1TCVA

Crystal structure of the purine nucleoside phosphorylase from schistosoma mansoni in complex with non-detergent sulfobetaine 195 and acetate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
285
structure length
271
Chain Sequence
ESVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures for the Potential Drug Target Purine Nucleoside Phosphorylase from Schistosoma mansoni Causal Agent of Schistosomiasis.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords purine-nucleoside phosphorylase
total genus 87
structure length 271
sequence length 285
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2004-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tcvA00
1U1DA 1K3FA 4DABA 4RJ2A 1PBNA 4YMLA 2AI2A 4TXJA 3MB8A 3OZDA 2AI3A 1Z34A 3PHBE 1K9SA 3OOEA 5EFOA 3D1VA 1N3IA 4L5CA 4LDNA 4BMXA 3EUFA 5CYFA 4M3NA 2PGAA 1CG6A 1YRYE 1RXYA 4DA7A 3GB9A 2XRFA 5FAKA 1Z5NA 3EMVA 1TGYA 4ECEA 1Y6RA 3UAYA 5F7JA 1PK9A 1RSZA 4F3KA 1OU4A 1OV6A 1A9SA 1I80A 4D8VA 1YBFA 5K1ZA 5F7OA 2A0XA 1SQ6A 1TCVA 4YNBA 1LVUA 4OJTA 3UAXA 1M73E 3BL6A 3E9ZA 3KVVA 5CCDA 1V2HE 2ON6A 1NC1A 2BSXA 5JPCA 5DK6A 2IQ5A 3LA8A 2I4TA 4DAEA 1RYZA 1OVGA 1PR4A 1Y1TA 1RT9A 4PNPA 3FUCA 5EPUA 4L0MA 1QE5A 3OZEA 4NY1A 3F8WA 4NSNA 1ZL2A 3NM4A 4JP5A 3K8OE 1TD1A 1ODLA 4LNHA 1PR0A 4TXNA 2A8YA 4MCHA 1RFGE 1OTYA 3OCCA 1ODKA 4OGKA 1PR2A 1JE1A 1Q1GA 3QPBA 4L5AA 1Y6QA 1Z39A 1RXUA 1VHJA 3KU4A 4L5YA 4TTAA 3FWPA 1PR1A 1B8OA 1RR6A 2H8GA 3ONVA 3DDOA 4LKRA 4G8JA 2OECA 5C80A 4G41A 4DAOA 5B7PA 4E1VA 1ODIA 3UAVA 1RCTE 3FOWA 5IU6A 4M1EA 1V48A 4TXLA 1RXSA 4F2WA 1ULBA 3LBAA 4OF4A 4R2XA 1Y1RA 4WKOA 2Q7OE 3EEIA 3O4VA 2OC4A 2ISCA 5IFKA 3KVYA 1V45E 3IOMA 4TXMA 4DA0A 2QTTA 4F2PA 4R31A 2OC9A 3SCZA 5B7GA 4LZWA 3U40A 5EUBA 3DJFA 2HSWA 1V3QE 5B7QA 3K8QA 4FFSA 1VMKA 4UC0A 1Z5OA 4YJKA 1T8SA 2QTGA 3OPVA 3OOHA 4EARA 1SJ9A 3KHSA 1TCUA 3OF3A 1PR5A 3DF9A 1LX7A 2B94A 2OXFA 4QARA 2QSUA 1VHWA 4TYMA 1U1FA 4YO8A 4MARA 1Z38A 1RXCA 1TGVA 4D8XA 1JDZA 4KN5A 4MCIA 4EB8A 1Y1QA 4U2KA 4M7WA 3GGSA 1PKEA 5F7XA 1JDVA 4DANA 4DARA 4X24A 4PR3A 2HN9A 4WKBA 2QPLA 1T8WA 1PW7A 5CCEA 4DA6A 3PNSA 1YQQA 3FNQA 4D9HA 3E0QA 4GLFA 5CYGA 3FAZA 1A9OA 1Z5PA 3BJEA 5F76A 3UAWA 1XE3A 1Z37A 4TTJA 4IP0A 1A9RA 1SD2A 3O6VA 1LV8A 1PWYE 3FB1A 3OZCA 4H1TA 2GUWA 5F7ZA 3P0FA 2A0YA 4WKNA 2QDKA 3E9RA 1K27A 1VFNA 1YR3A 2HWUA 3UAZA 5B7NA 4LNAA 3KVRA 4QEZA 1WTAA 4TXHA 1PK7A 5F77A 3INYA 4K6OA 1SD1A 2I8AA 1U1GA 4DA8A 1ECPA 1U1CA 1C3XA 4GKAA 3BSFA 2RJ3A 1JPVA 1PR6A 3TL6A 4TTIA 4JOSA 5I3CA 5F73A 4WKPA 1JDUA 5CXSA 1CB0A 5KB3A 1JE0A 4F3CA 1T8RA 2P4SA 1Z36A 3EUEA 4QFBA 4OEHA 1JDSA 3MMSA 1OTXA 1U1EA 4NS1A 1JYSA 4P54A 4BN0A 4TS9A 3NM6B 3DPSA 1ODJA 2AI1A 3KUKA 3NBQA 3BGSA 4TS3A 4D8YA 4OY3A 5CXQA 3LGSA 4I2VA 4WKCA 1G2OA 3PNPA 4QASA 1V4NA 1FXUA 1ZOSA 2A0WA 4OGLA 4QAQA 3OZBA 3P0EA 3ENZA 1V41E 5ETJA 4F1WA 4D98A 3UT6A 1T8YA 1T0UA 1B8NA 3ODGA 4JWTA 1NW4A 1PF7E 4BMYA 4GLJA 1Z33A 3T94A 3NM5A 5F78A 1NC3A 3DP9A 3C74A 4L6IA 4R2WA 2HRDA 1JDTA 3PHCA 4BMZA 1OUMA 2AC7A 1A9QA 1A69A 1ULAA 3IEXA 1YQUA 1A9TA 1Y1SA 4G89A 4GMHA 1Z35A 4QATA 1JP7A 1A9PA
chains in the Genus database with same CATH superfamily
2A94A 1FSGA 3ONFA 5FUVA 3T7SA 3PFWO 2QJWA 3UCFA 5HGXA 4JOBA 3S2GA 1WZEA 3AOEA 5B4TA 4CHGA 3V1UA 4I5EA 3HRHA 3WAJA 2AG5A 2QRZA 3UJAA 3DXFA 3A9CA 1PJRA 1WZNA 4L9SA 5BUCA 2QL6A 2YKGA 1GZ6A 4Y1FA 1PDWA 3KUCA 2FRDA 2P4HX 4YLEA 13PKA 4B45A 4LECA 4DMFA 1A8HA 3S1LA 3PHBE 3WHPA 2H63A 1XEXA 2Y1XA 1XJWA 3HVIA 5FEUA 2E4WA 3OOEA 1EX9A 1ZA2A 1CQIA 1IN4A 2JEYA 2OM2A 5CFQA 3EWIA 3KLMX 2PL9A 4ZYYA 4X97A 1DCKA 1S6YA 2GM9A 3N58A 4L3WA 2I6TA 4BASA 3EUFA 1KKUA 2FAXA 3G0CA 3QVWA 3ZXIA 4DQLA 1TECE 2HT6A 1AS2A 1R5JA 4UD6A 4MRAA 1P17A 2XPCA 4JNKA 2PSJA 3V9AA 3OI7A 1WO8A 1M1UA 3MF4A 2WHXA 3THYB 1T26A 3AIKA 2FMXA 4URFA 5K45A 3M70A 1JUDA 1NU6A 1DAMA 1RNLA 3D7MA 1Y6ZA 1C7RA 4O4IB 2OMEA 1NJ5A 2BTQA 4DLUA 5EZYB 3AJRA 3IKTA 3C3DA 2BDTA 2G1AA 1JKFA 1WXQA 1DC5A 2Q5QA 4HGZA 1KDPA 2VZ8A 1E61A 1QZTA 2C88A 3HJCA 4U3JB 3TZCA 3RS0A 4URUR 4DXAA 3NW9A 5JLJA 1CERA 1FP4B 1I80A 3UB3A 1RRCA 1AE1A 1EP9A 3IUPA 2CMKA 3B5JA 3CCFA 3GL9A 4CM5A 1MT3A 4CV3A 5IWCA 1PL8A 3CVVA 2XGJA 5BP7A 4X65B 1MIOB 4JLKA 4R40A 2YJGA 3CMMA 3DZGA 4H7DA 5D3MA 4BQPA 4COOA 1K3UB 2FWBA 4KQIA 3KWJA 4OSEA 3KVVA 4E07A 5AQ1A 1IU9A 3MJFA 4RU1A 2QP9X 3RCBA 3WK5A 3AF0A 1EYZA 2X5OA 1Q7GA 3X1YA 2BIFA 3K31A 4IF4A 3GFSA 1OE0A 3FTPA 1L7NA 4FMCB 1CJVC 4Q66C 2IPXA 3A6ZA 5G4LA 3JD4A 1JJ7A 1BS1A 1HGXA 1EK5A 1M34E 1QWOA 4S1WA 4BXOB 4JP3A 2XA1A 3Q0IA 5E7QA 5GZ6A 4EI8A 1R9MA 3UANA 3CLSD 2W11A 3GCWA 1QO7A 2B8TA 4B0PA 2IYPA 2RKOA 2VJCA 1UBTS 1EGVB 2AS0A 2WF8A 5A5VA 1E2UA 2XYRA 4JLBA 1MU0A 4KFUA 2VRBA 3P2OA 5G3YA 3E9CA 2QK4A 5CVJA 1ORWA 5I48A 2BJHA 3TX2A 1U2EA 3VC7A 5FJJA 3CQ9A 4V02A 1CWUA 1FP4A 4ARUA 3JZDA 2PZFA 5FLEX 4OSPA 2KLBA 2OZKA 2X8WA 4P22A 1TD1A 4GBJA 3GLIA 2XWSA 4BC0A 2PUEA 1XZAA 3PVSA 3RVRA 2B4RO 3R0VA 5IEBA 4D56A 4HPWA 4BX8A 4UTRA 4JN6B 1JR3E 1JHYA 1AQ6A 3LY7A 3PHGA 2P2ZA 1GTZA 1TKBA 4OQQA 1OWNA 3TI9A 1A8UA 2XCTB 3JQ7A 1O96B 2FFRA 3T7CA 4RVSA 4F96A 2Q3DA 2JGAA 4IOJA 3WNCA 4L5AA 1M2EA 5EUMA 