3E84A

Structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto-nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acylneuraminate cytidylyltransferase
publication title Structure-Function Analysis of 2-Keto-3-deoxy-D-glycero-D-galactonononate-9-phosphate Phosphatase Defines Specificity Elements in Type C0 Haloalkanoate Dehalogenase Family Members.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 51
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e84A00
4JB3A 3DDHA 4UW9A 2HF7A 1XPJA 4Y2RA 2ZG6A 1U02A 2O2XA 2CFRA 3OCUA 3SLRA 4HGQA 3KZXA 3L1VA 1LVHA 3QU2A 2W11A 1WZCA 4EENA 3S6JA 4MWOA 3NASA 5AW0A 1TJ3A 3L7YA 5ALDA 2GO7A 5AKYA 2HCFA 3NAMA 1J8DA 1VFPA 3A3YA 4CNQA 5AVZA 2HF2A 1YV9A 4HGPA 1QH9A 1ZD2P 2B8JA 3A1DA 1Z4JA 4EEKA 5AVYA 3KDPA 3ET4A 1L8OA 3ZX4A 3AR7A 2AGVA 1Q91A 2PR7A 5AKZA 3WK4A 2WF7A 3PDWA 1ZD4A 4KX5A 2G08A 4RESA 2WF5A 3OCWA 1TJ5A 3NANA 2RBKA 3PGLA 3ET5A 3U26A 2OYCA 1T5SA 2IOHA 5AKJA 3WGVA 3UMCA 1Z4QA 2ODAA 5AM1A 3OPXA 1IWOA 2YMLA 3I6BA 2QLTA 3AR5A 5AW8A 5AW7A 3L8GA 2DQSA 5AVVA 2AUTA 1Z5UA 3A1CA 3NALA 5AM4A 1SU4A 2YY6A 5ALQA 5ALMA 4BYGA 3ZI4A 4PNHA 3HLTA 4C4TA 2G06A 2R8EA 2HX1A 3ED5A 4Y2YA 3ZVNA 3SF0A 2D2VA 3WK7A 1T5TA 4NABA 5AKLA 4GIBA 1RQLA 1ZRNA 5ALPA 5ALOA 1RKVA 2OBBA 3OCVA 2X4DA 3EF0A 5AI5A 3L0CA 1NF2A 5AK5A 5ALRA 4EX7A 4MUMA 2G07A 4EELA 2ZXEA 5FP0A 2ZBEA 3ONNA 4IFTA 2GHQA 3ESQA 3QLEA 1RQNA 3ZWKA 2FPRA 5ALSA 3WKEA 2R8ZA 4FYPA 3DNPA 2FPXA 3I76A 4RETA 2CN1A 4Y2TA 4G63A 5AW2A 2Q5EA 2WHEA 3B9BA 4EZEA 1Z4IA 4XQ0A 1XP5A 4I9FA 2WM8A 4AS3A 1CR6A 3WKBA 1NNLA 3RFUA 4XOUA 1N9KA 3CZ4A 3AR2A 3DAOA 1SWVA 4QJBA 3NUQA 4CE6A 2YBDA 1Z4PX 2FPWA 2JAOA 2P27A 3M1YA 2OA0A 3QXGA 3L0YA 2YJ6A 3DV9A 3W5AA 4L57A 5AVSA 2JGAA 4HYTA 5AM0A 5A3RA 4UMDA 4XE5A 1Z4MA 5IS2A 4G9BA 3E84A 2C8LA 2MU1A 1U7PA 4YIKA 3W5BA 5AVQA 5AI6A 3UM9A 2G1AA 2PQ0A 3KOOA 3QU4A 1LTQA 4L6CA 1KYTA 2IYEA 3NIWA 1ZJJA 2CFSA 3L0BA 2FDRA 3SMVA 1RC8A 4F72A 4YIHA 5AW4A 3KD3A 4OD0A 1F5SA 3SKYA 3U7HB 1L7MA 2HHLA 4DWOA 1ZS9A 5ALLA 4J03A 4JDPA 2FPUA 3AR3A 4DCCA 4UMEA 3IJ5A 2B8EA 1RPZA 2HI0A 2WFAA 3U7FB 1L6RA 1RMTA 2AH5A 1FEZA 4Y2XA 4ZEWA 5AK3A 5AIBA 5ALNA 5ALVA 2JAWA 1Z4NA 4BNDA 2G80A 2G0AA 2P11A 3WK9A 3WKDA 4UAVA 3WK8A 5E0OA 4ZEXA 2GHTA 3QX7A 4HGOA 5AK4A 2NO4A 2O9JA 2C8KA 3IRUA 1RRCA 4FE3A 4L6AA 4C4RA 1O03A 2YMPA 5AI0A 2IOFA 1Q92A 1U2TA 2C88A 5ALUA 2FPSA 3N5KA 5AKXA 5IT0A 3FPBA 2YFYA 1SWWA 4BX2A 3OTQA 3SD7A 2HO4A 4IG4A 2HSZA 3AR4A 4NWIA 4Y2VA 1U7OA 1ZD3A 2FEAA 1RKQA 3FVVA 5ALKA 2R8XA 1RMQA 5ALZA 1Z5GA 2BY4A 2WF6A 3ZTYA 4YCMA 3ZVMA 4OCZA 1RDFA 3W5DA 3PGVA 3SHQA 2ZBGA 3N8GA 3QU9A 3QUTA 5JJBA 1XVIA 3B9RA 2I33A 3FZQA 4CF4A 2W43A 3AR8A 2C4NA 4Y2PA 1Z4LA 3I28A 5ALFA 2Q4TA 1VJRA 4UAUA 1WPGA 3HYCA 1NRWA 3M9LA 1TE2A 5AKEA 3FPSA 4YCNA 3EWIA 3QYPA 5AKGA 2ZBFA 4B6JA 3QU7A 2FUCA 1RKUA 4UMFA 4BEWA 1T9ZA 4UASA 3WGUA 4AS2A 2EAUA 2EARA 3K1ZA 4ZEVA 2BDUA 5ALGA 4DW8A 2JARA 4E88A 1VJ5A 5ALTA 3E58A 2ZBDA 3EPRA 5AHXA 4UU1A 4CF5A 5AVUA 5ALHA 2NYVA 5ALJA 2RAVA 5AW6A 4KNVA 5AESA 4OFZA 5ALIA 1ZRMA 5ALWA 3MMZA 3ZUPA 4Y2UA 1EK1A 4UM5A 5AKKA 3E8MA 3U19A 1L7NA 4O8CA 4KNWA 2AMYA 3ESRA 4HGNA 1PW5A 3R4CA 1QYIA 2YMQA 3ZX5A 4KN8A 3OCXA 2YN4A 2W4MA 3EF1A 1AQ6A 5AM3A 3W5CA 2B1QA 3D6JA 3TLMA 5AK6A 4AP9A 1WR8A 4OHFA 3E81A 1WVIA 2B30A 4I9GA 4UARA 4HGRA 1YJ5A 3B8EA 2I34A 5T41A 1Y8AA 3U7GA 2FI1A 3FM9A 2FUEA 4Y3UA 3SKXA 3GYGA 1QQ5A 2HDOA 2I55A 5AKIA 1L7OA 3L1UA 2WF9A 4BX3A 1CQZA 2BDEA 4QQFA 4CF3A 1TJ4A 3N28A 3UMGA 4UATA 3OCZA 3BA6A 1S2OA 4GXTA 4C4SA 2NO5A 2YJ3A 2GMWA 1YNSA 3WK6A 4BBJA 2B0CA 5IT4A 3AR6A 1K1EA 2HOQA 1ZOLA 5AIAA 2R8YA 3QGMA 3R9KA 4UMVA 5AI8A 5AI9A 3ZW7A 4HAIA 3N1UA 3WKAA 2HEGA 2RARA 3QUBA 1QQ6A 2YJ5A 4EX6A 4BKMA 4XPZA 3CNHA 3F9RA 3MN1A 1J97A 2G09A 3OCYA 1X42A 3PCTA 3MPOA 4Y2QA 3ZTWA 2YJ4A 2WF8A 3U13A 2IOFK 1U2SA 2Q4RA 3WKCA 1S8OA 3R09A 4KYTA 3ZU6A 3U7EB 2JAUA 1L7PA 2OM6A 1RLOA 1JUDA 1YMQA 1MH9A 4FFDA 1RMYA 5AVRA 4BX0A 4YH1A 2P9JA 4YCLA 4Y2JA 3QUQA 5AW1A 2B82A 1QQ7A 3AR9A 3UMBA 3VAYA 2B1RA 2C9MA 5AM2A 5AW9A 4DFDA 1EK2A 5ALXA 5AW3A 3BWVA 1Z88A 5AVWA 3L8FA 5AM5A 5AW5A 2QYHA 4YGYA 4NAVA 1RLMA 2YMMA 3QU5A 3N07A 2I7DA 3QNMA 5AI4A 2IA5A 3QUCA 5ALYA 4UM7A 4NV0A 3ZWDA 4KX3A 3ZVLA 3L5KA 5ALEA 2ZOSA 3KC2A 3NRJA 1TA0A 1YDFA 3J7TA 1Z4OA 1YS9A 2RB5A 5AICA 2GFHA 2I6XA 2CFTA 3WK5A 3L8EA 4BEVA 4NFLA 5A3SA 3L8HA 4Y2SA 3RF6A 3FGOA 2I54A 5AVTA 2EATA 4J2TA 1O08A 3IB6A 2PKEA 4F71A 5A3QA 3I1YA 2VKQA 1RLTA 2MSNA 3MC1A 5AKHA 1ZD5A 1Z4KA 1N8NA 5AVXA 3P96A 4H1WA 3KBBA 2P69A 4UU0A 1L8LA 4BNDB 3A1EA
chains in the Genus database with same CATH superfamily
