3BMCB

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and substrate (folate)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 91
structure length 248
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmcB00
1TB4A 1I32A 1HE2A 3PEFA 1HDRA 2B4QA 1KC3A 2O3RA 5KJEA 2R00A 2B5WA 3RWBA 3WBBA 4DQVA 4DYDA 3F9IA 3Q9UA 1XG5A 3FN4A 3INTA 2WD7A 5JAIA 5KIAA 3U62A 3KO8A 1V8BA 1YRLA 5KJFA 1I24A 1B8PA 3TFQA 2QZ9A 3G49A 4D3FA 4RF2A 4PG8A 1HXHA 2G0TA 4XYGA 2QX7A 3PP8A 3PIIA 5EIOA 4RL6A 1E1NA 4LCJA 1H94A 3OJOA 5BNFA 2ZQZA 4E0BA 3JQEA 1Y9EA 1HL3A 2E49A 4JBIA 2RCYA 4CLOB 4H15A 5TNXA 4NK5A 5BSFA 3CINA 4Q39A 4XDYA 5A5EA 3GAZA 3ZWVA 3JYPA 1KEPA 5AOVA 4DIBA 4LRSB 1GZ4A 1HDGO 2IXBA 3QLJA 4A7PA 2PGJA 4RZIA 4DC0A 4A10A 1E6EA 2VRBA 3VVBA 4BV8A 3H2SA 2DM6A 4WKGA 1Y5RA 3PGJA 3BHJA 3ICCA 3QJ5A 2Q2QA 3EW7A 4YAIA 1A5ZA 4RPGA 5ITVA 1YDWA 1HKUA 1ENZA 1E3WB 1M76A 1Q1NA 1OZAA 4UEJA 4GI2A 1HSZA 3ZW9A 1H6BA 2JCXA 3OETA 4CLDA 1F17A 3R3JA 1Z73A 2R2GA 3WICA 2V6FA 4J9UE 1T2FA 1YL6A 2VCYA 2B35A 1YB4A 3WMWA 1GQ2A 2VHWA 4WLFA 3RKUA 1X0XA 3QA9A 1ZH8A 2WD7B 3MJCA 2WWRA 1YS4A 4AJ4A 5L7YA 3GZNA 3GN1A 1Z75A 5DOVA 1LUAA 4Z0HO 1DFGA 3ON5A 4IJWA 1BSVA 4BO2A 1C0KA 1MG5A 3W8FA 3GVXA 4JX8A 2PZKA 1I3KA 4LISA 2GLXA 5JE8A 1H6DA 1R15A 3LLVA 4PZDA 5DCWA 4BL5A 2BHLA 3U5TA 1B14A 5A3VA 4CLRB 4LSMA 3N74A 3GLQA 2CDAA 2Q2WA 2RH4A 4BOYA 4MKRA 2NVWA 1SB8A 3AY6A 4PLWA 4RQUA 3JQCA 4ND4A 4Z0PA 4DYVA 1ADBA 2X22A 1X7GA 3AM5A 6LDHA 2JD2A 3JQ7A 5GZ3A 3ANNA 1RKXA 5TRTA 1ISJA 4KWIA 3FNHA 1EUDA 2Y1CA 1Q7CA 4ZQFA 3LF1A 4N5LA 5T64A 4EDFA 1H0KA 2VHXA 5JY1A 1IPFA 5KVQA 4TRMA 4MP6A 2VHVA 2W90A 1LX6A 4XA8A 2I9PA 3SC6A 3JQ8B 5A04A 3PWZA 1ZJZA 3N58A 3WNVA 2HRBA 4M55A 3NT4A 3KOUA 2Q1TA 2G1UA 1EZ4A 1BMDA 4TVOA 2ZCUA 1GV1A 2WJPA 3PJGA 4E2XA 4WOJA 1PS8A 4PVCA 5JPIA 1XEAA 2HKIA 3HN2A 4MKXA 3I9KA 4P8RA 4BNMA 2GN6A 1VL6A 4JK3A 3U0BA 1NPTO 2IEDA 3R6DA 2X5JO 1H6AA 3PI7A 4PLZA 3QWBA 5A4DA 4Y6PA 5G0WA 1PR3A 3ORFA 2H5LA 2HQ1A 2Y0DA 4ZHSA 1KVTA 1QXSA 4GGOA 1H2BA 1N1GA 2VUTA 3UW3A 1BW9B 4A2CA 1I2ZA 1YL7A 4BNZA 1PS9A 2YY7A 3S2FA 4AFNA 3QWFA 3AJRA 5AVOA 1PGNA 4RO0A 3C85A 1BTOA 1XWFA 1Q0LA 5KCZA 1C1DA 2DT5A 4AJJA 4QUKA 5GMOA 1LBEA 2PGDA 4KTTE 3DB2A 3BTOA 1T24A 2Y1GA 4JJIA 1YL5A 1GEGA 4RF5A 2DC1A 1WAMA 3AW9A 3DO5A 3PQEA 1VC2A 1UZMA 1BWSA 1FXSA 4A0SA 9LDTA 3G3EA 1DSSG 5EQFA 1N8KA 4R51A 4U0JA 4RPHA 5IJZA 5F1OA 2O2YA 1HTBA 4DIFA 1H93A 4XR9A 3WOHA 4BHTA 3GHHA 2C5AA 5L7TA 2ZTVA 5G4LA 4JXKA 5DBFA 4FC6A 4RVHA 3QP9A 2FWMX 1PGJA 3MEQA 3GVHA 1IYZA 4U6QA 1GYQA 1GCUA 1P1KA 2EP5A 1YB5A 1ADGA 3KEQA 5KKCA 4XJTA 2VYVA 4JP3A 2NTVA 1ULUA 3KUXA 4Q3AA 2I65A 5H82A 4XQ9A 2ZTLA 3NDJA 1RYDA 1ZIDA 3LZ6A 4D46A 4IDDA 2ZTUA 4Z3DA 1F0YA 2E4AA 2JAHA 4KUEA 4YPOA 4J2HA 1KEWA 1PTJA 3ZI0A 5CEFA 4L75A 1FF9A 2UAGA 3F46A 1BXZA 1UP7A 4N5MA 3WDSA 1QLHA 3VH4A 2HMSA 4DGSA 4P4NA 4R1NA 4AJ1A 1P44A 3KEOA 3UUWA 3AUTA 2FY8A 4WECA 4GX5A 2W2KB 1E7RA 1IHXA 3LSYA 4IXTA 4BNFA 4W99A 2OOSA 4XQEA 4DVJA 1NFRA 4OMUA 4FCCA 1PQPA 3GT0A 3F1KA 4L73A 3DZIA 5I8WA 4DBVO 3C8MA 2AG5A 5IXSA 5JFOA 5LDGA 3VTFA 1FDWA 1GDHA 3KYDA 4BNXA 4YACA 3DR3A 3EVTA 3FTNA 4R1UA 3W1VA 4FFMA 4XDZA 3GUYA 4YT8A 1RJWA 3L0DA 4TQGA 5EERA 3SJUA 1XGKA 1HSOA 4GSKA 4UAGA 1YGYA 4WLEA 4A26A 1ZK1A 5A9SB 3HJAA 1P1RA 4MVJA 2A9FA 2PR2A 1KIFA 1X13A 1EVYA 2G5CA 1KETA 1T2AA 4CLXA 1HYGA 1PJ3A 2PKQP 1UAYA 3ROPA 3PJFA 4B7CA 1QSGA 1UXIA 3OH8A 4PLPA 3NDIA 4UUNA 3WGHA 1DBVO 2GNAA 2YFHA 1GZ3A 2YQ4A 1ZUD1 3H6KA 3OJFA 3S2EA 2IZZA 3ZGYA 1GY8A 3OP4A 3D5TA 2B4TO 2GF2A 1WZIA 3OF2A 4BO8A 3FNEA 3HDHA 4PLHA 3WB9A 3L9WA 3CZMA 4FW8A 3E9NA 1A27A 1NR1A 2I3GA 2P68A 2Y1DA 2AQHA 1LLQA 1O6ZA 4XB2A 1HETA 3C7AA 3OBBA 2XXJA 1K89A 3CMCO 3W6UA 2BI7A 4PIVA 1WWKA 3AOEA 1QYCA 4XYEA 1ZXLA 5CDTA 1KVRA 3GA0A 3E9MA 1OOEA 1SBYA 3H3FA 2E48A 3WGIA 3WLEA 1NQAO 2FSSA 1S7CA 4OYRA 2PNFA 3GFBA 2YV3A 3ZNNA 3PPIA 2FOIA 1WMAA 4FOOA 4RVFA 1UR5A 4IMPA 2D1YA 3V2HA 8LDHA 2NU8A 2R00C 4DLBA 2DTDA 4IGFA 2YHIA 3HDQA 1O94A 4L8VA 3CH6A 5AQ1A 3LF2A 3R3SA 1ARZA 2JJYA 2ZATA 1BXGB 3DOCA 4E3ZA 2DKNA 5ILGA 5C7OO 2H63A 3I6QA 3LQFA 4IY1A 4K9DA 2Y68A 1IOLA 1A7KA 5BQFA 1GEEA 2GZ3A 3ITDA 3TZKA 1P9LA 3ZWWA 5H83A 4YQYA 4OAQA 3AY7A 3LDHA 3JQ7B 4OQZA 1WZEA 3AI1A 3BXXA 3EDMA 5IZCC 2YYYA 3GNQA 4J9VA 4O5OA 1YJ8A 4U0KA 1XYGA 5KJ1A 3WTBA 2UUPA 2QRLA 2ET6A 4E33A 3GFGA 4D41A 2FR0A 3ZCXA 1YVEI 1PJ2A 1YKFA 2J3HA 4GGPA 3WGZA 3ZWMA 4AJOA 5A9SA 4R16A 3ROQA 2GR9A 3ZV6A 2EXXA 3PLRA 1GADO 2HSDA 5BSHA 1AUPA 5TT0A 3ADPA 3L9XA 4OXYA 4J7UA 1LJ8A 4J1NA 4N7RA 3V8BA 1PL7A 5B37A 3CKYA 1YOVB 2P9CA 3NT2A 3R1IA 3GK3A 1ZJYA 1SOWA 4CMCA 5TF4A 2FR8A 4YJFB 3ZNOA 2VUUA 2I76A 5B4TA 2DBVO 3K5PA 3RC9A 4NR0A 3WQSB 3QVTA 3E82A 4WCDA 5EINA 3RFVA 1ZZEA 1W0CA 4NBWA 3W6ZA 1TT7A 1PZFA 3RJ5A 3BMCB 1DPGA 2J5QA 3KYCA 4BNKA 3AOGA 2P9GA 1NPDA 2EWMA 5DN9A 3RUEA 4CMIA 4RLHA 1E5QA 1JTVA 3DBRB 1RWBA 1LTHR 2YDYA 3U3XA 3VPXA 1EBUA 4JP2A 2NLOA 2HAEA 5TQVA 3X2FA 1JWBB 1HYHA 4E2WA 1P0CA 1QYXA 4UVHA 4U5QA 3GGOA 3HB4X 2GCGA 4KUGA 1QYWA 2V6BA 4RVDA 2NVUA 2R6JA 4E30A 1WXDA 3IL2A 4GAEA 1YONA 2QZZA 1N7HA 4L9RA 5C37A 