2AN4A

Structure of pnmt complexed with s-adenosyl-l-homocysteine and the acceptor substrate octopamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 93
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2an4A00
2G70A 3SSMA 2HMYB 3JWHA 4FSDA 3R3HA 1I1NA 2JH8A 2EX4A 2ZLBA 3GRYA 4PONA 3TLJA 1JG2A 2ADMA 4P7KA 4C05A 3ME5A 3EEOA 4EMSA 3FTCA 4RV9A 3KHKA 1G8AA 3CBGA 1V39A 1NBIA 3LKDA 5CM2Z 3PS9A 5E9QA 2ZIEA 4B17A 1EIZA 1NW3A 5U4XA 4RVHA 2YX1A 4DZRA 2C7OA 3FTEA 3C3PA 2B25A 3BWMA 1QAQA 3MQ2A 3SVZA 3UBTA 1AQIA 3DXZA 2Z6QA 3CJQA 3KQWA 2GB4A 3MGGA 1TW3A 1P1CA 4DF3A 2AZTA 2AN3A 2VP3A 3GRZA 4RX1A 3T7SA 1L3CA 2O06A 5P8WA 5KYGA 5EMKA 2AOTA 3OZRA 2ZFUA 1DUSA 1VPTA 3IYLW 2FK8A 4MIKA 4NECA 5DM4A 5ICFA 2V74B 3NWBA 1XDUA 4KW7A 4OA8A 4GBED 4ZTBA 3G8AA 4BY9E 3DUWA 3HA3A 4PWYA 4EKGA 3P9KA 3LECA 4X1OA 3OZTA 2NXCA 3PX2A 4E31A 2CMHA 2YQZA 3G8BA 2AOWA 1JG4A 2WK1A 2ZW9A 5EHIA 4DA4A 2Z6AA 3CVOA 1NKVA 3OPNA 5DXAA 4CWAA 3I5UA 3UJCA 3GIWA 3OCJA 2PWPA 2FK7A 3C6MA 2UYCA 3H2BA 4V0QA 2ONZA 1YF3A 3TMAA 1ORHA 1G38A 3CCFA 3DMGA 4PCLA 3HVHA 3X0DA 1R00A 5D1HA 4R05A 4C07A 3ORHA 1XDZA 3SX0A 3VYWA 5GP1A 1I4WA 2B9EA 2CWWA 3CJTA 5EMLA 4RSRA 5BP7A 1NE2A 1YFJA 1L3IA 3EGIA 3ID6C 3KPVA 1ORIA 1WXXA 3BWCA 5DX1A 3U81A 4BP1A 1N2XA 7MHTA 3G2PA 4KIGA 1JG1A 4IKPA 5K0EA 5CVVA 1P91A 1BC5A 4QVGA 4U7PB 1UWVA 4BLWA 3PTAA 3P9CA 2Q41A 5E8JA 5IKMA 2I7CA 4XCXA 5BW5A 3EVDA 3DMFA 3GXOA 2O0LA 1KYWA 3LHDA 5CVUA 2G72A 3P2EA 1YZ3A 5DT2A 5EZSA 4WVLA 3FUUA 5T67A 3GWZA 2UZ4A 1ZGJA 2PVCA 1VBFA 3UFBA 2IP2A 2PXXA 1YB2A 5E8RA 5E2AA 4OBXA 2PBFA 2HR1A 1QAOA 4DCMA 1I9GA 3P2IA 5FADA 5LQJA 3HNRA 4O29A 3LBYA 5ICCA 2AVDA 4R6XA 1DL5A 2P7HA 4OBWA 3GDHA 5CVDA 5EKUA 5KQSA 1XJ5A 1FJXA 3MAGA 2BZGA 1Q0TA 4FGZA 1RJFA 2WA1A 3KQSA 3KPUA 5DSTA 4IV0A 2ZULA 3VC2A 1XTPA 3AWIA 3DOUA 4QTUB 2VS1A 3E23A 3HA7A 2PT6A 1KYZA 4C03A 4RTRA 3JWIA 3B5IA 1KIAA 3KQYA 4IWNA 5DXJA 3NJRA 4YV0A 2QM3A 5K8VA 1N7JA 3P71T 4YUZA 3DXYA 3TR6A 1TPYA 4BLVA 4QPPA 2G1PA 3UJ6A 2QE6A 3LBFA 3UJ7A 5E2BA 2B3TA 5E9JA 5K03A 2O07A 3PFHA 4AZTA 5K0BA 3A7DA 3BZBA 1DCTA 2IDKA 4KWCA 4DMGA 4QPNA 4AX8A 1JQ3A 3C0KA 1O9HA 3M33A 4R8RA 1ZQ9A 4CKCA 4DKJA 2QYOA 4PYQA 4RVDA 5HZMA 2FPOA 4F84A 1KHHA 1N7IA 2UYOA 3KQVA 4HSGA 2XBMA 5DRTA 1M0EA 4LWPA 1INLA 1Q0SA 4HTFA 3EVFA 4PYKA 5ERGB 3UA4A 3LDUA 2BR4A 2ORED 4X60A 4CTJA 1ZKDA 3EEYA 3Q7EA 5JUWA 3KR0A 5D1NA 4EQZA 4AZSA 3TPZA 3FTFA 4RTOA 3KKZA 2HNKA 2PY6A 3IV6A 2I62A 3KQMA 2QRVA 4GOOD 2OY0A 4FR0A 5FTWA 2PV0A 4C06A 1NV8A 3HCFA 2IFTA 3G2OA 2ZBRA 4H0NA 3FUTA 4XUCA 4Y30A 3IEIA 4MTLA 5K05A 2AOXA 4KRGA 4V0RA 8MHTA 4FS8A 4QQNA 3I64A 5DTMA 2F8LA 3C3YA 1XVAA 3TKYA 1AF7A 1NW8A 2P8JA 2ZZKA 2ZZMA 3P9IA 1TW2A 2ZIFA 3KR9A 4PYNA 3P2KA 5LQRA 1JQEA 4YUWA 2IPXA 2JHAA 3MB5A 4PCAA 1L3BA 3M6UA 4ATNA 3A26A 3SSOA 4A6EA 3OU6A 5IH3A 2AOTB 4YUXA 5ICEA 3FRIA 4OA5A 1QAMA 2CL5A 3BUSA 4X63A 2NYUA 3VSEA 3AJDA 3FPJA 5HOQA 3M6WA 3NTVA 3K0BA 5FCDA 3SGLA 4OQDA 1Z3CA 2OPBA 3E05A 4LWOA 5LR6A 4E2YA 5G02A 2H1RA 2QRVB 4C08A 4Z2YA 3CC8A 2PWYA 4GC5A 3I58A 2BR3A 1QZZA 2JHPA 3GGDA 3THSA 5EC8A 2PX8A 1KPHA 2N47A 1L9KA 3A27A 1WXWA 1JR4A 1MJFA 1FP2A 3KR1A 5DRYA 5C1IA 2WA2A 4HG2A 5CIYA 5FWDA 2P3LA 3PVCA 3FYDA 4HTFB 4GOND 4QVKA 2GAFA 2VDWA 1EJ6A 1VL5A 1D2GA 1EQAA 3DULA 3EVCA 2FCAA 3P97A 4GEKA 5HILA 3DXXA 5HIMA 2O05A 3OU7A 3RIEA 2G71A 4E2WA 4YV1A 2JJQA 1SQFA 1XXLA 5DSXA 4P7JA 5EQJB 1D2HA 3FYCA 2AR0A 3B7PA 4KIFA 2YXDA 4PYJA 1JSXA 5DM2A 3MTIA 3T0IA 1WY7A 2P35A 3R6TA 3KPYA 4KDRA 3CKKA 4KVZA 5EEGA 3CJRA 2P41A 5HIKA 3DH0A 3GNLA 4QDKA 1QANA 3HVIA 3OZSA 5FQOA 1JSZA 3KQTA 3G5TA 3M70A 5KS2A 5F2KA 2FRXA 4M36A 3EMBA 5FUBA 2OYRA 4RVFA 3TQSA 4HRAA 3K6RA 5FULA 3QOWA 4RTKA 2HWKA 2YUIA 2NXJA 5EEHA 3S68A 4ER0A 3E7PA 3HA5A 2AOUB 4PGGA 1NV9A 1R8YA 2K4MA 2OZVA 5DWQA 5DX8A 5C0OE 1NW6A 3UJ8A 3ER9A 4PYIA 2R6ZA 3LX6A 3BWBA 3M4XA 1JTEA 1SG9A 2IDJA 3ANXA 3PB3A 2AS0A 1O54A 3HCCA 2ZWVA 2ZCJA 2Z6UA 5LQAA 4PINA 2IBSA 3I53A 3EVGA 3IHTA 3ELYA 1BOOA 2NP7A 2YTZA 4RYLA 3UZUA 5EG5A 3O4FA 5E1BA 5LQKA 3G2MA 2IH5A 2PT9A 4LG1A 2IIPA 4PYMA 2JG3A 5M5BA 2AN4A 5KQRA 1WS6A 1XCLA 3NVMB 3OFKA 4RVGA 3T7RA 2B78A 4HH4A 4PNEA 2HTEA 2ZZNA 3O7WA 2BM8A 3CGGA 4FT2A 1R74A 3F4KA 3LDFA 3TKAA 4ER5A 3R24A 2KW5A 3A7EA 5DTQA 4IV8A 4RWZA 2ZIGA 5K0LA 2VZ9A 2XVMA 5EOVA 5T64A 3EGVA 4CKEA 5E1DA 1P39A 2PLWA 4F86A 3G88A 4X41A 2PX4A 2P3QA 2GS9A 2OBFA 2P7IA 3FUVA 1X1BA 5EZQA 2VDUE 4DQ0A 2CMGA 4EVIA 1UFKA 3EVAA 3UJAA 2P1DA 2XVAA 5DM1A 3LCCA 3JWGA 3NMUF 1U2ZA 5CUQA 4CTKA 3NW9A 2HV9A 1ZHFA 1VLMA 3HCBA 3G5LA 3FZGA 3O31A 2H11A 4GOLD 4QTTB 4DM3A 3EVBA 1P1BA 3KQOA 3ELDA 1UIRA 1JG3A 2PKWA 3BWYA 3NDJA 5GINE 2OXTA 4RTNA 2UYQA 4FP9A 1M6YA 1IM8A 1RI2A 3DLCA 5CVEA 2C7RA 3T7TA 2EG5A 1RI3A 2P40A 2XYRA 1WZNA 3GCZA 5B1SA 3OE4A 3REOA 3WSTA 1OR8A 2DPMA 3LCUA 1G60A 3GO4A 3JWJA 5EMJA 1WG8A 4LECA 3FRHA 3GU3A 3LDGA 2G8NA 2AOUA 3DTNA 4G56A 3DLIA 2I6GA 3TRKA 3SR4A 3KPWA 3FUXA 4GQBA 4YUYA 1VQ1A 3FPHA 4QQKA 5HEKA 2PXCA 2UYHA 3OE5A 5LQUA 4OQEA 4FSXA 4P58A 2C7QA 5GM2A 5FQNA 1HMYA 2AN5A 2IBTA 2PGXA 3PT9A 5ICGA 3BGIA 2E5WA 4E70A 5KVAA 