3E84A

Structure-function analysis of 2-keto-3-deoxy-d-glycero-d-galacto-nononate-9-phosphate (kdn) phosphatase defines a new clad within the type c0 had subfamily
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
b'MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylneuraminate cytidylyltransferase
publication title Structure-Function Analysis of 2-Keto-3-deoxy-D-glycero-D-galactonononate-9-phosphate Phosphatase Defines Specificity Elements in Type C0 Haloalkanoate Dehalogenase Family Members.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase
total genus 51
structure length 164
sequence length 164
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3e84A00
4UMVA 5ALDA 2BDUA 3U13A 4MWOA 2FPWA 2P27A 4BBJA 3HLTA 3SKXA 1S2OA 1YMQA 3KD3A 4AS3A 4O8CA 2W11A 4XPZA 2JGAA 4JDPA 5AIAA 1ZD2P 4Y2PA 5E0OA 2WF5A 5AKZA 2P11A 3UMGA 4BKMA 3MC1A 1WPGA 1RLMA 2HHLA 3NAMA 3ZWDA 5ALLA 5AKYA 1CQZA 2C88A 4BEWA 3IRUA 4NFLA 1NF2A 3PGVA 3U7HB 4L6CA 1QQ5A 4I9FA 1TA0A 4NV0A 2G09A 2FPSA 4YIKA 2OA0A 3U7GA 3AR2A 3FPSA 3TLMA 3ESRA 4F72A 2ZG6A 2B8JA 5ALTA 4NAVA 1Z5UA 2W43A 2YJ4A 3QX7A 5AKJA 2P69A 2YBDA 3A3YA 4YCMA 1XP5A 4EELA 3MPOA 2ZBGA 2JARA 3E84A 2NO5A 3MN1A 4UARA 3QYPA 2WM8A 2RB5A 4J2TA 1Z4MA 3FM9A 3M9LA 3AR6A 3UM9A 1Z4QA 3OCUA 4Y2QA 1RMQA 1K1EA 4IG4A 1WVIA 1T9ZA 3L0CA 3L8FA 2B0CA 5AW6A 1RC8A 3NIWA 4HGRA 2PKEA 3MMZA 4EZEA 3QU2A 1Z4KA 1WR8A 1EK2A 3R4CA 4BNDA 3S6JA 3OCWA 2BY4A 4UAVA 4UU0A 3QUQA 4UM7A 2G07A 3SMVA 3WK7A 2OBBA 2PQ0A 3B9BA 2JAWA 3F9RA 4Y2VA 5ALKA 5AESA 3DV9A 3A1DA 1RQLA 1Z4NA 1ZOLA 5ALGA 5AHXA 5AW0A 4CE6A 4L6AA 3SKYA 5AKHA 4Y2RA 3I1YA 3OCXA 5A3RA 1PW5A 2VKQA 4XOUA 4C4SA 2FPXA 3R09A 3ONNA 4ZEVA 2C8KA 3L8HA 5AI9A 3ZU6A 1WZCA 4G63A 4HYTA 4UMDA 1QYIA 3U7EB 4Y2TA 3NANA 2HO4A 1YDFA 3EWIA 2FI1A 3QUCA 4UMEA 4C4RA 4EEKA 4KX3A 2ZXEA 1CR6A 3IB6A 3AR9A 4Y2XA 5A3QA 3QU7A 3ET5A 5AKGA 4L57A 2YMPA 1NNLA 1N8NA 3L8EA 2C4NA 2WF8A 5IT4A 2ODAA 2FPUA 3SHQA 1L7OA 2IYEA 3SLRA 4F71A 3WK5A 5ALNA 3QLEA 2GFHA 4YCLA 2DQSA 3L8GA 2EATA 3EF0A 5AM1A 2YJ6A 5AM2A 4Y2UA 5IS2A 5AM3A 1T5TA 4FE3A 2OM6A 1RKVA 4FYPA 3I6BA 2R8XA 3ZTYA 3AR5A 4FFDA 3ZWKA 1Z4IA 4AS2A 5AW3A 1RDFA 3QNMA 3E58A 5AW1A 4CF4A 2AH5A 1VJ5A 3P96A 1J8DA 5FP0A 2G08A 5ALOA 3EF1A 5T41A 2WFAA 3E81A 4UU1A 1XPJA 5AVRA 3AR8A 3VAYA 5AK6A 4QJBA 5AKLA 4B6JA 3BA6A 5A3SA 3N1UA 2BDEA 4MUMA 4OD0A 3WK8A 4OHFA 3QUBA 2I55A 2WF7A 1U02A 3L0YA 3ED5A 4BEVA 4RESA 4YIHA 1X42A 2CFTA 1NRWA 2YMMA 3QXGA 1SU4A 1YV9A 1ZS9A 4PNHA 4KNWA 4UM5A 1L7MA 2IOHA 4UAUA 1L7PA 5ALPA 3KDPA 3DAOA 2YMQA 4J03A 2B1RA 2YJ5A 1U2SA 1L8LA 1RKUA 3KOOA 5AKKA 3R9KA 1S8OA 5ALQA 5ALVA 3A1EA 3CNHA 3L5KA 4IFTA 4Y2JA 3ZX4A 3NUQA 1U7OA 3M1YA 4I9GA 2FUEA 3L7YA 1TE2A 2RBKA 2ZBEA 2CN1A 3NRJA 5AW4A 1T5SA 5ALYA 3WKBA 3NASA 3L0BA 3J7TA 4YH1A 4UATA 1ZRNA 3AR3A 1L6RA 4CNQA 2CFRA 5ALSA 5AVQA 3D6JA 2B82A 2QYHA 4OCZA 4C4TA 2P9JA 2G06A 2NYVA 2WHEA 2YFYA 4BX3A 3KZXA 2X4DA 3DDHA 3SD7A 3NALA 2WF9A 2I6XA 5AW8A 3U19A 5AM4A 3WK9A 1N9KA 3W5DA 1RLOA 3B9RA 1U7PA 3OTQA 5AI0A 5ALHA 2IOFK 1XVIA 3B8EA 2AUTA 2B8EA 2PR7A 3I76A 1QH9A 2W4MA 3AR7A 3WKCA 3ET4A 1ZD5A 3QU4A 1Z4LA 2GMWA 1Z4OA 2GO7A 3ZUPA 1Z88A 3QU9A 2R8ZA 3I28A 2YY6A 5AI6A 2EAUA 3KBBA 3N07A 4ZEWA 4BNDB 1O08A 4GXTA 3N28A 2R8YA 5AKXA 5AW5A 1RMYA 2YJ3A 5AKIA 1YNSA 4GIBA 1SWWA 1LVHA 1FEZA 3BWVA 4DCCA 5ALWA 3GYGA 2HCFA 2ZBFA 3WGUA 5AVWA 2HF2A 2ZOSA 3W5CA 4UMFA 2IOFA 3E8MA 3WKAA 3ZVLA 2YN4A 1TJ4A 1RMTA 5AM0A 4UW9A 1RLTA 1Z5GA 1TJ3A 1Y8AA 1MH9A 3ZVMA 5AKEA 3HYCA 1F5SA 5IT0A 4KX5A 4Y2YA 1L8OA 2CFSA 2Q5EA 4E88A 2FUCA 3KC2A 2QLTA 5AK3A 3CZ4A 3RF6A 3ZI4A 5AVVA 2B30A 2HI0A 4DFDA 2GHTA 3ZX5A 4BYGA 3WKDA 1Z4JA 3EPRA 1EK1A 4OFZA 3QU5A 2ZBDA 1Q91A 3OCYA 3K1ZA 1ZRMA 4ZEXA 4HGOA 3U26A 4KN8A 5ALEA 3ESQA 5ALRA 5ALXA 4KYTA 5AICA 5AVTA 2C8LA 4EENA 2HX1A 3AR4A 2G1AA 2IA5A 3QGMA 4H1WA 4KNVA 3W5AA 2I34A 1RPZA 3ZTWA 5AVXA 4Y2SA 2NO4A 5AK4A 5AIBA 1KYTA 3SF0A 5AI8A 2AMYA 4Y3UA 5AM5A 2C9MA 3WKEA 3OCZA 4NABA 2Q4TA 1TJ5A 4G9BA 3PDWA 4CF3A 3PGLA 2D2VA 4DW8A 3WK6A 5ALFA 3UMBA 1YS9A 1J97A 1RQNA 4DWOA 5AW7A 2HSZA 1RKQA 5ALIA 3WK4A 2HOQA 2I7DA 2AGVA 2B1QA 1VJRA 3W5BA 2HF7A 4YCNA 5AI4A 3DNPA 5JJBA 5AW2A 2WF6A 5ALMA 1L7NA 1SWVA 2OYCA 1Z4PX 3OCVA 3RFUA 1U2TA 4EX7A 2FDRA 2EARA 3N5KA 3U7FB 2YMLA 3FPBA 4RETA 3A1CA 4BX2A 5AVUA 1ZD4A 2GHQA 2HDOA 2O9JA 2HEGA 3L1VA 2RAVA 4BX0A 4XQ0A 2FPRA 3ZVNA 2RARA 3FZQA 3PCTA 4HGNA 2JAUA 3WGVA 4CF5A 1LTQA 1QQ6A 5ALZA 1ZJJA 2MSNA 2I33A 3L1UA 4QQFA 5AK5A 3ZW7A 1RRCA 2O2XA 5AVSA 3OPXA 3QUTA 1VFPA 2MU1A 2FEAA 1AQ6A 2G80A 2Q4RA 1Q92A 1YJ5A 4YGYA 3FGOA 5AI5A 4HGQA 2I54A 5ALUA 4JB3A 4NWIA 1QQ7A 4HGPA 5ALJA 4XE5A 5AVZA 2JAOA 3FVVA 1JUDA 4UASA 4HAIA 4EX6A 2R8EA 1O03A 3IJ5A 1ZD3A 3N8GA 3UMCA 5AW9A 2G0AA 5AVYA 1IWOA 4AP9A
chains in the Genus database with same CATH superfamily
