3E84A

Structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto-nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylneuraminate cytidylyltransferase
publication title Structure-Function Analysis of 2-Keto-3-deoxy-D-glycero-D-galactonononate-9-phosphate Phosphatase Defines Specificity Elements in Type C0 Haloalkanoate Dehalogenase Family Members.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 51
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e84A00
4J2TA 1WR8A 2AGVA 3WK9A 3WKAA 3S6JA 3SLRA 1RQNA 5AK3A 4HGQA 3QX7A 2YY6A 3NASA 4HGPA 2OA0A 4NWIA 2C9MA 2G1AA 4MWOA 3GYGA 5AK5A 2R8XA 4E88A 1TJ5A 4PNHA 5ALDA 4CE6A 2R8ZA 2DQSA 3HYCA 2RAVA 5AIAA 1VFPA 3U7FB 5AKXA 2I6XA 1ZRMA 1QQ5A 2IA5A 2HOQA 5AKZA 4DCCA 1QQ6A 4EX7A 3PDWA 3QLEA 5AM1A 1AQ6A 4JDPA 3KC2A 2O9JA 5ALRA 3R4CA 3TLMA 2WM8A 4UM7A 4O8CA 5AW6A 3KD3A 4UM5A 4CF5A 5AM3A 3WK7A 3KZXA 3L0CA 5ALIA 1RQLA 1SU4A 4GIBA 5ALHA 2FDRA 1QYIA 3QUTA 5AVWA 5ALGA 1Z4NA 4Y2TA 3L0BA 4YCLA 2OYCA 5ALJA 4L6AA 5ALWA 5IT0A 1Q92A 3L8HA 3RF6A 2FUCA 1WZCA 2MSNA 2ZBFA 3FM9A 4OHFA 5ALFA 4BEWA 2JAOA 4OD0A 4QQFA 3QU5A 4Y2JA 2O2XA 1MH9A 2X4DA 5ALPA 5AVUA 1LVHA 5ALMA 4B6JA 5AW7A 3ZUPA 3AR5A 3OCYA 5T41A 3RFUA 3UMBA 5AM2A 4BBJA 4BEVA 2HF2A 4Y2UA 1VJ5A 4Y3UA 4UASA 2MU1A 5ALUA 3KOOA 3DDHA 1YNSA 1Z5GA 2EATA 3R09A 1L7PA 2HDOA 3R9KA 3EF0A 1YS9A 5AW5A 1U7OA 5AKLA 3N1UA 5ALOA 1T5SA 5FP0A 3ZTWA 1ZJJA 4ZEVA 3AR4A 3L0YA 3NRJA 5AKYA 3AR3A 3FPSA 4OCZA 3QU9A 1L7OA 2EARA 5AKHA 3PCTA 2GO7A 2B8JA 1NNLA 1Z4IA 2RBKA 2YBDA 2FI1A 5AW4A 4AP9A 2WF7A 2JAWA 4C4TA 3ET5A 4FYPA 4HGNA 1U2TA 1LTQA 2NO4A 2VKQA 2GMWA 3DAOA 1EK1A 4H1WA 2B82A 1ZD5A 5AW3A 1ZS9A 5AVZA 4OFZA 2YN4A 1YJ5A 2BDUA 1CQZA 3ZVLA 2AUTA 3BA6A 1YV9A 2C88A 4ZEXA 3W5AA 3EF1A 1S2OA 2YJ6A 5AVXA 2NO5A 2WF6A 5ALZA 5AI9A 5AVRA 4F72A 3A1DA 1JUDA 4NABA 4Y2SA 2EAUA 1F5SA 3N8GA 2I54A 5JJBA 1RPZA 3ESQA 1O03A 2B8EA 3ZVNA 4EENA 1Z4MA 2HF7A 3OPXA 3AR8A 5AW1A 2IOHA 1Z4KA 5AI0A 3ZW7A 3A1EA 4F71A 5AKGA 1FEZA 4G63A 3I28A 5AKEA 2W43A 2W11A 3SF0A 1KYTA 5ALSA 3D6JA 3SKXA 4G9BA 2GHQA 3B9RA 3SD7A 3QU4A 3QUCA 3UMCA 5AW0A 2QLTA 5AKKA 5AIBA 5IT4A 3MC1A 5AK6A 4IFTA 5AM0A 3A3YA 5A3SA 2BY4A 3J7TA 4HGRA 4EELA 5AVQA 4RETA 5AM5A 2IYEA 4KX5A 3WK4A 3BWVA 3QUBA 2AH5A 1N8NA 1TJ3A 3SMVA 1T9ZA 2IOFA 3P96A 5AVTA 3IJ5A 2G09A 3IB6A 3M9LA 5ALXA 5AKIA 3QYPA 1PW5A 2ZOSA 3E81A 2GHTA 3L8FA 3MPOA 4DW8A 1L8LA 1SWVA 2B30A 2BDEA 2G06A 2OM6A 3WK6A 3PGVA 2JARA 5AM4A 2FEAA 2YMQA 2HHLA 1Z4LA 5AI5A 1Z4JA 1RLTA 2FPUA 3DNPA 3I76A 2G80A 5AVSA 3FPBA 3M1YA 3W5CA 1J8DA 4C4RA 1SWWA 4I9FA 2GFHA 4YIKA 2P69A 5AVVA 3QXGA 3OCZA 2YMLA 4BNDB 3KBBA 4HYTA 4DWOA 3U19A 1NRWA 3KDPA 2RB5A 3NAMA 1VJRA 5ALVA 1Y8AA 4Y2YA 1K1EA 2HSZA 1ZOLA 5ALYA 4CF4A 1XVIA 1CR6A 2P27A 1J97A 3WK8A 4KX3A 1Z5UA 4QJBA 4UU1A 3WKCA 3SKYA 2P11A 3CZ4A 4XE5A 3QNMA 2CFTA 2PKEA 5AI6A 5A3RA 1Q91A 1ZRNA 1L7NA 3AR7A 4CF3A 4L57A 4YIHA 1ZD2P 4YH1A 1XPJA 3AR2A 2FUEA 3SHQA 3CNHA 5ALEA 2I55A 2FPXA 3K1ZA 5AKJA 4UMVA 1RMYA 2JGAA 4KYTA 3WKEA 4YGYA 4C4SA 2PR7A 4UW9A 3IRUA 3B8EA 3EWIA 2WF5A 2Q5EA 3N5KA 4UU0A 4EX6A 1EK2A 1O08A 3E84A 2RARA 5AI4A 3ET4A 3L1VA 3ZWDA 4BNDA 2G0AA 4UMFA 4BX0A 4UMDA 1WPGA 4XPZA 1TA0A 3NALA 4NAVA 2C8KA 3A1CA 3AR6A 2ZBEA 3OCXA 2WFAA 2I34A 2AMYA 3ZVMA 1L7MA 2HX1A 3FVVA 1TJ4A 5ALLA 1QQ7A 3E8MA 2W4MA 2HI0A 4NV0A 1Z4QA 3PGLA 4KNWA 2NYVA 1RKUA 1RLOA 4HAIA 2YJ5A 4Y2VA 5AK4A 3U7GA 2YMPA 3OCUA 4UMEA 1ZD3A 2QYHA 3L5KA 2YFYA 3W5BA 5AI8A 4Y2QA 5AW9A 4RESA 2G08A 1YDFA 3QU7A 1S8OA 4JB3A 4Y2XA 4BX2A 4DFDA 3ZWKA 3U26A 2C8LA 3HLTA 2ZG6A 1RRCA 1RKVA 4UATA 5AHXA 3UM9A 5AVYA 4ZEWA 3EPRA 1RC8A 3NIWA 1TE2A 4KNVA 5ALKA 2D2VA 4UAUA 3U7HB 3N28A 2Q4RA 2C4NA 4I9GA 2CFRA 3I6BA 4IG4A 4XQ0A 2OBBA 4L6CA 4YCMA 3ESRA 1XP5A 2G07A 2FPSA 3U13A 5ALQA 3ZX4A 3U7EB 3ZTYA 2FPRA 3OCWA 2I7DA 2B0CA 4BX3A 1L8OA 4AS2A 1QH9A 3OTQA 2YMMA 5AESA 2B1RA 1Z4OA 2I33A 4EZEA 3QU2A 2PQ0A 4XOUA 3ZU6A 4BYGA 1RDFA 2ZBGA 2YJ3A 1Z88A 2HO4A 3N07A 3W5DA 2CFSA 3ONNA 4BKMA 3L8GA 2R8YA 4Y2PA 1RKQA 3L7YA 5AICA 1IWOA 1NF2A 5AW8A 2IOFK 1N9KA 4FE3A 2JAUA 1RMTA 3WGUA 1RLMA 5A3QA 4MUMA 3WKBA 1U2SA 2WF8A 3DV9A 2ODAA 4GXTA 2B1QA 3E58A 1RMQA 5IS2A 4FFDA 4UAVA 3UMGA 4Y2RA 1U02A 3VAYA 3F9RA 5ALNA 3QUQA 3I1YA 3MMZA 1X42A 3ED5A 3ZX5A 4NFLA 4AS3A 3FGOA 3NUQA 4UARA 2HCFA 3WGVA 2R8EA 1T5TA 2HEGA 4CNQA 3L1UA 2ZBDA 2ZXEA 3OCVA 4YCNA 1U7PA 3MN1A 3AR9A 4HGOA 1L6RA 3NANA 3WK5A 1YMQA 5E0OA 3ZI4A 4J03A 4KN8A 2Q4TA 2YJ4A 2P9JA 3FZQA 4EEKA 5ALTA 2WHEA 3B9BA 2FPWA 1Z4PX 1WVIA 5AW2A 3L8EA 3QGMA 1ZD4A 2CN1A 2WF9A 3WKDA
chains in the Genus database with same CATH superfamily
