3BMCB

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and substrate (folate)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 248
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmcB00
3TZQA 3SLGA 1QV6A 4BV9A 1AGNA 1JW9B 2ZTUA 1H9BA 5DOZA 1U8XX 1E3WA 1E5QA 2NVBA 4MVJF 3M2PA 4CMEA 5A5EA 5BSGA 5AYVA 1A5ZA 4HFJA 1GUFA 1MA0A 1KYQA 4YA6A 2FSSA 3L4SO 3JD0A 4K6FA 4WLNA 4I9UA 5G4KA 1GUZA 1E1NA 3V1UA 1HKUA 1LLCA 4BMNA 1O9BA 2AG8A 2X4GA 3IP1A 2C54A 3WDSA 2EKQA 2JHGA 4AFNA 3OA0A 3TN7A 1EQ2A 4EW6A 4UAGA 4FDAA 1DC3A 1I36A 3E48A 1UDAA 1Q1NA 3B1FA 5F5NA 4DPKA 1T1RA 3K73O 3PZBA 2IYOA 2YUTA 3OJLA 4XR4A 4WOKA 2WD8A 3LT0A 3B70A 4XQCA 3GRKA 4W99A 2FPGA 3LC7O 3AI1A 4KWIA 1ZEMA 2Y68A 2VYVA 2IDZA 2QRJA 3NJ4A 4YDRA 2WSBA 1G0OA 2RIRA 2DU8A 2OP0A 2A35A 1HE2A 3ONEA 3UKOA 2HSDA 5A5FA 3DFZA 1ML3A 4GSLA 2HJSA 4ZVVA 2Q4EA 1ZFNA 3IUPA 3JQCA 1DRVA 2AA3A 1K6XA 5C7LO 3OJEA 1T2EA 4MVJD 2VUSA 5IZ4A 3MEQA 2UUOA 4LSMA 1PS0A 4F46A 1OZAA 1N92A 1EK5A 5EERA 3L4BA 3AU9A 5CP8A 5HBRA 4I5FA 3INRA 4KQWA 2VHZA 4TZKA 1NWCA 1RM4A 3VZPA 4CMHA 3G49A 2ZTLA 1ZZEA 2PKRA 4HFRA 3M1LA 4CQMD 3FR8A 4I1IA 3HN7A 4JCOA 4PG6A 2HUNA 3V5NA 2PD6A 5I7VA 4DQVA 5EQFA 3HN2A 1E3LA 2FPPA 1V35A 3PLNA 1NR1A 1Y9AA 4MIOA 4QECA 2E48A 2G76A 3RJ5A 3L07A 4UVIA 1H6DA 3JYNA 1PJ3A 5THKA 5IF3A 5JAQA 4OIMA 1YONA 2P9CA 2NU8A 4WECA 1G1AA 3WFJA 2JCYA 1I0ZA 4IPTA 4DGSA 2QYTA 4PG7A 1N2SA 3GGOA 2QZZA 5F3RA 1M76A 4EYEA 1IY8A 4YAJA 3W8EA 3HWRA 1BMDA 4Q3CA 4JX8A 1E7WA 3KBOA 4RO0A 4E12A 2IEBA 4L9RA 2VHYA 1JQBA 2BKAA 3KSZO 1HT0A 2EW8A 1GCUA 3H6KA 2G1UA 1XLTA 3BMOB 5ENVA 1I5RA 4MIEA 4JQCA 3PJGA 2I5PO 1PWXA 2H5LA 4RVGA 3OJFA 2CVOA 4B7CA 1GEGA 2C29D 3GHHA 1BGVA 1HSOA 3ZU2A 5JSFA 3GEMA 2P91A 3MJCA 5IFLA 4EUHA 3ZI0A 2A9FA 4NPCA 1SAYA 1JKFA 4OAQA 1I2BA 4UEOA 3D3WB 3DTYA 3AW9A 3F9IA 4XWYA 2J5RA 4OHUA 4U0JA 4TROA 2WYUA 1K2WA 4YJHB 4ZD6A 3UN1A 4IIVA 1P1FA 1LSSA 3RUIA 5AVOA 4E4YA 4G65A 4LRTB 1P33A 3GVCA 3RJ9A 5T64A 4ID9A 2PD3A 4ZQHA 1RM5A 5CAEA 1TI7A 3IS3A 3QQPA 3FSRA 3H5AA 4OSPA 1HF3A 1VJTA 3MJVA 3HSKA 3QE3A 4M87A 2BH9A 1P45A 4EGFA 4TRRA 5JAMA 1SOVA 1U8FO 1B8PA 1Z6ZA 2D5CA 2X5KO 3KUXA 4ILKA 5DF1A 4JBGA 4CQMB 5BQFA 4RPGA 4PIVA 3F4BA 4FJ2A 1E7RA 3DMTC 4IM7A 4RZIA 1IL0A 3H2SA 3DBRB 3G0OA 1EVJA 4WNIA 5A9TA 3OF2A 4IDFA 2EJWA 4RGBA 3PP8A 5DBIA 3RASA 3ON5A 4Z0HO 1ENZA 3D3EA 1UXGA 4NG5A 3WGGA 3WWZA 2IZ1A 3DONA 3SC4A 2IXBA 1YE3A 3PQEA 3GY0A 4GQAA 2YY7A 3QWIA 4NFHA 1NNUA 1YGYA 3C24A 2ZKLA 4OKNA 3JQ8A 1GQYA 2YHUA 1J5PA 3ADPA 3EVTA 5FWNA 5A02A 1BDMA 3JQBA 1D1TA 3AJRA 1E1MA 1YL6A 3VPGA 5L95A 1E5LA 4J49A 3WS7A 3DR3A 1Z74A 5ADHA 1BW9B 4EJMA 1BHSA 4EJ6A 4NBTA 2Q1TA 1ZVMA 5EJ2A 1PZHA 2O50A 3JQ7B 3BA1A 1W8DA 4K9DA 2GLXA 1YL7A 3KB6A 4R69A 3AM3A 1M6HA 2JFHA 3RFTA 3H3JA 1ZMTA 2EWMA 3OJ0A 1ENPA 2CVZA 4XB1A 1LQUA 3TFQA 1R0LA 3Q11A 4MJLA 2Y1OA 3MCVA 4RVDA 2O2SA 4L73A 4IUYA 1YL5A 2IZZA 4BNIA 4JP2A 4D0RA 2VZ8A 1HZJA 3H3FA 2BI8A 4WJZA 5G0VA 4IMRA 1R37A 3PEFA 3EZYA 1UZMA 4AL4A 5CPBA 3GUYA 3UOGA 4A26A 4GMFA 4IY1A 4OYRA 1UH5A 4PLZA 4BKUA 1PZGA 1BDBA 1M75A 3QHAA 4ZN6A 3UXYA 1PR3A 1KEPA 4OH1A 4PG8A 1X1TA 5A4DA 4W7HA 2EXXA 3H65A 2O3TA 4GPD1 2YJZA 3KTDA 2YV3A 4B4VA 2OZPA 1QYXA 3ITKA 3FI9A 1P1IA 2B5WA 1E0DA 2G5CA 4DQUA 4YR9A 1Z82A 1R6DA 2D2IA 2O2YA 1JWBB 2GD1O 3B1JA 5CDYA 4J90A 2BMAA 1WXDA 3O8QB 4OXNA 1SC6A 4PLWA 5COBA 1YB1A 1EE2A 1UDCA 1NPDA 4E2ZA 4NU6A 1UXIA 1Y5MA 4OSOA 3HFSA 1T2AA 5JDCC 4XJTA 2D1YA 1ZSNA 2GR9A 3QY9A 1N5DA 1DJQA 1OAAA 4XYGA 3T7CA 3W8FA 2RHRA 1ZUD1 3FBTA 5L4NA 3L6EA 4ALKA 5DBFA 3VPHA 3WYEA 3H2ZA 1XU7A 4DYDA 4TQGA 4Y98A 4AJ4A 1EDZA 1V8BA 1U7TA 3AOEA 3WX0A 1NPYA 2UAGA 4UVHA 4D0SA 4M54A 4GKVA 2Y93A 3Q6IA 4CUKA 1WNTA 2YFQA 3KVOA 4LN1A 2DBZA 1I3NA 2EEZA 4XDYA 2J5QA 3RKRA 3DZHA 3ABIA 3AM4A 4YAKA 2QYSA 3MTGA 2UUPA 2I65A 1XYGA 2YFHA 2VHVA 3NT5A 1F8FA 3I9OA 3P5SA 1H94A 5AXAA 1PJ2A 4NNJA 4J4BA 2O48X 5TNXA 3C85A 1A7KA 2V6BA 5F1OA 3ZU3A 3DBVO 3ZW9A 4W6ZA 4DLBA 7ADHA 1CETA 3INGA 1S6YA 1FDUA 1BXKA 3QA9A 2DBVO 4PVDA 2CMDA 3S2IA 3KEOA 1F0YA 3FWNA 1ULUA 2OGUA 3WIDA 4E6PA 5AXDA 1NASA 2VNSA 5I7EA 4QFDA 3U09A 4GX5A 4ZA2A 2EF1A 1Y1PA 4RORA 1QYWA 4BNKA 3VC7A 3GOHA 5ENDA 3CH6A 2X86A 3JD4A 1RPNA 3A06A 5CHEA 4B8WA 4CQLB 1JA9A 3S1LA 1GDHA 2FSVA 4WCFA 2BLLA 3ST7A 2BD0A 4E30A 4MVJE 4PLFA 1KY5A 4TMFA 1R4MB 3UVEA 3BMNB 4OQZA 5L7YA 4QQRA 2J3JA 4N54A 1VC2A 3ORFA 2VWPA 2DUWA 1QP8A 1B14A 2FOIA 1LRJA 1HE4A 1YQDA 3VHRA 4IQ0A 4FGWA 4I8XA 3AI2A 3WGIA 2X58A 4F6CA 3PIIA 5G0WA 4XJSA 5TQVA 4O6VA 2IZ0A 3RSHA 1B0AA 4J1NA 2C5AA 1DO8A 1EUZA 2WDZA 2JCVA 1K6IA 1YKFA 3RFXA 3NYWA 2FN7A 4GGPA 4AJKA 1I01A 7MDHA 1Y6JA 4J2HA 4XQEA 5JW6A 1ID1A 5TT1A 2W98A 1L7DA 1PGQA 3O03A 3S2FA 4A0SA 2G17A 3DZKA 2GDZA 3IOYA 1U3UA 2X23A 1Z7BA 1TT5A 2B37A 5DCUA 4J7XA 4Z9FA 1X13A 4CM4A 3GG9A 5A04A 2CF6A 1PIWA 2FMUA 2E4AA 2PKQO 3FRJA 1MC5A 1GAEO 1DDOA 4JNKA 4TRJA 1UXHA 5G0TA 5F21A 1ZO8A 4RVHA 2Q2QA 3GMDA 3NX4A 3LT1A 2VZ9A 5LC1A 4ITUA 4NU5A 3KM0A 2FR8A 3ONFA 3JCZA 1I32A 3WJ7A 4PLCA 4BNFA 5JY1A 3EAGA 1LRKA 4GI2A 1P0FA 1W4ZA 3PK0A 4BUCA 1VJ0A 3UHAA 4BNTA 1GY8A 2RH8A 