3CLRD

Crystal structure of the r236a etf mutant from m. methylotrophus
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
319
structure length
319
Chain Sequence
SKILVIAEHRRNDLRPVSLELIGAANGLKKSGEDKVVVAVIGSQADAFVPALSVNGVDELVVVKGSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLGYASSLASKTGYGFATDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQSRSQNKDYVEVGGGNDIDITTVDFIMSIGRGIGEETNVEQFRELADEAGATLCCSAPIADAGWLPKSRQVGQSGKVVGSCKLYVAMGISGSIQHMAGMKHVPTIIAVNTDPGASIFTIAKYGIVADIFDIEEELKAQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.
pubmed doi rcsb
source organism Methylophilus methylotrophus
molecule tags Electron transport
molecule keywords Electron transfer flavoprotein subunit beta
total genus 98
structure length 319
sequence length 319
ec nomenclature
pdb deposition date 2008-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
D PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3clrD01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3clrD02
2EZTA 4PBTA 2AG1A 2J07A 4JSRA 4C78A 5DASA 3K35A 3KT8A 1H3EA 4V1CI 3HWWA 4TWJA 1SZCA 4ZCRA 4G5FA 2WQ6A 2B4YA 4A91A 3G59A 1Q17A 4CDNA 1M2GA 1N78A 1JIJA 2FSVC 4JYZA 1ICIA 3H97A 4CT0A 4FEGA 3IAEA 3OE1A 1ZPDA 2PZ8A 1PFVA 3ZJUA 1NURA 1Q11A 1K4MA 2A84A 1M2KA 4Q9DA 2JI7A 3L92A 2H4JA 3X1JA 2GKSA 4DLPA 3SZGA 1IVSA 4K9PA 3TZEA 3IH5A 4D5EA 5MF6A 2UZ1B 3FHJA 1MOPA 5MGNA 4K9NA 1EFPA 2PZAA 3PNBA 1KORA 5IJXA 4QQ8A 4BVEA 3PNVA 2AKEA 4X3OA 2CYAA 1IH8A 4EG3A 2WB2A 3LCJA 1EXDA 3SDBA 1IQRA 2PGOA 4JT9A 3LE8A 4MUFA 2A1TR 3N2YA 4OUDB 1BFDA 5DGDA 4DDHA 1YNOA 1PNOA 2A1UA 3EYAA 2WVHA 1UPCA 1WXHA 2WVGA 3DV2A 1M8KA 1DJLA 1EFPB 1LI7A 2YWBA 3F3MA 1KQPA 3COWA 2JI6A 4Q93A 1K97A 2D13A 2YY5A 2Z3VA 1VBKA 3HZRA 4H3SA 4JXZA 5K0SA 1QRTA 1XLTC 2PGNA 1NI5A 3PNYA 3AL0C 4UUAA 3N8HA 4UTNA 2YXNA 4UTVA 1QQTA 4JT8A 2Q5OA 4R2MA 4O8ZA 1JZSA 2QUJA 3CLUD 4K03A 4PY2A 2CV1A 3IOCA 2FWNA 1O95C 3F6BX 1NYLA 1YUMA 5D7NA 4MVYA 2EJCA 1O97C 4RMGA 2HMAA 3GUZA 4BN5A 3IVGA 4X3PA 4R2LA 4KR9A 1R6UA 2D54A 2ZP1A 3HGMA 3ND7A 2J4DA 3Q12A 3RJZA 4IAOA 1Q6ZA 1NZJA 2NSYA 4EF6A 2DUMA 4Y6LA 2JI9A 4AQ7A 3NBKA 4EG8A 1MAWA 1WZ2A 4BVFA 4JU8A 1WXFA 1G8FA 3E9YA 4JUAA 5DEIA 4YP7A 2BYTA 4NZPA 3H9BA 3FDXA 1YIAA 2FN3A 1POXA 4GM1A 1YI0A 3RIGA 5K3SA 2OD7A 4UTXA 4HJXA 3RFFA 1ZH0A 2CFOA 1PG2A 3FZNA 2H2HA 4QBTA 4D5GA 2EZ8A 3RK1A 4EGAA 2NXWA 4RUKA 2G36A 3Q10A 2H2GA 4G5YA 3GLUA 2AG6A 1O5TA 3FH0A 1ILEA 4K0RA 2XRZA 1T9DA 3ZGZA 1VL2A 1QRUA 3N05A 4KR7A 1OWOA 2JAXA 1FFYA 5K6RA 1S5PA 2VTBA 3HMQA 3CLSC 3CA8A 4MAFA 2AG0A 1EJ2A 2E89A 2J5BA 2IHUA 3AG5A 2X1MA 4XFDA 1QJCA 1YTLA 1KAQA 1WQ3A 4MVWA 1M2JA 3CLRD 1PT9A 2QJFA 4MW7A 3AFHA 4J76A 2CV0A 3I05A 1M8GA 4KPUB 5H7XA 2C31A 2PFSA 2NYRA 3KT6A 4E1AA 1IHOA 4F56A 3UOWA 1HYBA 3DO8A 2PANA 1GPMA 5EJ8A 3PKJA 4RJKA 1X6VA 2E0IA 3IOEA 1P7PA 3SP1A 4EG6A 4L3OA 2H59A 3U3DA 4I6GA 1HZZC 4G1CA 1MCZA 3TNJA 2VK4A 1T9GR 2OO5C 2E18A 1QNFA 2QTNA 3KT0A 1KAMA 2CYCA 1WY5A 2VK8A 1GTRA 1UPBA 5FO0A 2Q29A 1J1ZA 1U7DA 2CYBA 1O96B 4NAUA 1GAXA 2B7LA 2IP1A 4NX2A 1MA3A 2JA2A 1NP7A 2Q28A 4F4UA 1ZH6A 3G6KA 2DERA 4ZCPA 4Y6QA 3Q4GA 4I5IA 1X8XA 3SYTA 4JUDX 4R0NA 1M2HA 2GOYA 3JR3A 2A1UB 3D4BA 4ZZIA 1N2IA 2FR8C 1Y42X 4C7BA 1U7XA 2A86A 5EJ6A 3P0JA 2HGZA 1K4KA 1JIIA 1PFYA 2QUIA 3K9WA 3S3TA 2QQGA 4DDMA 4I6EA 1M8PA 3RK0A 5AHKA 3X1KA 1XNJA 3PDHA 4Q16A 4ZCTA 4WNYA 1JIKA 1NUQA 3ZG6A 4I6JA 2A1TS 4PBSA 1N2HA 2Q5JA 1BS2A 3IMGA 1KH2A 2A4MA 2VBIA 4RJIA 1UFVA 3L93A 3NBAA 1XNGA 1V8FA 1T9BA 2UZ1A 1KQOA 1V5GA 5FYQA 4CDMA 5FEMA 5IMSA 1T9CA 4COKA 3P0HA 1M1ZA 3VU8A 4F4HA 3CVUA 2X0KA 3ILVA 1U31A 5FO1A 4MLPA 1N77A 3ZGOA 4ZCQA 4GU5A 3COYA 4NATA 4QRDA 4ZT6A 1MB9A 1JEDA 4MW4A 1O94C 1PYDA 3A2KA 1MBZA 1TYBE 4UTZA 1KP2A 1OZHA 4HPWA 3OTWA 4U7JA 1FYDA 3LOQA 1N2OA 4MW1A 4XFJA 2Q5QA 1O96A 1GLNA 1N75A 4UUBA 1PFWA 3G5AA 2JLAA 5K0TA 1JSCA 2RE8A 1GZUA 2IJGX 2OQ2A 5H16A 2DETA 1N2GA 1YIDA 3FLMA 4HDAA 2YWCA 2OD9A 1IRXA 1N2BA 4MUGA 3GMIA 4HJRA 3D6VA 3D81A 2X3FA 1ZJWA 1KKUA 1Q77A 3RIYA 1V5EA 1D2RA 3FETA 3HFJA 4RMJA 1F7UA 2IHTA 1NUSA 4KXQA 4MPJA 2ZUFA 3N9IA 1KQNA 2VJYA 3X1MA 1M8FA 1J70A 1CT9A 4MW6A 1MB2A 3ZJVA 5IHXA 2OORC 2XRYA 3KFLA 4L2IB 5HUJA 3CF4G 1QU2A 1EUYA 2QTRA 4IF6A 1KH1A 4MWCA 4CQNA 2GM3A 1U0BB 2DXIA 1WKBA 4KPUA 4ZP1A 2DR2A 2DLCX 1G59A 1EE1A 5J5AA 2J08A 1YULA 4JZYA 1F7VA 4BWVA 3GLVA 1TYAE 1RQGA 1WOYA 4TWIA 4X0EA 4GRIA 2EZ9A 3K32A 2H2DA 1JILA 3E27A 1YI8A 3VRHA 1OZFA 1TYCA 2QUHA 3MMXA 4MWBA 5AHWA 4ZCSA 5TEVA 4ZT3A 2W93A 1H1TA 3PXUA 2PZBA 2C5SA 4BVGA 5EJ5A 2JI8A 4HK4A 2DEUA 1E3TA 1OVMA 2JLCA 4MVXA 4AS1A 1U2DC 5BWNA 4JUFA 3IVXA 3UMVA 1J20A 3AKZA 3RBAA 4K9KA 1T6YA 1I6LA 1I6KA 4QREA 2Q5LA 2DJIA 3GLSA 3DPIA 2Z08A 5J59A 1J21A 1J8FA 3IMCA 3CVYA 5EKDA 5TGTA 3SEZA 4UU7A 3VGJA 5LLTA 5EJ7A 3ND6A 5MFPA 4PBRA 1IQ0A 2WSIA 1ULHA 3NV7A 1N0HA 4R8MA 4MUJA 4RMHA 4FEEA 5DK4A 1O95D 3COVA 4U63A 4XSVA 4DE5A 2BTEA 5HG0A 3CVXA 2VK1A 2A7XA 4JFAA 4EG4A 3P52A 1OBHA 1JEEA 1TFUA 2PXHA 1EFVA 4FVTA 5EJAA 4NAHA 4EFKA 3M5WA 1H3NA 4K9OA 3BL5A 4YBRA 4MUIA 1Q1AA 1ZUNA 2X1LA 3CLTC 3JXEA 2Q27A 4BV3A 3FNRA 1U3DA 1OZGA 4MQ5A 4BN4A 3A04A 3FOCA 2OV4A 3ZIUA 4OUDA 5DEOA 1N1DA 4UU8A 1MAUA 