3CLRD

Crystal structure of the r236a etf mutant from m. methylotrophus
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
319
structure length
319
Chain Sequence
SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYVEVGGGNDIDITTVDFIMSIGRGIGEETNVEQFRELADEAGATLCCSAPIADAGWLPKSRQVGQSGKVVGSCKLYVAMGISGSIQHMAGMKHVPTIIAVNTDPGASIFTIAKYGIVADIFDIEEELKAQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.
pubmed doi rcsb
source organism Methylophilus methylotrophus
molecule tags Electron transport
molecule keywords Electron transfer flavoprotein subunit beta
total genus 98
structure length 319
sequence length 319
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
D PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3clrD01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3clrD02
4F56A 4BVFA 3ND5A 1U7DA 4KPUA 4I5IA 1D2RA 4BUZA 3DPIA 5EKDA 1IHOA 3X1MA 1HYBA 4JT9A 2H2AA 3TZEA 1IQ0A 2XRZA 1YBHA 4UUAA 1YUMA 1ZPDA 4EF6A 4MUEA 2NXWA 2VTBB 3IVGA 3CVWA 2JI9A 3CF4G 3N2YA 2VK1A 1N2OA 1O97D 3GLTA 3ZGVA 1F7UA 3AG5A 1U7XA 4YP5A 4L2IB 4J1TC 2IHUA 1Q14A 5AHKA 3GLRA 1MC1A 1VL2A 2GOYA 1UPBA 1K97A 4K9MA 2D54A 1JILA 1PNOA 1T9BA 3A2KA 1NYLA 3TNJA 1M2HA 1PVDA 1BS2A 1KR2A 2DERA 1KH1A 3A4IA 3CLUD 4ZCSA 1GAXA 2Q5OA 1WQ4A 2PFSA 2DPLA 3S3TA 4KR7A 4G5FA 3FLMA 2JI6A 3COYA 1OWMA 1OBHA 5MF6A 1X6VA 4JZYA 1GN8A 2J08A 4MVXA 3PNVA 1EXDA 2DLCX 2O5RA 4J75A 4U8HA 1G8FA 5EJ7A 4D5EA 1JECA 1N75A 2AKEA 2PGOA 2W93A 3GLUA 1PT9A 4K9OA 1U0BB 1QNFA 3FOCA 3A05A 4JUAA 4RMGA 2HZ7A 5KHAA 4HJXA 4I6EA 2QTNA 1Q15A 4KR6A 1LI5A 4BN4A 2O8VA 1H3FA 4TWIA 3DO8A 4NAUA 3ZXSA 3FY4A 2Q28A 3F3MA 1IH8A 3IOCA 5DASA 4JUBA 5K6RA 4MW6A 3JWPA 1XNHA 1K4KA 1E3TA 2QUJA 2H4HA 1Q17A 4QREA 5KWVA 1T9DA 4X0EA 1Y9DA 1JZQA 2XRYA 2EZUA 1NUPA 2IHVA 4Y6LA 4JUFA 2CT8A 3RJZA 1WQ3A 3HV0A 4A91A 2CV0A 4ZCRA 1QU3A 1QPBA 5LLTA 4MQ5A 2AG1A 2ZUFA 4MQ6A 2J4DA 3E9YA 3CVXA 1XNGA 5EJ9A 4NX2A 4FEGA 1I6LA 1PO7A 1U2DC 1OWOA 2QUKA 2E21A 2QQGA 4O8ZA 1ULHA 5LFAA 5IMSA 3COWA 3OTWA 3UY4A 5IJXA 4UU8A 1O94C 2PANA 5TS2A 3FHJA 1OVMA 4JUCA 3UOWA 4COKA 4BVBA 2NZ2A 1KH2A 2OD9A 1J1ZA 1ZH6A 4DJAA 4Q93A 3FWKA 3ZJTA 3CA8A 3QTTA 1JHDA 1M2GA 2Q27A 1JIJA 4JXZA 1DJLA 1YULA 3IAEA 2EZ4A 2CSXA 4H3SA 3UMVA 4RMJA 2X1LA 3TS1A 4EG6A 1MAWA 2TS1A 3IH5A 3NV7A 1NZJA 4JSRA 3Q10A 4BVEA 1EUYA 4HJRA 4MVYA 1B6TA 2E18A 4MUJA 4K9QA 3MLAA 1TEZA 4MVCA 2X1MA 4MWDA 2Z3VA 2BYTA 1NURA 3G59A 2DUMA 1V8FA 2DJIA 4RMIA 2GKSA 3KT0A 4NZPA 2A7XA 1JEDA 4V1CB 4KR9A 1S7GA 4JUDX 1BFDA 4X3OA 2JI7A 3SEZA 3GMIA 4ZT4A 4U7JA 1OBCA 2Q5LA 2H2HA 2R5WA 1YC2A 4Q9DA 2H2GA 3G6KA 4HPWA 4MW0A 3F6EX 5JBNA 4EG5A 4MW2A 3ZJUA 1WXFA 1GTSA 1NSYA 2IP1A 3FDXA 3K35A 1EE1A 1QRSA 3AIIA 3AG6A 1M1ZA 2QUIA 3IOEA 3JXEA 1JGTA 1PG0A 2PIDA 1JSCA 4ZT2A 3DLAA 5K6TA 1GZUA 2HMAA 1Z8NA 4EG3A 1O5TA 4ZCPA 4EG8A 2EZ8A 4FZJA 1DNPA 4JD5A 4MWEA 5J5AA 2JLCA 4F3RA 2WB2A 4MLPA 1H3EA 5H16A 2UZ1B 3CLSD 1OZFA 2DETA 4GPEA 1M8JA 1KORA 1OWPA 4F4HA 4NATA 2EL7A 2E89A 5LM3A 4MPPA 3H05A 4OJMX 1FYDA 3IODA 4EG7A 1X8XA 3CLRC 3IDFA 4DNXA 3IVXA 3UK2A 4EGAA 3ZJVA 2X7JA 1M2KA 1T6ZA 5HG0A 4ZT6A 3SZGA 1OZHA 1Q6ZA 2WVHA 4GU5A 2A88A 2D5BA 1F4LA 2Q5QA 4R8MA 1P7PA 4XFJA 1ZJWA 1VBNA 5FYQA 1VBKA 1J8FA 1PFYA 1U2GC 3EA4A 4IG9A 1TFUA 4JYZA 4DE5A 4ARCA 4UU7A 4ND7A 2V0GA 3AL0C 3ZGZA 1KP3A 2A84A 3HMQA 4JXXA 3VGJA 3H9BA 4UTNA 1N3LA 1XJQA 3VRHA 2J09A 2QTMA 4V1CA 2H4FA 3FSJX 1V5GA 3KT3A 1K4MA 1POXA 3Q4GA 4YBRA 3ZUGA 2I1LA 3ISJA 2PGNA 1WXEA 1ILEA 3GLSA 1T6XA 1A8HA 1RQGA 2OO5C 4OUDB 1KKUA 3NBKA 5IHXA 1KQOA 5BWOA 4YMIA 3HZRA 4MUGA 4MWBA 4KGDA 4PBSA 2QUHA 2PXHA 3IMEA 4PBTA 4XFDA 1PFVA 3SDBA 1YTLA 3CLRD 2D13A 5DB4A 1O97C 1NP7A 1O96B 3H9CA 2YY5A 4AS1A 3BL5A 1I6KA 1N2BA 3IMGA 1M2JA 3CLTD 3MMXA 3H99A 2AZXA 2B4YA 4EG4A 4MUHA 4RJJA 3ILVA 3FG9A 4UTZA 2UZ1A 2X0KA 4BWVA 4HD8A 3LQ1A 3PXUA 2J07A 4I6JA 2E0IA 4K9PA 2B7LA 2Z09A 4FEEA 1T9GR 1YIAA 1U28C 4C7BA 2Q29A 3X1KA 4G1CA 4GM4A 3RIGA 4QRDA 4UZFA 3MXTA 5EJ5A 2A1UB 4XSVA 4YP6A 2PZBA 4L3OA 1PG2A 1V5FA 1G59A 3RBAA 3IMCA 4C78A 1M2NA 3D6VA 4QQ8A 1Y42X 1WY5A 1HZZC 1LW7A 3QTBA 5FNZA 1PYDA 1YI0A 3TQIA 1TYBE 3HWX1 3IAFA 4MVWA 1N2IA 3L92A 4G6ZA 3CLSC 2WSIA 4CDMA 4K9LA 1SZDA 4R0NA 5BWLA 3P0IA 1T9AA 4MUNA 3COVA 2QJOA 4U63A 2AG6A 1J70A 3I05A 4KKVA 1POWA 5K2OA 4CT0A 1MBZA 3JR3A 1I2DA 1J1UA 1QTQA 4RUKA 4RMHA 4BVGA 3N9IA 3P0JA 3U1VA 3MUEA 3X1JA 3SP1A 1N1DA 4Q16A 5MFPA 1UFVA 2CUZA 1QRTA 1KQNA 4J76A 1PTJC 1O95D 3LOQA 4MAFA 1N77A 1N2JA 4WSOA 4AQ7A 2H4JA 3ND6A 4QELA 3ZGOA 4NDAA 4ARIA 2C5SA 1Q11A 2WVAA 1J09A 3KFLA 4DDHA 1TYDE 1GPMA 3HWWA 3D4BA 3H97A 4UTRA 4I6GA 1KAMA 1GLNA 4R2MA 3ZG6A 1S5PA 4G5YA 4PY2A 3MLBA 1IRXA 1WOYA 2H2IA 1SURA 3CLUC 2CYBA 2CYAA 3D6UA 4MWCA 4ZT3A 1XNJA 5F23A 3QE4A 2ZUEA 1N2GA 1D4OA 2IHTA 2Q5JA 4MW9A 1PFWA 4RJIA 1U3CA 5HUHA 3EYAA 1GTRA 2RE8A 4MUFA 2OQ2A 1M8GA 2YXNA 1PNQA 4BV3A 1KH3A 1MOPA 4BVHA 5J58A 1Q19A 1VLHA 4MUKA 1M8FA 2VBFA 3CR8A 4OUDA 2NYRA 4IAOA 1EFPA 5DGTA 4ZCQA 4JU9A 1OWNA 2OD2A 2YWCA 4V1CI 2A1TR 2A1TS 5FEMA 1J21A 2QJTA 5EJAA 1MB2A 4CDNA 1O6BA 3P52A 1JMVA 1TYCA 3GUZA 1KP2A 2J5BA 1O96A 5DK4A 3RFFA 3HL4A 4GRIA 3TZLA 1N78A 1OZGA 1WKBA 2VBIA 