3CLRD

Crystal structure of the r236a etf mutant from m. methylotrophus
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
319
structure length
319
Chain Sequence
SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYVEVGGGNDIDITTVDFIMSIGRGIGEETNVEQFRELADEAGATLCCSAPIADAGWLPKSRQVGQSGKVVGSCKLYVAMGISGSIQHMAGMKHVPTIIAVNTDPGASIFTIAKYGIVADIFDIEEELKAQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Electron transfer flavoprotein subunit beta
publication title Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.
pubmed doi rcsb
source organism Methylophilus methylotrophus
total genus 98
structure length 319
sequence length 319
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
D PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3clrD01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3clrD02
2FWNA 4UTRA 1KKUA 2CYBA 5J58A 5BWLA 4KR6A 2H2IA 3D7KA 1PTJC 3DV2A 1V47A 1J70A 3IVGA 1OZFA 1POWA 1YC2A 3GLVA 1LW7A 1NUSA 3FZNA 3H9BA 1DNPA 2QTMA 2HMAA 3AKZA 3GLRA 4DJAA 1JZSA 2A84A 3A04A 3GMIA 3GLSA 4D5GA 2VBIA 3HWX1 2WQ7A 4J1TC 1J1UA 4MQ5A 1QNFA 4Y6QA 4BVBA 3ND5A 4FZJA 4I5IA 3IAEA 2H4HA 4BVHA 4MLPA 2FR8C 2JLCA 3GLUA 2GKSA 1N2GA 2G36A 3FDXA 1HZZC 3FG9A 3A4IA 3UY4A 2WQ6A 1QPBA 4BUZA 5BWNA 2Z3VA 5TEWA 1OBCA 1O95D 1K97A 1NSYA 2QTRA 3UOWA 4EG8A 1MC1A 4PBTA 2QQFA 1MAWA 2OORC 3D81A 3AIIA 1VLHA 3JWPA 3MUEA 1KP2A 1M2JA 3CVXA 4K9QA 2UZ1B 4KPUB 1I6KA 2VJYA 5EJ9A 5HUHA 3I05A 2AG1A 3P0JA 5LM3A 4G1CA 1WXHA 1OWPA 5H16A 5JBNA 1XNJA 4QRDA 4PBRA 4UU8A 5MGNA 2Z09A 1GN8A 4JUCA 3ZXIA 1NUTA 4FZ3A 4GU5A 1UPCA 3RIYA 3D6UA 3FNRA 3IUEA 3N8HA 3CR8A 1IQ0A 2YWBA 2VTBB 4G6ZA 4MWEA 3EYAA 4RMGA 4YMIA 1PNOA 1X8XA 5TEVA 2PFSA 1JILA 1NP7A 1KP3A 4F4UA 2O8VA 3OP1A 4JZYA 3VRHA 2Z08A 1N77A 1G59A 3DLAA 1SURA 3K9WA 4F4HA 4NAUA 4BVGA 2VXOA 4WSOA 4ZCTA 1YC5A 1YI0A 3FY4A 2W93A 3Q10A 4GP9A 4MW2A 5K6RA 1EUYA 2A86A 1MBZA 4G5FA 4OUDA 3CA8A 5J5AA 4JU8A 3CVWA 1N2EA 1MOPA 1QQTA 4KKVA 2HGZA 1OZGA 3CF4G 3COZA 2Q28A 1TYDE 1NZJA 1Q11A 2Q5QA 3AFHA 1I2DA 3KT3A 4UU7A 3AL0C 5EJ6A 4Q93A 5DASA 1WZ2A 3EY9A 2X3FA 1VBKA 3N05A 4X0EA 4KGDA 2CFOA 1M2GA 3SEQA 4MPRA 5K0TA 2I1LA 4JD5A 2J09A 2X0KA 1O96B 4KXQA 5IJXA 1Z8NA 4ZT4A 3P0IA 4IF6A 1N0HA 1V5EA 5FEMA 1JEEA 1WXIA 2H29A 1OBHA 2HZ7A 3IUBA 3VGJA 4QBTA 3SZGA 3KT6A 1PI3A 4K9OA 4TWJA 1GTRA 1CT9A 1OWLA 3PNYA 4MUFA 2H4JA 3F6BX 4NX2A 2D13A 2J4DA 2IJGX 3RHSA 1J20A 5EJ5A 3CLTC 2J5BA 1H3FA 2PXHA 1U28C 4F3RA 4K9NA 1OZHA 3RFFA 2CT8A 4DDMA 3HWWA 1PFYA 4K0RA 1MJHA 2OQ2A 3SZ3A 3RK1A 3MXTA 5D7NA 1J1ZA 4Q16A 3C8ZA 4L3OA 1WJGA 1EXDA 1N2BA 4H3SA 1JIJA 4MUJA 2QTNA 1ZPDA 2J08A 3ND6A 5FO1A 1KAQA 1O5TA 4BWVA 1POXA 4RJKA 1U7XA 2H2DA 4R2MA 4Q9DA 3KT8A 3N2YA 1EFPA 1MAUA 1BS2A 1IHOA 1P7PA 1K4KA 4ZCRA 4JUBA 3GUZA 3CVUA 3IODA 3PNVA 5FYQA 4CT0A 2V3WA 4ZT6A 3Q4GA 1GAXA 1IQUA 2Q29A 1T9DA 1WOYA 4MW0A 4JU9A 2BYTA 1ZH6A 1YUMA 3ZUGA 2YXNA 5AHWA 2A1UB 2OD7A 5DGDA 1Q1AA 3L92A 2IHUA 1T9BA 4XFDA 1YBHA 2B4YA 2FSVC 4RMIA 3M5WA 4MAFA 2AG6A 2D5BA 3KFLA 1UPBA 4NDAA 1KH1A 1EUQA 4GPEA 1EFVA 1COZA 2E18A 1O0CA 1GZUA 2IHTA 4DDHA 1SZDA 1EE1A 1Q19A 4AS1A 3E27A 1NURA 1F7VA 1ILEA 1MCZA 4DNXA 1YTLA 2CV0A 2BTEA 2PGOA 3CLRD 4JSRA 4V1CA 2WVGA 1Q15A 2NYRA 1S4MA 1R6XA 1UFVA 5EKDA 3FH0A 1YIAA 5BNZA 5IHXA 1Q6ZA 4DE5A 1YNOA 2H4FA 2EZ4A 2H2AA 3GLTA 1ICIA 3COWA 4TWIA 1QRSA 4RMHA 1Q14A 4WNYA 3D6VA 4MQ6A 2DJIA 4MVXA 1N78A 4V1CI 5H7XA 3ZXSA 1XLTC 3Q12A 2FRDC 4YP6A 1D4OA 4RJJA 1I6MA 3CLUD 1GTSA 2JI9A 4I6JA 1IVSA 1M83A 4XSVA 2H2HA 4JUDX 2TS1A 3RJZA 1QU3A 3K32A 3ILVA 4U7JA 5KCMA 2O5RA 3ZJUA 1PYDA 2Q5OA 4MPPA 1J21A 4CDNA 4MW6A 1ULHA 4IG9A 4NAHA 2Q5LA 4R0NA 1QRUA 2WVHA 3FHJA 2ZUFA 1JSCA 3COVA 3MLBA 4MW9A 1O0BA 1HYBA 1TYBE 2QJFA 1PFVA 1XJQA 1JEDA 3TZLA 4EF6A 4EG1A 1H3EA 3ZGZA 1NUPA 2NZ2A 2RD2A 4D5EA 1U3CA 1F4LA 1PFUA 2H59A 4ZP1A 3UK2A 5TS2A 3CVVA 3PXUA 2QQGA 1K4MA 4OJMX 2NXWA 3PKJA 4FVTA 2JANA 4ARIA 2ZP1A 1NI5A 4L2IA 3OE1A 1O97D 1O95C 2YY5A 4K03A 4Y6OA 1NUUA 2VK8A 2QJTA 3LQ1A 2WB2A 2DPLA 2BRUC 4HD8A 5K0SA 2JI8A 3NV7A 4ZCQA 4I6EA 1TEZA 1ZJWA 4K9KA 3RBAA 4GM1A 4JUAA 2ZUEA 3U1VA 4C78A 3IMEA 1YHYA 3K35A 5DGTA 3TS1A 5DK4A 4MZXA 2B7LA 4PY2A 2XRZA 3H99A 1T6XA 4UUBA 1QU2A 1TQ8A 3LOQA 3QE4A 2EJCA 5LLTA 4JXXA 2EZTA 3U3DA 1RQGA 3PKIA 3TQIA 4IAOA 5K6TA 1WXGA 2A7XA 1PNQA 1M8JA 3SP1A 3IDFA 4JT9A 3IAFA 5FNZA 4PBSA 3UC5A 3G59A 2EZUA 2R5WA 3UMVA 3FLMA 1NM5C 2HJHA 5DEIA 5BWOA 4COKA 1JZQA 2JI7A 1QRTA 4UTZA 3AG6A 1QTQA 4MUNA 3DPIA 3FIUA 1G8GA 4GG1A 4HPWA 2V0GA 2VBGA 4ND6A 5EJAA 1Q77A 5MFPA 1N1DA 1ZUNA 4X3PA 1UPAA 3P0HA 1M2KA 5EJMA 3HV0A 1A8HA 5F23A 1PG0A 1H3NA 4ZT3A 5KHAA 3MMXA 2PZBA 1WXFA 1XNHA 4U63A 1OVMA 2EZ8A 2J07A 1KAMA 4HDAA 1WQ3A 3ISJA 4I6GA 3MLAA 5DB4A 2IP1A 3LCJA 1B6TA 1IH8A 3SDBA 3IVXA 4MWBA 3SYTA 1O94C 5MF6A 1KQPA 3NBAA 1G8HA 1TYCA 4OUDB 2CV1A 1X6VA 3QTTA 3BL5A 2EZ9A 4DDKA 5AHKA 1NUQA 3ZIUA 5LFAA 3ELBA 2H2FA 4MUHA 1KQOA 1N2OA 3RK0A 1Y42X 4ZT7A 4UUAA 1TYAE 1YUNA 2JI6A 3X1MA 2UZ1A 4KPUA 4DLPA 4CQNA 4J16C 1T6ZA 2OD2A 4R8MA 1U3DA 1MB2A 1JGTA 4JUFA 4BN4A 5K3SA 3ZGVA 3FWKA 4MUIA 4CDMA 4RPIA 4MVWA 1OWMA 4HK4A 4MUGA 4S1OA 4HJXA 1H1TA 2PZAA 3FSJX 4F56A 3IOEA 4MW7A 