2AN4A

Structure of pnmt complexed with s-adenosyl-l-homocysteine and the acceptor substrate octopamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 93
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2an4A00
3E23A 2HMYB 3G89A 5EC8A 5E8JA 1B42A 5GINE 3GNLA 5HIJA 1NW6A 2G1PA 3LDGA 3HEMA 3IHTA 3EGIA 3AXSA 2A14A 3EVBA 3OFJA 5DTRA 4GOLD 4C4AA 3IV6A 2ZZKA 2HR1A 4R05A 3FYCA 3DMHA 1YUBA 5CCXA 5FA5A 2JHPA 3DXYA 1EJ0A 5HOQA 3B3GA 5K0EA 2PWYA 1XDZA 3GRZA 1YZHA 3MGGA 1SG9A 1KIAA 5EHIA 4GOMD 3BKXA 3KR1A 1ZQ9A 3OE4A 1MHTA 5ICGA 4XUCA 2C7QA 3OCJA 3FTFA 3KQVA 3FUWA 2OKCA 2C7RA 3TR6A 3NWEA 4RV9A 2V74B 3KQYA 2I9KA 5K03A 3ID6C 2PSSA 1FPQA 3QV2A 3P2KA 4RTMA 4OBWA 3EEYA 3P9IA 5BW5A 1RI5A 2PJDA 5E8RA 3VC1A 4RSRA 4IV8A 5K05A 2ZVJA 3EVAA 2PT6A 1Q0SA 2IH4A 3LPMA 4XCXA 1G55A 4QVKA 4ATNA 4YUWA 1U2ZA 2B25A 2GB4A 2QE6A 2QRVB 3FRIA 2NXCA 3M33A 2YXLA 1DUSA 2B2CA 2NXNA 4GBED 5DWQA 1FP1D 5EMLA 2OY0A 1VL5A 3BWMA 4E2WA 3LDFA 3LX6A 1P39A 2P7IA 1BHJA 3ANXA 3KPWA 4RVGA 3EVEA 4YUXA 5IKMA 2NP7A 3DULA 2ZW9A 4MWZA 4QQNA 3UJBA 5K0FA 5EMKA 5C0OE 5K0LA 1JR4A 2N47A 5DT2A 5LQCA 3MTEA 4WVLA 3ER9A 4HRAA 4F84A 4P7JA 3GGDA 3R6TA 3IEIA 1L3IA 4H0NA 3DLCA 4YV0A 5DX1A 4E30A 3BUSA 3FPGA 5FQNA 4HTFA 5DX0A 3HA7A 3BZBA 1X1AA 2OB2A 1ZGAA 3A25A 1PJZA 4U7PB 3O4FA 2YTZA 3G5TA 1SKMA 2YQZA 3B7PA 3LDUA 4RTPA 5K0NA 1KR5A 3G5LA 3PX3A 2PKWA 5LSAA 1SUSA 1KHHA 5FQOA 1YFLA 3FPJA 3UZUA 5KQSA 3KQPA 5BP7A 3G2OA 3HCDA 1FBNA 2AOWA 4RTJA 3MB5A 3EVCA 5EMJA 3UJ8A 3P2IA 3UJ7A 4PYJA 3G88A 4HTFB 3CVOA 1R00A 1F3LA 5DLYA 2NP6A 4ER0A 2YR0A 3JWIA 4RTSA 2CKDA 2ORED 3C0KA 2WA1A 3UBTA 2JHAA 3DMFA 4RX1A 2C7OA 5HZMA 3SM3A 4POOA 3OU6A 4G56A 5EGSA 2R6ZA 2VZ9A 3F4KA 4BP1A 1D2CA 2O07A 5GM1A 5U4XA 3EVDA 3KR9A 3FUTA 3JWGA 4EKGA 2XYRA 4UOEA 4V0QA 3SX0A 2VDVE 2GH1A 4ER6A 3P9KA 2Q41A 2QM3A 1BKYA 5HIKA 4RTNA 2ERCA 1V39A 1JQEA 2AOUA 2P1DA 3M70A 4OBXA 4KDRA 1EG2A 2NYUA 2VDUE 3D2LA 3A26A 3P71T 2JH9A 4X41A 1ZKDA 3KQMA 4HH4A 5K0CA 4PWYA 3EVGA 3G8AA 3K0BA 5GP1A 4DCMA 4C08A 3MHTA 1AV6A 3VYWA 5EKXA 2C7PA 4IWNA 1R74A 3EVZA 3FYDA 1XJ5A 2UYQA 3HCEA 3GRVA 5LQAA 3Q87B 5DRYA 3A7EA 2ZWAA 2FK7A 5JR3A 1R8YA 4FSDA 2AVNA 2OB1A 2PXAA 2AOUB 4KIGA 4DF3A 1WXWA 4CTJA 2UYOA 1JG1A 3I53A 4NECA 3QOXA 2UYHA 3FPFA 1P1BA 1G6Q1 3HCCA 2BR3A 3E8SA 2FCAA 1JQDA 5EHGA 3GXOA 3SSOA 3EPPA 2ESRA 1VE3A 5HIMA 4X63A 5CVEA 2F8LA 1TW3A 2GA9A 3UA3A 2FYTA 4ZTBA 2CMGA 3OPNA 3PX2A 1L9KA 2EG5A 4P58A 2ZIGA 1XDUA 2H00A 4FP9A 5FHRA 1AQIA 4EQZA 1L3BA 2VS1A 5DM4A 4F86A 2GS9A 4E2YA 4L7VA 1H1DA 3FUVA 2YXDA 5ICCA 1XCJA 2ZZNA 4OA5A 3GO4A 3EEOA 1WZNA 2GLUA 3DXZA 3FZGA 3EMDA 4BLWA 5GIOE 2AR0A 4C04A 3GDHA 2OZVA 3G2PA 4QPPA 1IXKA 4IV0A 4MQ4A 3TMAA 4BLUA 4YV1A 4XUDA 1SQGA 1X1BA 3ELYA 4PGHA 5EG5A 5D1HA 3VC2A 4KWCA 3UJCA 1WY7A 4YMGA 3B3FA 1ORIA 2QRVA 3KQQA 4CXMA 4GC5A 2AOXA 5DM0A 5DTMA 2AZTA 1L1EA 5FADA 3Q7EA 4AZWA 1NV9A 2PGXA 4PYOA 1L3CA 5E9WA 3G7UA 1D2HA 3M6UA 1N2XA 1OR8A 3O31A 4M36A 5CVVA 1T43A 3UJ9A 4PYMA 1M0EA 2AOVA 2FRXA 2B3TA 3TKAA 1TPYA 1NBHA 2I6GA 3DOUA 1SVUA 2OYRA 2OXTA 2BZGA 3ER8A 2PLWA 5LQNA 1I1NA 4E2XA 1RI3A 4PNEA 5IH3A 3A4TA 2FPOA 2EX4A 5JUWA 4YUZA 1Z3CA 2ONYA 4CTKA 2EJUA 4FSXA 2XYVA 3E7PA 2HV9A 3KHKA 4GOOD 4GQBA 3V8VA 2IIPA 2Y1WA 3HNRA 2JHCA 3BWCA 3KU1A 5ICFA 3TM4A 4OA8A 4C06A 1DL5A 2IH2A 3KQSA 4PINA 1ZG3A 4RWZA 3GCZA 1KP9A 4RTRA 4AZSA 5CIYA 1KYZA 1YFJA 4R8RA 4CKEA 5K8VA 1YB2A 1ORHA 1RJEA 5EQJB 3CKKA 5T64A 5EKUA 3HA5A 4EK9A 1WG8A 1UFKA 3LBFA 2O57A 1X1CA 3LBYA 4RTLA 1WXXA 2HTEA 1IY9A 2XVAA 3OU2A 2FK8A 5FULA 3CJQA 2ZBRA 3UA4A 3VSEA 2UYCA 2YX1A 2AN5A 4LG1A 2UZ4A 1R18A 4R6XA 5H02A 4A6EA 2BR5A 2G70A 4FR0A 3SSNA 4GC9A 1XTPA 2IBTA 5E1OA 1XVAA 5CCBA 3CJTA 4M37A 1RJFA 3V97A 3AJDA 1BC5A 4YUYA 3M6WA 3B5IA 3PS9A 2HNKA 1QYRA 4BY9E 3DUWA 3UJAA 3GWZA 2IDKA 1VBFA 1XDSA 5DTQA 4LWPA 3L8DA 4YV2A 5K09A 4HGYA 3ME5A 1RI2A 5CVDA 1DCTA 1JSZA 3HVKA 1QZZA 4FZVA 4AX8A 3MCZA 3PLAE 4QQKA 3SMQA 5FHQA 4PYNA 3HCFA 1UWVA 4QTTB 4ER7A 2BM8A 5DPMA 2XVMA 1NV8A 1QAOA 1NW3A 4X60A 5FTWA 1N7JA 4YUVA 2G71A 2AOTA 2DPMA 3P9NA 2ZFUA 2WK1A 3JWHA 3HCAA 1F38A 3A27A 3LKDA 3LGAA 5DSTA 8MHTA 2H11A 3I5UA 3BGDA 1RI1A 5E1BA 2AS0A 2I62A 5F2KA 1INLA 5GM2A 3JWJA 3TRKA 1QAMA 4U7TB 5EOVA 3FTDA 4QDKA 5B1SA 1VPTA 1IM8A 5E9JA 3R3HA 2ZULA 4ER3A 3KR0A 1JSXA 4O29A 3RODA 2B9EA 5F2OA 3FRHA 4PCLA 5E9QA 3DLIA 4RVFA 2EJTA 3E05A 3TLJA 3RW9A 2HWKA 3OZRA 3P2EA 5CD1A 3T7SA 3CCFA 4M38A 3PFGA 4X1OA 5LR6A 2JH8A 1BOOA 5FUBA 3THSA 4ER5A 3PVCA 4PYIA 3C6MA 3P9CA 4E70A 2WA2A 3DTNA 3BWYA 3HTXA 5EIFA 5C1IA 2JG3A 1O9HA 1AQJA 3KPUA 3TFWA 3B3JA 3LECA 1PRYA 3C3YA 4V0RA 5HILA 5K01A 5FCDA 4KRGA 2CMHA 2ZWVA 4OQEA 4YMHA 2ZZMA 3BGVA 2ZIEA 2R3SA 7MHTA 2PX5A 4C07A 2G72A 2GAFA 3EGEA 3BXOA 4RTKA 3R24A 4HSGA 1EAMA 3DR5A 3UJ6A 5LQKA 2IH5A 2K4MA 3SR4A 4Z2YA 2CL5A 3SXJA 5KYGA 1JG4A 2P35A 3DXXA 3EVFA 2LD4A 3FPEA 3PTAA 2IDJA 1WS6A 3M6VA 3OE5A 1R6AA 5DRTA 4RVHA 3NW9A 3PFHA 3SVZA 4CKCA 3KQTA 3RIEA 2PVCA 3MQ2A 4GUAA 1Y8CA 2NNWB 4DM3A 3NMUF 4PIMA 2Z6QA 2O05A 2P3OA 2ZSUA 4C05A 1QANA 3LSTA 3HVJA 2FHPA 3NTVA 4X61A 2BM9A 3TM5A 4KDCA 