1SQGA 3OU2A 1D2CA 5EVJA 4F85A 1VP3A 2GPYA 5HIIA 3THRA 3FUWA 5LQNA 3MHTA 4AUKA 2EJUA 3RW9A 2H00A 1SUSA 3GRRA 2DULA 2YVLA 1MHTA 3A4TA 4GC9A 2FHPA 5C9ZA 3DMHA 3SM3A 4CKBA 4RTMA 2NXNA 1XDSA 3LL7A 1RJGA 2EFJA 4M37A 3KU1A 1PJZA 1FP1D 3LPMA 4QDJA 4E2ZA 4EKIA 2I9KA 1KPIA 5FWAA 3V97A 3MCZA 1NW7A 4CXMA 5HIJA 3LGAA 3FTDA 3MERA 1YFLA 1YZHA 4HC4A 4PYOA 1ZGAA 3SSNA 3KQQA 3DP7A 4E30A 1NW5A 4XUEA 3MTEA 3B3GA 4BLUA 3BT7A 2PSSA 2AOVA 4ISCA 4MQ4A 5E9WA 3TFWA 2BR5A 3R9XB 1VIDA 5DPMA 2LD4A 5JR3A 4X61A 3C6KA 3LCVB 1EAMA 3EGEA 4ER6A 3ELUA 5K09A 3MCTA 3PFGA 4HGYA 5E1OA 3UJDA 1T43A 3TM4A 1KPGA 2PJDA 1ZG3A 3B3JA 5F2OA 1KR5A 1IY9A 4MWZA 1RJDA 1NT2A 5EIWA 1JTFA 1RI5A 2XYVA 2ZVJA 1R8XA 4DCGA 5GOZA 3AY0A 5K0GA 4RTSA 4PYLA 3I9FA 1X1AA 1QYRA 1Y8CA 2Y1WA 5E1MA 3ELWA 3D2LA 2A14A 3UJBA 4UOEA 2GLUA 2VDVE 1X19A 2Y1XA 3G89A 3HTXA 9MHTA 5K0CA 4U7TB 5FHQA 3M6VA 3GRVA 2JHCA 2NP6A 1KP9A 4POOA 2ERCA 3PX3A 4P7GA 3ER8A 3HP7A 1RJEA 5GIPE 3P9NA 4MHTA 3LKZA 4YMHA 1XCJA 3BGVA 4BP3A 5FA5A 3FPEA 4P7FA 3BXOA 4EK9A 3G7UA 4RTQA 3BKXA 4M7RA 1G55A 3SMQA 3EVZA 5BXYA 5FA8A 2BH2A 5T6BA 3AXTA 4YMGA 1JQDA 3BKWA 5DLYA 2OKCA 3AXSA 3GJYA 2P3OA 3E8SA 2BM9A 1SUIA 3Q87B 5K0FA 3L8DA 1R6AA 5LQCA 5DX0A 1H1DA 1IXKA 2NXEA 1HNNA 4OX9Y 1YUBA 4AZWA 5MHTA 4GF5A 2OB1A 5GM1A 3HVKA 1VE3A 5DTRA 3HVJA 2R3SA 2C7PA 1RI1A 3QOXA 3EMDA 5EHGA 5EGSA 5CCXA 2IGTA 3UWPA 4FT4A 3HM2A 5EPEA 2YR0A 3B89A 4AZVA 5EKXA 3A25A 3NDIA 4R8SA 5F2NA 3SXJA 1L1EA 1X1CA 2PX5A 3GRUA 2B2CA 2NNWB 1F38A 4JXJA 4WXHA 4YV2A 1FBNA 3V8VA 4A6DA 4YUVA 1EG2A 1RI4A 3G2QA 3NWEA 5LSAA 5FHRA 1O9GA 5K01A 1R18A 2IH2A 1AV6A 1F3LA 5K0NA 2CKDA 2ZSUA 2ONYA 4RTLA 2AVNA 3HCAA 3LSTA 4FZVA 3PLAE 1AQJA 2PXAA 1G8SA 2YXEA 3QV2A 4C4AA 2EJTA 1G6Q1 3UA3A 3KQPA 3KPJA 3ERCA 1SVUA 3OFJA 2QY6A 2JH9A 4L7VA 1NBHA 1BHJA 1M6EX 4K6MA 5H02A 5CD1A 1SKMA 3HEMA 3B3FA 5GIOE 3TOSA 4E2XA 5GWXA 5BW4A 10MHA 3NVKI 4ER7A 2ZBQA 1FPQA 3KR2A 1B42A 4HGZA 1VP9A 3EVEA 1KXZA 1PRYA 2FYTA 1EJ0A 3P8ZA 3EPPA 2GA9A 4E33A 4RTJA 3VC1A 5CCBA 5K0JA 2IH4A 3BGDA 3HCEA 2ESRA 3RODA 4RTPA 2V7EA 5HFJA 3M6XA 4C04A 3TM5A 5EMMA 4ER3A 4XUDA 2O57A 4PIPA 3FPGA 4E32A 1BKYA 2XYQA 2ZTHA 2ZWAA 5CVJA 5DM0A 2OB2A 4GOMD 2OO3A 2ZBPA 4GUAA 3R0QA 4KDCA 2GH1A 2YXLA 4Y2HA 2PX2A 3UJ9A 3HCDA 5EIFA 4PGHA 3FPFA 1X1DA 4M38A 4R6WA 4PIMA 3DR5A
chains in the Genus database with same CATH superfamily
3Q0EA 2CLOB 1DWUA 1KZ4A 3FWYA 1E9BA 1H2EA 1P80A 3F8WA 4HNAA 5DVZA 1JG6A 4Z4QA 1Z3IX 5D6NA 5B57C 1WP4A 1QKIA 3JQ7B 1N6HA 1DRKA 3UMMA 3ME5A 2H5LA 3BXFA 2REXB 1WF6A 2P5YA 2C2YA 1DBVO 3CZAA 3KHKA 4RZQA 4U6SA 4WERA 4WKBA 4YCDA 3WLPA 4ONEA 3QX7A 3CLKA 4V0KA 2M6RA 1UOOA 1F4PA 3CJQA 5J23A 3GDGA 1PT8A 2GCEA 3B13B 4TLDA 4IAOA 4OJTA 3NAZA 2FSHA 4CG0A 4OLJA 3ZD6A 1IHOA 3LQ1A 3OY2A 4REQA 3M4YA 3AOEA 3L77A 5BUSA 1DSSG 3OWHA 4EFLA 5JAZA 5G1NA 5KWSA 4HQOA 4LVCA 3DYIA 2O8BB 4OA8A 1K6EA 2ZBFA 4ZTBA 3HO1A 3NKLA 2FPKA 4GKBA 4PWYA 4WFQA 2VNKA 2QSYA 3I9V6 3PR3A 1SMKA 1XZIA 3CNEA 5G3YA 4RZUA 4NG4A 1ZH4A 4MYTA 4BMOB 4N5MA 2C94A 4LV8B 2IDZA 3I52A 4JLAA 2GESA 1E2GA 1KBZA 1LNSA 5AKHA 3E9ZA 2PWAA 1R0BA 4RGQA 1M2OB 3W9UA 1RZUA 2CL6X 2P6MA 4YDRA 3R0ZA 4JFRA 2O48X 2JBAB 1A97A 2PTGA 3ASYA 3I8OA 3T1TA 3G23A 2QD5A 2G76A 3SX0A 3UGJA 3F7MA 4A2CA 3FCCA 2B9EA 1A8QA 3HO8A 3IP1A 5EMLA 1NOIA 3CEAA 1N2IA 2IKQA 5B2EA 4GR4A 4QODA 1LNQA 1U2DC 3L0SA 4HB2A 5D87A 3KDSE 2FETA 1KQOA 4O0LA 3M7IA 4QYIB 1VE7A 4MR8A 4HTAA 4JENA 4K26A 3D3WB 2QAJA 1E6LA 4DT1B 2RHHA 1UBSB 3FSRA 4IEIA 4XIIA 4ZI5A 3P2EA 2NUBA 1U9JA 4KFRA 2WJYA 2NYAA 5DI9A 3RYHA 2GEDA 3PC8C 4XRGA 1VBFA 1RU3A 1VRCA 2FAXA 1QSGA 2PXXA 3LS2A 5TVGA 1ZMTA 4EUFA 3CSDA 1Z47A 4L9RA 3I2KA 4BNZA 1I4LD 1SQ6A 1A8HA 3OLQA 4OI4A 4XAQA 1C1XB 3GDFA 3ESRA 2ERYA 4YAIA 2D1SA 2WKSA 3TGWA 4P0PB 4YAJA 1JS1X 2VPXA 1DL5A 1ZH0A 3UPDA 1K27A 3EIWA 1D8TA 2HDNB 3ED5A 4J7AA 4JKIA 3RRZA 3P9RA 3K72B 2ZM6B 1HDXA 5HK9A 3C3WA 1KVTA 3L8ZA 3PIIA 2R1VA 5ANRB 3N86A 5K1ZA 3DOUA 3UFXA 2J5QA 3J7AC 1XPRA 1HG0A 2EC5A 1X74A 2YNMA 3SKXA 2CLHB 5A3RA 1IOLA 2OG2A 4PRYA 4GLFA 3CLRD 5JD6A 2SICE 4JSRA 3OFVA 2HYIC 1QMPA 1QO9A 1N7GA 3GNQA 3OH8A 1B0ZA 2PWBA 2VSOA 3DNMA 5J5CA 1VMIA 2FN7A 4E51A 4EMUA 1BW9A 1SEPA 2YHAA 3EG5A 1MG0A 2VBGA 1LFAA 4L8YA 4TV8A 1JW9B 1RRVA 2QD4A 1LK5A 2WSMA 3LWBA 3DDSA 3NASA 1O94A 5ARDA 1HLGA 2ROQA 1R0KA 2ECKA 1UF9A 3N53A 3O4IA 2XGJA 3KKLA 4ZCQA 5JV5A 2ZVPX 1OXTA 5GJCA 2OHHA 3T06B 1DXOA 3SEZA 1O08A 3PNOA 3JQPA 3NKFA 4I4TA 1ZHHA 3FKJA 1IWOA 3HZRA 3CSUA 5FT9A 2IU0A 3TL3A 1DBSA 4DARA 4NX2A 1ZZEA 3SZ3A 3JYPA 1CQIB 1U2GC 2NVBA 2X9QA 1QO0A 3RADC 1AOXA 1XRJA 3W3AD 3S44A 1Z16A 4NONA 5CFMA 2Q3DA 4IEEA 1YAJA 2IRWA 1XMSA 1I7SB 1VHJA 4EBFA 2PY6A 4YT5A 2WQ7A 1IY2A 4WFIA 1RWXA 2GDJA 4CMEC 1K63A 5ENDA 3LT2A 1U0FA 1NV8A 1E94E 1JDVA 2VHJA 3CKMA 5AOVA 2VUTA 4PSVA 3G2OA 2XHZA 3D81A 1WHTB 1T1EA 3ZW7A 1PJQA 1I30A 4O4IB 5ELMA 2BOVA 3S1AB 3C3AA 4E15A 2C1XA 3ZHOA 1MGPA 1OCEA 3C3YA 3WOHA 4F7DA 3N7TA 3CRRA 3KQLA 2RK4A 1RQNA 4J16C 1X7WB 1M8KA 4G4JA 1FFAA 3JQ9A 4AO7A 2PL3A 3ICWA 3ZW9A 1FFCA 4PYNA 3P2KA 4KK3A 4O4HF 3IUMA 3EF0A 3RTDA 1PVDA 3V34A 5K0SA 