1JIKA 2XRYA 2VTBA 1U7DA 2CYAA 1WY5A 3A05A 1PG2A 3IOBA 4UZFA 2YWCA 5J59A 4AQ7A 3CLSC 4ZT5A 1J09A 3JXEA 4UZEA 2VK1A 4EFKA 3H9CA 4ZT2A 3F3MA 3ZGOA 3HZRA 2E89A 1JMVA 3L93A 4UTXA 1S7GA 4QPZA 2JIBA 4K9MA 1U2GC 3VU8A 2RE8A 1I6LA 4FEGA 1S5PA 2PG3A 3IMCA 1YI8A 2QUJA 2DR2A 4TS1A 1N2HA 4EG5A 3KT0A 3LE8A 2QUKA 1KR2A 2DEUA 1GLNA 2DLCX 1EFPB 4JFAA 2WSIA 1T6YA 1M1ZA 3COYA 2CSXA 1E3TA 1KH3A 1M2NA 4BVEA 4MWDA 1V5GA 2C5SA 3PRHA 4MUEA 1DJLA 5IMSA 4MPJA 2A1TR 3F6EX 3X1JA 3X1KA 2C31A 1U0BB 2AZXA 1OWNA 4BN5A 1JIIA 3ZJVA 2A4MA 2PANA 1TFUA 1O96A 4G5YA 2JA2A 3IMGA 3IOCA 1PFWA 4U8HA 1U31A 1MB9A 3HL4A 3P52A 1FYDA 4J76A 4QREA 3ZJTA 1YHZA 3CLRC 2EL7A 1ZH0A 1MA3A 2Q5JA 4GM4A 4K9LA 1N2IA 1Y9DA 1EFVB 2V0CA 4YP7A 4ARCA 1LI7A 1N3LA 1T9GR 1T9AA 4MW5A 1KQNA 2PIDA 2GM3A 4MVCA 1KH2A 4HJRA 2PZ8A 2PGNA 3JR3A 1IQRA 5HG0A 3TQOA 3RIGA 4P2BA 4EG4A 1T9CA 2JAXA 1F9AA 1MRZA 1V8FA 2VBFA 4V1CB 2IHVA 2GOYA 4J75A 2DXIA 4RMJA 5MFZA 3DO8A 4A91A 5EJ4A 3CLUC 2CV2A 3CLTD 3N9IA 1K92A 3S3TA 3A2KA 1JHDA 4JXZA 3ND7A 3OTWA 1BFDA 4GM0A 2X1LA 5K2OA 2OV4A 1VBMA 3FI0A 4QQ8A 5KWVA 3TNJA 3PDHA 2A1TS 1WQ4A 1IRXA 3AG5A 4BV3A 3NBKA 4UTNA 4NATA 4XFJA 2E0IA 1G8FA 3G6KA 4MW1A 4O8ZA 3QTBA 5TGTA 1Q17A 4MVYA 4KR7A 1R6UA 1O6BA 5EJ8A 4EG3A 1GPMA 2AKEA 4ZCSA 3FETA 2A1UA 1O94D 3D4BA 2DERA 5FO0A 3ZG6A 1EJ2A 2X1MA 4JT8A 3SEZA 4YP5A 2JLAA 1JECA 2H2GA 4ZCPA 3G5AA 4YBRA 4MWCA 1YIDA 4JYZA 1OD6A 4KR9A 1T9GS 1WXEA 3CVYA 4MW4A 2CYCA 4X3OA 2FN3A 1O97C 1VBNA 1N75A 2OO5C 1R6TA 1U2DC 3HFJA 2AG0A 1SZCA 1N2JA 2E21A 2QUIA 2VK4A 1LI5A 2IELA 2OD9A 4C7BA 1M8GA 3IH5A 1PT9A 1M2HA 4BVFA 4UTVA 4L2IB 2CUZA 3INNA 4FEEA 1WKBA 1V5FA 1YULA 4RJIA 2DUMA 4GRIA 4BV2A 2X7JA 1D2RA 1IFXA 5EJ7A 4MUKA 1M8PA 2WVAA 4NZPA 3FOCA 4R2LA 1J8FA 1KORA 4MULA 3HGMA 3CLSD 2D54A 2QJOA 5DEOA 4EG6A 1YI1A 4Y6LA 5HUJA 2QUHA 4ND7A 1PVDA 1NYLA 3U31A 3HMQA 4ZZIA 1OWOA 1QJCA 4RUKA 1PO7A 4QELA 3H97A 1FFYA 2DETA 1M8FA 3H05A 3PNBA 1VL2A 1XNGA 4EG7A 2Q27A 2A88A 4EGAA 1M8KA 4E1AA 3TZEA 2NSYA 1F7UA 4K9PA 3IVCA 3EA4A 3E9YA
chains in the Genus database with same CATH superfamily
5K99A 2PT9A 2V6MA 4LDQA 3WGQA 4DV1B 2QJWA 5ABPA 3H18A 2NUTA 2HIMA 3KTDA 5F12A 1AT1A 1LBHA 3LKZA 3UFBA 5JT1A 1GEGA 3G8DA 2PAFA 4MUAA 2Z0MA 3BWCA 1G2IA 2Q1TA 1TFRA 4BVBA 3NDJA 4I1VA 3UAZA 2J3DA 3DYIA 2FB9A 4ZWNA 3QEAZ 1VSBA 1SCAA 1X0XA 3LKVA 1C9KA 2IKSA 1PEKE 1OX4B 2FEWB 2QU7A 3EEFA 4KPEC 2WDZA 4LSZA 2M32A 5AI6A 1YMVA 3GIDA 3NHYA 1FC0A 4PLGA 1XTBA 1YOBA 1PGJA 1QONA 4IWNA 4PFKA 4A8JB 2B82A 4MX8A 5EVCA 4KPFC 3Q0TA 3OEYA 3TCNA 1T1IA 3K05A 3P1JA 4G5QA 1KJZA 2R66A 1G7RA 3HE3A 2ZDGA 4PGHA 1UKYA 2WZCA 4FR2A 5AI8A 5JBNA 2W2NA 4I55A 4YQYA 3RPEA 1XNJA 1HDIA 4QRDA 3ZVRA 4HI0E 1U5BA 3F6CA 2Z09A 4W9NC 3UJ3X 1PWEA 1H6AA 3CUYA 3KWJA 3C6QA 4L22A 3Q6IA 4RKRA 5IK2A 1E2JA 2PFGA 4MQFB 3NHPA 3K0HA 3OLYA 2FW7A 4RD2A 2FPWA 5I45A 3INGA 3LT2A 3QELA 1IM8A 4GPBA 3ESYA 4Y2VA 4Z6KA 1JAIA 3EOAI 2H54A 1BIFA 3F9IA 3I0NA 2AD5A 2PFSA 3AFIA 4FSXA 1B2RA 1ECGA 1PEAA 2HPAA 3JVVA 3KUDA 4KO1S 1A77A 2VP3A 2ACVA 5G0VA 3KZCA 2M6LA 4BO4A 1H4SA 1AU9A 2OBNA 1L3BA 1E7QA 1GA4A 1Z0FA 3GNSA 5JCZA 3NOXA 4PPQA 1R50A 3FDZA 2HBQA 2Q9BA 2R25B 4GKVA 4LAFA 5DTEA 4Z86A 1BKDR 4ZCTA 1WXDA 2A5FA 4GBGA 3EIHA 3EGCA 4LJ7A 5AW8A 2A86A 1R4NA 4ND5A 1EUYA 1NQXA 2AFIB 2R8PA 1RYBA 5HJ7A 3UKJA 1G291 2RJ3A 3WGUA 4CCYB 2N9UA 3U16A 3C3JA 3CF4G 3OQIB 4EYEA 3I45A 5MN6A 2ZULA 1I2DA 1C9EA 4MKZA 3ZZ1A 2G5TA 3AL0C 3TAXA 2CUTA 3MINB 4CEJB 1P80A 3AJDA 4HOYA 3AUKA 1QMGA 1G8KA 2ZYTX 4XLZA 1NIJA 2E4XA 4U3JA 2BFEA 1O96B 2J3HA 1M74A 4MSUA 3ZWWA 4IGFA 3M5DA 1XQ9A 3HKDA 3STVA 1QHIA 4FYXA 5EKSA 5I7FA 1G8JA 1UBMS 4IRUB 3RQIA 2VHTA 5EHGA 5ILGA 1W36D 4LF7B 5A1JA 1A72A 1DAEA 2DBYA 4O4LB 3KT6A 3BD8A 4WMLA 1H23A 4BL5A 1GTRA 3IUMA 5TPZA 3HWRA 2G71A 2P8SA 1NJ5A 1FPMA 1O2DA 1C2YA 1UKVY 1LNZA 2IIVA 3UMSA 4WZAE 3UV3A 1B1AA 5KJCA 1UMBB 1E18A 1EFKA 1Z68A 5M5BA 2GCOB 2J5BA 3HNPA 4KWTA 5FRDA 3ADKA 3ZV5A 2PR2A 4Z4QA 3RFFA 4PPNA 5FADA 3CLVA 4EUNA 1CK4A 1RWXA 4KAFA 5FAXA 3FJOA 4UQPA 5C5CA 3DP9A 4RHTA 4RLHA 5LZ5A 3IPLA 2H1WA 2I3GA 4EGCB 4F85A 3DZ8A 4AY2A 4MUJA 1KNXA 3GCXA 2V4UA 1GUAA 3FNQA 5ALTA 1AHIA 3VDMA 2EF0A 2AYXA 2AFRA 4HNHA 2WKRA 2ZVQX 4DM4A 1RBMA 3FPFA 3G1WA 4FDLA 4YPOA 3AVVA 5ALWA 1K4KA 2UZIR 4JQOA 4Y30A 3W9SA 1JFSA 2NV0A 4YTEA 3LPLA 4F3CA 2O5CA 1OKKD 1FS4A 2OCLA 4OLBA 4CT0A 1OFTA 4G1VA 4HTFB 5BMVF 3UTDA 4JEMA 5EWMA 3DZDA 1T9DA 4DWJA 4D26A 3JQ8B 3PXXA 5EP2A 3IQHX 3NWOA 3P9QA 4CG0A 4DPLA 1QPZA 3TZCA 4R71A 2J0EA 3DR3A 4QA9A 5SZKB 4XCVA 4A1FA 3WKEA 2IHUA 1T9BA 4MYUA 4C22A 4BNJA 2R8XA 3QX3A 2CBZA 3KFLA 1KEZA 4CQMD 1E5XA 3EISA 4URHA 3VR1A 2B2XA 1JR3E 5A5VA 2P3LA 1ABEA 3HYLA 4ICIA 4UCQA 1SQFA 1UINA 2NT4A 2VXBA 2O2ZA 3PUZA 1SCDA 4GRAA 4B84A 4CV3A 3GN2A 5C9ZA 3OE7A 1F2TB 4ABYA 4YMSA 3TZBA 2OCGA 1AO0A 1BWSA 1R5BA 4D3ZA 4X20B 3RADC 2AHOA 4GI3A 2V7BA 1KYQA 5AVOA 1XELA 1Z18A 4JI8B 5AICA 1WVGA 1YJ8A 2F8MA 3CUTA 5G4LA 3QA3E 4WACA 2EZ4A 1K68A 1I33A 1RYFA 3U81A 4K0KB 4H7PA 4MQLA 3F8TA 3BKXA 3FTDA 4ITRC 3PXAA 4RAQA 4WNYA 4F9FA 3TG8A 1X7HA 3KZXA 2L18A 1OLUA 3I1FA 5H7XA 3WRYA 4KI0A 4YCMA 1UDBA 3CLUD 3HK2A 1T2DA 4I55F 3CURA 3VI3B 1CQIA 1JJAA 1ZD2P 