3JWGA 1PWXA 1TM5E 3H1TA 2V7WA 2RKWA 4L57A 3SZGA 4A8TA 2F2TA 4WEOA 3MC1A 10MHA 2XSZA 3ZZUA 5IXSA 1EPUA 2B99A 4LCBA 1MO4A 4G09A 3BBLA 5E7IA 4FD3A 3JAKA 4UDNA 2YR0A 4DNFA 1PDVA 2PQ6A 3KAJA 1SIUA 3I4LA 5K0EA 4HNQA 4WL0A 2LPMA 3PIRA 1HFWA 4FE4A 3DOHA 4YRPA 3VH4A 4AKSA 4LFCB 1P1BA 1ZA1A 2PT5A 4JJIA 1N6RA 1O6BA 2OWEA 2GN0A 2KLHA 2TMGA 2VCEA 3JWIA 4HRAA 4ZODA 1GCGA 1YASA 2GOYA 3MUOA 3T5CA 4E31A 3BXFA 3FTDA 1ZVKA 5AVWA 1UUFA 4YJFA 1A8IA 3SP1A 2C2WA 1DWUA 2FZ4A 4LZAA 1B16A 1C0IA 1PV2A 3E27A 1QNFA 2Z2IA 2AXEA 5J63A 3J81A 1K63A 1KTIA 4R0NA 4C1NA 2OCPA 1KAGA 2IYVA 2WWIA 4TXLA 5E4JA 4CYMA 2C96A 3P2YA 1H6DA 3MAAC 821PA 3L8FA 1FVFA 4RC9A 1MGPA 4L4XA 3FOAA 3R7SA 4UQOA 4WLOA 2RHGB 4H6VA 4XX1A 4EUFA 1JHQA 4AG6A 1QDUA 3EUWA 5F1YA 4NXNB 2D2XA 1TIBA 2AFIA 1YR7A 1JVSA 1CIVA 1SBQA 1VMIA 4HNHA 1P61B 2PL3A 2R2AA 5ALXA 1QS0B 2VSXA 4QELA 2HRCA 1L4HA 4A8JB 1R0CA 5B3LA 1RHRA 2W2QA 3FGNA 2X6RA 4WKOA 4F4DA 3V5NA 3ECCA 3VHXB 3SKVA 3OA0A 4FT2A 1D6NA 3GFVA 3H5AA 3ROMA 3HSYA 4TKLA 1YCDA 4GXTA 3O74A 1UM9B 2P2LA 4MW0A 5I7SA 3TGPA 5ICCA 1HNXB 3WRXC 4YO7A 4OX9B 2KPOA 3ZJYA 2H2HA 4E88A 3SHWA 4JU8A 1CEYA 3P0JA 1HI9A 4ILKA 2BFFB 1TA4A 2IBMA 4G0XA 5KREA 4WBNF 4MUBA 2QAIA 3LDGA 4YMUA 2BMVA 4FQ8A 1G7RA 4O1IA 4BKPA 5HQ3A 3LMKA 1U8EA 1LS6A 4O2AA 4RD2A 1K08A 1YQ9A 3BMNA 4RD1A 4B3RB 2O2EA 3GAMA 1MX1A 4BKUA 3DVLA 3D6MA 2DKOA 1ZD5A 4DCOA 1HE1C 1V47A 1G3MA 3L0CA 5AOVA 3TZ6A 3ZY3A 1UP4A 1MJNA 4CZ2A 2ZB7A 1A8PA 1RP1A 1ISGA 3N75A 2R1TB 3KFLA 5CDGA 1JFFB 1WHSA 2ZDGA 5I5GA 2VHTA 2EQAA 3SNHA 1ZZGA 4MV1A 3OPVA 3KZVA 1US8A 3SBEA 1JAIA 3CJTA 4AWXA 3L1HA 2BRUA 2AUTA 4FOPA 2UVQA 3FDJA 1HT3A 4RORA 3OSUA 4F7WA 2FR1A 1GPJA 4Y2YA 4YAWA 3MBKA 1ABBA 2I7TA 5MN4A 1FUKA 4BKMA 4RZSA 2QBYA 4UTPA 1NP6A 2XX3A 1LBTA 2AFIE 2QSUA 4GX5A 3P9SA 4LW8A 1J99A 4QU5A 4P4SB 3VHLB 1QU3A 4R8LA 4NMWA 4AO7A 4NFYA 3MLEA 4NU6A 3IHTA 2VPZA 3FIJA 4HQ6A 1KP3A 2GD2A 4I4CA 4J7AA 1GY8A 4H4DA 5K3FA 1KO4A 2OBYA 2C9CA 1DDGA 3GMIA 4IV8A 2VR1A 3LDUA 4HF7A 2I4IA 1GUBA 1HQDA 1KXZA 3SVLA 5IVPA 5F3WB 3G1TA 4NPCA 1WHTA 4YBZA 2IY9A 3IO5A 4N0DA 3WFJA 4GYKA 1HYQA 1NXSA 2DH5A 4JSRA 4CVNA 2ACVA 1XTKA 2PT9A 1KSFX 4HLUC 2YC4C 2HMYB 4NBSA 4NH0A 1HTBA 3TLCA 3R75A 2VCHA 4PQGA 3V4PB 1Y4ZA 4OK3A 1GSAA 1Q0QA 1J09A 5BR7A 5WRFA 1Z15A 3AB7A 1HDZA 5TPWB 2GCEA 2PZMA 4HWRA 2XWJI 4RY9A 4LVUA 1UBKS 4B09A 4N0MA 5FR2A 1TYZA 1N4DA 2W0SA 5FBLB 3DBHA 4R51A 2EAUA 1JB1A 2XTAA 3EBPA 3H4MA 1FP2A 4DMRA 3MMXA 5IHPA 5EXDA 2HJGA 3IBGA 1HKHA 1HDIA 2WU1A 1NF9A 4KV9A 4UUOA 3Q85A 3B12A 1ONNA 1N5IA 1YUNA 2WV9A 4MYTA 4I3HA 1UKBA 2WYOA 4H6WA 2WHRA 3UUGA 2HIAA 4E08A 5JAQA 3SHFA 2IXTA 4P92A 4TKZA 1QSGA 5HRCA 1BROA 2JFNA 3M6UA 1OASA 3ZV3A 4EJSB 3U9SA 2RARA 2K5UA 3DWIA 4B6GA 3ZK7A 2QL9A 1PWYE 2CWWA 1NVTA 1ORHA 2IPNA 1QHGA 4MW1A 4YMWA 1R64A 2O23A 4BY9E 2A57A 4Y3UA 2OZEA 3U1VA 4GD3Q 3PGMA 5D1NA 5L45A 2Z4SA 3BB3A 1Z6GA 3O38A 4OFBA 3TI7A 1UPUA 2PX4A 3BWDD 4ZOLF 2YJNA 3B6MA 5FBWB 4YRTA 3BDVA 1A4XA 1SG0A 1YR3A 1C9KA 2AN5A 3C3AA 2C1XA 4RHEA 1NVDA 4QXQA 3S44A 3TLJA 4TKVA 1I51A 1XD8A 3ZVKA 1PG5A 4HNAA 4IJUA 4IDGA 3INRA 4L02A 4UUPA 4BFYA 4F3YA 3U1BA 4WXEA 1TEZA 3NVAA 3NFRA 3L2OB 1NPDA 3OZSA 4DCGA 5DM60 3GEEA 4CKZA 3ER6A 1OWMA 3LWNA 2H7YA 4YT5A 2HIHA 3I9MA 1WCYA 3JR7A 3N5CA 2CXRA 1MB2A 3ONDA 5AXBA 5A04A 3A1UA 4PLZA 1PGOA 5C3MA 4CCYA 3LWZA 1N5DA 3SJBA 1WD7A 3I5XA 4QQ8A 2JIRA 3HEMA 2P9ZA 4G97A 2JFOA 5JG7A 2QLMA 4TTSA 4XJVA 1ODFA 3O92A 2BMAA 1GZ5A 1O08A 2QUIA 1E99A 1R7RA 2XNHA 3GAAA 2VC2B 1E1YA 4XIFA 3R7AA 2YWJA 2ZSIA 4AZWA 2GJKA 1UPBA 4G81A 3VSDA 3L06A 2X8LA 1FE8A 2QKYA 3BXOA 3JX9A 3R7DA 4H60A 1GV0A 2V5AA 3N3BC 1BCSB 1QJCA 4M1KA 1KJ9A 1TM7E 4UTZA 5FXMA 1OXMA 4BO0A 2CWDA 1QC5A 2JZNA 3P1JA 3FTCA 1WLYA 2JFYA 1F6BA 1JILA 4HDRA 3ZHZA 4J3NA 1Q57A 1O96A 2LP4Y 2NT4A 3LBHA 4B5KA 2GBFA 1QC5B 5TGTA 1R50A 3OZXA 4CMIB 4NV3A 4K6FA 4OIMA 4D9JA 1WVMA 3QLTA 1I33A 5BUQA 1EFVA 3R6TA 3ZHOA 3KSRA 1SU4A 3C8MA 4JUAA 5JASA 4L5JA 4RD0A 2XF2A 5DMHA 5I6DA 4HWKA 1R4MA 2CNBA 1JEQA 1SU7A 2PPVA 1MAUA 3R5FA 4IICA 3IBSA 4NNJA 5COAA 3BN3A 5DZSA 5K0BA 1MV5A 2DE0X 5KQRA 4URYR 4JQCA 1WB9A 2HR1A 4OGWA 4AZVA 1JIKA 1GNQA 3E22B 4LF4B 4WZAE 2X0JA 4PSVA 4ZCIA 2J0QA 3FLBA 3A9RA 1GCUA 1LWOA 2R7LA 3DXZA 4IOMA 1KRWA 1OX4B 1E3LA 4CKYA 1YQXA 3RARA 1YVEI 3EN0A 1ZIYA 3S2YA 4BV9A 1D5CA 3B5IA 1TTHA 4HAWA 3WXBA 3ZXYA 4BU0A 2DHQA 4PTLA 4G1BA 1RHMA 3AMVA 3AHEA 2P2YA 4L9WA 2DR0A 4OHPA 2A0WA 3BE6A 5BQ3A 3R23A 3GDOA 1RBQA 4ITVA 1HDEA 3FKSD 1CRQA 1CFZA 3W04A 1S96A 1C8KA 2HF2A 3MCTA 2OHJA 3CNLA 4FBLA 4B4UA 1QFJA 5LDDC 3ZU2A 1XDSA 2XMRA 3ZDZB 1K5GA 5IAOA 3PJFA 4TWZA 3JVIA 4QBKA 3CLRC 3U7QA 3L79A 2ZU0C 1VYVA 4D3YA 3BPSA 3RTEA 1MAHA 1H2XA 2QGZA 2B78A 1MO2A 5EPEA 4B85A 1ZICA 4M9SA 5BYKA 5HRAA 2RD2A 1LF0A 1ZQ1A 4GRIA 3INTA 4NCHA 2QT9A 3CS3A 1KBQA 2ZIFA 3EVBA 4OA8A 3QENA 4IJQA 4BMDA 4RL6A 4M9QA 4BNDB 1AQNA 4L8GA 4B4OA 4A2PA 2V1UA 3GRFA 3ICQB 1P6XA 3BCHA 1KI9A 1OA1A 3C5CA 5LP6C 5TQ0B 3VGJA 4CEJA 2HHLA 1QAQA 3K4PA 1E0DA 1RKUA 2CLLB 4AKGA 5EIAA 5FBVB 2H1IA 4GNRA 5L6LB 3W9BA 1HRKA 3HA7A 1E9CA 1WJGA 4OSOA 1MAWA 1T2NA 1VKZA 2X3UA 2MYNA 4L8VA 3OZIA 4RDIA 2X0FA 1E94E 1AGNA 1FS4A 4JUDX 