3ZS9A 4CCAA 4RZ3A 4FXPA 3RVLA 1XCBA 5CX1A 3S70A 2Q1UA 1SR8A 2OHJA 3LWZA 3Q3CA 3Q8LA 4EG8A 4YRGA 1ECLA 1USVA 1XUOA 2HRRA 4Y2RA 4YP7A 3OCUA 4EFMA 3TLYA 1TD9A 3WJ2A 2X0KA 2NXWA 4ZJYA 1SFRA 2WM9B 3HYSA 4J6FA 4Q1FA 2VF2A 4PY2A 3CGGA 3DAYA 3IBTA 2WKSA 4ZVRA 3EVTA 2C9BA 3UK6A 2XTMA 3T52A 4DEYA 2HHHB 2BBWA 3KNZA 1T9AA 1JS1X 2XZDA 4EYKA 3ADCA 3R8FA 2VHXA 3BCRA 3F49S 4M9UA 4QOIA 3WGKA 3UCXA 5IVKA 1HPLA 4M0LA 5C5IA 2JFQA 1G98A 3HDHA 3HVJA 4UULA 2YICA 3A32A 1MVOA 3U56A 1VFPA 4UHCA 3KUDA 1KE2A 4OU5A 3PGJA 4DUGD 2SCUA 4YQFA 1J90A 3D3WB 3IXLA 4JUCA 1R15A 3JR3A 4MW6A 1D7AA 4IHAA 4S12A 1ZD2P 5IZCC 4RZIA 5BPHA 3C5HA 3O74A 3PHHA 4IFBA 1BKYA 1PR0A 2G71A 2VH5R 4PGHA 2W6QA 2BMFA 1NJ8A 4L07A 2JLBA 2GEKA 1EDBA 4JOBA 5GTDA 1JR2A 3WZMA 1AC5A 5BNZA 1T6NA 1SXPA 1ISSA 4JKYA 3W7BA 3CX3A 4CV3A 3UQZA 4GEGA 5I4IA 4CTNA 5GJVC 1AGRA 3O2JA 4CKWA 1QK3A 1Z39A 3IJRA 1HNNA 1CY4A 4JP1A 2AI3A 4O1HA 2CEKA 2ZJFA 1JEQA 2ZWIA 4J43A 1Z7YA 2GA8A 4UC0A 2YZGA 3AJ8A 1D7OA 1KK2A 1AU9A 3OE4A 1G8YA 4BFZA 1KYXA 1QYRA 3INYA 5CCBA 5EKTA 5JJLA 3DL4A 1SUSA 5DLEA 1SCAA 2LW7A 2Y0BA 4URZR 4B4VA 2H1LA 1P0MA 1KJQA 1H2RS 3AV3A 2IIQA 2IFTA 2WNHA 4Q4AA 5I4KA 3H2SA 1XPRA 4G0XA 1UBCA 2FB9A 4FOPA 3KLMX 1M8FA 1GUZA 5DYNA 4NV3A 1P77A 2HMWA 1ZNWA 2GPWA 4Q4DA 1Y5LA 5BT8A 2PJUA 3L4SO 5DTEA 1FS6A 2FHSA 3KYCA 1L0BA 3N6RA 4CIAA 2FRXA 3H5AA 4RPGA 1E5DA 3IVMA 1XVAA 3VYSB 1ORHA 1UDWA 2P40A 3T3GA 1ZRNA 2YS7A 4Y0VA 4YR7A 5EVCA 1U4NA 1GNQA 3A14A 3ZE1B 2C3MA 3ZLUA 3TB4A 5A4AA 1RKVA 3VM6A 1SUWA 5J2TB 2B4AA 1QLJA 2IYTA 3MEQA 1KK0A 1KZGB 1XVUA 4MQBA 1QHIA 2G5PA 1B3RA 1SQ6A 2PTGA 1NBEA 2IYQA 3KKNA 1IXRC 3Q1KA 1E0SA 4ALJA 1BX3A 5FPSA 2I1LA 4FC6A 3L1JA 2DFPA 2C4UA 3RG8A 4HZUA 1F8XA 1LNSA 3MGBA 4P5DA 3N0XA 4AX8A 5J2UF 3ONNA 4IFTA 4O2LA 4PO1A 1NLMA 1CK4A 1DHRA 2WSBA 4P9NA 4P6VF 2RCYA 4V0MA 3JQGB 2BN4A 3NHRA 2W2PA 1BWRA 4AO8A 4PTZA 1E79A 1N2BA 3IT1A 1ISPA 2FA9A 4H7FA 3EXAA 2JGNA 3IXMA 1NXQA 1RYZA 1T2FA 4YJ2B 1L4HA 1I2BA 1SXQA 4YPOA 1H0KA 1OGIA 1UAGA 2A3NA 2HF9A 4Z3OA 1UBMS 4WESB 3TMAA 5JCPA 1VMAA 3AHIA 1ZCAA 4ZCLA 4LWOA 3VR1A 3NONA 1JR4A 3E9QA 5CLFA 2FPKA 4DLXA 1K4MA 3INTA 4Z1MD 2VDNB 2XRYA 4RPCA 1JDVA 2PKWA 1A2KC 2AMFA 2JJYA 1U3TA 4DCVA 3ZD8A 4KXUA 3W0LB 2YJ6A 2XYQA 4V3BA 1TF2A 4TROA 4L4SA 2ZTHA 2VQ3A 3DPUA 2O05A 3JVVA 1X39A 2Q49A 1P60A 3QX9A 4RVUA 2FZKA 3JQDA 4M2LA 3QFSA 3F2IA 4O4LB 5E2IA 2I3GA 4O33A 3MHPA 3PUXA 5IS2A 3INNA 3ZR4B 5CYFA 2AYZA 4QQRA 5CK5A 3FOCA 3NVKI 2HTEA 4U7FA 5IJWA 1J0DA 4G5GA 1PKXA 3FVQA 1U5AA 3U49A 5E2AA 5IRCD 1KAOA 1X19A 2L82A 4M9XA 2IHKA 2R96A 3LIIA 4MV0A 3SC4A 4BDTA 1E2QA 1KFBB 1P5ZB 4ZYTA 1TD1A 1GNPA 1IPFA 1LVUA 1VL2A 1QKIA 1OYOA 2DZDA 2QP3A 3NIWA 4JLMA 1EGAA 1XR3A 4YY3B 2IXEA 3ZWYA 3D8UA 4C21A 3IIIA 2VSXA 5L4NA 1WXGA 1EFLA 1SBZA 1YBVA 1ZWLA 2B83A 2FMKA 2J3JA 2ZS9A 3EUAA 9ATCA 2VWGA 5LLDA 1UZAA 1ZS9A 1NP3A 1E6WA 9LDTA 3H1GA 3VVCA 4DBLC 2Z08A 5J59A 2PFGA 1UF9A 2GM3A 4EPYA 5SZIA 3JASA 4XYEA 2ATXA 4QXOA 3WTBA 3B1KA 5KYXB 3ZN2A 1APBA 2HLDA 3RVPA 4M76B 4LPKA 2JK1A 5A4MS 2P30A 1M34E 1D1PA 2PMCA 3P0IA 2H1SA 4KPGA 4RDIA 4PYIA 1QXSA 3NDIA 5HKAA 1WD5A 4URVR 2RK3A 3E5MA 3WSTA 1YT5A 4HATA 4AZ3B 2FUG6 2V0CA 1A97A 4DA0A 4TT8A 1N34B 5F1KA 2BEWA 3HJCA 4EGJA 2CL0X 2X23A 1WPXA 4A9AA 5L3ZA 2MSLA 2AZMA 3VHXA 1SA0B 1W6RA 3B70A 4BE9A 1OFUA 4GMFA 3ZWPA 3PEVA 4BFVA 1GGHA 1Z18A 4XASA 5JNVA 2QGFA 4ZTZB 1JALA 1C3LA 1Q92A 3RYHA 3T7TA 4L50A 2C88A 3N5KA 4U9HS 4JEIA 1ZUIA 3K1YA 4O4HF 4CI0B 4EFLA 1UWKA 4D1YA 2AI1A 2C78A 4QJ5A 2F3PA 2WJ3A 1ZN7A 4CL0A 4L73A 3PE6A 3ND5A 2UVPA 4J49A 4DARA 1FFBA 4CLRB 4HH3C 4YRAA 1E6CA 3U1BA 4BFYA 1RTTA 3GG9A 9LDBA 4ONEA 1N7HA 3GDWA 2Q3JA 4RK1A 4MWGA 1P6XA 4HC4A 4BPRA 1EI9A 2GEBA 3BXHA 5ALZA 4D56A 1KY4A 4W9MC 1FJHA 3ECAA 3A6HA 2O2IA 1UBOS 3L7KA 4AURA 1GVHA 1LX6A 3ZXYA 1UDRA 4RULA 3DTVA 3QWAA 4U2KA 5ITSA 1RP7A 3JAWA 4PGMA 4B84A 3EZ9A 2X7HA 2ZIWB 1M6VB 3O26A 3OI7A 3PQCA 5JTUA 4MX8A 3AR8A 1ISIA 2C4NA 4ENPA 4MHSA 4H1TA 1UIRA 1Q5PA 3NHKA 5B7QA 2G8LA 1T0IA 4IJ6A 3PE3A 4M0PA 4NCNA 3W8EA 3P9ZA 3BCSA 2VYQA 2BFMA 2EZ4A 2J6BA 2DC1A 5BPFA 2PUTA 2M6LA 3MS7A 5CNKA 1FRQA 3IC5A 3LHKA 3U6BA 1M1XB 2Y9PB 3VO2A 3VZBA 3BILA 4BTLA 4GPIB 5SY4A 1DUSA 4N5IX 1E3WA 2A6PA 4F9FA 5KNCH 2X19A 1E2JA 3LOQA 2IHBA 3F98A 5KVQA 1O54A 2VIIA 1EUZA 1T4CA 3KKKA 3LY5A 4P0TA 4PQEA 2Q46A 4G0YA 5D3MB 2HWXA 3EASA 4OXKA 1DC4A 1I5RA 3EGEA 1NHWA 1H22A 5GV8A 3C7DB 1Q7TA 2B8NA 2EARA 2VR1A 1CJMA 1N6IA 5CDHA 1T9GR 3A9UA 3PX7A 3K0EA 4EABA 4MZDA 1JAIA 5K05A 1G6KA 4JGBA 3PQFA 2OBYA 1F6DA 2GEJA 3MBIA 1JB1A 4PNPA 2H4HA 4JVLA 3KYBA 2HV8A 4J16C 4FFRA 1Z8FA 4IFEA 4F6LA 4FMPA 1NURA 4E11A 3PYMA 1VRVA 2X41A 2QUKA 3B3QA 3WNDA 4LTMA 1XCJA 3AI2A 5FX2A 2XNDA 5A71A 5B1SA 1DJQA 1V43A 4BCDA 3I62A 1U0SY 1GQOA 1MAAA 2VQFB 2IEDA 3MMZA 5TQVA 4LY9A 3KKPA 4LGYA 4WERA 5KAMA 2D13A 2A9VA 4NCJA 1KMHA 4C4PA 4US2R 1EBBA 1FNSA 1YJCA 4G09A 4WA7A 1X1DA 4TRRA 2NADA 1BHJA 2W2LD 5PNTA 2FN8A 1KMNA 3I2YX 1N7JA 1AV7A 4BQOA 4CJXA 4ENTA 3ZD9A 4QJ4A 3RUAA 3OQHA 4ARZA 4EA9A 4UTPA 3HXQA 1QG0A 1HLGA 4DB4A 3DAGA 5AQ1A 4UVDA 3OZUA 1IY1A 1LF0A 1WO8A 2O0LA 1UBNA 1GPUA 4QUKA 4TSFD 2LPMA 4LX8A 1SGWA 4NKRA 2P7HA 1HM5A 1RJDA 3E81A 2E4WA 1AMOA 4EM6A 2PWPA 4MCIA 1MW9X 2QLLA 3DM5A 2WAOA 4HGRA 3FUWA 2HIAA 3IP9A 3QZUA 2ZU0C 1E20A 3TKYA 1MB0A 3CUKA 3PQEA 4KSYA 4PPGA 3PNSA 4ER0A 4OP2A 3D0OA 1NTRA 3FUUA 3ASYA 3GP8A 5L53A 4JLBA 4FDLA 3G5AA 3EZ2A 2Z9DA 4QYMA 3PPIA 4KQIA 1OXMA 4I8XA 4ZEMA 4MA5A 4OXXA 2QYSA 2JLRA 3ILSA 3V2IA 3NHYA 4JX9A 3TBFA 3AQ4A 4PR0A 2QD4A 4R8MA 3QYAA 3OOJA 1D07A 1M2GA 1LPPA 3UKDA 3UUEA 3ZWCA 4D3XA 1L4LA 1Y0BA 1DKNA 2R79A 2ATIA 2BKXA 3QF4A 1NM5C 