4DQ0A 4K6MA 5EPEA 3TKYA 2XBMA 4ISCA 3WSTA 5MHTA 4E2ZA 5KQRA 2E5WA 4WXHA 1EIZA 5E2AA 1AF7A 2OBFA 4FGZA 4JXJA 4HG2A 1P91A 5T67A 1VP3A 3P8ZA 4PYLA 5KS2A 3CC8A 3CJRA 5HEKA 3ERCA 4LWOA 2ONZA 5DSXA 3BKWA 3TQSA 1N7IA 3NVKI 1FP2A 2Y1XA 3FTCA 4CKBA 1HNNA 2P41A 2PX4A 4C03A 1Q0TA 2B78A 2PXCA 3GU3A 3LCVB 4E33A 5LQUA 1M6YA 1I9GA 1FJXA 1VIDA 4AZTA 1G38A 3OU7A 3IYLW 2PBFA 1O9GA 1UIRA 4RYLA 2P40A 2G8NA 3AY0A 3GIWA 3GRYA 4PONA 3TPZA 4BP3A 4DCGA 2ZCJA 3GRRA 5KVAA 2H1RA 2PV0A 3MAGA 3PB3A 4CWAA 1P1CA 5LQRA 1YF3A 3BGIA 3GRUA 3ELDA 5D1NA 9MHTA 3I58A 1YZ3A 2YXEA 3HVHA 5GWXA 1RI4A 1JG3A 3FPHA 4QTUB 4PYKA 5CUQA 5GOZA 2IBSA 2P3QA 1ZHFA 3MTIA 3CBGA 3ORHA 3I64A 3M6XA 3DP7A 2YUIA 4MIKA 1RJDA 3A7DA 4KVZA 3FUUA 4P7GA 4HC4A 1O54A 4AUKA 1KPHA 4PCAA 5FA8A 4KIFA 3MCTA 4PGGA 5C9ZA 3QOWA 1VLMA 4QDJA 4Y30A 3NVMB 5EIWA 2IP2A 2ZTHA 5CM2Z 3NWBA 2NXJA 3BWBA 2PY6A 1VQ1A 1TW2A 3P97A 5CVUA 2PX2A 3KR2A 5DXJA 4E31A 1XXLA 1MJFA 5DXAA 3HA3A 1G8SA 1KXZA 3LL7A 2NXEA 5EZSA 3G2QA 5DM2A 1NT2A 3K6RA 1JTEA 3M4XA 5T6BA 3G8BA 3AXTA 5ERGB 4EVIA 5EVJA 3UWPA 3ELUA 3KQWA 2DULA 5K0GA 3OFKA 5F2NA 3TOSA 2GPYA 2OO3A 3DH0A 4RVDA 4GOND 5G02A 4P7FA 5E2BA 1JQ3A 1KPIA 2VP3A 2ADMA 2XYQA 1NW8A 4F85A 4PYQA 2P7HA 5EZQA 3U81A 1VP9A 4EMSA 4RTOA 3T7TA 3KQOA 1RJGA 2IPXA 5K0BA 3KPVA 1EQAA 2Z6UA 1JG2A 3LCUA 4DZRA 3HVIA 3G2MA 4RTQA 5GIPE 2BH2A 4LECA 2CWWA 2P3LA 1KPGA 4OQDA 1ZGJA 1G60A 3KPYA 3OZTA 4GF5A 5HFJA 1QAQA 2YVLA 3NDIA 4FT4A 3DMGA 1EJ6A 3H2BA 4P7KA 4E32A 5EEHA 2IFTA 2OPBA 2I7CA 1SUIA 3KPJA 3NJRA 3O7WA 4OX9Y 5EEGA 4R8SA 3REOA 2BR4A 4M7RA 4BLVA 1KYWA 2ZBPA 3LCCA 3X0DA 3I9FA 2VDWA 2O06A 4MTLA 2O0LA 2ZIFA 2EFJA 3HM2A 2QYOA 1NW7A 3HP7A 4FT2A 3FUXA 1M6EX 3PT9A 1I4WA 3AWIA 3C6KA 1NKVA 1NW5A 4HGZA 4B17A 1D2GA 3EGVA 5LQJA 1X1DA 1HMYA 1X19A 3T0IA 3UFBA 3R0QA 5BW4A 2KW5A 4EKIA 5CVJA 2PXXA 3FTEA 4A6DA 3THRA 5P8WA 2AN4A 4FS8A 3ELWA 4R6WA 5DX8A 2Z6AA 1JTFA 3C3PA 4IKPA 2V7EA 4XUEA 3SSMA 1SQFA 3LHDA 3T7RA 2IGTA 5EMMA 5FWAA 5HIIA 2AOTB 2ZBQA 3LKZA 4PIPA 2AN3A 5M5BA 3NDJA 3OZSA 4MHTA 5K0JA 4QVGA 5DM1A 3HCBA 4Y2HA 1XCLA 2P8JA 3GJYA 5E1MA 1G8AA 3B89A 3KKZA 2JJQA 2PT9A 4GEKA 4DA4A 1NE2A 4QPNA 3R9XB 3MERA 4DKJA 2AVDA 5E1DA 3UJDA 3S68A 3SGLA 2QY6A 4AZVA 2ZLBA 5ICEA 2PX8A 4KW7A 10MHA 3EMBA 5FWDA 1NBIA 2PWPA 3BT7A 5BXYA 3CGGA 4DMGA 1R8XA
chains in the Genus database with same CATH superfamily
3E23A 4GU5A 2X8AA 2PUTA 4TRRA 3AX6A 4FKZA 5E8JA 8OHMA 2ZKIA 2XB6A 1KYTA 3ANNA 4KAXA 4MUNA 5ECDA 4O4IF 1A7AA 1QF6A 2V0GA 4GOLD 5B3JA 4Q12A 3DMHA 3R7WB 4ZI3A 4EVQA 2C31A 1L5HA 4FFMA 2Q4TA 3IP1A 4BVGA 1RQ7A 2P9JA 4HYEA 1AGPA 3NYIA 3UUFA 4XUCA 1OX6A 3A4LA 1U2DA 3OCJA 3QY9A 2I5PO 3GLGA 4A92A 4AS3A 5JJBA 1JAZA 3ZKWA 1G21E 4EX6A 4HAYA 4LRWA 2WKRA 4LW8A 4WKOA 1C81A 3WK8A 4D6XA 2R6HA 1PT8A 2PZKA 1AZSC 5A3VA 5H4GA 5J23A 2AA3A 5CDUA 4EUFA 2L42A 2XZDA 2PT6A 4Q15A 2ACEA 2YWDA 4QVKA 1Y81A 5G0TA 4M6WB 1T4BA 4L78A 3GP3A 5GJWC 1RPTA 3S99A 1IU9A 2CL6X 1EAYA 1SKQA 1V0JA 3CA8A 1ZI9A 4JOQA 2FUG1 3OZCA 2OENG 5LD2B 1HEIA 1RWWA 1XMSA 4TV9F 3FW1A 2GT1A 4QQNA 3QW4B 4AJPA 2DB3A 3ICQB 5CITA 1S3FA 2P2ZA 2B20A 3P9YA 3SIXA 3IODA 2Y6UA 2AR9A 5DT2A 4D8TA 1G8JA 1WBJB 3NORA 4FGWA 1K5PA 2PNFA 3I83A 4TVBA 2AW3A 1S5PA 5K6AA 4UBJA 3RFUA 3T5GA 1DKQA 2AH5A 2F1OA 3SI7A 1M5TA 4B45A 1Z47A 4YV0A 3K8QA 3OMLA 1FPMA 4IGEA 1ONOA 3SYTA 3H99A 3RG8A 4C5CA 3QFSA 3HA7A 1X42A 5DCLA 1VMKA 2OB2A 4M7WA 4EDFA 3IQIX 2GN0A 2VIIA 3O2JA 3HJNA 3SEFA 4EHHA 1SKMA 4HOYA 2OOSA 2XCSB 2J6CA 3Q3CA 2PKWA 3Q7RA 2F1JA 1KDTA 4HRYA 1GAJA 2ZU0C 2BEJA 2HL6A 4HDQB 1MZPA 2Q3DA 1C14A 1NAHA 4CM5A 1FTGA 1JA1A 1T26A 2ZAOA 4BX3A 1S0UA 3QOFA 7AT1A 3GVIA 4HTFB 4EX7A 5KNCA 2RHGB 2Q5FA 3H5IA 1PSZA 1OLSA 2CNLA 1GAWA 5IC6A 3GRAA 3RTCA 4CT5A 2H65A 1C4KA 3GH1A 3CLVA 3GPIA 4JJGA 3TW6A 2O4CA 1QE3A 3OQBA 4MHTA 1F4LA 2G8LA 4TTAA 4FMBB 4DV0B 1N2GA 1ZW1A 2EBUA 3LM8A 4HWSA 3B51X 4FNOA 3UH0A 2BTEA 4GXTA 2WV7A 4IZOA 2XF2A 1N6NA 4QASA 3ROMA 6AT1A 3V4LA 5JCZA 1A9SA 5TGTA 1I0LA 1RWOA 2EP8A 3DNPA 3L6UA 5F2EA 3SKVA 4BMCA 4EO7A 3WAGA 1C1HA 1V39A 4JNKA 4M60A 4DR3B 1DWOA 1Z6QA 1WSBA 2OO7A 3TLEA 3D81A 4E6PA 5FI5A 1DV1A 3FLEA 4GG1A 3EVGA 4FGSA 4AZ0B 3WLKX 3H9UA 3ZE7A 3ZE1B 3I62A 3I2YX 3OMXA 1A9RA 3UA3A 2Y1CA 3MMZA 5DNDA 1UM9A 4W9MC 4CDRA 2FGKA 3EVZA 4MV5A 1QGED 1I3KA 1IE3A 1KEPA 1T2EA 2OD2A 1SC9A 1GCUA 1R8YA 2RC6A 3QF4B 4P4LA 1E9AA 2GD2A 3FMGA 4X54A 5H81A 4N5HX 3WX0A 2F3PA 2ORYA 4KIGA 1KFKB 4QBGB 4D3DA 2XRZA 2IHTA 3IJPA 3ILVA 2IE8A 1S2LA 2ZPUA 1E7SA 1LDEA 2CLLB 2QT0A 3DL2A 3FLMA 3IOEA 4KLAA 4LZLA 5EFZA 1RWPA 4JJ4A 4FPXA 3DJYA 4OQZA 4Q9LA 4Q16A 3SSOA 5MGBA 4D8VA 2B94A 9ABPA 5D6NA 4TYYA 1VE3A 5HIMA 3C5HA 2JKVA 2HXGA 3JPWA 4BQPA 4IXWA 1Z26A 3O0TA 2C4NA 3HDHA 3RVOA 4C0JA 2NV0A 5H8WA 1ST3A 2W37A 3DMTA 2OCAA 3EISA 5LLSA 2W2QA 3M3DA 4JCOA 5M3BA 1N5MA 1ZI6A 2ATIA 4RKFA 2P1RA 3FWHA 4E2YA 1SBQA 2YXDA 1K88A 4MGHA 3WZMA 2HPVA 4YRBA 2V3CC 4L5YA 3JVDA 4FGLA 1ZESA 3ZKAA 4TT3D 1C9EA 3FVVA 1RU3A 2ISSD 4NWIA 4UQOA 1DU4A 2IYUA 1YZLA 3WLMA 4ZP1A 4IR7A 5DN6A 3TMAA 1VDZA 5LYYA 4E11A 1E3WB 3IOCA 5I9TA 2OBXA 2Q46A 3NU1A 5A71A 2IBMA 