3PQFA 4YAIA 2YDXA 2P68A 3C3XA 5KCZA 4IINA 1M6WA 4OOEA 1XQ1A 4INAA 3WGQA 3BYZA 4L4RA 4CMKA 3G3EA 2IYPA 5TRTA 3RUAA 1DRWA 3BMCB 3DTTA 5A9SB 4Z9YA 3IUSA 1Z45A 1X0XA 3ZWNA 5IZCC 1GU7A 4RLHA 1FK8A 1ZJZA 3ZWMA 2DBQA 4WCDA 3DOCA 5CFZA 2VWGA 2RAFA 4WOJA 3GDFA 2EIHA 3BAZA 3O26A 3QP9A 1KEUA 3NEPX 2B69A 2ILTA 3AFNA 3H9GA 1NHWA 1RM0A 1T4BA 4ESOA 4Y6SA 1EQUA 4D46A 1XDWA 1B8VA 3LF2A 4MKZA 2XOXA 1HYEA 4BB5A 1P31A 5KJ1A 3AY3A 2EHDA 3ZDFA 4FS3A 4WUVA 3FTNA 2Z1NA 2NWQA 1YO6A 2ZCVA 4J91A 3M2TA 3TZKA 1U3TA 2P9EA 4DYVA 4UUMA 3IKVA 5T57A 3OSUA 2A4KA 4IS2A 4P22A 4CM8A 4XGKA 1HETA 3I9JA 4RV9A 4BO2A 4XDZA 1BTOA 1H6CA 3WXBA 4QX6A 1F14A 3F5SA 4R9RA 1OI7A 4YJDA 5DN9A 1DXYA 3HDHA 3ZWCA 2QQ5A 5IXSA 2CF5A 2OFPA 1PGNA 3KZVA 1GPDG 3E8XA 1V3VA 2J3HA 2Q45A 4OMUA 3WMXA 1PZFA 3D0OA 3RUDA 1ZSYA 3LYLA 4DPMA 3K2EA 3HQ4O 2GSDA 4II2A 1A27A 4DA9A 4LCEA 5A1TA 1NFFA 4DXHA 4ND4A 5TX7A 1NX6A 3TDKA 4YBZA 4D3DA 2H9IA 5GMOA 4NH4A 2WWRA 4NK4A 2JHFA 1TEHA 4I5DA 4ZJUA 1XIVA 4P4NA 3RKUA 3G17A 2NUAA 5ICSA 5J23A 2DPGA 4XRRA 1UP7A 4PLPA 2GERA 1I3KA 3E6AA 3MWDB 4NJOA 2I6TA 3U0BA 3VZSA 1U28A 3PWZA 3OEYA 1K5HA 4HBGA 5KVVA 2F1KA 3EY4A 4RPJA 4AVYA 5JC1A 4MP3A 2VT2A 3MOIA 1QKIA 1DPGA 4DL9A 2OBYA 4FJ1A 3KHUA 1PQPA 4LGVA 4LVCA 1PWZA 2DQ4A 2HQ1A 2FZWA 1ZK3A 1PJCA 3QLJA 4R54A 3HUDA 4TSKA 5DDIP 1E6WA 4MP6A 4EDFA 2SCUA 4CLOB 3L9WA 5JS6A 1D8AA 1ZXLA 2WYWA 3JD3A 4UVDA 2DFVA 1HDYA 2I66A 2OOSA 2X22A 1KVTA 5DP2A 4CMIB 2GN6A 1C0PA 3DBHB 3GZNA 4E2XA 4BNMA 1E3EA 1TA4A 2NNLD 9LDBA 1Q2XA 4CMJA 1LUAA 4P38A 1LNQA 2OO5A 3KV3O 3ZV5A 4BNGA 4E5YA 1EE9A 5ES3A 3DC2A 5K6AA 1GYQA 2V6GA 4AJNA 2ZCUA 4J7UA 4NR0A 4A5OA 2HCTA 3S55A 4TVBA 1DEHA 3P2OA 1U2DA 3ETDA 3MOGA 2X7HA 3UICA 1DHRA 3Q9NA 5MDHA 2IE0A 4WASA 5KTKA 1Y8RA 3U49A 1DC5A 4CLRA 3ADOA 4ONEA 2Q4BA 3KRTA 4W4TA 3I52A 4KOAA 1QRRA 5EIOA 4BNWA 1EDOA 2NU6A 1WVGA 3NT2A 3OIDA 3TOXA 3WMWA 1R66A 1WW8A 1SOWA 1J6UA 1E1KA 4BKQA 1BVRA 4YJGA 1XA0A 3NRCA 1IB6A 1IPEA 2P4HX 4II3A 3HADA 4W9NC 3WLFA 5H81A 5JE8A 5JCXA 4R1UA 2X9GA 3A4VA 2R00C 3LDHA 1LTHR 5KVQA 3NGXA 3O38A 4YRBA 1U7HA 1AN9A 2IODA 2W2LA 4D42A 4R1SA 4IMPA 5BNTA 3VAZA 4FC7A 3IJPA 1KVUA 4WGGA 3ZV3A 1E7SA 3DB2A 2X6TA 3ZZNA 3I5MA 3C1AA 1UZNA 4MVJP 3ICCA 1C1XA 1GL3A 3WB9A 4E3ZA 4ZRMA 4YQZA 3TZHA 1GYPA 3WYCA 2AW5A 4PLYA 2ZB4A 4BO3A 4D3SA 2O3QA 4BL5A 4R51A 4E31A 3B20A 4C7JA 1QLHA 3COSA 1E92A 4KTTE 4D43A 3CMCO 4AJEA 5JYEA 1A71A 3BTSA 3NGLA 4AJHA 4GH5A 4ZU3A 2O3JA 1BRMA 2AQHA 4RLSA 1C1DA 3GFGA 1ENOA 3RUFA 3JSAA 4JBHA 1HDGO 1HEUA 1N7HA 1U5CA 5HM8A 5EQDA 1KC1A 4E5KA 2PZMA 5JPIA 1E3WB 4OL9A 4R1NA 4CMEC 4CJXA 3ZWYA 1KEVA 4RL6A 3WGYA 3OETA 2ZQYA 1GADO 5DT9A 4ZQEA 3FBGA 3DXFA 4YJFB 4DREA 4O59O 2ZTVA 1S7CA 3AM5A 3KSUA 4XD2A 2PTGA 3L6DA 5G4KB 5C3MA 1KETA 4KWHA 2Y1CA 4LMRA 4YT4A 4Q3NA 1JN0A 2OP1A 3UF0A 3X2EA 3V2UA 5A05A 1MG5A 2W4QA 3O4RA 1QG6A 1A4UA 3ANLA 3NAQA 1Q7GA 4CLEA 1UP6A 2BGKA 4OQYA 3SXPA 4U6SA 4N5LA 4E2WA 2C20A 2FRDA 3DBLA 3MJEA 1H6BA 4D44A 2Q1UA 2CSUA 4QT0A 1ARZA 3FR7A 3RC7A 1ADBA 3SJUA 1XEAA 2D8AA 4ND1A 1YQXA 3FNFA 4MVJM 5EN4A 4DRYA 4XX0A 2Q3EA 3G1UA 4KUEA 3ZGYA 1ZCJA 2X1HA 4DQXA 3PYMA 1XG5A 5GZ1A 3GG2A 2QRKA 3A14A 2ZATA 3K6JA 1K89A 1Y8QA 3R3JA 4FFMA 4XA8A 2Q1WA 5JBIA 3TJRA 2ZJ1A 1OBFO 5ICMA 2VRCA 4WKGA 1NQTA 1PGOA 5MGBA 3GN2A 3KYCA 3TQHA 3PDUA 5C37A 1TLTA 2IEDA 1P44A 4U5QA 3VKUA 2X0NA 2HK9A 3I23A 6LDHA 2C82A 2I76A 1ISJA 1U4SA 4YT2A 2QX7A 1K0UA 1R4NA 4KZPA 4FB5A 2BFPA 3KLMX 4UVGA 1DFHA 1KC3A 3LLVA 4AICA 4FCCA 1ZW1A 4J1QA 1GUYA 1VI2A 4BMSA 2CDAA 3G1TA 1PL8A 4G5HA 3UCEA 3VH1A 4R5HA 4CV0A 3RU9A 2GN8A 4IJUA 3U9LA 4K6CA 3UH1A 1NAIA 2PWZA 1U5AA 3LZ6A 4NJMA 3HHPA 3EW7A 4YB8A 3AK4A 5ILGA 3K31A 1PJSA 3Q1LA 1FMCA 3UCXA 1T26A 1QXSA 4HXYA 5B4UA 5AOVA 1SO8A 1V3UA 3K2BA 4Y9DA 3ZWXA 2OORA 1GTMA 3GVHA 4MOWA 1YQGA 5BNFA 3ZV4A 2O4CA 3TPCA 1PSDA 2WE7A 4BIIA 1PJTA 1GCOA 3BXXA 3DZJA 1MFPA 2Q49A 3GLQA 3ZWVA 1VL0A 1ISGA 3DMTA 1QLJA 1LJ8A 4E5PA 4DTIA 4ZICA 2J8ZA 3QWFA 1LDBA 3HDYA 1GQ2A 1ZXBA 1TB4A 3VTFA 2P4QA 3M1AA 4BKRA 3JQGA 5F1PA 3OEWA 8ADHA 1F17A 1Q0QA 2D5AA 4LSWA 4RPKA 4YT5A 2WE8A 3DZFA 1ADFA 1LSUA 3PHLA 2B4TO 3W4JA 4ND5A 4Z0PA 1B8UA 1V0JA 4J16A 1ZBQA 3FNGA 4HNHA 4LVUA 3PJDA 1GZ4A 2J6IA 5COQA 3RAJA 3EVNA 2Q50A 3GAZA 1QYDA 3F4LA 1I3MA 3O9ZA 1RYEA 4HADA 1BW9A 2GASA 3T4XA 5L4SA 3DMYA 1A72A 1CF2O 1DC4A 3DZIA 5KOIA 1QSGA 3UAGA 3H7AA 2QZ9A 2VYNA 1B16A 3JQ7A 4TRNA 4CUJA 3U62A 3WNVA 3JQFC 4JK3A 4ZQFA 1D7OA 3MTJA 4CMGA 1FDWA 5EL0A 2H6EA 3C7CB 3K96A 3AWDA 1IULA 5K0ZA 4E21A 4OJNA 3WGTA 1Z75A 1EUDA 2VT3A 3WIEA 2J5KA 3WNQA 4MVJH 5HS4A 2ZQZA 4D3FA 4ALMA 3GDGA 1C0KA 1QR6A 2Y66A 2ZYDA 1J49A 3ZWAA 4F45A 3KETA 3HNPA 4R9SA 3JYQA 3VOSA 4YAGA 3PHHA 5DCWA 1FF9A 3GVPA 3GNQA 4R1TA 3JYOA 5G4LA 2JFFA 3D5QA 4DBVO 3WFIA 1I24A 1X7HA 3DO5A 2A92A 3KSDO 4Y6RA 4C7KA 3EUWA 4LMPA 1Q7BA 3GK3A 2C59A 2YQ5A 2WMDA 3C7DB 3CMMA 5BR7A 2FZEA 1V6AA 4LISA 4I9NA 2HLPA 5FI3A 4FFLA 3JQ8B 2NTNA 5IAAA 4YEDA 1X15A 2BFAA 4XEHA 4O63O 3NUGA 3GHYA 2JD0A 3D4OA 1VLLA 5T6BA 3EC7A 4PLGA 1Q0LA 4LRSB 4M89A 3DOJA 3GEDA 3TNLA 5C7OO 3QWHA 5L40A 2D0IA 2ZB3A 5JDCA 3GEGA 