1TZBA 3C1UA 4PAGA 4PXYA 3NIBA 3A26A 4JBXA 4JJEA 4YUXA 3D4BA 4IXMA 2IHUA 1WCIB 1RLUA 4I08A 5B55A 1MX1A 1EFRA 1GXSA 2AXNA 1PNVA 3AI1A 3EZ6A 3QY0A 4OGGA 2XDQA 5HOQA 3M6WA 1H2YA 2XUGA 3UHOA 1GN9A 5JRDS 5DCUA 2IYLD 4OQDA 1Z3CA 3O95A 1Y3AA 1NXSA 2UVPA 3K9NA 1U6IA 4EJFA 5HKAA 5A4AA 3VSCA 1KAGA 1W1IA 4ALMA 4F6CA 2EGGA 1A82A 3OX3A 1L5MA 1GRCA 1QZZA 5A06A 5C4GB 5BSVA 4N7MA 4BQRA 1KPHA 4B6JA 2Q6LA 5C1IA 4PZ0A 3RRJA 3QYFA 1Z0KA 1EH5A 1FNCA 2OQRA 1ZW1A 1U4OA 3P20A 4LXGA 5UKDA 4AJLA 4CHTA 1P0QA 5BSTA 4D4HA 4XM2A 5HRAA 4G5FA 2F9FA 3BIFA 3JVVA 4BNKA 4CKEB 1WU7A 2WFMA 2X3UA 1H9CA 4C20A 1HBJA 5JZMA 2RHGB 2Q1WA 5HQ3A 5ITZA 4E2WA 2JGKA 2JJQA 4M9CA 5DSXA 5EWLA 5CITA 2X5KO 1QKKA 4FYYA 4J94A 2X8JB 3ONVA 5EJ6A 1YA6A 1A1VA 2Y6VA 3LAWA 3T3DA 2W6PA 1C80A 3HLKA 1QRDA 2QN3A 1NF9A 4HQ0A 4V39A 4ALKA 4DVGA 2B7LA 1CY0A 1CD5A 3R3VA 1VGRA 1FFXB 2WMNB 4KAFA 1EDBA 3QPUA 4CM7A 5GADl 5D7BA 3ZHXA 3VHLB 3NHRA 3TQIA 4RTKA 5HNKA 2BUBA 3L5OA 4CBVA 1AURA 5M3BA 1DRVA 1QFXA 1IVNA 2K4MA 3LQKA 5AM1A 2W48A 5IEJA 5ITVA 1ILEA 4DV0B 3COZA 4YRRA 4PG4A 2CDCA 2R6ZA 3OUTA 2VBIA 5EZYA 3WLSA 4AWXA 1CE8B 1FTQA 2CVZA 4WOKA 3U39A 2H29A 3WI7A 1KZ1A 3MTQA 1EUZA 2WUWE 3IOCA 4LPKA 3E4DA 2NU8B 1VG0B 1WMEA 4YXFA 5BSFA 4TLAA 3W2IA 1ZMRA 2DPXA 2WAYA 3RASA 3GLFB 1SOUA 1A9YA 2CXRA 1GRQA 1CUUA 1EINA 2QM8A 1AKVA 2OYSA 1CUFA 4JBYA 2C54A 1T9ZA 4JA0A 4MQEA 4EO7A 4ER5A 5JY6A 1ZITA 4NH4A 1CRLA 5T64A 1XZQA 5IJAA 1ULAA 9GPBA 4F3TA 4CKEA 4J2HA 4II2A 1A9XB 5T3UA 3RBVA 4A8JC 3GGJA 1BCSB 2Q3JA 2Q27A 3EN0A 4IWYA 3PCTA 4GQIA 3UUWA 3GD7A 3W1WA 3KC2A 1J25A 2YJGA 3CR8A 4ZT2A 5K0TA 1ZS9A 1CEXA 4TV9A 1Q0LA 1SXJB 2ZJOA 4DHEA 2CBZA 3F2IA 7GPBA 4WKOA 3C14C 4EMBA 3SIXA 2HV9A 2A8YA 4P3NA 1P5HA 3ZWCA 3AVXA 4KLNA 3G5LA 1DEAA 2NU9A 3FPLA 1YCGA 3WB0A 1WOMA 4BO4A 3FNQA 1R15A 2ECQA 4RANA 3TLCA 3FG9A 5FO0A 1PD0A 1E6KA 3N07A 2JDID 2J41A 2QM0A 2UYQA 3RT9A 1M5TA 1A9RA 4CQLB 3LQ2A 2HRCA 4YBZA 4NCAA 1LJUA 2EG5A 1UPFA 2BJVA 2CJPA 2WT8A 4NVRA 3IDAA 3TW0A 2LIVA 3I72A 1OX6A 2XT0A 4DEXA 2ZYGA 1KZ6A 1YL6A 1F4VA 4LTMA 3RSLA 4ZO7A 4BE7B 4HB0A 3H1AA 3SS9X 2PSEA 2F00A 4RSMA 2AOUA 4G56A 4P4SB 4DA0A 1ZCZA 3EXIB 4HI0E 1DT5A 1JZQA 2JJ2D 1E4EA 4QQKA 3CZ9A 3CLSD 1RWBA 1ZVJA 2O3TA 1EDDA 1UADA 1Q22A 4UE6A 3L8MA 2CLLB 3I5MA 3KVVA 5LYYA 4GHWA 2VHCA 1YB7A 1M5RA 1O03A 2C58A 4M1EA 4XIFA 1CUCA 5DGDA 4DJJA 1FFBA 4TMWA 3SC2B 2QR2A 1MR3F 5A7HA 3OI7A 2UZ3A 5ENZA 4BJ6A 5LYJB 2IPLA 4UHHA 2B6NA 2CVOA 3ENZA 3ICQB 2YBEA 1QP4A 2H31A 3F7TA 3FDJA 4AMZA 1J24A 4H1HA 4BFUA 2FHPA 1C3JA 1XAJA 5ES4B 4YJ2A 3Q4GA 1HTBA 4TOIA 2W5UA 2XMGA 1EBBA 3DE7X 1C0EA 1X13A 3IQGX 1HNXB 1A3CA 3VHRA 5C1DA 3RC2A 1ZOLA 1KDPA 2GZSA 5F33A 4UKDA 1JU4A 3PC8A 4DJAA 2XBUA 1IM2A 1PT9A 3QJGA 1CNFA 3ZLJA 1DZ3A 3ND7A 1LY1A 5ADUS 4P33A 1SUFA 4ES6A 2D0IA 4PRKA 1JNYA 3LW8A 4X20A 4F12A 4U7JA 4KLAA 4NU6A 1JQLB 2YN2A 2NYRA 1G19A 2C2WA 5CJPA 1T6XA 3RG2A 2JIBA 4D8VA 1Z0FA 3IIIA 4KR9A 1TEVA 2CDBA 4ZO4A 3FE2A 3I1IA 4PHTA 5C8DA 3GEIA 3ZJVA 1TJ5A 4E5YA 5JAUA 2M2IA 3JQEA 4IOKA 4XJSA 2QL7A 3GNSA 1N9KA 3V7NA 3CBQA 1HFJA 3OQ6A 5JALA 4Y9TA 3U7QB 2I1LA 4NESA 4M55A 3BWEA 1OZGA 1AK9A 2IXFA 3EYWA 2O8EB 4C5AA 3K1YA 2E5FA 4HOYA 4KPYA 3K9LA 3ENVA 2NZ8A 2V0NA 3HKBA 4I8IA 4KTTE 4MCJA 4TLEA 2YHSA 2NPOA 1JI0A 4L7QA 5TS2A 4I1VA 3EFOB 3RWBA 2VWPA 5JJBA 4HJRA 4X3OA 3H11A 1XWFA 1KSJA 4G5GA 1FYWA 4LIPD 4ND1A 4NCJA 4PZ9A 4RIIA 4KQJA 5F2EA 2G17A 2ZSFA 4N6GA 3ZEIA 4NSNA 5CDYA 1EK2A 4WOCA 3IODA 1THZA 5JSUA 2J09A 1KC3A 1SQSA 4PC6A 3URMA 3DVRX 1KTIA 4M1ZA 3RF7A 4ZAVA 5K0FA 1GZUA 4DC9A 3WRYC 3G5AA 4C4ZA 3A9RA 2PZBA 4CM6A 1IEVA 1FBTA 1E6WA 5E3IA 3RF6A 5BORA 3GR6A 4F5YA 2C9MA 1KMMA 2BMWA 1AQUA 2YRWA 3HVKA 3L49A 3PFBA 4S0ZA 4IHAA 4L5CA 5GGYA 4N3CA 5BQOA 3T54A 3ZD9A 3QPVA 1A9SA 1I51A 3AUYA 2DWPA 3LXRA 5AHXA 1G17A 1BD4A 1HM5A 1U6KA 1R8JA 2OV8A 4U2KA 1KR2A 4MUAA 2GTPA 1OWPA 3NFYA 3NUGA 5DMXA 2BEUB 3KO8A 1CJMA 4FGLA 1F38A 1P0CA 3N1UA 1ARZA 1QM5A 5GZ1A 2HU7A 4UBKA 5HDQA 3V00A 1ECPA 3N8NA 3OZ7A 4PLWA 1NASA 4YT2A 4PLZA 4WXMA 3LYUA 5HZHA 1R18A 1BRTA 4C1NA 3R9WA 2HH9A 3D6HA 1QQ5A 3D7SA 4WLNA 3UO8B 4FQ8A 3ZI0A 1RYFA 2FRDA 4PLYA 2B2NA 5AH0A 2RG7A 1JLLB 4M99A 4KE6A 4R41A 5JCJA 1NHGA 3FFBA 1HI9A 1G6Q1 2EJTA 4US1R 5ES3A 3EHEA 2H18A 4UNNA 4GSYA 3IX7A 4CQLA 4HRXA 3IPAA 3S28A 4JBHA 1W88A 3BFVA 2OGSA 2A84A 4R1LA 2QVBA 2VF5X 2DBYA 4NBVA 1TEXA 2RH5A 4P6VF 1DEOA 1Z15A 5AVXA 1KYYA 3F5QA 3IV7A 3D9QX 2FZKA 2GFIA 3KR2A 3MRVA 3RROA 1AUXA 1VP9A 2Z5VA 5ARBA 1E96A 1ZN2A 3AVTA 1C0IA 4M1SA 3CG4A 4WLUA 4NU0A 1RLMA 2VLIA 4LYFA 2GM4A 3C4QA 4K9MA 1FDIA 3R7NA 3FNFA 1VPWA 4NMMA 2VYVD 1W2HA 2SKEA 1MKYA 5DGIA 1DTWA 3WK8A 2C78A 1GUDA 3HXTA 3QXXA 3DHWC 4Z0HO 4B40A 1WXQA 3HI6A 2ZOSA 3MAJA 4ER3A 3U4MA 1GCGA 4JBLA 2ATEA 5T4EA 2GYYA 2D06A 5TPWA 1GT6A 4EG4A 4MVJG 2EJBA 5FAXA 1CJUC 2P6OA 5HUQA 2OO3A 4Y2HA 1NVDA 3UAZA 1SH7A 2JA2A 2C8JA 4FYPA 4DPLA 5EIFA 2K87A 3WIDA 5A3QA 5LYJF 5DI3A 5EIAA 1K5DA 1ZM4A 2HMYB 1U02A 1KL7A 1ZEJA 2ZAYA 4FMDB 4JL6A 1I1NA 2QSZA 3TMYA 2ZLBA 1A2KC 2JA1A 1J21A 2NZVG 2QTBA 4G9EA 1QOPB 2X0JA 5A6SB 5KSYA 4A36A 4UVGA 4BNFA 3HFSA 4EMTA 