3N05A 4P3KA 4HUQB 1DAPA 1DX4A 4PFJA 2ZVPX 4UTVA 3R44A 4CT4B 5DBGA 4MAMA 5LJIA 1QJ4A 1UT5A 1JDUA 3FNHA 2Y93A 4XQ9A 2M98A 3L77A 3TLCA 4A4DA 2FPKA 2FWPA 1MT0A 3ILXA 5HCUA 3WKAA 1EDBA 3VR4H 1FDRA 3TW4A 2UU9B 4X97A 3MPUA 4F04A 3X1ZA 4HCJA 1U8AA 1YJQA 2ALJA 3OUZA 3BZUA 4NV3A 3W5JA 3WL4A 5IAAA 2HCTA 2O5EA 1UBLS 1R8QA 2BZGA 4C22A 3UPUA 1W581 2O7QA 4E2XA 5G4KB 1NNUA 3PCXA 4XIIA 2PMFA 4MICA 1W9HA 1T9GS 1X86B 2A0KA 3R0JA 4Q1EA 3TVTA 1PLLA 3OQ6A 1HBJA 4ZAXA 5IYZF 2Q2QA 3E7PA 2FZCA 4YRDA 3THXB 3FTNA 4Y7CA 3PQ8A 3HNRA 4JL5A 2PWAA 3BWCA 4PO1A 4ALMA 3A36A 3S2YA 4RWZA 2CDRA 4LHEA 1T4CA 3P9QA 1P4RA 2XUQA 4JOBA 1RIFA 2H9AA 1CUBA 3DYVA 5JNTA 2C2MA 4R0MA 4ZHQB 2ZIVB 5DWVA 1HY3A 2QLNA 2DR3A 2ZAYA 4URZR 3HA5A 1T5OA 3MJTA 1UFKA 2FSVC 3LBFA 5FB3A 2HLDD 3SLGA 2X7XA 2NLOA 2LTAA 3CPEA 4JOCA 3FB4A 2A88A 5BSKA 1AY0A 3MWLA 2UYCA 1IVYA 1E5TA 2C3MA 2VZEA 4LG1A 4Y1FA 1BAPA 4Y2UA 3DFMA 1XVAA 3FMFA 3D8NA 3RLFA 1AKUA 4HJXA 4GL2A 4RGQA 1OYYA 2IYTA 3HYCA 3H2KA 3PS9A 2C2KA 3BE5A 4U4AA 4YAFA 4ND4A 1KVSA 3DF7A 3GFVA 4MQBA 3GV0A 1PQ4A 3MUEA 1VLHA 3INYA 3NTOA 4QC2A 4M86A 1OXXK 1U9IC 2JAWA 1KKLA 1Z37A 4AJ1A 2EW1A 1HSOA 3WISA 3BMCA 3FZYA 3HYSA 4QQKA 5LQMA 4B2LA 1CUAA 2QLTA 5FL7A 5IAEA 4G9EA 3WK5A 4B33A 3U4MA 2VCYA 4LI3X 3EIXA 2GZHA 3AIIA 4QX6A 1D2MA 4ER7A 5FX2A 5IZ4A 5KTOA 2W6IA 2VQ6A 3BM5A 4G0YA 2X1MA 1W9MA 4KWEA 1YK1A 4WESB 3UAYA 1LTKA 4IS3A 5ALKA 1EX1A 3E61A 3USZA 2IT1A 2C84A 4IO0A 4CM1A 3OG9A 3NYRA 4LBZA 3ZLUA 3ITKA 4TXJA 3ZHRA 3ETCA 3EOZA 3PJFA 4J2TA 2AX3A 1L7BA 2FN7A 4KQ1A 2QTMA 3WB9A 1EJBA 3PA6A 4WSOA 2VJAA 1L5ZA 5THXA 3WGNA 2P30A 5FAXA 5AKGA 4OP1A 3RBVA 3A6LA 1NT4A 1VPTA 3EASA 1IUNA 1S02A 2YIDA 5B1SA 4URFA 2JFBA 3OAAD 2AC7A 3CVWA 4G0UA 1DXOA 1NNLA 4I9FA 4UE2A 4ND3A 3C8ZA 3EQ9A 1WRBA 2KI5A 2W2LD 4D9IA 3MMPA 1CY2A 3TSCA 4EEZA 2CLEB 5DNVA 1HZZC 3VAYA 1RLUA 2JH8A 2JVIA 2J3LA 2A30A 3COZA 2HRCA 3VC7A 5FUQA 2F59A 2ZXUA 3ACBA 4ECAA 3DOFA 1T5SA 4IDAA 3VNSA 3VYUB 1O94C 4BPRA 3H42B 4EG5A 1XK7A 3UB3A 2BKLA 3KPUA 5EIHA 3CZ5A 4DS3A 3C6ZA 5TQ0A 3RRNA 3UENA 1FW6A 3NNDA 4DGSA 4MWGA 3L6CA 2J7KA 1DBPA 2J8ZA 1QZ3A 4AY4A 2JGFA 1TZKA 1E79D 3RU9A 1U02A 3ZK7A 2XLBA 3WY9A 2IH5A 2X5JO 3QPBA 3HY3A 3WOHA 5IM4A 4QYIB 2CL5A 3EIHA 3L0PA 2GFIA 3TJZA 1T29A 4PZUA 3NHPA 1UKEA 1YCFA 1WS6A 2PQ0A 4POOA 2DHDA 3BCSA 2VPQA 2A94A 4ABTA 3M5CA 1BDBA 4WX2B 3JRXA 4V1CB 2NNWB 3LRPA 2O05A 5BN4B 1PS8A 1W73A 1GYPA 4Z7OB 5AXBA 3NTVA 1NBMD 4HNTA 3JQGB 1CWUA 2W6NA 4RIGA 4PX5A 4XUGB 4H4EA 4K0RA 3SIPA 1TTTA 2Q1WA 1QNFA 2R96A 5M2QA 4UDYX 4I1OA 5K2OA 1E1CB 1C8KA 3F2IA 3N6RA 1YIAA 3I3OA 4MW1A 3TE6A 3ZD8A 1Y8QB 4IWYA 4JV5B 2OBFA 4C76A 3H1GA 4JXJA 1K6IA 1LLQA 5E95A 1VP3A 4EZIA 3F4BA 2WDPA 1TJ3A 3HU5A 5LJLA 5J4YA 1SRQA 3VA7A 2XNKA 1XZCA 1TU4A 3KYDA 2BGTA 4MUKA 4D5GA 1L1QA 1U2GA 4F3RA 2G77B 1GD1O 2WF9A 3BILA 5JS7A 4KR2A 1F7VA 1CJSA 4KE6A 2CK3D 3C8HA 4KQJA 4RVUA 3PWTA 3VR4A 1NDUA 4X3PA 5JASA 2Y0DA 3AF2A 1GY8A 3UKJA 4IHQA 1SBZA 4X6UA 1B8UA 3GFSA 2PRIA 3QPUA 3TPZA 1H6DA 4HDRA 2HCFA 4DCGA 5IASA 1SD5A 1AQYA 3VDXA 3IR7A 3FAZA 2W6JD 3BJIC 4QNNA 3TLYA 4O08A 5KYYB 5LQSA 3L01A 1T13A 4F1WA 1SU8A 3IPXA 3BQNB 2I33A 2R5NA 2VXOA 2IDMA 3D3NA 3DTYA 4O1HA 1F8YA 1NM5A 5T4FA 4WJLA 5A5EA 2FE4A 3OY7A 1ENZA 2JLVA 3WK9A 4DIEA 1EE2A 3Q8XB 5GOZA 5JE8A 2V6IA 5BT9A 2B0JA 2WJYA 3GJQA 3REQA 3ZU5A 4BN0A 2NVUA 3NCTA 3DMPA 3TG8A 3AFIA 3WIDA 2WVAA 3HB7A 1GRVA 2G0TA 4LSGA 3M6XA 1E1KA 4M7PA 5AR1A 3DR3A 2RCYA 3UAVA 2Y1DA 2GPSA 3C7TA 2GA8A 3L7YA 4Y1GA 2ZVQX 1D7OA 4PGGA 1YTUA 3ORQA 3ROKA 1CJUC 2IP2A 4QPZA 4KIJA 5C8YA 2X8LA 1A98A 3RVMA 2PMCA 3A04A 4MR7B 3CWZA 3D7RA 1WVGA 2PX2A 1AKYA 1VKHA 4DM7A 3TLMA 1ICEA 1ISFA 4M9UA 1TCAA 1TQ8A 1GNSA 2TMDA 2QTNA 3LPNA 4FCCA 5HBRA 3ZTWA 1P4HA 2IEDA 2RHDA 2PL3A 1CJBA 2WIAA 1B0ZA 3BDAA 5CNKA 3HKDA 1T4DA 4BVBA 5F2NA 2J32A 1T9KA 3S27A 1PSDA 3AVPA 5G02A 5JTUA 1OFUX 4MW0A 3RYIB 2GMWA 1FP7A 1X7XB 1XNHA 1KH2A 5E2BA 2CXRA 5COBA 1XQVA 4TUYF 1THTA 1CQXA 5FI3A 3QMWA 2PSJA 3U09A 2Q49A 1N1EA 3HEBA 3N39C 2WJZB 3BMNB 1HT1E 4Z0PA 2AHOA 4G0VA 4ALIA 4EB6B 3UGQA 1NR7A 1LI4A 3FI0A 4UUNA 2OV3A 1CJVC 1CR0A 1CQJA 3GRFA 3H18A 1W5AA 3LGSA 4JUIA 4QGBA 3ZVLA 5HFJA 1VL8A 4G0MA 1M1YB 1LCIA 1AC5A 1F5SA 2LP4Y 3FF4A 2X15A 3MQ4A 4NJMB 3T5DA 4CLDA 2D6FA 1RZ3A 3DBRB 3PCRB 3O8RA 2PRYA 2XVYA 4P7KA 2IFTA 1E6EA 3OPXA 4ZRNA 4OX9Y 3FIUA 2B4AA 1XPRA 3C1UA 1XKXA 2ZYTX 5AM0A 2P9QA 2MSLA 1DIHA 2XQKA 5AH0A 3WRYC 2IU3A 3WICA 4RESA 2ABWA 4AT1A 2QN6A 2ZRJA 4KR3A 3KYBA 2O06A 1JG7A 4H1HA 2O0LA 2XJ9A 4KNWA 3T7DA 2O7SA 2XWSA 3GBPA 5K20A 3QF4A 3UMYA 2PQ2A 2XAAA 4V0OA 4TSRA 5E7QA 4QXQA 4DJJA 5BQ5A 3GOQA 1TEZA 1VLQA 3LT1A 4F45A 1OJLA 2N42A 4F91B 1GFIA 5E2IA 5HKLA 5M04A 2GVZC 4PC1A 1ADBA 3TLZA 2GERA 4H3HB 2VDWB 1DX6A 1S3SA 4ZV7A 5HF6A 1RACA 3QJ5A 1ZRNA 3V4SA 5JYCA 1XDDA 5DX8A 3GPCA 4L5JA 1ZSYA 1JTFA 1BXRA 1SK9A 3TOCA 3I01M 1BFDA 2W43A 3B1FA 1IUOA 4IGIA 2DKFA 2AOTB 4WGGA 4L85A 5DKFA 1WXHA 1RYBA 2ODAA 4RKRA 1T9DA 1XJCA 2VA9A 1SXJE 2O0JA 1U7OA 2OFPA 3E7WA 4H3SA 4PHCA 1QTNA 4RK0A 3FNIA 4JY7A 3LDHA 4UDOA 3V1LA 1JIXA 5IJ0A 5K6RA 1W4AA 2GN6A 4FFDA 4TTRA 