2AN4A

Structure of pnmt complexed with s-adenosyl-l-homocysteine and the acceptor substrate octopamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
publication title Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2an4A00
5JR3A 2PX2A 5E2AA 1QAQA 1UIRA 3EGEA 3FUXA 1D2GA 4QPNA 3LX6A 4PYJA 1Q0TA 3FTCA 1JSZA 5H02A 2NXNA 3AWIA 2GLUA 5EZSA 3CJRA 5B1SA 1JG1A 2JHCA 1MHTA 4GF5A 3EEOA 5K0EA 4RTOA 4QPPA 1ORIA 3KQPA 4E33A 3DLIA 1M6EX 3TPZA 3PT9A 5ERGB 2LD4A 1HNNA 3DMFA 2GB4A 3FRIA 2PV0A 3B89A 1RI5A 3BWMA 4Y30A 1EJ6A 2ZLBA 4R6XA 3P71T 3OZSA 2EFJA 2N47A 1BC5A 1SQFA 3OCJA 4KWCA 5DSXA 5E8RA 3RODA 1JTFA 5KQRA 1XTPA 3BKWA 3NTVA 2CKDA 3FPHA 2P1DA 3TQSA 5DWQA 2GAFA 5BP7A 5FADA 4C4AA 4PYMA 1F3LA 1R74A 2BZGA 4RSRA 4RTJA 3FUTA 4HTFA 3FPJA 2ZIFA 1BKYA 4F84A 4YUZA 2OO3A 5T67A 5CUQA 3HA3A 1QAOA 4EQZA 4FSXA 2PSSA 5F2KA 3A27A 1RI4A 4PYLA 4AUKA 3BWCA 2NP7A 3BGIA 3CJQA 3NVKI 3Q7EA 4CTKA 4POOA 2DULA 3DLCA 3EVBA 3G8AA 1SUSA 2IBSA 2IH5A 3B3JA 1VP3A 2R3SA 1WS6A 1YF3A 4RTRA 3EMDA 4DKJA 1WXWA 4HTFB 1NE2A 3GJYA 3K6RA 3PFGA 5D1HA 3EMBA 3NW9A 5EIFA 3FPEA 3IYLW 4HRAA 4PONA 5EPEA 1T43A 3BGVA 2PKWA 1R8XA 3KPVA 4FP9A 5HIJA 5C9ZA 1VLMA 5T6BA 3KR0A 4H0NA 4V0QA 3KQVA 3EVDA 4E2WA 3KR2A 5CVVA 3V97A 1G6Q1 4ER6A 3PFHA 5EHGA 5GWXA 1R00A 2AOTA 2PX4A 4DQ0A 3KKZA 2FCAA 2JJQA 1EIZA 2BM9A 3V8VA 3GCZA 3EPPA 3EGIA 5HIIA 3M6VA 3X0DA 3LKZA 4EKIA 3U81A 3OZTA 2PY6A 3HCDA 2NP6A 1NW6A 2PXCA 1ZHFA 2ONZA 2OKCA 5DTRA 3VC2A 5M5BA 1I1NA 1VQ1A 3B5IA 2P40A 4K6MA 3ME5A 5MHTA 3KPYA 1SKMA 3OE5A 3R9XB 3G7UA 1KHHA 2AOXA 2E5WA 1B42A 5BXYA 4GEKA 5DM1A 5C1IA 2AOTB 4WXHA 3IHTA 4BP3A 3E7PA 2F8LA 5F2NA 5ICGA 1VIDA 2QM3A 4PYOA 4XUEA 5CVJA 4IWNA 4ER7A 3SSMA 2YTZA 3KQQA 3UJ6A 2FRXA 3FYDA 3OPNA 2GA9A 4OA8A 2P7IA 1I9GA 3KR9A 3HP7A 3E05A 1L9KA 2WK1A 1EQAA 3HCAA 3NVMB 3R0QA 3IV6A 4PINA 3WSTA 4CKEA 1YFJA 3GRVA 2UYQA 2IP2A 1ZG3A 5EVJA 2ZBPA 4M7RA 4AX8A 3KPUA 4P58A 1AQIA 3UJBA 3MTIA 1KYZA 1YB2A 1O54A 1R6AA 1RI3A 4FSDA 4E30A 4RVGA 3ANXA 3MERA 3DUWA 3O4FA 3OU7A 2C7PA 1L3BA 4M37A 2G70A 3A7DA 2P8JA 3JWJA 4QQNA 3EVCA 4GBED 2PJDA 5FA8A 4KIFA 3NMUF 2HNKA 3PS9A 1RI2A 5FA5A 1DCTA 4C05A 2NNWB 2XVMA 3HVIA 5IKMA 5EMMA 4LWPA 1EG2A 1EJ0A 1R18A 5FHQA 3OU6A 5ICCA 1G38A 2VDVE 3GRUA 2GH1A 4FZVA 5K0CA 3TR6A 3ID6C 2AOUA 3EVFA 4X1OA 5JUWA 2ZSUA 5LQRA 2ZBQA 1N7IA 2AN3A 3DXXA 3ELYA 4FR0A 5EEGA 4YV2A 4MQ4A 2HWKA 4YUWA 3BGDA 2B9EA 3JWHA 5CVDA 5K01A 2HR1A 3LDUA 2YR0A 4QDJA 1RJFA 3A25A 4PYIA 5EMKA 3UJ7A 2EX4A 4RV9A 1VL5A 4X60A 3CC8A 3EVGA 4PGHA 4RTKA 5FWAA 1L1EA 1XCJA 2NXEA 4GOND 4HG2A 3SSOA 2AN4A 3LCCA 4E2ZA 4P7FA 2AOUB 3GDHA 5GINE 4G56A 2I6GA 3FYCA 1FPQA 1JSXA 3UJ8A 2H11A 2Z6AA 3DMGA 2PXXA 3QOWA 3BXOA 2ZWVA 4R05A 2FK8A 1D2HA 5FUBA 5T64A 4UOEA 3THSA 4RTNA 2H1RA 5CD1A 5E9QA 5GOZA 3LECA 5K0FA 3UA4A 2CL5A 5BW4A 2IFTA 1EAMA 4OQEA 3LDFA 4MTLA 4PCAA 4ER5A 4BY9E 3FUVA 4WVLA 3DP7A 4DZRA 4HC4A 3P9CA 1ZGAA 4JXJA 3REOA 4E70A 2ADMA 4PCLA 4KRGA 4MWZA 5DXJA 5LQJA 2YXDA 5DT2A 3HCEA 3LCUA 2C7RA 2PXAA 2CWWA 5K8VA 3AY0A 4Z2YA 4XUCA 2BR4A 4GC9A 5P8WA 2ZBRA 2JHAA 1XVAA 1H1DA 3KQMA 5E1DA 3M6XA 3E23A 2O57A 2YVLA 5G02A 1JQ3A 4YV1A 2DPMA 2IIPA 3C6KA 3P8ZA 4LG1A 1G8AA 3T7RA 4EKGA 2OBFA 3A26A 4CTJA 3GGDA 4E2YA 3MAGA 4PNEA 3C0KA 2IDKA 1WXXA 2ESRA 4GQBA 4HGYA 5CVEA 5LQNA 2IBTA 3ORHA 2AR0A 2BM8A 2YX1A 4GOMD 4FT2A 4PYQA 5HIMA 5EEHA 4DM3A 3TFWA 3LSTA 5CVUA 1U2ZA 7MHTA 3TOSA 2VDWA 4R8RA 1SG9A 1OR8A 3TM5A 3CCFA 3CGGA 2AOWA 1QZZA 4EMSA 5GIOE 1RJDA 3I53A 1L3CA 2IPXA 5DX8A 5EC8A 1VP9A 2OYRA 1NW5A 3UWPA 3UJCA 3M70A 4M38A 1SVUA 2OY0A 4RTPA 4HH4A 2ORED 2Q41A 4RVDA 5GM1A 2OPBA 3C3PA 1M0EA 1AF7A 3HCCA 1KPIA 1RI1A 3NWBA 1YUBA 5E9JA 3P9KA 2O0LA 5LQKA 3HVJA 2C7QA 2JG3A 4CWAA 3B3GA 4BP1A 3MHTA 3MCZA 2Y1WA 3SX0A 3VSEA 4C07A 3L8DA 2UYCA 4E31A 4F85A 4E2XA 4QQKA 3LKDA 2BH2A 1HMYA 1UWVA 1D2CA 2PT6A 3FPFA 3FTDA 3KQTA 1N7JA 3H2BA 3ELDA 3Q87B 3GXOA 4OBWA 3UJAA 5E1BA 3P97A 5FQOA 4KDCA 3M6WA 3G89A 5CM2Z 3GWZA 4RVHA 4RVFA 5ICFA 4CKCA 1JR4A 3A4TA 3M6UA 3R3HA 2AOVA 3LHDA 4IKPA 4QTTB 4EK9A 4YUXA 2A14A 4X63A 1PRYA 1QAMA 2PGXA 4PIMA 5DSTA 5EHIA 4RTQA 4ISCA 2K4MA 4HGZA 3F4KA 3KQSA 3T7TA 5E1MA 4ZTBA 1NV9A 4PIPA 5FWDA 3M4XA 3HCFA 1NW7A 5DLYA 2R6ZA 2PX8A 5EGSA 4QTUB 3KQYA 2ZZKA 3BZBA 4P7GA 4GUAA 1AQJA 3FTFA 5K09A 1JG4A 3O7WA 4PGGA 1BOOA 5EKUA 3SMQA 1F38A 2IDJA 3MQ2A 1FP1D 5LR6A 2UYHA 5CCXA 5E9WA 1QANA 2PBFA 3M33A 3QV2A 1P1BA 5EQJB 4IV0A 4ATNA 4X41A 5E8JA 2ZFUA 2AVDA 4FGZA 4PYKA 4AZWA 3ELWA 3KQOA 2WA1A 2GPYA 3G5LA 3FPGA 9MHTA 2UZ4A 3SSNA 3C6MA 2IH4A 4QVGA 2EJTA 1QYRA 5FHRA 4BLWA 5HILA 2ZVJA 3UJ9A 3UZUA 3NDIA 2IH2A 2O06A 5FCDA 2QRVA 2ZWAA 3A7EA 3G2QA 5GIPE 2ZIGA 5EMJA 5BW5A 3OU2A 2JH8A 1VBFA 1M6YA 3DMHA 3R6TA 1RJEA 2B25A 2PVCA 2P3OA 2ZW9A 1KXZA 1TPYA 2KW5A 4NECA 3FRHA 1JQDA 1NBIA 2V7EA 1WY7A 4R6WA 2B3TA 3LPMA 4XUDA 4YUYA 5LQUA 1O9GA 3KR1A 1INLA 2PLWA 10MHA 3FUUA 2G8NA 3CBGA 3I58A 4KIGA 1SUIA 3THRA 2FHPA 1KP9A 2NXJA 3KPJA 4KVZA 2P3QA 2XYQA 4ER0A 4GOOD 2AS0A 2QRVB 1XXLA 2GS9A 4BLVA 4OQDA 2ZZNA 2H00A 1PJZA 1JTEA 4MIKA 3P2EA 3LDGA 3TRKA 2QE6A 3HEMA 3B7PA 5KQSA 