1M8JA 4EG5A 2DPLA 3F6EX 1JECA 4MQ6A 1J09A 4RJJA 1O6BA 1H3FA 1EUQA 2JANA 1R6XA 4UZFA 4GP9A 5EJ9A 2R5WA 1KR2A 1A8HA 1B6TA 1WXGA 1N2EA 3FY4A 2H29A 3UK2A 1XJQA 4ZT4A 1QRSA 4BV2A 4QPZA 4BVHA 1OWMA 3DLAA 1Y9DA 1O94D 1M83A 3EY9A 4ND6A 1U28C 1PG0A 5F23A 2O5RA 2QUKA 3KT3A 1VBNA 1UPAA 4UTRA 3AIIA 3OP1A 4U8HA 1NUUA 1GTSA 4MULA 5JBNA 4MUNA 3QE4A 1QU3A 1WQ4A 3IUEA 3TQIA 4K9LA 1OBCA 4GM0A 4UZEA 1U3CA 2IHVA 3CLTD 4J1TC 1LW7A 1LI5A 1M2NA 1GN8A 5MFZA 2A88A 3MXTA 3QTTA 2E21A 3FIUA 1WXIA 1QTQA 2QJOA 3A05A 3COZA 1YI1A 2AZXA 4EG7A 1S7GA 1POWA 4TS1A 4F3RA 1QPBA 1N2JA 2CSXA 4MUKA 1G8GA 5LM3A 3SEQA 1PFUA 3TS1A 4MWEA 3UC5A 4Y6OA 3U31A 4IG9A 2NZ2A 1TEZA 2Z09A 2H2FA 1SURA 1DNPA 3ZGVA 1YHZA 3TZLA 5BNZA 1R6TA 5DB4A 1PNQA 3HWX1 2FRDC 4QELA 1I2DA 1O0CA 1VBMA 3IAFA 3FWKA 3IDFA 1V47A 4BVBA 1S4MA 3C8ZA 1WXEA 1YUNA 3P0IA 2CUZA 1KH3A 4ZT5A 1KP3A 5J58A 2ZUEA 2CT8A 1N3LA 4MWDA 4MPPA 5HUHA 3CLRC 3D7KA 4J75A 4KKVA 3IUBA 3MLAA 4MUEA 4FZ3A 4GG1A 3H05A 4P2BA 2WVAA 1O97D 4K9MA 5BWOA 2EZUA 4FZJA 4NDAA 2H4FA 4GM4A 2HJHA 2IELA 2QTMA 1NUTA 5FNZA 1JHDA 2J09A 3H99A 4JUBA 4GPEA 1JGTA 4RMIA 1OD6A 5BWLA 4JU9A 4MW9A 5KHAA 2H2AA 1F9AA 3ZXSA 4DNXA 4HD8A 2O8VA 3UY4A 4MZXA 2CV2A 3SZ3A 3ZJTA 1U2GC 3ELBA 1OWLA 1Q19A 2PG3A 1YBHA 4YP6A 4ND7A 4L2IA 5KCMA 1YC5A 2V0GA 1SZDA 5K6TA 1PVDA 2VTBB 1IFXA 4YMIA 3QTBA 1NM5C 3U1VA 4J16C 2I1LA 2TS1A 1Q15A 2D5BA 1J1UA 1YC2A 2EL7A 2RD2A 2VXOA 4K9QA 1NUPA 4KR6A 2VBGA 4V1CB 4JXXA 5LFAA 1Q14A 4MUHA 1MC1A 3INNA 4BUZA 2QQFA 1F4LA 2BRUC 5TS2A 1K92A 1JMVA 1PO7A 3PKIA 1I6MA 5TEWA 3ZUGA 2WQ7A 1PI3A 3FSJX 3JWPA 2V0CA 2VBFA 1T6ZA 1O0BA 4MVCA 4ARIA 4MW0A 3AG6A 5KWVA 3HL4A 1T6XA 1T9AA 4MPRA 1TQ8A 3LQ1A 5K2OA 3PRHA 1OWNA 1TYDE 2H2IA 3TQOA 4JUCA 3GLRA 3MUEA 2QJTA 1MJHA 3CLUC 4YP5A 3HV0A 1XNHA 5EJ4A 4ZT7A 3IOBA 1JZQA 3MLBA 3IMEA 3ND5A 4ZT2A 3EA4A 4DDKA 5DGTA 1PTJC 3RHSA 1IQUA 4MW2A 3H9CA 2H4HA 3CR8A 1D4OA 2X7JA 4S1OA 4G6ZA 1V5FA 3GLTA 4KGDA 4OJMX 5EJMA 3FG9A 3FI0A 1NSYA 1G8HA 3ZXIA 3D6UA 1COZA 2PIDA 1WJGA 3ISJA 1YHYA 3IVCA 1VLHA 4ARCA 1Z8NA 2JIBA 2V3WA 3IODA 4EG1A 4DJAA 4WSOA 4RPIA 3CVWA 1EFVB 4V1CA 1OWPA 3CLSD 3A4IA 3CVVA 1T9GS 4MW5A 2EZ4A 4JD5A 2OD2A 1MRZA 2HZ7A
chains in the Genus database with same CATH superfamily
2DFLA 4F72A 3JRWA 3UJCA 4TXNA 4D9BA 1ZITA 4JLDA 4UAUA 1LD3A 2XI4A 1GUZA 3K1JA 2B7CA 3QBDA 4YS6A 2BBSA 4TWJA 1QFJA 1P3DA 1N4AA 1JDZA 3PC4A 4E4RA 4L6IA 5DBEX 3C7DB 4KQCA 3M4YA 2W0SA 3R5FA 2DPMA 4TQAA 2LR0A 2J0SA 1YU6A 3H1EA 1T1GA 1Z4OA 3A6LA 4HQFA 4IO1A 1AMOA 1SHTX 2H0RA 1VE9A 4HMQA 1HURA 2XXBA 3RKSA 1B23P 3UT5A 3UJBA 3ODPA 5DK6A 2DWQA 1EK6A 4L5BA 3TEFA 4K9PA 2FXIA 3AXTA 4IDNA 3SZGA 1XLVA 4R3NA 1M2WA 1CEYA 2BR4A 1SA0A 3IIIA 5MGNA 4K9NA 2PZAA 4BLPA 3A4LA 4QQ8A 4DCVA 5K05A 2B4TO 3VR5D 5HKOA 5JXIA 1V16A 4LYDA 1RJ9B 4PSVA 4EKYA 1E2FA 4ZN6A 5K0BA 3CEMA 1I32A 2QHXA 4UE6A 1YB5A 4EGCB 5CDHA 1OR8A 3IBCA 3LUDA 4MCIA 1UZLA 1HA3A 1BDHA 3C6YA 3W6OA 3Q9LA 4Q02A 3WADA 5LUBA 1UT5A 2IVZA 1G4AE 1SA0B 3F5FA 3EGDA 4LJAA 3B52X 3Q7RA 4QDZA 4HGYA 5EZ6B 1TVCA 5IC5A 5A3RA 1I9GA 3COWA 2XKJE 2ZUUA 1F06A 4KUHA 4LGCA 4PRLA 4QOHA 5INTA 2Q6OA 4FYXA 2OILA 3EPRA 1C2YA 2HLHA 2ZJZA 1OXKB 3R7AA 3W4JA 3KJFA 1QRTA 1VSVA 4MHSA 1NI5A 3I2FA 1Z6TA 4D4IA 4NCBA 4P0TA 4BJ6A 4X9XA 5DTIA 3CLUD 4KQGA 1ZJZA 1EUZA 2VF5X 3IOCA 4PRKA 4XW2A 2EKDA 1SXHA 4Q05A 3K09C 1JPUA 5LA6B 3ZH2A 4U39A 3M3PA 3QHQA 5B4UA 5DM60 3BZUA 4E07A 4P80A 4GS5A 4YJ2B 3RJTA 1JPNA 4C9BA 3T5PA 4IAOA 5G0UA 1PGNA 1VIYA 2XA2A 3SBDA 2D1YA 3EUEA 1HZJA 3V4FA 5C2JB 4YCSA 2B82A 1QHXA 3LHFA 4OA8A 3UJ9A 1U9JA 5F3DA 4IINA 1UWLA 5TT1A 3SHVA 3WLOA 4CLHA 4BEJA 5HA5A 4BVFA 4JU8A 3W5HA 3EWNA 3ULKA 5LQMA 2V65A 2HXSA 1YE5A 3H9BA 4NXMB 5EP2A 4N47A 3CXRA 4UOQA 2CKDA 2R6AA 3KYDA 3U4HA 1EZ1A 3F73A 3MCTA 5K3SA 4OXXA 3VZQA 1BC5A 1YB2A 3BXPA 1SG9A 2ERYA 2VQFB 1MF7A 4TTIA 2OM2A 3OM0A 4CEJB 2ZB4A 1UMBA 1CJMA 4DQKA 4WBNA 1B26A 1SQ0A 4DRYA 4AY2A 4F38A 5ICEA 1J2YA 1JH8A 4NLLA 3EOBI 1YL7A 3FH0A 4QPPA 1VKRA 3UK0A 4KRFA 4L0DA 4QJIA 1U81A 3MRSA 3B8EA 2P5SA 2JIZD 5D00A 3GLFB 4DMKA 4G5OA 2BMDA 3LCVB 3HLKA 4MV6A 4YREA 3CLSC 3JZAA 4OLAA 2KWIA 2ZR7A 1NQVA 4A0SA 2M6RA 3PYMA 1IZYA 5AJHA 2JAWA 4GXTA 5BWCA 2NACA 3OZGA 1V9SA 4HSGA 5B7PA 5FNVF 3ZC3A 1FB5A 1IL0A 2Z04A 3H84A 2XSZA 2JLYA 1G0OA 3W5VA 1Q0LA 1DAIA 2Y0CA 4IF4A 1PRYA 1MVLA 2ORWA 2C31A 2HIAA 1E2BA 1W35A 2SNIE 4HDKA 1SVLA 1ZNZA 2FUCA 1OYWA 2JK1A 3K3PA 4MUYA 3T94A 3AVPA 4XDZA 3DO8A 4Z4CA 1EG2A 2AF3C 3MTEA 3JZMA 4BY9E 1BHO1 2AJCA 1W1WA 3IMKA 5AWFC 4JC0A 3G2KA 4EHHA 1NR1A 4FN4A 3ESXA 4EJFA 2XMSA 4FZVA 1IY9A 5LZ2A 3KEQA 3HEBA 3NWJA 3K6SB 1VE3A 2I87A 3HC7A 3PPIA 4I5GA 3FWZA 4HDSA 2DHQA 4GZ3A 3ZGLA 5CB0A 3VJRA 3LPLA 1W87A 2WJ6A 3B3AA 1VBFA 1TLFA 1TYZA 2FKAA 3B13B 4J6EA 3DMTA 3RAGA 2RGGA 4C88A 2NU9A 2XWSA 1LNQA 1WV1A 1WB6A 5T8KC 4AMZA 1G3MA 4WNAA 1YUBA 2WP8J 1TM7E 1TJ5A 3PBKA 4NAUA 2OVFA 4BO4A 2PRKA 3GJ6A 3ICQB 4B7UA 1N5JA 4FOOA 2BSQA 1SC3A 2WRZA 2ZB3A 3TWOA 4RF3A 2QZJA 1I94B 1UXIA 4PCLA 4CE6A 5I5EA 2OCKA 1N2IA 1IRIA 3ILSA 5HQ3A 3CWQA 1X80B 3P0JA 4MOWA 3ITEA 4U6QA 1A9XB 2R62A 1NYRA 3G2HA 1QS0A 5BNTA 3LUHA 3Q3HA 3TUZC 2NX2A 1NUAA 1E77A 4C7OB 1TKRA 3TXXA 2MSCB 5AICA 1CRWG 2YMPA 3G2IA 