2MYNA

An arsenate reductase in reduced state
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
131
structure length
131
Chain Sequence
MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin arsenate reductase
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 43
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mynA00
3C3KA 2FLKA 1NXOA 1JFTA 4DADA 4G0ZA 1L5YA 2MYTA 5IUNC 3JY6A 3NHMA 2CHEA 4N47A 3MQ4A 3CG0A 3QEKA 4LX8A 4MQEB 3LUHA 3VNAA 1QP4A 3GRCA 1URPA 3KTOA 4W5NA 1ZITA 2E4ZA 1SRRA 2GI4A 5CNMA 3I45A 3OLWA 3D02A 2MYPA 4O1IA 3KG2A 2NT3A 4EGSA 1TJYA 3Q41A 3S99A 4Z4GA 2MYUA 2FLWA 4MQFA 4EYKA 3KYIB 2FEKA 4G0PA 4PICA 4MS3B 1U2PA 3GT7A 3ROFA 4FE4A 3HM9A 1DRJA 4F3TA 2MYNA 1YK0A 3OM1A 4UHKA 1MIHA 3CRNA 2PUEA 4FE7A 1IIBA 4RDCA 4IMJB 4H60A 4QYWA 4YV7A 2FMIA 2FSPA 3T8YA 3W9SA 3RVMA 1USKA 3HO1A 2VK2A 4L4UA 4HYEA 4KQCA 3HUTA 4Z9BA 3RVKA 5TQ2B 3N0RA 1QO0A 4IF4A 3BILA 5C5EA 1BDHA 1EWKA 4EVQA 1PNRA 4NQRA 4ZYLA 3ILYA 5KC8A 1DC7A 4ETNA 3O1HB 4ML3A 1S8NA 4GPAA 4EYGA 5HM6A 5JNUA 4WWHA 3EAFA 4ETMA 3CTPA 4LE1A 1NXVA 1DCMA 2PMCA 3H5OA 4Z4HA 3CFYA 5JNWA 1YVUA 1DJMA 4G86A 2LPMA 2HQBA 4JB0A 2A9RA 2RJOA 5BQ3A 1SXHA 3LUJA 3DZDA 3H5WA 4ZMRA 2GBPA 2QW1A 1JHZA 4JAVC 2JBAA 4MLDA 1AB6A 3N0XA 2O20A 2IPLA 2FVYA 4OTZA 3N6VA 4G0QA 5TPZA 2Q5CA 1KRXA 3IPAA 1LBIA 2JCGA 2BGGA 3Q9SA 3A0UA 4H3HB 3KS9A 3CNBA 4P98A 4RWEA 4TN5A 3HSYA 3I42A 2FXIA 3L49A 4P1ZA 3SNKA 2FW0A 1JF8A 2WB4A 3JVIA 3HVRA 4IGAA 3K4HA 3N8IA 2GWRA 3RVJA 3EQ2A 1TVMA 3G85A 4KQ9A 3Q7RA 1UDRA 1JWLA 3RVSA 4EY3A 3E3MA 4MRMA 9ABPA 2P9HA 4RSMA 3IP9A 3QLVC 5CNIA 3JS5A 2PUBA 4UHJA 4HNQA 4IILA 3KLNA 5DTEA 1ZGGA 1YS6A 5TPZD 3H5TA 4E7OA 4MS4B 2MSLA 2QZJA 4RK5A 4PE5B 5EWLB 3Q15C 3QLUC 5TQ0A 3LOPA 4RK0A 1FFWA 3O74A 3OMXA 3HZHA 8ABPA 1LJUA 3NBMA 1NXTA 4Z4CA 5FBKA 1ZESA 5DKFA 4D74A 4QYMA 4RK1A 2A9PA 4S04A 3KSMA 5DCLA 2B4AA 2MSKA 4D6YA 3FFWA 2HPHA 2QVCA 3BRSA 4PEVA 4JA2A 1D1PA 2PL9A 3OLVA 3CS3A 4EUKA 5KI6A 3H6GA 4E7PA 4L85A 4XLTA 4G0XA 4KV7A 3H5VA 4NCBA 1BDJA 3KYJB 4MPTA 1FFSA 1CHNA 1JLKA 3EGCA 3HS3A 1MVOA 3RH0A 4YR7A 2WRZA 1C0EA 5FWXB 1DP4A 4W5QA 3UUGA 1FFGA 3EQZA 5KQPA 4RY8A 1DC8A 3QEMB 1NXSA 4ZJPA 4O1HA 3O1JC 1U0SY 1DCKA 4YCSA 1PEYA 3GBPA 3T6KA 3HJFA 1Z18A 4KNYA 1Z25A 3EULA 3NNNA 1LJLA 3SQNA 5IEBA 2IDMA 4W5OA 1I3CA 3O2SB 2PUFA 3JTEA 3BRQA 1D1QA 3CU5A 1E6MA 4KRFA 4MR7A 1KGSA 3HEBA 4OATA 1ZGZA 5HQJA 5IUKC 4MS4A 3RVNA 1XHEA 1USGA 4YRZA 2QU7A 2NT4A 1FSPA 4JP1A 4LE2A 2F8SA 3CG4A 4D6XA 5ED4A 3QX9A 1BDIA 1ABEA 6CHYA 5BR1A 2QVGA 5CNJA 1RZRA 3I09A 1JFVA 4MR8A 1HEYA 2QSJA 4LE0A 2E4WA 1K66A 1BAPA 2VUIB 2E4XA 4TLLB 4F06A 1VLZA 4N0PA 1JH9A 2RJNA 3KHTA 1Z16A 3C3MA 2R25B 2R4QA 1D5WA 2OQRA 3P9YA 4PYRA 1DBWA 4EYQA 1KMIY 2IPMA 2PKXA 1M2EA 2QR3A 1QP7A 5IX8A 1GCAA 3HDVA 3LUFA 3URMA 5KQGA 5BRJA 3C3WA 1M2FA 4RKQA 5FWXA 5HSGA 3H5LA 1YMUA 2FMHA 1VRVA 4YS6A 1JX6A 2L17A 4RXMA 4TMYA 3HUUA 3LUDA 3QX8A 3JPYA 3SY8A 4KFCA 5JS1A 2I6FA 3MF4A 5I4CA 3KCNA 4OG2A 5B3JA 1QO0D 1JBEA 4MQEA 2WJAA 3FGZA 4KK3A 2VUHB 3Q7TA 1JL3A 5DLEA 5TQJA 3RVQA 3TD9A 7ABPA 3LKVA 3DLHA 3OQOA 3I5AA 1DRKA 2JVIA 4MS1B 5EWJB 3IPCA 2FQXA 2H3HA 2HQRA 3A3KA 2L19A 2WY2D 3LUKA 4N03A 4RU1A 5BRAA 1EWTA 3CLKA 1SXIA 4MS3A 4XARA 4YLEA 4YP9A 2CHFA 4LZLA 4RK4A 5F64A 4YWHA 1ZAYA 2E4UA 4NV3A 5TPWB 5JNSA 2OENG 2JVJA 1A2OA 1LK0A 1PHRA 1JFSA 3CKMA 3H1EA 3FDFA 3LUGA 4RZSA 4ETIA 3M9WA 2F8TA 3E61A 3LUAA 1H9CA 4EVRA 3F7NA 5TQ2A 5TE9A 4KZKA 4JB2A 4RV5A 1YTUA 1GCGA 4W5TA 3B2NA 5IC5A 5DGCA 1MB3A 1MAVA 1DBPA 3CZCA 4WXMA 1PEAA 1P2FA 1P6UA 2GX6A 3OMWA 3A10A 4W5RA 5KC9A 4KPYA 1ZH4A 4RS3A 1K68A 4LDAA 2PE5A 1QPZA 4O5AA 2FQWA 3KKEA 3NNDA 1EWVA 4MR9B 1ZVVA 3HCWA 4H3KB 4RXUA 3VNBA 1APBA 5IEJA 3HXMA 4KREA 4KK4A 1Z2DA 2FN9A 4N76A 4IRXA 3OLYA 2V0NA 4B09A 4Y9TA 1XHFA 3D8UA 4QICA 2RDMA 2E4YA 4Z0NA 4OLBA 2ID7A 1QQBA 4Z9AA 3EJWA 3H1FA 3SAJA 4EYOA 3N75A 2RGYA 3MIZA 4DN6A 2IPNA 4TLMB 5T7BA 5KQLA 1QMPA 4RK6A 3DLBA 2NZVG 2QXYA 1B00A 1Z17A 2PL1A 1ISRA 1DG9A 1M5UA 2R47A 2FMKA 3F6CA 4YO7A 4RKRA 2YHBA 3KLOA 1PNTA 2J48A 3LTEA 2VYCA 1TMYA 2KYRA 2XDYA 3ROTA 3CZ5A 3HK2A 3QK7A 1OXKB 1NXWA 2CD7A 4RK7A 3FFTA 1WETA 2PUDA 3OQMA 3A0RB 3QLTA 3O75A 1SD5A 3RVLA 3FFXA 1F4VA 4RY0A 2PJUA 1EFAA 1RNLA 5EWLA 4G0OA 3GA5A 5PNTA 2HSGA 1MB0A 2A9OA 3OM0A 1QKKA 3TX6A 4QPJC 2QV0A 1P8AA 1E6LA 3UK0A 4NCAA 1JDNA 3H1GA 3O1IC 4MGEA 1W9HA 3T38A 3L6UA 3UKJA 3M9XA 1VPWA 3O21A 1D2AA 2L2QA 4MLCA 1P6QA 3IP5A 4MR9A 3RVPA 3BBLA 3MMNA 3SG0A 4DQDA 5FWYB 3ILHA 3LKBA 1FQWA 1YMVA 2IOYA 4PZ0A 2X7XA 2PUCA 3HDGA 1JDPA 4XASA 3K9CA 3OO0A 4MRMB 3F6PA 3DGEC 4G97A 5D2CA 2WWVD 1ABFA 2TMYA 4NICA 1YS7A 4OBBA 4XAQA 4CBVA 1EAYA 1SXGA 4Z4FA 2GKGA 1DZ3A 3JPWA 2NZUG 4WXEA 3IP6A 2FKAA 4F8JA 1TM2A 2E4VA 2FQYA 4FB4A 1RZRD 1R8JA 3BREA 5GOTA 3QEMA 1USIA 1T34A 1A0OA 2ID9A 4Q6WA 4Z4IA 5JNVA 2MSWA 3H5IA 2LP4Y 3O2QB 5JNTA 5JS2A 3GV0A 3LUCA 3FMVA 5FBHA 1U2QA 1U04A 1ZDMA 2R48A 3EDCA 5TQ0B 5IUJC 3QELB 2NUBA 4JOQA 4RXTA 1NXPA 2A9QA 2HJ9A 1NXXA 1Z13A 5EWMB 3OO1A 4RY9A 2ZAYA 3EODA 3IDOA 4LDZA 5B3JC 1KRWA 2LUOA 3DGFC 3MA0A 3GBVA 2JK1A 3JVDA 1E2BA 4XXHA 3GL9A 1RXEA 