1IQ0A 1VDMA 2LZ0A 1S2DA 4RV9A 2YW9A 3LKDA 4BPRA 4BQQA 3BJIC 2M1ZA 3DFMA 3C3PA 3BWMA 4H77A 4OSOA 1DAMA 4U9UA 4DZZA 1AVTA 1GPWB 1FSSA 2C96A 2GB4A 3DCJA 3KK0A 3KQWA 1ZD2P 1EXMA 1YGYA 3MGGA 4A92A 2Q6OA 2Q4EA 3QIAA 3TRHA 4WZBA 1V6CA 2B1QA 1JAYA 4KQ1A 5JI3E 1XJWA 4FYJA 1NIPA 1QZUA 1L3CA 2I7XA 3KDPA 1FTGA 3DVAA 3FNBA 1VM6A 3LUPA 4I8XA 5IKPA 5DM4A 2Y1KA 3UVEA 4G41A 1YVEI 3FDXA 4JJ4A 1XHEA 2GSDA 3MCWA 1KYVA 4AJPA 1XMQB 1CUWA 3GEBA 4K6OA 1MBZA 3I4FA 5DO9A 1M6VA 3HE3A 3V2HA 3PYMA 4E31A 3BD7A 4D3ZA 4GM0A 2CLSA 3BZUA 1QGUA 2A3RA 4EJ2A 2IS4A 1YZVA 1QVRA 4U6QA 4EYEA 3H83A 1ZUWA 1T8YA 3OPNA 3QFCA 4WZAA 5KNBH 1AKYA 1Y3BE 3HSYA 4M7OA 5C81A 3IEMA 1CQWA 3OCJA 1QKJA 5JMTA 3RARA 2FK7A 1FYEA 1T3GA 4KXWA 1UPXA 1JR2A 3KKQA 3KL4A 4YJDA 3LO5A 5AW9A 2EP5A 1G1MA 2NZWA 3C43A 3TW8B 3RS5A 4WX2B 1DIOB 1Q1EA 4RLQA 2A67A 4KWHA 4LGVA 4WY8A 1NXVA 5INTA 1JX6A 1WXXA 1R7RA 4WH0A 5DHPA 3ZDYB 1BX1A 1E5LA 1N2XA 3OCYA 2N9UA 1Q7TA 4YXWD 1QPZA 4F6RB 3KD2A 2TMGA 4IQGA 4KB5A 4YACA 4BQEA 2PEZA 3OJXA 4QVGA 4ENTA 3HJFA 4RHFA 4TVBA 4I1SA 3IAAA 2NVWA 4MUXA 3EWIA 3LYHA 3HVUA 4QXPA 4WN9A 4UCQA 5DP2A 5CVUA 4Y2PA 1C2YA 1KYWA 4IMRA 1Q1NA 3RU3A 2G1UA 4HSEA 1LQTA 1NVWQ 2UZ1B 1NY6A 2WJ6A 4J8PA 1NN0A 5NULA 2HZBA 1LDMA 2VOJA 3EIXA 2EW8A 3L18A 2J6IA 5L7WA 4YRDA 2PBFA 1E6CA 3A6DA 5JANA 2J7PD 3FNIA 4FYIA 4J0QA 5FUXA 4AYTA 4DANA 2XTZA 1E77A 4B34A 1L7EA 1M2VB 2P75A 2NU7A 1KI9A 1AS2A 1W0JD 2L2QA 4BLSA 1RABA 3KYBA 4MLDA 4MPPA 5M34A 3IA2A 3LTNC 2HHHB 5ERYA 3L1UA 2J3IA 1U2SA 4DQXA 1MNQA 2RDMA 1ISPA 4ADSG 1H4QA 1BGWA 3OCWA 5MGNA 3HABA 3U0BA 3PHLA 1XTPA 1YT5A 1V8FA 3ZY6A 2AW5A 1P3DA 1SBCA 2JASA 2PT6A 2YJTD 4V03A 1FFGA 4RTRA 2DEUA 3JWIA 2FRVA 4XX0A 1QG2A 1G291 1J8QA 5HJ2A 3ITNA 1N7JA 3ACCA 4EJSB 2JFHA 1D5WA 5AKKA 1AS0A 1XC7A 4B71A 4PHHA 2A92A 3VMMA 5FUWA 3LFUA 1TJPB 3B7GA 1RCUA 4K9PA 1H5NA 5I7HA 1UH5A 2D3WA 3R75A 4F71A 4WLVA 2VBFA 3FZQA 4FMBB 1R2QA 3W4IA 1DTWB 2D2XA 1VL8A 5AP9A 2A1TS 7YASA 1QLWA 3S2FA 5A3SA 4J7UA 2EFGA 4EI7A 3N58A 3T4EA 1U8XX 2OCKA 1QNLA 1P6XA 1O9HA 3M33A 3NRCA 4FFBB 4DDUA 2YC4C 4YH1A 5FWXA 4FB4A 1VBNA 3U6KA 3FCUB 1Y7TA 1ZIPA 1EZ4A 2OBLA 3CUTA 3FOBA 2W6CX 3LZDA 1NLZA 3NHFA 3PL1A 3WNVA 1Q0SA 3C15C 1QCDA 4K6KA 4NZOA 4E7OA 1G3QA 1GGMA 5J4KA 3P5SA 4ZKEA 1W88B 2E3JA 2J3JA 1MC8A 4I3HA 1TLLA 3HBLA 4LRSB 5DLDA 3PQ7A 3B9PA 3TMKA 1TKBA 4LY0A 2WUGA 1H4VB 3BK2A 1Y98A 1XB2A 5TPZD 1SU4A 3WNDA 4INZA 1QFSA 2VWQA 2YWGA 4DJEC 4LQ4A 3LC2O 4LOHA 4ARBA 2BI7A 2CHUA 4D1YA 4CEHB 4N5IX 4PQRA 1JZSA 3ZY3A 2VQSA 2ZBRA 4Y30A 4ZU6X 1FDTA 2I80A 3T5GA 1RXVA 3BX1A 3KFLA 3ZWMA 1GTVA 2ZREA 5IT5A 4LOLA 1C4KA 4GWKA 1FFYA 4ZQIA 1NW8A 1DAPA 4U2FA 5FV7A 2BMEA 1TW2A 3QF7A 1ZXXA 3BRWD 3MWFA 4RQTA 3E9YA 3MB5A 1BU8A 2JKVA 1LDYA 4JBWA 1WU8A 2P11A 5DYGA 3CNOA 2FQ1A 3NTQA 1YZYA 3P4XA 4KFUA 1LDGA 3FRIA 4PVCA 3K15A 3LHSA 4Y0NA 3TPCA 1QJCA 3WHLA 2P2ZA 5HK8A 5C8YF 5C32A 4G5QA 3ZJ4A 2GUWA 4JL5A 3IAFA 2O1XA 2WF9A 1KEVA 1Z8HA 2E37A 2XGOA 1TJ4A 3L4KA 3O3NB 1ICEA 3N59A 1QYVA 2IYWA 4N4AA 3RC1A 5KJFA 3V2UA 5AESA 3E5MA 3AR2A 3T5CA 2I87A 1TPZA 2MYPA 1ZOOA 5JVDA 3U16A 4PPGA 1E1MA 3THSA 5KHAA 5ELXA 4RAOA 5JC1A 1BMFD 3Q5GA 4KMMA 2TMYA 2VAPA 4TXNA 5F1KA 2FZVA 5C52B 3C1OA 4GAEA 5FWDA 1WDLA 2C8LA 3JW8A 3SK0A 3NOVA 1XCMA 3EUFA 2QQ0A 2IOQA 3CW9A 3CUUA 5BUZA 4GEKA 1CCWA 2IF2A 3H5TA 1T4GA 1T36B 4QNNA 1E4YA 4UUOA 2Q3CA 1BROA 1F9EA 1NRIA 4JP5A 1XXLA 4IGEA 4P7JA 3ZV4A 2R7LA 3A2MA 4BX2A 5LA6F 3SYKA 1XBTA 3R6TA 1LVUA 2Y6UA 4NV1A 4YLEA 5THXA 2DQ4A 1B6RA 1F0NA 1HA3A 2YXBA 2V9PA 4NOKA 2WKRA 3LK6A 3SJUA 4IDNA 4MJXA 3CUWA 3TIVA 1ZR4A 1H85A 5TF0A 1MZVA 3KIPA 3QVTA 2IZOA 4UMEA 4MK4A 4XCQA 3W8RA 3IESA 4HRYA 2V0GA 4MICA 1W5AA 1R0YA 4BWVA 5ALFA 2Q46A 4GPTA 2XPCA 1DU4A 1V26A 3D2BA 3D3EA 3GHYA 2W93A 1KU6A 2AUMA 4Z4IA 4KACA 1B3RA 2VP9A 3TW8A 2R5NA 3W5AA 3TQOA 1JFVA 3DZGA 5CPBA 4QX6A 3BDVA 3GL9A 3DMTA 4H7JA 4PINA 3SAJA 1R0WA 1YOBA 2XIQA 2PZAA 4UM7A 2WAAA 3OC0A 4F9EA 1N2SA 1ZUNA 2FN4A 4V02A 3ZD8A 2NP7A 1DJMA 4CTNA 1Y89A 3A58B 2QL9A 3MJSA 1U3FA 4CL8A 4NHOA 5IG2A 1KJQA 1R9MA 1D2NA 2CBGA 1WP9A 4M22A 3ZWBA 1KI6B 3T7RA 4OJNA 1NLMA 1QGUB 2PN1A 3MUFA 4HH4A 1XMPA 4JK3A 1A7JA 1Q44A 1NTOA 1RXIA 1TTQB 2CCGA 2VIIA 2ZUVA 2CWDA 3IBSA 3JWEA 1ESDA 1GQOA 4Q19A 2LNDA 3DMDA 4WCDA 1IUOA 3WKAA 4E14A 2AJ8A 3EIHA 2B1IA 5K0LA 4G85A 3E1GA 4ZCMA 3NM5A 1GQQA 5DE3A 4MWCA 2Q4OA 1X94A 1GR1A 2IHBA 1DKLA 3BIWA 2RCYA 4EDHA 3SQLA 1BWPA 1UMBA 3UMJA 4Y2TA 1EP3B 2GBLC 1MEEA 1M0TA 1ZC4A 2DFNA 3KELA 4WNYA 5LB4A 3SQDA 4TT3D 1CJSA 1UCFA 5JLJA 1FXUA 1M75A 1Z39A 3CTMA 3Q0TA 4MR9A 1G2QA 4RZ2A 3WLQA 4BLPA 4BMSA 3TDNA 4E3WA 3BWXA 4B76A 4NCBA 3H84A 4NMHA 1ZHFA 3JVUA 1NM5A 2FLVA 1M0WA 3CLUC 3LIPA 4ZMSA 2ZYHA 1A04A 1RE0A 5ALKA 3DHEA 5JAHA 6YASA 3GJ5A 4M9XA 1NKSA 3K05A 3LQ4A 2OXTA 4MVXA 3TOVA 1M8JA 1RI2A 2H1HA 3LXUX 1KORA 4ZCRA 1OJLA 5KSOA 2PUGA 1SBTA 1G3IA 4AN1A 4NXMB 3DT6A 1NYTA 2P40A 5A62A 2RIPA 3EOZA 3S29A 1OR8A 1PYDA 4JLBA 4TSFD 5EMJA 1PWXA 2Q2OA 3NGLA 3ZDBA 3I4LA 2CNDA 4ZOLF 3A1TA 3VSDA 1G21B 1JALA 1THTA 3EQ8A 3VPSA 3TRKA 3KPWA 3GW8A 5FJJA 1NPTO 1Y81A 4YUYA 4PZCA 1RVDA 5KTNA 