1TCVA

Crystal structure of the purine nucleoside phosphorylase from schistosoma mansoni in complex with non-detergent sulfobetaine 195 and acetate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
285
structure length
271
Chain Sequence
ESVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords purine-nucleoside phosphorylase
publication title Structures for the Potential Drug Target Purine Nucleoside Phosphorylase from Schistosoma mansoni Causal Agent of Schistosomiasis.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 87
structure length 271
sequence length 285
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2004-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tcvA00
4MCHA 4G41A 1PKEA 1RFGE 1U1DA 1U1FA 5IU6A 1ZL2A 4WKBA 1C3XA 1PBNA 5CXSA 1V41E 4YJKA 4R2XA 5EPUA 4TXJA 3UAXA 1N3IA 5IFKA 5F73A 1A9TA 4OY3A 3OZBA 1TGYA 4JWTA 4WKPA 3DPSA 4L5YA 4RJ2A 2AI2A 2XRFA 1OU4A 3FOWA 1TGVA 1VHWA 3SCZA 1OUMA 1JE1A 1XE3A 5F76A 1Z39A 4OGLA 1T0UA 5JPCA 3LA8A 1SJ9A 2H8GA 1TD1A 3NM4A 3D1VA 1V4NA 1OTXA 4IP0A 3IEXA 3DDOA 5F7JA 5K1ZA 4DA7A 1PW7A 2ISCA 4L6IA 2A8YA 3DJFA 4EARA 1SD1A 4F2PA 4D98A 4M7WA 2HWUA 3K8OE 3MMSA 4UC0A 2QTTA 3KVRA 4ECEA 1JYSA 1Z37A 1PWYE 4GLJA 3OF3A 5CXQA 4F2WA 1OTYA 4TS3A 3EUEA 4TXLA 3IOMA 3MB8A 4QAQA 3LBAA 4TXMA 1CG6A 3GB9A 2QTGA 4H1TA 1RXUA 4L5AA 4F1WA 4D8VA 1JDVA 1VFNA 2PGAA 3FNQA 1Y6RA 1NW4A 3GGSA 4I2VA 5EFOA 4QARA 4DA0A 1M73E 3BL6A 4KN5A 4OGKA 1ODKA 4GLFA 5B7PA 1PR5A 3P0EA 4M1EA 2P4SA 1RSZA 4PR3A 2OC4A 4FFSA 2OECA 4R31A 3KUKA 4G89A 1Y1TA 4JOSA 3OPVA 2A0XA 3O6VA 4DABA 3OOHA 2Q7OE 2BSXA 2I4TA 1U1GA 3BSFA 1TCUA 1NC3A 4X24A 3C74A 1JDUA 2B94A 2QSUA 4DARA 4DANA 4WKOA 3OZCA 4OEHA 4U2KA 2A0YA 1ULAA 1Y6QA 2QPLA 5DK6A 3PHCA 5F7ZA 1A9PA 1JP7A 2GUWA 1T8SA 1V45E 1NC1A 1JPVA 1RXSA 3OZEA 1VMKA 1U1EA 1Z5NA 3P0FA 4TTJA 1K9SA 1Q1GA 1PK7A 1K27A 3UAWA 4D8YA 3FAZA 4NY1A 1LV8A 1K3FA 3BGSA 1B8OA 4TXHA 3T94A 4TTAA 5B7NA 4LNAA 4MARA 1RYZA 5F78A 2AC7A 4QFBA 5F7XA 1ODIA 1Z38A 1Y1RA 3QPBA 4L0MA 1V2HE 1ODLA 2AI3A 3E9ZA 1SD2A 1RR6A 2IQ5A 5KB3A 3E0QA 3FUCA 3DF9A 1PF7E 1LX7A 3EUFA 3OOEA 4TTIA 5EUBA 1PK9A 1ECPA 1WTAA 4GKAA 4L5CA 1JE0A 4LNHA 1ULBA 4WKCA 4LKRA 1U1CA 3U40A 1LVUA 4YO8A 1TCVA 1OVGA 1ZOSA 4P54A 4NS1A 4QASA 1PR1A 4D8XA 1Y1QA 4DA8A 4DAOA 1Z36A 5B7QA 4NSNA 4QEZA 5F77A 3PNSA 4JP5A 1SQ6A 2HN9A 4LDNA 1B8NA 1QE5A 1V48A 4PNPA 3ODGA 4YMLA 1T8YA 4R2WA 1RXCA 1PR2A 1Z34A 3FB1A 4GMHA 3NBQA 3UAZA 1A9QA 1Z33A 1PR0A 4OJTA 3TL6A 4E1VA 1RT9A 3ENZA 4M3NA 3UAYA 3E9RA 2AI1A 4F3KA 1Z35A 3K8QA 5B7GA 1PR4A 3UAVA 1Z5PA 4D9HA 1CB0A 4BMZA 1PR6A 5F7OA 1JDZA 4F3CA 2OC9A 4OF4A 3LGSA 4TXNA 3INYA 5I3CA 5CYFA 5CCDA 4WKNA 5ETJA 3BJEA 3OZDA 3FWPA 3NM6B 3O4VA 4BN0A 1RXYA 1YQUA 3KHSA 1V3QE 5FAKA 4TS9A 1YR3A 4DAEA 1Y1SA 4DA6A 5CCEA 1JDTA 1FXUA 4K6OA 5CYGA 5C80A 3NM5A 1OV6A 4QATA 3DP9A 4YNBA 1G2OA 1YQQA 1YRYE 4G8JA 2ON6A 3F8WA 3KU4A 3UT6A 2A0WA 1YBFA 2QDKA 4BMXA 1VHJA 3PHBE 1Z5OA 2OXFA 1RCTE 3KVYA 4BMYA 1JDSA 3KVVA 1A9OA 2HRDA 2RJ3A 4MCIA 1A9RA 3EMVA 2HSWA 3OCCA 3ONVA 3PNPA 4EB8A 1T8RA 1ODJA 4LZWA 1T8WA 1A69A 4TYMA 3EEIA 1A9SA 2I8AA 1I80A
chains in the Genus database with same CATH superfamily
4YLEA 1YU6A 3IEIA 4C7BA 3ID6C 4TN1A 1XKTA 2BKXA 3FIUA 2JFXA 3K2BA 4H6VA 4UEWA 3MTEA 3ZLUA 4KO3S 4ZQHA 3ZS9A 3HWX1 1S6YA 3QU4A 5I5EA 1TEVA 2ODEA 4DR7B 5BW8A 1YT5A 2WHXA 1KQOA 1X1EA 4RENA 5A62A 3IV9A 4D9EA 2J31A 4URYR 5HQTA 1QLJA 3OT1A 1H5UA 2H85A 3B6KA 1JPNA 4P5EA 2MSEB 3PSHA 5CPFA 3K8YA 4F5WA 4AAYA 2IHTA 3G0DA 1O58A 1KU0A 2UZ3A 3UIEA 2OQRA 4RIFA 2INGX 4PC7A 3WK8A 4V0NA 5LP6A 3IDZA 4A82A 2Z98A 4X7RA 1XRQA 3NYIA 1ECGA 4AROA 4DYDA 2HNAA 4Z54A 5B64A 1CFZA 3MSCA 2GZ1A 1SM4A 3VC7A 2JAOA 4JYAB 3IQGX 2V1XA 5BV2P 3CJQA 3FLBA 4XTCS 1WUIS 5B3JA 3I2HA 3P9XA 4JYMA 4GR9A 2WWGA 5EGNA 4HXYA 2C03A 5JARA 2GYWA 5D01A 4KKVA 4R69A 1GL9B 4RV5A 2G80A 1UP6A 3TTTA 2IBMA 3FWHA 3RARA 3UB4A 5LR6A 2Q9UA 1UKZA 4OGLA 3ABIA 1KMCA 2D0PB 2P2LA 1BHSA 2ZBPA 2WY2D 5IYZB 1WW8A 2E82A 2GFHA 2JJMA 4QGHA 1XHFA 4DB2A 2Z5VA 1PUXA 1XD9A 2Y8EA 3RYTC 4A5SA 4ZXFA 1C2YA 4F4DA 1H3NA 1CHNA 3AONB 4NEHB 2IYSA 1VMIA 3KQNA 3D1VA 1IOWA 2ZYUX 4ASUA 5DSZA 4PG5A 1AGNA 1X42A 2C4HA 4UTPA 5SY6A 2H1WA 3O82A 3TG8A 1JTVA 5F7JA 1YCGA 1YUBA 3JQEA 5LMUB 5MGNA 1G17A 2ORWA 4O4HA 2TMYA 1QB7A 5FNVA 4HO1X 4GGMX 1PZEA 3MXOA 3RTCA 4DA7A 4H35A 4KU4A 2Y27A 5LLDA 1ZNZA 2VAXA 4N9WA 2Q5HA 2XNDA 4KWTA 3OETA 1FUUA 1DRUA 4FUTA 3JVEA 3W5CA 1JFRA 3JQAD 4Q4LA 5FXMA 2Z1MA 5ER9A 5EWMA 3F7OA 1D1SA 1R50A 1OYWA 1TKBA 3K8OE 5FV7A 4YV0A 4DA9A 1NRWA 5FLXA 4PTLA 1F3OA 4UM5A 3HA2A 2GUGA 2HCJB 3WIEA 3D8BA 3PQEA 4OJMX 2QTTA 5HF9A 1T2FA 3T7JA 3G9UA 1YZ3A 4P86A 5FKJA 5CW1A 1YQEA 2XA2A 3NWJA 4N41A 4IRUB 4UUMA 2VJLA 4OXRA 2OV8A 4KJZA 3ROXA 4DCPA 1OI2A 4PQGA 4X54A 4DQKA 1W85A 4DR3B 1M2KA 5EJFA 1QORA 1O97D 3JR3A 1W49A 4AYXA 7REQA 4BY9E 2Q1UA 5JCPA 1E3IA 2CJWB 5AJWA 1AQNA 3AVTA 1KERA 1USIA 2IJGX 2OLKA 4H3VA 1FY2A 3H1EA 4JSTA 3EZNA 4PGMA 2DHQA 3D2CA 3FMVA 3MHPA 5ITSA 1A82A 3NAZA 3IJ5A 1JLLB 1QKIA 5CT4A 2D6FA 3L6DA 1Q0HA 1QZZA 1FFBA 2Q6VA 3BE8A 4GECA 2WP8J 1BMTA 1CQJA 1NRXA 3GG2A 5EUQB 4ZC1A 2GPWA 