3IP7A 2P4UA 3GWGA 4XFKA 1CEYA 3C6QA 1GUBA 1C4WA 1NY5A 1PUXA 3HV2A 5GQSA 1NTRA 1Z12A 1JYFA 3N0WA 1TLFA 3M6MD 4WT7A 2YHAA 3GYBA 4LRQA 1ISSA 1W25A 4F12A 1BVHA 2JVKA 1VKRA 4G0MA 4M88A 2WJWA 5CHYA 5T3YA 4HNSA 1AB5A 2H0AA 1Z15A 2M1ZA 2AYZA 3MYYA 3QLVA 3R0JA 3RVOA 4F11A 5FWYA 3H6HA 2AYXA 2B1JA 4ZPJA 3OQNA 2FMFA 3TB6A 3T95A 2IYNA 1E6KA 1QNLA 5C5CA 4IMIB 1U8TA 1QP0A 1NATA 2JB9A 3LMKA 3H75A 2CWDA 1DBQA 4Z4EA 2W42A 5KWSA 4MR7B 4MYRA 3TMYA 3OLXA 1A04A 4MAAA 3G1WA 2LBPA 3MM4A 3QLUA 5E3JA 3RVRA 3TO5A 1ZHHA 1J56A 4G0YA 2FN8A 4KVFA 1XWWA 2HQOA 5IULC 1GLGA 2FEWB 4HNRA 2L18A 4MQFB 3DBIA 3RQIA 1CYEA 1Z2EA 3KJXA 3Q7SA 1YIOA 1F51E 1OXBB 1Z26A 3QELA 1ZY2A 2WMYA 5JNRA 2LIVA 1ZN2A 5EWMA 4N0QA 4MR8B 1D4ZA 4JASB 4Q6BA 1BA2A 1RPJA 4YGXB 4WZZA 1RXIA 4KMRA 4MS1A 1M5TA 5EWJA 2M98A 4N41A 5IBQA 1LBHA 4OLAA 2JRLA 2PUAA 3F73A 3NHZA 3C97A 4GNRA 1QQAA 1EHCA 3LFTA 1YK1A 1Y1LA 2PAFA 4Z99A 1GUDA 3O2JA 1JYEA 5CNKA 5TPWA 2FTKE 4Q7EA 1DCFA 5HKOA 6ABPA 3OLZA 2IKSA 2FEPA 4WUTA 5ABPA 3NNSA 4EVSA 2DRIA 3CHYA 1ZH2A 2PLNA 4S05A 1L5ZA 2N9UA 5KQMA 3SM9A 2ZWMA 2PUGA 2IPAB 4ZMSA 2JBAB 3N53A
chains in the Genus database with same CATH superfamily
1LRLA 2FLKA 3TR6A 5I47A 1UWLA 3IQFA 5LA6F 4DADA 1WHTB 5H3CA 2MYTA 5LP6A 4DABA 3ZOKA 1IOLA 2D1YA 3VNAA 4DXAA 3WIDA 2IYUA 1OX4B 3R7LA 2PX2A 1FMFA 3BH6A 1ZITA 3E27A 4B1FA 3L01A 5LQDA 3FIUA 4IUDS 3D02A 3E9MA 4YAEA 5B2EA 3JQ7A 1SWVA 2LDXA 3Q41A 4ZCTA 4O4HF 4JU8A 5HF6A 3ZY2A 3NONA 5TRTA 4NECA 1R74A 2ZWPA 2X42A 1YQWA 5J4HA 4BO2A 2JI9A 2WAXA 1Y9AA 1U7DA 2J41A 2OD2A 1YC2A 1VSBA 3VMMA 3Q3EA 1RT9A 4L3WA 1IZ7A 1FXWA 4E51A 3RVMA 3CBQA 1KZ6A 1IOWA 3L6CA 3BMNB 4F21A 2DPHA 2EL9A 3T9DA 3U4AA 1XC7A 2N42A 1HMYA 2QMYA 2ZUDA 3VC3A 2QD1A 4WLNA 5IBRA 2WOOA 1FJGB 1OIVA 2JEOA 3SQXA 2ZJ8A 2XCRB 3SI7A 3TW4A 3UVEA 3VZQA 4PQGA 1WVGA 4HWSA 1XCPA 5ELMA 5BP7A 3GPLA 3E7FA 5K8IA 3OIFA 3PPXA 2BFDA 2VSOA 3PWSA 5ILOA 1E20A 5T57A 3L8MA 1UOPA 4PNEA 1DJMA 4U9IS 1XJWA 1NIJA 3Q5EA 2VP6A 2V7BA 4BV2A 2ES4A 3P1JA 2XQFA 3AL3A 4FHEA 4ZANA 4JI2B 2XUQA 4WQMA 2MR5A 1V4NA 2QW1A 2BKUA 1QG0A 3Q6IA 4WXRA 4I08A 1O08A 3W9UA 3GDGA 3EG5A 1O7JA 2AIRA 3I4FA 3MD9A 3BXGA 4E94A 3AJDA 4LC9A 5BSFA 4ALLA 3AZPA 3FHTA 1CS0B 2QRKA 2JCGA 3GGGA 4BVAA 1DRWA 3KS9A 4LY3A 1D2RA 1M2HA 3LC2O 3ND6A 4B45A 3R5SA 3D5QA 1Z0ZA 1F7UA 5DO9A 2FRXA 1PU2A 1ZNWA 2VYVA 3UC9A 3H6KA 3I8OA 1HT0A 4DF3A 5B57C 2H7XA 2FK7A 2X4DA 4IIJF 4C7OA 4KN5A 2HD4A 3W5JA 3N0TA 4HEQA 1HTBA 3E3MA 4FTWA 1Y4SA 1R9JA 2IT1A 2JJ1D 3HKBB 4NI5A 1IN8A 4RSMA 3MHTA 1PWEA 2PEZA 1Z6ZA 3VTZA 3FWHA 3EFEA 1IBMB 2J9FA 2VDUE 3F6YA 1ODJA 4TX1A 4UHJA 3DHYA 2HK6A 2RC6A 2RI1A 3KLNA 5AHOA 4EKIA 1I2BA 5ALJA 1SB8A 3EVCA 1B0UA 2WD8A 1N8TA 4DA9A 1PJAA 2CHUA 3TRDA 3JQEA 2IZ7A 3GN1A 3ZJVA 1WG8A 4PNPA 5AIAA 4ZK2A 5T6MA 2PQMA 1ZCBA 1Q83A 2IXDA 4LOLA 3HXLA 1ZC3A 4Y2SA 4Z4QA 1AF7A 1E5TA 1KZ7B 1J2RA 2HDOA 4N3CA 5I7WA 5KYXA 3PNYA 2NUAB 3O74A 1X1TA 2IYVA 4BGEA 2ZB3A 1XA0A 5H9VA 4Z4CA 3ZJTA 2CT8A 3HYSA 1HLGA 5BWCA 1I7NA 2A1UB 2AL7A 1ZA1A 2GGSA 3JD3A 1C2YA 2Q99A 2PNJA 1RIIA 3R76A 5CW2A 1CQIB 3TZHA 3WAGA 2V74B 1E61A 1EX6A 3HLTA 4E3ZA 1ZBQA 3C7DB 3AI7A 2GVDC 3AOEC 1KJNA 1SJ9A 5LP6F 4BO9A 2XUHA 1QHYA 4XLTA 5J2UA 3QSYA 4ITRC 4UM9B 1BNCA 3F97A 3TJZA 2ZJ4A 3F3KA 3H5VA 4RIFA 4ENQA 3BJZA 3SIRA 1M2OB 2VG8A 4KACA 3CJTA 4K03A 5EFOA 1P5HA 5CA1F 3PFBA 3PUJA 4NH0A 1HDCA 4DILA 4DTIA 4BE7B 3ZJUA 3UUGA 2OCYC 3FCEA 4G1VA 2A67A 1M67A 3EVNA 4I55A 1L5GB 1V5WA 4UVHA 3O1JC 3UJAA 1HNWB 2VDVE 1D03A 1R0LA 2XLBA 4IZHA 4FQ7A 2XYQA 4KIUA 4HL6A 2F64A 1A76A 2GEDA 2Y66A 3PL5A 4O4HB 4QUBA 3GQBA 3IRVA 5ALSA 2GT1A 3PDJA 4ACBA 1B2LA 1RMQA 4RCVA 3ZDQA 1FXWF 5KYTA 3PEEA 3DV9A 2PUFA 3PPIA 4XVQA 2Y1CA 4M1ZA 4KWTA 1BX3A 3TUIC 2ZKLA 1ZGJA 5LYYA 3DMNA 1XMPA 1HT1E 1Y8AA 3M2TA 5F3DA 1J97A 4NMLA 3OD5A 4N6GA 4FGLA 1GAEO 2E85A 1USVA 3ACDA 4Z0TA 3EE6A 2QTVA 4S1VA 3IAM6 2CLEB 5AW5A 1BDIA 2QTLA 1R2QA 1YQQA 4I4NA 2Z1NA 1RYNA 4HWKA 5EHZA 2H1WA 2FWJA 3L0OA 4MI9A 4DJ5X 3SX0A 3ZD9A 5A0TA 4A2CA 2QTCA 1BGVA 3IOBA 1RP7A 1KIMA 2FZGA 1YQEA 2ZUVA 4PGFA 2R65A 4MO9A 4OFZA 5P21A 2GXSA 3I04M 3WB2A 1ACLA 2FMXA 3H7IA 4GUDA 2Q6IA 4XX0A 5K0ZA 1KDOA 2D5IA 5KTYA 1L7NA 5AVSA 1AU9A 4OGKA 5LMZA 2AOTA 5KWJA 1C1XA 4EKEA 1MH1A 1J20A 5EJ9A 1W88A 1M2EA 3HP1A 4FGUA 1XEWX 5A9RA 5FBRB 4RJ2A 1ZNYA 4PGHA 1ESMA 3DF7A 3H5LA 4BEBA 3DF9A 4C06A 4HMQA 4EQZA 4YS6A 4D8UA 3DMRA 1XTVA 4WK4B 5ULLA 1PV1A 2X8LA 4ZO6A 2V4UA 3RIYA 1DAFA 3SY8A 1MAHA 2LXNA 4FDVA 3RRXA 1Z6XA 3KVOA 4KYTA 1XNHA 3JYQA 3K4QA 4B6EA 2V54A 1IZ0A 3I9JA 1BCSA 4F9TA 5JMPA 2QAJA 4IIJB 1G5IA 2G9NA 2WJAA 4X0EA 4C3UA 3SZGA 1YB1A 2QB5A 2ARKA 5TQJA 5B2FA 4Z49A 1LJ8A 3P7MA 3DS8A 5AVWA 3GX1A 1X3SA 3B36A 2XJ9A 5JEDA 3RSZA 3H18A 1QDEA 2ZT5A 4NPAA 4RYDA 1RQ7A 3MCAA 4QODA 1Z5OA 1KPGA 1C4KA 4ND8A 5H7XA 4BN0A 4RNCA 1R6AA 3UJCA 1YV9A 1HTWA 2PYZA 1W94A 1V7ZA 3HA3A 3EGVA 4DLRA 3CLKA 1Y8RB 2IOFK 3K09C 4AQ7A 1MENA 5LUBA 1E3WB 1V1MB 4DMUB 1GGVA 2WD7B 6Q21A 1CY7A 1CLUA 4XZ3A 1I0ZA 3V80A 1RHUA 1QHEA 1H22A 1DDIA 1FU4A 3K92A 5MF6A 4HV4A 1BN7A 1JLLB 4GXQA 5J5VA 1O6GA 2OXEA 2ZCUA 4UDYX 3KT3A 5J2UF 2H3EA 3DOCA 4RD1A 