3Q12A 5H7XA 1NUQA 2QJFA 2JIBA 4BV2A 4TS1A 1UPAA 2WVGA 1NUTA 2X3FA 3SZ3A 4MULA 5EJ6A 4MW5A 5FO1A 1COZA 5K3SA 2JI8A 4UTXA 1H1TA 1T9CA 3DV2A 4IF6A 5DEOA 1YI1A 4ZT7A 2IJGX 1IVSA 4CQNA 4Y6OA 3AKZA 4F4UA 3KT8A 2RD2A 3ZIUA 4DDMA 3COZA 4D5GA 3PKIA 2VJYA 1J20A 1MB9A 2HGZA 1YNOA 2PZAA 5AHWA 1V5EA 1QRUA 4DDKA 3N05A 1PI3A 1YHYA 1KAQA 2H59A 1IQUA 2AG0A 4RJKA 2FN3A 1R6UA 3RK0A 1R6TA 1IQRA 1N2HA 2CV1A 1QJCA 4Y6QA 4E1AA 4TWJA 2A4MA 5EJ8A 1EUQA 2JANA 5J59A 1T6YA 4EG1A 4K9KA 4PBRA 3AFHA 4ZCTA 5FO0A 1CT9A 1EJ2A 1VBMA 2A86A 1N2EA 2WQ6A 2C31A 3D81A 5TEVA 2VK8A 1QU2A 3PRHA 3PKJA 3PDHA 2FRDC 1QQTA 1WXIA 2EZTA 4FVTA 1U3DA 3FH0A 5BNZA 5KCMA 4P2BA 1NM5C 2PZ8A 1Q1AA 5EJMA 1WJGA 2YWBA 1IFXA 3IUBA 2QTRA 3NBAA 2DEUA 4K9NA 3U31A 5DEIA 3C8ZA 1G8HA 1WXHA 3SYTA 1F7VA 4GG1A 5D7NA 3P0HA 2JLAA 3HFJA 2CFOA 3ND7A 1O0BA 5BWNA 4MW1A 1YC5A 4UZEA 5HUJA 1O0CA 4ZT5A 3EY9A 1YHZA 2VK4A 3L93A 1Q77A 2IELA 3PNYA 2BTEA 2CYCA 2VXOA 1K92A 3K9WA 3FZNA 1YIDA 3FI0A 2V0CA 1KQPA 4ZZIA 3CVYA 3RIYA 2FWNA 1MRZA 2OORC 1JIIA 1XLTC 1M83A 4MUIA 3ELBA 3G5AA 4HDAA 3IVCA 4HK4A 4GP9A 3UC5A 1NI5A 5K0TA 2HJHA 3F6BX 4JT8A 4JFAA 5EJ4A 1MCZA 3M5WA 1T9GS 4WNYA 4L2IA 4K03A 4QPZA 3GLVA 1WXGA 1ZUNA 2Z08A 3OE1A 1EFPB 2NSYA 2GM3A 1V47A 4ZP1A 4MZXA 2EJCA 4MPRA 3PNBA 2FSVC 4JU8A 1MA3A 2OV4A 2PG3A 1FFYA 1N0HA 1U31A 5DGDA 3CLTC 3D7KA 1YUNA 1JIKA 2V3WA 3RK1A 1O95C 5K0SA 4UUBA 3IOBA 4J16C 4MW7A 4GM1A 4X3PA 1G8GA 5TEWA 1TQ8A 2BRUC 2H2FA 2A1UA 1I6MA 4UTVA 2ZP1A 3VU8A 2FR8C 1M8PA 2WQ7A 2QQFA 4QBTA 4GM0A 2JA2A 1SZCA 4BN5A 3TQOA 4EFKA 1NUUA 3CVVA 2DR2A 3FIUA 2CV2A 1ICIA 3U3DA 2DXIA 3E27A 4MPJA 5MFZA 3INNA 2VBGA 3KT6A 5TGTA 4KXQA 1EFVA 3SEQA 3K32A 1MAUA 4YP7A 4S1OA 5MGNA 3ZXIA 1ZH0A 4NAHA 1PFUA 1WZ2A 1H3NA 2H29A 3OP1A 4MW4A 1MJHA 1TYAE 3IUEA 3A04A 4ND6A 3FETA 4FZ3A 1EFVB 2G36A 3HGMA 2JAXA 1OWLA 1S4MA 4R2LA 1M8KA 1NUSA 3RHSA 4K0RA 1JEEA 4KPUB 2H2DA 3N8HA 1JZSA 1YI8A 3CVUA 2OD7A 1OD6A 3LCJA 2EZ9A 1R6XA 1LI7A 1UPCA 1F9AA 3FNRA 3LE8A 4DLPA 4RPIA 1O94D 2VTBA
chains in the Genus database with same CATH superfamily
3M82A 2JHPA 4JVLA 3FOEC 3HPQA 3ZHOA 1JB1A 4ZOCA 4UFPA 3A3OA 2EP8A 5CDYA 3DPIA 2CL5A 3REQB 3UO8B 4JT9A 3NYQA 1N9ZA 2IU4A 5CBPB 5G4KA 4ZK2A 2OTCA 2R7LA 1GZ7A 1U2PA 4I81A 3CVWA 1N2ZA 4WNAA 4I46A 1ID8A 2X4GA 2PKCA 2VF4X 4K6KA 3TNFA 2HMWA 1U8ZA 4TQAA 4R1OA 1MC1A 4K9MA 2IYVA 4XGRA 4KN5A 5HIKA 3F1KA 1NFRA 5DKFA 4YONB 3FYSA 3SOZA 2P9YA 2Q3DA 1W5FA 1GVNB 1DTEA 1C4XA 3CZAA 4HDMA 5A05A 4L9WA 4D4HA 3CF4A 4B46A 1I13A 1XDWA 5M29A 4LHVA 1DTWB 2YL2A 1CX9B 3OMXA 4Q9AA 3SI7A 2Q3JA 2QRMA 4OXRA 3UXEA 5MF6A 2OCIA 1M7BA 3I64A 3T7DA 1GQQA 4PCVA 4ALNA 5JECA 1SXIA 2DLCX 5C1IA 3Q9SA 4K2HA 3P1JA 3RSLA 3QGMA 4PVDA 1H9BA 5C7YA 4FDVA 5KNCA 2ZUTA 4MLCA 3VBCA 3BK7A 1TVEA 1TW2A 1X3LA 5IJ9A 1EUDB 3N8IA 5KHAA 3K70B 2PX6A 3HRKA 2CLSA 2BMAA 1PS8A 4IJQA 5C5IA 1OZAA 3DO8A 1COWD 2NVUA 3C0KA 4IIYA 3WGLA 1IOWA 3FWPA 2QLTA 2Q9UA 3QYAA 1FDUA 3JWPA 5TR9A 4GX1A 3SE0A 4C3UA 1H9CA 2WU0A 1JPVA 1PQ4A 5D3MB 2X0JA 1AU9A 3BHIA 2BJWA 2ZAGA 2OV6A 2EZUA 1I7PA 1CUHA 5I7EA 1Z0DA 2ABWA 3V97A 1QUEA 2GI4A 4GLOA 3EVGA 2I6TA 3B78A 4RD2A 4IIFA 4Y9RA 5JSZB 1Q7BA 3PD0A 2PLRA 3OX3A 4PZCA 4TN1A 1II0A 2ZUDA 1R0CA 2V97A 1X1AA 2FSGA 4RE5A 2P90A 3DHNA 3MRVA 4HB4A 4RF2A 2BMFA 1XDGA 1QIIA 3ZX5A 3LFHA 1UQRA 1UH5A 4IQFA 5IJAA 1NVXQ 2HK6A 2LDBA 2ODQA 2ORVA 2HH9A 5DFAA 4COKA 1QRRA 3WMFA 1RWOA 4Z51A 1Z7YA 1DQSA 3Q0EA 5HDQA 3G5MA 2QD1A 4RCYA 2PIAA 4XASA 3KLPX 2YDXA 2XGJA 2REQB 3U3ZA 1JFFB 1NWCA 2R65A 3MQFA 4DWOA 4L4ZA 5B55A 5K9ZA 4H3SA 3TYXA 2WYWA 4XQ0A 4H18A 5BNTA 5JY1A 4UASA 2J0UB 1JU3A 2R1ZA 4Y6SA 3B3AA 3DEKA 2R1VA 3WMEA 1U8UA 2WD8A 1U9CA 3L49A 5FTMA 1T5DX 2C98A 4A2CA 2MYUA 2RAPA 2ZE8A 4B45A 2HMVA 3QPBA 1V8FA 1RZVA 2QGZA 4DV6B 1BWRA 1SCDA 1XVIA 4KVGA 2I7DA 5DX8A 1JEDA 4TWAA 1MXFA 1YNSA 5H0IA 1HDRA 1YB2A 1GSAA 3QF4A 1K8ZB 5HBRA 1NP3A 1DCTA 1K86A 5EZ5A 3SEZA 2D1TA 5D5HA 1KZ4A 1H2AS 4D9GA 4E12A 1KO1A 2O3SA 5HEKA 1ZHOA 2P41A 1PLLA 2Q5LA 4E1VA 3DFMA 2W8BB 5EXDA 4YMUA 3FNEA 3O8OB 1YUBA 3LCRA 1TKCA 3OA0A 4UD2A 4YJ2A 3ZJUA 4F3YA 1Y1PA 3F78A 4LX8A 1GTSA 3K35A 1QHNA 1G4AE 2OFXA 4H6VA 1W47A 4PPQA 1Q1BA 5KYYB 1M1ZA 1FRQA 2EX4A 2R5FA 3NDPA 3ZDXB 5K8UA 5ALFA 2CVFA 2MDTA 3L8HA 3H65A 1ZM4A 1KVQA 4L02A 4N4AA 2IE0A 2JCBA 1J1IA 4B4OA 2D7JA 1E92A 2ZBVA 2QRVA 4BO2A 3BDVA 4DY6A 1P2FA 1A8QA 2IXBA 4UHKA 3UATA 4RSGA 4R0MA 4OD0A 3SYLA 4KO1S 1P2UA 1PSDA 3GJYA 4LHYA 3MTQA 3VM6A 3C8MA 1ISJA 1PFGA 2LNDA 3IBTA 1ZGAA 3R0JA 1JFLA 4H1TA 4EI2A 3IE1A 2XKBA 4HATA 4OOEA 2WJPA 1NU8A 2XTJA 4UM7A 1QP0A 2H31A 2E4XA 3V1KA 1ORDA 4LCEA 3JQEA 4RESA 2ZZKA 4HQFA 3EH2A 3K15A 2CEKA 1GKLA 1ND5A 3TFWA 1JSLA 2X7JA 1SOAA 2Y3IA 3E7WA 3TM4A 1M2KA 1T6ZA 5H68A 5JWRA 1JDJA 1UBUS 3GMDA 1L7AA 3F7TA 1Z4PX 1YMVA 2K6GA 3DL4A 4R8MA 1ZJWA 3O9ZA 2RJ3A 3HACA 1BVYF 5FWAA 3PDIA 1C3XA 3LHSA 3ZXXA 3EA4A 3RSHA 1QH9A 4LFBB 2GCPA 2QRJA 2KE5A 4UQPA 2Q6VA 5TX7A 2VHVA 1W6UA 4ND7A 4WXHA 1KP3A 4KQMA 4LX0A 5JHHB 3RTAA 4H1UA 1OYOA 2XA9A 3JQBC 1S1CA 2Q5CA 2QTMA 2CLCX 1K7SN 3AGPA 5ICEA 4ZVRA 4P4GA 2L17A 1XK6A 2O07A 3HJAA 4FDMA 2VLBA 2JK0A 4PZZA 4LNUA 4AG5A 2YVAA 5HJ5A 3VNRA 4DCUA 1Z8FA 5KNDA 3A6JA 5L3QA 