1W1UA 2AGVA 2BFPA 3WWOA 4AW9A 3SLRA 3B3GA 2OM2A 1I0ZA 1KH3A 3NHPA 1F6WA 2CJWA 4RIGA 4IOKA 5CHEA 1EVJA 1VCMA 1AQIA 1Z2NX 2XQGA 4FWBA 4QRIA 3V55A 5LFAA 5EIOA 5F76A 3ZWXA 3AL2A 2IS4A 2J9ZB 5CGZA 3P32A 2Y1XA 2X14A 2BM1A 5D7BA 3GFOA 4EYKA 2C4HA 3QXCA 2QAGB 2D06A 2FKNA 3C97A 3V7FA 3HYCA 1HK7A 4MVJA 4K9NA 2WB4A 3ZJVA 3JZFA 2OO7A 3ZK8A 4CLXA 5KYXB 4LHWA 4G8CA 4FI3F 4Q1EA 4RVSA 3EXIB 4G6ZA 5LQJA 3TOXA 5JROA 3WLKX 5LCXA 5A9SA 1WCIA 3R3JA 4Z0PA 1QDEA 3NHFA 1YQDA 4QOJA 1MDBA 1NI4B 4YMTA 2RGNA 3NTXA 3N0WA 4EG4A 5LMZA 2R1TA 3L40A 3USCS 4EJSB 1JKJB 2QZ9A 1WEHA 3RIXA 4MVXA 3V9PA 5JVDF 2X7HA 1FVXA 3TW4A 3UT6A 7ADHA 1U9YA 3FPKA 1ZNYA 3KYDB 2D13A 4DZTA 1TM4E 4ALNA 4O8CA 4TSKA 2E3JA 4U9HS 3RSHA 4PZAA 4CMIA 1PVOA 2R00A 5A4FS 1BWSA 1C7IA 1R0LA 2XKAA 2O3JA 1MT3A 3B1YA 4JQYA 3G6WA 4MQ4A 5CA1B 2VSQA 4TYYA 1L4BA 3AJAA 1FDOA 1QYWA 1ZUIA 2FFJA 3SN6A 1UJNA 2CMKA 1GPAA 4BQOA 4JYCA 1SVSA 4ECAA 2G1PA 1T3TA 5ALGA 2CXPA 2NOAA 2VPPA 5FX2A 2HIGA 4MUYA 4JK3A 4Y0NA 1T1GA 5FBKA 3SFVA 1YH3A 4EPYA 3L8HA 3ZLTA 4EARA 5BR4A 2WICA 1N7IA 3OM9A 1E2PA 4MKRA 3RB8A 2I76A 2BHNA 3AVOA 1FBTA 1JR4A 1PJQA 2V7QA 3CT4A 1RWPA 1T26A 1HQYE 3TUJC 3VA7A 4XDGA 2M9MA 5GJCA 1Z0UA 2E85A 3OY2A 1NBOA 3TIFA 3ROTA 2XY4A 3V42A 5I5GA 3ICWA 2QAGA 1FQKA 1VL0A 1X8KA 1W1WA 4LYJA 4IIXA 4P5DA 4A6EA 4CIVA 5IYZB 4Y2UA 5KYXA 2XE8A 2XNDD 3Q11A 1NFFA 2ZQ5A 4IX9A 4CTMA 3GUHA 3EXIA 1CX9B 3K1TA 2GH1A 4NYMQ 4L4YA 3SYNA 3IVGA 3ZDXB 4ALKA 5HW0A 1UPFA 3CVJA 2QGNA 3QBDA 4NI5A 4OQEA 3T5PA 1P8AA 1J0DA 2PX3A 3DT9A 3GFQA 3LBAA 3LY8A 3PLNA 5EHZA 1NI4A 2YVQA 4R2IA 3MWEB 5BW5A 5C7YA 3THXB 4EJSA 1CNMA 2HCTA 1RWVA 1JKJA 2Z2IA 4JQCA 3SS9X 1YS9A 1HNXB 4FT4A 1T29A 1JDTA 1UQRA 1R27A 5DHRA 5CDYA 3F49S 4JX8A 3GJXC 4Q9LA 4E2WA 1WJGA 5P21A 4KVGA 4MIYA 2X22A 4DS3A 3IALA 4ZT4A 1LX7A 4GS5A 3V1LA 1K89A 3FPSA 4ZI5A 4YPVA 3OESA 2MSWA 3P0EA 4M22A 3WSWA 5CA1A 1OAKA 2IH2A 4AKHA 1F8FA 5AJZA 1ACJA 3KSRA 1BOFA 3VVBA 2I91A 1T0IA 4HH3C 3W5UA 2J5KA 1ZINA 2HPAA 5HKBA 2Z9CA 1IQUA 3O1HB 2FR1A 5AVRA 3H2IA 2QX4A 1FOEB 3NW9A 1U0RA 3TPFA 5A5VA 1OU4A 1DAMA 1YE8A 4CF7A 3ENKA 2GD6A 4OHVA 4OQMA 1C3VA 3D2LA 4BN5A 1RRPA 1Q3HA 1YZUA 1FW8A 4JLJA 5L51A 3UPUA 1AX9A 3ZD7A 4QGSA 4ENVA 4AP9A 3KU4A 2CLCX 1MFZA 4X97A 2EWVA 3Q2KA 3S0JA 4Z4HA 2PX4A 5IJAA 5JCXA 1N7HA 1U8YA 1ZRHA 1WMBA 3G5MA 3CNNA 2XWSA 2IXBA 3R1IA 3SLKA 4OYHA 5CW2A 3A1SA 3FFWA 5DW0A 1OH8A 4KCGA 2YHSA 2IEYA 1P9RA 3MGGA 2QZPA 4MV4A 2NU6B 1QP0A 3RUIA 2ZYIA 4ZYWA 1DI0A 1HNNA 1RADA 3N87A 5IYZA 4RXTA 4ARCA 3UMSA 4RJTA 1XA4A 2YN4A 3U0VA 1FSGA 4IPTA 3L8YA 4ZRNA 1A9TA 3CJQA 4ACBA 1WA5A 4W9MC 2GYYA 2QUJA 3AI7A 1KXJA 2FPOA 3B1JA 3PPIA 4HN4B 4Z4CA 4CM7A 2KBEA 4FWIB 2HWKA 2VK1A 2VF4X 1KC1A 3E70C 2G9VA 1R0YA 3MWEA 2I03A 2XTZA 2CJFA 1J9EA 3I9LA 4HH4A 5LUAA 3G49A 2X2OA 3CVVA 1AZLA 4QUDA 4RM2A 4XUDA 1EHYA 5ED4A 1YA6A 4I9NA 3G6KA 4AMZA 4BQPA 3WSTA 1RM3A 5BSHA 4WA7A 2FPKA 1JZSA 3NTUA 4FFMA 2QZ4A 2JIOA 4H1VA 2HF7A 1JTVA 1PFVA 5H02A 5CXQA 3ND8A 3QXHA 1GVNB 5KQRA 5DHPA 1ZGCA 2Q2VA 3DBHA 5KWSA 1Q0LA 1FJGB 5EGNA 2O6HA 1F4LA 1X15A 2ICAA 1K6IA 2YNMA 1P4RA 4IHAA 5ULLA 3U3JA 4C0AC 4CKEB 4J3JA 5LP1A 1D6MA 2QVLA 4AJ9A 1DC8A 3KJXA 1JG3A 2I1QA 2GBLA 3D1JA 2DKFA 3LHIA 3P2JA 4JITA 3QNWA 4OAOA 4DLVA 5BT8A 2BJVA 2QMUA 3SEZA 1U1DA 3H2YA 1G4HA 3TOCA 5JHGB 5KWJA 1JJBA 3RC3A 3IO3A 3OU7A 1A7JA 1QWSA 2VAWA 4RLSA 4WWHA 2G1UA 3V00A 3S2EA 1ZH0A 3CTPA 5DO9A 2BM0A 2ZAYA 1TVCA 3G1UA 1KYQA 4YACA 1QIDA 1C8LA 1P6UA 3FZNA 1UZMA 4ICIA 5F64A 1ABBA 4D92A 4M8IA 4LHZA 1M1NB 5JY6A 3FZGA 2NU6A 1AE1A 3IQEA 3EVGA 5U9CA 2E6UX 3HEBA 2F4NA 2WWRA 1WUKS 2PL1A 2CLOB 3JWIA 3B70A 4FDVA 4P82A 1GZ4A 1SRRA 2DWUA 4RD2A 4R5MA 4WOKA 4F1KA 5ICEA 1P2DA 2YHAA 4DA7A 4EI2A 1VOTA 3PDHA 2P9ZA 3E7XA 4Q9NA 1GRNA 1DTEA 3FR8A 4WZBB 5JZVA 3MS4A 4TMWA 4YJHB 2I4MA 2QRVB 5BSTA 2YYAA 2J3KA 3TEFA 4BBAA 5BXYA 3C7KA 2RIPA 1BS2A 4TKUB 4XR9A 4FUQA 2RGYA 1BA3A 3C2QA 1U7HA 4LOIA 3REQB 2VHTA 3TFQA 3FHJA 3HCWA 5AI5A 5DEIA 3EIXA 1AKUA 1OIWA 2EW2A 3B89A 3RT1A 2FR8A 2A3NA 3QJ5A 1E2GA 4QL3A 1L4FA 3X1DA 1NP6A 2ZTMA 4EF6A 1E1QD 5EA2A 4J0DA 3H17A 1RJFA 4I8DA 1IJBA 3N2KB 4H35A 3JWPA 4KZPA 1YONA 4RSRA 6PFKA 3P4XA 4R98A 2O3RA 4DNQA 1UPTA 2PV0A 1FXSA 5CJJA 3U19A 4TXMA 1Y3CE 1GFZA 4INJA 3LI2A 3ETJA 4W7HA 3RIGA 5KNLA 3LXRA 4LY3A 2WAXA 4CKEA 2O1XA 4I5DA 3PR2B 2Y71A 5DI3B 3UMYA 1CZRA 5E1DA 1DDIA 1ZOLA 4PYMA 5D2CA 1KIMA 2VAPA 5LDHA 2Q5IA 1P45A 4HZUB 4QULA 2JBAB 1KMHB 1T4DA 3COSA 1QVAA 1CFJA 3UT5B 4DIUA 1PSZA 2JBWA 4RMJA 5FQNA 1JLLB 3AHFA 5NULA 1WB9A 3LXXA 3DMDA 4FC6A 1X0VA 3NORA 1HZZA 3WKCA 3FMIA 3A25A 5I8ZA 3OQ1A 4BNWA 4F6RB 5I7HA 3ZD9A 3QNMA 3LOUA 4YCDA 1ZX1A 3L8ZA 4CEIA 4LHYA 4EMTA 5I7FA 1M1NA 4MVCA 1V4BA 2QYTA 5JJIA 3GEEA 1U4OA 4KOAA 1FX1A 3KIPA 2I2WA 4EO4A 4GHWA 2RHHA 5G41A 1ADFA 1JI3A 2G9QA 1X7GA 3FCXA 4C3VA 2JVKA 4L9RA 2BP7B 3INYA 5KDDA 4BASA 1E1LA 2BHRA 2F3TA 4JA0A 4UNPA 1HTTA 3V8NA 1AA6A 4TMZA 1DFGA 4WZBA 4BMVA 1XTVA 2VAMA 1HTBA 3QIVA 1Y3IA 3QI2A 4XB1A 4YJHA 5BSMA 1WS6A 4ARVA 2BMAA 3A6JA 1ONPA 4A0QA 2Z98A 4GW3A 2D5CA 1GG9A 4X0EA 2CVFA 1WXFA 3STUA 5BWMA 1N5JA 5KPDA 4AWAA 1C3XA 4WFQA 1H3NA 1XXHE 3ZU4A 1CG6A 5L40A 4BLPA 2H1HA 1NDHA 1X70A 4KZKA 1U3CA 3DQZA 2AFHE 3JD3A 1P18A 3NI2A 1X1AA 4QXOA 1V6AA 3QV2A 4KV9A 4PG5A 1PX2A 1B3BA 4RF4A 5DXAA 1NVAA 1GRVA 3GGJA 1OZHA 3N2KA 1LDYA 1SCIA 3RLIA 3USES 1GPKA 4IGKA 2IELA 2Y76A 3MB8A 2CE2X 3V7YA 4CMHA 4ZQHA 1IXZA 3E03A 4P3KA 2XZOA 2XB8A 5TF4A 4B8WA 3LYAA 3G02A 3OCXA 4MR8B 1XDDA 1WY5A 3K5PA 1ZESA 2VAXA 1HT2E 4FSDA 1Y5IA 3BXHA 1YBMA 4D4JA 3TKYA 3V8VA 1H66A 4R0VA 2HI0A 2JFUA 2JBAA 1KMHA 3R3YA 1EUYA 1W6UA 1N2GA 3O6VA 3FROA 1RKUA 1UC8A 