3M6WA 1QFSA 3UHOA 3V1LA 1W0JA 4EUNA 2LRHA 3E5HA 4C07A 2P1DA 1BZYA 3D8HA 3S2GA 1QF7A 5BP7A 3KXPA 3N28A 3IEKA 4BYMA 3ND5A 1LI7A 2OTCA 1DWUA 1N9GA 2F8MA 3KXKA 1NN0A 2AMFA 1L5KA 3SDBA 1XEWX 1LPSA 2GJ9A 2PGAA 4A8PA 1DWQA 4LSWA 1GNTA 2MR6A 1O5IA 1U0EA 1N2ZA 4AN4A 2WB4A 1NULA 1C9NA 1O94A 1JLKA 1SBTA 2IUEA 2R1UA 1KJNA 2FZGA 3KAJA 4TL6A 2ATEA 4NEGA 4E32A 5LM3A 1GTMA 4FYMA 2DYKA 3H2YA 3RYFB 4D99A 1JG1A 5KKAA 1F1JA 4G26A 4DNQA 5DGTA 4D44A 1KK0A 2OM2A 3MJ4A 4UNPA 2IIQA 2G1UA 2VP6A 1X39A 4GLFA 5IVPA 3DHEA 4PCAA 1CUCA 1NYQA 2JA1A 4EJSA 5ED4A 4K2AA 4C2TA 4HEHA 4HMQA 3L0YA 4YPOA 3WLPA 1VGQA 3ZDAA 1CY2A 1ZH0A 4ZOLA 4YN3A 4DXHA 5JECA 3V7WA 3VYTB 1L6IA 3ZD8A 4NG5A 1RZRA 2FF5A 3H2BA 4I66A 1U3VA 4N39A 4OXKA 5KCMA 4KN9S 5AI6A 1CUJA 2JEYA 3RVLA 4Q3AA 3RRYA 2C84A 3WB2A 1M7HA 3NTVA 5GV8A 1VJRA 5I45A 5JZMA 5F64A 3MJHA 4RGVA 1TQHA 3PUKA 1II9A 3TVYA 1VLZA 1XQWA 1TA0A 1ECLA 5AH0A 3WLIA 1HTWA 1UMBA 3JATA 1XRNA 3ZEAA 4B3JA 3LFTA 3AVVA 1E9DA 3BSFA 4MEAA 1TJ4A 3DMRA 4MUMA 3GDHA 5DT2A 3ZX4A 2RHDA 1Z68A 5DCYA 3MD0A 5TPZA 4OHVA 3GZNB 4EIWA 2F3TA 2JHPA 4OFXA 1SVUA 4GUAA 1Z8HA 4CN9A 3BOSA 5LB4A 4CG1A 4DZRA 2OMKA 2OV2A 4KQFA 5KTRA 4U2KA 3AEQA 1U9CA 4RA6B 2PUVA 3AY3A 4Y3UA 2JFVA 5TPWB 5CT8A 2P4EA 2QPLA 5BN5A 2VF4X 1O03A 2OPBA 1E5LA 3QY0A 3ICVA 1P6QA 1XN1A 3K31A 1CF2O 4FEEA 3DXXA 5TSDA 2ZIZA 4H7DA 4HGOA 4QYTA 4TLDA 1V8BA 5H83A 4K5QA 3KZ1E 2ODWA 2GUWA 4C2UA 2PCLA 4PRLA 1QIDA 4DBLE 2X14A 5HIIA 5BVHA 5I7EA 4L7QA 1V45E 4M4SA 3N6XA 4UAGA 1QK4A 5FUXA 1HXHA 1PLJA 2ZWMA 3FNIA 2ZIXA 3M6UA 2MOKA 2AFHA 3IYLW 4RWEA 1T3LA 1XZDA 5CM8B 3U49A 3QKTA 1YJBA 4IJMA 2O2ZA 3O5AA 3RODA 5LIPA 4CEJA 1BU5A 3H11A 1H9AA 2O7NA 5HUJA 4AECA 1FNMA 4GT1A 4D3FA 3B7GA 1UXOA 3N86A 4GLOA 3B6ZA 1FFGA 1JXMA 3CX8A 5EP1A 5L3SA 3BQMB 3REQB 5AW3A 2PV7A 1J99A 2IUYA 3KKNA 1ZH6A 5ERXA 1L4NA 3QK7A 4F45A 2XUAA 4OSOA 1GFWA 4RBNA 1JVBA 1ULSA 1DIGA 1HC7A 5BR1A 2O52A 3P9PA 3HXOA 3V80A 3RC7A 2HHHB 5IBRA 2NVUB 2XEDA 1GAEO 1U8UA 2PDAA 1YS4A 4P3OA 3RFUA 2CDNA 3ZU3A 3D0QA 5AXAA 3NC1C 3U1VA 5BW4A 3OVMA 3O4FA 5A3VA 2HQ1A 2HQOA 4BQNA 2XNCA 3AR7A 3E15A 4LXYA 6YASA 3JASA 1P2DA 2QT9A 3DCNA 1IM8A 2H29A 2PGLA 2GASA 4MXDA 3BCSA 2RJOA 4HN4B 4M1MA 1JFSA 3QVKA 1I1QB 4XLTA 5TMBA 4GC9A 1R0WA 1BMFD 3E9ZA 2B4YA 4HRAA 4ZD6A 3BYZA 1HYGA 5DM1A 4X9XA 1IHPA 3RIHA 2BVNA 3CSUA 3D7LA 4P7JA 3OLZA 4DBZA 5C7OO 3K1ZA 5IXJA 4X7MA 4QXRA 5L3QA 1NVMB 2F1JA 1UBOS 2O23A 5EE1A 4CIXA 5C35A 4YJ3F 5FV4A 2ATXA 3DFIA 4UZEA 2PUTA 2PX2A 3INNA 1KDVA 3PNVA 3T41A 3WNBA 1A2QA 5BQFA 5LQCA 5FO0A 1FFCA 1LX7A 13PKA 4B32A 4D79A 3DXYA 4C6TB 2XNHA 2I33A 5K8CA 5KNDH 4OQXA 3TLYA 3FR7A 2YJ5A 4L5CA 1G5QA 4UHDA 1RKUA 2YS6A 2FB9A 4PRZA 4YR9A 3LT5A 3KP1A 3TW6A 4DPKA 5F5NA 4IDBA 1DARA 1YB2A 3HDGA 2WEKA 3G0HA 3D5EA 3KM0A 4TPKA 4BC0A 5ICCA 1TK9A 2F64A 3KOWA 1L7OA 4Y9SA 5D87A 3HNPA 5CDUA 3BIOA 3VQTA 4C4OA 2B36A 4JFRA 3SX2A 1UT6A 2JGRA 3LUJA 3QXCA 2NIPA 4I0WB 1IEQA 1LVHA 1QKJA 2BT4A 2FFQA 1E79A 1KVSA 5JDIA 3EG9B 4S12A 4H7FA 4CI9A 2KE5A 1Y7HA 1OVGA 3I8OA 4KQ1A 1WETA 1UDRA 3F9RA 1KI6A 1O0SA 4NS1A 5KJ6A 4LF4B 1PSWA 3GGPA 5EVCA 2FPSA 2DCMA 1XMVA 4V0OA 1NBME 2YYSA 4G85A 1E5DA 1XJ5A 1KDTA 2IKQA 4WBXC 4HAZA 2OGTA 3DW1X 3WA6A 4DM7A 4WI1A 2JATA 4W1PA 4BO5A 4OUDB 3Q8WA 2FPUA 1LK7A 4H4EA 2GK7A 3ST7A 3TNFA 1SQ6A 4W6QA 4DIKA 1QE5A 3B51X 3B8EA 5A9TA 4U9IS 3WKDA 4OVKA 4XYGA 5COAA 2DR0A 4UDNA 2V1UA 3S70A 4DZZA 5EJ9A 5IXSA 1T0JB 5AXDA 2IX3A 1XA4A 3KXDA 1XRLA 1J2YA 4HH4A 3H05A 4YQZA 3R7BA 4RC9A 2J7PA 4DADA 4DMFA 2BMEA 5TXGA 4BNDA 3SPXA 4KH1A 3PFBA 3IVAA 4CTJA 3T38A 2NU9A 1NZJA 3MT8A 2V9CA 1YR8A 1VJDA 1C1HA 1WCIB 4DCVA 4QJ5A 4IV0A 1Z33A 1USUA 1FQOA 4EY3A 4B4DA 4ND1A 3FRHA 5FHRA 3ILYA 4EVRA 2HW8A 1NW3A 1MAAA 4YCMA 1LW6E 2W6ZA 2PL9A 4FFNA 1ML3A 3DE5X 4IVQA 4TKVA 5CFLA 2O06A 1ZSVA 3WGZA 1FTSA 5IFLA 5HDBB 1GQSA 1RQPA 4RK5A 4PICA 1QXSA 1U8AA 3DBRB 5DIFA 4OK5A 1CNMA 4NOLA 1ILEA 4IINA 1JEAA 5CA0B 1ST2A 4GOND 3L1IA 4WNAA 5SZJA 3C5CA 4J6EA 1XP5A 3V8QA 1BGWA 1UEJA 5EXDA 4MAAA 1FMTA 1HTBA 2V6MA 3FSJX 1MOPA 3FXAA 2FPXA 2PK3A 2RG7A 3L1UA 3NDIA 4H6XA 4NEQA 4RCYA 3RYHB 2DFPA 2GAOA 3CNNA 3Q7SA 4OHMA 2Y1GA 4FMPA 3KV3O 3C48A 4X20B 2VHVA 2CHUA 4O4IA 4DCTA 1NUTA 1Z7YA 3I32A 5FOUA 1WQ3A 1RQRA 2NN3C 5ESDA 1QGUB 3OP4A 1D6SA 1O8CA 2Y93A 1M8KA 3FDZB 3FUTA 1UKAA 3OQ6A 1WHTA 4NP6A 3RC3A 3TDNA 1F7UA 5DI3A 1U99A 4A1OA 4G67A 3T7DA 3BK1A 1OH6A 4OLHA 3O4VA 1FJXA 2WZCA 4PZUA 4A2QA 3JD1A 4Q1FA 3QOXA 4INZA 4LIPD 3PEYA 2XRYA 4FINA 4ACBA 4GU5A 5HIMA 3LPLA 1TQ8A 4R6WA 3P0HA 1TEHA 1W48A 4FJ2A 3U4DA 3NMUF 5FJJA 1NX6A 1E1MA 1JA0A 3WRWA 3MILA 4Q3KA 1J1ZA 4ZCPA 4DA6A 3B3QA 3L06A 4WN9B 2ZUFA 4GSKA 3NOQA 3L49A 5DGCA 3QKUA 1HFKA 1KFBB 3FUVA 2BFFB 4BV2A 2GPYA 1B4DA 2OCPA 1KFKB 4HAVA 4DSOA 4CL8A 4ENRA 1JJBA 1VL5A 4PG7A 4OAOA 3CO0S 1ARZA 2YNMA 4Q47A 4Q01A 3ZY6A 4AQYB 2LDBA 1QHXA 3A8TA 1Z6GA 3F8WA 3H5AA 4L16A 5FR1A 4BNTA 1G3IA 3OQMA 2QROA 4KFTA 2F4VB 3EISA 2DFNA 1QGAA 1AQJA 3TMYA 4F8YA 5HIAA 1MCZA 2Q3CA 1MW9X 1Z5OA 3BJRA 4A3SA 3ZCVA 1EFKA 2EIXA 1PT8A 3H5VA 3AFHA 3MOIA 1ODCA 3V8EA 2RH4A 1Y5RA 3OOJA 4OBWA 3QFRA 1DHRA 3UJ8A 3K5HA 3JALA 3GOQA 4PLZA 3VPHA 4BE4A 4BPBA 2HRDA 2XUPA 