4UMVA 4BFUA 4FE4A 4DV4B 2BDUA 1Y8QB 4DA6A 5EQFA 4DKXA 4I7EA 2IZ0A 1GNQA 1VXRA 3FKSD 4YQZA 1PFVA 1QANA 4U5XA 2C3MA 2QZ4A 1O5IA 3B48A 4FZJA 1NUQA 1IQ0A 4OI4A 1PJ3A 3BXEA 4HH4A 4EW2A 1Z8DA 2ID7A 1JMVA 1COWA 4XPZA 5IBCA 3HEMA 3QVMA 2EP5A 4H6WA 4LHEA 1ZJ4A 4MKXA 3SYNA 2G36A 5ADWA 1NBAA 4MAAA 1JL3A 4R51A 1U4NA 5KAPA 4BMVA 4ER6A 2ZRMA 1UBSB 1XEFA 3U4AA 3RYFA 1I1QB 4IMRA 1TADA 1YF3A 5HFNA 2P7IA 5BSVA 2G76A 4J75A 4Y6SA 4DSOA 3MS2A 3GC6A 5BQFA 3MINB 4RULA 3MCAA 2Q1TA 1MB0A 3N76A 2NZYA 4YFVA 3VDQA 2H5IA 2JI7A 1WPXA 4KQHA 3OZUA 4RVDA 2ESRA 1DC7A 3VPCA 4C76A 1LW6E 4X6XA 2JIBA 4FBLA 1QVRA 3VQTA 4M1KA 3ZLJA 1GNPA 1W34A 2V03A 3RF7A 3L8DA 2XX3A 1ADFA 4J0HA 3H2SA 1MOSA 2P9GA 2G9QA 4HQNA 4C4OA 4NYJQ 1B43A 3L7BA 3R9XA 4J4BA 4RJTA 4X7PA 4UBKA 5JTUA 3DKRA 3D8UA 1NHGA 5HJEA 2QR5A 1V7ZA 3ANXA 1G3UA 3Q10A 4KPEC 2BMFA 2VRNA 3NM5A 2B5OA 1QHIA 1J5EB 3CISA 4QLBA 3H5AA 5HFJA 3UJHA 3FSJX 4PN3A 3KB8A 4ML3A 5BNZA 2XQFA 4WA7A 1AQLA 2PYDA 2G25A 3AC0A 4LRXA 4XXHA 4UNRA 5CG1A 1XCMA 2O0JA 1P5FA 3AR6A 3G2IA 4FNOA 2PIAA 3W0LB 4UVIA 5CVVA 5JXGA 5K8VA 3NEYA 3WNDA 4TGLA 2ZSJA 4C4XA 4CCAA 4H0NA 1RWVA 4MPPA 3PFFA 1C1DB 1NMEA 5LNK6 1QYWA 3BRSA 2DOKA 2LDBA 1LH0A 2OQVA 3CF0A 3AI7A 1ZGAA 3MMZA 3NRBA 2Y2UA 5DI9A 4YRKA 1EM8B 3QPWA 4M46A 1Y4AE 2O3QA 4X3PA 2AJLI 3O1LA 3DGEC 1YB2A 3KKNA 3RR2A 2ZQ5A 4CQMD 5IJAA 5LB2A 3B6IA 5GTDA 4KMOA 3ZS9A 4CLXA 5B1HA 4DDWA 1U9CA 2XOKD 4LMAA 3KDAA 4DGQA 5JECA 3V4FA 2J48A 1JMYA 4B1FA 1SVIA 5BYKA 3EEFA 4DLUA 3IVXA 4N0MA 1UEIA 3FTCA 4YMGA 3G0GA 5C51B 1UBJS 4TL8A 2O3TA 2JGNA 1D1SA 2CNNA 2FSIA 3V1KA 2ILTA 5A3RA 4JHXA 5F1KA 1O2DA 2H1LA 3O94A 4BVHA 4PEVA 1HDIA 1L4UA 1Y4ZA 1AKTA 4GLFA 5KPJA 3UKDA 5IN4A 5AH0A 3QMWA 1JR2A 1MV5A 1VG9B 1VI5A 5DISB 5EZSA 2LIPA 4ZT5A 4YR7A 1XYYA 2IU4A 4LBZA 4OY3A 4D7AA 4G8JA 4PPQA 3V4ZA 2CB9A 4MCJA 2WLSA 1XDZA 2EBHX 4I8XA 1N34B 4X45A 4C0JA 4LDQA 4ZI3A 1KYVA 3CIFA 4TMTA 3VOBA 1L4LA 4QRIA 3SJ7A 3KYDA 5LQJA 1CR6A 1SCKA 1N8SA 2FRVA 1H8EA 5JWOA 2DVMA 1ELOA 3DBRA 3FF4A 4OH7A 1SIBE 1Z2EA 2FHPA 3HLYA 3IVRA 3M3HA 3U17A 4CL3A 3T5MA 1JQLB 3V7UA 2YMPA 4CQLB 1N8NA 1N9ZA 3NFRA 3VOAA 4RV5A 1PS0A 1EBFA 3LFHA 2QZ9A 2ZRDA 3QOXA 4J1NA 1Q19A 1B3BA 2C4VA 3TKAA 4B3MB 3RIMA 4IS2A 5B64A 3TKYA 4TS3A 3D1VA 5IT4A 4X64B 1MX1A 1OE0A 1NVEA 1R6UA 2CHUA 2VBCA 1XNRB 1GD1O 4XIFA 2W22A 1CKEA 1X3LA 1L4MA 4OU4A 4C89A 4RGQA 1JLMA 5DCYA 1KDRA 3IT0A 1ZH0A 3H7AA 4ZAFA 5CA0A 3UUFA 3JZAA 5EHNA 1PWXA 1G59A 4J0FA 3OQPA 4WXEA 1UQRA 2UUBB 1J8QA 2H1VA 2AFVA 3Q8XB 2IP2A 4ALLA 3A06A 5F3RA 4TV8B 3LGSA 5LR6A 4BO1A 4CEJB 1V1JA 2IBMA 2RCYA 3I6BA 4JLAA 4XKJA 3SX0A 2IU0A 4AJEA 1BFKA 2G17A 3AY0A 3CUKA 3R7WA 5DN6D 4QDJA 2IHJA 3RLIA 1P1JA 4DHWA 1GEEA 4G0PA 3L7MA 1B8NA 1TU3A 1T6YA 1WMAA 2A1TS 1Z4IA 2XQKA 3CR7A 3EY4A 3BXHA 5DBFA 4AJIA 4DNOA 4ZK6A 4KREA 4WXRA 4PC1A 1IWPB 2A7XA 1F2DA 2J8ZA 5JROA 2J6CA 3G9ZA 4P4TA 3KFLA 3E58A 5TNXA 1XKQA 2VK2A 4LYFA 4QU8A 3T0FA 3BXFA 3TLJA 3NWPA 3IEPA 3NBYC 4OLBA 4KXLA 5JVDA 4K1XA 4NJEA 5FNVA 3HZOA 3AHGA 3KAPA 4LCBA 4LFBB 1QO9A 4Q24A 1RWBA 2HKIA 3M49A 4FFMA 1Z0DA 2YZ7A 3DFUA 1F51E 1PL7A 4PAMA 3VSAA 4A03A 3DXFA 4K6GA 1T4GA 3E82A 3FYCA 2GD6A 2GA9A 1Z18A 3UMRA 3ZCTA 5A7GA 1Y4SA 5FA6A 4HQKA 4XEHA 5KREA 3TFOA 2HYIC 2KSQA 2YVAA 1JDTA 3WGQA 1R0CA 3WRVA 1ZOIA 1P75A 3VNBA 1GLGA 5A4IS 1HNXB 3IUMA 4RPCA 3LD9A 3WYCA 1SRQA 3FTNA 5TB5A 3RWMB 1MZPA 5KU7A 3QUBA 4DDUA 1U04A 3OOEA 1K3FA 4HRVA 1G7TA 1WXHA 2FN4A 3ICOA 3X0DA 4YIHA 1GKUB 2EHDA 3I83A 4G8DA 4FONA 4RVNA 1LF0A 2VJCA 2QJTA 3B70A 4V02A 1PCXA 3KSUA 1GKKA 3U60B 4LX8A 3CUVA 4F7DA 3HDTA 4OM8A 4QHSA 4DZZA 4ND8B 1BMQA 1ZM4A 2GEKA 4QXOA 4TMZA 3LCJA 1IPEA 4K9PA 5E9JA 2XR1A 4BYMA 4C7BA 3BMQA 5T4BA 2EFJA 2R86A 2IV2X 3PV0A 5HR5A 1XALA 3L4SO 1AS0A 3F3MA 3KUKA 3RRZA 3Q8MA 4TQAA 3EH1A 2VHJA 2R84A 1B0UA 4XTCS 1RPNA 1NQWA 1RYHA 4LE1A 1PJTA 5HE8A 1EAYA 4M1QA 2K7ZA 2QZPA 4RTSA 3G0IA 2VNAA 5CYGA 5ALVA 3PK0A 5K20A 4NULA 3GLFB 1R27A 3NYIA 4IFTA 2ZYWX 3LHFA 4HFNA 2P0YA 1VJ1A 3FPKA 4PLZA 3T3HA 3VMFA 1YA6A 2MSKA 3L7YA 2BZ1A 3WNCA 2H2IA 4TT3D 2FLVA 4PVCA 2YWEA 1X80B 2C5AA 5HDQA 4TPKA 1LA2A 2AOTB 3PJFA 5FTJA 5DP1A 5F5LA 1RI3A 5LKAA 3ZXSA 3R3HA 1KSJA 4DBLE 1DAMA 1H22A 1Q1GA 3QKWA 4FWBA 5KYYB 1MGOA 2RGGA 3F3YA 3KWFA 3OU6A 1IQPA 1L5YA 2QYHA 3A4IA 4D4MA 5EHXA 2X40A 3CPJB 2EIXA 4JWTA 3C4VA 4WCDA 1QZUA 3QHQA 3D43A 1WY7A 3CGWA 4LPSA 4JJ8A 3D81A 5EGNA 1D04A 5HFAA 1EZZA 3ACDA 3SBDA 3DV0A 3TCNA 3E5NA 3UJ9A 4WCVA 4DLBA 1AUPA 4QOEA 3RFTA 3EXIA 2H11A 4RZ2A 1SD2A 1NVAA 5BWCA 2GAOA 3OTQA 4KTVE 3RRYA 3PX7A 2ADFA 2XOKA 2PSJA 2IOFK 1QS0B 1E18A 3LHDA 3QITA 4MVWA 5DCUA 2B21A 1Y5MA 5FI0B 1XQYA 1DPGA 1LPNA 4PC6A 3EMBA 5G3YA 4F9EA 4XB1A 3EVCA 3WIVA 3V2UA 3GXOA 2B37A 1XL0A 2P4EA 3N6RA 4INJA 2HA3A 3O82A 2VDPB 2GCIA 1G41A 3QU9A 1M1ZA 1R9GA 4GOKA 1QC5A 3DBVO 3I28A 2B4AA 3TIFA 1OREA 1SPXA 3SC4A 4EUFA 2EAUA 3H4TA 3W2EA 3A36A 4K6HA 2E87A 3LCMA 4CQNA 4I66A 3SZMA 2XXBA 4GXTA 3DVRX 1BAPA 2HMYB 4OXQA 1J25A 3TB4A 1M1YA 3I9FA 1V2HE 5HIIA 3VV3A 3H0EA 1OU0A 3RYIA 2CXOA 4BV2A 2V6IA 4KH0A 1FEZA 3RTEA 1P4HA 3IUBA 4KRXA 4OO3A 4P83A 4TMVA 5AJVB 1VJCA 5GGYA 3U37A 3ILSA 1XQWA 4LRTB 3M4JA 2H00A 3TQQA 3KQHA 3KB1A 3WOVA 2ERYA 1O96B 5GJWC 7YASA 1NNI1 1ZVMA 3CB2A 3V9PA 1H3NA 2ZYRA 2GRAA 1QG6A 5G0UA 3A9TA 3ORFA 4B81A 1BOFA 1HQYE 4F1JA 1Q0RA 1H2YA 3HYCA 1DE0A 1PR0A 3TLBA 1E2FA 1E1DA 2CVFA 2PAAA 2AI1A 2NYRA 2DXIA 3K9QO 1PUIA 4EGAA 3P2OA 1Q50A 2Q5EA 2FUCA 4PYOA 1GR0A 3C16C 3CW8X 1S3GA 2PMBA 2Z2IA 