2J0EA 4D42A 3ZK8A 1GXSB 5TQJA 2ZI7A 1D6SA 1GYRA 1VA4A 4JP1A 3GJYA 4YTEA 1KZGB 1NMSA 2V8OA 1AZWA 1L4YA 3OP4A 3AT1A 4KO3S 4OBEA 4BLTA 5M2QA 2O2ZA 1QHNA 2WFMA 1XZQA 3ABZA 1X38A 4KO8A 1FYWA 1TCBA 3EC2A 3NASA 3VR3D 1KWGA 3WLJA 2O1WA 3MWJA 1PQYA 4WOJA 3STUA 5L3QB 3EHDA 3LC0A 3LDAA 2I99A 4M49A 4W1SA 4EGSA 5A6VA 4YJ3A 1Y7TA 4BQQA 1JKIA 2ZVQX 3SJAA 5FYQA 4JR0A 5KI6A 3L1VA 2NP6A 3QUQA 2ZYSA 3MTJA 3QNUA 3DLIA 1TZCA 4JI3B 2C7GA 1TKBA 4GU5A 1HMPA 4TSKA 1NXXA 2WC1A 4JKYA 2DTEA 3RB8A 1V39A 4H7JA 1O94C 4F2PA 2FZ4A 1MOZA 2ATCA 1V25A 2WD8A 2DT5A 1FDWA 3KC2A 4MR7A 4A03A 1P81A 1KP2A 3DMYA 4OM7A 2JD2A 3QBVA 3V7WA 2ZT8A 2CLFB 1WBJB 5HOEA 1P2BA 3VTKA 2V7XA 3DS8A 3HY3A 2RAUA 3L8CA 2YNMC 3Q3VA 4RKEA 1UBUS 1U0NA 1KAGA 4HDNA 1CZKA 5CA1F 3JQ8A 3PXBA 3RM3A 5FI3A 2W6CX 2GX6A 4JHXA 2UU9B 5FWDA 5KX5B 3GMIA 1V2GA 4HJRA 1P4RA 2PRSA 4QOIA 4U8GA 3WRVA 3DT9A 4U4AA 1V5EA 1L5GB 3ZE6A 4D4LA 2CHFA 4URWR 4Q9HA 4R0MA 2XBLA 2P4EA 4GOOD 3N9IA 3WGYA 4RTOA 4JLNA 5GVSA 4ODIA 1ST2A 2HWKA 3W9BA 2VTEA 1DKRA 3R9XA 1Y63A 2XPCA 2HCFA 3EXHA 1E4OA 2WF5A 1IHPA 1B15A 3WYEA 4EFDA 1RLOA 1A8IA 5ICSA 2H48A 4TUYB 5ICFA 1G17A 2B36A 1GRNA 2JLRA 2WD9A 4PZZA 4Y67A 5I9SA 4IWXA 1DQNA 4JVNA 1VZ2A 4RH3A 5FTJA 3VJMA 3U9TA 2AR9A 1U3GA 2GBPA 3O8DA 2FLWA 1S3SA 1WOYA 3D7SA 5FBLB 3THWA 5F1PA 2CFSA 2GN0A 4F4CA 4DMRA 2O1EA 5FH9A 3HVUA 3MMSA 3OPQA 5KTRA 3DQZA 5DHUA 4QT0A 4QFCA 2QZ4A 3LQKA 1WU8A 1WKCA 2P3LA 2JA1A 3MMXA 4PSUA 1CRQA 4CTJA 5H70A 4KN6A 1HL7A 2ASEA 4F1KA 1Q0RA 4NENB 1RVDA 2QN9A 2D3TA 3AF3A 4LDZA 3ZU6A 4BVGA 3O91A 4X8HA 1CQXA 2A5FA 1MA0A 2XGJA 2V4MA 4L74A 4IOKA 3V33A 2F4VB 4YV7A 1SZJG 2OVBA 2UYQA 4GXNA 4PAOA 1UJ4A 3S2FA 3V4LA 1IK6A 2ECFA 4RPCA 3T3HA 3NUGA 4BO5A 2GZMA 2QNRA 3WLRA 5GTDA 1JEYB 2Z08A 1EBUA 2JVIA 2H4YA 1OH6A 3W4KA 3LA6A 2ERCA 2F67A 3NI2A 3E5NA 2Q4RA 4EFLA 4F2WA 4NHOA 5KNBH 1ULHA 1GGJA 2G08A 2ZR8A 1W30A 3AR4A 1OLXB 4HCJA 4YRJA 2CFRA 3EVZA 2VK1A 1VL6A 1HE4A 1GFWA 3ZV7A 3VYTB 5CFNA 4RTKA 3O73A 1OBHA 1X3LA 2RJOA 3VDXA 4FVTA 1MHTA 1QQBA 5BQFA 4EFKA 2P8JA 3L04A 1YA6A 2NTNA 1KI8A 3JV7A 3G6WA 1Z5NA 3BL5A 1JLLA 4QYMA 4BNDB 4EHJA 4CR6A 1B8OA 1LX7A 2FXVA 2Q2NA 3H1TA 4LBYA 3GRCA 1E7RA 2WF8A 3I28A 1T5DX 3FPAA 1LQUA 3BK2A 4MQ5A 3RSZA 5CDGA 3FW1A 4ZU1X 1LXCA 2A8YA 1QH1A 1WRBA 3FSGA 1LK7A 4H9GA 3LYLA 5C8ZA 4GNRA 3RVQA 1EP1B 2X8LA 4AP9A 1B4DA 3CIFA 4YMUA 1IK4A 4MYDA 4WK4B 3TLAA 2VP4A 4X90A 4JJEA 4N7RA 5FUVA 4CM7A 4YXWA 4IUYA 1EUQA 3LUFA 2Q3EA 1RMQA 1PJBA 5KVSA 3AUSA 2XKKA 2RGNC 1HR0B 3MCAA 4B4OA 4DLYA 4YC7A 4QPZA 1Z3CA 4CMHA 1LH0A 3MAGA 1NAIA 3BULA 4K3UA 3HA3A 1U28C 2SHKA 3ZVKA 1BVRA 1QHYA 1W8IA 2F62A 3IA2A 3NT2A 4PPGA 521PA 1FSPA 1SKQA 2Y4NA 2XTJA 3BMCA 3URKA 1C7IA 1KZ9A 3M5CA 4JASB 2J0UB 4NJEA 3RAJA 5IM5A 3ZE0B 3QE4A 1E9SA 2BJHA 3E2PA 1Z63A 5CLFA 4GBGA 2GILA 2IZZA 1R1DA 3VKVA 4O2AB 2QA5A 4PLYA 4GYKA 5EYPA 1MENA 1UPXA 4DC1A 3SIPA 3AFOA 2BFDA 5KX5A 5MFZA 4ZQFA 2B30A 2ZIXB 1QBKC 4JI6B 4QLAA 4EHFA 2ARKA 2QIPA 1WY7A 1EFKA 2WTXA 2H00A 3JALA 3LD9A 4URFA 2QLNA 3MWEB 4WWHA 5E7IA 5BMVA 4DMMA 1KMMA 3DPUA 3HCAA 4KPFC 3EZ9A 2WTMA 1ULBA 4TS1A 3GPLA 3WFIA 4FB5A 4WZAA 5AVOA 3KM0A 2AR0A 3D0OA 4MUKA 1Y7IA 4JEHA 4CDGA 1WG8A 1GGKA 5K4GA 4YPVA 2QLMA 2ZBEA 1Y8AA 2PSDA 3LIPA 4LXGA 1YHZA 5A5GA 2O2SA 1R6TA 2PCLA 1F48A 4RK4A 2XE7A 2D3WA 2LIPA 1O9BA 4KQXA 4WCDA 2Q3FA 4QX6A 2P79A 2R48A 4TLBA 1XELA 4BNTA 1L4HA 5F9HA 1SUFA 3CSUA 4D2IA 3KOUA 4QDKA 5C8DA 2HM7A 3R20A 4G37A 2PH5A 5BUZA 1I51A 3E23A 3VO1A 5CDYA 2ZCJA 1C7FA 3MT8A 1LZLA 4AKTA 2ORVA 3HM2A 2VPPA 5KWSA 4MRMB 2OP1A 4KFSA 3PEYA 1M1YA 5KJCA 2BFAA 2IYWA 1XHLA 4QG7A 1FLDA 5EIEA 1CUCA 2OC9A 4FFMA 3GRKA 1WXDA 3N2EA 4ZOBA 3LI2A 2AQKA 3NGLA 4QVIA 2FPIA 2H2AA 1F9AA 2V7EA 3CB4A 3A4TA 4WXPA 3UY4A 1ETUA 3JVEA 4C04A 4PANA 2QPTA 2WHQA 1X14A 4JBYA 4XCXA 3BXOA 3L77A 1F0PA 4BMOB 2Q3BA 5HQ3B 1D0SA 1XAJA 3HO1A 1H9AA 4F9TA 3PDJA 3IX7A 4KZKA 4XARA 1PHRA 5BXQC 3F78A 3HDJA 5DNDA 2PAAA 5F7ZA 2EL7A 4K9QA 2R7MA 1TEVA 3I12A 3EMKA 1XL0A 3MTGA 2CBZA 1PR0A 3R76A 1IJEA 1RWXA 1JLRA 1ATIA 2V03A 4IKPA 4PQYA 3PU6A 4TV8B 3MTAA 4MUBA 3UV3A 4LXHA 4BCCA 5LXTA 4FR5A 4XLLA 1YF3A 1H42A 3RABA 4C6RA 4GPTA 4XPIA 3WK6A 3KFXA 5BRNA 5TS2A 1JMVA 4RLQA 5M34A 1IBMB 4ZVPA 1ZMXA 1CJTC 4XDHA 1TE2A 1B00A 3RYIB 1A95A 2BKVA 3BMOB 2GO1A 5CTAA 4C7VA 2Q3CA 3HYRA 3R2JA 3V8BA 1IN8A 4EFMA 1J0BA 4US1R 4CM8B 1NQ5A 1WCV1 3VISA 5FWYB 3K31A 4BX9A 2CK3D 1PYGA 2OK7A 2A5LA 2GPSA 3HV0A 3AP1A 4EHNA 1RI1A 4MXDA 4ZT7A 4R05A 4WN9B 2PSHA 2CHEA 2W2MA 4FZ5A 4A10A 2O8NA 3FPGA 2E7ZA 3R3HA 3FE2A 3NWOA 2H4HA 2FFAA 3KWMA 1CZOA 4FFBA 3ZU2A 2XQGA 1XMSA 3MERA 3KJXA 1QX4A 4AJOA 2D7DA 3IKLA 3FI0A 3O84A 1A4XA 3ZHOA 4IGAA 1JL3A 2HYIC 3AFIA 4UE3S 1DU4A 2QRKA 3L8ZA 3VO9A 2V3WA 3WHPA 2P9HA 4J0IA 5CVTA 2JJMA 1RXEA 4IQ8A 5KZMB 2O8DA 2WZCA 3N7AA 5JRDS 2I2AA 2GPAA 5IW8A 1QVRA 4V0KA 3U4QA 1VCHA 4HMOA 3J80A 4U3JB 1JHZA 4GGOA 2HZ7A 2VF4X 1NRJB 1SVSA 2BFMA 4DHEA 5L7TA 3W9YA 3Q6NA 1H8ED 1ZINA 2V98A 4I4LA 1K0UA 2CJXA 2F90A 5JQWA 1YXMA 4FDAA 4G1EB 3K1ZA 4BNUA 1XQYA 5ESXA 2WJVA 1ISIA 3C98A 2JCVA 2R1VB 4JYZA 4PG6A 4V24A 1PSDA 2X9NA 5LMZA 4DV3B 3D3KA 3DMTC 2OHXA 3MB8A 2H5LA 1MZPA 4DIKA 1PFVA 4ZMBA 3HG7A 5JO9A 1Q11A 1DC5A 1U6JA 1M2EA 