3CLRD

Crystal structure of the r236a etf mutant from m. methylotrophus
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
319
structure length
319
Chain Sequence
SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYVEVGGGNDIDITTVDFIMSIGRGIGEETNVEQFRELADEAGATLCCSAPIADAGWLPKSRQVGQSGKVVGSCKLYVAMGISGSIQHMAGMKHVPTIIAVNTDPGASIFTIAKYGIVADIFDIEEELKAQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Electron transfer flavoprotein subunit beta
publication title Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.
pubmed doi rcsb
source organism Methylophilus methylotrophus
molecule tags Electron transport
total genus 98
structure length 319
sequence length 319
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
D PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3clrD01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3clrD02
1G59A 2JA2A 1O96B 3X1KA 1M1ZA 2Q5OA 2JI9A 1MC1A 4EG6A 3TZLA 1Q17A 1O6BA 2PG3A 3SEZA 3SZ3A 2QUIA 4K9OA 4MVWA 5EJ8A 3IUEA 1MA3A 3X1MA 3FIUA 4JUDX 1KH3A 1N3LA 1JECA 4K9PA 1G8HA 2H4HA 3HMQA 2V0CA 5DK4A 4K9LA 3DO8A 5AHKA 1OD6A 5TEWA 4D5EA 4EF6A 5D7NA 1KR2A 1NM5C 3HWWA 4WSOA 4ZCSA 3Q12A 1QNFA 2AG0A 2AG6A 1I2DA 5H16A 4ZP1A 4KKVA 1I6KA 1WQ4A 4GPEA 3PXUA 3Q4GA 1Q77A 3D6UA 2PGNA 3HFJA 4GM4A 1OZHA 1PNOA 4RJKA 2JAXA 2QTRA 3FWKA 1Z8NA 1N2OA 4ARCA 1M2HA 4FEGA 3COZA 2HZ7A 3IODA 1NUQA 3D4BA 2WQ6A 3HWX1 1ILEA 2PZ8A 2A1UA 1PI3A 1O95D 1OWLA 3IOBA 2X7JA 2O5RA 3A4IA 3P0IA 3CLSD 4JUAA 1QU2A 4ZT5A 2GM3A 3RHSA 2WB2A 1M2KA 3D81A 1U2GC 4QREA 2VBIA 4F56A 2Z3VA 2H59A 2GOYA 4MW1A 3AG5A 4DDKA 1LI5A 1ICIA 4DDHA 4FZ3A 4JUCA 4L3OA 3SDBA 1IFXA 1T6ZA 1QTQA 4DLPA 1S4MA 2A1TS 1SURA 3PNVA 1U31A 1PG0A 2JI6A 2EL7A 3IMEA 4JYZA 4GP9A 1KP2A 4QRDA 1O96A 3RK0A 4UTZA 4F4HA 3ZGZA 4X0EA 5EJ9A 5IJXA 1N2HA 4UTNA 4XFJA 1GAXA 1Q15A 4YP6A 1OWMA 3ZJTA 4MZXA 4J1TC 1EFVA 2WQ7A 4NAUA 4GU5A 4MUIA 1K4KA 2BYTA 1Q14A 4MUJA 1OWPA 4J76A 4CDNA 4COKA 3AL0C 2FSVC 4PBSA 3ZJVA 1O94D 4K9KA 4HPWA 4AQ7A 2R5WA 1EFPB 4JD5A 1QRSA 2FR8C 1J1ZA 2ZP1A 4MW7A 2RD2A 3IVGA 2XRYA 1X8XA 4MW6A 1T9GR 3KT8A 2D5BA 1TYBE 4MW2A 4NZPA 3OTWA 2WVHA 4Q93A 4DDMA 1S7GA 3F6EX 5DGDA 1NSYA 3CLUC 2C5SA 3MMXA 5FO0A 4DNXA 3KFLA 4R2MA 3GLSA 1POWA 3H99A 1TYAE 1HZZC 3Q10A 4Q9DA 5DEIA 5TEVA 1KH2A 3OP1A 2WVGA 4QPZA 1XJQA 4UU7A 4Y6QA 1KAQA 1JMVA 5J5AA 2J07A 1M83A 5J59A 3VGJA 1JIKA 2J4DA 3ISJA 4EG8A 1N2JA 4I6JA 1UPAA 2W93A 1NURA 4CQNA 1N0HA 3X1JA 1MRZA 1IQUA 1MOPA 3P52A 3H9CA 1KP3A 2X1MA 3F6BX 3A2KA 2A4MA 3SP1A 3GLTA 5FNZA 1SZCA 1N2IA 2UZ1B 3TS1A 3D7KA 1M8KA 4KR6A 2FRDC 1OWNA 5EJAA 2X3FA 4QELA 3ZGVA 1T9AA 3TQIA 1GLNA 1WXIA 1WXFA 4XFDA 1IVSA 1EUQA 1SZDA 4BV2A 1IHOA 1XLTC 3HV0A 2VXOA 4FVTA 1D4OA 3ND5A 2IELA 1ZH0A 1O5TA 1EFPA 4ZCPA 1F9AA 3QTTA 5LLTA 4DE5A 4JSRA 3PRHA 5BWOA 4JU9A 5K6TA 2OORC 1B6TA 1U7DA 1YUNA 3CLRD 1D2RA 2PZAA 1OWOA 4FZJA 2V3WA 2VTBB 3EA4A 3ZUGA 4K9QA 1MCZA 1OZGA 2QJOA 2DERA 2VK8A 2CV2A 2J5BA 2CV1A 4IAOA 4RJJA 4C78A 3BL5A 1ULHA 2H2GA 1JEEA 1KQPA 2E18A 3P0JA 1EFVB 3ND7A 4BV3A 3INNA 4ND7A 2QUJA 1I6LA 3N05A 2E0IA 1T9DA 4KGDA 1TYCA 1PO7A 1JIJA 1JILA 1V5GA 4G1CA 5HUJA 2VBGA 3K35A 3COWA 3H05A 2FN3A 2VJYA 3LE8A 1O0CA 2A84A 1YIDA 3MLAA 2HGZA 2YY5A 4JT8A 1N1DA 5MF6A 4S1OA 1TYDE 1O95C 3LQ1A 4EG3A 2AG1A 4ZT3A 5F23A 4H3SA 3CVVA 1Y9DA 4G5FA 3CLSC 5EJ7A 3ZIUA 4C7BA 1XNGA 3K32A 4HJRA 1QU3A 1V5FA 2PFSA 3KT6A 2UZ1A 5J58A 1QJCA 3ND6A 2NZ2A 2DJIA 3COVA 5DB4A 3CR8A 4CDMA 2Q27A 3LCJA 3IVCA 4I6GA 3N9IA 1VBKA 3CLTD 3FI0A 1V8FA 2Z09A 3QE4A 3JWPA 2OD9A 4HDAA 2CV0A 1PFVA 5EJ6A 4HD8A 1FYDA 1WY5A 3EY9A 4GM0A 3VU8A 3ZJUA 1T9CA 2A7XA 1KQNA 5BNZA 4Q16A 3LOQA 2J08A 1JHDA 1WXEA 3NBKA 1J8FA 2YWBA 2VBFA 1MB9A 2VTBA 2V0GA 1NUSA 1IQ0A 1P7PA 2I1LA 4JT9A 1Q19A 1O94C 2C31A 2NXWA 4MQ5A 5IHXA 1YC5A 4RJIA 2D13A 1HYBA 1QPBA 2JANA 3IUBA 1N2GA 3E9YA 4BUZA 1F7UA 3CA8A 4ZCRA 5HUHA 1WKBA 1M2JA 2H2FA 3EYAA 3DPIA 3CVXA 3G59A 4MVYA 1ZPDA 4MPJA 2A86A 2PGOA 4U8HA 4WNYA 2QUHA 1GTSA 1BFDA 1V5EA 5BWNA 4V1CI 1N75A 2CYBA 5FYQA 5MFZA 3TNJA 1I6MA 4MAFA 4PBTA 2IHVA 1J1UA 2A1TR 5DGTA 1NUUA 4IG9A 4YP5A 1LI7A 5MFPA 4RPIA 3NV7A 2QUKA 3N2YA 2X1LA 2QTMA 4F3RA 1MBZA 3IAEA 2Q28A 4JXXA 3UOWA 5K6RA 1NUPA 3RIGA 2EJCA 3FOCA 2AZXA 4KXQA 4HJXA 1J70A 1IH8A 1WOYA 1KORA 2E21A 3F3MA 2CSXA 2Q5QA 5K2OA 4MWDA 4NAHA 2VK1A 4KPUA 2YXNA 3HZRA 3FLMA 1KQOA 4YMIA 1PVDA 4BVGA 2O8VA 5LFAA 3GUZA 3U31A 2IHUA 1R6TA 2DETA 1M2GA 3CF4G 2G36A 2OV4A 2H2IA 4X3PA 4RMJA 2RE8A 3PKIA 2AKEA 3IMGA 1K92A 2J09A 1MAWA 3S3TA 1J21A 1RQGA 3FH0A 1OVMA 3TZEA 2PANA 3MXTA 3KT0A 4PY2A 3RJZA 4BN4A 3FZNA 2CYAA 1Q1AA 4V1CA 4MW0A 1PNQA 5KCMA 1PYDA 4UTVA 1PFUA 1OZFA 3P0HA 1UPBA 3OE1A 3ZGOA 1H3NA 3PNYA 2JLAA 3CLRC 4MUHA 1QQTA 1O97D 3ILVA 4ZT7A 4BVEA 1ZUNA 2HMAA 2ZUEA 4BN5A 2B7LA 1O0BA 2WVAA 4GG1A 4MUGA 1R6XA 5BWLA 3A05A 3L92A 4X3OA 4MWBA 3SZGA 1YHYA 2JI7A 3NBAA 1GZUA 1H3FA 3GLRA 1JZSA 3FG9A 1WJGA 3CVWA 5HG0A 2WSIA 3C8ZA 2DXIA 4EG4A 4OUDB 2H2HA 5K3SA 3JXEA 1VBMA 4GM1A 3DV2A 3DLAA 3RIYA 1DNPA 1DJLA 1YULA 4RMGA 2QQFA 2E89A 5EKDA 1NI5A 3QTBA 2ZUFA 1MB2A 2Z08A 4EG5A 3A04A 1MJHA 2QTNA 1UPCA 2DLCX 4KR9A 1QRUA 2A88A 4ZCQA 5EJ4A 3D6VA 4MUKA 2QJFA 2DUMA 2EZ8A 