3INTA 2CD9A 1HYGA 2HO5A 3QRWA 3NTOA 2XXJA 2LDXA 1XELA 2JAHA 3NT4A 2WJPA 1X0VA 1ONNA 2EGHA 3STHA 4BNXA 4JN6B 3ANMA 3LF1A 3IL2A 3AUAA 1M66A 4CV3A 4ALNA 3ETEA 2C7VA 5B12A 3FHLA 1OC4A 4Q9NA 1M67A 1YOVA 4O1MA 5KVCA 1JKJA 1U3WA 4BNJA 1SB8A 2GN9A 3Q2KA 5K9ZA 4JJGA 4ALJA 1V3TA 4XIYA 3OIFA 2PGDA 4JP3A 4NHEA 3F1LA 5L53A 3K8ZA 1ZJYA 3ZHXA 5IDQA 5JAIA 1KVRA 2PFGA 2R2GA 2GNAA 2GZ2A 2NVUA 3AFMA 2PK3A 2HK8A 2ZIZA 3ZWBA 3N74A 4IXWA 3C7AA 3CIFA 4AJLA 5JAZA 2C07A 2DTEA 1JKIA 3WOHA 5JCJD 1PX0A 2PH5A 3E9NA 2B83A 3BMQA 2DC1A 1GQQA 1LRLA 2VOJA 2RHCA 4FJ0A 4NQZA 2HK7A 5IDYA 5IG2A 5C5IA 5L7WA 1XWFA 1SMKA 2FR1A 4BO0A 3RQSA 3K9QO 1O94A 4U7WA 3OM9A 4MINA 1ISHA 1R15A 1HZZA 4BNVA 1I2CA 1CDOA 4DPLA 4PZEA 3GPDG 3Q9UA 3RD5A 1NQ5A 1XCBA 1IUKA 2JAPA 2BI7A 2NTVA 4YWJA 2VZ0A 1HDXA 2EKPA 3SLKA 3EGOA 4BS9A 1MXFA 3T4EA 1XGKA 1O95A 2OUIA 4CL3A 1XKQA 1VSUA 1NTOA 1MXHA 4HY3A 4BGIA 3DL2A 1LDYA 3S2GA 1I10A 3BTVA 4EEXA 5KNLA 4S1VA 3CPSA 5DNAA 4GX2A 4GLOA 4GVLA 4UREA 4URFA 3VTZA 1N9GA 3RFVA 3PIDA 4NFYA 4BQRA 5T8KC 3ZNQA 1ONOA 4PG4A 1TXGA 2GRAA 3I1JA 2JFGA 1RWBA 3L9XA 3LLSA 4AJPA 4RF4A 2B0JA 1C3VA 3E18A 4PZCA 3PYLA 4XR9A 5KKCA 4DBZA 4FGSA 3TZ6A 1P1KA 1O8CA 4KDFA 5DBGA 2Y1FA 3VDRA 2ET6A 1YB4A 1PS9A 2HKIA 1BWSA 1A7AA 3TL2A 3VH4A 2CFCA 1XU9A 3LC1O 5F5LA 3PJFA 2Y1EA 5CEEA 4F3YA 1CQIA 3CZRA 4L76A 3LT2A 1B3BA 1JLLA 3N7UA 1A9YA 5H82A 3KO8A 2UYYA 1RJWA 3H9EO 3W8DA 3LK7A 1JDJA 5GZ6A 4CR8A 1VKNA 4YT8A 2DFDA 3ITDA 1P1RA 2PNFA 4CM9D 1LSJA 1PL7A 3JQ9C 5BSEA 4FSHA 1CIVA 1DIRA 4G2NA 4BO6A 5A03A 1EBFA 2TMDA 2PZLA 4YQYA 1WAMA 3CTMA 3IP3A 3Q0EA 4UUPA 4NK5A 3ROKA 2DT5A 2OMEA 2Q99A 1E6EA 3PGJA 5IZCA 1B7GO 3GPIA 4NI5A 3CKYA 3RUCA 4XQ9A 2WD7B 1YBAA 4L4XA 1PEDA 2EERA 3GNSA 5A3JA 1RM3A 2EP5A 4K28A 2FR0A 1DFGA 5C7IO 2BHLA 1QYVA 2Q46A 3FF4A 1JAYA 1T2DA 1KIFA 3SC6A 5F1KA 4XGNA 1DIAA 1TT5B 4DUPA 4Q3AA 1DB3A 4CM4B 5JFOA 1P77A 4TKMA 2X0IA 3D4NA 3WQRA 4D45A 5TJ9A 1PQUA 4A03A 1B2LA 1C0LA 3I9KA 3GAFA 3JTMA 2O23A 3LU1A 5EESA 1YBMA 3F47A 1LDMA 1MG0A 1PL6A 4O5OA 1I30A 4IDGA 4ALIA 3QJ5A 3E1KA 4NIMA 4BKPA 5U1PA 2V65A 2Y1DA 3NDRA 3PWKA 4Y6PA 3HDQA 4R16A 1N8KA 1IOLA 4HWKA 1Q0HA 1WLYA 2AEMA 4DIBA 1AUPA 1EUCA 3I4FA 1T1SA 2E82A 3R0IA 3RBXA 3HJAA 2X9NA 4H3VA 2RBEA 5DP1A 4GWGA 4M8SA 3UUWA 4EI2A 1YJ8A 5U9CA 4BO8A 4XZ3A 1VJ1A 2C2YA 2JKVA 1RYDA 3LVFO 2PLAA 1E7QA 2NADA 9LDTA 3GR6A 4Q3EA 4KMSA 4Z3KA 4U6QA 1EVZA 1U9JA 2PD4A 4TVOA 1HLPA 3JQDA 2CDCA 4BKOA 4J4HA 1LC3A 3BHMA 1G0NA 1H2BA 3RROA 4CV2A 3N58A 3U4HA 2B5VA 1K6JA 3I6QA 3JV7A 3ASUA 3IQDB 1ENYA 3V1TC 4JJIA 4QXMA 2CUKA 3MZ0A 1Y81A 4RDIA 3RUHA 4CUZA 4E13A 2YHIA 5ER6A 4IQGA 2PY6A 4HFNA 4QFCA 4XYMA 5BNIA 2IRWA 4IGEA 1GEEA 4B3JA 4L74A 5KJ6A 1DBVO 4PRKA 3PFWO 2FP4A 4GSKA 4EUEA 2PKQP 3GRPA 4Z3DA 4CM8B 4E0BA 2NQ8A 1E6UA 2VUTA 1BXGB 2GZ3A 3SJ7A 4ROSA 1ZNQO 4PVCA 4E32A 1NM5A 4HNGA 4A7PA 3F1KA 4UEJA 1O5IA 1CERA 2HRZA 3ZN2A 3JQEA 1GV0A 2EW2A 1NPTO 3UFXA 4I9HA 3R1IA 2Z95A 2Z1MA 3OECA 4MPDA 1Z73A 4E2YA 1IZ9A 3VZRA 1WDKA 3ZU5A 3DZBA 4H7PA 5CPFA 3RC9A 3ZNOA 3JQAA 1WMBA 3AUUA 3AU8A 2QG4A 3B1KA 2PGJA 3P7MA 3ZCXA 2NU7A 3AY6A 2Q1SA 3GH3A 5CDUA 4BV8A 3VH2A 1R12A 1T2FA 1UDBA 5JNLA 3EHEA 4F6LA 2Y0CA 4ZQBA 3PLRA 2PA3A 3MJTA 5IN5A 3ZHBA 4FC6A 4YRDA 1MC4A 2W2LD 2AEJA 2WYVA 2VN8A 5HTOA 4UVEA 1T25A 3DHNA 2DKNA 4MIYA 2QW8A 3AUSA 1NVGA 4RF2A 5IJZA 1YB5A 6ADHA 1NP3A 1ZKMA 3QVOA 5G0SA 2FHSA 2Y0DA 1NFRA 3KOUA 1AXGA 4BNNA 2W2KA 4XQGA 4DLAA 3VVCA 3WQQA 2P5YA 1B3RA 1JVSA 1R16A 5BT9A 1LC0A 3GUCA 1UXJA 4JBIA 4MVJI 4OGWA 3TSCA 1XSEA 4TWRA 1P1HA 5I8ZA 4MO2A 4W9NA 2WEKA 1DHTA 1QORA 1B15A 4QTZA 2R00A 5TIIA 2X8LA 1NAHA 3D4PA 2AXQA 3KYDB 3UGKA 2NQTA 2UDPA 2B35A 5U4QA 5I9NA 4ZGWA 1QV7A 4RVFA 4CM5A 5A06A 5KKAA 4B3HA 3QVTA 4BNZA 1P3DA 1LLDA 2VYVD 4I5EA 4WNCA 4R3NA 3RBVA 3CSDA 4CL8A 1O89A 3L6OO 3GZNB 4TRMA 5KIAA 4BNUA 3ROPA 4RQUA 5TGDA 5CDGA 1HE3A 4HP8A 2OXIA 4W82A 1DLIA 2ZTMA 1DOHA 3OQBA 2JD1A 1DFIA 2HU2A 1CYDA 4NFSA 1AXEA 3PFFA 4IIUA 4GAEA 1ZK0A 4Q3DA 3WJAA 1LBEA 3GVXA 5B1YA 4UULA 2W8ZA 1IPFA 5LDGA 5L51A 2Y99A 2DTDA 4WLEA 5G0UA 1BSVA 1Y8RB 4CLRB 1TVEA 4CV1A 3I83A 5BSFA 4GVXA 4RF5A 5JC8A 4IZIA 4PGFA 5JDIC 3GFBA 3H5NA 3RVDA 1MUUA 3IC5A 3UCFA 2AHRA 3PRJA 3A9WA 2X5JO 1MB4A 3HFGA 1A4IA 3ICPA 4YJGB 4YJFA 1AE1A 1I8TA 1JWAB 4P4GA 3OQ1A 5IDXA 1NQOA 2F00A 1NXQA 3G79A 5L7TA 3BIOA 2Q2WA 1GZ6A 4TKLA 3U5TA 3DQPA 5EMHA 3W1VA 2H63A 5DCYA 2J3IA 4ZRNA 3ENKA 2VRCD 4L8VA 4WE3A 2O3UA 4NBWA 1Z7EA 4XRGA 5TLSA 2FY8A 3GNTA 3IAHA 4XCVA 4BNHA 4PZDA 1U4OA 1RKXA 1DIGA 1HYHA 1PGJA 3LT4A 3WBFA 4AJ2A 4AJOA 1C1XB 2O3RA 4H16A 3SVTA 4HV4A 5CEFA 1P9LA 1YBVA 5GY7A 3S8MA 1ISIA 4HKTA 4JGBA 4BB6A 3H9QA 3PHIA 3DZGA 2JL1A 4RCVA 4Q39A 1PJ4A 2AMFA 2HMUA 2AQIA 1PU2A 1HXHA 4D7AA 1GV1A 3VH3A 3IJRA 2BF7A 4WPGA 4Q3BA 3Q3CA 5I7SA 1C1DB 1MP0A 1U3VA 3PDJA 3NTQA 1DC6A 3F46A 3NDIA 3ULKA 4B7XA 3GVIA 4LW8A 3DEYX 2C5EA 4I5GA 1AHHA 4NMHA 2DUUA 3E9MA 4YXFA 4R68A 3E03A 4QUKA 1EBUA 2BGMA 1GD1O 1OOEA 4OOFA 4UUNA 4B4WA 4B4UA 5ILOA 4EITA 2PV7A 4B8ZA 4FFNA 4RZHA 1YXMA 4OXYA 3BMOA 3WSWA 2D3TA 3AUTA 4CM3A 1NVTA 1H93A 4PN3A 3GMSA 4BO5A 1C0IA 