4ENWA 1JDSA 2B4QA 3F71A 1JLLA 2RHJA 4YJ3B 2AN3A 2GN8A 2R84A 4F6RA 1CS4C 1XTTA 1E9VA 3LXMA 4NH4A 2CSUA 4KPUA 5DFAA 3CN9A 5DZSA 4BVLA 4DMCA 2C9YA 1RQGA 3PSAA 4XM1A 1C8BA 2DJ5A 2P8JA 2WP8J 4JBNA 3T8YA 1KJWA 3H4MA 5IEJA 1NVXQ 5B55A 1I3OA 3A6EA 3VDNB 2XKBA 3W7BA 3M89A 2J59A 3QPDA 4XFKA 1ICEA 1QYDA 3BUSA 3D7KA 3U26A 2W2PA 2WILA 2Y1GA 3HLTA 5EFZA 1RRCA 2AMJA 2BCGY 1D2AA 3OEHD 3I3SR 1OKKD 2FJUA 3AUSA 5B7GA 3J7AC 1OTYA 4Z7QB 1O9GA 4UTZA 3W2EA 5JI2E 1TE2A 1Y3FE 2ASVA 5REQB 3UYKA 2VI5A 2WVJA 1W2WB 1YB7A 5TGTA 4YUZA 2GM5A 3C3AA 3M4YA 5ECWA 1MNQA 5I48A 3BVPA 4Y0VA 2R44A 3PJEA 5TMDA 3CPEA 3WMEA 3EMVA 4NOJA 2GHRA 4XZ3A 2LBPA 2VHUA 3FUVA 2IY8A 2FK8A 1VPEA 1ST3A 3BEDA 4YCMA 2QMZA 1L4HA 2O23A 4CFZA 1K5DA 4PIVA 2JLZA 5F1YA 3WNQA 4C7BA 5ALQA 4IIVA 4QT0A 3AY6A 3FWZA 1MQSA 1LSOA 2CGEA 2DPHA 2RH4A 2FFQA 1H05A 3JWGA 4MR8A 2WR8A 1MPXA 4O1MA 5HRUA 4IS3A 1LQ2A 3TD2A 4AXBA 4LCEA 1Y9EA 1M6HA 2BCEA 1NQOA 1DQRA 1PUJA 2I33A 4PPNA 4REOA 1M76A 1TFRA 2QJWA 5CFNA 3PNYA 4FKBA 1JQJC 2HU5A 3NHKA 1DCFA 2W6ZA 4YJ3A 4KFCA 1TRHA 4KHZA 4EW6A 4CHGA 4PNZA 4MGHA 1G2PA 2RSLA 4A3SA 5TLSA 4QPZA 3PA8A 4UTOA 1BTOA 2WWWA 2IKSA 2JHGA 2PUVA 2ZBQA 3BXEA 3GFSA 1X1SA 3OI7A 4GE3A 4IL5A 4Y2PA 2VTBB 4HGZA 4WZZA 4MPTA 1CR0A 2AZTA 1DWPA 2RGGA 4WBSA 3UOWA 1M6EX 4KMMA 1XEWX 1CLEA 1VL5A 3SJZA 2IPNA 2QGZA 2VIIA 4O1IA 1QG0A 1CCWA 3DE5X 2CVOA 5IDQA 3ICVA 3ODGA 3CKKA 5A3QA 4LK3A 4URZR 1U2SA 2WF8A 3K0KA 4LSWA 1IN6A 1CZNA 3V3KA 3TZCA 1NT4A 2ETXA 4I3HA 4NPHA 1XPOA 1RBZA 3M5DA 5FBQB 5REQA 2YN0A 2FTKE 2VRCA 3RAFC 5ALNA 1PUXA 1YBFA 3M0EA 2I4TA 4R83A 5IM5A 3QE2A 3PXBA 2IRWA 1WCXA 3IT3A 4ZEMA 2NAFA 3VHLB 2R6HA 1KAEA 2YCBA 1N2XA 5FUVA 5BPHA 2B7CA 4YRJA 3FDIA 3IV9A 4UHDA 4CW7A 1P0PA 2EWMA 1C3OB 3E2PA 1I6LA 4JUIA 1CRLA 3A2NA 4DYVA 4EF4A 4MDEA 2F3SA 2WI8A 1P5FA 3BWDD 2I87A 5FTJA 4PXAA 3K8QA 3NANA 4V0SA 2QT9A 5F2OA 4WJLA 1YAHA 1N3BA 2JGJA 1R88A 3GPBA 1LX6A 2VYCA 2ECFA 2GPWA 3HRKA 4QDJA 5A71A 4DM7A 4ZJUA 1NF8A 2QAIA 1V6SA 2WKRA 3D2BA 3QVWA 5FJJA 3SJUA 1JYSA 3PD7A 4WKNA 4P0TA 5KYVA 1ZAYA 4C4ZA 3I04M 3CPJB 5BUCA 1JYFA 1KZ6A 3IP9A 3QGMA 2W2TA 2BFBB 2QG4A 3QVLA 5IBQA 1JA1A 3ANLA 2VTBA 1IQPA 1HE8B 1QK4A 4JV5B 1OV4A 1NVEA 4PVDA 2TMGA 3RYCB 2QP4A 4MW1A 2OYSA 2C61A 1LF0A 4GL4A 5H70A 4D74A 1BXGB 1O3YA 1RQNA 2H48A 2Q27A 3ZGVA 9GPBA 1K5PA 3JX9A 3QEKA 3QOFA 3L7JA 2C96A 2HA0A 4X95A 2J33A 3RTEA 2PJUA 4Z1MD 3DDOA 4RVOA 4NS4A 1R74A 4KHPB 3DP7A 3B6MA 4QU5A 1KGDA 2R6R1 5EE0A 2QL9A 4PF1A 4X3PA 3FOZA 1XTIA 4XSHA 3K8OE 5A7FA 1TJ5A 1ZZEA 1DBPA 2HNAA 1QGZA 3OTGA 4YAOA 3L46A 2WZDA 3QBTA 5AIAA 3LUBA 5F7JA 1R0RE 4LBYA 1Z2OX 3GK3A 5AKXA 1Z7BA 4JYBA 4PHTA 4CTJA 2YZ2A 1GT6A 2PA3A 2SKDA 3QA3E 2CXRA 3UUFA 2GFIA 2JGLA 2RI0A 1Z29A 1CUVA 5J4HA 2JHAA 2UVQA 4QJ4A 1XP8A 2EEPA 4NICA 5I4KA 2YYZA 3QA9A 3LVBA 4EUNA 1QPBA 1XTPA 3R5FA 3K6SB 1CZHA 2GDZA 2BBSA 3FOAA 3HI6A 4BHTA 1G18A 5DLPA 2QQEA 1C3OA 1VHDA 3GRKA 3H1TA 1BD3A 1AGPA 2P68A 2VK8A 3I2IA 3HH8A 3LUKA 2RGRA 3JAWB 4LRWA 4UCFA 2RKBA 3BCSA 1YE3A 1DAHA 2OD9A 3LTNC 4NY1A 4R6XA 1V5GA 4BFYA 3TO5A 4MARA 3TJMA 1BE6A 4BQNA 2OV8A 1JS1X 4DB4A 2QRQA 4QIHA 4IJKA 4J7UA 1P4AA 2OQRA 3L4KA 3WMGA 3AF3A 1W0JD 2YWFA 5D84A 2Q21A 1ZKDA 3SAJA 2HYDA 3QUTA 4C14A 2RBEA 2I9PA 4JQOA 4IO1A 1TLTA 1CQJB 2BFBA 3T54A 5JQGF 3R40A 3FGPA 3MFQA 3TOSA 5FEUA 1I10A 4BNLA 4HDOB 1GUZA 2EGHA 1U0GA 4LDRA 4RV4A 3RYCA 3GJTA 4U6SA 1A8SA 3TSAA 1R5OA 2A2ZA 1BXGA 2G8NA 2VSFA 3CEMA 3KOUA 4IMIB 4OI4A 4UNNA 1JQEA 2Q3LA 3BQNB 1TZMA 2MSNA 6ADHA 1HYGA 1WQ1R 3SMQA 1A4XA 2RDMA 3DBLB 3FM9A 2E37A 3JXEA 2E9SA 1VKOA 3HFJA 4FEEA 3VH4A 4P86A 1ONBA 2X1MA 3HDHA 4S1WA 4DKXA 2HJRA 3TR6A 1DBRA 3Q88A 4LQLA 4DUYB 2V45A 4HH1A 1I2BA 1RHKA 2EYQA 1MH9A 4BO7A 2PSDA 3HABA 3P9QA 4D41A 4D4GA 4JOSA 1E6CA 2JHCA 2BW0A 2Y1KA 5BSGA 2WB2A 1B8UA 3DZJA 5CIWA 1F12A 4E4TA 2YY5A 4BEVA 1NLFA 1UOEA 5B2FA 1OV6A 5L7YA 3DBIA 2PRSA 3OURA 3IRVA 2AZDA 1A69A 3Q6MA 4HAVA 3COYA 4GRIA 4RD6A 3LYLA 3MJSA 1SQGA 5K0NA 3ZV5A 3GRUA 1Y6ZA 4LOAA 3EDMA 2WWYA 1Q0HA 1MCZA 1MT0A 4K1LA 1LDMA 1C7EA 2C95A 2BHSA 1NJ8A 1XAIA 2HDOA 4PRZA 3T38A 3WLEA 4KEAA 2ODQA 4RXMA 1Q7EA 3AK4A 4AUEA 1DEOA 2IHUA 3MRTA 3U4HA 4D9GA 3A1TA 5JSFA 4MP3A 1IULA 3LNCA 1LBEA 4LDPA 4DLTA 2ZIUB 5A5GA 3RKSA 4ZPJA 1LJLA 1XROA 1RXYA 5AKYA 1HGXA 1XO1A 3AR3A 2XMCA 4GXRA 2JIMA 4AECA 1Q12A 1D2NA 2ZE8A 3ETLA 3HJHA 3WBKA 4AUKA 1Q7TA 2VOEA 4LGYA 2V3WA 1KL7A 5EERA 1G3UA 4TLAA 3I4FA 3X3HA 1KQOA 1YJCA 5LKAA 2PE5A 4HATA 3H83A 4DWWA 2A88A 2W0SA 1NNLA 1CQJA 4AO8A 3GLGB 5FUWA 3WL8A 1Q2XA 2ZIFA 1NWCA 4J07A 3GIDA 1MOZA 2JLYA 1EBBA 1GQOA 1VG0B 4URXR 3COJA 5AYVA 4IJWA 4U7DA 3SYMA 5KJFA 1OI2A 2P9EA 4XB6B 2GVZC 1SOUA 4KH0A 5KO2A 2ZUUA 1H2ZA 1KEUA 1E5DA 4TYNA 3DBLA 4AJ1A 4OA8A 1SKMA 1Y6FA 2VKQA 4NFHA 3WLOA 3ZWAA 2ZT5A 2R6GA 3DOHA 3KQWA 1YI1A 4HRYA 4I2VA 1RVV1 1TU3A 2LKDA 2G82A 2VT6A 5AW3A 2PXAA 1ZBDA 3INNA 3LWNA 3GEGA 1NMYA 4C0SA 4MWSA 3EF1A 4OAPA 4DQXA 1IBSA 4YK7A 2OBYA 1AIPA 1E1RD 3AY0A 2EC5A 1L0BA 3C5WP 1IN8A 3ELUA 3JR3A 1FTWA 4FW9A 1WCV1 4MS3B 4BQFA 1JVNA 4H4DA 3SIRA 3WRWA 4DJ5X 3TLEA 5G0TA 3HVKA 1F5SA 4P08A 4ESVA 4RKWA 4ZYTA 1KSJA 2W2LD 4L5JA 1U0FA 