4NIMA 4RVGA 2BI8A 4XKJA 2XXBA 5F3RA 3BMQB 4FR5A 3L6EA 4WLVA 7ADHA 1C1XB 2VYND 4YWJA 5EL0A 4AJIA 3QY9A 7MDHA 4UUOA 4XJSA 5KVCA 3OMLA 2QHXA 2EHDA 4L74A 2GERA 2Q99A 3H2ZA 1LC3A 4QX6A 1JKJA 1U28A 4MVJH 4OJNA 3JQAA 1NQTA 4OHUA 1YQDA 2FPPA 4EUHA 3MJ4A 4BNUA 1PSDA 4OL9A 3OJLA 3R0IA 1I0ZA 3WGOA 3HG7A 3CSDA 3LC7O 4PLTA 5G0SA 2WYVA 3NV9A 3S2IA 4ID9A 3DOJA 4BIIA 1DB3A 1PJSA 1DLJA 4WOKA 3T4XA 3JQGB 5IDXA 4HP8A 4AJKA 4BNTA 1DIHA 3AI3A 2I67A 1HF3A 4DPMA 4O63O 4W6ZA 4L4SA 4HFRA 3M2TA 3RROA 1M6WA 3RBZA 3RU7A 5L40A 3OM9A 4DBZA 3PZRA 3DXFA 4PLVA 1TI7A 4FSHA 3ZH2A 1TEHA 3KM0A 1JW9B 2OZPA 2NVUB 4GX0A 3GN2A 1BHSA 2Y1EA 4YB8A 2C07A 2QIOA 1G0NA 2ZTMA 1NVMB 4R5MA 1DO8A 5FFFA 1D3AA 1KEUA 1XIVA 4BB6A 4E2YA 1CQJA 4GL4A 3I9MA 2AHRA 1DDOA 1B16A 4BGIA 3Q11A 5JYDA 1N2SA 3BA1A 4P4GA 4DLLA 4M1QA 1IE3A 3TZQA 2HMVA 3W8EA 4XQCA 3FBTA 1ZSVA 4ZD6A 4IBOA 1E3EA 1OI7A 1ONNA 3FBGA 4QQRA 3HFSA 4M89A 5F1PA 3L6DA 4UUMA 1HE5A 3IUSA 3NX4A 4E21A 1CETA 4WEOA 1XDWA 4R54A 4XX0A 3O8QB 3D4OA 4B7XA 3ZWXA 3GEMA 4HXYA 1I33A 4KDFA 2VWQA 1R0LA 3WFIA 4BKQA 3ETEA 1ZVMA 3Q2KA 1LDGA 4BVAA 1U5CA 3GRKA 3CPSA 4I9NA 2VZ8A 3RC2A 1ONOA 4URFA 4C7JA 3H9JA 1MV8A 4YRAA 1PWZA 2VT2A 1O5IA 3VH2A 4Y67A 1ENOA 5BR7A 1BDBA 2UYYA 4O0LA 4MIEA 3VVCA 3DC2A 4XYBA 1LXCA 2IYPA 5A1TA 4J43A 5DULA 1ULSA 3U09A 3FD8A 1DJNA 5CDSA 1E1LA 4OIMA 4EITA 3VKUA 2CD9A 3GDGA 3KB6A 5GZ6A 3ST7A 2NNLD 5F1KA 4CQMA 5C7LO 5CG1A 2EEZA 5TS3A 4R5HA 3KETA 1PS0A 3IQDB 4J0FA 3D3WB 3PJDA 4YXFA 1BXGA 1XCBA 2H9IA 1DRUA 2GO1A 3D3EA 2XF8A 2ZYAA 4DPKA 5JC1A 2B37A 2P2SA 5DBIA 3WJ7A 2BH9A 3F47A 1XKQA 3F3SA 3PLNA 2C2YA 4IMRA 3PQFA 3TOXA 3M2PA 1QV7A 4E5YA 1K0UA 3DQPA 3DZFA 4ILKA 2P5YA 5ADHA 4D0RA 4R68A 3RUFA 4ND3A 4HFNA 2GN9A 1OFGA 2J3IA 2GN4A 1GUYA 3WGGA 1MC5A 1Y6JA 4XR4A 4D3DA 4S3MA 4GSLA 1NVGA 3ZV5A 3ZU4A 1LDBA 1P74A 2AE2A 3S2GA 3U4HA 3B6ZA 4MINA 3AM3A 5IF3A 4IDBA 2EV9A 3RAJA 3WBFA 4BS9A 4Q3NA 4CMKA 4TWRA 1VE9A 1PQWA 5COAA 4EJ0A 5THKA 4B7UA 5BNTA 2OBNA 2Z95A 3WQRA 1EVJA 1KERA 1O0SA 4K28A 4YEDA 4LK3A 5CDUA 1WDMA 2D5AA 1LDMA 5U9CA 4BV9A 3MTGA 3NGLA 8ADHA 3IMFA 2IRWA 1GQYA 5IN5A 1GZ6A 3SLGA 2B69A 1TLTA 4RQTA 1QR6A 2DTXA 5A02A 4WEQA 4WLOA 2ZYDA 4ZA2A 4QO8A 1FDTA 1NPYA 2VHYA 2QRJA 4OOEA 1B3BA 2X5OA 4W7IA 1LQTA 3HDYA 3W4IA 1ZMTA 4KDEA 4WNCA 4DUPA 4BKPA 5EJ2A 4R9SA 4IGEA 3MJSA 3AK4A 1YWGO 2W4QA 4Z6KA 2E6UX 1D1SA 1VM6A 1YQXA 4MKZA 3T7CA 4IDCA 2BGMA 1V3UA 4OGWA 4J2OA 2PD4A 4CUKA 4Q3EA 4IS3A 1LDNA 2EG9A 1NWHA 2LDBA 2YUTA 3KYDB 1JAYA 3OIGA 3OQ1A 4IDGA 5A9RA 3I5MA 3KLMX 3C1OA 1LRLA 2CF6A 3DBHB 5THQA 5IZ4A 1WPQA 3SVTA 2EGHA 4RF4A 1VSUA 4FJ1A 2RH8A 2C82A 4ALMA 1WW8A 2VTDA 1U8XX 2POQX 1Z45A 4L4RA 2BFAA 3K31A 3ZWBA 2B4RO 1U4OA 2Q45A 4RJTA 1W8DA 2RIRA 2AMFA 3HFGA 4OOFA 1L1FA 3G1UA 3GNTA 3JQAB 4W4TA 1E3JA 3L4SO 3UKOA 2FZEA 1E92A 4B8ZA 5IG2A 4J1TA 4XZ3A 3KTDA 3MCVA 5A3JA 2BFMA 1Y1PA 1WVGA 5AXBA 2WE8A 4YRDA 4IQ8A 3H9EO 1AHHA 2EGGA 1OC2A 3AUAA 3BYZA 2JFHA 2V65A 2JCVA 3RC7A 4CV1A 2HMTA 3PYMA 3TZ6A 1SNYA 1L7DA 1CJCA 4MVJP 4NFSA 3UCEA 1QP8A 1YDEA 1NNUA 3OA0A 1EE2A 1E6WA 3O26A 3FNGA 4AJEA 4BO3A 4OM8A 4WLUA 4UVEA 1JA9A 3F1LA 4YCAA 1Y8QB 3U4CA 4XB1A 3GG2A 3U49A 3GRPA 1J6UA 2PK3A 4FPXA 3RFTA 1NM5A 1RM3A 4RDHA 4CL3A 4LSWA 3AM4A 3NJ8A 1XSEA 2BFPA 2QYTA 3QSGA 3AY3A 1J5PA 2QW8A 5ENVA 3DMTA 1SEVA 4FS3A 3OICA 3ZU2A 4IPTA 3EZYA 1BXKA 1WNTA 2Q1SA 4FD3A 4A5OA 4KTVE 4BO1A 4PVDA 4QSMA 5FYDA 4J0EA 4NMHA 5TJHA 1VRWA 4MVJI 1F8FA 1TA4A 1A4UA 3RUDA 1XQ1A 2OP1A 4H7PA 1VSVA 4ND1A 1PL6A 2QG4A 3F4LA 4NG5A 4W9NA 4XYMA 1A9ZA 3M1AA 1LRJA 4GQAA 4MJLA 4PLCA 4B8WA 3ENNA 5L51A 4UREA 4D45A 3AU9A 3O8QA 1PIWA 3GR6A 1NR7A 2NU7A 4JJGA 5JAMA 3AU8A 2NWQA 3ZNQA 4BNVA 4D44A 5GY7A 3ZHYA 3D4PA 2VNAA 4KOAA 1R16A 1BVRA 1Z82A 3ZHXA 1DLIA 4IS2A 4Q3BA 3HB5X 1UXKA 2G82A 1XU7A 2AQIA 4P4LA 1ADFA 1V3VA 5FF9A 1OBFO 4HKTA 3JQFC 4RZHA 2HO5A 4ESOA 1Y8QA 4CM8B 3GF4A 1EVZA 3E03A 4GVLA 4D3SA 1R6DA 2UV8A 3ZWNA 3GVPA 3IC5A 2X0RA 3RCBA 4EEZA 1P77A 1IL0A 4AJNA 3ZWAA 2W2LD 5T8KA 4FN4A 4LN1A 5JS6A 2X9VA 3CEAA 4GMFA 1WMBA 5HS4A 4WK6A 1HRDA 1O9BA 2H1SA 3JYLA 2JFFA 3RUIA 4OSPA 4UEKA 4AVYA 4TRJA 3JTMA 2OORA 5JW6A 3SXPA 1ZW1A 4J4BA 3FSRA 3JV7A 3E18A 1H2HA 3KHUA 4BKUA 1A4IA 2PFGA 4NBTA 3TZHA 3QRWA 4D43A 2UUOA 1TVEA 1EK5A 4EUEA 1VL8A 5TGDA 3P2OA 1YE3A 1Z7BA 4H16A 4NPCA 4DC1A 4BQPA 4ALKA 1FJHA 2NU9A 2O7SA 2HJRA 4UVDA 3OIFA 1E7WA 5JO0A 1J49A 3V5NA 4CM9A 4CL8A 1PJTA 5COQA 3KXDA 1BVUA 5CHEA 4Y98A 3GZ4A 4FC7A 3Q3CA 1B7GO 2EERA 1LNQA 4Y8VA 2OMEA 4RVSA 1ZXBA 2PD3A 5TJ9A 1SZJG 2J6IA 1UH5A 3GZNB 1GTMA 4H3VA 3QQPA 2RHCA 2ZCVA 4PLGA 4IINA 3D0OA 4YR9A 2VWPA 4NJMB 3MOGA 4E5PA 4CUZA 5BSGA 4PRLA 3NTQA 4CM8A 3GY0A 2DU8A 1PGPA 4PLFA 5AXCA 4DQXA 2G17A 2FZWA 3DEYX 4HNHA 3GQVA 5KTKA 3GEDA 1A7AA 4IJUA 4RCVA 4WUVA 3ZNPA 1NHWA 1NP3A 4JBGA 2EKLA 5IXYA 2PZMA 3C24A 3QWIA 1Q0HA 2CDBA 2QYSA 4CLHA 1A72A 1NVTA 1C14A 3ROMA 1U4SA 3D5QA 3DBLB 2BELA 1ORRA 1MLDA 1NXQA 2AXQA 1DIBA 1O8CA 2A4KA 3PXXA 1EVIA 1DFIA 3NTOA 1QG6A 4YDRA 3ITKA 1LC0A 3KSUA 4Y9DA 4TMFA 3SX2A 2HK7A 4ZVVA 1ONPA 1Y9AA 2GGSA 4E13A 1M67A 1KY4A 2GZ2A 3UHAA 1P1IA 1U2GA 