3CV3A 3IT3A 5CJ2A 1UXJA 2O7QA 2A0XA 1FLDA 1ZM7A 5AJTA 3SZRA 2C9DA 5KCMA 3O8BA 1WW3A 3FLAA 1Y3HA 5DP1A 4P32A 1R7RA 1K0FA 1FTGA 1T2FA 1UANA 2WTXA 3PGA1 4KWCA 3V9AA 5KJFA 1W5BA 2M98A 1GA6A 2YC4C 3E2MA 4X1OA 3ETLA 1EK6A 3E15A 2X0DA 3Q3JB 4X6UA 5LYJA 2QTHA 2NYUA 4CMBA 2GNOA 4IH4A 4R3NA 2UVQA 3V2IA 1OH6A 3ROGA 3AESA 3A11A 4S35A 4N8DA 4B9EA 2OC4A 2HADA 3WGGA 4D0SA 2FG7C 1YZTA 1F8UA 3ZV4A 3X1DA 4BNLA 4L4ZA 1VMIA 1LS1A 3GRUA 3NUZA 1WVIA 1SG9A 2RI1A 3VR6A 4YRFA 4ZQFA 3SAJA 1O97D 5K8IA 1IBLB 1ID8A 4DC9A 2PKQO 4WFKA 1EHYA 1E4OA 4CMCA 1MO5A 2UVPB 5GIPE 2HBYA 4FW8A 2O7VA 4OI2A 3KUCA 4L02A 1ZVKA 4LF5B 2OP1A 2ZW9A 1JEQB 5EFOA 2FRVA 2DCMA 4XYGA 1V11B 3WK6A 5JXGA 2AIRA 5FBKA 2E9SA 3AUAA 4HYYA 1GNPA 5CITA 2FW0A 4KQ9A 1RWOA 1NXTA 2SICE 1QDLB 3LC1O 4BE7B 2B21A 2PVCA 1T6XA 1E2IA 3H99A 3QMWA 4KWEA 5AOCA 5DN6D 1O6FA 2DWQA 3FNFA 1FJXA 3NDRA 2QQ5A 3F1LA 3OA0A 3YASA 4PLZA 2BOVA 2BE9A 3R09A 4F91B 2HQRA 1C3EA 3WIUA 3MCTA 2G4VA 4D9IA 4YYZA 2A9VA 3FVTA 3UC5A 3W4JA 3QVXA 5K0LA 2QVBA 2BFMA 2QMEA 3M6IA 4Q6BA 1V3VA 3OOYA 4MWZA 3RUEA 4NK4A 3T15A 4D46A 2W6QA 5FPSA 2G82A 3UAXA 4MR9B 2OBMA 3NHZA 3WGNA 1KHHA 1IULA 5EJMA 1MHPA 4U7FA 4I9UA 2WHPA 4IICA 1P5FA 4EUSA 3PYMA 3OPNA 4LGVA 1VKRA 2C9MA 1JG7A 5DWQA 4ZYYA 5B58C 3AR8A 3F6SA 1FQWA 3UIEA 3V8BA 1ZD5A 2RAPA 3HCDA 3QU2A 1Z17A 2Z4SA 4IJVA 4ZGWA 2Z2IA 1Z4NA 1AKYA 2E2WA 4CUKA 4MITA 5I4KA 3UNXA 4RTPA 2VP9A 3INTA 1KEVA 4DDKA 4JDPA 3FCOA 4XWKA 3H2JA 1R8XA 2BGMA 1P0PA 5F2OA 1QO0A 3R3VA 4DDWA 3OCJA 3ZLUA 5ADUS 1QVRA 2HMYB 2CF6A 2OOKA 3ZKWA 4MI3A 4DPKA 1SCBA 2OD2A 2ODEA 1EFRA 4AW9A 3HP1A 5FHQA 2UZAA 3FWYA 3LWNA 4ER0A 1CERA 4P7GA 5AUOB 1EWYA 1V4NA 4J07A 3BZUA 3ROTA 1N5IA 3IV6A 1F8FA 4N03A 2QX4A 4TLAA 4FX2A 2PKCA 2Y1OA 1H1TA 2EG5A 3V8MA 1SBHA 2CE2X 2X40A 5KNBH 4J43A 1ODJA 1Z25A 3QUBA 2R65A 1T4GA 1HUQA 3TKAA 3U9LA 1V16A 2GPYA 4JGGA 7ADHA 1QBGA 4FC7A 1WPXA 1TLFA 2YWCA 4AY5A 4ZJUA 3Q85A 1YD7A 3G1TA 4ND8B 3ABSB 2DFNA 4ZRDA 3TX2A 1LNSA 1MRNA 4N7MA 4W99A 2CXXA 4Q7EA 1B8OA 3H75A 2POCA 3P2MA 4BAZA 3ZD6A 3PNPA 1I6LA 2Q2NA 1S5PA 4I1OA 1TTHA 4MO2A 1FU4A 1QIJA 4CR7A 1AKUA 1P61B 2PS1A 3WL6A 4HDCA 2P3OA 2DLCX 1GLVA 1PJAA 1SVSA 3HI4A 4HAVA 4D4HA 3KM0A 5PGMA 2ZRGA 3EAQA 1LJLA 4ARSA 5JW6A 4MKIA 1WP9A 2V59A 1RBQA 2A1TR 2C58A 4PGAA 4JLAA 1MT3A 3PQ8A 3RSLA 4UNSA 1DQNA 1V43A 3BEDA 3F5SA 1U0BB 2OCBA 1MQ9A 2ZTHA 4K6CA 1PQWA 4JBHA 3GLIA 1H94A 2BZ0A 3GFSA 4P92A 1KDYA 1PFWA 4U8HA 4BNTA 3QFTA 5LYJF 2FG6C 5HQ3B 5CP8A 1APBA 5BRAA 3JQ9C 2EWVA 3KZVA 5JYDA 4LI0A 2G08A 5KUTA 1ENPA 1FJ2A 2HDHA 1YHZA 1ELOA 1MORA 2DVMA 3F2VA 4BQNA 1RTKA 3AUJB 3ZJTA 2Q1XA 3S1AA 1J9EA 3LRTA 4DBVO 3QEMB 3ESCA 1EFVB 1IDN1 1E0JA 5LQKA 2PKWA 4MW5A 3GDFA 4J0IA 4BZXA 2GGSA 5EIXA 2W6ZA 2YZKA 3RHFA 4EQ6B 4O4JA 1N9ZA 2GT1A 4LOHA 3FI9A 1X2EA 2X3YA 3IDSA 5FTWA 5KCZA 4P6VF 3HJAA 3O47A 3ADOA 4TYPA 5F1PA 2GOYA 4MPDA 3CBGA 3HLTA 2BI7A 1JHAA 1VCIA 3CLUC 4PZEA 3LC7O 4X9XA 2YV3A 1SUDA 1JHDA 2FJPA 3B12A 4B4WA 4DQKA 1SUSA 3MJSA 1T1SA 4B31A 1FX0A 1SBNE 3M6XA 1KI8A 5IWAB 1ZCJA 1AE1A 1L7VC 3TNJA 2QZ4A 2I1WA 5IK2D 2BV3A 1YA8A 2W58A 4PONA 1GFSA 5I8PA 5JQGB 4HH4A 3RVPA 4F1JA 3G85A 3K09C 3KUUA 1AURA 4M55A 4QYXA 4PFQA 4Q4JB 3REQA 5SICE 3SC4A 5KSZA 1ZSYA 2QYTA 4DCPA 2REQA 2XDAA 2D1QA 3BD6A 3OF5A 3NG1A 1UAYA 5E4FA 3I2JA 3IVAA 3EFHA 4B3TB 1XPOA 1G9SA 1SJ9A 2YH2A 1PT5A 4JT8A 1OXXK 3T52A 3ZG6A 4C07A 1K8QA 2A5YB 5TX7A 3PD0A 3VMFA 2JLAA 2W2KB 4L0CA 4C0AC 5ALFA 3TTUA 1W52X 3G5AA 4GX0A 2CFSA 2J87A 2JGLA 2CNLA 2I67A 3AW8A 3O3MB 5IJAA 1MX1A 4DBLE 5I7OA 1LLQA 4DIBA 1O97C 5LDGA 4OOFA 4PYJA 1U2DC 4JROA 3LPMA 1O08A 1ONPA 3N70A 3JWEA 1RRPA 2HEIA 1WP4A 4K9SA 2NPIA 1YS1X 1ZCZA 5T57A 2REXB 1UMCA 1T5SA 4OI4A 4EUFA 1E58A 3B7GA 2NUPB 5DBHX 3PXEA 2XE7A 2QWXA 1IBRA 2PL1A 2ZUVA 3L06A 3GXBA 4L51A 1CS0B 1DGQA 4MCJA 3LP6A 4NCXA 3DAOA 4RPJA 1PZMA 4QU9A 1Y4UA 1YULA 3K70B 4KIUA 4D6XA 1GGKA 1HBJA 4R81A 4NAVA 3FCXA 3D5QA 5IP5A 5JSKA 4HN2A 1N6NA 3OLCX 4DRYA 5TPZD 5K8VA 3HB4X 5CPBA 3HKCA 2QJOA 1U1CA 2JS7A 4EJSA 2DU8A 3NDIA 4UARA 4Z1OA 2GEBA 2O6HA 4ZOBA 5B6JA 5DGXA 3EXFB 2W43A 5JNLA 2HMWA 3DDNA 3DW1X 3EGOA 2X5OA 2V5UA 1E4EB 3PDJA 5BSUA 2DETA 3PS9A 4UE2A 5AHRA 5H4HA 5HHTA 4JI5B 2QS9A 3TQQA 2XXAB 4M7PA 2JFZA 5E4JA 2PX6A 3WZLA 4EG7A 1J4AA 1OFUA 3PE6A 4KXYA 2KBEA 3B70A 2BH2A 1RABA 2XMPA 4TLCA 5G0WA 3B9QA 2FWNA 1LTKA 3DOUA 3INYA 4D8XA 2G06A 1OZAA 3SD7A 1JU9A 2V58A 3DV2A 4HZGA 1OBVA 3O4VA 4LHYA 1YC2A 4YRQA 4FYWA 4CL0A 1D1QA 1XMPA 4D6YA 2HA4A 4XGIA 1HLFA 1XALA 5JRJA 5DPMA 4D5GA 1A7UA 1V3UA 3K53A 4FCCA 1UC4B 2Q07A 4MQ5A 5K20A 3G2NA 1EZ1A 3GRZA 1FNBA 3I6BA 3KPJA 2C29D 3IA7A 1M66A 1N2CE 3VKGA 3T7AA 2I54A 2ARKA 1B23P 2GKSA 4LRXA 4ZQEA 2G36A 3VYRB 3D7SA 3FSEA 2FAXA 3PUHA 4N4AA 5IXYA 1B3RA 3UY4A 5JSUA 3AJRA 1VG9B 1SIWA 3DWEX 2APJA 2RK4A 3ZJ5A 2QPLA 3N2GA 1CETA 1Q1QA 5WRFA 2I2WA 1MC1A 3JQBA 4NC9A 1FTYA 1VLHA 1E89A 3DZKA 1ZD1A 2H65A 2B8WA 2JARA 3PCXA 5HILA 3O8CA 3OE7D 4PGGA 3LVRE 3V1NA 3FZQA 5HUHA 3E61A 4RFLA 4YA6A 3EEBA 1H4TA 1ZMOA 1LPBB 4FUQA 1Z06A 4J0CA 2FSIA 1YONA 2W6PA 1P74A 2H7YA 1OHHA 3AEQB 4Y6RA 4B82A 1TQ6A 2VCHA 1GNTA 4JC0A 2WYIA 4F8JA 3JYPA 3WK9A 2HI0A 3PPVA 5DDIP 1HKHA 1IATA 1FVOA 