT7A 2XVMA 3KOZA 3P9ZA 3QBVA 1KZ9A 1OASA 2P9EA 5D3ZA 3SC4A 4M8SA 5G2OA 3KOUA 1SK9A 3MB5A 3QLVA 2QGFA 3U56A 5F7ZA 4OM7A 1OXMA 3AR6A 3GJ8A 2R84A 1JDUA 1XTQA 4FEEA 3TLXA 1XEWY 3V4SA 2QT0A 4MUAA 4D6YA 4LYEA 2BFWA 3TRIA 1FFHA 1Z7YA 3QMPA 2Q99A 3QWAA 4FC7A 2G06A 4O1HA 3ZHRA 4BBZA 2VJAA 4S24A 4B09A 4LDAA 4MV8A 4EG0A 4A91A 3GUZA 4OXNA 2A0UA 5HS4A 3T1TA 2AUNA 2VDKB 3MTAA 2NO5A 3EG5A 3GN1A 2E48A 3ORFA 4RPLA 2RH4A 1B7GO 3STWA 2O6LA 3E3MA 2X4LA 1V2GA 5DM1A 1OU4A 1W0JA 1JDBC 1ECLA 1L4LA 1Z34A 3JD4A 3KSRA 4AY4A 4QXPA 3D6TB 3B8HA 1E32A 1NMQA 2WC1A 4HN9A 1M7BA 2ZTSA 4RZIA 4OIMA 3F1KA 1S89A 5DTMA 3KJZA 4ZXFA 4C7JA 1I4TD 1XZPA 1YQUA 4J9UE 4OBXA 4PX5A 1Q16A 2FNAA 4M3NA 2B9EA 5KQGA 2VJNA 1EK5A 3ELYA 2E3JA 3B36A 3ACDA 5JAUA 1CQWA 1HNXB 1NURA 4X3OA 3UAGA 1FP1D 4PZDA 2EFJA 4FUQA 2HRZA 5D7NA 5B30A 1XD9A 4P9NA 4RMNA 1X70A 2RHOA 4GZMA 2AK2A 5KMGB 3FMOB 5EXPA 5EWMB 2RHJA 4DYDA 1E60A 2WEKA 5JZVA 5D85A 2PZMA 2XDQB 4KL8S 3DAFA 3VR5A 5C53B 4FM9A 1IJBA 3R9WA 3OO1A 1KNQA 1ZY2A 2H1SA 3P5SA 1DKLA 1M1NA 4DT1A 4KLAA 4X00A 4BZWA 3VR6D 3LUAA 1Z63A 4A6XA 1LVUA 1WU8A 3A04A 3GQBB 3I64A 3U7EB 3A11A 4ZJYA 5A1TA 1T9DA 2PGNA 3PJGA 4QPNA 1P9NA 1M1YE 5HF6A 3VU0A 5TXGA 1Q3HA 3GIDA 1YIDA 3IJPA 1CP2A 1DG3A 3KKMA 3NTUA 3H8JA 4OLHA 3NETA 1QVAA 5HCIA 4P80A 3ZXXA 2XAUA 1QKJA 1R18A 1BHQ1 4NH4A 1EINA 3FI0A 1X80B 2I6UA 4O4JF 2VTBA 3CVOA 4C78A 5H59A 3IMCA 3V4OA 2WYIA 2IWRA 3FXAA 4KVFA 3LV8A 4QTZA 4KREA 4KLZA 1PZGA 1KI4A 1X7DA 2O3SA 4NG5A 1IHYA 4RK7A 3I2HA 3BK2A 5J2UB 5ALDA 1A50B 4HQNA 3IA2A 4BNLA 4JJ8A 4GX1A 1MRSA 2FY8A 3DFZA 4LY9A 1TIBA 1U04A 2G82A 1O8CA 3RVNA 3TZ6A 1PT8A 3UBMA 5JNRA 3HYSA 3QX7A 2OM6A 3CVXA 1SXGA 5FPYA 2MSDB 4RCYA 4UM8B 4MYSA 1RQPA 1FFYA 1CEXA 4D79A 4EBBA 2DQSA 2Z9CA 5JRZA 3ZU5A 5EHXA 