3T0IA 2ZCJA 3BKXA 3AXTA 3PX3A 1N2XA 4XCXA 1WG8A 3ELUA 2QY6A 4R8SA 3PVCA 3G2PA 1JQEA 1X1AA 4OX9Y 2CMGA 4U7TB 3CJTA 3OFKA 3EGVA 4QDKA 3D2LA 3AXSA 3KQWA 5D1NA 5FULA 3DH0A 4FS8A 5U4XA 4C03A 5HOQA 4C08A 1AV6A 1SQGA 5FQNA 4RTMA 1YZHA 3AJDA 4PYNA 4OA5A 5KVAA 2HTEA 4DA4A 1Z3CA 5HEKA 1FJXA 1DUSA 3G2MA 2CMHA 3G2OA 3HTXA 2P35A 3E8SA 4E32A 1FP2A 1V39A 3HA7A 3VYWA 3ER9A 2WA2A 3EEYA 5K0LA 2VZ9A 1IM8A 2EJUA 3BWYA 3GO4A 2P3LA 3TM4A 2PT9A 5E2BA 2O07A 4DCMA 5DXAA 2QYOA 5KYGA 2XYRA 4RYLA 1VE3A 2AN5A 3BUSA 3DTNA 4AZSA 1XJ5A 3LL7A 5C0OE 2NYUA 1KPGA 1X1CA 5DM2A 3UA3A 3IEIA 3KHKA 5GP1A 4DMGA 4LECA 4GC5A 3DULA 1X19A 2EG5A 5DTQA 4C06A 1G55A 2FYTA 5LSAA 2G1PA 3LBYA 2YUIA 3HVHA 3P2KA 3T7SA 3VC1A 5K0JA 2ZIEA 3EVZA 3NWEA 4GOLD 5CCBA 5LQCA 2ONYA 3GNLA 3NJRA 3I9FA 5IH3A 4OBXA 3G8BA 1IXKA 3SM3A 1R8YA 3SR4A 3SVZA 5LQAA 4AZVA 4A6EA 2I9KA 1XDZA 1NV8A 3DXZA 3GIWA 3HNRA 4O29A 2AZTA 5EKXA 5DX0A 1XCLA 3GRYA 3P2IA 4IV8A 3LBFA 3MGGA 1G60A 4AZTA 1X1BA 4MHTA 5K03A 3GRZA 3G5TA 3MTEA 4KW7A 4F86A 5HIKA 5HZMA 5DM4A 1VPTA 3RW9A 4X61A 2PWPA 5DTMA 3KPWA 5F2OA 3B3FA 3PTAA 3SXJA 1JG3A 3HVKA 3BWBA 2IGTA 2BR5A 4LWOA 4Y2HA 1JG2A 5K0BA 3SGLA 5E1OA 1ZGJA 3P9IA 3DOUA 2B2CA 4ER3A 1P91A 3OFJA 1KIAA 1TW2A 2AVNA 2ZZMA 3DXYA 3O31A 1KR5A 1NT2A 5DRYA 3MCTA 2P41A 3KU1A 2XVAA 2Y1XA 3BT7A 5DM0A 3S68A 3EVEA 3TLJA 1NW8A 2OB2A 3PB3A 1YZ3A 1O9HA 3I64A 3TKYA 1ORHA 3MB5A 2PWYA 4FT4A 1NKVA 3UJDA 5K0GA 5CIYA 5K0NA 4EVIA 2OZVA 4L7VA 1I4WA 1X1DA 2VP3A 3QOXA 2PX5A 2ZTHA 4RX1A 2XBMA 1IY9A 3G88A 2O05A 3LGAA 4DCGA 4DF3A 1KPHA 1YFLA 1FBNA 5EZQA 5EG5A 2P7HA 3CVOA 4P7KA 5GM2A 3ER8A 1ZQ9A 4KDRA 1NW3A 5DRTA 3HCBA 3FUWA 2VS1A 5DX1A 5DPMA 4V0RA 1XDSA 4PWYA 3TMAA 1MJFA 5KS2A 5K05A 4RTSA 1NBHA 3FZGA 4C04A 3GRRA 1RJGA 4HSGA 2HV9A 5EMLA 5EIWA 8MHTA 4U7PB 2Z6QA 1DL5A 3UFBA 4YV0A 2G71A 1XDUA 3PLAE 2YXLA 2G72A 3K0BA 3GU3A 2Z6UA 5ICEA 2OXTA 2ZULA 3JWGA 3RIEA 3TKAA 4BLUA 2VDUE 2V74B 4RTLA 3ERCA 3FTEA 2I7CA 2YQZA 3HA5A 3P9NA 3PX2A 3UBTA 3DR5A 2HMYB 5HFJA 2C7OA 3I5UA 4QVKA 4YUVA 2OB1A 4B17A 5EOVA 1P1CA 2YXEA 4CKBA 4YMHA 2JHPA 2BR3A 2NXCA 5FTWA 4CXMA 1L3IA 1KYWA 1UFKA 3EVAA 3NDJA 4A6DA 4RWZA 2B78A 3LCVB 1BHJA 3OZRA 2I62A 2UYOA 3R24A 2ERCA 2FPOA 1G8SA 1ZKDA 1P39A 1Q0SA 2FK7A 3C3YA 3HM2A 4YMGA 2JH9A 2XYVA 1TW3A 4P7JA 3JWIA 1WZNA 3OE4A 3CKKA 4M36A 1Y8CA
chains in the Genus database with same CATH superfamily
1M75A 4HDRB 3K72B 3FFWA 4GLOA 4X00A 5F1YA 2QYTA 1QVAA 3FUXA 3PA8A 3H5WA 3HLTA 4MW5A 1IXSB 4H6VA 3IXQA 3NH9A 4OP2A 1DKQA 4QYIA 1XCMA 3T7IA 2GLUA 2ISSD 4G97A 3PLNA 3ABOB 1NQUA 4QTYA 3T1QA 3OQIB 4KYIB 3SLKA 4MRPA 4HAOA 5HWSA 1FFAA 4LW8A 1TPZA 2W37A 1BE0A 1TVKB 3FFTA 2VNSA 4JN6B 2HM7A 3X1KA 5FPKA 3C5CA 4G9EA 3JCZA 3IBYA 2EWWA 4UBIA 2SHKA 3H1AA 3DMFA 2O7SA 5BSGA 2HCFA 3ZX4A 4ZTUB 1VMKA 2QKYA 1EJ6A 3CLSC 3LBAA 3P71T 4PHFA 4LGYA 4B6EA 1YZLA 1J97A 3RU2A 1LF0A 1Q21A 3WGNA 1P5HA 5BUZA 1JTFA 4XASA 2R25B 4LQ4A 1ZRMA 4A6PA 1EUCA 2VOEA 3E70C 5C1DA 5T5QA 2P1DA 1T5LA 2XNSA 3QVXA 5FUVA 4GR4A 3DBLA 1Z6PA 2BZGA 5AJTA 5D87A 1E61A 1Y48E 4HTFA 5HUHA 1E5XA 2GN0A 2R8PA 3FN4A 2FX5A 3T0FA 1GCIA 1S7CA 3O4RA 2QOEA 2CE7A 3CZPA 4J0EA 2PSSA 3HYCA 2BFDA 2UV8A 3TB4A 1Y9EA 1B16A 1IYZA 1RI4A 5K3FA 2HF2A 3UWKA 3M6IA 4BBJA 2OC4A 4NATA 2Z9CA 4TKMA 3UY4A 2NTVA 1HNZB 2ZR7A 1FDVA 3C3XA 3AFOA 5LKRA 1DWUA 3DLCA 4D02A 1RQGA 1MB9A 5PNTA 4L0QA 2AD1A 2WUVA 2PWBA 3MILA 3MWYW 4ZEVA 2H4JA 1CS4C 2A30A 3I4CA 3QTTA 3TIIA 4F11A 3QX3A 4YACA 2A0FA 1N78A 3RSCA 1E1MA 4K2HA 2YN0A 5BNFA 4YRBA 1KNXA 2B8NA 4AS3A 4X20A 1KY3A 1TAHA 2QENA 4EG6A 4ND7A 5JH7B 3IEVA 1KQGA 1OLSB 1HNWB 1W6UA 2EGUA 4E7OA 1X3LA 1GNSA 1L4GA 4OHPA 4B7AA 2DBVO 2ZYTX 3HA2A 3K0CC 3PDCA 1R0YA 4EVQA 1L5RA 1OZFA 1ETUA 4YDSA 3VFDA 4C05A 1MJ5A 3OCUA 4DV2B 5J2TF 4F4HA 3QA3E 2NX2A 1F2TA 2O3TA 2QUHA 5JBNA 5L3QB 1TQ2A 2B1GA 2OAGA 4B2YA 1CEQA 1C1DB 2ZI5A 1HV8A 4LYAA 1RD4A 2QB5A 1L7VC 1L4YA 2VDWB 2Z43A 1Y4DE 4KMSA 2HIMA 1L2TA 3EGCA 1R37A 3EXEA 1VG0B 4OY3A 4LYJA 4BNWA 5JSZB 2GF9A 5CLIA 4BU1A 1CJBA 3R9XB 1JI3A 3NV7A 2ADFA 2WJVA 2RHLA 3WFJA 3F2VA 1UJ4A 3O3NB 4MVJD 2CXNA 1GXSB 1OZ0A 1ZYUA 3E7PA 4Q4AB 5ED4A 2O59A 1JGTA 1E79A 4PYOA 4Q3LA 1B2RA 3BFJA 5CB4B 2GETA 3T9DA 1XVLA 4YA6A 5D7BA 4IFBA 5KB3A 3NIFB 5T8KA 3ENZA 4P33A 2P7IA 2CFRA 3MGBA 3PXBA 3BXXA 2WK1A 1OFVA 1DO2A 4IDCA 3KAKA 1Y4AE 4O2AA 4OBBA 4HDOB 4GKJB 3NG1A 2D3WA 4QAQA 3TRHA 1RZRA 5IKOA 3TOZA 3AR8A 2ZBPA 4M7RA 1A2BA 1SBZA 3ED1A 1UBMS 4IIJF 3UV7A 4DW8A 4ZI3A 2R0QC 1T6XA 1KYZA 3G9ZA 1MX3A 3M4YA 4CF6A 3HSYA 3AETB 5IHXA 5FOQA 4OXRA 3O4FA 5TVKA 2PD3A 5J9FA 3INYA 1DC6A 1DEHA 3L49A 3TLZA 5KSWB 2H59A 4Q66C 4YQFA 2DEUA 5EYPB 3AHHA 3KX2A 3GCDA 2CJYA 2F1IA 2G83A 4DNXA 3ZH9B 1GR0A 1X94A 2EZ4A 2FW1A 2J3KA 3I9V6 1VHJA 4EKEA 5C2JB 4ZGBA 5EJ4A 2CMDA 3OCCA 2ODEA 3NAMA 4URXR 1CUXA 1QGUA 2BGMA 3PKZA 2EFHB 4EYOA 3N53A 2R8BA 2ZVPX 4CDMA 1JLHA 2ZBQA 3HYTA 3AUYA 2B4TO 3MCUA 1HE2A 3NC1C 3AL3A 1RS0A 1WAMA 3O8BA 4RPCA 2YINC 2MYTA 3BGDA 4D4HA 3CE6A 2YR0A 4FD3A 3WFIA 1CZNA 2OILA 3RIYA 4MCHA 3UJ7A 2R66A 2ZSFA 1UBEA 3DE5X 4FDAA 4PQFA 1FXUA 3OTQA 3VX3A 1RLMA 2XTMA 2BFMA 