1DLJA 2YQ4A 2XXBA 1FDSA 3EZLA 3QVWA 4BMVA 2FWMX 2UVDA 2VTDA 5FYDA 4E5NA 3IKTA 2EKLA 3V2GA 1EVIA 1OC2A 4ND2A 4UUOA 1YDEA 3ONDA 1MFZA 3D64A 3DHYA 1DRUA 3IIEA 3L4BC 2TMGA 3DAGA 5JO0A 4X54A 2PR2A 1LLQA 1P0CA 1P74A 3DBLB 4HFMA 4GKBA 5JO9A 3SBOA 3ZWWA 5G2OA 4JXKA 2BGLA 3FWZA 3DFUA 2VTEA 3D3WA 1YJQA 1H9AA 1HDRA 1JVBA 4QEDA 2UV8A 3NKLA 4MVJA 4DC0A 4YJHA 4IJVA 3ZV6A 3PXXA 4XKJA 3D7LA 3D1LA 4RDHA 1MGOA 2OL4A 1Y8QB 2BELA 4RPHA 4XB2A 4E33A 4E5MA 4P8RA 2V7PA 5CDTA 4CM1A 2VYND 3F6YA 4BO4A 4MDHA 2LDBA 3KYCB 3EK2A 4M1QA 1EVYA 4EEZA 4FR5A 1HL3A 1YWGO 1ISMA 4CQMA 1LLUA 1QYCA 2NU9A 2ZB8A 4CLXA 4GX0A 4N5MA 4IJWA 3DBRA 1R4NB 1UAGA 2ZYAA 3K30A 3U4IA 2AG5A 1MV8A 1LDEA 2JD2A 3WGOA 4M86A 4M49A 4J3FA 2DLDA 1E7YA 1LXCA 2B36A 4BVAA 4R4JA 2Y0EA 1E3SA 2YV1A 1T2CA 4RVSA 4Z9XA 3C1OA 2HAEA 2NACA 3CE6A 4FQ8A 4JROA 4NBUA 4GX1A 2AEFA 5JXWA 4R5MA 5AQ1A 3GN1A 1HWYA 3JQFA 1ZSVA 3HE3A 4NJMB 3RI3A 4QO7A 4YYZA 1PTJA 1E7MA 1R0SA 1WDLA 1SNYA 3FPLA 2DVMA 2DM6A 1PJBA 1KS9A 3QW2A 1EZ4A 3PPIA 2E49A 3JYPA 2NLOA 1O0SA 4W7IA 1DIBA 4PLTA 4CLHA 2X0RA 1ZK4A 3PQDA 2G82A 3FPCA 1KVQA 1DIHA 4NBRA 2ZB7A 4BNLA 5IDWA 2O7QA 4QSMA 4IDEA 5T67A 2HMVA 4IQ8A 1F8GA 3H8VA 3QWAA 2VWHA 1ZK1A 2OHXA 3AY7A 5LDHA 2YV2A 5TT0A 1W73A 3MWEB 2HRBA 5EPOA 5I8WA 1FDTA 1LEHA 2B4QA 1Q7CA 1M2WA 3JQGB 3MJ4A 3OH8A 4AG3A 4YRAA 4FOOA 1VKOA 3I6IA 5BSHA 2B4RO 1F06A 2E37A 4R41A 1VRWA 4IS3A 4CM7A 4IJKA 4WK6A 3PHGA 2CZCA 5DULA 2QHXA 4H15A 5KVSA 1E3IA 3PHJA 4R01A 3R3SA 3EMKA 4A27A 3ZW8A 4J1TA 2CDBA 2GGSA 3GF4A 2VHWA 3FD8A 3NDJA 1T4DA 2DPHA 2NV6A 1T24A 4BO7A 1ZH8A 5ITVA 1AHIA 1CEQA 1DSSG 1SEPA 3PGXA 1FXSA 2CVQA 3KXDA 2D4AA 4IZHA 4B3IA 2QRLA 3H9JA 1F12A 1P1JA 4EJ0A 3ASVA 4HX5A 2CNBA 3QSGA 1WPQA 2DTXA 3O8QA 4IXTA 1H2HA 3H9UA 1YS4A 3JQBC 3ZU4A 3QV1A 3W4IA 4FPXA 4N18A 1NVMB 4KP7A 4QO8A 1VM6A 1UZLA 2P5UA 3OBBA 4L4SA 2I9PA 2HDHA 5L45A 3V1YA 4CMBA 1X1EA 2OBNA 4OKIA 1ZEJA 3CZMA 4EZBA 1WDMA 4HUJA 4NBVA 5B4VA 1BVUA 1E1LA 2DBRA 4LK3A 3WR5A 2Y67A 3BHIA 3LQFA 3BTOA 2NM0A 1FDVA 2ZYGA 2R6JA 4MKRA 1E3JA 4YPOA 3H4VA 4BGUA 3GT0A 4GMGA 1XR3A 2C7GA 1SPXA 4CMCA 4JIGA 3DHEA 3BZUA 1HLDA 3BHJA 3LSYA 3NTRA 1CRWG 4UEKA 1YH3A 1VL6A 5THQA 1LDGA 2VOEA 4TZTA 5T5QA 1PGPA 1N1EA 2BFMA 3VKVA 4PG5A 5CEJA 1HRDA 4IBOA 5L9AA 4WLOA 1LA2A 1DAOA 1I2ZA 2PZJA 4IGFA 2X0JA 3WICA 4CR6A 3PZRA 3PWSA 3FN4A 5FI5A 1ORRA 4D41A 3SX2A 1HDOA 1NWHA 1UR5A 4YACA 2XAAA 3T7EA 1HDZA 3FNEA 1UJMA 3K92A 3WQSB 1KY4A 4J9VA 4WLFA 3PVZA 1NQAO 3ENNA 4FBGA 1E77A 2PH3A 4CQLA 4GBJA 5IXYA 4IDCA 1L7EA 3F5QA 1Y9EA 2JCXA 5I9LA 3OQ6A 4XYBA 1YOVB 1R4MA 1WZEA 1LX6A 1LSOA 3AOGA 3BMNA 4BO1A 3FTPA 1VSVA 3VDQA 3E82A 5T8KA 3RWBA 1GR0A 3I3OA 5B37A 2VQ3A 1YDWA 4ND3A 4P4LA 4CODB 3AOEC 3LC2O 1LU9A 3EDMA 5IN4A 1KEWA 4IDDA 5L4LA 4GL4A 2PZKA 3V2HA 5JMPA 2NVUB 3RIHA 3U3XA 3HG7A 3W6ZA 4BGEA 2V6MA 1EEHA 2O3SA 3OIGA 4Y8VA 4YTEA 1Y7TA 2WTBA 3GGPA 4J4TA 3WWYA 1C14A 3BMQB 4K26A 2GYYA 5AXBA 1NYTA 2POQX 2GN4A 3GC6A 4ZQGA 1KOLA 1SEVA 5FF9A 2O4UX 3GGGA 5KWEA 1WP4A 4J0EA 3TFOA 1L1FA 1N1GA 4C4OA 1I3LA 1CQJA 3JQ9A 4IDAA 3CEAA 2AE2A 3JD2A 4Z0TA 2C2XA 4XYEA 2O7SA 3KLPX 3HB4X 4L75A 1D1SA 1PS8A 5JCJA 2IXAA 1YVEI 1SZJG 4OXKA 1D4FA 4WCFC 4WCFB 3OP4A 5CG1A 1XQ6A 2Q2VA 2WD7A 4J0FA 3I4CA 3I9NA 4S3MA 4A10A 3RC2A 1XHLA 4AJJA 4FOSA 4DLLA 1N9GB 5FEUA 1HSZA 3RCBA 4B4OA 3QIVA 3FNHA 3TRIA 3C1TA 5JY6A 1KERA 2NVWA 5CDSA 3ZWOA 4ZHSA 3BMCA 3HB5X 4J2OA 5A9SA 2D59A 1LI4A 3DAPA 2NTJA 2ZJ0A 3U4CA 3TZCA 1PZEA 4AJ1A 4B7UA 3RC1A 2ZK7A 1K3TA 4R3WA 2Z5LA 5ITWA 5L3ZA 3OA2A 4OO3A 5DZSA 3RU7A 3Q2IA 4MP8A 5A9RA 1EFLA 4KDEA 5ER9A 1UXKA 1HDCA 2GUGA 1UUFA 3JD1A 4FD3A 4O0LA 3ZHYA 4EBFA 4XGIA 1BG6A 3IMFA 4JLWA 1PJQA 5HS6A 3AI3A 4J43A 1NFQA 3H5RA 4MVJG 2VWQA 4I08A 4FFPA 1H6AA 1IHYA 1OMOA 3DAFA 2I67A 1H0KA 5KJFA 3VPFA 1IYZA 4U0KA 1PR9A 2AQKA 3JYLA 2P2SA 3NV9A 4CPDA 3X2FA 5COAA 4OM8A 5H83A 2C0CA 1W6UA 1Y5RA 1D3AA 4Z6KA 2VRBA 2X5OA 1EFKA 3P2YA 4PCVA 2VCYA 4YCAA 4DIFA 3I9MA 3CINA 1ZK2A 1PQWA 3L0DA 1HTBA 3VPSA 5JMWA 4PLVA 2HMSA 5FFFA 3E5RA 4FFOA 3HDJA 2AE1A 3PJEA 1JTVA 4RJTA 1SBYA 4WLVA 4EUFA 3PI7A 1VE9A 5JLAA 2GF2A 4CM9A 1OFGA 1LDNA 4YVFA 2I3GA 3PTZA 1IHXA 4A2CA 5TF4A 1WMAA 2GZ1A 3KEQA 3TOZA 1X7DA 4FN4A 2EP7A 2GPTA 4CLDA 2GO1A 3WGHA 2VHXA 4LCJA 3ZNNA 3KYBA 3DOOA 2YDYA 3A1NA 5LCXA 1IZ0A 3B6ZA 3JQAD 2XPCA 3OFSA 1U2GA 4GGOA 4N5NA 1UAYA 4DMMA 4PLHA 4Y67A 3WBBA 1TT7A 3TWOA 1EK6A 1YRLA 2DAPA 1A9ZA 3FCOA 1BXGA 1B26A 1V9LA 1H5QA 2EG9A 4MKXA 4D79A 2A94A 1ADCA 1ADGA 1QMGA 1JU9A 4FFRA 4GLLA 4KUGA 3WG9A 4CR7A 4DMLA 1SB9A 4KUHA 4J6FA 4L0QA 4RQTA 3TF5A 5DOVA 1DAPA 3GDOA 3L77A 1W0CA 1SCUA 2AQ8A 2PGLA 3GQVA 4N7RA 2RCYA 4BQPA 5I9MA 2Y1GA 3A28A 3F3SA 5JYDA 1EMDA 2E6UX 4K1LA 4WEQA 2W90A 3M6IA 4FW8A 3ZNPA 4BOYA 1O6ZA 3ROQA 4J1SA 5GZ3A 1J4AA 3DDNA 3E5MA 1NHGA 4KTVE 4CLOA 2I99A 3V8BA 3VVBA 3OICA 1NR7A 4GWKA 4WLUA 1ISFA 4BNYA 1R0KA 4PRLA 3GZ4A 4RPLA 2J3KA 4CMIA 3DBHA 1NBOA 4J9UE 3S2EA 3GA0A 3ZH2A 4YAEA 3VPXA 3WTCA 1VL8A 3WGZA 2WM3A 3WSVA 5KJCA 1GZ3A 4NDNE 3QWBA 4FIZA 2NSDA 4B79A 4BO9A 1IE3A 1N7GA 4XIJA 3RUEA 2FPIA 1KVSA 3WYBA 2YHIB 2EJVA 5HA5A 