2FP4A 4NJOA 3LK7A 5C3MA 3LYLA 2CFCA 3EGOA 2Q2VA 3BHIA 3ZV4A 3K2EA 2D59A 3EHEA 1P31A 2OP0A 3ABIA 4O1MA 1DRVA 1AHIA 3ADOA 1X7DA 2DFDA 4MP8A 1GYRA 4F6LA 3LLSA 4FFRA 1MUUA 3KLPX 3VHRA 1JU9A 3PQDA 4KMSA 4DRYA 1M2WA 2PH3A 4LRTB 1NFFA 4DTIA 1GD1O 4BNWA 1V3TA 4UUPA 4WNIA 5IAAA 5C7IO 2TMDA 4J1QA 4IM7A 1R66A 1EBFA 1GPJA 4WE3A 3IUPA 4AJPA 4D7AA 1EUCA 3MWDB 3G79A 2XOXA 3KYBA 2YQ5A 4GWGA 2O3UA 5L4LA 3FI9A 2VWGA 2BD0A 4BO4A 5T8KC 2HCTA 2JHGA 5I7FA 5JDIC 5A05A 1AGNA 1Y81A 5HWSA 4BUCA 1IUKA 2OL4A 3G0OA 3GDFA 5K6AA 2JKVA 3TL2A 3V2UA 4KUHA 5BNIA 1CDOA 1YBVA 3TPCA 5JLAA 1LSOA 5JCJA 2JD0A 3UGKA 4DLAA 1MA0A 5G4KA 5I7EA 3KRTA 1O89A 5ES3A 4W82A 4YAJA 4RF3A 3WSWA 3DL2A 4EGFA 3HQ4O 4GKBA 1ZO8A 4TROA 3GGPA 3PHIA 3MWEB 3BIOA 4CQLA 3OJEA 4J1SA 3RUAA 2DFVA 1HDOA 4DXHA 4PLYA 3LT1A 3L4BC 3K96A 4QFDA 3T4EA 4D42A 1N7GA 3AOEC 3TN7A 1UP6A 4YT5A 1FMCA 1H9BA 4EW6A 1PU2A 3RU9A 3STHA 1VKOA 2Y99A 3I1JA 2AE1A 3I4CA 4LMRA 3PTZA 2RHRA 2GDZA 3H9UA 3IJPA 5G2OA 1HT0A 3Q1LA 4BO0A 2HMUA 3H5RA 4HBGA 3L6OO 1K5HA 3DZJA 5EN4A 1XHLA 1ZSNA 3TL3A 1NBOA 1YBAA 5DT9A 2X86A 1D1TA 4WPGA 4YTEA 4UVGA 1HDYA 2WMDA 2Q3EA 3DBLA 3HADA 1SO8A 2Q4BA 1R0KA 1JN0A 1IZ0A 4OKNA 2VZ0A 3DFZA 1I5RA 2W2KA 4N18A 3W8DA 3DFUA 3VPHA 4R3WA 3PZBA 3GNSA 3P19A 2F00A 4MOWA 4OO3A 1O95A 3D1LA 4CQMD 1AXEA 3QE3A 4WLNA 4BNLA 2O3SA 1I8TA 4OSOA 1MP0A 5CDYA 1E3LA 2D8AA 1IZ9A 1P45A 1U7HA 1JWAB 5TSDA 5L4SA 1CYDA 1R4NA 3TZCA 1HWYA 1PJLA 2NM0A 2X0JA 3JQAD 4R1SA 1HYEA 5DCUA 3IS3A 4CR7A 4ALNA 4ND2A 1DIRA 2BFOA 1GU7A 2BLLA 3G1TA 5C5IA 1LSJA 1PJQA 3ZWYA 3RD5A 3QIVA 3EK2A 3V1UA 4A03A 5AXAA 4K26A 1C3VA 4GVXA 1KVUA 4NFHA 3NGXA 1H9AA 4GX2A 3JQFA 2I6TA 2VT3A 2VWHA 1L7EA 1EFLA 4O6VA 3JQ9A 3K8ZA 1ISGA 3ZU5A 4ITUA 2PH5A 2UVDA 2XAAA 4G2NA 1CWUA 2Y1FA 4F45A 1MB4A 3DZKA 2GASA 4LMPA 4Y6RA 4CM9D 2BGLA 3QHAA 2C54A 4FIZA 4ZQEA 4CLRA 3PHHA 2IODA 4ND5A 4M49A 4J91A 4KQWA 4TRRA 4Z9YA 3ZV3A 5T6BA 4EJMA 2PZJA 2Q49A 1FDVA 1U3UA 4XGKA 1PL8A 2A92A 1Z6ZA 3JSAA 3JQDA 4BNNA 3WNQA 2G76A 3IKTA 2PKQO 3B1JA 5JDCC 1P33A 1VI2A 4AJHA 1DIGA 2JHFA 2JFGA 4PN3A 5IDQA 1SAYA 1ID1A 3FPCA 2PD6A 2VOJA 5G4KB 4BMNA 3S8MA 5DF1A 1A71A 4MDHA 2D4AA 4YJHA 1DEHA 1WP4A 2NV6A 1I3NA 5DDIP 4CM6A 5JCXA 2Q50A 2EIHA 1RM4A 3K30A 2Q1UA 4FJ2A 1CRWG 2VOEA 4FJ0A 1CEQA 1DC6A 3TJRA 4BKOA 4J3FA 5KJ6A 1DHRA 3MOIA 1XR3A 2VN8A 1AN9A 1ZNQO 2YHIB 4GBJA 4NZ9A 3SEFA 1DIAA 1J4AA 4G81A 4ONEA 3P5SA 2J3KA 6ADHA 1ZEJA 5IDWA 2GD1O 3PDJA 4CM1A 5CDGA 5DBGA 2DUUA 1GCOA 4Q3DA 1Z7EA 3ASVA 4HNGA 3A1NA 3EZLA 1ADCA 4BB5A 4IXWA 4C7KA 2HLPA 1E5LA 2JCYA 4PGFA 5T67A 2RBEA 4B4OA 3V1YA 4CMAA 2VNSA 2PZLA 5TLSA 3ZWOA 1OMOA 2NVBA 3TWOA 4FGWA 1U3VA 3E1KA 4PG5A 5DCYA 2XPCA 3K2BA 1DFHA 3TF5A 1ENPA 1NYTA 1E1KA 1HDXA 5HTOA 3Q2IA 1NFQA 2BGKA 2ZKLA 3GVCA 1YJQA 3ONFA 4XGIA 1E3SA 1UJMA 2ZB3A 3RKRA 2OUIA 5CAEA 4YAEA 4LVCA 5CPFA 3X2EA 4J7XA 3DHEA 3ASUA 3IP1A 3VPFA 4TVBA 5HBRA 4AJLA 1KBZA 1QORA 3NDRA 4TSKA 5JCJD 3WWYA 1AE1A 3C7CB 1UDCA 3L07A 3UXYA 3FNFA 4J16A 3DAGA 3HWRA 3HN7A 3C3XA 2J5RA 5JAZA 2EJWA 3IJRA 1U2DA 4AL4A 3RSHA 3OQ6A 3TQHA 1EEHA 1NQOA 2NSDA 2Z5LA 4Z9FA 4A73A 3NKLA 4II3A 1VL0A 1LLCA 3ZU3A 1E7QA 5F5LA 4I5DA 3IAHA 3GDOA 3WGQA 1PJBA 5A06A 1V9LA 3WTCA 4BO6A 3PJEA 4K1LA 1Q7BA 3AFNA 1RYEA 4D79A 4MVJD 3ETGA 5FWNA 4NDNE 1PZEA 1D4FA 3MJVA 4CMIB 4ALJA 3UAGA 4XWYA 4B3HA 1K3TA 1ZK4A 3W4KA 4EEXA 2YDXA 3CXRA 4TKLA 3JD3A 1UUFA 4A27A 3O03A 4BQRA 1EE9A 4UEOA 5H81A 4LGVA 1E0DA 3A14A 1T4BA 4OKIA 4U6SA 4YT2A 4CQLB 2AG8A 4D0SA 1WLYA 5I7VA 3M6IA 1W6UA 4M86A 1PGOA 5HA5A 1SOVA 5KOIA 2PWZA 4PZEA 3JQBC 2CVQA 4CMGA 4HUJA 4QO7A 3ZZNA 3LC2O 1ISFA 4J49A 3RFXA 3ZWCA 1NAIA 4E2ZA 3GEGA 4QTZA 5A9TA 2CF5A 4YAKA 2O50A 1R37A 3QWAA 4CQMB 4RPJA 4UULA 2O23A 1IB6A 2X0NA 3RC1A 2NU6A 2I66A 3CE6A 3CTMA 3MZ0A 5G0TA 4ALIA 1Y5MA 3QVOA 2Q46A 3D3WA 1UZLA 3VZSA 1WDKA 5G0VA 1RM5A 2AEMA 3Q9NA 3QV1A 1D7OA 1JVSA 1UDBA 1PJCA 2NTJA 1NQ5A 3TOZA 3PVZA 4E5NA 1UXJA 1SEPA 2Y0EA 1T1SA 4ZRNA 1NHGA 3WR5A 5HM8A 3PFWO 3UVEA 1VKNA 4WGGA 5JAQA 3K73O 3RUHA 3OJ0A 4NU5A 4P22A 1ISIA 1LU9A 4PRKA 4R1TA 3GH3A 4G65A 4OQYA 4WCFA 3K92A 3GOHA 4II2A 2IEBA 4HFMA 1JVBA 2C5EA 1MX3A 4JLWA 3RQSA 2AQKA 3G17A 4KQXA 2DAPA 1F8GA 1LI4A 2CUKA 3RIHA 3PHJA 1D8AA 1K6XA 2Y05A 4ROSA 3VOSA 1DAPA 1YB1A 1IHYA 3H5NA 4I9HA 3O38A 1VPDA 2ZIZA 4IDFA 4CV2A 2EJVA 2ILTA 2GUGA 3MJTA 1G0OA 1B2LA 1HE3A 5KNLA 3DZBA 1KY5A 3GC6A 5JNLA 4YT4A 1I2CA 2VTEA 3BMNA 1BW9A 2FSVA 3JYOA 5DP1A 4JBHA 3KVOA 2X8LA 3VDQA 3MTJA 1HLPA 1QMGA 3H7AA 2FRDA 3O4RA 4HV4A 4Z9XA 5L3ZA 1C0IA 3FPLA 1YXMA 4DMLA 3NRCA 5I8ZA 2IE0A 1E1MA 3T7EA 5F5NA 1J0XO 1ZCJA 3PK0A 5ER9A 2NTNA 4J4HA 5CG2A 1OAAA 4NQZA 2QQ5A 1DOHA 3GPIA 3WGTA 5JDCA 4YJHB 2X5KO 3BMOB 1DC4A 4TRNA 5DNAA 4ZU3A 4M87A 3CZRA 3NAQA 3RBXA 2D5CA 2P9EA 4MPDA 4DL9A 2Q4EA 3DOOA 3I83A 5ENDA 4R69A 1X14A 4RPKA 5T57A 1M75A 3ONEA 3NUGA 1GL3A 3AFMA 5L9AA 1X0VA 3VH3A 4LVUA 4BO7A 4MO2A 1B0AA 1QKIA 1I3MA 4E32A 5CFZA 4RV9A 1PZGA 3EYWA 2ZB4A 5I9MA 1JKFA 4NU6A 5A5FA 3AUUA 3KSZO 4YJFA 1U3TA 4CMBA 2DQ4A 1G6KA 1T2EA 4OXKA 3DAPA 1AXGA 3D64A 3KV3O 4L4XA 1QYDA 2LDXA 3WIEA 4CMEA 2B5VA 1PQUA 