2CUZA 1NZJA 3U3DA 3FETA 4Y6OA 3E27A 4MVCA 2HJHA 1YUMA 3IMCA 4K9MA 1U28C 4JUFA 1PFYA 1E3TA 4D5GA 1EUYA 1GPMA 3IDFA 2Q5JA 5LM3A 1F4LA 1Y42X 3K9WA 1YHZA 4BVBA 3CLTC 1M8FA 4K03A 4MVXA 1POXA 2IP1A 1TEZA 4ZT4A 1M2NA 3KT3A 3IH5A 2OD2A 1JEDA 4QQ8A 3N8HA 2JIBA 1EXDA 5EJMA 1EE1A 2PIDA 3I05A 5FO1A 3G6KA 2CT8A 4JXZA 4JUBA 4KPUB 3ZG6A 2PZBA 3RBAA 1PT9A 1K97A 4MWEA 1MAUA 4YBRA 3AFHA 1H1TA 4U63A 1X6VA 5K0TA 4BVFA 4UUAA 4P2BA 2XRZA 2EZ9A 3IOEA 1JSCA 3RK1A 4R8MA 4MUFA 4K0RA 4OUDA 4EG7A 3MLBA 4JFAA 4V1CB 4RUKA 5KHAA 4NDAA 4RMHA 5MGNA 2DR2A 2VK4A 2Q5LA 4ZCTA 3FHJA 3IOCA 4UZEA 1S5PA 4A91A 1IRXA 4CT0A 4ARIA 5EJ5A 4K9NA 1M8GA 1T9GS 1COZA 2QJTA 1LW7A 3L93A 4MPRA 4BVHA 4R0NA 2H4FA 3ZXIA 4UTRA 1U7XA 4DJAA 3JR3A 1KAMA 4MUEA 3HGMA 3CVYA 1GN8A 1M8PA 1PFWA 1IQRA 4JZYA 1YC2A 4MPPA 4BWVA 2EZ4A 4F4UA 4YP7A 2X0KA 4PBRA 4MW4A 2GKSA 1CT9A 1XNHA 4J75A 3SYTA 4TWJA 1KH1A 1T6XA 4G5YA 1KKUA 1WZ2A 3AIIA 5H7XA 3G5AA 4ND6A 3MUEA 1VLHA 1ZH6A 4ZZIA 3RFFA 2OQ2A 4MW9A 4R2LA 5AHWA 4ZT2A 3ZXSA 1OBHA 1OBCA 1YNOA 1U3CA 2BTEA 4L2IB 4MLPA 3GLUA 2NYRA 1ZJWA 2JI8A 3HL4A 4MWCA 1VBNA 1WXHA 1XNJA 4E1AA 1YIAA 4UU8A 3GLVA 4XSVA 3AKZA 3FDXA 1J20A 2JLCA 2D54A 4JU8A 3COYA 5TS2A 1BS2A 3TQOA 4EG1A 1M8JA 5JBNA 1U2DC 4UTXA 1NUTA 1YBHA 1N2EA 1PG2A 4O8ZA 2PXHA 1T6YA 1U3DA 1WXGA 1YTLA 2DPLA 3FNRA 4G6ZA 4NX2A 1K4MA 1Q11A 5K0SA 4KR7A 2DEUA 1GTRA 1O97C 4TWIA 2IHTA 3CLUD 2IJGX 1JZQA 2CFOA 5FEMA 4NATA 4AS1A 4HK4A 1JGTA 4EGAA 1YI1A 2H4JA 2NSYA 3M5WA 4EFKA 5KWVA 2B4YA 2TS1A 4FEEA 1V47A 4RMIA 2H29A 1FFYA 1NP7A 1N78A 4U7JA 1YI8A 3AG6A 4TS1A 3PNBA 4MW5A 3ELBA 2EZUA 1R6UA 1EJ2A 1PTJC 1NYLA 2YWCA 1G8FA 4IF6A 4OJMX 4I6EA 4MQ6A 2OO5C 4MUNA 1TFUA 3IVXA 3H97A 2H2AA 3UK2A 4UUBA 2H2DA 2QQGA 1YI0A 1N77A 2A1UB 3H9BA 1Q6ZA 4GRIA 1H3EA 1VL2A 4J16C 1A8HA 4QBTA 1JIIA 1TQ8A 3VRHA 2Q29A 2FWNA 1UFVA 3FY4A 3FSJX 3UY4A 4I5IA 4MULA 3PKJA 3CVUA 5TGTA 1QRTA 1G8GA 1J09A 1N2BA 4ZT6A 4Y6LA 3UC5A 1U0BB 3PDHA 1WQ3A 1F7VA 4UZFA 1T9BA 4L2IA 2OD7A 3IAFA 3UMVA 2EZTA 5DASA 3U1VA 5DEOA 5IMSA 3GMIA 2CYCA 3SEQA 2BRUC
chains in the Genus database with same CATH superfamily
1G59A 4B84A 3LUKA 1PAUA 3V97A 4ZDWA 4ZVPA 4DLKA 1BDBA 1ZBDA 3EDOA 2ANBA 2Y1EA 4CT5A 4EG6A 1NYTA 4WMLA 2W98A 4AY3A 2JJ8A 3L6UA 1KEUA 4U3JA 1BXGA 1MA3A 1IOZA 3AY0A 5FL7A 3LPMA 1WXQA 3X1DA 3PXXA 5E0KB 3RKSA 3Q72A 1L5LA 3TH5A 3O9MA 3GC6A 4NZNA 1NKSA 4U2BA 3D8SA 2R1VB 1DAGA 2QLNA 4IINA 3E7XA 2V6MA 3U48A 2G8NA 2VA8A 1AKNA 3KVVA 3SSNA 3IYLW 1RM3A 3WOVA 2VF8A 3LK7A 4PC3A 3UJ7A 1MX5A 4HEA1 4L51A 4FX2A 1SEVA 1U11A 1I2DA 2WK1A 3M33A 1MDBA 1JBEA 1PZNA 3IPXA 4N7BA 4P80A 4PGMA 5G3YA 1Q77A 5IDXA 5KVSA 1JP7A 3GJ3A 1OZHA 4GM4A 1I80A 3HYNA 3W2FA 2JAXA 2QTRA 4BNXA 4J0DA 4V3CA 3USES 4XQGA 5BWCA 1G4HA 1KMMA 1N6LA 1VKHA 3DAPA 4R1OA 4Y9SA 1E9BA 5FUBA 3PFWO 3OP4A 1CUGA 5JVDF 2PX8A 1E79D 4K9SA 3CXRA 4E6PA 2OBXA 1MAAA 3EIFA 2GCNA 2VCEA 3W5VA 1CS0B 4RPHA 1GTVA 1CD5A 1X14A 1Z29A 3LC7O 5JNVA 5MN6A 5K0EA 3OQNA 1ZU4A 4DLLA 1JLHA 1YKFA 2MYPA 3JCZA 4Q39A 4WKPA 1YFJA 2WNSA 2AN3A 1T6ZA 1P2DA 2JFGA 2LGJA 2RONA 3GJTA 1SQ5A 4HEJA 3QA3E 4JP5A 4JT2A 3SBEA 1RD4A 3CW2A 4R9RA 2GH1A 2VAPA 2VT7A 3DV9A 4N3AA 1XCPA 3K6RA 1VE3A 2NU7B 3MJFA 1BMQA 4GPAA 4X9XA 1VE6A 2PKCA 4P3KA 3RAGA 1CRWG 1ZM7A 1Q15A 1EI9A 3OWOA 1CB7A 4O5OA 1T1JA 4GU5A 4CL8A 3GVPA 1SPXA 1D5WA 3NIFB 4DA6A 2F43B 3BEDA 4H77A 4J76A 4A5SA 1XTPA 3LSTA 4X90A 1DAHA 5EJIA 3ZIAA 3ZHYA 1HLPA 1Z34A 2X4GA 3N5CA 2NGRA 5CYFA 4A2QA 2W7TA 3PI7A 3ZS9A 1QP7A 2CUTA 3T9BA 3TB4A 4MW7A 3USZA 1SK9A 1XRMA 2W43A 3JARB 1T9GR 4LYAA 4N5MA 1VJTA 1FDOA 5ESWA 3WTBA 4DUYB 1L6RA 3HC7A 3E1SA 1BG6A 2IY7A 4DDMA 1GEEA 2OO5A 1ZK3A 2NW6A 3S27A 3U2QA 3EVBA 2QY9A 1NAHA 4Y2YA 2K2WA 2PRIA 1K8RA 2X76A 5BVHB 1M1UA 1CUZA 4XDGA 4GPD1 5KZMB 2PKEA 4A6DA 3DBOB 1CS0A 3ACDA 3IDOA 4J2TA 1N7GA 4MUBA 2OEPA 1M83A 3PEEA 1MU0A 3GZJA 3M0EA 3MFYA 4X92A 4J3FA 3WQRA 1W87A 3QNUA 3HB0A 2UYCA 4FYPA 1NURA 4LJKA 2BRUA 2B7BA 3K9CA 3KXDA 3X1JA 4PV7A 2ASVA 3IP1A 1MOPA 2PMBA 2QY6A 3JD0A 4AIRA 2WYOA 4TMTA 2ANCA 3HR7A 2FWRA 4QFMA 4TVBA 4OJYA 2UVQA 3SP1A 4DEYA 2NU7A 5JW6A 4DKXA 1XPOA 3BILA 4C4RA 3EK2A 1LX6A 5JMTA 3DNPA 1Z12A 4GBED 5DBHX 2FEOA 1EFLA 2DU8A 4MCAA 4X1KB 2F90A 2JFFA 4XD7A 5JAPA 2F43A 3LU1A 1IHOA 4JQSA 1XLTC 1LV7A 4TMYA 3H2ZA 2AUTA 1BJKA 1QLJA 2W6OA 1EP2B 4DDTA 3MBIA 3ECSA 4YPOA 5LLTA 4TMVA 1W5BA 1IIBA 1U1IA 2VNKA 3Q5DA 1T9HA 3IFSA 3HFSA 3V1KA 3R0QA 3JARA 4AZTA 4AG6A 2K6GA 5B3LA 2DPXA 1OWOA 2MSCB 5CM8B 4XSGA 4PLPA 4Z51A 1LTQA 4R1PA 4PN7A 1FQOA 1M76A 4D56A 5KNBH 1E69A 2EBFX 4DMFA 2J5BA 3E1GA 2Q9CA 4Q5IA 1QIIA 2RIPA 5K0NA 1VZ3A 2WJ6A 3L4EA 3A3NA 2H7YA 3FOAA 2EKLA 4G65A 1QCZA 4IX1A 1KO7A 1KI8A 1N1GA 4LC1A 2EFHB 4OU4A 1WP4A 1DE0A 1Y3FE 3BUSA 2YV3A 4MRVA 3HP4A 1JJAA 4RZIA 5BVHA 1JILA 2JJMA 2IUYA 3IKLA 2GAFA 4I1PA 3U7JA 1UF9A 2JASA 2FN3A 2J7PD 4IFIA 1L3BA 1W1WA 4M1SA 2PXCA 2X13A 1O0CA 1K6XA 1HNZB 3I6BA 3C98A 1WD7A 3EZ9A 5EXTA 2AA3A 4DQVA 4POAA 1FNNA 2NWQA 4BB5A 4D6YA 2PJRA 4OMDA 3DCJA 4OQEA 3GLQA 3H8SA 2JW5A 4QNMA 1TYDE 3B2EA 4QYWA 2WUFA 2ZI9A 4XB1A 1R9GA 3L8CA 2PGIA 1X7XB 3M1YA 1GR1A 1U8YA 4IRUB 1YF3A 4M0EA 2C1EA 5J2UB 3RS3A 3UG7A 4DMKA 3L4JA 2PEYA 3ND6A 