3BMCB

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and substrate (folate)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 91
structure length 248
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmcB00
3GVHA 1EE9A 1B8VA 3VPFA 3PFFA 5BSFA 1DOHA 4PVCA 3CMCO 1T2DA 1CF2O 2IXAA 3GGOA 3VOSA 3PLNA 4CPDA 3OQ1A 4CQMD 4L76A 4J9VA 3VDRA 4BIIA 4DC1A 5A9SB 2RHRA 3FSRA 2DTDA 1ZO8A 1R66A 4GGOA 2C2YA 5A05A 2W98A 2GLXA 4HY3A 4DMMA 4DYDA 3ST7A 4MP3A 3JSAA 4EZBA 3KEQA 1DIGA 2X0NA 1MXFA 2I99A 2YUTA 5JAIA 5I8WA 1N2SA 4XA8A 1SPXA 3L6EA 3U4HA 1RPNA 4YJHB 1YQGA 3V1YA 3I9MA 5HBRA 3HDYA 3JQAB 1F17A 3W6ZA 3ENNA 3F5SA 4ZJUA 2CF5A 3M1LA 4ITUA 2OO5A 3RFTA 3RC9A 4OYRA 5IN4A 2J8ZA 3BHMA 4Z0HO 1HSZA 4EUHA 1DJNA 1GEEA 4RL6A 3VTZA 2JL1A 4PRLA 2C7VA 1HWYA 3TPCA 2P4QA 2VTDA 2Y1CA 3MOGA 4PG6A 2X0RA 4NMHA 5DF1A 3JD2A 1EVJA 5A06A 3GVIA 1U9JA 3JQAD 4J0EA 3GNQA 4EEXA 1ONPA 2JFGA 4PLWA 1TB4A 1W0CA 3MJ4A 1HYHA 1MGOA 2NTNA 3GMDA 2BD0A 4OOFA 3VH2A 2XAAA 1BRMA 5T8KA 1TT5B 3W8FA 1O89A 4EUFA 3UHAA 3JQ9A 2J3JA 4YDRA 4RZIA 5ADHA 5JXWA 3A14A 1HE2A 5FFFA 3DHYA 1GL3A 4DLBA 1IYZA 3ANNA 2A94A 3A28A 2HDHA 3D7LA 3PIIA 4DBVO 3ZGYA 3HDQA 4MVJM 2QZ9A 1B2LA 1DHRA 4BO5A 3AK4A 1VL6A 2J3KA 4UEOA 5L3ZA 1BVUA 1RKXA 1IE3A 2VRCA 1Y5RA 3F5QA 4FOSA 3KV3O 3TDKA 1QKIA 4J49A 3QHAA 4GKBA 1AGNA 4IMRA 5CG1A 3KETA 1FXSA 3ANMA 5JAZA 2RH8A 1WP4A 1YQXA 3ZWMA 4YEDA 2E82A 3LC1O 2D8AA 4XQGA 4CM3A 2TMGA 4PLYA 1AUPA 2BF7A 4ALLA 1CYDA 2WYVA 3VH1A 3D64A 4QUKA 1ULSA 2VHYA 2FSSA 3BMOA 2CSUA 2E6UX 3FWZA 1XU7A 4BL5A 1E5QA 3WLEA 3JD3A 4GAEA 3EZYA 5G4KB 1GDHA 2ZYAA 4PLCA 1V35A 4NK5A 4U5QA 1DRUA 3PQEA 3FI9A 4R16A 3ZCXA 5IZCA 4XYEA 2Q1WA 5G4LA 5KKCA 1WMBA 3G0OA 2JD1A 1LX6A 2Y68A 1GYQA 1I36A 5DDIP 4YAIA 1IHYA 4KUEA 1N92A 4NU6A 3T7EA 4E0BA 3JD1A 3O26A 1XIVA 3C7DB 3OICA 1WLYA 1N5DA 3OJOA 4RVSA 1YJQA 3M2TA 4ILKA 4NBUA 4S1VA 2G0TA 4KTTE 4WCFC 3H2SA 3ZI0A 1U4OA 2VYVA 1DC4A 4R1TA 2R00C 3ZWYA 4QSMA 2FN7A 4Q3DA 4LRTB 3FF4A 1BW9B 3BIOA 1WDKA 5L7YA 5JSFA 1E1KA 4LISA 2PK3A 2D5AA 1WVGA 3S2IA 2X9VA 3FCOA 1OOEA 1EBFA 3F46A 2NM0A 4M55A 4HUJA 2GZ1A 5KVSA 3L9XA 4BNZA 4CR7A 1U3WA 3KYDB 4XIJA 1ZK4A 4BUCA 4JBHA 3GVPA 2FZEA 4BGIA 2B83A 4IINA 1EBUA 1O9BA 2BI7A 4GH5A 1JU9A 1P77A 4AVYA 4Q9NA 5KIAA 2DPGA 5H81A 2HU2A 2QG4A 3WWYA 1R16A 1BWSA 2Q4BA 4PGFA 1Y6JA 4UUPA 5CDUA 3H65A 1CETA 2HMVA 4ZD6A 1PR3A 4MPDA 2GASA 4NBTA 2GN4A 3QVOA 4ZICA 1ZSVA 2NSDA 1EUCA 2OP1A 3STHA 5K6AA 4EYEA 4ND5A 2H1SA 4OAQA 3VZPA 4WASA 4XEHA 4CM8A 2VT3A 1ZXLA 3TZCA 4F6LA 4WPGA 3VHRA 5CEFA 3WGOA 4PLFA 2NVUA 2W4QA 5HM8A 1A72A 2ZYGA 3PGJA 4D43A 4U6SA 4XZ3A 4HFNA 3SBOA 4NFYA 2O7SA 3OJLA 4Y67A 2J5RA 1LDGA 3H9JA 5L95A 1PWZA 1T4DA 1IHXA 1NP3A 1WMAA 3FNFA 4NJOA 5ES3A 1D7OA 1XU9A 1LTHR 4J4BA 1W4ZA 5CPFA 1BDBA 2OZPA 3L4SO 1IUKA 3QJ5A 4AJJA 3Q2IA 3AW9A 4NI5A 3WTBA 4BO4A 5KOIA 2AMFA 4QTZA 4A27A 1JA9A 3HN2A 1T2EA 2ET6A 4TMFA 1YBVA 3OA0A 1U2DA 4JX8A 4A5OA 1E77A 1F12A 4YT4A 3L4BA 3OP4A 5JO9A 1X15A 3QVXA 4D41A 5A4DA 4BGEA 2VWPA 3GGGA 4MKRA 4NNJA 3Q0EA 3RCBA 1R15A 3SVTA 5T8KC 1U28A 5DCWA 2X9NA 4JROA 4I08A 4DA9A 2VN8A 4WLFA 3JQ9C 3RUCA 4CMJA 3KZVA 1GU7A 1UZLA 2HK8A 3OFSA 4B7XA 5JCXA 3ABIA 3C1OA 4RF5A 3P5SA 2VHWA 3NJ4A 1NHGA 1PGOA 3R1IA 3V2GA 2PV7A 5ER9A 2BMAA 4HXYA 3NKLA 1SB8A 3GDGA 3L9WA 3EMKA 4IJKA 2QRLA 3BYZA 5T5QA 4KP7A 4ESOA 1M76A 4BNKA 4EJ0A 3H5RA 1FDUA 1IL0A 1AXEA 4JCOA 2BI8A 5AQ1A 3WOHA 1PJSA 3EHEA 2BGLA 4CMBA 1LLDA 4IDGA 1E7SA 3UN1A 1A7KA 1YB5A 4BV9A 5JNLA 4Y6PA 1Z7EA 3PIDA 3BHJA 1MFZA 2VZ9A 3RUEA 3SLKA 4BNXA 1MLDA 3WJ7A 4R41A 1RWBA 3BMNA 1JTVA 2H5LA 3TOXA 1X7DA 2J5KA 2WD7B 2DBQA 2HKIA 3DAGA 4LN1A 3JQ8B 4O1MA 4YQZA 4E21A 2FOIA 5BSEA 3WGTA 4FFOA 3INTA 3PJGA 4XDYA 2HJSA 1A5ZA 5JY6A 1DEHA 3A06A 2IZ0A 3WYBA 5IZCC 3T4XA 5T64A 4IQGA 1NPYA 2Q50A 4K6FA 3GDFA 2AQHA 2XPCA 4J7UA 3PHLA 2Q45A 9LDTA 3DFUA 4YT5A 3S2EA 1I2CA 1WXDA 1ID1A 2CD9A 4WJZA 4XQEA 1I3KA 3GUYA 3H5NA 4BV8A 4F6CA 2UV8A 4E5YA 2B5VA 3PQFA 4WEOA 2VQ3A 1XELA 4HWKA 4F3YA 1A7AA 3A4VA 4PLTA 3KYBA 4INAA 3TZ6A 4L8VA 1I0ZA 1N7GA 3NT2A 2DPHA 4H3VA 1Y81A 1KYQA 3D3EA 3ON5A 6ADHA 5KNLA 2IDZA 5F21A 4CM7A 4PZDA 4YR9A 3MWEB 1WPQA 4XRRA 3O8QB 5LC1A 4IDCA 4CM1A 1GCOA 3WX0A 3T7CA 2C07A 2IZ1A 2ZTLA 4FJ0A 4OGWA 2DT5A 5EN4A 1E3EA 5ICSA 3AM5A 3NRCA 4OIMA 1ENYA 1WDMA 3RKUA 3NTRA 3M6IA 2X86A 2EGHA 5I7EA 1D8AA 1TEHA 2HRBA 5K6AC 3L0DA 1TT7A 1U3UA 1JKJA 4L4XA 2GN8A 4WKGA 1EZ4A 3HB4X 4CQLA 3MJCA 3I9NA 4PG4A 4IXTA 2CVOA 3MOIA 2PFGA 2D1YA 1E7QA 4GSLA 4EI2A 5TIIA 1QP8A 4GSKA 4FC7A 3PWKA 5F5NA 4BNYA 2GF2A 3E5RA 2ZTUA 4JP2A 5JS6A 2GERA 4E3ZA 5IFLA 1PJ4A 1E5LA 1GADO 4L4SA 4OKNA 1U3VA 1KY4A 1LJ8A 3BMCB 1FK8A 4MKXA 3I4CA 4OH1A 3RVDA 2NQTA 2PNFA 3EVNA 4M49A 1DB3A 4RQTA 5COBA 4CMEA 1A71A 2EGGA 2PGJA 4TZTA 5BNFA 1PJ3A 1DO8A 3VPSA 1I32A 4K9DA 3N7UA 2YQ4A 2NU6A 2OGUA 4D3DA 2VYND 3L4BC 5BT9A 1M67A 1B3BA 4FSHA 3ENKA 1XSEA 3AUSA 1ISJA 3R3SA 1F8FA 1UXGA 4CV2A 5JDIC 3KRTA 3VAZA 2EF1A 5T67A 2YZ7A 1GTMA 4WEQA 3W4IA 5ER6A 4IJWA 3I6IA 1GV1A 1RM3A 2NUAA 3OA2A 4PLHA 4CUKA 2GN6A 2BGKA 4FFNA 3UUWA 4WLNA 4IS3A 3Q6IA 2B36A 2EJVA 4TRRA 