4BFTA 3AY7A 4IQGA 5TDHA 3QPAA 4CV3A 1YRWA 3V8VA 3D8RA 1PQPA 4UZFA 1ZOLA 2DTDA 1W5EA 2ZS8A 1MOZA 4N65A 3ASUA 3HRIA 3AB3A 2ZSUA 3TAXA 3O1IC 1YASA 3ONVA 5AI9A 1OX4A 5FPPA 3BCUA 4MQ4A 2DHDA 2HIGA 4UUAA 4B3HA 2JH3A 5FPKA 1ZHFA 1WABA 6LDHA 3QVMA 3T12A 4AY5A 4ZYVA 1YB7A 2YZKA 1ZNYA 2EHJA 1OAKA 3OM0A 4KBGA 4WXEA 3RS3A 4B6RA 5J43A 2FF7A 3EGDB 2Q9CA 3JR7A 2I8AA 3L82B 1T4CA 4G9GA 1PD1A 1CY0A 5EPOA 4GKBA 3B48A 1BXRA 4HV4A 2R6ZA 3LF1A 2X1LA 3PFFA 3HJAA 3ZVNA 1IXYA 1B74A 1P75A 2KBEA 3X1KA 2PL5A 1EK6A 3PS9A 3BQ9A 3VR4H 3PIIA 1U3WA 2SCUB 3FOZA 3WS7A 3M6FA 3CF6R 3HYNA 1FW8A 4J6FA 3EMDA 3EUAA 3QPCA 4E5UA 2D7JA 3DQQA 2E5WA 3BEDA 3GRPA 1KOFA 4JODA 3W8RA 5KNDD 1N5KA 4RMHA 2EQAA 1OB5A 4OKIA 3A1VA 5DKFA 4MDHA 2JI4A 3JWEA 2VOJA 3QTTA 4X60A 1TDJA 4YRKA 4R2LA 1AKRA 4IDPA 4JLOA 5LOVA 3JD2A 4GWGA 1RDFA 4ND3A 4BLOA 5HQJA 3HA3A 4C0BA 2XNSA 4FGZA 5AHOA 2IEDA 1P1IA 5FPTA 1TW3A 4C4RA 2SHKA 2ECKA 2P6UA 2VH1A 2CJWA 5CVJA 5ALQA 1E99A 4Q3DA 2Y4OA 4DIUA 2XJ9A 2OFOA 5IX8A 1M54A 1QRAA 3IDAA 4S3MA 1E3JA 3FOWA 2RGNC 4US0R 1JKXA 3A3KA 4G5HA 3W8FA 1VBNA 4DV6B 4ILKA 2WKQA 3UKJA 4GE3A 4OAQA 5DE3A 3ICQB 1DRWA 1O5OA 2J32A 3IOBA 4ML3A 3IBYA 2ZBEA 1RHJA 3LQKA 5EKDA 2IP1A 3F3KA 4EW1A 2TSYB 1EVEA 2R7NA 4I6GA 5KJFA 3J81k 2NO0A 5J2TA 2H7VA 3C16C 3L4SO 2CLMB 1OZAA 1L7EA 2H08A 4AJ9A 1QYDA 3SXUB 2LBPA 4NH4A 1RBMA 4M1WA 4PPNA 3SLGA 5CU7A 3SJ7A 5JYEA 4IP0A 1GPAA 1Y8RA 3IEXA 3E5NA 4F6LA 1X8JA 3FD8A 1LRLA 1PWHA 2AK3A 3ZY3A 4A27A 3AEUA 2QP9X 1FJGB 3MOSA 3LXXA 4MKXA 4YJDA 3KAKA 1WBBA 4MKZA 1X7YB 4E07A 1OLXB 1J2EA 1EUCB 2I99A 3T4EA 1PWZA 2V7UA 3F6EX 2BUAA 5KNCD 5CDGA 1BCSB 3CR8A 4DQUA 3J81A 4FM9A 4XZ3A 5C2JB 3PLNA 2HMYB 4GXTA 1DXOA 5HNKA 1OY1A 1EJBA 2WRZA 3QHPA 1ZA1A 2MU1A 1Y63A 3M6MD 2H2DA 2YQ4A 4HLCA 5HTKA 3SC6A 4IDAA 2GESA 3MGAA 4K9DA 3V48A 3E7DA 2CEKA 3GAFA 2UAGA 1Z2NX 4M0KA 1G6OA 1R15A 2OV6A 3OQHA 4WHMA 3OCZA 4KYVA 5IZCA 1QU2A 2X1MA 1M0EA 4WZZA 2PTHA 3EXIA 2O3RA 3FX2A 4RD6A 2VF5X 3QE3A 2C2ZA 4I1RA 2C31A 2QRLA 4N0MA 4NDAA 4KFUA 4BV9A 2ZIWB 1NHWA 1UPBA 1Z37A 3DONA 5D6NA 3ORRA 3RAGA 2V5AA 4CLXA 2NYRA 3FPHA 1IIRA 1R4NB 1PWYE 4L8LA 5FOVA 3ZVMA 5GJBA 4YRJA 5DO9A 1Y5LA 2VSXA 1NNI1 2XVAA 5EXXA 3OC6A 4B5LA 2OV4A 1KOGA 4IY1A 3VGJA 3QP9A 1ZN9A 3UK6A 2HU5A 5EZYA 4Z0NA 5AKGA 4DZTA 3ZGLA 3GXBA 1NBIA 2AYYA 1KGDA 3DXFA 2GETA 5E9WA 5ICSA 3PBKA 3NQ41 5DV9A 2Z43A 1XZCA 621PA 2BZ0A 3NXSA 1VE7A 2BJWA 4RA6A 3HB4X 4LOLA 4I1SA 5TPWA 3R7LA 4F7DA 3AW8A 4L5AA 1JLRA 1WPQA 3ILHA 4R40A 3AT1A 5BT8A 1GR1A 3B1YA 1NR1A 2P68A 4HNRA 1RVDA 2OK8A 2PTGA 2C00A 3R0ZA 3QXJA 4O08A 1J21A 1GZ3A 3FPEA 3WZMA 1ZGAA 1CEEA 2A84A 2VNJA 3ZQ6A 4Z0PA 1NF9A 2WWWA 1R0CA 1XJWA 2RHMA 3PUIA 4WUVA 1Z73A 4J43A 4DV4B 2CBGA 5EIWA 4E2YA 5EFOA 2IH2A 4H31A 1ISPA 1K7XB 4JEIA 4UMFA 3EC7A 1KAMA 1HLGA 1PQWA 3GAMA 3MWFA 4W5OA 1I3CA 3WLLA 4MICA 1VL8A 1CR0A 4N01A 1LQTA 1TZBA 2CZCA 2C2YA 2ILVA 4X90A 2IP2A 2G63A 3PQDA 1RWWA 5AW8A 2GZHA 1WKVA 2QIPA 5DGHA 4YP5A 3B36A 3HR7A 2SECE 5P8WA 3K5PA 1O6ZA 2QTHA 2FEAA 2WNHA 1KPGA 4FZRA 4O0LA 4CUKA 1E5VA 1EXWA 2OECA 5LBTA 3GCWA 5FI0B 1T9GR 3TNYA 1GTRA 1FW6A 1HQKA 2VC2B 4D1YA 3REQA 2V8BA 3JVDA 5IAGA 4KK3A 2FWNA 2P0AA 3RO7A 5BWCA 1HQYE 4BL5A 1HDXA 3EJ6A 3KPYA 1P4GA 3EBLA 4ROTA 5ICFA 4IFEA 1XCGB 1VE3A 4ZTZB 2W2LA 3ND8A 5A5DA 4C4SA 3M6AA 5JTTA 2Y68A 4PVDA 4X66B 1AKEA 1ZDMA 1U1GA 2QRMA 3VSEA 2A35A 2NVUA 3NEYA 5FPSA 3RWMB 2VRWA 2EFDB 2H2WA 1Z26A 4C14A 4X24A 5AW6A 4G2NA 1PDWA 3WLKX 1FP1D 2BP7B 4YBRA 5J40A 3KL2A 4FFPA 4KO2S 4KPFC 5HRUA 3TLZA 5IEBA 1IB0A 1RKBA 4FOTA 3A6DA 2AG8A 5C37A 1XJCA 3LKZA 3P9ZA 3CNLA 2RBKA 4YA6A 3IB3A 1JBEA 2Z95A 4RPHA 2JZOA 4Y0NA 5DLYA 5C32A 5CFPA 3RU9A 1VKOA 3ZHSA 1I3LA 4HDCA 2OCBA 4IJKA 5HFJA 3RRFA 5C4GB 2PT6A 1QVAA 3GLTA 4PTYA 1N7HA 2PMKA 3O7WA 4ND7A 1DPFA 1F38A 4P80A 3SOPA 3ZKAA 4CQLB 4BQOA 3MCUA 3P27A 5HUHA 4TRRA 4QGAA 3RC9A 4AYTA 5D86A 3JAMA 2QYHA 5KYTA 3HVIA 2XYQA 5JVDA 3ELUA 4KMRA 4U2DA 2WU4A 3X1XA 4G1FA 2ZI9A 3BD7A 3KLNA 4L9WA 2I6SA 3LHSA 2OWDA 1WDLA 4PC3A 3OZEA 4BNJA 2A5JA 3AHIA 2V9PA 1DT3A 3AI3A 4NHEA 4J07A 1YB4A 1Z5NA 1NJ5A 3L8HA 1LD3A 1GAWA 3LHKA 4MYSA 3V1YA 4ZI2A 4XD7D 3T52A 4TVKA 3KYBA 1ZD3A 4YFYA 4YRRA 4DDKA 4MV1A 4TYWA 1LLCA 1VMDA 3MCVA 3V6MA 4HDNA 4ZPXA 1OB2A 1R6VA 4H3HB 3HPRA 3ZV7A 4KXFB 1YDWA 3MWGA 5IUNC 3THWB 2O0KA 2FWJA 4YB8A 3WDKA 1UP4A 2XCTB 3LOQA 1K8ZB 3PKJA 1HZZC 1W6RA 4LWZA 1R2QA 4V2IA 1UC4B 2IH4A 1N8KA 1MX9A 5KX5B 1UM9B 1O95A 4B7UA 4H6PA 1L8LA 3KQLA 3H75A 2Z6QA 2QG4A 4MARA 4E5MA 4FC6A 3KXIA 1THMA 1B0UA 1Y7LA 1L5SA 4R1OA 1WV1A 3X1DA 1JAIA 5IVKA 3G8BA 3FR8A 3EYWA 4KSBA 2WFLA 4OUDA 4RDHA 1MZPA 1LBTA 3TZCA 3BS4A 4YUYA 1IXRC 1VBMA 1BJTA 1Y5NA 3ED5A 3L1JA 4P08A 3OP1A 3KKOA 3H42B 3NWPA 1P4HA 5DLPA 1NBMD 3TKLA 2XAUA 1P7PA 4WV3A 4D9BA 3AUUA 1AGXA 2QUJA 2CXRA 3M7IA 1HV8A 3UAGA 4E4YA 1TVKB 3LVRE 4IEEA 2QY9A 3S44A 2HA7A 2YZ2A 2ZYSA 2PKRA 3FUCA 3EZYA 3IAM1 3TL3A 1I94B 4RTMA 1WR8A 4J0KA 2BMFA 1AX9A 3SEAA 2P8SA 3F4LA 2Z2IA 3OIUA 2RI6A 2LUOA 4BKMA 5HTOA 2O07A 2FSVA 4MV4A 3RFFA 1WTAA 1YHZA 1PK8A 4OHZA 3I9LA 2YHIA 3UATA 3A1SA 5J58A 3TX6A 2GS9A 1QK3A 3NNNA 1LLQA 1DUIA 1EK2A 4FKZA 2G08A 5CA0A 1XXHB 3ZJ5A 1IHUA 2ZT6A 