1XHEA 2Y0EA 1S1MA 3HABA 4L75A 4Z8YA 2J0QA 1AIPA 2ZRCA 2CFIA 5ARDA 4BAGA 2JLQA 1FZTA 2EXXA 2ZRMA 3DL0A 5IT4A 3WL4A 2CJXA 2GTPA 2W00A 1Y6QA 2IV2X 2VHCA 1DIAA 1PFWA 4TVKA 3I4LA 1V5GA 5A4FS 1HY3A 1N6HA 1QFJA 1M1YE 1KOGA 3K1AB 4Z7NB 4I1RA 3SOZA 4HKTA 2UYGA 3CVUA 1E59A 5B3JA 3ZYCA 3RHTA 4NYJQ 1ZGJA 1GADO 6Q21A 4XPZA 5CB4B 3MN1A 5HGJA 5H68A 1I6MA 5HFJA 2OHHA 1RWQA 2XT0A 3HU1A 1JN0A 5IBCA 3ZHUA 1PGOA 4E21A 1ULTA 3LW7A 4ZV7A 4K0KB 5H0IA 4YWHA 3EDCA 4XM2A 2PZKA 1BFKA 2ONKA 1F6WA 2NU8B 4OQEA 3T5GA 3BAFA 1XX6A 3GVHA 2CCKA 2XWJI 3IV7A 3NYQA 2VT6A 3LQKA 4YS6A 1ULSA 3K5WA 5CMLA 1X1RA 5LB2A 3VO9A 1N4AA 1PLJA 2XA2A 2O2GA 4M9QA 1JUDA 5ICSA 1TU3A 5GINE 4F84A 2GNPA 3BB4A 1KO5A 1OREA 1SVMA 1YD7A 3RROA 2Q62A 1H0RA 4RIGA 1SBHA 4CT5A 2VVTA 5A4JA 1OTHA 3CVYA 1LB1B 1PT5A 4ZHQF 3DR3A 4HAWA 4BUCA 3H8JA 4H1UA 4JP8A 4BKQA 2YQZA 8ADHA 2VTBA 1FUIA 5EJ4A 3CUUA 2IGBA 3UOAB 4BO1A 1XMQB 4E31A 1T25A 4L28A 4QEDA 4W9NC 4TZTA 5BURA 4QG7A 4OAPA 4EUKA 1YRHA 3BWVA 4Q7JB 4RY9A 1FX0A 3TJZA 3V55A 1EIZA 2OCLA 2PS9A 2VBFA 1E1KA 3AKDA 3A4VA 4WXRA 5K0SA 1XTJA 3EGXB 3L77A 2VOJA 4FFSA 4HNHA 4RKQA 4H6VA 5DXJA 1G42A 1KGDA 4DB2A 1Q1NA 3K20A 3G5UA 4LC9A 4DUYB 4E3ZA 1H9CA 1NC1A 1WQ4A 2ZBUA 1NOKA 4UM7A 1ADFA 3RTEA 1MD9A 4M54A 2V7QA 4AY4A 1D9ZA 2H18A 2ODTX 13PKA 4ZCQA 1YR6A 4ZT2A 4JI3B 3VV3A 2LKDA 3L4EA 3PXUA 4R71A 3RBZA 1G8FA 4E46A 4MRNA 2B7LA 1RPJA 3OFJA 4H77A 4FMDB 3SVLA 5K0CA 2YINC 2FJ0A 3DMRA 2EATA 2Q3DA 1O08A 1C1HA 1H2FA 5KVCA 3VYWA 2OCPA 1Q0HA 1HLPA 2BEKA 3AHDA 3EQ6A 5CXUA 1W4AA 2G9QA 1CY2A 4JEMA 4IICA 3NB0A 1G6Q1 5A05A 1THZA 3C6KA 4JH0A 1N8NA 4MQEA 2OV6A 4URFA 4ZAFA 3SHVA 2ZUDA 5C5DA 1M9NA 1OXVA 2WJYA 3KBBA 1RXIA 2CHGA 5TARA 3WMFA 3WYBA 2AZXA 1GUDA 3SYRA 3WHLA 2CD9A 3RTAA 3F4BA 1T8SA 2WAMA 5JVDB 4CETA 2EFDB 2Z8YA 3DV0B 4B76A 1LLDA 3JWJA 3SJZA 4D79A 3Q98A 1KQFA 1NA5A 2REBA 3U3JA 5IJ0B 4ME6A 1N7IA 2MWMA 3JQAD 1WY5A 3NS7A 5BW6B 4YRLA 2GTHA 4I2NA 3GU3A 5FUWA 5DHRA 4BZQA 3A26A 1B16A 4OKNA 4OQFA 4E5UA 5A7FA 2WPDA 4I08A 1KEKA 1NR1A 1C2TA 4V2IA 5EIHA 3SR0A 1X87A 1NU6A 4Z99A 4RH0A 4QDXA 1HTTA 1UDAA 3V7FA 1QU3A 4CL8A 5DV9A 4CBVA 2P9EA 2PE5A 2QTLA 3ZK7A 4U8GA 2W2NA 1N4DA 1QHXA 3V2HA 2X6TA 1PTJA 4RYLA 1N3LA 5B6PA 4HNAB 1ODSA 5AKYA 1H85A 3DEHA 5CUQA 2CNOA 4LE0A 4AG5A 2GZSA 3KQYA 4ZQFA 1ZRHA 4DV0B 2WWHA 5AR1A 2EHJA 2B8JA 2QDXA 4V2UA 1Z4JA 2IUYA 3QHAA 5FQNA 3UWPA 1I1QB 4UTOA 1IWBB 3E1SA 1VZ2A 2X1LA 5B1YA 3MWEB 5B1HA 1SN7A 3WBKA 1RE1A 4L74A 2R1TA 3P26A 3RJTA 3HCWA 4B3IA 3L3BA 3LPDA 4Q15A 2QAJA 4QBKA 3I73A 1G8MA 1OE0A 4XTRA 4BVGA 1HT0A 1SRRA 4FW9A 2GFQA 1TJ5A 1EZZA 3A05A 3QFRA 2BFBB 4TL8A 4BDSA 4KIFA 5KSOA 1SPBS 3M6VA 1IVSA 2IH4A 3G1WA 2XUZA 4KQXA 4ZQIA 3DTNA 1JFFA 3ZCRA 3I12A 4LSMA 4A15A 1ECPA 3FFBA 3HV0A 4H18A 4AZSA 4L5AA 3VDMA 3I6MA 1A2BA 4PE5B 5LQAA 3T4XA 2I2XB 1G20B 5F3RA 3B1YA 1RRFA 2N46A 1PQWA 4IDCA 1R0YA 4QARA 3V1TC 2CDBA 4E14A 1ZONA 4FZRA 2JGEA 2JBWA 3V46A 2AV6A 5EJIA 3GLIE 3JVEA 5IDWA 2VTEA 1V25A 2VDUE 1GPKA 2R1UA 4O4JA 3RC1A 2V0GA 3PQ6A 1R6VA 1N5DA 2V4MA 1GTVA 1NLZA 3H1TA 4K9QA 5EXXA 1XXHA 3CEHA 2GZ3A 3B48A 4H31A 4KJXA 4M38A 3SX0A 4DSAA 3VDQA 1PL0A 3LPCA 2RHJA 2D2VA 2VHYA 2J48A 3CZCA 1DBSA 3LWDA 3OEYA 1RRVA 4I36A 4TLBA 4V02A 4TT3D 4BLPA 1YIAA 3BMNA 3ZXUB 4OB8A 2HQ1A 3P9IA 5CFNA 4J7AA 2ATVA 4IDAA 4JLWA 5G1PA 3S1AA 1QPBA 1UDXA 2B2NA 2OBBA 4U7GA 2BSQA 1EWQA 2V7VA 3QXXA 4KYUA 4MS4B 4O2AF 3ZBQA 3TG8A 4RQBA 2IUEA 3WLQA 2XIQA 1TW2A 1TI7A 1OC4A 4MUEA 3W6PA 1NF2A 2WTXA 4TL9A 4ES6A 1PJLA 2ZJ1A 2HL6A 2DBVO 1BGVA 4EGQA 4JXKA 3WNQA 3JQ8A 4KKVA 5CK4A 1R6TA 3EZ7A 4BNFA 5TDHA 5A9RA 2GBLC 3NBXX 1G64A 4HX5A 3OA0A 1NQUA 3QE0A 2Z5GA 4OUKX 5ENZA 2BH2A 2P62A 1IPHA 2WMDA 3B3AA 4MVCA 4I3HA 2O0MA 2GXSA 3E3AA 3UV3A 4IDFA 3KUXA 5SZJA 1U1GA 3NKVA 3QV2A 4B3HA 2VDMB 2FZGA 1Z4IA 3MA0A 4EZEA 1KI9A 5B6JA 1K4YA 5DIFA 4EHFA 1U9YA 5TJHA 1AHPA 3I6QA 3KSAC 4YV7A 3CZ4A 1PQ4A 1SWVA 2BFNA 3MB5A 1ECBA 4BQSA 2EFGA 2C9YA 2VHUA 3IULA 1JFRA 1TADA 4B09A 1O3YA 4D26A 5DISB 5F7JA 2H48A 4HEA1 3ZE7A 4PC6A 1CS4C 1G4AE 1IHXA 2RGRA 4EPWA 2JGAA 3IKJA 3Q3IA 2I6GA 4EDFA 1R3DA 4GQIA 1L1QA 4RVCA 4C1NA 3H5VA 1MEOA 3BBPA 2XNSA 1SBTA 2IZ7A 1JXAA 1MABA 3E7PA 3FRIA 3LT5A 4IS3A 5TEVA 4ZGBA 5FV4A 2R60A 5FAKA 3AVYA 2P0YA 4OHMA 2IOQA 1JEYA 1GRQA 1X6VA 3LC0A 3E18A 4TMTA 2I22A 4YIKA 3W6UA 4Q4JB 1Z47A 3C1UA 1C7EA 2QXUA 4V0QA 1VSQA 4U8HA 1EESA 1YE3A 4LZPA 4L6CA 4LJ4A 1DGQA 1FNDA 2Q0XA 2BBTA 3R5KA 2QX7A 4QOGA 2CFSA 3GCDA 3SMVA 3MBOA 3ZEIA 3Q88A 4EW2A 1DJOA 1R7RA 3FKSD 1YZFA 2JAQA 1RACA 5L6MB 4Z4QA 1V11A 3VKGA 3P20A 4ZDJA 2FR8A 2BMJA 3WLPA 5CLQA 2CJYA 3SSNA 1NULA 3GF4A 1FFHA 1Z2NX 5JMWA 4Q66C 4MUFA 4IUYA 5ALLA 2FPUA 1SD1A 2ZW9A 3VRHA 2P9TA 1GA1A 1XEXA 3ZJVA 3U7FB 3FYDA 4PBRA 2OGWA 5JOQA 2L19A 4LZWA 1HRDA 1QHFA 5ALNA 3V9PA 3WLEA 1H3NA 3SBEA 1FFXA 3M3HA 2BGUA 1DIBA 4TYYA 3SSOA 1TRHA 4HPXB 5KSWB 4REQB 3ZHBA 1CYDA 3AZPA 3B5IA 1Y98A 2FWPA 3KKLA 2FMXA 1FQJA 2BF4A 3L2OB 4R81A 3AOEA 3F73A 4KVFA 1ST2A 2H11A 4PX2A 4YECA 3I5XA 4BEBA 1HT2E 4FGKA 5B2EA 3KKZA 4X1IB 2UU9B 1EUDA 1SCQA 2BI7A 2VF8A 3S2IA 2FEWB 4NG4A 3FFWA 3DV2A 4G0ZA 4LSZA 4MQ6A 4RGYA 4GOJA 5T4FA 