1TO2E 4EHIA 3O0TA 4NK5A 1O03A 4V3BA 3L1KA 3VKVA 3L77A 1MGPA 5BWLA 2WVGA 1U7XA 4HNHA 3AHCA 4D3FA 1ST2A 4OHUA 5CTAA 1W49A 3IPAA 2Q3BA 3CINA 3F3YA 4EGFA 1YI0A 4TN5A 2GNPA 5CITA 2HW8A 4YAKA 4XJVA 3HPQA 3E9QA 1Y4AE 1QFSA 5FJIA 3VAAA 3HXPA 3ZU2A 1W5FA 3VRHA 5K03A 3CPHA 1G3MA 3I28A 3FOBA 2W22A 4GE0A 2UUAB 5B1HA 4DEVA 4CUZA 1ORHA 4DADA 5HOQA 3IQHX 3AUAA 3I2JA 4QNMA 3VPGA 4QGAA 1XCGB 3SD7A 3VI4B 1MJ5A 1ZLXA 2CUKA 4NIMA 1YDMA 5DF1A 1LEHA 2RI6A 5FL7A 3CQ9A 2DY1A 2GJ9A 2NSYA 3I01A 4TTQA 1RXWA 4HNAB 3IAM6 5DX8A 1DAPA 1GPJA 1Q17A 3S1LA 5KQPA 4S2EA 3QTLA 3CCCA 1I2MA 2AI1A 1VP9A 3OPYB 2CNLA 3IR6A 1DX6A 2Q1TA 3QFRA 4E22A 4ENSA 2IH5A 3RIMA 4KX5A 4XRRA 3ESCA 1PT5A 4IHJF 1TQ2A 1ZOPA 3OZVA 2DR2A 4M8LA 1ADBA 1H1DA 4C0XA 4N7JA 3I37X 1O95C 2Y67A 5BMOA 1K0FA 1DKPA 3SVZA 2IPOA 1VE3A 1PNOA 2EZ8A 5BN3B 4J91A 4BFTA 2PMEA 2JFOA 3LC2O 2ZJAA 3DTTA 2KM1A 3PR3A 4O2BB 4TQ9A 3SR3A 3GLGE 3K0CA 2VJBA 2R1VB 2G6BA 3O0DA 3ZZNA 1ZHFA 4GWKA 2CXSA 2DUUA 4IIJF 1F0PA 2G06A 3SZOA 4MS3A 2I2BA 2H1VA 2I3DA 2QD3A 2VUSA 2ZIVB 1BCSB 3ORRA 5KAMA 3RG8A 2IX9A 1SULA 1FYFA 2O07A 2FXIA 2VH5R 3QMWA 2HHLA 3QWFA 4H0NA 2XE6A 2ZI9A 3HB0A 4BVJA 4BMYA 1QP4A 2GEFA 1YIAA 2XW6A 3PHHA 2QL6A 4J1SA 1Z7YA 3H8JA 4V2UA 5DNDA 5E8JA 3UH1A 1GSAA 2P69A 1EE1A 4R9NA 4RLQA 5D8DA 5EG5A 4MYRA 3OD1A 3QVMA 4BNGA 3GDGA 4PPYA 4FLMA 2AF3C 2B98A 3FB1A 1M9NA 4FB5A 4ILKA 5GQSA 3T1HB 4GX1A 5DNWA 3AJ9A 3P9SA 4HVAA 4BNIA 2P9FA 1K08A 1G7RA 1LSUA 1SCNE 2V7UA 1HEIA 3KUCA 2NUAB 4FONA 1UBTS 3UJHA 4BMCA 1K1EA 4CTNA 4ZI3A 5AD1A 2XEXA 4Z4QA 2XVZA 1PLKA 5FLYA 3ONFA 4G5SA 3A1UA 1Q7GA 2G72A 3CKLA 4XM2A 1J97A 3RVLA 2E4XA 5EE3A 3H4VA 2JFYA 3WK8A 1O4VA 1PZEA 4MVJM 4GPBA 1IG0A 4DCMA 4FGKA 1FQJA 2DHQA 1QANA 3ITNA 4HNAA 2ZE7A 4K9DA 3CZ4A 4FJ1A 3ZCUA 4UEOA 3ZU5A 1IDOA 4FHFA 3JQAB 3DEHA 3GEMA 2RGDA 1KVUA 1SGWA 4MZXA 1L7NA 3AR7A 3BE8A 2NZWA 1VL2A 1P75A 4KR2A 1EX6A 3KOZA 1U8FO 1RRVA 4ZI7F 1NURA 2DFPA 1E0JA 3TR5A 4ENPA 5CB0A 1CUYA 1WXWA 4CCWA 3V1NA 3I9OA 4GO1A 5EEGA 2XTJA 1NQAO 3TQQA 5BN3A 1QFMA 2OLJA 4O2BA 3G9QA 2ZW9A 3PDIB 2HK8A 1KMCA 3Q3VA 1YGYA 2PR7A 5KZMB 3HRIA 1MB2A 1Z35A 2R1VA 1LWNA 4WNIA 3OJ0A 2RD2A 1SUBA 4N0DA 3JVDA 2X9LA 5C37A 4KQGA 3EW7A 4FN5A 4YP7A 1VGQA 1MEOA 1GZVA 1BCSA 4FHDA 1G8FA 4GM0A 5EIWA 5KJEA 1P19A 4NYJR 3LY5A 3BRWD 2OQIA 1XE3A 4PR0A 4RPGA 4ROSA 5LU8A 1K8RA 2X15A 3HWRA 4B31A 3CBQA 4RHXA 1IUNA 3JQAD 4QXRA 5EPOA 3U4CA 2FWJA 4DIKA 2CXHA 3G5AA 1C7JA 1DELA 4HTFA 4CCSA 3IBGA 2JHPA 4W1SA 3MLBA 1NJ5A 2D0IA 5JS1A 1W52X 2FQXA 1II8A 3QH4A 1LSSA 2FSIA 2O19A 5CW1A 4YMLA 2XHEA 2C8KA 1BHQ1 4IH1A 1AN9A 3ZVRA 3RS9A 4QTXA 4XTCS 2WFAA 1TIPA 4RULA 1X3LA 1J8MF 2A1TR 2F3UA 1L7MA 2QM0A 2UZ1B 3K0AA 4IHQA 2DFTA 4P9NA 5HEKA 4D9NA 5ALLA 2XADA 3MTEA 3ZGOA 4DR4B 4C6SA 5ECYA 3HZRA 5K0BA 4CMEA 3W04A 4M1SA 1QHEA 2ST1A 2PFSA 3EZFA 4HAIA 4MVYA 1VPTA 4XUEA 3UK1A 1WXHA 3W2GA 2P2ZA 3R24A 3OU6A 4GX5A 2OUKA 2IITA 1SC4A 4JSTA 1ISFA 3IMFA 4HX9A 5HFJA 1IZ8A 4ALIA 3EQ7A 3ETDA 3H16A 3CYFA 2ES4A 2ZJ5A 3R77A 4MX8A 4ZAGA 3WRVA 5IUNC 5E9AA 4A23A 5LLDA 1PFYA 1BD4A 1QH8B 2H16A 4NH0A 3M9WA 1BX3A 1B8PA 3MSXA 4HXEB 4Q3BA 1PRYA 3NC1C 2OT3B 1FDWA 1G3IA 1XLUA 2ZB3A 2DG2A 1VE1A 3SQOA 5B4TA 4BGDA 4OM8A 1TCAA 2PO5A 2ZRPA 2G5TA 3GP3A 4PQRA 4UE3S 3V34A 2EBFX 3PDIA 3K9NA 3NDIA 4TT3D 1AH2A 3LGXA 2ZG6A 4RW0A 2TMYA 3BFKA 5DYYA 3LECA 3Q3HA 3WOHA 3EB9A 4C0HA 4PC7A 3QKRB 2YWDA 4O4IB 4B46A 3AILA 1HKUA 1RYMA 3LT1A 4ARSA 4GMXA 1EVYA 4M0UA 5TQVA 5JO0A 1PR4A 4B7CA 1Y1TA 2PUHA 4Q4HB 3ICPA 4HDKB 1B26A 3DPSA 5F5LA 1HNZB 1K5GA 1B6RA 4KXWA 4CWAA 1V7PC 3WLHA 1PIWA 2CNWD 2XRYA 3I1JA 4GMFA 1OB2A 2CCGA 3KUUA 4GOJA 3ESRA 4MUHA 2HKIA 1Z5OA 3RJZA 3ISTA 4OIMA 3ELYA 2VUIB 3EY9A 1Z08A 2R6DA 4YV1A 1ZMOA 4P2BA 2IP4A 2UZ1A 1ADYA 4TT3A 3CSDA 2OESA 2GJAA 1NA5A 2FRVA 1P29A 3M70A 4UTXA 4QOIA 4BLVA 4YRDA 3LS2A 2DB3A 4LY0A 2QMYA 3AW9A 3QU2A 2Y6VA 3KHUA 2OWEA 1QOZA 4RFLA 3O9MA 4AX8A 4DB2A 2W6NA 2CHUA 2SECE 1NDUA 1BQEA 2HLDA 1JJAA 2H2HA 5JBIA 1B3RA 1ZXLA 2YJ3A 4L85A 4DLLA 4TTPA 4A0GA 4YGXB 2HADA 2NXEA 4BNJA 2CFSA 2PL3A 1VSBA 4KQHA 3AEUB 1QFZA 4Z4FA 1NYLA 2CNWA 5B58C 3L7YA 4QHSA 4RPCA 2XHZA 2VHWA 1UBOS 3AM4A 3TWOA 2JFXA 4QJ5A 3A9CA 3DEZA 4XIIA 5IFLA 2KHZA 1TFUA 1QR6A 2H5IA 3PSHA 1Y4UA 2P6MA 3W2TA 1DWUA 1JE1A 4FMCF 2HT6A 5NLLA 2A5LA 4O4LF 4E3WA 2RC5A 3BQ9A 5CT8A 3L79A 2ODEA 1H2FA 1QGUB 4MQ5A 4OQLA 3JQGB 2HNBA 2IOYA 3QKRA 2JJ2A 3EAFA 4O4IA 2P8SA 4WMLA 1FX0A 5LQUA 4JI8B 4E15A 4RZ3A 1TT5B 1U02A 2Y4NA 4JYZA 3RRXA 1KEKA 1QIFA 4J9UE 3KKPA 4HDKA 1X14A 2VL7A 3KUKA 1TAHA 1E32A 3IT1A 4IMRA 5JY1A 1DAIA 1SEVA 2EU8A 3BHJA 4D8XA 2BGMA 4CBVA 3L1UA 5EIXA 4OX9Y 2ZJFA 3DR3A 3M6LA 4YCNA 5D7NA 1ZH6A 4GOXA 1DDGA 3AR9A 1NYRA 4AO6A 1I7PA 5KWEA 5LOVB 3EZ9A 4IIEA 1RJGA 3U7QB 2XUQA 4OHMA 4CMAA 3OE7D 3F0TA 4D8TA 3ZGLA 2HRQA 1NNEA 1ZIXA 1YHZA 3EA5A 3GY0A 2JW5A 2AXQA 2COUA 1HETA 4HQOA 4RS4A 3C5HA 2LUOA 4PTYA 1BYIA 5J59A 1PNQA 2FNAA 2VOJA 4K2HA 3PUWA 1N6HA 1PAUA 2JIBA 4BO6A 1XMJA 2Z9DA 1NMQA 4RVHA 3AEUA 3NBUA 5JVDA 3UANA 1Z5NA 2H3HA 2G5GX 2VQ3A 1TM7E 4N76A 1CJUC 3GPCA 1HLPA 2WHXA 4YRSA 2VSNA 3AP2A 2YY6A 3L7KA 3B3FA 4EGSA 2EJVA 4X6UA 1MX3A 