1BXZA 3OMLA 1MX3A 3ETGA 3WTBA 1U1IA 1VPDA 2I3AA 4KQXA 5CG2A 3TL3A 4U8GA 5TS3A 2GCGA 2X9VA 3ZWPA 5KJEA 4XYLA 1JAXA 3NJ8A 4AJIA 4G81A 1ONPA 3KYDA 1I33A 3MJSA 5A3VA 3CUKA 3ZHZA 5I7FA 2EV9A 3CXRA 5AXCA 2JJYA 4PFJA 1FJHA 2BFOA 3I9LA 3UW3A 1X14A 1WZIA 2HMWA 1CJCA 2H1SA 4A73A 4RF3A 2XF8A 3ANNA 5B4TA 3C8MA 8LDHA 5EINA 3D5TA 1ZIDA 4DWVA 3ROMA 3WLEA 4NZ9A 3PYXA 5TSDA 3K5PA 1MLDA 1PJLA 2V6FA 2Y05A 3JQAB 2BRUA 2QIOA 3BTUA 4WEOA 5TC4A 1GPJA 3OJOA 5HRUA 2HJRA 3IDSA 1ZMOA 4CMAA 1X7GA 2YYYA 1CWUA 4CM6A 2HMTA 2P9GA 5TJHA 4DIOA 3QVXA 5HWSA 1GFSA 3OHSX 1UP4A 3U4DA 3W4KA 2VNAA 3W6UA 4DC1A 1HE5A 3VZQA 3HZZA 3E9QA 4IDBA 3R6DA 1GYRA 1ULSA 1DJNA 1J0XO 2YZ7A 1G6KA 2VUUA 3DWFA 3QVSA 2EGGA 5JDIA 1WWKA 4ALLA 5K6AC 4JJFA 2CY0A 2YW9A 3JQ6A 3P19A 3SEFA 3EYWA 2W2KB 1LQTA 4BGVA 1KBZA 2RH4A 2G0TA 4M55A 4J7CA 3RBZA 4BHTA 4DVJA 4RVUA
chains in the Genus database with same CATH superfamily
3N8KA 1U2DC 1NQVA 3OF5A 3V48A 3VC2A 4KBYA 5M7EA 3M49A 4A8HA 2BFBA 3LCCA 1DT5A 2FE1A 2ZSKA 3HNRA 4IILA 4OXXA 4QVKA 1SCDA 1U0RA 3R0JA 2NVBA 1E3WA 1H4SA 1ISSA 5BSGA 5J2TA 3GLIA 3QBTA 3VAYA 3ZJUA 4D5GA 4FOLA 3KUCA 2QNBA 1MA0A 2YVQA 1JZSA 4M9SA 4YA6A 3L4SO 1EDBA 1Z3CA 2UYGA 2YWFA 3R5SA 4WLNA 3WGLA 5D3QA 3U19A 4MIKA 4OQNA 3V1KA 3N5KA 2LTAA 4OI4A 5DT2A 3HXKA 5L6LB 3WL7A 3IP1A 1ZESA 6REQA 4YJ2F 4LZJA 4KR3A 4Y9RA 2GPYA 3IESA 3WDSA 5EXEA 2IHYA 3NM4A 1UM9A 1CPYA 3DWEX 3VFDA 2PYZA 2ZI6A 1WBDA 5CM8B 3OA0A 2GXUA 2QDKA 5CYPA 5ALVA 3I61A 3TLYA 3QNUA 4OUDA 1G19A 3RHFA 2GEJA 3CRNA 1XRMA 2NYAA 3ESCA 3PPYA 4LJ4A 5F5NA 2M6RA 3K73O 5D7BA 3M3HA 2ZIAA 3ZBQA 3QUQA 4E08A 5SYAA 2V3WA 4GPAA 4WOKA 3EVBA 5EGSA 3V80A 2FPGA 2Z98A 2PUWA 3O92A 2QM8A 1C29B 2Y68A 1AGYA 2IDZA 1NJ1A 4RWEA 3K7EA 2QRJA 1Z07A 3KXKA 4O2AF 2G9NA 3TJMA 5A2GA 4LJAA 2DU8A 2RIRA 2P0EA 1HE2A 2I6FA 2VXYA 2VP6A 4JU9A 3R8XA 3UKOA 4GSLA 5KKNB 1QRDA 2R1VA 3DVQX 1N2BA 2PO7A 2HDOA 3R7FA 2WWXA 3SS7X 3DMDA 4R84A 4AO6A 4BAUA 4CIWA 3K70D 2P67A 3GLFA 4JSYA 3UJNA 3TW4A 3DA8A 4MVJD 5IZ4A 1GPYA 2O14A 3RNLA 1C3OA 1X3LA 2HA3A 4YQEA 2PLRA 4OHXA 1U0BB 1VP9A 5IC4A 1JALA 4XTRA 2AJLI 1F2TA 1MO6A 3GFVA 3RWMB 2JLAA 4GRIA 1K5GA 5K01A 4DYHA 2PJDA 1UPBA 2NTYC 3PRHA 5HBRA 5C8VA 4WL0A 4I5FA 1SC1A 3QI2A 4LDPA 5EZYB 5K8VA 1QHHB 4TZKA 4FW9A 4LPSA 2ON6A 4OHMA 5JXHA 4C1NA 2O8EB 1L4BA 2AFHE 2Q28A 3T95A 2HUNA 5I7VA 4DQVA 5EQFA 3UO8B 3OHPA 5IEBA 2OV3A 3VR2D 4UNRA 3EDQA 4OBBA 4YUZA 2JGIA 2RGWA 1N6NA 1Y9AA 1NR1A 1JH8A 1RI3A 1SC9A 2A88A 3G88A 2ERXA 2QUHA 2JI4A 2ZJ3A 1L4FA 3LKBA 2BFDB 4OXQA 3R75A 1IK6A 4KXVA 4AZTA 4DIEA 1QHGA 1YONA 3BMXA 1ITZA 4KO4S 1JEYA 4Z4FA 1UMCB 3K9FC 3N8HA 1G1AA 4RMNA 1JECA 2FRDC 1P80A 2JCYA 1RMTA 3CUTA 4FOPA 4IPTA 4DGSA 3NHMA 3RTBA 4LC0A 3SXJA 4EYEA 2EX0A 3ZK8A 4JELA 1LKZA 1BWRA 5JZ9A 2B98A 3W05A 3HWRA 5CBPA 2C4VA 4WNAA 2DJ5A 3KOYA 1E7WA 3KBOA 4KOEC 3GGJA 3DEJA 5HGJA 4RO0A 4E12A 4D9HA 5DWDA 1SXJC 2WD9A 4TS9A 2JLCA 2FAXA 1BN6A 4L9RA 2GHTA 4J75A 1COZA 6Q21A 3U4MA 4TLBA 2BKAA 4ZZIA 1HT0A 2Z5VA 2VBIA 1ZMBA 1S8AA 4FZJA 1CVRA 4NP6A 4HCJA 4UAUA 1RI1A 3QEAZ 3IDFA 1OPXA 2RB4A 3LSTA 4FHGA 4RAQA 4WNYA 1XKTA 1XTZA 1A3CA 1N2XA 2I5PO 3B9PA 5GGYA 5JYEA 1FLVA 2NT4A 3GJSA 3CEJA 4JJ7A 3MCTA 1VBMA 4B7CA 4MO9A 4Y2VA 1WJGA 3Q7IA 2UKDA 2BL4A 2Q8QA 1MRNA 4JI6B 4DG9A 5IFLA 3NIBA 2X6RA 2XHEA 3NC0C 1FFDA 1WW3A 2ZSFA 3COPA 4H3KB 4YRMA 3CE9A 1JDPA 1TLLA 1PT6A 4TX1A 1JKFA 1QDUA 2LCFA 1SZDA 3L7CA 3O90A 3Q5DA 3FRHA 4MWEA 5T6MA 3EMVA 4RSGA 4YYEA 3K70B 4TYYA 4MNTA 5HZHA 3ZS8A 3AM1A 3K4HA 1U0LA 4MHOA 4NLLA 4YJHB 1DEAA 1ABBA 4UXJA 3HBNA 4IIVA 3RUIA 5AVOA 4K40A 1MABA 4LRTB 1P33A 1UFQA 2VC2B 4MQLA 5CJPA 3RJ9A 4ID9A 5H4GA 2RGRA 2Q6LA 4DB2A 3QQPA 3G8DA 1M6YA 4ZDIA 2YTZA 3MJVA 2J4FA 2PQ2A 4IKPA 4NFLA 4EGFA 5JAMA 4AX4A 3H9BA 3EGXB 1Z33A 1B8PA 1IOWA 3GBVA 4ILKA 4M8IA 2I4TA 3GH1A 5MN6A 3D6HA 5BQFA 1XDSA 1GNTA 3F4BA 2YMPA 3FYDA 1PL0A 1IBSA 4RZIA 3OCUA 4RE5A 3H2SA 3DBRB 3AI7A 4BN4A 3MCZA 2XZLA 2ISQA 4G41A 1XRNA 2CCJA 3JVUA 1VTKA 3OF2A 3OVMA 3Q88A 3PP8A 3LNCA 1Z5WA 2FLWA 3U3ZA 2JC3A 2QX8A 5AKIA 1M2HA 2JHAA 2HCBA 2IZ1A 2PKEA 4GQAA 4BP8A 4MV5A 4L0DA 3QWIA 1YASA 1HEYA 1OWNA 1NNUA 3IR7A 1YGYA 5HKKD 1L4KA 2BM0A 2O7VA 4RTRA 1XB2A 3C24A 2J3DA 1J2EA 3UAXA 4KFTA 1WB4A 3ADPA 1O0CA 1NBMD 5H70A 5A02A 3A05A 4J16C 5F76A 1BDMA 5ELMA 4MV9A 4QDZA 4OI1A 1E1MA 1YL6A 1CE8A 5L95A 5AJVB 3TKAA 3FOZA 2WB4A 2LKCA 3GZTB 4J49A 3T1HB 2AKAB 3TX2A 5P21A 3BJZA 3UMJA 3ZQ4A 1BW9B 5ADHA 3EEOA 2Q4TA 1J90A 2XDAA 3DEHA 1XTIA 1YVDA 1ZVMA 3HV2A 4A92A 1KFEB 5DH9A 2GAFA 2FFAA 3H5TA 1YL7A 3AVTA 2QTGA 3AM3A 4S2EA 1CW2B 2W48A 4TLAA 2EWMA 2LV8A 1ENPA 2CVZA 3QLTA 1VGRA 4RFSA 3B6EA 2C77A 4GRDA 3TFQA 3HEBA 1SG6A 3BD7A 4DV6B 1E2UA 1FUYB 5DTMA 1E9CA 1ZICA 2CNWD 3ZOKA 1TF7A 4OJQA 4BNIA 2ESRA 4IUYA 3W79A 2HU7A 2NP7A 2VZ8A 2A0XA 3KSRA 1FSFA 2A1UB 3JWJA 3ZK9A 4NTZA 3EZYA 1UZMA 3P2MA 1XVVA 2HGSA 3I01M 2HSWA 3UOGA 4A26A 4AL4A 4DDMA 1TFUA 4GMFA 4BX8A 1SU7A 1AHNA 4IY1A 1P6QA 4X1IB 2ZLBA 2I78A 4FYVA 3IAFA 1BDBA 1M75A 4YMGA 1Z56C 3JZFA 2XMQA 4ZN6A 2IT1A 1PR3A 3CX8A 2LGJA 5A4DA 4PG8A 1X1TA 4J1TC 2B8WA 1W581 4W7HA 3KL4A 5SZIA 