3B12A 3IE0A 3TQRA 2IPAB 5AW1A 3UH0A 4LJRA 3P2KA 1T2FA 2ECOA 1QX4A 1A5ZA 3KKOA 3ND9A 3O03A 3LUDA 5I7FA 1UJNA 4A92A 3NBKA 4N39A 3ZNNA 5F9HA 3TB4A 5EHZA 1KI2A 4Z2YA 3AEQA 5HWSA 4U0JA 3KAPA 4BATA 3PUXA 4Y6PA 3GZNA 5CCBA 1QS0A 1LV8A 4C2AA 2AJCA 4PBTA 4WXEA 4E6PA 3E8SA 1P91A 1Y3CE 2H11A 2YC2C 2KQUA 1CJSA 5DB4A 2IXAA 2LDXA 4MV8A 3EEBA 2CL7X 3FFAA 3RRZA 1NP7A 3ESAA 4CM8B 5J4LA 4XA8A 3BL5A 4JA2A 1WA5A 1Z08A 1YQGA 3IMGA 2I4OA 3ZZMA 2OXIA 1Y5NA 4QLAA 2RCYA 3OJWA 1XRQA 5G3YA 3TSOA 1B15A 3OTHA 5GJBA 4JL6A 2FUEA 2P9TA 3OJOA 2D5CA 2YV1A 1B4DA 3N75A 4KIJA 1ODIA 3I4FA 3GRPA 4NEQA 4EZEA 4C7BA 3E3LA 2Z6QA 1U28C 1QVZA 2R68A 5GZ1A 1ZYUA 4RDIA 1U8FO 1ZLYA 3D6NB 3J7AC 1XDSA 1VSUA 2K2QB 2ZJ5A 5IYZB 4BMYA 5F73A 5ADWA 1NKVA 1SK9A 4F4JA 3N2LA 1JFSA 1YTUA 2DVMA 2LWIA 2ATIA 1T4CB 1CR0A 4KXWA 1YS6A 3LBAA 2ZZMA 1NJ2A 1YE3A 1OE0A 4HPJB 4BNNA 1K3TA 4MH0R 4OQNA 4WCFA 4A0RA 3SLRA 5BQFA 1JLLA 3HWX1 3IAFA 4HDNB 3GWGA 2O8EB 1K2WA 4G6ZA 2WSBA 1QFMA 2JAUA 4AICA 2HA7A 4R0NA 1C3EA 3VTAA 4C14A 1NBME 2AG6A 4WIAA 1GTMA 1NMYA 4RIEA 1A4IA 4BFVA 1UOEA 5CDFA 1E20A 1FX1A 1MEEA 2F3PA 3JR3A 3V9AA 2IWHA 1JNXX 5ENDA 3NH6A 4W82A 3THXB 3TIXB 5B2FA 3OQ1A 3X1JA 4U5XA 3OP4A 3HO8A 3KS9A 4CIBA 1BDBA 1KQNA 3GJ4A 1Z9BA 1NJ1A 4JQSA 4BY9E 1NU6A 1X7YA 2GKOA 3NORA 4MAFA 4XM1A 1YA4A 3FTFA 2GEKA 4NWIA 3IELA 4QELA 3NGLA 5ALMA 2ID9A 1W9MA 2QPLA 2CK3A 4N9QA 3ETCA 2V58A 4GLJA 3AB7A 3SM9A 3GRFA 2PLAA 2J5RA 3HWWA 3E2MA 4LE2A 1FDSA 1UR5A 3OT1B 5E9JA 3REQA 5HFAA 1NN5A 1KAMA 2ZR8A 1QZTA 2XMBA 1JEYA 6ABPA 3P9KA 4IBOA 2AWOA 4EELA 2FJ0A 4WNAB 3UAVA 3CN9A 4ACAA 1H4QA 4X6XA 1QLJA 3ZJYA 5C7LO 4NQZA 1QHGA 5TMPA 3T54A 1PFWA 1IN4A 2ZBPA 2FGKA 3IUMA 3U7GA 3BCRA 3GG2A 4PCUA 2DJ5A 2XVMA 1VI2A 4O4HB 4YDRA 3T8YA 5JBIA 4RIGA 4HDMB 2LP4Y 2PL3A 1DRWA 1ZK4A 3D2BA 3KHUA 4E14A 4ZEOA 1NN0A 2I71A 3EGDA 3Q0IA 2J59A 3TDNA 5LD2C 2NTNA 5ELMA 2PUGA 4ACBA 4JI2B 1PL6A 3NHWA 4D3XA 1KEEA 3OZCA 3BGWA 4MARA 1JA1A 4ENRA 2BSAA 3R3VA 1ONOA 1ZNQO 5K4GA 2H57A 2IXTA 2RHCA 1E3QA 1LK7A 2P6OA 3KXDA 1RJFA 2Z9DA 3WRVA 3CKKA 3TAHA 2BRUA 1QVAA 5BWMA 2I99A 3E1KA 3FHCB 4B5LA 3I9V6 4CN8A 4CEIB 4TS1A 4RMNA 2WVGA 3RVDA 3PPYA 1LS6A 3FNHA 4L4RA 3WGZA 4D92A 2CZCA 5K3SA 1H5QA 1V9LA 1WD5A 2JI8A 3JS5A 1NQXA 3Q3GE 4CL0A 3WWOA 1Y3BE 1VL8A 5A02A 4LHSA 1YI1A 4N6GA 5FOXA 1RI2A 2E49A 1KR5A 4CLOB 5JASA 4UFNA 1IVSA 4HRVA 4O1IA 2VHTA 4QO8A 1PHPA 2R11A 1ZMOA 3QWAA 4ZO6A 4DDMA 2MYTA 2H1CA 1XVAA 4DJJA 5IJ0A 2GF0A 3N7UA 3HXOA 2JAWA 5JSZA 4FK8A 1SH7A 1ZZGA 3U3RA 3BERA 4B4VA 3TOSA 4OHBA 3B7WA 4A2WA 1IQUA 1XLVA 1O6GA 1PR6A 3C3PA 4PHGA 4F5ZA 4AX4A 3E03A 1WMAA 5AM4A 1PJ3A 3ABIA 4FFDA 1SUSA 1XO1A 3FYHA 1IPEA 1LS1A 1Y7LA 5FHRA 4NEGA 4Y6QA 1RP1A 1BAPA 1ZOPA 1XV5A 2HL6A 1RI4A 4BBPA 4C7MA 1KK3A 1P1IA 5JSQA 5CD1A 1Y5RA 3NJ8A 5HXAA 1EUQA 2X6QA 3ICWA 5IZCA 5JZ9A 2HHJA 1RHUA 1FXUA 3LPMA 1W30A 1SZPA 2HK8A 3KSRA 3M4YA 4K9DA 4DEXA 4PQRA 3ZCUA 1EFKA 1NRWA 1FJHA 1K9SA 1KZ9A 1VBMA 3D81A 5AVVA 3ISTA 4LYDA 3M34A 3GFGA 4FE3A 4ZU6X 2FRDC 4JL5A 1Z2NX 1QQTA 1WXIA 2OBLA 1EGQA 4KK4A 1G9XA 4DZRA 2QKYA 3HA5A 3HN6A 2YY6A 5TQ2B 4J0DA 3JZFA 3GJQA 3WO0A 3SFTA 5DEIA 1F7VA 2WA2A 4KU4A 4GG1A 5I3ZA 3ESQA 2B20A 2X19A 2XR1A 3UJPA 1AF7A 3V80A 3IR5A 3MYRA 2BTQB 2O7VA 2QD2A 4O08A 5TT0A 3QF4B 1APBA 2P7HA 2OCGA 2PZEA 3DBHB 4FR2A 6REQB 2JJ1D 1TUGA 1YQTA 3MOSA 4I2VA 3EVBA 1E2GA 1X8JA 4LRUA 2B2CA 4WKCA 5DTRA 3UJ9A 1VCMA 3ICEA 1DO0A 3ZDDA 3DKKA 2JLVA 3FIJA 2CSUA 1EVYA 2CFTA 4W5QA 3EPRA 1PCXA 4PLZA 3JX9A 4M9RA 2PZLA 3S0JA 3MUFA 4XDYA 4KYUA 5EPOA 4DCSA 5IEJA 3PTZA 5JH7F 5DBOA 3E1SA 4EMUA 1NG1A 3BH7A 1NOKA 1F0YA 1S8AA 4HLUC 1JT2A 4C7VA 3HXLA 2W71A 2W9XA 4H1HA 4DS3A 4EHIA 1D8TA 4F1JA 4R8LA 3FNFA 4QYTA 2B4QA 3JU3A 2D00A 4TKVB 2VLIA 4X8OA 5DGDA 4FC6A 3WLMA 1DBPA 2DPMA 2VAPA 3UUEA 4ZPJA 4OGFA 2W2KA 5D6NA 3RQSA 1V71A 5DM1A 5K3FB 3TLGB 3AL2A 1O95C 4C43A 4JZKA 4MW7A 3GLGE 1Z28A 2RH5A 2I54A 4X3PA 3ZGNA 5JZSA 4OQLA 2W6NA 3JVVA 1BXRA 2Q3EA 3CEPB 3L0CA 3N2NA 2ZP1A 2BWJA 3FGPA 1W36D 1BDMA 5T8KA 3E84A 4QE3A 3T99A 1S3SA 3C14C 2RCNA 4UBJA 4DAOA 4MWGA 3V6LA 1I1HA 2FEOA 3C7TA 2CV2A 1FXSA 5IKEA 2R6DA 1PTJA 1RE0A 2CHVA 3ZKWA 5KOIA 2P6PA 4IINA 1AGYA 2HLNA 2F6RA 3IP1A 4GGPA 2V6IA 4LGVA 3K6JA 5HR5A 1E7MA 3G49A 4P53A 4I4TA 4Q6WA 1UDXA 3STTA 2FRXA 5FCDA 2CLDX 5I6DA 3A04A 2QVBA 4LBVA 3GVCA 3BSSA 2EJTA 3QX3A 1VE7A 3R9XB 2DQZA 3OCXA 2RHOA 4Q9HA 1LLCA 4TL9A 2NMVA 1JEEA 2WT8A 4KPUB 3ZY3A 3AM3A 4C3OB 5LR6A 1IM8A 3K2EA 1WX1A 4Q1EA 5JJCA 1OFTA 1PLJA 2O2HA 5FQNA 3U7IA 4XVUA 1Z62A 2B2NA 3W6NA 5A3QA 4G0XA 4CIWA 1UADA 1FFEA 2GHRA 4Y2RA 4CMAA 4C05A 3I0ZA 3I6YA 4N5MA 5AM1A 1TM7E 2FGJA 1X13A 4JT4A 3KLBA 4ARIA 4BNUA 3URKA 3GBPA 3C8DA 1GG5A 1T2CA 2E4VA 4QOSA 4MUEA 1RAIA 2NXWA 3EBOA 1QS0B 1KAGA 4TS3A 5E4FA 1ZD9A 4OQFA 3ADPA 4PANA 1B6SA 4TLMB 1PDOA 5KJFA 1Q14A 3TTVA 5I48A 4LKOA 4P3YA 1ZAYA 1ZU5A 5EZYF 2WJ6A 3NHFA 3THWB 3A2KA 2VNKA 4Z3KA 2YUTA 1XB2A 4OKNA 2NT3A 1GOTA 1KR2A 3KFVA 3B6IA 1QIFA 3GPDG 5DCWA 4F06A 4DDTA 4XJTA 2J3DA 4CCWA 4G5FA 2XNJA 2R96A 4LNHA 1PQUA 3LQQA 3RPEA 2QLFA 3BFPA 4DLVA 2QIPA 5J2UA 1ZIXA 3UT5B 2COUA 4CXMA 2AD5A 2HO5A 5SZIA 1R5NA 5EIBD 3SHFA 4IOJA 2CF5A 4GQIA 5CX1B 5EVCA 