2FN9A 3I58A 4IJKA 1I33A 3SSMA 2WNHA 5FR2A 2E1PA 4OMDA 3HADA 1I13A 4RTPA 4O4HB 4EB8A 1WPQA 1ACJA 3UJ6A 3RSQA 5BQXA 5I4CA 3V7FA 4D82A 3FHJA 1M6NA 2VNJA 1IMJA 3E22B 2XYRA 2XTNA 4NCKA 1A9ZA 4ND5A 2GJ9A 5DIZA 5IJXA 1XRPA 2C9OA 4LHYA 4NVRA 1ZUIA 2HTEA 5JD6A 2ZJ8A 5G4KA 3TSYA 2YN2A 3HR8A 1IN1A 2ZPUA 3GLFA 1U1CA 1FFXB 2GEDA 2ZETA 1Y8QB 2D74A 3A4VA 5CT6A 3GNSA 3STHA 2FR8A 3UK1A 1EAYA 2M6LA 1Y98A 1NW8A 1KQPA 3A36A 4DSNA 1KEKA 2Z5FA 3MN1A 5AW4A 4TLDA 2BFEA 1R8QA 2Y1EA 4N5NA 2ZBQA 4DF3A 3CWCA 3D2CA 1PW7A 3INRA 4X61A 5DLQC 4E14A 4BC0A 4X24A 5I4IA 5K0SA 4OX9B 5ILQA 2PL1A 1Y3HA 1ZKMA 3MWLA 4IIHA 4Y2VA 3A1WA 5E7MA 5EIBD 1WABA 4WFKA 3V4ZA 4NG4A 2CXSA 4J07A 2NO0A 1E9BA 1JXQA 1NBAA 1OA0A 1NYLA 1DRUA 2G5PA 4Z0NA 3ZI0A 5A2GA 3PVCA 2NYUA 3AEXA 4IX1A 4KDCA 3L7IA 3H4VA 4L16A 2PTGA 4MWSA 2D54A 4PWZA 4QHYA 1T8PA 5MDHA 5D51S 4DMFA 3AF1A 3Q9UA 1R8YA 5HPYB 3NTRA 1QIHA 3KAPA 2G7ZA 2HSDA 1MV8A 3JZIA 3IRVA 1F4PA 1U7WA 2NV0A 1NXTA 4FMCB 1WE2A 3GH1A 2E4WA 1JQ5A 2VAVA 5BR8B 4JLMA 3GEDA 5HRCA 3Q87B 2IUSA 3UKJA 5CG2A 1EJBA 5JXWA 4UEKA 4MQUA 4HJXA 4EB0A 1ZH0A 2QYHA 5AI8A 4HUJA 2CFOA 1PG2A 5I8ZA 3TVYA 4UE2A 3PXCX 2J6CA 1RW4A 4EGAA 2Q2OA 1VXRA 1EDDA 2CCGA 1FVOA 5DHPA 3U3ZA 1ZEMA 4N65A 2YBEA 1Z4LA 1V2HE 1BCRB 3ROMA 2IEIA 1D04A 2RB4A 1KYXA 2XRZA 1C1YA 2F17A 1HGXA 5CG1A 3ABSB 2DQSA 4Z3KA 3O3OB 3M6VA 3BQ9A 5MHTA 2QLTA 3LLUA 4CEHB 2R1TB 2WMNB 3GA0A 4X6LA 2OCIA 3AOEA 2FUEA 4ETNA 3HVJA 3IXQA 2J3QA 4L0MA 5TVGA 2LD4A 2VYFA 3H5IA 1SUAA 4G07A 4KO2S 4WFJA 2UVQA 1KMIY 2CV0A 2HA3A 3LVRE 3I05A 4Q4HB 5CFOA 1N2CA 1OFTA 4R2XA 4LNUB 1XTJA 3OCWA 1DKNA 5DN6D 3DPSA 3IE0A 5K0JA 1MW9X 1DBIA 2XF2A 1TZ2A 1MGPA 3OKFA 6CHYA 5EUCA 5IDWA 2XNJA 3M3DA 1IZ8A 1G20B 4N1AA 1SUSA 5CIWA 3R7FA 4CIXA 2XUQA 1JKFA 3LGSA 4Z9AA 5EJ8A 2PUCA 4K05A 3VNVA 1RLJA 2VT3A 3JQBA 4FFNA 4EG6A 4B6EA 4FQ5A 2G1KA 2QQEA 2Y92A 3NDPA 4GX5A 4L0QA 4XXHA 1T1JA 3COSA 3CX8A 5CFRA 2LKDA 2X8AA 1IIRA 3IV9A 2YQ5A 4Z54A 2EW2A 2J3MA 2QRMA 3QHPA 4CKZA 4PN3A 2XB2A 4YJDA 1MC8A 2XIQA 1TC2A 4ZQGA 1AG9A 1SBHA 2ZI5A 4HAZA 4ZTZB 2EP8A 4EUKA 3G3EA 1BA3A 2HJSA 4FZRA 4Q3DA 4BHTA 1J33A 1Y8CA 2E4YA 4ENTA 1W5SA 1D5WA 3QWBA 4LOIA 3A9UA 4HQOA 1YB1A 3UB2A 4B6GA 3QX3A 1PLJA 1CUZA 3E5MA 3HB0A 2WLSA 1AGRA 2GVDC 4ENQA 4CMIB 1M74A 1QUEA 2PWPA 3T1NA 4DNOA 4P5EA 3BD8A 4I3FA 2IY8A 2VRWA 3ESZA 2B8NA 2H1OA 3T0IA 2X13A 1J2JA 2PUFA 4M4SA 1JIVA 4LGYA 4DLXA 3D2AA 3ITNA 5KC9A 4ZEOA 1MXHA 1QZXA 4IEIA 5FBZA 2R8ZA 1RYDA 3QPUA 4I50A 5HZHA 5A02A 3HYSA 2X77A 1OMOA 3GYGA 2ZT6A 3KWJA 4PW0A 3GAZA 2GVZC 1JWAB 2RDMA 3VPBA 1XV5A 1U3VA 1X86B 2ODPA 2IC5A 3Q9SA 4BMYA 5E95A 5TS3A 1N4DA 1HX7A 4BXOB 3WLHA 1CUEA 2FQQA 1WCIB 3JWEA 4W7IA 4YJFA 2WSMA 1G8PA 4R5HA 4IICA 3KQWA 2YVQA 4TWAA 1CZNA 2A9OA 5I51A 1XP8A 1KYZA 3FOBA 1T24A 1T9BA 1VM6A 4IDDA 4RJTA 5B3JC 3SE0A 2P4HX 1N3IA 5JAIA 3DAYA 4UVHA 3HPRA 5AJZA 4DREA 4DV1B 1OV6A 1T2NA 4JEUA 4K8OA 4MWGA 4QSMA 3WGNA 1HFKA 4XQ9A 5BN4B 1L4GA 2MYTA 1VOTA 1A8SA 3L7MA 4UHHA 4EYKA 4C89A 2Z2YA 1B43A 1V45E 3VDQA 1C7RA 2R6ZA 4OHPA 2DX7A 4MW1A 1KQ3A 5KKAA 4IJMA 4AJ2A 5IVIA 1P5RA 4JJAA 5I7HA 2XCSB 4YACA 3U60B 3WICA 5ALTA 5KC8A 5BUSA 2HF7A 1XRQA 2VPIA 1JMKC 2CWDA 2WWHA 3E3AA 3GEPA 3IXLA 3PHCA 4RBNA 3LHSA 3V8EA 3VKHA 4CL2A 4KN9S 1NULA 3HA7A 4M36A 4WFIA 3LO8A 4MTLA 3TNLA 4FLEA 4YR7A 1IPHA 4RORA 1E18A 1XEXB 4DLTA 5EFZA 3K20A 5A1TA 4IIDA 2DWUA 1A8QA 1J0AA 1ZNXA 3I2IA 1Q0UA 1T2FA 5IJ9B 1V11B 1M5UA 2G04A 1W47A 2NNWB 2Q07A 1F3OA 5F21A 1MQ9A 1WEKA 2DC1A 4Q9KA 5F5LA 2RKOA 2Y1DA 3FJOA 4CFZA 4TTRA 1L5QA 3AM1A 5EWLA 2AN3A 3IBYA 4Q1AA 2FFHA 3HJRA 4HAWA 2GAIA 4I1VA 3JQQA 4FCWA 5KX5F 2JHGA 2VWQA 3A1VA 3BMNB 4FGZA 4TMXA 3WLSA 1VIDA 4LEIA 3PPWA 2XODA 4IV0A 2R7KA 5IJ9A 3QU2A 4JGBA 2OXCA 4BFZA 1YZUA 2BEVA 2YJZA 1BO6A 1QVVA 3VR3A 1Q57A 2P2GA 1GSOA 1VPVA 2NM0A 4HDQB 2NO9A 3EXHB 3WX0A 4BBJA 1F0YA 4U02A 3TD2A 4BECA 3K9FC 1OZFA 1XCBA 1PQUA 4RS4A 1ZLXA 2XNDA 2FHPA 4D4GA 5DHFA 4CIWA 3EGCA 4HS4A 1ZKDA 4N03A 4URXR 1HYHA 4AS3A 4LUCA 3BX1A 4BKOA 3T9BA 2XDAA 2IXDA 2WT9A 4AS1A 3T7TA 1G2IA 3H6HA 1PX0A 4C1BA 3IPCA 3OCZA 3PGXA 4P83A 3UMVA 1EDOA 2GAFA 4MV5A 4OGKA 3V46A 1I6LA 4N5IX 5A3SA 4F5WA 1CDZA 1J23A 3L0PA 1VP3A 3Q85A 3FAKA 4EG0A 2FKNA 1V9CA 1ZRNA 2QAJA 4JENA 4MR9A 3OJFA 3SEZA 5FRDA 4B35A 1BAPA 3A32A 1KY3A 2MCFA 2D59A 3S44A 4FGJA 4PBRA 5DHQA 4DXAA 4Y1EA 3CUUA 1E9CA 1Q7EA 1ESMA 1TUIA 2JFQA 3D8HA 3USES 5E9QA 3DQQA 4BASA 1U1GA 3LY8A 3L6RA 4IOMA 1Z15A 2BGKA 1TFUA 1EFVA 1DAOA 3NOVA 3ZZTA 5CM9C 4HGOA 3M5WA 1PQWA 4K9OA 1XXHA 3JQFC 4D0RA 2BP7A 3W2FA 4BV3A 1FU8A 4D3DA 1T10A 4QHSA 3SVLA 2Q8QA 3AJRA 3WQQA 1RRCA 4XVRA 3AHEA 5CUQA 3YASA 5B4TA 4PX2A 1K98A 5EUMA 3JR7A 1QBGA 4H1TA 3AEQA 4WZ6A 4KRXA 5DHAA 5LMCA 3K0HA 3MTQA 4Z4EA 1NNUA 3ZVLA 2VWHA 3HZZA 1W0KD 1P72A 1Z0JA 2HOQA 3GGDA 4RQBA 3WP0A 5K0ZA 5KSZA 3LYAA 1WXGA 3BTUA 5HW0A 4HDCA 5C1OA 5K6AC 3HDVA 3PD7A 2O5CA 4V0RA 4DCUA 3GBPA 2ZE6A 1M76A 3OP1A 3GHHA 3U1TA 1ZW6A 4EGQA 1I3NA 4JEMA 2AKYA 5EE5B 2B2XA 2WABA 4ENRA 3CEAA 3NG1A 1GDHA 1JPVA 2HO4A 3FGPA 4YJ2A 4O4JF 5DWDA 2HHAA 4G8JA 3T7DA 3RYHA 3LX4A 5KVCA 3W6ZA 4FM9A 4Q1EA 4EEZA 1DZIA 3F5SA 1UP4A 4WY2A 1FXWA 3WLEA 1FNCA 1V8DA 1AS0A 3G5TA 5FOWA 3QF4B 4I5EA 1DOHA 5GV7A 