2IOFA 3K2QA 3H0CA 3ZD6A 1RP1A 1U2PA 1VE6A 2P2LA 2ZR9A 3PZBA 4DIFA 2GD6A 1AV6A 1PEYA 4PZPA 1H69A 3I01M 3TIXB 4INZA 2PNJA 1N77A 4H4CA 4QXRA 2JATA 3GCXA 4DCTA 1TEVA 1QORA 4F56A 3EZFA 4P98A 1QTIA 2ZUCA 3L6BA 4XH9B 3DOIA 1X7XB 3PQ7A 5DTJA 1JNYA 1WUHS 2ZRFA 4RQUA 1ZD3A 1L7QA 2FEAA 4ALNA 3INGA 4EQ6B 2DH5A 3UKOA 1DO8A 3DZDA 4NMLA 1KK3A 5TX7A 4DILA 4FB4A 2QVXX 5CLIA 5FA5A 1P3Y1 4YJFA 2F6RA 4J3NA 3V8PA 3VNQA 3KQHA 2ZBGA 1U3UA 3QUTA 4MVJG 1X8LA 3GAZA 3OJCA 4P82A 1H65A 4R2LA 3PIIA 4ILEA 4OK5A 3QV1A 4KFUA 1CE8B 3UC9A 5JXGA 5HQTA 2IEZA 2O5EA 2DQYA 4FZ5A 1CBUA 4WOKA 4D92A 3UFXB 3DXFA 2DHRA 3K72B 5EYPA 2O2DA 4PICA 4DLTA 2E1RA 3MTBA 1KRWA 4QG3A 1KVTA 1YHNA 4D9NA 4OQNA 4EA8A 1P2UA 2O2SA 2Y66A 4O0LA 4LJRA 1DCKA 4YAFA 1NRWA 2PMWB 4X24A 3IB3A 1R66A 3S2UA 2FAXA 3DKIA 4H08A 1V0JA 2JEYA 5KZMB 1AJEA 1I4DD 2TYSB 4HCJA 2OFPA 4YPFA 3F6SA 5FD8A 2ZYDA 5HJ5A 4W5HA 1RKUA 4PTYA 4I9HA 3KSMA 1QFXA 2Z04A 1DRUA 4BEWA 3KPUA 2AF4C 4UASA 2IYVA 4Q82A 2YZKA 3REOA 1JVNA 1LRLA 4PAOA 4YN3A 1IQUA 5DM1A 3TX2A 4FYMA 2QDKA 3TS1A 4Y1RA 3LI2A 1HQKA 2AZDA 4AJ4A 1AKRA 2JFGA 1E9AA 4WCDA 3Q9LA 4AJLA 4B7ZA 4U7PB 3VMMA 1UQRA 1U0HC 2YZ7A 3IPLA 4ZI2A 4LBWA 1MO5A 3RADC 3O7MA 5A2QA 4G24A 2R7KA 4KE8A 3TMYA 1XQYA 1NXOA 3RAEC 2YXBA 4K26A 4ZVQA 4F9GA 2W90A 1ISJA 3QTLA 3JQGA 1L4GA 3CLKA 1TZKA 4JJIA 4K9PA 1QB8A 5E9JA 4F38A 4MKGA 3F4LA 1S96A 3LS2A 3AVVA 1CWUA 1KEZA 2HTFA 3DE0X 5SYAA 1M1ZA 5KHLB 3JSXA 3RSFA 5K4HA 1J8VA 1MJGA 4WLOA 4DVGA 3R4CA 2HD4A 1EWTA 2FSSA 2PPVA 2YOFA 1ZAKA 4YJ2A 3BRWA 4WBNF 5DSXA 5BVHA 3BXOA 7ABPA 1RI4A 4NULA 1LDEA 4L16A 1M6HA 4I4TB 5DH9A 3ZY4A 2QG9A 4YMTA 3QEMA 3M34A 1KC1A 3TSZA 3PT9A 1JSCA 1AQ6A 4JL5A 1ZVJA 3W5CA 1E8NA 2OV3A 5LMUB 1J0EA 4ZAZA 4DV1B 2Q2QA 2PUWA 2SKEA 1DI0A 4J4BA 5EHXA 2PXXA 4FYIA 4JVNA 4M7OA 3OE5A 4M22A 2FW6A 1NWHA 2INGX 2BKLA 4A8TA 5IWAB 1FP4A 1SUEA 3KEMA 4GOOD 2UXBB 3G1UA 4REMA 1QUEA 4O4LA 1AE1A 2Y92A 5IP5A 1GTZA 2PU5A 2FXIA 2DBYA 3TZHA 4LE1A 2VJOA 3TTTA 4D5GA 2WF9A 5DZSA 4BX3A 1J5EB 1JBQA 3HCEA 3O3MB 3QTBA 2YWDA 1UC8A 3HDJA 1SZDA 3OLXA 5FJIA 1B8PA 4JX8A 4NRDA 1NJ2A 2BDEA 4DQLA 3E1KA 4FONA 4MHTA 1KI6A 1ZIXA 3GLVA 2HNKA 2CXUA 3I2IA 2OLKA 3KB2A 5SYNA 3VKUA 5KJFA 1S7GA 1JHUA 1BQEA 3DEZA 4LHZA 4OJYA 5L4SA 2AWNA 1RAFA 1T5DX 3F3YA 5CDGA 1NBHA 1EVYA 4MVJE 2UUBB 2BUBA 1P9NA 3ZE0B 1NBOA 3SZUA 3I6IA 3CX8A 4MWDA 2JLXA 3PNOA 5JR3A 1P4JA 4NMHA 4W6ZA 4YV2A 2A7XA 5DNAA 2XUDA 4G5XA 3AU8A 3U9TA 1ZCJA 5JZSA 2DEUA 4KNYA 3BEOA 3TXAA 4WLEA 3PEFA 2XWBF 2YWRA 5ILGA 3CNOA 3ZPXA 5KYXA 5DO9A 3WLOA 1R0CA 4U02A 2FMFA 2YJ5A 1PI3A 1JZQA 2I3ZA 4MWBA 1U0OC 3A6LA 1TYEB 5EHQA 1G16A 4KV9A 3LL4A 4D44A 4D43A 2HCJB 2R4QA 4MPPA 4DLUA 2IHZA 3D7LA 1O96A 4JWTA 2VP9A 2B9VA 5U4XA 1VKRA 3R7NA 1BXKA 3SR3A 4UNNA 1U7XA 4M60A 4MXDA 3E6AA 4M7WA 1B74A 2SKDA 4UTXA 5IVDA 4FNMA 5TR9A 2PKQO 1QTNA 2PLAA 1AK2A 1ZM4A 1IWPB 2OM6A 4C0BA 1Q0SA 1Z56C 3VR4A 5B12A 4MROA 5F23A 2VP5A 2WYVA 2F8MA 3MYRA 4GMKA 1NMSA 3K9GA 3PXXA 3BHNA 4IIDA 4P3PA 4DIMA 4KITB 1MH9A 3K6SA 1FVHA 2PU7A 1WXWA 2P75A 4V0KA 3VOSA 4B6OA 2GAIA 5CITA 5TEWA 3KKQA 3FFXA 2B8TA 3TZLA 2QAIA 3FPLA 2L2QA 2NU7B 3AEQB 4NF2A 3U7GA 2R2GA 4Y2JA 4YDHB 3RJMA 1DNPA 1XJQA 2KJQA 4IIHA 2NTNA 3KZOA 4WZAA 1RPNA 3KOXA 3ZDBA 2GOYA 2QWXA 5IK2A 3UMMA 4ACAA 1LZLA 3LO8A 4MYTA 4RCYA 1CY1A 2OQ2A 1KVRA 1CY6A 3ZHQA 5ALXA 4IEEA 4AMVA 5JMTA 3ABQB 2PFSA 4MPRA 5EEGA 4GXNA 3C87A 2QZSA 3DONA 3L7OA 5A03A 2G9ZA 2ZRHA 3QHQA 3QVMA 1P39A 5AW5A 4ER7A 1NRJB 2HPAA 1IG0A 2GCNA 1HE3A 1QYDA 3QNMA 1ZU5A 2JAXA 2BGTA 2FWJA 2RGDA 3KWLA 4JLPA 4L9WA 4PFQA 4CQMB 5L7YA 4A5SA 3OM8A 1BEZA 1M6VA 3C8ZA 2GZHA 2FN4A 3KVRA 1XTSA 3D3KA 1I3MA 1P62B 1P73A 4QGHA 1H4TA 3LT1A 2AXEA 3F9IA 2YWFA 1QHYA 1VC2A 3GGGA 1PQUA 3GK3A 1D4AA 2QX8A 2D5LA 2JGDB 1WHSB 3G59A 1YI8A 4FGLA 4QAJA 5D5PA 2PKEA 4X66B 5U1PA 1ZAYA 4K9MA 5FFMA 5KNBA 1VB3A 1PSZA 2JLVA 4E70A 1JFLA 1J23A 3AT1A 3WGGA 4H7JA 4XKJA 1R64A 4IVNA 2HUNA 5CW1A 4H1WA 2AW3A 4ESVA 4JQYA 3HBLA 2GAFA 3HCBA 3PSHA 5D3MA 3QITA 1OBOA 3B1JA 3ESCA 2Q4OA 3SQNA 2WU3A 1MKYA 1TTQB 3DDHA 2X5OA 4ZTBA 3PUJA 2QLMA 4H27A 1QOPB 4UW9A 3ESDA 2DB3A 1MUUA 3E9MA 2RHRA 3V1NA 5HR5A 3AGPA 2O2XA 3NV7A 2Z6AA 1K4KA 1EUYA 2R66A 4BLOA 4MLPA 3KVYA 1MBZA 4DCMA 1YJXA 1RCFA 4K05A 4ZVSA 2GAOA 4JZKA 5HQ3B 4HUQB 6LDHA 3TQCA 4MVXA 3RHFA 1BDBA 4MVJI 3I2GA 5KQLA 2OGSA 2QTVA 2QRLA 3Q7SA 5JFTA 2ZCJA 3AF2A 1ZOPA 3Q72A 1SC4A 2Q9AA 4C0QC 4NYIR 4PX3A 3L7YA 3FWHA 1U7TA 1RXYA 2ZI7A 5TT0A 4OJQA 2OYRA 3NAMA 1M54A 2GF0A 4OJKA 4EVSA 3KYDB 5BQPA 1P1BA 1TJPB 1UP7A 1GG2A 3GUHA 1G5IA 1U9JA 3KXPA 4HJXA 4QOJA 5FOUA 5HBRA 3HS3A 1T24A 3Q85A 5M7EA 2AYYA 4LOHA 1K3FA 5C8DA 1R8XA 3C85A 2V03A 4YGXB 1BC5A 2ANCA 3H9EO 2GJSA 3VJLA 1CF9A 3ET4A 1PHRA 2A58A 3MAAC 1ZVMA 4KLAA 1NQ5A 3CUTA 1YB2A 4J0EA 3PYLA 4RD3A 1NW6A 1JHRA 4B3MB 1LBSA 4NH0A 2WTMA 2G08A 4CIDA 4Y0NA 4YJHB 2WF5A 4G1EB 4ARSA 3GEHA 3V7NA 3OKFA 2Y27A 4TV8F 1FU8A 3ET5A 4LJYA 1ML4A 2B5WA 2TMDA 2ZREA 5IKEA 5IXJA 2JJQA 3B7PA 4GLJA 3GFBA 3RFTA 1KYZA 3GL9A 3WX0A 2CFOA 4IRXA 2GKOA 2D7DA 2GDJA 4WASA 3I0ZA 4IUBS 2BPOA 5TV2A 5IMSA 1RJEA 1JH9A 2GLTA 5AW8A 2R47A 1N2CB 4OSEA 1QU2A 1E5VA 