4MDYA 3ILXA 3U9SA 2CSXA 3O1HB 2IV2X 1W6UA 2ZXEA 2DJIA 2VZEA 2AZMA 4WLUA 4Y7CA 3W5BA 1JHZA 1EG7A 4U2EA 3CRQA 3U40A 3G9XA 1PJCA 5BYJA 1E66A 1ACJA 1PGQA 4YO8A 3HCEA 1WUTA 1W0KD 4JI5B 2PWPA 3LCUA 1PR1A 4O8ZA 5JZ9A 4G0NA 3HU1A 5T3YA 3FDZA 4MUAA 2B8WA 2GBFA 3ZYCA 5DM70 2OGWA 3IE1A 3ZGZA 5CVCA 5FFFA 1WNTA 2YX1A 3HHEA 4QEZA 1MH9A 5IM5A 5J4YA 4JJZA 1RXWA 3QRWA 1W59A 4J0CA 2YOFA 3PNSA 3GFVA 2PS3A 1PJ8A 3UPDA 3V7FA 4G4IA 1KBZA 1AXGA 1TUEA 1X15A 2QXTA 2L42A 2V54A 1GQRA 4QUIA 3FPCA 3G23A 3JQ8A 3LLVA 4PZCA 1E4OA 1HT0A 1H65A 3EZ6A 4ND2A 2QLBA 1UJNA 4CW7A 2IHJA 4ZOBA 3RSLA 4DW8A 3RVMA 4RDXA 3HYLA 1Z63A 2Q6KA 1GU1A 3HBFA 5EC8A 1D8AA 3T5PA 1IIBA 2PX8A 1JR2A 3ZPXA 4EY7A 1IQUA 1XMJA 4JJAA 1S3SA 4MDEA 5ILQA 1OILA 3KEOA 1JHVA 1GZ7A 1KI8A 1TYDE 2AJCA 2W70A 3ZDCA 3FHTA 5E1DA 2BFFA 5JNTA 1IN8A 3H5WA 1G1MA 4BGIA 5G0VA 2R9VA 5CB6A 5TC4A 4NARA 3JYPA 3HN7A 3IP3A 1ML4A 2CYCA 1TFRA 4NBWA 1V5GA 1HDCA 2I3AA 4LCBA 4P3XA 3R7AA 3RFCA 1GT6A 3O03A 2QPAA 4MJXA 3SWWA 1ZIOA 2G77B 3ZZUA 5WRFA 1DU4A 1ANKA 1N78A 1PX2A 2YXNA 3FFAA 3CHYA 2GRUA 1YZTA 1GUDA 1P4SA 4M8SA 1P61B 2OB1A 2PMBA 5GZ1A 1F51E 2G09A 4RFSA 3U31A 4A10A 2ZKIA 1FX1A 1X8LA 1VG9B 1AO0A 3SLRA 5L4SA 3DPUA 5ALDA 4HAXA 3R74A 1BXKA 1HG1A 4MYTA 4KQKA 1ZD1A 2PBLA 3NORA 3WGHA 4DTCA 1M1NA 3MMZA 2V9ZA 3RG8A 4F06A 4F3CA 2OC9A 3ZBPA 1ZG3A 3GJRA 2Z2ZA 5AVVA 3QGMA 1G8MA 4M1ZA 1A71A 1NUUA 2HXGA 3E9MA 4ER5A 3MJTA 3JQBC 2WM3A 4PG4A 3RK1A 4YAKA 2XA9A 4E13A 1SCQA 1IEXA 1OC2A 2E6UX 1ISGA 4HB0A 1P17A 3PXGA 1QNFA 1USGA 3VX4A 3UAOA 5CPBA 2EW1A 3IJPA 1VE6A 3R4CA 1ORRA 4HTFB 1FNNA 2VDQB 2EDCA 1OH7A 2VZ8A 4ME6A 2ZZNA 1ZZEA 2WJPA 1XO1A 3LV8A 3Q9LA 4PAMA 5FYDA 1T5BA 2QN9A 4C0XA 2FDXA 2ZR9A 1Y6FA 4X6XA 2J67A 5E3IA 3ZQKA 1HT1E 4UEOA 1T4GA 1YR3A 3OCJA 2NSYA 4DMUB 5LC1A 3QMPA 1SEPA 5J4VA 3BWYA 2SCUA 3A7DA 3DE7X 8ATCA 1AZSC 4NJMA 1EWVA 1L8AA 4CL0A 4EVQA 3DAGA 5JJLA 1FXUA 3KC2A 2K6GA 3PEUA 5TGZA 2OEPA 5C80A 2AFIB 3RVBA 2HRQA 3WBBA 4ARIA 1QO0D 1SHTX 2IDZA 3EIUA 4YDQA 4DWVA 1TMYA 2WMDA 3QXXA 1Y3IA 4KUEA 4BKRA 4QPPA 2PRYA 3OI7A 2AUMA 5C1DA 3T3IA 2ATCA 3THYB 3MWKA 4E2XA 4DE5A 5KSPA 3LRTA 3JRXA 3VH1A 3X3HA 1H2FA 4LJ6A 3GF4A 3I8XA 3M1IA 3BCRA 1GXSB 1CUYA 1ZQ9A 2W98A 2FHSA 2XWPA 4F3TA 1LLFA 5JH7B 4BZPA 1IJBA 4WFIA 3BWCA 2DQYA 4UTZA 3K9FC 3H6HA 2YY7A 1KQ3A 4CDMA 2Q5QA 3A06A 3ZXXA 5I7UA 3T5AA 5AKLA 3I01M 1MFZA 4REMA 1WP4A 4C01A 2QI9C 4J4BA 4N5DA 4L4YA 1QFXA 1DBIA 1W8DA 2RJ3A 2JFNA 3BL8A 4PZYA 1SCIA 3G1UA 5GONB 1NXWA 3SX0A 4BS9A 2LE0A 3H16A 1MLDA 1CK4A 1JEOA 1LCIA 2JFBA 4M7OA 4X93A 2NV2B 3GELA 2YFHA 4Y6QA 4LX0A 3ISVA 1SUFA 5C8YA 2BF4A 5BSRA 3GRZA 3SX4A 4CL2A 1WDMA 2E1PA 1D9ZA 2XTMA 1C3OB 1NN5A 1DTWB 1I3NA 1IDOA 1RW4A 4RIGA 4BLPA 3TIIA 1T0PA 2GT1A 3W7AA 3LQFA 4RZXA 5ESXA 3CVUA 1OBCA 3D6UA 5J2UF 4YP0A 1HMYA 2ZUDA 3ONEA 2FXIA 3VJMA 2QW1A 4R9NA 1L1FA 4DNPA 3WMWA 2L19A 1X7YA 2VP4A 3GFQA 1N2GA 3PTLA 1KJ9A 2D0DA 3N7AA 1RFGE 1KSGA 4Z2AA 3ESQA 3GJ6A 4LVNA 1M75A 1RYDA 4HTAA 1BDHA 1FFSA 1IOZA 1L4EA 5IU6A 4KQGA 1QF6A 2OBXA 2HA2A 1FRFS 3AJRA 4QU5A 4AY6A 2WWFA 2OILA 3UJ3X 2V4ZA 5KPJA 3P2KA 4R8LA 3B6IA 4MYHA 1V7PC 2QIOA 4Y9DA 3A2NA 3PLRA 5ES3A 3ZK9A 1Y6ZA 1MHPA 1SCJA 3I6YA 1N6IA 2P9HA 3I5AA 3UMBA 4EHAA 2OG1A 4ZYTA 1ZR4A 5AOBA 4X1KA 4ON9A 16PKA 2ZM6B 4EFMA 5EPUA 3W6OA 1F06A 1D09A 3SBXA 1IBRA 1KC3A 2BM9A 1YE5A 3QELB 1FE8A 3AIKA 1FMJA 1N3IA 4FK8A 5ALKA 1R4NA 4ZCSA 4OY3A 3TLEA 3LH5A 4CPDA 5JCJD 3OWXA 4LZNA 1YJ8A 4HGPA 1IN6A 4L5YA 1I8TA 4B44A 4I3GA 2AI2A 3K9HA 4IAOA 4RD0A 3OU2A 3ZJYA 2WIDA 4UM9B 4WGFA 2UUAB 2J1LA 4CIBA 4UHEA 4KQ9A 1IQRA 4GZLA 5CG2A 3ZGVA 5K3EA 1OJ7A 1ENZA 1X7ZB 2CUTA 2Q1WA 1SVKA 2XNJA 4DT1A 1EWQA 1OAAA 2GBCA 5DHPA 1X86B 2WYHA 3DULA 1KMHA 3FDJA 3G68A 4MVXA 3T9CA 4TZTA 3WHIA 1PL8A 3GLGA 1UWCA 2VF2A 4B87A 3SYNA 2QE6A 2IXFA 2CHVA 5CJPA 5T41A 4BC1A 3NM4A 2G9ZA 2WG2A 4JXJA 4IDFA 1SAYA 4MP3A 1PKXA 2V55B 2POCA 4IQ8A 4XE5A 4HF7A 5CJ2A 5HCUA 4G0QA 1RMQA 6AT1A 3TQSA 3G88A 2FUNB 4BLRA 4OAPA 1CP3A 3IO3A 4N6NA 5JCJA 1KYVA 3DZDA 3L79A 4PGHA 3FYTA 4N3NA 3DPIA 3TINA 4ZQBA 1AKVA 3QKSA 4RANA 1RRCA 2DXIA 4WNYA 2YV5A 3P2YA 1W581 4U02A 1VPWA 2Z9BA 3OWHA 5EUCA 1E9RA 3NUQA 1GA4A 1I4OA 2OUKA 3UGTA 1SD1A 1BD4A 1EINA 1JQDA 2GVZC 2FFAA 3NYWA 5ALRA 3H2GA 4ZI5A 5F35A 3NHYA 1YB1A 3ZOZA 2UYHA 2BZ1A 1IAVA 4PE5B 1DKNA 4HY3A 1KFEB 4W5WA 2SNIE 3AL0C 3FVTA 3C3XA 4P34A 4UC0A 4HFNA 1WMEA 1BVUA 4HN2A 1NE2A 1I32A 4D4KA 3U7QB 2I4LA 4MJ7A 5TV2A 4BP9A 1K7SN 2C5LA 3A11A 2GPJA 3NOXA 1LJLA 3ZGOA 4DGSA 4QULA 4ZCMA 2O8DB 2QN7A 1GDDA 1DJLA 4LXXA 4ZO9A 3ROGA 2DERA 4FU0A 3VDQA 1SMKA 1DDOA 1ZYUA 3DAPA 4ZVRA 1QP7A 4PIPA 3WFJA 3FFTA 4V0KA 2V58A 2FEMA 5KC8A 2N46A 4E5VA 3EWIA 4Y2PA 1IUKA 3WBJA 3WBKA 3HRKA 3X1YA 3H5TA 3PDUA 1VXRA 1GKLA 2BM1A 1E58A 2MMCA 4LRTB 4O6VA 3ZVLA 5LZ2A 3K5WA 4D0SA 1A4IA 2G0TA 2I2CA 2WU0A 3VYUB 5ARBA 1ISSA 1XB2A 2CFCA 1PJAA 4LWPA 5EIFA 1BEZA 2XQGA 1XOIA 4A73A 3B9BA 3F6RA 4AURA 2EZ9A 1M1YE 3CLUC 3A1FA 3WZLA 3JS5A 1UEIA 1CY8A 4B9AA 4JX8A 1C4KA 3UY4A 3E2MA 4ZK6A 2IYFA 2BV3A 4NMXB 1NVVR 3VAZA 3LDAA 4UPEA 2RGGA 4MEJA 2CFOA 4OHFA 1FEZA 2HY7A 4LSZA 4WJKB 4PPFA 1Y9DA 2FEWB 3O93A 1XJ0A 4HBZA 4BVAA 5LLTA 1FTQA 2GJKA 