3LF1A 1E94E 1Z7EA 2OXRA 3FPHA 1IM8A 4QFDA 5EN4A 1X77A 3KXKA 4JUAA 3ZJ4A 1ZAYA 5HKKD 1L5MA 2WD8A 3DHYA 1YIAA 3MQ4A 2G5CA 3PC8C 4HNSA 2GO7A 3HKDA 1H94A 3OZIA 5LL6P 5L95A 2YZGA 3JTEA 3VR3A 1UZNA 3OQPA 2HFKA 4RKYA 4RJIA 1JSRA 5GADl 3PC8A 2HWKA 2QRZA 3C98A 3JASB 2XQJA 4BFVA 5AVSA 3RGWS 1NHWA 4OOFA 1VSQA 3L84A 2XUHA 2Z09A 3EA4A 4L8FA 4MWTA 1JTVA 3EWIA 2E4ZA 1YS2X 4YUXA 1QE0A 4I19A 4BE4A 1I2AA 5CGQB 5HUQA 3MJFA 3QSYA 3EPRA 2IXGA 5ANRB 2ORED 3TW4A 4ESHA 1U1GA 2GCEA 2GEDA 2EDCA 3I3SR 4X1KA 4EKEA 3O75A 4CV0A 3HA7A 4M9RA 4O3FA 1QH1B 4KQ1A 4BHTA 1E9AA 2ZJ7A 4X6XA 4QQRA 1KR2A 1US8A 4NOKA 1T36B 2QVLA 4FU0A 3D2LA 3LIPA 4MO2A 4OA5A 1FYWA 3S99A 5JZMA 1XMPA 2G9QA 5LC1A 1EWKA 3GDHA 4G09A 3R0IA 1IHOA 3GJ4A 4I2VA 4LOKA 2QN3A 4CHGA 1TM5E 3GCGA 1JZSA 2NVUA 3K3PA 4KXXA 3X1JA 1WDTA 3HGMA 4B7ZA 1Z4NA 2IOYA 5F77A 4DQDA 2BM1A 3R7BA 1QRAA 3UFXB 4CQJA 3AR5A 4QDOA 1WNTA 2IU4A 1YBVA 2GPNA 3HI4A 2EBUA 1DJLA 1QRUA 2IW1A 3QUCA 1A9PA 2XXAB 1X7ZB 2JK1A 2QL6A 2XB8A 3SX0A 3ZY6A 1EUDB 4F8EA 5DU2A 4G63A 5FWYA 2CSXA 3ORYA 4RY8A 4P4SA 3FZGA 5JAHA 2C9YA 2RIPA 3L1IA 1G7RA 1XXLA 2IIBA 1RLOA 5FFMA 3QGMA 2INGX 3LVFO 2FCRA 2P6NA 1GPWB 1MOSA 3FB4A 5JPCA 4FJ1A 4BWFB 1PX2A 2JD0A 3H17A 2HJVA 4D3ZA 1FYFA 2JK0A 4UTXA 4LYYA 2A78A 4BNZA 4ERXA 3W7BA 5KOHB 1SC4A 3ECSA 4PYQA 5A4JA 3EMKA 5SZIA 1HTBA 3JARB 4DOMA 2LRHA 2QD4A 4BGVA 5C1BA 1LTKA 1NYQA 1A4UA 1K3TA 3KKPA 3UW3A 4RETA 1WCIA 1MOQA 1TAGA 2IIPA 2UYGA 1S1CA 1UPBA 1E62A 3C5WP 4TT3A 2WKPA 4WK0B 3TVYA 3IHLA 3F4KA 3Q8LA 2XWSA 2Q9BA 4BCBA 7REQA 1QP8A 1II9A 2AV6A 1UIRA 2XYGA 1R5NA 3QEKA 1GCGA 5MFZA 5DNVA 1QIHA 1CJVC 1GGFA 3KEFA 4HBZA 2PUWA 4H31A 4RQUA 3QXSA 1Q1ZA 1D07A 1R00A 4YRFA 4DLKA 4N40A 4KXYA 3HPQA 3K1AA 3TQHA 1FJ2A 2PA0A 2ZCUA 2DPYA 3M6IA 2EX1A 2RGUA 