3HLKA 3IDFA 5TQ0A 4DR5B 5AK5A 4DARA 1ZQ1A 2B92A 2DPGA 3FTDA 1PZMA 2P9YA 3JQGA 4KVAA 4EMBA 5L95A 2C5LA 1YUBA 2Q0QA 1GOTA 3B1XA 3QWIA 5IVKA 3DAPA 3M6VA 1TT5A 4HAUA 3U7FB 1L5FA 2IUFA 3KT8A 3ESYA 4II3A 3RODA 1N2JA 1EVQA 1VIDA 4DCCA 1I1QB 1X1QA 1GGHA 1N5IA 1PYOA 1IQ0A 1XU9A 2D0PB 3L82B 2QP3A 5IAKA 5BSRA 3AVUA 3C6YA 1EXNA 1N3YA 5IBRA 3DVLA 5LYJB 1R0ZA 4EFLA 1LXCA 4O2AF 1DIBA 1PR2A 2FPMA 3K5WA 3ESZA 1T43A 4RYDA 3FBTA 4KUGA 2M6SA 5LOVA 3EEFA 4Z9YA 2H18A 3C1AA 5AJXA 1R16A 3TDMA 3U7QA 3CF4A 2O0KA 3MJHA 1S1MA 2MOKA 2HZ7A 3QWHA 3PT9A 1XA3A 4WJZA 3NIBA 2FG6C 3AF6A 4EL0A 4X63A 3RSSA 5G1NA 1HT1E 3QKSB 2Q9UA 2Q6LA 3C48A 1FUUA 2GPSA 1A8HA 3HVJA 5IM4A 2Y93A 2GPNA 4M3NA 3VR2A 2DLDA 2JCSA 3ONWA 3KPVA 1N0HA 1U8CB 1UXIA 3L0BA 5EJGA 5EIHA 3RT9A 4BRZA 1YGPA 3TUZC 2DCMA 5ALWA 1S7CA 4MINA 4MUEA 4MA0A 3WE7A 2W5UA 2ZS8A 4P34A 3IKTA 5CG2A 4FGUA 1XYYA 2EZTA 3R8XA 4XLTA 3GD5A 1BW9B 4PWYA 3WHKA 3KWJA 1LW7A 1N6LA 3BG5A 3AY7A 3EN0A 1LPOA 5DX0A 4MYUA 4CETA 2DPXA 3A4YA 3IOCA 3K15A 1PWYE 2RHMA 2H1OA 1XRMA 1K7YA 2X4DA 5ALPA 1N32B 5E7IA 3TK1A 2B69A 3FSGA 1P2SA 3C3YA 1OXKB 1S0UA 5DKFA 1XCJA 1Z7GA 5CB8A 1ZW1A 4EQ6B 2PGXA 4EH1A 1GGMA 3RAPR 1QYRA 3B51X 3K73O 4DLNA 2G5CA 1NMXA 2ZB7A 3GAAA 2J7PA 4RH1A 1R18A 1WO8A 3NG1A 5GV8A 5JAIA 5FLXA 1SIWA 2FPLA 4GP7A 5LYJA 1OROA 4D6XA 5JRJA 2CEAA 2PQ6A 4P4UA 2R47A 1N1EA 3LF1A 3PNSA 4MRPA 4NE9A 4HLQB 2CWWA 3TQIA 1I4TD 1BGVA 1ZJJA 4ZXFA 4H31A 4Q6BA 5EZ5A 5HQ3B 3PQ3A 4ZHSA 1KY2A 1R7RA 3LRPA 2XPCA 1X7DA 3LCJA 1Y7TA 1V2HE 1PS0A 2CHEA 3PEUA 3PIDA 5E4FA 3SBXA 4R54A 3VC3A 1O7JA 4I08A 3B60A 2PFGA 2ZTVA 3U6KA 2XT0A 3QKSA 3OKAA 1UKAA 2QTHA 1VRCA 1ZUHA 1HDYA 1TX4B 2FQWA 2ID4A 2WAAA 1VRWA 5BQOA 3STHA 5G4KB 4Z9AA 1EE9A 4OBWA 2DERA 2D1TA 1RYYA 1VYVA 1PEYA 4W82A 4M89A 1IUOA 4DY6A 4N8SA 4A2WA 2YOGA 2R79A 4NOMA 4TZKA 4XSGA 3B2QA 4R3WA 4CRWB 4ETWA 5IDXA 3FRJA 5IJWA 1MFPA 1BW9A 3EC7A 1HDCA 5FPKA 3A4VA 1V5WA 4E30A 3KKKA 3JARA 1Z6TA 4DQ0A 2VJPA 4YT2A 3JZMA 2IUEA 4NYIR 4FK8A 1N7JA 2C83A 1TYEB 3NOXA 4RKFA 1USVA 1J0BA 2CLSA 1OWOA 2FJPA 3B13B 4P93A 4ERXA 1LDBA 1DCTA 1J20A 3FNQA 1U5BB 4LZLA 3IMGA 4O59O 4EQ6A 1E7SA 4RD4A 4PR3A 5LD2B 3PD0A 1MRNA 3ELDA 3H5LA 3ZDDA 3NFRA 2HJSA 4R1TA 2O06A 5H5JA 3GLIE 5LN1A 3PE4A 1QUEA 2XUGA 5DI9A 3RJTA 5JT1A 3WWEA 2Y27A 3T5MA 4QG3A 3DKPA 4Y2SA 4GWLA 5MF6A 3DHYA 1KZ1A 3D8HA 2KI5A 4IDFA 4Q3EA 3X1YA 1JFVA 4PV7A 3WLIA 3ZQKA 5JZSA 1L5ZA 1SZDA 5HQ3A 1OT3A 3HDJA 4LJ9A 1NG1A 2E48A 4P7FA 5I7AA 2JANA 2QEQA 4NX2A 4ILEA 2CT8A 3BICA 4Y1EA 1V8DA 2ZUTA 3Q0TA 4JBHA 2B2NA 3A1EA 4U0JA 2BGKA 2WIKA 2N1MA 3B1VA 4M7OA 2ZYRA 1F7VA 4R3UC 4X91A 5FO1A 4C4OA 2ZI5A 1GUFA 2IYSA 2BFFA 3FE2A 3NHBA 4Q9DA 2QVXX 5G4KA 3SF0A 4KREA 1W30A 4NMLA 1IVYA 1M3SA 1KC3A 4OB8A 2XZDA 4FMDF 5D3ZA 3SGLA 1E9FA 4M1KA 5B7QA 3RSGA 3ETNA 3GLHE 4U9IS 1B1CA 2PN1A 4PVCA 4QDZA 3LQ1A 1M2JA 2Q2OA 2BISA 1QKIA 4RETA 3A05A 1O5TA 1RC1A 3KAPA 4FNMA 4MHSA 5GJVC 3TAUA 3PEFA 1C3LA 1SVOA 2C5EA 2W9XA 4JBLA 4V39A 5C1PA 4BYMA 5HZKA 3W5SA 3AEYA 1EFVB 2G4CA 2JZOA 5C5DA 1LK5A 2D2EA 4PC6A 4QJIA 1TF2A 3HBNA 1TU0A 4I5IA 4AJOA 3D02A 2DQ4A 3GAFA 1U5BA 1JQ5A 2BV3A 2HF9A 1JWLA 4IGAA 1UWKA 1S8FA 4Y1FA 2ZU6A 1TKRA 4M0MA 1AF7A 5FUYA 2A1IA 1NVBA 2VJNA 2QTCA 3TLJA 4DR2B 4CR8A 3O31A 3KFVA 4M9QA 2XDQB 3G88A 4BFSA 3LX6A 1SWVA 2PWYA 1M2KA 4NFYA 5AFSA 1RTTA 2JARA 2A78A 2NSHA 1JSZA 3PZRA 4ND6A 4R8MA 3TAHA 2R7KA 1O95D 4Y6QA 3UMVA 3WYEA 3G2LA 4YAIA 1A8QA 1D2GA 2JATA 1L4LA 3R2JA 4MQEB 4CM4B 4CIBA 1U0SY 3ZY3A 2FEXA 1IY1A 2G80A 3G8CA 4X8OA 1WW3A 1U2RA 5JMWA 4JI5B 2WT4A 4OJMX 1ILEA 5M2QA 1QRDA 1ZCAA 3R3UA 1HDXA 2YN2A 5C1IA 5IUKC 5B6PA 2OV1A 3MCTA 5B6IA 3BWXA 3C43A 2CNNA 3GCGA 3ZNNA 5GGXA 2IHVA 3DJYA 1CDDA 3FYSA 1ZM9A 4RD0A 1NRWA 3NAMA 4HEJA 2OD7A 1FU7A 2AL7A 4KTVE 4MUJA 5EXSA 4ZEOA 3AT1A 1PLLA 4PAQA 1ZD1A 4FB4A 3IB3A 4YRAA 3V4FA 1U0EA 4R7TA 1FJ2A 2BZ1A 1UZUA 1CWUA 1EU1A 1F17A 3GDHA 1FFEA 1S9HA 3NLLA 5C3MA 1QXSA 1PFKA 3JRNA 3JWEA 421PA 3VDMA 1K4YA 3UHJA 4TROA 1Z75A 1JH8A 5FBZA 2PUDA 3T94A 1QRUA 1O95A 5EESA 5LZ8A 1XNGA 2V6JA 3SZRA 4AZ3B 1ND5A 1WE2A 3CX4A 4PAWA 4H4CA 2BH9A 4UUPA 4WLEA 5HFAA 2C4TA 1ZRNA 4FZVA 4HFRA 3TXYA 2FG5A 3L4SO 1JHOA 1K7XB 3S68A 5C5CA 1N36B 1R2QA 2P78A 2HJVA 1NQWA 2PLRA 1L3CA 3MAAC 1EFVA 2PQMA 2WSIA 4G0OA 1KEEB 1WU8A 1PN3A 1Y81A 3OA2A 4GMDA 4MKHA 4XCXA 5D85A 3MMPA 1Z68A 3JTMA 1ISSA 5G0WA 2JIZD 5BQ5A 2PGDA 1COWD 4DT1B 2VBFA 4TPKA 5HE8A 3SHFA 2O2JA 1Z3IX 1C1YA 5LQRA 3U5TA 5KCMA 4ZDWA 3STTA 1XMIA 1CE8B 4ARZB 2XDQA 5CNJA 1II0A 4JIGA 4XGQA 5H9WA 1JQAA 1T24A 2V0CA 4Y30A 3ZZ1A 1M34E 3HZZA 1M7HA 3UG7A 1SU7A 4PZZA 5J5CA 3TS1A 3VH1A 3OIFA 1IAVA 1R8QA 4AMBA 2V58A 5EN4A 1AMUA 3A14A 4UFOA 1ODTC 1WKCA 4BLRA 1W5BA 4MQEA 3L01A 4CM4A 4DAEA 4NYMR 5B1YA 2PU5A 3WDLA 5HCIA 3I5YA 3NPMA 5F1KA 1XZPA 2XQVA 3ZPXA 1CRPA 4D02A 1V8BA 1VE7A 1BMFA 3G2PA 1EDEA 2ANCA 3KEQA 4BX0A 3OZCA 4ZOLF 4IRUB 1WOMA 4QRDA 2LWIA 5L8VA 5CH8A 3AR6A 1U8ZA 1O6ZA 2CL7X 3LWBA 5ESDA 1CY7A 4N65A 2HX1A 4L08A 3BKXA 3T61A 4IY1A 4B85A 4U00A 2YUTA 4TTRA 2Z83A 1QQ7A 5BR1A 1JHMA 5TY0A 1FQOA 2A59A 1AQYA 4DV0B 4KIUA 3Q3GE 2R4QA 3K71B 2F8TA 2PRKA 3VPFA 3FYDA 2QPOA 