5GMOA 3MT7A 1N5JA 5TF4A 3VH3A 4ZCMA 3I92A 1Q0LA 4DLUA 4JUAA 4V24A 1MUUA 1IONA 3AONB 3QU5A 5FT9A 5ITWA 5JSHA 4CHTA 4DIMA 4KQJA 4MVJP 4EUFA 3QELA 4K40A 1FP1D 4KR0A 4V0SA 4UCQA 3KVNA 4HEHA 4LY0A 1JAZA 2DQKA 2QXYA 3R1IA 1L4GA 4JLOA 1Q3TA 1E3SA 1HFWA 3CZ5A 3IOCA 4NDNE 2WC1A 5K3EA 5JXIA 3S81A 3BSWA 1B0AA 1MB4A 1JLLB 1XNHA 1CFJA 4HDNA 2PTHA 3KXLA 1C3LA 4ID9A 2XTAA 5E95A 3IQEA 4BZZA 3V34A 3EPKA 4NVRA 4YAFA 3WYAA 4KXLA 3S29A 4EW3A 4ZTUB 1EZ1A 1J9ZA 2GXQA 3WQBA 4UDNA 3Q5GA 2XZTA 3FDZB 5FRDA 5EWLB 3VAZA 3G5LA 3QV2A 3RU2A 4GHWA 3QBTA 1SC3A 3BGOS 2P9HA 2MMCA 4HGNA 1XEFA 4N54A 2PLFA 3HEBA 2WHQA 2R79A 1UKAA 1I6LA 1TL7C 1U2DC 3JWHA 2MINB 3O4FA 4MJ7A 2IIQA 4O8ZA 2GAAA 2GZDA 3LO5A 5DYWA 4GRAA 3I01A 3PBKA 1NM5A 3CR7A 1RPNA 2HA2A 5E2AA 2ZRMA 2GPYA 4JAVC 3WYBA 2I9PA 1ISSA 4AMGA 1NF3A 1HO3A 3CNQS 2IHKA 4JEUA 4KQ2A 4AJPA 1AMOA 1ZH6A 3FCOA 3SBDA 3WB1A 1WB6A 4RS4A 1LRLA 3QTTA 1SHJA 4JXZA 1YT5A 3WQRA 2Y2UA 1S8FA 2AC7A 2FW8A 4AXBA 4INJA 1OBVA 2P2NA 3E35A 2VDOB 4HEJA 2X1LA 3A1NA 3RV3A 3VDRA 1FW6A 2HIHA 4KHZA 3I23A 1IZ7A 2JGKA 4Y6RA 1EDBA 1BCSB 1ONNA 1XA0A 1GDDA 3EMVA 3FAZA 2IHJA 3ESZA 4K9QA 5AJZA 1GU1A 1VJGA 2VK2A 4H1WA 3PX7A 2CXNA 4BNVA 3CNNA 1MPXA 3ZWAA 3KL4A 4AJKA 4EO7A 4BV8A 3LT2A 2Q62A 4MXDA 2JFFA 3N2ZB 4LZPA 3REGA 1C1XA 1V35A 1DC3A 2ZE7A 4R69A 1HKUA 2GFHA 4E3ZA 1IY9A 1U0LA 1VA5A 5CXXA 1SMKA 1D2HA 3CB2A 3ZHYA 4CV3A 1AV7A 3LQKA 4UHJA 5ALYA 3TTSA 1EVIA 2WFZA 1DWOA 3DWIA 3H4VA 3LC7O 3G13A 3PHLA 3JQCA 3VTZA 2CXOA 1R16A 1SULA 3EJWA 4GNRA 3WQSB 3G9QA 4QKQA 2A67A 1KRWA 3NHSA 4YJ3A 5CIYA 3U3OA 4R7TA 5I7RA 2O5EA 2YNMD 1KYVA 2CN1A 3FDXA 1U1EA 2AW5A 2O1WA 1A27A 2P67A 1E2EA 2LW7A 3I58A 2WZDA 3KD2A 4KDEA 3RVRA 2O2ZA 1ESNA 3BXOA 3UTCA 4CMEC 5F4BA 5DXJA 3BD8A 3TGLA 4BS9A 2X8BA 3RC9A 5NULA 2V7QD 3O75A 2FZCA 2C4HA 3DLAA 2UUOA 4IJVA 2F62A 4PO3X 3RGWS 1RC1A 1P1JA 1DEOA 4KE9A 4F6RB 5LYJB 4NMWA 3OCYA 1HSZA 4OFXA 4ZEVA 2GLXA 3ED5A 4M4SA 2KM1A 2ONYA 4TMZA 5KOJA 4PNEA 2EHDA 4G1FA 5JY6A 3W5HA 1XZGA 1L4UA 1OXUA 3NVDA 4H7DA 2W2VA 3GNLA 2Z1NA 2V9CA 4LSWA 4DCTA 3QP9A 4FKMA 5IBPA 1WPQA 4BFZA 3EBLA 1T2EA 2WDZA 1YMUA 4OHMA 4PIVA 1TAQA 4F7DA 4X8HA 5JSUA 2YJTD 3ASVA 2AVDA 3U6BA 1KO8A 3AHCA 3QY0A 1C9YA 4JP8A 1C4KA 3K9BA 5AHOA 3A06A 5AI5A 2VYCA 1BN7A 1TQHA 5D86A 3OD5A 3OPVA 4CEJA 2EKZA 5MDHA 1CUEA 1XROA 5KYGA 3SSAA 1N9KA 3DLHA 2BM0A 1F4LA 5GONB 4WCVA 4QC2A 4XJSA 1GTG1 1M0TA 1VBKA 4M1OA 4X1OA 3TR0A 4WDQA 3GD7A 1E7RA 1IJEA 3EUAA 1HBJA 1RAFA 3EVZA 4IG9A 3ZLVA 4ERXA 1KZHA 1YBAA 1SG9A 2LTAA 4EKIA 4AWAA 1YZ3A 1ZL2A 2IU3A 2RGRA 1TT5B 2JPDA 3KXKA 3SVTA 3ILHA 4U2DA 2AZMA 2C7PA 2WDPA 2YYAA 3T3HA 4ZC8A 1A8SA 1UJBA 2QT1A 2O2IA 4EUEA 3MVEA 4JJFA 2GVDC 4R1UA 4YMSA 4ETNA 5LIRA 4NCAA 3QFTA 3USES 3ZUGA 2G1JA 3AXTA 1Z3CA 1ZRNA 4I14A 4PZDA 5KX5B 2NU6A 4LXYA 1TCUA 3B5EA 1TPYA 3L4SO 1CY4A 1KDVA 3RYFB 2VATA 3DLIA 3UV3A 3D7LA 1UEIA 3T9DA 1KQOA 1MC4A 1EXWA 1CC1S 1F20A 4OJQA 1C1DB 1ZSVA 3HJFA 5EGNA 3V2HA 2O50A 2PXHA 2ZTSA 3JWIA 1SXJE 4QDUA 1M0WA 4PN3A 4JJ7A 4ZDIA 2A0YA 2NYUA 1B43A 2POQX 1Z13A 4RELA 1E3IA 2IPNA 1GUZA 3JZDA 3DD1A 4QL3A 1V1RB 4D26A 2C9OA 1MQ9A 3ES9A 3HKDB 3N5CA 2PGLA 4GAEA 1RWKA 1ZS9A 2VHXA 4DLBA 4MI9A 4PYIA 5JQWA 1WZIA 1M5TA 3QUSA 1T3ZA 4RIIA 4KAAA 4ODIA 1TD9A 3W5DA 3LPNA 2ZYVX 4AJHA 5K3FA 3TLGA 4K9PA 5IPFA 4FYKA 1D1TA 3QKSB 1ZDMA 3C4QA 4I55A 5KKCA 1CR2A 3SYKA 3WHPA 5BV8A 5LB4A 2ZJ6A 4M2LA 3KUCA 1H9AA 3SC3A 2YRWA 1P19A 1CF9A 2H08A 2NUTA 2VNAA 5K09A 5F12A 3A9VA 1TTTA 3G9ZA 5C1OA 4F84A 1GGFA 3JVIA 3GGDA 3Q3JB 2JGJA 1HZZC 3JYQA 2RHHA 3WRXC 1X80A 4AZ0B 2F00A 2N3ZA 3SDZA 1XKQA 2PVCA 1EPUA 3H5RA 4MINA 4QSMA 1NPDA 1OAKA 3SLKA 4U6QA 3BBPA 1K1EA 2XUOA 4M1YA 3THSA 4AJ1A 2OWDA 2ZWVA 2ZSAA 1O6ZA 2C78A 2WNHA 5BWLA 1KFCB 1EG7A 2GAJA 2HXGA 3DCYA 3O8DA 4AF6A 1FLVA 4KKVA 5C34B 4B7UA 1GRRA 3ZWMA 1F0PA 5KI6A 2PGIA 4KUGA 1TJ5A 3IQFA 2XECA 5GVRA 2VOEA 3QLVC 4L4XA 3K6SA 5E2IA 4D8XA 4KFUA 4RL6A 2DUWA 2D59A 2C2YA 1QB7A 4URYR 3BGVA 1RXEA 2L18A 4J9VA 4WZ6A 1C7IA 4R1PA 5TMDA 5BV1A 1UAYA 3O1JC 4F7WA 1P33A 1EI9A 2UVPB 4HRAA 3PWSA 3SQMA 1G41A 5DYIA 1RVV1 4WKNA 4BLTA 3OC0A 1QCYA 1P1RA 3KDAA 4WFQA 4ZANA 3GFOA 4R2WA 1ORIA 4I6GA 4Q19A 1URPA 2HT1A 5BORA 2FUCA 4MKZA 1FS4A 2OK7A 3WDKA 5KBYA 4ZVOA 2HA4A 5K2MA 1LQUA 3E7FA 4FU0A 4Q7JB 1USKA 3GJ6A 3FSEA 4US0R 5IC5A 4J7UA 3VYVA 3A4YA 4B71A 1Y6GA 1KIAA 3RR2A 3KOOA 3KQKA 4F5YA 5L6LB 3GROA 3T61A 2QQ5A 2XKAA 3QVSA 5KX5F 1NXQA 2Y2VA 2OZEA 3CJQA 4I9HA 1XTSA 2QE6A 1AKRA 4MCAA 2PWAA 4ONEA 4OUDA 1FF9A 4IAOA 4O2AA 2XODA 4P4UA 2GF9A 1E94E 3OIDA 4ZCQA 1GPJA 4J1NA 5E9AA 3K0FA 4QEKA 1EFDN 1FTWA 1CDDA 4X95A 2A1TS 5AW3A 3OUUA 3DHWC 2X8WA 3ZI4A 4DR5B 5ECWA 3W9BA 1UMDB 2L19A 4H2DA 1JAIA 3FFBA 4PAQA 3ZNPA 5I9IA 5AOVA 2G40A 3OWHA 3DDWA 3IKTA 2C61A 4YEDA 1JR3E 1C0PA 4G8BA 1QVRA 4Y7CA 1WETA 1E2HA 5DNUA 2FMKA 2KLHA 2CZGA 2COKA 2M1XA 2W6ZA 1E9AA 3HSYA 3IHKA 3MG9A 3QZUA 4YI3A 4OMFG 4PF1A 4RSHA 5D3QA 3NEYA 4TUYA 2B34A 3SS8A 3UANA 721PA 3LCMA 1YB5A 4JASB 2MU1A 2JASA 2HBQA 2PZGA 5C52B 1HM5A 4L5JA 3PNSA 4BLSA 2H4ZA 4RULA 5HQJA 2O52A 4CKBA 4FX2A 4RIFA 3DBLA 1OAOC 2C20A 4ZGWA 2HWWA 5K6AC 4Q82A 5DGHA 2G25A 3GPBA 4QTUB 3I30X 2W6CX 2QG4A 3AIOA 3I3OA 