4GPD1 3SIPA 3L6CA 8AT1A 1OJ7A 2PMKA 7ABPA 3DKRA 2VNKA 4UASA 5L3RA 2F43B 2B94A 1QYXA 2BP7B 2XUKA 1PW5A 1KYWA 3C6QA 2B0CA 3N07A 4QOHA 3ZVKA 1A4RA 1W1WA 1YJXA 3GA7A 4LGMA 4B6OA 3V8QA 1APBA 3STXA 4CYMA 2O8VA 1WUYA 2VYFA 1Z82A 5FI0B 2D2IA 1JWBB 3AVVA 5CDYA 1E66A 3ZVRA 1BKSB 4J90A 4RVCA 4FHDA 3CZ5A 1WXDA 4MW0A 1GUDA 4NBNA 1KPGA 1FMJA 2BW0A 4I0WB 2RI1A 4MQFA 3L7BA 2ZPAA 3VU9B 4B75A 4D3YA 1D09A 2IEIA 1U1GA 2DQSA 1JYEA 1BX0A 1MO3A 1X7XA 2PT7A 4YIKA 1SHJA 2IWHA 4E2ZA 1F5SA 5LQDA 2F90A 3BHNA 3HFSA 3HUUA 5B6PA 4PTZA 1AO3A 3AEUB 3RF6A 1JHYA 1ZSNA 1FTNA 3H11A 3VHXA 1DJQA 2B8NA 4NY1A 1D8TA 1MRZA 4XYGA 3T7CA 1ZUD1 4P81A 3V6LA 4URWR 3NHUA 3WNBA 4KLZA 5DM4A 2QN1A 1LTQA 4ALKA 3LQKA 1XDZA 3F0TA 1XU7A 4JLUA 2FJUA 1XL0A 2V5UA 3FIJA 3H5OA 3L6RA 1I6MA 4EEKA 1V8BA 1OAKA 5B6IA 1U7TA 2O5EA 1NPYA 2EJTA 1ECPA 1MMFB 2PXAA 2ZE8A 4GOLD 4UVHA 5E4JA 4AF6A 5I4BA 2ZRPA 4WK0B 5EIBC 4CUKA 1RXIA 2WUDA 2PQ6A 2GD6A 5CT4A 5LBUA 4F4FA 5A4MS 2RBGA 3K09C 3DZHA 3A36A 4U2EA 1F8FA 5KEIA 3VJLA 3I28A 3NC1C 4DCJA 2E6KA 3QHQA 2WWIA 5FEMA 1NW7A 4DMHA 4NV3A 1JLSA 1YULA 2CYBA 3FFWA 1GZUA 1TO2E 1I3OA 1MHPA 2V6BA 2Q5HA 4IRMA 4L8GA 4NNPA 5F1OA 4QULA 4W6ZA 3ZU3A 4DLBA 4AKIA 7ADHA 3WRXC 1LPNA 1QGED 4PPQA 5B7GA 1DCFA 3THYB 3W90A 5IS2A 4C5CA 3MUEA 3KKOA 3S2IA 3GIWA 3PCRB 1J2UA 3VJMA 4C4TA 4H18A 1Z37A 4DCSA 2GBCA 1ULUA 3FWNA 3PGMA 1QHEA 2OGUA 2I1LA 3RFUA 1GZ5A 5D3ZA 5A4FS 1ZR2A 2V54A 4GIBA 3GD5A 3U09A 2OYCA 4S24A 4XM1A 3UUEA 4ZT3A 1SD2A 2J6HA 1KEEB 1PCXA 1QYWA 1A9RA 2H51A 2UYQA 2V8BA 3VC7A 4BNKA 3GOHA 3QU5A 4HDAA 9MHTA 3JD4A 2XRMA 5TQJA 4HNAA 4O1IA 5FAXA 3HCPA 1Z63A 1YR1A 5CHEA 4V0NA 1F8UA 4WZBA 4YIHA 2BLLA 1JTEA 3C4JA 2H0QA 2ZT6A 4L8LA 2QT1A 1KY5A 2YIDA 1OAOC 4MPRA 3D6JA 3PRYA 4QQRA 4R7ZA 3A7DA 1F8XA 4OGLA 1YVUA 5BQ5A 4ESEA 1UWVA 2DUWA 2O52A 2VWPA 3IAEA 1P2SA 1FVOA 1L5FA 1B14A 4AC9A 3LUAA 4OQ4A 4FGWA 3UTCA 1QB8A 5K5EA 3WGIA 1SKBA 3TPZA 5LA6F 2WIKA 3G7NA 4NESA 1ICIA 2UVQA 4PC3A 5TQVA 3DM9B 3TNDA 2I6QA 2RKWA 2YV4A 1OHHD 1B0AA 3RSHA 4CCAA 4TYWA 4GPBA 1DO8A 1JIUA 5A3SA 5CB6A 5LNK1 3PC8A 3Q8MA 2JCVA 4P5EA 3WDMA 3SSAA 5JW6A 1BE1A 1I01A 1RP7A 2I7VA 3SOZA 4MUFA 2DB3A 2OWDA 2Z5GA 3AFHA 3IA7A 4LF6B 1ID1A 4OQDA 4I4TA 3GPBA 4IYRA 3O03A 4ND7A 2DFKB 1L5YA 4RKFA 3DZKA 2P35A 2R60A 3MS2A 3T12A 1VCOA 3IDOA 4IH4A 4N40A 3ZYZA 3PFGA 5JQGF 2J30A 1JG3A 2P1ZA 3QFRA 4J7XA 3ER9A 3LCUA 3CU5A 1ZVJA 1A5AB 1TM7E 1T8TA 3BILA 4HWTA 1EI9A 4R2XA 3A6EA 5IUKC 3ADDA 4TRJA 1FA9A 3RSZA 3QNMA 4KXXA 2XX3A 3EXHC 1NNI1 1PG5A 1YFKA 1JH9A 2HHJA 4Y1EA 4ZQIA 3LT1A 5DASA 2VZ9A 3MA0A 4B2YA 5BW8A 5EP4A 1Q20A 1TM5E 2VA9A 4IIBA 2V4ZA 1I32A 2GARA 1RQGA 2FN3A 1E2DA 4YJ3F 3JALB 3EAGA 2HWYA 1ZINA 4MS3B 4DR1B 1W4ZA 4ZYVA 3P26A 1E98A 1NTRA 3PK0A 3UHAA 1JE1A 5JXWA 1KAEA 5DM60 2C2OA 2LWIA 4YAIA 3HJHA 3ETCA 1GDTA 2PKXA 1U0JA 3F73A 1NLYA 4C06A 3QXXA 2PRYA 5AVZA 1RQ2A 1TTPB 1Z16A 1RQPA 2HA2A 1I5EA 1GPH1 2Y3IA 4CNBA 4Q9KA 4QOJA 4B4VA 4FINA 4INAA 2CKMA 2AI2A 2HBQA 5REQA 4ZI7A 4BQEA 1EWQA 3GFFA 2YJ3A 3G3EA 2NSJA 3EJ6A 4JZKA 3W3AA 5TRTA 3KZCA 1GTRA 2I03A 4KO8A 3HM9A 1SRQA 4MV8A 1OWPA 1VRCA 1E9VA 3MCAA 2XEDA 4YGXB 5LYYA 1X0XA 4GOND 1X1DA 1GU7A 3BL6A 2GWRA 1ZJZA 3ELBA 3G5LA 3UHPA 3IKMB 4WCDA 3VU3A 1Z06A 1Z4IA 4IAOA 3WGUA 3TGPA 3G0GA 5E8RA 2ADFA 5BMVA 4WOPA 3V6MA 4CDGA 1KEUA 4KWEA 1P0MA 2BFCB 4RHXA 4NU0A 1QO0D 3NVDA 3PEYA 1GNVA 3JWGA 3OURA 1RMYA 3KG2A 4JJ6A 3AF1A 1RWVA 4P3NA 5FB3A 1QCZA 4C4RA 4ESOA 5A3RA 2YCLA 2G1PA 2HI0A 2TECE 3LF2A 4NMMA 4UM9D 3AF6A 2GKSA 2XUHA 1B2RA 1FTSA 1QFMA 1V8DA 4JJ8A 4DR7B 4YI3A 3E15A 2G5TA 2I4MA 3NLLA 1AS0A 2BCJQ 5ERGB 2CZQA 5EVJA 3M2TA 1R8SA 2EZUA 9GPBA 3V46A 1GPBA 2Q8NA 3IPLA 1TGVA 4BCDA 4YAWA 3GJ8A 3Q7PA 4EHAA 2JGMA 1EP1B 3F5DA 3GU3A 2A4KA 1PWHA 2DUMA 3OSUA 4P22A 5AK4A 5FBZA 1S0UA 3I9JA 3OLYA 1UINA 4XDZA 3VMMA 3WXBA 5H80A 4QX6A 4ARUA 2VP9A 3DP7A 1ESEA 1P61B 3CR7A 4XJXA 3ET5A 3OPMA 2VDNB 2AFHA 4RESA 3C6YA 2ZS9A 3P2EA 2JCSA 4UDYX 2O6HA 1X7YB 5BQOA 4I3HA 4CKBA 1DXYA 4DA0A 5K0GA 2Q9BA 3UFBA 5IXSA 1PGNA 3A1DA 3CGWA 5HKBA 3C41J 3KZVA 1URPA 5K8TA 1IHDA 5C5CA 8MHTA 4OMUA 4DLXA 3QFHA 3ROXA 3D0OA 1DKNA 1ZSYA 3LYLA 1YU6A 1Z29A 3K2EA 3BL5A 4HDCA 1A27A 5D2CA 5ES4B 1M0SA 4J7AA 4QGGA 1U04A 2N1BA 5THXA 1Y9DA 4ZYLA 1R88A 3OT1B 4OJTA 5LM3A 1O87A 2YWBA 1DNPA 5IMBA 1ACLA 2QTWB 3R5FA 4HLUC 5LZ5A 5JJLA 4N76A 2WU3A 2JHFA 1TEHA 2LIVA 2ST1A 3EIXA 3OLVA 4JA2A 3V3TA 4A0QA 3E22B 5FLXA 3W3AH 4EPTA 1KH3A 1RW4A 3MB8A 4TN5A 4XIIA 4WW0A 2NUAA 3VV3A 4HX9A 4YCBA 3EEQA 4XRRA 1L4EA 1UP7A 4PLPA 1WCYA 4XLZA 1M1ZA 2C83A 1J9EA 4Z7JA 2V7TA 4E09A 4IRUB 1C9MA 2I6TA 2X0FA 3C98A 3NWOA 5DNUA 3JVVA 4GI7A 1JFRA 2JATA 2JLUA 3SCZA 2WTXA 3OEYA 2FUEA 2P6OA 3OQVA 1N8TA 4TWIA 3P4UA 3BGOS 1VKRA 3DVRX 3EY4A 2INGX 4AVYA 1W0KD 4MP3A 1EPUA 5DNEA 3WBKA 1FFCA 5IU6A 2OBYA 3FJYA 2HNKA 2TSYB 2WJHA 3KHUA 4ZCQA 2XEXA 4D8WA 2DQZA 1FYFA 4F72A 4HAYA 1WVIA 1AVTA 3HO1A 2PRIA 3H4MA 3G6WA 3KJHA 4EDFA 3NALA 4CLOB 2ZTHA 1XTSA 3NV7A 1ZU4A 4V0RA 1D8AA 2GM5A 2VHTA 1XO1A 3BZBA 3JD3A 4O2RA 3X1DA 2DFVA 1QE0A 1G6HA 4DFDA 2X22A 13PKA 2GRUA 2GSWA 4LY0A 2H0RA 4NENB 