4LOLA 1I33A 4KUEA 5LZ9A 4C4AA 1FU8A 1II9A 1G98A 4L28A 4AZ3A 4ESHA 4DUPA 1BN6A 2AOVA 4C9BA 3F6PA 2NZVG 4OHKA 1NUTA 4MKXA 3KP1A 3O8DA 4Q03A 1L4EA 5L7WA 5CP8A 1Z5VA 3KLPX 5DSTA 4ND3A 3TOVA 1JG1A 2SKCA 2P3LA 3O91A 1O6GA 4KE7A 4DFDA 3EOAI 2XMDA 1Q7RA 1JH9A 4JR1A 2EFCB 2P4SA 1IB6A 2OFPA 1KVRA 2O2IA 4H7EA 1CE8A 4I1UA 1UXHA 4M99A 4ARZA 4XWGA 5AVYA 4C7OB 221PA 3OZDA 4GRAA 4U5XA 5EQJB 4G1UC 5ICCA 2RJNA 2IXAA 1M10A 3GJQA 1K2VN 4RZQA 3OTIA 2YWHA 5BN1A 1VP3A 1P4GA 3O93A 3VVMA 3WBFA 3EY4A 2G17A 2GBIA 2JCGA 1E7QA 1BU5A 5JXHA 2Z4RA 1ULAA 3MCAA 2IKQA 3D0KA 4LHVA 5E4YA 4JOBA 3ZY4A 5B64A 4FBLA 1SUSA 3K96A 3IP3A 1G20B 2FYTA 1JEJA 1TK2A 4WNYA 3C8HA 2PZGA 3UUEA 1YOVB 3G79A 3VISA 1RD4A 4NXNB 1G9TA 1L5VA 1R3UA 2PXCA 3QG5A 3V3TA 4BPRA 2F8LA 2ODNA 2GEUA 3DEIA 1L8OA 3CZPA 3X0DA 3I3OA 4BX3A 2OBMA 5K0GA 2EP8A 3BWCA 5L3SB 1NMSA 3EIFA 2WHPB 3M6XA 4WFIA 5CVDA 5ITZA 1EBFA 3RBVA 2FFAA 3DVRX 3ND9A 2O5CA 3HMQA 4U2GA 2VDMB 3GA0A 3KTDA 3FYHA 4G4GA 1UXGA 3GIWA 3PLAE 3A06A 4E5KA 2VJAA 1BNCA 1XQ9A 1J39A 1CTQA 3FDFA 3FHCB 3H3XA 3QPUA 1GCOA 3W6UA 3ZXUB 5AXCA 4MMYB 1WABA 4IJ6A 3ONNA 4BV2A 5C8DA 2F62A 1DE0A 2HIMA 2F4VB 4LVNA 1T34A 3D64A 5F51A 2I62A 1F1JA 3A4MA 4PLFA 1NPTO 5AICA 4ETNA 2O14A 2C2KA 2PR2A 1AXEA 2ORIA 3MT7A 3I1FA 3OH8A 2P5YA 4RIEA 3ND5A 4UE6A 2MHCA 4C2TA 2WLTA 1HV8A 1XNQB 1ZOSA 5KYNA 2QRMA 3ABSB 4K03A 2VSYA 4BKRA 2QZSA 4ND7A 2C59A 3STWA 4X6LA 5KC9A 3DFKA 2F7SA 3H6KA 4PLPA 4LJ5A 4DAOA 2JIPA 1YJXA 4MCIA 1N78A 1G7SA 1ES9A 1CK4A 2AHOA 1E3WB 1XI2A 4Y9RA 2E4UA 4RK6A 1GG2A 1QQBA 4QPPA 3C5EA 3I1YA 5B37A 4HB0A 4YREA 5JQGB 4IDBA 3CRQA 4PICA 1Y7IA 3DE2X 2HRZA 2Z5FA 2VF2A 3UNXA 2QNBA 1GPNA 1M1ZA 2IFTA 3IIEA 3KD2A 3HWWA 1G21E 4IKOA 2XB6A 4Z0HO 3WGVA 4EB6B 1G20A 1RXSA 1WETA 4DMUB 2HEGA 3BERA 4Q7EA 1YOVA 3ZVKA 2O0MA 4TVBA 3KV3O 3G2MA 3QPWA 1EUDB 2EL9A 2ZXEA 2B35A 1DB3A 1TA4A 4EPVA 3GCWA 4Z4GA 4HAXA 4YXWD 3FOCA 5A0TA 5L3SA 2HT1A 4G0QA 2X8AA 3F90A 4AK9A 3TEMA 1EQUA 3GBVA 2WHPA 3T0IA 3HBAA 4C06A 5K8IA 1R10A 5DHTA 1OPRA 2YRXA 2YJ4A 1OBVA 1SIOA 3THYA 1S2DA 1H4QA 1P39A 5ALTA 2MMCA 1Z7WA 3B9BA 4I50F 4N5LA 5CNMA 3KWLA 1JNXX 2K2WA 4GLJA 2R0QC 2I3BA 4UQOA 1GUAA 2VHYA 3PFHA 3Q72A 2QU7A 4A2PA 1G0OA 4MOWA 3L7OA 1B0AA 3C1UA 4DIDA 3FOFC 2NTVA 1KYYA 1WXDA 4G1EB 4ER0A 2MSCB 1OAAA 1VJTA 2P6PA 2QN1A 4BRUA 3JS5A 3SDSA 2PZ8A 2YRWA 2CC2A 3H8VA 2IUTA 4P38A 3NASA 5JO9A 3GD7A 3E1GA 3MJCA 1H6CA 4F1WA 1EG7A 3AERB 3WI7A 1A5AB 3S27A 4U7WA 4CMGA 2YASA 2WYOA 5F12A 1LRJA 2JFQA 4M87A 1XKXA 1OA1A 4E88A 5CD1A 4OGGA 1TIBA 1GZHB 1E9RA 4AF8A 3PPWA 1OILA 2DC1A 1E3WA 3ADBA 1XBTA 3IUPA 4QICA 5JQGA 1GN8A 3D6HA 4XPIB 3FIUA 3TMAA 2J6IA 2D6FA 2PMDA 1X1TA 4DILA 3AZOA 4U7HA 3ER6A 4IEIA 4MJ3A 3UENA 4C3UA 2VT2A 3NO4A 4EAQA 5TF0A 4AT1A 4EB6A 4RD3A 4X3OA 4IXMA 2RHGB 1CUUA 4PIMA 3HV0A 4B83A 2PT5A 2A5DA 2BMWA 1EUDA 3P26A 3L9WA 1PJSA 2BR3A 2DPYA 5KNBH 4L3VA 3AKYA 3EHDA 4EY5A 2V59A 4QM7A 1LLCA 4D96A 2WM8A 4BKQA 4AJIA 3IESA 2PSJA 3KYCB 4C7KA 4HQRA 4X1IB 1T8SA 1X7ZB 1XRPA 4U2CA 1D4FA 1FP1D 3PHIA 3X1MA 2FOLA 3DMFA 2PCLA 5HE9A 1EXDA 3PEWA 1UBGA 1DTWB 3STYA 1D4ZA 1YR3A 2LXNA 4BUZA 4PLTA 1CZKA 4XQCA 1T6NA 3K9LA 4FYHA 3KQLA 5D00A 4L7VA 4AJEA 4P4GA 3TLAA 1WNFA 3N75A 1UOPA 2ZRQA 1A2BA 2FU5C 2ZTUA 5E6UB 5JNSA 2Y2VA 4FZ5A 5C0OE 2JI4A 3OFVA 5E7QA 2QRNA 1M72A 1PF7E 5EUBA 5KJCA 4Q0MA 3ZDEA 1RAHA 1XKLA 2WM9B 4IDHA 2ZULA 2WU0A 3C3WA 4Y7CA 3VC1A 2VNAA 3H0CA 3USZA 2J3IA 4F3NA 2Y4OA 2JGEA 2ECOA 2ZBFA 3UAXA 3AERA 2JJQA 3BMCB 3OLQA 1DT5A 1Z6XA 5DK4A 3MRVA 3Q5DA 5E9JA 5A4KA 1KJZA 2Q2NA 4HL6A 3KE8A 1EZ1A 4IIGA 4CM6A 5HCNA 4YAGA 3RFUA 1ECCA 2DQYA 4NU0A 1BVHA 3MTIA 4BIMA 3U3KA 4FOPA 4XPIA 3KTOA 4M1EA 4RXUA 3R8FA 1EM8B 1R6UA 1D2RA 3CVXA 3DF7A 1ZICA 1JA0A 4PWZA 3M6AA 1PD1A 3CONA 5K0TA 3WHIA 2ZXUA 1YRLA 2EATA 3I58A 2IX3A 3R09A 2C9DA 4RPKA 5C4IA 3IAXA 4HZGA 3U44B 3W9YA 4JI3B 2V0GA 3G7UA 4INOA 2ZRIA 4MI9A 1X7XB 4O02B 1UQTA 4ZO8A 3WWPA 4CLRB 1Y63A 3GLRA 3KYCA 5D6NA 3T7TA 4EWLA 4F4JA 3TG2A 4B6RA 1X7ZA 1TYCA 2UYGA 1DPFA 3L0YA 3D3QA 4X1OA 4YPFA 1A5ZA 2J0QA 5ESRA 3RV3A 1KFBB 1JV2B 4HTAA 3WB1A 1PGQA 1D07A 3PFNA 2AOXA 1I7LA 4KJZA 1DTWA 1QZZA 2Q2WA 3BTUA 2HC9A 4J0HA 4OREX 4YCBA 5D3MB 1XZGA 2HR1A 3T7CA 3JD0A 4NBWA 2UYQA 4F2HA 3RRFA 2Z09A 2O8BB 2B8JA 3HDTA 2A9RA 1ZA2A 1VIMA 4IJQA 3HUEA 3PB3A 3MJ4A 1KQNA 5E6UA 3RJ9A 1TCBA 3THXA 1OWNA 1OBCA 1RABA 2O2SA 3I1IA 3NM6B 4GM4A 4PSDA 4WHMA 4ZJYA 3S1SA 4AQYB 1NKVA 1ZOIA 1NKSA 5PNTA 3ZCVA 2AEJA 3AW8A 1RI2A 2HBYA 4JLPA 1HYBA 1MVNA 3ET5A 4BXOB 3BMNB 3BMCA 2D8MA 3OEEA 3VR0A 3N2LA 1NBEA 2C2MA 4XUGB 4I99A 2XB2A 2F8MA 3OE4A 5EAIA 2G40A 3OPQA 3RYIB 3S5JA 3HA7A 3NTRA 1IOVA 2UXBB 2BHLA 4IVRA 4KOEC 2E4AA 3FDJA 2VDWB 4FE7A 2QTRA 5TJHA 5F35A 4CDRA 4QTYA 7GPBA 4ZJZA 4NRDA 3VI3B 3Q8KA 2KPOA 2AUTA 2WWIA 4KO1S 1EM8A 1DRWA 4NAUA 1Z0KA 2I1WA 5F21A 2PANA 1PZNA 3B3JA 3P94A 1XAHA 1S2OA 2C5FA 2FMKA 4IH9A 4EVRA 1GSHA 1ODFA 4B82A 2ISCA 3H1GA 2A6PA 3VDXA 1Z18A 2EX1A 4LKOA 4CG2A 5HUHA 3U44A 3GGSA 2EAUA 3WS7A 2I54A 3MAJA 2F3PA 2C2BA 3H04A 2HNKA 4JB0A 4LFCB 4AMYA 4ANFA 1X7XA 4PINA 2HMAA 1X0XA 1YB6A 4WVFA 1Y98A 1NR1A 2SICE 1QLHA 4QBTA 2PNJA 1A71A 2XDWA 