1ENPA 1F9EA 4R9VA 4YTEA 5LVAA 1AZLA 1HEUA 3N5KA 1V7PC 4DLZA 1MHTA 1ZD3A 2JH9A 4V2UA 4JY7A 4FMCF 5JCXA 2GM4A 1H1LA 5CHYA 1RHJA 3O90A 1R5BA 4MUYA 5T4FA 1YF3A 5HF8A 2P27A 2YJ4A 3QQPA 4AO6A 5JYBA 3U2QA 2O48X 2A1IA 4ZVNA 4F1WA 1KI6A 4M98A 2CCGA 3SR4A 1PG5A 2XZOA 5LBTA 1TYZA 1K9VF 3L6CA 2C99A 1KMHA 1MQ8B 5AW5A 4OHUA 2C4WA 2FX2A 3Q0TA 3H83A 5C9ZA 5LMUB 3LQRA 2A2ZA 3LJKA 3CZCA 1G291 1CCWA 3ED1A 2FEKA 3NIBA 1PNVA 1V8ZA 3E82A 3QUBA 3NT2A 2WPDD 4U5QA 4IIJF 3MW8A 4DBVO 1ZOOA 3MJFA 3B7PA 4CM3A 1CUZA 3TIIA 3DZKA 3F90A 4G5HA 3U80A 3RAEC 3LYUA 1D7AA 2PT5A 1TA4A 3L7OA 4QBKA 3TW4A 4BFYA 2WIKA 3REOA 4BO1A 2ODBA 5HUJA 3RS4A 1EBFA 4LI0A 4YRRA 4TMKA 1H69A 1BE8A 5SZHB 4BASA 1BVUA 4ZEWA 2IW1A 3FI0A 2I67A 1FP4B 1PNTA 1QYCA 2HQOA 2JFXA 3L0ZA 5CVVA 1C7RA 2FX3A 2VRNA 2WIAA 2ZJFA 2ZSKA 3CWQA 3DL7A 5AKEA 4R8KA 4QDJA 3ZU6A 4CKYA 1YB6A 3EPPA 2O8FB 4K05A 4BMSA 2HJHA 4HSEA 3UJCA 1KI4A 3WJ2A 2A9PA 3HUDA 4FR5A 5LN1A 4MWZA 1I4TD 1H4VB 1WXGA 1TZCA 3O3CA 2NSYA 3MIIA 1BGVA 2PRZA 3QX9A 5LYJA 5LU8A 1KI3A 4HZIA 3PNBA 1SBQA 4M9CA 1YS9A 1QJ4A 2I4IA 2ZYSA 1FFYA 3TAUA 2VJLA 4BMNA 1CQXA 3FTEA 4ZOBA 3D8RA 3A6FA 1N6HA 3HR8A 3DEJA 3O82A 3RRNA 4C4RA 1KJ8A 1QHEA 3A11A 1GCIA 3BXFA 1C9MA 3Q40A 3VUEA 4W7HA 1X92A 4AD8A 1XZDA 5IULC 4IR7A 621PA 1L8LA 1P77A 1RRPA 1V3UA 3MTIA 4IGIA 4JLDA 1J0EA 1YCFA 2QQFA 4JXKA 5T4HA 3WBFA 3R4VA 2O8DB 4IDDA 3MJHA 5FP0A 2WFMA 2DXIA 3DA8A 3LWNA 3GFRA 1HYQA 3INNA 3Q7TA 3KT6A 3RSCA 1GP2A 4KXYA 2ATCA 3C3JA 1EFVA 2PKWA 3JZMA 4UVHA 3RC8A 1DZIA 1KU6A 3TFQA 4TYNA 1EGMB 1NTOA 1N1MA 4HX2A 4YB8A 1XZFA 1KY2A 2B4AA 4ZC1A 5G1PA 3D9QX 3MM4A 2DE0X 2W7TA 2QB5A 1YOBA 3TAXA 1ODKA 5AD1A 5CITA 4YQFA 3KEMA 1R8SA 2AQ8A 2JBHA 2YV4A 3WLJA 2ORWA 4OA8A 1MX1A 1QFYA 1QE3A 3P9YA 1YI8A 4YAUA 4MB2A 4HVCA 1OD6A 1CYEA 3BMNA 1CG6A 1LI7A 3ERCA 3NPMA 1F9AA 3HVRA 1X7GA 3SCZA 1P3JA 1SXHA 2YOGA 3C41J 2PX4A 4G0OA 3ODGA 4QUHA 1X7HA 2BP7A 2CC2A 3LM8A 4YCCA 4J3JA 1P81A 5KDDA 3UNXA 3KKZA 4I5IA 3GJXC 2I66A 5DVZA 4C9BA 1JVNA 1N6PA 2E82A 4MWTA 5KDOA 3WNCA 1FFSA 1A5BB 1SVIA 4Y2TA 1EEXB 1QGOA 1W6RA 2JVJA 4HTFB 2HTEA 4ZGBA 1PR0A 2P9EA 3NUZA 3IV7A 4WLNA 3WNBA 1UWCA 1UXKA 1RI3A 2ZB3A 4O2AF 1VJ1A 2XD9A 3T7SA 3A2MA 2X2FA 3EXG1 4Q0MA 3D59A 4N7JA 1ESMA 3CRNA 2Y66A 2HI0A 2A0UA 1EJ6A 1MB3A 2YW2A 3DOIA 3F74A 3T3DA 4GYYA 2DERA 1VI6A 3GNTA 3QUTA 5FFNA 3ILSA 2WZBA 5CFPA 1U2RA 3S3TA 4CQMB 3L0IB 3GLQA 2QD4A 2JI6A 1MU0A 3LC2O 4M1KA 2K2WA 3D2CA 1EUDA 3QOXA 1RC8A 3DOJA 3BN3A 1P7ZA 4IHJB 4UKDA 4UHBA 1MH9A 3V4LA 1QP8A 5LOVA 3S8EA 1CJUC 1DFHA 1L0BA 2W2XA 3K9CA 5C7IO 3NOXA 3PR3A 4A6PA 3T5PA 4LUCA 2JI4A 2AEMA 2QL9A 4AN1A 1F06A 1Z0SA 2GXSA 3U3KA 5AVXA 2IEZA 3I6IA 3LX6A 4V0NA 3BMCB 2JJ1A 3NONA 4G84A 2FFAA 3HBJA 4FOPA 4M1QA 4MVJI 5EE0A 2PJRA 3MD9A 3C5HA 4DWVA 2BKVA 5HVNA 3Q87B 3RJ5A 3HB7A 2IYRA 1VPDA 1ZI9A 3KQVA 3G2IA 1W5BA 2HDNB 3LP5A 4PWYA 5C37A 4IEEA 1KSFX 2C4NA 3F97A 5KWVA 1T5BA 5ESDA 4X0EA 4KN9S 1JZQA 3MELA 2NPIA 5D3ZA 1DT5A 3TLMA 1RHRA 1XZNA 3ZVKA 4HBZA 1NF8A 2WIBA 4MX8A 1M34A 4KG7A 2CMGA 1PGJA 4RQTA 1V45E 1PX2A 4FEGA 4YAJA 1K88A 2XZLA 2E21A 2XOKD 1ULHA 2VHQA 1PZNA 3ZHTA 1DBQA 4XUEA 3C1UA 2UVPA 3FHJA 2DECA 1FCJA 2WZCA 3JD1A 4E2ZA 1OH8A 4W1SA 2W6ID 1D2CA 1U0EA 3UOWA 4A7PA 1HR0B 4FC7A 2OD9A 4DJAA 2R1VB 3LY7A 1LBTA 3V46A 3LGAA 1SA0B 2OBBA 4Y2YA 2B35A 1BHQ1 1YULA 3G7SA 5I9BA 1MHPA 2LKCA 3RFVA 5IZCC 4QHTA 1VSBA 3UMVA 3PR1A 4MVJM 3TS1A 4A5SA 4DMRA 2FVXA 1UM9B 4EGQA 3GCWA 3NV7A 3TLBA 1WXQA 2IS6A 1EUYA 2P2DA 1B3RA 4P5DA 3HCOA 3OFKA 4POOA 1B6TA 5CAEA 1JP7A 4MUJA 3IKMB 4EO4A 1O4VA 2BYTA 3H9QA 3OZ7A 1ZXBA 4B3MB 2DUMA 4D46A 4GVLA 3AR5A 3FVVA 4M1SA 1MAAA 2GCEA 1OXXK 3VKVA 3OF3A 3KTDA 4C0JA 1SD2A 4CFYA 5KSWB 2VDNB 2EJVA 2Y1XA 3KPUA 1G38A 4WNIA 2YMPA 1XPJA 4RD0A 4KR9A 4C06A 4ALIA 1R9GA 3ITEA 4UE2A 1RLOA 1WR8A 3IMFA 4P81A 5E8RA 4KITB 1IM5A 1OTHA 4MV9A 5AW6A 3Q3EA 2FLVA 3L18A 1SU6A 3ZHSA 2IH4A 4LXTA 1NMXA 4HDOB 1XZ8A 2H2GA 3WLKX 1WUYA 4C76A 1V9SA 4CMBA 1H8EA 1QF9A 2WP0A 4ALKA 4WD3A 4ME6A 2J45A 5LKAA 2C07A 4JVMA 3ZQ4A 2PTGA 1A82A 1F60A 1CBUA 1UIRA 2HCTA 3F9IA 1QC5B 3H1GA 1OC4A 4TT8A 2QROA 4E5KA 3GVHA 3GJ7A 5ALDA 5I7HA 4HUJA 5EMHA 5EMMA 1P9OA 3HV2A 4JD5A 4DCCA 2MR5A 4HWKA 4C0BA 2JLCA 3C3DA 1OA0A 2J6BA 1YQUA 3KD3A 4DJTA 7MDHA 3WLOA 2BV3A 3TQHA 2KHZA 1IJFA 2FPRA 1P0FA 4RO0A 4TMVA 2WSLA 3RASA 1XRNA 3OAAD 3VI3B 3KK0A 2WK1A 1C8BA 1XQYA 4CMKA 4Q1CA 5DGCA 4CGYA 3WLSA 4WY8A 1G3IA 1ORTA 1OX5A 1XI2A 2A5DA 3LXUX 4DQXA 1W87A 2EBHX 3ZBPA 4MDEA 4J1SA 1ZGGA 1WCIB 4NK5A 5AVZA 3O1LA 5J2TB 3PXDA 4FN4A 4G5XA 1JHRA 3OESA 3A4VA 1BXZA 2H1HA 3NHJA 1J49A 4U2FA 3FWZA 4EGAA 3EG5A 1PZEA 3W5IA 2QMQA 1OYWA 4ZVPA 2BFDA 3AMVA 4BNZA 4XEUA 4C88A 3ROTA 2V1UA 4DRXB 3U49A 5KMGA 3PFNA 4PSUA 4XM2A 4F97A 3DEIA 4A27A 1Q1ZA 4KOEC 1U2QA 4O29A 5FUMA 1OW3B 3VAAA 3WX0A 1CUSA 2XE4A 4AS2A 4C7OA 4OKSA 4GGMX 4NOMA 1TEHA 3AUJB 4J94A 4Z53A 1W52X 1O2DA 4DMMA 1TF7A 3IKJA 5AQEA 5D84A 4JLWA 3V8BA 2EXXA 3V1UA 1QO0D 5EIBC 4W9MC 1IYZA 4AVYA 2BZ0A 1YDWA 4NCBA 2QPTA 4L74A 4HYTA 5JADA 4MRSA 1XVTA 2B3TA 3TXAA 5BVHA 3O95A 5JU6A 2QEQA 1V6AA 2O6LA 1OX4A 1T0BA 1PL0A 3EC2A 3OTIA 4X91A 4A26A 1KAEA 1RXWA 3NOOA 1EAYA 1JEQA 3GEIA 3KUDA 4ITVA 