3SIRA 2ONYA 2D2VA 4S1NA 2W6NA 3GJSA 4BBPA 3W8DA 4RTJA 1ZN2A 1QCCA 3JVUA 1EK1A 2FRDA 4PCUA 1Z4QA 4G0PA 1RHQA 4HFRA 3VNQA 4HN9A 1NBEA 4ITRC 3SEQA 1KVTA 5GY7A 2F3UA 4B3HA 5A5DA 1QH9A 2ZRCA 1QYWA 5T6BA 1ECPA 3I6BA 4JJIA 1SURA 5CHEA 1RPJA 1W0JD 3NRCA 1OCEA 2YJGA 3TGPA 1LY1A 3KE8A 5LU9A 1NJ1A 4MLDA 1VMIA 2HMWA 3KKZA 5GVRA 3D4OA 3L7KA 1DQZA 1NMZA 2YZGA 4HZIA 2LRHA 3ANSA 4J0FA 1SBTA 2WSSD 4GDMA 4E0BA 1OY1A 2QUAA 2G82A 3IDFA 1EFHA 4F5EA 1IWPB 3PHJA 4EJSC 2X6RA 1X8KA 1ORTA 1HL3A 4RD2A 1P6QA 1WR8A 3VPGA 4JP5A 3T9CA 4CKWA 3I9MA 3SQMA 2ZWVA 3K4QA 3PB3A 4F2HA 4G2NA 1JR6A 2LGJA 3MLAA 3ZOZA 3NDJA 5FV4A 2VP0A 5ADWA 2LCFA 4RVCA 2YFYA 5BWOA 1EGQA 2EZUA 2PO7A 3TG8A 4JGGA 1WETA 4P3YA 5KYYA 1DRVA 2WSSA 2O1XA 4CG2A 3PD0A 1E0KA 4HLUA 2A0YA 2IOFK 3H0EA 4FQ8A 5CLHA 4E32A 4PSKA 3HKDA 1L0BA 3ELBA 3NOXA 2W98A 1YZVA 4FW9A 5H9VA 5DM4A 3FRIA 4ND7A 5JNUA 3LYHA 1HRKA 3C3CA 1NN0A 1LWNA 3KZ1E 4FXOA 1QOQB 4LCEA 3ZH9B 2V58A 2VOJA 1UBSB 5T4EA 2VZ0A 3G7UA 1CS4C 4RZHA 1W29A 3WMRA 1LLCA 5ERXA 2FUKA 1VLLA 1DB3A 2I3AA 3FR8A 1E1CA 4HYTA 1U4OA 4MA4A 4TPKA 3A1CA 1XTUA 4EBFA 3P9YA 4REMA 1Y0BA 3LQ4A 3WGJA 5YASA 2IH2A 3QVKA 4YT5A 2C9CA 2YJTD 5B55A 1S4QA 4B85A 4B71A 2RHGB 2V7QA 5HKAA 2JH3A 1XMXA 1SHJA 2L0XA 4O5AA 4GH5A 2OFOA 2H57A 1MO3A 1P9OA 5DNCA 1P44A 2AN5A 1B0UA 1BGXT 4MPRA 4E5VA 1XMIA 3RC9A 2HRBA 2WM2A 4LFBB 3OZBA 2ZJOA 3KTFA 3GLRA 5ALSA 3JD2A 3CEPB 5AO9A 4ZYYA 3FTFA 4NFLA 3T7IA 4PGMA 4RLSA 1A5TA 3G8BA 4WEOA 2ODTX 4YX9A 3EZ6A 3IHWA 1EVKA 3PPXA 2W6OA 2XLCA 4XD7A 2IOYA 4EX7A 4DA4A 3LWNA 3OUZA 4KXUA 3ZWNA 3U5TA 2YHBA 2X86A 3SS8A 1L7DA 4BQNA 3KVRA 3HXMA 2Q3LA 4TRMA 4LRWA 2D2IA 5IDYA 3RUIA 2PLRA 5EKTA 4BNNA 4C5CA 2PRIA 4BZXA 4RVOA 2WDZA 4RHYA 4ZDIA 1WJGA 3MJVA 2LIVA 3WLKX 1UEIA 1DBPA 1YZLA 2PX6A 2ZSIA 3P5SA 4M9SA 3Q3IA 1Y8ZA 5DBFA 5DOVA 5THXA 1E59A 2F43B 2Z95A 3QVWA 2CXQA 1L7MA 2X8JB 4FONA 2X7XA 5TVKA 4DCGA 1NBME 1NSTA 1Z8DA 2RJNA 4ZKDA 1VIVA 2VNSA 4V1CA 1HOTA 1NVEA 4B0PA 1ESCA 2GHTA 4B82A 4EHIA 2HBRA 4JDPA 5C1PA 3WLFA 2EZTA 3RRFA 4PBTA 3N8GA 4C78A 1OAKA 1T2VA 1WUHS 1Z5GA 2ONZA 3K35A 4QO7A 4XB1A 3QBJA 1UBOS 3TZ6A 1FXWF 4CXMA 2WTAA 1XA4A 4OYLA 2NU8A 1XZIA 5L3SA 3KSRA 2P2SA 3LXUX 5DIFA 3UAVA 3ZWDA 1UBNA 4YMTA 5JSZA 1T8WA 5LMUB 4OTZA 1U9CA 4ARAA 4IILA 1TM4E 1JSLA 1ZPDA 2VXCA 2IDMA 2EIHA 3GCGA 5AK3A 3VR4D 2FW1A 2FR0A 3GFPA 4HL6A 1RKVA 4CMJA 1ZIXA 4TKLA 3P4XA 1VCMA 4KPYA 2VP2A 2H4JA 2ZSJA 1MABA 2PKRA 1KQFA 1E99A 4D4HA 4JYAB 3BJIC 4BX3A 1ZN7A 1VPDA 3TJMA 3LFUA 3W90A 3PCXA 2PIAA 3KZVA 1MX1A 3R4CA 4IIGA 5ALJA 2KBFA 5HIKA 1S0UA 2HHCA 2MIIA 1RHUA 2PGOA 4FR0A 1LVGA 4I99A 4OQFA 4N5DA 4FGSA 2WWGA 1HLFA 4L50A 4YMGA 5EVJA 3DFFA 1OLSA 2VTVA 3PQDA 5CX4A 4HGRA 5FUMA 1P80A 1EHYA 2Q3MA 4CKCA 4O4IA 4P33A 1K97A 2PWBA 4MKGA 3V6MA 4BWGA 1GPLA 1A4UA 1RQXA 1W9HA 4WZZA 3PITA 2FP4B 4MJLA 3BGWA 5H4GA 4NESA 3LU1A 4ER7A 2GESA 4BWFB 2ON6A 1G8JA 2NT4A 1V3UA 2ZE5A 2GYWA 1N33B 1PWYE 2GM5A 1LDMA 3LBNA 3NIWA 4Y2QA 3PWZA 1WVIA 1GKLA 3P7MA 2HMAA 1T26A 5E6RA 3GUZA 3A3NA 3ETHA 4X3PA 2TSYB 1U7PA 3AJ9A 3E7FA 1ML3A 3H6KA 1QIDA 3P45A 2GHIA 2CMFA 3Q1LA 4Z9FA 3QZUA 3W7BA 3A4MA 2GN9A 4ZAZA 2E2WA 4NCXA 3PNQA 3F0TA 2H7CA 4MV8A 2DLDA 3RIEA 1G6Q1 4DRXB 1WXFA 1WZNA 4IOJA 2P0YA 3KSUA 2OYSA 4JJZA 2O7SA 2BYTA 1HXHA 4N0QA 2AC4A 3L7YA 4MYSA 4JOQA 3E9ZA 1YJAA 3VM6A 3VBEA 4BFXA 4CFSA 4B3MB 1MVOA 1ORIA 4KVGA 3SE7A 1L1RA 3GRFA 2CHQA 1FFXA 1DFIA 3H1GA 4B47A 4BX8A 1WUYA 3VKGA 3ONFA 5AR1A 4F1JA 1UQRA 1U0EA 5ENZA 1BQ3A 1LDNA 3CGGA 3PQEA 4ESEA 4P4TA 4E2WA 2ZT7A 3C6MA 3PRKE 5FLEX 3HBMA 2AS0A 3O7MA 3EGIA 3OIUA 1GQYA 2JZOA 1ILEA 4F0JA 5HYVA 1PV4A 1HNXB 3MCVA 1DWUA 3I1FA 3KK0A 3QKRA 4NICA 1S2MA 2J6HA 1E2JA 4UU1A 3S55A 1AT1A 1S5PA 1GVHA 3BIWA 3BWDD 4RVGA 3W8NA 5JD5A 3RADC 1TZKA 2AG0A 2WPDA 4I55B 4WOKA 2IHUA 1KPIA 3S1AB 5J2UF 2QTHA 1YH3A 1OX4B 5AW8A 3D5QA 1X1EA 3KZMA 1H23A 2ZYTX 2JAHA 3MD9A 3QPWA 4G5RA 2HT6A 4I36A 2Y1KA 1PYOA 5IK2A 2D1TA 1GXSA 2W2LA 1OXSC 1Y1PA 1KC3A 2WUFA 3Q1KA 3PQ7A 5EZQA 1VFNA 2NUTB 1LI4A 5FA6A 5A0TA 1SRRA 2JF0A 4WMLA 1X7WB 4COOA 1JAXA 1M6WA 1XPRA 1SKBA 4P38A 5KNBD 2DF8A 1IMOA 1RAFA 2EX1A 1ES9A 4OMCA 4EW1A 2I7XA 3LUGA 4GMHA 3ZWCA 3OEHA 1L3BA 4DJTA 1HYGA 1NQAO 4PR3A 1V7QA 2R84A 5EWJA 2FEMA 4IIJB 3DTNA 3QHAA 2VA9A 4YMSA 2VJDA 1J9EA 5JSFA 4I6GA 3H18A 4BS9A 1HZZC 1QG4A 2CCJA 1JBKA 3GPIA 3TNJA 1DEHA 1T9GR 1XRRA 2SBTA 4CF4A 3BCHA 2Z4RA 1JKJB 5LFAA 1EWQA 1W4BA 1E96A 3MBKA 2GRAA 2ATIA 3W4IA 1PW5A 1PL7A 2QTFA 3QY0A 1B3BA 1IE3A 1QYXA 2OKCA 4PYIA 2Q29A 3HCRA 2CYBA 2Q28A 1QIFA 4K46A 1FRVA 4LWQA 3C5HA 1Q84A 3ORRA 3CUKA 2RAPA 5B1HA 4IPTA 4D9CA 2XUKA 4JQSA 1JHVA 1D03A 2QMHA 5AIBA 2YWHA 3JQ8B 4JUDX 4DIMA 4JBGA 3F67A 5SYNA 1N0WA 2PJZA 1KI6B 4HF7A 3WVNA 5BY2A 2QN6A 1HDXA 1KI9A 1KJ9A 4JBHA 4FS3A 3BIXA 1N1MA 3OKCA 1Z45A 2I8CA 1HTWA 2GK4A 2P77A 2GM9A 3FRJA 2GCOA 3CPJB 5LLSA 3UMGA 4EO9A 3T1YB 1KXJA 5JCOA 3S3TA 1BOFA 1KEPA 2ZIFA 1SNYA 1VRVA 3FPFA 4ZV9A 3T12A 3PHIA 4RQTA 3X1KA 1E2GA 1KK1A 4GYYA 4IOLA 3MCWA 1HLGA 4CM3A 5IK2D 4CV3A 1FUEA 1I4EB 4X20A 1ZM4A 5J1TB 3EE6A 1FFSA 1BS2A 1A72A 1MZVA 2BZ0A 1XQVA 4I46A 4RO0A 1AZTA 4ESOA 2Q6LA 3CWZA 4GMFA 4QVGA 5ABPA 4CMEC 1A5SB 2ODQA 3DHVA 2EKPA 3KTOA 4N41A 1LLFA 