4G0XA 2FG7C 3LLVA 1QK5A 3HKBB 5AW1A 2QX9A 1A9XA 4HH0A 3IJRA 1VC2A 3SC6A 1CUEA 3OTWA 1OR8A 1E8DA 4UTNA 1TDJA 2CFCA 3AG6A 3ENQA 3KHSA 4TXJA 5LP6C 2Q6VA 3BBLA 4FNOA 4BQSA 5AH0A 1RYDA 5HBRA 2FSHA 4IIJA 2Q46A 2P75A 4WKCA 5K9ZA 3ZGXA 2DVMA 2O8BA 1QZ3A 1KYTA 5DB4A 3SKXA 3ZKWB 4F85A 5KQSA 5DWDA 3B5EA 2ORVA 1JDUA 3AXSA 2DZDA 4GNRA 2OZKA 1XMXA 2AR0A 2BFCB 1U1GA 2OVFA 2P1RA 3HPRA 4RK1A 7MHTA 1YRWA 2HA7A 3LZCA 1M2VB 5ESXA 2XBLA 4FMPA 5EQFA 5A3SA 3LX8A 3LMKA 5CNKA 4BXOA 3BMNA 2XUHA 1DKNA 3A37A 3LVQE 4MGYR 5EGSA 4CYMA 3LPMA 4K6FA 3IIMA 4EELA 4ENRA 4AY2A 1RVDA 2DFLA 5JSQA 1XJ5A 3DAYA 3QY0A 3B1FA 4TQGA 3NIGB 3IUQA 4MV5A 4NU5A 3V7UA 4DDHA 4YRLA 1Q83A 4Z7JA 2NPFA 1PJ8A 2VDWA 4MLCA 4TTSA 2ZYTX 1KPHA 3DO6A 4ZAXA 2ATVA 1GDTA 4I3GA 5I9SA 1D0VA 4DXHA 4JC4A 3VR1A 1GDHA 1E79D 3LHFA 3D7RA 1ZN2A 2JFWA 2FGJA 3GPDG 3KCQA 4EHNA 2FWIA 3O5AA 3AYZB 3QOXA 5YASA 4M9SA 2ZS9A 2H1CA 1IWPB 2JGNA 2O2EA 1W29A 2QMEA 3A6FA 3IKVA 5BNWA 2R4UA 2XUPA 2JLVA 2GXAA 5ER6A 3TTVA 4I5GA 2Y9MB 4I9HA 4NOKA 2Q3HA 4YJ2F 2FMXA 1NATA 2OAP1 1AV7A 3QHPA 5CVCA 5EYPA 3M3DA 4N0PA 5IXYA 5TIIA 1N2IA 2DEUA 3EBLA 4FEAA 3KB6A 1BIFA 4JYAB 2HDNB 4Q3LA 4DMMA 3VR5H 4S1TA 3HKBA 4HXFB 4PZDA 2VG8A 3E9EA 2OO3A 4HYTA 2IYNA 3ITEA 1YBHA 1GFWA 3OFJA 1L7AA 3TVTA 2H7YA 4DY4A 2GBFA 4UUMA 1D2EA 1J5PA 2BJHA 4P22A 4QD3A 4ZDJA 3U4QB 4FOTA 2I67A 3PXCX 4GH5A 2H1IA 5HK9A 3KALA 2WAMA 5ALYA 1UH5A 1IK4A 2DBZA 1A9SA 5FXMA 3ZKWA 2VDVE 4M1OA 5LM3A 3O94A 1FLDA 4I4TF 5HQTA 2BFCA 1K06A 2FPGB 2FVXA 1M2VA 3B3AA 3NXKA 4NVRA 4PBRA 1EWQA 1G1AA 2OVBA 4FSXA 3KQYA 5B58T 4G1FA 1XJ0A 4TQUS 3IH5A 1I80A 1N2EA 4E5MA 1LCIA 2QX7A 2PMFA 4P53A 5T4FA 1X1DA 1KHTA 1J8QA 3VOBA 1EP1B 4YIHA 1ZD2P 3SHQA 1XPJA 3CNHA 5BORA 5ALEA 3IGFA 2YUIA 1OU0A 4CFSA 4PU0A 2R86A 1K68A 2GGSA 3O21A 1NYTA 1VDMA 1JIKA 3K4PA 3QOWA 3PXUA 4NV1A 1VJGA 3K1YA 1GL7A 4H7JA 1MB9A 3QPAA 3FFAA 3WB0A 2D54A 1N4DA 1NN0A 1T9BA 1A2QA 3KOXA 4R31A 3HFSA 3PXAA 1ULBA 2ID7A 1YU6A 3Q7PA 4KQ9A 4MW2A 1F3LA 5BWCA 2GKOA 2C1EA 1UBLS 2C3MA 3OIGA 4YS6A 1IVSA 5HJEA 1JXAA 3HM9A 3IAFA 5DTJA 4F8EA 1KE1A 3U6BA 4GVLA 4JXXA 3UV3A 3OPVA 3PJGA 3IR5A 4QSMA 1Z0FA 5CVEA 1Y82A 1KEPA 1D2CA 5KDLA 4AJPA 3ZOKA 3PGMA 2ZSEA 1W25A 1HQKA 4NKRA 3LUPA 1MC4A 3OPMA 5KWIA 3KSAC 3A6GA 1PFWA 2HSJA 3SSOA 4FLFA 3H3JA 2BONA 1UIMA 3VNUA 3B3QA 1L1RA 3CX7A 2DU8A 4IXTA 5EKTA 3OFND 2QN2A 2ZZKA 2BI7A 2P2GA 2JEYA 1U6JA 3Q3CA 3D0OA 2I34A 1E5VA 2FCRA 2HXGA 2JZCA 4BO5A 4ZDIA 3ZVMA 4FFSA 1E2MA 1WSDA 3TZKA 3DR5A 2P6RA 2GBGA 3LL4A 4YUWA 1CIVA 1B8OA 3AY3A 5TSDA 1QAOA 1VSTA 4G5GA 3C3JA 4B2YA 1D0IA 3DV2A 2ZSFA 4W9NC 2BUBA 2FPGA 3CZCA 3G2NA 4X44A 3K70C 2EYUA 3I32A 2XNJA 4AM8A 4BZPA 5BRJA 2YMPA 4Y67A 5JAMA 3Q8XB 2EEZA 1O94A 1XU4A 2VXYA 3K0FB 1A97A 5HS4A 3W5JA 3Q8MA 1X74A 3P9NA 1KE2A 4NJMB 4LZWA 4ZAYA 3ZV3A 3L7AA 3CG0A 5EWLB 4O0LA 4B1FA 1D3AA 3S40A 2HHHB 3CH5A 3PYLA 1I2CA 1N3IA 5FHQA 1N5KA 4Y98A 4NECA 3GMSA 5B3KA 2V6BA 3HK2A 3PC4A 2A9JA 1C9MA 3AIOA 1S7GA 1YFKA 3GAMA 7ABPA 2FX5A 2IZ5A 3JRXA 4QBIA 1A3CA 1SURA 3GH1A 4JI1B 3X44A 2R9VA 1RKVA 4A8TA 4DCUA 3INTA 4LUCA 4HX5A 1H0RA 1QIMA 1RWQA 3C3PA 5E3JA 4ZEWA 4MCHA 4KFUA 4YRMA 3HDYA 2PRIA 3BOSA 2FOXA 1HLFA 3U7HB 4AUNA 1C7FA 4D9BA 3EZXA 1DKLA 1NJFA 1GPDG 3B85A 1PWXA 4GSYA 5ESWA 3TTUA 4EHJA 4IVQA 2H5LA 2YJTD 3OLYA 3WYBA 4E32A 5JSYA 4PG4A 5L3QB 3W1WA 5K4AA 5B2EA 3SR0A 2PIDA 4Q9KA 2QXUA 2C99A 4JSRA 4P36A 2FPSA 2GCOB 3GJ6A 4M7WA 1SBZA 1N6PA 2OHHA 5I9TA 4DIMA 1A98A 1KJJA 1QRRA 2YWEA 2Y0DA 1WBBA 1UOOA 1GXSB 3HDGA 4QPJC 4AS2A 3B12A 1IUKA 3LK7A 2OMKA 5J4VA 4DKJA 1ZBQA 1DJQA 2DFNA 4M76B 5AESA 5EL0A 5K0LA 3E9CA 4RVDA 3I23A 2JFGA 2B1RA 3NH9A 5K3CA 5CFOA 4X66B 1P1CA 4RTQA 1OIXA 2W2KB 121PA 4MRMB 4JJAA 3H9EO 1QH1B 5IH3A 1P4JA 2IPXA 2JH3A 3LPDA 4JH0A 1H1TA 1WD5A 2J45A 2Y68A 3K0FA 5J9FA 4B2IA 3OOHA 3MQ4A 3TTWA 1RQ7A 4H3SA 4OGFA 4MEJA 3OJXA 4F96A 4NJMA 4CR6A 3U40A 4KR0A 1DBIA 4EIWA 4M0FA 1T35A 1E2JA 4QBHA 5CM9C 5EWLA 2OY0A 3Q10A 4HSGA 3W90A 4NCJA 1USGA 4ZZIA 1XF1A 2QVYX 3WIUA 2CB0A 1R5JA 3FSRA 4F1JA 4K05A 5DGXA 5ILGA 4IAOA 2VYNA 1EA7A 2JJMA 1YZTA 2R7NA 3LBFA 1O8BA 4YYEA 4PC3A 3BXFA 4KU4A 4OLHA 3WKBA 4PTLA 3HLYA 3L43A 1L8XA 1J00A 1GVHA 1QRSA 1YT5A 4PYQA 1ZKMA 1XD2B 4AMVA 1JU9A 1CUIA 2XYGA 5J2UF 1C7RA 5IS2A 1NX9A 2JFVA 2B61A 3HKDB 4CL0A 3C14C 2IYAA 3C4VA 5GWXA 4ENUA 2O8DA 3ED5A 4W7IA 4RACA 4CCYA 2W2MA 1JHQA 4BKPA 2LDXA 4HUQB 4OY3A 4AN4A 5KDOA 3TZBA 5J58A 3FTNA 1AGXA 5L3QA 5HM8A 3SZUA 1DRUA 1LPPA 1GPH1 4AZWA 1W581 1V8OA 4C87A 2GCOA 2KWIA 4FNGA 2H2AA 3CX3A 4G0WA 3ICCA 2ZJ4A 3MG9A 1P7VA 1NOJA 1C80A 1PJTA 2WEKA 3NYQA 2D62A 3M82A 4RC9A 3HBJA 1GXSA 2H11A 2HXSA 3N74A 1TTTA 1U9JA 3VU8A 1PKEA 4DC9A 1E6EA 3UAYA 5D5QA 1E9BA 1A4UA 1QCYA 5IP5A 5A7GA 5DT2A 2XH8A 1UT8A 3I6QA 3R23A 4MW5A 1VBFA 2FMUA 1QNLA 5KJ1A 1G291 1FMFA 4TVKA 2W2KA 3UPTA 4MRMA 2Z2JA 1QH1A 3W3AA 3WDKA 3ZEAA 3ZHVA 2QNRA 2IYRA 2K7ZA 1EP3B 5ES4B 1BHSA 5F7ZA 4EG3A 4W8GA 3LLMA 1QIHA 4RX1A 4DCNA 4HVLA 1QDLB 1Q0ZA 1DAOA 1NNSA 1CP2A 1YZFA 2E18A 3JYQA 3MQFA 3IQIX 4KGZA 1H2BA 2JFFA 1U8XX 2LV8A 2P90A 3CSSA 1OWMA 4QYSA 3ROKA 3RYHB 4C07A 4WLUA 3CRNA 1QVWA 3U1VA 1I7SB 4EHLA 