3HB9A 1WW3A 4FDUA 3VH3A 1EJ6A 1I7LA 1WVMA 5LYJA 1AGYA 1N6HA 3ZDAA 3EMVA 3UEOA 4EHAA 3UPTA 1PJQA 4Z2AA 3MQ2A 1MJGA 1X14A 4G8CA 4ZVLA 3ZWDA 1RKVA 5BPHA 5I48A 1D7OA 5JANA 1U2DC 3OECA 2OGZA 2W2QA 5IZ4A 2P5YA 4CF6A 3EZGA 2P5TB 1SXPA 1QPZA 3AUUA 1WCWA 3EXIB 3TF5A 1KQ3A 1M54A 2JHPA 3BK7A 3JQ7B 4C7JA 5CIYA 4R01A 5IM5A 5IT9A 2O8DB 4DCCA 3CLHA 1ACMA 1SKUA 3LF2A 4GZMA 4ADSG 1TVCA 2YYYA 1XK7A 2YFYA 2X9VA 2V0NA 4J94A 4N3BA 5FV7A 1L4YA 5HRCA 1M2VA 2ORVA 4PZAA 2YIDA 2RDMA 2Z6AA 3DPSA 1QGYA 3BHMA 3UXMA 4HLUC 3FPBA 2QJFA 3IEKA 3KR2A 4FN5A 2ZRIA 4I81A 1KKMA 2G3YA 4RVCA 1AGXA 1YE8A 4PCVA 1CZHA 3ZLBA 2BD0A 3GRKA 3L05A 3NETA 3COPA 1X1CA 1E4OA 1W19A 1AQNA 1DIOB 1SUDA 5J40A 4NHEA 4ZZ0A 1A8IA 2R47A 2OFOA 3FW1A 3VBEA 3BE8A 4E14A 1IAQA 1TMYA 5D3MA 1BFKA 2BFDB 3C5WP 4IDDA 5IVKA 2MDTA 4RK7A 4Q3BA 4RVUA 3VFDA 2PUDA 4EZBA 5G53C 2DPXA 3QVMA 4EI9A 2XB2A 4IP0A 1UPTA 3IAEA 5K3OA 1P75A 1D6JA 3ZG6A 4U7TB 4NENB 2VH2A 1O5OA 2PPVA 2A9OA 3HACA 3KLMX 2GSDA 4LK2A 3OPQA 3RHZA 3TX6A 4EHFA 3GFSA 1I3MA 3JR3A 1IHUA 4CYMA 4KQ6A 1TZKA 3A1TA 5AK4A 1EUQA 5FYDA 3DB1A 5J5CA 2R1TA 13PKA 1K86A 2VJDA 3AO0B 4MR9A 5INTA 1HDZA 2FQ1A 1UWCA 2WFLB 3K72B 3CUWA 4RH0A 4RM2A 2Z3ZA 3K9BA 2ZK7A 2LCFA 4PGMA 4KTVE 3WGHA 4JQOA 2K6GA 4HPWA 4B79A 3VNVA 1SIBE 2ZJZA 1CJUC 4HX9A 1QOQB 3K1JA 5BWLA 1E99A 4WACA 4XGRA 1ESZA 1XJQA 2W11A 4LXGA 4Y6GB 4ZQEA 4JJEA 5BVHA 2J9FB 4IS3A 1TJ3A 1LB1B 3W7VA 1NZDA 4F9GA 4BKQA 3RUFA 5DHPA 3O83A 3ANXA 5C53B 4EUHA 1PT5A 3ZUPA 1N2ZA 1QIFA 2FSVA 2Y71A 3C4JA 5JRDS 2CFOA 4IQFA 3B1WA 1NJ8A 4I6GA 3PZBA 3ZV7A 3LUCA 3UAYA 4FZVA 2WZQA 4OHXA 2I71A 3L0BA 3DQPA 4TTAA 3X2SA 2YXDA 3I2GA 4GS5A 3L9XA 5KYXB 1OX5A 3V97A 4G09A 3SK0A 3AP2A 5BN1A 4E1AA 4ZALA 3CN9A 4B4KA 2QL9A 1EZ4A 3FR7A 3I23A 2LUOA 1TFUA 2HXSA 3JVDA 4CCYA 2C58A 2ET6A 3ZWOA 1HQDA 2IE8A 2P4UA 4MKFA 4MW6A 4LG1A 2EFCB 4OI1A 3W2IA 4UAGA 5J2TA 1ZK1A 2ZT7A 3E3LA 3A2KA 4CQMD 3GRPA 2O2DA 4GRAA 4MW5A 5L3RA 2XBUA 1VSTA 1TAGA 4W9NC 3M6MD 3EUAA 1A8QA 3RV3A 2D5AA 4EFLA 3FTDA 4GM4A 4EEKA 2FV8A 2P2YA 3KJZA 3MWEA 4Y6QA 5DGXA 4AIIA 1DDOA 5ALLA 1E2IA 3JTMA 5J3JA 1GNSA 1JHOA 2M1ZA 4UOQA 1U8ZA 2GD2A 4I55B 3IE1A 2HMYB 2AYZA 1XHLA 2O1XA 1E3LA 3QLVA 4DMMA 4DV7B 1UL1X 3KEGA 2AXQA 2PVSA 4WN9A 1O0CA 4NVRA 2PHZA 1J06A 4CODB 1RPNA 5GIOE 3DKPA 4F9FA 3PX2A 3GQBB 3U31A 1XAHA 2K7ZA 5A9SA 4KFUA 4E4TA 4B81A 1C1DB 1V8OA 4URWR 3PX7A 4DWJA 4J2OA 1POWA 4Z4EA 2OBYA 1TZ2A 5A4MS 3QMPA 2ODPA 4MAAA 3EAQA 3EX7C 1U2GA 5E3JA 3QLUA 2NADA 3QPAA 2KE5A 3V3KA 3J7AC 1CFJA 2HQOA 1O57A 4BVJA 3OZRA 1J6UA 2QTVB 2Q6KA 3F9IA 3GI1A 2IU4A 3DLCA 1EP1B 2H2GA 2WJHA 4Q3AA 4RTLA 1CUCA 1CUIA 5C3UA 5JNRA 5A2QA 1Z7BA 1UUFA 3DYBA 2ID8A 5K4HA 5JCXA 4JASB 1J09A 1GA1A 5DYNA 1G2IA 3T7IA 4A4DA 1X1SA 2F62A 2YWRA 3HKEB 4HK4A 4YEDA 4B43A 3I61A 3L1JA 2VDPB 4RAQA 3GGPA 3OBIA 1LBHA 5EFZA 4XX0B 1EGHA 2BEJA 4FFNA 1U0HC 3R74A 4BRWA 2OZPA 1SHTX 3HSSA 2X5KO 4TWBA 4RTQA 2AOTB 1T2CA 5DLPA 1G8YA 1C1XB 1DQZA 4NJEA 5JO0A 3C6MA 1GUDA 1SZDA 3H0KA 4A92A 4OA5A 4BYMA 1X1DA 1MC1A 1TZBA 4UOEA 4N0DA 3KK0A 1TJPB 1MVNA 4KN8A 4DQVA 1IWOA 1UP6A 2J3QA 2P6NA 2P7IA 3OLZA 4J0QA 4LCBA 3NCHA 2C4WA 3KWLA 5EEHA 2VRBA 2BGNA 1Z83A 1QAMA 2VT7A 4XLLA 4QJIA 3QBEA 1FW6A 2E1RA 3QTBA 3H8WA 4WBXC 5CEEA 3PRKE 3QXXA 3SN6A 3UBTA 4RENA 2HJVA 3TNLA 1T8YA 4XOUA 1DQNA 3ZDEA 5CH5A 4XJTA 1BCSB 2LCIA 3CW9A 3PUHA 4ICIA 4CMKA 1AHPA 1W44A 1PWZA 4TYPA 4R9RA 3L5KA 3NUQA 4W5NA 2E4ZA 1LPOA 1Z4PX 1O96A 4PQEA 2W9XA 4KN6A 4WJLA 1S9DA 2JK0A 4PWZA 1SUAA 2EW8A 4QAJA 3WQBA 3OE7A 3BF7A 1YT5A 3NHAA 4IDCA 4JBIA 3R9IA 4MQFA 4ON9A 4K6HA 3T7AA 2G4VA 2JI8A 2Q8PA 2XGOA 3N70A 4TTQA 4UCWA 3VBCA 3DO8A 3UT5A 1QDLB 4ZQBA 2B8TA 2WUDA 4TTRA 5EJAA 4BQPA 2MYNA 3OM1A 1OI4A 4RPLA 3U9LA 3ZYZA 3F2IA 3BH0A 2OG1A 3LTNC 3EPRA 4LFAB 3DM5A 2JFYA 4OXXA 4UCQA 1G3IA 1IUPA 1T10A 3A6FA 3QWIA 5M7EA 4R84A 4CIWA 1NUHA 5BXYA 3SIPA 3HO1A 3AF3A 1ANKA 2GMWA 3MJFA 3HUTA 4RYLA 3FWZA 3BMOA 4CKCA 4FYVA 1KZ9A 3C24A 4FW9A 5J43A 5KWEA 2EQ5A 3NOOA 1S2IA 2E18A 3PC2A 1NLYA 3A1FA 3NDJA 2ZIFA 3OJLA 4I2NA 4IHQA 5KAMA 1GDHA 3CRW1 5IHXA 2DY0A 1SY7A 2AOVA 2QM3A 5LYJB 2EF0A 2R5NA 4CLRA 4AJ1A 3LYHA 3WDLA 3WAKA 4B4OA 4EMUA 5KJ1A 3Q1KA 1DCMA 5K6AC 1PV4A 3BGSA 4Z4HA 4BGDA 1MA0A 3VOBA 4R2JA 3TEFA 2HRQA 4A9AA 4K9MA 2HQBA 4EO9A 3HCNA 3VU9B 3QJ5A 4BFVA 1C9NA 1SELA 4GKBA 1VCHA 1RM3A 3FUVA 4FINA 4QDOA 4TOIA 5JAUA 5AKXA 4DUPA 1PR4A 4LAFA 4DLVA 2IEIA 2BZGA 5JMWA 1YRHA 4F2GA 2BFEA 4LSWA 2JH8A 1E6CA 1YB6A 3G5LA 4DJFC 3KVYA 2D1SA 3PPYA 4XD7A 1M2VB 3ONFA 4KG7A 1KDRA 5A7GA 1EE1A 4P98A 1N3LA 2VT3A 3CONA 2WSBA 4MI3A 3IPLA 3FUUA 3UT6A 1ZR2A 3N2KA 4HWOA 1VSVA 2DWCA 4KDRA 1HLFA 4MV9A 3OQ1A 1BX0A 4H59A 5CH3A 5EHQA 4JLSA 4KGXA 1EJ2A 4PC1A 2HPVA 1V8BA 3LBHA 5DN9A 5HJ7A 3RVSA 1WTAA 3D4PA 2TYSB 4ZOQI 3EQ7A 4HNVA 3S8YA 3SSOA 2H1IA 3DPIA 1CUXA 3IDQA 5TMPA 2CZGA 4LXUA 4QQFA 5MDHA 1JEQA 4BE9A 5KNBD 2RHGB 2XB8A 3AR6A 5D3MB 5EP3A 5KJEA 4QG3A 4C3VA 2W6QA 4K6OA 5HZMA 5CM9C 3EXAA 3QKTA 1GSAA 2WWTA 3CZAA 2VJAA 3IVAA 2QZJA 3E4CA 3MWDA 4UU7A 3KZVA 1J8YF 3P2JA 4MX8A 3P5BA 5TQ0A 1KVUA 1Z68A 2DKFA 3DXZA 2G25A 4TXHA 3D7RA 2C77A 3RIXA 