5G0SA 3U19A 2VC2B 2D4HA 5CX4A 4MUNA 3SBDA 4E94A 2IUSA 4RHTA 1Q0TA 5A4IS 2O3JA 4NESA 4YONB 2W2OA 2QTNA 3ESBA 3NOOA 1FTSA 4DYVA 2C4MA 2QM0A 3NLLA 1I33A 4MVJA 2XBLA 1VPWA 4ZGWA 1M2OB 2OO3A 1BW9B 2Z1MA 2QE7A 3HCEA 1XCPA 1VMEA 5CDTA 5LQJA 3BE6A 3T7CA 4NECA 4FNOA 3TI9A 5JS2A 4FKBA 5AOCA 1GYQA 2AOUB 2PVPA 5BNFA 4K5QA 4CG2A 4FDAA 5F7OA 2MR5A 2GI4A 2C2GA 1T4CB 1Q14A 1VE1A 3PPWA 1LJUA 3B9PA 3PFCA 1HQDA 3SSAA 4DY4A 5ADUS 2G1AA 2GN2A 1EGMB 2NVWA 4IWNA 1W36D 2DCMA 2PJZA 1T29A 1UOQA 2OT3B 3I73A 4C3VA 1EVLA 2ZYUX 1DV2A 1HQCA 1W73A 5A4FS 4A2CA 5F7XA 3CUTA 3E48A 5K51A 2B2CA 1FDUA 1UAYA 4D42A 5A5FA 4HH4A 5FV4A 2YWCA 2ZAOA 4Y0NA 4M7RA 3IAM1 5LKAA 3DLPX 1MVOA 3Q0TA 4N6NA 4WUTA 2G4LA 5EJMA 5SY4A 5HKBA 1BMDA 1K5DA 4P33A 2EP8A 3PLAE 3H97A 3UICA 4ND8B 5KSOA 3PIDA 4KQHA 1C7ZA 1BS9A 2KS6A 5AI6A 4ASUA 3LPDA 3QI2A 3RRYA 4QUBA 1WQ1R 2QX7A 2QJTA 3OZFA 4OXQA 2QRKA 5BWNA 2D7DA 3G82C 2HZBA 5E1BA 4F2HA 3I8OA 4MVJH 5JAOA 2I4RA 5KTRA 1RWWA 5JDIC 1RE0A 3DF7A 3TNYA 1UT5A 1QRSA 1WB9A 1IQRA 4JEIA 1QOPB 5GP1A 4PN7A 3CKYA 3IAXA 1DXYA 3TN7A 3VA7A 5EIBD 5JDIA 3B9RA 4OH1A 3PS9A 2QVBA 4OI2A 2GNOA 2XE7A 3KJXA 4G6ZA 4MCHA 5EGSA 4BTVA 3QE2A 4BMYA 2B8NA 1N92A 3AJDA 2GZRA 2OENG 3CUUA 3B6KA 4UEOA 2CUZA 2QLFA 5AVKA 2YZNA 2BZSA 2CF6A 2FK7A 3IFSA 2RHTA 1AUOA 4M9UA 2GB4A 4LBVA 5LB4A 1IPEA 2Y9PB 4KXQA 5L6LB 2IEYA 3FPFA 4ZVRA 1RCFA 4MV5A 1WXGA 3DHNA 2AFVA 3A6DA 4DLLA 2MWMA 1L7BA 3GEMA 2WG1A 3DB2A 4JA0A 2QL9A 1UXOA 3IIMA 1DLJA 3KXPA 4CM4B 1PNOA 3NDPA 1E1CB 3OVMA 2X8AA 1COWA 5JNTA 4UVGA 1AKNA 1XQ9A 1LBTA 2J5RA 3KHSA 3MJVA 1GADO 4WNYA 1Z6YA 2DJ5A 2VAPA 4G0OA 4WW0A 3KKNA 5TVGA 2PVCA 4K40A 2C58A 5C4GB 3DPSA 2RI0A 4NZNA 5K3BA 3OOWA 4OQDA 1MO6A 3AP2A 1RTTA 3R8XA 4GPAA 2ETVA 4LOIA 3C3BA 1WNFA 3GEBA 3UMRA 4KJXA 