4R1MA 1XZLA 4BAZA 1OREA 5BV1A 1FU4A 2VKTA 1THGA 1REQA 3GZNA 5AICA 2HWKA 2FX5A 1E3EA 3R40A 2H2DA 2P9JA 1WMFA 2FPSA 3JPYA 1DO2A 3EARA 3QXSA 4P38A 5CK5A 2X8JA 1TAGA 3AVOA 5IARA 3ZV5A 4BNGA 4U3JB 2GJ9A 1IHPA 4UNSA 5T7BA 2JIBA 5ES3A 3S27A 4XPZA 1RXYA 2FG5A 1T3LA 4AJNA 2C9BA 2W0SA 1NN5A 5ALPA 3TRJA 5K3CA 1CRLA 3BC1A 3I1FA 4BQQA 2H5IA 1SUPA 4LI0A 3U7IA 4ZYZA 5EIWA 4NCBA 2LPMA 4JUIA 4TVBA 2BHTA 4PHHA 3I5AA 3ETDA 3MOGA 4TL8A 2G88A 4PCUA 4FR0A 3CT6A 7YASA 5MDHA 2IE0A 4UJ3A 3CPEA 1WV0A 4HXGA 2ZYIA 4WASA 5DRTA 1Y8RA 3ED5A 1DC5A 1P91A 4H2DA 4CLRA 4ONEA 2F55A 1I6KA 1KI3A 2D2FA 3CHYA 5EZ6B 3JASA 5KI6A 1W0JD 3PXEA 4WH0A 4MW7A 4BNWA 3NT2A 3WMWA 2XECA 4F91B 3QPUA 1R66A 1WW8A 5ERYA 4YJGA 3UQYS 4BKQA 1SGWA 3BA6A 1YNOA 3C8ZA 3NKFA 2AR7A 3HADA 4DLNA 2R86A 2VDQB 2QD5A 1WV1A 3ES9A 4IIGA 1MTOA 4A1FA 5HSGA 5D51S 5EI5A 2J9FB 5H81A 3WLFA 4ER3A 2BLNA 5JE8A 4LRWA 3A4VA 2O0LA 2V9PA 3AKCA 3BB1A 2IYAA 2WF8A 3NGXA 4OA5A 1KO8A 3O38A 2A58A 1U7HA 2B8JA 1Z4KA 1BEZA 3Q8WA 4M6WB 1SG0A 4MW5A 4KHZA 1IRXA 3VAZA 421PA 4C0QC 4E15A 2GO7A 1CQXA 1OIVA 5LR6A 4ENVA 3PD0A 1FNMA 4IJMA 2FW6A 2PUFA 4OEHA 2HFKA 2X6TA 2P2GA 1UZNA 2QDXA 2ZUTA 4GYYA 5LIPA 1Y6ZA 3A1CA 4EG7A 5CA1B 1C1XA 1GL3A 1UWLA 3RYIB 1SCNE 4HDKA 2GBPA 4LNUA 4N3NA 4YQZA 1JHZA 2AFVA 2AW5A 4RIFA 5FV7A 4PLYA 3TZHA 1RFGE 1AQJA 2ZB4A 2XI4A 4TMTA 1ST2A 2XNKA 3FDXA 2O3QA 3B38A 5JS7A 3BGDA 3IBSA 3WNDA 4BL5A 3UM9A 2HHAA 4F38A 2VZEA 3T9CA 4C7JA 4N4AA 4G5YA 1L5HB 1RXEA 3OF3A 1E92A 4KACA 4D43A 2PX6A 3QBEA 4AJEA 1JHVA 4CW7A 3HA2A 3RC3A 4AJHA 1L4YA 4GH5A 3A4YA 2O3JA 1BRMA 3GI1A 2W83A 3LGAA 4ZAVA 4UBOA 5JBNA 4JBHA 3FG9A 1OH6A 1TTQB 4AKSA 5AM5A 1U5CA 2C2ZA 1KC1A 5EQDA 3O8RA 4C05A 1RMQA 4QIHA 3MUOA 1SU8A 1TKAA 1BYUA 1FPMA 4GBED 4OL9A 4R1NA 5JPIA 3W6NA 5FTKA 1K66A 2GJKA 4MGKR 3D1JA 3QYJA 1ZC4A 2VHJA 5UKDA 5DT9A 1H4VB 4UD6A 4DJAA 4ZI3A 4XVHA 5FFMA 4ZK2A 5HM6A 2GH1A 2YH2A 3LDGA 3VR1A 2CZGA 1S7CA 3WO1A 2J48A 2PTGA 1CUUA 2HLHA 2JVIA 2Z2KA 3GJ3A 2XTNA 5EWJA 2YNMA 4LMRA 1VG0B 3GGDA 3P8ZA 4YT4A 4JR1A 2A1TS 1JR4A 3SSNA 3PQ3A 3V2UA 1Y63A 3H8WA 3U9TA 4KNWA 1TTTA 4MRRA 4YUVA 2W4QA 2F1HA 3D7SA 1QG6A 1JDBB 1K4YA 4AU1A 1KJNA 2ABWA 4ARAA 1RAGA 2J46A 1Q7GA 4RY8A 3K6SA 2EQAA 4I50F 2PSHA 3ZY3A 4CLEA 1KRWA 1S5PA 1X70A 2WJVA 4GE0A 2B6HA 4JQZA 3WK8A 4E2WA 2C20A 3DBLA 3JQPA 4HGZA 2Q1UA 3NUQA 3QQ5A 2CSUA 2ATCA 1ZRNA 2OTCA 2SHKA 1NZJA 3AHGA 3PXUA 4XPIB 3RC7A 4EF6A 3CISA 3G0IA 3FETA 4MVJM 2X41A 3FPFA 3MWLA 4G5QA 3HEAA 1IRIA 4WOCA 4OV6B 5EN4A 3W2EA 4B17A 1RIFA 1ZD3A 4DQXA 1M1YA 2LKDA 3GWGA 3ADCA 2KB0A 4TTTS 2ZATA 1EFDN 1K89A 1Y8QA 4QJIA 4XA8A 1GU1A 1X7WB 3HS3A 3TJRA 3KQLA 1QGUA 1QGZA 1K8XB 3BN3A 1C1HA 1JHQA 2E5FA 2VRCA 4PHGA 5ICMA 1PGOA 3TNYA 3T1NA 3GN2A 1XEWY 2ZIWB 1ESDA 3PGKA 1V5EA 1DAKA 1A8QA 2AJ8A 4UHEA 1YR2A 2R44A 1TLTA 2IEDA 2WINI 4ES6A 2ZM6B 3TZLA 1LB1B 1Y7LA 1LD3A 2LVBA 1KI8A 4WXEA 1GARA 1GO2A 2GJ8A 2DCUA 2HH9A 3H1TA 2Z1DA 1ISJA 1KNXA 3UMYA 1RAAA 2Y0BA 3FDFA 4DF3A 3BWVA 3E3LA 5JBQA 3NBAA 1R4NA 3B52X 5KYYA 1UQTA 1DINA 2RAVA 2PCLA 2FSUA 4CF3A 3K2IA 3WLTA 4UTNA 4DN6A 3K0CA 3IDZA 4FCCA 5KQMA 3M6UA 4J1QA 3TBKA 5LP6B 1VI2A 3U2QA 4MX8A 5BWBA 2JLBA 2XSZA 4LOLA 3UCEA 5I4CA 1SK8A 3VH1A 1MPTA 2PX5A 2WOOA 4R5HA 3RU9A 2BOVA 5J5VA 2FPPB 2GETA 3COYA 3U9LA 2YFKA 2RG1A 4RFVA 4M2LA 1O96B 2OQRA 2XGGA 3ROFA 3ZD7A 1DUVG 2PYDA 4NJMA 2HF9A 3MPOA 2BEUB 5H02A 5LQNA 4YB8A 3AK4A 4IZ6A 2NZVG 2YN4A 4KN9S 1C9NA 3LKDA 4HYTA 5DHTA 2DPYA 2FWAA 3KKNA 5GONB 1JF8A 3GL9A 1NUAA 3I9V1 5AOVA 3TAHA 1V3UA 4Y9DA 1SOAA 1T0BA 2OORA 3CLVA 1GTMA 1YI1A 3AHCA 3AP1A 3F7MA 3GVHA 5CFLA 2WABA 1ZUNA 4RHYA 2JGJA 1YQGA 1F8YA 3GEPA 3NFRA 1MBZA 1TU0A 4CNQA 4BIIA 2QD1A 5JHHB 3GRYA 5KX5F 5FWYA 3IAS1 4DOMA 3ZWVA 5BW5A 2YWRA 1Z3IX 3OZFA 1LJ8A 1UK7A 3V4SA 5IYZA 2EKZA 3QWFA 1KFJB 3MTBA 3O1LA 3T38A 1GQ2A 2HQSA 2REQA 1TB4A 4UDNA 4D4KA 3ZZUA 4BKRA 3M1AA 4TT8A 3JQGA 1SQ6A 4IGIA 4C6TA 1XQWA 2DWQA 3GLSA 2AV6A 3HLKA 4RPKA 2D5AA 4YT5A 1FIUA 3AP3A 5KYTA 1LSUA 3ND6A 3FFXA 5DWQA 5CU7A 3W4JA 2V6IA 3KUKA 3GRZA 4HAIA 3LX6A 1V0JA 1P2DA 4DV7B 2MWMA 5MFZA 2VP2A 1V71A 2B82A 2JAOA 4LVUA 3PJDA 2CW5A 3OKCA 1Q1AA 4EJSA 1CEEA 1OH8A 2DOKA 2Q50A 3DAHA 1OXMA 4HATA 2GBIA 4KIJA 5AUPB 3SDZA 1M2VB 3F4LA 3O9ZA 1MENA 1R00A 4QLBA 1Y9JA 3D6MA 5C8YB 1A72A 4H0FA 5HFJA 4DVGA 1QSGA 3BFVA 3OLZA 3WRYC 2QZ9A 4RD2A 1DJPA 3M6FA 4LZNA 2QL5A 3MF4A 4EB8A 1AIPA 1DEKA 2CSXA 4LAFA 4CT5A 4JYMA 4JK3A 2A30A 4MAFA 4S35A 3MTJA 4G5FA 5AJXA 5JZMA 1FDWA 5EL0A 3T06B 1GVNB 1HNWB 3AWDA 2ZIXA 1T2UA 3CO5A 3ICOA 4K1XA 4OJNA 5BV2P 2OV1A 1RXSA 1Z75A 2ODEA 4JR2A 5JSZA 3DXYA 3RIGA 1P4GA 2J5KA 3WNQA 3PG5A 5HS4A 3OPYA 4QOIA 2WW8A 2IOQA 2QENA 3CW9A 4ALMA 1JEAA 1QR6A 3VOBA 4EJSC 4EA6A 2VDWB 2AOXA 2AWNA 2QXUA 4O08A 5C5EA 4F45A 4TYNA 3U3MA 1OBCA 1TIPA 3W2HA 3JYQA 1Z7WA 5A2QA 4IRXA 2QU8A 5LWQA 1FF9A 4PQGA 3GVPA 3I6ZA 3IEKA 2P6UA 4LWPA 2P0YA 5IAJA 4E5VA 3BH7A 3ZGXA 1AKWA 1ACJA 4JUAA 4KQMA 2JFFA 3O21A 4QOEA 3KSDO 1X7HA 2QJOA 4Q02A 4ZVSA 4EA7A 1MX5A 2IY7A 3EUWA 3R09A 3WK5A 1WW2A 5BR7A 3OG9A 2WMDA 1KP9A 1RC1A 3VQTA 2YJ6A 3W5JA 2AUNA 5KOJA 2I4NA 3STTA 