3BTVA 2W98A 1I30A 3OHSX 4FQ8A 5CP8A 1C0LA 3H3JA 2AEFA 1ZKMA 3B1FA 4J4TA 1E3WA 2WE7A 4NFYA 3LC1O 2Q1WA 3DZHA 4BNIA 4MVJG 1KC1A 1QYVA 3D4NA 4NI5A 2YHUA 2C29D 4R3NA 4NBVA 4XQGA 5EMHA 4CODB 1ZK0A 2PKRA 4O59O 1GR0A 3EMKA 1HDZA 3RVDA 2J8ZA 3DAFA 3GUCA 3WFJA 2CVZA 2DUWA 2WD8A 4ALLA 1UAGA 2HMWA 1GAEO 4HWKA 3VAZA 1TXGA 1KVSA 2AEJA 2FPIA 3E6AA 5ILOA 2IXAA 1T26A 2X0IA 5A03A 4ZGWA 2IZ1A 3NYWA 3LU1A 2OGUA 1YH3A 5EPOA 1LQUA 2ZQYA 3A4VA 1W73A 4IUYA 1YQGA 1NAHA 3E48A 2DTEA 1BDMA 1Y7TA 3B1KA 1P1HA 3I23A 2CY0A 2Y66A 3WJAA 3ZN2A 2NUAA 3U4DA 5TC4A 4MP3A 3RI3A 2DBRA 3JQGA 1X15A 4CMHA 3OEWA 1ZBQA 5HS6A 2O3TA 3ULKA 2DVMA 2O4CA 1T25A 2J5KA 1P3DA 4OH1A 4JQCA 2HRZA 2V7PA 4B4VA 1BGVA 4OXNA 2CMDA 3FHLA 3I9LA 3WS7A 2C7GA 4WCFC 1MC4A 1X7HA 4XIJA 1U3WA 3SLKA 4IDAA 4WASA 1DC5A 3S1LA 3WGYA 3VH1A 5ITWA 2C2XA 3VC7A 4JN6B 1TT5A 3LVFO 3WIDA 4AG3A 2WYWA 4XRRA 1R0SA 3JQ6A 1HDCA 2AA3A 1EQUA 2ZB7A 4PCVA 3HHPA 3NT5A 3QVXA 1X1EA 3PRJA 3DWFA 4ZICA 4IJVA 1UZNA 3GMSA 1ZK3A 4RDIA 1B8VA 1UDAA 2WSBA 3PGXA 3GGGA 1DHTA 1T4DA 1NASA 3WYCA 4WJZA 4E4YA 4EYEA 2HK8A 3NTRA 1Y8RB 4CM4A 3O9ZA 1NX6A 4YQZA 3VPSA 2J3JA 3W4JA 3CIFA 4MIOA 1CQIA 1C1DB 3V1TC 4DQUA 1CIVA 2CSUA 3E5RA 2VQ3A 4NBRA 3DMYA 3DBVO 2EP7A 1KVQA 3DTTA 3HZZA 3ZHBA 3EVNA 1F14A 2VYVD 3A06A 4GPD1 4MVJF 3B20A 2FPGA 4J90A 2EKPA 1B8UA 3QVSA 3H5AA 1ZFNA 2NQ8A 4QFCA 4AICA 2OBYA 3OA2A 1NWCA 2V6GA 4INAA 2AQ8A 3F4BA 2X1HA 2FR1A 3FRJA 3NJ4A 2X58A 1VJTA 2PGLA 2X9NA 2CNBA 4J7CA 1Q0QA 4N54A 4EI2A 4ZJUA 1XA0A 4Q9NA 1IULA 2WM3A 3ICPA 1JDJA 2JL1A 2GPTA 2HK9A 3ENKA 5BT9A 4PG6A 3JYNA 4DWVA 2W8ZA 5KKAA 3PDUA 3PYLA 4L76A 1GUZA 1ZSYA 3UH1A 3E5MA 3BAZA 3HE3A 3QWHA 4ZQHA 3GHYA 1N9GA 3TNLA 1EDZA 1Z74A 1U5AA 2D2IA 4NJMA 4R9RA 3WMXA 4F6CA 3IKVA 4W9NC 3WYEA 4TZKA 3H65A 4L0QA 4P38A 1KOLA 3FF4A 1LRKA 3KSDO 4E6PA 3HUDA 3PIDA 2ZJ1A 4B79A 3PWKA 1JQBA 4QXMA 1DRWA 3BZUA 1NTOA 1P1JA 1C0PA 2OHXA 4R4JA 1V0JA 2Y67A 4PG7A 4Q3CA 3E9QA 3GVIA 3KYCB 4DA9A 1N92A 1VJ0A 4IZIA 1IPEA 3F5QA 2I5PO 4YYZA 1XLTA 1ENYA 2I99A 1M6HA 4K6CA 1N1EA 2CDCA 2C59A 4ZQBA 2VHZA 2C20A 2O4UX 5JBIA 5ICMA 3I9OA 3PHGA 4BNYA 3JD4A 1E77A 1R12A 3IIEA 3I4FA 2A35A 5L4NA 4BNHA 4BO5A 5COBA 2ZB8A 3QW2A 3VTZA 4HY3A 1LSSA 1PX0A 1UXGA 3PWSA 5BSEA 2VRCA 3BMQA 4QEDA 5IZCA 3OECA 1CERA 1E7SA 2IYOA 2X23A 5U1PA 2NQTA 3DHNA 4NHEA 1B15A 4B3IA 5L45A 2VZ9A 1E6UA 3H8VA 3I52A 5F21A 2O7QA 4CLEA 5L7WA 5I7SA 3B70A 1Y8RA 3ETDA 2CVOA 2CZCA 3UFXA 4LW8A 1PGQA 3JQBA 1E3IA 2D0IA 2C7VA 9LDBA 2PTGA 2UDPA 1ZEMA 2H6EA 2JD1A 2YV2A 4XIYA 5AYVA 5B4UA 3A9WA 2X7HA 2A94A 2P4HX 1R4NB 5JDIA 4MVJM 3QVWA 3WQQA 4CPDA 4GX1A 2BMAA 2WEKA 3JQ8A 1UXHA 2VUSA 1EFKA 2RAFA 4BO9A 3DDNA 4EBFA 4JIGA 4F3YA 2B0JA 1V35A 1BRMA 4Z0TA 2JAPA 1I36A 3EUWA 4CM5A 1GQQA 4NNJA 1HZZA 1U1IA 2FHSA 4HADA 2GSDA 3H9QA 3ZW8A 4GLLA 4J6FA 1QRRA 1FDUA 3EY4A 3H9GA 5EESA 4BMVA 3F5SA 2X4GA 5B4VA 3I9JA 5IN4A 2GN8A 1JAXA 4E5KA 3OQBA 1GV0A 4ZQGA 2DLDA 1G1AA 1T2CA 5IDYA 4BMSA 3JCZA 1ML3A 5AXDA 1S6YA 1H6CA 3ZHZA 1SCUA 3OSUA 4CJXA 4XYLA 5I9NA 3V2GA 1PJ4A 4MIYA 1R4MB 2V6MA 4FFLA 5JMPA 1Q2XA 4W7HA 5JSFA 4NH4A 2C0CA 4KWHA 1EK6A 3GPDG 5DOZA 4UVIA 1ZMOA 1BG6A 3GG9A 1FK8A 4IJKA 3GMDA 5L95A 1PZHA 1EUZA 3IP3A 3P7MA 1FDSA 1EQ2A 1I2BA 3M1LA 4I5FA 3DONA 5KVVA 1I3LA 1P0FA 4N5NA 2SCUA 3WG9A 3FWZA 4YJDA 4CM7A 1N5DA 4U7WA 2E82A 3FCOA 1SB9A 3I3OA 1WDLA 4XD2A 4PG4A 2DBZA 2FMUA 2PY6A 2IDZA 4TKMA 4CR6A 2O3QA 4FB5A 3JYQA 1V6AA 1F06A 3F6YA 4FFOA 3WWZA 2PA3A 2HDHA 5CPBA 4NK4A 3C1AA 3WX0A 1QV6A 3JD0A 1TT5B 3P2YA 5LCXA 1K6JA 4KP7A 5L53A 4B4WA 4X54A 4XRGA 2B36A 3FR8A 4B3JA 4CM3A 4ZN6A 4RVUA 4RORA 2P91A 4Z3KA 1JKIA 2Y1OA 3TDKA 1ISMA 2NADA 1XQ6A 1YOVA 1DAOA 1HZJA 1GUFA 4I5EA 1GPDG 1U7TA 1XELA 3VZQA 3JQ9C 3JD1A 2AW5A 3EC7A 3EAGA 4DREA 3PHLA 5JY6A 5ICSA 4YJGB 4BKRA 5MGBA 3AUSA 2I3AA 2W2LA 2P5UA 1I10A 1DXYA 2DBQA 3WXBA 4AJ2A 4DIOA 5JC8A 5KWEA 3ROKA 1M66A 5IFLA 1RM0A 5JXWA 2ZYGA 4PFJA 3IOYA 4YVFA 5T5QA 3FR7A 4BGEA 3RASA 3VKVA 1HLDA 2ZK7A 5CEEA 2FN7A 1UP4A 2O2SA 3DTYA 4FDAA 5JO9A 1LLDA 2X6TA 3HDJA 2TMGA 5TT1A 5TIIA 3COSA 3ZDFA 4CV3A 4BGVA 4GWKA 1LDEA 1C1XA 2D3TA 2HU2A 4F46A 2PLAA 3I6IA 5U4QA 1A9YA 3U9LA 4RLSA 4IZHA 1KYQA 2YV1A 2HUNA 1PR9A 3NEPX 1N9GB 4HFJA 1MFPA 4YAGA 1YO6A 4IQ0A 3H4VA 1I01A 3TSCA 3OEYA 1E7MA 3U4IA 4I8XA 3UOGA 3A28A 2Z1NA 1HE4A 3WLFA 3KBOA 2Y93A 4IDEA 4TZTA 3Q0EA 3E8XA 2YJZA 1LA2A 3HSKA 1U8FO 1R4MA 1DJQA 3BMNB 2O3JA 3ZWPA 3K9QO 4HX5A 2Z1MA 4XGNA 2WDZA 2Y0CA 4YA6A 4YBZA 3PFFA 4G5HA 3FTPA 1H5QA 1P1FA 3ANLA 4BNJA 3TRIA 4QECA 2GYYA 3SBOA 4I5GA 3UF0A 1MFZA 3DHYA 3ANMA 3JD2A 3K6JA 4YJGA 4I08A 1OC4A 5ER6A 3UCFA 5DZSA 3UCXA 1EMDA 4JNKA 1K2WA 2OXIA 4E12A 1VLLA 4I1IA 3DZGA 2YZ7A 2BRUA 1PEDA 4XEHA 2EF1A 3VZPA 5I9LA 3C1TA 3KZVA 1YBMA 4C4OA 4CR8A 5J23A 4DPLA 4LCEA 4RGBA 5TX7A 3BMOA 1T2DA 1MXHA 4I9UA 3AI2A 3GAFA 1QLJA 3VDRA 5CEJA 3DBHA 3VPGA 4IIUA 2QRKA 4MVJE 4JROA 3D7LA 1MG0A 3OFSA 1K6IA 5K6AC 1LEHA 1B26A 1GYPA 1PWXA 2F1KA 2NACA 2O48X 3HNPA 4RPLA 4DMMA 5FEUA 4EJ6A 3L4BA 3PYXA 4FBGA 3LT2A 4R01A 4EZBA 5FI3A 1SC6A 3OIDA 4FGSA 4GLOA 2X9GA 1CF2O 3FWNA 4YRBA 5B12A 2B83A 1SPXA 