3W1EA 5DTEA 4AN1A 1M6VB 1DFHA 2FSPA 3D0KA 4KLAA 1V6AA 3B5IA 3LDGA 5F98A 1M73E 4MUXA 3VVBA 3U7RA 4BRWA 3V8RA 4EB0A 3P9KA 5A6SB 3TZKA 1E2FA 5FWXB 5IMSA 4WLFA 5SY9A 1BHQ1 1A8HA 4C43A 1C80A 2P2YA 2JI6A 2G9VA 3BFXA 5F12A 5AD1A 3FOAA 1MW8X 2P4SA 3I62A 2DLCX 2IP4A 4TYQA 1T91A 4BAGA 5A4MS 4O4LF 1DL5A 4ZCLA 2OHIA 4GAEA 5JYCA 1OLOA 2ZYAA 3OE5A 2HYDA 3THWA 5DULA 4LJYA 2G88A 1K2WA 3SZOA 3I5MA 3SU8A 5FUWA 3L02A 2J0QA 3KOOA 3N9IA 2VDUE 3W4IA 5K99A 4W5QA 1VJ5A 2D2XA 2OZVA 2XR1A 2DPMA 2UUOA 1VYHA 3N2GB 2A0XA 3RF6A 4F9FA 3RS5A 1UM9A 1KGSA 3D2AA 1KO7A 3AIMA 4HS9A 2ZYTX 1R6TA 2RBGA 3LUBA 2J3QA 1NI4A 4L02A 3A4IA 4AJEA 1W30A 4Q3NA 4B80A 4IUCS 5TT0A 2VJAA 4EG3A 1N0WA 2H06A 5BORA 5CFQA 1TCUA 3UUFA 3N5CA 5EOVA 4CCWA 2JBWA 3PL5A 3RS2A 3TRHA 2YN2A 1DAEA 3LXRA 1G3UA 4BIIA 1WL8A 3UJ7A 2IF0A 4DANA 3DOIA 3I30X 1RPTA 1V3UA 1YV9A 3AF4A 4XUEA 5FEMA 3OZCA 3IC5A 2WZBA 4M9UA 1A8UA 4LWOA 4OEHA 5ECWA 4AZVA 4QELA 1CFJA 4EDFA 1OYOA 1BE6A 2FP4B 5ITVA 1H2AS 1Y6QA 2IHYA 3IUBA 1H5QA 2X0NA 2Z58A 1OZFA 2C4MA 3EQ2A 1NJGA 3PC6A 3PUZA 1RRVA 1TVKA 3NDRA 3HXTA 4PR0A 3L4BC 3IP5A 3OMXA 5DK6A 2AE2A 4WLEA 5A3JA 3RAEC 1RAAA 1C3VA 4JUFA 5INTA 1JHXA 1FU7A 2ZI4A 3DEYX 3F6YA 2H51A 3I4CA 4MW0A 4W82A 3TE6A 1XZIA 4OK6A 2OORA 3BE4A 1MAWA 2A5GA 1KK3A 4ZQGA 4I6JA 2JIRA 3HPQA 5L3VA 4TWZA 1PNOA 3X44A 3ANTA 4QICA 3PQ8A 1SRQA 2QP4A 2L2QA 3I9MA 3L01A 4CMJA 5L6MB 1Y1PA 4ZRDA 4NFHA 4E46A 5B30A 2GCNA 3D3JA 3R3YA 3S5UA 1OFUA 5DTIA 1EB9A 3K1AB 2FOLA 4TRJA 3GPLA 3RGWS 3TUIC 2O2XA 3KQTA 1NJ2A 1GSAA 3VVCA 3TM4A 1V26A 2JEOA 1XLVA 4ZHQF 1GQYA 3FSGA 3QEMB 4M7RA 4A6DA 2KYRA 2CNWD 1L4FA 2HIMA 3U3RA 4CVNA 1J1UA 1C1DA 2JS7A 3KEMA 1R6XA 1QZXA 1FDIA 1J7KA 2EGUA 4I4TF 4ZT6A 4ENQA 4PM4A 1JMYA 4MR7B 1K3FA 4CNQA 4F97A 3F0TA 2W6ID 2F1RA 1AXEA 1NBWB 1RXIA 1IN5A 2CJPA 1SVNA 3QSGA 2BI4A 3BM5A 1KJYA 4WOJA 5KTPA 1KOJA 1XFDA 2XZDA 2ZTLA 3PUYA 4L78A 5J5CA 1CZHA 1L5HB 4MWSA 2AJLI 2IL1A 4OIMA 5BRNA 2V7GA 3L7CA 1P1RA 4QOIA 3W9BA 3ADKA 2FPIA 1NRIA 3CUTA 3COSA 2LW7A 1MJNA 1ZISA 3QF4B 4MUFA 2WI8A 3OOHA 4Z8YA 6ADHA 4INJA 4JI2B 3NFRA 2JL1A 3I9OA 1B76A 3CRZA 4MGYR 1KOLA 2J48A 1L5NA 1G60A 1OWLA 3BDIA 3GEBA 4J3FA 5TQVA 3WJ2A 4PN3A 2XMSA 4FFVA 3ZDZB 1ISJA 4WZ6A 2QG9A 3C41J 2P69A 1XTVA 1AH2A 1W19A 3DBHB 1PT6A 2BFCB 4ZAGA 4MWBA 2B0CA 4REQB 5ER6A 2EG9A 2B20A 1NVKA 4XB1A 3FPAA 2OSBA 3LRXA 2C7VA 3VPDA 4AO7A 4OBEA 1BCRA 2RHHA 3ETGA 3G89A 4IIVA 1QZUA 1XWIA 3W5VA 4IPTA 2XLBA 4GM0A 4F04A 3MCTA 4HVLA 1AS2A 2EFCB 3G0IA 1RAGA 4YJ3B 3RUCA 4ZZ1A 1TVCA 4ZJPA 3PUVA 5CNMA 2PX5A 1Q57A 4FMCF 4GMDA 4ND8A 5J5AA 1WLYA 4LNHA 3RIEA 4QOHA 1MX3A 1YTLA 2AXNA 3DT9A 1NVXQ 3HEMA 2FN3A 4DR1B 5FO1A 2PL3A 1UXHA 1ACLA 4HH1A 1USKA 2H17A 4GIBA 3VU3A 4CTMA 2HGZA 3L0PA 2W42A 3PD0A 2JGDB 1Y80A 4LZLA 4N03A 1FNSA 3U3KA 3TECE 4P9NA 2PH3A 1UMDA 2WFZA 1L3CA 2VSOA 4CEIB 4LG1A 1K63A 2B4QA 3TLJA 3LE8A 1K68A 2A57A 1C9MA 1SCUB 1Y1QA 4YV2A 3CRVA 4PW0A 3OKAA 2QAJA 1FIUA 4G81A 2TRSB 1R9GA 2RCYA 1Z36A 4LTNA 4ZQIA 3TM5A 2FZCA 2DFDA 2VT7A 4ETWA 3V97A 4EG7A 3RSFA 1Y5MA 4GBGA 4UBMA 3N0WA 3G2MA 3NNSA 2PPLA 2Q07A 2IZ7A 3LX6A 3TNLA 3JARB 1K1EA 2DWUA 3SYRA 5EUMA 2XBLA 3AVWA 3E9QA 5HR5A 2OOSA 1DP4A 3CWQA 5FWYA 1YRBA 2JASA 2Q50A 1RXCA 2XRMA 4B71A 1P7CA 4UEKA 3ZK8A 5JOQA 2VQDA 3B12A 2BCGY 5KJCA 4LHYA 3CZ5A 3TK1A 2JC3A 4TM8A 5ALXA 5IN5A 1R0LA 4TV9F 4YT4A 3CGGA 1C9KA 2AFIA 2P65A 1WB6A 2CLIB 2XUJA 3UV3A 3GA5A 1D2GA 1IZ9A 4HFJA 4AN0A 2D8MA 1DUSA 1JN0A 2EHDA 2JFOA 3OEYA 4EGCB 2XE8A 4KGZA 3KHUA 5M3BA 3RS0A 3ND6A 2C2BA 1L4BA 2I7VA 3AK4A 4N0QA 3ICWA 2O8BB 3ROFA 1Z35A 5B7GA 2WKWA 2WSBA 3DOCA 3LYHA 1L1QA 1KVRA 3THSA 5REQA 1GXSA 4C4TA 3T7EA 3E9YA 1ZU4A 3GCDA 1U0HC 3I9KA 3IKMB 5T6MA 2X15A 3ZWOA 1E2BA 4MRNA 3E82A 4H1HA 2H2HA 3ND9A 4HSGA 1RHMA 4I1YA 1B16A 2CVOA 1JS1X 3GUHA 4RESA 5EJAA 5F7OA 5DBHX 1RWBA 4OQZA 4X5OA 3FW1A 3ZQJA 3GIDA 2J09A 2ZRKA 3EZ7A 1K8YB 2SICE 3LK7A 3ZC3A 2EP7A 1JPUA 3A28A 1ATZA 1J39A 4RTKA 1G8PA 5FOWA 4LSGA 4L6CA 1GJRA 3NIBA 1EGHA 3V1NA 4A8TA 4KK4A 1Q1AA 4YRCA 5IANA 3DMYA 4RSGA 4C20A 2ZUCA 4RVDA 3TIFA 5H02A 5JEDA 2PX3A 2UUPA 2XKAA 4JJ6A 1AHPA 4FVTA 4L2IA 5KJ1A 1C3OA 3H1BA 2J9FB 4GYWA 1DFIA 1SU7A 1ETHA 4HAYA 2Q62A 1RWQA 4RABA 3LLCA 4C4XA 4EYEA 3RKSA 3O8DA 3TQTA 5CYOA 2RH5A 1RCFA 2HX1A 4YI3A 3ABSB 1RWPA 2I6XA 2F48A 2IHZA 3AM1A 4DWOA 3H0EA 5KO2A 3NIFB 2O5EA 2MYTA 2FE1A 2WINI 3GFOA 3VO1A 5JSZB 1XDWA 2B4RO 4GG1A 5KU7A 2IS4A 5JI3E 1T9KA 3WWZA 1JU4A 4AX4A 3K09A 5IAAA 1XIVA 3R20A 1JDTA 3WKEA 1FDOA 3R7SA 2QEQA 1ESMA 5EIOA 4PC6A 4MW7A 3NM5A 4QXPA 1AUPA 2Q9BA 3EY9A 4XYLA 4X6YA 3HKEA 1N2BA 2C1ZA 3OIWA 4AICA 4QTYA 3ER6A 3L07A 4Z51A 3H7IA 4KRGA 2AX4A 4NPAA 4YJ2F 3HJUA 2A3RA 1BXGA 1F8FA 2A6PA 3BAZA 1DAOA 4M49A 1DQSA 1RKQA 3U2QA 1K2VN 1D4OA 1VHJA 4OKSA 1W88A 2JCGA 3BSSA 4O25A 3SF8B 1T6NA 2WPDA 1RJFA 4U2FA 4J94A 5K7SA 2ZJYA 1N5OX 2GBPA 1O9GA 5D3QA 3WDMA 3B2EA 1K5HA 4XQEA 3WRYA 1X1AA 4AP5A 3VPBA 2J07A 2VJYA 5AJUA 1Z0ZA 2RD2A 1YFZA 2OFPA 4D3XA 3A6HA 1GGJA 4BE7B 5CEJA 2II6A 5L8VA 1H2RS 4ARVA 2PUBA 3QVVA 2ZAIA 4JLAA 1RKVA 4YAFA 3GW8A 5KOYA 1QJCA 4PZEA 5CDFE 2AL7A 3ROEA 4RPCA 1PV1A 1EWTA 2PZEA 1W52X 1GU0A 2JRCA 3DZIA 2R1TB 1SVMA 