3BQNB 1GVNB 4P58A 3A05A 1FSZA 4AYXA 2ACEA 3G0IA 1A2OA 2XY4A 3BE8A 3GLHE 1YBFA 3TIXB 5KQPA 2ZYRA 2HJSA 1IBSA 2A9VA 4A9AA 3AEQA 4MLCA 1F0KA 1SBHA 3SC4A 1QUFA 3SQWA 2C82A 4YI5A 3GFPA 5DCYA 4AKSA 4HNTA 3FYHA 2RJ3A 4DUYB 5CLIA 2BFNA 4MQEB 1UQUA 3VPXA 4B2LA 3M1LA 1EG7A 2Q5LA 1RQRA 1JQBA 3GLFA 4AU1A 4QOHA 1EFDN 3PUYA 1C41A 1TAQA 1YBHA 1FP1D 3KJXA 4DSNA 3EPLA 1Y3CE 2GASA 5IMBA 2P5UA 3ZHYA 2H3EA 4K6MA 2H3HA 4R51A 1CULC 1T0PA 4PYOA 5JS1A 1B1AA 4YJKA 4BNTA 5LUBA 2ENUA 4DQLA 2B7CA 4JP1A 4RH1A 3X2EA 3OF5A 5IC4A 4BLUA 1FW8A 1YNSA 2PSSA 4KLRA 3GLGB 2JLZA 2BR5A 3AIOA 4V0OA 1GUYA 3VPAA 3OHSX 2I2FA 2PMBA 4B3JA 3OT1A 4XSVA 1M1YE 1UZAA 3LCVB 1RKQA 4HNHA 2OV2A 5D85A 1KOLA 1Z9BA 4QU9A 1TQ2A 3P9ZA 2UUPA 4JLDA 3GK3A 4EABA 2YOHA 3G0GA 2GEFA 4FFBA 3T41A 2VTVA 1KMHA 1ZCFA 2AC2A 2BSAA 1KWGA 3KXDA 4Y6OA 1R8XA 2DBZA 3W6OA 2Q1YA 5JHGB 1UKBA 5BN4B 5KSPA 5E7JA 1OTXA 2W83A 3WL5A 4GI7A 4UOEA 2Y1XA 1ECGA 2QNBA 3E1SA 5H59A 4PN7A 4U7TB 1GGHA 2XZTA 4Z99A 1G7TA 5BVGA 4EGJA 3NNDA 3WB9A 3JQ6A 3C4VA 1IG3A 1OTYA 1O87A 2EL7A 2Q7DA 2HXYA 3QTTA 2OSVA 3SE0A 3O8RA 2ZB7A 3HWWA 1V8ZA 3P9NA 3W9BA 2PRYA 1PR6A 1H5UA 3IAXA 3X2SA 3L79A 5IPFA 4J6EA 2XA1A 2E85A 3LM8A 1BYUA 1G1AA 1STOA 1YJXA 3E7FA 3L0BA 4OKIA 4RAQA 4B84A 5BYKA 3K2QA 3P9SA 2KM1A 3D43A 1YDWA 1W48A 4DLRA 3HN7A 2C4VA 3PNMA 3QMPA 3SHFA 5AFSA 2OBMA 2UUOA 1KFCB 3TVYA 1REQB 1PR0A 1R27A 2WW8A 1Y1KE 3AX6A 4CQMA 3GJZA 1OFTA 1XXHB 2OGUA 3PIDA 3L8DA 1O0SA 2JGLA 2HT6A 4CLXA 5KKNB 3REFA 1L5NA 1XPUA 3I0ZA 2V59A 5JSZA 3ZE7A 1BJTA 1EK6A 1FUKA 4PZYA 3V8EA 3NRBA 1H6DA 2IYUA 2HJHA 1I0LA 1I2MA 1P8AA 3R1IA 2OXIA 3DOFA 3LA8A 4XQGA 4IGIA 4CM3A 2FHSA 4YR9A 1FBNA 1XXHE 1C9EA 1KZGB 3UAYA 4AN0A 1NQXA 3RU9A 1EG2A 3OTWA 3IQFA 1PEKE 1Q7RA 2PUTA 1L7DA 2V7TA 4WESB 4BQNA 4CVNA 5ALXA 5IZCA 1F3LA 3FCAA 1Z08A 5AI0A 3U80A 3LSTA 2D4AA 2F1RA 2AG5A 3E9NA 3H04A 4HX2A 1ZNXA 2WZBA 1YCDA 4HXEB 2GHIA 4BKQA 1CIPA 1P9NA 1QX4A 1T4CB 1SVUA 2A9QA 4Z9AA 3OFJA 2OMEA 2ALJA 4M6WB 3WIVA 5IJZA 3TUZC 2IIQA 1BHJA 1J1IA 2IYPA 3B20A 1N2HA 1L6IA 1O97D 2WIDA 4KQHA 3WWZA 4DGSA 1HNZB 5HJEA 3NBUA 5IF9A 1IQPA 1VLLA 2B37A 4DQDA 2JEZA 2W2TA 3SR3A 4YYEA 5AVVA 4ZD6A 5L3QB 3BN3A 4P34A 1DXYA 1YK1A 1L5KA 4NC9A 4ZC8A 5C7LO 4Z0TA 1KXZA 2QPTA 4JI5B 1Y9EA 4YAWA 3MPUA 4EJSC 1NJ1A 2EIHA 4S24A 2VSQA 3P8ZA 1CV2A 2QI9C 3F5DA 3MJRA 3RYCA 1ZJWA 2JD0A 3DZJA 3E2MA 4DLZA 3RYCB 2I0FA 1ULHA 2HA5A 2XGGA 2AK3A 3L5KA 2W6MA 2VUIB 3HCNA 1NLFA 1XNHA 3T7IA 2XQJA 4AQYB 2OD9A 2CXXA 4OQLA 3LP6A 4MB6A 4QELA 4D9FA 4DTCA 4ZPJA 2J3DA 4GGMX 3VZQA 3DWIA 3W1EA 3WSWA 2X8LA 3DFFA 4CMIB 1Y9JA 4YJFB 4L3VA 4TYWA 1RPTA 4B2IA 1K92A 3H9JA 2YASA 1P81A 1L7AA 1FQOA 1X1DA 3VUFA 3QEMB 3IERA 3WG9A 1UT5A 3GEHA 3EA5A 1T4CA 3FCOA 3OKAA 3ONFA 4MIEA 3RRXA 3W3ZB 4ESHA 1FNSA 4FSDA 4U5QA 1CHNA 1L7BA 5I8ZA 3QJ5A 1Y4SA 2P9BA 1GLVA 1MO2A 1R9GA 5DOVA 2VHTA 4ZOAA 2QSJA 2BGJA 3B1JA 3NTUA 4MGKR 3B82A 1VBKA 2V65A 3K92A 3STXA 4ABYA 1CZHA 3PI6A 5E9QA 4H7PA 3SU8A 5AVRA 2PAFA 1L8LA 4RVHA 4PV7A 1E99A 5CNKA 4K9SA 1CZOA 4FYMA 3VO1A 3CLVA 3UC9A 4EX7A 4B6GA 2F17A 1M1NA 3RTGA 1C81A 1EFVB 1FXWF 3IKMB 4UD2A 3WJAA 4KQIA 3C85A 2G5TA 4HP8A 2BELA 2GXSA 2HGSA 3G1UA 3ITKA 4PQYA 2A33A 3EODA 4LJ6A 4K5QA 5WRFA 4N3GA 2P9QA 3MTJA 1E3TA 1U04A 1W0KA 3OZRA 4D4LA 4XYBA 4DT1A 4Z9FA 3CNLA 5K3SA 1W4RA 2MWMA 1W5TA 5TS3A 1N75A 1JDBB 2PRJA 1PGQA 2AT1A 3AP2A 5TJ9A 3ZDFA 4K9KA 2XTJA 3FXAA 3WGHA 1DEXA 4NFHA 2IF0A 5GVRA 1V1MB 3QVMA 4JI3B 2NX2A 3G8BA 2NZUG 3ICCA 3EA4A 1T1JA 3KZXA 1PJ3A 3GCDA 2VHQA 4BKRA 3F6EX 5CFNA 2ZWMA 4A73A 2QTNA 2JAOA 3C8HA 5I9LA 2WJVA 2JBAA 1Z25A 4G67A 5GJBA 1GG9A 2A35A 1S8FA 2O4UX 3DVSX 3MIZA 3PQ2A 4KNWA 4O63O 2VRBA 4BRWA 5JU6A 1YA4A 2HB6A 4M0DA 3HYNA 1XDZA 1YQDA 3AZQA 1XZMA 2YDYA 4DC0A 2Q2NA 1I4DD 4YGXB 1DEKA 3PJRA 1EIWA 1ETUA 1ORIA 1ISMA 1R9NA 2ZTVA 1DT3A 4PY2A 1F8YA 4INOA 4XWAA 4CIWA 1E20A 4F9FA 5K0EA 3DLBA 2VTEA 3LC7O 4CMIA 1N2OA 4BLWA 5HOEA 1J0XO 1OLSA 4NPHA 5BT8A 2F9MA 3HMQA 4N3BA 2X8BA 4Z9YA 2OCIA 3LRTA 3SZLA 1TFUA 2G72A 2RI0A 4TYMA 3H6GA 4JLOA 1SUDA 3PA8A 3ZQJA 2QUHA 2IP2A 1MRSA 3V8QA 3KLNA 5E8RA 1G8MA 1VG8A 1OASA 4WLOA 4Z0PA 2VNAA 3KJNA 1H1TA 1Q6ZA 1XKQA 4XYMA 4ZQFA 4OFZA 1PS9A 4M1OA 4WCFB 5IC5A 2GWRA 1HEUA 2AC4A 1BE8A 2P62A 1E0JA 4IDCA 4BMCA 3U44B 1BZYA 1OD6A 4I9UA 2OG1A 4QXRA 4BX0A 1KKUA 1BMQA 3WZ2A 3UMRA 1Q0TA 5AKXA 1TM2A 2WA1A 4XJVA 4M6WA 2JEOA 1QV9A 1UEJA 2IXEA 3WYAA 4EHHA 1U8EA 3HA7A 5KJEA 2CLIB 4UU1A 3GBVA 3WWEA 1SIOA 2EBFX 5DYNA 1NJ5A 2PSFA 4AMBA 5EZ5A 5DTJA 1CRZA 3NJRA 5JJCA 3U60B 1XPOA 3H11B 2IYEA 4HV4A 3DPSA 5G40A 3UF0A 2JGFA 5F4ZA 4XWGA 3KTAA 1ECLA 2Q6KA 4C1BA 1U5BB 4GOKA 2G1PA 1Z82A 3CNQS 3DPIA 4MMYB 2QE6A 3X44A 4GQAA 4UPVA 3VR3D 2RMKA 3U4QA 2EARA 1W4LA 4UE3S 4DJDC 1ZH6A 2C2GA 2XSZA 4XOUA 4EF5A 1XTIA 5K03A 1D4FA 4CNBA 4MRMA 2FSGA 4RF2A 4AZTA 3F6CA 3PUXA 2ISSD 4AN4A 2NSJA 5CAEA 3ANLA 3RVPA 4KWCA 1O77A 2Q6VA 1T2EA 1TVKA 4IRXA 4Q82A 1TCUA 2GN2A 1DKNA 3MYRA 2QYOA 4KAJA 1P74A 5HZMA 3GBPA 4J0CA 3CRMA 2OQVA 1Q50A 2DQZA 3Q1KA 5DRTA 1Y6GA 4D9IA 1JHRA 3WKEA 5KTSA 2HDWA 4DV6B 4UARA 2BR4A 3IJRA 1Y3DE 2OQIA 4DLWA 