2JHFA 4KQWA 4UZSA 2EERA 2IXDA 4R8VA 5CT8A 4ZQFA 2WJ4A 4WBNA 4RMIA 1T0UA 4REQA 4DDTA 4HEA1 1WUIS 3L3BA 5G53C 4ZI5A 1N3LA 4AP5A 5BV2P 3EMBA 1Q1GA 5H68A 1FMJA 4YWHA 2Q8QA 5K6AC 4P4GA 4CMHA 3GUCA 3WWOA 4IVPA 4ID9A 3WYNA 4EI7A 1LNQA 3IO3A 3T3GA 2DH5A 1DUVG 1IFXA 1O6FA 2ONCA 2AG0A 2H1FA 2WIGA 1FDIA 4OVKA 4D81A 3N87A 2D1QA 4IX1A 1CU1A 2Z9CA 4MYCA 1Z8NA 5FI1B 5BWBA 1HQDA 5AI0A 1YR9A 4HNAB 2DTXA 5FA5A 4DSOA 3NJ4A 2WAOA 1SHUX 4OHOA 2NVBA 4KRYA 1TC2A 1XDZA 4PEVA 3NALA 3T1VA 2HIHA 4H4DA 2G9NA 4R9NA 1URPA 5IF3A 4BNDA 1N6PA 5EHXA 4TTVA 2C7QA 5TIIA 2MOKA 2Z98A 3PF8A 2EFDB 2W8BB 3H8SA 1CBUA 2O8FA 1P0FA 1QZXA 5B1IA 5CA0A 1U5AA 5CW1A 5ULLA 3K5WA 2OECA 1G6HA 5K03A 5JQWA 3RYTC 3ES9A 2EKZA 2C1EA 4I5GA 1O08A 2I3AA 3K1YA 1A9QA 1LLDA 2Q4EA 2QTCA 1EVEA 3PEVA 4FC6A 4JWTA 3MINB 2Z9DA 4M0UA 3KL4A 1QHNA 4KPYA 1IUKA 1ZJ6A 2X4IA 3BTSA 1DC6A 1WMSA 3DQQA 4UREA 3ANSA 3OCVA 4BNWA 4K3UA 4KQKA 4MVCA 4UAJA 5C4IA 1QM5A 2FEWB 3VO8A 1C8VB 3KBBA 5JADA 1PFVA 1PUXA 3O4RA 5DHRA 4YMUA 1YIOA 2OWEA 2X9LA 2WUGA 4TSFA 3ADCA 4J4HA 2J6IA 2JLBA 2WHPA 3UJBA 4GE3A 4I14A 5K0LA 2IEIA 2V7VA 3NUQA 3I72A 2IYAA 1NYQA 4HRAA 3MN1A 3QPAA 5EJIA 1SKYE 5MN6A 4MA0A 1PK8A 4AO6A 2HF2A 3BB3A 1KMMA 1RBQA 2M9MA 3IIEA 5DX1A 3ZHQA 1VE1A 4YRIA 2CLDX 3LGXA 4YHBA 1BKDR 3UHPA 4FX5A 5KOYA 1IG0A 2HJRA 3O2SB 1STOA 2ECOA 3SHWA 2WTUA 1G3IA 2A59A 3B7PA 1JR3E 1O95C 1VSUA 2R6R1 3ETHA 5ELMA 1UPBA 1OBFO 4X3OA 5JXJA 2YMMA 3SF0A 1SUSA 2ZIZA 5CB4B 1J7KA 1WE2A 5K4GA 4B6EA 3FI9A 2C3OA 3WLRA 2OCIA 4R7ZA 4DHEA 4S1NA 4AKHA 2FFRA 1SULA 2EC5A 4MS3A 2WWFA 1A1VA 1V6AA 1T0HB 3OZVA 3M2TA 3QFFA 1H4SA 3IXMA 5ALQA 3MXOA 3G13A 4YAJA 3V1TC 3H4VA 1C2YA 1Z6AA 4IDDA 3D02A 4U6QA 3L2OB 2GF0A 5K99A 3I04A 2OWDA 1CVIA 1XC7A 2H4ZA 3EVDA 4CV1A 4AY5A 2PEZA 5JYBA 3SX0A 1OWMA 1XZDA 4MDFA 4V38A 4KWHA 1QFXA 3EEIA 3DD5A 3IKMB 4TLMB 3RHTA 2WTNA 1QC5A 3RRYA 3AZQA 1DNPA 4OI4A 4AD8A 2PZBA 4EY3A 5BNIA 1BGWA 1UADA 4DR4B 1EG2A 1U81A 2LDXA 1KORA 3EDCA 4UVDA 1KJ9A 2GEUA 3EUWA 4WJKB 5KHLB 1P75A 4BZZA 4YGYA 4G2NA 3SICE 4AP9A 3MTDA 4GVPA 4ZAVA 4JQSA 2VJCA 5EKXA 3KVNA 3V4OA 1EX7A 4EHBA 4LXTA 2Q4OA 1JUDA 4IQ4A 4P7BA 2EWMA 2PJZA 1EM6A 1E4VA 1MR3F 1YDGA 4XGRA 1J39A 3SBDA 3USES 3AR5A 3L9WA 2AOUB 3IMEA 3ZK9A 4DMKA 4ZJUA 3C74A 3TW8A 4CTJA 1U6KA 2HA7A 4TRMA 3ZJTA 3O4VA 1MAWA 1BDHA 1LDGA 4O4JB 3TLBA 5LA6B 3WGMA 1OIVA 1GR1A 4FCWA 5EHGA 5F7ZA 2GNPA 3SZOA 1I2AA 2FR0A 2YWRA 3TN7A 1K89A 5CLHA 5ESRA 3NT5A 3QBJA 3X3HA 5LBUA 2HEGA 2N46A 1U0OC 2HFJA 3VNQA 4EOGA 3FYTA 1VJGA 3OPNA 2KWIA 1W59A 1I3NA 3PSHA 2VP6A 3B70A 4ZRDA 2GPTA 2R66A 2PG3A 1OU0A 4ZJPA 2XLCA 1QOQB 3FYUC 4C6TA 5H1YA 4YFYA 2I99A 1EFRD 1Z18A 2H3EA 1T9BA 2OYSA 2ZAMA 3ACDA 3AWDA 1POXA 3BRWD 3NTUA 1P29A 1KZ6A 4PLPA 1NFFA 5E6SB 3B7GA 3STYA 3EY9A 4BB0A 2B30A 3H9JA 1ATZA 4WWHA 1V26A 1XKQA 5IABA 4MVYA 1XQXA 4UU7A 4ICIA 4IP0A 4Q7MB 1OXVA 1IH8A 1X1BA 2IZ6A 2F00A 2G5CA 3KLPX 4GR4A 4WY2A 4GSLA 4Y2XA 4US2R 5JYEA 1R4NA 1R66A 3JQ7A 1WY7A 4D0NA 4J1TA 4GL4A 4G0QA 3NBZC 1N7HA 1Q7TA 3OZDA 1WABA 2O0KA 4CXMA 4LNUB 1DXYA 2X4DA 3H11B 5LOVB 2Q5JA 2I8AA 2H7YA 2NSYA 3LL4A 1PNVA 1C30A 1CVLA 2FMIA 1TVCA 1RRGA 3O31A 2CVQA 1GL7A 2WYIA 1Z82A 3PRJA 5CVVA 3G9TA 5LOVF 5FKJA 4U2CA 1T6BY 2PVPA 1ZNZA 1SOUA 2VPYA 4N3NA 4TMYA 4DG5A 3DV0A 5MF6A 1XCGB 1R6VA 1SZCA 3N2KB 5BSHA 1PE0A 1U9IA 2QN2A 2FMUA 4FN5A 2JIDA 3WZ2A 4BV8A 3O94A 3RRFA 1TYEB 1CG6A 4YCJA 1KDYA 3E8MA 2GD0A 4GQAA 4M9QA 5HDBB 3RROA 3A9RA 3MSCA 2INGX 3EGDB 5IH3A 5FYDA 3HL4A 2HHCA 2HMVA 2Y4OA 1YDWA 1Z3CA 3AEUB 4XPIA 2EJUA 2RGGA 1NQOA 2NU7B 2VK8A 3AZPA 4D0LB 3ILYA 3EXHC 4R3UC 1ZJYA 3JD1A 3MTGA 4TV9B 3QWHA 3DMRA 1PR6A 5FUMA 3W05A 4PLHA 1T10A 1EVIA 2WUFA 1B6TA 3IIIA 4UAGA 5KI6A 4MNTA 1FSPA 1PW7A 2VJMB 4CDGA 3CZPA 3AM5A 4D98A 3B8HA 1OX4B 3CZQA 4F56A 4EZBA 5LQDA 2ZT8A 4YRPA 2BFFB 2VR1A 2R86A 4J1QA 4LE2A 2CD9A 2LVBA 5JQGF 5J40A 4MO9A 2FOXA 3AERB 1Y5LA 4EK9A 1V7PC 2O8CA 4DFDA 1A7KA 2XMDA 3CFYA 2A5JA 4TV8A 5JD6A 4DLBA 1N75A 3S1SA 2FK8A 2ZUCA 5FULA 3DKRA 4OQLA 1NJ1A 3QXCA 3ZCRA 4NPHA 4PGMA 1X7ZB 1JEDA 3QX9A 5H02A 2WYUA 2NX2A 2CJXA 2YQ4A 2I7VA 4HYYA 1XGKA 2QU8A 5AW3A 5CFNA 2Y05A 4G84A 1HT3A 2YFKA 4RM3A 5F1KA 3TRJA 3V97A 2H17A 3GDGA 4D0RA 2O8BA 1GITA 4BVEA 4D4HA 1FVOA 1KE2A 3EJ6A 2NVUB 3WWCA 4YUAA 2IX3A 3KU4A 2JFUA 2Q5EA 2WJWA 1ISGA 4Y1EA 4D4MA 1FP4A 3AHJA 4WN9B 3WRWA 3A9TA 3Q0IA 5KOIA 3F6SA 3LHKA 4N5DA 2JAPA 2VA8A 1T2DA 3W5UA 5U9CA 1KSFX 3N7UA 5EZ5A 1DCTA 1QZZA 4CUKA 2HK6A 2GJ4A 1BHQ1 1XYGA 4GPEA 3RVRA 4QUHA 1ID8A 5BT8A 3B60A 4Q21A 1W1UA 4RULA 1UWVA 2ZRIA 1T5LA 3K30A 3V7NA 1LKZA 1LNSA 1WOMA 2HF8A 2UDPA 2V4MA 2C5FA 3QYFA 4YQEA 2DF8A 2JJ2D 4YJDA 3PGKA 3STWA 3CV3A 3U4DA 3VO9A 5EWLB 2XWQA 5K0TA 4MDEA 3VR5H 4DLVA 4WOPA 2HSGA 5EUQB 1NDHA 3AW9A 2IQIA 1RI1A 1VI5A 2H1IA 2PS1A 4OBEA 3PHHA 3TIVA 1T1EA 2AF4C 3F5DA 3KAKA 4TKVB 5FOSA 5EOVA 3T1OA 4BE7B 4N65A 4L2IA 1U9JA 4URWR 3TCKA 1M2VA 1OYWA 1X9HA 4YCAA 2FW0A 1W36D 1ZSNA 4RVFA 4Y2SA 4LFAB 3RW9A 1XR3A 3T06B 3G7SA 1Z2CA 4RPJA 2ZJ1A 2ZJFA 1EKXA 2PWBA 1BOOA 3KEQA 4B47A 2DFNA 1DEKA 4KREA 3GLTA 1J56A 1SU7A 4X7MA 3AF3A 1DQYA 2PZAA 3ETDA 