2RARA 3HSSA 3GJ4A 3OEHD 4DY6A 1I2BA 4FYVA 4DC0A 3OWXA 4YCNA 4X1KA 4GZ3A 2JBWA 3IAS1 3I8SA 3QKRB 4Q9LA 3TZBA 4D6PA 3UKDA 1R4NA 3CLTD 5I7RA 2CXPA 2CMDA 1U98A 4FDVA 1OC4A 1SCAA 2WLSA 2C29D 4PS1A 4BO1A 4HD8A 1JT2A 5HBRA 4ARSA 3DM5A 4HDOB 2O5CA 1QG4A 4R5HA 1LPAB 1Q0SA 3N0TA 3Q0EA 3NT5A 5B1HA 3TB6A 1KO1A 1M34E 3LQKA 4KP7A 1R64A 1XTRA 2OBNA 3EMVA 4NE7A 5AVJA 4O4IF 4YLGA 2HSJA 1XTKA 3OA0A 4BIMA 2FW7A 5IVDA 4C89A 4KIJA 2GD6A 1CR1A 2GILA 1PK8A 2GO1A 2OCPA 2J31A 2R5NA 2SKEA 2V0GA 1YJ8A 4XYGA 1EDDA 1IBSA 4LV5B 5LJLA 3UK7A 2BHRA 4KYTA 2FN9A 1YC5A 3FVQA 3BDAA 2JD0A 4BEVA 1TMOA 4ZIRA 5CM2Z 1GCAA 2WIFA 4ZKDA 1LK7A 2O3SA 4TLCA 1C3OA 3IJ5A 3O82A 4TXHA 3DAOA 3KFXA 4DSZA 1NBIA 1Q0LA 1EEXB 3WA7A 4Z3DA 3IE1A 3JYQA 2V03A 4TTAA 3SKYA 2OFOA 3E84A 1BFDA 2QD2A 2ZUUA 3MYYA 1MABB 5I7UA 4KB5A 4L6CA 1CTQA 2O5EA 4HNAB 5A03A 5FOSA 3D0RA 4OJNA 3U0BA 2GFQA 4TMZA 4AJ9A 3UKJA 1GNQA 3JYNA 5B30A 5E1OA 2O2CA 3KSUA 4UTOA 3LD9A 4S2UA 4YP5A 1X7XA 4N9QA 5J2UA 2HK7A 2I8CA 1E9AA 2XH8A 2Q28A 5ED0A 1NVEA 2XZTA 4R98A 1E9DA 1RVDA 1PWYE 5CIWA 3VPAA 4Y9DA 5G0SA 5FJJA 2HWKA 3OKAA 4F3TA 1EA7A 2C7VA 4K1LA 4UM9D 2B9EA 2VK1A 2R5FA 3RSZA 1A7AA 1C7FA 1F12A 1SAYA 4YMIA 4FKMA 3TZHA 4G0WA 2CW5A 2HCTA 2VP2A 1S2LA 3BXFA 3OPYB 3QKUA 1G55A 2XA2A 5KB3A 1IBCA 4II7A 4R9UC 2YASA 4FEAA 4HDRB 1XLWA 2WICA 4NWIA 2M1XA 3DDSA 4BMCA 1MR3F 3W9SA 1TGVA 2YY7A 4GE0A 2AV6A 3LNTA 3UGQA 4PY2A 5F1PA 3WB0A 4DWOA 6NULA 2VP4A 4V1CA 1JVSA 1EVLA 1U9IA 2VJDA 4YO7A 2IOHA 3KL4A 1C2YA 3G3EA 2FGKA 2VP3A 4DSUA 3CLRC 1KVRA 1QQTA 2ONZA 2VSYA 3G2NA 4RHTA 4TKUB 3THWA 1WDTA 3ETLA 4YVFA 5E4YA 4P0QB 2RFLA 5CT8A 3VR2D 4BAUA 1DJMA 4JYBA 2QDXA 1RAIA 2HBZA 2Q2QA 3KTAB 2NO4A 1NQXA 2Z30A 1MABA 4TSFA 3KALA 4DM4A 1L5KA 1QF6A 5LQUA 2JLBA 4HNAA 5JNTA 4QTUB 3R44A 3QEAZ 4FGUA 3K0KA 2J9RA 1ZCBA 2V6GA 3L6RA 1MDFA 4HYQA 5CFMA 1ID8A 2PGDA 1I7SB 1FW6A 4TS9A 1XJ5A 3U4DA 4L6AA 4E0BA 2XSZA 3PDJA 1NZFA 3IA7A 3C5HA 4YAJA 2FFAA 3WAJA 1TYEB 2GT1A 5MDHA 3WLFA 2BFNA 2FH5B 1O6FA 1MB2A 2GQ0A 2IOQA 3A04A 3OZRA 3Q15C 4NBTA 5SZKB 1NT2A 3ZWKA 3ICQB 3IOMA 3IE2A 5KSZA 4QXQA 4JVLA 3K0CA 4FOLA 5C18A 4MCJA 1Z4LA 2BUAA 4YR7A 4KQ2A 3Q1KA 4KQWA 5E3JA 4K9MA 3MCVA 3OPYA 3HPRA 5AJVB 3WL8A 1XZAA 1CDEA 3FSGA 2Q0XA 4RVGA 2OMEA 2GD1O 3D2CA 4HDRA 1HNWB 1T5HX 2GF9A 2VWGA 4QKQA 4HMQA 3UJ6A 3WBBA 3WLKX 3PGVA 4DLSA 1BQ3A 3BMNB 3D3EA 3WISA 4UUOA 4AMGA 3NKLA 1Z13A 4MYUA 4R54A 1AN9A 4DIUA 4XI9A 3SZLA 3PC2A 5FUXA 5EE9A 4EHIA 4Z4IA 4WLNA 3I04A 1PQYA 3V9PA 5JS7A 1XDZA 2BBWA 2GTHA 4TKUA 3OQJA 3ZV6A 4XRGA 1TK3A 4LE1A 5JOQA 2PS9A 3DEAA 4RSHA 4Y30A 1JPJA 5LNK6 3WOHA 1JBQA 3PPIA 4L4SA 3QE9Y 4F4IA 3WADA 3TLYA 3KTAA 2GZHA 1W2GA 4KFTA 4C2BA 1ZRHA 3FPSA 4N3CA 4K6MA 4B31A 5LL6P 1N5OX 1N2CB 1Y5MA 4J9UE 5DP1A 5ELMA 4UFPA 4R8MA 2REBA 2Q4EA 3BIXA 3KHSA 1H9BA 4GOKA 2V5UA 1P9NA 2OQRA 2PNJA 1E2JA 1PJBA 3U26A 3X0DA 4H7IA 3U6KA 2WSBA 2PZKA 1VLJA 3I9NA 4XD2A 5F12A 3VX4A 1E2IA 2QRPA 4BLOA 3EMDA 4O2AA 4LXGA 1O57A 3K3PA 1TJPB 4LZLA 4E15A 4EUFA 1IMJA 4FE3A 4MUEA 4MWZA 3BFKA 3CVYA 1LGYA 5J4YA 1BU8A 1M6EX 3PNSA 3U5TA 4ZYUA 1FMLA 2X0KA 2EFJA 1D4ZA 2O0JA 2WAXA 1CT9A 1OSNA 2YFHA 4HQRA 2JEYA 3DB1A 2FX3A 3ZHUA 2AUNA 5M3BA 2YJ6A 5AKLA 1Y1TA 4ND6A 4PYLA 1VLHA 1ZR4A 1IIRA 3Q6MA 3BMNA 1OXBB 3B3FA 5F5LA 3KNZA 1A50B 3CPSA 3NYRA 1AA9A 4OP3A 3C3PA 2NYRA 3P5BA 5I7AA 5CFPA 5DF1A 4E1AA 2RGCA 1SUIA 2HJRA 4Q7MB 1XZLA 1DX6A 3FDXA 3FYHA 4C2AA 2O8DB 1VPVA 3GA7A 4KQGA 3THXA 1STOA 2XYQA 3JD2A 2HHAA 1T29A 2D4AA 1N9GB 5E4JA 3ZJ5A 2ZJBA 5C4MA 4RMNA 3FCYA 3IIEA 4NP6A 4B9AA 5KJFA 1J8DA 3FNRA 2V7WA 1Q11A 1L4GA 3AEUB 4CMIB 3U0VA 2DEUA 1TM7E 4E22A 1I4TD 1KZHA 4KSBA 1F4PA 2BE7A 2XMGA 2Q5EA 4RAQA 4YRLA 3VI3B 4BMPB 1A5SB 2XT9A 4KE7A 1FTQA 2FR0A 5MN4A 4FU0A 3UV6A 3PGJA 3TD2A 2GZRA 2XUFA 3ABOB 3BZWA 4DC1A 1EXVA 3OMXA 1AUQA 4FEEA 4OCZA 3ER6A 3VKGA 4OGLA 4QTTB 5H8WA 3RC8A 3UCEA 3ZV3A 3BFXA 2ZROA 2QU7A 3PNBA 1RJDA 4EIWA 4RTNA 4GP7A 1NYLA 1G7CA 4OQLA 2RHGB 4OJMX 4DEXA 1MQ9A 5L3QA 3BD9A 2C96A 1BMFA 4G0VA 4XGRA 4RVOA 1YB1A 3H5AA 3MSXA 3RT1A 3BGIA 3AY3A 1PQWA 1FEZA 1YI0A 2H00A 2EBUA 2PHZA 4HAYA 4IJQA 4YGXB 5EZ6B 5ARDA 1SG9A 3SHWA 2ZBUA 4WN3A 4CLEA 3GYGA 1JLKA 2FWNA 2EX4A 5JXWA 2C7QA 5CK4A 4IIXA 3ZQUA 3VV3A 2H7XA 1IK6A 6Q21A 1ZRMA 1EK6A 1FLNA 3JVIA 5EP4A 1OU4A 4RBNA 1M7BA 5IVIA 2OZVA 1T9BA 2QP4A 5T67A 2IXEA 4U6QA 4KNYA 3L0SA 1M7HA 1U5CA 2R7NA 4GPTA 5L3ZA 2QMUA 2DWOA 3T3EA 16PKA 3QGMA 4BFUA 2O8DA 3HGTA 4P32A 5EQFA 1UOEA 1AXEA 4JLJA 3GLGA 4B79A 1M1ZA 4JJFA 2VYVD 3P20A 2AN4A 1TUEA 1IN6A 2BW0A 2NO0A 4UVIA 4FONA 3AEUA 1WKVA 2FUEA 4CMIA 1FUUA 1T10A 4ZXFA 1NTRA 5CIYA 1ECBA 4K9LA 3CUSA 3DO8A 2GNOA 5UKDA 1XMVA 2QVBA 3IO3A 3V42A 3VPFA 1L7RA 3INRA 1K7XB 4KRGA 1KDZA 3UOGA 2ZR0A 2VDLB 3Q12A 3TMYA 4AQDA 1W8DA 4QRIA 3QLUC 4CR7A 3PXUA 5FQNA 2G1PA 2Q6OA 4LSMA 4X93A 1GPUA 2UZ0A 2G67A 4KVFA 1E7YA 2QRKA 1KNXA 3PPWA 3PNPA 4G1VA 3ZBQA 4EFDA 1Z5OA 5FDFA 2WHYA 3OCJA 3GAAA 3I01M 1J99A 4FHEA 5FUVA 1L5GB 4CFSA 3C3EA 4QBIA 3ONEA 3P97A 3ENVA 1IZ0A 2C84A 2X7JA 1EE9A 4Y2QA 2C2XA 2ORVA 2WP0A 2GJ4A 3P0IA 4WZ6A 5BQ3A 1D6SA 4B7CA 3QPWA 5KINB 4RJ2A 1Z38A 3NJ4A 3IEUA 4MJ7A 1JHAA 4B2PA 5HKAA 2QZSA 5KNDD 2QBYA 1SIWA 1PJZA 3EF0A 