5DNCA 3OOEA 1E0AA 3GYBA 4RMHA 2A59A 4EKYA 2H3EA 3A3NA 4IUDS 3QU9A 4TQAA 2HSDA 2H07A 4K9PA 4QUEA 1QQBA 2Y92A 3I3OA 1J07A 5HIMA 1DRVA 5C5EA 1A7KA 2A0YA 3CSDA 3PDWA 4U6QA 1ZC3A 1E9SA 4Q1VA 2BFMA 1IC6A 1EBBA 4ENUA 2XDAA 3UGKA 2DHDA 1H2ZA 1N9GB 2RJOA 1P91A 4Y0AA 3TB4A 4J0CA 2FKNA 3MGKA 4MP8A 4ZOLB 2DAPA 5BNTA 1QBGA 3CRVA 3PL5A 3HFJA 3LQKA 2ZT5A 3WAJA 2IHZA 4FGSA 5FNVF 5H80A 2MSLA 1K0UA 4EELA 3UY4A 1R88A 3KWFA 4KE6A 1P0QA 3R6DA 2FRDC 1NBMD 1YFLA 2NU8A 3VPHA 2B0JA 3GZNB 4ZHQA 5IF3A 2IBSA 3ZDRA 3BXEA 3PXEA 4M76B 5KQLA 3CF4A 3H6KA 2CLKB 4DNFA 4QX6A 4Q4LA 5EJEA 3R41A 2HSWA 1UJBA 2J59A 5TQ2A 1FUKA 1L9KA 1MTOA 1UWKA 3N2EA 4KSBA 4O59O 4HS9A 2QQ0A 1DMSA 5A4AA 1JJAA 1PZFA 3KM0A 4XFJA 3HI6A 4R9RA 2Y1GA 2JBAB 3MTEA 3VR0A 1ZISA 3PNSA 3FBWA 3LKBA 1FZTA 1NRWA 3EGOA 2WJVA 3TYXA 3A2KA 1E3IA 3MMPA 4O8ZA 4V03A 5FLEX 4ZVPA 4EUFA 1XZJA 3I28A 1WV0A 1ZNWA 2FMHA 2OSVA 2BZ0A 3AEUB 3NHRA 3DQQA 1C8BA 4CTKA 2EKPA 4INJA 1BOOA 2YS7A 3NI2A 5IVHA 4FD3A 2BE9A 3QXJA 3SZRA 3W1WA 4DKXA 4HRYA 4HKTA 3L0ZA 4KUEA 1P0PA 1PEKE 1GL6A 2ZIGA 3KSZO 3JWPA 4IG9A 1ENYA 5TT1A 3QU4A 2H4YA 2ZWAA 1W34A 5C1OA 2OYCA 1BROA 1GZ6A 4II3A 4J7UA 3IEMA 1V1RA 2XGJA 2PGIA 2VZEA 3MT0A 4I1IA 4Q7JB 1IRIA 1VKHA 2JI8A 3PQ2A 5HCUA 3AYXB 1Q0ZA 4XLZA 4QFBA 5D5HA 1H8HD 2RGXA 3JQQA 1I7LA 1KJ9A 5EKXA 3S6JA 3THRA 3TLZA 3ZUPA 5L4LA 5KDLA 2GEJA 4ZYWA 2BH2A 2V7XA 4RGYA 1SIBE 1THTA 1O9BA 3NHUA 3Q9NA 2GKGA 2HLDA 2B35A 1HE8B 2I33A 1XEWX 3CCCA 5ICFA 4F5EA 1E3QA 1P5ZB 4G0XA 1FQKA 1O97C 4W9MC 1R6AA 3D4BA 1O9GA 2C5LA 4PG6A 1Z4QA 4U3JA 2F8TA 4IXTA 3A4NA 3A9UA 4J0EA 4N82A 3AHEA 2NSYA 2J30A 3IIIA 1OLUA 3QOFA 3P5BA 4ZRMA 4ZYLA 2OXTA 2IKSA 2NUTA 2JFPA 5G4LA 8OHMA 1OBVA 4OP3A 2AJ8A 3EC1A 4BLUA 1EXDA 2Z6QA 5AQ1A 2GN6A 3ZDFA 5K3EA 3HYNA 1L4UA 