3ZWPA 2C3MA 2WMDA 3O21A 5BN3A 2GEDA 2E6KA 2VF7A 1XMVA 1ENZA 4PLCA 2YJZA 5ALYA 1YZKA 1YO6A 4M7PA 1RIFA 1W6UA 5J23A 1ZXXA 2VUUA 1A9TA 5FOQA 1JEEA 1M2KA 4R6XA 3VZCA 1UFRA 3U7QB 1G98A 1GG9A 1KPIA 1NSFA 2JRLA 2W6MA 4JGBA 4TS4A 5J43A 2ODWA 2X4DA 4MROA 4B0OA 4FHEA 3KYJB 5ALFA 1Y3AA 4BFUA 4B7AA 4J90A 2NYAA 2R1ZA 2ZKIA 1AGPA 1Z62A 2JCGA 3B6ZA 1Z56C 4MMYB 3A1DA 1XHFA 4F5DA 2XECA 3IAS6 4BFLA 2BCEA 2R6CA 3VOAA 4BMVA 2QTRA 1QB8A 2H29A 3QNWA 1PBNA 2PR2A 1KEKA 1DV2A 2VH5R 3CBGA 3OE7A 1L5VA 2I6UA 4F9TA 4NDZA 3ZC3A 1QANA 2W2LD 5CA0A 5SV2A 4JKIA 5JSYA 1LQTA 4XOUA 1P1CA 4FN4A 2VF5X 5TMDA 2B8WA 1N7HA 5E3IA 5ALVA 1NY5A 4W7IA 1BGWA 3ETCA 4CL3A 2OCBA 3IQEA 4RANA 4TV8B 3SJ7A 4EEKA 4Z99A 1T5DX 2W2VA 3LHDA 3VYTB 3MT9A 3K0FA 4FS3A 3WK7A 4AJIA 4CM8B 3GZJA 3LLUA 2QL7A 4P3NA 2QR2A 5ALIA 4BNFA 5CDYA 3EGIA 1ENPA 3LKBA 3KTOA 1TK9A 1FFEA 1LPNA 2FG7C 2WVAA 3DZIA 3MCVA 4W5HA 4C2TA 1PR9A 2ZTLA 2PUVA 1ZNWA 4MQUA 2Z83A 1NMQA 4JA0A 1L4MA 3FR7A 5CB6A 5KIAA 2INGX 3DEIA 4K9MA 2HCTA 5JO0A 1FRNA 1KYQA 1NVXQ 2XQVA 1L4YA 5MN5A 2CVQA 2AT1A 3QX3A 1VG8A 2F3RA 2IC5A 3LF1A 4PSCA 1EFUA 3R3SA 1WDMA 3EK2A 4O0LA 3CJQA 5D3ZA 5HA5A 2DT8A 4BEWA 1D2MA 4JY7A 5TDHA 2XQJA 3SHQA 3E35A 3NT5A 4MW4A 5NLLA 3P4UA 5FAKA 1TAUA 4YX9A 5F9FA 2R1VA 1LQUA 1TGYA 3IV9A 5C4IA 2WRZA 3R6DA 3ZEIA 1AX9A 1V1MB 3C8UA 4MINA 2DGDA 4MIEA 2O2JA 2EJTA 5AWFC 1NVVQ 4XEUA 4C22A 4C6HA 4FZ5A 1YR6A 4F3KA 4JSTA 3RU3A 3WMFA 3N8KA 1FYWA 2A9QA 2G7MC 3HCDA 4WXHA 3DDWA 1GP2A 2ZETA 3H2JA 4UBNA 4CDNA 4W5NA 4UDYX 4D92A 2APJA 2X15A 3JCZA 3FETA 1Z26A 4XYEA 4IJ6A 3W5SA 4Z4FA 3RHSA 4LHWA 1SC1A 4JGIA 1HORA 4Y2VA 5EMMA 4D96A 3CZ5A 1JQKA 5JAPA 3O2NA 4AG5A 3B5EA 5AW3A 4QYMA 5LSAA 4JLAA 5KYTA 3V8VA 2BAGA 4LNUA 2R6ZA 1G5PA 2WNHA 1WL8A 1XLVA 4I8DA 5AJWA 1C7FA 3VI4B 4YRJA 3RSFA 1RQ2A 3THWB 2F8SA 1X0VA 2WJYA 3QIVA 4KO3S 1IJBA 3T5TA 3VJRA 4DAEA 4QUAA 3GT4A 5IVDA 2ZI7A 1JSLA 2II6A 2W4MA 1BCRA 1C3VA 3FUCA 4MHTA 3OQIB 2O1WA 2PSDA 1U2GA 4L0MA 3FRIA 1JVNA 1P62B 1U0HC 2B21A 5LUBA 1EB9A 3RTAA 2RGCA 2VPPA 4NZZA 4EA6A 3GLGA 2IF0A 2N47A 4J0CA 3VTFA 1SQSA 1V3UA 3GRZA 4P82A 3G0HA 1ND6A 3NPMA 421PA 2XUKA 1NXTA 2W22A 1ATIA 4WESB 2YHUA 4ZAYA 3WL6A 2FR8C 2NO9A 3W5DA 2ONZA 1MC1A 2VJMA 3LCUA 1T0PA 3IAEA 2RGDA 4RSMA 2GK6A 5AT1A 4BNTA 5B2EA 3U61B 3DNMA 1M2WA 5KAMA 4JR0A 3HZZA 1GNLA 2F43A 3B6JA 1X19A 5K0LA 3WHIA 4Y6LA 3NNDA 2ZBQA 5ERYA 3Q8LA 2QG4A 3TL3A 2DLCX 2JCVA 5KVVA 2Q6IA 3MTBA 1UIRA 2QRUA 3SC6A 4NH4A 1OZFA 2CXUA 3K32A 3EMDA 4QVKA 4PPNA 2P7IA 3NYQA 3D0OA 1SOWA 2QD4A 3A1SA 4CTNA 3LZ6A 1BDIA 1PJCA 3JZFA 3RWOA 1MH1A 3F2IA 1G8PA 3MSXA 1PR2A 1QZUA 1EAMA 4KJZA 4DQUA 4GC9A 1H9CA 3H16A 4NC9A 2D7DA 3RTBA 4BQRA 2AN1A 2FW6A 2R6HA 3MWEB 4KFSA 1PN3A 4WINA 4WHMA 4UNNA 1RXUA 4DLPA 3DT6A 2HYDA 2IWRA 2EHJA 2VAWA 3GV0A 4NOKA 3U7EB 3DZBA 2FMUA 2L82A 5FFFA 3O95A 4FOTA 5KSZA 1B6SA 4G0QA 4FX2A 2I66A 5T8KC 1U9ZA 2A9RA 1VIYA 1H42A 2GBGA 5KOIA 1NWHA 4JVMA 4LJYA 1JA0A 3RU9A 4MVJI 2EG5A 4IS2A 3TSZA 1OR8A 3B51X 5K0NA 1SURA 3IGFA 4KSBA 4XSHA 3L3BA 1D2HA 5FPQA 3QVTA 2VG8A 3ETHA 4GVPA 3RJMA 1QKIA 5LP6B 1DX9A 1CHDA 2OEPA 4EATA 2C2MA 2O8CA 1BJRE 1W36C 1XUOA 3N8HA 4MYDA 2E4YA 2X4GA 1O2DA 1X77A 2PZEA 4NWIA 4XQ9A 2YWBA 1WRBA 4RNDB 5EJ9A 4IDHA 2DH6A 1W5TA 1UMKA 2FCAA 2G82A 4QFDA 5E8RA 1TF2A 5HF8A 4DIEA 4XWWA 3QLUA 1DG3A 1I2MA 1SHZA 3ZDXB 3L8GA 4QGBA 3TCXB 2HA0A 2XY4A 1IJKA 1EGMB 1I0IA 1T3LA 1WDWB 2ZYDA 3BD9A 3O2JA 4JB0A 2O4CA 3EXEB 5THQA 2B8NA 2G6TA 2G36A 1UJBA 2DPYA 1QXSA 1OAKA 4GFDA 2UYHA 2Q29A 5KNDD 1GAXA 2PMWB 4KDEA 3DV0B 3M6MD 3NGXA 4U5QA 3WLRA 5FYDA 3HCAA 2YXLA 3U9TA 3GW8A 4BB6A 3ZW8A 4ABYA 3GIDA 4XRGA 3ZY4A 4GGPA 1F2UA 1R18A 1WD5A 2XE4A 3P7MA 4HO1X 1J2JA 3GLQA 1SUBA 2YW9A 5E0KB 4N39A 5EZYF 5A9TA 4MKHA 3N2IA 5FUXA 3WLQA 4O4HA 1ZCJA 3IQZA 4LE1A 7YASA 1U9CA 5CMLA 1XQXA 2GZAA 3Q9SA 2PUWA 1SXQA 3M6IA 4KIUA 5IUKC 2VQDA 3A1FA 3RRFA 1J7KA 3L0SA 2AW5A 2KMLA 5TQ2A 3VFDA 3U4QB 2EERA 3CG0A 3UH0A 5TS2A 2JJQA 2OXCA 2HQOA 4F7DA 4BX3A 3L46A 5IM4A 2Q3FA 3OFSA 4PG4A 3STUA 2EX0A 2KI5A 3I9FA 1C1DA 4KXFB 4UAJA 5ARDA 3K9FC 1S8AA 2VUHB 1G17A 2V3VA 4GICA 3PPIA 2B37A 3IOYA 5D01A 5BYAA 1L5ZA 2G28A 4LS3A 4ND4A 2UZ3A 5TX7A 1YIOA 2OYRA 1ZZEA 1T3SA 2VHYA 3CF0A 3GRPA 3ND5A 3MOGA 1VPVA 5AK3A 1SM4A 3VBCA 3O82A 2VN8A 3I23A 5FLKA 4XIGS 1GL7A 1TCUA 3DV0A 4MWBA 5FRDA 5K0GA 3UHOA 4JP8A 4W9NA 4DV6B 2DQZA 2BTEA 3KSZO 1GEEA 3A7DA 3KXDA 2IYTA 2DBZA 2POQX 3F6EX 3HB7A 3NHJA 1TA9A 4LXXA 9ATCA 1S2GA 4Q16A 4PVDA 4JVNA 3QTBA 4OL9A 2NG1A 3EXG2 4AIIA 4V0KA 2QXUA 2R97A 1H69A 2PEYA 3E03A 2JD1A 4FFBB 4KFCA 5JFGA 5KYYA 5A7GA 4N7JA 1U2ZA 3OAAD 5G4KB 3KEGA 1FZTA 1NQAO 1AK9A 1Q20A 3NHMA 3OCJA 4PYMA 1ZD4A 5ECYA 3KZXA 1F2VA 5I4CA 1H6BA 1BD3A 3MG9A 3GLFB 3HSKA 4G4IA 4R84A 3C41J 3PXUA 3FNFA 1XKLA 3K6SA 4HATA 1KQ3A 2NOAA 1V7QA 3LF2A 5BV1A 3NHWA 3OQPA 2IUYA 2OCYC 3IHWA 4BVEA 3JQBA 4IAOA 3CUUA 3O2SB 3R7LA 2GM5A 4YCBA 1QIMA 3TZQA 4TMXA 1GTVA 1CE8B 4DOMA 3EEOA 2AE2A 1VE1A 2TMDA 4MQ6A 3BMCB 2OORA 3NOQA 3TX6A 2Z2ZA 3NANA 2TMYA 5FQOA 4YMGA 1CUUA 3DKVA 1NN1A 2YS6A 4DA6A 1PVVA 3KJQA 4N54A 4QUHA 1U2RA 1XMIA 3WJ1A 5DB4A 5FWNA 4KVZA 3WLOA 4JXXA 2A5FA 1W5EA 3BSSA 4E13A 2BEVA 