3KDAA 1AF7A 2VJKA 3EOAI 2EZ4A 4I9NA 4LISA 3KT6A 2HLPA 1RPZA 3QE4A 4BVJA 2P9HA 2XB8A 3JQ8B 4YEDA 1HYQA 3IURA 2BFAA 5K3BA 4RC9A 2OCPA 4O63O 3UMBA 3PKZA 4EY5A 2XA2A 1NI4B 2JD0A 2V3VA 5IM4F 4LRSB 5C7OO 3DOJA 3GEDA 4QDKA 4ZVOA 1CIPA 5CNIA 2OCYC 3QWHA 1ZN2A 3WLIA 5KUTA 5JDCA 2BGGA 1SK9A 1DMSA 1RABA 3DL0A 2Y1WA 1VI5A 3MVEA 5B3JC 5FL7A 3CKMA 2HO5A 1FZTA 2BR4A 2FZ5A 2IS1A 4QPPA 2G9ZA 5KWIA 2Q2OA 1CJUC 2WJPA 4NBKA 4PZ9A 4F9EA 2YWGA 3QMPA 3UAWA 1PUJA 3MTIA 3ZGLA 4C3UA 1KJIA 4M0DA 1U3FA 1GA4A 3IL2A 3PDIB 4FM9A 1T9KA 2C7VA 3ETEA 3GMTA 3B6IA 5B12A 1OC4A 1OH7A 5JEDA 1M67A 3C7KA 1JKJA 1W44A 1UPCA 5CD9A 2GEBA 4TV8A 3MFQA 4A2WA 5EJEA 2YWJA 5C0OE 4ALJA 1TUBA 2B6NA 2HBYA 3CB4A 3QLUC 3QVMA 3OIFA 2YWHA 2JEZA 4RS4A 1UBCA 3RK1A 1ZJYA 2HRRA 2EF0A 2ZJZA 1KVRA 1QWSA 1TM2A 1CRPA 1U1DA 1COWD 2GNAA 2NVUA 3ELUA 3K0AB 4OQFA 1JEQB 2VSYA 2ZIZA 3LBHA 3ZWBA 3QPDA 4E46A 1RPAA 2KI5A 4OHVA 1E5VA 3V4ZA 1J2TA 1Y8ZA 3AMVA 2HIHA 5JCJD 1JKIA 1QOQB 3SYKA 3ND8A 3WOHA 2JAQA 2PH5A 3N2KB 5DCLA 1FXUA 1T8RA 1BE8A 2P8SA 2XMBA 2XWJI 3BMQA 1QQ5A 1QX3A 3FROA 4BP3A 1CQWA 1LRLA 4QU5A 2RB5A 4NQZA 4MCJA 2RC6A 1QH8B 2IBSA 2YXLA 4ZDJA 3T1TA 1DMRA 1EG2A 1XLVA 4BO0A 4MINA 1DX6A 4E14A 3GROA 3UA4A 1G1MA 2VJAA 1QS0B 4MQEB 4Q18A 3VNSA 2W43A 3CEHA 2OFWA 5BPFA 4RELA 3QYPA 1XCBA 3KD3A 4CG3A 1IUKA 3U31A 2JAPA 2JRCA 2IY9A 2RK4A 4YY3B 4LYYA 3SLKA 3WOVA 1OLOA 3EGOA 3HI6A 3MS4A 3T4EA 4RJKA 1XGKA 5AHOA 3IPCA 3QU4A 1VSUA 4Y0AA 4HY3A 3KPVA 1XMVA 2Q9UA 4JVSB 1I10A 2PX4A 2QX4A 3BTVA 3FUVA 3R4CA 5AOBA 3RAPR 5KNLA 1A2KC 3ORHA 4GX2A 2VF4X 4ZVUA 4DGQA 4KAFA 3N6RA 4LQ4A 3JZIA 3FTFA 1SCIA 1H1LA 5DRYA 2FSFA 1QAOA 4BQRA 4Q01A 5T8KC 5JXGA 2XWSA 1ONOA 1WHTA 1G8PA 1TXGA 3TGLA 2GRAA 3HWWA 4Q9LA 1G291 1OYWA 1SXQA 3EULA 4PFQA 4JB3A 2OGWA 3NBUA 1YR9A 5L6MB 3C6XA 3AYZB 4KV7A 1BHO1 4KZKA 4AMBA 5ENZA 1PV2A 1D1QA 2BC9A 4I55F 5B1EA 1VBFA 1F6BA 1Z4QA 1GG5A 2W6JA 3KT0A 1PS9A 5J3JA 2PJZA 2PVPA 4OHPA 4A6EA 3TL2A 3UXEA 1RT9A 3EGCA 5HK8A 4G0NA 3IHKA 4TVKA 4U6NA 1T91A 1MKYA 2Q7XA 2Y1EA 3DLHA 4UMDA 3LT2A 1JLLA 1CUHA 2WTMA 3FPAA 2ZSJA 3M6XA 4LKOA 3GLGB 4MWTA 1OH5A 1FLDA 5EKDA 1OX4B 4QNRA 1QVWA 1PNRA 3KWFA 4L9WA 4QT4A 2VTBA 3BICA 4CR8A 3CB2A 4YT8A 1VG9B 3TMAA 1TAQA 2FMFA 4Y9SA 1P1RA 2QTFA 1C8KA 3KOXA 1SIOA 1QO7A 5EMKA 4CG1A 4Z3OA 1UZAA 4HEA1 1XMSA 1YIAA 3G2NA 5ALKA 5FH9A 1W4RA 4ROTA 5K05A 5CLIA 1P72A 1XTPA 4YUAA 4FSHA 1CIVA 3T7SA 4BO6A 1FP4B 3HCBA 4HTFB 2PZLA 1OLUB 4O4LB 3U1TA 1NR5A 3NBFA 1X86B 3PNMA 4PO3X 1MU0A 5JECA 3RG8A 3WI7A 1G5PA 2Q99A 2UZAA 4JKOA 4ARZB 4K86A 5IZCA 3L0OA 2AFIB 2ZT7A 5JZBA 4G4JA 5F77A 2XCLA 2NGRA 4GT1A 4XQ9A 2I33A 3ET4A 4WKCA 5J9FA 5ULLA 4L4XA 1G7CA 1PEDA 1V7PC 3K0FB 3Q2OA 4JYAB 4AD8A 2FEAA 3SQOA 3I6MA 3HCCA 1D2MA 3GNSA 4PWYA 4BC1A 2VEOA 3TW8A 3DXXA 4PS1A 1A76A 3L7NA 4U39A 1DFGA 1QYVA 1RAFA 2OC4A 2Q46A 3S2UA 2DJIA 3VAAA 1KYVA 1KIFA 3BVPA 5CVJA 5F1KA 4ZDWA 5BVHA 3REQA 3V4PB 1TT5B 1LI5A 1S2NA 1MW8X 4EHIA 2JFYA 2LNDA 2OECA 1BS1A 4M1OA 4CM4B 5LXTB 1KDYA 1I7SB 4ZTZB 4TKMA 2QUJA 4IUBS 1P7ZA 2XB2A 4GC9A 5TJ9A 1PQUA 5EVCA 4A03A 3QELA 1XMOB 2WAOA 5JRDS 2QD2A 3GAFA 3HUEA 2EC5A 2Y27A 3I9KA 3JTMA 3LU1A 1FSZA 3FZYA 3GO4A 4L0CA 4LMBA 4K6MA 1PL6A 4ALIA 3ZLTA 2R8RA 4KN5A 5BP7A 1Y4AE 3PUXA 4TYPA 1C30B 4DA7A 4XM0A 5AM0A 3EBOA 3NDRA 4Q34A 4RAOA 2Q3MA 5DBHX 5HJ7A 4R16A 1KS2A 4B46A 1M2NA 2FFQA 3FCCA 3HSYA 1WLYA 4Z8YA 4RU1A 2F64A 2BTQB 4R8KA 2AEMA 2AZ4A 3NYIA 1W52X 1AUPA 1EUCA 1XTRA 4UBKA 4C3ZA 4DIBA 3JRWA 4JOCA 4LHVA 1ZI8A 4HDSB 1P9WA 2AMJA 4C4XA 2KBFA 5KDDA 1Q0UA 1HNNA 2D0OB 2IGTA 2YIMA 3L06A 4QYWA 5DP1A 1JR3D 3EF3A 1TUEA 2YCBA 1WB5A 3ACDA 4NU8X 2W2MA 3NORA 5U9CA 4B87A 1ZOIA 3G7SA 1GAXA 2IVZA 2FEPA 3PNYA 4BFLA 1E7QA 1PR1A 2YZ2A 4EPVA 2D06A 2NADA 9LDTA 4Q3EA 1O6FA 4BFCA 1XQVA 3CRRA 1IY9A 1HLPA 1YSCA 2ZS7A 3NBYC 3O3NB 4TM7A 1IY1A 1YDFA 4B81A 4O4JB 4D3XA 2X14A 2CDCA 4OQMA 4BKOA 1LC3A 4MDEA 2Q8PA 3ZCTA 1G0NA 1H2BA 2FSGA 2V45A 3WO0A 5DX8A 2IXDA 3A6GA 1LPOA 2KPOA 1M7HA 4Q4HA 3K1ZA 4NXMB 3IQDB 4EK9A 3L79A 1N6HA 3MWDA 4KE9A 4RKYA 4FTWA 1V16A 3AZOA 3O1IC 4YK7A 2CUKA 1W47A 3K4QA 1A04A 3LBNA 5E2BA 3AVYA 2HU5A 4GMDA 4RDIA 3RUHA 4CUZA 3KQNA 4OHYA 2W6ID 2GCEA 2PY6A 4BVHA 5B2EA 3SIWA 3KQUA 2ODQA 4JUBA 4P31A 1YBHA 2XD9A 3SVZA 4B3JA 5HP4A 1W48A 4JMPA 1DBVO 2I2CA 2OVBA 2RHWA 3K6KA 3PFWO 4MROA 4ZT6A 4AMZA 1UBNA 2P9TA 4E0BA 1NMQA 1R4ZA 2ZRKA 1BXGB 3H19A 3KQTA 1H0RA 2WJYA 3KUUA 3MYYA 4L3WA 4ROSA 2WF7A 3BB3A 1BGWA 1NM5A 1USGA 4O4HA 1XFDA 4UEJA 2QS9A 1CERA 2AYYA 3FPBA 2HRZA 4CIYA 3ZN2A 2QBYA 2ZANA 3QPCA 1SQGA 4Y1RA 3S7ZA 2FEKA 1RD4A 4QFMA 5AOAA 4F92B 3UFXA 5CIYA 3NHSA 4I9HA 1F20A 1PNOA 2HTEA 2FLVA 1FC0A 1RWOA 2OKCA 4MPDA 4HNQA 3HYRA 4E2YA 3HCNA 5AVTA 3VZRA 1P7CA 3EIWA 4R3UC 4DCCA 1NUTA 2X2PA 1GR1A 5CPFA 1T5DX 4DUYB 1CJSA 1WMBA 1VYVA 5DW3A 1NI5A 4WXMA 2JCGA 4MK4A 1UEXC 4TMVA 1WKVA 2H4XA 3D2CA 1NBHA 2E4VA 1FTGA 1E1QA 2WFZA 3OZAA 4LPKA 3GH3A 5CDUA 1XRPA 2WUVA 1VGQA 1NQXA 2FG7C 4LIPD 5J2UA 4I4IA 1AURA 3TM5A 2HA4A 4BN0A 1ML4A 4EM6A 4TKVA 2O8CB 2OCKA 2JJ1D 3TFWA 3MJTA 3T94A 3NW9A 3ZHBA 1UC9A 1JILA 1HPLA 1JSRA 1RQXA 2W2LD