5DI3A 4IXWA 4JUIA 5CDSA 2ZZNA 3B6MA 4LTDA 4Q4CA 3A1CA 3TE6A 2Y99A 3D3QA 4YRBA 4JUFA 4BYGA 1BD3A 5JRJA 5B7PA 3VTAA 4BQPA 1Q7RA 2IBMA 5DM60 4E1BA 1C3VA 5JECA 4R2HA 3RAJA 2IP2A 2VQEB 1KYYA 3OIFA 5HZKA 4LNHA 3ZQ6A 3K35A 3WA7A 2V7TA 1Q2XA 3WHKA 3RS4A 4MGYR 3C70A 1J00A 4MMYB 4NE9A 1DJLA 5KTNA 1IBKB 4PPFA 4AJIA 1ORTA 3C7AA 5LZ2A 3W1EA 4TTAA 3RW9A 1P29A 3RCBA 2N1MA 2PGDA 3CLRD 3BB1A 4BO0A 2DRIA 5KPJA 1IXKA 3PRJA 5THXA 2FRVA 3NYRA 3QFFA 3VNSA 1P2BA 1BX1A 1A95A 2O52A 3V4LA 1KKLA 2FW9A 1AUXA 2PA3A 2Q4EA 3DULA 3K1AA 3RS2A 4EX7A 2BM9A 3TCKA 1WW2A 1NI4B 4X63A 2EU8A 1YTLA 1T8YA 1NPYA 2JCGA 4HO1X 1UBTS 2P9HA 3QNWA 4IOKA 4NBNA 4RHCA 3H3XA 3QLEA 4XWOA 4B4UA 4K28A 4YC7A 4ZVMA 1LDMA 2ZT7A 4DANA 2WNIA 3BQMB 1A8UA 3OA2A 3AHCA 2PHZA 1KJZA 1KO8A 4M4SA 3HVIA 1NMEA 3PRYA 2WVAA 1Z2OX 4MUJA 4ZU1X 2PA0A 4XR4A 1L5KA 4RETA 4HPJB 3T54A 4XRGA 4TVBA 3E9DA 3WZLA 3TLJA 2OP1A 5AW2A 2EFHB 2VBGA 2XYPA 3W1VA 4NK4A 4AT1A 2EIHA 2BGIA 2IC5A 3HN2A 2YRFA 4H0FA 3G2NA 2XGMA 5LNK6 2BD0A 3WMXA 2BGGA 3QI7A 1D1SA 3P2JA 4MKFA 2VJCA 3TLGB 1GLVA 1VKZA 4FCWA 3AEKB 4LXTA 4DCSA 4DC0A 3G0IA 1T0JB 4DOMA 2HJWA 2P27A 4TKUB 1P91A 4JB0A 2XR1A 2VUUA 3HBMA 121PA 4CGYA 5LC1A 3PJEA 3CFYA 3OZWA 5IMBA 1GTMA 3O21A 1BAPA 3TL2A 1BDJA 4N1AA 3WK6A 2NZWA 3DVQX 2JFNA 3S28A 1IBCA 3ICVA 1R5NA 3THWB 5AUPB 5E6RA 4AXBA 3OHPA 1WW8A 2WFLB 4GKBA 4IHJB 4UJ3A 1V48A 2Z0MA 3EGXA 4BNMA 4AWXA 5J4LA 1B73A 4GBMA 3TL3A 1QFYA 3PVSA 2QMOA 5HDBB 4F96A 1ARZA 2O1XA 3DDWA 5ENVA 4H3HB 4XCXA 3FCXA 4N3AA 1TFUA 1ZJJA 1VE1A 4FDUA 2IIPA 1ZOSA 3MMNA 2XUKA 3VZPA 4OD0A 2J0VA 2ZJ8A 4MK4A 3JYPA 1X80B 4FP9A 2C99A 4HDAA 6YASA 3AFGA 1E79D 2WT4A 5LWHA 2ZI5A 4CQLA 1V8ZA 1B2LA 1U0LA 3OE7A 4GR9A 4A1FA 1VMEA 3FHTA 2CMGA 2WINI 4BZWA 1S2DA 3G0CA 1XAIA 2VDWA 1T29A 4LXUA 3O8LA 3OH8A 2LV8A 4KQHA 4CKXA 4IH4A 4ZEWA 1WG8A 3TM5A 1U3FA 4MQFA 3I92A 1FL9A 3UJDA 3B12A 1Y6FA 3KL2A 3TTXA 2G80A 3Q0TA 3HFJA 3ICOA 3VBCA 4MINA 4Q37A 5ADVA 1AY0A 2EW1A 1DX6A 1NU8A 3QYFA 4I7EA 1LBIA 4WY2A 5CW2A 1E2IA 3DBRB 3I61A 2GHTA 3HP1A 4OY3A 4MGHA 2QHXA 4F3TA 4GLLA 3V48A 3CX4A 4AN0A 4B4KA 2Z8ZA 1JMKC 2J0SA 2HGZA 2FZLA 3HJTA 3R6DA 4R1PA 2K6GA 4BVEA 1E8MA 1QZTA 4JCCA 4L6AA 3R3ZA 4BFXA 2GS9A 4HLNA 2G9NA 3E5RA 2V7WA 4NJEB 3M4XA 3AK4A 3LHSA 3HB9A 4QYIB 4B1FA 4JJZA 4GGPA 4PLHA 1USIA 2EW8A 2WD9A 2HREA 1DRJA 1GL7A 1V71A 2G25A 2WJPA 2H0RA 3QELB 3I1FA 3MF4A 3X1ZA 1Z0ZA 5EVJA 3S81A 2YVLA 1P9OA 2IHYA 1SWWA 1K98A 3FMOB 4U39A 3QTTA 2RD2A 1JLLB 2P9ZA 1T91A 3NEAA 1PRYA 1BFUA 5JBQA 1PVOA 4W63A 1M2VB 3DEFA 2FMTA 1M5TA 1IUOA 3PE4A 4NBUA 4I4NA 3VBEA 5JPDA 2AD5A 5AK0A 3VR6A 3KJIA 5IAAA 1J8FA 1TF5A 2X0JA 1ZN8A 4JIMA 1SC3A 1HDIA 3HKDA 1QIDA 2HHJA 2ZITA 4O63O 5EWLB 3MWEA 3AILA 4L02A 1GYQA 1HE5A 3GLHB 2PJRA 3B53X 3TBKA 1H9AA 3TLBA 3I3SR 1C0EA 3ZE6A 2O48X 2E55A 4A16A 3LBFA 2B99A 1W2GA 3URMA 3ZCXA 3O8RA 1VLQA 4WWHA 1G5RA 1VZ3A 1DAOA 2HLDD 1EVZA 2UYOA 1JBKA 3SK0A 4JT8A 3CSSA 2H0QA 1R5BA 2Q0HA 1E99A 3HBAA 4X9XA 4QTYA 3RSZA 1QVWA 2A9OA 2VJLA 4OA5A 4DY6A 1KK1A 4EUHA 3C6QA 1Y63A 3WGTA 5KBYA 3SU8A 4R0NA 2AC4A 1X8KA 4ROSA 3MG9A 2GCPA 2CKDA 2FN7A 2QJWA 3IPRA 4B0OA 5L3SB 4UE2A 1R6XA 2F17A 1NIJA 1OXSC 2JA1A 4FYHA 4D4JA 1KQNA 1M2KA 1SUAA 2VL7A 4RK5A 4ZJPA 2I6UA 4C20A 2IDJA 1ZQ9A 2YN0A 3IQWA 3KCQA 3PLRA 3RWOA 2B5OA 3B1ZA 4BMVA 1FJXA 2D5BA 4WMLA 5IBQA 1VHLA 4DZRA 4Z7QB 5JH7F 3L41A 2JW5A 2H29A 3QG1A 4KQMA 3NYWA 5E7JA 1E3MA 5HX7A 3T1NA 2X6QA 3FTDA 3L6DA 3L79A 3FWPA 2Q3MA 5DJ5A 4ENVA 3R7AA 4II7A 4UCWA 2P5SA 3TTYA 3OLCX 2OO3A 1BVRA 3DC7A 4C0JA 2EKLA 4E88A 2EZ9A 4E08A 1ZR4A 3VPDA 3BE4A 3T7RA 5FTMA 1C1DA 3CE6A 4X90A 2Q2WA 3AI7A 1DKMA 2OAP1 3K3PA 1F2UA 1L5OA 1K9SA 3GFGA 3H9GA 2HRBA 2X7JA 4ZN6A 3ZWQA 2RAVA 3SXPA 2AS0A 1B42A 1PWHA 2MR5A 1G21B 4CFYA 4OX9Y 4QIHA 4DQUA 3DO8A 2NAFA 2BCEA 5LYJA 1L4UA 3ZLVA 2C7OA 1EK1A 1BJRE 3DTVD 4BP3A 2V6GA 4MIYA 4P84A 5EXSA 3T12A 3MJDA 4O8CA 4KNWA 4FX2A 4NNJA 3I23A 2WMNB 5LOVB 3GHYA 4HGNA 1DIOB 3OLZA 4L76A 3FCAA 5A6SB 1SD5A 5H82A 1STOA 1L7VC 2YWJA 3H5WA 3PHIA 4BO2A 4ZIRB 4GZ3A 4PNZA 4OA8A 1RYHA 1G55A 2LBPA 2FE4A 5M29A 1F8GA 1G9XA 2VXBA 3PFIA 5HA5A 2FF5A 1RWPA 3NJRA 4A2WA 3ML1A 3TLMA 1NQOA 1EKXA 4JBYA 1IEWA 2F67A 3DFMA 2NAPA 5DHTA 2GETA 2W6JA 1N0VC 3F9CA 2LZ0A 1SB9A 1AKTA 3QNUA 3T8YA 2R5WA 5LUAA 1VXRA 4IRUB 3GVCA 3KVOA 2GN4A 2EQBA 3ZUGA 2E37A 4OOEA 3ROTA 2BTQB 1Z2AA 1H9BA 2PG3A 3K9QO 1JKJB 5JADA 4DZZA 2GPTA 3DA8A 4XZ3A 2AK2A 3KFLA 2PKRA 3E7FA 3UMVA 1EPUA 3DAFA 4B7UA 4B0PA 1U0FA 3T3EA 3M1IA 5CU7A 4RLHA 4Q4JA 3UMGA 3AM5A 4E5KA 1Y3AA 3TGPA 5BORA 1E9CA 1NMXA 2VJPA 3F46A 4ZVVA 4MW7A 3H1BA 4ND6A 3DHWC 4UHFA 4AJPA 2Q2NA 2FXVA 3W5IA 5E9AA 1P44A 2C4MA 2XNDD 3MXTA 1Z63A 4R1LA 1KAQA 1LPSA 2MSKA 2PL1A 4HSGA 2F3RA 1HTBA 3KEGA 4J1TC 5EJ7A 3ABRB 4CMEC 4K6GA 3AJ9A 2POQX 3QGMA 4F3RA 3HZOA 1GL3A 2F3QA 4KE6A 2SBTA 3A4TA 4MRAA 5HYVA 5AI8A 4BQRA 5K3EA 1NW8A 1EGHA 3JAKB 1A9OA 3RO7A 1JIKA 1GG9A 4UD2A 3UGTA 4A8HA 4PAQA 3N9IA 2C95A 2Y6UA 2J9FB 3I6ZA 1A88A 4QQ8A 4O29A 4KE7A 1AGXA 3AZOA 1K0UA 4WKGA 3TTWA 4BKMA 1OF1A 3W5JA 4FQ7A 2GM9A 3C6YA 1GZUA 1WSAA 2DY1A 2HK9A 3NGXA 3LU1A 3UWSA 2ZWOA 3F6CA 1H1LA 1T43A 2C2HA 2QL6A 