1NXTA 4AECA 5FBKA 3ZDZB 1CBUA 4HX5A 2QR5A 2CBZA 3BQ9A 4D74A 1G3RA 1N2XA 2JHAA 2BAGA 3K9LA 4KCGA 2ZUFA 3CX3A 2DLNA 1BH6A 1O95C 1QH1A 3EHDA 4NU0A 4O6VA 5K1ZA 1A9RA 4YJKA 2BZ1A 5REQA 5C37A 3VOAA 3R7AA 4BLWA 4PEVA 4OL0A 1A5BB 3FPJA 5CLLA 1E1CB 1UT8A 1BE0A 3EW9A 3D2BA 4LRWA 1JG6A 4KQHA 1TU3A 4EY7A 4CLRB 2K87A 1N5IA 2NU9A 4KV7A 2N3ZA 3SC2A 5CVJA 2BBTA 4PAMA 2ZI4A 4PG6A 5EIXA 4MPTA 4XFJA 1P60A 3BGDA 5BSUA 4U5QA 4CEJA 4IVNA 1PFWA 1Z4NA 1OGYA 3HS3A 2IITA 3AHIA 4RJTA 1TF2A 7YASA 3WX0A 5L3QA 1I36A 1I2ZA 3VPHA 4XWWA 2QXUA 2XAUA 4RLHA 3T5PA 3WGMA 4FFBB 1DC8A 4CQJA 2IS2A 1NBMD 1PDOA 1CZNA 2AXEA 1SKQA 2QM8A 5BYKA 1Z47A 4CIDA 3HJFA 1GKKA 1QOZA 4LDNA 1I1OA 1R0XA 3X44A 2A94A 5EJ5A 4QFMA 1ZVJA 5IEBA 1RKUA 5E7QA 2NZYA 2BCJQ 3SYKA 2C2WA 4AY2A 4HS9A 3UMBA 1VCNA 1A8HA 1NQOA 3WXBA 4AZTA 3SZUA 3NB0A 3UT0A 4DIEA 1Q21A 1HFWA 3HP7A 1C0IA 1Y37A 3NM6B 4MZDA 4X6YA 4A23A 3EZXA 2HBRA 2OFXA 3C3YA 2NTVA 2WKRA 4BO5A 1XJCA 3JD2A 4J91A 4CG3A 5J2TB 3DUFA 3EVAA 3JQAA 4I3GA 3CVJA 3QX9A 4EW3A 1AA6A 1ZOOA 3M4NA 1XQ1A 1ZMBA 1ZPDA 1F9AA 1GYRA 3ORYA 1U65A 2QSJA 5DU2A 3MB5A 5THQA 3IQDB 4DYHA 1G5HA 4AMZA 3OOSA 4NYIQ 2XVYA 3MWEB 3VSCA 5AMXA 2HA5A 1CR2A 1X8KA 3GNSA 4J7AA 3NJ8A 4QDUA 4U3JB 2EDCA 1Z16A 4NFSA 2PJDA 1NBME 3C3MA 4LVOA 2R4QA 1RVV1 3LSTA 4ZARA 4YN3A 4YV1A 3RU7A 1N36B 3W5SA 1ML3A 1N34B 5B58C 4JCCA 1YTLA 1GZSA 3AETA 4FFMA 4DC1A 4IZOA 1N6IA 3GCZA 2XSZD 5TF0A 3ZWAA 4LGMA 1DQPA 2VJPA 3U09A 3GJZA 1Q50A 2DQ4A 3EYAA 5CCBA 2RI6A 3KL2A 5G0SA 4DLXA 4ER3A 2JA1A 1R6BX 1XF9A 3ZI4A 5IKPA 1U9ZA 5H3LA 3CVUA 3HR8A 1X80A 5IJ0A 1RAEA 1Q0PA 4FUTA 2UXBB 3QVKA 1KXJA 4KQMA 5A02A 1NQVA 1XE3A 1X8JA 4QBGB 2ZT8A 3C7CB 1MTZA 2J5BA 4AFNA 5JSFA 4KODA 1EM6A 2XNHA 5AT1A 3O6VA 1IC6A 1S2DA 3VVBA 4OG2A 1P4RA 3QV2A 2ETVA 3DVSX 2Q1SA 3L82B 3VYWA 4ZOLA 4AZ0A 4YMSA 1I14A 2Q0XA 1I51A 3AKDA 5A4AA 7ABPA 2JASA 2CF6A 1Q1QA 4AXBA 2C59A 3N8HA 4GZ5A 1KETA 3LVQE 2RGGA 3SFVA 5JATA 1IXYA 3OIGA 1GEGA 3W8RA 4ITUA 5KHOC 3HFSA 3L8ZA 2LCQA 1NPTO 4D57A 1Q14A 1NJSA 4KI0A 1AZTA 1GKIA 4EEXA 5HYVA 1JKIA 4MS3A 4K28A 3ZNOA 1LWNA 2HF7A 2XVZA 1QQTA 4NJEB 4LKOA 2Q28A 4C03A 2PGLA 3F2VA 4O5OA 3U44A 4C0JA 4LOIA 3WZ2A 4ABYA 2R87A 4RSGA 2DR2A 1JFSA 1V0JA 5KTKA 3IUSA 3FZEA 3EK2A 3QSGA 3AERB 5LC1A 3T7SA 4LY0A 4BATA 5JSZA 2QN3A 2ECOA 1GFIA 4IH4A 5EIWA 1YA6A 1BE8A 5T4HA 1N8KA 4UU1A 1JFRA 2CLMB 2M6KA 2VLIA 2OKGA 4R3WA 1T25A 2Z2XA 4XCXA 2A3NA 2Y1EA 2ZWOA 2R66A 2BLLA 3IHTA 5HOQA 1KPHA 3T3IA 3H11A 3R3ZA 1LGYA 3C16C 1O4WA 3L18A 3WLIA 3GJXC 3HG7A 3WK5A 4ZYVA 1EK5A 4W5RA 5D3ZA 1K2WA 4OLHA 5ENZA 4C29A 1Z0IA 5D8DA 1PG5A 1O96B 4UMDA 3I83A 1N9GB 1EWVA 2AEMA 4FXOA 4BU0A 6AT1A 3RBZA 3B5EA 5ALPA 2QP4A 3T1VA 3FOZA 1V11A 3I1IA 3FPHA 2ORYA 3NC4A 1IB0A 5F21A 3CISA 4RVFA 2XUJA 3BXHA 3WK8A 3ZU4A 5LIRA 5I9TA 1MGPA 5G3YA 5CB8A 3UT5B 2BFOA 4O8ZA 4BIIA 4TYWA 1XHFA 2V9ZA 1LPNA 2GEUA 3ETJA 4KAFA 5JFGA 4PYMA 3BWVA 4U2DA 3SAJA 4KX5A 1NL3A 2V0CA 3B9RA 2FGKA 2Q3HA 1GKLA 4J9VA 2FZ4A 2VC2B 4TUYA 5DGDA 2CJXA 3UHPA 1F8XA 1RE0A 1ZCAA 2PRZA 2R6JA 221PA 4R8VA 1E1QA 3WOHA 3GG2A 2J5XA 4IJKA 1B00A 4PBRA 1D6SA 3FNGA 4IS2A 4MGKR 3ZQUA 4JP8A 2FMKA 1W87A 1WQ3A 2GS9A 2ZRQA 2YN4A 1ZOIA 3P2IA 4P82A 4MRVA 4R9NA 5JC1A 3VUFA 4OIMA 3MPUA 5AOBA 2H5EA 2RGWA 3F5SA 4WPGA 1DG3A 3QVLA 4Q9LA 1B74A 2W71A 4J03A 4FYXA 3PCRB 3C6ZA 1B6GA 5BV0A 2ZE8A 1UZAA 3IEUA 4YRIA 3CLRD 1U7WA 3O92A 1SK8A 1SBTA 5C1BA 1AMNA 2BFEB 2NXCA 3GLQA 3COSA 4BWFB 1P8AA 4OKSA 2PT5A 1JDNA 1HUQA 1SOWA 4KO3S 4NSNA 3EZLA 2BJVA 1BQ4A 1VP3A 1XTIA 4OHOA 4FYPA 1OB2A 3QX3A 2YWBA 2DQYA 1YQDA 2PSJA 3K9HA 1ZVQA 3KSBC 4QX6A 5A05A 4IDQA 3TLCA 2FR8C 2YXNA 4JP3A 1FLVA 4Q47A 4LSMA 2K2WA 5IT0A 2DPYA 2B35A 2XWBF 1W76A 3E7PA 3GDFA 2XCSB 3UV7A 1ZL0A 1Y5LA 3K20A 4ZOLF 4LQ4A 4F1KA 4OX9B 3PICA 3DNPA 3S2EA 2OCGA 2B2NA 3UWOA 3FPGA 5CEFA 3UATA 3PFKA 5EVCA 3ETEA 5I4IA 4O3FA 1JEQB 4OJNA 4H18A 4DMCA 3SLGA 1E2FA 1E3TA 1RM0A 2VDMB 1OAOC 1SQ5A 2QRGA 5GAJA 1D0VA 2BHRA 1MJHA 2OBLA 1ES9A 3FWYA 3LVRE 2V55B 3IEIA 4GPTA 4OH1A 4DY6A 1EDDA 4K3VA 5T4BA 4NJMB 4ZCMA 3TG2A 5JS8A 4WGFA 3RIGA 3VKGA 1A88A 4UFNA 2ZS7A 1MHTA 3UZUA 3RHTA 4HBGA 3JQQA 5FBHA 1CSEE 5TQ0B 3GAAA 5IUJC 1JILA 2CVQA 3L41A 4GKVA 4JOQA 4ND6A 3VZPA 4B33A 1NXPA 1YDHA 3IXQA 3MSXA 5CBKA 3NWEA 4UAVA 4B3GA 1U8FO 1XTSA 2OE2A 3AI3A 3UH1A 4FIDA 2DX7A 4BNGA 1QH1B 1E2BA 1TM3E 4JI8B 2QJTA 4M7RA 4LJYA 5JJCA 2KWIA 3CJRA 5DHRA 5EJMA 3HL0A 1QUFA 1EUYA 1YD7A 1CUGA 3K35A 4JLJA 3VSAA 5JJIA 2D1RA 3D3WB 3WLTA 3KP1A 5EHXA 1ZONA 1TI7A 1ENPA 4FXPA 4KYIB 1KERA 2NU9B 3SC2B 5B3LA 2GXQA 4K9OA 2VPPA 4JLNA 1M1YE 3STVA 3TLKA 1CK4A 2VPZA 821PA 3HVHA 4KBYA 4CEJB 4HTFA 2X0NA 3MLAA 4Y30A 1XAGA 4DA0A 3KDPA 4M9ZA 1SQ0A 4NR0A 1BHQ1 1KK1A 1XWIA 1YRWA 3EISA 3LDUA 5L3QB 4BL5A 3HGQA 3PFGA 1RYHA 3B89A 1JMKC 5A5VA 2GZ2A 4D9GA 1OWNA 4G2NA 3II6X 4P4SA 3WYDA 3D0KA 4DCJA 4WX2B 4JODA 3JYLA 2EGHA 3R9WA 1IATA 1TKBA 2VHTA 3TB6A 1J9EA 2CFTA 4ZQCB 1GU1A 3TLYA 4D5GA 2EZ4A 3TXYA 3PA8A 4J8PA 5HQTA 1KH2A 1NIPA 3QOYA 4G1FA 4JJ7A 3CINA 2D59A 4PY2A 5LMUB 4BLRA 5LBTA 2WP8J 3V00A 4LIPD 1YZGA 1VL6A 4MINA 4HWTA 4FMCB 1T4BA 1RIFA 4TUYF 4RMJA 4KWCA 