1N1EA 4JNKA 3UKOA 3KO8A 4FQ8A 1UZNA 1QLJA 2NU8A 1U5CA 3W4KA 4BO9A 2J5QA 3LT1A 4LMRA 3CINA 4EGFA 1NM5A 2QHXA 5TRTA 2AG8A 1YL5A 3OJEA 3RKRA 3RUIA 1YB1A 1H5QA 2ZB7A 3PDUA 4FW8A 3PK0A 2RAFA 4ALMA 2J6IA 1ENZA 3DWFA 3GVXA 3PLRA 4QFCA 4OO3A 4JJIA 3HJAA 3JQGA 4E33A 2X58A 1OC2A 1Q7CA 1LBEA 4BKUA 2DC1A 5ITWA 2G17A 1IB6A 3GHYA 2EKPA 3DB2A 4GKVA 1L7EA 5BSHA 2JJYA 5DOVA 4GX5A 4TWRA 4FOOA 2B37A 5THKA 3VPGA 1D1SA 1T26A 2CVZA 1Y8RA 1ZEJA 1MA0A 3F9IA 1NXQA 4MINA 4N18A 5JMWA 3AM3A 1Q0QA 3ANLA 3ETEA 3OBBA 4YRDA 5FI3A 3TSCA 3D5QA 1DIAA 4FPXA 5KVQA 5A9RA 1PX0A 2DQ4A 3LT2A 1J0XO 3D4PA 3RUHA 2DTXA 2PH5A 3OF2A 4R69A 3JQFA 3Q3CA 4J0FA 2WTBA 4CLDA 5JMPA 2WYUA 2E49A 3BTVA 1C0KA 2VHVA 3V2UA 4UUOA 1ZBQA 2VWQA 1R4MA 1KOLA 1Q0HA 2WYWA 4W82A 4E2ZA 1LSSA 5TSDA 1K6IA 1O95A 3UICA 2P4HX 2YV1A 3TF5A 2GCGA 1OC4A 3QY9A 2Y99A 3GLQA 5JCJA 1E1LA 3C7CB 1NVMB 1B14A 1VKOA 3S2GA 4RLHA 2VWHA 7MDHA 2AQKA 1I8TA 2IXBA 1NPDA 3CE6A 3R3JA 3HE3A 1SAYA 3AUTA 1LUAA 3GRPA 1I33A 4KZPA 3FRJA 3GZNB 1Q7BA 1H94A 1I5RA 4NDNE 3IP3A 4WCDA 3PQDA 3WGGA 2AE1A 2JCVA 4GMGA 3IDSA 2GYYA 3I9LA 4IIUA 1IPFA 2FPPA 3C85A 3TL2A 3WMXA 1PS0A 3E9MA 3D3WA 1VI2A 1Z73A 2H9IA 4ZU3A 5I7FA 5G0SA 1SCUA 3HNPA 4EDFA 5BQFA 4DVJA 4KUGA 5IDWA 1DSSG 2HUNA 4ZRNA 1FJHA 1C0LA 3MTJA 1CQIA 1U5AA 1A9ZA 1JVBA 4BNMA 3DMYA 4Q39A 3Q2KA 1ZH8A 4GI2A 2FR0A 4DPKA 1EFKA 3IUPA 1H9AA 3TN7A 5AYVA 4AJ4A 3EC7A 3HSKA 5T57A 4XQ9A 2WEKA 3GAFA 3LT0A 4JP3A 4KWHA 4DREA 3DC2A 3F47A 5K9ZA 2VTEA 1KEVA 4RO0A 4MIEA 4R51A 3KM0A 2HK7A 4D44A 3AM4A 3IKTA 2YY7A 1YBAA 4ND4A 4ZVVA 3ZNPA 4FFRA 1QYCA 2ILTA 1MB4A 2NU7A 4Z6KA 1Y8QB 3ZV6A 3IAHA 3VC7A 5KCZA 2IYPA 3NX4A 5A3JA 3GPIA 3RUAA 3GR6A 3I23A 4BMSA 3VH3A 1ZMTA 1BTOA 2AA3A 3OQ6A 3PTZA 1TA4A 2VHXA 2X1HA 3C1TA 4DXHA 3PRJA 1SZJG 4BVAA 4CMEC 1KY5A 4D45A 2YYYA 3JQ7B 3K2BA 3IP1A 1H6BA 4X54A 1PJCA 1T2FA 3H4VA 4J3FA 2EKLA 2O2YA 5JO0A 1ENPA 2AQ8A 1X1EA 2Y0EA 4BB5A 1L7DA 2Q2VA 4PLPA 5A3VA 1UUFA 2QRKA 1CEQA 1H2BA 5TF4A 2O3JA 3COSA 1OBFO 3O38A 5THQA 1PJLA 3U4CA 5DP1A 4G5HA 1B8UA 1PL6A 4RF4A 4ZQEA 1O0SA 1GUFA 4R1NA 1DLJA 1U4SA 3QIVA 1IULA 2V6BA 2NWQA 3BTSA 4GMFA 3ROMA 4DQXA 4J4HA 4ALIA 4BNJA 2Y1FA 4FDAA 3HWRA 4BMNA 3HFGA 4PLZA 5IDQA 3CUKA 5DULA 2YQ5A 5TJHA 2B35A 5K0ZA 1E3IA 1SC6A 5CAEA 3QVSA 2OOSA 4XQCA 2D0IA 2XF8A 1W8DA 3TZHA 3E1KA 3DOCA 4PFJA 4DPLA 2OHXA 3HDJA 1Y5MA 3S1LA 3AU9A 3TFOA 4OXYA 3ZU5A 1AXGA 5EERA 3U9LA 1N9GB 3JCZA 3CMMA 3NT5A 1GFSA 3QA9A 4K26A 1HETA 1P1RA 4LK3A 1Q2XA 4AJ2A 2FY8A 1P1JA 4E2WA 4BNTA 4XYBA 2PTGA 1TXGA 1TI7A 3ZWOA 4YAGA 3L07A 5I9MA 3JQFC 2JCYA 4W99A 2IZZA 2B4RO 4XKJA 2UUPA 2AG5A 3OETA 4UVHA 3K8ZA 4I9NA 1MX3A 3HUDA 4J1SA 4CM5A 3NV9A 2A92A 1Z7BA 1NFRA 2V6MA 3RI3A 4XGNA 4BNNA 1QMGA 3VVBA 1D1TA 1HXHA 3DBRA 4AG3A 2IODA 4Y9DA 5JYEA 4YAJA 1I2ZA 3DZFA 4TKLA 4YVFA 2RBEA 5A02A 3DL2A 1UDBA 1WAMA 2CDBA 3ZNQA 3TWOA 3EY4A 1EUDA 2Y93A 3VKVA 1BSVA 4FC6A 4J91A 2P5UA 2YHIA 5LCXA 3AI1A 3U49A 3BMQB 1GPDG 4CLOA 4RVGA 4QT0A 3WLFA 3KSDO 8LDHA 4RVHA 2GUGA 5I7VA 1E1NA 3QVTA 3WB9A 5JC1A 4E13A 1PWXA 2DLDA 3WFIA 1C1DA 2QRJA 3KEOA 4GL4A 2PKRA 4WGGA 4A26A 3TRIA 3V5NA 4DMLA 3QWIA 2GZ2A 3OJFA 4FN4A 2OP0A 1DC6A 1R4NB 1ULUA 3UOGA 4B4UA 5TJ9A 3CXRA 2BKAA 1I2BA 2OFPA 1HF3A 1HDYA 4K1LA 3DBLB 3K96A 4ROSA 1T2CA 1X7GA 5I8ZA 4FBGA 1UAGA 4MVJD 4E4YA 4NJMB 1PQWA 2QZZA 3Q1LA 1LEHA 1MUUA 4RZHA 5JFOA 1G6KA 1LNQA 2EERA 1GPJA 3QVWA 2FR1A 1OI7A 2O4CA 4GLOA 4AJOA 4CODB 1UP4A 3E03A 5EIOA 3JYNA 1DC3A 3H7AA 3WYCA 1B8PA 3IQDB 2I5PO 1DBVO 2FP4A 4FFLA 4R1UA 5C7IO 1ADFA 3KTDA 4OXKA 2GD1O 3ZWVA 4F46A 4L75A 4XRGA 3B1JA 1B7GO 5TT0A 1K2WA 3PWSA 3D4OA 3FNEA 3R6DA 1YL7A 1WWKA 3UH1A 1QYVA 3V8BA 4YJFB 1GV0A 2AEMA 4J9UE 4IGEA 2FPGA 3LVFO 2EG9A 2VCYA 4P4NA 1O5IA 4G81A 3I4FA 5LDHA 2BGMA 2UDPA 1V9LA 3RQSA 3ZWBA 3U09A 4WLOA 4D0RA 3S8MA 4WNCA 4FB5A 1A4IA 1ML3A 1LSJA 1YDEA 3GEDA 4U6QA 5IXYA 5KWEA 1ONOA 2AHRA 2NQ8A 4PG5A 3VZSA 1E3LA 3QQPA 2DBZA 1UAYA 3UGKA 1LLCA 2HSDA 4CMIB 3TZKA 2PA3A 2Q1TA 3HDHA 3UVEA 4MVJF 4Z3KA 3PHIA 2DKNA 4WCFB 4XYMA 1LC3A 4IMPA 3AJRA 1ONNA 3L77A 1KVUA 5H83A 2VZ8A 1J49A 3ICPA 4GPD1 4GWGA 3T4EA 2Q4EA 1ZK2A 1U1IA 3VH4A 1VKNA 1PJQA 4LMPA 4P8RA 7ADHA 2EKQA 2WE7A 3DHEA 5IJZA 2HMWA 3W8EA 2WWRA 1KERA 4FS3A 1BHSA 4CM9D 4DTIA 3VPHA 4K6CA 1UZMA 4XJTA 3PP8A 3EYWA 1GCUA 3KSUA 1E6EA 2ZKLA 4WECA 5G0UA 3GRKA 1PEDA 4KQWA 4G65A 4E6PA 1FDVA 3B20A 4AJKA 1ZK3A 1AHIA 3O03A 2D4AA 4ZQGA 1PSDA 5TC4A 4CMAA 3VVCA 2O7QA 3ZN2A 3DOOA 1ZSYA 4B4WA 2VYNA 3S2FA 1BXKA 1W6UA 4BS9A 4YJGA 1H2HA 1JAYA 4C4OA 4E5KA 2QYSA 3JQBA 2JD2A 4LSWA 3G17A 1M66A 3GK3A 3PZBA 4MDHA 1E0DA 3SX2A 3E18A 1UDCA 5L4SA 1MV8A 2X8LA 4TVBA 4ALKA 2B69A 3U4IA 2I76A 3ZU2A 2Y0DA 4IS2A 4N54A 1N8KA 2JHFA 4UAGA 5BR7A 3FN4A 5KJFA 3JV7A 1SEPA 5DCYA 3WWZA 2HMSA 1YOVB 1DRWA 2Q3EA 2X22A 4YJDA 1VJ0A 5TT1A 1VSVA 3K73O 2YHUA 3GN1A 4TSKA 3X2FA 4J6FA 1GZ3A 4BNIA 1XYGA 1MP0A 4E5NA 1I3LA 1DIRA 1XA0A 1Z75A 2P5YA 5HS6A 3GQVA 4GVLA 3UXYA 3WGZA 4IPTA 3D0OA 1IPEA 4ID9A 1DAOA 5JDCA 2FSVA 3ETGA 4NIMA 3OIDA 2ZYDA 1HDZA 2NADA 1A27A 4Z0PA 3RBVA 2CUKA 3K9QO 3PEFA 3UAGA 1GR0A 3LZ6A 4YB8A 3AI2A 3LU1A 