3KB8A 3OF5A 3ZHOA 5I7UA 5EP4A 4KFCA 3TUIC 1WUTA 2G63A 4NJMA 5FCDA 3QFRA 3IE1A 3T4PA 1DFHA 1BXRB 1KDOA 1ZD8A 3LO8A 3L7CA 4ACBA 4EG6A 3D6MA 3IUMA 4YDSA 3RREA 4AXXA 4D4LA 5BN4A 3D3WB 4XSGA 5HOEA 2DHQA 2GAFA 3GIDA 4IEFB 4B3DA 1E7WA 1GLGA 4R7GA 4NXMB 1Q0PA 3UJ6A 1VL2A 2H1HA 5KBYA 5L3VA 8ATCA 4Z2YA 4Q7JB 4ZK2A 2X3YA 1YQEA 3BIOA 1D3AA 1BCRA 1QQ6A 1TVKA 2RGCA 4L8GA 2BZ1A 4R3WA 4RVHA 3KKKA 3GCDA 3ZU6A 3TFOA 4Z7JA 1UBRS 4F72A 1JALA 2BGMA 2P3OA 2VF7A 3KNZA 3QYJA 5AJUA 5DIFA 3RCBA 2G17A 3LP8A 1E9BA 4G8DA 3GN1A 4RE5A 2NUAB 4TWBA 5AVTA 1OBVA 1CQZA 1MENA 1E77A 1PQYA 3LLUA 4XIFA 4DQ0A 1MHPA 4EO4A 1ECCA 4X95A 3BQMB 3WSTA 4NTZA 4FFSA 1UM9B 5IEBA 3CEJA 5TS2A 1M6WA 3OT1B 3QMPA 5TDHA 4FYWA 4IMIB 3O4HA 3ZCTA 3S8YA 4OHCA 2XUJA 1XA0A 1XZ8A 5HEKA 4RJIA 2XCQA 1V3VA 2X0RA 3VUFA 4HNUA 3T1HB 5BSUA 3KCNA 4UBOA 3ZD6A 4PQYA 5IU6A 1MQ9A 1CUCA 4XJSA 1GEEA 2W98A 1H3EA 4FX2A 2BHRA 2JGLA 1XB2A 4COKA 3OQOA 1Q0TA 2B78A 1MLDA 3CF0A 1IEWA 4PRZA 4KO2S 5CIWA 1BEZA 5JZ9A 1N7GA 1G38A 4DA0A 3QYAA 2IXBA 5IKPA 5D7NA 2GBFA 4WBXC 2IS2A 3AY0A 3LX5A 4Q24A 1ETHA 3IEUA 4NC9A 1U2DC 4Z2AA 1F17A 2G5TA 3MFQA 2H1RA 4FEYA 3DT9A 5JAIA 1E0SA 3KUDA 2R84A 1BFKA 1E6WA 3PI6A 4EPXA 1AGYA 1J8DA 1K5HA 3I58A 1HDYA 1YDEA 2F2TA 4U9HS 3EIOA 3GJ4A 1DT3A 4PX2A 5LWHA 2QPAA 3TPFA 1Z4QA 3ZD7A 2H2DA 2UVPB 1OLSB 1W4ZA 3VVLA 4W5WA 3RS8A 1AKMA 3FN4A 3CBGA 3QWFA 2QTRA 3VTFA 4XH9B 4DRZA 4EFMA 4ENWA 2YY5A 2G83A 4BUZA 1TKAA 1WZ2A 1HLFA 2F1HA 2VHCA 3ST7A 4E6EA 1L4EA 4GRAA 3WOVA 2QI9C 1C0IA 1VLMA 2DWUA 4RQBA 1M6HA 4F7DA 1PBTA 3P52A 1AMOA 2WILA 3IUQA 621PA 2XZTA 3WFIA 3HB9A 1TA4A 3CPHA 5FWNA 4JYZA 4C4SA 1RM4A 1ITZA 1YBMA 3WMFA 1VA5A 3NHRA 2RGRA 3D6FA 1G8YA 1GDHA 1LRLA 3LL7A 4GZ5A 4Z9YA 4BFWA 1ZIXA 3NLLA 5HTKA 3TZCA 4H7PA 2FW6A 3UQZA 2PUAA 2EZTA 3G8BA 3IJEB 2BGLA 3CS3A 3DB1A 1P81A 2Z2JA 2QQEA 5GZ1A 2OAGA 3Q3EA 4TROA 3TOSA 4EF4A 4YT4A 1M1YA 2GBLC 1P2VA 1C3OB 2Q6IA 3Q3HA 1AHHA 1XCOA 4D41A 4ZOAA 2PQMA 4AY2A 5THQA 3IT0A 2PRSA 1UBHS 3HKCA 2WJHA 1PFKA 1R0RE 3JQAB 1JSRA 3ISVA 3EY4A 2OVFA 2Y9MB 3DL7A 2Z5FA 1K5GA 3RJ9A 1KEKA 3TIFA 1K9SA 3A2KA 3PL5A 1JPJA 1ECFA 3QWAA 3CUTA 4E1BA 1PZEA 1MMFB 1N3BA 3G2MA 2IY7A 2GJKA 4HMPA 1NXWA 1G60A 4OQDA 4H7IA 5BRAA 1X8JA 2V6BA 2WZQA 2X7HA 3N86A 2BSQA 2OL4A 2F3UA 1I3LA 2V0NA 3DOOA 4GWLA 4E14A 3DV9A 4IMPA 4QU5A 4KLCA 2JLUA 1UDCA 2ILTA 3PXDA 5DZSA 5LCXA 2KPOA 2XCIA 4FBMA 3AY7A 1XZBA 5EJMA 3PQFA 1KO5A 1GNPA 3PPXA 4O2BB 4RPKA 3H1EA 3HC7A 1SMKA 5KNBA 2QQ0A 3PNOA 4YLYA 1JP7A 5JI3E 3A4VA 3E1SA 4Q39A 2QTTA 1KYVA 1HORA 3PXBA 1F60A 1NW7A 4QXOA 1CUHA 1HYQA 2Z09A 4KE8A 4AO7A 1A2KC 4E21A 1RE1A 1TCCA 3W5IA 1Q77A 3WK6A 1NW5A 2IYVA 2UZAA 4J3JA 1GNVA 2PJRA 3KFVA 3J80A 4E0BA 3GEEA 3QNMA 1B43A 1NP7A 1LGYA 3CPJB 4S1OA 3CNLA 5AJZA 4BTEA 4EKIA 5JFOA 1F8UA 4V1CI 4U2KA 1H9BA 5K3AA 3DC7A 1KI7A 1W5FA 3THRA 2EJBA 4A6DA 3HFSA 2I4TA 4PC3A 3O8OB 2G06A 4LNHA 4K81B 4NFYA 1UC9A 2QHXA 5LA6F 3S40A 2MU1A 3T7RA 1TT5B 2J30A 2DT8A 2PE5A 1Z4MA 3IIKA 2HMTA 5DGIA 5M5BA 1YD7A 2RGYA 3RS9A 4ZJYA 2FX3A 4MRVA 5CFPA 3QEJA 2J3MA 1ONSA 4OJTA 5EY5B 2A5DA 1DTWB 2JGDA 3MBKA 4C2TA 4CLRA 4OQQA 2PT9A 4ARBA 2XRMA 3ZY5A 3MERA 4BO1A 2FEOA 3RSLA 4GKAA 2AVDA 3D5QA 4OKSA 3SGLA 3THXA 1DDOA 1RQXA 3FDZB 3FG9A 1EK1A 1LW6E 1UXOA 1ZD9A 3CGGA 1VLZA 3NZEA 4BGEA 2R00A 2ENWA 3VHXB 4G37A 1N5KA 1GR0A 5CT6A 4DIKA 2JIMA 3UK6A 3RVNA 2HM7A 4DY6A 4ZZ2A 4EW6A 2M6SA 3U3OA 1Z0DA 4XWTA 3B8EA 4OFXA 3FFAA 4BQNA 2X3UA 3DV0B 4RS3A 4XD7D 4TL8A 4M9XA 2XD9A 3C6YA 2F1RA 3O83A 1ZQ9A 3OE4A 4A91A 3DL0A 4D9MA 2VK4A 5CYGA 5IHXA 3BRSA 3VZCA 1AUPA 1CY6A 3MXTA 2Z2IA 3KOWA 4OKIA 3RWBA 4R1QA 3EC7A 5IM5A 5BN3B 5HRCA 5JNVA 1K92A 3ID6C 4KO8A 4J16C 3UAOA 5LP6F 3USCS 2OVBA 3RFXA 1KIFA 1T0JB 1QYXA 4NONA 1GCOA 4P35A 3RF6A 1BGVA 5KWIA 1KQOA 3ULKA 2HQBA 3SBOA 4MEAA 3HDJA 3EAGA 1ZUWA 1KZHA 2QE6A 4Q1FA 2GBGA 2FP3A 2XUPA 3K3PA 3QUCA 4QICA 4CG2A 1V16A 2H4FA 1NSFA 1Z7WA 2KB0A 4FEAA 2GARA 1EIWA 1UMCB 2YYYA 1P39A 5IW8A 1IM5A 3GVCA 3KXLA 3L6EA 3SJAA 2NP7A 1Y8QA 2GTHA 4M0PA 1L5RA 2ZR8A 1VG0B 2YWHA 2JNWA 1ONBA 5DYYA 2I3GA 1JJIA 5JALA 2ROQA 4OGKA 1KO4A 5FOWA 2XXBA 1M8JA 1N9KA 3V8EA 3NQ41 5JZBA 3R6GA 4X20A 1H3FA 2O20A 3VHLB 1SKAA 2FZEA 2FSVA 4EZEA 3H87A 3MB8A 5H9WA 1ZC4A 2PL5A 2VKTA 1Y8RA 3LOUA 1QRDA 3AEUA 4B83A 4QHYA 1DLJA 1UBMS 2KBFA 1E3EA 1B0AA 3OJLA 1F2TB 4DAEA 2I1WA 4FMCB 2PWZA 3ZJVA 3ZV4A 3VOBA 3L8GA 4C5BA 4B35A 1JQJC 2OCKA 3VPDA 3SHTA 2XDWA 4EA6A 4HADA 3RC3A 4KBYA 2EZ9A 2IPNA 1ODFA 4PZAA 4RTJA 1UT6A 3G6WA 3MB5A 4C4RA 3V2HA 3T3HA 3UJ8A 3B6EA 2PDAA 1ZD5A 3KTFA 5TQ0B 2XMQA 4EKEA 5C4GB 2PXHA 3CLUD 3B7WA 2YR0A 1X15A 4JLPA 1Q1NA 2WSYB 4G2TA 4MMZB 2LV8A 3FYUA 3LP5A 2FMTA 3A31A 5EGSA 1QGYA 3O9ZA 4H7DA 4GLOA 2XUKA 2O07A 3UATA 4IY1A 1Y1PA 4OJYA 1CNMA 1JFRA 2GEVA 3NXSA 3W1VA 3WGGA 4UMFA 4JKIA 5IXSA 1NMZA 3FXAA 2VYFA 2QENA 3GDWA 3H0CA 3EF3A 1V43A 2GDJA 2RONA 1RRVA 2V8OA 1SCAA 3GFTA 3P71T 2PHZA 5CNIA 4JJFA 4WN9A 5C3MA 3VOAA 3U49A 3A3NA 3FNEA 3KYCA 4UUMA 3SIWA 2XZLA 2SHKA 4KLRA 3KLBA 4DUGD 3LPLA 5LMZA 3BPSA 2WYHA 5CDFA 3Q5GA 5DDIP 3GRVA 1NW9B 3DE6X 4M1KA 5B4TA 1Y3HA 3QIAA 