3I9FA 3LTEA 3LY5A 2GTIA 2PO5A 2HLNA 5HRUA 3RIEA 4MDEA 3B3GA 2XYVA 5H59A 2R00C 4DOMA 3SJ7A 4LXUA 5EXDA 4FFBA 4M1QA 2ODWA 3E8XA 3SR4A 1XYGA 2IDJA 2VPWA 3B3AA 1FMLA 1YK1A 1TNDA 3TI7A 2PMCA 4BLPA 4DQDA 3WYFA 1GNRA 5CFLA 5G4KB 1SQ6A 3DLAA 1SRQA 2WD9A 4FGWA 4IXNA 2YDXA 1EM6A 2BGIA 2VUSA 1I8TA 4LK3A 3T1OA 5LD2B 1YC5A 3IO5A 2CNNA 3VH3A 5D3MB 3VPAA 5LZ9A 2O59A 3OKPA 4J0DA 4Y6SA 2PNJA 2RG1A 2FZEA 3PQ3A 4M0UA 3F3YA 1JHUA 2HSGA 3IKMB 4A92A 2VT6A 3MRTA 1O8CA 1W2HA 2R84A 2QX9A 4O25A 5LIPA 1CEEA 1KMCA 2GPAA 5IAJA 2NN3C 2X4GA 3EY9A 3NHUA 3NH9A 3H7IA 2NU9B 3V32A 3CH7A 2FETA 5IVKA 2WYWA 1RVV1 4UZSA 2PZEA 2RCYA 2WWHA 4H7JA 2X0KA 3T0GA 4XAQA 3VC2A 5KYUA 1TM2A 3NX4A 2DQSA 3GELA 4GOND 3W7AA 2L0XA 3ZDFA 5FFMA 1L6RA 3AHGA 2OO3A 4UHJA 3VR6D 4D9EA 2H29A 3FVWA 1OBHA 5JVDA 4LRQA 3L04A 3PNYA 4DY4A 3NMUF 4ETWA 3WHLA 1A9PA 1SH7A 4PYKA 3V1MA 1JLLA 2V8BA 1DO8A 1S3IA 1PW7A 1U7HA 2NVBA 2XVXA 3NWBA 3O8QA 3OJLA 4FGSA 4PTYA 5TVGA 1Z12A 1PX0A 1DLIA 4F3RA 1RQ7A 1ESMA 3DNMA 3OI7A 4FFPA 1SU4A 4DYVA 1MO2A 1WKCA 4JP8A 4KVAA 1RLTA 2H11A 1M1UA 4GF5A 1A9XB 1IOWA 2BKUA 2PMFA 1RT9A 2P78A 1VC2A 1N2BA 2VYFA 2QTGA 1ZPDA 3KQVA 3LUDA 4NV3A 4RLFA 2O1SA 1YVUA 1KQGA 4OCZA 1U8EA 3WDKA 1I7LA 1RAEA 5M3BA 1G17A 4OHFA 3HJHA 4UDOA 3LJKA 4W8OA 3WIVA 3LP5A 1L7OA 1KJ8A 3DMRA 1MD9A 3L79A 1FSFA 3GD5A 4NNPA 3SFZA 3U7FB 1FUYB 3B1ZA 4JVOA 1QOQB 3QKRB 1DHTA 1X7XA 4LWZA 4OGLA 2ATEA 4IIBA 4UU1A 5K8JB 2OK8A 2G1UA 3TTVA 3TD9A 3ZX4A 1Z34A 5J2TF 2UUAB 3ADPA 1WOYA 1I3LA 5LNK1 1XCOA 4H0CA 1U99A 4I50A 4XGRA 5CJPA 1XNQB 2C20A 3ZCSA 2FGKA 1M54A 3EC7A 4G5OA 4MAFA 6LDHA 2AOUB 5LLDA 3NNSA 1ZHOA 2DOKA 4C7KA 5K3EA 1JYEA 3OD1A 4RKYA 1N6LA 2IYPA 4ZZ2A 4NZNA 4BGEA 2GAIA 2F7SA 2ETXA 3GRAA 3BMXA 4RH3A 2BKVA 1OTHA 3MTAA 4LWQA 5IXSA 1QO0D 2LKCA 1DC3A 3HDTA 4BNHA 2ZXUA 1FUIA 1IXRC 3LDHA 2XKJE 3GFTA 4L8LA 4N5NA 5CRIA 3LP8A 1VG1A 1MOQA 2FZ4A 1Y8RA 1EFRD 2J3JA 1GNQA 4GS5A 2JRLA 3PQ7A 4FFVA 1UFVA 4RY2A 4BJ6A 2IXFA 2ABWA 3P9ZA 4L75A 3ACDA 4B7AA 4LWPA 3P4XA 1XO1A 1JB9A 1NVKA 4PXAA 5ICMA 5GOZA 1SULA 1AVTA 2UXBB 1EGMB 5FI5A 1BKSB 1QZXA 2J6IA 3ELYA 5BNIA 5FCDA 5D3KA 4C29A 5HF5A 1NC1A 1I6MA 3KIPA 3R7WA 4OKNA 4AJIA 5C53B 2VDJA 2XNHA 1NM5A 4HKTA 4L8GA 1ECLA 1OOEA 5K9ZA 4FW9A 3P9NA 3CN9A 2F4NA 2CN1A 3C5EA 3EGEA 4G63A 1Z13A 5C1DA 2NPOA 4YAJA 2FPGB 3M5PA 4PTZA 3M33A 3U80A 5JSYA 1ULHA 5HM8A 1PQUA 2YOFA 4OXIA 1KY5A 5CMLA 1A27A 3LCVB 3MJTA 4R0NA 4B3CA 4PLHA 1E9RA 2EJUA 3DA8A 1PS9A 2R11A 3DE6X 5SZJA 2PSFA 1YZKA 1EBUA 1L7DA 3EFOB 4BX2A 5BV2P 3ZTTA 2N1BA 4KGVA 3THYB 3PTAA 2RD2A 1XDZA 3NB0A 5B5SA 5KNCA 4JH0A 3GK3A 1XD2B 3PD7A 4FNMA 4V24A 1CQZA 2WSMA 2X9NA 4NE9A 3SYRA 5CBKA 2R7LA 1Q0TA 1NQTA 1X8JA 3WGMA 3NC1C 4E33A 1E0AA 4MQMA 5DHPA 1OIXA 1R6BX 1RLOA 4DJDC 1OLXB 4QAQA 3RLIA 1JKJA 2P9GA 2FPRA 2VQ3A 5D01A 2CJFA 3BN3A 4B45A 4C0KA 4H6XA 5JASA 2BSQA 2VJMA 1B76A 1L7XA 2VZLA 3QWHA 1DIHA 2BSAA 2HYDA 5BW8A 2K2QB 3B5EA 5I9NA 1BA3A 1SCIA 2IS6A 1UPTA 1C1XB 3ESQA 5CK4A 4OB6A 1KDTA 1T8WA 2I87A 2ZYGA 3OX4A 4J0EA 3VVCA 1H66A 1O3YA 1AG9A 2O1WA 2R8BA 1GUFA 1Q20A 5EQJB 1NTRA 1FDIA 1TX4B 2HBZA 3KXIA 5HNKA 1LX6A 3QVJA 4BPBA 3WWDA 4WZBB 3L7JA 5E2IA 5JMWA 5K6TA 2E85A 3AR3A 2XPCA 3VYVA 1L5OA 5JTTA 1PNQA 1VCOA 5FPTA 3TPZA 5K8LA 3WRYC 2CXRA 5ICSA 2PUVA 1JQBA 1VYUA 4KDEA 3LYLA 2BBSA 4QBGB 1J23A 1E2LA 1WB5A 4YP0A 4LKOA 5A4DA 2JI7A 3K9HA 1QTQA 3BBPA 3EVAA 1EB8A 3A25A 3DPIA 2EIXA 3H3JA 3EX7C 4L9RA 3MTJA 2RGEA 3ILSA 4KVFA 2Q7XA 2YASA 1ZVMA 4ZC8A 2WC1A 5F1YA 3NC4A 4PYQA 2WJHA 2NM0A 5AJZA 3KSBC 3TZKA 4XVCA 1KAMA 3PUVA 1YE5A 5FLEX 3TLZA 2QK4A 3AP3A 3O2SB 1IH8A 3WRVA 3STWA 4H77A 2A0FA 1VE7A 2JFGA 1GN9A 2HOQA 4UVIA 3SYTA 3OCUA 3KLNA 4CUZA 2VOJA 1TYCA 5CX4A 1OX4A 3K3PA 3O90A 4MLDA 1R5NA 2MDTA 4ZVTA 1NUQA 2PR7A 3OBBA 3RK0A 1N2OA 4MWSA 5EXTA 2HMTA 4ZT7A 4I50F 2PLRA 2QP3A 2XBMA 1J22A 2CCKA 3BD7A 2OUKA 2YBDA 3HYNA 1IG3A 3KTOA 2HLHA 1CE8B 5DTIA 1JDBB 4UFNA 3OP4A 5KBYA 2VRWA 4JIGA 3LLUA 5COBA 3SOZA 1T2CA 1KK3A 2NO9A 3I72A 4RFVA 2EERA 2C2MA 3MAAC 3QG5A 4MUIA 1RVDA 1W8IA 2YJ3A 4DLVA 4MQFA 3MRSA 4NE7A 2XDWA 4PZPA 1KL7A 5TMEA 4A2CA 2C2KA 3CMMA 4FK8A 4BMDA 2FPOA 1U7DA 3CINA 5EEHA 3DUFB 4MARA 1GPNA 4LZPA 3V4PB 5E2AA 3WGJA 4P7BA 3KYBA 4FXOA 2H5JA 1P2UA 3FYTA 1J09A 3OQBA 2XE6A 1MIOB 1P9LA 1FP2A 2P2GA 1E2KA 3CCCA 4JLDA 4KIFA 3CYFA 6ADHA 4I8XA 1BX1A 1T2EA 4G5HA 2CJWA 4M9QA 2DR2A 3L6OO 3UA3A 2BR4A 3KT0A 4BKUA 3T1TA 1W6UA 4CCYA 3L4EA 3GJ0A 3PRYA 4QXMA 4P3PA 1QVVA 3OQIA 1DBQA 2C4WA 2RAFA 2WIFA 4GGPA 1ECBA 2C5SA 4LTNA 4A2QA 1OSNA 4ES6A 4FOTA 3KHSA 4REOA 4F6RB 5K4GA 1T34A 2ZS9A 3MINA 1IN5A 2OKGA 3MQFA 3R6WA 3P27A 1E1QA 1L7EA 4MA4A 4RD4A 2XB4A 2P8JA 4DA9A 2OK7A 5C8VA 3L4KA 5ICGA 4RANA 3WLAA 1UBUS 4M36A 2GWRA 1O96A 1WXXA 1PJQA 4AY4A 3TOCA 1K08A 3SXPA 3GHYA 3DOCA 1D2NA 1BW9B 3NIFB 1NL3A 3P52A 3QEJA 2HSDA 2GYUA 4O4LA 3ENWA 5BN4B 3WMWA 2EL7A 3BWDD 1DKUA 4L72A 2AHRA 3HBJA 4P34A 3UANA 5LMZA 2R6FA 4DCSA 1Y9DA 4AB1A 4EY5A 4RLQA 4RTMA 4FB4A 1UMBA 1C41A 2PWYA 1HG1A 1VI5A 3QLTA 2GCOA 2W11A 4LYFA 2PPLA 3S44A 2OGZA 3TE6A 2OB1A 5FWXB 5ENVA 3BTSA 1KYZA 3QMMA 4GIBA 3IR7A 3PTZA 3TQOA 3CCFA 1DOAA 5JC1A 4XX1A 1WBJB 2QYHA 3SKXA 4ALLA 1DIRA 1IN4A 3DV9A 