3ZWNA 4TRNA 4NU5A 3GC6A 4RGBA 1BGVA 4MVJG 5CG2A 4YT2A 1RYDA 3EUWA 1K6JA 1YXMA 3ADPA 4PLVA 3ZNNA 5DOZA 1ZCJA 3H6KA 5TLSA 1FMCA 5AXAA 2IE0A 1HE4A 3DZKA 4FIZA 4BO1A 3KYCA 5I9LA 1EMDA 4OSOA 1PR9A 1YE3A 3AY3A 3KXDA 3ZHBA 1ZFNA 3GOHA 3JTMA 3MCVA 3TQHA 3VZQA 1X7HA 2JKVA 3DTYA 4WLEA 4FR5A 2W2LA 3IIEA 2YV3A 3VZRA 2ZJ0A 3CEAA 4ND2A 1E1MA 4LSMA 4RDHA 4NG5A 1ZK0A 4BNUA 3JD0A 3TL3A 3K30A 3Q9UA 4UVDA 3LQFA 1JN0A 2P9GA 2EHDA 5JPIA 1ZEMA 3U3XA 3BMOB 2VRCD 1CQJA 2ZTMA 4A73A 4U0KA 4YAEA 4D0SA 1U7HA 4EJ6A 3ZHXA 1PL7A 3AUAA 5JE8A 3PHGA 3RD5A 3GHHA 4B3IA 3WS7A 5BSGA 1XKQA 1T1SA 2C7GA 1GAEO 2FHSA 3PPIA 5H82A 3EK2A 1RM0A 3IC5A 4XIYA 5CPBA 1Q7GA 1H0KA 1LDEA 4YTEA 2QQ5A 4NH4A 4YACA 1GQ2A 2FZWA 2QYTA 5AXDA 1JQBA 5DBFA 4BO8A 3GUCA 1OZAA 3WGIA 1E3WB 2OUIA 1VL0A 2AEJA 1H6DA 2PZLA 2ZB4A 3Q11A 5HWSA 2HMUA 3LF1A 1H6CA 3F6YA 1YWGO 3K6JA 2HMTA 1NPTO 3FNGA 1D4FA 1SO8A 4WK6A 3ZWXA 5GZ3A 2I66A 4HFMA 5ENDA 4YQYA 2LDXA 4KDFA 2JHGA 4ZQHA 2UVDA 1CIVA 1N7HA 2VT2A 4XJSA 1HL3A 4U7WA 4BO2A 4CM4A 2R2GA 3I52A 4AICA 1L1FA 3FD8A 4RPLA 1C1XA 3DAFA 3RBZA 1ISGA 3ITDA 4BO7A 4CL8A 1HYGA 4E2YA 2GR9A 2Q46A 4RPGA 2HRZA 4R9RA 1N1GA 1SBYA 1VM6A 1KVQA 3RU7A 2VYVD 1ZZEA 1LDYA 4ONEA 9LDBA 3KSZO 1SB9A 2EP7A 5CP8A 4BNHA 1DAPA 1NR7A 1WZEA 4IGFA 3OM9A 5ILGA 2AEFA 3K92A 3HQ4O 3IJPA 4J43A 1UDAA 3DBHA 3WYEA 5TGDA 1UXJA 1YONA 4NR0A 1AN9A 4R4JA 3WBFA 4GBJA 4HX5A 4MVJH 1BXGA 3QWAA 2BRUA 2PD4A 4BGVA 2WSBA 2V65A 3LLSA 5CHEA 3IJRA 2X4GA 2AXQA 4AJPA 4CLRA 5U4QA 4CM8B 1KC3A 3ZNOA 1QV6A 4CR8A 4O59O 3L6OO 3WIDA 1D3AA 2NVUB 3QLJA 5EJ2A 2WMDA 2PR2A 5B12A 4BKRA 1JLLA 4IDAA 4P22A 5JYDA 4QQRA 2ZQZA 3LLVA 4RORA 1ARZA 4W9NA 4DL9A 4YAKA 3C24A 2DFVA 4LRSB 4E12A 4XYGA 4AJEA 1H9BA 2G82A 2C29D 4NPCA 3ZU4A 1EQUA 3KB6A 4PG7A 3ASVA 4CQMA 3WR5A 2X0JA 1GYPA 5U9CA 2XXJA 1PJ2A 4HKTA 4YT8A 3GGPA 3H8VA 1V3UA 3H3FA 4D3SA 1T4BA 4DPMA 3CZRA 3JYQA 1PGJA 3PFWO 5JDCC 1LC0A 1GZ4A 1NYTA 3OH8A 2JFFA 4M87A 1J6UA 4OOEA 4XD2A 1PQPA 3RASA 1QYWA 3IL2A 3I6QA 4M86A 5A9SA 2Y1DA 4QX6A 2IEDA 4M89A 5F1OA 2BFAA 2NVWA 2V6FA 3P2YA 1EDOA 2EV9A 4PZEA 5C37A 3AU8A 1G0NA 3TFQA 1NQOA 3ZU3A 2NNLD 4IDFA 3WQQA 4YJHA 3WTCA 1P9LA 1I24A 2CF6A 2X9GA 3OQBA 5HTOA 3M1AA 2UUOA 3JQAA 1P45A 5B37A 1EE2A 4L0QA 2GO1A 3ZWCA 1JWBB 2RHCA 2YW9A 4EUEA 4RJTA 1QLHA 3GF4A 4M1QA 4LVCA 4IJVA 3N58A 4IDDA 3RIHA 4L9RA 5JLAA 3JQDA 2CY0A 4YCAA 3GZ4A 3H9QA 1NR1A 4IIVA 1KVRA 3QWFA 1F14A 1LDMA 5G0TA 3PGXA 1RM4A 3WSVA 1HLDA 3RJ5A 3D5TA 2EP5A 5AVOA 4R01A 1PL8A 1MC4A 2WM3A 2PLAA 3I9KA 3DXFA 3W4JA 3DMTA 3O4RA 2BHLA 3BMNB 5JY1A 4OQYA 4BO0A 4J1QA 1YDWA 1Q1NA 5DT9A 3ZZNA 2PZMA 4R9SA 3L6DA 5TQVA 1U8XX 1TT5A 3MWDB 4II3A 3W8DA 1A4UA 3DTTA 2VHZA 2YJZA 1NAIA 4QECA 3OECA 4BQPA 1PZFA 1WNTA 4J7XA 4AJNA 4ZHSA 1P33A 2DVMA 4M8SA 1DJQA 3I3OA 4DUPA 1UXHA 1UH5A 1HDOA 4IQ8A 4O5OA 1LXCA 2BFPA 3FBGA 4GLLA 4L4RA 1V8BA 3Q9NA 1ZXBA 4LGVA 5KVCA 1QR6A 2PWZA 4CL3A 2Y1EA 4F45A 4XWYA 3U4DA 1K3TA 3EW7A 4J2OA 3ZHZA 1DFGA 2CNBA 2X5KO 2DAPA 4DYVA 4B8ZA 1QV7A 1E6UA 3HHPA 5F5LA 3R0IA 2O3UA 1YJ8A 3IS3A 1ZKMA 1Y9AA 8ADHA 4MOWA 2VOJA 4Y98A 3RC2A 4PVDA 4KTVE 1LLUA 3F4LA 5FYDA 3WSWA 5G4KA 1WDLA 4G2NA 2NV6A 1DFIA 4B79A 4CV1A 4A10A 3FPCA 5BNTA 2EWMA 3QSGA 3RC1A 3NTOA 1DIHA 3D1LA 1T2AA 1K5HA 1XGKA 1OFGA 3GDOA 3GNTA 3OSUA 4RF3A 2GGSA 3PVZA 5EPOA 2ZK7A 4CUZA 3GFGA 4IM7A 4OM8A 3ZV5A 2Q49A 2W8ZA 4NBRA 3SC6A 1YO6A 1PTJA 5CDGA 4FD3A 3AUUA 4OL9A 2V6GA 4NZ9A 3RWBA 2CZCA 5A04A 4Z9YA 3IKVA 1TVEA 1V0JA 2VNSA 2X6TA 4BMVA 2D59A 3ORFA 4CMCA 3IOYA 2WJPA 3KBOA 5DNAA 2A9FA 2QIOA 4UVEA 5AXBA 4GX0A 5IZ4A 1XG5A 1HDRA 4CQLB 3SXPA 2O50A 1BW9A 1MC5A 1X1TA 2FPIA 3CZMA 1R0LA 5B1YA 4DBZA 1YB4A 1M6HA 3E5MA 3FR8A 4PZCA 3LYLA 2HAEA 4PCVA 4CMGA 5IF3A 3ETDA 5LDGA 1H93A 4RPKA 4JJFA 4YA6A 1T25A 2IYOA 3DHNA 4W9NC 5TNXA 1LA2A 3CPSA 2H63A 3FHLA 5G0VA 2G76A 3KYDA 1ADBA 1PS8A 2DTEA 1JW9B 4WE3A 4QXMA 3JYPA 4CM9A 4JLWA 1NVTA 5KTKA 2AW5A 3EZLA 4MJLA 4ALNA 3MJSA 5FI5A 1UXKA 3U62A 3C1AA 4XDZA 2HLPA 3NT4A 3ZWPA 3H9UA 1RJWA 1MXHA 2BH9A 4GQAA 2C59A 1HDCA 5CEEA 4RCVA 4EBFA 1J4AA 4Z9FA 3WICA 1WW8A 3LT4A 1X0XA 1NFQA 4B8WA 3DDNA 4K28A 4NFSA 1XQ6A 5DN9A 2DUUA 4FCCA 4QO8A 2NLOA 4TZKA 2FRDA 3RFXA 2O23A 5DCUA 5C7OO 3JQ6A 4L74A 1E7YA 1TLTA 4Q3EA 3B1KA 1AE1A 4JIGA 4EEZA 1GQQA 4AJIA 2ZCVA 2JAPA 3GNSA 4ZGWA 1U7TA 4B7UA 2RCYA 3U5TA 2JFHA 2VUTA 4E5PA 1K0UA 1BVRA 4U8GA 3S55A 4OHUA 5EINA 1HDGO 2PD3A 3AY7A 3JQGB 1PZHA 1ZW1A 5I9NA 2Z1NA 4XCVA 1SOVA 1I10A 1E92A 2B0JA 3O9ZA 5FWNA 1JKFA 3ROQA 5IG2A 2P68A 4JBIA 5L7TA 1SOWA 3DMTC 4E5MA 3PZRA 3U0BA 1XCBA 2WD8A 1B16A 1Y8RB 3ZW9A 2P2SA 2X0IA 4OXNA 4ZQBA 4HP8A 2Q1SA 1YOVA 2IRWA 2YDXA 5JW6A 5L9AA 3BTUA 3KLMX 4I9UA 4HFJA 4YXFA 3OIFA 1KS9A 3OMLA 1PJBA 2I9PA 2W2KB 3GVCA 1PJTA 4OKIA 1P0FA 1UR5A 5MGBA 3N74A 1NNUA 1SNYA 1F0YA 4BO6A 1R4MB 4D42A 3JYOA 2VUUA 1CWUA 1JWAB 1NWHA 3LK7A 3NYWA 5DP2A 4KOAA 5ENVA 1DXYA 1EVZA 2GRAA 4HADA 4P38A 3UCEA 2HJRA 4RF2A 4WLVA 2E48A 2X7HA 4S3MA 3UCXA 3ZWWA 4BNWA 1A9YA 3GEMA 3KUXA 3RJ9A 4P4GA 1HSOA 3NGXA 1IY8A 3G49A 3H9EO 3CTMA 5IAAA 3P7MA 2D3TA 1R0KA 1PZGA 3INRA 5A5FA 2BELA 5F1PA 1UP7A 3B70A 