4L5IA 4NCIA 2FZVA 2PU7A 3EGEA 1U5CA 1W44A 1UM9A 4P35A 3R7BA 4QBGB 5D6OA 3HPRA 2HF9A 3EXAA 3FCXA 1DLJA 1IOVA 4JP2A 3LPCA 1BVUA 4CTMA 3C3PA 3F71A 2IEIA 2BI8A 2ECPA 3G5TA 5A3QA 2ICAA 3B7GA 1ZRNA 4RFLA 3GC6A 1NOJA 2F3UA 1LLCA 1S3SA 2XDYA 2P2NA 4KH0A 2QN8A 4GWKA 3HR7A 4J1NA 4OHMA 4ENVA 3GZTB 1MFPA 4WBXC 4C21A 2VRCD 3NHUA 2BFFA 2QW0X 2GEKA 3VV2A 1JA9A 2G4LA 3JYQA 1FJHA 4FSXA 2WHQA 4BVKA 3A9TA 3ER9A 3IXQA 5E3HA 3G17A 5IKMA 3CNNA 3OZWA 4V0ME 1LUAA 3M4JA 4OXNA 4WCFA 2VQEB 4DSUA 2C0QA 3B9PA 1NNI1 1PK7A 1PT8A 2XUGA 3K0FB 1AK1A 3SZMA 4DIFA 2A33A 1FS6A 2GFIA 4DM7A 5AFSA 1GUYA 3W2IA 1SD1A 4TLLB 2Q4DA 5JE8A 2R8EA 1TF7A 2G6BA 3LT5A 1DKNA 3RVOA 3VKGA 4O4LA 5DSXA 1G3QA 3REOA 1A7UA 1PLKA 3OLWA 4ALIA 2VRNA 2XXJA 2DY0A 4HFRA 4F5YA 2P9QA 3JASA 4X61A 2YV3A 5C18A 2IZ5A 5GGXA 2D0IA 4UVGA 1DEHA 1HTTA 2MJLA 5DHFA 3KQKA 4FNMA 1YKSA 1EUCB 4RDCA 3V8PA 3VR3D 5FPTA 3UTDA 4ACAA 4QREA 4YJ2B 2XMQA 4A5OA 3B48A 2BW0A 2OOSA 3A31A 4IIVA 5KQPA 3MS7A 2VP3A 4Q15A 4BE9A 5AVJA 5KSWB 4UPEA 2D3TA 3R20A 2WD9A 3N05A 2VT7A 3OZGA 1W35A 1QFSA 3NZEA 1P80A 3MOSA 3QHAA 5T4BA 5CX1B 2W6ZA 1Z8FA 5FQNA 4FK8A 4WVFA 2R1UA 5J4HA 3I9KA 3GNSA 3F3MA 4JJKA 3AXTA 4A15A 2FTKE 5L7WA 3EOZA 1KYVA 1CZHA 1A72A 1V25A 4G4SO 3I62A 2AF3C 1TO6A 5TB5A 3LPLA 4MUGA 4RMJA 1R37A 3T38A 1NR5A 2J6BA 3WLSA 1WOMA 3MOIA 1TYDE 3FAKA 4GZ3A 1ODSA 4R1MA 3U26A 3HYNA 3IDZA 2BGLA 3DPSA 2QRGA 4G8BA 9LDBA 3DEKA 1J00A 2VO1A 4ZARA 1AUXA 2J3MA 5CVCA 4C07A 2RGGA 1O87A 2FX5A 2I99A 3EQZA 3P19A 3UGKA 4CM6A 3VC2A 2HK6A 1Q3HA 4C89A 4B3MB 2A78A 3K5WA 4R3NA 3RUDA 3FNEA 5IVIA 2HCRA 3PLNA 3L7NA 4O2BA 4DIMA 1VJTA 2H5JA 5FH9A 2O59A 2ZAIA 1SWWA 1UWVA 3AUKA 3I6QA 4R69A 1QAOA 2R48A 4MSUA 4PPQA 1Q22A 1O57A 3GJ7A 4JIMA 3O8NA 3TLEA 1XEWX 3ZDRA 5KTOA 1SUWA 3FPFA 4CETA 4TL8A 4F04A 3L43A 3MT8A 2V7QD 4NENB 5EE5B 4IIUA 4N4AA 1N7JA 3T7AA 2GKGA 2Y4OA 3F49S 4D98A 1KAMA 1O89A 1MIHA 4PZYA 2CE7A 1AZSC 4ETMA 4OBBA 4IHJB 1JVBA 2COUA 4IIJF 4EVIA 1AO3A 1PFKA 2WTBA 5GADl 5C31A 4E4YA 5AUPB 3VR1A 7REQA 4HX9A 2WY2D 1YDWA 1ZYUA 4S0XA 3QEMB 4O8CA 4X6UA 5EXXA 3SX2A 4EQ6A 4EKEA 3SDBA 1ZJ4A 1XMXA 3UV6A 4UTNA 5JQGB 3D6HA 1FY2A 2EP7A 1UBRS 2YWCA 4Q9LA 1MVNA 3I37X 1QBKC 5LP1A 2FYTA 2VPTA 2FUEA 1XSEA 1E3EA 1WCXA 2PBRA 2PX3A 3ORQA 3P0RA 3BX1A 5FORA 3SVZA 3RRBA 4AMZA 4PLVA 1FXWA 2OKGA 2ZI5A 3SLGA 1EVQA 3EZNA 3MGBA 4AO8A 4OHWA 4L5BA 5H70A 2QD3A 1RLOA 3ND6A 3MRTA 3QVXA 1WUTA 3BJRA 1BN6A 4BX0A 2E5LB 4CEHA 2AR7A 1OX5A 3SF8A 4XGIA 1UANA 2VA9A 3H83A 3IT3A 4EY7A 5LOVF 5KPJA 1WMFA 4YRIA 3BIFA 4ZVSA 4EFLA 4HDRB 2ZE6A 4RZ2A 1P81A 3CPHA 4PANA 4Q02A 3Q2KA 1VSTA 3P9NA 221PA 2Z5VA 4PYKA 3N59A 5LYJA 2FPSA 5ALOA 4ODIA 2NO1A 3T7IA 4JLDA 4U2DA 2XCSB 1TQ8A 2H1CA 4J0QA 1EK0A 4N3NA 3O73A 1ZD8A 3NTRA 3BK7A 4LRSB 4Y9DA 5FA5A 3RAGA 1RM4A 3TLAA 5IUJC 5K8TA 2C5BA 2EJVA 3T6KA 5B5SA 2RB4A 1JX6A 7AT1A 5IFLA 1L9XA 4EPXA 2P6UA 3L0YA 4D02A 2IUEA 4Z3OA 4ND6A 1OX4A 4Y2SA 5JEDA 2ZW9A 1HEUA 2WYIA 4JC5A 5G53C 4ZEOA 5DSZA 4RYDA 4FN5A 1CJTC 4RKRA 1FYFA 1OAAA 2CLIB 2EKZA 4BRSA 5A4KA 4PG8A 1HT2E 5KOJA 1EGHA 3T9CA 1LDYA 2QVGA 3SEZA 3B70A 5KYNA 3EPHA 5ITWA 3F6YA 1J0XO 2LTAA 2AHRA 5J2TB 3WZMA 1E66A 3AIMA 2WTEA 2C20A 3N2GA 4TROA 2K7ZA 3C5HA 1CVRA 1H8HA 2RGRA 1OBFO 4PLHA 2O8BB 3K35A 1USGA 1CUGA 4KXLA 5ED0A 4ARSA 3G13A 3A4LA 1E3WA 1T1IA 1KU6A 2PGAA 3P5SA 4FEYA 3RFTA 2R8ZA 1ZXLA 2OAGA 2Q5EA 3L8HA 4DC1A 4EUHA 3ERCA 1V6AA 2PKQO 3IUYA 2XRFA 4A92A 3RADC 3OMLA 4JX9A 4DNXA 3RK4A 2O2ZA 4W9NC 4YPFA 1PL7A 5DBEX 4EF4A 1II0A 2EFEB 3QWHA 1U11A 2H1LA 4EO4A 2XXAB 3UGTA 2IP2A 5K8LA 3KEOA 4XR4A 3UAYA 5CH5A 3PHHA 2BFDA 1GGKA 2HFKA 3HFSA 5AJZA 4BCBA 2Z6UA 4CLOA 5KQSA 1ULTA 5H7XA 4DBLC 4I9UA 1N75A 3E7PA 4HQNA 1G0NA 5G0VA 4HQ0A 3I4CA 5CH3A 1BJTA 3BXHA 1NX9A 2W4QA 1X94A 2ATIA 3ZTTA 4C0KA 3REQB 3PE3A 1UZNA 1UOQA 2H6EA 4NOMA 1DAHA 3HY3A 4NCNA 2A1IA 1IUKA 2IZ1A 3RRNA 4H16A 3CISA 4CKBA 4E5YA 4R1TA 5DYNA 1CJUC 4RTSA 1TQ2A 3GA0A 5H80A 4DQVA 3MT7A 2PUAA 2AWOA 1UZAA 4EDHA 1E4OA 1ITZA 3FMPB 2BGIA 3M1YA 2W37A 4QOIA 4RGVA 3ID6C 3WL7A 1SG6A 4X8HA 1W2WB 1Z2DA 2VJQA 3KEMA 5CP8A 3T0IA 4BNMA 3FOCA 3DLBA 2Y0BA 1ONBA 2B61A 1GNPA 2WC1A 4HYQA 5LQJA 1FP6A 4JOCA 4XOIA 3TQTA 3QQPA 3LA8A 2WVJA 1L7MA 2ZCUA 3R6GA 4PLTA 1H1LB 1EK1A 1JLKA 1GU7A 1L7RA 2I4TA 3KKMA 4WXRA 3V4OA 4I5GA 1W94A 2B3DA 1L4EA 1GGEA 1L5QA 3RIXA 1FJXA 4EB6A 5KYXA 3L4EA 3A3OA 3AZPA 4IDAA 1KZYC 1Q0HA 5ARCA 3B3QA 4DCUA 3AW9A 4LSGA 4FVTA 2NPFA 1PS8A 3ENVA 2UXBB 1ELOA 4WDQA 3RKUA 1WPQA 2BI4A 3CNBA 3EODA 4HEHA 2QRVB 2CNLA 4MCAA 4MUYA 1YJCA 3C6MA 4S1OA 2YFKA 1ZH4A 2CL5A 3MGCA 2H1VA 3LH5A 2GM4A 3AFHA 3ND9A 1YT5A 1XF9A 4MR7A 1URPA 2PQMA 2XYPA 3NI2A 3W6ZA 1SQ5A 4CT5A 2GEJA 3WIOA 5ADWA 3VU8A 1MABB 2J1LA 1R9GA 1FFCA 3F5MA 3QE3A 4R41A 3RV3A 2ZVDA 2P77A 4ND5A 4RF2A 3UJ8A 2C4HA 2VTBB 5EFZA 1JU3A 3LC2O 3ZU4A 3V3TA 1C8BA 1LI5A 1WXGA 1SVKA 3L7OA 3F90A 4CDGA 3BCUA 1JDJA 3DM9B 3A3KA 3BBPA 3VDNB 1ODKA 1S01A 4MGYR 4Q7QA 2R7MA 4INJA 5E0OA 5FL7D 2IPLA 1NW9B 4P98A 3THSA 4HDSA 2FRDC 2NO5A 1OFTA 2ZIXA 5E6SB 5TS3A 2OVFA 1DKPA 2SKCA 4I2NA 1ZCAA 1JG1A 2DQYA 4GPZA 2MSWA 2EX4A 1CY1A 1T5LA 4KR7A 1NRWA 4XGRA 5LKAA 3MGGA 1YB6A 2CFSA 1B74A 2YUTA 1OZHA 