4WZZA 1UOOA 3U48A 3ZDCA 3AF0A 4UM5A 1V45E 2QHXA 3ZHCA 3HR8A 2JEZA 2NSLA 2YWFA 1OHHD 1DWUA 3NKVA 1DMSA 3P45A 5D87A 1SKBA 4CF3A 3LTNC 1VBMA 4QQ8A 2DTDA 3MUOA 4YY3B 1MP0A 4OFWA 1K1EA 4N41A 1GZ6A 4PQFA 4DLXA 4ZYXA 5G3YA 1FTQA 2HFKA 4M1SA 1WY7A 3OQ1A 4HTFA 3D4PA 3C39A 4GQIA 3HVRA 5ERGB 2ZT5A 4F38A 3EGDB 5SV2A 3SJBA 5FA6A 5IM4A 3QVGA 1J06A 3JQ8A 3WP1B 1KYTA 3BWXA 2QBYB 4AJ2A 3T54A 3IP9A 2M6KA 1IHPA 4DR1B 2QRGA 1WCIB 2J67A 1VE9A 3VPBA 5JNVA 4HNQA 4KSBA 1JHZA 3LVQE 1PVOA 1IUNA 1GYPA 4ENPA 2W90A 1Q2UA 2ZRCA 3KJZA 1HM5A 3G8BA 3JAWB 2JNWA 3QPDA 4N0MA 2AI2A 2IX9A 1GGFA 4LHEA 2QI9C 2Y0CA 4YRTA 5F64A 5BYBA 3AI2A 1KMIY 4EW3A 3FNBA 1BX0A 4X3CA 1BH6A 1RQXA 1CNEA 1MV5A 4Y7CA 2OO5C 1H1DA 1R6TA 2FR8A 3GA7A 4KTTE 3SFTA 3UJAA 4EW2A 2YV2A 1F2TA 3VOTA 4NEHB 3LCMA 1L5YA 4WV3A 2IELA 1N8TA 1WZCA 1SCNE 4X20A 3L7CA 1U0EA 2FWRA 2G4LA 4XIFA 3GF4A 3TX6A 2YN4A 3BB1A 1XPRA 4HF7A 2NZUG 1G64A 1H0HA 4YROA 4FEEA 1C4XA 5CCDA 2HA3A 1JLRA 3K8OE 1WKBA 4OV6B 4P58A 4CG2A 2NYVA 3DHVA 3NEPX 1W88B 2KE5A 4QYIB 3ROKA 3UAWA 2V6GA 2QY9A 1VBFA 5EJ7A 1E1RA 2ORYA 2ZJYA 5IAOA 1Q0QA 3QXHA 3N8IA 2W6OA 3LDAA 4C06A 1CYDA 2VF4X 4EENA 4TLDA 3R23A 2NUBA 1T8RA 1D6JA 1LRLA 4ND7A 3WLSA 2HT6A 2AJBA 4IDHA 2AB0A 3IKLA 5TE9A 4F9EA 3A1EA 5DWDA 3CQ9A 2FY8A 3CW2A 4BUCA 5K01A 1M0WA 3PBKA 2CMDA 1FQOA 3LX4A 1CQXA 5H68A 3LNTA 1RHUA 2I4OA 3GFVA 1QPGA 3H5RA 1SCKA 1H1LB 3TZEA 4LVCA 3J81k 1YZNA 4QSMA 3H0EA 1SR8A 1CJUC 1YASA 4FWIB 2B69A 2Q99A 3JRXA 3B85A 1M7BA 3EIOA 1TT5B 4PYRA 3KR9A 3PQ2A 4X90A 3NDBB 2CFCA 1GL3A 1N7IA 4FBMA 4XDZA 1WG8A 4ZOLF 3ZI4A 1ZRHA 1XTJA 4YJGA 1NX6A 2WOOA 1PDVA 3HCBA 3DOFA 3UW3A 4F4DA 1B42A 1AXRA 1PUJA 2O1XA 4MLPA 3SI7A 1TXGA 3STUA 1E1MA 2UVPA 3IUQA 4NBVA 1X7DA 2LCFA 1CZRA 3H3XA 1E8NA 1EFHA 2CJXA 3UG6A 1D5CA 2F9MA 4WOKA 1IM2A 2FEPA 1JEQA 3P9YA 4F2DA 4E5YA 1V11A 1L4MA 4CLHA 1CPYA 2JFXA 5CD9A 3PA6A 5B1EA 4NJEB 1K97A 2PD6A 4URUR 4EG8A 3D81A 3JWPA 1PWXA 1RHMA 4ZVRA 4O8CA 4JITA 5HIMA 3MUEA 2ZWIA 5E6UB 1SQGA 4D92A 2J9XB 3ZPXA 3NP9A 4B2YA 1TK9A 2IWRA 1QV6A 5KZMB 2QY6A 2J9YB 1DC6A 3I8XA 4ZVUA 2ZJAA 1DJPA 1Y34E 4TWZA 1JFVA 3QMVA 4OJQA 2WTMA 1W9HA 4EHKA 4EJSC 3TIVA 1D0IA 4UNQA 1FS5A 3OHPA 2H06A 3L7YA 2ZRMA 3NT5A 1T0PA 1IQ0A 4FLFA 1ZZEA 3NBXX 2IZZA 4HGQA 3WJAA 2VTBB 4MR9A 1G3IA 4IFTA 5FWDA 2WHXA 5LMNB 1X8XA 5K0NA 1TMOA 1E2BA 3W2IA 3DFZA 3LCRA 1XZNA 4JZYA 3OPYB 4QFBA 2XH8A 2HJVA 5JYBA 1IJKA 3NAZA 3KS9A 4IIHA 1X2BA 1LCIA 4ZU3A 5IVIA 3ZE9A 2CHFA 4CM4B 1RP1A 1FYFA 2EFJA 4BE9A 4W8HA 4BVAA 2BEJA 1Z0DA 1TD1A 2P5SA 4BFTA 4AJLA 5DO9A 1JQ3A 3VZDA 1G6KA 1TPZA 3K7EA 4ISBA 2RSLA 3KB6A 2HT1A 2A9FA 3WKBA 5FV4A 5EMHA 1F8YA 1TYDE 2IUTA 4QNMA 3D3KA 2WJ3A 3QWIA 4HHEA 4JYCA 1E64A 1LFDB 4RFSB 5AJUA 1E2GA 2C3OA 4UASA 1O7JA 1X1BA 2WSLA 1BOOA 5TJ9A 1R0YA 4DQLA 1Q83A 1YU9A 4WERA 1H65A 4CTOA 4E21A 1Q50A 2CFOA 2W00A 5FXMA 1MJ5A 1J24A 1E77A 2N42A 3HMKA 2AK2A 2QAIA 3IOYA 1CVIA 4ZT4A 3WGIA 2EEPA 4OD0A 3KP1A 1Z29A 3WLTA 1XFDA 2WFLB 5D5QA 2DQZA 5T64A 2Q2WA 2QAGA 3JQBC 3L7AA 3VKVA 4E88A 3IERA 5TF4A 2E37A 4C4AA 2Q4RA 2PSEA 2CKMA 1EZZA 2AR7A 3EEIA 4NX2A 2WTUA 4YP9A 4JKOA 4OJNA 5T4BA 1R4MB 1W25A 2XB6A 4PYLA 4ZAVA 4AK9A 5KMGB 4FIZA 5EJ5A 4JYBA 4LSGA 4EOGA 4YRNA 2PXHA 4LE0A 5J58A 2PSDA 1Y98A 3R40A 4ND8A 4TMYA 5B3JA 3TLCA 2G1KA 5EJEA 4LXIA 2AI3A 4BRSA 2PWAA 2WFZA 3KEFA 2HRCA 4KAXA 3K4HA 2ORED 1BVRA 1H69A 1ORHA 3DYBA 3SQOA 3IUSA 4LJLA 3CUKA 3QVKA 2EWWA 3RAGA 1DAKA 3JD3A 5FTLA 3HRHA 5EMMA 2BFDB 3URMA 2JGEA 3D2AA 4EYOA 4WXPA 1UAAA 1G1AA 1PTKA 1FNDA 1P39A 1UF9A 4ZQCB 3OSUA 1WUYA 1B6GA 2GPNA 1XR3A 2AE2A 3WBBA 3G49A 3O31A 1JA9A 4FHZA 2R60A 4KTVE 2MSDB 3O4GA 4HL6A 4TLEA 2X5JO 5JE8A 2CK3A 4HXFB 1NXPA 3R74A 4EBFA 3VO1A 1CP2A 3KKQA 4ALMA 1AMOA 4OHCA 2YVLA 4HCJA 4KAJA 1ITZA 3FM9A 1UBNA 4MH0R 2TMDA 1QFXA 1JSLA 2OD7A 4XD7A 2DUWA 4C0WA 5JAZA 3HO1A 3HYSA 2HLDD 3DCIA 4YREA 4XFDA 2B4YA 1UBLS 2JLVA 3BMQB 2C3MA 4LZLA 4R9UC 2H7XA 4IH9A 4CKBB 4ZIRB 4IVRA 3O75A 4L0DA 1EFVA 5D00A 1R00A 4DDHA 3TOVA 3Q9UA 5IVDA 3UJHA 2RGAA 3PQCA 3T0FA 3JATB 1NJ1A 2OYRA 4EQ6A 1T2UA 1WZNA 3U3ZA 1U3WA 2QN2A 3DT6A 1NOIA 4KEAA 3W06A 4CFYA 1CD5A 5I7HA 2CV0A 1EX1A 2VHXA 1J2TA 5ALSA 3QG1A 4GH5A 3U17A 1CZNA 1XCPA 4JLKA 4UHEA 1PZHA 2I0FA 5IJZA 4DCNA 4D3FA 5BQ5A 1RWMA 2WF9A 4Y9UA 2GBGA 4OM7A 4QEZA 1E3LA 2G70A 2WIJA 5AKLA 1P2SA 1QRSA 1ZD3A 5CDTA 3NETA 1LVHA 4MQ6A 4PNHA 3HHEA 4RF2A 4DREA 5DXJA 4TSKA 5DSTA 4Q3EA 2EJVA 5JQGA 4NONA 1ZCBA 3BAZA 4YP6A 3QBDA 1L5MA 4COOA 2QENA 5JSZB 2B36A 1DX6A 2H2HA 2GRUA 3D4LA 3RU7A 1RRFA 2TS1A 4RACA 3W7VA 4PQYA 3K9BA 1THGA 4N54A 2II6A 4D80A 1KRWA 1UBFA 2F1RA 5HFJA 1B8VA 4FQ5A 1YU6A 2FFRA 4MW6A 2J5QA 2KB0A 4PSCA 3UJBA 2W2KA 5B3LA 3FOBA 2OHIA 3I28A 3IIEA 4WEOA 3ZDBA 2NX2A 3RBVA 2W2OA 3T5CA 5IX8A 5DTQA 4DXAA 2P79A 2QA5A 3ZDRA 2FX5A 1E5LA 3MCUA 4M1WA 2Z6VA 1C2TA 1JEDA 2WW8A 4KQCA 4GPD1 2C8JA 3AR9A 5KJEA 4MI6A 3AR7A 1IYZA 4DM3A 4RVCA 1DCTA 2ZVPX 1SC9A 3CRZA 2QQGA 2NLOA 3GRKA 1USWA 4B6RA 4DADA 1YVRA 4O3MA 1E1QD 5JNUA 4ZHSA 4Z4CA 2FI1A 2VYNA 1MXHA 2BEUB 1DOHA 2JBHA 3DMHA 4U6SA 1CS0A 2FMKA 1EP9A 2WLTA 3PNLA 4EDFA 1DAMA 1QX3A 2KSQA 5ALXA 5EE1A 3PWSA 1Q1NA 3U7JA 2JFHA 2DBZA 1UKAA 5E3JA 1KRHA 2WF7A 1WU7A 