3DBRA 5EQDA 5JMWA 4CLOA 4GMGA 4IIVA 3WYBA 4KZPA 4S1VA 1KS9A 4B4UA 4FFNA 1MGOA 2OO5A 3UN1A 4U8GA 4FFPA 5GZ1A 3BTSA 1U9JA 3N7UA 3RJ9A 3UICA 5K9ZA 1E7YA 2OFPA 4QT0A 2VRCD 5LDHA 4K6FA 2GRAA 1F12A 1VJ1A 4GH5A 3C7DB 3RUCA 2YW9A 3AWDA 2WYUA 4M54A 4CV0A 5HRUA 4M8SA 1IY8A 4WCFB 5FI5A 3ONDA 4JGBA 4JJFA 5B1YA 2ZJ0A 3INRA 3SC4A 3I9NA 4XCVA 1LLUA 1T1RA 1X1TA 4Y6SA 2BF7A 5KJCA 1Q7GA 1KEVA 3INGA 4ZRMA 3S55A 1ZK2A 1ISHA 2BKAA 5KVSA 2EKQA 3MJEA 4GKVA 4IQGA 3LT4A 1DC3A 3BTUA 1XU9A 1JLLA 4CM4B 1LDYA 1SMKA 5DP2A 3SJ7A 4BGUA 5MDHA 3WSVA 1EDOA 2DPGA 2EW8A 3CUKA 3CMMA 4FOSA 3RBVA 4CMEC 3BHMA 1GFSA 5LC1A 2WTBA 2DPHA 3DMTC 2GZ1A 4R41A 2HJSA 4EUFA 4BNGA 2YFQA 5G0UA 1W4ZA 3Q6IA 3IDSA 4PZCA 1RPNA 3VZRA 4JCOA 5K0ZA 5JYEA 3BMCA 4E31A 4E5MA 2EW2A 2IZ0A 1LSUA 2VYNA 1B3RA 4CMJA 4CUJA 2PV7A 3L77A 4NBUA 3TFOA 2E37A 1HEUA 3LT0A 2P4QA 1MXFA
chains in the Genus database with same CATH superfamily
5LQAA 1O4VA 1GPAA 1TB4A 4HXGA 2VAMA 1AZWA 2XLBA 4D92A 2W6ZA 2PSDA 3RVMA 4JWKA 3EIOA 4JOBA 1TE2A 4LDJA 1KC3A 4KIUA 4LA4A 4PWZA 5CJJA 4QXPA 3MUNA 2O3RA 2O2IA 4HBZA 1RJ9A 5H5JA 1EXVA 2BM0A 1RMQA 4A5SA 4RHFA 1T4MA 2UZAA 3IE1A 3C5EA 5JAIA 4IAOA 2WD7A 3U62A 3IQZA 2YTZA 1B8PA 3EMBA 4R2MA 5TB5A 2DWQA 3G49A 4MDEA 1NBHA 1SXGA 1UDWA 3Q7RA 4HUQB 1YBFA 4WKCA 4PRZA 4UAUA 1E1NA 3PVCA 3OJOA 4CEJA 2QMUA 1P9NA 1DEXA 2ODTX 4CLOB 5M04A 4HVLA 4H15A 3T0FA 4HC4A 3M34A 4NICA 4Q39A 4QU0A 5M2QA 4ZTZB 3M81A 1K68A 1KEPA 2OD2A 3HDGA 2XTAA 3VJRA 5BSUA 3V4OA 4DIBA 1G5RA 3T8YA 1EVLA 4R2HA 1X42A 3T7TA 1PFGA 4W5RA 4IX1A 1U04A 1CNEA 4E94A 4RA6A 4INZA 2NUPB 2A1TR 1Y63A 3TQCA 2EBUA 4QBTA 3H2SA 1FFGA 4AN4A 5BUCA 2DM6A 3EXHC 3SEQA 2ZIVB 4MX8A 3ICCA 2VHQA 1FP1D 3LTNC 3EW7A 1T3TA 3SXJA 1A5ZA 4HZUB 5CBPA 1K7EB 1UMDB 1TO6A 2IBMA 2ORVA 4LQCA 4Y1GA 5ITVA 2RE8A 1II0A 3K09A 1Q1NA 2R6R1 1ZS9A 1OZAA 1Z0SA 2C31A 3CRRA 1N5MA 4UCWA 4LRQA 2O8CA 1WKCA 2XW6A 1F17A 3D8BA 2R2GA 4WI1A 4TWAA 2G63A 4TV9F 4AG6A 5FV4A 1B4DA 2XJ9A 3KQQA 4I5IA 1YB4A 1Z9BA 2AN5A 2CE2X 2VHWA 4DR1B 3RV4A 3BGOS 1TPZA 1X0XA 3TCKA 1YSCA 1K06A 1UC5B 4KK4A 3VPBA 4CBVA 1NMSA 3RC8A 5JECA 2DMRA 1X3SA 4ISCA 4AJ4A 4F9EA 1XF1A 4X8HA 2Z5VA 3GZNA 3GN1A 3OIWA 4KODA 3PEYA 1UFOA 5IJ0B 1JJAA 1KMIY 1Z75A 3GEBA 1NXWA 2WJIA 1M1YE 4RTLA 2UUBB 3PC6A 2ZRCA 3LX8A 2OM6A 4V0ME 1I3KA 3THOA 3HM9A 2J6HA 4O2AB 2DPLA 1G5HA 2I4NA 1JWLA 3AEZA 3CNNA 3EBPA 3QG1A 2WUEA 4KJZA 4IJ5A 4BRWA 3U5TA 4KI0A 1MCZA 1PNOA 4V2UA 4K9PA 2WSMA 1FNSA 2XNCA 4FFDA 3GLQA 1ZONA 3T5BA 3L40A 2Q2WA 4BOYA 2NVWA 3HXOA 4PLWA 4RQUA 3M33A 4Z0PA 5KQMA 2X22A 2B21A 1HT3A 4GZ5A 4G5FA 2JD2A 2YRWA 2R79A 1SKAA 1UK6A 5HCNA 1DXHA 3IEXA 5TRTA 1TF7A 4QGHA 3FNHA 2Y1CA 3HV0A 3RARA 3EGEA 4NMWA 4CZ2A 4MCJA 3LF1A 4EDFA 1H0KA 3NHAA 3PC8A 1P8AA 3Q5EA 3HLKA 3KQKA 4P6VF 5B1DA 5MFPA 1LX6A 1JU4A 1W34A 2I9PA 5HQTA 2C1EA 2WW8A 1YI1A 5A04A 3PA8A 4FGLA 4LDAA 4EJ2A 3BCSA 5BXYA 1Q11A 1W59A 4B2IA 4C6RA 1XN1A 5AMXA 1H65A 1R9JA 1W85A 2O8DB 4TVOA 1XROA 2ZCUA 2X1VA 2WJPA 3CNBA 4CL2A 2I4LA 3G8BA 1PS8A 4PVCA 5JPIA 1Y3AA 1XD9A 2AVNA 721PA 3U4GA 3HN2A 4PNZA 4E46A 5JYBA 4IJ6A 1EE1A 4P8RA 4BNMA 4JK3A 1VL6A 1BQEA 3B9QA 3KALA 2O5CA 5KNBA 3LFTA 3R6DA 6REQB 3A4TA 3PI7A 5LYJA 3M6FA 4PLZA 3RVLA 3IAM6 3FZQA 5A4DA 5AQEA 3ORFA 1XZHA 2DERA 2HQ1A 2WSIA 2X2PA 2Y0DA 2IUUA 2ERXA 1H2BA 4BEVA 5IJ9A 3HP7A 2VUTA 3NG1A 1I2ZA 4BNZA 5DWQA 1PS9A 2DG2A 4A1FA 4Q93A 4CEJB 2G25A 4RM2A 3ZVNA 3CN9A 4PPFA 3ZE1B 1AHNA 1MC1A 1X19A 2F59A 2E3JA 1GN9A 1SQGA 4RK1A 3VSBA 4QUKA 4K2AA 4KTTE 1RYHA 4X7PA 4CNQA 2XRFA 2FN3A 3T94A 3BTOA 3P9CA 3THSA 5C1OA 1GILA 3CA8A 3GFSA 3PQCA 4MPRA 4MW4A 1RDFA 1CY1A 2B99A 3ELBA 1PVVA 1ZN9A 2DUJA 5GOZA 2WTXA 5DHAA 1X1CA 3QYFA 1UZMA 2PG3A 3EQ8A 3O92A 4AROA 2XKAA 3G3EA 5EQFA 9LDTA 3GXOA 4RPHA 5ALPA 3NOXA 1LBQA 2ODWA 4JL5A 4CIXA 2C5AA 3MWEA 3IIKA 1FLDA 4F6RA 3HYTA 2B3DA 1T34A 1XHFA 4JXKA 3T99A 3FFXA 5DBFA 3CU5A 4JHXA 2FWMX 1VB3A 5CNIA 3EBLA 3GVHA 4MUNA 1R5OA 3R8CA 1GYQA 3RSGA 1GCUA 1PR5A 2P65A 3GJ5A 3VRHA 2Q5OA 1ADGA 1IRIA 4XJTA 2ANCA 4NS1A 5LJIA 3DB1A 2NTVA 4XQ9A 1R6UA 3H1BA 2XAUA 4CETA 3PXCX 5JANA 1RYDA 1ZIDA 3HRHA 4HYEA 4IDDA 2MYPA 1F0YA 2WQ7A 1IZ8A 4MQEA 3SVZA 1J0AA 1V25A 5CM2Z 4KUEA 1UM8A 1PR2A 3HYCA 1BDJA 1L8XA 3IEKA 3DKRA 2XYGA 5GV8A 4PZLA 5KC9A 2UAGA 3EG5A 4NYIR 4N5MA 1DV2A 1UP7A 5FP0A 3WDSA 3WO1A 1S2MA 2BAGA 2HMSA 4DGSA 2ODQA 2OWDA 4MV3A 4P4NA 4PXSA 4R1NA 4TXMA 4ZT6A 4AJ1A 2XVYA 3AUTA 5G3ZA 1ZVJA 3VA7A 2GA8A 5BWCA 2JIDA 4FR2A 2DH6A 5E4TA 3LSYA 2MSEB 3A37A 4BNFA 2IYAA 2OOSA 1M1NB 4URYR 5J47A 4FCCA 5B6JA 5BSWA 3M5WA 4I2VA 4MUBA 3URMA 2FMTA 1NSYA 4V1CA 1T1JA 2IOHA 1UJNA 2X1LA 3IP6A 5FRDA 1BHJA 1UOPA 4ER6A 1USUA 5GONA 2RBGA 3RS0A 4Q4CA 1HL7A 3ZQ6A 3U5ZB 4PAGA 4NXMB 3CLKA 4G9EA 5LDGA 2QPOA 3TBFA 3UWSA 1FDWA 4EHJA 2JLZA 1PAUA 2ZSUA 3F71A 4G5YA 3GGDA 2QMQA 1Q5PA 3DR3A 3EVTA 4R1UA 4TMVA 4FFMA 1RI3A 2DSNA 3C3BA 5ALRA 3WGKA 4FWIB 4AYWA 4B74A 3PUIA 1XGKA 1HSOA 5EE9A 1GRRA 4GSKA 4N41A 1CS0A 2OOKA 3RRZA 1T5TA 2YBEA 2W6PA 4WLEA 2I8LA 4A26A 4OFZA 4UNNA 2YH2A 1Y89A 3KEGA 3ELWA 1R88A 3R4CA 1HORA 4N8EA 4Q9LA 1SXPA 1EVYA 1W0JD 3H1TA 5DRYA 