1O2DA 1JFFA 2GTHA 2CLDX 2PLWA 1C0EA 1XZBA 3CNQS 1P8AA 2A57A 1V8FA 4HSEA 4PNHA 4QASA 1QV7A 4UHCA 4U7GA 3SYRA 5J43A 1P9RA 3N8KA 2PBFA 4L9WA 3V4PB 2GPTA 2WKRA 3KQPA 1FU4A 4MLPA 2MR6A 1N77A 4DDUA 2O2XA 4IBOA 1YDWA 1EFUA 2YASA 3IBTA 3KCQA 4AO6A 3W2HA 2ZJ7A 3PE4A 5GZ3A 1KJYA 5C31A 3U7FB 2AUTA 4HPWA 3TTXA 4F6CA 5F33A 3P9CA 2PJDA 1NMEA 2XOXA 3MOGA 3O47A 1BU8A 3F97A 2JLAA 3AKEA 1GN9A 4QRHA 3NWPA 3REQB 4YYEA 4KE8A 3G0GA 5G0SA 2YWCA 4YLYA 2W2TA 2PXAA 3PIRA 1XTTA 2JFNA 2FPOA 5L8VA 4MRPA 3KPJA 2X3FA 4CHTA 1G5IA 1GNSA 2ZWIA 5K8TA 2IXAA 3T0GA 4ZJZA 5A9TA 1D2MA 2C04A 2BDTA 4WLOA 4KV9A 1BEZA 3ZCXA 3FDIA 2QB5A 2VRCA 5C7IO 2ZUCA 3F5DA 3TTUA 1G63A 3ZJVA 1LSSA 1QRRA 3O8QA 4PC7A 4RA6B 2OORC 1CR1A 1DPGA 1HG1A 5CVUA 4HVLA 2IEYA 3L6CA 4AZ3A 2RAFA 3L2OB 2IV3A 4W8OA 4L3VA 4W4TA 4MA5A 1EKXA 2QU8A 2VDLB 4LOHA 3ORHA 4B3CA 4OQLA 3G1TA 3AJEA 1WZEA 2OGZA 3A1EA 4A0QA 5B3JA 1U11A 2E4ZA 1CJVC 2R68A 2VYVA 2ZZKA 3KB8A 4F6RA 2IPLA 4RW0A 5KJFA 1FP6A 3B1YA 5AHXA 1E20A 1W4RA 4N12A 4AMUA 5ES4B 3CNHA 2LZ0A 4XDYA 5KS2A 1VLQA 4EGFA 2Y0DA 3CZAA 1RJ9A 4CETA 2CXPA 1KS2A 1U8AA 2B4RO 4U9UA 3UPUA 2QX6A 1RU3A 5T57A 4YUZA 1XDUA 9ATCA 4Q39A 2CDNA 4O8CA 5EHIA 2JI8A 1SR8A 1DUSA 2BELA 3OLQA 1LK0A 3A11A 2HL6A 4JYBA 2RKWA 5CB4A 3VTFA 3RRZA 3S70A 5M04A 1ST3A 2DMRA 2DY1A 2FPWA 2J3KA 2C58A 3VPAA 1K6JA 2R4QA 4ESVA 2PMKA 1PZNA 1JYFA 4M1QA 3IELA 2O7RA 1HYQA 3KZNA 3RYTC 3ZKWB 3L84A 4QULA 3BK1A 4N9WA 2IYYA 1Y6ZA 4BNJA 4EMBA 1KMQA 2EF0A 1GKUB 2VAWA 5CB4B 3EUAA 2EQAA 4HB2A 5CD9A 1Z6PA 4S3MA 3IVMA 1ORHA 4IIXA 3MWEA 4KR0A 3BRWD 1V11A 3M0EA 1UXJA 3AWDA 1T5TA 2QE7D 1ODCA 2PXHA 3A6HA 3ZPXA 4DFDA 2XUZA 1UWKA 3AUYA 2O2IA 3MT0A 3MWKA 1C2TA 2BFDB 3D1VA 2HBZA 1Y6QA 4L72A 4RVNA 3HBAA 4S1VA 5BN3A 2QNBA 2N0SA 2OCGA 3I9LA 4B3XA 1M1UA 4DA7A 1Z4JA 4O25A 5HQJA 1YS9A 2XVYA 3H1PA 5TLSA 1B3RA 1VCNA 5J2UB 5HRAA 2OV4A 3PDIB 2ZE8A 4G1MB 4GBJA 3O8LA 4HX2A 2C95A 2HH9A 4M22A 3SC2B 4CMKA 3DKRA 3CNOA 2RB5A 4Z1MD 5KQPA 1ODLA 4AZTA 5J5VA 4QD3A 4X1IA 5KAPA 2QORA 3ZDDA 2Q1YA 1U2DA 1AF7A 1RZUA 4L4RA 4TT3D 1NJFA 3RF7A 2PX2A 3HE3A 3VI4B 5EJ9A 2AT1A 4S12A 2VA8A 1W36B 2IXBA 2HNAA 5ELXA 3WBKA 2QSJA 3LVQE 3PA6A 1L4LA 5EIHA 4IRUB 3D6FA 3OQIB 2DYKA 3A9RA 2AJDA 4KWCA 4BE9A 1XPOA 1VBNA 4UTRA 3B1FA 2DHDA 4JH0A 2R96A 1WSWA 5LQJA 2BN4A 3Q3EA 2A5YB 1VE1A 1XWIA 2JDID 5JPCA 2PMDA 5JBNA 2IX9A 3PTAA 4WINA 2GARA 3TIGA 2WIJA 1OBCA 4G67A 3NC4A 5DN9A 5C53B 4D0SA 1KOGA 2Q0SA 3EXFB 4I4IA 2LNDA 3U7HB 1TW3A 3ESAA 2XDYA 1U2GA 1YDEA 2QI9F 1PJCA 3V6LA 1DQSA 1FA9A 3E8SA 4YI5A 1VMEA 3KTDA 4AKSA 4EYQA 2E21A 1T43A 4PFKA 3FTPA 3RWBA 1XWWA 1DV2A 2EL9A 4PYMA 3F8SA 1E3WB 4RKQA 3T34A 4JJ6A 4MIYA 5G4LA 1POWA 3G0CA 4PYRA 1U5AA 2WHEA 3WLMA 1T5HX 4B9EA 3DKVA 3S8EA 1CRPA 1NJGA 1R5BA 3ZBTA 4X65B 5JS1A 1NLZA 2VJPA 3EPPA 4F3CA 4RA6A 1T1SA 2OB2A 5CA0B 2JBAB 4B2IA 1CUFA 3I9V6 4IH1A 1BN7A 4IGFA 3FXAA 1DNPA 2YV1A 3LJKA 5M29A 4O1IA 4LV8B 1PWEA 2BFPA 2OO3A 1IYZA 3BCUA 5C5IA 2X2PA 3PRYA 1VL0A 1VBMA 4TV8A 3SYNA 1S4MA 3DUFA 2NTJA 3DBHA 4D3ZA 1QGED 1UKZA 3Q3CA 1C4KA 3RVRA 1DELA 4JYPA 2UUBB 4QU0A 4LVOA 1A4RA 4OGFA 1IN6A 4E5UA 4EATA 3AFGA 1N3LA 1M0WA 3F6CA 1A50B 3LP6A 2M1XA 3CZ9A 4MPPA 3RREA 2ZIEA 2B20A 2I4OA 5IAEA 5EXEA 1JJIA 4WHMA 2Z57A 3PS9A 3VFDA 3DM5A 3PTLA 5KUTA 4J0QA 3FTQA 3QPCA 1FDVA 3CONA 4UHFA 4ES6A 3P2YA 3H2ZA 5IT5A 1A2OA 1SCUB 1FQOA 1IDOA 3B5IA 4YRMA 3ADCA 3WWYA 1VL8A 3EZNA 1M34B 1PBNA 3THOA 2YOGA 3KLMX 5AOBA 2GZRA 3PYLA 4LNHA 1QFYA 4Z2YA 4URVR 4J3JA 5IAAA 3EMVA 1DVRA 2EEPA 1DX9A 1GLGA 4NC9A 4MZXA 2X8JA 5ITZA 4Y6PA 4RC9A 4PC3A 1OWLA 4MVJP 3AJDA 4EA7A 3S2IA 1SPXA 1DIAA 1QZZA 1BE1A 5KCMA 1GKIA 2WJYA 3ABRB 4O0MA 2IZOA 3DBLA 4W9MC 1HE2A 4EEXA 4W5RA 3D6NB 1YFLA 5LUAA 2REXB 5DF1A 3ZXUB 2C1ZA 2GPYA 3KELA 1SFRA 5KTOA 2YVLA 4LE2A 2IYTA 4KR6A 3DZDA 2QD5A 4ZVLA 4CM1A 1K3FA 1BHQ1 4I1UA 1X1DA 1BX1A 3UW1A 4XPZA 1F4LA 4QT4A 4BNLA 3BB1A 3N07A 5DYWA 4ZJYA 3FSJX 4CEIA 1C81A 4UHJA 1AK9A 1UL1X 2IU4A 5AHOA 3AESB 3DD1A 3A9WA 2AX3A 4OHRA 1AQUA 1AXEA 5JHGB 1PJSA 5HBRA 3PZRA 2VDJA 4MW0A 4YRQA 4ARIA 3V1LA 5ADVA 3CLUC 2FPMA 4R2WA 1M0TA 1NWHA 3KRTA 1XZGA 1CY0A 3JALB 4GKAA 4MCJA 4N8SA 2OYCA 2GD1O 5BNWA 1P61B 2FJ0A 2Z2JA 4Q7MB 5CX1B 5E4TA 4GPBA 1CIPA 2GQ0A 4Z6KA 1FYEA 1GCGA 3P9QA 5J47A 2QVLA 1J1IA 1TLTA 2VDMB 3BGSA 2ASVA 1SQ6A 5BOVA 2P1DA 3IBGA 3IP9A 4KB5A 3U9LA 3D6UA 3QI2A 3WGGA 1XEAA 3ISJA 1Z5ZA 4H2DA 4D8YA 5K01A 3QFSA 4E13A 1GZDA 4DRZA 5DBGA 1J4AA 3I2HA 2ZTMA 4G0XA 1G7RA 2VUHB 4E21A 2HR1A 1L8OA 3TCNA 1EFVB 2UKDA 4OHWA 2ZRQA 4OEHA 4UW9A 1NPYA 1MT3A 1T9GS 1ECFA 3AR2A 3N3AC 4HH1A 2PX0A 5E3IA 3TPCA 3V1KA 2C7PA 5CXSA 4UXJA 2IQIA 4B75A 3MPOA 2E1RA 2X58A 1YDMA 3GIDA 1OB5A 1E0DA 1BE0A 2IW1A 1A9QA 1FDSA 1CUHA 4FGUA 2EX4A 2AR7A 1GZ6A 1HE5A 3UG6A 2H9IA 1OHHA 3E03A 1R3UA 3WGMA 2OCAA 4C4RA 4NIMA 4DXHA 4P58A 3LH5A 1W0KA 1YK1A 2ESRA 4ZO9A 3TTYA 3THYB 3I9NA 3IR6A 5EMJA 5C1IA 1NURA 4YJFB 1GGFA 1NVVQ 2PUAA 3NR2A 3TPFA 1UPUA 1KI1A 5CYOA 4CRWB 1QHHA 5FR1A 4BVJA 1N7JA 5KYTA 1GA6A 3NIBA 4P4SB 1Y1KE 4NPAA 4RVSA 3AVQA 1XO1A 4OQZA 2QW8A 3TJRA 3C5EA 3QOXA 4Y1RA 3RS5A 3IEUA 5U4QA 1W1UA 2W90A 2IIVA 2AKEA 4DLVA 4EG3A 2X3YA 1A7KA 4F9GA 4GQIA 4MUFA 2XZOA 2XCUA 2IHNA 4OUDB 1H2FA 3DZIA 