4N0PA 4DIFA 5BN3A 5ICSA 1W0JA 3BIJA 3HU5A 3P9NA 4ZMSA 2LXNA 2WSSA 5JCJD 1ISPA 4CV1A 1IATA 4IH4A 4YXWA 3FUCA 2PUJA 4DLAA 2Y71A 1KVRA 4REQB 5FTWA 1XEWY 4EGCB 4UJ3A 1DO8A 4Q3AA 2JZCA 3MJTA 1DXQA 1CZUA 1OCEA 2R84A 3R75A 2F43B 1GQSA 4GW3A 4QSHA 3UM9A 2WJAA 3CLTD 1VPTA 3EZFA 2REBA 4RXMA 4DLTA 1N7JA 2XSZD 4G4SP 4L6IA 4EECA 1GNLA 4RJJA 2GEUA 1UBSB 2ZJ7A 2B0CA 1Q7EA 3HL0A 5KAPA 1UUFA 4KFCA 3ZTYA 1UDBA 1Y3HA 2E0IA 4Q18A 1Q50A 3EFHA 1T9GR 1RI1A 2EF0A 2IYPA 3B89A 4JOSA 1CDZA 4R3WA 5G0VA 2HCBA 4KFSA 2I62A 1GXSA 3DTNA 3GY0A 4UZFA 5F64A 3H1EA 3A27A 4CKWB 3FBWA 1E1RA 3N70A 3CW8X 2G09A 4IYJA 3W77A 1RZUA 1FNBA 5KZMB 2O8EA 5E3HA 1U2ZA 3A25A 1HFEL 5K05A 4Q7EA 4G63A 3V2IA 1UJ6A 4X41A 4KMOA 1BMTA 4OU5A 2BFPA 3KPJA 5KNDD 4R6XA 3DFUA 2SKEA 1LNQA 3E48A 1UXIA 3PQ8A 3RSFA 3UK6A 4GECA 3CLSC 1FU7A 1L7DA 1RIFA 3U3MA 2I22A 1T9AA 1KPIA 3SX4A 1TYEB 3I5AA 2VP5A 4B40A 1E1YA 1EX9A 3AIKA 3I05A 2NACA 2VHCA 5EXPA 1GGJA 3TSWA 2EEPA 1GGHA 1ODSA 2Q4DA 3LW7A 3O83A 2FI1A 3FBGA 1KQFA 1DDGA 1AXGA 3IBYA 5J2TF 3MUEA 3HFGA 3VH1A 5HK9A 4LNUB 1JV2B 3U4DA 2NPOA 3WIBA 3ZX4A 4EYEA 3BMNB 2DBYA 1P4HA 1G42A 1KMNA 1NTRA 1U8TA 3GEGA 3ND6A 1YRYE 2JIZA 1N0VC 1R8JA 4MVJD 4MHSA 4QGBA 3UUGA 1J09A 3KZCA 3AEQB 1TGYA 2ZTLA 4KP7A 4EZBA 3HUEA 1WUJS 3SHWA 1J2EA 1V5WA 2OAGA 1NP6A 3TSCA 1XMSA 4MI3A 5K0EA 3QPCA 3R7DA 2VXYA 1G2OA 1OLUA 1CZOA 4ZJYA 2QAJA 3D6UA 4HTFA 4KBGA 3ORYA 2Z04A 3EG9A 4UBIA 4WVFA 3D3KA 3NTLA 2P6MA 4FYIA 5LBIA 5EKUA 3BS4A 1E3MA 3IILA 1JJIA 3I52A 3PVZA 3AF1A 3TSYA 1KEEB 4JLBA 3ZV5A 1A7UA 3B52X 3WTBA 4RETA 2BVNA 1JLSA 1DINA 2FWPA 4J0GA 1CV2A 2BAGA 3HI6A 2Q0XA 3K7EA 5HKLA 4JU9A 4FWTA 2VPTA 2WG0A 4EVIA 5I45A 2EL9A 2KYRA 4NG4A 3ZY4A 5DM0A 1I24A 4CCAA 2F9LA 5LQCA 3BAFA 3FX2A 3EXIB 4RHCA 1SUBA 4CM9D 2FQQA 4NZNA 1KHTA 4NYIR 5CB6A 4MGZR 1TYCA 1AK2A 1I0LA 3KAKA 2HTFA 2WWWA 4M6WB 5DK4A 4H4EA 3DS8A 4GVXA 2XZPA 5T3YA 1OZGA 1ZONA 4IHAA 2CFSA 1WKBA 3H5TA 3VYTB 1DT3A 2FZGA 4D3ZA 3S1AA 3QRWA 3Q2KA 1SN7A 1BZYA 3V4FA 3R0QA 4IDHA 1CR6A 3DV2A 2UYHA 2AVNA 4G8CA 3CWZA 3DE2X 2PMKA 3LVRE 4ZT7A 1KS9A 3W6ZA 1NPYA 2C9BA 2HXYA 4A10A 4CI9A 2XA1A 4Y6OA 5L45A 3QWHA 2H0RA 3WLLA 1TQ4A 4QPNA 4KQEA 3UJDA 1GARA 2JFYA 1BD3A 4PQYA 3GRRA 3BB3A 3C1OA 5B5SA 5AHWA 3AVOA 5KNLA 4U2GA 3RARA 4LVUA 2EU8A 2QTWB 4JNCA 5E1OA 1DTSA 5DSZA 1HUQA 3BH6A 3QFFA 3RYIB 1BMQA 1VE5A 4B7ZA 5DTMA 4Y2JA 5BP7A 3JQ9C 2HREA 4RTNA 2R4TA 4ZMBA 3U62A 5IKOA 2C2ZA 3KU1A 5IH3A 4EPXA 4YT4A 1QJCA 2YXDA 4J90A 5JE8A 3RS8A 4DUZB 3B1YA 4U3JB 5BUCA 4Z8XA 5CLHA 4HVTA 3O26A 2JANA 2KW5A 2EJBA 5J59A 3TVYA 5ESRA 3CUKA 3KP1A 1LTHR 1M6VB 4ZI5A 4DIBA 4ND1A 5FBVB 3JSAA 3IV6A 2VCEA 2G06A 4EB0A 1USWA 1A9TA 4RFVA 1Y8CA 2OG1A 3O3NB 5AIAA 1UODA 4JI8B 4QBFA 2VUTA 4KO2S 1ZJYA 1VIYA 2OQVA 2AFHA 4RL4A 2X0FA 2IC5A 3L9WA 3BKXA 3N7TA 4FGWA 2CVZA 4B3FX 1Z75A 5ES4B 3NBAA 3W78A 1L9XA 1SKAA 1MRSA 2DFLA 2AMLA 2P6RA 2P9BA 2L2QA 5IARA 1XELA 1WUKS 4OF4A 1PQYA 5EC8A 1QG6A 1YRQA 2WV9A 3A6KA 3ZWKA 4KQIA 3K1TA 4DLKA 2ZJ8A 1JH9A 3VXKA 3VKFA 1HQYE 1YFZA 2O3QA 3G82C 3OZVA 2QOEA 5HQ3B 5JAPA 4RA6B 5AVWA 2BGUA 1UMBB 3A4LA 3HRIA 4JR0A 4WUVA 3AHEA 2QI9C 4NJEB 5L3ZA 2FSSA 5H9WA 1F8FA 1R74A 1J8DA 2VRCA 5K6AA 5LMNB 4JT8A 5LQNA 5KJCA 5KQRA 2RC6A 2ZKLA 3T12A 4L2IA 4KMSA 2Q49A 1PJ4A 5CT8A 3ONNA 3ESYA 2I3GA 3F5DA 1L7RA 1KQGA 1Y6FA 1A76A 2FFBA 5CCXA 3CZMA 4GPAA 2IW3A 4BKQA 1DFIA 1KFJB 4H4CA 2VP9A 3K2BA 4YLGA 3UT0A 4I1SA 1XNQB 4K6CA 1QDUA 1SHZA 2R9VA 4XCQA 3R7BA 4E11A 2H06A 2B7CA 2IX9A 1MZVA 3UWMA 2XH8A 1JYEA 3GFQA 2BRUC 2H2FA 2DKOA 2RHGB 3D2LA 3FUWA 4FWBA 4KVFA 1ZVVA 3HO1A 3PENA 3QEKA 1LTKA 3CVOA 4CR8A 2F90A 2ZBQA 4UTVA 5JI3E 1M8PA 4I5GA 3ONVA 4QBTA 3FCAA 1DUIA 1NUUA 3TW8A 3U1BA 2P0YA 2IZZA 2QLLA 4PO1A 3E27A 4TRJA 1SKMA 2AXQA 3A9UA 1QWSA 4AY3A 1R6DA 5F2KA 1JHZA 5EVJA 1IN7A 5K3AA 1NDUA 3HZZA 3QLVA 5BQ3A 3O4JA 2OLJA 2RAUA 2WMOB 1Q92A 3OCWA 4MA0A 3ZXIA 4KX5A 5IFLA 1ZHFA 3V5NA 3C15C 1OBOA 3GJ5A 5PNTA 4MMZB 2C2KA 1LDYA 2GYYA 4ND6A 4B9EA 4REMA 3IEIA 3G6WA 1LJLA 3DTVA 3JD2A 4D4IA 3HGMA 2HMTA 3SYMA 3HKBA 2V4ZA 3NBXX 2Y1DA 1S4MA 4O4IB 3ZXYA 3A1CA 4BKUA 5ES3A 4K0RA 3RIGA 4EGJA 1U2GA 4BIIA 3CKLA 3S7TA 3YASA 3ASUA 2CNBA 4YAWA 2XRMA 1Y3FE 2ZJ4A 1AMNA 3O73A 1G6KA 5FI5A 1UL1X 2C03A 3WLPA 3EFOB 2QK4A 4A15A 1NY6A 3IP8A 2LVBA 3GLUA 5M3BA 1NMQA 1ZU4A 2I34A 1XZIA 1D2RA 4O3FA 4ALJA 1RYMA 3TQCA 4NH4A 2Y1CA 1FE8A 1CQZA 1CUCA 1EXNA 3A3PA 4Q3KA 4R31A 2HBYA 1N92A 3C24A 1OFUX 1RKXA 1TRHA 3IVGA 3LA6A 4G4JA 2DHEA 2H4WA 2VDRB 3TL3A 1NXVA 5CLFA 2Y0DA 3G2MA 5TPWB 1HMYA 2G9VA 3OU2A 5DBGA 2C83A 9ATCA 1UPBA 4S2EA 3C3AA 6CHYA 4HWRA 1BD4A 2OXFA 5CB4B 5KINB 2XGGA 4PLCA 5ICGA 2VCYA 1QB8A 3DQQA 3MC1A 4FMDF 3CUYA 4MWOA 3AR3A 4NPCA 4AMUA 4A0HA 4CF6A 2FMXA 1QTRA 1RP7A 1XGKA 3ZVRA 2WUWE 5HIJA 3ZBUA 1E32A 1H6DA 1OWMA 4ALMA 1OZ0A 5E6UB 2J08A 3L8GA 4BP1A 1GPBA 1Z06A 3BRWD 3OVMA 3TFOA 3R9WA 3LYHA 3GV0A 2LKDA 3ZZ1A 1IBLB 1EP1B 1H5NA 1QHIA 5AKLA 2NXEA 1UEJA 1LU9A 1SB8A 3OU7A 5G2OA 1QNFA 2V98A 4QQKA 2Q3FA 2E85A 3GRUA 3GHHA 3FRHA 4BYMA 2YICA 2H0QA 1AT1A 4PZ9A 2G0TA 1HE1C 3SQDA 3ZKWB 4C1NA 5A62A 2RB4A 3X1DA 4EARA 9MHTA 2CFIA 3BFJA 3F3MA 5DASA 2Q1UA 3FYUA 3W7VA 4EJ0A 3ZD7A 1A9RA 1R27A 