2PKYX 1YXMA 2DP4E 3K6JA 4EA8A 1W75A 3QKSB 4OA5A 4LTDA 2RGBA 5A0VA 2X1LA 1IN7A 1EDBA 1GXSB 1PJAA 3PTZA 4WQMA 3RIGA 4E12A 1TVKA 1EI9A 4KDRA 4EJSC 2BKEA 5ITZA 1CXZA 4K7JA 1DKOA 1L4UA 1TD9A 3HUTA 4FW8A 5LC1A 4G8JA 3IT1A 2OECA 3FCYA 3IUBA 3AR8A 2HCFA 1LQ2A 2PQ2A 3PDHA 4MYSA 4LX0A 4QDZA 5EN4A 3UOGA 5I8PA 2FDCA 4ZV7A 4IFTA 4OCZA 1GA6A 4DAOA 3EB9A 1UJ2A 2O48X 2WJ3A 4Q9KA 3VR5A 5EXTA 3IAXA 3JR3A 5AI0A 2PZJA 2OGUA 3O7MA 1YA8A 3WADA 2QRPA 3FWZA 2R6R1 4X20A 1YU9A 4WFKA 2R8OA 4D8TA 1GAQA 4ARIA 1EX7A 2Z43A 3GJ3A 4DLVA 4ZXPA 1BKDR 2ECKA 1ULBA 2JVIA 2XLCA 5TMPA 1MQSA 1IB0A 2DU8A 3AU9A 2IYFA 5SZKB 2RK6A 3MXTA 3O91A 4ND8A 4DQ0A 1JBEA 4GE3A 3HSSA 2JZOA 2R5WA 3FHLA 3PJDA 3MJDA 3KPVA 2GILA 3HL4A 1IHXA 2Q7OE 3SJCA 3H9BA 1R3UA 3FZQA 2XSZD 3OH8A 4CLEA 4KMSA 1U99A 4I08A 3FF1A 1S2NA 3VXKA 1E8NA 1R8XA 1KVSA 3ZVRA 4BQFA 2PMDA 4HGYA 3IOMA 2G0NA 1TK3A 4NABA 1HR0B 1N8NA 5KVAA 4KG7A 4Z4IA 4N6GA 2AFVA 2X1VA 2O20A 3LUPA 4B8WA 1ISMA 2QQEA 2Q41A 1ZITA 4UQLA 1JFFA 4FW9A 4LYAA 4OTZA 3T1YB 4IIDA 1NGSA 2WD7B 3F4BA 2GCPA 1AKMA 3AKEA 1ST2A 3L01A 4JV5B 3A26A 4LJLA 4O63O 4WA7A 1KJYA 3JSAA 3Q1KA 3DWEX 1AZWA 1PZMA 2B3TA 1UFKA 5A5EA 3A2KA 5KOHB 3QVLA 3W05A 3OHPA 4GSKA 4EITA 4R9UC 5EJ7A 1C8LA 4PW0A 4G0UA 2F4NA 4HYEA 4MOWA 5CM2Z 1FNMA 2PWBA 3O1IC 4ZP1A 5GINE 3HJBA 3JQ8B 2ACEA 4BQOA 4JA2A 3WLPA 4FLMA 5H5JA 5CEEA 8OHMA 1KQPA 1OLSA 2ZPTX 4DEXA 1OIXA 4GP6A 1T2VA 2BFBA 4KLNA 4RMGA 4Z7JA 1OKKD 4K6MA 3GUUA 3L77A 3U4MA 3VPHA 1YJ5A 2QB5A 4MYRA 4WOJA 4N6OA 5AVZA 3WYCA 3AT1A 4HUTA 2VP0A 3PGA1 1KDRA 4OH1A 3NG1A 1ZK4A 4MULA 1M1YB 1M0WA 2HBYA 1IHYA 2QQ5A 1QPBA 3QUSA 1U0TA 4WZZA 2B5VA 4BO2A 2A5GA 4JR1A 4PC1A 3MRSA 3I76A 4DLNA 1DSSG 1XVAA 4X3PA 5IMSA 1NPYA 2J3HA 2ZUEA 4EIWA 3QX7A 2SHKA 3QVKA 4CM9D 1XTQA 1DJMA 2R84A 3ZHQA 1Z38A 2ID7A 4NCAA 1K4YA 2VAXA 3AUSA 2QUZA 2HZ7A 3HUEA 3QYPA 1Y8ZA 3F6BX 4O4JA 1IXKA 1CP3A 1B6TA 1ZH2A 2H11A 3LXUX 3KZCA 1ZNZA 1E58A 3TXXA 4B2PA 4LV5B 1L7VC 3OEHD 4E30A 3DAFA 2ERXA 1FYEA 1Y1QA 3WGQA 3KQPA 4U2KA 1K7FB 4F6RA 4ENRA 4QJIA 3C4QA 1H4SA 3MS2A 1JHAA 4C3OB 2HDHA 4P81A 1B1CA 2RJNA 3F1LA 3O7WA 4AJLA 4CM7A 2V3CC 4YAGA 4LDAA 4PR3A 5K8CA 5B3AA 3GGGA 4WVLA 4KN8A 2F00A 3LBNA 2ZWVA 1RWMA 5DNEA 5DOVA 2AOVA 2FVXA 2ZB8A 3OEHA 1XTVA 3U48A 2H08A 2OD7A 1KVQA 5EJGA 1EUQA 2BH2A 3N2NA 3NV7A 1DC6A 1MXFA 3A1NA 3NRJA 2XE6A 1X8LA 3PNMA 2CVOA 2GEFA 3RC9A 4XWKA 4F38A 2DY1A 4Y8VA 1Z37A 4OYYA 4BNDA 3IDAA 2OQVA 5AM1A 2ZT7A 1SD2A 1XKTA 1E7WA 2Q0XA 1Q91A 2VUTA 1XVIA 3LX8A 1KEPA 4KRYA 4S1PA 1M54A 5BSHA 2W7TA 3Q4GA 4EYOA 1Q44A 1TJ4A 2C04A 3B85A 4OLBA 2D54A 4M86A 3ZJ5A 5I7UA 1YI1A 3ZGOA 1ZD2P 3KPJA 4BLRA 1FBTA 1GZSA 2NTVA 2WU3A 1NAIA 1Q1AA 3OE4A 5CLQA 5CAEA 2DUMA 3PUYA 4D97A 3R3ZA 2VJKA 3LDHA 2Z95A 4MEAA 3NYIA 1K27A 1VFNA 5ALPA 3PEYA 1ZU4A 2ZJ4A 1Q0TA 1MGOA 1K2VN 1NTRA 1SEVA 1XA0A 2JF0A 2EC5A 1M2JA 2P67A 4FJ0A 2X9VA 5LL6P 1FLDA 1ZUHA 5IAJA 5CB4B 2E4AA 3MD9A 1GGVA 1XRQA 2QXTA 4HG2A 2XT0A 3SBXA 3TQIA 4ATNA 3F67A 1TM1E 1E1RA 5J4KA 1N8TA 5TRTA 2CC2A 3OG9A 4HXYA 4OHCA 3UEOA 1IC6A 4EW1A 4AKTA 4EYQA 5EHZA 3B52X 3OQNA 1Q83A 4K81B 1RPZA 4OHRA 3OQ1A 2EP5A 2D5IA 4MB0A 1WB6A 1V8OA 1OYYA 2VP5A 4DA8A 3HZRA 2OAQ1 4RTNA 3ECSA 4OB8A 1XU7A 3EIOA 2P9EA 4BVJA 1VFPA 1OHHD 2QS9A 3D6UA 4S1TA 2EW1A 2DPLA 4OUKX 2O7RA 2ZRFA 5JAHA 1MJ5A 2XOKA 3WK9A 3HXOA 4BXOA 5F2NA 2WJPA 5IYZF 4J8PA 3C3CA 1TPYA 3MRVA 4AY5A 4I9HA 2GPAA 2BN4A 4JBNA 1MLDA 4LOIA 5KB3A 4GOXA 5D6NA 1H93A 5LU8A 4HYYA 3D31A 4XYGA 2XTNA 3D2BA 3NKLA 4K26A 3N9IA 4UJ3A 3KOXA 2GJ8A 4C4AA 1M3SA 2PZAA 4KVGA 5SZJA 1TAQA 1G20B 5T67A 2DBQA 3K70C 4QFBA 3N8GA 1UOOA 4S05A 3SI7A 4C0HA 3IPLA 2OHIA 3NUZA 3PWKA 5LLSA 3ZE7A 1OTXA 3O8BA 2WNIA 1XU9A 2PRYA 1EWRA 3LT2A 4AF7A 1Y98A 3B7PA 5JH7A 1CUHA 4LCEA 4LBYA 3PTLA 1QQ5A 2CZGA 3EZLA 1X0XA 3OFND 3B8EA 3EHDA 4MKIA 4PINA 3U3ZA 5LQCA 4QQFA 4G0VA 2PK3A 2C4NA 3NM6B 1ABFA 3GLHE 3V1YA 2WWFA 3HXLA 4U7PB 4Y6GB 4D5EA 1C4OA 4FIZA 4Y6RA 1LC3A 2QRQA 4DCNA 4IDNA 4TZ0A 4DT1B 4J3JA 4R9VA 1ZGZA 5BSKA 4PZ9A 1T4CB 3U13A 1HQYE 2AQ8A 2ID4A 4PIPA 3C45A 3QOXA 5HILA 5KHAA 1AGXA 1U28C 3VZRA 1CQJA 3K9QO 1U81A 5JS8A 4CI0B 2HUNA 1Y7TA 1G2OA 3JZIA 2QMOA 1DPFA 1Y9AA 3DYVA 5FOUA 1ZOSA 1MB0A 4CI9A 1H2WA 4F91B 3H86A 4YV7A 1IZ8A 2Q8PA 1DBVO 2BEKA 3I2GA 4QPNA 4D9GA 2AZXA 4HVTA 3ONWA 4XYBA 3WAGA 2QI9C 1L8XA 5LWHA 4NQZA 1XZJA 1TVEA 3G2LA 1KFBB 3PPWA 3A9SA 2ORIA 4GXRA 5JD6A 3IE1A 4G0YA 1C0KA 2VDPB 3PKZA 4YPVA 2ZSEA 2E85A 2BCGY 1GU0A 1Y8QA 3H8WA 2E18A 4M4SA 1ZH0A 3NLLA 5ELXA 2QUBA 4O4JF 4XB2A 2G83A 2DPXA 2C5SA 2G9QA 1Z33A 4ENPA 2AEJA 3AW8A 2QP3A 4J16A 2EKPA 1EP3B 2FX2A 3GLRA 2DFDA 4GO1A 1QHIA 3M81A 3Q6NA 4G24A 4Q5IA 4XD2A 2XNDA 2BI7A 4NV1A 2G04A 3QKWA 1OKKA 1NKVA 3M1LA 1S9DA 2PH7A 1GN8A 4YRDA 4YCMA 2XUAA 3QQ5A 5LVAA 2ZITA 3QY9A 4QFMA 5DTMA 1T24A 1IRIA 2HLPA 4DJTA 2B9VA 1RI5A 1XZHA 1U02A 2ERCA 4GLLA 5F4ZA 3JQDA 1AU9A 1C41A 4JBLA 1FDTA 4ZK6A 4HNUA 3K3PA 1UBSB 5AH0A 3EASA 2D59A 1CF2O 1P9NA 3NJ8A 1C2YA 4PM4A 3RUAA 3X1KA 4D0SA 3I42A 1XCMA 1Z4MA 3TZLA 3V55A 4AJNA 3WA7A 2H7XA 4H7PA 2GJSA 5H83A 4FCVA 4MQ4A 1LKZA 4EG8A 1JP7A 1PJSA 3CSDA 5JNVA 5K3FB 4TYQA 4C0AC 3S3TA 5C52B 1BA3A 5LIPA 4DXDA 3W4JA 