4UVGA 4JBGA 4JK3A 2I6TA 2DBVO 2NU9A 1LQTA 3MJTA 4B4OA 4B3HA 1P1HA 3UW3A 1UXIA 1W73A 1U3TA 1XR3A 3ZV4A 5KJCA 5L51A 3WNVA 3G1TA 2EW8A 4Y6RA 2WD7A 2ZTVA 4JN6B 4XB2A 5JCJD 3JQ8A 4UUNA 3DFZA 4W4TA 3P2OA 3D3WB 2CVQA 4ZQFA 4J16A 4RQUA 4R3NA 4EW6A 4DLAA 1PS9A 4BNGA 1G1AA 4J1NA 3VPXA 3WQRA 2GPTA 5F1KA 3E9NA 3M2PA 3QWBA 3B1FA 5IN5A 1KEWA 1GD1O 4JXKA 4OJNA 4TRJA 3W1VA 1UP6A 2FWMX 4UEJA 4W7HA 1C3VA 4I5FA 5C5IA 4DIOA 3PJDA 1GZ6A 1Y9EA 4UUMA 4IDEA 4MVJI 4WOKA 3E82A 2OMEA 1EVIA 3OEYA 3C8MA 3NDRA 2VWGA 1ZUD1 3WG9A 4DGSA 3DONA 1PZEA 1X14A 4WLUA 3RAJA 1QXSA 3QP9A 5B4UA 4RVUA 1B0AA 2C5EA 2GSDA 3JYLA 4N5NA 3RC7A 1KETA 1PGPA 1NTOA 3NJ8A 4IQ0A 4DRYA 4QO7A 3PJEA 3ZH2A 2QW8A 3C3XA 3DOJA 3DEYX 2PZJA 3O8QA 1DLIA 3WXBA 2QX7A 5AXCA 5TS3A 3I9OA 3TNLA 1E3WA 3LDHA 1DC5A 3OJ0A 2X5JO 3WNQA 3GMSA 1DHTA 4DQVA 4XGIA 2Y0CA 3UFXA 3DZIA 3QRWA 4II2A 4ZRMA 4YRAA 1YQDA 1PGQA 2PKQO 4RVDA 3PI7A 4MO2A 1EK5A 2CDCA 3AFMA 2OORA 1R0SA 3K5PA 2DFDA 1EEHA 2EJWA 2SCUA 2ZB8A 3BZUA 3GG2A 3G1UA 1I3NA 2X23A 1K6XA 3IMFA 3KHUA 4CR6A 2OL4A 2WDZA 2NTJA 1S6YA 2I67A 4BNLA 1ISMA 2EXXA 1LSUA 1HE3A 3HADA 4URFA 1OMOA 2Z5LA 4A7PA 2Z1MA 1NWCA 1VJTA 5CEJA 4DC0A 3OIGA 2GNAA 4J4TA 1M2WA 3SJUA 2RH4A 2PH3A 1H6AA 5L40A 3GT0A 1GQYA 3GH3A 1CERA 1R37A 1NHWA 3A9WA 1M75A 3G79A 2O4UX 1Y1PA 3C7AA 3GPDG 1ISFA 3LSYA 1IZ0A 4TKMA 3X2EA 1ORRA 5EL0A 3H3JA 3B6ZA 1P0CA 1CJCA 1EDZA 1ZK1A 2G1UA 2OBNA 4E2XA 3BMCA 3GY0A 4UVIA 3AOGA 3EAGA 3AFNA 4XX0A 3WDSA 1NFFA 3RUDA 3KLPX 3ULKA 5A1TA 2I3AA 1GEGA 2VZ0A 1V3VA 1JVSA 4FFPA 3LF2A 3WMWA 3ICCA 3CSDA 4L73A 3NUGA 4MIOA 1Z74A 4O63O 4R5HA 1GUZA 2XXBA 2JAHA 3ITKA 5KVVA 4PG8A 4RVFA 3E8XA 2EEZA 2HQ1A 2A35A 4I5GA 4JJGA 2LDBA 4ZA2A 4MVJE 3MEQA 2Y1GA 3V2HA 1QRRA 1Q0LA 1V6AA 4MIYA 5G0WA 3DZJA 1ZNQO 2O3QA 5JAMA 1XQ1A 2TMDA 4CLXA 5AOVA 3EVTA 1MG0A 3PHJA 4BQRA 2HCTA 2E37A 3CIFA 4KDEA 3AY6A 2O48X 3H2ZA 3RBXA 4WUVA 2C82A 1CDOA 1V3TA 5B4VA 2FMUA 3WFJA 5KJ1A 3DBRB 3HFSA 3ASUA 4H16A 1DPGA 1KEPA 2RIRA 2P9CA 1KBZA 5JDIA 1HZZA 4IJUA 3H9GA 3WGHA 5L4LA 2ZATA 3E6AA 4I5DA 2ZB3A 4PRKA 4LVUA 1Y7TA 1XWFA 1DFHA 2YHIB 1HTBA 4XB1A 4CLOB 3EGOA 4YWJA 4FGSA 3F3SA 4RDIA 2Q2WA 2OXIA 3QWHA 1VC2A 2CDAA 3OHSX 2WE8A 1ZMOA 1C1DB 4KWIA 4CV0A 4GX2A 2F00A 3GEGA 3MZ0A 2ZIZA 5EMHA 1T24A 1P1FA 1ZJYA 1T1RA 3NEPX 1ZVMA 4CLEA 1NAHA 1VLLA 1VJ1A 2C0CA 1IOLA 3JQCA 5CDSA 3MTGA 5A03A 2D5CA 1ZJZA 1P74A 3ZWAA 3V1UA 4BOYA 3GG9A 5KKAA 4CMKA 2BLLA 4E30A 1KC1A 3F1LA 1E7WA 3ROKA 3QE3A 1S7CA 2DBRA 1Z82A 4RPHA 4NFHA 4H15A 5ILOA 2W90A 5A9TA 1JDJA 3GZNA 3PYMA 1YGYA 4RLSA 5I7SA 3INGA 5DZSA 1OAAA 1P31A 1HRDA 1EVYA 3BTOA 2AE2A 5ITVA 4IZHA 5G2OA 3ZHYA 1BDMA 2B4QA 3BXXA 1QSGA 4N7RA 3CKYA 3PDJA 2B5WA 1JAXA 3FTPA 2BFOA 3VKUA 1ISHA 1C14A 4Z0TA 1QORA 4PIVA 4CMHA 1LDBA 5C7LO 3GA0A 3QV1A 1VPDA 3F4BA 2GN9A 4Y8VA 1EQ2A 1R12A 2O3RA 4CLHA 3ZDFA 1DRVA 1PU2A 1M6WA 3FBTA 1NVGA 2H6EA 3UCFA 2NACA 1NQ5A 4Q3AA 4Q3NA 1VL8A 2BFMA 2VNAA 4LW8A 4TROA 1RM5A 3NGLA 2O3TA 4O0LA 4FFMA 1YL6A 1EFLA 4ALJA 4BGUA 4BO3A 3AWDA 4HNHA 1JKIA 2V7PA 1B3RA 4YYZA 1WZIA 5IXSA 4LCJA 3PHHA 3KOUA 2R6JA 4J2HA 4KMSA 1U8FO 1I30A 1P1KA 1Y8QA 4DIBA 1QG6A 1CRWG 3I5MA 4QFDA 3WGYA 3JQBC 1VRWA 2EIHA 3LC2O 4BNFA 2UYYA 4MP8A 3ZW8A 1HEUA 1YH3A 2I65A 2JCXA 1E3JA 3QW2A 3DZHA 3JQ7A 3BA1A 3RFVA 3DO5A 3SJ7A 1C0IA 4PN3A 2F1KA 5FEUA 4UREA 4YRBA 1E3SA 3I83A 1DDOA 5IDXA 5HRUA 2Q2QA 4WOJA 2PY6A 1GYRA 4NBVA 3FWNA 1LDNA 2IEBA 4R5MA 1LU9A 3TZQA 4N5MA 1B15A 4YJGB 5COAA 1E7RA 2XOXA 4IXWA 5BNIA 5CDYA 2J3HA 1AHHA 1BG6A 5GZ1A 1HT0A 3RROA 4R54A 1BXZA 5JC8A 5L4NA 1NASA 3PYXA 1LRKA 4CV3A 4CM6A 2PD6A 3PYLA 1ADCA 4IUYA 5HA5A 1XEAA 4AJ1A 4EITA 1P1IA 3A1NA 1VE9A 1QYDA 3AOEA 5GMOA 4U0JA 2DUWA 1FDSA 3DZGA 4ND1A 1QYXA 3DAPA 1P3DA 4WNIA 5JAQA 2ZJ1A 1O94A 1B26A 4YBZA 1FDTA 1YS4A 3E48A 5CFZA 1MFPA 1I01A 3NAQA 3PJFA 4XGKA 3SLGA 4CJXA 5IDYA 1N9GA 2PGDA 2Z95A 1NX6A 4A0SA 5CDTA 5ICMA 1YRLA 4HFRA 2B4TO 3FNHA 4P4LA 5C3MA 1PQUA 1EUZA 1BMDA 3MJVA 3PWZA 1I3MA 1YBMA 3H5AA 4NQZA 3P19A 3E9QA 4GX1A 4J1TA 3WIEA 2YFQA 3TJRA 4FJ2A 4B7CA 1J5PA 1LSOA 2GDZA 1Z45A 2EW2A 4I1IA 4I9HA 3SC4A 2O2SA 4BNVA 1O6ZA 4H7PA 5A5EA 3HB5X 4XR4A 1E7MA 2NVBA 2E4AA 4TQGA 1LI4A 1F8GA 4C7KA 6LDHA 5HS4A 2A4KA 3SEFA 2OBYA 5EQDA 4EJMA 4Y6SA 2PGLA 4M54A 3GN2A 1ZIDA 2C2XA 1XDWA 4Q3BA 1VSUA 2GZ3A 1YKFA 1ISIA 5GZ6A 1MG5A 3LC7O 3KYCB 3ONFA 3W6UA 4HNGA 1LRJA 3NDIA 1NBOA 4N5LA 4AL4A 2FR8A 4IBOA 2Q1UA 1F06A 4Z9XA 1DIBA 5U1PA 4E31A 4JQCA 1ENOA 3EDMA 1Z6ZA 4KUHA 1HYEA 2W2KA 4J90A 2YDYA 4D7AA 2Y66A 5KJ6A 4TRMA 1KEUA 4A03A 3BMQA 4CUJA 4UEKA 1SMKA 2C5AA 3DBVO 4D46A 3HG7A 1LLQA 4GVXA 3MJEA 3DZBA 3RUFA 2CMDA 4BB6A 1XLTA 2W2LD 3GAZA 2VOEA 2UAGA 4JGBA 4MVJA 3VDQA 4GWKA 1PIWA 3FPLA 2POQX 2O3SA 4PLGA 4OQZA 4IY1A 3I9JA 5TX7A 3V1TC 2ZCUA 4LCEA 2HO5A 1R4NA 4RPJA 3DR3A 4W7IA 1O8CA 3WGQA 3ONDA 1KVTA 4ND3A 4BKOA 3WQSB 5J23A 1G0OA 1ZSNA 1U2GA 2ZQYA 3DBLA 4HBGA 2VUSA 4QEDA 5COQA 4B3JA 3BHIA 1SEVA 4NJMA 2Q99A 2D2IA 3JD4A 1R6DA 4NK4A 1HE5A 4FJ1A 5F3RA 4HV4A 3OEWA 4OMUA 1KIFA 1UJMA 2P91A 3WBBA 3K2EA 3FR7A 1HZJA 2YFHA 3JQEA 3D4NA 5B4TA 2C20A 4BKQA 5FF9A 4CM4B 5EQFA 