4MI9A 3IRVA 4X1YB 4Y2HA 4FONA 4DCCA 4PSDA 4ARAA 5KIAA 5C52B 1ESEA 5FBQB 1T8RA 7AT1A 2H2GA 4LZWA 4OTZA 1MZVA 5BN4B 5KYWB 2VSFA 2W2TA 2H5IA 2GEFA 2QUIA 5FWDA 5TE9A 5EFZA 5I47A 2BEVB 3K3PA 4MWDA 1OROA 4GE0A 2WMOB 3V7UA 2E4UA 1JG2A 4MVCA 1E77A 1DIOB 5JAQA 3T3DA 3SC3A 1EVIA 3RC1A 4BB5A 1DC5A 2BBSA 2GRJA 2QL9A 1IZ0A 3HN2A 2ECPA 1BYIA 1KY4A 3BJMA 4JT4A 1I6MA 3BN3A 3KPVA 1F2DA 2NPIA 2J3IA 3ZCQA 1TKAA 4ZAWA 1LBIA 1N2OA 1UADA 3F6PA 4HDKA 4V38A 1VL6A 3A6ZA 5DBFA 1X7DA 2YXBA 4NBNA 4XX0A 3PR2B 2PUJA 1OWPA 3W4JA 4QJ3A 1TT5B 1WU8A 3H2ZA 4G1CA 3VH3A 1TPYA 1QRRA 3VSCA 5KBYA 3WGJA 1G9XA 1YBAA 3A9WA 3VO9A 4AYWA 3PQ6A 4Q7QA 3R9XB 1EJ0A 4LRYA 1U5CA 3I52A 3TTXA 1IJFA 1VDMA 3NEJA 2OG2A 2W43A 4XYEA 4YJKA 3TDKA 5CDFA 2ZCJA 1ZOOA 1IK6A 3DP7A 4XI9A 2XI4A 2XXJA 5LA6A 2Y6VA 1XI2A 1CVIA 2EG5A 1AS3A 1OFGA 2XB9A 4OGWA 3BQNB 5JD4A 5JC8A 1VLJA 4JWTA 3VYSB 1JEYB 2HTEA 3GD7A 1NQTA 1EUZA 2V7BA 3LPCA 1J22A 2ERXA 2AKEA 4F7WA 4CXMA 1LDGA 1O1YA 2YZGA 4HYQA 1P8AA 1EESA 1DC8A 3W9UA 1XT6A 3T06B 4U7DA 2X7JA 5SZIA 4NKRA 3SCZA 5A7FA 2XYGA 3MWJA 2JD2A 5GJVC 3ILSA 4B6PA 2P1RA 3MTBA 4IFTA 1QV6A 2LKDA 4AMVA 4EMUA 5FBKA 1FYDA 2CSUA 3TJRA 1A9XB 3CEMA 3PWZA 1TNDA 3N8KA 3FYUB 3RSGA 3OPYB 3IBFA 2FRDA 3U17A 3VC1A 3IAEA 5ITZA 1VE1A 4EVSA 9ABPA 5HKOA 3BBLA 5DBEX 3BSYA 1O6FA 1QTIA 4TM7A 2IU0A 1U7XA 3BTVA 1FDSA 2YC2C 3X1MA 4JGGA 4URFA 2LV8A 2BI7A 2PX0A 5ALTA 3WGLA 2ZATA 4GDFA 2BEWA 7YASA 3SHTA 3BWMA 2EP5A 3ZV5A 3PGXA 4CQMB 4HZGA 4E6PA 1N6NA 1NG9A 1VM6A 4N4AA 2AZDA 5EWLA 4FP9A 2IIBA 3ICCA 4HNAB 4KFSA 3MEQA 4FEGA 2WC1A 3OUUA 4AZ0A 4QUJA 5J3JA 1NVGA 2OO5C 4NU5A 1KP3A 3SS7X 3E27A 3QE0A 5B1DA 2H1FA 1ZITA 2R60A 3JQ9A 1XPUA 5LMZA 4HNVA 4H4DA 1RWNA 2B25A 2XF2A 2Y05A 2YHUA 4L3OA 4UCWA 5DI9A 2X8BA 4BQEA 5AI4A 3NBXX 1G6KA 3KQUA 3AI2A 2GWRA 5DTJA 3PKZA 4UXHA 1IZ8A 4YBZA 5DW0A 2RJNA 1I0ZA 3N2GA 4WW0A 1UDCA 4DIMA 3U0VA 1KXZA 1VKZA 3KZCA 2YWCA 4JL8A 5NULA 4A8JA 4DILA 4BO0A 1L6RA 3DCYA 3HBMA 3ROQA 3GJ0A 4D0GA 4KSCA 3W79A 1XZGA 1LH0A 2DPGA 5EQTA 1QYWA 1EK1A 2I2BA 4J0HA 2VZ0A 1G9SA 1CF9A 1IEVA 3QPUA 3KZKA 4F2WA 3GEDA 3MSXA 4NJOA 1HL7A 3KJGA 4GI5A 4IKEA 2DT8A 2ZTHA 3LJKA 3KX2A 4B83A 4K9OA 1ACMA 1OHHA 2CE2X 3A3OA 3AR4A 3EA4A 3SBOA 1M2JA 1QWOA 3BIXA 3E8XA 1L5WA 3GRKA 4TT8A 3I05A 1SUBA 2GA8A 4H1TA 1F0NA 4UARA 4FW9A 1ZM2A 5BOSB 2GF9A 4UFNA 3TG2A 2RGAA 3C5WP 3HR4A 1L7DA 4K3VA 4Q03A 3WGNA 2ZE5A 4RIHA 4AVYA 1G38A 4V3BA 1JQBA 4OUKX 3WLSA 2QU7A 3MFYA 5FTWA 5A0TA 2YMLA 3T4UA 3H9CA 3BMCA 1DBVO 4RH1A 5FTMA 3ZIUA 1I7LA 3A10A 4CL3A 2ODTX 3AFGA 2CN1A 3ML1A 4F93B 1NMXA 2XDYA 4E7PA 4MIKA 5CB4F 3QVTA 1MDBA 1E0DA 1MKYA 1QAQA 1Z6AA 2LKCA 4OOFA 4FLEA 4DEXA 5CFNA 3H3FA 4HQRA 4WAUA 1XMOB 3DT8A 2OAGA 1G63A 4M1EA 4NZPA 4WZAB 5DPMA 3UMCA 4GNRA 1REQA 4UUPA 3DTYA 1QE3A 3DL0A 9LDBA 4GEKA 3BH0A 1T15A 5H3HA 2PZKA 1UPTA 2XMDA 3DXZA 4XUCA 3RT9A 1GPUA 3QEMA 4BFWA 1F0PA 2HA5A 4Y2SA 5GP1A 4NYJQ 4D8UA 1WB9A 4XM1A 3MG9A 3TAUA 1NZFA 3L18A 3WSVA 4WEOA 1EE1A 1WM1A 3NRCA 3QENA 1P3JA 4FYXA 1NQXA 4GXNA 4MLCA 4MR7A 4JOSA 3TW8A 1W9MA 2G83A 4NYIQ 5FFNA 4Y9RA 1HURA 3INGA 1Q95A 1EAMA 3UUWA 3QEKA 4NNPA 3A25A 3A04A 3GDFA 1T5LA 3H9UA 4UFOA 3QVJA 4C4ZA 1QHNA 2DX7A 1YONA 3LLUA 3RTAA 1L5HA 1JQJC 1CY6A 4FYVA 5EHNA 4IIDA 4C5CA 4FBMA 4WESA 5IUKC 5BNWA 2EYUA 1DRVA 1YE8A 3LK6A 4G4GA 4PX2A 4GKJB 2ARKA 3HVHA 2WW8A 4RHEA 3ONNA 3V4PB 4X95A 4AULA 1NQWA 1W9HA 3HXLA 4HSEA 3R7DA 2I4IA 3L6CA 4MB0A 3ZUPA 2P6OA 3IXMA 5KQGA 1JIKA 3SKXA 4HB2A 4ZT3A 1V39A 2BRUA 2UYYA 4OXYA 3DR5A 5KQPA 2VHJA 3OQ1A 4UUBA 1C7FA 4EEZA 3O0TA 1BS9A 2QXYA 3DC2A 1D7OA 1SA0B 2BFCA 2CYAA 3DBHA 1ZSNA 4IEFB 4PTZA 4ZTBA 2X13A 5LXTF 1CBUA 1Q77A 2RHLA 2OD7A 4KOEC 1UAYA 2BFNA 4MS4B 5IDQA 3IA7A 3PFHA 5FI1B 3AKEA 3DTVB 4E88A 3NGLA 3C8DA 1N2XA 1PJLA 2DPHA 2XY4A 3AF1A 3AESB 1SQFA 2C2HA 3ECSA 3FY4A 2V45A 4MKIA 4XGQA 1K3TA 1HE2A 2Y67A 3ESBA 1EU1A 3JYHA 1AK9A 3SIXA 3ZD9A 2X5OA 4K81B 3TSYA 4GWKA 1P80A 2CVPA 1S3IA 2MINA 5CBPB 4PHHA 3T5GA 3TFQA 1ZCFA 3WGYA 5F4BA 2FGJA 1XU4A 2ZJ5A 2E0IA 4JQCA 1QGED 2R8XA 1Z4PX 2C5EA 1RJGA 3DVRX 3KOUA 5ANRB 4OP3A 4B6OA 3RAJA 2RHWA 4ROSA 3AOEC 4ZQEA 4ZYYA 4PO9A 3JW8A 3NHJA 1CUVA 4J03A 4ZRNA 1MRZA 3RVQA 5THQA 2BI8A 4W7HA 3IOYA 1LV8A 3N8HA 3HXQA 2XCSB 2FSGA 3J7AC 4MYCA 3BGSA 3BIFA 4UPDA 5FUVA 3T95A 3IDOA 4TXHA 4CM5A 4MPRA 1FS4A 4N3BA 3L77A 2DKNA 4WADA 4A0QA 2O7RA 1WDKA 1W73A 2BSAA 2FUG1 3DE1X 5E6SA 1W36B 3HC7A 1U6IA 3IPAA 4CF5A 2J6IA 4OHOA 3B1WA 4IQFA 5B5SA 1WA5A 1JI3A 4UDYX 1TTPB 2GYVA 3CN9A 4KXWA 3IQXA 2V3WA 3WG9A 1TKCA 2Q28A 4AZSA 3RUFA 3RGGA 4NK4A 3RB8A 3IBTA 5I01A 4RLFA 1Y4UA 5I7SA 2A1TR 2C8LA 1QB8A 4L0MA 1ZI6A 1GYRA 1K4MA 4ASUD 1KSFX 3KT0A 1JU9A 3GH1A 1UBEA 4HX9A 5K01A 4W9RA 1SG0A 1ZL0A 3G9TA 2C4VA 1J2RA 4XUGB 4P7KA 5HRCA 1OVMA 4E2ZA 2C83A 4RCZA 4HUQB 3HZRA 4D4IA 5EMJA 5AICA 1K5PA 1T43A 4P32A 5CA1B 3VRHA 4IDGA 4MROA 2FSFA 2P75A 3EUFA 3ILVA 4U7PB 5D5QA 4B3FX 2ISQA 1JG4A 1KDZA 5FTNA 3CRRA 1J5XA 3IIIA 3T5TA 2NQTA 1D6MA 4KLCA 2IXAA 2HK9A 3RSSA 4Q02A 2ZRBA 2VYFA 4NFYA 4G0PA 4EWLA 5U9CA 5BSTA 1GP2A 3GEEA 4LHSA 1VDZA 1JEDA 1O96B 3QV1A 2O8FA 4WKCA 3HLKA 3SQOA 4Z6KA 4OREX 1NDHA 1R1DA 4DCNA 2Z2JA 1M6HA 3QYAA 2X0DA 