1O95D 2IDZA 1J5XA 2RH4A 4IGFA 1QGYA 3VC2A 5K03A 1SXPA 2X9QA 3A6JA 3OQVA 3KP1A 4GO1A 3RC9A 4IKPA 2RI6A 4G8BA 2WU1A 2J7PD 2ZM5A 4NDZA 1W5AA 1I7SB 1VZ2A 3S2EA 4XWTA 2FZ5A 4ETMA 4Q4HA 3UJ6A 4CXMA 1SXJB 2W6JD 2Z43A 3EW7A 4PCAA 2A9PA 4ZEXA 1HE3A 2NU6B 2FR1A 3GB9A 2AUNA 1UZLA 3BMNA 5DN6A 2BONA 4O0LA 2BE7A 1RNLA 4U2CA 4XI9A 4JP1A 4RMJA 5IP5A 5IUKC 5KYXA 4MLCA 4XYEA 5F7XA 1UIRA 2B7LA 2VNIA 2J32A 4Z4HA 4X1YB 2H1OA 3PC8C 5J2UB 2IXTA 4IRUB 1KYTA 2H92A 2W2KB 4Q3OA 3TRIA 5I7UA 2H07A 4NI5A 4FSXA 1GT91 3TTXA 2PRIA 3EDMA 2W4QA 5A7FA 3NUZA 5BP7A 5FTMA 1J8YF 2FR0A 5LD2C 3HMKA 1DLJA 1SUSA 1KE2A 4GM4A 2C7GA 4QTTB 1X1RA 5SY9A 1JBQA 5BV8A 1JTEA 3QEMB 1CP2A 1RQNA 4EUKA 5DBHX 1CE8B 3IV9A 3SC2A 2FKNA 3AUTA 4JC4A 3MTDA 1KVQA 2IHTA 5EKUA 4ZV9A 3IIIA 4TLAA 1J2RA 2JLBA 4L4RA 3HSKA 4IIFA 1YVDA 5LYJB 3DZCA 1UADA 5AI4A 5DX8A 5H1YA 2VJQA 1T2AA 2J6IA 4UHCA 3O8BA 5FTWA 3AQIA 4G5GA 3HXTA 2HIHA 4LRUA 2P6MA 3U4HA 4GP6A 1E99A 3KOXA 4PPFA 3TJRA 5IKPA 2BFEB 1XPOA 5SY4A 1WU7A 3T5DA 2DPGA 2EJVA 2CXTA 2UVPA 4MULA 3VC1A 3WP1B 1E5DA 4S12A 4HN9A 4TSFA 1FXUA 2BM8A 2YINC 4BGVA 5J9FA 4Q9DA 1VQ1A 5E6RA 1DIOB 3TD9A 1VRCA 3H1PA 4R2IA 4GOLD 4UFOA 4KQ2A 1RHQA 4O2BB 2OGZA 4FFBB 2QSJA 5M34A 2OV4A 2VOEA 4MTCA 4KBYA 3PKIA 2I2WA 1ZIXA 1O6CA 2PZ8A 4MGHA 2OFOA 2H63A 1WL8A 3TRJA 2XCLA 1Z7BA 3AVOA 3CKKA 1KMQA 1VFPA 1E7WA 2JLCA 4M8KA 3UZUA 4HGQA 1KNXA 2D2EA 3T3OA 3IPAA 4NWIA 1XU4A 5JD4A 1G60A 2FSFA 1VB3A 1JX6A 3IV6A 4G5XA 4ND4A 3UATA 5FTNA 5KTYA 3HJUA 4BOYA 4KEAA 2A0XA 4PLPA 2GJKA 1AG9A 2AFRA 2O6LA 4PZUA 4RZQA 1P9LA 3KRTA 3PUJA 4EFDA 2WIDA 4RQTA 2R4UA 3VSEA 3FOZA 1CCWA 3HA5A 5E2IA 5FFNA 5EXEA 2ZUCA 5I9BA 4TV9B 5DYNA 4L78A 1ZU4A 2FLWA 2H65A 1DWQA 2GSDA 2XMGA 4L1KA 5AXAA 2JLYA 1GCGA 1TI7A 5A5DA 5HKAA 1KQPA 1PGQA 4UEWA 1SVMA 3WLFA 5A4DA 1STOA 1FL9A 1WLSA 3GAZA 5J5CA 2H1CA 3ANSA 3F6BX 4XWOA 4E5SA 4HDNA 2ZJ4A 3H9CA 1H5QA 4PO1A 3UANA 2LUOA 4IOJA 4RLFA 1MG5A 3FTFA 4JDPA 4KGVA 4Y2PA 3ZN2A 1TEVA 2HTEA 4GI3A 2OO7A 3WLMA 4W9NA 3QG1A 1N1MA 1TPZA 4M36A 3C87A 1YJCA 3F4LA 5A4KA 3L7LA 4LBYA 3TG2A 1XD8A 3GJRA 4IEFB 1ICIA 3D4PA 3CKLA 2JA2A 3P0IA 3H04A 4FR0A 4NZ9A 4CHTA 1KMMA 3R7DA 2JGRA 3MJCA 4OUKX 5AKYA 3T3NA 1BKDR 2QX8A 2HUPA 4BEWA 1Z33A 1FRQA 3UPDA 4ZYLA 5K0EA 2HMWA 3GEHA 1M8KA 2XUIA 4NFLA 2BZSA 3IPXA 4PF1A 3PXDA 5H4GA 1HDEA 3DE5X 3G2PA 1EWTA 3ZIAD 4U3JB 3U7GA 3SF8B 4JJ7A 3Q8LA 3MG9A 3EFOA 1WKCA 1B0AA 1RAEA 2BEWA 3D3WA 2ZIEA 3REQA 2CCJA 4KIJA 1GPBA 2BGNA 2BGWA 3QX7A 2IVFA 4GRIA 4Q4AA 4QBHA 3UYKA 3HZRA 5CM9C 3OZDA 4I4IA 3NFYA 5KYVA 4L0MA 2ZJ8A 3PPWA 5CT5A 2RK3A 1II8A 2Q6VA 1Q1QA 5I8ZA 2JARA 3M6FA 4DM4A 3WR5A 4L76A 1LLFA 2YRFA 5KKCA 3ZHRA 3SQXA 4EOGA 1K68A 1N0UA 2X8LA 3ESBA 4H1TA 3KKMA 1QMPA 3A31A 3NM4A 4X8OA 5LBUA 4DSZA 4A82A 5KWEA 2X0EA 4X00A 4FQ7A 5I01A 2CEKA 3RUFA 4D6PA 3V42A 4IG4A 2LPMA 2AR9A 5AHRA 5AW6A 3P4YA 5DYGA 4AU1A 3NIWA 2G72A 3GZNA 2P91A 2FMUA 5LNK1 3N0WA 6ABPA 3LK6A 4G23A 2BYTA 2BTEA 3QU2A 2E49A 1PNOA 1US8B 1EXDA 2NZ2A 4TUYF 3N2ZB 4GECA 1P0QA 1QTNA 2BI4A 2TMYA 1QDLB 1FFDA 2WY2D 3ERCA 3JSAA 2YV3A 4JI3B 2C2HA 4J0IA 2C5EA 1XDUA 2J7PA 3CUEF 4MW2A 3H6GA 4LBVA 3SQNA 4UNNA 4Q18A 3OUZA 2AZXA 1LQ2A 2VDWB 2F48A 3E9ZA 1PZXA 2O23A 3EGVA 1MR3F 4QFCA 4ER3A 3ED1A 1V1RB 5KYWA 1ZOLA 1PR6A 2AOVA 2PSFA 1K63A 4EBFA 5ARBA 5ULLA 3F67A 3Q85A 5CDGA 5IXYA 2O2HA 1AQIA 4R4JA 3FRIA 1W5TA 1GZHB 4YP9A 2RGNC 4KODA 1K98A 4WE3A 5LZ5A 2V4MA 1D2AA 2YHBA 1GQFA 3HB4X 5EC8A 1PZNA 2WTEA 4ZO6A 4AXXA 5TPWB 1KR5A 3I01M 2JBWA 3W9BA 4DLAA 1DBIA 1P9OA 2E4UA 2OB1A 3AF3A 3LBYA 4WY8A 3B3QA 5LLTA 3IIJA 1IPFA 4OLJA 3C97A 3IGFA 2XUFA 4INPA 3AL2A 2X3YA 2KMLA 3CE9A 3QRWA 3GLHE 3IEVA 2XITA 4W5JA 1LGYA 2PU7A 1QK3A 4WNIA 1YDEA 4EB3A 4G0NA 3LLUA 5CDYA 3A9VA 2GARA 3LTNC 3S2IA 1I7PA 1BSVA 1O6ZA 1OKKD 1DELA 1WPQA 2I7XA 3EWIA 5C4GB 4EKEA 1A9XA 4KX3A 3KZKA 1H3EA 4IHJA 4RXUA 3RIYA 2O8BA 4TS1A 4P9NA 3B38A 5JNUA 1ARZA 2QV0A 2OCDA 3P9PA 4B75A 3VR0A 1GAJA 3QU7A 3PWTA 4X65B 1M6VB 2CXUA 1H4VB 1K08A 3RK1A 2WKPA 3LBHA 4EO7A 1KEPA 4N8DA 4PLVA 1JE1A 4L8VA 4ESOA 5CXSA 3CLVA 2L69A 5IT9A 1PEDA 3DGFC 3KKZA 3MWKA 3LKVA 5TS3A 1JWBB 1E4VA 2RGYA 3KTDA 5JSHA 1MD9A 2ODAA 1UXGA 1B6GA 2PRJA 4C9BA 5L3QB 5L3ZA 2W6OA 3FPEA 4DA7A 1XSEA 1POXA 1AKYA 3MT9A 5L3VA 1R0BA 1RWKA 1Q15A 2E6KA 4M9XA 3PDIB 1FY2A 5HKLA 5K51A 4GSLA 3FLEA 2ZYUX 5KYNA 4XCVA 3ETGA 2R6HA 4DA4A 5DX1A 5BMVF 1V6CA 1XRLA 3EF0A 3Q15C 3T7KA 3MQ2A 5CITA 1BJKA 5DM2A 2HQBA 4MR8A 4MI9A 1JHUA 1SK8A 1ZVKA 2OM6A 3AESB 3AYZB 2B36A 4B2IA 1QVZA 4J16C 3ROEA 2WJ4A 2H4WA 3HTXA 1T2NA 4MNTA 4A5OA 1ZNXA 3A2NA 4MX8A 2YXEA 3GDHA 3ZDXB 3AV3A 4Q19A 5DXAA 3B85A 3FKQA 4TV8F 4FYXA 4QTZA 3NMUF 1O5TA 1PDOA 2WFLA 4V24A 1CSEE 4R9NA 1X19A 1G6Q1 5JMPA 5KJ6A 1MKYA 1XEXB 4N8SA 4A92A 1FS5A 5T4EA 3LHKA 1KH1A 1R37A 1VJ0A 2R1TB 3QNUA 3ETDA 3SXUA 3ZD8A 3TSYA 1Z35A 1FFXB 2OLEA 4RTNA 5JOQA 2NT3A 3EQ9A 3ISVA 4FEEA 4P4NA 1PFUA 2BHSA 3BK2A 3P26A 1ORIA 3G82C 2QK4A 3HGTA 1QGZA 4FIDA 4G07A 1E58A 4LVOA 4NCKA 3VZSA 4CKCA 2L19A 1G5HA 2RONA 5T41A 5FOWA 5BXQC 1IB0A 2AYYA 1SKYB 3ETNA 4H7PA 3WICA 4P7FA 4PWZA 4OF4A 5JTTA 1QUFA 4UU1A 1YKFA 4KTTE 4QUBA 4D8YA 3K32A 1NXOA 3A4NA 3BA1A 3IODA 4YK7A 