3TF5A 4CHGA 2XECA 3TNFA 1BS9A 1JIQA 2WVJA 2VJDA 1VHLA 3CX4A 2HMUA 3PDHA 3R23A 4GM1A 4RSMA 2NTJA 3VX3A 1SXPA 2J0UB 2XOKD 3KV3O 1G6Q1 2FN9A 2IYRA 3KQLA 4DCJA 2QM7A 2C96A 4TOIA 1P2GA 1XEAA 4OAQA 4RIFA 1OXSC 4WNIA 3JD0A 4C3VA 5B4VA 1P6QA 4AY6A 4X63A 4H7KA 3LX8A 2CLSA 3O90A 5HQTA 2QTZA 4HXYA 1M2VB 4DV1B 2OQVA 2F3QA 3AFMA 3KVRA 4NU0A 2LXNA 4DDMA 2DFVA 1XV5A 2WTEA 2W9XA 2RK6A 2ZBVA 1EH5A 4QO7A 1R4AA 4WEQA 3EEOA 1GPMA 2X5NA 3AK4A 1ISJA 3O1JC 5L7WA 3M5DA 3NI2A 2EQ5A 4EELA 2B1GA 3NWPA 2HA3A 3TH5A 4CU5A 1Z8FA 5KKNB 3A9UA 4OHZA 1KK0A 1BXGB 5K8UA 1GFSA 4BLUA 5TPWB 5HKOA 3S2SA 4LXYA 3IQDB 4YO7A 3MF4A 3B1WA 2D54A 2OQ2A 5CK5A 3B3FA 3MJEA 1E5DA 5JW6A 1K75A 1GZ6A 1CIVA 1E0DA 5I9BA 3AKYA 4HDCA 4AZWA 3IUBA 3DZKA 4WEOA 5H4HA 3NKFA 1QHYA 1DBSA 3FBTA 4JQOA 4ALLA 2E37A 2QX6A 3G7UA 1WW2A 4QJ5A 3VR1A 1GKLA 5LM3A 1XYVA 2HV8A 3F7MA 2H3HA 1WOYA 1KYXA 3DOCA 2GBIA 2FPPB 1DGQA 1IBLB 1GIAA 4FW9A 1MNQA 3ZQ4A 2JFHA 3K7EA 2IJGX 3R5SA 1BWPA 1KK1A 1PP4A 1SR8A 2EEZA 2O2XA 2QJOA 3DW1X 3F3YA 3GHYA 1E9DA 3HU3A 3K1TA 3OE7A 4KFUA 3JSXA 4BQIA 6NULA 3ER8A 5LQNA 2QZJA 5HVNA 1U90A 3DOIA 3KKEA 3I6QA 4GS5A 2BGNA 4NNPA 3OH8A 4WKNA 2WUWE 2LUOA 1A4RA 4GMHA 1Z4PX 3ANTA 1RNLA 3LT2A 2B5VA 3AERA 1Y6JA 4FZ5A 4CPDA 4LF6B 4EUNA 4I08A 4FINA 1DINA 1J2UA 1OHHD 1UMKA 2Z2XA 3QVVA 2ZTVA 5KWEA 4OA8A 4XX1A 2Q9UA 4MO2A 4U7WA 1PJLA 3KS9A 4CM8A 2RBKA 4B3FX 4AZSA 2DUNA 2GK4A 2YBEA 4RFSA 1XYYA 4IIEA 1DFIA 2XGGA 4DWWA 1QH1B 1DBRA 2CMKA 2IEYA 5AT1A 5JNRA 4MQLA 4R8RA 2BEWA 5KU7A 5EQJB 4ZQIA 4H60A 1ZVQA 4KVAA 4YALA 2Y1OA 1NUTA 2D74A 1FSZA 2HTEA 1ZIPA 2J3JA 3ABOB 3FKSD 3HN6A 3R6WA 3L8MA 4CFZA 1LZLA 4FONA 3CRNA 2R68A 4R0NA 2G7MC 3QKRA 3WLAA 3A70A 4FNAA 2FZVA 1Q6ZA 2VP2A 1NBEA 3N07A 4J7CA 1Y9JA 2FDXA 2UKDA 3L82B 4L0DA 3FM9A 1R0LA 1N5RA 2J85A 3CB2A 5TMEA 1V7CA 2GBLA 3MJVA 1NI4B 1EA7A 1G7SA 2BMEA 5EZ6B 3S0JA 5A5VA 2QUIA 3KB6A 3ABSB 2XF8A 1E9CA 3EQ8A 3D0QA 3H86A 4JEIA 1RHMA 4MVJI 4BNNA 5CLFA 2FGJA 2OAEA 2CHUA 4R2LA 1NP3A 3ZIUA 3AONB 3ZHZA 5F78A 5B6JA 4KUHA 3OF3A 3WGYA 3S55A 3K09A 5AI5A 2OCXA 2XMGA 4J6EA 4JBYA 4MVJM 3U37A 4RQUA 4D46A 4ZMRA 1I2MA 4IYRA 3W3AD 3WKBA 5BN1A 1D7AA 2G71A 1TU3A 1XXHE 5HXAA 3RDPA 2WK1A 4YP5A 2SKCA 1Q83A 1AZTA 4FD3A 3ZDDA 3U7QA 4UNSA 2YZNA 2FCRA 3GG2A 3TRKA 1B73A 4C0WA 5IKXA 1NUPA 5DBHX 4Z51A 1OFTA 3GFRA 4LC1A 1US8B 2C9ZA 2ZULA 3F5SA 3PHJA 1SIOA 1TD1A 3AJAA 2C9MA 1OLXA 3DHYA 1U8EA 2EJTA 3LXMA 3PUIA 4JR1A 2V5AA 2WMYA 1OV4A 5T7BA 3CCFA 1ZU4A 4JEHA 2FETA 2NV2B 4Z0NA 3T3EA 5KCMA 2CDBA 5KX5B 1WPRA 3CNHA 4KB5A 4BX8A 2IW3A 2E4UA 1H2AS 1NBOA 3DEHA 1BMFD 5DEOA 1E59A 2V96A 3NTQA 4MKZA 5FORA 4DLSA 2NVWA 4QEZA 4TWZA 5CK4A 5JJIA 1CK4A 4WAUA 2QP3A 4R4JA 4Y6RA 3OOWA 3BH0A 5BQXA 3FOEC 3NWOA 2WJ6A 5KTMA 4QXPA 1JN0A 1WQ4A 4YMHA 1HPLA 3PD0A 1JWAB 2ZIEA 3QEAZ 3R4VA 1PD0A 1BD4A 3COSA 3EQ7A 2M6LA 2CYBA 1PJ3A 3P2OA 1YJ5A 4ZQBA 5F5LA 4UFPA 1JR6A 4IVQA 3RE1A 2Y6VA 5KC9A 3PUHA 1T8RA 1XZAA 1NXTA 1BJRE 4FFWA 3LVFO 4HEQA 1WF6A 1NZFA 5CXXA 1VYHA 2CUTA 2BKAA 4KQFA 4RZUA 1TIKA 4J75A 2OK8A 5ALUA 4ZI7F 5CD9A 6ADHA 4IQ0A 3Q8LA 1SQ0A 3OBBA 1I5EA 4DCPA 5IXYA 4TX1A 1U4SA 1CR1A 1KEVA 2YV3A 2RGBA 3H7AA 1JEAA 3TQOA 2GESA 2G80A 4KI7A 5HZGA 3FCXA 4ISCA 3W5CA 1CUGA 1A9TA 3KZMA 2FN4A 2W48A 1TE2A 3MOIA 1B0PA 1ZK2A 1T9HA 3P7MA 3TRDA 4J7UA 1AQ6A 5JSFA 1V5IA 1WVIA 4EB3A 1UPUA 5EP2A 3CJRA 2ACWA 3AFGA 2HGZA 4LWOA 4ZCQA 5K8IA 3UT0A 3GLVA 3WNQA 5IXJA 2JD1A 4FE7A 3FTCA 4I5FA 4UAVA 4M2LA 3I2HA 4M89A 1EEHA 5AESA 3HMQA 4YRGA 4ZFNA 2QVCA 1V5EA 4ZDJA 3PVSA 3QMVA 1GGJA 1SWWA 2NQTA 3N75A 4BP8A 3K15A 5ADWA 5DISB 1S9DA 1D0SA 4CIXA 5IYZB 3T7KA 5E7MA 3UUGA 3KUUA 4E5VA 3TGPA 2IZZA 3ZDBA 5HGJA 1SVLA 2WT8A 1TF5A 3BSSA 2EATA 2PV0A 3E9CA 1N8KA 4EUSA 2VTEA 4LY3A 2IIVA 2VWQA 9MHTA 1YZ3A 1DQNA 3HVHA 4MI1A 4C7MA 2DC1A 4ZCMA 1M1NB 4H7FA 4UM8B 3LZDA 3TNLA 1NIPA 2QE7A 3LCRA 3AHGA 5HKAA 5SYMA 4KFSA 3U13A 1KR2A 4RJJA 4OJNA 4GH5A 2HCRA 2A6PA 1RJDA 1UJNA 1BN7A 2JFWA 4KX5A 5AKEA 3BTUA 4LYHA 1X92A 1TAHA 3AUJB 4KACA 3IELA 4ZGWA 5CBPB 2AN1A 1E8MA 1UKZA 4KK4A 4E09A 1B23P 2AXPA 1K7EB 2NXJA 4JI6B 1C2TA 4KH1A 1TW2A 2JCBA 4RGBA 4DSTA 1JYFA 1PGNA 4P38A 3KR2A 5AXCA 1N2HA 1TZMA 3OPVA 3BA6A 3I2GA 3D59A 4NCIA 3ZD9A 4H6WA 2GWHA 4B44A 5A9SA 1ODLA 2IZ0A 1Z5WA 1ONNA 2ZUWA 5I5EA 5ERGB 2VJKA 3S2IA 4EVIA 3ABQB 4BC0A 5ELXA 3UWPA 1NGSA 4GYYA 2WKQA 3DDCA 5U1PA 1C0PA 4ZU1X 2FSHA 1AKNA 3ZZTA 5EJ6A 4P7FA 3IT3A 1NVBA 4JK3A 1GKIA 5FLYA 3Q9NA 3GLSA 4TKLA 2VOEA 1PG2A 3WRYA 4XQ0A 4FLMA 5A0TA 2NT4A 2P7HA 3PKJA 2A7XA 5EZQA 4QUBA 5SY4A 4A8PA 1YQ9A 4NE9A 4P4UA 4ZU6X 2FG6C 2C2XA 2XMSA 1RQGA 1AV7A 2H16A 3AUSA 1I13A 2I67A 2ODEA 4ZYWA 3HU1A 3BICA 3BTVA 3KSMA 2A9KA 3MCUA 1G21B 3OOJA 1RQ2A 5K3DA 1V5WA 3O7WA 2QRLA 3QVJA 4FGJA 4GNKA 4Q05A 1CZHA 1Z12A 5DGCA 3W2GA 1B2LA 1Z5OA 4HN4B 3V7UA 5I9MA 4DY4A 4NE2A 3GOHA 2EFJA 1MN6A 3QIVA 4M1EA 4ZCLA 2VJLA 3TK1A 5K45A 2B61A 1HO3A 4O2AF 4F1JA 3SY8A 3CURA 2XA2A 5HMLA 3BK2A 3C97A 5G0WA 3NOOA 1BSVA 4D8UA 1EXDA 4ZZ1A 3Q8WA 2ZM5A 3QHPA 5EJ7A 4C3ZA 4ZCPA 1EP2B 3R0QA 3CLSD 3CZRA 3SKYA 4QAJA 3ISTA 4TWAA 4CLEA 4ZK6A 5JSUA 1E2KA 1OI4A 4OO3A 