4OKSA 4E2ZA 2OL4A 1VTKA 4YO8A 1M6VA 2PTGA 3RLIA 3HY6A 5A4AA 5KDDA 3X2SA 3BD6A 4I1SA 2PXXA 3WE7A 2V8BA 5T64A 4DWOA 2WUEA 1VECA 3HPQA 4QGBA 1DAFA 1QG0A 2IKQA 1H1TA 2ZRIA 3D1VA 4RS3A 1MO5A 4B33A 2UXCB 1SWVA 2X86A 4N3CA 5I9SA 4WKPA 4AZ3B 1T24A 2FRVA 2IYWA 3AF4A 3MLEA 1ZUHA 2A59A 2V7TA 5I9IA 5BNZA 1JDVA 5I5EA 1K68A 5AVKA 3PNBA 4EYEA 4A7PA 3EBPA 3WGTA 2EERA 1OSNA 1X13A 2W22A 1MIOB 2D4AA 2C7RA 3AKYA 4UU8A 3EISA 2YFKA 1GL6A 2DFTA 3ND5A 5AJHA 3S2GA 2J6CA 2D0PB 2WKSA 4HDKB 2WSIA 3S8EA 4W5OA 5DK6A 1P6QA 1M2VA 2CLSA 4AJOA 5CEJA 2YVLA 3ND6A 1J0AA 2QGNA 4PSCA 3QBJA 3DVAA 3EWAA 3E18A 2I29A 2EQAA 3E27A 1BCRA 4PNEA 1HA3A 1N36B 5HRUA 3OKCA 4N7JA 1HWYA 1UBSB 1I4EB 3AILA 1GGMA 2WJJA 1OLXB 4IH9A 2X1MA 4OATA 4OG2A 3TFWA 4A15A 1QH9A 4K9KA 2Q07A 3LSTA 1E5LA 2FMXA 2FZEA 3LGXA 5TEWA 5JV5A 1NOKA 2H57A 3A6KA 4K8OA 1ZY2A 4MB6A 4L78A 2C3UA 3TVYA 1QVZA 4BU0A 1QZZA 4BZWA 1GY8A 1UBKS 3AEUB 4HMQA 5DX8A 3TSCA 1VP9A 3UWPA 1W5SA 1CQIA 2OY0A 2BKAA 1LPOA 2VPPA 4TTTS 5LYYA 2OG2A 3ZWNA 1OB5A 4MV7A 3OLQA 3O4VA 5BORA 2BT4A 2CF6A 2HRQA 2XNKA 2XDQA 4BWYA 1UAGA 3M81A 1DELA 3M6FA 2ZXEA 4F4UA 5EUQB 3DZGA 5K3OA 4IZOA 3UWMA 2R85A 5TQJA 3L8DA 4B43A 1TU4A 1MT3A 3P9YA 3F47A 5CD9A 3MRTA 4OFWA 4JXZA 2IZ0A 4X5OA 4GL4A 2G0AA 4KTTE 3SC6A 2PT6A 1PJCA 3NBZC 2I6FA 4OI0A 3E3MA 2JJ8A 3T34A 4CM3A 4AC9A 4PGAA 1ADFA 1RHKA 1QNLA 2X5JO 4ZI7A 5H16A 2Y1FA 3CR3C 3NBQA 4M9ZA 1A9ZA 2ZJ4A 3B3AA 3TH5A 3ZVNA 4TQAA 1RPTA 3SZGA 2DHEA 1E9SA 2DSTA 2EHJA 3P20A 1JIVA 3L1JA 4ISCA 4P31A 4QHSA 4YRZA 5C5IA 1Q50A 3ISJA 1SU8A 2X1LA 2E7ZA 1T4CB 3D5QA 2GN4A 2OORC 3UAYA 5CFNA 1RLUA 3LVQE 4PR0A 4AROA 1FTGA 5E6RA 2GCIA 3C3DA 4B3FX 1TQ4A 4HZUA 4HH1A 4MOWA 3KNZA 1YHYA 1J6UA 1TM3E 4ZZIA 5AVZA 2RMKA 2WICA 1PQ4A 1XWWA 3JD1A 5F2EA 1K1EA 2GPSA 4HRXA 4MWOA 3VMMA 3ABZA 3HDYA 1TEZA 1K89A 1JXOA 2GF2A 1WUTA 3KKMA 4ATNA 3QNUA 4PRLA 4YMVA 2JHGA 5AOBA 2AHRA 3E6AA 1AS2A 1GKKA 1ZESA 1Q1BA 5ES4B 4P4GA 3RS3A 4ZAXA 1CUHA 3C6MA 3BE6A 3AK4A 1M54A 1E4YA 2G4CA 5DHSA 4LXQA 5TJHA 5SY6A 1E18A 3UZUA 4LZOA 4BO4A 3P94A 3X2FA 2HIHA 2VZEA 2JRCA 1SULA 2OZEA 2R8EA 4WZBE 4CIXA 4I4NA 1KRHA 1DT5A 4BJ1A 4C43A 4AICA 3RFCA 1M8KA 2RHOA 3H2SA 4XYMA 3TLKA 4EJSC 4BPRA 1ZPDA 2BFEB 5JVDA 1XTZA 1KK0A 2BONA 4D41A 3RT1A 4DR6B 3QE2A 1JAYA 1GZ7A 2H2DA 1QRRA 3N58A 4MV3A 4CU2A 2PUCA 1ETHA 521PA 1EP2B 1W4BA 4BBPA 3AR9A 1Z0UA 4TMVA 2QTMA 2WJWA 2I7TA 3ZCQA 3BEOA 4MIKA 1S8AA 2UKDA 4G1FA 4GM1A 2Z04A 4J49A 3VR4H 3L82B 1DKLA 1RSZA 5KNDH 3EAGA 1RRCA 3DLBA 2QL5A 3E8XA 3QTLA 3LQ2A 4ALJA 3R5TA 1WZUA 4W99A 4UM9D 2QT9A 2W2XA 2A1TS 2FMHA 4ZVQA 3DDSA 4K7JA 2QYSA 5KJEA 4EHJA 3BH0A 1H0HA 1Q1ZA 4TXMA 3D2LA 1OF1A 4DV1B 3Q8KA 5GPBA 1E3WA 3HACA 3EB9A 1KEZA 3ZE1B 2FVYA 1SQGA 4GRIA 4BP9A 1JHVA 4YRAA 1V8DA 3KOZA 5FOTA 3GGGA 3K0AA 4IXWA 3UGTA 2VXCA 1BEEA 2LRHA 5AVYA 1FP2A 1CZLA 3MMSA 3PUYA 4OI2A 1YR7A 1N7HA 5U1PA 4EG3A 4O08A 5T7BA 1XEAA 3LHIA 2WWTA 3GJ0A 2I34A 3D0OA 1V8OA 3FHJA 4REOA 2FSIA 2J9RA 4HX9A 4KQ2A 5BMVF 4H16A 4C3OB 1MAWA 3SYTA 5KTSA 1Z2PX 1R4MB 2JI9A 2YH2A 2HO5A 3OA0A 2EG5A 1KOLA 4JKOA 3ZIAA 2AFHE 2P6OA 2YUIA 2HK7A 2IOFK 3G2HA 4J43A 5CB8A 2C9OA 5LYJA 3AYXB 1Y81A 4FX5A 4HAXA 4MJXA 1UXGA 2RGUA 4BLPA 4BQPA 4NCKA 5IUNC 3NJRA 1A77A 2VJDA 4MW9A 4Z1MA 3UV6A 1LF5A 1TKBA 3D9QX 4RDIA 2OHFA 4D2IA 3WXMA 2F4NA 4A6EA 3PGMA 4FJ1A 2JLXA 1IN6A 1KEPA 5I9MA 4D99A 1UADA 3MGGA 1X38A 4N3BA 4YP1A 1FNCA 1ZK1A 2V6GA 4X8HA 3BFVA 1WULS 1H94A 4TZ6A 6GPBA 2RH8A 5EE1A 2BR5A 1ESZA 2J9FA 1T25A 1NNI1 1LH0A 2Q5JA 3WGZA 2EIHA 1G5RA 3BQMB 4K9PA 4UZEA 4PG8A 5B12A 3E53A 3TYXA 4V1CB 1KWGA 2VHWA 3SS9X 2A2ZA 5CGQB 4YJ2B 3O31A 3FBWA 4M88A 4P4LA 5KSYA 4GMDA 2C61A 4JASB 3OQPA 3OFND 5JYDA 2RAPA 3AM3A 2V98A 2WYUA 4G5YA 3UMJA 5A03A 5JATA 1DRVA 4W9MC 1RRVA 3QX9A 1X1RA 4TVKA 1A98A 1E8DA 3RSSA 4YT2A 5FWXA 3HPRA 4Y3UA 2Z98A 3R3SA 1OA1A 2IHZA 1E6WA 4DNPA 4EVIA 5A6SA 3K6KA 1QQBA 3AZOA 3L6DA 2AFHB 4ROTA 4DJJA 4RPJA 4HDCA 3VVMA 4MKRA 3FR8A 3R7DA 1KPHA 4HH3C 3AG6A 1O6FA 5CM9C 3H6HA 5AHWA 2PANA 1IMJA 2P7HA 1S6YA 3MJDA 4X85A 4EG8A 1NW3A 1RWMA 2JLZA 2C4TA 2W8BA 2YCBA 2V3CC 4QM6A 1P2TA 2ADOA 2IPNA 5FI0B 1NMQA 4PWYA 5KOYA 1GQYA 4M0PA 2YIVX 3P45A 4FFWA 4S3MA 1X15A 3TW6A 2P5UA 3NALA 1T5IA 2OR3A 2HJRA 3RVSA 1QE5A 5KDOA 2HV9A 5DN6A 1Q2XA 1RQXA 3NAZA 2VHCA 4JU9A 1O6BA 2Y8EA 2WYWA 2ZSKA 3VO2A 2WI8A 2DPHA 3ZWWA 3ETLA 3JWGA 1W36B 2FUKA 3CNNA 4BKRA 1T6BY 1K7SN 1SXHA 4KXQA 3CN7A 4KACA 1QHNA 4F2DA 5A4FS 2YIMA 3BK2A 2WD7B 1FYVA 3GFSA 3PYMA 4RADA 4RF5A 3TZ6A 4DZTA 1P1CA 3KXDA 3TL6A 1FX0B 1GR1A 3GN2A 3URKA 3O95A 1FEZA 3EY4A 3K6SB 2XX3A 1V6SA 5I7SA 3DHNA 3OMXA 3LCVB 4KYTA 4RF4A 3TO5A 3UH0A 1T1RA 2FZWA 4DIUA 4J07A 4PQYA 3LOUA 2JGDB 3HADA 1K8RA 3DE4X 1C14A 3SQOA 2LCIA 3WC4A 4DJ5X 3K9FC 1KWKA 4FR2A 1TM2A 1AUOA 2G63A 1X77A 2HDOA 1XZHA 3K9WA 4NE7A 1BOFA 3MGCA 1PFQA 2QMUA 3L0YA 2CNWA 1XYGA 3ZXXA 2B6NA 1A9OA 1MG0A 2M98A 3BXHA 3NTOA 4WI1A 1N0WA 1ZC3A 3HDTA 3RK4A 1H2EA 1UMCB 2FE1A 1O8BA 3K53A 3CJRA 5HE9A 4ZIRB 3NZEA 3GLKA 4LF5B 4FOTA 2IHBA 1Z6XA 3DF9A 1TKAA 1N1EA 1A5BB 1YBVA 1GAEO 2VJBA 4KO4S 5ESWA 2Q46A 4E5MA 2Q0QA 4NOKA 4JB2A 