1BJKA 1IJBA 1OV6A 2Q3CA 3QUAA 3OPYI 6NULA 3PU6A 5T7BA 2JK0A 2JAPA 1LLUA 4FT2A 2JD0A 1GZ7A 1XRRA 1M2OA 5I8ZA 1AF4A 2Z95A 8LDHA 3G02A 4X1IA 2DUNA 4NMXB 5IEJA 2GPNA 1GTRA 1R9NA 2CL5A 2IE8A 2ZRGA 1ZH4A 5FL3A 4B46A 2E4VA 5E6SB 2ORIA 1T1GA 1EZ4A 4QUBA 3WIEA 1NJ6A 2IZZA 2XQFA 3ANLA 2YR0A 1OB5A 2UUCB 4IQ4A 1UJ6A 1VSTA 3FAZA 1RYFA 1VXOA 4CWAA 4MUAA 3FSRA 4XDHA 1NZFA 2OZLB 2W98A 2NT3A 1HDCA 4HEJA 3WNZA 4RJKA 5FWNA 1X7XA 1EYZA 3GA5A 5IABA 4L5CA 3B6EA 1Q2UA 4HXYA 4EGFA 1NBAA 1JR6A 4US1R 5U4QA 1OFHA 4D6PA 2AN3A 1DAEA 5T6MA 2Z56A 1NF8A 4MV7A 2GJ8A 5HRAA 4QRHA 3LQYA 3PFBA 4EL5A 4N5NA 5REQA 4EFNA 5IC6A 3D4LA 4JWKA 5IUJC 3A0RB 1Z5NA 3VFDA 3M8KA 3HCPA 4EG5A 4TMZA 4EW6A 5CA0B 1VB5A 1W9MA 5AYVA 3ROMA 3ZWDA 3AXSA 4TX1A 4GWGA 2REXB 3DO5A 2OMEA 4RZXA 2V5UA 3KC2A 1VLJA 2GZRA 3TGWA 5KYGA 4KAJA 2JIZA 3A1NA 1COZA 2GI4A 3HNOA 4RK0A 3MUFA 5EGSA 3W79A 4BU0A 5CDFE 2RSLA 3OKPA 3BXEA 2EL7A 2Q5LA 3M6IA 2EWMA 3C3DA 4IEFB 3K8ZA 1J2RA 4NBWA 4XJTA 2XYHA 2PN1A 1Z7BA 4AJ9A 4F71A 2PD3A 5LDDC 3W6NA 1X13A 4II2A 1IBSA 4GVLA 2Q28A 1EH5A 3LBNA 1YZ3A 3SHWA 4YRNA 3E4DA 2PMEA 5BWCA 1MV5A 3F97A 3RDPA 2R8OA 2BEUA 4O0MA 4BWFB 2XB8A 2QRVB 3KOMA 3WYDA 1CUWA 2A9QA 3UOWA 2ZIUB 3HKEB 5HVNA 3H8SA 3W5HA 2KS6A 3V97A 3BJEA 3D1VA 6ADHA 3V4ZA 4NEQA 3G2QA 4XWWA 1PL7A 2ZRBA 3EIOA 3Q7IA 4GRAA 4LYAA 2Q5OA 1LFAA 3EBOA 2DTEA 2NO6A 3UICA 1Y5NA 4KOEC 3I9FA 2I7VA 4C2TA 2XWSA 3K0CC 5IFLA 3W5VA 1PEKE 2VYVA 2EVWX 5EXPA 4BV2A 1WTAA 1JHMA 2DAPA 3FDIA 2R2AA 3PUIA 4AQ7A 4N7RA 4YO8A 5DN9A 2NUBA 3NDPA 4PAMA 4RVGA 4RVDA 1NQXA 5D5HA 5H02A 1WS6A 4ATNA 3QMMA 1U2EA 2C2GA 3F1KA 5F98A 3EVCA 1JT2A 3A9WA 3QVGA 2V4ZA 1K5DA 4GRDA 4GW3A 2QZ4A 1MO4A 2BHNA 3KU1A 4DSZA 5JD5A 3ZV3A 4I1IA 4BMZA 1JA0A 2J5BA 4OBWA 5TJ9A 2V7QD 3H83A 3OSUA 5FEUA 2X14A 3O2NA 4HS9A 3OEEA 4LJ6A 1WZUA 4EJ2A 4MRPA 5FOQA 4QPZA 1AT1A 1QH1B 2KWIA 5AOCA 2CBGA 1KJWA 4FGWA 2ZJ5A 4XGRA 4RGVA 4PZZA 2Q6TA 1U8XX 1GPDG 1ZCBA 3CONA 4LOAA 5DWQA 4YPVA 3EQ2A 1ZD4A 4AICA 1I14A 2NZUG 1CJUC 1X9HA 4U3JB 3E9CA 2QI9F 1JG1A 1N3YA 2EKBA 3NHUA 2OXIA 4NONA 3T1OA 4QGGA 4HRXA 3JTMA 1T5SA 4NS4A 3CXUA 3R5XA 4Y2GA 5FYDA 3EXEB 1FRFS 4ZYXA 3L7IA 4OXNA 1LDYA 1BNCA 2IODA 5BUQA 1J42A 3L7BA 4DSTA 1GO2A 3AOGA 2HNAA 2OHOA 3Q8WA 1HH4A 4HDKA 3ZHVA 2GEFA 4HWPA 5FULA 5AUQA 4BS9A 4MUIA 2IBTA 4H17A 1LRKA 3SKVA 2OORC 4TWRA 3RJZA 1DQPA 1QHNA 3W7VA 5AVVA 2ISSD 2YFHA 3QY9A 3ZDFA 1UL1X 4DRYA 3ZKWB 5AM4A 1M6YA 3BVPA 4ZOCA 1G6OA 2DTDA 2YY6A 3DFUA 2O3RA 3HA3A 4G4JA 4N0QA 5CA1B 1XZCA 1Z74A 2JI8A 4QFMA 5K8TA 5AJYA 2WPDD 4C3ZA 1RBYA 1HORA 2RIPA 3O7WA 4XJSA 5CHEA 2HU5A 1TLTA 2CF5A 2HLNA 4A0FA 4PZAA 2YY5A 4QREA 4YT2A 1ZYUA 2PL9A 3UY4A 1ZL2A 1HA3A 4HWTA 5BO5A 4LS3A 2AQKA 2X9LA 5KQGA 4QL3A 2HK8A 1NTOA 4PVDA 1F8YA 4A2QA 3CLUD 3OOWA 3OCVA 4WY8A 3T0IA 2JVJA 2Z57A 5DW3A 3V7WA 5K0JA 3KELA 5G40A 2BFFA 3L9WA 3G5LA 5AI5A 1PUJA 5ALRA 1YJ8A 2XAAA 3B51X 3HJRA 5ENDA 2G9VA 2NMVA 3N8HA 4J91A 2ZAYA 4XUDA 3H2IA 3JYLA 5L51A 3P2OA 1QF9A 4BTEA 2PPLA 3HKCB 4US0R 2FPRA 3UJ7A 1Q1BA 3UATA 2WABA 3D4OA 5I3ZA 3PNQA 5CIYA 3U7RA 1OLSB 2ZANA 1H2YA 4JMPA 3IE2A 3DMTC 3FB1A 3RARA 3NFYA 1TECE 3FJ1A 1X77A 2JHGA 2R25B 3C3XA 4FIZA 4CEHB 4J2OA 3CH7A 3ASZA 4HLCA 5FO1A 5ECGC 1YB7A 1FU7A 3WKBA 2K87A 3NBQA 4J16A 5HZGA 1KZYC 4FI3C 3GGJA 4C5BA 2CHFA 2GZDA 1T6BY 4L8WB 3VX4A 5LQDA 2ISCA 2J6CA 2PIAA 1NQTA 1T5BA 1Z13A 2R8RA 4U0KA 3IEKA 4JLNA 5EQDA 2NVBA 1E77A 1YZLA 2NU7A 2QB5A 3AEQA 4AKTA 1IBMB 2FRDC 4C7OB 1FSSA 4Q1AA 1JZTA 2IXTA 3RIMA 1M1NB 3KJXA 1QONA 1UMKA 3PNPA 1SVUA 4RS3A 3RVKA 1GA4A 4XDZA 1H05A 3EFHA 5I7RA 4PSAA 3EZ6A 2X86A 3BGWA 4DRXA 2KX7A 1FRZA 3SCZA 2GILA 1KC3A 2RH5A 3VNAA 2DETA 2CJFA 3N2NA 4JI0B 3H9UA 2OP0A 2PVCA 4KAAA 2I2CA 2IKQA 4UQOA 4ETMA 5T4EA 1JDNA 1FCJA 2PQ0A 3X1YA 1KI1A 4RTRA 1NUQA 2OBFA 2P4QA 3IBGA 4HXEB 4B5LA 1KYTA 2A1UB 2QX6A 2ZBPA 3GRYA 3PRHA 1BXZA 1LRJA 1P7WA 2VNJA 4EPXA 2J0EA 3CPJB 1YUBA 5BSTA 4HN4B 4NR0A 1UJ4A 2Q6IA 3V8RA 1S3GA 1WSDA 5AVJA 1F60A 4GDFA 1IHDA 2JGDA 3RU9A 3PPXA 2CXQA 5EIOA 2F1OA 3AR3A 3H2KA 2VJMA 1AXGA 2Q1SA 4P7JA 4W1QA 4ZHQB 1SM4A 2E87A 1O9GA 5T8KA 4DAEA 4Q4HA 4E5NA 1NYQA 4HS4A 5SY9A 1NYLA 3FFAA 3OOHA 1C1YA 1W35A 2HJRA 2J3MA 3BFJA 2C8VA 4C07A 1CUBA 4NC9A 2IOYA 2LP4Y 1MAWA 5JSKA 2G0AA 4DMGA 1RHMA 1AKVA 1NM5A 2YHBA 1EE9A 1PJQA 1UKYA 3FDZB 3ZCVA 3UWDA 1D2EA 3A1VA 3H04A 2FZ4A 4M0CA 5J4HA 1Z0UA 3MAGA 4FBMA 1V1RB 3H2JA 1GDHA 2NYAA 4KO8A 5CM9C 4NECA 3RSHA 3X1WA 3JVUA 2RHGB 3IGFA 4YP0A 5KNDH 1AQJA 4I4CA 1O1YA 1UKZA 1W75A 4KPUB 2CJWA 2B21A 4IEIA 4BNIA 2X9GA 4JBIA 5HQ3A 4HUQA 4K6HA 1VL0A 1D04A 1PJBA 4BJ6A 4EARA 4TXJA 1II9A 1U2TA 1M7HA 1U0NA 5C35A 4NE2A 5HXAA 4Y8VA 5IT0A 3ZQUA 3GJQA 3IE0A 3AVXA 4EECA 3FWYA 1XEAA 5EQTA 5FFFA 3ICEA 2R3SA 4DMMA 1P81A 4HMPA 2YHUA 2RHWA 4XVCA 3QPCA 1DWOA 4FMCB 5C81A 5A4DA 1ZI8A 4XGNA 4MUKA 1GGEA 2ZBRA 1BYUA 1PJ4A 2Q8NA 3B5JA 3FVVA 2IHVA 5JI3E 5KYWB 1BHSA 3BMQA 4E07A 1RNLA 5BT9A 3B3GA 4O4IA 1V1JA 4YCMA 3N70A 4Y6OA 4ZYVA 3C48A 3HY6A 2UUAB 3IODA 3COVA 1SZPA 3N8GA 3B36A 4YJHA 4Z6KA 4N0EA 4JC0A 2WU4A 4TYMA 3U4QB 4R0MA 2XWQA 3E2IA 4KFRA 4U63A 4B9EA 4DT1A 2ZYSA 3AF1A 1PZFA 1GKLA 3T9BA 4ZJZA 