1PGNA 3G3EA 1LQUA 5KJEA 3IUSA 4E32A 5L53A 4MKZA 4XR9A 1C1XB 4I8XA 4OSPA 3F1KA 4BHTA 4R3WA 3NTQA 2I3GA 4BKPA 5MDHA 2PZKA 3RSHA 2PKQP 3ONEA 4DWVA 4YPOA 4Q3CA 4YJFA 1C0PA 4UULA 3BAZA 3KVOA 2NTVA 3WJAA 1FDWA 4O6VA 3CH6A 4R1SA 4AJLA 1P44A 4NBWA 3AI3A 3VTFA 1X13A 2VRBA 3I1JA 4DIFA 4XYLA 1RYEA 2P9EA 1HDXA 2YV2A 1K89A 3HZZA 1GUYA 5T6BA 3TOZA 4A2CA 1IZ9A 3DBHB 4KQXA 5GY7A 3ZV3A 2DU8A 4D3FA 4RV9A 1X0VA 4J7CA 4NHEA 3NDJA 2X5OA 4DLLA 3FTNA 4IZIA 2C54A 4CMIA 1BXGB 5L7WA 3GFBA 1E6WA 2Y05A 4MVJP 4R68A 2AQIA 5EESA 3RU9A 1HKUA 4WCFA 4ZN6A 2DM6A 4CLRB 1FF9A 4I5EA 1NQTA 1LRLA 4W6ZA 1YVEI 2R00A 4GGPA 3PXXA 2G5CA 1EK6A 4TVOA 4Z3DA 1XHLA 3AOEC 4D79A 3HN7A 4B4VA 3ADOA 3UF0A 1HLPA 4C7JA 2J3IA 2Y1OA 4FGWA 4MP6A 5L45A 5DBGA 2Y67A 5DBIA 1GY8A 2JD0A 4CQMB 1NQAO 4AFNA 3ROPA 5JBIA 2HK9A 4DQUA 1ADGA 3K31A 4IDBA 4AJHA 1KVSA 2CFCA 3DQPA
chains in the Genus database with same CATH superfamily
4AO8A 2ZU6A 4MUGA 2ZBGA 3BRWD 1L5YA 1ONSA 1PW5A 3F5MA 3CMCO 4DIDA 1JEYB 1K8QA 3FETA 3V4RA 3FYCA 2XUDA 1YHYA 2I6FA 2JANA 4L76A 2IDMA 4J9VA 2W98A 2WT4A 4DMMA 1XRRA 2D5IA 3ST7A 2UXCB 5I7HA 1DIGA 1V6SA 2ZJ3A 3KU1A 3WJ1A 1K4YA 3HV0A 4AXXA 2I99A 2PUJA 3QZUA 5MN6A 1FJXA 4XA8A 2DXIA 3U4HA 2WIJA 4YJHB 2CEKA 1C8KA 3Q8WA 1RMQA 4L15A 1N3LA 1L4MA 1PT7A 3KBBA 3QKIA 5CK4A 5FUYA 3HDYA 3CH5A 2FR8C 3ENNA 4KK3A 2DY1A 1E3DA 3D8SA 4KPFC 1FQOA 4TTRA 2VQFB 3BHMA 1JEJA 1HSZA 3A2MA 3EGDA 3L8EA 4II7A 3S70A 1QWOA 2VS1A 3EVFA 5F2NA 1G4HA 2OCIA 3Q7QA 4JVNA 4P5PA 1VRCA 3EASA 2VQEB 4NL4H 2C7VA 1HWYA 2CGEA 2WUGA 2YHAA 2EHJA 3HB1A 2P4QA 3R75A 3UENA 4BFTA 2QB5A 4O4LF 2AYYA 2VHQA 2X0RA 2DUJA 4FZ5A 5D3KA 4BJ1A 2QJWA 1I5EA 3B9RA 3A11A 1Z06A 2B92A 5ENZA 4XCQA 3ZXSA 3KSBC 2Q5QA 2G5GX 1RVV1 3NYRA 3JQAD 1QH1A 4KQ1A 1F20A 5FTMA 5LP6C 4MJ3A 2JFGA 4PLWA 2WJ4A 5BV2P 4OPMA 1HYHA 4NEGA 2NTNA 1FNBA 1HRKA 1KPGA 1N2CE 1RAEA 3A3PA 2JI7A 4LY9A 4GP9A 2VUIB 3VH2A 5CFRA 1KFEB 2XAAA 3NTUA 3TR5A 1NSYA 1V7QA 3FCUB 4V1CB 5KOHA 2A5LA 4ZYVA 3NB0A 1N75A 1O89A 1ODTC 3L0YA 4OK5A 2VDRB 1RXVA 2J3JA 3G8CA 1CUEA 1CDDA 1QJ4A 1GL3A 3K05A 1AA9A 1IYZA 2OG2A 3ANNA 2L42A 1D6SA 1I7NA 1Q0SA 2VATA 3A28A 3PIIA 4CYMA 1QIHA 1FJGB 3ZGYA 2YOHA 4YMUA 2QZ9A 5CA0A 2Q3CA 3ORHA 1KZ4A 4Y2UA 1UJ5A 3AK4A 2VDUE 3FHCB 4UEOA 5LJLA 1CZUA 2FPPB 2J0EA 4XARA 3DMPA 3QBTA 1K97A 2JIMA 4M0FA 5ED4A 1RKXA 2Z4SA 1KJZA 1AZSC 2X8WA 3R41A 4FOSA 1UODA 3KV3O 4HZUB 4MV5A 3TDKA 1AT1A 4J49A 1K7FB 1EUQA 3L8HA 3H5IA 4GKBA 4IMRA 1COZA 4ZAXA 3ZXIA 5DLYA 2QSJA 3ISTA 1G8KA 3ISVA 4ON9A 5JAZA 1XNRB 4WL0A 4BJ3A 2WU0A 1GKIA 3TZLA 1TMGE 4MRNA 3ZWMA 4C5BA 2AJ8A 2G9UA 1CHNA 3HXPA 4YXWD 2H2HA 4CM3A 2P5TB 2XGJA 4KIFA 1CYDA 2HGSA 4XB6B 3ZK9A 4QUKA 2I91A 1ST3A 2FSSA 2IY9A 3KV1A 1CIPA 1XU7A 3GBPA 3TS1A 3HI6A 3H97A 3D8BA 1E1CA 1GNLA 2LTAA 4V0ME 2PE5A 1IBRA 2FQWA 2V4UA 4GAEA 1UKYA 5G4KB 2GWHA 4QG3A 1Z0ZA 2VYQA 4X6YA 1XZBA 1V35A 3A04A 4DDVA 2PZFA 5FPYA 4TYNA 1T8WA 4X0EA 5B3JA 5FTNA 4ZFNA 1L4FA 1ZUHA 4CCAA 2OKGA 3OJXA 5JALA 4JJ7A 1JALA 4OUDA 4B0PA 4YLYA 4IQ4A 3G0OA 3AVWA 4MYDA 2Y68A 4ARIA 5DDIP 1IEVA 1ZD4A 3DQQA 3S1AB 3CONA 3DAOA 4E0BA 3IE0A 1QFJA 2XE6A 3JD1A 3KWMA 4FUTA 5FTLA 2OGTA 2PUBA 2V45A 2MINA 3BEDA 3C7DB 3OICA 4HB4A 4ZTBA 3OCCA 5B3LA 2FTKE 1N5DA 3PUKA 4GZ5A 5CXQA 4RVSA 3M2TA 4ILKA 4D9HA 3CLVA 3REOA 1LBIA 4M9CA 1J8YF 4NBUA 3ZXYA 5BPFA 2QDKA 2FVXA 3H2SA 2H54A 1XDDA 7REQB 2ZIFA 2VYVA 5CFNA 2NUBA 2BJVA 4R1TA 2OV2A 1SXPA 3ZDDA 4DKXA 3ZWYA 1PR2A 4M1ZA 4LRTB 3MJRA 3FF4A 4G4JA 1BW9B 1D2HA 3IJ5A 4GPAA 4LISA 3BREA 4BX8A 4I6JA 3FJ1A 3RS8A 1L7MA 2ANBA 2FW6A 2W2MA 3WA7A 2OR3A 5KVSA 3F78A 3G88A 5SZHB 3LKDA 3V7FA 4KR6A 3OSZA 4TTSA 3SI7A 3ADDA 2FZEA 3R40A 3E2PA 2GD6A 4JELA 5J2UA 5CB0A 5BR4A 4JZYA 1JU9A 1ULZA 2XR1A 2BTOA 2FFJA 4Q9NA 4B85A 5KIAA 3GLTA 3RPEA 1Y48E 2DPGA 3V8PA 3RSLA 4CG2A 1C9KA 4JLJA 2HU2A 2XB6A 3T1HB 3G0IA 3FSGA 2G88A 2P2YA 2HJVA 2PMBA 3D6NB 3WWYA 1T0UA 5A6VA 2OXFA 2EX0A 2Q4BA 2G80A 2ZSJA 4UUPA 1BGWA 4F9FA 1QHHB 1CETA 1DDGA 1OWLA 2HMVA 4C0JA 1PR3A 3JZMA 2YJTD 4XLTA 2GASA 4DZRA 1YF3A 3SF0A 3QVOA 1QQ6A 3AFIA 1U1CA 3ZJTA 3ER6A 1EUCA 1SUDA 1ZN9A 1XPRA 3P4YA 4EYEA 2H1SA 3H11A 2C4VA 4LDPA 4QUAA 2XMQA 4XEHA 3VZPA 5K01A 2CJWB 4CM8A 1RWXA 2VT3A 2AUNA 2CLEB 2C7PA 1QMPA 3GJYA 2I2WA 2YH2A 3VHRA 4KXQA 3KKNA 4OB8A 1AO0A 1ZLXA 4H4EA 2GYVA 2NVUA 5BV7A 4FFDA 2GQ0A 5HM8A 3SOZA 4ID3A 3ECSA 3SJBA 3LUBA 1K6EA 4OGFA 4WNAA 4HDKA 1X86B 2O7SA 2R68A 2RI6A 3OZGA 1U02A 2R1ZA 2PKYX 3A2LA 3C87A 3OJLA 2E89A 4Y67A 2IHJA 3H9JA 5ELXA 4KMMA 4XPZA 4OYLA 1CFZA 1DP4A 4J07A 1NP3A 3NC4A 1D1QA 3OO1A 4NJOA 1Z5WA 5FJJA 1LTHR 1N9KA 3L4SO 4QJ3A 3VU9B 1ZZGA 4NJEB 3A1TA 1YFJA 3AZQA 4U1RA 2YCBA 4BFLA 1RIFA 4QTZA 1AGXA 3HN2A 5DKFA 1H69A 2IU4A 3K4QA 3W90A 1E0SA 1YBVA 3C6ZA 3DV2A 3OA0A 2H2IA 4F21A 4QM7A 2FK7A 3L1IA 3RS5A 2G70A 2OHFA 1X2EA 3OP4A 5JO9A 5CB4B 4R8SA 4WFIA 1J23A 3DHVA 4D41A 4W7SA 1KDOA 4DJAA 1YASA 2I4NA 3H8JA 3DD5A 4D4GA 4C2TA 5T8KC 2ZTHA 4DJEC 2X9NA 4DA9A 5GIPE 2VN8A 3ZZMA 4Q4CA 4OKSA 4Q1EA 3KZVA 1YAHA 2HK8A 3K1JA 1W4LA 1ZRHA 4HSEA 5IVIA 1RAGA 5T41A 3RVLA 1CJSA 1E4EB 1Z5VA 1M1YE 4X85A 3P5SA 4EHLA 