5JQWA 5FLEX 4UVGA 3DEJA 3YASA 5M2QA 2BDEA 2HBQA 5BSMA 4QOHA 4B82A 5FA6A 1EFCA 1FQWA 1T0UA 3FAZA 4KWCA 4MJLA 4O2BA 1OHHA 3RODA 4MVJI 5JU6A 3FSRA 1AZLA 1NM5C 4KZPA 2OD7A 1LDEA 1AHHA 2X3UA 1PVVA 4Q18A 5DLEA 1JKXA 3T5AA 4MW6A 4UXJA 7YASA 3KP1A 5DWQA 5EE9A 2IPLA 3WK7A 4F8YA 1P9NA 3Q88A 4C4AA 3L8HA 3PNQA 1ULUA 2B94A 4J7XA 1OW3B 1NP7A 4GDMA 3P27A 4B6RA 5C1OA 4KI0A 2XNDD 3QG5A 4FMDF 4V2IA 3L7JA 3LY8A 2CHEA 1W44A 1C5KA 2FNAA 2GVDC 2C0CA 2IHUA 4OSPA 3WL3A 5AM2A 2UU9B 1DIHA 1APBA 3K09A 2QW8A 2RBGA 2GLXA 3ULKA 4M1QA 1UWKA 1H6AA 2WTEA 1G5PA 2VNKA 2VQ6A 3BGIA 3FGZA 5K4GA 1SKQA 3TD2A 3K70C 1Z7YA 2HU5A 2PEYA 3G8AA 2BSAA 4HRVA 4TLAA 2PWAA 4ZT2A 5IJWA 3QKIA 3ILVA 1U5CA 1SURA 3FJ1A 4LJKA 4C0WA 4EHBA 1B0UA 2R3SA 1WS6A 4I1UA 1EHCA 2CNBA 5JD6A 1OV6A 1UPTA 4WLOA 1C2YA 4IDDA 1UF9A 4DKJA 1YVEI 4F6LA 1IZ9A 1T3TA 3FFAA 4OHBA 5H0IA 3RTAA 1KY2A 5JCXA 2CFIA 1JZTA 2YWGA 1BSVA 2Q1TA 3U7QA 3AVPA 2E4XA 2OBBA 1AKQA 4B3DA 1Z15A 1FDOA 1OH6A 5T6BA 1YVRA 1UMBA 1NUAA 1U3TA 3TNDA 1GSOA 1C80A 4WUTA 5IARA 2A67A 2R2GA 1UK7A 2QXYA 4GXTA 5HP4A 1NQOA 4GE0A 2A9PA 2IYEA 4PSVA 2O5EA 2QNIA 1R00A 2F59A 1MFPA 3TZQA 3R5FA 2AE2A 1AE1A 2X5KO 2BM9A 1TGYA 1SU7A 4HBZA 3KJQA 3V7FA 5BN3A 5HRAA 4QXRA 4IS2A 1GGFA 5K5EA 1E3IA 4MGIR 2LP4Y 2RGDA 2HB6A 2CUZA 3PQCA 2ONZA 5K4HA 4QLAA 1WD7A 3B5IA 3IIKA 1P0CA 4FEAA 1GFIA 1LCIA 5EESA 1DI0A 3KKKA 1WVGA 1G8JA 3Q8MA 3E58A 1E4VA 1NF8A 2JH3A 3D8BA 3T0GA 3LVBA 2ZI4A 5TV2A 4GKKB 3NX4A 2AXEA 8OHMA 2B61A 3EXG2 3PEUA 4I50A 3VPFA 1LI5A 3ZU6A 4CMHA 3ROGA 4QYWA 5DM70 1YULA 1U9JA 3FVVA 1WNTA 1KI7A 2W00A 2JD0A 2PQMA 3B38A 1YJQA 3KR9A 2RK6A 3WL8A 4C08A 1HQDA 1SQ0A 1VKJA 2OOSA 5B1DA 3A14A 3LU1A 5J5AA 1IVSA 3H3XA 1P1KA 1LBSA 3RUDA 1NLUA 1RHRA 3SX4A 3IKLA 4KBYA 3C8DA 1WMSA 1D1TA 5FL7D 5EHXA 3K1JA 1YB2A 2AG6A 1OX5A 5EKDA 2QMEA 5BOSB 3JYPA 2VWHA 1O89A 4KAAA 3WYBA 5I01A 1T2FA 1MVOA 1L8AA 2B1RA 4W1QA 3T4XA 1CDDA 2CNOA 2HNKA 2IS6A 2D5AA 3MWGA 3TFOA 1TZMA 2DPGA 1X7DA 1SAYA 1Y9AA 2IYFA 2NNWB 2PUWA 1EG2A 2DM6A 2P2CA 4MLPA 1G5QA 1I80A 3V48A 2Z2IA 1E2DA 2MMGA 4BFCA 1BX0A 2ZTUA 1KEUA 2FQYA 4HYTA 3GFTA 4MAFA 4XFDA 1JEAA 1SNYA 1U2GC 2JKVA 2PS9A 4QU5A 3T12A 3EGWA 1ND6A 2DQ4A 1Y8QB 4MYCA 3H6KA 1EI9A 3GJZA 4W9NA 4MW2A 3QJYA 4QODA 4OHXA 3CVVA 1NMEA 4NPAA 2ZT5A 1UKAA 4NY1A 5L4SA 4EPWA 5EUMA 4EX6A 4HNTA 4JWKA 2XW6A 3RVPA 3S81A 4KQ9A 1VRCA 3TJZA 4F9EA 2EX4A 4RV9A 1U31A 1Z82A 1ESDA 1L1EA 5ALPA 3ZZ0A 4AJ4A 3W4JA 3ETCA 1JALA 1WLYA 4UU0A 4IW3B 3LCCA 3FDJA 3KUDA 5CW2A 4QGFA 5T6MA 2M32A 2OXFA 3MJSA 2GUGA 4FEGA 4MZXA 1ABEA 2KWIA 3BXPA 5HUJA 2FK8A 4F0JA 4KXMA 2JAPA 3L6OO 4AW9A 5JZ9A 4NZPA 2J67A 5SZIA 3AYZB 1V5GA 2G3YA 5EIBD 1U7ZA 2CFCA 3ANYB 4CIYA 4KQXA 4KX5A 3IUQA 1VZ3A 2GYVA 4MRSA 3ZDQA 4HRYA 4IF6A 1S2DA 4E70A 2R68A 4PCLA 3LUBA 2IEYA 3VSAA 3W34A 1G3MA 2JFWA 3BVPA 3WQQA 1N32B 1COWD 1JHRA 1GITA 3D8NA 3GMDA 3GUZA 3KSDO 4IHJF 3DEAA 2OV4A 2DGDA 4NDNE 4JT8A 3RTBA 4AQDA 1NXSA 4P2GA 3M6XA 4Q1FA 1UQUA 4ZVNA 3CUEF 3F7OA 3LQ4A 3K92A 5BN4B 4OJQA 1YAHA 4PBSA 2YQ4A 3T7RA 3W3ZB 5KWSA 3FJYA 3OJOA 1JL3A 4UZSA 3P0EA 4RHXA 1DOHA 3SICE 3LWBA 2GYUA 3OT4A 3BJEA 4V0LA 5E9AA 4R81A 4B74A 3Q8LA 3Q11A 4XPIA 2CY0A 1SQ5A 3H2GA 4MRMB 2O1WA 4DDVA 1MH1A 2RG7A 4OP1A 1MXFA 4GYYA 5L3RA 4GKAA 4UMVA 1ZAKA 4P98A 2H1SA 2HO4A 5IKEA 4BV8A 5JAMA 2I6XA 2WB2A 4EMSA 4UAGA 3M3HA 3I53A 2QTHA 5GIOE 4B84A 3FYUC 4E11A 4UCWA 4DTCA 1HE5A 2I0FA 5LMCA 1E64A 1MV5A 4PAWA 1QV7A 5A7FA 4B35A 3FGOA 2ZJOA 3COSA 5GM1A 1C7RA 1I2AA 4NI5A 1S4QA 3K2IA 4XYEA 5LQKA 4ENTA 4WLUA 1ZKMA 4BNXA 4EHFA 1P73A 5I8PA 3IDOA 2GN8A 4I1YA 4GICA 2AK3A 4RKFA 5FPYA 5BW8A 3D8UA 4NBSA 2Y2UA 4A0RA 4XYLA 3QBEA 4WAUA 2H0RA 1KHTA 5A5EA 5DISB 3UMVA 1N7JA 1QFYA 1HFKA 1T0IA 5DN9A 3I12A 1V1JA 3CUKA 3EA5A 4UCQA 2ZJFA 1T13A 3WLAA 2AEEA 4R4JA 3A9WA 5CM2Z 3RJ9A 1R88A 3TTYA 4V0MA 3UH1A 4A4DA 2BHSA 1Z8DA 3ENKA 4WBNF 5CYGA 4Z2AA 1JBKA 3CLSD 4D9JA 3UMSA 3GQVA 3NHZA 1LS1A 1M2EA 4JQCA 4URHA 1E20A 4HGZA 3LWDA 5MN6A 3GJ3A 3UMCA 4B6OA 4BAZA 5A4MS 1KEEA 1L4FA 1YMQA 5IDXA 2Z5LA 1N5KA 4AX4A 4UUQA 4UZFA 1SIOA 3OOSA 2NUTA 2RBEA 4GUAA 1AQJA 4H9GA 3EF0A 4L4RA 5AKXA 2PCLA 1N33B 3NTLA 3RRYA 5DBEX 3A1DA 5K45A 2FQWA 3PHJA 4D9EA 4S35A 5DHRA 1FFCA 3GGCA 4WESB 1PR2A 4GWGA 1MOZA 2Q21A 1Z36A 1BMDA 5E9WA 4HDMB 3QY0A 3KG2A 4BVJA 2LGJA 4MRAA 5JNLA 4JQZA 4PYKA 5D51S 4JA2A 4KEAA 2VHUA 2CNDA 2O0JA 2BEUA 4LMBA 2Q6LA 4FGWA 2EJTA 5JAQA 3OZEA 4RH3A 1CX9B 5DWVA 5D85A 3M3PA 1QV9A 2IODA 1GG2A 1JQAA 2QRVA 2QORA 3E3LA 3V4PB 3QQ5A 2PRKA 3LLVA 3RFXA 2HA6A 1VBFA 4X6XA 1P0MA 2ZS9A 4JLDA 3T7KA 4MV9A 1KJWA 2V7QA 4EL0A 3FRHA 3SHVA 2HA0A 3A9TA 1TZBA 3EIEA 3FIUA 3JASA 1XTQA 4M1MA 4LNAA 1O9GA 1P1HA 1WP9A 2A92A 1G17A 3O4GA 4OTZA 1I8TA 1H05A 2G8NA 2PZLA 1M2FA 4QRHA 1I9CA 4CTMA 3ADKA 3THRA 1EX1A 1D9XA 1BE6A 1OFHA 3HI6A 3O7MA 1UPAA 2P3QA 4OL9A 4UVIA 1Z8HA 4QU8A 2GBGA 3BTUA 1TE2A 2AS0A 4MITA 1XXLA 4JR2A 2YCLA 2E89A 1NY5A 3TRIA 2JK0A 3KFVA 2G9VA 3F7NA 4N5LA 3P9XA 3V8MA 2B2NA 2CL7X 3SAJA 2IHKA 4WPGA 4C29A 2C04A 4ZZ0A 5K6AA 4YRKA 1FTWA 1U63A 1S8NA 3G1WA 4CKZA 3ZK7A 1PJRA 3L1UA 3G49A 4PN7A 1NNEA 1CY4A 3TQFA 