4ZV9A 2V4MA 3G17A 5KNBH 3GVIA 3DLBA 4DCUA 2FE1A 4NCNA 4WY5A 1W4BA 3G1WA 3T3HA 1L9KA 4UFOA 4ZU6X 4EPWA 2BGWA 5TEWA 1J49A 2L18A 4NPCA 1CZRA 4M87A 1DO2A 1OILA 5B4UA 4UHEA 3DUFB 3JQAB 3GLFB 2NMVA 2ZJBA 1YHNA 4TTPA 5CITA 2OUKA 2R60A 1GLNA 4ARBA 4G23A 1R37A 1GU7A 1VI2A 4H77A 1F1JA 1SQFA 2QQEA 4IDPA 2P2GA 4WZZA 3KUDA 1UAAA 4YP6A 4Q02A 1Z4LA 3AI2A 4FFWA 5CT8A 2LKDA 4BMPB 1G8MA 4GMHA 4OQLA 1NI4A 2XZDA 3PQDA 4A0HA 5JFOA 3FLAA 4G5GA 3GHYA 2NXEA 3C97A 1TLLA 1AT1A 3OLCX 3VAYA 3LT4A 4URUR 3LFTA 3NVDA 1QIHA 1RM5A 1M1NA 4HNGA 5LXTA 4UE2A 5DGIA 1N2JA 5BUZA 4B46A 5HW0A 1EFHA 4AN1A 4ENRA 2I2DA 4DIDA 5IARA 3T41A 1DKQA 1J0DA 1JDBB 1JR4A 3QG1A 2WDPA 3ITEA 2K2QB 2ZZKA 3IYLW 3QYFA 1VXRA 4LV6A 3G68A 2NACA 4PHFA 1MDBA 1PAUA 5FUWA 5AM2A 1V6AA 5TIIA 5IJ0B 2DFNA 4L7QA 2ZWMA 1GDTA 2XGJA 2IS6A 4U7FA 1WB6A 3ZBPA 5SY4A 4D8YA 1OZ0A 2JBAB 1PGNA 1KAMA 3LT1A 4GR9A 5EPOA 2FG5A 2E4AA 2VRWA 1JFTA 3TQFA 2AG1A 1TYAE 2G0NA 1KZ1A 4BUCA 2VJYA 2G40A 3FNIA 3HYTA 1M66A 1PYGA 5HEKA 1L7BA 4MV3A 4X91A 3DQZA 3UWMA 4AZ0B 4IXDA 1URPA 3RREA 2JZNA 3G8BA 2NVBA 2JCBA 3UW1A 3I01A 3OEHD 3RFFA 4MHSA 4RLSA 1T24A 4IFTA 1HDGO 2YFHA 3S8MA 4FHZA 3F74A 5CFZA 1Y48E 2HHAA 1O9HA 3H1TA 4FMDF 3S99A 1GTMA 3ZI0A 3U3XA 1FUUA 1HE8B 2FEKA 3CKYA 3PGXA 4MS3B 2DQSA 1O9BA 2OV8A 4JL8A 1I8TA 4QYIA 4EJMA 1F2UA 1ZOSA 2NM0A 2AUNA 5E1BA 4NMMA 1T6ZA 3VPXA 5JYBA 2JGAA 3HXQA 3WRXC 4PZCA 3JQGA 2FPIA 1P5ZB 1R5JA 2DE0X 3CEPB 1VJ1A 4L8WB 1SU4A 2B9VA 1CJCA 2ZB4A 1K7EB 1VLJA 1N1GA 1Q57A 1VRWA 4D0LB 3KZNA 1VG8A 3AINA 1ZD9A 2OHXA 1KI8A 1X39A 1E7SA 3JSXA 3RRNA 2GCEA 2GYVA 2IXBA 1P4GA 1YR8A 3PNSA 5L7TA 3KQMA 4P3XA 3IJEB 2BMAA 2KMLA 2W8BA 5IAJA 4G1EB 4ETNA 3OT1A 4P22A 4FFRA 5HM6A 4U2GA 1C4OA 1CNEA 3M4YA 1JEJA 3CMCO 1KH1A 5CLGA 5KNCD 4BFTA 1FE8A 5JXIA 3QVTA 3NYIA 4OHUA 4E21A 1E1LA 1TVEA 2JIZD 3SYMA 5C35A 1P9RA 3EPHA 4QAQA 3FTNA 4CKYA 1XEXA 1U9YA 2C9YA 2JAHA 4GW3A 2BCEA 3WLLA 2DY1A 1QGUA 4BRZA 4D99A 2RJOA 3BT7A 4C7OB 2Z43A 1IN1A 4FSXA 2DC1A 4P4NA 4JAVC 1V11B 3ZW9A 3FNFA 5IKMA 1R0BA 4JZKA 5DRYA 1C7QA 2NV6A 1O5TA 3B3QA 3LCRA 1VTKA 1ODTC 1TO1E 3T4EA 4Z4IA 1HQYE 2QWXA 4R2LA 4YUVA 1O94A 3EXG1 3MELA 2XCLA 3A0UA 4H3HB 5HKAA 3GC6A 3ZJ5A 5JG7A 3ZWBA 2H9YA 4ZCLA 4TN5A 4GFDA 5DNUA 4AS3A 2Z1DA 5CH8A 4B83A 3A1WA 3RC3A 2QN6A 1ZZGA 1P4JA 1VBNA 2Q2VA 2GHTA 4TTTS 1IAVA 3DYVA 4TUYB 4TL6A 2PMKA 3Q5DA 4JDUA 4EA9A 3HBMA 4L5IA 4UDXX 1SOMA 1JR2A 2PGJA 3LHIA 3KVRA 2Y1WA 1QONA 1UC8A 3M7IA 4PVDA 2HQ1A 3ZY6A 1RQGA 2VNJA 1I7SB 3TDKA 1MW8X 1HL3A 1D2MA 1ZQ1A 3PVZA 3TNFA 5KNDH 3AVPA 5DSXA 1UADA 4EY8A 7ADHA 3BEOA 5FOXA 2ZJ2A 4JJ8A 3S70A 3T0GA 1GL3A 4JX8A 3K1AA 1N6PA 4TTIA 3HM2A 3PCTA 2FFBA 4IF6A 4DJEC 1ORRA 1GUZA 2FX2A 4QJBA 5LXTF 5IBCA 3CA8A 5CAEB 4ZEMA 1WB9A 1EFRA 1Y33E 5LU8A 5B1IA 4IWNA 3HR4A 2FI1A 1M83A 1K4KA 2H4WA 4JK3A 4P38A 4UAUA 4HT3B 2V6GA 5AK0A 4M9SA 3PBKA 5FI3A 1ECJA 1GGMA 3HZZA 2Y1FA 4TS9A 3TAHA 4AJHA 1SVUA 2MSEB 3EGOA 2XQVA 4O4JA 4Y6RA 5G02A 2EW2A 1D1PA 5F76A 1H8ED 1FRVA 3OLVA 4R2KA 3DKKA 4WZAA 4E5YA 1NA5A 5BOSB 5HHTA 4E0BA 3D1LA 5FHRA 3LQ4A 2Z95A 2WWYA 1WQ1R 1TGVA 1K27A 1NDUA 4XGKA 4B4VA 1UK6A 3F7MA 4Y1GA 3PYMA 3BD8A 4GMKA 1J9GA 2ZUUA 3G0GA 1SXQA 2VDLB 3K0KA 3C0KA 3DO5A 4R0NA 1ADFA 2DWOA 1P0CA 1YASA 1PFQA 3OZXA 3EQZA 2CC2A 1H93A 1HYBA 1NN0A 1VC2A 3GDWA 5AKYA 3RU3A 1MT3A 2FEAA 3DWIA 5DGTA 5LMCA 2A4MA 1VYTA 2E9SA 2NYRA 3EOBI 2JGMA 2DTEA 4JJIA 2E5FA 1GNRA 1XKLA 3EULA 3L4SO 4O3MA 1LJLA 1NQ5A 2LRHA 3F5QA 4J3JA 3UWDA 1GGFA 1I3CA 1PE0A 4CV1A 4DBVO 1PQWA 1Z0JA 1A9XA 2OAP1 3DOJA 3MTJA 2PQ2A 4JYCA 1ZI8A 4EKYA 2LV8A 1JQ5A 1QFYA 1EGAA 2XUIA 3PFFA 1H0KA 2PGIA 4UZFA 3C3BA 1P45A 5FORA 2G76A 4J07A 1GADO 1LLDA 2C92A 1OLOA 2ICAA 1N6NA 3GLHE 1TIKA 1DBRA 4OKNA 1W85A 1AD2A 4M0CA 4JOCA 4JP1A 1E4YA 4IXMA 2F8SA 3IMKA 2QX7A 1XVVA 3CG4A 3O8OA 4BB5A 1KYQA 2NTYC 2Y8EA 5EMLA 9ATCA 1GZ7A 2P0AA 3W6ZA 3UJNA 4EX6A 3WK4A 2R86A 4FU0A 3WB1A 1CHDA 3EXG2 1XEWY 3OZEA 2Z98A 3GFQA 1K66A 3JZAA 3UOWA 2CYBA 3D6TB 2JGIA 4HTFB 4AY4A 5L9AA 1P61B 3KQHA 2C5SA 4KFRA 2PT7A 2QLLA 1VLZA 4TMZA 3RKUA 5JVDF 2P4QA 2RJNA 1CZKA 1E6WA 1RYMA 3ND8A 2WZDA 3DULA 3P2EA 3GARA 3WL8A 3M2PA 1H2FA 4LXQA 5LBIA 4HGRA 3WYAA 3UGKA 4P4SB 4EABA 4PBSA 1J90A 1RLMA 4OM8A 4AN0A 4X8LA 3D8TA 3LT0A 1N9KA 3LUFA 4JZYA 2CJPA 3CT6A 2EQAA 3MERA 1IUKA 2I80A 3WGIA 4DA7A 1CR1A 2YTZA 3AYZB 2HCBA 2I3AA 4IGEA 4LY6A 2H4ZA 2V6JA 4NARA 3KOZA 2DG2A 2PUHA 5FF9A 4BNXA 1PEKE 5FUMA 2OVFA 5J63A 1NLUA 3MUNA 3QU4A 4P92A 1T26A 3KQWA 3JPYA 2J6IA 4DLLA 1EXVA 1TJNA 4X94A 4FE3A 3JQ6A 1B76A 3KCNA 4AY3A 1XRJA 1IZYA 3K70D 2YY5A 5D87A 3LXUX 1J9ZA 3Q7TA 1QYIA 1SBNE 2DBRA 4DWWA 2AZTA 3N7AA 1BG6A 3ULKA 4E5NA 5FI0B 1Z33A 3LKVA 3PRYA 3RBXA 2RKBA 3SR4A 1FTYA 3KLPX 1VZ2A 1PTJA 1EHIA 1EGQA 3GFBA 4P5PA 4QO8A 1JTFA 1BWSA 2GZ3A 1WZNA 1YB4A 3E3AA 2B36A 3ETCA 1NI4B 3SS8A 4OB8A 3WFZA 5GMOA 1EX1A 4IYRA 2GHRA 3WLEA 1JIXA 1M73E 1WOYA 3N3AC 3R7WB 2QN7A 4INZA 3TYXA 1OV4A 5K8CA 1VP9A 1M1NB 4KI7A 2RIPA 1FDSA 3NXKA 1R6XA 4DMRA 3C6KA 4KFSA 4DNPA 2R5WA 2AFIE 4QYTA 2NVUA 3HYRA 4O4JF 1KDVA 1U31A 5DHSA 5B6IA 2F8TA 5ARDA 2DJIA 5I7RA 2ZZMA 2CBGA 3LS2A 1E9SA 1ADGA 