5EJ6A 2HQSA 3V2GA 2PV7A 9GPBA 2GKGA 3NKLA 1B6SA 3V7NA 2YL2A 3FOWA 2JZOA 1LW6E 3PL1A 5FA6A 4ER3A 3KYIB 4BZWA 4ZXFA 4IJKA 5EZYF 2QRLA 4FEEA 2ZT6A 4EW2A 4G1CA 1QCCA 1ZU5A 2IA5A 4KP7A 4X7RA 5HCUA 5T5QA 4BNKA 2Q4OA 3EVAA 2DQKA 3LWBA 3M82A 4TGLA 5CT9A 4C03A 3DE4X 3FPKA 3ZJUA 1MPXA 3WOHA 3DP9A 3LP5A 2ZYTX 3ADBA 4IDGA 4MIOA 4BP3A 1YB5A 2TS1A 4BV9A 4GFDA 5JNLA 4LY0A 5HKLA 1C4OA 2XB9A 2NU9B 3U7QA 2EJBA 4Q82A 3N6RA 3F5FA 4XM0A 2GN0A 3NWOA 4EW6A 1WF6A 3H2GA 4RJJA 2JHPA 1YV9A 2K5UA 4PZYA 3MHTA 1QQ7A 1SZDA 3TSYA 1FNNA 4ZC8A 1KYVA 2QVLA 3O1LA 5DMXA 1SFRA 3TOXA 1X7DA 4O1MA 3HDVA 5EJ4A 1SG9A 4QM6A 4MUYA 3JQ8B 4E21A 5BSEA 1B0ZA 2P1ZA 3C5CA 3PXDA 4FFOA 1IRXA 3PJGA 4M0LA 5CLFA 4KPEC 1EJ6A 2JIDA 4CKYA 3JWJA 1UWKA 1J0CA 1XTTA 5IZCC 4KZKA 1E66A 2YJ5A 2Q50A 3D7SA 3JAWB 2QENA 5B57C 1XD9A 2AQHA 1GAQA 2DQSA 1KJIA 1WVMA 3B3JA 2XPCA 5E9AA 1MRZA 4I1UA 1F3LA 1YDHA 1RXSA 5JG7A 4OLFA 2IS1A 1R0YA 1XT6A 4H7FA 3RYIA 1Z4NA 4ANFA 4O02B 1M5UA 1IJFA 3EMBA 2GAFA 3PPWA 5D6OA 4LVNA 2Q6KA 2R86A 4F6CA 1L1RA 3S2ZA 1BHQ1 1JECA 1JQ3A 3CVJA 4MQFA 3SYMA 1NBMD 2YNMC 5B1HA 1FLVA 1WSDA 3IURA 2AFVA 4PLTA 4QUGA 3KYBA 5KO2A 3H8WA 4L8VA 1MJ5A 1N7GA 1VMAA 3OT4A 1GDTA 5EJEA 1W1IA 1KWGA 1PFKA 3D3EA 3JWGA 3IPYA 2GCOB 2W7TA 4M83A 3E1GA 5EKUA 4CT5A 5L3SA 3MWYW 1GGVA 4IHJF 3TQTA 3G8DA 5HZKA 2F3PA 3FZNA 4WFQA 1I7DA 4MV9A 1WPQA 3MPUA 3CXUA 3HCRA 3DXXA 3O8QB 1XI2A 4RIEA 2XKKA 1Q83A 1UXOA 1R0BA 2C96A 3O6VA 4O2AF 1TYBE 3H1EA 4N82A 1VL5A 3UW1A 1AK9A 1DARA 1Z6AA 1U8ZA 3PUWA 2X14A 1G98A 2ZIUB 2O14A 2IHNA 4NCAA 3VYRB 4F96A 3UJNA 1ZD5A 1R0WA 4IO0A 3NWBA 3TTVA 4UUBA 3NTRA 3PTAA 5AK4A 3QFSA 4WZ6A 4ZODA 1ORWA 1CE8B 4MA5A 1V41E 2X86A 1OIXA 1X1SA 3IAUA 5KYYB 4F3TA 3O2NA 4A2QA 1FP1D 2SCUB 5C5DA 5I7EA 5DLPA 1WUYA 2K7ZA 2JJ1A 1XPOA 4HQNA 3D1JA 1KAQA 3LY7A 1SUPA 2QUKA 1FRVA 1U3CA 3K0AA 4GDFA 2Y9MB 4PHTA 1JNYA 1TT7A 1U3UA 1C81A 4L5AA 1F2TA 3SZLA 821PA 2BFFA 1EZ4A 4Z4FA 1BCRA 3L5KA 8ABPA 4M9QA 5J5VA 1E8DA 5AOBA 2QUZA 4HDAA 5FJIA 2CVOA 3MMPA 1XLVA 2JK1A 4ZCSA 4LHVA 4BJ6A 1CV2A 4CU5A 1LPOA 2C4WA 2PFGA 3ZE0B 4GSLA 4EI2A 4U02A 1KJJA 2ZE7A 2IIPA 1AO3A 3M5WA 3PWKA 4J03A 4GNRA 2GF2A 3OZEA 3E5RA 3OQJA 3QOFA 1P81A 2YXNA 1QTQA 1D07A 1E5LA 5DTMA 5BUQA 2PZAA 3BMCB 3GLGB 1LJ8A 1L9KA 3HM2A 4MKXA 3I4CA 4Z7JA 1TUGA 2A7XA 3SM9A 3RVDA 4ZJYA 1D0SA 2QD5A 2NQTA 4NBKA 1Z2CA 3EGVA 2NG1A 1LBSA 3CGGA 4KQJA 2HF8A 1QB7A 4JYMA 1A71A 2PGJA 4RXTA 2XGSA 4XUDA 4ZQCB 1I32A 5DI3A 4MUIA 1A7UA 3L8GA 5NULA 2YQ4A 2AKEA 2P30A 3A27A 1U2DC 1WMSA 2O1EA 1U7PA 2YXDA 3TNDA 5K0GA 3COJA 2VYND 5FXMA 1E1RA 1M67A 2WV7A 3DDOA 1Z36A 3N87A 5BT9A 4FEGA 1P0PA 3RHSA 5IW8A 3AUSA 5JDIC 1F8FA 3TFWA 5F9HA 1NUSA 2EF1A 1LPSA 1H4TA 1UCFA 4PAMA 5T67A 5TMBA 4PQRA 1YIDA 3UWDA 3KYJB 1K9VF 1HEYA 1GV1A 1RXIA 1X7WA 2Q3FA 2REQB 2ZR0A 2NUAA 3OA2A 1OJ7A 2NX2A 2BGKA 1T10A 1TJNA 1NOJA 4TV9F 5JANA 4ZDWA 4BYMA 2DUNA 3HFJA 1W94A 3KAPA 1DBIA 1WPRA 4HNAB 3HP7A 4ZDKA 1XEXB 3ANYB 3K9WA 1N1EA 2O2DA 4L3OA 1ZCFA 4JNKA 4FQ8A 3N6XA 1U5CA 3GNLA 3LT1A 4LMRA 1QRTA 2CLFB 3A6KA 1TAQA 1YJBA 3CO5A 3CTPA 1NM5A 3KE9A 3MJFA 1J0BA 2VQSA 1ANKA 3L6UA 3SBDA 3AHFA 2RAFA 2W37A 1ENZA 5T7BA 2RFLA 3D6UA 1ST2A 2B2CA 1WKCA 3OZVA 2J3DA 1B73A 1SU8A 3D6TB 3VX4A 1Q7CA 1JEAA 1LBEA 3GRUA 3PNMA 1U6JA 3RIXA 4D9NA 1SXGA 3QEBZ 1B0PA 1M8JA 1NBME 5A5VA 2WQ6A 1DJMA 1C4KA 2SNIE 2JJYA 5EIBD 4JP5A 1XTBA 3GMIA 4WXHA 5DOVA 5LIPA 2XUZA 4TWRA 1EZZA 4FOOA 4QPJC 3G6KA 3VPGA 4RVCA 4BBZA 4RA6A 1YBFA 3NI2A 2OYRA 1Q50A 1VHJA 2A59A 3WMGA 4IIDA 3IHWA 1QO0A 1H85A 1Q0QA 1YKSA 3ANLA 3ETEA 3OBBA 4MRSA 5IM4A 6CHYA 3PC6A 2CK3D 2OQ2A 4I55A 3NYQA 5K8LA 2QG6A 1JILA 3IAM6 4HNQA 5EEHA 4B8YA 5AIBA 4AN4A 3RUHA 4R69A 1V4BA 3AYXB 2XMZA 4J0FA 1L3IA 4YP6A 3EA5A 4AMUA 2LZ0A 1DAKA 3MERA 2WYUA 2E49A 3DFIA 4OIMA 4RU1A 3E4DA 1QIIA 3TIIA 4Y18A 2ON6A 4ZVLA 3PQ8A 3HO1A 6Q21A 4F5YA 3UJHA 4W82A 3MTBA 1QG4A 1SJ9A 1BDJA 4LJ5A 4RANA 4IUCS 4HX2A 1A4RA 4JHXA 3EFEA 1YBHA 1EFPB 2P4HX 4XD7A 4DV6B 2YV1A 1BU5A 1GTSA 2QTAA 2P9BA 2FOXA 2QMEA 4ZYXA 2ZXUA 3NIBA 1W4AA 5JCJA 1E1LA 3PEEA 3I37X 3WHKA 1B14A 1JHQA 1RFLA 3S2GA 3CA8A 4AZ3A 7MDHA 4UM5A 2IXBA 3CE6A 5AJVB 1NPDA 2C92A 5JOQA 1SAYA 2AVNA 1LUAA 3AUTA 3CLRD 2Y4OA 4FT2A 4JYZA 5CVJA 3STTA 1EG7A 4KHZA 3E22B 3W5UA 2Q5LA 5D6NA 3USCS 3M0EA 2AX3A 4CFZA 5ECDA 4REQB 3UHFA 4OL0A 4DSTA 2BBWA 2GYYA 3I9LA 2A9QA 4TT3D 1T4CB 3EEIA 4YLEA 3HN6A 2VRNA 3OQOA 4GDMA 5ALLA 4B1FA 1CB0A 3B1WA 1I1HA 3CZCA 3LT5A 2ALJA 2VJBA 4PS1A 1IFXA 1JRLA 3PXUA 1IXKA 2HREA 4BAZA 1C9EA 2Z2XA 4FDMA 4YIHA 5JEDA 4KACA 3W2IA 2JH8A 3FFTA 4WZZA 3RYHA 4EDFA 2FXIA 4KNWA 3VYTB 2EC5A 3S3TA 1QS0B 5JARA 2C5GA 4GE3A 1Z34A 4F3NA 2HUNA 2DR0A 2ZJOA 3GPLA 1GA4A 2H51A 1FJHA 2LKDA 1XC7A 2YVLA 5ALHA 5DTQA 5D1NA 2ZFUA 1J20A 5FPSA 1CQIA 1U5AA 2G4LA 4PGGA 3NHAA 2AJBA 5FWYB 5A7FA 3GRRA 4U8HA 1CZLA 3DLPX 2QD1A 4UATA 2OFWA 4Q39A 2JEZA 2B3TA 1ZH8A 1PG0A 5A0FA 1EFKA 3VDNB 4DUGD 1K63A 1H9AA 4Z4GA 1Q1AA 4LJ7A 5AMXA 2J09A 4AJ4A 1WX1A 1ZHHA 1E5XA 3I6ZA 4GC5A 4M7WA 5KTTA 3ESBA 4PE5B 1UKAA 4X7MA 3K6SA 2BSQA 3FCXA 5HKOA 3AESA 2E5WA 4B83A 1ZOIA 2VTEA 1Z29A 5LLDA 4MIEA 