3X1WA 3BE5A 3AFMA 3FMPB 3ZCUA 3ZWYA 4F92B 5D3MB 4B3MB 1KNQA 1ZLXA 3OH8A 2IS1A 3LSTA 3NKLA 3CSDA 3ORFA 3VJKA 3L5OA 4JHLA 4YMSA 2ZUSA 1W47A 2UYOA 1QZ3A 1SKUA 1O5TA 1XZ8A 2BHLA 1II8A 2KHZA 2QMEA 3DEJA 3DAHA 3EZXA 4L57A 3WDLA 5IWAB 1JLSA 3NVDA 1GTSA 4ZQFA 4R9RA 3LOUA 1BN7A 1EVKA 1JJFA 1M0SA 1SVIA 3BFKA 3K9LA 1WB4A 4P4GA 3DMDA 3ESAA 5B7QA 3THXB 2BUCA 2J9FA 1KFJB 1IMOA 4M2LA 4X3CA 1EWYA 1B0PA 1GNPA 2PFSA 2R7LA 5IJAA 2A0KA 3FDIA 3AU9A 3NHPA 1IM5A 4AJKA 3H5NA 1DS6A 1XPRA 1DKLA 3MWEB 4ZOEA 1GPWB 2HOQA 2PVSA 5JAOA 1XCJA 1N6PA 1AUQA 3W5JA 3QX3A 5EQJB 5IN4A 2MSKA 4UU0A 3D1JA 1O94D 1Z5ZA 2EXXA 3OX4A 4G8DA 1YIOA 3GPBA 4AJOA 3JAWB 3NBQA 2W22A 1KEPA 2LP4Y 3B1XA 1GL7A 2OLEA 3LQQA 3AUTA 3LBNA 5BT9A 3AKZA 2JKVA 2O48X 3W8DA 4LHVA 4Z99A 2R68A 3T6KA 4BTVA 4CM7A 2ZUUA 4PSKA 2QZZA 4PYMA 4NE7A 2IH5A 2ZJ2A 1MC4A 3HU3A 4O0MA 2EKPA 2WVAA 4NTZA 4U8GA 5FR2A 1DC3A 5LSAA 4BMPB 2XCOA 3NJ8A 2I2DA 4Y7DA 5DMXA 1GAQA 4XDGA 1A7JA 2PS1A 2LTAA 5HJEA 5HILA 3TBFA 3USCS 2TMGA 2JFUA 3SF8A 1LQ2A 2I80A 3VKFA 5A3RA 1RZRD 3ZHYA 2CXTA 2JVIA 5DNVA 3RHTA 2IGBA 3M34A 3ZD7A 2E48A 5SYAA 3N2KB 4HWOA 4TRNA 4LISA 3Q3JB 3UGQA 4GOJA 3B1ZA 4HP8A 4CKCB 4K7JA 3GV0A 2R8OA 1TMKA 3L92A 3UKOA 1GVNB 2ONJA 1CZOA 2JLSA 4UMDA 4H3SA 3R8CA 4YT5A 1QVZA 3I6QA 2NZ2A 3WHLA 3DLIA 5B4TA 3A2LA 2WD9A 5JFOA 1ZOIA 3B52X 4Z53A 3RSHA 1F48A 4B35A 1NJ1A 4I5IA 3W8EA 2BDTA 3IPLA 4R7TA 4URWR 5TPZD 5HF8A 1COWA 3BDAA 3H9BA 3JYLA 5E6UA 5DNWA 2CUZA 5C4MA 1RIFA 1XX6A 3BJEA 1MEOA 3OZDA 5C8DA 1I4TD 5KYWA 1WU7A 2RHGB 3QY9A 2Q8QA 3NM6B 3PC2A 4QOEA 1TM5E 2DJ5A 4EO7A 2PUEA 2EQBA 5I4BA 5IBPA 3RYCA 1QGZA 1YQDA 1PN3A 4FDTA 5CLGA 1HF3A 3GRRA 2QBYA 3UK0A 3WBFA 1N75A 3IMGA 1QONA 4LYAA 5K0EA 5JHHB 3OE7D 3C87A 3EODA 3TOSA 3U5ZB 4EY5A 2X2FA 1CS4C 3VR2D 2I62A 4KNWA 1ZGBA 4UAVA 3R5KA 1SUEA 3VSAA 3DFZA 1FXWA 3AHEA 4CE6A 2CVHA 4LY3A 5CYGA 1G3QA 3NPAA 1W76A 5AJXA 3WIUA 1QHFA 4FR0A 3PEVA 1Z8DA 3OZUA 3EC1A 5ENZA 3GVHA 3UTCA 2W6JA 1FCJA 4NE2A 3DHNA 1DDGA 3R9XA 1JR3D 1J70A 1X7HA 1M8GA 5KOJB 3E18A 4OLFA 1GFSA 4Q82A 2P0YA 4H4CA 3G2IA 3A9VA 3C6QA 2QNIA 1J2UA 1FK8A 5AUOB 2VPPA 4FNAA 1RAHA 2VHWA 2M6LA 4FFBB 5AJYA 3PTAA 1AKNA 2OXFA 4QWWA 2ZAGA 4QQNA 2REBA 5FD8A 4DV1B 2V98A 3INRA 1A5TA 1L8XA 5DXJA 4MUJA 2WU3A 4GX0A 1KYWA 4ZEOA 1BWPA 2HV8A 4G0OA 4KE9A 1IWPB 4NAUA 3N6VA 2H2IA 4S05A 4PZ9A 2ZROA 1QX3A 2Q3BA 2ZIVB 4BCBA 2C7RA 1F2TB 4TVOA 4D9NA 3HXKA 3C3EA 4A0SA 3PUWA 4J91A 1Y48E 4RPLA 3RE1A 4R2HA 2NU8B 3S1AB 3W2EA 3GLFE 4O4HF 5FNVF 4Q1BA 2RH9B 3CZCA 3DVQX 4X71A 1K9VF 4G3XA 2PZAA 1A9XA 1T5TA 1YNSA 4IILA 4P6VF 4N48A 1C1XB 2HREA 3FYUA 5K4HA 3CT4A 3JCZA 2C7PA 2O8VA 3NIWA 3CC8A 3DH0A 2IZ6A 3UICA 7ADHA 3DHVA 2WWVD 3ZE9A 4NBSA 3DDNA 5AHWA 3RG2A 5AHXA 3E5RA 3RTBA 4JJ7A 2EZ4A 1KMNA 1XDSA 4HX5A 5FDFA 3MUFA 3P32A 3DBLB 1NATA 1Z18A 2JFFA 3WWYA 3TLGA 2XYRA 1YMVA 2Y9MB 1K08A 4DRXB 1GCGA 5J2UB 4IVNA 3RCBA 1NDUA 1XRPA 1V43A 1U8EA 2OAEA 3A4LA 4JENA 4MVJE 2DECA 5AMXA 1XQ1A 2PMFA 3CUEF 3HACA 3ORSA 4FYHA 4ZEWA 2DQ4A 4EQZA 5LVAA 3HXPA 4GGOA 1NUPA 1YZQA 2OGUA 5DNAA 4L73A 5T4HA 2R7AA 2BD0A 2OQ2A 2QV0A 2V7XA 3PX3A 3GLFA 1E94E 3NEAA 4B46A 2VSNA 4L72A 3DFFA 4EI9A 1N6RA 3MD9A 4RV4A 5AKYA 5I8PA 1I24A 2FK8A 1LY1A 2R6GA 5BQPA 1NHGA 1R5JA 5KTKA 1E79D 2B21A 3SIWA 5E9JA 1A9TA 1N2SA 1QIJA 1V8DA 1QYIA 1WZUA 1XELA 2X3FA 1NR5A 3FPFA 3IB6A 3R75A 1PJBA 2FUCA 4DN6A 1QWSA 1HOXA 8LDHA 4CN8A 1ZN2A 2AKAB 2O2EA 3OOSA 5LUAA 2PEYA 4JAVC 1CR1A 3JQGA 4OSPA 1OBFO 2FZEA 3LIIA 1LU9A 2UZ1B 4IRXA 4U00A 3VO8A 4AX8A 1SGWA 3FROA 4Q4CA 2AZXA 4JBNA 4RLSA 3QXGA 2ZVJA 3OQVA 2B5OA 2Y71A 3DGEC 1Z28A 4GVXA 4N3CA 4UM7A 3VSDA 4MGEA 4QJBA 2QTVA 1VECA 3RQSA 3VPAA 5KPDA 3HMQA 1E6CA 3BEOA 5JT1A 3B6MA 5BSKA 1KO1A 2XMPA 2R6FA 3OM8A 2AB0A 2B8EA 5GIOE 3Q8MA 1CF4A 3C7TA 1AV6A 2ZRHA 1UC8A 3N1UA 4MGIR 4ZT4A 4H3KB 3ZEIA 4GR4A 4ZOLF 4CIYA 3CH6A 3CWZA 1EFPA 3F98A 3LF2A 1Z7WA 5HX7A 3R6GA 2A5LA 2IYXA 4FTWA 3ETEA 4XWAA 1HUQA 1UWLA 4GPTA 1K0UA 3A14A 2GILA 2VFAA 3EFEA 3RRNA 3TAHA 4MGHA 2TYSB 3HKCB 3GQBB 3NHBA 3PQ2A 4AKHA 3HCOA 5DP1A 2Y1EA 1IULA 2EFEB 3V2GA 2Q5EA 4WY5A 1QLHA 4BGUA 5JAZA 5LL6P 1R3DA 2ISCA 2QZ9A 4R1UA 1BTOA 3HHPA 2IK8A 4HWTA 3HCRA 5CHEA 1GNQA 3VKWA 3VJRA 1TJPB 4KQCA 4YQEA 1LNZA 4W63A 3QX7A 2E5FA 3BERA 4FJ0A 2G6BA 2P67A 2C61A 5E2AA 1ZD9A 2FW7A 4C0WA 4JOCA 4W5HA 4JT2A 3G1WA 4YMGA 3TTSA 3SZLA 2J3HA 3ZOKA 1XYYA 2Q5IA 4IXDA 1C30A 1OKKA 3SE0A 2J6CA 1PBTA 3RD5A 2ZYDA 4WXRA 5HE9A 1IZ7A 1TZKA 1X1TA 2GJSA 2ZP1A 1B43A 2OD2A 4MJLA 4OBBA 1KI2A 2JJ2D 1K8XB 5HDQA 1U0JA 1YAJA 3ZNOA 3ICEA 1NYTA 1C3JA 1QOQB 1HFEL 2GLUA 3LQRA 2KX7A 1EVYA 3OD1A 1CJUC 1NJ6A 3AG6A 4FN4A 2G72A 3DS8A 3IP7A 1OXBB 1OF1A 1S7GA 2QLNA 3DNFA 2R84A 3IBGA 5LQUA 4LRSB 3S1SA 4YHHB 3NO4A 3EF1A 2JDID 3NHSA 1PT9A 5AM4A 2AR9A 2IU6A 1ZGCA 4XWYA 2YV2A 4JI6B 1ODTC 5CR9A 5IKPA 5K8IA 3AZQA 3AU8A 2GXAA 3LBYA 1W1IA 1YFJA 2NGRA 2WJ3A 2IIVA 1FL9A 1K3UB 1S96A 5GMOA 4EGQA 4EYQA 5TT1A 5HYVA 1MVNA 4Z49A 3TQCA 4M86A 2ZUEA 2DHCA 1W25A 2GJ4A 1SA0A 4NH0A 3C3DA 1B6GA 3I4LA 1OH5A 3L7LA 2F1HA 2I03A 1INLA 2ZRNA 1UBMS 1SEVA 1H42A 3V4LA 2HMSA 2X42A 4MS4A 1G7SA 1I36A 3ZTWA 3VISA 1F2UB 1HQDA 3W6UA 5HZHA 3KOMA 4RELA 3KKPA 