1OX4B 2NPOA 4GFDA 3OCUA 4CLXA 4OQQA 4AZ0A 4M7RA 1NNLA 4KIWA 4PS1A 4D25A 2BKXA 1AQ6A 4KFTA 1UJCA 2PQ0A 4UUNA 4W5HA 1F2UB 3ZVLA 2GNAA 4RD4A 1A8PA 3NDBB 4DR6B 3BRCA 5JMTA 5TMBA 3AJ8A 2FLVA 3K0FA 5HRAA 3JR7A 3S2EA 3ZGYA 4Z4EA 4QQFA 1VPTA 3OC6A 4N40A 2A9PA 3F7MA 5GZ1A 2G08A 4EKIA 1YB6A 3NEJA 3C6KA 4B33A 1C2YA 3G2NA 2MR6A 2I3GA 1K3UB 5SY9A 1LLQA 4MULA 4XB2A 1XZKA 1UBNA 3L7DA 5HSGA 4IIXA 4WJLA 1PUJA 2HTEA 3DJYA 3NHYA 3KEMA 4YCJA 1AB6A 1YMUA 2VC2B 2GUWA 1K89A 4BEWA 3CMCO 4G0XA 1Q0ZA 1FSGA 4G1EB 2BI7A 1ECBA 3W6UA 4XWOA 1E0AA 2X8JB 2E4VA 3PGA1 4PIVA 2XLCA 3QEAZ 1SIOA 4ZAYA 5K3OA 1UQTA 1FXWF 4YMUA 2ZR8A 1G2OA 3F5MA 1G2IA 3THXB 3E9MA 1M74A 1OOEA 1SZPA 1SBYA 3ML1A 4H4EA 3B5IA 4LXXA 2G77B 1NQAO 2GD6A 2X14A 4UARA 4TZ0A 1QH1B 3SSOA 4HDSB 1RE0A 1UBJS 4ZHQB 3LKZA 4RVFA 1Z4QA 2D1YA 1CHNA 2RAVA 4HH4A 1E8MA 5KC8A 2RGNC 5EZ5A 3IAS1 3VV2A 5CB4B 2YHIA 3ONVA 4X7RA 3AJ9A 2A67A 4MKGA 1BX1A 1EM8A 2BGUA 3CH6A 2O5VA 5AQ1A 4V02A 4F91B 2JGEA 1BXGB 3N2GB 2Q62A 1N2EA 3CEMA 2HADA 4NL4H 4DLWA 3AG6A 2VPQA 3O75A 1N4DA 3G7SA 4NZNA 4RKQA 1V6SA 3LQFA 4KREA 1UK8A 1T9AA 1XQYA 4G0OA 4K9DA 2Y68A 1N6IA 4MNTA 4A8TA 1E69A 1VKJA 1A7KA 1QGAA 4RQBA 4ENUA 4DQLA 1N2CB 1QAMA 4GPAA 4X41A 3TZKA 3M5CA 5SYNA 3E53A 5H83A 4YQYA 5EZYF 3ZWWA 4M1ZA 4Q4JA 5DNYB 5A0VA 5LBIA 1E18A 2O06A 3N8KA 4K9LA 1T29A 3F9RA 4IWNA 4KXVA 4MEJA 4ZT7A 5C51B 1LVGA 5CHYA 3TINA 1EHIA 3G8YA 3T1OA 1GGEA 3GNQA 3DQZA 2P0EA 2EOAA 1LK0A 3E9YA 4KH0A 4L0DA 4RUKA 1PD0A 5DX1A 4AIIA 1JAHA 2IEZA 4B46A 3O0TA 3RVNA 3HXMA 2RGUA 2J9ZB 3LE8A 1C3EA 4JLJA 3DT8A 2GOYA 2FR0A 3IEMA 3ROFA 3HCNA 4F4IA 1YVEI 3PUXA 1YKFA 2R5NA 4TQAA 3B2EA 5D3ZA 1FNNA 5B1IA 3WGZA 3HLTA 4HDMB 4BVGA 5A9SA 4FINA 1YK0A 1YS2X 5EQJB 2PEYA 4C6TA 4KGDA 2EXXA 3EIXA 1MB0A 1CK4A 3W1EA 1MZPA 2LIPA 4FW9A 3L9XA 3OE4A 4WZAA 1HT2E 8OHMA 1PL7A 1FMJA 2QMYA 1VDZA 2CUZA 5JCZA 2P9CA 1U4NA 3L84A 2W6CX 3EISA 1PR4A 1U28C 4LF8B 5BVGA 4DNFA 4B73A 3ZNOA 1H4TA 1U0EA 2VUUA 4PGMA 2I76A 3JXEA 4DJAA 1E2DA 1FVHA 3W9YA 4R84A 1C7RA 1YMVA 3RC9A 3L4KA 2B1QA 5EINA 1E8NA 4IIBA 1VJDA 2WWHA 1PZFA 3KAJA 4X8OA 4U4AA 5ALWA 3BMCB 3KCQA 5LXTA 2H2AA 2J5QA 2GJSA 3AOGA 1NPDA 4B3BA 3BQMB 3DP9A 5K0EA 1K5GA 3MAJA 4O4LB 3A36A 4RLHA 1E5QA 2XZLA 4RE5A 3U3XA 4MUFA 1EBUA 2CNWD 4JP2A 3ZUPA 2NLOA 1DIOB 4WQMA 3X2FA 1JWBB 4OI4A 5AM1A 2F67A 1P0CA 1LK7A 4F97A 4O4IF 1Q84A 4X8MA 4W5TA 3NOOA 4C87A 2GCGA 5KSZA 4MYCA 1XDBA 2C2HA 3CYFA 4KUGA 4NS4A 2Q6KA 1YMQA 2AOTB 5E4FA 2FJPA 3TIIA 2V9CA 2HK6A 2WU1A 3A1FA 4GAEA 4AP5A 2XYQA 5HZMA 3ROTA 3UPDA 3E22B 1L5RA 1N7HA 2HQRA 5C37A 3UUFA 2HHLA 3TR5A 3WLRA 2B61A 3OZWA 1AUVA 3BMQB 5ALOA 3NASA 1MQAA 1E4EB 2B8WA 2ECPA 4QGBA 4B31A 1NU8A 2ORWA 4KPFC 3V2IA 4MPTA 2JB9A 2IHZA 3SE0A 4YWJA 3ZC3A 1RQRA 2QMZA 3RIGA 2Y3IA 2X7XA 5AVKA 3L1JA 4MO9A 1RQ7A 5FWDA 1LWOA 1MAHA 1GGJA 3OMLA 3SF8B 4HB3A 1MD9A 3DL7A 2GERA 4CU2A 4QX6A 1JKJA 5KINB 4C1NA 3SVLA 1OAOA 5HNKA 3W78A 4BJHB 1QVZA 3OFJA 4X8LA 3TKLA 3ORHA 4X44A 3GMTA 3OQOA 4OL9A 3UGJA 3BSYA 1I0ZA 4YCBA 2HHHB 3CSDA 5BT8A 4PLTA 1N57A 1T8RA 4QDZA 2B98A 3CF4A 4ZO6A 5G0SA 5AUOB 2XCTB 2LCQA 1DI0A 2AL7A 3K35A 4GOKA 4TZ6A 4RH3A 1DLJA 3L0SA 3QPCA 4WOKA 3C6BA 1N1DA 4MR8A 5GM2A 2GDJA 1T1EA 1QJCA 5CR9A 4CDNA 1HF3A 3DFMA 2WABA 1NJ5A 3NHLA 1HG1A 3ED1A 4IH4A 4LJ5A 1YDGA 3ZBUA 3U61B 4L8FA 2GFQA 3LHSA 3KUUA 2VFAA 3KB8A 3C5CA 5B55A 4D4JA 2HIMA 2TYSB 4DBZA 3PZRA 2XMDA 3RGWS 3X1ZA 1KOGA 1YS1X 2Q4TA 5HTKA 2O0JA 3PHBE 2IPLA 4HD8A 4E22A 4MHTA 2QN2A 2GSWA 3WA6A 2XGGA 3ZTWA 1BHSA 2Y1EA 4CF3A 2C07A 1G0NA 4MUIA 4C0JA 2ID9A 4HWSA 2Q2NA 3A58B 2GRJA 5B6PA 4CEHB 4OX9B 2ZE6A 3BD8A 3P26A 2O2XA 3GEIA 4RSHA 3MMZA 5EVCA 2AYXA 2RHTA 4KMRA 1ABFA 2FPLA 1CQJA 1UKCA 1FJGB 1B16A 3A6FA 4P4GA 1D8TA 1GRCA 4DDKA 1IE3A 4DLLA 3TZQA 2HMVA 3OE5A 4P82A 3UAYA 4XQCA 4ZD6A 3LY5A 1VSQA 3H0EA 3QNMA 4IBOA 5DSTA 3M89A 1WXFA 5NLLA 3UT5A 5KOYA 3CVVA 3AG5A 3QVGB 3H6HA 1U90A 3HFSA 4M89A 3ZYCA 1ZD9A 1HE5A 2OY0A 3IUSA 4OP3A 4E21A 1CETA 4WEOA 3R3UA 4R54A 4XX0A 4P3KA 4H3SA 3WYAA 3OLYA 5I51A 4ZVSA 5LXTB 3OZ7A 2VWQA 2I2AA 1D2RA 2I34A 4BKQA 4KSCA 4JUIA 3DFKA 4UTRA 2XDQB 1CUHA 4MS3B 5IH3A 1CE8B 1LDGA 3TUZC 4KPYA 1VPWA 1XDSA 4G86A 3CRNA 4G63A 1ONOA 4I9NA 4PYOA 3LKVA 3RC2A 4C7JA 3QUSA 2LXNA 1T0JB 5KS2A 4DUGD 3EFBA 3N9IA 1O5IA 2GM5A 5FWAA 4Y67A 1PEAA 3WA7A 3JZDA 4XYBA 1CUGA 2BUCA 3G5TA 4IF6A 4J43A 1DQRA 5GV7A 3FD8A 4OJKA 2PGAA 1DCFA 1RWQA 3PWTA 3A4LA 4OIMA 1R6BX 1G5TA 3V8QA 4MQFB 3HPQA 4EITA 2O5EA 3W05A 3GDGA 4UNIA 1E6LA 4P31A 3ST7A 3UFBA 1X1QA 2NNLD 2SBTA 3A0RB 5C7LO 1EFDN 5TS3A 1JG2A 1F2VA 2FEMA 3GLGB 5GJBA 5KEIA 3KETA 1L7PA 2XA2A 1E9AA 2H06A 1E8DA 3EGDA 4OBWA 3GP3A 3O4HA 4K3VA 4YXFA 2OFWA 4DUYB 1NI3A 2H9IA 5BMVF 3R7LA 2GO1A 3AL3A 1Z5WA 2ZYAA 3H2KA 2EFDB 1OZ0A 4PGGA 4R8RA 3TX6A 4DPKA 2BH9A 2WWYA 1QFYA 1XKQA 2IW3A 3MM4A 4IMRA 3AHJA 3PQFA 3TOXA 4C2BA 2WIJA 2VJBA 4ILKA 4OQPA 3ADKA 2K4MA 1V16A 5DGCA 4EAQA 1E60A 4FI3C 4LY6A 1Q1GA 3F97A 4PZAA 4R68A 4HHEA 1WA5A 1Y5LA 3RUFA 3GP5A 4HFNA 4GEGA 1KYXA 1GUYA 4B43A 1MC5A 1Y6JA 4FYXA 5FOVA 1KK0A 1LDBA 2AE2A 3BA6A 1PZNA 4IIFA 4RY0A 1O58A 1QHEA 3AM3A 