1J23A 3UZUA 4RTJA 1I0ZA 1VL1A 1W9HA 3OZUA 4YMVA 5BV0A 4OQPA 3O2QB 1E96A 3DMPA 2HLNA 2ZREA 4WGFA 3DQZA 3ZCXA 3K72B 2X9QA 2VPYA 1DUVG 2BZGA 4UUPA 1I30A 2RAPA 4OK6A 4P3XA 3RS5A 5DXFA 5BQOA 3WK6A 4OQNA 2IU6A 3KT8A 1WO8A 1IUOA 4M0DA 5KDOA 2IL1A 2AMYA 4L5YA 2Q3LA 4GECA 2G8LA 3HCFA 1XRJA 4JVNA 1JDBB 5DN6A 2P67A 4Z3DA 4HWPA 1WBDA 1UT6A 4UEQA 2EYUA 2FTKE 1II8A 4QJ5A 1JVBA 4X24A 4BGUA 1CRZA 1U6KA 2LV8A 4I5GA 4N39A 3STXA 2XIJA 2ZFUA 1C7FA 3AVUA 1ULSA 1Z8HA 4ZTZB 2G9VA 4R2IA 3CH4B 5FBLB 1OE0A 2PS1A 1J99A 1GARA 1GQ2A 4DLXA 5DM70 2DBYA 4B4DA 2F3SA 2D59A 3BPSA 1JQKA 3OCJA 3S7TA 3KBOA 1KJQA 1RWPA 4R68A 1EPUA 5EC8A 5T8KC 3B1ZA 4QD3A 1JQLB 2EL7A 3PCTA 4HADA 3GOQA 3QNUA 1SHJA 1ZH0A 3AGPA 4FYPA 4X3CA 4TTQA 4Y9SA 3ROXA 1M1NB 2GD2A 4PPYA 5EZYF 5T8KA 4DT1B 4HAWA 3ZBTA 3LZCA 4NBLA 4Z9BA 2ROQA 3CPHA 5EKDA 3T9CA 4CL0A 2QSUA 1Y42X 4MV6A 1H4QA 2AMFA 1OYYA 3P2YA 3NBFA 3ILYA 4F9FA 3LC2O 3KELA 1ODLA 5JALA 1R37A 5AW5A 2IY9A 5I7EA 5IS2A 2BFFA 2XUIA 3MTQA 3N6RA 3PA6A 1IBMB 4KR7A 3WJ7A 2VTBB 5C31A 1GG2A 2OUKA 3FNEA 1GZSA 2E4WA 2W22A 3EDQA 3L5KA 1PR0A 1VG9B 1GYRA 1ST3A 2H2GA 2TRSB 3JQ9A 3C15C 3T0GA 3TNJA 3WMEA 1NW7A 2ZBFA 3SX2A 4DREA 1YU6A 2J0SA 4KODA 3R2JA 4PZUA 4OXXA 1ZUNA 2ZDGA 5C8DA 5FJIA 3CH7A 3QM1A 2MMGA 2DH5A 2OCAA 3QMWA 1DMRA 2VIIA 1J22A 1E2HA 1JB1A 3GRRA 1Z6XA 4IXDA 3DZKA 4LV6A 3CNNA 3O84A 4XJSA 3ZD7A 1A8UA 3CNLA 3WGOA 2AG0A 1KK3A 1P9LA 1VYTA 3OTWA 4OJMX 4IDEA 3R5FA 2VSXA 3L3BA 5JROA 1QZ3A 5HF8A 2JBHA 1Q1QA 1YUNA 1OXUA 2FI1A 2JCSA 3ABRB 2BYTA 1PT7A 1YD7A 3HV2A 3LHKA 3I2YX 3KEQA 4UZSA 3IQIX 3MUNA 3EFBA 1UKYA 1FQJA 1Y3FE 3KQPA 4GMHA 5JZ9A 1PN3A 1XRPA 3CJTA 2VRNA 4A92A 5CRIA 3HKDB 5A6SA 1Y9JA 1VBFA 1L8XA 5LNK6 3BQNB 3FKSD 3TSYA 2RHCA 1R0WA 3LFHA 4D98A 3MD0A 4YRDA 1H4VB 4TWRA 