3FVTA 3GOHA 1DIBA 5J1SB 3WRXA 3K71B 1C80A 4O6VA 4EG4A 5GVSA 3B38A 3GARA 1DO8A 2WIAA 1SG9A 1FNNA 2QQFA 1GYRA 1C1XB 1CD5A 1Q2XA 2AI3A 3KKNA 3OZDA 2DF8A 1E7YA 1R5OA 2JL1A 3PVZA 2QW8A 3SFZA 4E14A 5JRZA 3KDSE 1JAHA 3VOTA 5C5IA 5A6SA 5ITSA 2I2BA 5KO2A 4FNAA 2MSCB 4JZKA 5IDXA 3OM0A 1YMQA 4C2UA 1G8HA 5CNIA 1CB7A 2H0AA 1RZUA 2Z6AA 1V9LA 1P9LA 5KVSA 2VNJA 3RUPA 3DG9A 4RA6B 2X5KO 2I7VA 1ZRSA 4URHA 2DPMA 3KB6A 1NBHA 4LOHA 4WN9B 3TAHA 1S5PA 4H7FA 3C5EA 4X1IB 2C4KA 3AUXA 1O5TA 2V6JA 5FO1A 4PFSA 1YVDA 4X92A 2GERA 4U8HA 3D2AA 3SPXA 2WIBA 1DX4A 1XZFA 4J7XA 4N47A 4KGZA 1EKXA 4XIYA 3F98A 1E2LA 1QGDA 2FE1A 3ELUA 4B79A 3TTTA 1KNQA 1ZGBA 1ORTA 2X1HA 3BE8A 2V0NA 4X54A 2WJHA 3X44A 3NBXX 3DGFC 4DA7A 3GB9A 3OTIA 1JR3A 1Q1QA 4LF9B 2BZSA 2QN9A 2UZ1A 2YASA 5CURA 1XDBA 3MNFA 2QXYA 2ZR9A 1Z5NA 4AZTA 1WUIS 4I9GA 2ZI6A 1ZR2A 1ZL0A 1GHTA 1Y34E 2H17A 4Q39A 1Q12A 4F12A 4YQFA 1VZ2A 3FOZA 3ES9A 1VLLA 1NBOA 4XCVA 4ZRNA 3R74A 3W3AD 2QN7A 5M2QA 3H99A 4M7OA 2IOFA 3EF0A 1IN6A 1A9SA 1DS6A 2I2CA 4ARBA 4PC3A 4H3VA 3DZ8A 4G65A 3F47A 1YB5A 1FNCA 3BCRA 4C7BA 1ZKDA 1ZMTA 2RBGA 3ETLA 5PNTA 3ZIUA 2P30A 3PD1A 4X6XA 4QHSA 3F7OA 4CEHB 3CEMA 3KSMA 2ZVJA 4I19A 3M5DA 3HY4A 4B35A 3U19A 4J4TA 4U7GA 3Q98A 2BGUA 1THMA 4QQNA 2P6RA 2QLBA 3H9GA 3V33A 4N48A 2CMHA 2NQ2C 2AJLI 1XVLA 2YCLA 3IJEB 3IQGX 1NQUA 2ODPA 4PSKA 2BGWA 1GGMA 2PL1A 2QGFA 4HXGA 3RKSA 3MUNA 1KORA 1RYZA 2EW2A 2BEUA 2VJMB 5AVSA 3ET4A 1G5FA 2F9LA 1GEGA 4JQYA 1CNEA 1YRWA 4NIMA 2OV6A 3B1KA 1MUUA 4EG1A 4H7KA 3NONA 1I3NA 3AF2A 4KQGA 4Q7EA 3WSVA 4A0QA 4AS3A 1EJ2A 3RIMA 1E2JA 1RQNA 5IHXA 1T3GA 3BSWA 5EWMB 3ROTA 3AR3A 4Y2RA 4FGLA 2PMBA 3UJ6A 3V9PA 1L3IA 3GLTA 2JVJA 1QCZA 3HVRA 4UBLA 4RHXA 1ZMBA 1JZSA 1L5KA 2V74B 4OQ4A 5CM8B 3BK2A 2B6HA 3FLEA 4O29A 1PNTA 2G0AA 5DGDA 1M6EX 4X5OA 1A2QA 4A0FA 1FP7A 5FL7A 2PM8A 4XQGA 4KXNA 3QEOA 2PMEA 1YAHA 5BY2A 3R40A 2J3QA 5BMVB 2BKVA 1WQ3A 5EKTA 2WKSA 3ASVA 3JRXA 1D2NA 4KLRA 2JG3A 1FXSA 2FEXA 2O0MA 3PU6A 3AEUB 4EGAA 5TIIA 3FYSA 1W46A 3W5CA 2X13A 1XPOA 4F8JA 1IVYA 5EQFA 2JAUA 2AZTA 2XVMA 4H4CA 4B74A 1VYUA 1QGAA 1QO9A 1SVIA 1Z0AA 2GF0A 3OUUA 1M2FA 4B7ZA 4DCMA 4ROSA 1MB3A 1XD9A 2P62A 1XI2A 4GVXA 1C7JA 3OJ0A 2XBUA 3GUZA 3L1KA 5CLLA 4L5YA 4GEGA 1KOLA 2HRRA 2OZLA 4F5WA 1PR1A 4JKYA 4YCAA 4RESA 1RR6A 4FBGA 4GT1A 4MO2A 1PJ8A 1T9GR 1O0BA 4X7PA 3N76A 5CT9A 1JZQA 1QH8A 3QGMA 3EX7C 3P4YA 4XM0A 3MWGA 3RSSA 1D2AA 5FI0B 4TTVA 3ZLUA 1Y9DA 3NWOA 1D3AA 1CF4A 1SKYE 3NX4A 1T35A 3U44B 3WB9A 4JCCA 3SYMA 2Z4TA 3W3AH 4NFLA 3U5ZB 3EBLA 1JJBA 3PI7A 4K9OA 3U2QA 5CA1F 5JXHA 5K4AA 4ZTZB 1ZHFA 1ZU5A 1RYYA 1JH8A 1NBWB 4O8ZA 1NYTA 5D5QA 1TIKA 3GVXA 5JSKA 1T4BA 2B1QA 4Y7DA 3PF8A 3W7BA 1CRZA 1R6AA 1U5AA 4D0LB 3SD7A 4H7IA 1PRYA 4KODA 2W48A 1Y1RA 1E6KA 2PWPA 1ZSVA 1MA0A 1YA6A 4TL7A 1JL3A 2CGEA 3Q11A 4RKYA 3F5DA 3DHWC 1E5QA 3NBKA 4HTFA 4HWGA 4YREA 1XZPA 3BB4A 2IDKA 3CFYA 5GV7A 2W2PA 1FL9A 3I5YA 4FGJA 3TOXA 1G21B 2WIDA 2H1RA 4I4TA 4D4HA 2VNHA 4E6EA 1UEXC 1LWNA 2YIJA 5GIPE 1GPYA 4UNRA 2O7NA 3CWCA 4PNZA 3NHKA 1N1GA 1RZVA 3ILSA 5C3UA 1FDSA 2P1ZA 3F1KA 1FEZA 5B7GA 4Q4AA 3A3PA 3I58A 3M3PA 3DJFA 5DN6D 1Z4LA 3QLVC 3PNOA 3G2QA 4Y1EA 5KEIA 1BAPA 4UVHA 1I5RA 3C43A 3VJLA 3W8NA 2PTGA 2NUPB 2QN1A 3CRVA 4WEQA 1EUDA 1H3NA 1CU1A 3GEBA 4QOFA 5AM5A 3IUNA 3VPAA 3COPA 1U0JA 1BRMA 4MB6A 1Z6PA 2OR3A 2YOGA 4NP6A 4FYKA 3EXHA 4FLEA 3GEMA 3HXKA 1T29A 4Y98A 3TW8B 2AFHB 1GG5A 3AG5A 1CUYA 2W6IA 2HGSA 4G0ZA 1XEAA 3MJRA 4EOGA 2B92A 3IP9A 4QOJA 3ROEA 2GT1A 1I7QB 2HA7A 2QTGA 3G0GA 1MAAA 2Q28A 5M3BA 1Q6ZA 5JCOC 2PCJA 3CEAA 2XQKA 5LLDA 3ZDAA 1JDNA 4PYLA 4JB3A 4PHFA 1MP0A 3AERA 3DCJA 2FWRA 2XCQA 4BN4A 3PJEA 2CNWA 2Z8YM 5CVVA 3O4JA 2HA5A 1GNTA 3P45A 1V8DA 2F1JA 3C5WP 3IDOA 3KC2A 4U2GA 5DMXA 3DA8A 4HZGA 2H2WA 4BV3A 1VJDA 4YQZA 2NZJA 1VSVA 2ZWMA 1L7BA 5BN4B 3V8MA 2WAAA 4NHOA 4E2ZA 1GXSA 4EX6A 4E70A 1GLGA 1I4EB 1LZKA 2XQGA 3QVUA 1KO7A 2BZ0A 3KO8A 3IO3A 1K89A 1SOMA 2YXNA 1W29A 2FK7A 3JARA 4YIKA 4N8EA 3LV8A 3BJMA 3JPWA 4RE6A 1Y5IA 1W7AA 3C3WA 1CKEA 5IDWA 4ONEA 3DBHB 3P71T 2CBZA 4LSZA 4AY2A 2BZGA 4D0NA 1FSZA 3KWMA 4L4RA 2J7KA 3PFNA 5EJIA 2R751 5JADA 3EIUA 2ZB3A 3NALA 4J7UA 3IIEA 3HKEA 3OOJA 4OH7A 4EPTA 1W8DA 2OPHA 1W0KA 3TLXA 5KWVA 3C15C 6LDHA 4MITA 1OFHA 3ENNA 2ZDHA 1KFEB 2GVNA 1JDVA 4YQYA 1IEQA 3HKEB 1H2YA 2X0IA 3PIDA 4MGHA 3SU8A 1J5PA 2CUKA 4TSFD 4QT4A 3FN4A 3PYLA 1E2GA 1NV8A 4RF3A 4ZTUB 1E1LA 3LT0A 5ICFA 2ACKA 2PIAA 2CLOB 1XP8A 1EM8A 4RPKA 4Y1RB 3A4YA 3AEKB 1M6NA 4KGDA 1MOZA 4P86A 3LUKA 1UPTA 5CH8A 4KQMA 3ZWOA 4XDGA 1N0IA 2O50A 1PBTA 1VE6A 2PNFA 5K0CA 3CX7A 5IC5A 1POXA 3W6PA 4B6JA 2X0EA 1X15A 4H9GA 4C76A 3WLAA 5AMXA 2G4VA 3OM1A 4XR9A 1X13A 3DBLB 1W6RA 2YMLA 2RHHA 3T06B 4CKWA 5A62A 1RM3A 3LLSA 2RK4A 2ZQYA 2H59A 4M9XA 1Z18A 1OLUA 2XJ9A 3CCCA 1P2BA 4H17A 4Z86A 3DOJA 1ISSA 1I36A 1VA4A 3NDPA 3COJA 4OJMX 3S7TA 3BTSA 2MHCA 3RBXA 4G8CA 1OH6A 5IAEA 4WADA 4CQMB 4KX5A 5DFAA 1YOVB 2JFVA 4H7EA 1QHSA 4Q3DA 4W1QA 4C6TA 4V1CI 4PGGA 5CDSA 3I8OA 1ZHHA 3RUEA 3V2GA 1K5DA 4LNAA 4Q4LA 3UFXB 5F9HA 3DFKA 4NJEA 4C29A 1BDBA 4W99A 2IE0A 4QEZA 3VYRB 4GRDA 1MF7A 1FZQA 3DBRB 1U0SY 4NZNA 3RSCA 4ALJA 2LXNA 2ZS9A 4EKIA 5IANA 5EJEA 