3OZGA 1XIVA 4U7PB 2QN8A 3ICQB 2E2WA 3P9YA 4DMKA 3CUSA 3CLRC 1OBOA 2YJZA 4PNHA 1XD2A 4BDTA 4HVCA 2HPHA 1VGVA 4JWTA 5JD5A 5KVSA 3OZAA 1WKVA 4LMAA 3HKDA 3EGOA 4PANA 5EINA 1DRKA 5I7EA 3NXSA 4NCKA 1NLZA 4PCUA 1F14A 1ZH2A 4C0KA 2NU9A 3TQRA 4EUFA 3CVYA 3S44A 4HUQA 1FMTA 4I19A 4MUAA 2R6AA 1Y3DE 1MA0A 1Q1AA 3CEHA 3EDQA 2QTLA 2VP4A 3PDWA 2YZ7A 2J3HA 2VYFA 1SRQA 1Q50A 2N75A 3ZCRA 1HEYA 3KC2A 4WOBA 3G0HA 5F4ZA 3WJ1A 1A9YA 1JJFA 3SBDA 3RC9A 3I8SA 3DE7X 3FCUB 4W8HA 4A91A 2ZYSA 3V6MA 1RT9A 3NKVA 3NMUF 2OB1A 2ZDHA 4CT5A 5JFOA 1S3SA 4LC9A 2ZT7A 3QWAA 1TK3A 2ZYWX 4UM5A 5EIAA 1B7GO 1J21A 4YMHA 4RDCA 1OLXB 5HR5A 3LKBA 4CEJB 3BHNA 2ZQYA 4FZJA 4KFTA 3CX8A 2Q1SA 4YWHA 1Q3KA 4GKKB 4F92B 1C14A 3DLPX 3TLBA 3IHLA 3EPPA 3RJMA 3HEAA 5JBNA 5AVWA 2H2IA 1XJQA 1NF9A 4NJEA 4R2HA 4R0NA 3RSOA 3H11B 3OQ6A 3PFBA 1XD8A 5KBYA 2X3UA 4N01A 3MAGA 5C52B 1IEQA 5IZCC 3ANXA 3OTOB 3M4XA 3E4CA 4WRRA 1TD9A 5D01A 4TLLB 1Q92A 2HIHA 2IT1A 4WKPA 5ARDA 2XMSA 3ITDA 2ALJA 1NQVA 3PUKA 1OFVA 4EA8A 4WN9B 4E14A 4UULA 3QQPA 2LVBA 2JASA 3JSXA 4AY5A 1R64A 1VCHA 1YOBA 2BWJA 4JMLA 4I8IA 5B5SA 2IS2A 1XKTA 2ACKA 1AKNA 4ZDKA 3L6UA 1F4PA 2BI8A 1LK7A 5CRIA 5ALMA 2DRIA 5FBRB 3ORFA 4B6JA 5F3WB 3OWHA 2XOXA 3EFHA 2VRWA 1XMQB 5AUOB 4EM6A 1O5IA 3LO5A 2ZRCA 4KQEA 5HJ2A 1WV0A 3V8PA 1C81A 1WZUA 1JB1A 2QS9A 1VG9B 4OTZA 4TXNA 5JEDA 1W7AA 1MMFB 1C2TA 1W59A 16PKA 4URHA 1ADGA 1F2UB 1Z5GA 4LXYA 1W96A 4KWCA 2PT7A 2VR1A 3SXJA 2H9AA 2I6GA 4BOYA 2HSDA 1TTQB 2QTGA 1HBJA 5AXBA 2KW5A 2NQ2C 1XMSA 3DFIA 3ILVA 1QG4A 2NPOA 5DLDA 1M2HA 1MIHA 3HN7A 2B37A 2CYAA 1Z56C 3ADPA 3AI2A 1LZLA 3OIWA 3QVOA 1SBYA 4P5PA 4K3UA 5KNCA 1IIRA 1CJCA 4ZEVA 3WRXC 1XRQA 4I1OA 1ZD9A 5C4GB 2RAPA 4ZA2A 2VP5A 1OLXA 3P5BA 3Q12A 4R9UC 3CR7A 3L7NA 4BVEA 4CEJA 2Y99A 4YRTA 3T15A 8OHMA 1XHEA 5AKHA 1WZNA 4CKCA 5ABPA 4DJFC 2QUHA 4JL5A 5K6AA 3Q2OA 1XCBA 4PSCA 1CUFA 2OL4A 3H11A 1TYAE 1Z4IA 1DBSA 2K6GA 1FSPA 2ON6A 2QTVB 1HNWB 2X0DA 4RE5A 3IBYA 1CUSA 3HJFA 4WN9A 5COBA 1Y1LA 4RQUA 2DH6A 1MH1A 1CY0A 1OHHD 2D3WA 2I6QA 3Q3JB 1AS3A 1E59A 1LTQA 2NO4A 3UUGA 3F7MA 3FZYA 4AZTA 1FJXA 2GSDA 4J0EA 1THGA 1R9MA 5EOVA 3I53A 3V2UA 2Y1OA 1FRVA 1XZHA 5LR6A 4QT4A 1VMKA 4N48A 3EZ7A 1KFCB 2XQKA 4P3NA 1SQ0A 2HF8A 4MMZB 5AVKA 2W6PA 1XCMA 3HTXA 3KKNA 5FOTA 4BQEA 4ZT5A 4V0MA 4FR5A 4XCQA 2IDMA 1PGJA 1DG3A 1UC5B 2ZVPX 3RRMA 4MDYA 1JLMA 1RIIA 1F2UA 1E9EA 3B6ZA 2AJLI 2JAPA 3CWZA 1CVLA 4IKEA 5BNZA 2HQBA 3MGCA 2NXJA 3WIVA 2A67A 1PR1A 3SPXA 1JUDA 1Y48E 3EZYA 3OWXA 4OJQA 3OBIA 4U7JA 3CB4A 4JZYA 4ZGBA 2PH5A 5LP6B 1CEXA 3ESQA 1IPFA 3G5UA 4GUAA 1BX0A 1FP4B 1BDIA 2CL6X 2IY9A 2Z30A 4DLBA 4AKGA 1Y6QA 4KSCA 2YVLA 3C85A 3VYVA 4E94A 2PUAA 3FNFA 1OBHA 1Z2CA 4E07A 5E0KB 1T1RA 2BEJA 1H0SA 2VUHB 3PGJA 1OA0A 2GCEA 3NEAA 1G66A 4IUYA 1FEZA 2FAXA 2VJYA 1DOZA 4V0ME 4GGOA 1N34B 4B3RB 4WE3A 2W11A 2VWPA 1GG5A 1OXMA 1R6BX 2RCNA 1IMOA 1Z47A 3MTGA 1L5LA 2DE0X 5A4DA 4MV9A 4G24A 2CLFB 4LJ8A 3WLTA 1ORVA 2BFDB 3B9RA 3D8RA 3D3EA 3EVNA 4XARA 4Y8VA 1Q22A 4YC7A 5T3UA 4B48A 4MRVA 2CDCA 2I3ZA 4EKEA 1HA3A 4H0CA 3QF4B 3OVMA 2ZK7A 4Q7QA 1J1ZA 3BWEA 1YCHA 2Z1MA 1D8AA 3GGGA 4G1VA 2VZ8A 4BNFA 5MGBA 1KZYC 1T9DA 5T57A 1E9AA 2XD4A 1ODJA 5C32A 4QU0A 3UY4A 3LIPA 3M3PA 4WOCA 5LMCA 4N0EA 4FE4A 3SS8A 4NPAA 3EXG2 1KI6B 3DFZA 4I4CA 4ABTA 5JMTA 4TVSA 1S4QA 2WE7A 5A9TA 1ZGHA 2WSYB 5ALXA 4GQAA 5GY7A 3CR3C 1JR6A 1C8VB 2B8WA 2WD8A 3FDZB 3TLZA 2VPIA 3IPRA 3LH5A 2ZOSA 2GHTA 4E11A 4WBNB 4ZYLA 2WTXA 3BTOA 1IJKA 3PUJA 4F56A 2PUCA 2BELA 3UATA 3NDPA 4L5CA 4N6OA 2L2QA 4QWWA 2GZ1A 2W4IA 4YXFA 3GFFA 3DTVB 2PSSA 1NF3A 1Z4LA 2YMQA 5LP6A 3OETA 1DAKA 3TE7A 3RSFA 1FP4A 3LCVB 3L6RA 3BMOB 1J8DA 1KS9A 5G0UA 4BMZA 3EHEA 3SICE 3FKQA 3EVDA 2AOUB 3HWX1 2B1JA 3L18A 1OX6A 1GT91 3H8SA 4LW8A 1YDHA 2YMLA 4ENTA 4K9KA 4OBBA 2ADOA 1JQDA 4WY2A 1YRBA 2H4WA 3GA7A 4GSLA 1QV9A 3ZDCA 3KDPA 1AMNA 2GEJA 2Z5GA 1AQUA 1DRVA 3TLCA 1P2FA 1GTG1 4LHSA 3S2SA 1QF9A 3RS2A 2HSZA 4XYMA 3REOA 4EGQA 1GKYA 1H93A 1E7WA 4X8MA 4TS9A 1JW9B 2A5FA 2AN9A 1MIOA 2LTAA 3LC7O 3PFFA 4X85A 4Q1VA 1F9EA 2XNHA 5LMUB 1OH6A 1KBZA 4UNRA 1Z5UA 4V1CI 3WLNA 5JYBA 1O4WA 2C5HA 3K53A 1EPUA 3EFOB 1UJ2A 2X4LA 4BWVA 5LBUA 3VC2A 1OCEA 2X40A 3JZAA 3ZDYB 2C9CA 2WJAA 2GCIA 2P3SA 3MXOA 4XA8A 5AI6A 4D4IA 5FWNA 1A7AA 4PO8A 4TV9F 3ZE0B 1E4YA 1K7FB 5B12A 5M3BA 1E3MA 2EW8A 2POQX 1N6KA 1AZTA 1SUFA 2YHBA 2OTCA 4YH1A 2QLBA 3UB2A 2NXCA 2AX4A 4YLGA 1CR1A 4H7DA 3IP7A 2FSPA 3DG9A 5F4BA 2I2DA 1AM4D 3RTDA 5CLHA 3IP8A 5FQOA 3FDZA 4DXDA 8GPBA 2GD2A 2MYNA 5I6DA 3EF3A 3R6LA 4K5QA 3R5TA 4NCXA 1Q5PA 2CDAA 5ILQA 2D2IA 3FY4A 1N0UA 1CEQA 2AC2A 1XZNA 2ZDGA 3GX1A 4TT8A 1Y80A 5G3YA 4B3XA 2GAAA 4FDLA 4QYIB 3WO1A 2Q5QA 5E3HA 1N57A 4XLLA 3DTVA 4FM9A 3NUGA 2YVUA 3Q15C 1TC1A 2NYUA 3D3NA 1UFQA 3NAQA 5CDFE 1GGFA 1EHIA 3BMOA 5EMMA 3RUCA 3O8RA 3OSZA 2AOUA 3FNIA 2RARA 3HNOA 4KC0A 3ET4A 3VNAA 3AWIA 5EZYF 4LHXA 2WG0A 2G0AA 4DQUA 1C41A 4PZUA 2YRFA 5F9MA 3X1WA 1WXQA 3RTAA 3GNTA 3HVIA 1EJ6A 4OP2A 1B8NA 5FOUA 5AJTA 3OQNA 1X9IA 3K70B 3RH0A 1XQYA 2MT9A 1LA2A 4WESA 4D2IA 2HMSA 3KUXA 3PTAA 3MMSA 4UHCA 2X2EA 2AJDA 3W1VA 5JDCC 2FEMA 1LK0A 1NN5A 4HR7A 4CN8A 5IBCA 3SX2A