3PRKE 5KWIA 4XJXA 3GRKA 5JNUA 4Z9XA 4F3TA 1VPDA 4CLRB 4RKYA 4I4IA 1F8FA 1GEGA 4WEQA 2AG1A 2MT9A 4RK4A 5FULA 4K26A 1OPRA 4URYR 5FBLB 2C4HA 2P9EA 2Y6UA 3KFLA 4L50A 2O7VA 4QPZA 1HE4A 3WQRA 2O50A 1AGRA 4MWEA 2FSUA 3HY3A 1FJXA 3UUGA 3LPCA 4EDFA 2P35A 2ZUFA 1E0DA 2VZ9A 4K86A 3KE9A 1TUGA 3BG5A 3OZBA 5F7ZA 4YQEA 3ZV3A 2PT9A 2X5OA 2UYYA 3I8XA 4Y2XA 3WMRA 4BECA 3KSAC 1KI3A 1E3MA 1P2DA 4RYLA 4NYIQ 3P5BA 1UH5A 1U3UA 3G5UA 2E0IA 3IFSA 4MLZA 1GTZA 1HC7A 1GFZA 1Y7LA 2HLDA 2QUKA 5JSYA 3N2GB 5C0OE 2QUZA 4Q9HA 3H9UA 4QFCA 3WDKA 1JJVA 4UTVA 1X74A 2Q3DA 3HDVA 1DB3A 1GSIA 3ZCXA 3QKRB 1VSTA 4BFVA 4F2PA 5B3JC 1H5QA 3VC1A 3DMDA 1CF9A 3DYIA 3VOTA 3ILXA 4EELA 5CCBA 2XZLA 5EKSA 5LNK1 2ONYA 2ZI6A 3PC7A 2A0WA 4NCAA 2NZJA 2R751 3JQQA 1EWYA 5K3DA 4HLCA 3ZVLA 3ZYZA 4AZVA 3TE6A 1PSDA 2OAQ1 2XE7A 2WV9A 3MUEA 3OLZA 4WWHA 1BGWA 1NVAA 1J23A 2J32A 5E6UA 4B5KA 1T2DA 4Y1RA 2C5LA 4UPEA 1RWNA 2B8TA 1YJAA 1G3RA 2RGCA 3VM6A 2WOJA 3GRZA 1TF5A 5HIKA 3CG4A 5HTKA 2EV9A 5A0VA 2OBMA 1K8YB 4WHMA 3LKBA 3SEFA 4XIIA 1Y6QA 1M2KA 4TS1A 1UBFA 1X87A 3ZE2B 1VIYA 1KC1A 5J4KA 5FXMA 4BMZA 3HKEB 1A7KA 4J0DA 3DZDA 1IBCA 4MJ3A 4J0JA 2X1VA 3B1VA 1RZ3A 4CU5A 4Y18A 2G9UA 1WB9A 3E22A 1NYLA 5C8YA 2V0GA 5L45A 2COKA 2ASEA 3NCTA 4UMEA 3EVEA 4M7OA 3M82A 4ME6A 1QKJA 1NW8A 2NU8A 3ZCPA 5LWQA 3NIWA 2QMHA 2HNAA 2XCLA 1WBJB 1UJNA 3VDXA 4BWFB 1OMOA 1NKVA 2BMVA 1YDWA 1ZN2A 5JCJD 5FFNA 5BQ3A 4G0XA 1K3UB 1I4WA 2EQBA 2ONCA 2Q49A 4X8LA 3VJKA 3EFOA 2JFXA 4IDPA 4I55F 1K97A 3H9QA 2XWBF 4DE5A 1W48A 3ZQKA 1U5BA 3KK0A 3V8NA 3GLFE 1IUKA 3N2EA 2IZZA 1USIA 3CINA 5BQ5A 3KZCA 4Q9DA 2DUNA 3ZLTA 3VR5D 5CH3A 2D2FA 2WTXA 5DPMA 2JGAA 2FDRA 4Y6LA 4EUEA 4BCCA 1EK0A 1XLUA 5KUTA 1IATA 5M29A 2CJWA 3WWEA 2CVZA 2D2XA 3OMLA 2QSZA 3U1BA 4LX8A 3PI7A 2ON6A 4BAUA 4YV0A 2G71A 3HCNA 3HKDA 2YXLA 2G72A 3N76A 3OY7A 4S1VA 2HHAA 1UKZA 1KGDA 4ESVA 3OD1A 2ROQA 2V74B 1ZNQO 3C6BA 3SE7A 5HQ3A 4C3VA 1WXEA 1ZM4A 2CW5A 3OM9A 2VOJA 1O4WA 5A5FA 5EIXA 1J39A 2O2GA 3DT8A 1XTRA 3V2UA 4YWJA 1BDMA 3KZMA 2WD8A 3H1FA 3NRBA 2QZZA 4L0MA 1N2IA 4MQEB 3R7SA 2O8NA 3LPNA 2XUFA 4FWBA 4A6DA 2W11A 3BILA 3D3WA 1U2TA 3T3PB 3OZRA 2BSQA 4P7BA 4XD7D 1DG3A 3FKQA 1G8SA 1N0IA 1XAJA 1KH2A 2COUA 4Q15A 1P7PA 1I2ZA 1J20A 1DPGA 1E6EA 1DX4A 2PUHA 2V59A 3JYQA 1B1AA 3ORYA 1E2BA 1AVTA 4OAOA 1KMHB 2ATCA 2OZLB 4GOXA 3QXXA 5SV2A 3V4OA 2CE2X 2O8DA 3PSHA 2XRFA 3NKVA 4JVSB 1CLEA 2RHBA 4QPNA 3L06A 4I9HA 4KYUA 4PYJA 3GLFB 1V6CA 3NBAA 3W6ZA 2JHCA 2BP7A 3JALB 3F3KA 3DOCA 3HDHA 3LL4A 5THKA 5TNXA 3V1LA 2NO7A 2L18A 2Q5EA 5CR9A 1YOVB 4J1QA 1PYGA 2GZRA 4KRYA 3PCXA 3C1AA 2EJBA 1SXIA 3N0RA 4GRAA 4DMLA 4E03A 2GHTA 1J06A 3AB3A 3O75A 3OX4A 3EXHB 1IIRA 5ALQA 4LE2A 3H3JA 2HF7A 4DSOA 1P7WA 2OVFA 1LDNA 1B1CA 4NCJA 1VI6A 5I7EA 4FYIA 5JG7A 2YFQA 1DO8A 1PFVA 1TIPA 3C5WP 2W83A 3FPHA 3D64A 1UPXA 4HNSA 4R9UC 4RCVA 3GZJA 1M1UA 1U8CB 4O8CA 4OLHA 3ZW9A 1V8BA 4N0PA 2I4RA 4ZCIA 2O8BA 1V8FA 1IOVA 1XD8A 4BO2A 4AD8A 2ZJ6A 2WIDA 4BMNA 1T15A 2IVZA 4DMKA 4F84A 4BLOA 1P3DA 4L22A 2EC5A 4JJAA 1KEKA 1Y8RB 3UK2A 2VXBA 1H6CA 2AZDA 2GERA 4NVRA 5D2CA 1OBHA 3PVSA 3CZQA 5KCMA 1T6NA 1XZMA 4IMIB 4HXGA 3WLKX 2VP0A 3ICVA 4NMMA 4DV3B 2QLJA 5KO2A 1RAAA 1WHTA 5H70A 3L7IA 5JYCA 5PGMA 4F5EA 4KO2S 4XZ3A 4I19A 3R7NA 1ENYA 1MIHA 4TV9A 3ZR4B 2FE4A 1V71A 1CQZA 4ESEA 4YX9A 2ATVA 3JS5A 1JR3E 4FCVA 3BS4A 1Q5PA 2YHAA 5JI3E 1PV1A 1LW6E 2GWHA 4BLTA 1OILA 3CF0A 3OT5A 5GGYA 2F2TA 1ZITA 3EMBA 3Q2OA 3OZXA 5JCZA 3AVUA 1ZUWA 4E5NA 4PONA 2DRIA 4LXIA 2V03A 2YHIB 1G7SA 4LAFA 5BN5B 3ZKWA 4JKIA 4RA6A 4R68A 4TV8F 3W1WA 4HS9A 1HZJA 1X1EA 3JQAA 4EFLA 3UUFA 3W2IA 2YV4A 4HWGA 4PAQA 2DETA 2IELA 4J9UE 3RHZA 2QTWB 3UC9A 5LMZA 9LDTA 1EFHA 1U1CA 1GTL1 1LB1B 1VJ5A 1E4OA 2VZ0A 4B3IA 5ADHA 4ZICA 4HN4B 5D01A 3O9VA 4INJA 3FOCA 3IKVA 2PLAA 4N1AA 2O4UX 3GCZA 2CBZA 3JRNA 1HM5A 2PDAA 3L6BA 4OGGA 2O3RA 4DJTA 3H2JA 5JNSA 3A4NA 1A82A 2WT4A 4UAVA 1WHSB 1Y1TA 2IYNA 3PXXA 2NSLA 5I47A 1R6TA 4D7AA 2W4IA 4IMJB 4GP6A 4K6MA 4BZQA 4JBLA 3B8HA 3DNPA 4EY3A 6REQA 3FMFA 1U4OA 4TSKA 1KHHA 4I1VA 1Z18A 1B42A 2GJAA 3AY6A 4HO1X 2IL1A 1A5ZA 3N70A 5DM1A 5DHQA 4CFYA 5TGDA 3IHTA 3Q41A 4M0LA 3ZV7A 5FBQB 4LBZA 4ASUD 1QXSA 1KERA 2C00A 4GM4A 4D82A 1BVRA 1GNVA 4IDNA 3KCQA 5I7HA 2P5TB 3T3OA 2IXFA 1L8XA 1IZ7A 1NXPA 3G9TA 3R0QA 4FFBA 1L9KA 3BDAA 4QG7A 4R51A 4DCVA 2FF7A 4YIKA 3HRKA 1BXGB 5CYFA 2ORYA 1MD9A 3EZ9A 2ZBDA 4AMUA 1Q1GA 3B36A 2CV0A 2PL5A 4FQ8A 4BP8A 4HWSA 1G42A 2Z5GA 2VPZA 2GM3A 1R6AA 4BV3A 2HHJA 3BD9A 1N6HA 3L8CA 3DUWA 3MERA 3F5FA 1UDRA 4DV6B 4HDRA 1PV2A 3N2IA 4WUVA 2IOHA 5KU7A 4F71A 4K6CA 2VTKA 5FA8A 4DS3A 2HAEA 3OQBA 3HVIA 5EJFA 2O1XA 1EJ0A 1WPRA 1QC5B 2DBYA 2GRJA 1P9WA 1EUDA 4DPKA 1C9NA 1U4NA 1LQUA 3OQIA 3QUCA 4FN5A 1R27A 3TD9A 1ULAA 4WJLA 4WT7A 5ADWA 2C3MA 2XGMA 3FSEA 1KI8A 1RWXA 3QEMA 3AL2A 2PUFA 4QG3A 2Q0XA 3GFOA 3CM0A 3QXHA 5EP3A 3ZPXA 3ELBA 2BGRA 3ZBUA 5AJVB 2INGX 3KIPA 2B9EA 4QEDA 1H8HD 1H4SA 1KKLA 4QDJA 2UVQA 2B35A 5KTPA 1RVDA 2BIFA 4HQRA 2ZSDA 3R5KA 4RGQA 4WK6A 5BSUA 3AIIA 5IUJC 3CC8A 4WEOA 2AW3A 2YC2C 1CUWA 1KJNA 1VSVA 1VIVA 4R71A 4ZOEA 3BJRA 3DLPX 4JLSA 1U1IA 5FFFA 