4DCJA 3QUAA 1GCOA 2PT7A 5D6OA 2H4HA 1O57A 1BWQA 3LX4A 1KEKA 1Z4JA 3G8AA 1OX5A 2WVHA 4X44A 4YAEA 3AVYA 1V3TA 1XLTA 3HDQA 4L07A 4XWOA 5B7PA 3OC0A 3QJYA 2GM4A 1EBBA 1SO8A 2AVNA 2VR1A 2ODQA 3KB1A 4L9AA 2BM8A 1CJKC 2REQA 2VJMB 3BMNB 1S8FA 4MUKA 4WNIA 5IVDA 4CM8A 1V1JA 1EQ2A 3O73A 4ZYWA 4PR3A 3UM9A 2ZJ0A 3OLCX 1QAOA 4TMWA 1K7CA 1CJVC 2ACWA 3ME5A 3OKPA 1UEXC 4OHUA 4P2GA 4IJWA 3ECCA 3EUWA 5CVEA 5EESA 2Y0BA 2C3MA 2LIVA 4DRYA 2VT3A 4U2BA 3T3MB 1BU8A 4U2GA 2LR0A 4E21A 3OFKA 2O5VA 3WL7A 1DFGA 4IH4A 3X1ZA 1TU4A 2MSCB 4ZREA 1QHGA 2A3NA 3FGPA 3STTA 3JQ7B 1J7JA 1G6Q1 1T1RA 4O4LB 1QJ4A 4FOPA 3WYCA 5AM1A 5KZMB 4DLKA 1M0TA 3LECA 4YCAA 2Q7OE 1SOAA 1R4ZA 1ZNWA 2H1VA 3HCDA 3VHXA 3BD9A 3KETA 2EKZA 1Q1EA 1UK7A 2FYTA 3LT4A 2BGKA 4HQ0A 4EUSA 5LJLA 1Q0TA 3E9CA 2WWHA 3EXG2 3W5DA 3AWDA 1BAPA 3UWMA 2Z8YA 3DG9A 1L4MA 4HMOA 1HT3A 1UZUA 2J4FA 3NH9A 3MT0A 3VNAA 2F9MA 3M6VA 4UNNA 3T99A 2PSEA 2I2XB 3H1PA 2NUBA 4K87A 4Y2QA 1ULAA 2YC4C 4IXWA 1DQRA 4NZNA 3TZBA 3A1NA 3H1FA 2YWDA 1V16B 1B8PA 2WF9A 1I3KA 4QRDA 4MQ6A 4ADSG 4B82A 2QR5A 1DKRA 2ZBFA 3O38A 4MWTA 4OGGA 2GN8A 4PXAA 1ZOPA 4KLNA 4ZVUA 4JVSB 1Q20A 3E7FA 4O2AA 5CW2A 3VU1A 4DWWA 1QVWA 1WRBA 1MA3A 1SUIA 1LFDB 1MNAA 1L5FA 3QJGA 3WNQA 3S8YA 1FFYA 3WZ2A 2CKDA 5HG0A 3O3CA 1AD2A 1FMCA 1NC1A 1VZ3A 4EFDA 2VH5R 4NOKA 1RXSA 4RSMA 1XWFA 1A3CA 3EZ9A 4MGKR 5EY5B 2JFPA 3UHFA 3UW3A 1VMKA 3D7RA 1PEDA 2GN2A 4RVOA 4PWYA 1C4OA 4QQRA 2UXDB 4XVCA 3P0FA 4GPEA 3JD0A 3NCHA 1KQNA 4GI2A 1FSSA 4Z9AA 1XBTA 3HZOA 4E03A 1WS6A 5HZKA 3S8EA 2E2WA 5CAEA 1BN6A 1U2GA 2ZBVA 3Q4GA 3SNKA 1U8ZA 2WM9B 3ZDFA 4LVCA 1L5QA 4NY1A 2ZWVA 4DLNA 3I61A 5IJ0B 4DLSA 3NV9A 3IVCA 1MUUA 4KVAA 1WY5A 3C70A 1NSYA 5D3MA 3RLFA 1A97A 1XVLA 5AM0A 3FVVA 1D4AA 1JQLB 3FCXA 4R8MA 1WDTA 4K05A 3IHLA 1R66A 4K40A 4ZHQB 1ZXLA 4LFBB 2C2MA 4BLQA 2XHEA 3ACBA 3ONFA 2GEKA 4Q9HA 1D2CA 1GNVA 1LV7A 3HWSA 1AT1A 3M1AA 2YJTD 1TUBA 4I4TB 5TS3A 4G5RA 2DU8A 2MMGA 4L8YA 1IAQA 3L8YA 4DJTA 3JVUA 4CGYA 1ODIA 1B26A 1VPVA 1Z38A 4QXMA 3DUFA 3MIZA 1X92A 2DUUA 2G82A 2VQSA 2VQEB 1OAOC 4CLDA 2H9AA 3EHEA 3E8SA 2P4UA 5ARDA 3GHYA 3D7NA 3TMAA 5FOQA 3IUJA 1GV0A 3I9NA 5A2QA 5HW0A 1E2PA 4CFSA 2WF7A 1LSSA 2Y0DA 3O8LA 3OTQA 1PZHA 3TWOA 1O97C 3QHQA 3BWBA 4BB0A 4BV3A 4YUWA 2XEXA 1OXVA 2ZTMA 1ZC3A 3R3HA 5KMGA 3DMNA 1U2TA 2E21A 3SQMA 3WGOA 4CMKA 2D2FA 3L4JA 1O8BA 4LQCA 3A1DA 2OCGA 1DX9A 4PAWA 1VJ1A 2ZG6A 3N2LA 1Q2XA 3GJXC 4XWTA 4MVJM 4XH9B 2C96A 5JNVA 3SSAA 2BTOA 1PFKA 3HDHA 4YUZA 2EFYA 2ILTA 5EAIA 3P20A 1R12A 2OXEA 4FYIA 2LDXA 3CF4G 1RMTA 3FCYA 1RBYA 1SKAA 4FZVA 1BO6A 3TCKA 4K6CA 4EKNB 4DXDA 2VCEA 5EUBA 3W05A 2FSIA 1XTSA 1U31A 4GPAA 5JG7A 3TSZA 4FS3A 4DHWA 4WERA 5GGXA 1EHIA 2O0JA 2CBZA 3CLUD 1X8XA 1HKUA 1CUXA 3GJ4A 1IL0A 3CW8X 3WQRA 4EENA 4CKXA 4QVIA 4TWBA 3N2KA 2VJOA 4HAOA 4G2TA 4P82A 5JQWA 2XGJA 5SZHB 4Q15A 3U3XA 3PZRA 4G97A 4CKCA 3U9TA 1L3IA 2HSGA 3ECAA 3ETJA 2AQKA 3ADPA 5L3RA 4A4DA 2B8JA 2PYIA 4XEUA 1FLVA 5ERGB 3QLJA 2VP0A 2HAEA 3TO5A 4KQ6A 1S8NA 4FMCB 1L8QA 2UZAA 3FB4A 5CNKA 2Q6OA 5KSOA 4Y2TA 1LVUA 1G8YA 1E1DA 3LMKA 4TKUB 2Y0CA 1IN7A 1JTEA 5ALOA 3WWOA 4E09A 2COUA 2C99A 4FCVA 8ABPA 4QLAA 3GVPA 1TCCA 3BMOA 4UBNA 2IPLA 4Y30A 4G0YA 5COQA 3D5QA 3F8SA 2WUEA 1V96A 2V7PA 3RBZA 4KPYA 2QUKA 3TLXA 3KSMA 5CVUA 1B1CA 1R0ZA 4QQKA 5JLAA 3ZKWB 5A9SA 1T9GS 4UVEA 1DBSA 2F9LA 1O9BA 1SIBE 1NNEA 2M1XA 3UWDA 4CMIB 2AJBA 1YQTA 1LJ8A 3WL5A 4AI6A 5EKTA 3ODGA 4GL4A 3M70A 1E3WB 2H1RA 3LI2A 3UANA 4LNUB 3TR5A 3AZOA 3EN0A 5BW6B 3S68A 3W77A 2ODBA 3E3MA 4I1VA 4PYLA 4RMGA 3VR4A 1O54A 4EEKA 3QV2A 3ZWWA 1U2RA 3SBDA 2DUJA 3L7AA 4IH1A 1KQGA 1E4EA 2GXSA 3K71B 1SNYA 2YZMA 4JUDX 5FA5A 4X0EA 3UBMA 4I1PA 3IT0A 4BFXA 3L1HA 1NFRA 4NIMA 3KG2A 5KOHA 3SMVA 5MFZA 2W8BA 3D7KA 2FN9A 4OBXA 5KOJA 1XZPA 3OQBA 1JVSA 1HDIA 2GA9A 1GLVA 3AINA 3CZAA 1J0BA 2LCIA 3ENZA 3I34X 3IV6A 3PNQA 4CMGA 5JC1A 3LU1A 4TV9B 1EPUA 5C51B 1G5TA 1ZIPA 2B78A 5SYMA 3OAAA 2IU3A 4J0FA 2ZT5A 4I81A 2A7XA 1RM5A 1FUYB 4RULA 5CGQB 3OZFA 3K92A 2B35A 3V34A 1WXFA 1ZHHA 3UAVA 3GO4A 1OBOA 4FT4A 2HU2A 3L0BA 1GZHB 4KO1S 2D1FA 2W2LD 2FQQA 4UVGA 3TI7A 3NYQA 4NMMA 1Y4DE 3CBQA 5A06A 1KEUA 4Q34A 2PBFA 4Q9IA 1JDZA 1F2TA 1WSAA 4ZJYA 1QS0B 1BW9A 1U2PA 2XDQB 3OUTA 4PZLA 4LBZA 4RL4A 3WIOA 5LQKA 3LCCA 2F1OA 4H7HA 3FVWA 5B1HA 4MUBA 4EG0A 2Q4RA 2VAMA 5DSXA 1ZHOA 2PKQP 4JB3A 4TXNA 3SFVA 4ZVVA 3RVSA 2I8LA 3RTEA 4KL8S 3JYOA 3P45A 3HSSA 4LY9A 2UUBB 1DEXA 4QGFA 2C4UA 1C7QA 5B3AA 1PU2A 4GBED 3T1OA 1XMXA 3BMQA 3DJYA 4QC2A 1NYRA 1Z0UA 2ZJOA 4LF6B 2VN8A 2KJQA 1UH5A 1B15A 5C5EA 1L7BA 2AQHA 3NR2A 1DZIA 3VNUA 1FRVA 1DX4A 1FVOA 1K66A 3QBDA 4EHLA 2CXQA 1WNFA 2WK1A 4DJDC 4DRXA 3HGMA 3QUSA 2QRNA 5LOVF 2XGGA 1XZLA 1VJTA 3U7EB 4FYYA 2F8TA 4I8IA 3IAM6 1ZVMA 1E1KA 1EGVB 1E18A 3PSAA 1J8DA 4JELA 4O8CA 2FLWA 4IIFA 3A3PA 1KNXA 3DL4A 2DHEA 4P4SA 1M7BA 1YKSA 5E9AA 1YRYE 2IEBA 3H6GA 1NSFA 1E5XA 3O4IA 2A0WA 5ALPA 4TKZA 1Z88A 5ALZA 2Y0EA 3Q5DA 3O8BA 3WHPA 2ZJ1A 2OV3A 4X1IB 1O3YA 3T4PA 5LKAA 2Q5CA 3P0JA 2A9FA 4BWVA 3MRXA 1JIXA 3KVYA 2D0OB 4M46A 4MW4A 3HJGA 4PHCA 4U3JA 4YJ2B 5F4ZA 2GK3A 1AKTA 4OI1A 5KYYA 4UHJA 2YZ7A 5DX8A 4QUEA 3CIOA 1X9GA 1UL1X 4NRDA 2VJPA 1ISRA 2WU8A