1VJ0A 5LJIA 1QRTA 2AW3A 5SZHB 1XLUA 4IQGA 2X8WA 3FYSA 4JP3A 3OPNA 2HRBA 1G8JA 4J1NA 5IBPA 1LCIA 3B2QA 1RAIA 1WP4A 3IR6A 3TNLA 1POWA 2WG2A 2QXUA 2WHRA 3EIUA 4Z54A 5KTKA 4P0PB 2YRFA 4JBHA 5LUBA 3OUUA 2VKTA 4MVJG 1Q95A 3BFVA 2WVJA 2Y99A 3E15A 1GPLA 4RA6A 2R8PA 5FUQA 1AQNA 2OV2A 2XEDA 4AUKA 1QTRA 3FVVA 2Y0PA 3FOCA 4DCMA 2A5LA 4IDGA 2BW0A 1ZO8A 4MRNA 1SHZA 2IYWA 1US8B 2H7VA 4J0KA 3RJMA 1SBHA 3UAYA 3AR7A 5I9NA 1EB8A 2BF4A 3OLCX 4WADA 2NVUB 3KAJA 3ZWXA 4PLGA 4B2PA 3H1GA 1LEHA 3ZWMA 1AZWA 3T5BA 3O31A 1E2MA 4DLNA 5D00A 1X9GA 4RPIA 2P3QA 2W2QA 3CW8X 2LE0A 3ACCA 3PCRB 1WXXA 4U39A 4YREA 3RVSA 4TXMA 5FWYB 1OYWA 3M1LA 1FDOA 1ZCFA 2I29A 2FR1A 2V7WA 4XB1A 3AY7A 1EVKA 4MZDA 1N5IA 4JXJA 5LXTF 2F8LA 3EFEA 3A6EA 1GPYA 1X92A 5IMSA 4WFIA 4PGHA 3TX6A 1PFUA 4BIIA 1JG1A 4KPUA 1PJ3A 4JLSA 1PJQA 4EB3A 1IOLA 2Z2ZA 3D2CA 2ZI5A 3LLUA 4RVSA 7MDHA 4EEZA 2VUUA 5C0OE 3E2PA 4DMLA 3ESDA 4DTIA 5IYZA 1PK7A 4FR0A 3VBCA 4Y2UA 3H5NA 4KQKA 5AKYA 1U2TA 4DIBA 5BSWA 5LUAA 4MRRA 4N4AA 4PPQA 2GEKA 5CA0A 2APJA 5MDHA 1V16A 1N0WA 3EIQA 2O1XA 3BBPA 4X7MA 4LZNA 4BEVA 3CW9A 4X64B 4M1SA 1DO8A 1WCIB 4UDNA 1E3DA 1NXSA 1E79D 2O1WA 2RGCA 2XRFA 4IJUA 4MMXB 3ZHCA 2HR1A 5JQGF 2OL4A 3T7RA 2Q5FA 4INZA 4TV8F 4YAWA 2ECOA 5EPEA 2ONZA 2EFEB 3OLWA 3P4YA 4JX8A 1OV4A 1Q92A 4O4LF 4Q1BA 5CYPA 4D9HA 5KUTA 3L0BA 2NYVA 3QKIA 3BSYA 1S4QA 2MR6A 3QNMA 1FCJA 1E4VA 2WSMA 4LK2A 5FF9A 1H66A 2R62A 1ONOA 2NTVA 5DP2A 3K1AB 4ZGGA 4LXIA 4RTPA 4P0QB 3DMDA 4YA6A 4YT8A 3HJUA 3NRJA 5CB6A 1JZQA 3OPXA 1KJ8A 2HIHA 3KR1A 4MR7A 4A16A 1TDJA 3QE0A 2BLLA 1AX9A 3AG6A 1YDHA 2Y1CA 3UAXA 2F4NA 1J8DA 1Y6JA 1H6AA 1DIBA 1I5RA 3A6FA 1C81A 2NU7A 3BSWA 4KWCA 2VBIA 2CC2A 3WBBA 3TXYA 2R8ZA 2QTAA 3IX7A 1RYEA 3WLOA 4CNQA 3TLAA 4NJOA 4WL0A 4BB5A 1KKMA 1CLEA 