2QUJA 3PEFA 2WM8A 1M2FA 2MHCA 2X9NA 1WMEA 3FCCA 3LIIA 2C82A 2Z30A 4NOJA 4QREA 4J7AA 5AICA 3LWBA 1ODFA 5DM60 3WWDA 1E1LA 1EJBA 2A5YB 3IB3A 1NVGA 3DVSX 5CM9C 3S70A 2KMLA 4C4ZA 2QVXX 2CLLB 1V9CA 2FPWA 2IP4A 2ZLBA 3II6X 3PPXA 1MFZA 3H6GA 2FN4A 3K96A 3TL2A 1W48A 4F4DA 1UPFA 2NZUG 1N25A 2Z8YM 4NARA 4X1YA 1MJFA 3CVVA 3ZHXA 2LCIA 2H9AA 2AKAB 2PX2A 1TF2A 3UY4A 1T0JB 3SQWA 2XTZA 2YXPX 1A04A 2XNHA 4G0NA 1HXHA 3ROZA 3WISA 1DCKA 4MV5A 4OHXA 2YWDA 1J1ZA 1JNYA 2GX6A 1TLLA 2WU3A 3FWKA 3P5BA 1XYGA 4P3XA 4WV3A 3HNPA 1JIJA 3NXSA 3DP9A 4PX9A 3TJZA 1NQTA 1H1DA 3DM9B 2GBLA 1Y4DE 1F2UA 1DV2A 1RABA 1WV0A 2Y9PB 1Y4SA 1G3UA 1RM3A 3CUUA 3MWDB 1SBIA 1SIOA 4IXMA 4MS4B 4UTPA 3BTVA 4O4IF 1B7GO 3V4SA 5KQSA 4EYQA 2HRBA 3AI7A 4MV7A 2HF7A 3OQ6A 4MYRA 1TEZA 3OE5A 1B42A 4DQLA 4Q7LA 1YJ8A 5IT9A 3JAKA 4UHCA 4MIKA 2C3UA 1Z38A 1GT91 3E70C 1TA0A 4NZPA 1XRSB 4ZI7B 2C5EA 1TVMA 4JLMA 1E2LA 2V74B 4YJ3B 2OKGA 2RH9B 2Z3WA 3T15A 3JQ6A 4EKDA 5EINA 4JBGA 1JJ7A 4R41A 3G0DA 4ZYYA 5FOTA 1WTAA 3GMIA 4ZT4A 3ZI7A 4E2XA 3KAQA 4GI5A 2H2HA 4ZAYA 2EYUA 1XDZA 3SQXA 1MB0A 4OB6A 3ETDA 4IDNA 5BYAA 3IO3A 1SOWA 1Z37A 4PC2A 3I73A 3HMKA 2Y4OA 4M6WA 3FRJA 2Q1SA 4PIMA 1JQJC 1RBYA 4XAQA 3SZLA 1NVTA 4QXQA 5SICE 3GOHA 4ZAGA 3CR3C 3EDRA 2Y1WA 3IOEA 2YZGA 3HB0A 4YACA 1HLFA 1JSCA 2UV8A 1Q1QA 2HU8A 5A4AA 3VMMA 2IEDA 1O5TA 5IF9A 4O1MA 3IUPA 4S2UA 3W2TA 3DV9A 1W73A 3QUQA 1ULTA 3R76A 2GA9A 1GTJ1 3IRVA 1JSXA 2IHZA 1LVHA 4B3IA 4HS4A 2IYOA 1EX6A 2QBYB 5FH9A 2I6GA 4CNQA 4X94A 3KSUA 3N2GB 4TMXA 5JS6A 5L40A 1RYBA 4ENQA 5CTJA 1MO6A 1ZN7A 3V42A 3CG4A 3X1ZA 3EVCA 4EBBA 1G5HA 1EEHA 4GP6A 3TIVA 1M73E 3WV5A 2BD0A 1TF5A 3GNQA 1I1NA 5HILA 3RU3A 4V0OA 3ZWXA 2XCLA 2Q2WA 4QJIA 4DPKA 3AJ9A 3RUAA 1XP8A 2XMGA 3QXHA 3LW8A 4LXGA 4RPHA 2AMJA 5EMNA 5EWMA 3MLEA 4W5HA 1RLIA 1XZEA 2FSFA 2Z2JA 1SO8A 5GZ6A 5CA1F 5LZ9A 2QMZA 3D3EA 4YASA 5D2CA 4LYGA 3NG1A 1ULAA 1HTBA 5FI3A 2O0HA 4FT4A 3EGEA 4G09A 2O9JA 1AO3A 1RW4A 1YQEA 1RCFA 3M89A 2V1XA 4XFJA 5BO5A 4XX1A 3ZE9A 4C2TA 3A4MA 1ORHA 4WESB 4BLVA 4X84A 3FPJA 3UQZA 4RKFA 3BBLA 3ETNA 3K6RA 3M1YA 3O3MB 4UEKA 4NMMA 4QDZA 2XMSA 5ILGA 1I7DA 1YDMA 3NX4A 1OASA 2ARKA 4MQEB 3L06A 3RRJA 1VHQA 1QH1A 2LCFA 4JLNA 1WOMA 3C98A 3PNPA 4BNMA 3VNUA 3DMDA 3OJ0A 5JEEA 2GCIA 1AZTA 4TVOA 4FNOA 4UNNA 3H42B 1ZK1A 3MT9A 5AFSA 2C8LA 2B1RA 5GM2A 3VGPA 4UTNA 1GNRA 3ISJA 1XD9A 3K5HA 4UEOA 1ADJA 3FOZA 2R1TB 4L07A 5JG7A 4BAGA 2W8ZA 3KZOA 1TKRA 3B5JA 1IM2A 2N0SA 2VF7A 2ADFA 2WOJA 1UBGA 4U2EA 1VOTA 1F5SA 1CLEA 2AIRA 3IKLA 1NFFA 1U2DA 4KAXA 5J5CA 5ETJA 4XIJA 3T1QA 1G2IA 3C7CB 3ETHA 4O02B 2EW1A 4AM8A 5BWOA 3W5AA 1WDTA 1NDQA 3OFSA 2OP1A 3IMEA 3TEFA 1H2WA 5C32A 2DTDA 3OUZA 4H3HB 2KJQA 1O97C 1VXRA 1Y6ZA 2SHKA 4BDSA 3H9CA 3MGGA 2PMEA 4HNVA 2ZIAA 3LF2A 3D6TB 4JS0A 4UDXX 1H6BA 4X66B 4C2UA 2JDIA 1JJAA 1GEEA 2VF5X 2WFAA 1BH6A 1R0BA 3OCVA 4YJ3F 1Q57A 3GYBA 3HXKA 5T64A 2JAQA 4KI7A 3L8CA 1I5EA 1A4UA 4A1FA 4YCMA 2IK8A 3LZCA 3P9QA 3OETA 4KEAA 3VTKA 4ZYLA 2FPGB 2OAEA 5FNVF 1GQYA 1LDNA 2V7TA 2W8BA 3GCZA 4IO0A 1JLKA 1DBRA 1DV1A 2D7CA 1QIEA 2ODNA 3CBGA 1EDOA 1RBQA 2BM9A 4GKVA 3M3DA 4CDGA 2BEWB 1P7VA 3QENA 4BO3A 3IEVA 3KBBA 2XMRA 4Q4HB 3JW8A 3RWOA 3D6FA 2CMFA 2CFCA 2YZKA 1Z2OX 4R1TA 3WY9A 2QV0A 5IKMA 1L5QA 1T4MA 5L3SA 2ZCVA 5B12A 3UMJA 1G59A 3DQZA 3F6SA 3LDHA 5DLPA 1SVLA 3DOEA 5IH7A 4D74A 1FLNA 1DWPA 3ANYB 2BSXA 3ONWA 4N7BA 4IO1A 1QWOA 2YRXA 3J80A 4BB9A 2JIOA 4ERNA 3LC1O 2PVSA 2DWPA 1O0SA 2P9GA 6PFKA 1W7AA 1QIKA 1X70A 1XX6A 4NOLA 2V7BA 3PT5A 4C6TB 4GI1A 3F98A 4N40A 2DBZA 2EDAA 4C1BA 1GNQA 4NU5A 4YJDA 1Z16A 5LNK1 3MEQA 5HIMA 2VA9A 2NVWA 3R8FA 1EFAA 2WOOA 5DPMA 1TC2A 3EAGA 4KIWA 1F1JA 1LC0A 3EGCA 4P4SB 2P9JA 3B36A 3L2OB 4HGZA 1K3UB 1O1YA 1QMGA 1UFVA 3OIUA 1Y3IA 3RC3A 3UHFA 1YKFA 3CVJA 1PEKE 2PBZA 3AVTA 3UG7A 1PTJC 4GYJA 1CUYA 5B6PA 5JD6A 1D0SA 5KX5A 4FCWA 3SJCA 2D06A 2Z9CA 1KSHA 2OZPA 2CXPA 3A9TA 3DOUA 3IIJA 4HZGA 4NDAA 2WVAA 4QTZA 2VKTA 1E59A 3X1YA 3TK1A 3WL4A 3U19A 4TRNA 4I1PA 5EZQA 4OK5A 1E9RA 3AY3A 1DAGA 1M6WA 1KRHA 4WUTA 1TZJA 1GD1O 3H2SA 4HX5A 4RZIA 5KYVA 4NMLA 5IXJA 3ZDCA 2XCUA 3R7NA 1CRQA 3OF5A 2WKQA 4LGYA 2CYBA 1EZZA 2HSGA 4MHOA 2RJOA 5MN6A 1NW7A 1QYRA 5AKHA 3VJRA 1T6BY 4LDPA 1I14A 2HBZA 3LL7A 1JEAA 3B5IA 4YP1A 4Q1AA 1GY8A 4NMHA 3RYHB 3TMAA 4DA7A 2YKGA 2XTNA 4C0HA 1IUNA 5AKGA 1PX0A 5EHGA 5TQJA 3Q98A 1VLHA 1R5JA 4MCHA 4BOYA 1YL6A 2IY8A 4B75A 2ECPA 2Q3LA 4OQMA 2I1VB 4ATNA 4WY2A 2QR2A 1QLWA 4BVAA 2X3UA 2WE7A 2ZYRA 3ESCA 3QPAA 1EB8A 2I65A 1C14A 3NP7A 4MGEA 3M70A 4UXHA 4D9IA 4FDUA 4TM7A 2J5BA 4IMPA 2O3TA 1WP9A 2ZRDA 2XBLA 2AYYA 1N78A 1JHPA 2P79A 2XGOA 3AJRA 4UHDA 3WRWA 3FVTA 3MWEB 1YZHA 2R87A 4DZTA 2WNSA 3QXCA 3LDGA 1CNEA 4PE5B 1UJ4A 2OHJA 3DBLB 1CJCA 2BFNA 4GUAA 4DXAA 2BGRA 3EZXA 4J1TA 3DE5X 2XHZA 4KBYA 2GGSA 2HWKA 3FUTA 2AUNA 4MB0A 3HM9A 1O89A 4R1SA 1I4WA 5BMVF 5EHXA 3HHPA 4CM1A 3ELUA 5A3SA 2IH2A 2LGJA 2WR8A 4X54A 1DEAA 5F35A 2R66A 5FV7A 4P0PB 3IAXA 4D9JA 3WK7A 1A9YA 3L0OA 2JEYA 1CZLA 2D0PB 1U65A 1W29A 3HR4A 2O2EA 2JHAA 1H85A 1I7QB 1U3VA 1QH8B 4ZRNA 2JLUA 3M4NA 3KQHA 1YASA 1I0ZA 4NLLA 4BRUA 3LPDA 2UUAB 1QYVA 2A57A 4RD6A 2QNRA 4BJ5A 4AZVA 3BB4A 1T3HA 3WNQA 4YRQA 2IPXA 3BHMA 