2ACEA 2NUPB 3QFHA 1J8QA 1Z2NX 3NHKA 3QVGB 3SQXA 1GU0A 3HE3A 4IDFA 4IKEA 4CQLB 3PHIA 1HG1A 5J4LA 1C8BA 5DFAA 5KQGA 3QOWA 3S2ZA 4TXJA 1AMUA 3DA8A 5J47A 1CUVA 2VSOA 1BQ3A 4BEVA 3P0FA 5JQGB 4UBLA 1BRTA 4JUFA 1MJGM 3FCEA 3SQLA 3MWEB 1VG9B 2ECKA 3GRCA 1NNUA 2QHXA 5EHNA 3FWYA 1TM4E 1FFHA 2F43A 3AR5A 3C8HA 4M89A 4WTOA 2JLWA 3OQ6A 5DT2A 1XDGA 1Y8AA 1LJ8A 4UMFA 1R8SA 2HC9A 3TW0A 1NP3A 3RVMA 4O63O 4K9DA 2UAGA 1R0KA 4CMGA 1DQSA 1OLSA 1TAGA 2OCPA 4Y6RA 3WNCA 1H2AS 1KMNA 2VF2A 4Z3OA 5KNBH 2A33A 2ZEJA 1MC8A 1ZH6A 3GGDA 4U2CA 5BPFA 3C0KA 3H8JA 4EMUA 5L3QA 3A6GA 3UW3A 4DUYB 3U5ZB 3COJA 3DTYA 4P08A 4C1BA 4D9MA 2OLJA 3H86A 3QUTA 4RNCA 2W93A 1R9MA 1MBZA 3RU9A 4HGQA 2H4YA 4NMXB 5CVUA 5T8KC 4JSRA 5CH5A 1TD9A 2VDWA 3BAZA 1GZ5A 1T4MA 2P2SA 2X6QA 4DR3B 1U7WA 1L1QA 4MQMA 1O6ZA 4RMIA 4LRQA 3CRRA 5KI6A 2Z6AA 1OQAA 1KDVA 3OAAD 3RADC 2BLLA 5BXQC 1CJUC 2GJKA 4RYDA 4H3VA 1CE8B 2YBEA 1AHNA 3KLPX 4DJDC 2GK6A 3HJHA 5T3YA 4F2HA 2CK3A 1NOIA 4B7XA 3SQDA 1XWIA 4C7OB 1NYRA 4BGDA 5ITWA 1I30A 1KARA 1IPHA 4Q4AA 2QY9A 3DB1A 3S5JA 2D8MA 2H4WA 4BP1A 2P0YA 2COEA 2Y1WA 3M1LA 4PHGA 3EPJA 1NQXA 3S3TA 5AVUA 2CUNA 3CF4G 3IVXA 2X76A 3G2LA 1T9GS 4F1KA 4YGYA 5BR8B 2VSNA 2HHCA 4A03A 3MMNA 4V02A 1QTNA 2NNLD 3RAFC 2GCOB 3IGFA 1ZIXA 1BRMA 1EB8A 3OLYA 1FDTA 4E4YA 3RAEC 2QP3A 3P4YA 1R50A 1F8UA 2M6KA 4J1SA 3V9AA 4Z4CA 3GDFA 1E59A 5KNBD 3AETA 4QTTB 1V4VA 2X2FA 4FX2A 2W42A 1JJAA 1KI6B 4IYRA 5DTIA 3EUEA 4OV6B 3GEGA 3PIRA 2JJMA 2BMWA 3OUUA 621PA 4HNUA 2VP5A 2QUBA 3OE1A 4Y1FA 5IMBA 2FPIA 1KZ7B 3WWOA 4AUNA 3QX7A 3HL4A 3I0ZA 2ZZKA 1AU9A 2VHQA 5DIZA 1BDIA 2GYWA 3NC0C 4B44A 1P7ZA 3V4FA 3W5CA 5AXDA 1CZHA 1UJ2A 1NMYA 3IRUA 1I5OA 3LFTA 4D6XA 1ZOPA 3LWNA 5EQJB 1XXHE 3G6WA 4NOJA 4F12A 4NENA 1SC4A 2ZFUA 3OZIA 2Q2QA 4IEFB 4YASA 4P3XA 4EVRA 3K70D 3P9ZA 4P3PA 3ETNA 4EI2A 1BN6A 4S0ZA 3SSNA 1AUQA 5DNEA 3UBMA 2HBYA 3NDIA 4KQMA 2GESA 3FDXA 3L7BA 5B2ZA 3V6LA 5GIPE 4U6QA 1PNRA 4C89A 3QFTA 2IPOA 3BL8A 3R6TA 2YW2A 1T9CA 3KOOA 3TOVA 2R7MA 5CB6A 2NM0A 3VU9B 3WNQA 2A35A 1JQDA 1NBIA 5I9LA 5HBGA 1VMDA 3LUPA 5IYZB 1GSAA 3TQTA 3OP1A 4JLPA 3IR5A 1GNRA 1HT2E 4IGKA 2PMDA 3TIXB 3T1HB 4X1YB 2A9QA 1KP9A 1T0HB 1BGXT 3Q85A 1SXQA 2J30A 3L01A 4RLSA 2XYQA 5IABA 3EEIA 1JWAB 1MIOA 4EFDA 1K86A 4WNAB 1IHPA 3E5MA 3EEQA 3KWFA 4DQLA 4HDKA 1AGYA 2CVHA 1H1LB 3CS3A 3QEAZ 3DF7A 2BBTA 3JZMA 3KAPA 4KQIA 1G20E 2W43A 2M1ZA 5BYBA 1AG9A 2ID4A 1ZLYA 1ISRA 4UQPA 1ZVJA 3PV0A 2XCOA 2JLYA 2CBGA 2R8OA 2D06A 3FLAA 3P1JA 3QELB 1PGOA 2D5BA 3QWHA 1Z5UA 4EG7A 5DLPA 5KYYB 2B83A 4M0FA 4N49A 4Y2QA 4REMA 3T54A 3UXEA 4LZLA 3CJTA 4JLBA 3ZZMA 4AMYA 1OLXA 3T5TA 2LBPA 1GNQA 3KSRA 5EY5B 3QF4B 1CRWG 1I01A 2D59A 2ETVA 1DINA 1GO2A 4PLFA 3BORA 2WU1A 3ZQ4A 4M0MA 3AEUA 1NYQA 1CT9A 1SD1A 3SNHA 3WLIA 4KMMA 4NAHA 1K08A 1A4UA 3SHOA 4D6PA 3ER9A 1Y1QA 1K0UA 5LU9A 3OETA 4U9IS 3ND7A 4JENA 4YP0A 1C3EA 5WRFA 1THGA 1ZNXA 221PA 2EKBA 4FGUA 4Y2JA 1LVHA 4PZPA 2X8BA 1P31A 1VHQA 2JGIA 4P36A 3UA3A 2FP4A 4DMGA 4PLVA 3QGMA 4DIEA 4CF5A 4IDEA 5DK4A 5DTQA 3R9WA 4P5DA 3E5HA 2G1PA 3HVHA 2V3WA 4O4IF 4DV5B 3PQEA 1EDEA 2EGHA 4GOLD 5EZYF 4JL8A 3LLCA 4X65B 2OO5C 4G23A 5A4JA 2R96A 4ZJPA 3T3DA 1ZGHA 2Q5HA 4DC1A 5CW1A 4L27A 5TRTA 1Z0FA 2LIPA 4L5AA 4OVKA 1L4BA 1D0IA 2PPVA 5FUMA 5AW6A 1MCZA 3WTBA 1UZLA 1MA3A 2XMSA 1OPXA 3DMPA 3F5SA 3DQZA 1T4CA 1IQUA 2H0AA 1UM9B 3SXJA 4K0KB 4G5FA 4M1TA 1B8OA 1PAUA 2HA5A 4GNRA 4RMHA 5E1OA 4RABA 5LM3A 2VJOA 4HN2A 4ZHSA 4UCFA 2GBLA 3A1CA 3DEZA 2ODTX 4US1R 1UK6A 2H4ZA 3TQQA 2ZZMA 1WO8A 4LYHA 1Y3FE 4PQGA 3SG0A 4C0QC 3WSWA 3IQEA 3NHWA 2O3QA 3F6YA 4FE4A 1MO4A 4BGVA 2BTOA 3FMIA 3UAVA 1C1XB 2EF1A 3TLJA 2QN7A 1VMIA 5JYBA 4XVRA 1IVNA 2O23A 4JCCA 2ZVQX 4JELA 3DFMA 1P80A 4M0UA 4U8GA 3VR6A 4JJGA 4MUGA 1UOQA 3B1YA 1PQYA 5CNKA 5DYYA 5HHTA 5CIYA 5TIIA 1OU0A 1WCIB 5ANRB 4Q7JB 3ADCA 4Z53A 1KVRA 5ESXA 1BU8A 3U39A 4LDAA 3WMFA 4UNRA 1SCUB 5JZOA 4FE3A 3IQWA 3NEYA 3FPKA 3SI7A 2P4QA 1M34E 1GUDA 3G8DA 3OOYA 4NHOA 3VO1A 4I5DA 2CHUA 3IELA 5MFZA 1N0VC 3F0TA 2YN4A 3KSZO 5DNWA 3SHTA 3W4IA 1TUEA 4AG3A 3GDGA 2BFEA 1KR2A 4FHCA 3TMAA 4S2EA 1A9XB 1U4SA 1BFDA 3PNVA 3DG9A 3PWKA 4PHCA 2OV2A 4U00A 4KG7A 2YY6A 4HSGA 1PFKA 4NR0A 5EIWA 4TYPA 3TIFA 1GUZA 5JZBA 1ULBA 3MLAA 4EBBA 1ECCA 1SN7A 4XR9A 4A2QA 3S0JA 3H2KA 3GLHE 1QYIA 4R40A 4OOFA 3C3MA 4NDAA 1Y6FA 4DMUB 1LC3A 3UTDA 1IFXA 3OURA 4CKBA 9ABPA 2PSEA 2VHTA 1ESNA 3MCVA 2JZCA 5I6DA 2OTCA 5JEEA 1AIPA 3ND8A 2YVKA 4RLQA 1NFFA 3WVNA 3SF8B 1NQ5A 3QWAA 3DZJA 1SEVA 2NW6A 4U2BA 3AWDA 4FBLA 4KXUA 3RNLA 3WKEA 4HY3A 4U6SA 1Q0SA 2QDXA 1EZ1A 1DXOA 4DJAA 2Q2VA 3NHFA 3RWOA 3EWIA 4E5YA 5CTAA 2YIJA 1L7DA 2D74A 4DOMA 2HCRA 1G8PA 4YCNA 2D5CA 1EGAA 2CLCX 3IP8A 2OMEA 4NXMB 1M34B 3QPVA 4B4WA 3FKSA 3K0HA 3ZTYA 4ENVA 5DCUA 4XM2A 4V3BA 5KWJA 5CD1A 2UUAB 3EZXA 5KOHA 3IB3A 3MBKA 3BN3A 3EEOA 3ZWQA 4FKZA 1HF3A 2JI4A 1QK3A 1KIMA 1G291 1QX4A 1IBSA 2FPRA 2WT9A 2X41A 3HJNA 4B6QA 3TG2A 1W8DA 5B1YA 3GGPA 4QBKA 4O4LB 2GCEA 2J4DA 1KO1A 3IALA 5KNCD 4KC0A 1C3OB 3WLOA 1ONBA 4B8ZA 4Y30A 4PS1A 4KXLA 1SZCA 2ZLBA 1DUVG 4RCYA 1M2NA 1XRPA 2N47A 4G63A 5E8RA 4DQUA 5KQRA 3SX2A 