5A3SA 2DBVO 3CMCO 3SC3A 2ORED 3ZBQA 2QLNA 3RBAA 3AKCA 3ZY3A 4HFRA 4EQ6B 3FJ1A 4KV7A 1XXHB 1XZPA 2WF7A 2HB6A 3CVOA 5ARCA 2JLXA 1GRCA 2TMDA 3SNHA 1H69A 1XRMA 1A7AA 2B78A 4N9WA 4DJEC 1Q0LA 4RMNA 2B1GA 3SVZA 4ZRMA 5CFZA 4Y6OA 1ZN8A 1Z9BA 2DFTA 4DDKA 1LBEA 5TXGA 5A9RA 4PNHA 4L6IA 2A14A 3GARA 4KNWA 1DEOA 3UCXA 2ZIGA 4QDOA 2IJGX 5JXJA 1KSHA 5LP6C 1ORHA 5ALPA 3U9LA 2WAYA 3HFSA 3DAOA 2OCPA 2Z09A 4NV3A 2AG5A 5H3HA 2EF1A 1A71A 3OT4A 4G09A 3PI6A 2XQIA 3RRNA 1A88A 1CW2B 2EWMA 2I80A 3AZQA 4RD6A 1EXMA 3RGWS 4EVIA 5LWQA 1TVMA 1ZVQA 4P7GA 4HWGA 4E22A 1KGSA 3L40A 1OZGA 3TBFA 5I4BA 2Z6AA 2P78A 4J94A 4F5YA 1N4AA 2ZSDA 2GQ0A 2RI0A 3ZS8A 2XMQA 4CM5A 2IODA 1R3UA 4DT1A 1DX6A 1O8BA 2FSVC 5A1TA 3ESZA 1H9BA 4NL4H 2ZYHA 1PJBA 4JBXA 1TTHA 3HDHA 4BVGA 4JEUA 5GZ6A 1U7DA 5EE5B 5E4JA 2CE2X 3DMFA 3L7KA 3RYFB 5DGDA 4RNCA 3V1MA 3IVAA 4OBEA 1BHSA 5DYIA 3CUYA 3ZU3A 3NHAA 3DE4X 3VYWA 1MOPA 1F7VA 2WI8A 4DQXA 1CY1A 3D3QA 3HNOA 1W4RA 2COEA 2XA9A 4MV4A 2QT9A 1OB2A 2VDQB 4UATA 3MTIA 1QZTA 3A26A 2PWYA 4WFJA 4X93A 1I9GA 2V65A 3FMIA 3LFUA 3RU3A 3TX2A 1XVAA 4EKYA 1NOIA 1THTA 4RADA 3GG9A 5CVUA 3Q7RA 5C1OA 5M2QA 2GZ3A 2QS9A 4LOLA 4ITVA 5JATA 3PUKA 4IKEA 5B6JA 3C6KA 3UHJA 3C5CA 1K8YB 4QGHA 3AU8A 4C7MA 3R9XB 1NC3A 3SDBA 2OWEA 4UFPA 1USIA 2P5UA 2DH5A 3PENA 3R3JA 4NONA 4CMHA 1QBKC 4K9OA 4BB0A 3GLRA 3D2BA 4C7OA 5J1SB 5FPQA 3GCXA 2IDJA 3CNNA 3ICCA 5LXTF 3OTHA 5CIWA 3SLGA 5KQSA 1OJLA 2ANBA 3KUXA 4YJGA 3G3EA 3PLAE 2Z8XA 2Y6VA 4TKLA 4UTRA 2ZRJA 4TT8A 2ERXA 3SC6A 2H2DA 2GHIA 4RY8A 3NNDA 3AR7A 2HBZA 3OM9A 3ET4A 3WQQA 2C9OA 3LY5A 1KO1A 1NWHA 5A5FA 4I50A 5HRUA 1LV7A 5H80A 1NY5A 4JQCA 3IAXA 5JC1A 2OILA 4YB8A 3RJTA 1D0IA 4M8IA 4YDRA 1XEWY 4EUSA 2YHSA 3VNUA 2DP4E 2QP9X 3PDCA 3NKLA 1UOPA 1RACA 2DPHA 1VP3A 1XUOA 2R68A 1XA0A 5FWDA 4UVHA 3IURA 2IPLA 2O14A 2YFKA 3O1JC 3ODPA 4RQUA 3GDWA 4MHOA 3A9CA 4P86A 3OPYA 3UEOA 4UNQA 1M10A 3QWAA 4NOLA 2NVOA 4YP5A 5EKSA 1OH5A 2X77A 1YSCA 3FWPA 2YJ3A 3M9WA 2BMAA 1A97A 4MVJH 4DIOA 1YR2A 3BKXA 2YIDA 3GR6A 2PX6A 4Y1RA 5E9AA 4B79A 2QUZA 2HA2A 4M53A 1U0HC 3AOEA 1YQDA 4DCCA 1DAIA 1OMOA 4J4HA 3L7JA 5JSQA 1HLPA 4C0BA 3KZNA 3FGPA 3DLCA 1L7EA 2YWRA 4AY6A 2BUBA 2IOFA 2QUJA 1DT5A 1JECA 4MMZB 1PLKA 1YIDA 1DX9A 2IXFA 3B6KA 2LR0A 4HTFA 4K7JA 4JNCA 3LPLA 4O2AA 3C45A 3SEFA 1HL7A 2O1EA 3CA8A 4FK8A 3ZH9B 2E4AA 1NM5A 1IM2A 3PFKA 4WK6A 1KU6A 2RFLA 2WTMA 3UH1A 1UJCA 2IOQA 2QYTA 4KX5A 3MOSA 4KUEA 1HOXA 2O5RA 5IDYA 2BGTA 2WEKA 4O0MA 2GCOA 3DMHA 2ST1A 3C7TA 3IVMA 4G4IA 4AZVA 3C3WA 4K6CA 1J2JA 2YRXA 3WZMA 4DIUA 1N0HA 5AVVA 1TYDE 2YWXA 4RJ2A 1X7DA 4PFKA 1QFZA 2QAJA 2OP0A 5B4VA 3R4VA 2RGCA 2FZCA 1SPBS 1KMCA 1NP6A 3GLQA 2IWRA 3QFCA 1C7FA 4B6FA 3BTOA 1O95C 2CVQA 3PUIA 3DBRB 3DO6A 1D2EA 3AF2A 2IYYA 2Q0SA 1AF4A 4U2DA 3NJ8A 4ZPJA 4GPD1 4MWSA 2QE7D 4BKPA 1H3FA 2Q2WA 1BDBA 1KHTA 1RHKA 5EIFA 5JLAA 4LZJA 3UQYS 2ODBA 4BJ6A 3NGMA 3A14A 1YBVA 1YJQA 2BF7A 3PSAA 3LKBA 4MRNA 3WTBA 1DEHA 4TKUB 1BU8A 3ORHA 4J6FA 3T7JA 4QKQA 2W6IA 1YBMA 4KE7A 5HTKA 3RODA 2NZJA 3LH5A 4CUZA 1OQAA 2A3RA 5F7ZA 4ARZA 1ULTA 2F55A 4M60A 1AD2A 4XQ9A 2DB3A 1H2FA 1V3TA 5J2UF 4QD3A 3PIRA 1E2HA 2VSNA 4JI5B 2X9GA 4O4IA 2BM9A 3QVOA 3WK6A 4CTJA 3JD3A 3L01A 4EO9A 3IKVA 5LOVA 3AWDA 1WX1A 3IEMA 1Z6ZA 1XA3A 4B3RB 3BRQA 2JW5A 5AW7A 3DWIA 4QE3A 5A71A 4W5TA 2IP4A 1MXFA 2WD7A 3GJSA 4B4OA 4RK5A 2PZJA 3R7WB 3AKZA 1P2TA 3U3KA 2FQWA 4XM2A 3H9QA 4R0MA 2PZFA 1AQYA 1LLDA 3IT3A 1ZK0A 2H0RA 3BERA 4GX2A 1WMBA 3AUSA 3PVSA 3R3UA 4L07A 1KEUA 1ENYA 1NVGA 2NSLA 2NUBA 4QDTA 4RJIA 3MUFA 4R5MA 4WHMA 5E6SA 3W7AA 4BWVA 1MIOA 2VT2A 1BS9A 3FY4A 4EI7A 5JVDB 3MTGA 2PL1A 2NOAA 2P8JA 3BMCA 1SBIA 4NJEB 5FNVB 2ES4A 2AZDA 1B8VA 2IEZA 5CPBA 3WGHA 3B2NA 3V33A 2C78A 4ZU6X 1HE5A 3ZWOA 1D6NA 1FB5A 1JSXA 1PLJA 3PCTA 5EZYA 3PEEA 5SV2A 4D6YA 8OHMA 3OJXA 3SR3A 3AWIA 4UNIA 4N6GA 4M22A 4AK9A 4ZCTA 3A4LA 1SC4A 5JI2E 4ESEA 2QN1A 4S1TA 2MU1A 3HEBA 2F00A 2O1SA 3E3NA 3LHSA 4X7BA 2YBEA 4NOKA 4DADA 1UQUA 3KTOA 3TL2A 1BA2A 4WBNA 1YJ5A 3A3NA 3DAFA 3FI9A 4YGYA 5AI5A 5IU6A 1BJTA 2ZIFA 3PR1A 4DQ0A 4V1CA 3JQAA 5CDFA 3W3ZB 4V0NA 4XLLA 3RFVA 4OOEA 5AVZA 3ZJTA 1R8XA 2W00A 2DPLA 1SHJA 2FWNA 3EJ6A 2XUAA 1ZIYA 3NQ41 3V7NA 4RAOA 1VSBA 4DLTA 4EX6A 3HM9A 1UWKA 1TLLA 5GMOA 2PEYA 3OPYI 2O0MA 3AY7A 1PJSA 2AF4C 5KSYA 2JFOA 1NQOA 1RE0A 4R81A 1JVNA 2CK3A 5CAEA 4AP9A 3CR3C 1F9AA 1E7YA 2OHVA 1SCUA 1CUGA 1O4VA 3BGIA 3BMQB 3HO8A 3RSLA 3NVAA 2VDKB 1LRJA 3L9WA 1JHVA 2COKA 1N2XA 3STHA 2PSDA 1EWKA 5DCLA 4G1MB 1O6FA 1BE8A 1J99A 2Q7XA 2QAIA 3FFBA 3HHEA 3KD3A 3CNOA 4RHUA 4JKIA 4A0GA 4BLTA 1CQJB 2YN2A 4MUGA 1ULAA 4DC0A 5A2QA 3OQMA 1GO2A 4CMJA 1BHJA 3N7UA 1EGMB 4HYEA 1CUWA 2JEYA 2HK8A 5L9AA 5KSWB 1WOYA 3EGEA 3SZRA 2R62A 1Y9EA 3NR2A 4O4HF 3LV8A 5B30A 3C48A 4PWYA 1QIMA 1PL0A 2QD4A 4L5IA 5H68A 1SVWA 1NKVA 3R5XA 7AT1A 4AXBA 4QGFA 1IEVA 3I2YX 3A8TA 3QELA 2WG1A 4YMVA 4YR9A 1BS1A 4FLFA 5HS4A 2RHHA 5H4HA 1TCBA 3JR7A 4RWEA 3OJLA 4RYDA 4HS9A 3IRUA 3UHPA 2GF2A 1EGQA 1OT3A 1U6IA 4JNKA 5HF5A 4RCYA 4XGNA 1W0JA 2RJ3A 1F2UB 3RSFA 1EDOA 4L6CA 4DR7B 1SZCA 2ZQYA 2RHRA 2EL9A 3BE8A 4GKAA 4PO8A 4DRXA 4YP7A 3TSCA 2BBSA 2C94A 4WGFA 1FF9A 4WY2A 3VOSA 1HYHA 4CMEC 