1SY7A 2IJGX 2BTQA 2EFYA 2W70A 1A8QA 4TWRA 4RKWA 2RHBA 2R1TA 1WQ3A 2VT6A 1PQWA 5COAA 4EJ0A 4ER5A 3ER8A 3EZ9A 2V3VA 4B7UA 4RHTA 3WYDA 1TK2A 3PNVA 2QLMA 3R9XB 5IK2A 1BH6A 1KERA 2G5GX 4K28A 3DKKA 4JKIA 4WA7A 4B7AA 1WDMA 4AB1A 4D97A 4HN4B 4Q82A 5KTPA 1CT9A 1MRSA 1YDHA 3PX7A 4WX2B 1KYTA 1VL1A 4NCNA 4BLTA 4ODIA 2O59A 1L4BA 2LTAA 4L3OA 2HA3A 3NM4A 1W5AA 2XWBF 4LE1A 1L5MA 2ATVA 3SHQA 2DTXA 3AUJB 1C50A 3QBEA 3ITNA 5EZQA 3CUVA 2ZYHA 1UOEA 1U7WA 1L5HB 4WLOA 4ZA2A 4IILA 4BJ1A 2B2XA 1FU8A 1FDTA 1NPYA 2VHYA 4OOEA 1CZNA 3FDZA 4ZZ0A 4W7IA 1FS6A 3WIOA 2FX2A 1LQTA 3HDYA 1D2NA 4IQFA 3W4IA 1ZINA 4DUPA 5T4HA 5EJ2A 1YVPA 4KXNA 3GA5A 5HIIA 3S28A 1YWGO 4Y2YA 5KYYA 4Z6KA 1SUIA 1VM6A 2HFJA 2WHXA 2ZRAA 4NKRA 2BJVA 3K0AB 5LR6A 4Z0NA 3T7CA 1KI4A 4ZEMA 4YJ2A 4AXXA 2EAUA 1N6PA 2ZAYA 2LE0A 4PXYA 4JQOA 4J2OA 4IEEA 1RQLA 4NPAA 3L0OA 2LDBA 2VF4X 1JAYA 1VCMA 3KT8A 2HF7A 1WZUA 2VAWA 3I5MA 3E7DA 2CF6A 4HNRA 1JG7A 1WPQA 2CXOA 3B1YA 2P0AA 1GL6A 1VSUA 2R8EA 5ALSA 3TTTA 2C82A 3U3ZA 1P81A 4ASUA 1WR8A 2VTDA 3GYGA 2ZEJA 4GE0A 3SKYA 3SLRA 1FC0A 4E5DA 5ITSA 1L4GA 1Z45A 3MYYA 4L4RA 2BFAA 3K31A 4HNSA 4QJIA 5K0NA 5EJ6A 3D43A 2Q45A 3GO4A 1BQ4A 2PUEA 5HE8A 4RJTA 3ICQB 4JEUA 4QT4A 3VKHA 2AMFA 3B48A 4E03A 1F0NA 3W06A 5CIYA 2VTBB 3KUCA 5HIJA 4R6WA 4FUQA 3WLQA 3ANYB 4GP7A 4F84A 2XCUA 2WTAA 2MR5A 5C80A 3FSEA 1KZ4A 3NI2A 4Q6BA 4IEIA 4J1TA 3W1WA 1KAQA 3DZCA 2ZRQA 1JJVA 2FRXA 4A4DA 4PZUA 1CZUA 1NVVQ 1UBSB 1Y1PA 5EWLB 3I9FA 3FCYA 1Z4MA 1F2UA 4K9QA 3HVUA 1YAJA 4IQ8A 4RGVA 5ECDA 3NBKA 2WP8J 2JFWA 1NXSA 3U9TA 2JFHA 3TVDA 3DQQA 2JCVA 4YMHA 1Q57A 2JARA 3RC7A 3V9AA 1TADA 2HMTA 1CJSA 1FBTA 3NPMA 4Q18A 4OU4A 3ND6A 3PYMA 4YLEA 3TZ6A 3V9PA 1VFNA 2B82A 2XDWA 4QBGB 3FDXA 3F8SA 4DB4A 3UCEA 4NFSA 5AW9A 2O0KA 2ZS7A 3CF0A 1NNUA 2HRRA 3CJQA 3ICWA 1EE2A 5ALYA 4BBZA 1UPAA 2GARA 4GI1A 1VBFA 4WLUA 1UZUA 2ZUUA 2GZMA 5GJCA 1YHNA 1Y8QB 1KE2A 3M4NA 3BAFA 1IBSA 4XB1A 3QKRA 3ZIUA 4XWKA 4O4HA 3GRPA 1VQ1A 4TS1A 4RKEA 3ZEIA 5HGXA 3RFTA 4G97A 3HB9A 4LSWA 5JJIA 3EEIA 2AX3A 2XIQA 4GVPA 5JOQA 3MLEA 3EN0A 2BFPA 2QYTA 2DR2A 3AY3A 1KPHA 1L7BA 1J5PA 1WMFA 4NCHA 3RQIA 1ESMA 2ZWOA 4G84A 3GU3A 4QGFA 3QVUA 4IPTA 4URHA 3U7FB 3AF4A 1WNTA 2Q1SA 2J9GA 1B0PA 5T3YA 2K5UA 4KTVE 4KE6A 1JHAA 1TJ3A 2CSXA 5FYDA 4C88A 1JS1X 4KFSA 4YJ3F 1SCQA 4JA0A 1F8FA 1ZC3A 4HGNA 4I6GA 1TA4A 4ID3A 3RUDA 1WSWA 2DSTA 2LD4A 2OP1A 4PRYA 1H8HD 1VSVA 1PL6A 1Z5OA 2BT4A 2QG4A 3F4LA 3LRXA 4NG5A 4IEFB 4XYMA 4B8WA 3RYCB 4XGRA 1XZBA 3FKQA 4XM1A 5LMCA 1ZOIA 2NT3A 3JWJA 3ESYA 1FMTA 1K92A 2X4DA 1OLXB 2BGJA 3A04A 3GH1A 4HSEA 4D45A 1PDWA 2RGBA 4MUKA 1PTKA 2DWCA 1NR7A 1Z6QA 3KYIB 4JJGA 3AU8A 3AHFA 4G0ZA 5EUBA 3ZNQA 4D44A 1NY5A 5GY7A 1NKTA 3D4PA 5AM4A 3LOUA 2JFZA 1AGPA 1HLGA 4Z7JA 1EQAA 2I1LA 1NLZA 1YIOA 4Q3BA 4TKUA 2J0SA 2GILA 2X42A 2ZZNA 1RXVA 1DADA 4LGYA 1UXKA 5ALGA 4P4LA 1ADFA 1ITZA 1FFXA 4HDAA 4UNPA 1V3VA 5FF9A 4H27A 4ZVMA 1E96A 2AMJA 3E5NA 4M76B 3EPJA 3L93A 4RZHA 4CDMA 4EKEA 3DAHA 1WV1A 3E03A 1GNTA 3F3KA 4HGYA 5AJUA 2C4KA 3IC5A 4P9NA 3VU9A 4G23A 3PBKA 4EEZA 2HDWA 4AJNA 4G6ZA 2ICAA 3G8DA 4LCBA 1RXSA 5CVEA 4RFSA 1DAMA 2X77A 2VL7A 5FPPA 3DV9A 3COPA 3L7MA 3P9NA 5JMOA 2X9VA 1RLJA 1WMBA 1WO8A 3O3NB 1HRDA 4WK6A 2AZTA 1JFRA 2FG7C 1Y4ZA 3D6VA 3JYLA 5EFOA 4CIVA 1YR9A 1YZUA 2UZ1B 1T36B 3TNJA 2OAQ1 4ETNA 3WZ2A 4BRZA 4UNRA 1W94A 4PZZA 4E15A 4M22A 4TRJA 3UHFA 3WL3A 4F86A 5GONF 3JU3A 1EU1A 1MT3A 5DH9A 4UW9A 3PFNA 2PX4A 2O8NA 2Z4SA 1ISRA 5I01A 1H2HA 1P0QA 3KHUA 4BKUA 2VHUA 4NBTA 1HDEA 3MXTA 5IEJA 5JYCA 1EK5A 1II8A 1VL8A 2JFQA 2OQ2A 2HBRA 3EXG2 4XCQA 3WGUA 4CDRA 4NPCA 4H16A 4J0DA 2P9JA 1L8QA 1TC2A 3HA7A 4ALKA 1FJHA 2NU9A 1SC1A 2H51A 5DMHA 4YI5A 3OIFA 2PX2A 1E94E 1J49A 3DMDA 1N2JA 5AK5A 3GLVA 3K9GA 4CM9A 1TAUA 1VIDA 3PDHA 4HG2A 3QUAA 2D1SA 1BVUA 3EIUA 3KXDA 4HEJA 4Y98A 4OB6A 4A0HA 5IT5A 3DCNA 5KNDD 1H0SA 1G9TA 4CQJA 2R1ZA 3A4NA 3CVUA 4MWOA 2PD3A 4IVNA 3H4TA 1EFVB 1GTMA 1LF5A 1XNHA 4GNRA 4PV7A 5AJTA 3JPWA 4BHTA 2O57A 1NULA 1E99A 2JHPA 4QELA 3HJTA 1BVHA 1PFKA 5BMVA 4S2UA 3TMAA 1EGMB 1X92A 3A1UA 3C5HA 3OFNA 4NJMB 3MOGA 2J6BA 4E5PA 5BSGA 4PRLA 3UV7A 4CM8A 1ECCA 4YRJA 4AZ0B 2VJYA 3KAPA 3PEWA 2GEVA 3G9QA 4EHIA 1P60A 3HXPA 2G17A 2WJZB 1XZJA 1IQUA 2ZDQA 3I01M 3NZEA 5KTKA 4ZAXA 3GEDA 1L3IA 5BV7A 1X7WA 4LE2A 3ZNPA 1AD2A 1QB8A 4JBGA 4KI7A 3TOVA 4RDCA 3MBOA 5IPFA 1ETUA 3GLTA 3QWIA 1QFSA 2CDBA 2QYSA 5FUBA 1F7VA 5EE0A 4CLHA 2AFHB 1C14A 1E79D 4YASA 4HT3B 4DEVA 1BCSB 3AEUB 5EJ7A 1W36B 4LDQA 4HUTA 1ORRA 1EZZA 2RI6A 2AXQA 2J59A 4ZGGA 3PFGA 2PUTA 1EVIA 1DFIA 2P6UA 3PI6A 3RUPA 4NY1A 4YDRA 3DDCA 4RTNA 1ZGGA 2H0RA 4TMFA 3WQBA 2Q5QA 3VO2A 4F0JA 1ONPA 1Y9AA 4LJ9A 3VR5A 2HCFA 3QKWA 3F67A 2FP4A 4NJOA 4WTOA 1H8ED 5C3MA 1QLWA 1ZUNA 3G85A 3ZD6A 4PYKA 4LV6A 2XEDA 4JJ8A 1JHVA 2C9YA 1AKWA 2G8LA 3GRCA 4DSTA 3THYB 3QFRA 2OP0A 4ZVNA 5F2KA 4DMKA 5AKGA 1M54A 3ZD7A 4YJ3B 5CD1A 2WMOB 3ER6A 1H1LA 3UZUA 3C3WA 4MB2A 4GS5A 3OOWA 3ORRA 4PQFA 1XMVA 4EKNB 4FFRA 5BURA 1MUUA 4PC6A 3CJRA 3VHRA 1KH3A 2DR3A 3LKDA 3PQDA 1K7XB 1N2ZA 3MGCA 5TE9A 4E5VA 1M2WA 2J3QA 2PH3A 1NFFA 4Z7OB 1GD1O 4D8TA 1UQUA 