2V7QD 2HCBA 3HKCB 4ME6A 4HG2A 1RLIA 3AG5A 3GRZA 1N0VC 1RZRD 1L4EA 3P2MA 3BCRA 3HJCA 4D9KA 2NM0A 4DR1B 3VR5H 2F17A 3H8VA 1J07A 5HRUA 4QEDA 1IY2A 2WZBA 1U4NA 3C1TA 3LYUA 5E9WA 3HCBA 1ZJYA 3INTA 5EJ9A 3E3LA 4ZAWA 1THZA 3SHVA 4G41A 3HJFA 1FYWA 2Z98A 1AJEA 1UBKS 1A4RA 1H23A 1Q7EA 2Y71A 3N6XA 4N4AA 5I9TA 4BLVA 3QI7A 5DWDA 1Z45A 3B70A 3GJYA 1NVTA 1PS9A 4JA2A 4L9SA 2YY6A 4ENSA 4J2HA 1ZZEA 5A1TA 4AWAA 2PUHA 1SCKA 3EIQA 4KPYA 3ESRA 2PZJA 3DMHA 1G6OA 3FDFA 3OCWA 4UU1A 2WTNA 5AKZA 3WHPA 4E6EA 3DV0B 1DTEA 3ZVNA 3HO6A 4LW8A 2REQB 2W11A 5TRTA 3V8EA 1QO7A 3CH7A 1NVVQ 4I8DA 4YAWA 2B7CA 1N0UA 4O2AF 4RK4A 1VG9B 2YH2A 5CT6A 5NULA 2CWDA 3BD7A 3T7JA 5KTNA 1AQLA 2BLNA 3KFLA 5EOVA 4YXWD 5IN4A 1UQUA 3HPQA 4FLEA 4OHBA 3K0BA 1YA8A 3NEJA 3QA9A 3C8DA 2R11A 3H99A 1JSZA 4HO1X 1A9XB 2QPTA 4CM9D 1CJKC 2GPNA 3LT4A 3U09A 4EH1A 4G81A 2YXDA 3OP1A 1VLQA 1T2UA 4RTOA 1TF5A 2J4FA 1SXJC 4KQHA 1JMVA 2ZZNA 1UM8A 4KITB 3VGJA 1G3IA 2ONKA 3OKPA 4I4CA 3ADOA 4JNKA 1BFUA 2VIIA 4GMFA 4EA7A 5ADHA 1U0HC 3T3NA 4IDAA 3L8DA 2GSWA 1E96A 1W49A 2ODNA 4YH1A 4KO8A 1LCIA 1IQUA 2NYAA 5K03A 2JVKA 4KN8A 1K3FA 2NSLA 2YBDA 1DKUA 2YBEA 4QHYA 4RDIA 4RQAA 5IYZB 5LIRA 5T7BA 4RHEA 2BMVA 2YMPA 3LSYA 5J2TA 1L5RA 4DNOA 5ALQA 2FLKA 3RJTA 2EGUA 3ZQ6A 3GBVA 3U3RA 3RUIA 2Z3ZA 3G7NA 4EVRA 2PT9A 2NP7A 1XTIA 5CITA 2J33A 1GJRA 5IEJA 3OC6A 1IVSA 4UOQA 3VC7A 4W9NA 4ZYLA 2XVAA 4ZGWA 2XNHA 4I19A 1Y4SA 1D4OA 1NC3A 4GGPA 1U3VA 1L7XA 3N2LA 5CA1B 4DE5A 1YIOA 1SC3A 2WWXA 4UEWA 4JU9A 1V71A 1PZFA 4AJJA 4DV7B 3LP6A 4QULA 4I4TB 1WMSA 2DQ4A 4RE5A 1YUBA 3ZE6A 2H9YA 4JELA 2OESA 4FILA 3LGAA 4LV8B 2F55A 1JVBA 3NHLA 4LNAA 1VA4A 3IP8A 1OH5A 1AF7A 4Z4CA 4C78A 2AEFA 2ZT5A 1PJTA 3HKBB 1T15A 1O2DA 2BKEA 1M33A 1KGSA 2J67A 3AERB 2GR9A 2CL6X 1DQPA 5EGSA 3Q3EA 4B3FX 3HXTA 2PMEA 2GI4A 4EJSC 2C78A 1ZHOA 1A97A 2GBLC 3TM4A 3L43A 3WK4A 5ESXA 3UJ9A 5JNSA 2ZRJA 4MUMA 4QT4A 3K35A 1VPTA 1EBUA 3DEKA 2ZS8A 5MGBA 4DV2B 1E2PA 3HI6A 4M3NA 4CHTA 1WS6A 1PQUA 4MKRA 3SF0A 3HDGA 3Q98A 4BO3A 5LDHA 4Q12A 2Q62A 1K3UB 4FE7A 4BIIA 2F3RA 2WD7A 5GOZA 3Q3VA 4QU5A 3EASA 2IYPA 1Y1PA 3OCZA 4TRRA 1ZW6A 3DO6A 3L77A 2M2IA 1O95C 3DXFA 3WLPA 2VJQA 4TN5A 1SZPA 3NDPA 4ZYYA 5IYZA 4WCDA 3ZIUA 1PV1A 3IXQA 4HJRA 1W73A 2PJUA 2NZ2A 3RABA 2O3RA 3ESCA 3I2IA 2HX1A 1E1NA 1FUIA 3A1EA 4B4VA 1IUKA 5JATA 3N9IA 4X1OA 521PA 4GBMA 5T4HA 4TROA 3R20A 2R84A 1QGUB 4RH0A 3DOFA 4XR9A 4HAZA 5EE3A 3TTWA 5JH7B 5EJ6A 3PDUA 3AESB 2Q7DA 4DNQA 1FYDA 2PFKA 4KWTA 5CA1A 1GLVA 2DZDA 2HXSA 3KU4A 5AWFC 2WU0A 3GFRA 1Z4JA 2DR0A 3EULA 3FYUC 4LVNA 3E8XA 3OE5A 1JHDA 3OE7D 3D02A 4PSDA 3VKUA 2GZAA 5A2GA 2CUNA 1BIFA 2PL3A 2Q9BA 3H75A 3WRYA 1J7JA 5IANA 1SELA 3G9UA 3PB3A 1Q16A 3L7IA 2CBZA 3LPAA 2IKSA 5DHUA 4X24A 4DGSA 4ENUA 3HKBA 3K1YA 3AUTA 4Q7LA 3AERA 3HN6A 3LW7A 3EPHA 5IHXA 2ZTVA 4I1SA 1W5EA 2ET6A 3REFA 3ZY6A 1O58A 3IUBA 4D9HA 4F8JA 3ILYA 4BUJA 3O26A 5DBEX 3QPDA 5SZHB 1DQNA 5HE9A 3E48A 3FUWA 2GGSA 5DDIP 2H57A 2A0WA 3IJPA 3PU6A 3D6AA 4CTNA 1KS9A 2GTPA 3AETB 1FSGA 2P67A 3VZCA 4N6GA 3GBSA 1FYXA 5IJ0B 2BDTA 1I6MA 2CJYA 2ZITA 4FYKA 5CT5A 4JYCA 5HSGA 1PNRA 3O4HA 2A1TR 3K0SA 3VC3A 3CEMA 1NWCA 1CUUA 4NARA 1MORA 4R71A 1BYIA 3KELA 2G71A 3QVKA 1UR5A 4JVMA 3R0XA 4HGNA 5AIBA 1SOVA 2JIZA 1GITA 1DXQA 5L7YA 1K6EA 4ZV7A 3R0VA 4DKJA 1FS5A 1TZBA 1LW6E 2OO3A 3LP5A 1YVPA 4XX1A 5EJ2A 1J1IA 4F60A 2YZ2A 1XI2A 3EHEA 5C3UA 1IH8A 3FCUB 1CFZA 5LSAA 3WB1A 3DDCA 2Q4BA 3FLMA 1QGUA 5JH7A 2O2DA 3NHAA 1TLLA 4XCVA 3KQWA 4S35A 3AESA 4A23A 5JDIA 2VXBA 3OTOB 1H65A 5IAKA 3U31A 5JV5A 4JX8A 4IICA 4PSUA 5C8DA 3ZU6A 5ADWA 1W581 4IHJA 3LBIA 4LC0A 5LLDA 1H2HA 2V45A 5I5EA 2Z8YM 4WEQA 3TZEA 2BI4A 2JGEA 4P4TA 1R0BA 4TTRA 4BN4A 3UHJA 4F86A 2XTMA 1G0NA 2D8AA 1I5EA 2O8FA 3RVQA 2G5GX 1AGNA 1H6DA 4E33A 2AH5A 2YVAA 1SXHA 1KEPA 1YBMA 2IOFA 1NULA 2N0SA 3OE1A 4I1UA 2A5GA 3SX2A 2X5OA 3U4AA 2BEVA 1E98A 2B7LA 2JLRA 4BN5A 5LR6A 1HNNA 1XTTA 1I0IA 1A7JA 2H7VA 3GAMA 4Q1CA 5FTJA 1H93A 5EKTA 5E9QA 1ORRA 1PBNA 1WB4A 3I58A 3SZGA 3AETA 3OIGA 2WG1A 1JZSA 1NNUA 1QM5A 1JPNA 1T1IA 2HXYA 1AURA 3JQBC 4GE3A 4HUQA 3S2GA 4EI8A 3MUFA 1VLMA 3WYCA 4LJ9A 1GFZA 2AF4C 2P9QA 2RJNA 4JBGA 2AJCA 1QQAA 1HMYA 2WR8A 3DV2A 1SZJG 1H5QA 1G4AE 1IEXA 1YULA 4EA8A 3ZXUB 3QVTA 3IEVA 1XMSA 1JAHA 4W8OA 4D0RA 4YAFA 4XVUA 1NI5A 4R4JA 4IIGA 4IIDA 3CZ5A 5IT4A 5J2TF 1UP6A 1V35A 2ATVA 2J5RA 4C20A 4M38A 4A3SA 1KDYA 5DWQA 4ZEWA 1BDHA 3DL0A 1L8XA 1PKEA 4ZRMA 3TJMA 3FROA 5I7OA 1UEIA 4M0LA 2WTMA 1EFCA 1QF9A 4G09A 2JLWA 3CWCA 1MEOA 3VBEA 3AIMA 4D9FA 1YHNA 1KO4A 1SBTA 1WABA 3O03A 1EX7A 1ODTC 2HWXA 4YMGA 4HDQB 2OO7A 2C5BA 4JY7A 1JG6A 3EIEA 3U6BA 1H4QA 2BGLA 2QTTA 4II2A 4UBKA 2DCMA 4MMXB 4BVBA 3OZCA 5ARCA 1POXA 1CUVA 5JYCA 2HQOA 4CGYA 1GGMA 1XCBA 4P4SB 4DPKA 3IH5A 1SO8A 3QWIA 1FQKA 3QYAA 2JJ2D 2A78A 4WH0A 5AW5A 3ZDRA 5CG1A 3P0RA 2PIDA 4I3HA 1IG0A 1ZSVA 2V58A 3FZYA 3G6KA 3NIWA 4CI0B 4DR6B 1RAHA 1EA5A 2G28A 4J4TA 1N33B 1EVIA 1Q1ZA 3ESYA 2P6RA 2P0YA 3BJIC 5JR3A 4MQEB 3KXIA 4V0RA 4HWSA 3DWEX 1SKYB 3MJ4A 4PCUA 1H1TA 3R23A 5BSKA 3O8RA 4TQAA 1ZN9A 3CQ9A 3NYQA 4WERA 3PGKA 1HF3A 1M0WA 1E9EA 2C82A 2PU5A 1C4WA 1M6NA 2CNWD 2WHXA 4RGYA 3HEMA 1CJUC 1RKUA 3V3KA 3ENZA 3W9BA 2DR2A 