2HJRA 3KR0A 1HT3A 1U8UA 3G6WA 3R20A 2O2XA 3IA7A 1S1CA 4LYGA 3S2ZA 3T12A 1JDUA 4ZARA 1VJ1A 1Z4JA 3S0JA 3AM4A 3T1HB 5KWJA 3NHSA 2YIVX 5TPZA 3ZCQA 5IYZF 4OREX 3T9CA 5JRZA 1Q12A 3A11A 4OM7A 3HR7A 1SURA 2D1QA 2RI1A 3AGPA 4TS4A 3TB4A 4ARIA 3OM9A 1CUIA 2ZYUX 3DBLA 3GMSA 2QPOA 2WDZA 3AR9A 3VA7A 4XUCA 4WCFA 4AP9A 3I1FA 4EHFA 1YMUA 3RV3A 3Q12A 3WMWA 1UMBB 3CF4A 5ALRA 3JD2A 3TKYA 3NAMA 4N9WA 4Y9SA 1EESA 4H6PA 4JBIA 1L5VA 3IALA 5LWQA 4JBNA 4F11A 3DOJA 4YCSA 1T0UA 1VKJA 1DZIA 3SC2A 4AMGA 2JHAA 3G2NA 5B4TA 1I4TD 4LQCA 2X76A 4Q3LA 5K3OA 3GP5A 4KQ9A 1OBCA 1V8OA 3GPIA 3HBAA 1JGTA 1IEXA 3BUSA 4YREA 1XFDA 2NYUA 2OHOA 2VZ8A 2ZSAA 4GLBA 4PXAA 4RE5A 3VSEA 4Z51A 5FPKA 2HPZA 3DMRA 1ZUNB 2G36A 4M83A 3B3QA 4B7XA 3FSEA 3D7LA 4P2GA 5LU8A 2HQOA 2ORWA 3U3MA 5AVYA 1QDEA 4FXOA 4IF6A 3ZQUA 5JNLA 1UXIA 1V5WA 3EVNA 5EC8A 2PX8A 1U0RA 4O2BA 3OE7A 3TTTA 1X7DA 2FN8A 4DA8A 5KI6A 3SHWA 1DKQA 3RKSA 3FYDA 5AUOB 3SYRA 3R8CA 1ZC3A 2GM3A 2YQ4A 5AW4A 2PO5A 3Q9SA 2REBA 3PXGA 4EG8A 2VF4X 2ZUDA 3DXXA 4CKWA 1QB8A 1N32B 2FEOA 3GA0A 2JF0A 2OXEA 4H7IA 2VH1A 5KPJA 1K2VN 1KZ9A 1JSXA 4KFCA 3UBMA 2HCJB 3NETA 5KNLA 1UT6A 1UMDB 4IWXA 2O5VA 3SJZA 4MVJI 3CKKA 1H93A 2AZDA 1EFRD 2C9ZA 1MABB 3CJRA 4LHEA 4TL8A 3FHCB 1JJ7A 1ZK0A 2QX8A 3GNLA 3I9V1 1JQKA 3HVIA 4L2IB 1NX6A 1YZNA 2MYUA 3BB4A 3D31A 3S2IA 1A9XA 2P2DA 3R23A 1VHTA 3LYLA 3Q98A 2OYRA 3TQSA 4E07A 4FX2A 2IP4A 1HE3A 2GFHA 2NUAA 1F17A 2RB4A 4RGBA 1QTQA 2AWNA 1V47A 1XZ8A 2WWXA 1PFQA 3HA5A 4R8MA 2X0FA 1RCFA 4GPD1 1SA0A 4XWTA 5DWQA 3AW8A 5IAKA 1DKPA 4Y1EA 1DAOA 1TTTA 5K6TA 3PXUA 1NQOA 5TRTA 3EDYA 4C0SA 5JBNA 2D7JA 1GO2A 5K2MA 2BKXA 4HQ6A 3EFHA 3EF1A 3RTCA 3TL6A 3AI3A 4FR2A 2OAQ1 1B8NA 1DX6A 4JGBA 2PIAA 4MGHA 3AR3A 3HG7A 1Z5ZA 2H0QA 1JBEA 1G5QA 5IFKA 2JLRA 1DO8A 4R2XA 4PYMA 3H4MA 5AK6A 1ZPDA 2G09A 5TQ2A 4BVJA 2OQ2A 3W2GA 3VRHA 4PNEA 3LPAA 3SNKA 4CG1A 1W4CA 3C70A 3NKVA 4TVOA 3ROXA 4YT8A 5B7NA 4B4WA 1CVLA 1E5XA 3GIDA 2GEBA 3LBHA 1AV7A 3RSGA 1VG1A 1ZWKA 2RJNA 2WMOB 1KZYC 4GP9A 4EPTA 3GD5A 4HB3A 5BR1A 4KQWA 5CHEA 5E1DA 4YP6A 3LUCA 5F1OA 1DC6A 1ODFA 4X41A 4UVDA 4DKXA 1I14A 3STWA 2BGNA 2GS9A 5ALQA 3WYGA 4IGAA 2QXYA 3GT3A 3GVXA 4NAHA 4G09A 3TX2A 4HDCA 3IUBA 3QVXA 1JIXA 4WZZA 1QORA 2WQZA 3NTLA 4JUDX 3REGA 1EWYA 4BFSA 1E7WA 2KHZA 2BKVA 3G2LA 3PD0A 4N12A 3HCBA 2H7YA 2WAXA 1AMUA 3WLNA 2IIVA 1PJTA 2AZMA 4R1PA 1XR3A 4DLUA 4QTTB 2ECFA 2VT2A 3I5AA 1A4XA 1Z0SA 3QWBA 3UTCA 1JG3A 2EFEB 2NXWA 3NALA 4B6EA 1SVLA 1PSDA 1PG2A 1M6YA 1IM8A 4WUTA 5BMVB 1ICIA 4HWOA 3H1GA 3LSYA 4IF4A 2I7TA 2DPMA 4GL2A 4MW4A 2C5GA 3HY3A 4HLCA 1X6VA 4MW7A 4NE7A 1RYHA 1OQAA 4TMZA 3QH4A 3M3DA 4GE3A 1ZRSA 3IBFA 4H7EA 5K0ZA 2BFCA 2C8KA 2YVAA 1P45A 3LUFA 2WJGA 4KHZA 3FPHA 5JZOA 5HEKA 3C7DB 3V4ZA 2C7QA 4NKRA 4LBZA 3KVRA 4NBTA 1L4FA 3PT9A 2P2LA 2NO0A 2VDPB 3CRNA 3VR4D 4HLQB 1YC5A 4BWFB 3OU2A 3U2QA 3FSGD 5IWCA 1WDMA 5HBGA 2OFFA 5J9FA 1YHNA 3THRA 4QGSA 4CF7A 1CR0A 4B6OA 2ON6A 4I5DA 1HZZA 2ZSIA 2JW5A 3DV0A 3KDAA 1OAOC 1WXDA 1BNCA 5KAPA 4LTDA 5DIZA 4XR4A 4ZYTA 2EYQA 2FWJA 2WI8A 4WGFA 1RJGA 3D4OA 3EXEA 2CL7X 3PUWA 3TE7A 1EEHA 3A6KA 1T0JB 3A04A 3TS1A 3HHEA 3UJPA 5L6MB 2XNCA 4MH0R 1KH2A 2B0CA 5LIPA 3OLWA 1RFGE 1TUIA 1YQGA 3O8NA 4WIAA 5CYPA 4MQUA 1X77A 3DP7A 4E4YA 1K4KA 3A2LA 2X2OA 4KOAA 3EG9B 3EXHB 3B3GA 1PW7A 3OMLA 5LQDA 2QYHA 2DWQA 1ULSA 3IBTA 1GNSA 2BPOA 3K4PA 4I2VA 3HFRA 4HF7A 4IDAA 1BWRA 1R6VA 2ZB8A 4QIHA 4Z4GA 4GX2A 5FL7D 4H3VA 5LZ9A 1NQVA 3KT0A 2QTWB 1GFWA 4OLHA 3TM4A 4H17A 4BO2A 1KPGA 2YOFA 1OZHA 1KTVA 2HIGA 4JGGA 4K9QA 3IFSA 5GPBA 3RLIA 3SYLA 1U1FA 2P8SA 2TMDA 3FSGA 1NT2A 4MROA 1PIWA 4B7CA 4ZT6A 2VP2A 4A0SA 3AESA 4JY7A 3ONNA 1JEQB 3GFBA 4M0FA 2JD1A 3WFZA 3L6DA 1M2KA 2WIJA 4DV4B 5DHFA 1P4HA 3KXKA 1KQNA 3VOSA 4KIWA 4BOYA 5CB4F 1SD1A 3HTXA 3TGLA 1S5PA 2EBUA 1U1DA 1MIOB 4KVAA 4M0UA 1LX7A 4R2MA 4W1RA 2JHCA 3AM1A 2ACVA 2FWAA 2G6TA 2HK6A 2I6QA 4JLSA 3PX3A 4KL8S 1OZ0A 5LVAA 3GZNA 1OB2A 1RJEA 2DFLA 1JA0A 2WSSD 3BTSA 4NZ9A 1K9SA 2PH5A 3AVQA 4TS3A 4ZO9A 1N1MA 1LBEA 2XEDA 5FA5A 4EI8A 4G8BA 4F96A 1MB9A 4M3NA 3LP5A 4EG5A 4N76A 2XUPA 3Q6NA 1W6RA 5KEIA 3UG7A 3O21A 1UPAA 3NBMA 2XB8A 3GZJA 3STHA 3PIRA 3W4JA 3H3XA 4DDMA 1XRQA 1E2HA 3O47A 3RIMA 2C4NA 3ZU5A 2AJCA 2VDRB 4ZVTA 1XU7A 4L72A 4B7AA 4TKZA 4TYQA 1XAIA 1JHUA 2ZI6A 1WQ4A 4CMHA 3K7EA 5DX0A 2PX0A 1YE8A 3KJGA 1M5UA 4IS2A 2QI9F 3MBOA 3SZOA 1GPDG 2A5GA 4TXHA 4AJOA 4NBRA 2DC1A 2R3SA 3VNSA 1XN4A 4P93A 5CCXA 2OOSA 1ITZA 4LPSA 4Y1RA 2BN4A 1D2MA 3ORSA 4MQFA 1P33A 1WEKA 2M6SA 4JLVA 4M2LA 4MR7A 1G0NA 4NULA 3ITEA 3A9SA 5CFOA 4DG8A 4GXRA 1RPAA 5HTOA 2O7VA 5LZ2A 1XKXA 4FK8A 3IQZA 2O2SA 2GXQA 4BTVA 4Q7JB 1PS0A 4YJHA 1XVIA 2I1VB 1DPFA 3ASUA 1GPBA 3T1QA 2GCOA 3RFCA 3VU8A 1AV6A 4BCBA 3F97A 1UBGA 1M1NB 1S8OA 2QRPA 1A4UA 4N65A 1R0ZA 1RYNA 3HUEA 3SOZA 2Q3LA 2A7QA 3VH3A 3QV2A 5AXCA 1PGOA 1QB7A 3G02A 5AOBA 2VPIA 4C2BA 3ZV3A 1V41E 5IKXA 5DI3B 2O7NA 3EAGA 4XE5A 3ERCA 2ZWOA 3AU8A 2IOFA 3AERA 1E2LA 4CIXA 1ZNZA 2FWPA 2AI2A 3IOMA 5AI8A 3AYXB 3H5IA 4GP6A 3WGTA 4EUHA 4ZT3A 5TDHA 1YKFA 3L3BA 4BFZA 1PKEA 1J70A 1Y9ZA 3T0GA 3WIEA 3OM8A 1BDIA 2B4YA 1KDOA 