1QFMA 1H66A 5CJJA 3VTKA 4BECA 3F7NA 4ARAA 4HYTA 2X77A 4IOLA 4I4IA 3IEPA 4C2AA 4X00A 2GM9A 3VDQA 1EA7A 1S7GA 4IIYA 1PFKA 2J85A 4FOPA 3RE1A 4EYSA 4EFDA 1MAVA 1MEJA 1EUCA 4K3UA 3UG6A 1UXOA 4D9MA 3QMMA 3L0IB 4KLCA 2V3WA 3WO0A 3CH5A 1KZ4A 2Q2QA 2VPXA 4OQNA 5YASA 3MWKA 4ZQIA 2V7GA 4R2HA 3EH2A 4HR7A 5HFAA 1AK9A 1VE9A 1MRSA 2PGAA 4ZZ1A 3WYEA 3MCWA 1IY1A 4WVFA 1APBA 1I5OA 5IDYA 4XH9B 3ER6A 2E5LB 1Z2DA 3LNCA 3EVTA 4WNAB 5IC6A 1NU6A 1QIGA 5HRAA 1EH5A 2JIQA 4GRIA 4A7PA 1Z5UA 1EBFA 1RWOA 3HPRA 2EP7A 2B2CA 2G9ZA 4WMLA 3JQGB 3MJTA 5CB4B 1QQBA 1RRPA 1VRCA 2Q0QA 5E2IA 521PA 3RYCA 2NAPA 3B53X 1PYDA 2YZ2A 3GJ3A 4I9FA 1DLIA 3QX7A 2IPNA 4IEIA 3IC5A 1HFEL 1XD9A 1RBMA 1Y3AA 3K94A 1CZUA 3JQBC 3N2ZB 4R1TA 4C1BA 5BN3A 5CFLA 2WKWA 4AJOA 4RMIA 4NP6A 2FPMA 4CMGA 5AJHA 1AZWA 1XU4A 2CZQA 4QOIA 1K8QA 1NDQA 4OKIA 5HE8A 5U4XA 1IBCA 1OROA 3TQCA 5M3BA 4R1UA 4OHPA 5DBGA 4I1VA 2W8BB 5B4VA 1W1IA 1IJKA 4N54A 1UMBB 3OT1B 2VEOA 3Q7PA 1V1RA 3LTEA 5BW4A 4JR2A 2R1VA 4UEOA 3PD7A 4L8FA 4CHTA 3HK2A 5FO0A 1NBOA 4H7DA 3M1IA 1XEXB 1KEUA 2RBGA 3UUFA 4MUNA 1DSSG 1DXYA 1QGUB 2DFLA 2J0UA 4TT3D 4AVYA 2B98A 3NANA 3RVLA 5GJBA 2I33A 1B41A 2Y77A 4OQYA 1YZHA 3V1YA 4Q4HB 3OQIA 3PIIA 3D6AA 5PNTA 3TB4A 4CMHA 2BTEA 2WJVA 1KEKA 1H0RA 3T3GA 3GLTA 3O1IC 3U4GA 4AJEA 1GCIA 4YMTA 3S1LA 5HP4A 5CIWA 1V9LA 1G2QA 3EQ6A 5F73A 3STXA 1KYWA 2CXNA 5EL0A 2AKYA 3Q98A 4P3OA 4XUGB 1QVAA 2GK3A 2W6JA 4B31A 5JYDA 2CUKA 3ILHA 3UAGA 5HS6A 4B3HA 4EB0A 1E2UA 3WP1B 1Q20A 1RYDA 4WNYA 2C9OA 3D6VA 3WGQA 5LWQA 4FOTA 1NJFA 1DADA 4RCYA 2QW8A 1EAYA 2B5VA 1U8UA 4WCFA 4P32A 2PX3A 4KPUB 4R1NA 4A8JB 2ODAA 3HCOA 4JC4A 2Z08A 4RVDA 5LPNA 2UUCB 1R8JA 2BFNA 3BCRA 1USIA 3N05A 2XTJA 2D2EA 3B2QA 3G1TA 4I8XA 5G0UA 3B38A 5BQOA 4AKHA 4TYYA 3CLSD 1XVLA 1ESEA 3V9AA 4AF6A 3ZV3A 5E6UB 4YQEA 1Y6FA 2Y4OA 3HB5X 4RA9B 1J8VA 3OU7A 3SU8A 1O58A 1XZDA 3PC3A 5F5XA 4DGSA 2V5AA 3CMMA 1YVPA 3EEBA 2LTAA 4WXHA 4JT9A 2NSHA 3FF4A 3EODA 2PEYA 3IDOA 1R50A 5BMVA 3GZTB 5KNCH 2QNRA 3DDCA 1UH5A 3LCJA 3AEQA 4ZVRA 4BBAA 1N1MA 2PH1A 3C4QA 5AOAA 2I34A 1AOXA 2WKPA 3T7DA 4XFKA 3QGMA 4E09A 4OUDA 3OKCA 2CNKA 3H8VA 2P9ZA 5AXDA 5IU6A 5ARBA 2ZXUA 1TYEB 5LKAA 2AH5A 1BKYA 2VHXA 3EVFA 4KU4A 3Q12A 4X1KA 5IAEA 5ITVA 1YQXA 2CDNA 2IGTA 2QGNA 3PL1A 1DAGA 1O9GA 5K03A 2O4UX 4J1QA 1JPJA 4UC0A 1WNTA 1T5IA 1KC3A 4PYIA 4E2FA 1PF7E 4ROTA 1OF1A 3OH8A 1R00A 4MVCA 3UOAB 3ZQ4A 2AG8A 2BUBA 3E0XA 2GOYA 1F2VA 1QRAA 1ZWLA 3DT8A 3ITNA 4HY3A 3QJGA 4RF4A 4EPTA 4KAJA 1XVAA 4KXMA 5K6RA 4Q0MA 3UENA 2ERCA 4E2ZA 1XZLA 4C0AC 1NBIA 1OREA 3A6JA 3T94A 4D4MA 4QARA 3D1JA 4D3SA 2RCNA 5NULA 1TTTA 2EKBA 4OMUA 1XX6A 1JEAA 1ONPA 2WWIA 1A9XB 2ZB7A 3B1VA 3PD1A 4JJ4A 4OD0A 3TECE 1RXYA 3R4VA 1IPHA 3RTEA 1VL2A 4HGOA 3BRWD 3VX4A 1ZD3A 1CUEA 1UWVA 2BM8A 2F3PA 2GK4A 2RHOA 3G6KA 2NTEA 4K5QA 3HJHA 4LJSA 2FH5B 1L4EA 1T13A 2GM5A 2IXGA 1NBHA 3IR7A 4LYGA 1HH4A 4TSFD 4Z3DA 3I9NA 1NRXA 4ND7A 2B2XA 2YUTA 4Q34A 5ILGA 1U3UA 1W85B 3A1DA 1UC4B 1TO2E 2BR5A 4IQ8A 1TRHA 4ZAXA 4BX9A 3O8OB 2FZ5A 4KVAA 1M2WA 4UAJA 1Z26A 5JCZA 4IHJA 4RTSA 4LJ7A 2B7CA 4ZCQA 2IHJA 4HLQB 2RHCA 3ENWA 3H87A 4FFLA 1A72A 3T3PB 1EVLA 3NIFB 2ERYA 1KIFA 2HA6A 4OLAA 2H2DA 1N2HA 2EP8A 1PS9A 3OCWA 1NNI1 2FEXA 2R79A 4RHTA 3ZWWA 1CV2A 4MH0R 2BONA 1UT6A 2AG5A 2HIAA 2C3YA 2OMKA 3KJHA 4MPRA 3WL4A 4E13A 2QSUA 5CUQA 4YVFA 1CQWA 3T61A 1DEHA 5TGZA 1BE6A 1AMOA 1UPAA 5DI9A 5T8KA 4YRFA 4CM6A 1WD5A 1RXSA 1U4SA 4D6PA 2IV2X 1KNXA 2CHVA 1XQXA 4X1YA 2ZYGA 3VYUB 4PLTA 5JHHB 3ICQB 3GU3A 1Q1AA 3W3AA 2WILA 3IOMA 2DR3A 2YMLA 3N74A 2IE0A 3K30A 2Q4DA 5MHTA 4P5DA 1TQ4A 2CGEA 2WI8A 5E2BA 2BBSA 4OBXA 3ZS8A 4YAFA 4FS3A 2B6NA 2OO7A 2PMBA 1SR8A 5C81A 2CXPA 1WSAA 2F2TA 1UAGA 4QPDA 4TKVA 1JAXA 3LECA 3BWDD 1LF0A 5H9WA 4RD0A 5DZSA 1D1SA 3G89A 3GRCA 2PCLA 2ZKIA 3PUKA 4OO3A 5EMNA 5KINB 1PK8A 4KXNA 1IPEA 1QYXA 4B3BA 2XCTB 1IZ8A 1FL9A 4U7GA 4MHOA 4GMXA 4TMXA 2A57A 2DQKA 2EV9A 4LZJA 4DRZA 2OHVA 5GVSA 2V5UA 5KKNB 3CTMA 3O4IA 2EFGA 4AMGA 3DEJA 5I8WA 3DV0A 3KYIB 3PXUA 2FPWA 5NLLA 1U2PA 2FSHA 2REXB 3K15A 1HURA 2DH5A 3GHHA 2NLOA 1WB4A 3DONA 4MQBA 4I1SA 1C9JA 4X7MA 5LQRA 4F3TA 2ECPA 1KQOA 3BM5A 2G77B 1NN5A 1BKSB 4RC9A 3GJSA 1XLTA 1ORTA 5K0SA 3C3JA 3EZ7A 5KTSA 4KIWA 1Y1TA 1BA3A 1NMXA 4LMRA 4RD4A 5E4JA 2X2FA 3ZU2A 4DQXA 4Z3KA 5KZMB 4EVQA 1V7PC 2I6UA 4S2UA 2WHRA 2XWJI 3IAUA 5JXJA 1PNRA 1GSIA 1C14A 4ZC8A 1L4NA 1W36D 3KB8A 5GVRA 5TMBA 2A30A 4DQ0A 1JXMA 3B13B 3ILSA 3O3NB 4RADA 4M89A 3B1FA 1G17A 5ICMA 2WF7A 3DFIA 4WADA 1ETHA 1LSSA 4CMAA 4P0QB 3CFYA 3AX6A 1Y5RA 1E89A 4JQCA 3T3MB 3OP4A 2NYVA 1QE5A 3QP9A 4PIPA 3OFVA 5K09A 2QV7A 5T5QA 2QDKA 3G0IA 4NV1A 5SYNA 5AVTA 1Z4JA 5EP1A 5MFZA 3NRBA 4NBTA 1KKUA 1ZCJA 1P7ZA 5C9ZA 1XMQB 2PLRA 4QPPA 2CFIA 4QFBA 4TL7A 4YUYA 5FL7D 1EE9A 2WC1A 3FOCA 4JHLA 4LK3A 3JAMA 4RJJA 4EPYA 4JI4B 2C2BA 4P4TA 5EE3A 3ONDA 1COWA 4RKEA 5HUQA 3VR4D 4QULA 1BGWA 1ADCA 1J07A 3I42A 3RYCB 3F98A 1QC5B 2FPLA 1GZ4A 2R8RA 3WIUA 2PM8A 4UEWA 1YZTA 4PONA 2VOEA 2YXLA 3Q8XB 3TZLA 5BN3B 1XKQA 4DAEA 1G19A 2Y93A 3BC1A 2HNBA 3DG9A 1VB3A 3K5HA 2R3SA 3M0EA 2ZYHA 1JHPA 1UDBA 1IQRA 2I29A 3H9JA 4IHJF 5F4ZA 