4KWCA 4LKOA 1C0LA 4C0KA 4M36A 2W2VA 4LDAA 3HU1A 2XMBA 4Q66C 5IYZF 6PFKA 2JS7A 3ZZUA 3W2TA 3D6FA 3KK0A 1V9LA 4UBLA 4XR4A 4US2R 4O3FA 4G8JA 4YK7A 3B85A 3V8QA 4JLKA 1SKBA 3JR3A 3NALA 4RNDB 4UNSA 3RTDA 3BICA 1ZQ1A 1KDTA 2PRJA 4WE3A 3LK6A 5G4LA 1ONOA 2PKYX 5K5EA 3U44B 2FGJA 1YU9A 4DR2B 4HNTA 3JR7A 4OJTA 5CA1F 1KKUA 3GDHA 1UFQA 3PFIA 4W1PA 4OHPA 3SI7A 4AFNA 5LD2B 5GONB 3DXYA 3F96A 1XCLA 3L8GA 1CDZA 4B6FA 4CIAA 2Y67A 2XCTB 3EAQA 2Q1WA 3FOWA 4OM7A 4P4SA 2XUAA 1IPEA 5AW7A 3GRAA 4BFTA 1PDWA 1DEXA 2JPDA 2EFCB 1HQYE 4OXKA 4NKRA 4RTLA 1GZSA 2IT1A 3T7SA 4FLMA 3M34A 1JPUA 2PX3A 4HWPA 2I65A 1GTMA 1M8JA 4MQEA 2GVZC 2GFHA 1KK3A 2C7GA 4U5QA 1N2EA 3F3SA 1MOZA 3ZW9A 3DVLA 2F3QA 4DMLA 1IM2A 1WBBA 1H6BA 4G6ZA 1HQCA 1AK1A 3SY8A 1YDFA 2OV6A 1G8AA 1TKBA 4BRZA 1NQTA 3PIIA 4KQ1A 4U9IS 2IS4A 2DUJA 5HJ5A 5D1NA 1GKLA 1ZA2A 4G5OA 4ES6A 5FD8A 1QVZA 2J5QA 2PH3A 2RK4A 2X2EA 1JN0A 3JY6A 4JQCA 4Q00A 4X7BA 5B1IA 3M5WA 3ZOZA 4CYMA 4EFKA 1RXWA 1J23A 1V47A 3C43A 2XA9A 3HUFA 2H29A 3TI9A 4DLTA 3QM1A 2G0TA 4LJ4A 3O3OB 4Y8VA 1FFYA 1X87A 3FTQA 4LGYA 4YRFA 4Z49A 2EZUA 3KG2A 5I9IA 3PVCA 1R6UA 5BXQC 3H4MA 3DR5A 1FTNA 5JAIA 2FW9A 3IBFA 2E4VA 5H5JA 2Q5FA 4F2PA 3GX1A 2WWIA 3R0IA 1B2LA 1TL7C 1U28A 2I2XB 2WINI 2ZKLA 3AKEA 3JQAD 1USGA 2CXHA 5IDYA 4Z1MA 3ZX5A 1Q0HA 4QJ5A 4RXMA 5DLDA 4JC5A 3U44A 4ACAA 1ENYA 1NNLA 1JIXA 3G5UA 4RKYA 5A4IS 3VRHA 2C97A 2VDVE 5KWIA 1UFVA 3VKFA 1PR5A 5D6OA 2GCGA 5GONA 2B2CA 3A9VA 4UVDA 2RSLA 1N2BA 1AKTA 4IHJF 2XUQA 1PW7A 3GLKA 3QLTA 4R1LA 5HIMA 5I4BA 3PFFA 4M89A 1LDEA 1UZNA 1V95A 1JG1A 1OIWA 3KPVA 4P4GA 1CBUA 4FIZA 2EZTA 4B6SA 2BCEA 3EAGA 3K53A 3K6SB 1MJNA 4H16A 5FKJA 1ADFA 4DSAA 2HJVA 1Z5ZA 3DF9A 2JKZA 3G68A 3KJQA 4QLAA 1NXOA 3OJWA 2R8YA 2X5KO 5ECGC 3CR7A 1G3RA 4LXIA 1BWSA 4G9BA 3TBKA 1NW9B 2PD4A 2R6AA 5K8CA 4TTTS 2C00A 1V8BA 3FNQA 1VHJA 1YKSA 4AJPA 5CDSA 3KQOA 1TTTA 4E46A 4YRGA 3DOHA 2FETA 2JGDB 2PA3A 3PNMA 4U1RA 1JLLA 5CRIA 4B32A 2O2EA 2JCXA 4HCJA 1MOQA 3R3UA 4G5GA 5JARA 3AONB 4AY4A 3DBIA 1Z4KA 2DECA 2GPSA 3RPEA 5FLEX 1H5NA 2R79A 2FSSA 3PC7A 1ZD8A 4ZZ2A 4HFJA 1KR2A 3AJ8A 3PQ3A 4NPAA 1WB9A 2HDHA 4PLHA 1QMPA 2P9CA 4LWQA 3DEZA 1OJ7A 1GHTA 2C8KA 3C87A 3R6LA 3SR0A 4X63A 3JWHA 2AEEA 1YZKA 4C0WA 2O50A 4WVLA 5EYPB 5A3RA 3TQRA 1XXLA 5I7SA 1YONA 1JPVA 2DBVO 4L5IA 1W6UA 4BKPA 4F5ZA 4CETA 1CYDA 3VJKA 1NUQA 5KWJA 3MIIA 5KNDA 5ECWA 3HWX1 3WNBA 4HNHA 3L46A 3ZVRA 3HB9A 2X15A 4BNWA 5EP1A 4IKPA 4B83A 1SXQA 1OZAA 6REQB 5JXJA 2WLTA 3KAJA 1WU8A 4YHBA 4MWOA 5TY0A 1E1LA 2O1EA 1CEEA 3TW4A 3CZRA 4J1SA 1WXDA 2VAXA 3LDGA 4V0NA 1XLUA 1XTJA 4RD6A 5JO9A 3S81A 3PNOA 3HZOA 5KDOA 4QM7A 2X5NA 4QGHA 1RHQA 1TD9A 5A0VA 1IPHA 3ESQA 1NJGA 4O02B 3OX1A 1HYQA 1UJMA 2ZTUA 3CF0A 4FDUA 4R6XA 3K6SA 1Z63A 2VHYA 2O7QA 3R24A 2HWWA 5HCUA 1MMFB 1RAAA 1W0JA 2EL7A 1U9JA 3FMOB 1YDGA 5DLEA 3GO4A 1V1RB 1HM5A 4P7JA 2V97A 4B80A 1C0EA 4TKVB 4NV1A 1Y82A 3PF8A 1TVMA 2PCLA 1EBBA 3DW1X 2KSQA 2QX7A 1BHSA 2WYIA 3DUFB 4X7PA 5DTMA 4IIJB 2YWFA 1RYHA 2JGDA 4IFTA 3VR5D 2RGRA 4LFAB 3VZRA 1BROA 2B4TO 3QQPA 4DVJA 4PBSA 1UBSB 4XWOA 1G18A 3L79A 2PGAA 5BYJA 4IDOA 4B4DA 4AQ7A 2VLBA 1RC8A 2YZNA 1X7ZB 1DMRA 2CXTA 3OE4A 4Z6KA 4O08A 1ZM9A 4N40A 3PKZA 2VDWA 3WKAA 4AZVA 1CY2A 1GTJ1 3QJYA 4YJGB 3VO9A 1QP4A 2O6HA 3ABQB 3PI6A 4ZDKA 5ICSA 4ETMA 2BP7B 1S6YA 2XDQA 3RVJA 3ZDEA 2YUIA 2CEAA 2WUWE 3OY2A 5EYPA 3EX7C 4EYKA 2JIQA 4X61A 4EHFA 3U7EB 4F85A 1QG6A 3GLSA 3FHLA 5EKSA 5LB2A 1GKKA 3UWMA 1VCMA 2FB9A 3FLAA 3NHZA 4QX6A 3RSFA 4EFLA 4DV0B 4C2UA 3BJRA 6REQA 4HKTA 3T5BA 3HB7A 4R2JA 3YASA 1KH2A 4OP2A 2XA1A 3OOYA 1H4TA 2DHEA 2HMWA 1SBQA 3ISJA 4TPKA 5EKUA 1VTKA 5HF5A 3W2EA 4ZJUA 1LRJA 2O19A 3BX1A 4ZPJA 4C2TA 1XRLA 4HAUA 1W48A 2JJ1D 1DUIA 3WRXA 2BKLA 1YQTA 3LBFA 2EV9A 4A1FA 3H9CA 5BRJA 3ZHBA 1CZUA 2XV1A 3TMAA 4AVYA 2BMFA 4A8JC 4HQ0A 4P34A 1V1RA 4KLAA 4TKVA 5FP0A 1A77A 3W4JA 2PCJA 5HJ7A 4W5TA 3EG9B 4WHMA 1WW2A 3GT4A 4QOSA 5CX1B 2XGJA 1YBFA 3O5AA 2ICAA 1ZC4A 4M46A 4NE2A 3UUWA 1VJCA 1S2GA 3TLGB 1SZDA 1YMQA 3A6JA 3SHQA 3WLLA 1I7DA 4MGZR 4G0OA 5KYYB 1MZVA 3PUXA 2DQSA 2Y1WA 1GQOA 1XN1A 2IEGA 3HQ4O 1X7ZA 4JEHA 1ECJA 1P0IA 1QOPB 1U0RA 1VL0A 2FPPB 4PR3A 1A1VA 4URVR 1B8OA 2W70A 4KZKA 4O6VA 4YJGA 1RXIA 3B52X 1MB4A 5ERXA 1VIAA 2C9MA 1Y1LA 4JR2A 4Y9UA 2H5JA 1V4VA 5KX5B 2Q3FA 4YQZA 2BP7A 2AMJA 5DWVA 1OZGA 1EKXA 2QJOA 3RAEC 1MVLA 4RV5A 1GRVA 4G5QA 1UMCB 3SHFA 1QQBA 1VE5A 1Q92A 2AOXA 2AR7A 1F2UB 3ND7A 5HW0A 2IVZA 5CNJA 4H31A 2FZ5A 5FLKA 2CLOB 1LBTA 4ND8B 3SSMA 5F78A 5F77A 1OUMA 1DG9A 2OCGA 1Z0AA 4J8PA 4ZQCB 2Z5GA 3TBHA 2CSUA 1KI4A 3BK2A 2QNBA 1U2GA 4CCSA 5DU2A 1UJCA 5ABPA 3K1TA 5C8XA 4AZ3A 3OI7A 1TUBA 3O1IC 4PXYA 5I7WA 2H8GA 2IPLA 4LMRA 5GONF 3MLAA 3U40A 3CZAA 1CRQA 5E6RB 1QYIA 2FUNB 4S1OA 1VCOA 5FI3A 3C3JA 1T35A 1YB7A 4HDSB 1RWVA 1NBOA 2YJZA 4WLOA 1DAMA 3TCXB 4RK0A 3CLSC 4DLNA 2DGDA 4GOLD 4C7BA 1C5KA 4EAAA 1V5FA 1QU3A 3GFBA 2CK3A 1QYRA 4C04A 1X8KA 3DZHA 1RKVA 1Z7GA 3RSLA 2JLVA 2AYXA 4IILA 4BP9A 1FRFS 1QGOA 3I1IA 2AC4A 3EG9A 2Q27A 5B6JA 2EHDA 2FSVA 4PPNA 4B3SB 1DQZA 1XCJA 1WPGA 3TLGA 4AJOA 4CXMA 3QHQA 2BEKA 5L53A 3T7RA 1TM4E 2H5EA 5HBGA 2Q99A 2VSNA 3DS8A 3T9FA 5KYYA 3F49S 3VU8A 1RPZA 3FMPB 1H8HA 