1Q22A 3KM0A 2HK7A 4FHZA 4LXHA 4EG4A 4HWGA 3ZBPA 1Z3IX 4EFMA 3IKTA 4ZVVA 4H1WA 3ZNPA 2R8ZA 3BJMA 4UDNA 4FFRA 5LP1A 2GBFA 1MB4A 3T5TA 3E7PA 3ZV6A 1BKDR 3F8TA 3VC7A 1RQ2A 2VP6A 4IDHA 1XVLA 4MNTA 3GR6A 3RUAA 4BMSA 4KQ9A 3EVGA 1W1UA 1ZMTA 1OASA 1QE3A 2AA3A 1UBRS 1QZ3A 1TA4A 2CLLB 2G08A 2X1HA 3OQ6A 1SZJG 1D6NA 1Y5IA 4D45A 1EIZA 1NBIA 4B3MB 2YYYA 2H2FA 1HL7A 2OCYC 3BS4A 3C7KA 3I2JA 3IP1A 1A1VA 3H4VA 2AVDA 1J5EB 4X6UA 1DS6A 3A3NA 1XVUA 4Q9AA 4J6EA 1RU3A 2XB8A 2O0KA 1YOBA 2FI1A 5D84A 2WTAA 1NL3A 1NN5A 2BTEA 1FRQA 3HXKA 1X1EA 2JK0A 3FZEA 3FH0A 4I3HA 4P7JA 1L7DA 3D4IA 1QHGA 4PLPA 2QRKA 1DT5A 5C8YF 1CEQA 2HH9A 4AYWA 1GZ7A 1HBJA 4IVPA 5THQA 3U4CA 5DP1A 2I4MA 2N9UA 4OK3A 4RF4A 1R8YA 4ZQEA 5ESRA 1JL3A 2WG2A 3SCZA 3KQSA 3WP0A 3EODA 2J07A 1II9A 2QTRA 2AZXA 2OWDA 1DLJA 1P7PA 3KVYA 3QIVA 4PX9A 1T5BA 1TMOA 1M1ZA 4J4HA 2QLJA 3T06B 3EFBA 2QSZA 3VPAA 4A2WA 1YR7A 3NW9A 2ZQ5A 2RHMA 4ITRC 4LZOA 2GPSA 2B9EA 4XWWA 1TUEA 3CUKA 5TJHA 5K0ZA 3ESZA 3FJYA 4GOXA 3SHFA 1E3IA 3F73A 2R4QA 5E6SB 4CFSA 4NYMQ 3RS2A 2AFIE 2XQFA 3B1ZA 1JA0A 3QPVA 3TGPA 1M1NB 3OC0A 2OHXA 3S1LA 1Y5MA 2A1UA 5DTRA 2R5NA 4I1VA 4OXYA 3TFOA 3TEJA 2CSXA 5DYWA 3CCBA 4QAJA 2MSKA 1N9GB 3C39A 4YC7A 1GFSA 1WV0A 3QU9A 4EL0A 3CCFA 1CZRA 1R3UA 1X7XA 1SOAA 3A25A 3IDOA 1Y1TA 4LK3A 3VYUB 2MDTA 3U6KA 4OG2A 2OSVA 2FY8A 3M6LA 2QVBA 2PDAA 5B7NA 4FOPA 1ZA2A 1FFDA 1GPBA 3OZAA 1NI5A 5ALOA 4CL0A 1IM2A 1B23P 3PWTA 2FMFA 2ZUWA 3PFCA 4N9QA 1CS0B 1Q1EA 4G25A 4OBEA 2M2IA 1QHSA 3GH1A 1VPWA 4UVHA 3K8ZA 4EARA 4EYQA 3O8RA 1USUA 1SVOA 4CM5A 4F8YA 1W85B 5F76A 1NFRA 2XUIA 4DSNA 3RW9A 3TXXA 1D2AA 5EP3A 4FONA 3T1OA 5KSPA 2ZJ7A 3QHQA 4FMPA 4DNFA 1XZQA 5JYEA 4D9CA 1I2ZA 2KM1A 3QEKA 3I3SR 1LS1A 1ELOA 2JLRA 3N8NA 3UYLA 9ABPA 1ZGBA 1KZ7B 1WAMA 1ZS9A 2R6AA 3DL2A 3CEHA 3O3MB 4RMGA 4EHNA 5KYUB 1MTZA 2FG7C 1BSVA 1V1JA 4PFQA 1GFIA 1OVMA 1KI2A 1QGAA 3HCBA 2OE2A 2VHTA 3R8CA 4C6SA 1VIDA 1XXHE 3EXEA 2D7DA 4OLBA 3AI1A 4P9NA 1ECPA 4A91A 3BMQB 2CYAA 1F6BA 2YMMA 4G0PA 4RVGA 4UBOA 4OX9B 1C3OB 1TZKA 4MR7B 2J9GA 3B12A 2VLIA 1B41A 4JI3B 4F3CA 2IZOA 3GP5A 1BFKA 3KSDO 5AVZA 4KE9A 8LDHA 1PEKE 2PBRA 3IXQA 4RVHA 2GUGA 4NU8X 5I7VA 3QVTA 3UMMA 5JC1A 2MSLA 3P4UA 1VSQA 2DLDA 2R79A 2V0NA 3C6KA 3LQYA 4R81A 1F9EA 2EJCA 2RARA 3CNHA 3RGWS 2PRIA 2ZAGA 4LWQA 2I6SA 5TPZD 4AS2A 1RC1A 3AEUA 3IHLA 3QUTA 5K0TA 4EQZA 2OP0A 1DC6A 1EWTA 3KJQA 2VVTA 3DKIA 5FD8A 3BGIA 5TJ9A 3TBFA 4G09A 3WI7A 5LYJB 1LJUA 1K1EA 2BKAA 1G66A 3CRNA 3CXRA 2OB1A 4IICA 4ER0A 1AKTA 3C6BA 4FW9A 3EBOA 4FU0A 4PF1A 2Q9CA 2LGJA 1I4OA 3QUAA 4K1LA 3DBLB 5CXSA 2EU8A 1JG3A 3UG6A 4E5UA 1TK9A 3ESYA 4FBGA 1AUXA 1QH8B 2QVZX 3DLCA 4AB1A 4GEKA 3UHPA 4N0MA 1LNQA 5INTA 1GPJA 2FZCA 2FR1A 2ZXEA 3QVWA 1B6TA 1KSFX 1WEKA 4KL8S 1UP4A 4AJOA 4DRXA 4KGVA 3J7AC 5EIOA 3PFBA 4MTLA 5CT5A 3RAEC 3AR3A 3CF4G 1UMBA 4DA0A 1S96A 2CEAA 1B8PA 4Z49A 1H9CA 3T3OA 3EW9A 5C7IO 2H92A 4GSYA 1BC5A 4Q4AB 1EEXB 3KTDA 4UW9A 4QLOA 2Q62A 2J9FB 1QIMA 1EM8B 1OR8A 4RK1A 1EHYA 3K71B 5DGIA 5CVTA 3JARA 4A5SA 3RVQA 2ZI4A 1K66A 1TA9A 1ADYA 1ZNZA 3B1JA 3D8NA 4P83A 4BQQA 4XRGA 3IKLA 5KNDH 2FMTA 1DO0A 2H1FA 5HUJA 1ZI9A 1SCQA 3LLCA 4ZOQI 3D4OA 2FLVA 2NT3A 3FNEA 1YL7A 4GXRA 4NLLA 4F2WA 5LU9A 1N8TA 4GI5A 5LMZA 4G4SO 1GV0A 1IH8A 3EXHA 3LW8A 5TVGA 2F6RA 2YXLA 4FCVA 4X1YB 2O0HA 1E9DA 2JA2A 4LVOA 2GJSA 2WVJA 3AR7A 4JH0A 4NV1A 4KSCA 5FQOA 4Q24A 5FUXA 4ARUA 4PAGA 3OZCA 3COYA 3GLUA 4PAQA 2VCYA 3VR6D 5LDHA 4P58A 3K9FC 3U60B 2ZKIA 4AZ0A 1A8PA 2F2TA 4UU8A 1G6HA 5FWXA 1EK0A 3QMMA 4YX9A 4D0RA 3S8MA 4OHFA 1TNDA 4WNCA 3CUWA 1W0JD 1YDEA 3NHJA 3INNA 2BJHA 4ML3A 4TUYF 4FB5A 1E4VA 1R0ZA 2AHRA 1QTRA 4NAVA 1NVDA 4WACA 2H29A 4PG5A 3WHPA 4C87A 1N77A 3L7NA 5LYYA 3HTXA 3IALA 4R9VA 1NATA 4CMIB 4R8RA 2BEUA 1J33A 2PA3A 2W4MA 3UVEA 1PYDA 3K53A 4OREX 4J3NA 4CF4A 2A1IA 4Z3KA 3PNKA 3T0IA 3R9WA 1V5FA 3R20A 3NP9A 1Z0UA 1ONNA 3L77A 1KVUA 2QY9A 4TLBA 5DCLA 4GPD1 3UAOA 4KITB 1A9QA 2YY5A 4FX5A 1GPNA 3R3YA 4UJ3A 1V8PA 2LNDA 1OU4A 4P8RA 4DQ0A 2EKQA 2FX3A 4DT1A 2KBEA 3FPBA 4Y2HA 3RYFB 5IU6A 4YK7A 3TDMA 1SU4A 2AD1A 3TVTA 5LBUA 4C4RA 1OLSB 2H48A 2VK1A 1IZ8A 2VTBA 5HF9A 3VPHA 3ZZ1A 2A9VA 4ADSG 1MJFA 3EYWA 4KFUA 2E3JA 5JU6A 4PYQA 1LVHA 1M1UA 1P8AA 2FEWB 1V16A 3AT1A 2AF4C 2PANA 5JZBA 1BIFA 2FW0A 4UMEA 2WFAA 1PEDA 4E6PA 4G65A 2PUDA 2JH9A 4LHYA 4UNIA 2HD4A 3G2QA 3MWFA 1GNVA 5C2JB 1RTKA 3ENWA 5F33A 3JSXA 4ZQGA 4CMAA 5TC4A 3A4YA 2ODTX 4JVOA 1C30B 3ZN2A 3DOOA 3HGTA 1SULA 1FTYA 1M9NA 3I9V1 4WZAE 4BS9A 1W6UA 3ZZTA 3ZQUA 1SRRA 2D5LA 1JAYA 2YZNA 1H8ED 1SBQA 4ISBA 1ESEA 3R7BA 1WBBA 2QVXX 1E96A 1Q20A 2WT9A 5CCEA 1FQWA 1VZ3A 4RY8A 1D04A 1FMTA 1MORA 1OFTA 1V11B 3RNLA 3TLKA 2XTZA 2JGFA 3GK3A 3PZBA 2A9JA 1E0DA 1DKRA 2NZXA 3QVGB 4MYRA 1UPFA 5BSWA 5L4SA 2JLXA 1FMFA 5F7ZA 3CLTC 4KAFA 3U4IA 1N3YA 1P0IA 3VBEA 3ZU2A 4IS2A 1N8KA 3F6CA 1GSIA 3MMZA 2P77A 3CYFA 13PKA 4R2KA 1EWQA 1PAUA 4Q48A 4UCFA 4ZMSA 1NY6A 3QMVA 3IVGA 4FLEA 2X22A 4MR8B 4PGAA 4PNZA 4ZT4A 3SD7A 5JZ9A 4O2BF 3VR5H 3M6WA 1VCIA 1WQ1R 2YHUA 1G5RA 3AIMA 3GN1A 4TSKA 1ESMA 2NGRA 4Y0NA 1PJ8A 1VKZA 3X2FA 3TRJA 5HXAA 1GZ3A 2C8VA 4BNIA 