2Q6KA 2WWGA 3FPSA 1P3JA 1ZJWA 3G8BA 4M7RA 1RJEA 1TB4A 3DV0B 5DGIA 3ZGZA 4TYQA 4AP5A 4MVJF 1X8KA 4WZBA 1AHPA 3R8XA 4JJGA 4UQLA 4B4VA 4MDFA 4B48A 3LNCA 4JUBA 2JVKA 4D9JA 2VEDA 1TQ8A 3CM0A 3H9JA 1OWPA 1AA6A 2WMDA 4V0QA 3TQOA 4EUHA 3L4KA 1CJCA 2FMTA 2BTQA 4HTAA 5C8VA 3GZJA 3CX7A 4HVLA 4TQ9A 2EFYA 2JIZD 4BNIA 3DMYA 4IHKA 4DM3A 5F7OA 5U4QA 1CV2A 1UOQA 4YJ2A 4OPMA 4TTIA 3GAAA 4GPAA 4EABA 4UKDA 3BREA 4ZIRA 4LX0A 1XP8A 4RTJA 4M6WA 3IP1A 2HQRA 3M9LA 4BC0A 3WYGA 2FWBA 1YBFA 3N2IA 1V39A 1DKPA 2XDYA 2Z2JA 3FYDA 4GMFA 3ZU2A 2C4KA 3ORSA 1NIPA 3N7AA 4R8SA 2BP7B 4RMIA 4URHA 5HDBB 3B51X 3UXYA 2FEWB 3NV9A 3OFKA 1EHYA 1QC5B 3G5LA 3KQYA 4JSRA 3KR2A 4MDHA 4R84A 5EXPA 4YQEA 3U56A 5F1YA 4PQRA 1Q0TA 3MJTA 3ACCA 2O8NA 2XUQA 2VCYA 1QHEA 2CDAA 4PBRA 4Q3KA 3QVKA 4DREA 1E7RA 4KXYA 2BHTA 1LS1A 3SX2A 4X3CA 2XTAA 5IDXA 1M1YB 1TJNA 2VC2B 1NBIA 1KA9H 5JSYA 5JBIA 2Q3EA 4RNDB 4WFKA 2CDBA 5H3CA 5AUNB 3RYIB 2ACKA 1B93A 2ZJ5A 1XDDA 3KVRA 3R44A 3LUKA 2C4WA 1YK1A 3W6PA 4IXMA 3WNZA 3WNVA 3LC2O 3KXLA 4LJLA 3ZOZA 3OM8A 1LQTA 2PUVA 3CJTA 2GPJA 5EQJB 5FT9A 1WCWA 3CG0A 2IELA 3L0ZA 5JV5A 2AXNA 2Y1XA 4IW3B 1T4MA 2JFGA 3G59A 2AD5A 2Q7DA 3U0BA 2IYTA 3X1DA 5H59A 2WHRA 4BMDA 2RHDA 1OYVA 4IDNA 1DQRA 1E9RA 3TQHA 4CKEA 1WOMA 5EVJA 4QWMA 1BMFD 2OCIA 1QB7A 4HYTA 4U7HA 5EERA 1C8BA 1UDAA 1EI9A 1U4OA 3LZDA 3OI7A 1P61B 4KQJA 3KLMX 2EERA 2EIHA 4N48A 1D8TA 2AIRA 3RQIA 3U61B 4AJHA 3PT5A 3ITEA 2XIJA 3HB5X 3AFOA 2VAPA 1USUA 2Z8YA 5EE0A 4C5CA 3RDPA 1Z45A 1EBUA 3DMGA 1KYXA 2BHNA 5CNMA 3V8BA 4JBLA 3AM3A 3BF7A 4L8FA 4F11A 4RUKA 3F5MA 5J63A 1GUBA 2BFBA 3LCVB 4Q4HB 4B3SB 1Y6GA 4KR6A 1YE8A 4ZAXA 2ZRQA 2DCUA 3AFHA 1Z47A 3ET5A 3FMOB 1O54A 4MYSA 4EHNA 1FS6A 3GWZA 2ZR9A 3BMNB 2I4IA 2CJYA 3M83A 5DM1A 1FX1A 4WZAA 5GZ1A 3T9FA 3AOEC 3KOMA 3VNQA 1MC5A 3PGA1 4I4TF 4R01A 1QKJA 2AEMA 1ECGA 1ZU5A 5KYXB 2OQIA 3RSCA 4DLVA 2PEZA 1VIYA 2D1FA 3EZ7A 2QG9A 3UCFA 1WY5A 4WVFA 2C2ZA 1OXTA 4WLUA 1R64A 3DW1X 2X15A 3TOVA 1N8KA 4Q4DA 1K06A 4ZAVA 1YD7A 1G8FA 2QI9C 3LP5A 2HZ7A 2ZIVB 1WULS 3P0FA 4B46A 2J87A 2G1UA 4EA9A 1NM5C 1QVWA 1ZXXA 4ZQCB 4YCLA 3ANYB 3F5FA 3NWBA 4G0MA 4AZ3A 4UNPA 1A7JA 4LKOA 1U0OC 4ZDKA 3IHLA 5IXJA 4X90A 2J09A 2CLOB 3ASVA 5B57C 4HB2A 4YV1A 1POWA 4LDJA 3LMKA 4FE3A 3O8RA 3DOIA 4AKSA 1CVRA 4E1BA 2WMOB 3V2GA 2H3EA 3J81k 3II6X 3MHPA 3UMFA 1T1IA 4RTKA 3FIJA 4IXTA 3WZLA 4G2NA 3BCSA 2GNAA 4KAAA 5FDFA 4KQ1A 4NCAA 3HZZA 2H4HA 5SYMA 1Y9JA 1GPNA 4AY5A 3TS1A 2F3SA 4EPTA 4AS2A 1LI7A 2IPOA 3ASZA 4YLYA 4UTOA 4LTMA 3O3CA 3RJMA 5FOXA 2J3LA 8ABPA 1RDFA 4LQDA 3SDSA 1NSYA 3KJEA 4UPVA 1U0SY 2UVPB 2XUOA 1WZ2A 2W6NA 3BWXA 4IICA 1G5IA 2AH5A 3AU9A 5EEGA 3PYXA 4DUGA 5E6RB 2BSAA 1EFVB 2HPVA 4IL5A 2FMHA 5AXDA 5LA6F 4EO4A 2MINA 3CCCA 4EG4A 1N2CE 4JP2A 1V4VA 3PU6A 1Z6QA 3C2QA 1LC0A 3GFFA 2EKPA 2R6AA 4CDGA 3W8FA 5CB8A 4RK6A 1XCJA 1KMIY 3HCWA 4PQEA 3X44A 3V80A 4JFAA 5IMSA 5JNSA 2G1JA 2O54A 1Z37A 3CLRD 1DG9A 1KGDA 1MMFB 1NTOA 2XMDA 1R2QA 4ZQBA 5M04A 1ZYUA 2ZTHA 2ATCA 1T8TA 3JWHA 3DD5A 5HF6A 1LBHA 4LF5B 4CM9D 4BC1A 4XGQA 2GSWA 3WYBA 1GIAA 1CUIA 721PA 2WP0A 4JYBA 4UC0A 1X42A 4PZEA 1MAAA 4LVUA 3I12A 1YBAA 1P39A 1WUHS 3IVGA 3HBMA 1HDXA 2J9XB 1CFJA 1TIPA 4TXLA 1SA0A 1P44A 3Q8WA 4JBYA 4IQGA 4Y7DA 5TS2A 4J4TA 3W8DA 4M9RA 1BQ3A 4CPDA 1W93A 4BNLA 3HCEA 1R66A 4DJFC 5LM3A 2I71A 1LBIA 5IBPA 4BASA 4J03A 1H9AA 5J4LA 3MIIA 2OK8A 2YICA 3DMPA 3T9EA 5HQ3A 1CNFA 3GQBA 2V59A 1J09A 2V0GA 1OU4A 4M0LA 5I45A 2PS0A 1L4KA 1XTSA 3HA3A 5AKKA 1HL3A 3VZCA 4ENQA 2IS6A 2IYUA 4UM9B 2CXNA 4R8LA 2H16A 3OFSA 2JLWA 4QBIA 4LJRA 2H7CA 3VO8A 1W1UA 1FDUA 2D3WA 3JQFC 3NUQA 4A8JA 4DWWA 5F3WB 3HWWA 5BNFA 1ZUHA 4TZ6A 4P7JA 4ASUA 2HJVA 3VVBA 1IPHA 2W2LD 1DAOA 4UHDA 2CBZA 2HY7A 3K9BA 1UDXA 1EVQA 1G8PA 3U7RA 4BAGA 5HMLA 1F60A 1QF7A 3A3PA 2ZK7A 3COVA 1KI2A 1G1MA 1P29A 4QJ5A 4WPGA 5F2NA 4CNQA 3DOUA 5ALSA 3HFGA 1NASA 5LQNA 1PL8A 4YP6A 4Q34A 4BRWA 2QRQA 1HFWA 1TM5E 2ZT6A 4OHWA 2I2XB 3RUPA 4E4TA 1LXCA 2Y68A 2ECOA 1HV8A 2FN8A 3RNLA 1E5LA 1Z6PA 3OEHD 2VHWA 3O9ZA 5ER6A 1K5PA 2YUIA 3EFOB 4OSOA 1HZZA 1WXEA 3D3WB 2H1IA 1TM4E 4D8UA 3REQB 1YTUA 3IOEA 3IAUA 3K5HA 2E4ZA 2FW8A 3CLSC 3A32A 3E9NA 3O9MA 3P9SA 3QOFA 4PHHA 4Q4AB 5DDIP 3TLAA 3C41J 3RB8A 3Q3GE 4KVAA 4U0JA 2IKQA 1QYDA 3NDRA 3IQHX 3IDQA 3OZXA 4JJZA 3B8EA 1FX0A 1G19A 2B99A 2ZKLA 4KXMA 2IHBA 3V7WA 3QE9Y 2P5SA 1QH9A 1M7GA 2XBUA 5JFGA 1GTRA 4DLLA 4OJKA 4ZKEA 1ESDA 5KNDA 1MC4A 1S8FA 4B09A 3OPQA 2GEFA 2JH9A 5FPHA 3ESYA 1KJZA 3SSAA 3IBFA 5I9MA 1AKVA 3D7KA 3ZLUA 3N8KA 4EY3A 3M9XA 3L6UA 4D74A 1JU3A 3N0XA 3Q7IA 4A23A 1Q6ZA 4TLCA 2A35A 1BMFA 5IBQA 3UAZA 4HH0A 5K3CA 1U31A 2P3QA 4GVXA 1GU7A 1E9BA 5BV7A 2GKOA 2DTEA 2NLOA 3N28A 3NDIA 4GI7A 2EU8A 5H5JA 1GTMA 4DLYA 3CINA 2CXSA 1G3RA 3ICVA 2EDAA 3MSCA 4C3VA 2D06A 2X9NA 4K81B 3GMDA 1XKXA 4J16A 5CH5A 3H9EO 4EI2A 4JXXA 2CL6X 2QROA 3AV0B 4ENRA 5IYZB 5KYWB 1C9EA 4TTPA 2C2YA 4BFCA 1X74A 1KHHA 2PD6A 1BVHA 5DK6A 3KAQA 4MA4A 4ZJYA 1K3TA 1G6OA 2WAMA 2E4VA 4OQXA 5AM0A 4EVSA 3RK0A 4D4LA 5CXUA 5CB4A 5GWXA 1YRYE 3LQKA 1LFDB 5FBHA 1IUOA 2P2NA 1C41A 3L43A 3SXPA 4CLOA 3OTWA 3FFWA 3ZWWA 2CWDA 1IK4A 3Q2OA 4GFDA 2GJSA 4O63O 5FWYA 5KHOC 3DPSA 3NETA 