2WTXA 1TYBE 5CX4A 4NXMB 1ZOLA 4PXYA 1WCWA 3DNFA 1Z2PX 3MWKA 1NLMA 5CYOA 3OWHA 1GZVA 4O3FA 4CUKA 1YHNA 3L7DA 1V37A 1U80A 1WZIA 3PRYA 4RK0A 1DC3A 4H1HA 2C00A 1C3XA 1SUSA 3FGOA 4R81A 1V5WA 4X8MA 4YRAA 2VH1A 1N7GA 3ILYA 4F60A 5CNKA 3I39X 5JW6A 5DX0A 3Q1LA 5DM70 3VU9A 1EK6A 1KFCB 4JJ6A 2R6JA 3E7DA 3JTEA 2QOEA 3R0JA 1S8FA 1YB7A 2XKJE 4I4TF 4C88A 4B2LA 1CUVA 3LBFA 1EA7A 5PGMA 4TM8A 5I7OA 1HG1A 1WE2A 2A6PA 2ST1A 1QHHA 1ZDMA 3DOCA 2CLKB 1RRVA 1U0NA 1ZCBA 2BKAA 2JFBA 2PRIA 1P9RA 2XOKD 2YZNA 3C1UA 3NB0A 4GPEA 4HS9A 4EG3A 5L95A 1SA0A 5LXTB 3G6WA 4OHKA 1EZ1A 3DKRA 3HJUA 3CZ4A 3OZVA 2FMKA 4IWNA 5FP0A 1OIVA 1KI3A 4Y6QA 2WV7A 4CCAA 4GMXA 4YCNA 4IH4A 2F1RA 5AW1A 4I1UA 3DBVO 1B1AA 1C1HA 4EGSA 3IKMB 3KQQA 1Z4JA 2M2IA 3EDCA 2ZJAA 1NLFA 1BFDA 2IXEA 3E82A 5CLJA 3I0MA 2OUKA 2FOXA 4A26A 1UK9A 4LF7B 3AK4A 3RT1A 2IF2A 3HQ4O 2JGEA 5MN6A 4C03A 5GWXA 3D4OA 1TYEB 4FU0A 4NMLA 5D84A 4CF6A 3O1JC 4BGIA 1J0DA 4WLEA 1LA2A 3IMCA 3KHKA 3GCDA 1AM4D 3WGJA 1PWEA 4KYVA 1ZUNA 2F59A 2IP4A 3I04A 2VBFA 3FMIA 4I2VA 5DRYA 4MQFA 1NP3A 4AY4A 3LUHA 1SXHA 5K0FA 3ICPA 3UM9A 4CLRA 4L6AA 4K6GA 5K4GA 1ZWKA 2FWJA 4RVUA 3NIGB 1NJ8A 1WNTA 3L7JA 2V1XA 1FDOA 1IDOA 3VZQA 3ROPA 2VDOB 1GPKA 2F3PA 3BYZA 3CIOA 3E7XA 3AC0A 1EJ0A 3OZBA 3P0EA 2NUTB 4NEQA 1N6LA 5ESRA 4MWCA 2NU8B 4CF4A 4F1WA 3TSCA 3LXRA 3U9LA 2FMTA 2D7JA 4H59A 3CO0S 3A7EA 4LC0A 5JZBA 2A9KA 2WILA 1N32B 2BFAA 5GJWC 5B1SA 1R9JA 4Q4HA 2NTEA 4FHCA 1BIFA 3TKLA 2O7VA 3ZU3A 1IYZA 5LMNB 1E1CA 1A0OA 2AF4C 2GHTA 4TX1A 1EFDN 1D4OA 3H0KA 2GAOA 3STWA 1G6Q1 3EFEA 4M21A 2WU0A 3AVVA 3EZ9A 2XOEA 3GZNA 3NM5A 4I5FA 2A7QA 1RJ9A 1Y42X 3GPIA 4EEZA 2MTBA 3H5RA 5J3JA 5JD5A 3HHEA 1VPDA 1XZQA 3MM4A 4M0MA 1VMEA 2FV8A 1B8UA 3BWCA 3EMKA 2VZ9A 3QUQA 2XADA 4DA9A 2M9MA 4YUWA 5DI9A 5A6VA 3K16A 2WF5A 2O54A 1U9JA 2JLQA 2K6GA 2GR9A 4GOND 4MKGA 1M0TA 1TZJA 1DC7A 3IJRA 1R10A 3I04M 1P8AA 1ANKA 3KOWA 2QG6A 5EWMA 2BKXA 1HE3A 3LKZA 1I3CA 1SXJD 1YCHA 2MYTA 2GVDC 3KYCB 3PBKA 4U63A 4BNXA 4J4BA 4A03A 4BCDA 4C2BA 4ER3A 1YQUA 2YRWA 3FDIA 3OM8A 4ZV9A 1EZ4A 3RYHA 5CEJA 2XUHA 4FKZA 2W43A 3DL4A 1PT9A 3NHFA 4ZZ2A 4RK1A 4O0MA 1SUCA 3S5JA 5JJKA 1XRRA 2X8JB 3ZVLA 3H65A 4QSMA 2G17A 2DHRA 1O94A 1VZ3A 3E53A 1KMNA 4XARA 2IX9A 4GDFA 1GZ7A 2ZG6A 4JWKA 1WMDA 1YQWA 4KXUA 4H15A 3AY0A 3HMKA 1Z73A 2BFDB 3H13A 4FDVA 2NSJA 2WHYA 4HDKB 2HYIC 5HJ7A 4LRQA 3K5IA 3HS3A 1E0JA 2DKNA 3FZGA 4KR0A 1DKUA 4LI0A 2C4UA 5H1YA 4IIEA 1M7GA 3I9V6 2IZ6A 2SCUB 1MO3A 1V2GA 4NNOA 3ANLA 4LXHA 1GR0A 2GAAA 2P8JA 3JQRA 3KCQA 4HEA1 1N2JA 4L9RA 5DDIP 3TRKA 1QAMA 3VHRA 5L3QB 6ADHA 2D0PB 1SY7A 1U8YA 1OXKB 2DC1A 3EH2A 3JV7A 3L05A 1PEKE 1UM8A 3TRJA 5C8YF 5JV5A 1P1KA 1TYCA 1PE0A 1MOSA 1N3IA 2GNAA 1AB5A 3GGPA 2OZLB 2AJTA 2QM3A 1C4KA 2RK3A 1NVBA 3MJVA 4GPIB 4HVLA 1C14A 3P9ZA 3INNA 3OLZA 3R9KA 1CUSA 3T3MB 3SYKA 3W5IA 4BDSA 4BO7A 2NO7A 1RC8A 1KAEA 2GCNA 2BKUA 5FUQA 3QEKA 3RJTA 1OB5A 3A6EA 4JHLA 1G7SA 3UGQA 2AOTB 3H04A 4I66A 2WSLA 5ES3A 1ZN8A 4QDXA 4A7PA 2EQBA 3SOPA 4NS4A 4A36A 4DV2B 3W06A 4B3JA 2E0IA 5C81A 2I8CA 3VAAA 5GV8A 4CLHA 5I7EA 2JFFA 2EL7A 1E2EA 3UVEA 3JQAB 2AC2A 5C8VA 5LJLA 1OYOA 1JEOA 3AR9A 3DC7A 2V9PA 1BFUA 2CYAA 4XPIB 2NZ8A 3G68A 1E1NA 2BFMA 5F7JA 1U8UA 4PGFA 1R8SA 1SXJC 5IMBA 4ZO6A 1N6HA 4FB5A 5JFTA 3EXFB 4JLPA 2DQSA 2Y8EA 2PZLA 3DZCA 2FCRA 1RPNA 4FDLA 4OQPA 1G3IA 2V9ZA 4QOGA 4TQGA 2WB2A 1IJFA 3GJRA 2H31A 5TR9A 3RS7A 4BX2A 3AHGA 3M34A 2I3BA 2EBHX 1RZRA 1C4WA 5YASA 3FFTA 5JH7F 2E49A 3DCIA 1U5BB 1IONA 3L7KA 4XSGA 1N4AA 1ZVJA 5CA0B 4JBXA 1P1IA 2FA9A 1YBMA 2NYUA 2Q4RA 5J5CA 2PNJA 1FFYA 4OJTA 3DDHA 3EIEA 3PL1A 2C54A 2XR1A 2PMFA 1TQ4A 3B3FA 3FPEA 3PA6A 3U0VA 1M7BA 3RYTC 5AIBA 1GGHA 1GRVA 4UXJA 2DTEA 5C8ZA 4NEGA 4P7FA 5JT1A 1U3UA 3C98A 2PRZA 4XLTA 3U3RA 2X0RA 4Q3AA 4Q37A 2H9AA 3HCRA 3UAOA 1A8QA 3X2FA 4BGEA 4Z5XA 5EXPA 4CUJA 4R8SA 1QZZA 1HZZC 1UKVY 2H57A 2V65A 1Y5MA 2LE0A 2MSDB 3NDJA 3O1LA 4NU0A 4PICA 4N3GA 5J4LA 1X8JA 3BXEA 3NHZA 2QTVB 4J29A 2P2GA 3AM5A 5DWQA 3UKJA 4C4PA 2J3IA 1Z5ZA 4KNVA 3DUWA 3PHIA 2J5QA 1I14A 2CLMB 1UP6A 1RPJA 5BV2P 1N78A 4NPHA 3KJZA 4LOKA 5DF1A 1U7DA 1VKRA 3R5XA 3G2NA 2R7AA 1WS6A 3A2LA 3HFGA 3MW8A 1AMNA 4UMEA 3NM4A 3LM8A 3QPAA 1Z7YA 2E48A 3UK0A 3NASA 3SZLA 2ZUDA 3HEAA 2J0EA 3FFWA 1E3DA 2ECQA 5KNCA 1JLSA 2CFTA 4JYCA 1J42A 5DTJA 1Z6QA 5BSMA 4UOZA 2R6GA 1YHYA 3A2NA 3IP8A 2GXSA 1X7DA 2V97A 2ZJOA 2TSYB 5EVJA 5JBIA 4UDOA 4QJ3A 1UF9A 3VVMA 4AJHA 3D7LA 4LWZA 5EE0A 3OCCA 5HZKA 4G0OA 1EWKA 3E70C 2IV3A 2RG7A 3AB3A 4OPMA 4X66B 2Z8YA 4KITB 1F51E 1JNYA 1J21A 4B80A 1OD6A 2DXIA 1C3OB 2JBAB 5LA6B 2IZ7A 3T4EA 2A1UB 5BWBA 2WFAA 4M9UA 1Q16A 2XB9A 4FFLA 4RMIA 5B53A 3SICE 5CXXA 5MHTA 4ADSG 1UJ4A 4YRSA 4NMHA 1SOAA 1P2GA 1QIIA 4DS3A 4Q9DA 4YLYA 1RXWA 4OQZA 4B87A 4EO9A 2Q9AA 2QVLA 4DZTA 2FN4A 2FUKA 1JHDA 2C5HA 4LQ4A 4NYIR 4DJ5X 3CKYA 5BWOA 5HX7A 2Q0SA 5DWDA 2P4QA 1GYPA 1WM1A 2NADA 4BLSA 5AVYA 3WGGA 4ZCRA 3GCXA 2VSFA 2BTQB 3L07A 5EZYA 1R0RE 2FPXA 3UQYS 5A1JA 5LYJF 1JDPA 2D00A 2X2FA 4OHOA 1GNRA 5EP2A 2OBBA 3BQ9A 1Z3IX 4MWOA 1WXEA 4ZVTA 1S4QA 4KLAA 2V9CA 5EJ4A 3ASZA 1IB6A 2VZ0A 1D2EA 3I1YA 1ODIA 3IP5A 5E4FA 4ZAFA 5CRIA 3WKEA 1DAIA 2YFQA 4LZZA 4N9QA 