3PS9A 2VFAA 1BU5A 4M54A 3B1YA 5KUTA 3K6KA 4Q1VA 3ZGYA 2C61A 2BSAA 2OESA 1I4DD 1XZPA 3B3FA 1P0PA 2PRJA 3BIOA 3U4IA 4QNNA 1V1RB 1H1LA 5B58T 1TB4A 3P0HA 2YCBA 4YMGA 5C18A 5FUBA 2GPWA 1WP9A 1XBTA 2P9EA 2DUMA 3SQMA 3QKSA 1RI2A 1UBUS 1IWBB 1E63A 4QXAA 4FZ3A 4MS4B 1Z88A 3PHHA 3PJDA 2GFHA 4OX9Y 1DXHA 1RAAA 4HH1A 3FHCB 4RK5A 3THXB 4X7BA 1SA0A 3PI6A 1TRKA 3OQIB 2ADMA 4IVRA 4KQJA 1CQJB 4IDGA 1EGMB 4U39A 3RC7A 1J5EB 2O59A 1IE3A 3DQQA 3AHDA 1ORDA 3A4NA 4PHTA 3BCSA 1Y7LA 3MBIA 3P9SA 3GB9A 5DKFA 2W7TA 4JT4A 4M99A 2AK3A 2V7VA 1OZAA 1YR3A 5I7UA 2F55A 3M6LA 3K73O 2H4YA 4W63A 4Y9DA 2O19A 3KZKA 1NP6A 4G5FA 2XMCA 1VJDA 2QVCA 1ECPA 2IU3A 2W37A 4KJZA 1KARA 4KV9A 3R7FA 4J76A 1EUZA 3BFKA 3OIDA 1RPZA 4BQOA 2H8KA 1DC6A 1E2MA 3ETLA 3FYUA 3DDSA 4EBFA 1MD9A 3G9XA 2FSSA 2ATEA 2QPLA 2XZLA 4O0LA 3ICPA 4YRBA 1WHSB 2I99A 1CHNA 2JD1A 1AY0A 1YKSA 4PLGA 4WCFB 5D86A 3M6VA 1I2AA 4FZ5A 2ZRNA 1WZIA 1YONA 1UK8A 4CNQA 7REQA 1VPLA 2FCRA 2JS7A 4FGWA 4G01B 4M0DA 4XI9A 4ZI7A 3IALA 5JZ9A 1V3UA 1U0SY 3DAFA 3ROGA 5M34A 3BL6A 1X7HA 1ZYUA 2F43A 3GBPA 3I9FA 4PPFA 4TRNA 1IM8A 2M1XA 4U7WA 4BO0A 4Q21A 4D4HA 5AW4A 3IIKA 4B48A 3N5KA 1DOAA 1UBMS 2IDMA 2QTMA 2YV5A 4ND3A 4NOKA 1CR6A 1H0HA 1UMDA 2JFVA 2AB0A 3C8ZA 3DBLB 1ZM2A 2F9FA 4JUIA 4DJAA 3PDIB 5TLSA 1ZRMA 2J4CA 5EESA 1EP2B 3T99A 3TD6A 4AT1A 5BMVB 1QFZA 3ABZA 1QIKA 2JLYA 3AEQB 5IAKA 4YAKA 4IPTA 2WJ4A 3INRA 4MV5A 2C9BA 5EE9A 5T6BA 1TF5A 3O84A 5G4KB 3WIBA 2VUTA 2C0PA 4IIBA 1QGAA 4LE2A 2CK3D 5L40A 3NBXX 2XA9A 2HRRA 1KZHA 1H6DA 1L4KA 4X1KB 3CZPA 3TQQA 3MINB 2GRJA 2NWQA 3PHIA 2H2WA 5HFNA 4BS9A 4UJ3A 4EG4A 1OASA 1FRNA 4HFRA 2D1FA 4BKOA 1DIAA 1TTPB 2G88A 1GGJA 3CZMA 5FA8A 2NYUA 3GW8A 3SJCA 5C5DA 3GJRA 2I78A 3R1IA 3G79A 2XRZA 4XPIB 4P81A 2X9LA 1KI7A 1LU9A 3O93A 4QUHA 1M8JA 1T9GS 2PKXA 4RH3A 5AJUA 5U1PA 1MXFA 5CBPA 2ZAOA 3E48A 4XWYA 3DOIA 4C6SA 3UAZA 3H4MA 5FKJA 3ZTTA 1N92A 3GCDA 4B34A 3OPYA 4AICA 5JT1A 1EVZA 1GRRA 2HEGA 2VATA 2R00A 1Q0SA 2COEA 3QX8A 4Q1EA 1R64A 4ZEVA 2DHCA 1A2QA 2AKAB 4TV8F 4PRKA 1JDBC 2NYAA 4MTCA 1G6OA 1NN3A 1WXFA 1T1GA 3HYLA 3TPFA 3P9QA 1UJ5A 5IG2A 3LHKA 5PGMA 1AG9A 2PLFA 4FGZA 4QWWA 4WD3A 4HZGA 1CD5A 5DNCA 4PRYA 1IBSA 2QT9A 4MQEA 4E6EA 1AIPA 1SVIA 1F12A 3L7JA 4YT4A 1JECA 4HAXA 3L07A 2C1EA 4LRYA 2FP4A 4W8OA 3WLKX 4XVCA 5BSWA 1Y8ZA 1ZM3A 4CMEA 3VPSA 3RPEA 2YWCA 4EUNA 2HLDD 2IS1A 1NW7A 1U4OA 3LQ1A 1WJGA 3IA7A 5JBQA 5LXTB 2NZ2A 3I0NA 3QWHA 4FMPA 3LUKA 4QGHA 2OZKA 3OQ6A 1RQPA 2G28A 1ZRSA 2JFGA 4URHA 4EMBA 1EWTA 1GRQA 2PZGA 4YP9A 4QRIA 2GN9A 1FTWA 3T9EA 3THOA 1RKQA 4ZVQA 2PS3A 5ALTA 2ZJ5A 4REQA 4QQ8A 4ZCIA 2XKKA 3VO2A 1RPAA 4R1QA 2AZ4A 1XJ0A 2QLJA 1AUQA 3OPYI 1N5OX 2ENWA 4HDSA 3B52X 3AEZA 2ENUA 4X1YB 2VJOA 1D7AA 4CU2A 1EVQA 1JLRA 3I53A 3JWHA 4YRKA 3M4JA 5JZVA 4CM3A 3O03A 4IGIA 4PO9A 4L9SA 1AJEA 4XB1A 2XADA 3B2NA 4ARUA 3PJGA 1BXKA 4N6NA 4LVCA 5CJ2A 1PIWA 5IK2A 1YFKA 3KTDA 4KQGA 1D6NA 5JCOA 5B3KA 4RPKA 1P1JA 4ZI7F 3UK1A 3FPAA 2CB0A 4RMNA 4ZVSA 4JI3B 2A5GA 1P5JA 2H7VA 1Z4OA 2XNKA 4KR0A 5I7OA 3GIDA 1XAJA 4HC4A 2W0SA 4P3NA 3HFRA 2ISSD 1QLHA 2YYZA 3LKZA 5LZ9A 4EY6A 4FX5A 1K1EA 4C4AA 1QYDA 5AJYA 1IQ0A 1WUYA 3DV0B 5D01A 5K3FA 3ZHCA 1ZG3A 2ADFA 1OA0A 2O8VA 1W73A 3C5CA 3DJYA 4IRXA 1K75A 5AJTA 3TXXA 3WHIA 3DEKA 5KPJA 2X76A 1V9SA 3RT1A 4HUQB 1SUBA 4KLAA 1KI6B 4RL4A 2RKOA 2DCUA 4R8KA 2Q6LA 1Y3CE 1KF0A 3HVKA 5G2OA 4JJAA 1SKAA 1UBSB 5I3CA 2P4SA 4AURA 4ALJA 4KXLA 4DN6A 3D7LA 3S5JA 2YVAA 3RUHA 5ADUS 2VWGA 3KDSE 1T0IA 5L45A 2AC2A 1DEOA 1OU4A 3MJCA 1HE3A 3QUAA 1SBQA 1VL1A 2IP2A 2JANA 3SD7A 4J3FA 4W82A 3Q2OA 2G5PA 4CTOA 4KPFC 2OHOA 4GGMX 4KWHA 1GZVA 2IPOA 4R6WA 2YXPX 4RKRA 3TLXA 5COAA 4CQLA 2YDXA 1DE0A 3MRVA 3EZNA 4MGHA 1S2GA 1LRJA 2HNAA 4H7EA 3I30X 2PD4A 3HBAA 1FMTA 4IVPA 2PLAA 5FLYA 1FFBA 2WPDD 3DHEA 3KV3O 4EGFA 2X22A 3LXRA 1GXSA 5JDIC 2OCXA 1VLQA 5ICEA 1J1UA 3KHSA 4C0SA 4N5MA 5FP0A 2JJ2A 5BURA 3FFXA 3O1LA 4WY8A 4S35A 2PJUA 3UJBA 4F60A 1UPFA 4KGDA 5GY7A 1DZIA 1PZMA 3ABRB 2WQ7A 4WLFA 3U6BA 3T0FA 4KUGA 4YAOA 2Z5FA 1K5GA 1W93A 5IYZA 1QV6A 3G2QA 3KQLA 3RS0A 4C2UA 1Y7PA 2C7OA 2YVLA 2QYOA 3FD8A 3NAGA 3M9XA 1GPLA 4ISBA 2PY6A 1KDZA 2NU6A 3FTQA 5KTRA 2DKOA 4BMOB 3DUWA 4FR2A 5ALWA 4P3KA 4YRTA 2HFKA 4R31A 2FE4A 5TT0A 2D0OB 2EAUA 2XVAA 3U37A 2IOYA 2CJWA 4C4YA 5FFFA 2PUCA 3EARA 3WQQA 4IMPA 1WPXA 2JIBA 3F6PA 3GNLA 3L7DA 4N7BA 3SEAA 3E70C 3HB7A 2DJ5A 4B7ZA 2BTQA 5BPFA 1OHHD 1T9HA 3OIVA 2QX6A 4ZQFA 4CDRA 1JWBB 1PR6A 3D1VA 1H1LB 1RC1A 1YCDA 2LKCA 5DMXA 4G4SO 5L51A 3EBOA 2R6DA 4IH9A 1GY8A 3T7KA 2Q3LA 3C45A 2CEAA 3QKSB 3H19A 1JQJC 2I9PA 4UTXA 2Z8XA 4BWVA 3D4IA 1X86B 3EXHC 3L4KA 1JT9A 5SZJA 2J31A 3H9BA 5JS2A 3NVKI 4QSHA 5ED0A 5LLDA 4HDRA 1X7ZB 3D6HA 1SA0B 1W47A 2BR3A 5E0OA 3IVCA 1E0JA 3D6FA 4RD3A 3BGOS 2D2VA 1NV8A 1SUSA 2CYAA 2HIGA 3P0JA 3TCXB 5LB4A 1U7OA 3H16A 4RQUA 2YJ5A 3T7EA 5B3JC 5L4LA 3BS4A 1KJJA 3DGFC 5CDTA 3QBVA 3GBVA 3VTAA 4AX8A 1HT3A 1Y89A 5TJHA 1XO1A 2IY8A 4K1LA 3SDSA 3U0BA 2XDQB 1AH2A 2KBEA 3QE9Y 1K98A 4AYXA 1CEYA 1FRQA 3JR7A 3LBIA 2C78A 1JAYA 3QF7A 1ZXBA 2XGGA 1T2NA 1CQZA 3MTBA 4UD2A 4C05A 5L3SA 3K3PA 1OC2A 2WIKA 3KAQA 4FLEA 5C8YB 