4O08A 4V0ME 3X1KA 1PYGA 1XTRA 5BV0A 2F3UA 1SC1A 3LP8A 4UUQA 1GA6A 4EB8A 2DBRA 1Y7LA 3OHSX 1VM6A 1W46A 1TYEB 1XOIA 5J4VA 1NVUQ 5KVAA 1E96A 3BE6A 3CCBA 3DZDA 1P6UA 1CUUA 4JXZA 4IHJB 2VZ0A 1JZTA 2FMFA 3TVTA 4MW0A 2QX6A 1QOPB 2ZJ0A 4FHCA 5NULA 3W77A 2O8BB 3LFTA 5HQTA 2C7QA 4MVCA 1FMFA 3MGCA 4BKQA 1P80A 1M2WA 2RKOA 1S8AA 2ZWAA 1YKSA 4PPGA 3AR4A 4TLEA 1MO2A 4G85A 2IA5A 3F5SA 2E1RA 1FVOA 5AVOA 2GN6A 2WAOA 4XR9A 5CFLA 5E8RA 2Q8PA 1WXXA 5CW1A 1MABB 1SD1A 4C0AC 3P2KA 2GEJA 3TXYA 1GPMA 2X1LA 1MUUA 1RRFA 4ZVOA 2FOLA 3JAKA 3PJRA 3TIIA 4QULA 5F73A 1CEXA 2DX7A 1GPAA 1KRHA 3I9KA 1TJ5A 3K9WA 3OKCA 4ACAA 2CD9A 5AJHA 2OK7A 1RJ9B 2Z30A 2ZS8A 1FYFA 2WJ3A 3AP1A 1JDBB 1J0AA 1Z68A 2PUGA 1CZUA 4Z3KA 4MR8B 2QRGA 4OEHA 5CA0F 3BG5A 5G02A 5JXIA 5KDLA 2CLDX 1ST2A 3D6HA 3KSAC 5AYVA 3JQDA 3QI2A 3QXXA 1JAHA 4JSTA 5LBTA 3V1LA 1TUGA 2PS1A 2SNIE 4MQBA 4OOFA 2GBLA 2I67A 2FKAA 2WZBA 4YCNA 3DNPA 4RELA 5AXCA 4ZO7A 5JHGB 2WFLB 4RL4A 5DNVA 3PNQA 4G5HA 4R3WA 5CH3A 3L82B 2QMQA 1SWVA 4TWZA 5C8YA 3UFXA 4H18A 1CQPA 4UJ3A 3ST7A 1U2TA 5B36A 1HI9A 1OVMA 3JYHA 4YAGA 3UWOA 3LBAA 1XF1A 1VL8A 1PT5A 2G04A 3MFQA 3SXUB 2UZ4A 3EZFA 4BX8A 3MK31 1TC2A 5HWSA 3MBOA 3X1ZA 1Z2OX 4Q48A 5BOVA 3S28A 2DBYA 2II6A 2FPRA 2IYQA 3WL8A 4CKCB 2HN9A 3NPMA 4N54A 4CLRA 4MI3A 5TIIA 1GTVA 2JA1A 1P73A 3VSCA 5JVDF 5HIJA 2R751 3ZEIA 1RRCA 1KI3A 3E2PA 3OIVA 4I8DA 1H2EA 5JJCA 1Q6YA 5AO9A 3V4PB 2D5LA 4YO8A 5I4KA 4ZFNA 1OIVA 5CB0A 3DQZA 2ZJ7A 3A6KA 2DEUA 2PMKA 2QN6A 3FGOA 3DG9A 3KKPA 5EHIA 3L6RA 1ISHA 5ERXA 4BJ5A 5BSKA 2FFAA 1JRLA 1B15A 4JJFA 3TW0A 1GFIA 4HGPA 3RC2A 4IG9A 3OZWA 2I7VA 3AJEA 2AMFA 1RIIA 4QYIA 1XA4A 4JC0A 2R8EA 3MJ4A 4PW0A 1FZTA 4HAZA 2XGJA 3GAFA 2OLKA 1E2IA 3FCSB 3FZEA 4G86A 1GU0A 3UUWA 5JAHA 4JI2B 2O2CA 4UE3S 4UUMA 1UBLS 1G5TA 2DPYA 1VMAA 3FTPA 3PUXA 1R8YA 2L42A 5CDHA 3NEAA 4ENWA 1V16A 2AE1A 2E2WA 1C5KA 2XGSA 3QE4A 4MWOA 3MUEA 5KDOA 1S2OA 2JDID 2JGEA 2WJZB 4O8CA 5AUQA 2VK1A 1HE4A 5FUVA 4AS3A 1NULA 3LC0A 1NE2A 1Y5IA 1B6SA 2WR8A 2W11A 3ABQB 2O2ZA 4U02A 3T4EA 4PC2A 5PNTA 5AVJA 3Q6MA 4TYMA 5BNIA 5KNLA 1H66A 4II2A 5HJ7A 1QH1A 3JVVA 4DT1B 1A8IA 3LYHA 5JEDA 3U9SA 2BHRA 4FGUA 3L9XA 1T9AA 4XB2A 3JATB 3ORQA 1XZJA 2BMWA 1CR0A 2BFFA 1O94A 1UKYA 1E4YA 2HSWA 2VATA 4ZOEA 1SVOA 4AJJA 1RLMA 3KJNA 3PHJA 4PX2A 1GTG1 1LNZA 3GCWA 3OQHA 1L5NA 3TB6A 3DDNA 3PHIA 3G7UA 2BVNA 4XFKA 4ZZ2A 5B1IA 3K9CA 4N82A 1YZGA 3RS7A 2FPMA 2VF2A 3TGLA 3CVVA 3BQMB 4ZQFA 1YHYA 5D51S 1B0ZA 4B47A 1MJFA 2AG8A 1BOOA 5LJLA 4WX2B 1B8PA 2RDMA 4AY3A 5TJ9A 4UAGA 4ZVSA 3W1VA 3F5QA 1WMEA 2MSWA 2ZI3A 2FPSA 3E0XA 3LPDA 1T9DA 1PGJA 1YVPA 3KUUA 3GGDA 2GM4A 2C9BA 2H2AA 4AG3A 3Q40A 5JD5A 1E61A 4PIMA 4F97A 4M83A 2X7XA 5BUZA 2PUTA 2F8SA 1OXMA 1II0A 5K4AA 2NO9A 2FEXA 2Y4OA 2ZI9A 2D62A 2KI5A 4C7OB 5K3SA 1RP1A 1EJ6A 1UT8A 2OO5A 2LNDA 3P9NA 4YJGB 3H16A 3TCKA 4PG7A 3GPIA 4XSVA 1SBCA 1XTBA 1BCSA 2OXCA 3WGZA 2ILVA 1G8HA 4CTOA 9MHTA 4A8JC 1AX9A 4MYDA 3GJ8A 3TW8B 2NTEA 4HZUA 3GLIA 2PH3A 3K0FA 4I50B 3ZW8A 2J4CA 1AIPA 5DM4A 1QRDA 3V34A 1QMGA 4QAQA 2CMDA 1GZ3A 1H5UA 5AJYA 3EZ9A 3L7OA 4M21A 4LSGA 4PZYA 3H19A 4HGZA 4Z53A 2PKEA 2DY0A 4BP8A 4OB8A 1EG7A 1U0EA 4LN1A 4OFWA 4YYEA 4P53A 3W90A 1EE9A 3KQMA 2ZATA 2BY4A 1IONA 1Z29A 3EGDA 4GR5A 3OPYB 4UU0A 3L0DA 3ENQA 4IY1A 4DEVA 5FOTA 3AO0B 1PQYA 1MT3A 1AKNA 1W96A 1V9SA 2ZPAA 3HY4A 3FSEA 4Y1RB 4KMMA 1P3DA 5KTOA 4NRDA 2NXWA 1SVNA 4NJMA 4DAEA 1MEOA 2JGKA 3DV9A 2B9EA 4EHHA 4RVFA 5JAQA 3G2NA 2F9FA 1QX4A 1YACA 4Q7JB 5KNCA 2FJPA 4GR4A 2ZYDA 1HE2A 4AMVA 3NKFA 4MB6A 3W4JA 3KK0A 4D02A 4B6QA 4HTFB 2Y67A 1W1IA 1VHJA 3HCCA 4OHCA 5CG2A 4O2AB 2QTFA 4HAVA 5K7SA 4B9AA 5JY6A 3E8SA 4PHGA 1KMHA 4EEXA 1VG1A 4KW7A 4E3WA 2IH2A 4D3XA 2X0FA 1F38A 3OH8A 4R0NA 3H65A 2DERA 4F4FA 4BMYA 4QPPA 2GCOB 2JBAB 5GOZA 2VBGA 2O59A 1MJHA 1R1DA 5FUBA 3MT0A 3ZHUA 4YRZA 2PSEA 4ZXFA 3ADCA 1XKLA 4W5NA 2QRZA 4MTLA 4PZPA 2X5NA 2P3LA 4YLGA 5JIBA 5FYQA 1SNYA 5JNVA 4BCBA 5HKKD 5LMCA 3IQIX 2BUAA 4DGSA 4X0EA 3DM5A 1V8FA 3P0RA 3IQGX 4U7TB 1KY3A 4B76A 1R0ZA 2FJUA 4X8LA 2J85A 5F12A 4E15A 4IOMA 4ERXA 5K0FA 3CTPA 1NPDA 1IULA 2REOA 1VHWA 3HGMA 1LPSA 4Q9HA 1PTJA 3TQRA 3CRQA 4U7FA 5BQ5A 2NV0A 3OJCA 1IHDA 1TQDA 3ZWPA 1AF7A 4L3WA 4RTRA 2WF8A 5FPKA 3U31A 2OHIA 2H2GA 3MCVA 2VEOA 3A1WA 4HATA 1EGAA 2EWWA 1L7OA 3FLAA 3GJ5A 4FZ5A 1XYGA 3KZMA 1GPWB 1MORA 1AK2A 2QW1A 3X1XA 1PVOA 4DCPA 3ZK9A 4CFSA 4ARZB 1ODKA 2GZMA 1DMRA 3M81A 2FAXA 3AHHA 1KIAA 1DBRA 2WWHA 4G0VA 3L8GA 2C0CA 3AZPA 1LBQA 3K09A 4MINA 4LYHA 4Q3LA 1PSWA 1EEXB 4O4IB 5KCMA 4E14A 1TLFA 1I24A 3U09A 1NQVA 3UVEA 1XDGA 2CLIB 1IJKA 5H7XA 4IUBS 3Q0IA 1EFTA 3BGVA 4BN5A 5I7HA 3MELA 4KGZA 5CVEA 4FKZA 3F3SA 3TRHA 2B1IA 3HUDA 2WD7B 2GF9A 2AZMA 3ZTYA 4J0KA 5K3AA 4EYQA 2ZYGA 4MPDA 4KU4A 5F1OA 3AR5A 1PG2A 3A37A 3EQZA 4KI7A 5JEEA 3W06A 1B00A 5EUBA 3RAFC 4HDMB 3BJMA 1FYDA 3HJNA 4HQOA 4EQZA 4G1CA 4WQMA 4OI2A 2G1KA 3EQ6A 4WKBA 3FHTA 3I9V6 2JLRA 4CF6A 3DTNA 3EZYA 3RS2A 4PG4A 5E6SB 3P96A 2QVCA 1MIOB 2XKKA 3ODGA 4OA5A 3BXOA 2GD2A 1YC2A 3E3OA 1DPFA 1G3QA 1PRYA 2DF8A 3L0IB 2PV0A 4ITUA 1DG3A 2V5VA 2J07A 1N2JA 5EZYB 5CIQA 4HYYA 1WO8A 3D3KA 4E2ZA 3G8DA 2ODPA 4QJBA 3TQSA 2I8CA 3FVQA 2C2BA 