3N2KA 3T41A 2I6FA 4RDXA 5AYVA 3MAJA 2BHNA 1FX0B 5IU6A 1QP8A 2YDYA 3LUAA 1U3WA 1ZUIA 3D2CA 4N7MA 5LQMA 1Q77A 1S3IA 1GARA 3H2GA 3CRQA 4JC0A 3LSTA 4JJGA 1G8AA 1DRWA 3FYTA 3KJGA 4JYAB 4PZLA 4R2XA 2PS0A 4A1FA 1TTPB 4IG4A 3E81A 5IZCA 5HSGA 3Q8MA 3GOQA 2OILA 2EVWX 2VK4A 4YJ2F 4DTIA 6CHYA 2C3YA 1G63A 2DFKB 1W36D 2PSFA 1CC1S 2Y0CA 2CY0A 2C59A 1YC2A 2DZDA 1SQGA 1X7XA 1WY7A 2WMNB 3QITA 4KPYA 1IMJA 3QJ5A 3L8ZA 4ZQCB 4GKJB 1E1QD 2G0TA 3I5UA 4EW3A 4TUYF 1QZ3A 4FZRA 2C9ZA 2GQ0A 2JLSA 1FOEB 3IP7A 2OMKA 4OBEA 4MWGA 5KSPA 3RG2A 5FO0A 1G20E 2QTTA 1YS1X 4RV9A 5IAKA 1F6DA 2YXEA 4MVWA 1PZHA 3NTQA 3OLYA 1O94C 2HQSA 4PTYA 1XMJA 1ZK3A 2EV9A 3U40A 4FTWA 3GBSA 3CKMA 1VCHA 1D5WA 1YS6A 3TTUA 5A4AA 1IIBA 3EQ8A 1Z0DA 1KC1A 1KI6B 4LBVA 4N7BA 1HZJA 3GDWA 1RWWA 4MV7A 1UJ6A 4Q0MA 5H9WA 3RYHB 1SHLA 5K6TA 4C0QC 4MGZR 4Y1GA 4JDPA 4JELA 5AKXA 2GK7A 1G8JA 4QQRA 5KDDA 3NNSA 4FM9A 4KNYA 1NVFA 1QYCA 2XYGA 1UH5A 1DBWA 1J49A 3LGAA 2YY7A 3HU3A 3PE6A 2ZULA 1AXRA 1KE2A 2PV0A 3KD2A 3H6GA 1R6TA 1NUQA 5ERXA 4B9EA 4DQDA 1E5TA 2Q5LA 2WG1A 2C58A 2DFVA 1EMDA 2JFUA 3DUFA 1RQRA 1JHMA 1YQGA 4UEOA 5KYYB 1ORRA 2Y1OA 4N5IX 3F3KA 2OV2A 4EARA 3BWEA 4AAYA 4P84A 4DHWA 3LJKA 3Q6IA 1QRAA 1GA1A 2ZE5A 1HT0A 4O2BF 3CCBA 2I0FA 1EA5A 1LSJA 3ICCA 3KEQA 4IYJA 3OFJA 4MJXA 4MK4A 1R00A 4NCJA 2WAYA 4QULA 5DYTA 2PKEA 5IDYA 3S2ZA 1ND5A 5K2OA 5K5EA 4Z4QA 4L51A 1JKJA 3SC2B 4HGNA 2G07A 1Z0IA 2QG9A 3FF4A 3H19A 3GJ5A 1MO6A 2ZOSA 1I7LA 3ITNA 5CM9C 3TTXA 2B4AA 3FWNA 3WZ2A 2Q49A 3OTGA 3K9BA 4P2BA 4YA6A 1OPRA 2O8BA 5ECDA 4BP3A 4IGIA 3ZWDA 3DTVA 3L02A 1L6RA 2AA3A 2QRMA 1OC4A 3M6XA 5JNWA 2VPYA 1TUEA 3UICA 3WBJA 2D13A 2JEZA 3ND7A 4R7TA 1MW8X 5LB2A 2B1RA 1TJ5A 1M1ZA 1QGUA 2BWJA 4MW9A 3RYFA 1H23A 3QY0A 4UULA 2EBWA 4TTPA 2A9PA 1YFZA 4RZUA 4PTZA 2IXDA 5GVRA 2W58A 1OF1A 3HWX1 3A0RB 4HC4A 4KPUA 3TIVA 4DE5A 4CKBB 4EYSA 1OIWA 1RVV1 1ZMXA 5JJ5A 2N1BA 4FEAA 2B8EA 2J9XB 1M83A 2W6NA 2ZK7A 3D5TA 2PYDA 1CNMA 1RRGA 5CIQA 5JZSA 1ESCA 4XX0B 3DXYA 5DXFA 4FYIA 4UOQA 3TQOA 1XZIA 2YWFA 3KS9A 4OIFA 1W0JA 2DETA 1HE2A 1EX6A 2W6ID 3Q7QA 4X7BA 3ZZ1A 5KCZA 5DHTA 1L8OA 4YGYA 2HV9A 3FPKA 3R7WA 1FF9A 3WWZA 4YAJA 1U94A 3INGA 1Z5PA 4PX3A 1L1QA 2OOKA 1YS9A 4G5GA 2YHAA 1W4CA 3QVGB 4UMVA 1IH8A 3ROZA 2YQ5A 3E1GA 3JATA 2CLEB 3CRZA 3D6FA 4ZWNA 3H2IA 5JH7B 5EIBC 3VVLA 1GUFA 1UMCB 4K03A 1FPMA 2C03A 3TMAA 1VXOA 2C2OA 3C16C 2H1FA 3C6QA 4N0EA 1N2CA 4IKEA 4MPTA 4E51A 3VNUA 3TR5A 2D4HA 3GYBA 3AEYA 2A0YA 3DE6X 1VA5A 3HR4A 2O4UX 3JALA 3VSBA 5K8UA 1HE8B 3HG7A 4W8OA 2G80A 5HQ3B 1OGYA 4D4JA 3IDQA 1OPXA 4AF8A 4J2TA 2GPJA 3LDAA 4QDOA 1U2SA 2A5DA 1H4TA 2Q2NA 5JAMA 3JQPA 4M9RA 4YJFB 1PZGA 2FGJA 2XYHA 1W5AA 1W8IA 3A1CA 4G9EA 2ATEA 4CM8A 3EVFA 2MSEB 3QM1A 1MA3A 4YMSA 5TE9A 4E7OA 4GQIA 1QG4A 1W2HA 3WS7A 2OCKA 5FTKA 1VBMA 5B2FA 3FSGD 3K0BA 4EG7A 1ESEA 3E9MA 3FBGA 3L4SO 4GKAA 3W2GA 3W6NA 3E2PA 2WJJA 1RXVA 1WPXA 2HCBA 3J7AC 1TEXA 2XNDD 3FZYA 4KBFA 4DWOA 4AKIA 3GUVA 1ENOA 4HDMA 1REQB 4B31A 3BFPA 4UDXX 2J0UA 3EDQA 1XNRB 2OTCA 3HTXA 4JD5A 1D07A 1X38A 5KPDA 4I7EA 1YFKA 2E2WA 1OQAA 1SCUA 1NYLA 3AO0B 3AL0C 2CKMA 1C8VB 4E2WA 1ZGCA 3Q7EA 2G5TA 3K6KA 4RE5A 1T9AA 1JHXA 2UZ0A 2YH2A 2XMPA 3EUEA 4A91A 3CLRD 1HEYA 4BV2A 1BE6A 4G9GA 3WL8A 4OQLA 4YFVA 2QJFA 3FGPA 2QTBA 4LVCA 3TXYA 3WMWA 4DCJA 3GF4A 3U7HB 2F55A 4D3FA 1FFDA 1WDKA 3COWA 3DFUA 2RGNC 3V8EA 3U7JA 3EAFA 4NS1A 4HQOA 1ZW6A 3Q3HA 3VH2A 3ZHXA 1TYAE 2UVDA 1NJ6A 2Y92A 1GQ2A 2WF7A 2ZUSA 5A5FA 3C87A 1U65A 3EC2A 1PX0A 2OHVA 4HDNB 4DNQA 3IJ5A 1V96A 4V0RA 4XRRA 4TYWA 2DLDA 2DT5A 1LV7A 1Q95A 2I71A 3FRHA 4GOLD 1P0PA 4EA9A 3O4HA 3GT0A 3MJCA 4UVEA 4MJ7A 3FROA 1KYXA 2YJ3A 1E1QA 4MNTA 3QPCA 4YRKA 1UK6A 1NN3A 2ZIZA 3N0VA 2CXHA 2I55A 5FLYA 2CXQA 2J6IA 5LDGA 1Y7PA 1U7WA 1FYXA 2QRKA 2VWPA 3L40A 1SXJA 3PE4A 4OGLA 1AUVA 5CG2A 4MUHA 4QAQA 1JJFA 1FA9A 2H0QA 3FE2A 1QCCA 1G5QA 2LIVA 1OYVA 3FUWA 3UJBA 4X3CA 3WR5A 2QX7A 4BL5A 4OQEA 2XCRB 1XN1A 5B64A 4HGRA 1MO5A 3RC1A 1JFTA 3SGLA 2OBLA 3L8MA 1SFRA 1PG2A 2ZI9A 1N2HA 2F8MA 2WUWE 3LC0A 3Q2OA 3A9UA 4H7JA 2HM7A 4RH3A 5CVDA 5EHIA 1KDYA 3RR2A 3UCEA 1PNOA 1Z2AA 4CR6A 3ADOA 4FT4A 3ODGA 4K9KA 4DA4A 1R4NB 1RLIA 1XVUA 4KMOA 4LJAA 5DHAA 2IYAA 1P4JA 3PJGA 1PF7E 4RWEA 4BMYA 1AOXA 3GEDA 3JY6A 2PKWA 3EIQA 3HLKA 3P2EA 2QU8A 2FPGA 3PQ3A 1T9BA 1YAJA 1PTJA 4QGAA 5AJVB 2YRXA 1MJFA 2FW1A 2HHJA 3BWBA 4WCFC 2WKQA 4INPA 4IUCS 5FTMA 3WLNA 4C7XA 4QT0A 4DR1B 3HN6A 1D4ZA 4EEXA 1WVGA 2VF2A 3UT0A 2PIDA 2VJOA 2CBGA 5A1TA 1H22A 4EGQA 3D5EA 5LMZA 2LUOA 4ZCMA 5HKAA 1PV4A 2VTVA 5ELMA 2IV7A 3A2MA 5DCWA 4CRWB 3E0XA 5LQRA 2XW6A 2QIOA 2YWXA 3HM2A 1CHNA 2Z57A 4JJEA 1J06A 4XVCA 4K6HA 1A9YA 4DYHA 4QLAA 3K0KA 4K3VA 4L9AA 2J9ZB 2ETVA 3OTQA 4QYXA 5CGZA 4B44A 2RAFA 1QH1A 2R00C 3KWLA 4B6RA 3ABRB 4G89A 4NYJR 3EEBA 3H6HA 5EZ5A 2RC5A 3V4VB 3PFFA 1QYWA 2CEAA 2QSYA 4IFIA 5EKDA 1PAUA 3R1IA 4DLTA 4C4XA 3LQ2A 4JUBA 2V58A 4DMHA 2XTJA 3GT3A 2BLNA 2Q07A 3R5KA 4OJNA 2PO7A 4UREA 5LBTA 1N0VC 4TWRA 5FWAA 1QHXA 3S2IA 2J3EA 2WABA 3CW9A 4JODA 3CMCO 2ZSAA 1VJCA 5B3JA 5E6UB 4JXZA 2PH1A 3OE5A 1T2CA 3R6LA 4C14A 3TQQA 4DYDA 3AM1A 3IPAA 2HBRA 3B20A 4M1WA 4BAUA 4CCSA 1M5RA 1ORIA 1QVAA 5HW0A 4BNYA 1D6SA