3FW1A 4JI1B 5BNZA 1HFKA 3N2EA 3VHRA 3QFFA 4AURA 3I5YA 2Z5VA 3CT6A 2VK2A 3FJ1A 5KYTA 3FHCB 1S9HA 3LQYA 3JQQA 2OG2A 5FPHA 4KLNA 2VOEA 3R9XA 5LNK1 2JGFA 2X14A 4RX1A 3S2SA 1UMCA 4DF3A 1BA2A 1IB0A 1RJ9B 2C2OA 1F2UA 3MJDA 4YJHA 3OMWA 1N2GA 3E9YA 3NC0C 1V8ZA 2I3ZA 2WD9A 3M70A 3S2UA 1RSZA 1A9PA 2BJHA 2QPLA 3CA8A 4RETA 3ZV7A 1DTSA 4KG7A 2C2HA 4OBEA 3DPIA 4RY2A 3X1XA 3ZCQA 2N3ZA 2IXFA 1ZCFA 4J7AA 3A2NA 4CLDA 1M5RA 5DYWA 4MVYA 1DKPA 2XXJA 3D1LA 5DYIA 2ZBDA 1ORWA 2J0SA 5J9FA 5G41A 1SHJA 2DUNA 3P9ZA 1NUAA 2NUTB 2VJMB 4G0PA 3RVLA 4E11A 4HN9A 5HF9A 1J56A 5E6RA 3V4VB 4WW0A 2VDNB 3A1CA 5IK2A 2G72A 3T4XA 3DE6X 1HO3A 4URYR 2ID7A 4BMVA 5KWSA 1L5VA 2Y76A 3TD6A 1V5WA 2HREA 2G5PA 3PC3A 4NLLA 5A4DA 4GQAA 2I1WA 3OQHA 4KN6A 1AN0A 3HKEB 5AM2A 2BMEA 4NFYA 5HOQA 2B1JA 2QVCA 3LL7A 3T9DA 1R5BA 5F9MA 3O31A 4HJXA 1J70A 1Q91A 3WL6A 3BF8A 3W5AA 2GASA 3SE0A 3M9XA 1R66A 4CE6A 2VOJA 1RWKA 4GICA 2ORWA 1OXVA 2OGZA 4JJ4A 1T4GA 5HYVA 1NKTA 3GUZA 1BFKA 1P4HA 1M2GA 5D87A 5SV2A 2IP4A 2OV4A 5A4MS 4MK4A 4BBZA 3HUTA 4G8CA 4N5LA 2WKSA 4DIMA 5EFZA 4EW1A 2XVYA 2WDPA 1RQGA 5BQPA 1ZUD1 4W5WA 1SC1A 3FLBA 3HJGA 3BG5A 4RM3A 3KKKA 3ASVA 4LBVA 4BLWA 3PEFA 1RJ9A 3IQZA 2G0NA 3ABSB 4IM7A 4BPBA 4OFBA 2RC6A 3KJZA 3IDQA 2AG5A 3ISTA 4GOJA 4JZKA 4P7FA 1XWFA 3PQ4A 3B7WA 4RVFA 4XYEA 4N7JA 3DLBA 2W6ZA 4Q1FA 4YUWA 1SKYE 2XLBA 3MGAA 3QV2A 2V1XA 1QHXA 1GADO 1I3LA 4FJ2A 4WOKA 2FQXA 5K3BA 5I7FA 1O0BA 3OT1B 1SUSA 1Z37A 8ADHA 1TT5A 2XRMA 5ADVA 4ZAYA 4D3XA 1EYZA 2IYTA 3FUTA 4YCAA 1FFXB 1GZUA 1H3FA 5IBPA 1QVRA 2AWOA 3D8HA 3F74A 4IJWA 4C6RA 1DKQA 3SU8A 2GZSA 1MOSA 3F3YA 4LOLA 1Z33A 4QDXA 1BO6A 1E2MA 3IT1A 3BFJA 5ETJA 4GOOD 5KKAA 1X74A 3UW1A 1D6JA 4BNUA 3QBEA 4HB4A 2H3HA 1JKMA 4Q4AB 5FULA 2QYSA 4XA8A 4BNKA 2NVUB 4CM4B 1U0OC 4QBKA 4LYHA 5T4FA 4LV6A 1NTOA 3WWYA 3MLEA 5BOSA 5DI9A 3HKEA 1EEHA 1F2TA 4O1IA 4DLRA 5CB0A 3SDSA 4NENA 1H69A 1T3SA 4F4FA 5C32A 3CUYA 4R1MA 4ZQIA 3ED5A 3BZUA 3RHFA 1HEYA 1T8WA 2DUMA 1VSBA 1XTUA 3RVKA 2D0OB 3EXIB 7ADHA 1RXCA 2M6SA 4WFQA 1Y33E 5F35A 3RBXA 1YFKA 1OKKD 4PLGA 2ZWVA 3R8XA 4JCOA 1NMXA 2CFIA 4B8YA 5AVXA 3AOEC 2R9VA 3M3PA 1SPBS 3QU9A 3OPXA 3RUPA 2YZ7A 5A7GA 1QV9A 4TL9A 5JCJD 1UXIA 4I1VA 2RBGA 1Z0SA 1KERA 2ZT8A 4IUYA 1M2NA 4OSPA 4TYPA 2YMMA 4E2ZA 4HATA 4QXAA 3WXMA 2DHRA 1DX9A 1NW5A 3UOAB 4Z2AA 1UXGA 1E3LA 3UHAA 2FMKA 5KVCA 4XEUA 3RWMB 3VTKA 4OAQA 2ZI6A 3W6NA 2HLDA 2PAFA 3TLCA 2AJLI 4B48A 3DLCA 2ZRLA 3EGDA 4BC0A 4DIEA 1JDJA 3T9CA 1K97A 2GDZA 3OT1A 4RHUA 2Q1UA 4Y2HA 4BQQA 4EUKA 1O7JA 1BAPA 3AFHA 2G4LA 4PYIA 3Q2KA 4CF6A 5JC8A 4YYEA 1H1LB 3GLGB 3PUJA 4IIEA 1FFXA 3OAAD 2LIPA 1B73A 2D5CA 2POQX 1IN1A 3LGXA 2VAWA 4K0RA 3WGHA 1G42A 5JJLA 4XJSA 1GPH1 1RRMA 3O92A 4I1OA 4NRDA 4M9ZA 4Q4AA 4YS6A 2G9VA 1VHDA 4K28A 3E5MA 4R0MA 2MOKA 2EJBA 4UPDA 4CM4A 5EJ5A 3LFUA 1YZUA 1RC0A 1FXWA 2IYZA 3JD3A 1P2FA 4BBJA 4EW6A 1ZVMA 2QJTA 2BGNA 5C5EA 1K27A 3HXKA 1NXSA 2J5XA 4HQNA 1G60A 5H59A 5DHQA 3TTSA 4N47A 1ZEMA 1Z0ZA 3LC2O 4WPGA 1YAJA 3KZXA 2YNMD 3LNCA 3EXIA 4KU4A 4LZWA 2POCA 3DLTA 2RHCA 1WY7A 3HO8A 3VNSA 1LNSA 1ISMA 3AJ9A 3BE8A 2IF2A 4LN1A 1MX9A 1EWVA 2G8LA 2VR1A 4TWJA 2HMUA 5J5VA 3TRDA 5BR7A 4U7DA 1XMPA 4QVGA 2R6CA 4KXLA 1AK9A 1FUEA 3V1UA 1E1QD 2Q3DA 4H7PA 3M6AA 4MEJA 1HEUA 2R8BA 3D6TB 3N7UA 3OOHA 5GJVC 1O6GA 4YUAA 1LPNA 4R2LA 4G4SO 2REOA 4D99A 4PTYA 2UUBB 3IX7A 1MVNA 2P6OA 3V4ZA 1WXHA 1YIAA 4B6PA 1MNQA 1MTZA 3DMFA 3NWOA 1Z8DA 2FN8A 5JCZA 2AXEA 4MRNA 4AJ2A 1FSZA 4BGUA 3FB4A 3KL2A 3OU6A 2JLCA 3COYA 4DCGA 1VMKA 4G5SA 4GMXA 2IYRA 1JYFA 4Z9YA 2F3UA 1ZGZA 2H06A 3KD2A 4I1IA 4RVHA 5H68A 4HX9A 4DIDA 3HXMA 3G88A 2Z9BA 1LA2A 1Z62A 2ZVJA 1R74A 3AVXA 3SOZA 2KWIA 3TVYA 3QOWA 1XWWA 2ZREA 4MA5A 3EUAA 3KEFA 3CG4A 1D2NA 2QDKA 4LHSA 3DHEA 3W06A 4EDFA 4JB2A 5TT1A 5E3IA 4IX9A 4BNTA 1JDUA 4R3NA 1MTOA 2AI1A 4UVGA 4E5KA 1GVHA 1A76A 4YJ3B 4H1UA 4I99A 2GBFA 5DN6A 1YI8A 3PWKA 1JHMA 2ONYA 4PRLA 4CG1A 5AOAA 4HFMA 3OM9A 3QFSA 1PFKA 2Z4RA 2FQYA 3WLSA 5BW5A 1CDDA 4FC7A 4WKNA 1ISRA 2C8VA 1KMHB 2HRRA 4NMWA 2AMYA 5IM5A 4BKOA 1Q6ZA 2EL9A 3ACCA 2P9BA 3JD1A 5GM1A 2G70A 1CUDA 2HPHA 2Q29A 1Y48E 2CZCA 4J7CA 1WE2A 2FWJA 4OH1A 1OXTA 2PV7A 3L3BA 5KCZA 4FI3F 1J09A 4IOLA 3LDAA 4AJ4A 5KDDA 3GLFA 4EJMA 2HT1A 1WLSA 4TYYA 4JYPA 4P4UA 4B3DA 3ZOKA 2V7TA 1PGJA 2EEPA 4WJKB 3GRUA 3LWBA 2VEDA 1F0NA 1NN1A 4W5NA 2RK6A 1G7SA 2QD5A 2YYYA 1P4AA 2ZBEA 3EIHA 5E7MA 3X1KA 2JDIA 2FPUA 1KIMA 1MC1A 1W6RA 2AMVA 3ZKWB 4H1HA 4FS8A 4UTPA 3DDOA 1XCOA 1EK5A 4OB8A 1KTVA 2YFKA 4N7RA 2GXUA 1Z6QA 2HL6A 4UFNA 3W7AA 5JFGA 3D5EA 1FTWA 2GJAA 4UREA 2GZDA 1BEZA 1Y1SA 1QNLA 2H4HA 3RS4A 3BWXA 5AHKA 2ZJFA 4HQKA 4KH0A 5TEWA 1JX6A 4EF6A 3W78A 2Y92A 3C45A 1Z8FA 5D7NA 3KQMA 3RYIA 4AB1A 1QHFA 3IV9A 3AM1A 5BR4A 3NX4A 4MKGA 1RAEA 3OO0A 1J42A 1B16A 2JA1A 1HETA 1AXGA 3H2GA 4FDAA 4IPTA 1AS3A 1U8UA 1XOIA 2PGNA 3NCHA 5F33A 1J8QA 3HCNA 3EOZA 1ML3A 1E5TA 3KKQA 2GPTA 3EZ6A 1C7EA 1GYPA 1P0MA 2P2YA 3BS4A 3LRTA 3Q3HA 5A3VA 3U81A 4DLAA 4HNGA 1KWGA 3G8YA 4CNQA 4L8YA 2BKAA 1Q2XA 3ETHA 4IDFA 4Q05A 3K73O 5I7HA 1O5IA 1KMHA 2Q1SA 4IV0A 1U7OA 3LDFA 4JVOA 3PS9A 1VJRA 1V8OA 3DTVA 1E4EB 2YWXA 1E8NA 3MHPA 1SXIA 3H1BA 2VHXA 5ANRB 3TSZA 5I3ZA 1JQBA 1WDKA 3MWLA 