3WNBA 3K9HA 2C1XA 1M0TA 2IGTA 3NYWA 3UJCA 3W5VA 1KY5A 1USWA 4BUZA 1EHCA 1PAUA 3ZLBA 3UJ8A 4EATA 4WBNB 3OQ6A 3L18A 2ZDGA 4B3CA 5C18A 4LMRA 1V3QE 2HXSA 4X8HA 4ZEOA 4XVHA 4V1CB 2P4HX 3JQAB 5MFZA 2IHKA 4JJIA 1OTHA 3NBUA 3CLRC 3GFGA 4NG4A 1B26A 3A1FA 3QLUA 3T3PB 1YS1X 2WPDD 4JD5A 4OQLA 3QG5A 5BWOA 4G25A 1M2VB 4PR3A 3THXA 2XGGA 1UKZA 1B74A 4NFSA 4Q6BA 4S3MA 3FNIA 3SOPA 2ZUEA 1E7QA 3DMTC 4KG7A 3QLVA 5D3ZA 2H9IA 3A4VA 1A82A 1QZXA 3TLXA 4MZDA 1B6RA 3MJRA 3KPYA 3O4GA 2FG6C 3KJHA 4J49A 1KYZA 1QYXA 1SCUB 2OOKA 2VFAA 3BEDA 3K72B 3KYJB 1YXMA 1U2SA 2QENA 3PC7A 4MYHA 3T52A 4W1PA 13PKA 3U7IA 1ZH4A 2BLLA 1L8LA 4IOLA 3BIXA 5FO0A 4YAIA 3FPHA 1B7GO 2IYOA 1VKZA 3J81A 1Z0KA 2DLCX 2PZMA 3DUFA 1KJWA 1EKXA 2WKQA 4E7PA 1MAVA 1U3UA 2YJTD 3IQDB 1PFYA 1XMSA 5M3BA 3TGPA 2G40A 1E92A 3ZLTA 4S2UA 4Z1MD 5KDDA 1IHPA 2ONYA 1P8JA 1TLTA 3L6DA 4PAWA 2RAUA 3GCZA 4R9SA 4RJLA 1CIPA 1NFFA 2AC7A 3VBEA 5I7SA 1ZHOA 2QRHA 1KO8A 2V3WA 3KT0A 3VO2A 3F1KA 3D6NB 2RBKA 2ZZNA 3L8CA 1H2BA 3H4MA 4PRZA 2CW5A 1CD5A 2PGIA 3BCUA 3WY9A 4C04A 3ADDA 4A91A 4WK0B 1GT6A 4J1SA 4GW3A 2RMKA 2W2QA 4XGKA 3QPVA 2ZTSA 5DYTA 1L4NA 1MXHA 3RRJA 1MHTA 4D9EA 4IUCS 1Z08A 1Y5LA 2WJIA 3TE7A 4JLDA 4BN0A 2R87A 1NUSA 2NYVA 2B8NA 1OYWA 1RJFA 2Y1GA 4DRXB 1THMA 1IIRA 3BIJA 3EXG1 2O6HA 3TK1A 4OBWA 4QT4A 4HFMA 4E4YA 3P4XA 5E1BA 4LV5B 1UBMS 1XAHA 4M38A 4MVXA 4D3DA 4WZBB 3BGWA 4AVYA 4KK4A 1A9YA 1HQKA 3ER9A 2Q1YA 3IEKA 3NS7A 5BUQA 1E4EA 2BTQB 1LK7A 3OEED 4P08A 2J9YB 2AUTA 5H8WA 3THOA 3ZBPA 5JD6A 4ZZIA 2X0DA 3ZPXA 2JLVA 1G8AA 2KPOA 4F6RA 2W4MA 4ZIRB 5LN1A 3QW2A 1GFWA 1EDDA 1G21A 1RXSA 1WCV1 5A03A 1G63A 2WWYA 1KK2A 3DE3X 3CIOA 3M2TA 4RH3A 3RU9A 5BW8A 4JR0A 3FPCA 4HQ0A 3OJFA 2C00A 3HS3A 1U9JA 4R8RA 3FNQA 4J29A 4JDUA 1QHFA 3N07A 3ME5A 5LZ9A 3AF0A 4A6EA 5A4MS 2LVBA 3GP3A 3HN7A 4EHKA 2OAQ1 2FRXA 2WHPA 2F43B 3M7IA 4QAJA 7REQA 2FWPA 3C8MA 3L05A 1NF9A 4MV9A 2XCRB 2YQZA 5CK4A 3RS3A 4ZQGA 3BWVA 4KOEC 3K9GA 2DE0X 2WTXA 2H1HA 1DJPA 1TA9A 2ZSHA 4ZMBA 4JFRA 4OXNA 1QXSA 2IYFA 4N49A 1H8HA 3WB2A 2YWHA 2J3EA 1G18A 5K6RA 2Z9DA 3WBFA 3WFIA 1JKFA 2QF7A 1KI6A 2WWXA 2C9YA 5EJAA 1DEXA 2FW6A 3PE4A 5DV9A 4DKJA 2EKLA 4UCWA 3I8XA 4EFLA 2FDCA 3EISA 3ZV3A 1U0JA 3A27A 4HR7A 1HDCA 1NUTA 2NTVA 4Y2YA 5E7MA 4B3DA 1IOZA 2CFSA 4CKEB 1FNCA 3EYAA 2F1OA 3MJFA 3LOPA 3PUZA 2D54A 1DS6A 1PIWA 1Q7GA 4W7IA 4WXHA 1X2BA 4NHEA 1JILA 5IUJC 1R9MA 4RWZA 3HNRA 3RFXA 2C59A 5EUCA 2GHTA 3BWCA 3FAKA 1ZN9A 5A4AA 4GPIB 2WFZA 4ND5A 5BY2A 2VIIA 2GPAA 3ZXUB 1YT5A 3NWOA 3WKDA 1WKVA 1J42A 1H65A 2Q3FA 4HVCA 3VR2A 2IYPA 1JG4A 1SVSA 3K1ZA 3S2FA 2BFBB 1T8PA 3CRW1 3EDCA 3LWBA 4GX5A 2ZYTX 4M9CA 3ZI7A 4F46A 4NATA 4GI2A 3QMMA 4IHJF 3QVUA 4HRXA 2QTNA 4WZAB 5AICA 5AVTA 4WZ6A 1KZ4A 1SCNE 1QO0D 1SOUA 1YZQA 4A10A 2FGJA 1A98A 1WVGA 2Z1NA 1CS0A 4LWZA 4CLEA 4PNEA 3IMFA 3R0JA 3SEZA 4IXNA 1XD9A 4HQLA 3KYBA 5DTEA 3GJ0A 1IOWA 3GCDA 1IY0A 2CJFA 2WW8A 3C8DA 4XWAA 3TJZA 2Q3LA 3SEAA 1Q2UA 1XZAA 1JVSA 3OCZA 1C9YA 3O91A 3P52A 2BSQA 3OLZA 3X1JA 4AZ3B 3BXGA 3QZUA 5H0IA 2ORYA 3N8NA 3TPFA 4DAOA 3VR5A 2F2TA 1L4BA 4MWZA 5CU7A 1U8UA 5F9HA 5HYVA 2JH8A 3IDFA 4OJNA 4JLOA 2P2LA 2J0QA 5CCXA 5EKXA 4TWIA 3VYVA 1VDZA 3WK4A 2HOQA 3CNBA 5DOZA 3DDOA 2JCVA 2IIQA 2O8VA 2VUUA 2B1QA 3GFQA 3ZYCA 4B7XA 3W5BA 5KJEA 4AKHA 2GAAA 1K7CA 2Z58A 4C30A 2WWWA 3C3KA 4B87A 5B5SA 1Q95A 3R0VA 4U5QA 4LFAB 3O38A 4K3VA 2EJCA 1CEQA 3KJIA 2OYCA 3RG2A 4Q4CA 5IBRA 3C3MA 1O7JA 3O92A 4IJ5A 1PTJC 2OZPA 4E07A 4GOMD 1EDZA 4EX7A 5HCNA 4R2XA 4YRAA 3IE0A 4HF7A 5KI6A 1E1RD 1RP7A 4JQSA 2M98A 3HMQA 2XJ4A 4F3KA 3PLNA 4X1IA 1DWPA 1ZY2A 1JG7A 2C8VA 3K9NA 3M5PA 4B0OA 4X20A 1LNQA 2A0YA 2BKVA 3THYA 1MQ8B 3B6EA 2A0WA 2YWBA 4UTXA 3FZQA 1E59A 1E0JA 2I2DA 1L4EA 2D5BA 3WGVA 4M1OA 3BKWA 1FU7A 2XW6A 1LTQA 1FMTA 4CWAA 1P4AA 4GQIA 5KOJA 1NR7A 1IN8A 3ZJYA 3SBXA 1C4OA 2FPKA 1IEWA 2BMEA 1TCUA 4BO9A 4S2EA 4UDYX 4LDZA 4LDPA 3RC7A 3ISTA 4DXDA 2NQ2C 3C98A 4PSCA 1TYAE 3M3PA 1W6RA 1HDZA 2YDXA 3HVJA 1Y1LA 2GDJA 3KYCA 1Z06A 3SR0A 5FOSA 1DC3A 3WGNA 2D4AA 4DR2B 1HORA 3T35A 4NPAA 3EEYA 4RHCA 1RE1A 1TAHA 4EL0A 4NYMR 4DWJA 3I2GA 3ZW9A 3P7MA 1GZ5A 1H2HA 2DJ5A 2X6RA 2ZEJA 4LY9A 4R05A 4UASA 4Y8VA 3GVCA 1NG9A 2YN0A 2AWNA 3U3MA 2OV3A 4GC5A 1SA0B 3KLPX 1Q0ZA 3PC2A 2HV9A 4X66B 4ZREA 3WWEA 1A76A 1OY1A 3FDIA 4ZOLA 1T4DA 1E6UA 2R0QC 2CXQA 2QAGA 3SQOA 4QYMA 1T0UA 4R69A 3STYA 1UANA 1CNMA 3VU8A 1ISFA 2A0UA 1B41A 2PHZA 3MOIA 3R77A 1F8GA 1AV6A 5HQ3B 3GQBB 3COJA 2UUPA 5C2JB 2CNLA 3PC3A 2G8LA 5C3MA 1X92A 2BCEA 2MCFA 1YR6A 2W8BA 3HUUA 3MUNA 4FCWA 1XL1A 3LTEA 5IG2A 3G89A 1ECFA 1LC3A 3NC4A 4B5KA 1QM5A 1AGPA 1FK8A 1SH7A 1EP3B 4FJ2A 1G42A 3WIBA 5E0OA 2JB9A 2PUWA 4GZMA 1KEEA 4RD2A 4PTYA 1Z7YA 3RPEA 2DFNA 2M1ZA 1LPPA 4BTVA 1Y9AA 3ICPA 4Y2GA 3SDZA 1XN4A 1LQUA 1D4OA 3JYLA 1DC4A 3NAMA 3P0JA 1JFTA 3D5TA 1E79A 5ALLA 5DNDA 3SZOA 1UC5B 2FTKE 2ZU0C 5EMKA 3EVGA 3ZR4B 5IZ4A 8GPBA 3U7HB 1W0CA 1H4TA 4FUQA 5CVTA 4TYNA 4WW0A 3AIKA 2GLTA 3QUSA 5K0CA 2NZUG 3LUFA 4LHVA 2HRDA 2QOEA 4AX8A 4PX9A 4L4SA 4J2HA 1IEQA 4H0CA 3CW9A 3I1IA 4WOCA 3RTGA 2ACEA 1T9GR 2JFWA 2I7CA 3H1TA 3A3YA 2JRLA 2ZSIA 3KQVA 4GZLA 4QYWA 4TMYA 1U1CA 3DC2A 4MGKR 1AKUA 1WUIS 2WAXA 