4UBNA 3NRBA 4ZVRA 5BW8A 5LNK6 3AR3A 3N6RA 1PN3A 3G59A 3W5VA 5IAAA 4RULA 2CBXA 1XL0A 2D8MA 2RGNA 3F7OA 4UM9D 4YRRA 5C7IO 4IM7A 2GH1A 5ERGB 1E1QD 1GPJA 5AM0A 1WX1A 4AJPA 4D7AA 1Y6RA 1EUCA 1AA6A 1W87A 3QYAA 2P27A 4QGGA 1T2UA 1WHTA 7YASA 4H0NA 2ZT7A 5GJWC 4GWGA 2O1SA 4AKEA 2VWGA 4FGUA 5KTNA 2QX9A 2I8AA 4R2XA 4BO4A 4EMTA 5I6DA 3ABZA 4I1PA 2HCTA 4I14A 1YU6A 1AGNA 5D7BA 3N8IA 3UT5B 4B7ZA 2GJKA 2J9XB 4GUAA 2XRMA 1VG1A 5IW8A 1ILWA 1GTVA 2I2CA 4X00A 2OECA 5BYJA 4EQZA 3KD3A 1X7XB 3G2KA 3ZLBA 2J4DA 3FZYA 1ODJA 2GPJA 5LU8A 4MAAA 1BKDR 2PMFA 3KRTA 1O89A 4ZKEA 4HDKA 3WSWA 1NMXA 4EGFA 4YECA 3DL2A 3K8OE 4OGFA 4OJYA 1V8DA 5HKAA 3LK6A 1S8NA 2HEIA 4M8LA 4B3MB 3ZWAA 1QIEA 4WH0A 3WRYC 4RQAA 1EG2A 1K66A 3OLQA 3H11B 4PBRA 3RTDA 4DXHA 1RE1A 1Y6GA 2DFVA 2K2QB 3QFSA 4PLYA 1M5UA 5JXGA 4O2RA 5ALFA 5FPSA 1XX6A 3O9VA 4HATA 3RU3A 4CKYA 4X62B 1ZX1A 2I3BA 1V1RA 1H9BA 2HXGA 4EW6A 1T9KA 1HNXB 2ZYWX 3EGXB 3P8ZA 5KHAA 4H59A 3RU9A 5KSOA 1YJBA 2AE1A 1QHGA 2VATA 1P7WA 2H16A 2YXEA 4RIIA 4Z5XA 2IHJA 1LW6E 3MJHA 2KLHA 3PTZA 2I71A 2RHRA 3IAM1 4UHDA 1YDMA 3DM9B 1HT0A 1D1PA 3T5GA 1OXBB 2GPBA 2QL9A 2WMNB 3KPWA 1SWWA 5FTJA 1V39A 4K6KA 4LBWA 1FEZA 2CL0X 4GMXA 4HBGA 5EMMA 3ZIDA 4F38A 4HVCA 4HDNB 1BN6A 5H7XA 2WHPA 2FG6C 4QD3A 1FSSA 2X86A 3B13B 3LRTA 2O0HA 3EJWA 2JCGA 2REQB 1EEXB 3BSSA 4KN5A 1MO6A 2QV0A 4L08A 4UVGA 4TLEA 5EAIA 4EUNA 2Q3EA 1XRPA 1ZRNA 3PLAE 2ZYVX 1FX0B 1UWCA 2WJ4A 3UT0A 3N0RA 1QNLA 1W35A 4I55B 5A4JA 3GUHA 3FOZA 3NHSA 3U4MA 1SCDA 3Q12A 2Q9BA 4N18A 4K03A 2BFDA 5FPTA 2YHSA 2PXAA 4QRHA 3LHDA 1A2KC 3AV3A 4LHVA 4EG4A 2ZKIA 3PZBA 2IHKA 2YFKA 4Q21A 2QGNA 4OO3A 3IAS6 5TF0A 3D1LA 4KNVA 4HDRA 2X0DA 3RANA 3S44A 4MLZA 4BNLA 4OSOA 3FOEC 2JJ2D 5CDYA 1E3LA 1E0SA 2NZUG 3EZFA 2Y0PA 5TSDA 1JWAB 2HNKA 5L4SA 4ENTA 4TKZA 2JFBA 5K8CA 1JJ7A 1NKVA 2NM0A 1CU1A 3SQDA 2RKOA 1S2NA 4GXQA 4CCWA 3DWEX 2GJ4A 5P21A 4X66B 1JGTA 4HAUA 4DQ0A 2H9YA 3N2KA 4PANA 1BHQ1 3D8RA 3NALA 4HS4A 3H2GA 3T3NA 3UMRA 4GRDA 5ALNA 3EK2A 5EHXA 4GYWA 1R6XA 4HXEB 4K26A 4CGZA 1C3VA 3DVRX 4L0CA 2Y6UA 3T5PA 1XEXA 1SVWA 1JZSA 2VWHA 2HY7A 3QXJA 3FSGA 2IEYA 1CNFA 1NVDA 1OW3B 2VVTA 1NLMA 3K8ZA 5TARA 2PH5A 2BKUA 2R8BA 4BZQA 3EEBA 4UNSA 1RHQA 2YVKA 5LDDC 2VQFB 5LZ9A 1WF6A 2WSSD 5GAJA 1M72A 2BGLA 2XCIA 1TAQA 2FMXA 2W9XA 3QHAA 4Y9UA 4FIZA 5JXHA 2EU8A 3L8FA 1O0CA 1SHJA 3R3VA 2DHQA 4H7EA 4EECA 1DEAA 4P84A 4RZQA 2NO4A 2PZJA 2Q49A 1FDVA 1U3UA 4XGKA 3VVLA 1PL8A 1KJWA 2XT6A 5JNRA 4KO1S 4QREA 3KFVA 2OEPA 2OILA 1OTXA 2G7MC 2HDNB 3F2IA 1R00A 4D98A 1KTVA 1UODA 2YNMA 3MD0A 1P33A 1WOMA 4JFAA 4DDMA 4KGXA 2WA1A 1DIGA 2GXUA 2EDCA 3LKBA 2JHFA 2JFGA 5D6OA 3ZV7A 5IDQA 3SFVA 3TTWA 4M8NE 2ADMA 3T3HA 4KBGA 1N2IA 1ICEA 3RRNA 1JLRA 1ZU4A 2FQQA 2XMRA 3T41A 3ZHTA 4YLYA 2CVPA 4TL6A 1WP4A 2NV6A 2F3TA 3QXXA 4LOIA 5DDIP 3C7KA 5ITZA 1G8AA 5HILA 3I45A 4EAAA 2GBFA 3P97A 4CEHA 2OYCA 2BGIA 2FOXA 2XRYA 3CT6A 3DMNA 4FDUA 4GC9A 4WBNA 2H57A 2VPPA 3RODA 3TJRA 3WADA 3CNLA 3AUFA 1NRXA 5K3EA 4HGZA 4OYLA 4J3FA 4CVNA 1VPVA 4GSYA 4UMFA 3L8MA 1IFXA 1DHRA 3NVMB 5C8VA 3AJAA 1QS0A 1T6NA 1GSHA 1NMEA 1M8FA 1ZNQO 3TSOA 2W0MA 4NZ9A 4ONEA 4FTWA 2YXLA 1SUSA 3P5SA 4NTZA 5CK4A 5EZSA 1WZCA 3BWVA 5DHFA 3MFQA 2C4TA 3TL6A 4TUYB 3YASA 4ROTA 2PX8A 1Q6YA 1UMBA 1UJ4A 3OPYB 4IXMA 4XVRA 4CDGA 3ILSA 1ADCA 1MW9X 3ZK8A 4A6DA 3W5SA 5EHGA 1L0BA 4EOGA 4EMUA 5ICEA 2AJTA 2L2QA 3HKCA 3T38A 1EI9A 3TQSA 1CR2A 4C7KA 4ZI7F 5B7PA 2JCYA 2F55A 3ZXIA 4L6IA 2QN6A 3K5WA 4QYTA 5T67A 4MS3A 2DEUA 4B4OA 1UFKA 3K0CC 5CX1B 2X0FA 4CMAA 4QEZA 1QAOA 5TLSA 2RFLA 1BC5A 2IEIA 1FA9A 3LC0A 2XXAA 1U3VA 3NLLA 4PSVA 2CEAA 1QANA 2KJQA 2UVPB 2VSOA 4TYWA 2F3QA 4C7XA 3K2BA 2H00A 5JAPA 2PXXA 3V8EA 5KPDA 1RD4A 5HTOA 2DFKB 4P58A 1NFQA 2BGKA 2ZKLA 3LV8A 1YJQA 3RSQA 3ONFA 3ZK9A 4XGIA 2KYRA 1NYLA 5AW4A 1NOKA 1CR6A 2N75A 3ROEA 5CPFA 4R31A 5FXMA 4EY4A 1GGKA 4E1BA 5LP6B 1N5JA 5ICGA 3DHWC 5JRZA 1KQPA 2E21A 1QHNA 1QORA 4TSKA 4CW7A 4KRYA 3GFFA 5FCDA 2NYAA 4MVXA 4JI1B 3C7CB 1UDCA 4C3UA 1FFHA 1MOZA 1XU4A 1USVA 3GLHA 3MTQA 1GUDA 3DAGA 3CCCA 3CUSA 4GPTA 3TNFA 4R05A 5EIEA 3C3XA 2J5RA 2A84A 5JAZA 1K7YA 2VDPB 4AURA 3IJRA 3V34A 1H8EA 1X3LA 3OWOA 3Q2OA 4MGIR 3MWDA 5DHUA 2P2YA 1BJRE 2NSDA 2QKYA 4JP1A 1N0HA 3M9XA 4LPKA 1YI0A 1V41E 1VL0A 4AC9A 1LLCA 3ZU3A 5KHOC 2WILA 2WZCA 5F5LA 3GDOA 4M60A 4PSDA 7MHTA 3WGQA 4LC9A 1L5LA 4OXRA 3SQLA 2PSEA 1GTRA 4BO6A 4K1LA 4M1WA 5FWYB 1T0BA 4D79A 5F2OA 4NVRA 3TOCA 3ETGA 1GZ7A 4J07A 4NDNE 1D4FA 1R9GA 1E2KA 2WKQA 4ALJA 4AUMA 1JHQA 3NB0A 2GNOA 4YP5A 4MIKA 1CUFA 3UAGA 1JQLB 4F9FA 1AF4A 1NC1A 1SVLA 2QTTA 4LJSA 4TX1A 1KDRA 4HQ6A 5D3MB 3L8ZA 4YP0A 1DNPA 3W4KA 4TVSA 3CVWA 4KNYA 5J2UB 4M36A 4RTKA 5EXSA 1XLWA 2C0QA 4H2DA 1KP9A 3KD2A 1E0DA 4BNDA 1T4BA 2Z57A 2ZLBA 4D0SA 1GLVA 1P2UA 3I5AA 5IM5A 3GLHE 1VIVA 3TRHA 3QPWA 4IO0A 1WLYA 5EHQA 5I7VA 2W42A 1TEZA 1V3QE 3IA2A 3VSAA 3IVGA 1F1JA 1HEIA 2IU4A 4UUAA 1QP4A 1W6UA 2RAPA 3WRWA 1C7QA 1MJHA 4ZRDA 1SOVA 3DPIA 5DTRA 5AOAA 3ZDCA 2H92A 2WLSA 4PZEA 4QJ5A 3VC2A 1B23P 3HBFA 2DUMA 2ZIFA 5DGTA 4HMOA 2RB5A 4RESA 3ZZNA 2P7HA 1ISFA 3LC2O 1SC9A 2WAYA 4J49A 2QK4A 4EHAA