1BYUA 4DLUA 4NFLA 4WVFA 4CMEC 1H2YA 1KC3A 2FA9A 3SHQA 1DHTA 1RPJA 3M8KA 2BBSA 5AJYA 2V7WA 3EBLA 1JA9A 3CSDA 4CMCA 1IXRC 3IBGA 3W5IA 5IVHA 4MMYB 2PJZA 3WHLA 2XUJA 2FWMX 1TLLA 1L5GB 3FPJA 4JLWA 5MN4A 2OYSA 3WLTA 4AJNA 2ZIFA 2OO3A 4OF4A 4CN8A 2X7XA 2A9VA 1XI2A 3F6EX 1WSBA 1WWKA 5T4EA 3W05A 4YJ3F 3WWDA 4KVFA 3O9MA 1U11A 3DMRA 4V1CA 3HLKA 1RKVA 4FUQA 3LK6A 4OHWA 1SCKA 1JEJA 4HGOA 1P44A 3B3JA 3MMZA 4CODB 1WF6A 5BSHA 3VKHA 5I7RA 4C87A 1WPXA 3I9OA 4FS3A 1JIUA 1UKBA 1KBZA 4RO0A 3WJ7A 2AX4A 4EECA 3EZYA 3AF6A 3TLEA 3S7ZA 2W0MA 3PI6A 1Z0DA 2AN9A 4ND5A 2AE1A 4ZDIA 3U7FB 2FEOA 4URFA 5B7NA 4GX0A 1UMDB 3O4IA 1SHJA 4YRIA 4EHLA 3WA7A 1N77A 1OZAA 2GD0A 4AU1A 5HIJA 1KJZA 4B32A 1ZBDA 2O8EB 1EHYA 3TAXA 2VUHB 2ZUVA 3DPSA 2AFHA 5IVIA 1TCVA 1VG1A 2AC7A 3WGKA 1A8SA 4TRNA 1OFUA 4NYJQ 3KZOA 5FYQA 1WQ1R 4ARAA 1T2CA 4TLMB 3F5MA 1W35A 1EIZA 1XMXA 3AKCA 4DNFA 4E13A 4NNOA 3EPPA 3GH3A 1CJTC 3LKZA 2Y99A 4N7BA 5YASA 1T10A 3OZTA 2IZOA 5K0SA 2DPLA 1F17A 1V2HE 4D3SA 1Y33E 3ZGOA 2HEIA 1CYEA 3IV7A 2V5VA 2Z2YA 1ZH8A 2DWUA 4JL5A 4WQMA 5B58T 5LA6B 5B6IA 5CT9A 1E6MA 3BPSA 4DPLA 1OFTA 4XCQA 1TK9A 3I0MA 1B7GO 2Q2OA 1JFVA 2Q8QA 1IBMB 2HHHB 5FO0A 3EG5A 3OTIA 1FFXB 2GFIA 2IHTA 2NWQA 2WF7A 1OTXA 1H93A 2WRZA 3AESA 3FZQA 3MBOA 2WD7A 4FYHA 5EKTA 1WTCA 1P4GA 5IDQA 1PZGA 2X9NA 1FS6A 1FX0A 2GJ9A 3C24A 3L84A 4C0BA 1EFLA 2X14A 3K6SA 4FE7A 1TCCA 1YFJA 1D5WA 5AKHA 3WNVA 4EGFA 4EYSA 1YJBA 3A0UA 4JR0A 5IFKA 3PLRA 4LMAA 1Y3AA 3ETEA 1G5TA 1D1QA 2BFBB 5KPDA 2PZEA 1QOZA 3GMTA 1GZHB 2HSEA 3OSUA 4P82A 3GAFA 4L0CA 4DA7A 2GNOA 2OZKA 3KYCB 2HJHA 3MHPA 3DZIA 1G9XA 4MIYA 1L3BA 1PCXA 1MRSA 4NU8X 1ZD1A 3RUPA 5BV8A 1HQYE 1L8OA 4KR6A 1SCAA 2HWWA 3U26A 4NC9A 3VPHA 1H3EA 1ESMA 4AJ2A 3TJMA 2NO5A 3TECE 2VBCA 1XU9A 4LWPA 4PIVA 5TMBA 2DLNA 5FV4A 4G1CA 2GO7A 4AN0A 3EIWA 3STWA 4DBLC 1XMQB 3S8MA 5DNCA 2ZJ5A 3DTVB 4BVFA 1F1JA 2AOUA 4MA4A 2JDIA 2O3UA 4G0YA 1SIBE 3FE2A 4NZMA 1JJIA 4OQZA 1KY4A 3F6CA 4X1OA 4BNLA 5E7QA 3DXXA 5IM4A 2O7NA 3EZGA 4KBGA 4B3RB 3K09C 1Q7CA 1J9GA 2J7PA 3PZBA 1K5HA 4BO1A 5BT8A 4UE2A 3RASA 2C78A 2SKDA 1CETA 3GXBA 1P2UA 4I6JA 1N25A 4BNHA 2ZJ0A 5H9VA 4UAUA 3LDUA 4RS4A 3GLGE 2J0VA 2BZ1A 3A25A 1JN0A 1EX7A 4KTVE 4LOLA 4C4ZA 4CMBA 2CVFA 3N6RA 1X80B 3UG7A 3QUAA 1E7SA 4G1BA 1GL9B 1JSLA 4I1RA 4FYXA 3NWPA 1GWNA 4MH0R 4R54A 1NF9A 1Y1RA 2ZE7A 1MC5A 6ABPA 1J2YA 1ZIOA 3C7AA 4QXAA 1W52X 1C9KA 3RGWS 2W2NA 3U4QB 1JEQA 2PVSA 4UOEA 1NQWA 4IYJA 1OROA 2PM8A 1XHLA 1V1MA 1KSGA 5DHTA 2WFAA 4CIDA 1TA9A 1ZX1A 4KR0A 4QUAA 5FBHA 5DYGA 4IIBA 1EAMA 1T1SA 1A9YA 4BY9E 1Z16A 1VPEA 4TQ9A 2VPQA 3NPAA 4URZR 2GVZC 5SICE 4UHKA 3AG5A 3S55A 2R5NA 5LQJA 5DU2A 4NOLA 3V3TA 1NVFA 2GD1O 3DHWC 1JYSA 3U9LA 4DLZA 1CF2O 3DVLA 3VAYA 1JHDA 4J94A 2XNCA 5H3CA 3AUKA 4ZA2A 2PFKA 2YZGA 4XUCA 3O3CA 4TWAA 2WY2D 2ZBRA 5H81A 1W94A 1A7AA 1WCXA 1E1RD 1JQ3A 2I6SA 3AB7A 2DPMA 4MUBA 4PQRA 4TM8A 5EIOA 3SS8A 1GPLA 4DREA 2X22A 4PGFA 2VF8A 2Q8PA 4EKGA 3BMCB 5EJ8A 2VLIA 1R9JA 2PAAA 1T5TA 4UDOA 4N48A 4DEYA 4B4KA 1ODCA 5KTOA 1G8HA 4L4UA 1RQ2A 2X5NA 1U2QA 2OEPA 5CVEA 5G0WA 1TCAA 3RGGA 2TMYA 3QP9A 1B3RA 1QHHB 2DUMA 2QV7A 3N8HA 3OZWA 4AURA 4BYMA 2IP1A 1YOBA 4MVJE 3RREA 3GLGB 3TKLA 1XNQB 5DYTA 1WDMA 3FPBA 1A97A 2QU8A 2VSQA 3R4CA 2PSJA 1GKYA 1Y5RA 5L6LB 2HA3A 4A1FA 1GV1A 3WIEA 1BH2A 1GPDG 1L3CA 4NMLA 2DQYA 2EP5A 3R3ZA 2WJGA 2IVFA 5CT8A 2W6IA 4UJ5A 1DP4A 1YXMA 3BZUA 5C34B 4ETWA 4QLBA 2FX3A 2I6QA 1QHIA 4DQDA 4ZXFA 2VNAA 4JMLA 1CJVC 1A96A 2H06A 3CWQA 5LD2C 3Q5GA 1Y80A 3B52X 2ZRLA 1UXJA 2OBNA 5LLSA 3LOQA 4CWAA 1GAXA 1AX9A 1BIFA 1YZKA 3V2GA 4BJHB 2VDNB 1YQGA 3CW8X 4ISBA 3EF3A 5ILQA 2B98A 5KQPA 1E9DA 3ZWBA 4PLZA 3B85A 2RH5A 1HZZC 3W6OA 4A3SA 1HMYA 3GPCA 1UWVA 4F9TA 1CEXA 2O2SA 2VYFA 3LPAA 4NK5A 3FDZA 4KV9A 3T3GA 3ZBTA 3GJ6A 4X84A 1UBCA 3GXOA 4WACA 4C4YA 3H2ZA 5EVCA 2QD1A 3FROA 3L04A 4PM4A 3H1EA 2WOOA 4PBTA 1JPJA 4Y2PA 3TDMA 2JK1A 2EX0A 1AN0A 4HFJA 5FNVF 4C2TA 5BOSA 5IVPA 1K4MA 5AI6A 4NCIA 1XL1A 2PGXA 3W3AH 4DMCA 1FP4B 2UZIR 4ZOLF 1NY6A 1U0TA 3K9QO 4NNPA 4QC2A 4HQFA 4XQ9A 1I6MA 3NHRA 3KYDB 5E1MA 3ROTA 5C18A 4PANA 4YV7A 4O5AA 1EWQA 1RWVA 4UKDA 4QRDA 3B1WA 2BI7A 4QTUB 1W30A 1ZH0A 4P7GA 4OP3A 1ZI6A 3N07A 4FTWA 4MP6A 3JARB 4PGGA 1LBQA 2DTDA 1SWWA 4CL2A 1J0EA 4Y6QA 4YJGB 5ALYA 3GCGA 5EKUA 3A3KA 4PZDA 4MA0A 2QTLA 1E62A 2OWEA 4IDAA 2GAJA 1QDUA 3C3CA 1MR3F 3DVQX 4N01A 1DADA 2VK8A 5K4AA 2HMVA 3KL2A 2B9VA 1C81A 1OGJA 4GI1A 4V0OA 1QCCA 2JLUA 1ARZA 2G1UA 3CLRC 2WHPB 2XLCA 1N5OX 4BMCA 3CO5A 4XRGA 1M7BA 2BZSA 2VCHA 1NR7A 2GEKA 3KOYA 4QGHA 5HILA 3UJ9A 3V8PA 1CLUA 2NYAA 3BERA 3BF7A 2QXUA 2QZJA 4IHAA 5FLKA 4D97A 3A4YA 3QI2A 4CDGA 3IQFA 2WJ3A 2XAAA 4N6GA 2PVCA 4BE9A 3DR3A 3TMKA 3WRVA 1JVNA 4RFVA 3O8OA 1N6PA 2VJNA 2KW5A 2Y0BA 3E0QA 1PT8A 3ACCA 3NRJA 2EDCA 4MEBA 4GRDA 4L9RA 4NECA 1ZH4A 4XOUA 4AYTA 3GUUA 2PGIA 4DR4B 1CF4A 2H63A 4ZAGA 2EZTA 4WFKA 1EGMB 4W6ZA 2E1RA 3DV0B 3O2JA 2AA3A 4W1PA 2WWYA 3W3AD 4KIGA 1W5EA 2D3TA 1BE1A 4IOJA 5AM1A 3U9SA 3HBNA 2ZUEA 4OGLA 3ZCUA 1T8YA 1V47A 2L17A 1V4BA 1QQ5A 5GOTA 3Q8WA 4CLOB 1E0JA 3VUFA 4XM0A 4HHEA 1WCV1 1QPZA 2ONJA 2H7YA 