4UULA 2Q3CA 3PFWO 3SEQA 6NULA 3D5QA 2IDZA 4B6FA 1E61A 4BQSA 1DAIA 4EVIA 1JUDA 4Q37A 1V43A 4CDGA 3PUKA 4V1CA 2GEFA 1M1UA 1SEPA 3IDQA 3PHGA 4DIUA 5JT1A 1RBMA 1A7UA 4KIFA 2CMDA 5JH7F 5B1DA 2ZYVX 2VNSA 1VJ5A 5AKHA 2H7YA 1QDEA 5FWDA 3DFKA 4HEHA 2FX3A 1L4YA 2I2FA 1OF1A 3Q1KA 4HDSA 3PHJA 1TW3A 4C6HA 1D2AA 1NI5A 3UJAA 4AJ9A 2QBYA 4RGQA 3EUWA 3C4QA 3K9HA 4C7XA 1UCFA 5IC6A 5DO9A 4UUMA 5GGXA 3CF4G 1I80A 3TZBA 1JJVA 3H5AA 1VMIA 4XCVA 5KVVA 4I6JA 2NUPA 4RC9A 4LRSB 3UT5A 3JD1A 1T3GA 1K5HA 2JB9A 3AHCA 4QODA 1SZCA 2QLBA 4AIRA 4RXTA 4ARZA 3G17A 4Y8VA 5KC9A 2LR0A 2W0SA 4RAOA 1IQ0A 2D74A 5K4GA 5MF6A 3ZGYA 4BS9A 3AKZA 3ISJA 1P4HA 3V4PB 3CNOA 3WK5A 2IDKA 3C6ZA 4HDQB 3ANXA 4B44A 2RHWA 4HQOA 3SYNA 1X38A 1Y8ZA 5BR1A 2GPWA 4ZEXA 4ARVA 3R75A 1GEGA 1UDBA 3F78A 4B2LA 1CR1A 5CCDA 5EJFA 3BTOA 1HC7A 3NHZA 3WLPA 4EPYA 3A9RA 2OK7A 4P84A 3RIMA 3TGPA 4BCCA 5CCEA 2YC2C 3HJTA 3NP7A 3QBTA 4M9XA 3F9CA 2FW8A 5BV8A 3K15A 4MVJE 4PXYA 5H9VA 3VX4A 4DC1A 5C3MA 3LQ1A 1RZRA 4JP5A 3OFNA 3Q11A 4A7PA 2MJLA 2IY8A 2GCNA 4CL8A 3E8XA 2ZGVA 1NGSA 3ZNOA 5A5VA 1T9AA 1O6ZA 2VK2A 4GX5A 3LLVA 5IW8A 2ZB8A 1IJKA 1K66A 4OSOA 1I4LD 2D0PB 2J1LA 4ZOBA 4EY4A 5L7WA 3UCXA 2WQ6A 2ERXA 2IYFA 1N2JA 1QO7A 1XHLA 5DHFA 3SR4A 4EX6A 4PSUA 3SSNA 3IUYA 2R5WA 1J39A 3ROPA 1A4XA 2Z8ZA 4NCAA 1KEKA 4L3VA 3O7MA 2MHCA 5CYFA 2XB4A 2C4KA 2ZR9A 1HQKA 1NJFA 4Q1EA 1A7JA 4R1NA 3UTDA 3KDAA 2P4EA 4MWOA 7MHTA 4KQWA 4CLEA 4EMUA 3VI4B 1G3MA 1KY3A 3P94A 5LMCA 1HKHA 3AM3A 1UBNA 2EFDB 3IPAA 4D9BA 2C0QA 1PZNA 5E8RA 4BGEA 5HFAA 3T3OA 3AU9A 3A58B 1NBOA 3U3DA 2OBYA 4R9NA 4WKNA 1ZDMA 2CYBA 3O2SB 5A9RA 1VPVA 4RS4A 4X5OA 3M4XA 1DC5A 1E0KA 1NNI1 5IKOA 1L2TA 5DNAA 3MA0A 4NYIR 3RVLA 3VYVA 2P2CA 3Q98A 4JGGA 3CMCO 2OKCA 4RUKA 4S35A 4JSRA 4FR5A 2NU8B 4DSNA 