1YB7A 1C7IA 2PJDA 2Y1FA 1SK9A 4G0WA 2EXXA 4RSGA 5KKNB 4NYMQ 4ZRNA 2WJAA 5B6IA 4YECA 4HLQB 2NPOA 4EECA 2I1VB 1Z22A 1REQA 5K0GA 3N7TA 1JDPA 4JJEA 1OAKA 2HUNA 3DE0X 2JI6A 3D3NA 4X97A 3DWGA 3CLKA 1HLFA 3ZE2B 1QHNA 3PDJA 1CEEA 5EN4A 3I04A 2B0CA 1O0BA 4N8EA 1C7RA 1EP9A 4HO1X 3UJPA 4E08A 4F2WA 2JEOA 3DEIA 5LSAA 1XRNA 4I50F 4GMDA 4L95C 4TXHA 3J7AC 1WP4A 2NU9A 2PZEA 2QTRA 3Q3VA 1DRWA 1EFRA 3GDFA 4HN2A 5JQGA 2CLSA 4HZGA 4M1WA 2ICAA 1S7CA 4GYJA 1NU8A 3DJFA 4LJ4A 1E62A 3RWBA 4HG2A 3B9BA 3CH4B 2X2OA 3ESXA 3OP1A 5F2OA 1E2EA 3GYBA 5F52A 1QP4A 2QB5A 4AI6A 1NUPA 2BGJA 3NC0C 1M2FA 2AG6A 1C50A 4E5PA 2XB4A 2QVZX 3HRIA 5DN9A 5EGSA 2C8JA 4TKMA 1E1QD 4YRDA 3BDIA 1W76A 4LYDA 5AKHA 2EL7A 5TSDA 1W2GA 4YAWA 2BRUA 4G5OA 4HB3A 1LS6A 3O2JA 4OREX 2VKQA 4NOJA 2MSLA 4C4SA 5CB4B 3WLRA 10MHA 4ZEVA 2AC4A 1E1NA 2M6RA 4C4ZA 4CG2A 2CFIA 4CLOB 3C85A 3C0KA 1WZCA 3DV2A 5K0LA 2A1IA 3T1NA 4A9AA 3OLYA 4UMDA 3DCJA 3AUUA 4JBNA 4YCBA 3KV3O 4O2AF 5FWYB 1E0AA 2PX8A 2HSJA 5DSXA 5IK2A 2V4UA 2FQYA 3G02A 1OXVA 1XVLA 1AN0A 1DO0A 5BQOA 2V7VA 4CLDA 3EXHB 4X6LA 1NXWA 1GARA 2CJPA 3INNA 4FI3C 1LLQA 3ZWYA 1NJ1A 4C4RA 3I58A 1L5GB 4O1MA 4IVQA 2BBWA 4S24A 3O5AA 3GROA 3AR9A 5LQDA 1S6YA 2DBQA 3QIVA 1KNQA 3RUEA 3IUYA 4UPDA 2WIKA 1YS7A 4Z9XA 3IAS1 1C4XA 2WTAA 4GZ3A 5A5GA 3CZRA 1YHZA 1Y3HA 4P4UA 4I4CA 1U0NA 1JU4A 4IDFA 3LCUA 2LD4A 3GFTA 5K3OA 1X7ZB 2JJ1A 3JD1A 4HD8A 4KYUA 2P5YA 4QFBA 5BRAA 2OHJA 2YXPX 4UTNA 4F9GA 2Q4DA 4UBJA 3P9ZA 4PZAA 5FH9A 3S5UA 2F90A 2Q8NA 1YQWA 2PWAA 2HK9A 2ID9A 2DHCA 4R9RA 1SOMA 3SQLA 3B3FA 3JAKB 4P0PB 2FP3A 2VRCA 1EWRA 2CYCA 4MITA 4P36A 4WJLA 4IQFA 5GZ3A 3SYMA 4ZICA 3P45A 4NDAA 1I32A 2WK1A 4OBBA 2ZTVA 1N6LA 4G81A 3AI2A 1XJ5A 4FYPA 1KKUA 2IZ1A 3TQCA 3G17A 3DZGA 4Z4QA 4DMLA 4YBRA 4A15A 3QHPA 1JQBA 4Z9FA 4RZHA 3PWKA 1RXVA 1RI2A 1NGSA 1GGHA 5J2TB 3OHMA 2J9FA 4GS5A 4HEQA 2VAXA 5C8YB 5ARDA 3RASA 3UFXB 1B4DA 1SVLA 2V9PA 3LS2A 1G291 1DADA 2FB9A 1LSSA 5E6UA 2OQRA 3DC7A 1I4EB 3ZZNA 1LBSA 5I9LA 1O8CA 4CETA 1VJ5A 3RVLA 3ZVRA 5EIOA 4CDNA 1J8VA 2J3KA 8AT1A 4J3JA 3DDSA 1WHTA 4M76B 5KTNA 3WP0A 2CBXA 2VA9A 4DV7B 4CZ2A 1XRRA 3N8HA 5DTMA 2HT1A 2H7YA 1JIVA 4IIJB 3FYUC 4RD1A 5EZQA 3RYHA 1B2RA 4CLRB 2HIGA 1FMLA 5DULA 1E0KA 2OB2A 1X7WA 3T9CA 3PUVA 5KUTA 2ACWA 2PGAA 3MVEA 3DKVA 5I8WA 5DLDA 3DWFA 1U7UA 3DHWC 3RTAA 3ZHCA 2DU8A 2HQSA 4NVRA 4V0LA 1GSIA 2FCAA 1JHDA 2BM0A 2XXJA 4OHFA 1BN7A 4TTTS 3BC1A 1FOEB 5C1BA 2ZE7A 1XNJA 3FGNA 2ASEA 4CR8A 3DM9B 3UCEA 4QU9A 4ZYVA 5IF9A 5FO1A 5T5QA 4U7PB 3FYHA 1YFZA 4MCAA 4QYIB 2P9TA 4WBNF 3GGPA 4OX9B 3FVRA 3RIEA 4KPUA 2AS0A 1P0MA 5CB6A 3FNRA 3JQRA 1ZCJA 1G20E 4L16A 5DLEA 4G0QA 3HEAA 1OLXA 2NN3C 1W88A 1MQSA 1WDTA 1Z2CA 3EWAA 1J0BA 1RSZA 5LJIA 2ZVQX 2OVFA 4M7PA 2YMQA 1BW9A 1V5WA 4I1RA 2QRVA 4EITA 1A95A 3AT1A 5LDHA 4TKVB 2WYWA 1YZLA 1W25A 1FFWA 1URPA 1V96A 3RO7A 4UOZA 2R97A 2XBMA 1P3Y1 3PEFA 4CM1A 4DYDA 5EINA 5L3SA 2UZIR 3DS8A 2REQA 4XTRA 4IWYA 1L3CA 3MJSA 4DOMA 2OC4A 5MN5A 4BJ1A 1DRKA 4GX1A 4J3NA 3B5EA 1C7QA 3GNQA 1L3IA 4NY1A 4PICA 1KO4A 3F7OA 3HR8A 4I1IA 1QH1B 3DE1X 3L5KA 3ZX4A 1YASA 4KKXB 5F33A 1IYZA 1F0PA 3M1YA 1CIJA 3IQXA 3K4QA 4HVTA 4A2QA 1ADCA 2DC1A 4C0QC 5EJ6A 3V48A 4G37A 4NKRA 3E23A 1VBFA 3FJOA 5G4LA 1M5RA 1T5OA 1UDBA 4L9SA 5G2OA 1N2GA 1RYEA 2WM3A 3IJEB 1NY6A 5IJXA 1AZTA 1P5RA 2APJA 1MAUA 1MC8A 2AOWA 5D87A 1YR1A 4E12A 2R85A 5FR2A 3ESDA 3KZ1E 1RYDA 4RIEA 5EAIA 1P45A 2XCOA 3F9IA 4XYGA 1VKOA 5JE8A 5K09A 2WNHA 4E1VA 1JHQA 1ZJZA 2Q9UA 4A8HA 4BJ3A 3RS9A 1W47A 4RSRA 4MP3A 5J47A 3P71T 4IZHA 2PZLA 2WUDA 1BTOA 4Y6GB 3ZY4A 1X9GA 3P2IA 1K4YA 3ROFA 3TEJA 4OYYA 1QIEA 4FCTA 4U6SA 5C37A 1MW8X 3EDQA 2WNIA 3FKJA 5FUMA 4R3NA 3UB4A 4C5BA 1OHHD 2PKQO 4A8PA 1KTIA 5ESXA 1Z2AA 4N0PA 3T12A 5IASA 1BCSB 3B78A 3OM0A 3QMVA 2GZRA 3SX4A 2VNKA 2AWOA 1QPBA 3WWPA 3MHTA 4BLPA 2WHXA 3I9NA 3K0FB 1VHTA 1X1EA 3ONFA 4IIGA 4AJ1A 4YJ2F 3WB0A 3UK7A 3WIOA 4YHHB 1JKXA 4TLMB 4IIHA 3MMNA 3MCTA 1BEEA 3RANA 4HI0E 4F0JA 2GASA 4ND1A 1SKMA 4FW8A 3USZA 1IDOA 1G2PA 4LW8A 2GN8A 4F2PA 1KVSA 3F6SA 8LDHA 4GI5A 1G55A 1CUSA 3DCIA 3UAVA 5A0TA 4U7JA 4WUTA 4X91A 4DCOA 3W34A 5HIAA 3GLFE 3ELBA 1N5RA 4IVNA 1OWNA 4P5DA 3TR6A 1T43A 4DILA 1Q21A 1UBCA 1UK7A 3K8ZA 5TT1A 2WWRA 4WKGA 1SUFA 1TIKA 3ZU5A 5CNKA 4KR3A 3L93A 2FA9A 2HGZA 3MPUA 2CL7X 2XD4A 4ZHSA 2BH2A 4B3IA 1E63A 3U39A 4NJMB 3IDAA 3OBBA 4G1EB 5T67A 1NR5A 1Y42X 4R1SA 5IJ9A 5K8TA 2YH2A 4HNGA 1QGAA 4GXNA 4HVAA 4P3YA 4BGUA 4FDUA 2Y9MB 4BU0A 4NCIA 3LIIA 2QGFA 2YN4A 3VPBA 1YS2X 2FEKA 3EGWA 1YZFA 4BBZA 5KWVA 4ZVNA 1Y8AA 3EC2A 2X1VA 3I0ZA 1CUDA 1E9FA 5DHSA 1WDWB 2A30A 3I09A 3C6BA 4P5EA 4CCYA 1BYUA 1DOHA 1S3IA 1XTZA 5HSGA 1I3MA 4FT4A 4HLUA 1L8OA 1HTTA 1U1GA 4FN5A 5KJFA 5ER9A 4D3FA 1HO3A 5C5EA 5KNDH 5HOEA 5IANA 3KT3A 3ZDBA 2X8WA 4H77A 3W2HA 3NAGA 3PZRA 4MR7A 5LZ2A 2OHHA 4WDRA 4IRXA 2V1UA 1XVUA 2NMVA 4GEGA 3OAAD 4KDRA 4F91B 5KIAA 3EMVA 3ZDCA 2JGDA 4E5DA 2XYRA 5DZSA 1USGA 4BVKA 4W7HA 3OCYA 5C46F 3A4YA 2QMOA 1SUCA 1WXIA 2RGRA 4B44A 4HGOA 4IDBA 3U26A 3WGTA 3FOAA 3LJKA 4HDKA 5TQ0A 2C92A 4J7UA 3BTUA 5K8JB 4IR7A 3H2JA 3CFYA 3R9IA 2C8LA 4TZKA 2RK6A 1JEYA 1EUYA 3LDUA 2NT4A 2EZUA 2Z8ZA 2CNWA 1G4UR 4I55A 2GHRA