3QIAA 5I7SA 5AXAA 3K4HA 1M1YB 1L4MA 1DKLA 1K5PA 2AZ4A 1FA9A 3L43A 5FLXA 4YRCA 4ZAZA 4TLLB 1K4YA 2NZ8A 1MDFA 1F2UB 5FPKA 4OL0A 3WNVA 2P2YA 3THXA 2OO5A 4IVNA 5CH3A 2WM2A 1QAQA 2XQVA 2LV8A 1JEOA 4LMRA 5BQXA 3W4IA 1S3IA 1IUPA 2OSVA 2Z5VA 4NFHA 3X0DA 3ZQUA 2FMTA 2XVYA 1M2VA 1LJ8A 1Z5UA 5JMOA 1CUWA 2QTRA 1M6EX 2VEOA 2Y05A 4O2AB 4WVLA 3GF4A 1NUAA 5LXTF 1DAFA 3CKYA 2HLPA 2ZRKA 3TCNA 3TTWA 3ZWQA 4EPVA 3O8LA 3TR6A 5JS8A 4ZT5A 2O8FA 1CLUA 3DAHA 4E94A 2FE1A 4URWR 2CYCA 3GYGA 2FJPA 3K9WA 4CKZA 4NIMA 1VRWA 3Q2IA 4UNQA 3A2LA 3UJHA 3BTOA 1Z5OA 3P0EA 1XLTC 1W4BA 3AR2A 4IX1A 3NWJA 1R18A 2JKVA 3ELBA 4NEHB 4TLDA 3S6JA 1OV6A 1KAHA 3V8VA 3ZWOA 4DSZA 4M87A 5K0TA 4OLAA 5F7ZA 1JN0A 3I9JA 2FP4B 4H9GA 3IT0A 3IJPA 1JB9A 4BX2A 5EMLA 2ILVA 4QOFA 4QEZA 4UUOA 4C21A 3LX5A 1SCQA 1PHRA 4G26A 2ZVJA 2QZPA 4TKUA 5DOVA 3D6MA 1F17A 1NE2A 2HSDA 1FFCA 2J7KA 1GGVA 4CM9A 2MCFA 3WYCA 1AKVA 2BKXA 3H1FA 4RZUA 5AJYA 1P31A 2WU1A 2ZPTX 4ZVVA 1HORA 4JVSB 2FQ1A 3ICOA 4GM1A 3FB1A 4TXMA 1ESZA 4JFRA 2H9YA 1VCHA 3ORFA 4HAUA 4LTMA 3ZQJA 5M7EA 1DAEA 1SBZA 3U4QA 3X2SA 2MSCB 3G0CA 2H3HA 1I94B 1STOA 2Z95A 3T38A 3VVMA 3VNQA 4FYPA 4LWQA 3G2HA 2PQ0A 1XEAA 4ARAA 5ELLA 4B3BA 2FY8A 1LLDA 2JGLA 3QVOA 4F6LA 1JKIA 3IL2A 2WJHA 1L6RA 2A0XA 3HCBA 4AECA 1AQNA 1MAUA 1LSOA 2AK3A 1Y4UA 3GLHE 3R2JA 2JEOA 3JVEA 4YRKA 3NMUF 5CG1A 3T5TA 1QKJA 2JJMA 3O0TA 2FR1A 5C3MA 2AXEA 5HCIA 4A16A 1HTWA 5H4GA 1Z73A 3GT4A 2JIZD 4MVJA 1A9PA 4H3VA 4MQEA 1L7BA 1LV7A 5LNK6 1UFRA 3L8YA 5SZJA 3HEAA 4OFWA 1VE9A 4Q01A 3DKIA 1NE7A 4XUCA 2YJ3A 5HE9A 5U1PA 4O5AA 2OCBA 1N7HA 1W1IA 1PKXA 3F6CA 3BTSA 1TK9A 1ABBA 2JZNA 2PZJA 1MV8A 1FL9A 1XFAA 5DT9A 1F1BA 3THWA 1Z4KA 1SCUB 1Z45A 1HYBA 2WJIA 3NC1C 1H5UA 1SU4A 2X2OA 4BMOB 3CIOA 5CCEA 3QG5A 1ZPDA 3BILA 5TQVA 1SVWA 3UT6A 2NO4A 2JI9A 1FQOA 2VK1A 3R44A 2R6GA 1AQLA 1JHAA 2CJWA 4MLZA 4IIJB 4LZWA 4NBSA 5DBHX 1RBMA 2AS0A 2OHGA 1EVZA 1WSAA 5TQ2A 3RUPA 5ADUS 2AG8A 3M5PA 2RGNC 2GD0A 1P2DA 1QK3A 1RYEA 3M49A 4ZCLA 4FOTA 4HG2A 5L7TA 3M83A 3S5JA 3PUVA 3QJYA 3FW1A 1P2SA 3LBYA 4Q3DA 3OEHD 4G01B 2VUHB 3A4IA 3DBHA 1DJNA 3FCSB 6REQA 3G23A 2FW0A 4N7RA 1R6AA 4V03A 2IOYA 4JQOA 4PVCA 3U7EB 5K3BA 4RQBA 1NRIA 5REQA 1DIAA 3ZD9A 1EXDA 1P7YA 3VKHA 2PK3A 3A1UA 3S1SA 3DEYX 1NL3A 3T7EA 4G9GA 1SPXA 2J0EA 2WAAA 3OFVA 3FOCA 1E6LA 2W00A 3PWTA 4Q3LA 2J5KA 5CYOA 5C8YA 1QG0A 3LK7A 3ETLA 4OI1A 1UDWA 1MC8A 4ZHSA 4I8IA 3F4KA 5E1BA 1P4AA 4JXJA 4BMVA 4S04A 4XB1A 3M1AA 3IIMA 2H4XA 2DQYA 4NR0A 3VTFA 4EPRA 5K6RA 1Z29A 4F5WA 2QDKA 1QM5A 4P5PA 5F7JA 1W1UA 3LVQE 3QKIA 4A8JA 4EHDA 1O08A 1INLA 5ILQA 1TADA 1N6LA 2OZKA 4FHZA 2IITA 2XMPA 4A03A 4IW3B 3BIOA 4FGZA 2IHVA 3VU1A 4LZAA 3QEAZ 3AHFA 4U9UA 3ZEIA 5K03A 4ZK6A 4MYSA 3I4LA 1WCXA 2RHDA 3JZIA 2C1EA 2PYDA 4OJYA 3SNKA 2I03A 1WMDA 2ZSHA 4G0UA 3LRXA 2J4DA 1X9GA 4LZZA 3CFYA 4HP8A 4MRMB 1ZMRA 3N39C 3DTTA 1R4NB 4LOLA 4HT3B 2CWWA 4TMFA 1U6JA 2H52A 2MT9A 2QSJA 4RPGA 3ZTWA 5KSYA 1P5ZB 1V1MB 3OLVA 4H59A 5G1NA 1LBSA 1XL0A 4WH0A 2WJWA 3O4RA 1G20A 1AGRA 3ZH2A 1GFWA 2UZ0A 2PU7A 2QJWA 2OO7A 4H7JA 3AM1A 3NT4A 2IYTA 2Q99A 1T3TA 2R00A 4C7JA 3Q9UA 1QH0A 1Z6XA 1XRPA 2HDWA 3E58A 2BMWA 3O7MA 4FHCA 4PG6A 5ERXA 4B3XA 4GMKA 1ULZA 1Q44A 4X62B 4TTSA 4EVSA 3VH4A 1SJ9A 3EZLA 1UZNA 3DEHA 4Y9DA 2TS1A 1W0KA 2ZPUA 1VGRA 3Q10A 1OV4A 3OZRA 1MO2A 4HJRA 3SX0A 1XD2A 3P8ZA 1CJTC 2QPAA 2REQA 1NNLA 2XBMA 1PJ8A 4CN9A 1Z33A 4ZOLB 5DO9A 1RQLA 5EQFA 5IDWA 4GI7A 4KLAA 2YWGA 3RE1A 4Y2XA 2WKPA 1UZLA 4PZ0A 4WXYB 1MG0A 2OKCA 2VT3A 1E0DA 4HWSA 2HNAA 2V54A 4NENA 4TGLA 3HKEB 4WQMA 3RVNA 3SC6A 3HTXA 4RCVA 4EI8A 5CLJA 3T34A 5E6RB 4IS3A 4IWNA 2QTZA 3C3KA 3ZN2A 5JNWA 1S2NA 3WZ2A 2B2XA 1JBQA 4M7WA 1L3IA 1QC5A 2XMCA 4AMZA 1OXMA 4RC9A 4I1RA 5F5NA 3AESB 5L3VA 1T8RA 2AOWA 3BMCA 3Q7IA 1NSYA 1XPUA 1BVHA 5JJBA 4CTMA 3HHEA 3W1VA 3TB6A 4B2IA 1IDN1 4G0QA 1E1RD 2D2VA 2OOKA 2VJOA 3PD1A 3QEMA 5DE3A 4PHFA 5GWXA 3E3NA 4HDSB 2WYHA 4FJ1A 1G5RA 1QGYA 2QX4A 1W5TA 3M9WA 2HMAA 4Y6GB 5DLDA 4XOIA 2AXNA 2JCXA 2OA0A 2WJZB 3ST7A 3B9PA 4RKQA 4TV8B 1H8ED 4IFIA 3BICA 3DVQX 4B73A 4K0KB 3TKLA 1F51E 3LDUA 1R9JA 4PO9A 2HPAA 4OMUA 4Y9TA 5FBWB 3OJFA 2NV6A 1RXSA 4GR4A 1RR6A 2XKKA 3BRQA 4B6PA 4N65A 5IN5A 3THYA 2XB2A 2VP2A 1W4LA 2J67A 4QRIA 3GBSA 1OWPA 2XF2A 3KJHA 3R24A 5J5VA 1QH8A 3UK1A 1J24A 2VJMB 5G02A 9LDTA 2QXUA 1P5FA 4LJ8A 1ECLA 3FPFA 4LZNA 3Q8XB 2R25B 3M4ZA 4WJZA 2EJWA 1JDBB 1KDRA 3ZY5A 1NLUA 1ZISA 2OLKA 4N41A 1E2IA 3DE7X 4JP2A 2AX4A 4DQUA 5B4UA 4DB4A 3PGJA 2QL7A 2P68A 2X5KO 5F1KA 3WAJA 4KXXA 4MTCA 1NJ6A 1NY5A 3E6AA 2NNLD 2ZSJA 4HNQA 1TFUA 2VPPA 2WWRA 1NR5A 2BTOA 1VSVA 1X74A 1HT3A 4NCXA 3T4EA 4E5UA 5JRJA 3KPYA 1WCV1 3FMIA 1GNVA 1JRLA 3LNTA 4IVPA 2YCBA 3I1JA 1AF4A 3VRHA 3WHKA 1GL9B 3OJEA 3QVXA 2GPTA 1FMLA 1KXZA 1YKGA 2GN6A 4RH1A 3Q4GA 2B1GA 4YBRA 4N0MA 2FZ5A 3P26A 1V43A 1VMAA 3VO1A 1NW6A 1WF3A 1ZRSA 3VHLB 1M2WA 4D43A 2ZAIA 5ENVA 2WHPA 3U40A 1HQKA 1XSEA 2GK7A 1WVMA 3EXEB 4IDAA 4NKRA 3I04A 4MWBA 3AR9A 1IBSA 4BJ1A 2DQSA 3NBFA 2GCOB 4GKKB 1J8YF 1GZ3A 3ADOA 3VAYA 5KTSA 4RK4A 1WB9A 1OIXA 2HR1A 2NYAA 4PSKA 5AHXA 4L28A 221PA 1Z4LA 2FP4A 4QDXA 1PWXA 2ZUVA 2SCUA 4A5OA 1T8YA 2ROQA 3OAAA 2JFGA 2DR0A 1P8AA 5JVDA 4LF5B 3H99A