3G82C 1RT9A 4N8DA 2R00A 3DE1X 4Y0AA 7REQB 2WVHA 4J2OA 4ERNA 5KNDA 5KTTA 3EPKA 1QB8A 3QYJA 4IHKA 3I0ZA 1M8KA 4RDXA 4UNRA 2FSPA 1M7HA 2JS7A 1N5MA 3IERA 2NPIA 2P9GA 1QS0B 3C7TA 3GMTA 3GA7A 4QEKA 2GAAA 4RM2A 1SC1A 3AP2A 3HZRA 4H3SA 2WWWA 4C07A 4LYAA 1YFJA 1F2DA 1W85B 2CXTA 2ZSUA 2IOQA 3PWKA 3R40A 1JHRA 3WE7A 5AW5A 2PV0A 1GT6A 4KO4S 4QGFA 3KAJA 2B4AA 2HQRA 3F6BX 3QM1A 4NZYA 2OWEA 3CUTA 1FTNA 3GUYA 1V4NA 2NVOA 1DUVG 2X2FA 4GR5A 4X1KB 3KSZO 1K6XA 3ENNA 3W9SA 4CW7A 4DABA 1PR3A 3QTLA 5FNVB 3V9AA 1NX6A 1ZD9A 1SC9A 1T3LA 1V6AA 3QEBZ 1H2YA 2WYIA 1G19A 4FIZA 1QYCA 4R8VA 2V5AA 5B7QA 2ZPTX 2FFBA 1V1MB 4Z0PA 1NZJA 5JXJA 1E64A 3FGZA 3WQSB 2QTZA 4OQ4A 3UW3A 3G23A 4GOLD 1XRLA 5EZYB 3TIVA 1AMUA 1E3LA 4ILKA 4Q4LA 4CF5A 2YXDA 2FFJA 4Z0TA 3UENA 3HXTA 3ZTWA 1QF6A 4UVGA 1ZL2A 3SSAA 4M9CA 2ZRIA 4B7CA 4MR9B 4ZK6A 3BREA 3FKJA 1U2PA 3RIGA 3OI7A 4MCAA 2EC5A 3RFFA 4EY4A 3I1IA 1BEEA 2XB4A 4RAQA 5I7EA 1E6MA 1OIWA 4HPXB 4D5GA 1NDHA 4IZOA 1Z4NA 4RUKA 4O2BF 1P73A 4ALLA 2AH5A 4D6XA 5ARDA 1ZGHA 2JLQA 2HIHA 3W6PA 2ZTSA 4EAAA 1QRUA 3N05A 4UMFA 2IX3A 1JFTA 1WAMA 1NZFA 3TOCA 3FVRA 3NEJA 5HKLA 3WYAA 2O7VA 3E05A 3EXIB 3MF4A 4X64B 4B73A 4HB0A 1Y1LA 1CU1A 2BH9A 2J5BA 1SRQA 1QCDA 5LYYA 2IQ5A 2AIRA 4XFDA 3TFQA 4E1VA 2OLKA 4MVWA 4OHFA 4PPQA 1PT9A 1DPFA 4I81A 4DG9A 5LYJF 4DR1B 4I50B 3PF9A 3RG8A 4A7PA 1XT6A 4B43A 1GG9A 1U8XX 2OB1A 2IGTA 3OFSA 4L73A 4WE3A 1PT8A 1GR1A 1Y4UA 3CKMA 1JEQA 1XOIA 1WB9A 2YWJA 3K1YA 2BV3A 4REOA 3A28A 1W0CA 4JLPA 3KSAC 2Q7XA 4E5DA 1RJEA 4JI5B 3LBYA 3ZK9A 4MB2A 4BNMA 4FI3C 4FMCF 4TKUA 1RYEA 1NBMD 1X6VA 3EEBA 2GHRA 3T7EA 3DD5A 1BRTA 3GFVA 1YBAA 3DZKA 4PGFA 3UWSA 1XXHB 3KHKA 2H59A 4URYR 4MQEA 1XD2A 5FPTA 3AR8A 3VNBA 4H0NA 3M1AA 4ZQIA 3MS2A 3PNOA 1RTKA 3NV9A 1CXZA 5K20A 2OBBA 1FTSA 1EFAA 3AONB 4AKIA 3DLBA 1KSFX 2Q1XA 2PGLA 1VJ1A 2I2DA 3UOAB 3QMPA 1YFKA 3T1HB 3QLUA 2CYCA 4QXQA 4B45A 3ML1A 3PJGA 1CY1A 2JGKA 2PV7A 2ZCUA 3OOEA 2O2CA 4TUYF 1IY8A 2BGRA 2W6MA 4NULA 1V1RA 4UEQA 3DWEX 5C3UA 3HXPA 1DHRA 3EASA 3LZCA 5I8WA 3G2MA 4INZA 5A4JA 1C14A 1HQYE 1Q44A 4GMDA 1LV7A 4LMPA 4MRAA 5J2TB 5G3YA 4ZCPA 1J8YF 3TTVA 4DJ5X 1Z38A 2ZJ0A 5HKKA 3BGVA 1XZKA 2P9EA 4M88A 3FPLA 4BIIA 4GX0A 3AUKA 3MUFA 4ZEMA 1RXUA 3FYDA 4MAAA 1AK2A 3URMA 5EJ6A 2VQEB 1DZ3A 2ZJ6A 2FZVA 2REQB 2OV6A 3GELA 2CHUA 2HU2A 2P3OA 2XQVA 4RLFA 1MD9A 4UUQA 4MWOA 1XX6A 3R7WA 3REOA 5AVRA 3R7SA 1JS1X 2OGWA 1LBIA 1W2WB 2FEPA 1X15A 2WYUA 5IT9A 3B3FA 1Y89A 3JTEA 3CF6R 2OSVA 5BSTA 3EG9A 3GUVA 1M1NA 3NH6A 1XYGA 1ABEA 3O93A 4V0ME 2H9YA 2WWYA 4KKXB 4L3WA 1ZUHA 2W37A 2ECKA 1H8EA 1SUPA 1HTTA 1Y5IA 2A4MA 2HF2A 3CUWA 2O3RA 2YW9A 1OKKA 4KTTE 4XX1A 2C4MA 1CUXA 2HBYA 3DB1A 3U2QA 4BQSA 1TXGA 1LA2A 2ZIZA 3U3JA 1OZAA 2PZGA 3GJXC 4NPCA 4V0OA 4PYQA 1XZJA 1D2HA 3P0HA 4XYBA 3RIHA 2VHCA 2WKPA 3A6KA 4S24A 5EIAA 3AESA 4B4KA 1S8NA 4D8TA 4DB4A 1AGPA 3AERB 4N0PA 1HNWB 3V8VA 1NKSA 2IDJA 3A31A 4MW4A 2J87A 2BFWA 3PTZA 5HGJA 3TBKA 1GUAA 1JFFB 2YCBA 5E2IA 1Z0FA 3H5WA 3HHEA 1S2GA 3DZGA 3KJNA 5IC6A 5I7FA 1VPWA 2BTQB 3M1IA 2VSOA 4UBMA 1YR9A 2GXSA 3HCFA 3OPYA 4A26A 2C4WA 1GQFA 2WSLA 4HS9A 3H4IA 4C2AA 3O8CA 5LZ5A 2YL2A 3DR3A 2I4RA 2J46A 4DLKA 2X22A 4XUGB 3X3HA 2WWVD 1RAEA 3GEBA 1EAMA 4GQBA 1H8HA 3NBQA 2WPDD 1RI4A 5I48A 3QKIA 3ACBA 1MH9A 5CVVA 1WV0A 3FETA 2DQZA 1ZJWA 2E4AA 2H11A 4LXXA 4RZUA 3S2SA 2CBXA 3G89A 3X1MA 4D44A 2QKYA 1TFRA 1YOBA 5DDIP 1ONPA 3SJCA 3RKUA 1LPSA 1RYHA 1QU2A 5ALMA 3WLAA 1D9ZA 4MWCA 2GXQA 2A3RA 1E58A 3R9IA 1KHTA 1X1BA 2XW6A 3KB2A 5FTKA 3EC1A 4F45A 5CLLA 4UDYX 4XYLA 2IPXA 2HK8A 1XCPA 2WWXA 4CF3A 3L0IB 2YHAA 1Z8HA 2VAPA 4D0NA 3LFTA 4X0EA 1Z5UA 2BCJQ 3QG5A 2WTUA 1ZZGA 3ORYA 2C5BA 3KOZA 3ZY3A 2V74B 2QX7A 4NEGA 5L51A 2MYUA 4TMTA 2DWPA 3VVMA 5HZKA 1JILA 4QM7A 4O2LA 1L5NA 3HM9A 4UU8A 2HCRA 3ISTA 1BTOA 4XM1A 3ZWVA 3PXUA 2BI4A 4J90A 3MJSA 3VKUA 3BH7A 1L8QA 1E60A 3GJZA 5P8WA 3BC1A 1J24A 1YZHA 2AG5A 2MHCA 4AK9A 1N25A 1AUOA 3IVXA 3DE7X 4R68A 1BU5A 1TECE 1DINA 2IP4A 2QLJA 3VR4A 3I53A 3SDZA 3RVSA 4IQGA 3ANLA 3H0CA 4RIFA 4MQLA 4FX2A 2A78A 3PYXA 1WP4A 2ZZNA 4EF4A 3JQ7B 3L5KA 1BH6A 1M34E 4C3UA 3GCDA 3E15A 3ZJYA 4WACA 1UK7A 4Y2HA 2ZYUX 3GA5A 16PKA 4TTVA 4DPLA 1R0ZA 2FN4A 3COVA 1U2ZA 4H1VA 3RODA 3TLEA 1DCMA 5E9AA 1C8VB 3BIJA 3REFA 3F6SA 1UXHA 3FMPB 5EIBC 1W19A 5BSEA 1U0GA 2WWTA 4MZDA 5HMLA 1R18A 4ZREA 3BTSA 4ZYZA 1M0EA 3PHGA 1H0KA 3AFNA 4MUIA 1V48A 2C96A 3VVCA 4WXMA 5JDIC 1HWYA 1J5PA 3FRHA 4JKOA 3WAKA 2E3JA 1NXSA 2R8OA 2IVFA 1UXOA 2GM4A 4ZRNA 3ONNA 3RTEA 2PBRA 3L49A 3NHUA 4MCHA 3K5HA 4OUDA 1HQDA 2DRIA 1FSZA 1XDWA 9LDBA 3ANNA 1R3DA 3G8YA 4I9NA 5CTJA 1RHMA 3ICEA 4BKUA 1N2CB 3WRYA 4LKOA 1ORVA 2ID7A 3EPJA 5F2EA 1FRQA 2GJKA 1QGUA 2HRRA 5IJWA 3FPKA 3HCBA 4H7KA 2WJIA 4M89A 1I8TA 1RADA 1T36A 2REOA 3BD6A 1XRMA 3QBTA 3MTBA 4OX9Y 2JHCA 3O94A 5F78A 5CDFE 2I34A 2V6IA 1CB7A 2CL7X 3T1VA 1N5RA 4QQNA 1I4OA 3LQFA 4KQIA 5HE8A 2FVXA 1AIPA 1UBKS 1Q92A 4NMHA 4AJNA 5EOVA 1ODTC 3LNTA 4IIJF 4YRIA 1L5HA 3CX4A 4MICA 5FUXA 4JLBA 4LI3X 1BE8A 5T3YA 3DGEC 3FCOA 2Q6TA 5C5EA 2EYQA 4CQJA 4J1TC 4B79A 4NXNB 5JZMA 1KI7A 5G02A 2YV3A 1GN8A 4CR8A 1A9PA 3MXTA 4GI7A 2AFRA 3SEAA 3SM9A 5BV8A 1UC4B 3JQGA 3F2VA 3P2IA 3I09A 5FTNA 4DMGA 4J1SA 3CNBA 