3REGA 3UCFA 3FTCA 1T25A 4FOPA 1E62A 3OWXA 3B7PA 2P68A 3FZEA 1YZQA 1LLCA 4ITVA 4MR8B 4NU8X 4GM1A 2C2WA 2Y0EA 4MVJP 4FBGA 1F06A 3VUFA 1WE2A 4I5EA 4K26A 3ER6A 1Q0SA 3OZVA 3TSWA 2C5FA 4P53A 5CVDA 1Z33A 4HLCA 4EJ2A 4UUBA 5CM9C 3TMYA 3QU9A 1QG2A 3EXFA 1QB8A 2NXCA 3LOQA 4FMPA 1T0BA 2XITA 3RT7A 4EI2A 1E4EA 1W1UA 3H17A 3OVMA 5FBZA 4W1PA 4B76A 5IJ9B 3JQRA 1OF1A 2XXAA 1BMQA 2WYHA 4XSGA 1OE0A 1B6SA 1RIIA 1Q1GA 4RMNA 3PLRA 4RIEA 3GA0A 3OJEA 5JV5A 1NMZA 4OBWA 4D3SA 2I9PA 1BE6A 1E1NA 1NM5C 2ODNA 1XCLA 3KZNA 1KJIA 5F2NA 3BILA 4UUQA 2EW8A 2JFYA 3OC6A 1KFKB 1YS2X 2VBGA 4I5GA 1W2WB 4GL4A 3GCWA 1K9SA 4PGMA 1XU4A 1M2KA 2QGZA 3ZCUA 3KU4A 2DMRA 4UUMA 2GYWA 3R3ZA 1WLYA 3HACA 4KW7A 3PWZA 3L1KA 2HJGA 4YQZA 2GASA 2AZ4A 2LRHA 3KU1A 3P0RA 1NFQA 4N5LA 4KQKA 3E7PA 4MWBA 5KEIA 5KNBA 2BHRA 2PHZA 1RXWA 1Y5RA 4D02A 1O58A 1P2TA 1G8HA 3R1IA 4BU0A 1QB7A 1IZ9A 2OE2A 1E79A 3ZHZA 4BVLA 2F59A 1AA6A 1VKOA 5LNK6 1KMNA 3WB2A 5HEKA 1GO2A 1P44A 5BSEA 5FPKA 1RPTA 5FOSA 1C9MA 3AFGA 1AQUA 2JI6A 1GTL1 4DEYA 4E2ZA 2QL9A 2WWIA 3AP2A 3QVLA 4WI1A 2FN4A 3AGPA 3E3MA 4GGMX 3VTFA 1YKSA 3F6YA 4F4IA 1MB2A 4JLJA 2YRFA 5IT0A 3ETJA 1MVLA 3E3NA 4TKVB 3AEQA 3PC7A 3HCFA 3RV4A 1XSEA 4ZK2A 3ZZ0A 4HJXA 4GSKA 3FRJA 5JCXA 2GVDC 4IDPA 4E30A 3FYUB 1K7SN 3LUCA 3O0DA 1UADA 1EK5A 1L8AA 2G9RA 4IDQA 3NRCA 2WVJA 4QXQA 5AYVA 1E1RD 2X4IA 3WMFA 2FF5A 2J3MA 2MMCA 2B98A 1A5SB 1HK7A 2AZMA 4KX5A 4KLZA 1J5PA 1VLJA 3CHYA 4D0NA 1UJBA 1DE0A 2JGFA 3CLSC 2OA0A 3VZBA 2XUAA 1UM9A 2G7MC 1YH3A 3I5MA 5G4KA 2VCYA 4IRMA 4NG4A 4DHEA 1ORIA 4XWOA 2LPMA 3OOHA 5ED0A 4BZWA 1F48A 3IPCA 5KWIA 4AAYA 2PH1A 3AVTA 5JQGF 4OHWA 4C2UA 5JO9A 3O2NA 2AXPA 2HA7A 3GCGA 1PLLA 4IIFA 3GGPA 2Z1MA 3K2EA 5EP1A 1U3VA 2ZR0A 2VAPA 3LU1A 1DL5A 3SQNA 2DJ5A 5AJVB 3U40A 1CLEA 4MOWA 2BW0A 1M1ZA 4BO6A 5FBWB 2Q6KA 3JTMA 3RJMA 4QGAA 2C7PA 2Y68A 3WC4A 1NU8A 4LV5B 4D96A 1EP2B 1WMFA 1XN4A 2NU9A 1JVNA 2R3SA 5FTJA 1UIMA 1G20A 3W6ZA 4HUTA 1U6JA 3EBPA 1CY2A 4LISA 2VJPA 1JIIA 3LUKA 1E2DA 1X14A 3LBYA 4ILKA 4A0GA 3HEBA 2Y05A 3OPVA 2AH5A 2VCEA 2PT6A 3I6QA 4JODA 4RK4A 3SE7A 3U7RA 3R7SA 5FA5A 1WBDA 3JYLA 2PUAA 5D84A 1MC8A 2XQVA 4A8JC 5J1SB 3CX8A 3GFGA 1XDBA 2XEXA 1BXKA 2WHRA 3ONNA 1WWKA 2Q5JA 3A70A 4IX1A 3SU8A 1TIBA 2IWHA 4GMKA 3TRHA 3H4MA 1FE8A 2BP7A 1S1CA 1E20A 4RWEA 3AEZA 5IDVA 5TQ0B 1KQNA 4NR0A 1EK2A 4MP3A 5LXTB 3OETA 1EQ2A 4TYQA 3V4FA 4RJLA 1XDUA 1TM3E 4EHAA 7GPBA 3RIGA 4P2BA 2F1IA 4EYSA 1C8LA 1Z15A 2JAXA 2BT4A 3RKRA 3PQ6A 2JGDB 1A9XA 3WYAA 2VKTA 3LUHA 4LNAA 4II7A 1RXYA 3B78A 3C8MA 3DO8A 2RHCA 5ER6A 1I6WA 2AN3A 1JEOA 2ZB4A 1ZK4A 3JSXA 1JTEA 1KO1A 1K92A 3D1JA 2WRZA 1FK8A 3QVTA 4RCYA 4D25A 3CH5A 2XNKA 4LA4A 1M1YE 3TVDA 3IIKA 1Z08A 3FI0A 4CF4A 5KWVA 3ODPA 1NVEA 1RI1A 2B92A 2WV9A 2R7MA 3PFGA 4J0KA 1RAIA 5ER9A 5JD3A 3TEFA 1ZI6A 1R5JA 4X65B 2RHHA 3QKRA 2UXDB 2OQIA 4OQDA 3OF3A 3UT5B 5AM1A 2WT4A 4WOCA 1NVUQ 5KWEA 1L7AA 1Q17A 1SVWA 4L6CA 4OBEA 3U4DA 2RDMA 1WA5A 3W1VA 5B64A 2BJVA 1PEYA 2ECKA 5C51B 1ARZA 2DT5A 1KEWA 2H85A 2NU7B 3MJVA 1NXXA 4BFCA 3L41A 2I7XA 3OH8A 4E5UA 1CCWA 4FZ5A 4LBWA 3U0VA 2WFAA 1FP4B 2PEYA 4OXQA 5HGXA 2ADFA 3LS2A 5DJ5A 3S4YA 1ESZA 5SY9A 3SFVA 5I01A 2WIGA 1UDCA 4WY5A 2WPNA 3JVDA 1QYCA 1XK6A 3T1NA 3N28A 5L3QA 1BE0A 2FUCA 1ACMA 2ET6A 4BMCA 2NAFA 1KNQA 4R7TA 2HIAA 1NF3A 4S1NA 2PE5A 1YHNA 3KEOA 5JS6A 1E2PA 2VPZA 4EVIA 2AG0A 3N59A 4Y67A 2EJBA 5JAOA 3ML1A 3WWEA 1PJSA 1PK9A 3C87A 4QJ5A 2Y1GA 3IR6A 5JZMA 2C7OA 3NUQA 5BRJA 3VYSB 4X92A 2BI8A 1FS6A 1XRMA 4IHJB 4PICA 4QBHA 3GC6A 4BVFA 3R3XA 3RHZA 1XD8A 2GNAA 4Z9BA 3PE4A 1GZSA 5F35A 1F12A 3ZNNA 5AM5A 2X7JA 2LCQA 1P4JA 3DZHA 3MWFA 4GW3A 3L6UA 2P2SA 5DOZA 1VYVA 2WVAA 3L7MA 4PYOA 3L1VA 2JBAB 3VVBA 4A0FA 3FTFA 4IQ0A 4CR8A 4MPTA 5BQPA 3ROMA 4DC1A 3GRRA 4M46A 1HEYA 3DWGA 5IUKC 3FAKA 3FOFC 5CM8B 1SNYA 1Q7RA 1U98A 2F1KA 4H35A 4QFDA 1GQOA 3FPAA 2QLLA 1OPXA 3H87A 4RSGA 1SCQA 1P5JA 4O0LA 1P9WA 2PRIA 3S68A 2CD9A 4FQ7A 1RJ9B 3ZLBA 4CYMA 3PUXA 3G02A 1E6UA 2AA3A 2A88A 2HV8A 3EBLA 4NOMA 5CT6A 1Q7TA 2CXHA 3QPCA 3DPUA 3NYWA 4E09A 1CW2B 1DKPA 3EFOA 4TKMA 3WX0A 2VPPA 3DZFA 3TBKA 3THYA 1QRAA 4AJJA 3O82A 4FCVA 1UQTA 4MQ4A 4V0NA 3G0HA 1POWA 2J0QA 1N6KA 1XD2A 4G26A 3H9BA 1DNPA 2NO0A 2REBA 1IPFA 3QV1A 2CK3D 1QIIA 4EY3A 5LZ2A 1WDTA 4KUHA 2JAQA 1LLFA 3L6CA 4Q37A 3O0TA 1NVVR 1JSZA 1OLXA 1PL6A 3IBTA 3G2JA 2DR0A 2Q3DA 5EERA 1JDPA 2XTNA 4QUHA 3VPHA 5CLFA 3Q72A 2FR8C 2XUKA 4XD7D 5JALA 2B6NA 3MT0A 3O2JA 2JLCA 3GLUA 3L8MA 2DC1A 5AW0A 2C5AA 2WU8A 3ZU2A 1N2GA 1XTKA 2VJNA 3QV2A 3UJCA 4C1BA 4JJ4A 2C7QA 3FG9A 1C1XA 1CZLA 1SVUA 1TK3A 1R0XA 3A4IA 3NWPA 5EZYF 1DS6A 5A03A 5KOHB 4CM9A 4ER5A 3T9BA 3IRVA 4AZ3B 3X1XA 1E9BA 5HJEA 1N92A 2DFVA 5FTKA 5M04A 5J9FA 1ML4A 4OBBA 3AO0B 4N5DA 3DM5A 4BJ3A 2V4MA 3ZCVA 4BMSA 4F92B 3PEUA 4XIIA 4ZN6A 1OXUA 1SWWA 1ATIA 1J2RA 2OTCA 1VMDA 4L8FA 3VNBA 1JHVA 4Y9RA 2X4LA 1C7JA 4LXQA 4U6NA 1QTIA 1C0KA 1RHJA 2QE7A 1Z7GA 4TV8A 4XLTA 3E9CA 3FNRA 3GUCA 4L50A 2WUDA 2RH5A 3VDXA 5KIAA 3DKPA 3R3SA 1VB5A 1XV5A 2YZ7A 3JD4A 3N0TA 5G0UA 1P1IA 3T7JA 3DMYA 4EA6A 1OAAA 2FQQA 1OMOA 1KP3A 5D3QA 3GP5A 1M1NA 4KGZA 1U65A 4N7RA 2QX7A 4QDTA 3RUPA 3U60B 3PHBE 4IJQA 3RS5A 1J2UA 1J5XA 1JR4A 2AW5A 