5JSKA 4XWYA 1X1SA 1YS2X 3K0CA 2HKIA 2R2AA 4OUKX 4CNQA 3PX7A 3SSMA 2ZJ3A 3W8NA 4AG5A 4U6SA 2WE8A 1O4WA 3E9DA 5F77A 5B58C 1N0UA 1SXHA 1AB5A 4MA4A 4IDQA 1KTVA 1M0WA 2WU8A 2DPHA 2XHZA 1P33A 5G0SA 5EJFA 3QMMA 5AHOA 3W7VA 5A2GA 1BDIA 3WL7A 2HA5A 1KJJA 2MHCA 3OZIA 3KAPA 3M5WA 2WEKA 1YE8A 3Q85A 4GEKA 1NE2A 3KP1A 4X8MA 4XPIB 5K3BA 3EWSA 1QK4A 2GRUA 1HRDA 2WRZA 3S68A 1J5EB 1AGRA 1MFZA 1QO0A 1QUEA 2H4YA 1G1AA 3DA8A 2XSZD 3S7ZA 4L95C 2P1ZA 1EUCB 4MAFA 2B4QA 1MCZA 1GPKA 1RM0A 3C41J 4C2UA 5A0VA 4MVJD 1QE0A 4Y9SA 5ERXA 2ZT7A 3LY8A 2MSDB 1NW6A 1ZUNA 1I2BA 2F64A 3OM9A 721PA 4QPCA 1VKNA 4Y2PA 5DTRA 1NJ8A 4GRIA 2DECA 3EXEB 3OZ7A 3JASB 4R05A 3FYCA 4B0PA 4O2BF 3SDZA 4LXHA 4JZYA 4AJ9A 1BO6A 3FDJA 4D5EA 3RC1A 2A8YA 2G36A 4WCFC 4H0CA 5K8LA 1ENOA 1CZRA 3LYUA 4NAUA 4US1R 3DCYA 4B8ZA 5KHOC 4JT2A 5BUQA 1I7QB 4AB1A 2D2FA 3TQIA 5I4BA 1M9NA 4B34A 3ZDEA 2VSYA 1GU7A 1KY3A 1QO7A 1Z6ZA 3KFLA 3KWJA 2WHQA 1W44A 2PCJA 3WGQA 2C7RA 1H2XA 2DBYA 1RABA 3T9DA 4M1QA 3HBMA 4R2IA 5E8RA 1L4KA 1P17A 5BVHA 4PO3X 3CT6A 3VU9A 4P3OA 1PZNA 3LPMA 4JS0A 3ZCXA 4OK6A 1H0HA 2Y3IA 3B2NA 1FQJA 3NRJA 4V3BA 3P1JA 2CNBA 1S8AA 3UK2A 2IV3A 1ZD2P 4FLEA 2ODBA 3EXHB 3N2YA 3NFRA 4FNGA 3TGLA 2PGJA 1H4QA 2UVQA 3F5QA 3HWX1 1BHJA 3KPWA 1W2GA 2ZB4A 4GXRA 1CPYA 1GVNB 3RKUA 2ZW9A 3DWEX 3H9GA 3OLVA 3CXUA 4DLNA 4E5PA 2E82A 1GM5A 2V03A 4LQ4A 2CFTA 5FNVB 2E55A 1T91A 5I7FA 1DRJA 2R8OA 4EB6A 1NVMB 2DY1A 4DZTA 5EXTA 1X7ZA 4KX3A 4Q4JA 4N12A 3KL2A 1ZGBA 2QRUA 4ZYVA 2CB0A 3GWGA 3T9FA 1V1RA 5HS4A 4HTFA 5DX0A 1KH3A 1T9ZA 4R98A 5I7OA 5HPYB 1XIVA 1JBQA 2ZEJA 3DMDA 4U7PB 3AHIA 1KY4A 1H3NA 3EDRA 3G5TA 3IVXA 2NM0A 1TO2E 1FQWA 3CZCA 2IIQA 4UPEA 3IAEA 2BCGY 5SZJA 3FAKA 4II2A 4OG2A 5LIPA 3HXMA 1V3TA 4JLBA 5FPYA 3WNZA 4ZANA 2HWUA 1MOZA 2P5TB 3AFHA 5BP7A 2GZAA 2I6TA 3FETA 5ERYA 1JAIA 1FRZA 3OFNA 5C5DA 5LPNA 4PZLA 3ZQ6A 2IYNA 4S05A 3AR7A 3RI3A 1WU8A 3WG9A 1DIAA 2ORED 3C0KA 5FV7A 4W9NC 1Z0KA 3DAHA 3L18A 4EGCB 1EFTA 2UUOA 4G56A 5GADl 3H4IA 4UTZA 4CR7A 4E08A 4TZ6A 5DNEA 1GGFA 3LY7A 4TRJA 1SVMA 1JIKA 1ZX1A 2IS1A 2X42A 5ALJA 2AQIA 3QJYA 5IN5A 4RTNA 4UHCA 4GUDA 4KQGA 3P5SA 1JQEA 3KSUA 1K63A 3C1TA 2JCYA 1IG3A 1AOXA 3ET5A 4B40A 5JVDF 2B35A 5EJ2A 1V3QE 4JHLA 2G9RA 4JJIA 4PWYA 1U0TA 2AX4A 4UD2A 3ROXA 2EL9A 4ND6A 5EJ5A 3WXMA 3T99A 1QCCA 1OWNA 4AW9A 2WUEA 4L72A 4B87A 3M8KA 4X6LA 1HNZB 1SCKA 3C3WA 5B3JC 4MKFA 4UHJA 1RLOA 4DUYB 1UXKA 5TQ2B 5DGDA 2JAQA 5KX5F 2PEYA 2W2KA 2E0IA 1H2YA 3Q3VA 4KXXA 4V0SA 5F7XA 1JWLA 3AEXA 3EZFA 3DDSA 3CLSC 3RF7A 2QXYA 2VSNA 1GZHB 1YCHA 3CINA 4CKBB 2BR3A 3O3CA 1HZZA 2OMEA 4L6AA 1UWLA 3D2CA 4RADA 1RLMA 3QH4A 3NH9A 2JI4A 4JP5A 1C9DB 3LRXA 1QRAA 1BQ4A 3I6BA 3QG5A 1H6BA 4ZO7A 3AGPA 2FF7A 3MVEA 3D0RA 3K9HA 4S35A 1I0IA 2F55A 3BIFA 1YHNA 2GCPA 3F71A 2V7TA 4Q1CA 3ZHCA 4B46A 1C1DA 2VHUA 4OK5A 2AEJA 3W77A 1I4TD 1G9XA 5ICCA 3EW7A 3QVKA 4NU5A 4IHJA 1CTQA 3GP8A 4HRXA 4ZVUA 1EFRA 3HG7A 3LQFA 2VZLA 3QVGA 4OGGA 1ZVMA 5TRTA 3G2PA 2IDZA 4UBIA 3ET4A 4IICA 3HGMA 3I42A 3OT1A 3NT4A 4MQ4A 1PJ8A 1S8OA 4HTAA 1MKYA 3TR5A 3GLIB 5ENDA 1WZEA 1BRTA 1S6YA 1QHGA 2XGSA 1O03A 1BFUA 1R5NA 3ESBA 1T5TA 1Y4DE 3PHIA 4G07A 1KVQA 3PE6A 5JNWA 5JNLA 4O0MA 1D5WA 4RLQA 5FPPA 4XLZA 3UMVA 3KDPA 1RYEA 2VNSA 2WFLB 3AKZA 1BEEA 4K26A 4RIEA 3U4GA 4INPA 2DBQA 3B6MA 4XVUA 4YI5A 5HUHA 3LTNC 5C1PA 2ADFA 2WT4A 1YMVA 1VIYA 7ABPA 1VJCA 2NPOA 1CQIA 2RHMA 2RHLA 1TT5A 2GJAA 1DTEA 5G41A 3L49A 1HTBA 2R6FA 1E1RA 1EM8B 2J9FB 3C6XA 2EFHB 4LS3A 5F4BA 2OYRA 2QRQA 1X8XA 4A73A 4EA8A 2GZSA 3SJ7A 2D7DA 4ESVA 3IBGA 1J1IA 2FPGB 1W85B 5TV2A 4PNEA 4INJA 2GVDC 3AJEA 2ZJ5A 1XQ9A 3B12A 2X13A 3FRJA 2IWHA 3KHKA 1IONA 2IELA 3VO1A 4DLAA 5JAHA 2Y1WA 1HFEL 4KTVE 5DO9A 3SX2A 3ERCA 2ZTMA 3ZGYA 4RJKA 1Y42X 1NC3A 4I50F 4MVWA 1ZP6A 4PNPA 4BBJA 2KLHA 4BRZA 5ALNA 4NBWA 2I4NA 5DLPA 3ZWYA 1JSCA 3A0RB 5DP1A 1JE1A 2C5EA 3PDIA 4BV9A 3N5KA 1EDDA 4GPZA 3EF1A 2P62A 1C5KA 4JLDA 1C7EA 5IBQA 1O0CA 1XZFA 1NJFA 4Q4AA 5TGZA 1YI8A 3G85A 1H05A 4J1NA 5JOQA 3VKGA 1BA2A 3FVQA 1OV6A 2XVAA 4MQFA 3TCXB 1I2CA 3WYAA 4FD2A 2NVOA 4C4PA 3WHLA 4O2BA 2OESA 5HZKA 2HIGA 5I7RA 3WQHA 3WVNA 3LUHA 4A6EA 2J9YB 4ZI2A 3TI9A 3OWXA 3CVYA 5C37A 1ZIOA 3GN2A 3TXYA 1BWSA 2RDMA 4YS6A 4TZ0A 5ED4A 1ZH2A 3KAQA 3EEQA 3DXFA 1R10A 1EWKA 1WIWA 2R8EA 4U5QA 3EHEA 1ZA2A 4DEXA 1XKLA 1IJFA 1XTQA 5CNJA 1LRKA 3W5VA 4EMTA 2VQ3A 4NULA 1UBSB 1A04A 1JQBA 1E32A 3L8DA 3OCZA 4ARSA 2NZXA 4HGOA 3N8NA 5F1YA 4QYWA 2COEA 4EPRA 4JNCA 4I8XA 2R48A 4O4LA 3KEOA 5JWOA 5EERA 1D6MA 3FJYA 4X92A 5CDTA 5HRUA 5DPMA 4WUTA 1O97C 3KOUA 2R1TA 4XCVA 3PDWA 4C0SA 3WL5A 1TUIA 4ID3A 5FTWA 2XQIA 4CHTA 1M2FA 4QPJC 2D5CA 1Z63A 1Z5GA 2GZRA 4UZEA 1NVTA 3DM5A 1NPYA 4KQ6A 5HG0A 1FDUA 3TB4A 3ZHSA 4EATA 2CN1A 3MTAA 5ALZA 3SQWA 2G7ZA 3JU3A 4JJ8A 4TWIA 3RS0A 5D84A 3VKHA 2P0AA 5CHEA 1KAEA 2J48A 1ZWKA 1TMYA 3ROPA 2YWJA 4RENA 3B48A 2C98A 3QUBA 3QPCA 3EXG2 1J8YF 1UJ6A 5FBHA 3SE7A 3FDZA 3T34A 2UYYA 2A4KA 2D8MA 4G6ZA 1HYEA 1KARA 4TSFD 1TMOA 2FRDA 4JLOA 1PGOA 4NG5A 5J59A 2R00C 3EUFA 3H9BA 1L7XA 4KVFA 4A7PA 1GYQA 2VNAA 2WYOA 3ZDXB 3C6MA 1AS2A 3GNSA 1RYNA 2AFRA 4FOPA 2QUBA 