1XIVA 5KREA 2FW0A 1QPGA 2RHHA 2CLIB 3KL4A 3QJYA 4Q7EA 4YRCA 4NNPA 1I9CA 1THGA 3ZVRA 4CDGA 1BCSA 1ATZA 4ZT4A 1NI3A 3F71A 3LUJA 3G2HA 3WV5A 2KQUA 2R48A 4D9BA 4UHHA 2BUCA 3DNMA 1EVQA 1P74A 4MW1A 4RU1A 3V4PB 4Z0PA 4F12A 2ZPTX 1JEJA 3P0EA 4W9NA 3LQ4A 4HI0E 1ETHA 5DXFA 1DZIA 3V9AA 4PHGA 4HYQA 5IARA 4J75A 3CRW1 4X7MA 2ZIXA 2HQOA 2BFOA 1D8AA 4YJ3F 3TQFA 3PF8A 1XMSA 3N7AA 5DSZA 4BRSA 4YRKA 1QP7A 1HE4A 4WKNA 1QGUB 2JD2A 1LD3A 2ZRNA 3N3AC 4UHKA 4R8KA 5H3HA 4G1FA 3HCFA 1T8RA 3IT0A 3GLKA 2Q2OA 3WWEA 2ONZA 2HIMA 1N75A 4JI5B 5C53B 1OT3A 3S2SA 3HEMA 2W6ZA 3CH4B 3TLZA 4YFYA 2RGNA 5ALTA 1YAJA 1BMFA 5LVAA 1J9ZA 5IYZF 3GLFE 3AINA 2X8WA 2I8AA 1DOHA 1E92A 1T3ZA 1N57A 2ZSHA 3AIOA 3EPRA 3ZV5A 3ZHSA 1YIOA 3QE3A 2NYVA 5CCDA 4OB7A 3UBTA 4OQMA 3JATB 3BMCB 3WLTA 4PN3A 2YOGA 2IUUA 5A4IS 3RODA 3WMWA 4EZBA 3GZ4A 2FQYA 3KTAA 1GVNB 1GARA 1HOTA 1T36B 1TUBB 2C57A 2QM7A 1N2EA 3GGDA 2DHCA 4V0SA 4YI5A 1S7CA 4BO5A 3C97A 3FOBA 3DDOA 4BWYA 5BWNA 3PHLA 3T3HA 3H75A 4R9UC 5H4GA 1ENZA 1A9XB 5HJ7A 1Z22A 3V8QA 3OO1A 5HIIA 5LIRA 4OKSA 4D8XA 4N6NA 4C5AA 3G0BA 4RA6B 1X70A 4BB0A 1P61B 4LPSA 4XYMA 4EB6A 1V7PC 1F06A 4GBGA 3O2QB 2B92A 1OAKA 621PA 3OOSA 4RVSA 5JAHA 5KTTA 1UK6A 3KWJA 5ICFA 2VAXA 1JYEA 1TVMA 3BFXA 3UZUA 1XP8A 4BVBA 3CX6A 2FNAA 3BULA 5K3DA 2I7XA 3NCHA 4AP9A 1V96A 4I6JA 1P8AA 4TKUA 1ADJA 1N8TA 2NU9B 1GFSA 2A0WA 2AK3A 1P5HA 3TNDA 4CUKA 4DLYA 1BN6A 2Z43A 3MSXA 3DMPA 2BM0A 2BFDA 1BDHA 3FM9A 1LU9A 1PUXA 4PRZA 2I55A 2ATCA 2SKCA 4FYVA 2OCBA 2ZJBA 2C2MA 3DDZX 1KERA 4C43A 4DYHA 1PUIA 3O94A 3PQ2A 4NI5A 1JNXX 2QVGA 1U4OA 2WZQA 4TTIA 4RVFA 1AXEA 2W83A 1W1WA 2EL9A 3QEJA 3S2GA 4F2DA 1DG1G 3AUYA 2XGSA 4FFMA 1EHCA 1OTXA 1S2LA 1EG7A 3ER6A 3L0ZA 3VI4B 1UR5A 2WA2A 4BLVA 2J0UB 1ULUA 2EW2A 2BHSA 4M1TA 3FD8A 1K3TA 1EWYA 2GUGA 1Z7GA 4J07A 3TPCA 2IZ5A 4RJTA 3FOFC 2EEPA 1H3EA 5F2OA 2PKQP 4X92A 2D06A 4GX2A 4K6CA 5FUXA 3D8SA 4LWPA 4ZQCB 3HB7A 1W88B 1Q0PA 3BWDD 1VL8A 3ENVA 4P92A 5L8VA 5LWQA 1AUVA 2J7PA 3JW8A 3P2EA 3TQHA 2G1PA 1QJ4A 3H1PA 1JG7A 3GZNA 3IJEB 1RIFA 5K1ZA 5KYNA 1YRLA 4GZMA 4QEZA 3WLSA 1YR9A 3BRWD 1WXFA 3STYA 1SOUA 4PZ9A 4HDSB 5DP2A 2GB4A 1XEFA 2DLNA 4Z9YA 1LI7A 4BMPB 2R8BA 5JEEA 3KR2A 2ZEJA 3E9RA 3ODPA 1UWCA 2OV1A 4BP9A 1N1MA 4JVMA 4QX6A 3MPOA 5FYQA 3PA6A 3ETCA 1XKLA 3T0GA 4C0XA 3D3JA 3A6JA 4NPHA 4OLFA 5DK4A 4LZOA 1FDRA 2ST1A 4XWAA 5BSEA 3V80A 2LIPA 1U2QA 1WBDA 1FLNA 3H1FA 3UOGA 1P0QA 5BYBA 2XHEA 4C78A 3BCUA 3KQSA 5FEMA 4P0QB 1RKXA 4IXDA 4DR3B 2GVDC 4WH0A 3OQPA 4YRTA 1T5LA 3VKHA 1J2YA 1L7PA 4NJEA 1C3OB 1CLEA 3O4VA 2IYFA 2YV3A 3AZQA 3KP1A 4RM3A 1W48A 4QGBA 4WXEA 3QJ5A 3HL4A 5TPWA 5KWIA 4RW0A 4G0VA 2WAXA 1X74A 3OZCA 3LD9A 4JLSA 4A82A 3ECCA 4L3WA 1CUZA 1XDDA 1IN7A 2VJQA 2WWTA 3BORA 5H9WA 4JUBA 3HWWA 4KGDA 1E6UA 2IUSA 1VKNA 2B82A 2GBLA 4EF6A 2PSEA 3LP8A 2D0OB 3B2NA 4LDPA 3L4BC 3F6YA 2ID9A 4EFKA 3BM5A 2JRCA 3P2MA 1XWWA 3T9CA 4C5CA 3LRTA 5CNJA 1RHKA 3ZDDA 5K45A 3HSYA 3WBBA 3KZMA 1E6LA 4QDKA 1Y9DA 4PLFA 4EG7A 5JYCA 4JOCA 3VJKA 1K92A 4BV9A 2BP7B 1LGYA 1YQTA 1HMPA 4O4JF 4RM2A 2XXAB 3KETA 2J7KA 1PZHA 2QAGC 4NHEA 1CUCA 4RENA 3LTNC 3IQZA 3OX3A 4NS1A 1TAGA 1YHYA 1Z3IX 1RADA 3N07A 4LTNA 5C8YA 3TCNA 4EHIA 1L5VA 4W6QA 3FNRA 4DXHA 1FJ2A 1WRBA 3L5KA 2P7IA 1FFWA 4AY6A 2Y68A 3QF7A 1H2AS 4D98A 1P2FA 4C6RA 1CUEA 2E89A 1VA5A 1ZN9A 1J2UA 2GFHA 1RTKA 1FXSA 2CWDA 2HJHA 2CXTA 1UWLA 4FOSA 5FPHA 2C2XA 2GRUA 4IV5A 1NN5A 2OAEA 3GT7A 3L8EA 1WXDA 4R2XA 3TKAA 1UEXC 3GYBA 4INOA 2I54A 1BVYF 3FNBA 4M0UA 1JE1A 3UAYA 1A9ZA 1C29B 1QDLB 1SU7A 3DMHA 1GGKA 1WUKS 4OHXA 1ND5A 4UUMA 1G291 4NBVA 2O2CA 3PDHA 1UJBA 2ODEA 4IJKA 4N8EA 5L3QA 5AKHA 5CG1A 2BMEA 1ZD5A 5IC4A 3RUHA 1GN9A 3N0WA 3GJSA 1JSRA 2CJPA 4HR7A 3VR4D 5E3HA 2PUBA 4H6WA 4N12A 1MRSA 3A1EA 2IX9A 2DFDA 2YHIA 3FSGA 4H7DA 1H2EA 4INPA 5EKXA 5GM1A 4DIDA 4S3MA 1EFPA 4HQKA 1ZM2A 1VBKA 3RH0A 2Z3VA 4X64B 1VKHA 5KYYB 5A0FA 4BFTA 5LM3A 2PD6A 3H1EA 3N2KB 4JL8A 4BQNA 2DWUA 5IK2D 2AXNA 3IQGX 2DLDA 1TXGA 2AW5A 2RGAA 4MEAA 3UGQA 3N6XA 2QTFA 2XBLA 1N5IA 1UMBB 3VVMA 4BKRA 2IDKA 1P1KA 2II6A 3EZLA 3I39X 3NASA 5K3FB 1XE3A 3LXXA 4PLZA 5KO2A 2QSUA 1G21A 4R9NA 4AROA 1XTPA 4QHTA 1U0GA 2QN9A 4JJ4A 2MSEB 4WA8A 3IMFA 5TSDA 1JHQA 3QVKA 4GZLA 4UOEA 3AY3A 2YC2C 2HF2A 2HAEA 3SLKA 1IB6A 3STXA 5LOVA 3W6OA 2ZDGA 1OR8A 2A5JA 3BWEA 2ZWPA 1NW5A 4R1OA 3THYA 1N5LA 1R37A 1JP7A 1QQAA 3BE5A 5F33A 2H5IA 2QD5A 2QP4A 3F7OA 4IIUA 4EUEA 2G83A 4IDPA 1Y6ZA 2IRWA 3PT5A 5DNCA 3JQ6A 3SZRA 4RSGA 3WBFA 4CKZA 5FI5A 1SIOA 4ZCSA 1K8ZB 3EDYA 2O8EB 1V3QE 1JHPA 3HDGA 3I58A 3TTVA 3VR2D 2ZRKA 1VYTA 1NUTA 2IV7A 2H57A 4F1WA 5KNBD 4TWIA 1QH8B 2WDZA 3MB8A 3UMSA 3O6VA 4HNRA 2X0DA 2C4WA 1BQ4A 3PDJA 1W5FA 1FYDA 4FFVA 3LC7O 2BM8A 1JQKA 4RFVA 3ZXXA 3PC7A 3ZIAA 1RXVA 2EERA 1UZUA 2QV0A 3C3MA 4JNKA 4LHXA 4GKJB 1GNLA 1E18A 3IOCA 5BRAA 2QLTA 3NP9A 4YQYA 2XF8A 2RH8A 3QHPA 5CCEA 1I4TD 4WZ6A 3B9QA 4UBIA 4BN5A 4OI0A 3VH4A 5LN1A 2XTZA 1PVVA 4XGQA 1GN8A 1JEEA 4B74A 1Y7HA 3NWEA 1KJ9A 3G7SA 1T35A 4D0LB 3PQ8A 3VPSA 1REQB 3LQFA 2REQB 1QPZA 2BMAA 3WDSA 3DG9A 2Y2UA 3JQBC 3HLTA 2W4QA 3ABZA 4XWTA 4G1CA 5MHTA 2X8JA 3D4IA 2QNRA 1QCCA 2H4XA 3BXZA 2QOEA 