1USWA 3RAFC 2HIHA 4KGXA 3RTAA 4YXWA 2IC5A 1FSPA 2XKJE 4JC8A 2GA9A 4PS0A 2IH4A 3OD1A 4N5NA 2HYDA 2UDPA 3Q0IA 1E1DA 4Q15A 1L1FA 2FY8A 4ZTZB 1MUUA 1NVGA 2BRUC 3LT1A 1U9YA 4HWTA 2CUZA 1POWA 2OAGA 3M6XA 1Q1GA 1NI4A 2ODPA 1E62A 3EIOA 3TTXA 2QDKA 4PIPA 4MEAA 1GNRA 5CVJA 2V7BA 2OB2A 5DM0A 1JN0A 4RDCA 2JGAA 2VQEB 3DAYA 1FEZA 3E2PA 4J0HA 5CEJA 1TCVA 1XELA 1KI6A 4YMWA 1DX9A 3EQ2A 2HSEA 2QTLA 2JGJA 3A4YA 3E7WA 5CXSA 5IUKC 3WWDA 1KNQA 3DJFA 1V7CA 3VYSB 3AJAA 3O4GA 2JH8A 2EX4A 3C2QA 1MT0A 4UHBA 1JT2A 3VPHA 3WGMA 2C5AA 4CL3A 2OGTA 5KB3A 2WD7B 1XCPA 2WPDD 3T7EA 4QFMA 2J6BA 4PC1A 1YFLA 4W7HA 4O1MA 2A1IA 2EZTA 2W6JA 1OH8A 3FCYA 1QR6A 5L4LA 1SGWA 2HBRA 4G1FA 4ZTUB 1AQYA 5FPSA 3VZSA 1NP6A 2B25A 3NB0A 1ZLYA 3MQ2A 4NPCA 2PHZA 1AQIA 3BPSA 3BD6A 3JQGB 4JITA 3UT5B 1N6KA 2C29D 1T15A 4EBBA 4HCJA 2IJGX 3MINB 3PTLA 4E5NA 1FJ2A 3GXBA 4YAEA 2O06A 1NUPA 2I1WA 4QAJA 4WFKA 3VYVA 2ZFUA 4L0CA 5B3AA 5BNFA 3U62A 4Z54A 1EXDA 2A78A 1IZZA 3RUPA 5A0TA 2FW1A 2PVPA 3C8MA 4M0EA 2WJHA 1GU7A 5G4LA 5KYUA 5A6VA 4OP1A 2GR9A 2BFEA 3L84A 3QFSA 2LPMA 1JQAA 3F8TA 4FMPA 1U3VA 2EJWA 3NHYA 5H0IA 5IN4A 4L78A 5ALIA 3WNCA 3A4MA 3H8VA 4LRQA 3NHBA 4G4GA 3UH1A 3IPYA 1W30A 3UKDA 1GQYA 2XLCA 4H15A 4MPTA 1ECBA 2NSHA 4OSEA 2FU5C 4MAFA 2ONZA 3GUYA 3W3AA 2J0SA 4IZHA 5BPFA 3HVHA 4HAYA 1K8ZB 2ZIWB 2QDXA 3GQBA 4NBLA 2B1GA 1KGDA 3HU3A 3SIRA 1R88A 4EHLA 3CB2A 4MGYR 2CV0A 2GMWA 4JLNA 1G8JA 4FFWA 4XOIA 4KIGA 4IO0A 3R5TA 2HD4A 5EYPA 3HHPA 5TPWB 3F6YA 3TLKA 1WXHA 2VSFA 1CYDA 1YAHA 3KUUA 1F2VA 4JT8A 4XYGA 1BFKA 2AFRA 2YFYA 2WG0A 2BZ1A 1UBOS 3D7NA 3NEAA 4DG9A 1ZWLA 1XQYA 2I2WA 4QJ5A 1ZSNA 2ZM5A 4ESVA 3WYNA 1TU3A 3L02A 1QC5B 2CVQA 3KOZA 5B6PA 1GUBA 1ZGJA 2J3KA 1TZJA 3GJTA 3V1NA 2K7FA 4JJ7A 2WSLA 1GNLA 1W581 4CM4A 3O9VA 1IXSB 3H65A 1QAOA 1P62B 5FLYA 1VSQA 3HDHA 4DCMA 4EG6A 4KVGA 5IXSA 2ZI9A 2JCVA 2PM8A 2P6UA 3HNRA 3MWDA 4UUNA 4NEQA 3LBYA 1MAVA 3QU4A 3DTVA 1S9HA 2HRDA 3PGLA 3Q7SA 5FBWB 5KJ6A 3K5IA 4PGFA 2UUCB 3H1PA 1PS8A 2X6TA 4XGNA 1UINA 2IOHA 4IV0A 4R5MA 5FTKA 3PWZA 2MYNA 3K53A 3KEQA 1JKXA 2XR1A 3B5IA 2P1RA 1XL0A 1PEYA 1M2EA 5HXAA 1JXOA 3GVCA 4X92A 1Z7WA 4Z8XA 1PR2A 2V03A 2YIJA 2ZTUA 4D0NA 1ISHA 1XD8A 1LZLA 4CM4B 1CQJB 4HKTA 1Q0UA 4I4TF 3QWHA 1MXHA 5H3HA 1EXWA 3DZFA 3EYAA 2PKEA 1Q84A 3PE3A 3O8BA 3T7JA 1A9QA 1XWWA 3B48A 1A5SB 3VNQA 4H1WA 4D26A 3RS2A 4Z7OB 3HB7A 3UK6A 2FZGA 2KWIA 4A6XA 1BWSA 2ZRDA 3AEQB 4Q1CA 1QWOA 4AY4A 2LV8A 1XEWY 4DNQA 2PYIA 1FLVA 1NLYA 1T8UA 2QN7A 4ZYLA 1RWOA 2XBMA 3F9CA 1JSCA 5E4TA 4IIGA 1N4AA 2FDCA 5IMSA 1F5SA 4OK3A 1GG2A 3EVFA 4A5OA 3MEQA 1AKEA 3UA4A 4CN9A 4D25A 3AZPA 1NA5A 1ZKDA 3ZZUA 3R09A 2JFPA 2DY0A 4LZNA 4OXRA 3SZRA 5I8WA 3IJ5A 5JUWA 1FJGB 2ATVA 2QZ9A 4KSCA 3MWYW 5TMBA 4RTOA 3G5UA 1H3NA 3E3MA 1R4NB 2OM6A 2VXBA 3IV6A 3QKRA 3ZJYA 4KTVE 3HZHA 3BQMB 1K6MA 2H2GA 3DONA 3KG2A 4FR0A 5FTWA 5G0TA 4UTPA 2HQBA 3KFXA 4HNVA 1MAWA 2QRKA 3OCCA 2DXIA 3AKEA 2BBOA 3QVSA 4XD7D 3DW1X 4UMVA 4WBXC 5ER9A 3EUWA 5BN5A 3U5ZB 4PSDA 2VHYA 4DCSA 5AI9A 2F8LA 3TOZA 5FEUA 1KA9H 1SUEA 3R44A 2ZZMA 3P9IA 2DB3A 2BEJA 3KR9A 5AJYA 3BJRA 1J9GA 3HKCB 1F6DA 4DIOA 5JATA 5MDHA 3WGVA 2FZLA 2V7UA 4XWWA 1P8JA 5HS4A 1I6MA 1EFLA 3JY6A 4I9GA 1H1LA 5IW8A 5LBIA 3ZWNA 1L4YA 1CQZA 2G0TA 1KEEB 2N75A 2XF8A 3IULA 3OSZA 5CNJA 5EQTA 4MI3A 1SCKA 1D1QA 3GEEA 4HMPA 3KTAB 1K1EA 4AVYA 2A0UA 2ZETA 4HBGA 5JH7F 2Y9PB 5FOTA 1OT5A 4IMJB 1Y33E 4KLCA 3U3OA 1T5BA 5AD1A 4LWOA 4G0WA 3UW3A 2F4VB 1VKOA 4MS3B 3TTYA 3X1WA 4C08A 4XFDA 5HTKA 4PBSA 1JAZA 4X20B 2JHPA 4GVXA 2AQKA 1VJ5A 3HPQA 2Q1SA 2EJVA 1M7HA 1WXWA 2PKQO 2D7CA 3U49A 4F2PA 2I78A 3RSSA 4M9SA 4HG2A 2F2TA 1FZTA 4P7BA 4HQFA 2GJ8A 1C1HA 2BE7A 2RJOA 4S1PA 3MLEA 4AG6A 1D2GA 5HIMA 1J90A 3C5WP 1GPKA 2WV9A 1P0IA 3B1YA 3ZHTA 1FNMA 4E5UA 4YV1A 5AOAA 4EI9A 1Y8RB 2G88A 3RWOA 2HT1A 3PEFA 3K70D 5FFMA 4AJKA 3ABZA 3M4JA 4L5BA 3L7AA 3EIEA 3F0TA 2ZI4A 4RMGA 3PPVA 4H0FA 2YZ7A 1JEQA 3EH1A 2C61A 4L02A 2JZNA 4E09A 1O9BA 1UBCA 1O57A 2Z08A 4GI2A 3ZK7A 2YWDA 4IJ6A 3V1LA 1C4OA 4D02A 1IPHA 3K6RA 1QHIA 4IJQA 4FIZA 3VX3A 3DDNA 5F51A 3R7WB 1IN1A 3V5NA 1GTMA 2DPHA 2E82A 4RK5A 5IYZB 5MN4A 3OMWA 4W7SA 2GN9A 2R6CA 4R7GA 2HK8A 3A28A 2QRHA 5AUQA 3OQ1A 3TRIA 1GSIA 4RSGA 5BQPA 4FW9A 1DV1A 4XVQA 4CMBA 1WSBA 1NJFA 1OXKB 1XLTC 3AG6A 4JN6B 1GADO 1YGPA 2P78A 2ZBVA 4L8LA 4NCNA 1U31A 3B6EA 5A9RA 5FOXA 4G07A 5FX2A 1SM4A 3BVPA 1DWOA 1O2DA 4I7EA 4IV5A 2X22A 2JIZA 4N1AA 5HZGA 2QN9A 1B74A 4PGAA 4DRXA 5J3JA 4YRTA 1XCLA 1BQ4A 3FZYA 3SC3A 2SNIE 4HAOA 3RWMB 3WWYA 1GT91 3SPXA 2CXHA 3B9QA 5I7AA 3BZWA 3M6MD 1FRZA 3NIWA 5LMCA 3KEFA 2XHEA 5AKIA 2VP5A 3W2HA 3EBLA 3DMPA 3PSHA 1DXQA 5DGCA 4LE2A 5HF6A 4FBMA 3WMFA 3F73A 3MT0A 3QU7A 5I7RA 2G9UA 1L4MA 2IZ6A 4L6CA 1TC1A 1PN3A 2QTZA 4LHVA 3THYA 3CF6R 3MWEA 4HH1A 1S89A 1THGA 3Q41A 2RH9B 4DY4A 4X84A 3UV6A 5TT1A 4QGGA 4EA6A 4PCUA 4FNAA 5DEOA 4FGJA 4OP2A 3C3BA 4G0OA 3RVNA 3EX7C 4RD1A 4YECA 3ZJTA 4D79A 3DZDA 2X5NA 3H5AA 5GINE 5F5XA 2BGRA 1N6NA 1JHXA 3LT4A 3QENA 1YQUA 5DYWA 1CQIA 1QG6A 4XEUA 2BMJA 4G36A 2QRGA 2O14A 4GD3Q 5HCNA 4ROSA 5FI1B 5B1SA 1W36B 2CLDX 1C4WA 2GO1A 1ACJA 3GO4A 