4HEQA 2VHZA 3NIGB 3R6WA 5AXAA 1M73E 1YR8A 4HAOA 1P1FA 2M9MA 3K8YA 4PLWA 4RXUA 4F56A 4MV5A 4F6RB 4F2DA 5BSGA 1ISGA 3HR4A 1FDIA 2AN5A 3OTGA 4Q9IA 1QTQA 1ZVKA 2P30A 4MYRA 5JD5A 3GCGA 4L5CA 4RF3A 3K4PA 1YDMA 3O83A 4X1YA 1SURA 3D3JA 1HDGO 1F8YA 1U31A 3F67A 1T5LA 5JQWA 3GV0A 4QRDA 1S8OA 2JK1A 2NNWB 3DGEC 4TVSA 4UTZA 4V38A 5F3WB 3ZKWA 4HBZA 1DQYA 1Q0UA 4IWYA 5CFQA 4KE6A 2KBFA 1Z68A 2CNDA 2Q7OE 3UC9A 4QNNA 4FBLA 3WBFA 3TVDA 4Q4LA 4E1BA 3N75A 3ZJTA 4D98A 1HT0A 1JAZA 4MUIA 4CGZA 3B3QA 5LUBA 1JA1A 3BEOA 1O89A 5T57A 1D0IA 2FDRA 5BYBA 5BMVF 1CEXA 2BFPA 2OOKA 3H1PA 5F1YA 1O94D 4OQYA 3UENA 2IBSA 2BLLA 1FDWA 5CEEA 1N25A 3BXEA 1EFPB 4L22A 4RZUA 1NL3A 2WZQA 1S8NA 1P2TA 3FNIA 3Q9SA 5DIFA 4F92B 4ZQGA 3FDIA 3KHKA 4C4TA 4FDMA 3V33A 3ITKA 1C0PA 1GD1O 2HLPA 2XW6A 4UPEA 2I8AA 4WOJA 3D8TA 1JIVA 1IAVA 1S7GA 5EIBC 1SU4A 1FXWF 2L19A 3Q1LA 2DQYA 3BF7A 2IS1A 3G8DA 2EXXA 1FX1A 2IEAA 4LBZA 2XE7A 2C5SA 4BN0A 1FRNA 3LX8A 3ASYA 1PU2A 3GUVA 4R2MA 4J3JA 1SVNA 2XGGA 4YIKA 2GCPA 2XQKA 3SMVA 1LBSA 2QR5A 4DMRA 3NM5A 4R84A 3HO1A 1E4EA 4AS3A 3GEEA 3C5WP 1ZGAA 2E5LB 5HTOA 1XJQA 2X9GA 3L4BA 1AXRA 4EKEA 3DAYA 2R87A 2HU7A 2OCYC 1JIKA 4PW0A 3N0WA 1SKUA 4BX9A 5AVWA 2IEIA 4KOEC 5DBIA 4MDYA 5BN4A 4HNSA 3AR6A 3RSQA 4KXNA 2DG2A 1Z5WA 2XR1A 3DWGA 2ZIXB 4II3A 4CQNA 4YA6A 3FTNA 2OCKA 3GGPA 3BTOA 3QZUA 1K3TA 4AJLA 1USUA 3S4YA 2X1MA 5JALA 4RDHA 1PT7A 3K9QO 3A2KA 3I2FA 2R7AA 2DUUA 3VC1A 3HA3A 1N2IA 4TSRA 4ROTA 2IYAA 3MCTA 2V6IA 4YRTA 1E60A 4MICA 3ZY5A 5F9FA 5J4LA 2FRDC 2HK6A 3A11A 1A27A 4EKGA 3LKDA 1NSTA 1W4RA 1WXIA 4DGQA 2A9JA 3CX6A 1I7QB 4OI2A 3OJ0A 3DFUA 4QXMA 1Y7LA 1MJ5A 2E5WA 3D7LA 4LGVA 2IY9A 2XQJA 4LVUA 4ZCPA 1EFPA 3QF4A 1U0JA 2QW1A 1XFAA 1I32A 4EY6A 2XPCA 4X8LA 4C4PA 2OORC 3QI2A 3DZDA 3CTMA 3VPXA 4TV8F 2HWYA 4KNVA 5DYGA 3T3DA 3QVSA 5U4QA 1DO0A 4BEWA 1OQAA 4W82A 4G2NA 5KJ1A 221PA 1U8FO 4IIVA 4N8EA 5ALWA 3TRHA 1R5NA 2VAMA 2CNBA 1JEEA 3HP1A 3FR8A 2ZI3A 1S7CA 2ZB7A 4F06A 4REOA 3RRYA 3G5MA 3KSMA 2XWQA 1E7SA 4N5DA 3UJNA 2EGHA 3K72B 4B73A 1PR6A 3VZDA 1ZM3A 3NBXX 1ZLXA 3COWA 2H92A 1H1DA 1UKCA 5ALGA 1APBA 3F47A 3G0DA 3VSCA 4X44A 2PLNA 5D5PA 1YIDA 4QZVA 4PAWA 1PDOA 3IT0A 4OHKA 1RLMA 3OO1A 2ZIXA 3C4VA 4M1MA 1F8FA 3GWZA 5F52A 1R3DA 3K9GA 4OHWA 2AYZA 1SCIA 1QAQA 4INPA 3CVVA 1GXSB 4QOIA 2P78A 1BCRB 1X1TA 4CQLB 3II6X 2PR7A 4FYXA 3I37X 4YRJA 1L1RA 1E6EA 4L5BA 4LJSA 3TGPA 5LD2C 4A15A 1TLTA 1U2ZA 1SUFA 4ZOQI 1M2VB 5BSFA 3AUXA 2A14A 4CCWA 2YV4A 3EVCA 1C8KA 3AFOA 3D2LA 3R6GA 4ARVA 2PYDA 2XLCA 3EGXA 4UAGA 3ZCSA 4PYRA 1PL0A 2Z09A 2FR8A 5CXUA 3P71T 3DYVA 3OCVA 4CKEB 2HIAA 4QG7A 1SVSA 3RJ5A 2QM7A 3TYXA 3GR6A 5A1JA 2OWEA 4EJ2A 4Y1FA 2A3NA 4FZVA 3VR0A 2O54A 1JS1X 4GWLA 2J08A 4RQBA 1W35A 2XF8A 2ZB3A 3QLEA 2JZNA 1RCUA 2YZMA 2K2QB 2XY4A 4M9SA 1VYVA 5M7EA 2R8XA 3FN4A 1IHDA 4KTTE 5C53B 3GCDA 1NMSA 3GY0A 1RU3A 4TL8A 2SECE 5TMPA 1GPNA 1Z22A 5IJ9B 1SCQA 3M9LA 1HDIA 1X0XA 3ZNNA 1WTAA 4YB8A 5EUMA 2P2NA 3RREA 3A0UA 5D5QA 2Q46A 1B0UA 4QSMA 5JBQA 1ABEA 1IMOA 2H2FA 1EBFA 3AB3A 4HH3C 3RWBA 3C5VA 4RVCA 4KRFA 2OP0A 3UGJA 1GTSA 4CV3A 3DZJA 2A0YA 4XJVA 1JEOA 4WZBA 2JHFA 4RZXA 2GO7A 2ZJ0A 3WAKA 9LDTA 2HK9A 2QRVB 2PX0A 1L2TA 2JLQA 4D3YA 4MP8A 1Z0IA 5GJCA 5JIBA 2VH5R 3A9TA 3FMFA 2QAGC 5CBPA 5JS2A 1NXXA 6YASA 2I22A 1GXSA 4U2KA 5AJHA 1BCRA 4CQLA 4IDBA 4OYYA 4C30A 5EFOA 2X1LA 4JLAA 3E4DA 2RKOA 1D1QA 4PHCA 4WZZA 1M2VA 3A4YA 2PMWB 4LYYA 2R0QC 1O9HA 2EJCA 2OBMA 1E2EA 2I6XA 3ERCA 3HBNA 1MN6A 2CSXA 2J9FB 3MHTA 3OFNA 2UZ4A 3Q7SA 2XBMA 4NBWA 3L8EA 1GPWB 1KQOA 1II8B 3F6YA 1AE1A 4CKEA 3KR9A 1SD5A 1P4SA 1KIFA 2ZCVA 4H1TA 1YJ5A 2QTGA 4GF5A 5FUQA 1CY1A 5HZGA 5AK3A 4PO8A 1RYYA 4E03A 3ZU3A 3NAZA 1FDRA 4Q9NA 4OXRA 3BCSA 3FH0A 4ZO9A 5J4VA 1KIAA 2X0EA 3FZNA 4NCJA 1KXZA 1W59A 2A5FA 4RJTA 5AVTA 4BO6A 1KWKA 2G1JA 3K2QA 5IJ9A 3S44A 1IN7A 2I9KA 1CZLA 3ZGOA 1HRKA 2XEDA 1H3NA 2QORA 2QMEA 5CH5A 4X6XA 4DRXB 5L7WA 1JF8A 2NXNA 4AS2A 4YALA 2HR1A 4PNEA 5IP5A 4GLJA 1W36B 1MW9X 1YHYA 1HPLA 3WYFA 3HA2A 4HQLA 1GZ6A 1R37A 1IZ8A 4EBBA 4G3XA 3G85A 1NJ1A 2CXSA 4LRXA 1VA5A 2QRVA 3P7MA 4CQMB 2AI3A 4XUGB 4KRYA 4DR3B 1SU7A 4OUDB 1OT5A 1XMOB 3L1KA 1DU4A 5TPZD 3B1ZA 3DWIA 4Z7OB 3NKVA 2V7BA 3DLAA 3ZHXA 5JFOA 2NPIA 3P2OA 3BGOS 4MR9B 1SUDA 5C3MA 3GJZA 4MNTA 1T5DX 1L5HB 4OKNA 5KEIA 3WWZA 3NC1C 2JLXA 2ZUFA 3RVRA 5KNCD 2Z08A 5CLHA 4Q34A 1ODKA 1MJHA 2HZBA 2XUKA 5E1MA 3AR5A 3PHCA 4HP8A 1QIGA 4UM8B 3VISA 2Y99A 3CRQA 5K0FA 3QHAA 1QRUA 3TG2A 3BWDD 1RLUA 2A0FA 5BSVA 4FFSA 4WK6A 2W2NA 3FETA 4F71A 1ODLA 3C5EA 3CKMA 3NM4A 3V2GA 4UNRA 4BBPA 4EQ6A 1ZH4A 3ZEIA 2Z2XA 4ZZ0A 3OIDA 2C2GA 1QWOA 1XT6A 1XMJA 2I7XA 4UD6A 1T8TA 5F3DA 1NPTO 1YHZA 3WP1B 2ZUDA 1QUEA 4TMWA 2EG9A 5CVDA 4ICIA 4QU9A 3L7BA 1WX1A 1TJ3A 3M5PA 5BVGB 4B3XA 2H63A 5FHQA 5KHLB 3ZKAA 4DRXA 2W2XA 4GT1A 3IRVA 4F4CA 4Y2GA 4TTVA 2IH2A 3DXXA 1A04A 1EGHA 1FW8A 2XWSA 1HG0A 2ZRIA 3IUMA 9LDBA 3QPCA 4U63A 4F11A 3K16A 3OLQA 2VHQA 1N5KA 3U62A 4GMDA 5EHQA 5GZ6A 4CQMA 5IFLA 2Y66A 1T0JB 4M9QA 2CNLA 4OUDA 1NVUQ 3Q7RA 4IS3A 3AHHA 4IMJB 5KHAA 3NB0A 3A1DA 1PS0A 2R6JA 1B15A 4MR9A 3OOEA 3VAAA 421PA 4GDMA 3WQSB 5LWQA 4ARIA 1DC4A 1F5NA 2UXDB 1BHQ1 1ZIOA 2ZYSA 4ARZB 3V4SA 2JD1A 2E4AA 3JV7A 