4NULA 1G59A 2ZU0C 3LLMA 5DV9A 2PRJA 13PKA 2FVYA 1XKTA 3I4CA 2VXOA 4WSOA 4KP7A 5K6RA 2NV6A 1HQCA 1QAOA 3M89A 4GZ5A 1NLZA 4PWYA 4YV0A 5C32A 1ZGBA 2ACWA 3U4QB 2VJOA 1MEOA 1QH1B 2Y1WA 3G2LA 4DIEA 4RZ2A 4RY8A 4RTSA 4Z4EA 1SBTA 2BGRA 4OK6A 3L5KA 4RPHA 1OZGA 4C3OB 1X92A 4F7WA 3BXOA 2AZTA 3GBSA 4YT5A 3WK8A 4WJKB 1OB2A 2FZLA 1A1VA 2Y1LA 1H22A 4UU7A 1X9HA 2O07A 3MB5A 1CE8A 5J4VA 1P19A 3TF5A 4JD5A 2GBPA 3OMXA 3R4CA 3ZQJA 4B87A 3R3YA 3M9LA 4OHXA 2VYND 5I5GA 2HF2A 2C95A 1Z6QA 3F3SA 3D6NB 2VZ8A 5HJ5A 4FDUA 2OAP1 2XWQA 4G86A 4UVHA 1Z4QA 4LS3A 4E70A 4UM9B 1PUIA 1DUSA 2INGX 3K70D 2ZI6A 4MUFA 2CLIB 1O6GA 1UQRA 5KTKA 2YWHA 2GEJA 1QHFA 3DKIA 1NVAA 2EW1A 3KJIA 5I47A 3GLIE 4QM6A 3DUFA 3Q7EA 1GKUB 2NIPA 2WA2A 2X42A 1WDLA 1H3FA 2WIKA 1RYNA 3C3DA 5E9WA 1TRHA 2RGCA 3W7BA 1IHUA 3A6EA 1MRSA 1XTUA 2QV0A 4KI7A 2W6JA 3EZFA 3BTVA 1CKEA 4F3KA 1T0UA 3OF2A 4L0QA 2FRDA 3T7KA 4PLWA 3V80A 2YOHA 2A78A 4H08A 4W5QA 4E4RA 4LFAB 1JDUA 2J08A 3NNDA 4FFOA 3EXHB 1O5TA 4OHBA 4OYRA 4TMKA 4Q9DA 4RS4A 3H16A 3T5TA 1P2BA 1ZYUA 3PICA 4HUJA 2ZAYA 4C7XA 2HJWA 5IZ4A 2OSVA 1EGQA 4F6RA 3JY6A 3K16A 1IB0A 3ROZA 2IPMA 4HQOA 1C81A 1E7MA 2N75A 1ID1A 3KSRA 4YFYA 1FSPA 3UWMA 1ZM4A 3KEQA 3EASA 2C5HA 4W1SA 4F2WA 2GN6A 3RSSA 3G2KA 1EWQA 2ZSIA 3HDJA 4PC3A 4ZAYA 3ROFA 4HH0A 1BW9A 2WWYA 3EF1A 4TTQA 5EEGA 4OMUA 3L92A 4RADA 3WQQA 1Z73A 1ODIA 2QM7A 3R8XA 3NFRA 3VH2A 3IP6A 4RMIA 2LW7A 5BN4A 5IU6A 5KNBD 4WLUA 2GJ8A 2Z56A 3O7MA 2C96A 2XNSA 3N2IA 3EQ8A 4G2TA 5KX5F 3DEJA 3O2QB 4LZAA 4AZ0B 4GR4A 1E79D 4M1EA 4OXXA 3RG8A 1D7OA 1Q19A 3T5MA 5FWXA 2GM9A 1ORRA 3FLBA 3WGVA 2FU5C 5GGXA 2ZYIA 5CG1A 3D59A 5JAIA 2ZGVA 4XGQA 2BR3A 4TTAA 3DJFA 3AZOA 4G0MA 4OXYA 5AHXA 2V8OA 1II0A 3HRIA 1Z0UA 1ILWA 1K8YB 1S4MA 4HQLA 4Y2JA 2C2BA 3DZBA 1OBFO 3JWHA 1G5FA 1Q6ZA 5I6DA 2FP4B 1RJWA 1U3TA 2AOTB 1DBIA 2C77A 3T6KA 4E2WA 1MAHA 5HKOA 5IFKA 1XRJA 4RY0A 1KIAA 1TTPB 4I9FA 3BDIA 3VQTA 2R8RA 3ZWKA 4TWIA 1AO3A 1JVSA 1OAKA 1Q14A 4YLGA 5B1SA 1T13A 2EU8A 3B2NA 4GR9A 4R2IA 3UAOA 3QE9Y 2GPTA 1P4RA 2OFPA 2HGSA 4W7HA 3RK4A 4DJEC 2ANCA 3GPBA 3EGDA 4NCJA 4M8LA 4TN5A 4PYMA 3UB4A 1IVSA 2ZKIA 4HB3A 3S40A 3RSGA 2QBYA 4WOPA 4TV8F 4NOJA 1A71A 3VHRA 1WCIA 1VSQA 2C9CA 2ZTMA 2GPBA 2JAHA 3IAM1 4YUYA 1K66A 1E3WB 3DEKA 4MJ7A 4FQ8A 3JAWA 1QSGA 4X71A 4E2FA 7REQB 2IZOA 4ND4A 1Y9AA 1O9HA 1Y9JA 3UUEA 3QXXA 3PFKA 4UTPA 5I4BA 4RSHA 1ONNA 4INPA 2X7HA 4YJKA 3DVQX 1XJQA 1S2OA 1QH8B 2G76A 3E03A 4QTUB 2FWIA 3HGTA 3KQWA 2UUOA 3CY6A 4HC4A 5KHOC 1Z6ZA 4U5QA 4KPYA 1R8SA 1EA5A 4MNTA 4HDNB 2V7XA 3V9PA 3PGJA 4YAEA 2VTEA 5KQSA 3HB1A 4DAOA 1UXOA 1GPWB 2D8MA 4FSHA 1BCRB 1KO8A 1BAPA 2EWMA 2VK8A 4XJTA 3ZGNA 4QYIA 2VUIB 1NONA 1W88A 3O9VA 3Q5GA 1EXWA 3A1CA 2EHJA 3BIOA 3SE0A 2B94A 8ATCA 3HUUA 3BHJA 4PC2A 1G3MA 1A04A 2CB0A 3S2SA 3OIGA 3X0DA 4NNJA 2FUNB 1DQZA 3OE5A 5JCOA 2VNKA 1CVRA 3M3DA 2C03A 3TFQA 3NI2A 1VZ3A 3EVNA 4Q3CA 4MP6A 3H1PA 4QVIA 4YRCA 4D9MA 3SKVA 3LT1A 2BFOA 3L0BA 4AS2A 2VHUA 2ZSKA 3H1TA 4N8SA 5IBRA 4E51A 3Q5EA 5GVSA 4DR7B 4GL2A 1H1LA 3A4NA 3GH3A 2A1IA 5IYZB 1CJMA 4UTZA 2YZMA 4UATA 3OIVA 3I92A 3W2TA 2WNIA 3S7ZA 4BP1A 3HXLA 3MHPA 2QTVA 1TM5E 1FSSA 5JMOA 1NBMA 4X3PA 1DIBA 1ZL0A 1GRRA 1GR1A 4LDJA 4OSOA 1KMQA 3E4CA 3PJGA 4YAKA 1H3NA 3PLNA 3KYCB 1WDMA 1E98A 2KLHA 2KYRA 2UVDA 2VWGA 3GEPA 3PC6A 1WPGA 4HDAA 2IH4A 1XDWA 2Q0HA 3D6HA 4BMPB 4Q1VA 3TUIC 4XB1A 2QRUA 1SUIA 4JB3A 1Q12A 1U2SA 2Y1KA 3IVXA 4CKEB 1FSZA 5MF6A 4TXHA 5FPQA 3VC1A 3KOXA 4NH0A 4YMVA 1WMEA 2EKPA 2CEAA 2WWVD 2IGTA 2XBLA 3VTAA 3IJ5A 3V4VB 3WYNA 4BPRA 3DXXA 3GGGA 3OU6A 4BLWA 3FHTA 4ZVQA 3CUWA 5B6IA 4Q9JA 3VV3A 1G0NA 4B74A 4ZDJA 3K70C 1X1TA 3J81A 4R9RA 5BV0A 2IYQA 2CBGA 4B47A 2I4IA 3SLKA 1Q1BA 2XOXA 2XQKA 2HCRA 4WLVA 3ZY6A 3HN7A 1SEVA 4Y2QA 4D9GA 3AF4A 1QG4A 2O57A 3ANTA 3S27A 1PD1A 4F56A 1XZPA 5D6OA 2Y3IA 3V7UA 2AMJA 5LZ7A 4MGEA 3NANA 1BCSB 2QP9X 1OROA 1ZEJA 3MXOA 1U81A 4KIGA 2VTBA 1BD4A 3BWMA 4YJ2F 1EXNA 2CYAA 3H1EA 3ANMA 2YMLA 3M6LA 1WLSA 5BNTA 1M3SA 1PG2A 2CDNA 2JFNA 4LYEA 3LWBA 2D06A 3D1LA 1IZYA 3QKSB 1XLUA 3IP3A 4JVSB 4N12A 3F3MA 5EKXA 4AT1A 4WEQA 4DLAA 1M76A 2Q0XA 1SUWA 3KX2A 3V4ZA 4B0OA 2ZBPA 4HDQB 5FBRB 3DTVA 3K20A 4UNRA 4PAWA 3JZAA 3B48A 3G5TA 3WVNA 4RTNA 1MEJA 2PKXA 3DC7A 3H9GA 4R6WA 4H4EA 4IJUA 3TRFA 1FTNA 2P9BA 3QW4B 3GMTA 4F7DA 1M2WA 1Y9ZA 3RT9A 1GLNA 2XQGA 1LXCA 5JY6A 5AVQA 3FOEC 4MUYA 1E3TA 2AR0A 3L18A 3OFJA 1I0IA 2JRCA 3AI3A 3PRHA 4MV6A 3EF3A 1ORDA 1P45A 3UXYA 4QZVA 3X1KA 4FE7A 4KKXB 2J6HA 2YXPX 3T06B 4EUHA 2GCEA 4MV9A 3A31A 1XWWA 5BV8A 2GM5A 3I1JA 2AFVA 5LVAA 1A98A 3N2LA 1P8JA 1X94A 4L5IA 2PX0A 3N2EA 2WFLA 3I6YA 4C4XA 3OZ7A 1KO5A 1HETA 3MS2A 1CJSA 4J0JA 1FW8A 5SY6A 4MS1A 3WKCA 1FYDA 2ESRA 2QM8A 3K5PA 4US0R 2V0NA 3OFSA 5AUNB 1HDYA 2Z6QA 3HBMA 3U3OA 4BATA 1GFWA 1L7MA 3EFEA 1QTNA 2NSHA 4P80A 1R4MA 3OUUA 4OA8A 3UT6A 3IPRA 3KD2A 4KUEA 4N65A 3OMLA 5A5GA 3VJLA 5KMGA 4ARCA 4QU5A 3NBMA 2QRHA 1T9HA 4CM9D 1CUBA 3EG9A 5FBLB 3ROPA 2QZSA 5IS2A 3DEIA 2R6CA 2F3PA 1LPSA 4RKEA 4UW9A 3JR3A 3JZDA 2QMHA 2ZJ2A 3ORRA 1YMUA 4FGJA 4HYQA 4IDFA 4QHTA 1KK2A 4LG1A 4Q00A 1SBZA 2I6QA 3GEBA 2DPXA 4BZQA 1ISSA 4WK4B 1BMTA 3CUUA 4ISCA 1FUKA 4FR0A 3P20A 2R8OA 3UM9A 2P6RA 