3AHIA 4B3IA 2QL6A 3U39A 4NCHA 4UJ3A 2XYPA 3SBEA 4BP1A 4ZYXA 1WDMA 1UADA 2ZRPA 2ZBGA 1RDFA 2FW9A 2WHXA 5JQGA 2BY4A 5A5VA 2AOVA 1VJ0A 1WXXA 2GBFA 3L1JA 4MGEA 3N0WA 3ZNOA 4X45A 5BSRA 3K9HA 2EFEB 2FHSA 1D6MA 5KPJA 4KXNA 4GSKA 5TF4A 5G41A 3L6BA 3KQTA 3M4XA 1UJ2A 1KVUA 3HDGA 5BQPA 5FUQA 1NRIA 3WLIA 2VNKA 1T3ZA 1G8YA 3K0CC 4OLHA 4CR7A 1WZUA 2PZEA 1O0CA 4FDTA 1XJ0A 1YRYE 4HBGA 4J8PA 4GMGA 3R0IA 3TR6A 1T4DA 3EDOA 4MS1B 2WDPA 1RXSA 4GGPA 4YRLA 1ID1A 1LS6A 1XEFA 3PFHA 4LZJA 5LBUA 5PNTA 3IUQA 4KQ1A 3RS0A 4DDTA 2R00C 5DHTA 1GITA 4V3BA 2FZWA 2BUBA 5AM0A 1CZLA 1GIAA 1YVRA 3CLRC 3VHXB 1BG6A 3PNKA 3PCRB 3L0DA 7REQA 4QYXA 4CN8A 2XITA 1X8JA 1INLA 1SHUX 2F8LA 2VJCA 5E1MA 4LC0A 4CMIA 4WDQA 2IELA 3KYIB 1Y5LA 2MR5A 2Y1WA 4MB0A 4UUNA 3O8BA 2XEXA 1OD6A 1V37A 5KNCH 5AUOB 3U62A 2PR2A 1QGZA 1HEIA 3MW8A 4DNXA 2I2WA 3IFSA 1PUIA 1AB6A 2PD4A 4PZLA 1QHHB 1U2GC 3K09A 2ZVPX 3RYHB 1J90A 3R74A 1QAMA 2E82A 2VPXA 1QIKA 2ZYAA 3JAWB 4PHCA 4X8OA 1JU3A 2R25B 4ZO8A 2XMRA 1NVVR 2O2YA 1XLUA 1IONA 5EMNA 1C9MA 3SM3A 4MV4A 1RQLA 3WGKA 1U8CB 1FBNA 2CWWA 2JEZA 2C7VA 2Z8XA 4TS9A 5EVCA 3REQA 1O87A 2VDRB 2NUBA 3HSSA 5BN5A 2EHDA 5BV7A 5KTSA 2HEIA 1E79A 3M5DA 1UDCA 4YCAA 1RKUA 1JR3A 3RT1A 3TAUA 4DJDC 5H4HA 1N3YA 3NXKA 1D7OA 1TK2A 1QGOA 5ARBA 1M75A 5B3KA 4DARA 1DCKA 1EFLA 2Q99A 3HVHA 1RI2A 4N3CA 5ALYA 4DM3A 5JEEA 1JI0A 2FZ5A 2JAOA 1ZR4A 5JVDA 1IVNA 5ALPA 2XKBA 1KSJA 1MP0A 2G9ZA 1OLUB 1T6ZA 2P6UA 4I1SA 1BD4A 1MLDA 1V8PA 2EJUA 2XQJA 1T9AA 4OG2A 3MWDB 4PAMA 5JSYA 3SQDA 2ISCA 3ZCQA 4PS1A 2C78A 2WJWA 4P35A 2ZRJA 4OJQA 3OX3A 4BFUA 3LBFA 2ETVA 3PP8A 2C2XA 4IR7A 2R4TA 4XA8A 3FTNA 2BM0A 2EFGA 3UPTA 2BISA 3ENZA 2G09A 1PTJC 2YZ7A 2IUUA 4QU5A 3UGQA 4QICA 1XJ5A 1TPYA 3CRNA 1OIVA 3OIDA 3CY6A 5D85A 3NHRA 3OZUA 4KITB 4OF4A 4PWYA 1B1AA 3KUUA 3PWTA 2WM9B 1MEJA 1V5FA 4S1OA 5EERA 3UATA 4DIFA 4ZYLA 1I14A 1W9MA 2UV8A 3OZXA 4XQGA 3JAMA 2GJSA 2IH5A 1YHYA 3MINA 3IVCA 2G4VA 3PLNA 1EDBA 2R97A 5CLIA 3TGLA 2BR3A 1NF2A 4G4SP 4ARZB 5EGSA 3D7LA 3FBTA 5D8DA 3SXUA 3DYIA 4UNSA 4OQMA 4WADA 2VHUA 4AJIA 2ROQA 1TL7C 4YAFA 4B87A 3H5RA 5A06A 1AQNA 2V7VA 5GIOE 1EMDA 5B36A 4JD5A 5KIAA 5AM3A 1NW3A 1KZYC 3C0KA 2BSXA 2ZROA 2JJ2A 3JQGB 4UVDA 2OZLA 3WK4A 2H3HA 3JASB 1O95A 5ENDA 2PZMA 1T2EA 4INOA 4YGYA 2IOHA 4FP9A 3F46A 1ZDMA 3UAYA 4WZAB 3GB9A 2NO7A 3UGTA 4A91A 4KR3A 1FRFS 3O1HB 5E3HA 6GPBA 1XU9A 2A9FA 4I9GA 1DDOA 3L8YA 3SHFA 1QFSA 1T3TA 4TYNA 3ADPA 3G2PA 4QLBA 3QVGA 3UV6A 1OILA 3K1AA 1WCXA 5AKEA 2XGGA 3OG9A 3OT5A 1JR3D 4UFOA 3VZSA 1NASA 3K8YA 3NCHA 3FBGA 3OQIA 2CXHA 1Y4SA 1W49A 2ZBVA 4AJPA 3TLBA 2A9PA 4M55A 5BO5A 2LTAA 4IL5A 5BR7A 3RU2A 2XCTB 2XWPA 4ER0A 2CJFA 5DNUA 3N2IA 2P9TA 3TW0A 2Q1WA 5AKZA 1QG6A 5CB6A 1BWRA 4HB3A 2GD2A 2Y93A 2ZPAA 1DOAA 3VX4A 4EYEA 3EXG1 2VUSA 4ID3A 4MRVA 1BRMA 1XNRB 1N1GA 3IE1A 3O8QB 2QR2A 1W7AA 3HUTA 2YWEA 3JQPA 3FNEA 4BLOA 2IYAA 5I47A 2FSUA 4GE0A 2G4LA 4ZAWA 1R9MA 4HNVA 5JNTA 5FPPA 2G1JA 2A2ZA 5BR4A 2C83A 3V32A 3HU5A 2F6RA 1VBKA 4OREX 3B89A 1ESZA 3I6IA 4U0KA 4ZQEA 5EINA 4F3NA 4BV8A 3WYBA 2PRYA 3AL0C 2W2QA 3N8HA 2O54A 4OJYA 3SMVA 3DO6A 2BFFB 2PQ0A 1Z39A 2QRGA 2VJLA 2VO1A 3C97A 1P0MA 5E38A 1FJHA 4GPZA 3D59A 1KO1A 4G9GA 2IS2A 1L7VC 1TM3E 4YQZA 4N8EA 4WAUA 4ZO4A 1NXVA 3F9CA 1NOKA 2OC4A 2CB0A 3MQFA 5E7JA 2H1IA 3L7DA 1OX5A 3G49A 3FCUB 4RKFA 1JLKA 5KYXB 5D3ZA 1MAWA 3TTWA 1TUBB 2F64A 2G6TA 4JUAA 1EQUA 5DEIA 3EISA 4CKXA 4D1YA 1MQSA 3BQNB 2Z5LA 2FSHA 3AU9A 2PT7A 3GJRA 1CQZA 1M2OB 2ZJYA 5CT9A 1RZ3A 5BW6B 2AFHA 3GP5A 5B1SA 4I14A 4AZSA 4CL0A 1SG6A 2ZG6A 2LWIA 3RK1A 4CG3A 1QYRA 4UMDA 3QW2A 1L7BA 1O5TA 4IV5A 2W2XA 4ZDJA 2P1ZA 1T9DA 5FL7D 2HMUA 3GFFA 3ZVRA 5CFQA 5IUKC 2CDCA 1VG0B 3W5UA 3HMQA 1BGWA 3F7MA 1WBBA 3DHWC 4U2CA 4L85A 1PE0A 4KV7A 4QXPA 3LQ2A 2F48A 1KPGA 4WBNB 2IDZA 1YGYA 2JW5A 1SD1A 4YVFA 3RK4A 4H3HB 4MI1A 1JFLA 5KCZA 3GLGE 2IY9A 2WY2D 3QQ5A 1J8VA 4L8FA 1IAVA 1LNSA 3NYRA 4KG7A 4KPUB 5CNMA 1NKTA 4JBIA 4QWWA 4JWTA 4DLAA 4YDQA 2VF2A 4DR4B 1IHOA 2P2YA 3EGVA 1RWQA 2DY0A 4FDMA 2JL1A 4YHHB 3AHGA 1XRNA 3I9KA 3QJ5A 1H9CA 2K5UA 1HETA 1JB1A 3ILXA 4EVQA 1PJTA 1P5HA 2OAEA 2IDKA 2QN2A 5LOVB 1S2OA 2DE0X 5DYYA 3JARB 2Y9MB 3EIOA 4YBZA 5HCIA 4ETIA 1U65A 3C6BA 1Q91A 2YNMD 4QBFA 1Z5WA 4UNQA 121PA 3KR1A 4PC6A 1CJKC 1Z75A 2QUZA 4HWRA 3FHOA 1AGYA 1KHHA 2VK4A 3N8IA 4UDXX 5K8CA 3O3CA 1JV2B 4HLDA 2H52A 4ZRMA 3KYJB 3INYA 2NTYC 2ZIGA 3I2JA 4G86A 4X6YA 3P9KA 5HQTA 2WG0A 4HDOB 3QVTA 1J1ZA 3G8CA 1O96B 1SULA 4ZXPA 1K5HA 4S05A 3LRTA 4B9AA 5GIPE 2VS1A 3AJ8A 4NTZA 1ETHA 2C2ZA 3H1FA 3HY6A 2OR3A 3PICA 3U3XA 5ALUA 3AVUA 1Z56C 1RWVA 4F04A 1Q3KA 1GT91 3WNVA 4C4XA 4OHOA 5F98A 2NP7A 1NPDA 1EFRD 1NA5A 5A3QA 5DSZA 3KJQA 4GI2A 3U4MA 2O50A 2OHGA 4CBVA 2WPNA 2FW0A 5C8VA 2ZUWA 2PSSA 2YXBA 3PF8A 1NVDA 4PHTA 4CPDA 5T5QA 3VO2A 3W8EA 3IKJA 2PS9A 1SIBE 3QU4A 4WNYA 3TINA 1NUQA 5T6MA 2OHOA 5BV1A 4HRYA 3HJAA 3UJ3X 2W6ID 3DE6X 4QYIA 1YZ3A 3N5KA 3UT5B 3X43A 3PCTA 4HZUA 1V3QE 1SIWA 1FNBA 2IA5A 5IFLA 3L41A 3AI3A 2HJRA 3RJ5A 3L93A 3NBAA 1NT4A 3EF1A 5AKIA 1H94A 1EP9A 3DXYA 2ONKA 1DIRA 3LXMA 5IMSA 2I22A 4XVQA 5IBRA 2R87A 3VV3A 1V1RB 4F2DA 2HCJB 5FO1A 5TQ0A 3TSCA 2VCHA 5I9NA 2KQUA 3IAHA 1LBTA 3PR3A 3OJ0A 1D5CA 1KDPA 1P1RA 1V95A