3U4CA 1TRKA 4LQCA 1U7HA 1XF9A 4A0RA 4LRSB 4WXYB 3O0TA 4IH1A 5TQVA 4DTIA 3H9QA 4MLCA 4X1IA 2NP6A 1QRDA 2AZTA 2Y0DA 4F5EA 2PTGA 3L18A 4LMPA 3VO1A 1C9YA 4ALLA 4KFCA 2IV7A 1R0CA 2K4MA 4AWBA 4O3MA 3E61A 4MHTA 4NMXB 1G17A 5DI3B 1TK9A 1Z2EA 2VUTA 2F62A 5JAOA 3GRPA 4D44A 3PG5A 1IJKA 2OP1A 3UWPA 4K6GA 3GZTB 2L2QA 2O48X 3VKWA 5BVGA 2G7MC 1OXSC 3M6XA 3MERA 4W5QA 2W0MA 3OCYA 1ZJWA 2CXQA 1VBNA 2CVZA 3V8RA 1RWNA 1WF6A 4P3YA 4QLBA 3KM0A 4XSVA 1Q20A 1P7YA 1B76A 5DKFA 1UT6A 2DLNA 2NQTA 3FFBA 3NAMA 2C61A 5B3AA 2G9NA 3U49A 3WWCA 1NRIA 5KYNA 4MAMA 5JBIA 2YJ3A 3LX4A 2ISQA 4NL4H 3A28A 1R5OA 4BYGA 5H9WA 1W34A 1LU9A 1COWA 1L4BA 1GSHA 1S8FA 1P81A 2O2GA 2QMQA 1QX3A 3LZ6A 2Q1TA 3QFCA 4L0MA 4LPKA 3KTDA 3WQQA 3ADKA 3AVYA 1LEHA 1NMEA 5K0SA 1NY6A 1J9GA 4GZ6A 4DQUA 1DWPA 1EK1A 1HSOA 4EHJA 3CLUD 3K5HA 1QGED 1JZQA 5IU6A 2HM7A 1WPRA 3TI7A 4B6EA 4IOJA 1AB5A 1P91A 2SKCA 3C7TA 3Q9UA 1RZUA 4MYSA 4D3ZA 3SXUB 1KC3A 2OGWA 2I6SA 4ARZA 3D9QX 5AI4A 1GAWA 2WF6A 3A7EA 3LZDA 1R8QA 4KAXA 4BWFB 3EEOA 4M54A 1JDTA 1ZNZA 4NG5A 1YRQA 1PTJC 2PO5A 1F06A 2ZU6A 4GH5A 4FD3A 3UK1A 4TS3A 2YYAA 2GN9A 3O7WA 5HTKA 4EUHA 2H1VA 4GHWA 3VUFA 1CVIA 3OBIA 4KGZA 1L7AA 3IBSA 4BATA 4ML3A 3VSEA 4NNPA 4BU0A 3KOUA 3F2VA 3V7NA 1BVYF 2MMGA 3OHPA 5DI3A 3UICA 1EXNA 4LZJA 2M32A 3AF0A 1UBHS 3H1GA 3EVTA 2YR0A 1QJ4A 3PUVA 4F1JA 1QIKA 3L0IB 3JVDA 5C8ZA 5DK6A 1QHHB 3OEWA 1P80A 3EBOA 3ILSA 3G2HA 4DAEA 1RZ3A 1WQ3A 4UZFA 2IZZA 3S2YA 2B5VA 3A4TA 2BOVA 4Z0PA 1K5GA 1BKSB 2E55A 4QUIA 3TRIA 5DASA 1QTIA 4RPGA 3AM3A 5DEOA 4DT1B 4I2VA 4O2BB 1CJBA 1QG2A 2XQGA 1KK2A 3ZDAA 4AMUA 1TQHA 4JSTA 4U6NA 2JA2A 1QHNA 1HXHA 2JZOA 4MHOA 4E5MA 4PLTA 3O4FA 2WWFA 1JT9A 2ARKA 3WDMA 4KCGA 1JXMA 3ZDQA 2P35A 1VYUA 3CRRA 3K70D 1J0XO 3H11B 4WACA 3PJEA 1BEUB 1XQWA 2ERYA 4AUMA 4OA5A 4FFMA 3T7TA 3KJNA 5DGIA 2YVUA 3Q5EA 1TVKB 1TQDA 4YN3A 2HXGA 2QRJA 1LDYA 3DDHA 3BBLA 5C9ZA 2IYUA 2DY1A 3GEHA 3QYFA 3PC8A 1EJ6A 1XZIA 4DSNA 3VZPA 2A6PA 1GPYA 3LY5A 4IY1A 2AG0A 1DOHA 1G9TA 1MG5A 3BL8A 3G17A 3H65A 3M3DA 1FSPA 1EUDB 2QD1A 3U9SA 2XNDD 1VE9A 3D6UA 3PGLA 3Q0IA 4FSDA 3TDNA 3AV0B 3A6EA 4XUDA 5A3SA 4F7WA 3T4UA 5B64A 1R4MB 4XQ9A 1N4AA 1VMIA 3VBCA 4E13A 4GEGA 4CTOA 2Z56A 4HNVA 3SZRA 4DLYA 2VWQA 2ZVQX 4OB6A 4NC9A 4EB8A 3QBTA 4CHGA 1KO8A 1C9KA 2RI0A 3MCZA 1WU7A 3AEYA 1V4BA 3FYTA 4C05A 2C3MA 3PT5A 4KPEC 1NATA 2B2NA 2EQAA 3EPRA 3D81A 1QHHA 2XE4A 5IUJC 4D3FA 1N8TA 2HJSA 3E3AA 1R16A 1ZD2P 4TUYB 5EIHA 4LF7B 1EVJA 1IATA 1JEJA 2NADA 4XM0A 5AVUA 4LDJA 3P9KA 4KQJA 4JP1A 1WSWA 1ZXBA 2EWMA 4AP6A 1S4MA 2B94A 1J33A 1VE7A 1B6GA 3KEGA 4DT1A 5JSHA 2NZ8A 1Y3DE 1T8UA 3IMEA 3X3HA 4BFYA 2ALJA 2I3BA 3F5DA 3GIDA 2P75A 3KLPX 3ZGZA 2IKQA 5IJXA 3IDSA 2GPYA 2VP9A 3PD0A 4RXTA 2P3SA 4J1TC 5IM4A 1YJAA 4EHAA 4AF8A 5FWXB 2YQ4A 1QDEA 2W6CX 1P2SA 1TVKA 2W48A 3DL7A 2ADFA 3RKUA 5CGZA 2Z0MA 3A6DA 2EERA 1C0IA 3CO0S 3QY9A 1GEGA 5IBCA 1MZPA 3HB5X 1LPOA 2H0AA 2WFAA 4RIEA 5AYVA 2M6KA 5LQDA 2OBYA 3H6HA 3IVGA 4DWVA 3O8OB 4BQSA 4MW6A 3PITA 1HYHA 3SYRA 1F9EA 4BNZA 2Y93A 5LVAA 2WNHA 3HYRA 4Q93A 2PPLA 2R97A 2GZ2A 1R4MA 4HH4A 7YASA 4J0GA 2VH2A 5JFTA 3OZVA 2ZE7A 4J7UA 2CGEA 1T25A 3R5FA 1Z5VA 2C2YA 3GPIA 3KFVA 3CGWA 3CPJB 1L7PA 3H42B 4DQDA 4RWEA 1GDHA 3E8MA 1E6CA 3Q10A 4RADA 1E8MA 3M82A 4WZBE 2EP7A 1O54A 1EGVB 1T1RA 2VBCA 5EVJA 1JJBA 1BE1A 2A1IA 2Z1DA 3RB8A 3ZE7A 4BTVA 1ISIA 4PAOA 4B2YA 2VQEB 4CKYA 3CVOA 1N2JA 2O2JA 2VTKA 3D5TA 3D6JA 4KO1S 1UPAA 1XU4A 3MWFA 3ONWA 1L4YA 3Q87B 3E0XA 3QLJA 3QUTA 1U0GA 3URKA 1M54A 2PS3A 2QSJA 4MUYA 2VZEA 1EVYA 2A4MA 1P1BA 4M1QA 1RQ7A 3CY6A 3NDBB 4JJ7A 5CM9C 2J6IA 4KODA 2WE8A 2MTBA 2C7RA 2OAQ1 5FWXA 4ZK2A 3DP7A 4URZR 4WNCA 2QUBA 1ADGA 2E4ZA 4HB2A 4E30A 4R9SA 3B60A 4KXUA 5JCPA 5FWAA 2VZLA 4L27A 1M75A 3NFRA 5KTTA 4DR7B 1LZKA 4UJ3A 4RABA 1MQAA 1T2FA 1EX1A 4NCKA 3CN7A 4GUAA 1B6TA 1B41A 4CR6A 3U1TA 3KLBA 3O8OA 1YUNA 2XDAA 1N3YA 2XNCA 3BA1A 1JMKC 3AR7A 4TT3A 1H3EA 1YQUA 4RACA 3SC2A 2VCHA 2K5UA 3AJDA 3WK9A 2LCIA 1T2EA 3RT9A 2G88A 3CTPA 5KQLA 5CB8A 1F4VA 3VVMA 2OMKA 3IPCA 4IR7A 1JLSA 2D74A 4I50A 4F3YA 5LYYA 3TXYA 1DXOA 4FXPA 4IDQA 1WMBA 1QV6A 1RXYA 3ZTWA 2EKZA 2AOTB 4KLRA 1EGAA 2JGAA 1JIJA 4PLFA 1UWVA 4CM1A 4MRMB 4CEHB 3M6FA 4JJEA 4D41A 4CDGA 2NO6A 2F3TA 1XA4A 4HLUC 4AXBA 3CNLA 1W1UA 2Y2UA 3ZHSA 5AJTA 5MHTA 3NV9A 3DOJA 4CV1A 3ETNA 4C6TB 4EKIA 1DBIA 4RIGA 1BXRA 3C3KA 4I3GA 2ETXA 2FUG6 3GFOA 4ALJA 4D2IA 1M2OB 3KYIB 4U00A 1XRJA 3ZLUA 3IGFA 4PYOA 4E1VA 3LQQA 1YZNA 5KOIA 1YS2X 1XEWY 1YACA 2IZOA 2WG0A 3DEFA 3LXMA 2PFSA 4ZEOA 1SHKA 3I0NA 3LO8A 4UD2A 1ISFA 3CH5A 3QTLA 4UCQA 3STXA 4A2CA 1NJFA 5DB4A 8LDHA 2C4NA 4LF6B 3H6KA 4B3CA 3DZKA 1LJ8A 4BJ1A 3H4IA 4WNAA 1GYQA 4C0JA 4ZT6A 1IUNA 2G76A 1YO6A 3TKYA 2DX7A 1IN5A 1E58A 5HP4A 1QP8A 2H08A 4FHCA 4IWXA 2IBMA 4HDAA 3UW3A 5FPPA 1I0LA 4QBFA 2CHVA 1AO3A 3HB1A 3PDIB 1QFSA 3E2MA 3UA3A 1G20B 5ER6A 2F1JA 1WXEA 3VXKA 3JYPA 4RZ3A 3BRWD 1NLZA 1GR0A 5CVCA 3REQB 3SM3A 3BREA 1U7PA 4D74A 2ZSKA 4OMCA 3VH2A 3WWDA 4LOJA 3AI7A 3TOVA 3DMGA 4EARA 4M7RA 4OMUA 2D2FA 3ABZA 1N2XA 2GN4A 1UZUA 4M0CA 4I7EA 2JAOA 4M76B 2QJRA 1Y0BA 3I9V6 3T7EA 2AOTA 4L3VA 2J6CA 2ZQYA 4MRMA 4CEHA 3WZLA 5FL7D 2YL2A 3CMMA 1UK7A 1WD5A 3BRQA 5U9CA