5ENZA 5KQRA 4GNRA 3S3TA 3ZUPA 3R5HA 4P5PA 4TS9A 1KEEB 2QE7D 3K96A 4XDGA 2BFDA 4ER7A 5FKJA 1FP1D 1UPFA 1RHRA 1Z6GA 4AP9A 1XPUA 2COEA 3ZZNA 3AG5A 2B8JA 3NBQA 5C8DA 2B7CA 1CVLA 5LD2C 1XRQA 3JQPA 1PG5A 2ZRQA 4N40A 3UXHA 4BLVA 1AJEA 3D8RA 16PKA 3STTA 1YZHA 3SS8A 3RV3A 4AS1A 3UGQA 1R6UA 3A0RB 3N74A 2O52A 3LX5A 2H0AA 4HDSB 3TB4A 1DC4A 2C07A 1QH0A 5J4KA 2CNDA 4Z4IA 4X91A 1LJUA 3R5KA 3JZMA 2TMYA 1SBIA 3H6GA 1PLJA 5AJXA 5ALZA 4ARUA 4MWCA 4CKBA 3HNOA 3ODGA 4DQXA 1OD6A 1EGAA 4J1TA 1GAJA 1NBWB 1P60A 2A35A 4R01A 2I33A 3PV0A 4EUKA 3O1LA 5REQB 1ZQ1A 3Q3VA 1Q2XA 2XOEA 3ZX5A 3AVPA 5AWFC 2AFHB 3JATA 1FFDA 4A0HA 5D3ZA 3V7YA 1KOGA 1CFJA 1W76A 3GEDA 5C4GB 5JANA 3D0RA 1G8PA 3KJQA 2O8BB 5HK9A 2QPAA 1UBHS 1VIAA 5EZ6B 3BSFA 2P9HA 3WSVA 1W5TA 1CRQA 3L46A 3DLCA 2I76A 2VA9A 2AKAB 5EA2A 5EN4A 3CBQA 4QHYA 5KI6A 1HSZA 3ZY5A 2RC6A 4EG0A 4H4CA 4G67A 1EESA 3CF2A 1ETUA 5DSXA 2PRYA 4UC0A 4PW0A 1IONA 1PL8A 1FVXA 3FOCA 3PR2B 2ZWAA 3GYGA 621PA 4EG6A 5JSZA 1E7WA 4H59A 3VPFA 3DM9B 4LCJA 1SVOA 4HV4A 4CDRA 3QYPA 1IB6A 4X85A 3U31A 2HTFA 2PNFA 2I3BA 4JELA 4KPGA 4PVCA 4W9RA 1N1MA 1BQ3A 1KVUA 1V48A 1NAHA 2W6JD 3H97A 4WIAA 4BXOB 1FFYA 1E63A 3ASVA 2YMPA 2VAWA 3SSMA 3TM5A 1EHCA 2P9YA 1ZOSA 1ESDA 2XGGA 2WTEA 5COAA 4PN7A 2Q3LA 3AYZB 3BFVA 3MJFA 4LGCA 3SHWA 5L9AA 3EA4A 4X8LA 1R2QA 3CRMA 2VYVA 1A5BB 4WLFA 3EIFA 2OCPA 1TM1E 4ZYWA 1ZNQO 4K8OA 1NP3A 1XBTA 5E6SB 3ZH2A 1LDEA 5IJWA 3LT4A 3QF4A 4YP1A 4X44A 4G41A 5EIOA 4EB0A 1VJCA 5BN5B 1I5RA 3N0RA 2GZAA 2R48A 2NO1A 2BEUA 3IBFA 3JD1A 1GPYA 3NALA 4A3SA 4BFZA 2AG8A 4Y0NA 5HOQA 4QM7A 3ND5A 1GTVA 4JC4A 1ZJJA 3L0ZA 2MCFA 4JNCA 1DKMA 3LL7A 4J2HA 3ZCPA 4QSHA 2XMSA 3VJRA 4IQ8A 4AO7A 3LQ2A 1OXMA 4MR8A 3WNVA 4WFIA 1GQQA 4RKWA 3D6TB 3RQSA 5HZMA 4QUEA 2ZRFA 5CJJA 4YRDA 1C8VB 2FWAA 1YUBA 4HAWA 3WS7A 3AIIA 3UWOA 3RREA 4Q1DA 4QPPA 1JA0A 2XCTB 4F4FA 4J6EA 1JFTA 1NG1A 5IJ9A 2D5CA 1PNVA 2Q5CA 3EUWA 2R4QA 1GQSA 4IFIA 1F2VA 3AQ4A 1I4OA 3IALA 4RH1A 5TGDA 1PAUA 4FUTA 2JEOA 3AFOA 2X8BA 2NU6B 3VHXB 2GFQA 4JUCA 4U2FA 5MGNA 4IMPA 1FMJA 1SZJG 4JJKA 1XQYA 4ENVA 4ZDIA 1OB5A 1KF0A 4BBAA 2ECFA 3M1LA 1YDEA 3R0VA 1Y6FA 1PR1A 1HQKA 1TB4A 1P5RA 1ZK3A 2FPIB 2I1QA 2Q6IA 1KARA 2WP8J 4HMQA 4R4JA 2G67A 3UXMA 5TEVA 1J7JA 1K3UB 1I7PA 2HSZA 3H11B 2YTZA 3I0ZA 3GVIA 4BZZA 4H7DA 2CZGA 1IZZA 2JIMA 3KXKA 5JJ5A 3EPJA 3L49A 3ETCA 3VU0A 5JY1A 3AB7A 4G65A 4NMWA 4TTTS 3QUQA 2Q6TA 4JR2A 2CMKA 4TLBA 4MW2A 4P22A 4RVDA 5E1MA 4DV3B 3M1YA 3SM9A 1QQBA 4DWVA 4ZYTA 3OQPA 3FUWA 1U8AA 3L82B 1R8JA 4FXPA 1QBKC 2PL5A 4HTAA 4CFZA 3EXEB 3SIXA 2UUCB 2QLTA 4D9FA 2VF7A 3M70A 1ZWLA 4TTIA 3ZU3A 1YJAA 3B1VA 1OTXA 3PR3A 4OQNA 3T1QA 1Y81A 1YOVB 3MWYW 2X3FA 4HAIA 4J6FA 4TWRA 2YXBA 2IYUA 1XG5A 4KFRA 5TXGA 4DT1A 2BIFA 2I2BA 3KVYA 3D8SA 5GZ1A 5LWQA 4BV8A 4YN3A 1Z8NA 2OWDA 3QY9A 2DT8A 5IANA 3GDOA 4TKVA 3SLGA 3W6PA 2CKDA 6YASA 1UJ4A 2PJZA 1IJBA 2OCKA 5DIFA 3K9LA 3KKPA 2OC9A 2WG2A 1ODLA 2H1HA 4P3KA 5F77A 4C1NA 4FFSA 2OILA 3UV6A 3W3AH 1OR8A 1K0UA 2ZIXA 3FYUA 2HCTA 1B14A 4N3BA 2KMLA 1OWLA 1TM7E 4L73A 1B0AA 1B0UA 1Y1KE 1VIVA 3NHWA 4U00A 1BNCA 2XIJA 1W19A 1Z07A 4MHOA 4QIHA 1QGYA 1WNTA 1I1NA 1N7JA 1DBRA 1W44A 2VP6A 2CD7A 2XMBA 3DHEA 3KJXA 4JB2A 2O14A 2I4LA 2A3NA 3HO6A 3MOSA 3PDIA 5ALMA 1CQPA 3MXTA 2FFQA 5CB8A 4J9UE 2GCIA 2ORIA 4TGLA 1ENZA 1HE4A 2FXVA 3PI7A 1O4VA 5GJBA 1J49A 2QW8A 1L6IA 3UICA 1XTRA 4K81B 1KAQA 4LJSA 1DRJA 1OASA 2GESA 4FJ0A 2H2DA 1NT4A 2W0SA 3A6GA 5HE9A 4ACBA 1FQKA 1VP3A 3PT5A 2X5XA 4YWJA 1KPIA 4MICA 2JKYA 3I64A 5FH9A 3GD7A 5G40A 1ZOLA 2HNBA 3QGMA 1OT3A 4AJ9A 1HE1C 3GFOA 1XKLA 2OV8A 3LUPA 1NBMD 3R3UA 3W1EA 2IL1A 3R6LA 1FYEA 3HY6A 3CM0A 4ZT6A 1GAXA 4ZCMA 2Q3HA 4XPZA 3MB8A 4RZHA 3D31A 2CZCA 3D8TA 4IXWA 4X61A 4ZYZA 5KTYA 2C0CA 1ZH6A 2NO6A 2YXNA 1HL3A 3PB3A 5C8YB 1U2RA 5ULLA 3BT7A 4MEJA 4WFQA 4D9BA 2QSZA 1CDZA 2O48X 5KYGA 3RS3A 1WHSB 1HWYA 1KH1A 2I78A 3ABQB 4LJ6A 1JDBC 1H85A 4DYDA 1XVAA 1ORWA 1ZD8A 2IZ6A 4DUYB 1P6QA 1Q0RA 3IA2A 1DBSA 3I1IA 5F51A 4JYMA 4QUBA 3BGWA 4UMFA 4DMHA 2ZSBA 3DR5A 5LXTA 1F7VA 4I7EA 2N0SA 3H84A 4ME6A 3AQIA 4GBMA 2OV1A 2WVGA 1DKNA 3ER9A 3A3NA 2DPHA 2BONA 1ADFA 2O23A 4PRYA 4EY8A 4LJ8A 3O84A 1FMTA 4XUGB 5I7SA 4WT7A 2LGJA 4Q4LA 4QG7A 4Y2UA 1A50B 1QGZA 4DE5A 1LF0A 2VDVE 3NOOA 4WNIA 3RVBA 1N5DA 3GNLA 3HN6A 2BGNA 1K4YA 2OWEA 1QYXA 2X6RA 5CVCA 2H16A 1RCUA 1HEUA 5EUQB 5DNWA 3K92A 4V1CI 1EXVA 1CUYA 3H8WA 1LSSA 3IP8A 2E3JA 2FRDC 1AQYA 1JHRA 3UT5A 4D8YA 2I1VB 3OPYI 2JIZA 2RKWA 3NVMB 1D2HA 1GRQA 1JXOA 4KRFA 4NEQA 3KBBA 4TVBA 4LOJA 1DO2A 2NU7A 3ILYA 2VLIA 3ILVA 3OX2A 4UU0A 2HEGA 4J9VA 3U7IA 3GNQA 2PX5A 2IZ1A 1FP4A 2GSDA 4RELA 2CDCA 3RARA 3DTVD 1L8QA 1E3SA 3OCWA 4K6MA 4O5AA 2ATXA 4IGKA 3WFIA 4BYMA 4EO7A 4PXYA 1DO0A 1XTIA 3ANLA 2HCJB 1DJQA 4MW9A 5AP9A 3AK4A 2G25A 1KDVA 2PT7A 2JK0A 3L8ZA 1RCFA 4C6HA 2DHRA 1ANKA 1KY2A 4AFNA 2NZ2A 4U1RA 3A27A 3G0OA 3J7TA 1HE2A 1NKVA 1N0IA 2QMQA 4UNPA 1MUUA 3W9YA 1QF6A 3D3QA 4ZVKA 1XMOB 3K6SA 1EFDN 3EXG2 3ZBTA 3OT4A 5JUWA 1AHPA 3K9GA 1DEXA 4H3VA 5AKJA 1KSHA 2F6RA 4AQYB 1SOAA 4PZYA 3UFXB 1R3UA 1NXVA 3OE1A 4WNAB 4PX2A 3OHMA 1E2QA 1QJ4A 1U3UA 3O8NA 4OB7A 1CF2O 2H1VA 3W2FA 2WB2A 2VQEB 1ZCAA 4JXJA 1OIVA 1K2WA 2A4KA