4ZHQB 1BVUA 7ADHA 3AY0A 4LMAA 1CR4A 1TADA 4G89A 2E82A 1OFUX 1U0EA 5FO0A 1XF9A 1L6IA 4PG5A 3O8LA 4R1PA 3WGUA 4X6LA 1D4OA 3EIHA 1E9VA 1FNMA 2O52A 3K2BA 3OEWA 5CA1F 4F3CA 4BXOA 2C8JA 4NNJA 2PH1A 5LDHA 4D3FA 1IEVA 4J7XA 4I1PA 1PT9A 2XMSA 4FPXA 2WHQA 1SZPA 3EWAA 5AIAA 4NNOA 1W8IA 3IOBA 2C1EA 4HXEB 3O8RA 2R86A 2OCXA 2Q5JA 1ADJA 4EI9A 2W2KA 2WJ4A 2GO1A 1SFRA 1R16A 1QIDA 1P7VA 3WNZA 4XGRA 4LJ5A 1V1RB 4ZQFA 3CLSD 5F12A 2OK8A 3B12A 3L5OA 4QOIA 4JEHA 1TRHA 1VHQA 5K45A 4XWAA 2EX0A 2KMLA 2OXCA 3KHTA 5COQA 1FSGA 3ZHYA 3LVBA 3KJEA 3KS9A 5DBEX 3FHLA 1NSFA 4F84A 3LUCA 3PQ3A 3SFVA 4ND5A 1IY0A 2GSWA 1RI5A 4QPZA 2PG3A 3UJHA 3NVMB 4YYZA 4DPLA 3OZXA 4DR1B 2V5AA 1I6WA 1XDDA 2VHEA 1MO3A 1JLRA 3HVIA 3H5LA 4GE0A 2OFFA 1A4IA 5H9WA 4BMCA 2QI9C 3TDKA 4U3JB 2FPSA 1ACLA 3UJ7A 2VSQA 1CJSA 4OF4A 1ZIOA 4P58A 1C0EA 5EINA 3T94A 1OLUB 4ZCIA 4IIJF 4X65B 2NUTB 2EW8A 4HNRA 1F0NA 3ETHA 4ZQGA 4BZZA 3WL6A 2HADA 2PDAA 3NBAA 2B9VA 4BNTA 5F2NA 1G2OA 4QOSA 2P9JA 5AJHA 5IXSA 1KBQA 3ENKA 1MQ8B 1Q77A 3G3EA 1QE5A 3LI2A 4IXMA 3GL9A 4KAJA 3D1VA 4PHGA 1Z2DA 2ZAIA 2VHUA 4NV0A 1PE0A 3B6EA 1H0SA 1ZR2A 1TJYA 2B61A 5DTQA 1KC1A 1HFEL 3H2SA 4DXHA 1JBQA 3B6MA 1NLFA 3N6VA 3KV3O 4V3BA 1NBWB 3Q12A 2NADA 2KX7A 3P2IA 4HLUC 2H5IA 3L6DA 1JHDA 1PSWA 2PGJA 3KOXA 1LTHR 3J7TA 1VE5A 3R6GA 3MJHA 5DNDA 5ESWA 5DSXA 1CLUA 1KY2A 3RARA 3BD8A 3PLRA 4FEAA 1Y4SA 1II8B 1IMJA 4HDOB 3HXQA 2QROA 3BUSA 3HQ4O 3T7IA 3IDZA 4N3AA 4QYMA 4TYNA 1WDLA 4PVDA 2EERA 2ZI4A 3QKSA 1D1QA 1FMTA 3M9XA 1YQGA 2Q07A 1Y1SA 1M7HA 3TFQA 4BKOA 5FLXA 1LLQA 2ZJYA 5HKOA 1NFRA 4DLYA 1UFKA 1MJNA 1PR2A 2E1RA 5LZ7A 4UEWA 4MQUA 4EL0A 2DETA 1BXRA 5IC5A 1ZK3A 4A26A 2FOLA 2ZTLA 1TMYA 2R65A 3UWKA 1PNRA 1HNNA 4XB6B 2JIPA 1UJ6A 4UAVA 3NIDB 2Y0BA 3ZLVA 3HNRA 1O58A 3BF