2YOHA 3IAEA 5EKDA 2AOUB 2NV2B 3NJ8A 4EMSA 4WBNB 3NBUA 2ZFUA 4RKRA 1CUDA 1JFVA 1LVGA 1T5TA 3LCMA 2AKEA 1RQLA 1MQSA 2XB9A 1ZPDA 4NP6A 4YTEA 2Z6UA 1CNFA 2GZ1A 3EOZA 4Q16A 4ND8B 4JP5A 3RVNA 1KKUA 3IKVA 3SXUA 3JD2A 2OG1A 2AEEA 1J2JA 4JZYA 3UJ6A 2M2IA 1PTKA 2ONCA 3AUXA 4GI1A 4LVCA 5FOXA 1OTYA 3SE0A 4DJEC 4ESEA 3MD0A 5J43A 3G9UA 4L8YA 4KGXA 4QSHA 1FSPA 2J9FA 1BW9A 1V16B 1HMYA 3DZCA 4HDRB 4YP6A 3U4HA 2HFKA 5BOSA 3T1TA 3RNOA 3M49A 2RJ3A 2GN0A 3RK1A 3CLTD 1T2DA 2NU6B 1IPEA 1L8AA 5ALSA 5KNDA 2JJMA 5I9IA 3G8CA 1LC3A 1GQQA 3K70D 1W36D 3H4TA 4M1KA 5K8CA 1W1IA 3ENKA 4LYYA 4G63A 1NOIA 1NYTA 3OU7A 2YZMA 3G8YA 3DF7A 3ILVA 5EMNA 5B3AA 4EO7A 4XQ0A 5HIAA 1VIVA 1E2KA 3OM0A 1UKVY 2A59A 2GCOA 3AF5A 2VCHA 4IHKA 2MYPA 3ZW9A 3FUVA 1QH0A 5E6SA 3IAS1 3B2EA 2Q6KA 5JJIA 1N9KA 3FGZA 2WHXA 1RQRA 4IJMA 1X1CA 3UH1A 4MVJH 5K0GA 1G38A 2IP4A 2ZUSA 1C9KA 1Z4PX 1P9LA 2FPWA 5IVIA 3TFQA 3K0AB 4LYHA 2GD2A 2WQ6A 2VPYA 4KHPB 2W6PA 3WLKX 5GJBA 1RM4A 5AJVB 3M9WA 2KM1A 4DM4A 4UDNA 3GEBA 3ENWA 1ZY2A 3O4FA 1OWMA 2E4UA 3QJGA 4JSYA 3GRVA 4W7HA 4AN1A 3PA8A 4D4IA 3EEOA 1BKSB 2A0YA 3IQEA 3WXMA 5HK9A 4WQMA 5L4LA 2H1CA 4TLLB 3I32A 1NPDA 3ADOA 4BQQA 4AULA 3RLFA 2PD4A 3QLUC 1JDPA 2DE0X 4I1OA 4YRRA 1HL7A 3EE6A 3ZGVA 4BNTA 4QKQA 1YR1A 3NIDB 1B0ZA 3AIIA 3W5BA 2CCJA 3FCSB 1J21A 2FOLA 3EVGA 4PBTA 4XR9A 3PI7A 5CA0A 2VF4X 5T5QA 3LUBA 3PCRB 5SY6A 3EIUA 3M6LA 2BHLA 4HTFB 3C7KA 3URKA 3U3DA 4MP6A 1XYGA 4QD3A 3RK0A 4BQEA 1UT5A 1V9CA 4WNAB 2D1SA 3GJ7A 3E7WA 5GOTA 5GPBA 4F0JA 4CM3A 3P1JA 1W85B 2RHLA 5J2TF 4F5WA 2J3HA 4UNRA 1RJWA 1YNOA 3E9ZA 4N40A 5F5LA 3S44A 3U62A 1G8AA 4AECA 1CUJA 2IXFA 1IN5A 1RPZA 5TLSA 1ZIDA 4OHZA 3OQIB 2VQSA 5IDXA 1HLDA 2ODNA 2D5CA 4Z0NA 4G0PA 2XX3A 3BIWA 4QSMA 1CTQA 2EWWA 4H9GA 1OBCA 1FMCA 3OLVA 1CUHA 2LD4A 1MX1A 2CBXA 2FZCA 3HKEA 2Y8EA 3QQ5A 3K2BA 3KR1A 5IM4A 2NNLD 3VJMA 1ODIA 2DH6A 1IN6A 3PUVA 2FPGB 1EFTA 1YI0A 4ZU3A 2NO4A 2O9JA 3HPRA 2W6NA 4LW8A 2QN6A 3OUTA 2WWRA 3IHKA 4N9QA 4UM8B 4YJ2F 1F8FA 5JRDS 1ZLXA 1EBFA 1HFJA 1OJLA 3FUCA 4PO8A 2PSFA 3DO6A 1JA1A 5DT2A 3KU4A 1T8WA 1IJFA 2ON6A 3DMGA 3I9V1 2I3AA 4R69A 4AJ2A 3RRYA 5AOBA 3TSAA 4LOKA 2HSWA 4MI1A 2D1FA 1L8XA 1ZL0A 3EXHA 4JU8A 2OV8A 2X9NA 5JCXA 3M3PA 2DPYA 2V9ZA 4K87A 1WEHA 2Z3WA 4KXQA 1IYZA 3C6XA 1E7WA 2QUZA 2DWQA 5DMXA 4YMVA 2MOKA 2WJJA 4OP3A 3RYIB 4C06A 5I7WA 4JBLA 2E18A 5G4KA 1R0ZA 3KAPA 4Y2VA 1NUAA 3BZBA 4FDTA 4BB5A 2J4FA 3DB2A 2QYTA 1ABEA 1KEUA 4O4LF 2ZUFA 2ZJAA 1JJVA 3ZDRA 5B3LA 1SK8A 4OHOA 4DIKA 1EJ6A 1QH1A 2OILA 4NYJR 5DGDA 4F4FA 3QKSB 4UCXA 2BY4A 3WQHA 3ZTYA 4M37A 2X42A 4OQZA 1GGMA 4CMBA 1NUSA 4ND7A 3VH3A 3WY9A 4DG8A 3HI4A 1BXGA 4TYPA 3QU9A 3OE7D 1U0JA 4FBGA 4GC5A 4ZJUA 4A0HA 2HU8A 1U0EA 3N3BC 4HEA6 4M87A 3LQQA 3K9BA 5HG0A 7GPBA 3WDLA 2UZ4A 3OFKA 1PL8A 1LQ2A 4NZ9A 4PX5A 2Q21A 3H2ZA 4ZVOA 4HFRA 1G19A 3NBMA 5CVDA 1JEAA 3M5WA 1GPLA 2ID7A 2Z5VA 1XVVA 3JYOA 4FLEA 4PRKA 5I7VA 4ZOLA 1ADGA 4V39A 1HX7A 1A5ZA 3AG6A 3HYCA 4X95A 2J8ZA 4Y0AA 1LI4A 4BCCA 5LIPA 1II0A 5CA1A 4F91B 2RKOA 1D03A 1SHTX 3M4JA 1NF9A 2D7JA 1DSSG 1JJ7A 1WB5A 2V3WA 2H92A 3FYUC 3LG2A 5LP6A 3ST7A 4B3RB 4QBFA 5AKGA 3N5CA 2ZBFA 1FIUA 1OUMA 3IPYA 4WZZA 2GPYA 4F9TA 2XNCA 4R83A 1JQLB 2QLNA 4YJKA 2W2XA 1XYVA 4GOKA 1OZ0A 5KHAA 4LY0A 2F1IA 4NIMA 1QO7A 2Z4TA 3ROPA 1PX0A 3AM1A 4HYYA 1NLYA 1L4EA 3EMDA 4TGLA 2H54A 3UW3A 4KLZA 2XZTA 1X8XA 1VJ5A 2B25A 2RHOA 3CSUA 4WUVA 4CV1A 1DBQA 2FW1A 2ZBDA 4G5RA 4MCHA 3I9OA 3W2GA 3OJ0A 2J5RA 1O57A 2O3SA 3HR7A 4L8LA 1KH3A 5C3MA 4LVNA 5ALHA 3VR6D 5LXTB 1VOTA 4L22A 4YBRA 5EA2A 3S55A 2J32A 2F3SA 2ZGVA 3BGOS 2RGBA 2H85A 2ODPA 4JGGA 3USCS 4CMIA 1P72A 1V3TA 2XSZA 3I30X 3T4UA 2I2AA 4I81A 5A3JA 5I7HA 2CSXA 1O5TA 1A72A 1UBRS 3FRJA 2H1VA 5B5SA 1C0LA 2VS1A 4DXDA 5CDTA 2WKPA 2C4TA 1AO0A 1QP4A 1K75A 1KQPA 1OLSA 2X4GA 3DL7A 2P68A 3ND8A 4RACA 3EVFA 3EPPA 1KMQA 4Q1CA 4F9EA 3C8HA 2XQVA 5G02A 3RC8A 3A3KA 1E1YA 4I6EA 1MO6A 4M0KA 5AJXA 3SYNA 3V1MA 2YMQA 3RVJA 2YH2A 4ZVLA 2IH2A 3GNLA 4R51A 4UNQA 1EWRA 2ZE6A 2H2FA 3EQZA 4FFOA 3BE8A 1RYMA 4TWBA 4GXQA 5D2CA 3CUWA 2O3JA 4P3KA 2H4FA 4QBIA 4R1UA 1OFIA 3UXMA 2B1QA 3AJDA 1VSUA 1B8NA 1G2PA 5A1TA 5F1PA 3FOZA 3MIZA 1ICIA 3ZLBA 4S1NA 4TM7A 4OREX 4RTJA 4YAUA 2FDCA 5DTMA 1ONOA 3CH6A 3G0DA 3PDIA 1YRAA 2XRMA 1A3CA 5F21A 4P3XA 3COYA 4CG1A 1Y48E 3R3SA 2AWOA 3EH1A 2RG1A 1DB3A 2P4EA 1L1FA 4WZBE 4RZUA 4M6WB 2HDOA 4X71A 2XGGA 1E58A 2DOKA 5GONA 3TR6A 3D6MA 4GX1A 3PFWO 3TSCA 4J6EA 1ZKMA 4K1XA 2B0JA 3EG9B 4Q0MA 3M4YA 5JWRA 3DD1A 1GCUA 5BUZA 1QG2A 2AF3C 1PW7A 1D2GA 2JI9A 3WDMA 4FGUA 4ZRMA 1S2OA 4PR3A 4XJVA 2Q5HA 1DFGA 1U8EA 1SC6A 4FKBA 1B1CA 4K9KA 4WK4B 2BT4A 1TCUA 2Y1WA 1X3SA 3BK2A 3P4UA 2WIKA 2HMSA 3L01A 3IMEA 4EY7A 4OH1A 2OCKA 4Z1OA 3KFXA 4B4OA 1TU4A 3T34A 2Y1OA 1VKOA 1WHTB 1VYHA 2WUEA 4DBVO 3GWGA 4GP7A 1KAEA 2ZS7A 4XQCA 1T0BA 4CIXA 1TTPB 1DTWA 3GDFA 3C1TA 3EQ9A 4A0QA 3MJFA 2WKQA 1KOJA 3EZGA 1TNDA 4DQXA 3HVKA 4I1VA 1EG2A 2E5WA 5EP4A 1E7YA 1N1EA 4ZI7B 3ICQB 3LV8A 3QUBA 2F55A 4ISBA 1QQ6A 3S3TA 4A6PA 1EP9A 1T6XA 3OT4A 3I53A 4JJEA 1QSGA 1YBMA 2JANA 2NXJA 2PMKA 1XQ9A 1QHEA 2DCMA 2I7CA 1WL8A 2WB4A 2PV7A 2CHEA 3NW9A 3B1WA 4RSHA <