2JG3A 3GD7A 2Q3MA 4RVOA 2XTZA 4N5MA 5JZMA 2C3UA 4MVXA 4YCLA 2PKEA 2FEPA 4LY6A 5ARDA 4N41A 3FWKA 1ECBA 1ULBA 3BJRA 4M54A 2IOYA 3EBLA 5FLEX 2HGSA 4FJ2A 1LY1A 5D5QA 3QFTA 5LU9A 2H0AA 3SR4A 4DV6B 4DDKA 2HRQA 3TR0A 4ARVA 1UPTA 5KYGA 1G19A 1NXPA 3L05A 3RIHA 3FPEA 4M8IA 3KJEA 5CLJA 4GIBA 2VBCA 4WFJA 4JFAA 4Z53A 5EHQA 4EBBA 2X2PA 1K8QA 1B1AA 4PIMA 3D8TA 2AG5A 2PX0A 4F1KA 3GW8A 2GK6A 4FYMA 5CG1A 2JI7A 3TX6A 4H1TA 3TBFA 5GVRA 1I32A 5CX4A 1UQUA 2N1BA 3OEED 3A6ZA 4LSWA 3ZW8A 3K4QA 4HDKB 2ZE8A 2Z8YA 2UZIR 3G9QA 1IIRA 3IAFA 1W5SA 4ZVTA 3P8ZA 2BEUA 2HNAA 3HADA 3QLVA 3L0OA 4FOSA 4LYYA 4P32A 2VEDA 4M0EA 2EBFX 4OOEA 1PL8A 2X76A 4FMDF 4S12A 4UTXA 4DLLA 3ZC3A 3WLQA 4H27A 1JIVA 1HETA 4PYRA 3CUVA 4YGXB 2RHCA 3WGLA 3ONDA 4NG4A 3D7MA 4ZREA 4C4YA 5BYKA 3ACCA 2E48A 1C9NA 3AGQA 3A3OA 1E4OA 4BQRA 4KUGA 4BMYA 5BN3A 2BC9A 1D8AA 1ZPDA 4NVRA 2GNAA 3I4LA 3BC1A 3QU7A 4RABA 1AHIA 1FJ2A 4UVIA 4BFYA 4FE4A 4MGEA 3QUSA 1ISMA 3AF0A 1PL6A 4EQ6B 1FSFA 2HTFA 4FYVA 4G1FA 4CT0A 1R0KA 4TWRA 3VOTA 1UQTA 2H52A 2FFAA 3IP8A 1IBMB 2EZUA 3RADC 1ZXBA 1DIOB 2PRZA 4ZPXA 1RJ9A 2HD4A 1JH9A 2VHQA 2E6KA 1W4LA 2UVDA 2WW8A 2NZYA 4R9VA 5DGXA 3R20A 4ZOCA 2Q6OA 4JBLA 4RV5A 1P5FA 1WKVA 3AFNA 1UBOS 1HEUA 4FOLA 4MSUA 1LXCA 1YHZA 4EO9A 2ST1A 3G2HA 2HADA 1YB4A 3FUUA 2B6HA 4H16A 2FUEA 4XX0B 4DG9A 2I80A 2OSVA 3KSDO 2V9CA 4HPXB 1OPXA 4IUCS 1S2GA 4PIVA 4WKBA 4YJFB 1GJRA 5IK2D 4JT8A 3AI3A 1N6RA 3CM0A 5FUVA 1K2WA 2BFFA 4QOHA 4KXYA 1C80A 2VFAA 1V6CA 1I7NA 4LCBA 3N0RA 3E0QA 4UXHA 4V0MA 2O8CB 2ZSJA 5DN9A 1XXLA 4JLAA 1UP4A 1UJMA 5G1OA 2FWMX 1I6KA 1KXZA 1RMYA 3NUGA 4OL9A 2DBVO 3I2KA 3V8BA 2HLNA 3M4XA 1NLMA 2BE9A 5TARA 3WJ1A 4Z9BA 3KTOA 1ILEA 1L5YA 4EHLA 1AQJA 2Q1YA 4JP3A 1G42A 3H17A 1R3UA 4WZAA 1ZICA 3N8GA 3JAKB 4FEEA 2JIZD 4HRVA 3WQQA 3LC7O 4LYJA 4CGZA 1XVVA 4CU2A 4F3KA 3HZHA 1CYEA 5FBLB 5T4HA 1DO2A 2NADA 3TBKA 4B73A 3IDOA 1DQPA 4S0ZA 1YK0A 2P9GA 4DZRA 1VJRA 5AJTA 3HBNA 1J23A 3PWKA 1NXOA 4IFIA 4DOMA 1PWZA 4MUAA 4RFSB 4JXKA 2QX8A 1LPBB 2I0FA 4OHRA 3GLHB 3QENA 3WNCA 2KLBA 1TF7A 3IVRA 3JAKA 3KJGA 5HGXA 2LDBA 2BKUA 3WDMA 3G9UA 1H42A 4P5PA 3BXXA 1Y82A 5KOJA 3A1FA 1N2JA 3RG2A 3K6KA 1R0XA 4BS9A 1SB9A 3CWCA 3N0TA 2QOEA 4JVMA 4M7RA 3MC1A 4Z9FA 2ON6A 2YIJA 3W3ZB 1EJ2A 3EPHA 4CCAA 4V0NA 2CYCA 4TS1A 1S2MA 4Q3EA 1M6EX 2IZ1A 4MB0A 1ZCJA 4ND8B 3IURA 3RANA 4B6FA 3ZGZA 4I4IA 4ZYYA 5KYTA 1OXUA 2QRKA 3C4QA 4K9RA 3I3SR 1EFUA 2B0CA 3RT1A 3S1LA 1NG9A 3QOYA 2IUFA 5BNWA 4HBGA 1KJYA 3ZVKA 2C2HA 1E1CA 4OSOA 2RH5A 1M1ZA 1VJDA 3K2QA 5DM60 3HLTA 2N75A 4QECA 3LWZA 1IM2A 4OB6A 2FEMA 3WYGA 3FVWA 2Q7OE 2AXEA 2XQFA 4HH3C 3LA8A 3DVLA 3TX2A 3BFPA 3V4PB 5FF9A 3CR7A 2B9VA 1QFJA 3HYLA 4NF2A 2JEZA 2GPWA 2ZRNA 3M6AA 1G7CA 5JS1A 4EWLA 1W25A 2HPZA 1YQUA 3PNQA 4XDZA 3TJRA 3LU1A 4OHPA 2Q5OA 4K6FA 4N4AA 4Y2VA 5IVPA 3AP1A 4D9NA 5E1DA 4WDRA 3CVUA 4UW9A 3V5NA 3HI4A 3D6JA 1DAOA 5DIZA 1EGVB 3OZEA 2GK3A 4F11A 2F62A 4HDMB 5F73A 1XDBA 2OCYC 2HU2A 4GE0A 4ZALA 1G98A 4AZ3A 1H0SA 1EQ2A 2GZ3A 3QXHA 4FHEA 3IHKA 1DZ3A 3LD9A 5HIJA 3X1YA 2WFLA 3FTPA 2W7TA 4AK9A 3QWIA 4Y6GB 4KZKA 3J81A 1JFSA 1VMAA 2WUDA 5NULA 4C4AA 3ZQUA 1NC1A 3AUYA 1PR3A 1YUBA 3HH8A 3N5CA 3DQPA 2QG6A 3PUWA 5HOQA 5BPHA 2ZREA 1HGXA 2REXB 3V8PA 5FR2A 1K2VN 1VL6A 4RA6A 2YL2A 3NYWA 3PXEA 5MFPA 1BROA 1Z4OA 3HJAA 5BRNA 4KRFA 1JJBA 3FUWA 1OT3A 3UFXA 4Y9RA 3T3IA 4A2PA 3O74A 1FPQA 1N0VC 4IL5A 4MS1A 3KOXA 5DOVA 3EEYA 3HJBA 4JI5B 4RTMA 5IX8A 3DEJA 2AJ8A 4U7GA 2J0QA 2C5LA 2WZCA 4PRKA 1LI5A 2P6UA 1ND5A 4W82A 4WNCA 5F7OA 4WMLA 3W9YA 2WLTA 1CLUA 1Y0BA 3HKBA 3S6JA 1G2PA 1WEKA 4P54A 3ORYA 3M33A 1TFUA 2B4KA 3H6HA 5FXMA 4D6PA 3O1HB 2O54A 1USWA 5DHSA 3ZXIA 1KYQA 5FAKA 2QM0A 2YY7A 4EY7A 1QG4A 3C7KA 1VHTA 2BF7A 4QOIA 5IKMA 4JXZA 1EVLA 4RELA 2Q0SA 4RVGA 1E7YA 4OL0A 4HLQB 4DA8A 4AJLA 1YAHA 3CBQA 5EMKA 4BNUA 2VJYA 1JR4A 4LBYA 1IZZA 4TLLB 5LQCA 4WVLA 1IN6A 3EC2A 3GGDA 4B3MB 4CBVA 4WOJA 4ZZ3A 4G81A 3GY0A 3TLGB 1YOVA 1A8IA 3HNOA 4ZEWA 5AW4A 1OJ7A 3BIJA 4JBNA 2QRHA 4GZ3A 2Z2ZA 4YRFA 3GUZA 3BZBA 421PA 3DOEA 2J41A 4GI1A 1J1UA 2ZANA 3CUSA 4LISA 4MMYB 1UWCA 3QZUA 4IO1A 2UUPA 1ABFA 4HVTA 1V45E 3ZLBA 4TUYA 4GXNA 2WM3A 2EKQA 4LY9A 4POAA 3DFIA 4DIUA 3WHKA 1DCMA 3FGOA 3GMDA 1JG6A 1QB8A 5HZHA 5DULA 3E9MA 1NHGA 3RUDA 3WIVA 3R5XA 1EFHA 5EJ9A 4M1YA 2R1TB 1RVDA 2AMVA 3GG9A 1RR6A 4M3NA 4HDAA 3SQLA 4I81A 2WA1A 3IXLA 1C8LA 2DPGA 4QOGA 4PLTA 3VAAA 2EWWA 8GPBA 3UN1A 1W1IA 1ND6A 5F64A 2WF8A 4QU8A 4M7OA 2WNHA 4E4YA 2Q0HA 3QHQA 1ICIA 3H6KA 4PHFA 3WTCA 2XE4A 1PJSA 1J0CA 4E5YA 3KR9A 2XYRA 3C48A 2AC4A 3MK31 3V1UA 4BNJA 2I03A 3AVUA 2AFHE 1A5SB 3B1XA 1PV4A 1NPTO 2L2QA 1T5IA 4MKXA 4D0SA 5EP1A 2QE7D 5EWMA 1SO8A 2EV9A 3SDSA 4AURA 4LXUA 3P45A 4LHWA 1GSOA 3B3AA 4MUXA 3GVHA 1G8MA 2GR9A 3HR7A 1R9GA 4PXAA 2RGNC 1KH1A 3HPRA 4LRUA 4BZXA 4XQGA 1QH8A 2NNLD 3PEFA 4GD3Q 5LNK1 3A1NA 1Z62A 1J25A 2UYQA 1ZM9A 3F7NA 4I3HA 4BMDA 4BBPA 4TVSA 5AUPB 5JR3A 1JA9A 1B76A 1IQPA 3HJTA 3O1IC 3VR6H 4LZNA 5CP8A 4CYMA 4QYTA 3MJ4A 2FMFA 4DF3A 1GRNA 2D06A 4K9NA 1WF3A 1YR6A 2Z83A 2ZT5A 4BKQA 3HCCA 3ZN2A 3HXLA 4OXQA 1XVLA 3FHCB 3MAAC 4GYJA 1LPMA 3WO0A