3A9SA 3U81A 1TMKA 2Q3DA 5EMJA 4YPOA 5BQXA 1M0EA 2JGFA 1KWGA 3R3YA 4BXOA 3AVXA 3FSGA 5A0FA 2PO5A 4IV8A 4HLDA 1G9XA 3S44A 7REQB 4KPEC 1QZ3A 1UDXA 5AI9A 3I76A 3RVOA 1QOPB 3MT8A 4ZO7A 1AK2A 1XYGA 2F43B 2B6HA 1FYXA 2WJYA 3FLEA 2FMFA 1BXZA 3U4HA 3E5NA 5IXYA 2OL4A 1E79D 3P9NA 3I2IA 5LBUA 4BVGA 3DBOB 4GL4A 1WIWA 2SNIE 1L4GA 5DLDA 1BZYA 2A0XA 1ODSA 4CUZA 1B73A 3HB0A 4XM2A 3E8XA 5EE0A 1Z08A 1JGTA 1UQRA 2H6EA 3GT4A 4D81A 2I65A 1O89A 2HN9A 1GLGA 4G37A 4A0SA 2P62A 4LBZA 5LOVF 3PHBE 1IK6A 3A9VA 4KMSA 1HRKA 3KJXA 3R8CA 5KVSA 3MAAC 1YJ8A 5JYCA 2QVZX 2O2EA 4UVIA 4OXRA 3TL2A 4N0QA 2Z6UA 1RJGA 3T3OA 3PG5A 4LFCB 1GUFA 1O4VA 1PK9A 4YGXB 5EPEA 3F5MA 5EWJA 5ETJA 3K0AA 2RAUA 4C08A 5LDDC 5IBQA 2C1XA 2WSYB 4PSUA 4L4ZA 5D7NA 5HZGA 4UBIA 3REQA 1D4AA 5JTTA 3UMCA 4GNRA 2YL2A 5IYZF 2ZYAA 1Y1LA 2XRYA 4UPVA 1ESDA 1KL7A 2D5LA 2HKIA 2QY9A 2V4ZA 3OEHA 1JYEA 4TM8A 4U8GA 5CNKA 5AUQA 5TPWA 2IOQA 5CBPB 4P3PA 1ZU5A 2XY4A 4QU0A 2DPGA 4TLCA 3OPYB 5H5JA 3GUCA 3ADBA 2SKDA 1G38A 2JFNA 1KBQA 5CYGA 1SG0A 2ZIGA 2Q6VA 4S05A 3ZZTA 2EYUA 1KAQA 4M55A 5ESWA 2IS4A 4AYWA 3SM9A 5FDFA 4Q9IA 1Y7TA 3KQYA 1QYCA 3MOGA 5LDGA 5TX7A 3ESRA 1HA3A 1U1EA 2XODA 4IJ5A 3E5HA 4J0CA 4OJYA 5TARA 4B6PA 2ZUTA 4HN4B 4RIHA 4HS4A 5J9FA 5K9ZA 3OPXA 2HF2A 4R69A 2J8ZA 3ZHVA 1GPDG 2E1PA 2ZJFA 3LT2A 3P0RA 4MQEB 1FXUA 5FAXA 1U7XA 4MP8A 5LZ8A 3V42A 3AVOA 2FP4B 1SRRA 1PZEA 2OILA 1ADJA 2BKAA 4MRNA 3ZHUA 1W8DA 2V97A 1E2QA 4UW9A 3VR3D 3WGOA 3WISA 1CULC 3AVVA 5BNTA 1ZUHA 1TAUA 1J0AA 1QIIA 2VSFA 3ESXA 1JJFA 3QNUA 4NBLA 3TI7A 3H5NA 1PGQA 3IUEA 1G3MA 2HPAA 3I6BA 2JIZA 3C3CA 4RBNA 5FL3A 4HUTA 2XJ4A 5JBNA 4CM9D 1P44A 3C3XA 2CNLA 5BWOA 3A70A 1RXWA 1G4AE 5KCMA 5FOVA 4NWIA 2O2SA 2ORWA 3MSCA 2B7LA 2XB9A 5KPDA 4X90A 2R0QC 3LX8A 4QBHA 2PU7A 1MLDA 2R7NA 1I3KA 3MTGA 4IF4A 4AZ3A 3BDVA 1W5BA 1N5KA 1YBAA 3P9PA 3JVVA 4TMFA 3THYA 4RZXA 1OT3A 1O0BA 1EMDA 2BF4A 3KOWA 5THKA 3B6JA 4YT5A 1VGVA 3VR2D 3ILYA 4Z8XA 3VR6A 3B20A 3HDTA 1Q84A 2BFBA 3ORFA 4QFDA 3DVLA 4L4SA 4ML3A 4TKLA 4NBSA 5FWDA 3WRYC 4YMHA 4KQ2A 3ZU5A 4JDPA 2X8BA 4CG2A 3R7BA 1RTTA 2E6UX 2WTXA 1JMYA 3W2FA 4QELA 1RWKA 1Y63A 3CQ9A 3GZNA 1CERA 3H17A 5FPHA 5JOQA 3UBMA 2VN8A 1ODCA 1PJRA 2FPPB 4YAUA 5K8JB 5EIBC 1CP3A 1SOUA 1XCBA 4JP2A 1E7QA 3KYBA 1JLMA 5LZ5A 3BTOA 2COUA 3UJ9A 1ECCA 5K3FB 2I7XA 3IB6A 3S2IA 4Y1EA 2NU8A 1BMTA 3NV9A 3BE5A 3IPAA 1KRXA 4TT8A 3QFHA 1SIOA 2YW9A 3FLMA 4NHOA 1YB7A 3NTRA 3PDWA 4MI1A 4PG8A 1JR3D 1XOIA 4M1EA 4P1ZA 1BS9A 2W6CX 4Q3KA 4U63A 4US1R 1GNPA 1OPXA 3HVRA 2GWRA 1JVNA 4UHCA 3WWYA 4MB6A 4R40A 1M7HA 4M86A 4KOEC 1Y4AE 3STHA 3W5VA 1OI3A 1PQ4A 5BSKA 3U1VA 1FDWA 2GN2A 5IM4A 2P6MA 4JWTA 4WI1A 1OJ7A 1PBTA 1T0HB 3WGLA 2UZ4A 4ESOA 1G98A 5E6SA 2JZCA 2JKVA 4CQLB 3Q9NA 4R1OA 4UNNA 4EG5A 1J39A 1ENOA 1Z0UA 1V8FA 4RABA 1YS6A 3ZXYA 4NAHA 3BBPA 5EZ5A 3DVAB 3TDNA 1GXSB 4E7OA 3KT8A 2VWHA 1U5CA 1K6EA 1GWNA 1M1YB 1HYQA 2P2CA 3O4FA 5JO9A 4A8JC 2ZEJA 3FETA 2P1RA 5HIKA 1Z4MA 1ELOA 1DWUA 1XV5A 3G9ZA 4X6LA 5B1HA 3FCSB 4Y9RA 1H3EA 5F98A 2FWRA 1ICEA 1ZGHA 2OQ2A 3Q72A 1TUBA 4V2IA 1JFFB 1ZOLA 1AQIA 1E0DA 1ECGA 1IHOA 4L9RA 1PWXA 4F8EA 5IYZB 3DO6A 1DINA 5K7SA 3VV3A 4L51A 3QVVA 4LMAA 3WLPA 4WASA 3NH6A 1C50A 2P9CA 3ZGXA 1JR3E 1A9PA 4F38A 2NU6B 5TSDA 5JH7B 4UATA 2WWGA 3LRTA 3V33A 1DRVA 1SC3A 4C5CA 4BFLA 4V38A 4LOAA 2GZ1A 2IY7A 4DW8A 5HIAA 5K8LA 3CF4G 2FNAA 3BXZA 2W6ID 2Z4RA 2CJWB 2RHRA 2QF7A 2QZ4A 4XEUA 1RC0A 1QRTA 1A8UA 2R8PA 4XVHA 5AESA 5JQGA 2BTQB 3CC8A 4FYYA 2F17A 2BPOA 4YR7A 2PZBA 4AZVA 4DV6B 2YWEA 1SXJD 2IJGX 4V3CA 3BVPA 4Y67A 3S2YA 3B3JA 3EHEA 3R41A 4ZJPA 4JBHA 4F46A 4FNGA 1PL0A 1ZCZA 1H2WA 1CY2A 1PEYA 2QTWB 3K0FA 3L7LA 3PLNA 5EHGA 1YVEI 3GPBA 3KXIA 5EJ6A 3ZLTA 3D8NA 5FNVF 2LWIA 5I9NA 1P2TA 4Q3DA 3DR3A 3VO9A 2QI9C 3EN0A 3HY3A 1XZKA 2IF2A 4RM3A 5HILA 5HKKD 3GF4A 3SXUA 5I3ZA 3QW4B 2HW8A 2QL5A 1Z5WA 1TF7A 2QA5A 3MGGA 4ALMA 1KU0A 4LDJA 4GMGA 3HKCA 3COYA 2H54A 1PJSA 4J1NA 4YAJA 2E48A 4AD8A 3T06B 4Q12A 3OI7A 1SVNA 1JHXA 3OA2A 1LLQA 1NRWA 2GBFA 5D1HA 4TLEA 6CHYA 2F4VB 1G291 5BR1A 5LSAA 1KFCB 3EZ2A 1RZRA 1DC4A 5I9MA 2JLVA 2Z2KA 4ZKEA 3L7IA 1DAIA 4RUKA 3V46A 4L4YA 4ZEWA 1RMYA 4ZA2A 5IN4A 3KQKA 2DKNA 4BXOB 4B3CA 2EF1A 1GQOA 3LDHA 1SXJE 4GR5A 2JLBA 1QPGA 3PXCX 2VHVA 4LNAA 4J2TA 4TM7A 4E03A 2C7PA 3P9YA 2ZBGA 2AF4C 5IAGA 4DQKA 4PCAA 3ZHQA 1II0A 5BSTA 4EJFA 3BG5A 1LX7A 2C2ZA 1XIVA 4XQCA 1Y1SA 1EFLA 4Q1AA 1QP7A 1GCAA 3T52A 1L7AA 4MUEA 1E9AA 4B40A 2HU7A 2IYEA 3BFXA 4LF9B 4BMXA 1DIHA 3ANSA 1Q0HA 2HK7A 3CW2A 4JELA 1GAQA 1GFWA 1H23A 1YMUA 4NBRA 4WK6A 1ATZA 4AM8A 1UP4A 4M83A 4HDMA 5DM70 1MEEA 2XRMA 3KFXA 1GTSA 1CDOA 3UOGA 1FP4A 3QUSA 5DNEA 3TDMA 2YNMD 3R3JA 2DHQA 5IM4F 2XITA 1XYVA 4DREA 2DYKA 5HJ2A 1ZXXA 1L5NA 2I6QA 2GCNA 5ECGC 3UN1A 3DP9A 5JAZA 1OGJA 4CLHA 1C1YA 1E6EA 4X1IA 4CKBA 4QGAA 1KP9A 1JZTA 1THMA 1XMIA 4ZVUA 1A8PA 1WSWA 2RCYA 4OAQA 5JMOA 1T8SA 1G1AA 1FC0A 4I0WB 3BWBA 4RW0A 1FOEB 3EGXA 3F3YA 1XPOA 3DLHA 5ECYA 5JI3E 2PCJA 5EWJB 3IPCA 3K0AB 1ECLA 2O3QA 4NFHA 5FTMA 3A3KA 3OZBA 4C7XA 4X45A 2JDIA 3REQB 4M9UA 3K6RA 2C7QA 2XTMA 2FAXA 5KQSA 1SXIA 3QUCA 3TVTA 4X3PA 3DYIA 5L3ZA 2EHDA 1Q0TA