4HH3C 1Z5VA 1OZFA 1QDLB 1TMGE 1WG8A 1CT9A 1Z83A 4P22A 4C01A 3T1OA 1MVLA 4KXFB 1G2PA 1D03A 3H7AA 2O8BA 2JFZA 2DCMA 3K0AA 3Q7QA 4I5GA 4KJZA 4M87A 4PO1A 2GEKA 4DQKA 3TD6A 3GJ4A 2X2FA 4KQKA 1HMYA 4B45A 4NZMA 4X7BA 3CW2A 1BGVA 2EWWA 2QW1A 4H27A 4QLAA 3TQHA 2A9PA 4WK2B 4MVYA 4I50B 4HZGA 1C0PA 3QF4A 1DCMA 5JW6A 5HIIA 1ZDMA 3QKSB 5G4KA 4KNYA 1O6GA 1Q14A 2GRAA 3WADA 4EDFA 1L7OA 2H00A 4LFCB 4LF9B 4IZIA 4JT4A 4TKMA 3N9IA 2R25B 1MHTA 1DBIA 3KYDA 5AHWA 1ZBQA 4V3BA 2HF7A 4XCVA 1J2YA 1PJZA 3CVXA 2VATA 3V9AA 1JLKA 3GOQA 3NGXA 4XX0B 5FKJA 6NULA 2V97A 4HDKA 3MERA 5C8YB 4HC4A 4CEIB 1QHGA 1C7QA 1YCHA 1WBJB 3EY9A 3TOCA 4V2UA 5KOYA 3MWDB 4NG5A 4DVJA 1NMSA 2Y71A 1OFHA 1MB2A 1WPGA 3CGWA 3N2KB 4JX9A 2XQGA 1R5JA 2ODEA 3QX8A 4IX9A 4JLUA 4K03A 4WK4B 2HKIA 5EP2A 1T5SA 3ZWXA 2WUVA 3DC7A 3G85A 4IHJB 4DCCA 4ED9A 3U5TA 1RLOA 2YQ5A 5K09A 2XCTB 3O73A 5DBHX 5JFTA 2ZT7A 3OJCA 1N9GA 2GD1O 3DEYX 2FFBA 3HZOA 4RZIA 2XKKA 3B2QA 4Y2SA 2AXPA 4U8GA 2LXNA 2O19A 5K0GA 1T13A 2RGCA 3MELA 1TMOA 3SBDA 1KQ3A 3SMVA 4AY5A 3OT4A 2QBYB 3A6LA 3TNJA 3ELWA 5HPYB 5IVDA 3ZGXA 1Y6QA 1CUSA 4MYRA 5FNZA 4RPJA 3G2IA 2PGLA 1M6NA 2ONCA 3UWOA 3OPXA 5LA6B 3AI2A 1J0DA 2ZJ3A 3K2EA 2WFLA 5FORA 2ERCA 4N40A 1FCJA 1LSSA 2LDXA 4JROA 1V2HE 3KOOA 5JYCA 5LKAA 4LRYA 4EEKA 4LE1A 4LJRA 1QV7A 4BP8A 2YS7A 3LBNA 3GCXA 1WHTA 3GF4A 3VPFA 2QV7A 4RENA 2BFCB 1X7GA 5GJWC 4L4YA 2C92A 2OYCA 5EL0A 1QHHA 3ZLVA 4DLXA 3VR5D 5HZKA 2R97A 3AB8A 1NG1A 1Q3HA 3LLCA 5FUVA 5FBVB 3R3UA 1MJ5A 3OLYA 5DDIP 5DHQA 2BHRA 2EFHB 1IOWA 5KQGA 4X65B 2XUKA 1C3VA 4LEIA 2BH2A 2ET6A 4TM7A 1BG6A 1M83A 2OKCA 4JYPA 4WY2A 1HO3A 2AJBA 3RSFA 1OHHD 2HMTA 2LCQA 1KP2A 1B14A 1IBRA 3OC6A 3KJZA 1IXKA 1SU6A 1SXJD 3E5NA 3HN2A 4MMXB 4OMUA 4GF5A 4Q3NA 4XARA 5K99A 4GGOA 5HVNA 1COZA 3D4IA 3GFTA 3DOIA 2Q5EA 4MRPA 4LSGA 2IGTA 4LBWA 3S55A 4X62B 2FR1A 4ZK2A 5JNUA 4QVIA 2NT3A 4HFNA 1CUEA 3GLQA 2AX4A 2Q99A 3HDGA 5I7WA 3LX8A 4R8SA 4LDJA 3ZK9A 4JJIA 3RG8A 1MF7A 1SUCA 4G4SO 4YLYA 1S7GA 1HT1E 1K5HA 4QOEA 2VJDA 1K89A 5FH9A 4FFNA 4MYDA 3ZGYA 4NYIQ 4J16A 3ZDDA 5CIQA 1KQFA 1W46A 4FWBA 4Q4JB 4FTWA 3HP4A 5JNSA 4MIOA 3OMXA 4FZVA 4CMGA 2YXEA 4MV4A 2Y0BA 5KDLA 4ZN6A 4GWLA 3AINA 4HDMB 3BXZA 3DAHA 2WUFA 4Q21A 3DQQA 3T7CA 1C4XA 1PLJA 3JQFA 2HA6A 4QU8A 2R7NA 3UAGA 4DMHA 4EECA 3UEOA 1PK7A 4CV3A 5H02A 1M6EX 3C3EA 4H4DA 4IFEA 1N0HA 2AMFA 1VMEA 2OGWA 3BE6A 3HEAA 2VR1A 4H6XA 3HEMA 2PPLA 5LXTB 2RHLA 1VHLA 3D7KA 2CE2X 3HXKA 3LHIA 1Z6ZA 4U63A 4YFYA 1DINA 4GLJA 3IEXA 5C35A 1PJBA 1P3JA 1KOJA 1J5PA 4R98A 1SA0B 5LA6A 3TVTA 3EGXB 2H9IA 1I01A 4M0PA 4I4NA 4LKOA 1WBDA 2AJDA 1UOEA 3LPLA 2IYYA 4PX9A 4U8HA 1Z37A 3EPJA 1L5HB 4X24A 2DJ5A 3FBTA 2HJWA 3SZMA 4DR4B 2FW6A 5B2FA 1NVXQ 1JYFA 2XKBA 5ISMA 5BPHA 1ZHOA 3JS5A 2V7EA 4G6ZA 4PC7A 3ZH2A 1D07A 1NSFA 2B0JA 3TCXB 4R9NA 4XX1A 3A2KA 1TOAA 2XYQA 1MAHA 4YPOA 1UMDA 2D13A 3FTNA 4FDUA 4Y2YA 2C88A 3P26A 4R54A 1NVKA 2PX2A 3FPSA 1DQZA 3AERB 3S4YA 3AV3A 2ASVA 4PGHA 3COYA 3FPFA 4CHGA 4MJ3A 2QLLA 1QE0A 4I5EA 3TAUA 1Y6FA 1BX0A 1T29A 3JWHA 4NH0A 4MQBA 3R3ZA 4CLEA 5LP6B 2I76A 2A0WA 5C8YA 1KK1A 3D02A 5LXTA 4RS4A 5C5EA 4MVJM 2MYTA 1V16A 3V4PB 6AT1A 1TVEA 4FDMA 3KFVA 3R6WA 1M2OA 1NVUQ 4XGRA 1MAAA 1J6UA 3FVRA 3RGGA 3RU7A 3A6PC 4AUNA 4JELA 4XQ9A 1NW3A 1WV1A 3PQ4A 3AU9A 4GXQA 4LSZA 1EJ2A 5KYNA 3P5BA 3H2ZA 1HDOA 4X8OA 4X71A 2JHFA 1FSFA 1N57A 1RP7A 1TW3A 1Z0ZA 2NO6A 1JF8A 1FMJA 3E58A 3L8GA 3ZI4A 2CNBA 4CF3A 5A2QA 5F7XA 1OKKA 4J7XA 1HYQA 4IHJF 2QB5A 2R6GA 3GH1A 1MLDA 3AF0A 3OF3A 5FYQA 1OOEA 2BDUA 2KQUA 5CDGA 1JDNA 1FW6A 1VIYA 1UBFA 1SXIA 2JIOA 1U5AA 1JT9A 3F67A 4B4OA 5ADWA 4LWQA 2HBQA 1KC1A 3ECCA 3BAFA 4D44A 4EKGA 3W06A 4I19A 5JEEA 3AJ8A 1Z6AA 2PL5A 3P9KA 2V54A 1D4OA 1TKAA 3TL2A 2IXDA 3PX2A 3IP8A 4CLDA 2VXOA 1C1DA 5L8VA 3PG5A 2PKRA 2W8BB 4FFVA 2ZDGA 1QQ7A 2B8WA 1SAYA 1QO7A 2I8LA 3AR5A 3IEPA 3GYBA 3HCPA 3MBIA 4ND5A 1UM8A 2NIPA 1X8LA 3GARA 2JCYA 4LY9A 4BVEA 3JQ7A 4XGIA 3GLFE 4ZEWA 1CY1A 3DMGA 1HDRA 3FW1A 2H2FA 3L7JA 3MRSA 3QTBA 5AKJA 2IS2A 5KINB 4BFXA 1E1RA 1USIA 2HF2A 1A4IA 5J2TB 4COKA 1ADGA 2ODTX 1XT6A 3O4JA 4TMVA 2IKSA 1KZ7B 3O7MA 3BWCA 2H1WA 1XVUA 1PVOA 2XB6A 3A1WA 3RKRA 1P75A 1IQRA 1RRPA 1QRAA 1VMKA 2JJ8A 2RFLA 4HN9A 1RAIA 2XE4A 3H2KA 3C39A 2Q5JA 3TAXA 1P91A 1PJLA 3JRXA 2PUDA 4R9UC 1Z36A 1UKZA 2CXUA 2X9VA 3RYIA 2GCNA 1NM5C 4FZ3A 2GOYA 4HMOA 4RMIA 1JEEA 3DAOA 3QG1A 4GBJA 5AKLA 2ZJZA 3QUAA 5EZSA 3TZQA 4ZI2A 3K0CC 1OX4A 2EBWA 4BNLA 2I2AA 1W36D 1RPNA 2FG6C 3WRVA 4P5DA 2IWHA 2ODAA 2GKSA 2HLNA 1RAGA 2UXCB 3IIKA 4L4XA 5LQJA 1ISRA 1R4MA 1H66A 4X1YA 5EWJA 3NZEA 3DHYA 1FL9A 3CCCA 4HNSA 3TBHA 2Y9MB 1JE1A 2DECA 3PZRA 1T6YA 2FDXA 4IHJA 2GYWA 1OIXA 4J9UE 3SJCA 5JCJD 5KQSA 4C88A 2JB9A 1ZVKA 1PNTA 2G4VA 2BIFA 1KEKA 1ISGA 4ITVA 3IT2A 3ZQ4A 4D0GA 2RCNA 3D2CA 3HCOA 3M1YA 4PFQA 4Q4HB 3PR2B 4YJ3A 5DSTA 3WFJA 3ZHSA 2VEDA 4EY8A 4DE5A 2IIBA 1NMZA 1WOYA 2ZAGA 4GZ3A 1SQ0A 2Y27A 3R77A 1QRUA 4OLAA 2JLQA 2HWWA 2GBLA 3L6CA 5TMDA 3SVLA 5F9HA 1E18A 1YFKA 5CA1B 4IWNA 4BP9A 3EJWA 4HPWA 1TEZA 2EVWX 4CGZA 2PMFA 3NDPA 3DHVA 4I55A 3DXYA 3WGUA 1TPYA 4XLLA 5IJXA 3RUIA 5EUMA 4GVPA