4DLRA 2WSMA 2W6ZA 1WABA 2C99A 1DIRA 2GRUA 4HYEA 1BE0A 1NUHA 3FVWA 1IIRA 4B87A 1U0EA 2B98A 3F7NA 3RTAA 3WDMA 3D0OA 5HQ3A 5KNBH 4AS1A 1RJGA 1K27A 2J33A 4ER7A 4QRIA 1F4PA 2CKDA 3FTFA 1DXOA 4NIMA 2ZYDA 1HDZA 1A95A 4OFXA 3UYKA 3R9XB 2CUKA 1EX6A 2HPZA 3LZ6A 1ULHA 4YB8A 4K9KA 5D3MA 2GJ8A 2ONYA 4A3SA 1XRMA 3A6EA 2OCPA 3C6MA 3I9FA 1GNQA 4EZIA 4MVJG 4AWXA 3GLIB 4YT2A 1K6JA 1YXMA 2F1IA 3SJZA 2WM2A 2MSNA 4EKGA 2WWVD 3R5SA 5D3QA 5DOZA 1ZCJA 2J31A 3OFND 5TLSA 3Q9SA 1CVIA 1MR3F 4BMCA 4YPFA 1VL1A 4ZO7A 2R97A 3IOBA 5WRFA 1LVUA 2HFJA 2HSWA 1T0BA 2NUPB 5FPPA 4XOUA 1YR6A 1IN1A 3II6X 5AW9A 1M72A 3ENQA 3IPCA 3KXDA 3TQCA 4G1MB 4LECA 2QTBA 1NJFA 3VFDA 3DTYA 1VI5A 3ONNA 4Q9LA 3S5JA 2NAFA 3VYWA 3QYPA 4NOJA 1TZCA 4Y9UA 5HIMA 2ZJ0A 1C41A 1C7IA 4UM9D 3MGGA 2AB0A 3BXEA 3CEAA 2I8LA 3AUFA 3TW0A 4CT0A 1L5FA 3ZEAA 4BX9A 1ZK0A 2YRFA 2VJKA 3P9XA 4NZNA 4Y1FA 5CU7A 2UZ0A 3L0ZA 4TWIA 3GWZA 4DSAA 3C97A 4CIBA 4B6QA 2BGTA 3Q3JB 1B4DA 5ALYA 4QRDA 4RTLA 3AF4A 3LQFA 3D8TA 4PO3X 1LS6A 3KQWA 1JN0A 4G8CA 2EHDA 2YZKA 2A2ZA 3SQDA 2AR7A 3OEEA 2VRCD 4A73A 5EHQA 4D0SA 1NF2A 4MHOA 4U7JA 1PL7A 4JP1A 1RWMA 2AOTA 5IBPA 4EF6A 5JE8A 3G7NA 2BF4A 2CCJA 1JKXA 3QM1A 4YDSA 4B3IA 3SC3A 5BN4B 2VPPA 1T1SA 3OJWA 3PPIA 3FPSA 2UXDB 3EK2A 5CNKA 4UOZA 3IC5A 3QLVC 2EKDA 2OCKA 4HUTA 5KYTA 3SP1A 5HK9A 4GZ6A 1M6YA 2A0YA 1RLJA 2ZJ4A 4RK0A 3HJUA 3AFGA 2AN4A 4YTEA 1U0NA 4YACA 4ERNA 4QZVA 1GQ2A 2AJTA 3TM4A 5DBFA 2BE7A 1HPLA 5IANA 4IKEA 1AKUA 5EWMB 1OI3A 1OZAA 3PUJA 1CQXA 2ZB4A 1AUQA 4ZVQA 4YWHA 3VHXB 1TX4B 3KUUA 3KOXA 3VNQA 3F6YA 1YWGO 3K6JA 2ABWA 2HMTA 1RCUA 1NPTO 2IOHA 1D4FA 2EZTA 3MINA 1J99A 3OLWA 3P2IA 3Q6MA 4HFMA 1W4RA 1KAEA 3SFTA 2QN7A 1GGFA 3F8WA 1TKAA 3C5HA 2HI0A 3HU2A 5FULA 2FSUA 1N7HA 4JT2A 1U9ZA 2XYHA 2FYTA 2IHTA 1TMKA 2DGDA 2Q2NA 3V1MA 4RPLA 4AP5A 1C1XA 1D5WA 1TK3A 4QJ5A 1XA4A 4WFKA 4BO7A 3ZHVA 4B32A 1HYGA 1RJFA 1QF9A 4E2YA 1T5HX 2ZRAA 3M4JA 4LC1A 4R9RA 2BE9A 2XTAA 1DQNA 3BBLA 5CM8B 2LP4Y 3A9CA 3MOSA 2DCUA 1ZZEA 5KC8A 4KXFB 3ZZ0A 1SB9A 1SWVA 2B8WA 2ZEJA 1XROA 4DRZA 3MT9A 3WGUA 5I48A 5J58A 2I6QA 5JNSA 3L7OA 3BWBA 4R6WA 1R5BA 5T4EA 4PZUA 4WBNA 3OM9A 5IKPA 4IXNA 4URVR 2AEFA 3K92A 1J97A 4IHAA 1GJRA 3SIPA 3HQ4O 2O5CA 5B7PA 4I66A 4DLTA 1DKUA 1UDAA 4KIUA 3RK1A 4TLCA 5BUZA 2GAAA 4JLMA 1ATZA 4JB0A 5TARA 5IT5A 2R5FA 3N07A 2FE1A 4BEWA 3WBFA 3KUKA 4GBJA 3ZHRA 4HX5A 3A6ZA 3TLGA 1PEYA 2Z57A 2BRUA 4G84A 1JPVA 4L6IA 3ZIAA 4E88A 1OFHA 4V1CI 3TXAA 3T9AA 1IZZA 1F2UA 1TE2A 1IWPB 1D2RA 4AJPA 1SWWA 1MJHA 1KC3A 3HNRA 3NETA 4CR8A 1Q84A 1Y1QA 5AJYA 1CR0A 3AUXA 2V74B 2F90A 3WO1A 2PR2A 4DCTA 5B12A 3WNZA 1G8PA 3GIWA 4BKRA 3EPLA 1O54A 3RWOA 2QPAA 4P22A 3FVVA 2ZQZA 3LLVA 1TK2A 4RORA 5LMNB 4YMIA 1PUJA 1DKLA 2DFVA 4E12A 2EZ4A 4XYGA 3WG9A 4YCMA 2IV2X 5L3QB 1FU8A 2BM0A 4EABA 1MMFB 1E61A 3AR2A 1M2OA 1Z6TA 2E4ZA 1GYPA 3KOOA 2PAAA 2ADOA 1PJ2A 4F8JA 3AIOA 3LRTA 3RVKA 1C1HA 1YNSA 1V3UA 4GUDA 4D3SA 4MUHA 4KQFA 5CVEA 5DYTA 3QNMA 5KNCH 2QGFA 4AI6A 4Z51A 1A8QA 2BR3A 3CZRA 3JYQA 4H6XA 4PZZA 1PGJA 2FSVC 1LC0A 4JOSA 2P11A 2Z2KA 4C3VA 1JEYA 1N2HA 3SE7A 1TJPB 1ZIOA 2IYXA 2QK4A 3B9BA 1Q1QA 4PV7A 1Z47A 5K4GA 3PJRA 4ZDJA 4M86A 4NCKA 3PCRB 2RGXA 4KXUA 3AY0A 2IGTA 2IEDA 3CT6A 3MILA 2BKEA 3CF2A 1P72A 1C8BA 3CG4A 4RHCA 5LXTB 2E4VA 1EDOA 1XTZA 2VBGA 4RS3A 3K0KA 3MBIA 5J2UF 5I5EA 1VHQA 1OFIA 4OFZA 1NQOA 2HBYA 4QXQA 3ZU3A 5ADUS 5KNDD 4RH1A 3WQQA 2CW5A 4YJHA 1SC9A 1G7RA 5K3AA 2X9GA 5HTOA 1M73E 1XMOB 5A4AA 1H2XA 3JU3A 3T35A 3VVMA 3FUUA 1SXJB 4C7BA 1E9AA 2VKTA 2RHCA 4NNPA 3ZE1B 1QLHA 2G06A 4M1QA 3P9ZA 4HDRB 1G6OA 3JQDA 1KRXA 4Y2TA 1PNVA 2CNNA 1NR1A 3QIAA 4KIWA 1OW3B 1ETUA 5HSGA 1M5TA 2BLNA 1LPPA 3PGXA 2ID4A 4OQFA 3CVWA 2LR0A 4G0YA 3ZG6A 2FEKA 2YVAA 2JHCA 2P6OA 1PL8A 2ZBQA 1Z6GA 3D5TA 4EG8A 5BWBA 3BORA 1GHTA 3TR0A 1TLFA 4Y1GA 2IS4A 3AF5A 1R5OA 1ZM9A 2XVMA 4MGEA 3W4JA 5EHXA 3DMTA 5BSKA 1SVWA 1G7TA 4R0NA 4BO0A 3CF0A 1R64A 3RS9A 3C3PA 2ROQA 5K1ZA 1Z15A 2Z09A 1JR3D 2VCHA 4V1CA 5TQVA 1NVVQ 1U8XX 4HAOA 4CI0B 4II3A 1FTQA 2H07A 3GARA 1H42A 4FGUA 4A16A 3HCPA 1JDVA 5LNK1 3FJOA 1UJ4A 4DM3A 4F7DA 4ZHSA 5J4KA 5H80A 1O7JA 3VKHA 2QM7A 1N0WA 1IN4A 1DJQA 2GHQA 2IZ7A 1ODCA 5FCDA 4DUPA 3WGNA 1UXHA 4LF7B 3BDIA 1UH5A 4O5OA 3MTAA 1WUKS 4IQ8A 5A4MS 2XNDD 3JALB 3WKDA 1N7JA 4M37A 3A10A 1EPUA 1QH0A 2WJ6A 2XMGA 3Q9NA 4HZUA 1MNAA 1ZUNB 1ZXBA 2VNKA 3P2MA 3NIFB 3ZGXA 5ITZB 3AINA 3FW1A 5JRZA 4EX7A 4WDRA 4B45A 1T5DX 3MRXA 4COOA 4L07A 4H60A 3WLIA 2FW7A 1T6BY 2JLZA 3CRW1 4G89A 5F5LA 1SIOA 2NYVA 3UGTA 4KE6A 1A2QA 2RKOA 2WFMA 4PYJA 2O8FB 4MSUA 4AG5A 3Q10A 3HVUA 1Y7HA 4TWAA 1XTPA 1JV2B 3OEHD 4MOWA 4Q34A 2XZLA 1XL0A 2VOJA 1OV4A 4Y98A 3LK6A 4DJTA 4BQIA 4W9RA 5E4TA 2O7NA 3BXZA 4HWOA 1MZVA 2VAXA 4LCBA 5G4KA 1TLLA 3M8KA 1NY5A 2PGIA 2XMPA 4BFYA 4CNBA 4TS3A 4LMAA 1BNCA 2QTHA 1IN8A 2EWMA 2FG5A 4FR0A 4P36A 2B6NA 1IMJA 3EVCA 2I3ZA 1XGKA 4UUQA 1VE5A 1NMQA 1GR1A 3SSOA 3O7MA 1HORA 4EW3A 3M6XA 1XWWA 3L1KA 2AMLA 4CUZA 5GTDA 1GFWA 1UBUS 4IM7A 3SNKA 2P1DA 5JYCA 2Q49A 2W8ZA 2XX3A 3H13A 4G37A 4W5HA 3KLBA 3S1AA 3SC6A 5CDGA 2G83A 4FD3A 4R1LA 3AUUA 4IP0A 2BFEB 5J2TB 5KI6A