3KT8A 1L8QA 2XLBA 3C7TA 2FW8A 3HEMA 5HYVA 4U8HA 3RI3A 5KQSA 5FTMA 1SY7A 5HE8A 2QSJA 4L4YA 2XCSB 1YASA 1HDOA 3S2SA 4YPVA 2QY6A 3PUVA 1Z07A 1FMCA 2HYIC 4E1BA 1M5RA 1DAEA 2R1TB 3ZX5A 1QE0A 1P5FA 2NXWA 4MRMA 4WOPA 2VJPA 4NE9A 5I9TA 2AZXA 1WMBA 2DHCA 3DAGA 3AJ8A 3VA7A 3JQ9A 1FVXA 1ULSA 2MYPA 2VL7A 4NMWA 4Y9UA 3WP1B 3JZDA 2H3HA 2HIGA 3F3MA 2C0PA 1HDEA 5JMPA 4Q4DA 1G3QA 4GIBA 2B4AA 2V7UA 2ZUUA 4X45A 4JOQA 4D0LB 1AQ6A 3ORFA 1JHXA 2IEBA 2P3LA 3GLTA 3GPDG 1S2GA 2O3SA 4B45A 4HMOA 5E2BA 4Z7NB 4UJ3A 5CLJA 2NQTA 1J99A 3RVNA 1AKYA 1O96B 2NGRA 3HU5A 1B4DA 1Q44A 3GPBA 4UVHA 3UW1A 1XJ5A 1PR5A 3EASA 4NU5A 3VR4A 5KNDA 1TMYA 3SE0A 1N8SA 1X1CA 3K5PA 1SPXA 2WU8A 4UBOA 3GBVA 3COVA 3BSWA 5BO5A 3P2KA 4JJ8A 1Z7EA 2ZYIA 3T9FA 4LGVA 2XUHA 4QM7A 2PH3A 2VHYA 4NCHA 4GI3A 3FMPB 1K5GA 3L02A 4RXUA 4COKA 1W2GA 1BS2A 1K7CA 4D8UA 2I4IA 3HJRA 3JV7A 4GECA 4DY4A 4CEHB 3QKTA 4PZAA 3I2HA 4J0GA 4NK4A 4UFNA 1YZNA 3C48A 2CB0A 1P5RA 1ZC4A 1MEEA 2A57A 4C20A 4Q7KA 4CQMD 1SMKA 3Q3HA 4Z7JA 1G60A 2TMGA 1X1BA 5A9SA 3G2IA 3W1EA 5HZMA 4O2AF 4HCJA 2NOAA 3CW2A 3FVQA 3VKWA 3MZ0A 1IEWA 1HT1E 3EOZA 3BWBA 4BFWA 3GT3A 2JJ1D 4Y2HA 2AXNA 3PDWA 1FMTA 2W2LA 4DN6A 1HT0A 3BMQB 3FNRA 5ALTA 1P74A 3OFJA 3TXXA 1TW2A 2AFIE 1VA4A 3DXYA 3R6DA 1QH1A 5DRYA 4AS2A 3A2LA 2MSNA 1ZDMA 3FCYA 5JS7A 1I3KA 2Y1XA 4HDMA 1DZIA 3EARA 1EVEA 4LZPA 1CUBA 1E9VA 2WR8A 4YVFA 3WHPA 5JECA 1MGPA 3EGDA 3B48A 5ELXA 2Y0CA 1XOIA 4HLUC 2R9VA 4LXGA 4MDEA 3NEJA 4DXDA 4XWKA 1ZJ6A 1N2GA 1NMXA 9LDBA 3NTQA 4DLLA 2GSWA 3QTBA 3BXGA 2B99A 3IDAA 5CDSA 1GAQA 2OZVA 2QTNA 2YHSA 4ZHQB 5F7XA 1AK1A 3NHYA 1CQPA 5DE3A 2C9BA 3MUFA 4NFHA 3KB8A 1W2WB 4TS4A 4X3CA 1E2IA 1YR1A 4RM3A 3RJZA 5EG5A 3DEFA 3HV0A 3O1IC 4B6GA 3PFNA 1KTIA 2CL0X 4REQA 2JAWA 1Y6RA 2NQ2C 3LXMA 2XWJI 1D6JA 1LY1A 2OCKA 2M6RA 3TLGB 3DP9A 5J3JA 1LNSA 4PC2A 1G21E 1N5DA 1L7XA 1NBHA 3M2TA 5DTEA 1Q0QA 3SIPA 3TQCA 4OHFA 3TSYA 5CDYA 2PRYA 4U7PB 3C3WA 4ICIA 4LRYA 3D3NA 4NYMQ 2GDZA 4D3XA 1CRPA 1R12A 3N7TA 3I2FA 3RIEA 3N8NA 2QPLA 4HH0A 1ZIPA 5K2MA 3TKAA 4MI9A 1QTRA 3AOGA 4RTLA 1PTJA 1ZNZA 3BULA 3EIOA 3QH4A 2AFIB 3E4CA 3LRPA 1RZRD 3DO6A 3SMVA 4OB6A 4TN5A 4CHGA 5EOVA 5FD8A 3ZDZB 4K46A 2HFJA 4GSKA 2QN8A 3I28A 1SHKA 1LUAA 5E6SB 4CKEB 1RBQA 4YRLA 2PVPA 2QD2A 2IS1A 3QYFA 1MOPA 2FAXA 2UYOA 2XA9A 1S8OA 2H31A 4J7CA 2XB9A 3PZRA 2G07A 4XLZA 3QNMA 3T6KA 2G17A 4TS9A 1KO8A 1HGXA 3GGJA 1QH8B 3WA6A 1WZNA 3LGSA 1GQFA 1TZ2A 2WVHA 3OE4A 1TJYA 4PLYA 4QA9A 5I5GA 2IW3A 3G5MA 3RSHA 1IC6A 3F5QA 1VDMA 5DGCA 4DKXA 2WHXA 3FX2A 1QYWA 4EG0A 5BSKA 2P9FA 3H5IA 2OSBA 4WXEA 1BXRB 5GGXA 3M34A 4RULA 1LV8A 2WG0A 2X4DA 1GPBA 2ZB3A 3BXZA 4EOGA 1MHTA 3G7SA 3T7AA 1FSFA 4YJ2A 1KVUA 4UM9B 1VMAA 4UBNA 4LXYA 2H2HA 1OYOA 3DLIA 3DOIA 3N2GA 1G21B 3W8FA 4E4RA 2XUPA 3QQPA 4HXFB 4QXOA 4MCAA 3QLVA 4IX1A 3TSAA 3NORA 1JYFA 3QKRA 4G8CA 5CAEB 4UHEA 2JPDA 4CEIA 2CDCA 3DDUA 3HZOA 2LNDA 3OCJA 3H65A 4EY7A 1EVZA 1KFBB 3G0CA 2ZYSA 3P2JA 4C88A 1UK9A 1VC2A 2WVGA 2F1RA 3IOYA 3PQ5A 4MWSA 1F14A 4GKVA 4EJ2A 4IG4A 2OBYA 1NP6A 5GONF 2IZ5A 3TQSA 1IWOA 3U4CA 2NQ8A 3NGMA 1TVMA 4G4IA 2R8XA 3N2YA 4E15A 3HFRA 5KYUA 4BWVA 1KOJA 4FDUA 5AVSA 5BVHA 4FI3F 5T67A 2DY1A 2YRWA 4IOKA 3O2NA 3P2OA 3KE8A 3O3MB 3T4PA 1E2UA 1FDWA 3T7EA 3PUZA 3HWRA 3VRHA 4AL4A 4L15A 4TM7A 2FFHA 3ZDBA 2L82A 2NP7A 1N7GA 4CVNA 4CR8A 4MRRA 3HKEA 4MWDA 1E4EB 1TEVA 4ETIA 2HRZA 3PX7A 4G24A 4XQGA 2KM1A 3WL4A 2IU3A 3NLLA 1UDCA 2AJ8A 5BQPA 2I3DA 3G0IA 4A82A 4CLHA 3C45A 4HGNA 4UPVA 1ZS9A 3IMKA 3TLYA 2IUYA 2KHZA 1N4AA 4CCYB 3G59A 4NULA 3NBFA 4MW0A 3H04A 3GJYA 3X1ZA 1IWBB 1E9EA 4MB2A 4DA6A 4I6EA 4DUGD 4ETMA 2AKEA 1LEHA 4YMTA 1LW7A 2J59A 4H15A 3U4MA 1QGYA 2FN9A 4A0FA 1VLMA 1NC1A 4ZKEA 2MSDB 4XGQA 1XMIA 4Q9KA 2B92A 2ZBFA 4DLNA 4MRNA 4HNVA 4MKGA 5CFRA 3EWNA 3Q3CA 3BA1A 3OX3A 5KQLA 4Q7LA 4UUNA 2R8YA 3NIBA 3KJIA 2JHFA 2FCAA 2Q27A 2A5JA 2P67A 3A2MA 3V8VA 5H4HA 4X64B 4RJLA 1JHMA 4WXYB 5LCXA 1GADO 1QCDA 1DMRA 5B3AA 1YQEA 3C43A 3SZOA 3ZY4A 1NW6A 1RE0A 1TKRA 5M5BA 1L7MA 3ICWA 2RHJA 2YL2A 2JLBA 2WWGA 5JJBA 4B73A 4H18A 2XMRA 2IIQA 3PC8C 4HYYA 4C7XA 4B46A 1WETA 1IN5A 2G6BA 5C1IA 4HVTA 4X92A 1HTTA 4P4NA 1PWEA 2H85A 3ZGXA 3TVDA 1HL7A 3ZV5A 3D6MA 5JVDF 2ZRPA 1VE6A 1M33A 1MXHA 1DKMA 1U6JA 1X7ZB 1PHPA 2J41A 1RQLA 1H9BA 3QRWA 5M3BA 3FUCA 4MQEA 3V2HA 1FC0A 1LDYA 3E05A 3OEHA 3RFFA 3EIHA 3L8ZA 4B2IA 5I45A 3V1TC 4G86A 3LT4A 3V8EA 2QQFA 1DC4A 4ARBA 3LQ1A 5EA2A 4P80A 4R8MA 2CSXA 3U61B 3G13A 1H4QA 4TLDA 3NS7A 1L6IA 1QIDA 1XTUA 4ZPXA 5JDIA 4YLEA 5JAPA 2Z8YA 3KOUA 5IUKC 2IYLD 4RVGA 2J5RA 4DA8A 3OU7A 4D56A 2ZSAA 4GG1A 1LSOA 4LZNA 4XB2A 1KKUA 2QG9A 3IQIX 4LYGA 3RRMA 1QHXA 3KHSA 4XWGA 4TRMA 1P6UA 3C7DB 1LZLA 1R0WA 2QF7A 3GLFA 1NBAA 5IKMA 2UZ1B 3PUXA 3UPUA 5EMMA 5JPCA 2H5JA 3CZ9A 3GUCA 3B7WA 3KTAB 3NHSA 1PK8A 4HP8A 4RL6A 1GRNA 2XJ9A 1W1UA 4IIGA 2CYBA 5AW9A 5CA1B 3LBHA 5L40A 2W2MA 4LF6B 2O7RA 4POAA 1NN5A 5JUWA 4DEVA 3LDAA 4BC1A 4FR0A 2YJGA 4WY8A 1CJSA 4PXAA 3GFPA 3ZLJA 2OHXA 3FYTA 1OYVA 5IX8A 4JL6A 3QEOA 3L5KA 5KSOA 2HR1A 5LP6B 1D7OA 4YRMA 1C4KA 1Y98A 2GQ0A 1IUNA 4MDHA 2JAQA 4DNQA 5TPWB 3FB4A 4DDTA 1THTA