2AN4A

Structure of pnmt complexed with s-adenosyl-l-homocysteine and the acceptor substrate octopamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2an4A00
3C3PA 3T7RA 3R0QA 4DM3A 3E05A 4LECA 4KVZA 3TKYA 5DRTA 1NV9A 3Q7EA 3ME5A 4R6XA 2YXDA 3HCCA 3P97A 3BGIA 4HH4A 5DSTA 1HMYA 2PGXA 3SMQA 3UJDA 4EK9A 3UBTA 1BHJA 1SUSA 1O9GA 3R3HA 4GUAA 5GM2A 1BOOA 1VLMA 2IH4A 1WZNA 3TLJA 3VC1A 2ONYA 3BWYA 3H2BA 2FPOA 2B2CA 2V74B 4EMSA 3R6TA 1INLA 4E31A 2O0LA 2XBMA 4ISCA 1YF3A 3A7DA 1BC5A 5LQRA 2PX4A 3E23A 3K0BA 2UZ4A 2AS0A 5EOVA 2AVNA 3FTCA 4L7VA 2GB4A 1EJ6A 2AOXA 5MHTA 3DP7A 4O29A 3MB5A 3GIWA 1O9HA 3DXXA 5GM1A 5LSAA 4P7KA 3HCDA 3JWGA 4GOND 2DULA 1P1CA 3FPJA 3EMBA 5EMKA 3NJRA 3O31A 3OZTA 4PYLA 5EKUA 3SR4A 2P3OA 1QAOA 5CVEA 4E33A 4QQKA 3LSTA 2CWWA 3PLAE 5F2OA 2N47A 2EJTA 3AXTA 4A6DA 2C7PA 4FZVA 2BZGA 1AF7A 3TMAA 5DRYA 8MHTA 2IGTA 1X1BA 3EGIA 1PJZA 1M6YA 3P2KA 3BKWA 4KWCA 5CM2Z 2IIPA 2ZWAA 3EEOA 3G8BA 3FPEA 4M36A 3UJBA 2NXNA 3KQWA 3MERA 3MTEA 4BLWA 5BP7A 5JUWA 2CL5A 3GJYA 1EAMA 5E2BA 2E5WA 3VC2A 5H02A 1YZ3A 2P1DA 2ZTHA 4BLVA 1NW3A 3DXYA 2G70A 4X60A 3PX2A 1U2ZA 5ICGA 3RIEA 1ZHFA 3MGGA 4YUWA 2EG5A 3HEMA 3TM4A 3DMGA 5DTMA 5LQUA 5BW4A 3F4KA 3GGDA 2Z6AA 2C7RA 4QDJA 3ER8A 3HTXA 5EHGA 4ER6A 1SQFA 2PJDA 4PIPA 3IHTA 4AX8A 2FYTA 4C04A 3EVGA 4ER0A 4RTQA 3I53A 5FTWA 2JHAA 5E8JA 2ZZNA 3UJ7A 3EVEA 3M4XA 4RYLA 5BXYA 3P9KA 2IDJA 4YUXA 5K0FA 2ZW9A 2ZLBA 5EQJB 5P8WA 1EG2A 4QTUB 4F85A 4GOLD 3KR0A 4RTKA 3RW9A 2IP2A 3K6RA 3IV6A 9MHTA 2AN4A 2ZFUA 3HVKA 1FP2A 4PYIA 4WVLA 3UJ8A 4DQ0A 5FA8A 1HNNA 1JQ3A 3TPZA 3BGDA 3GRUA 4P7JA 3CC8A 4E2ZA 3AWIA 4Y30A 3OU6A 2AOWA 3MQ2A 1R18A 5M5BA 1IXKA 4M37A 4U7PB 2OB1A 2PV0A 4HRAA 4OQDA 4Y2HA 5E2AA 3FPFA 3KQSA 2XYVA 3MAGA 5FCDA 3DMHA 1QANA 2QM3A 3BWBA 1XCJA 2OKCA 5FULA 4X63A 5CCXA 5EKXA 4C06A 2QE6A 2F8LA 3KR9A 5CVUA 1IY9A 5LQCA 1XXLA 3JWJA 4QQNA 4V0RA 4AZTA 1WY7A 2G71A 4KIFA 3ELYA 4AZVA 5K0JA 2VDWA 3CKKA 3NW9A 2PX5A 5EG5A 2ZIGA 1VE3A 3LDGA 1QYRA 1NBHA 3VSEA 4E32A 1DCTA 1KXZA 4FT4A 5EHIA 2AZTA 1G60A 1JQDA 4RVDA 3EGEA 3I58A 4E2XA 1M6EX 3FTEA 3CVOA 3M6XA 5JR3A 4JXJA 5DWQA 3NVMB 3UA4A 4E30A 1EIZA 3ID6C 4RWZA 4DKJA 2R3SA 4FSXA 3PX3A 3HVJA 5DM4A 3G2MA 5U4XA 5K0GA 2ZBRA 2VP3A 2Y1WA 4IV8A 4HGZA 4PWYA 5D1HA 1YB2A 1Y8CA 5LR6A 2ZVJA 1T43A 2XVAA 2ZIEA 1R8YA 5CCBA 3AY0A 4FS8A 3E8SA 3KQYA 4HSGA 1JTFA 4PIMA 4XUEA 2IPXA 5DX0A 1B42A 4RVFA 4CTKA 1R74A 2QRVB 2PLWA 2OZVA 4X41A 1QAMA 1XDZA 5DXAA 1NT2A 2FK8A 2YXEA 4PYQA 1X1DA 3ELUA 3OZRA 3A26A 1G55A 2O07A 3SGLA 3OU2A 2YTZA 3M6UA 4EKGA 1JG1A 1NE2A 4MHTA 2AN3A 5FA5A 1ORHA 3REOA 4KDRA 1NW7A 3I64A 1H1DA 2LD4A 1WXXA 3BWCA 4WXHA 2B9EA 2IBTA 1G38A 2P3LA 5EC8A 2QRVA 4PYJA 4RVGA 5DX1A 5EMMA 3HVHA 1XDUA 3P9CA 2PWPA 3EVBA 3L8DA 5ICEA 5DLYA 3GNLA 5E8RA 1L3IA 5HZMA 3LKZA 3EGVA 2CMHA 5DPMA 1QZZA 4IV0A 1RJGA 1G8SA 3CJTA 3DMFA 3GDHA 3MCZA 3KQMA 3P2EA 4QVGA 1EJ0A 3HCBA 5LQAA 4GF5A 4DZRA 3ELWA 4RTRA 3EVCA 3LCVB 3FTFA 1UIRA 3GRZA 5E1DA 3P71T 3ANXA 1RJEA 2JHCA 3HCFA 4EKIA 3PS9A 1XVAA 3PTAA 5K0LA 2ZZKA 1KPGA 2O57A 5FWAA 3SXJA 2C7QA 2PXXA 2H1RA 3DXZA 3KU1A 5EEHA 1I1NA 4CKEA 3C6MA 4MTLA 3TFWA 5EEGA 5K8VA 10MHA 1WG8A 5DTRA 4G56A 2P3QA 4LWPA 4MWZA 3QOWA 4E70A 5EIFA 3CCFA 2OXTA 1ZG3A 3O4FA 5CD1A 3GWZA 4P7FA 4AZSA 5GINE 4RTOA 4RX1A 5GIPE 1ORIA 2GLUA 3SSMA 4YV0A 1VBFA 1NW5A 3SM3A 5FHQA 5T67A 4DF3A 1JG2A 1KPHA 2I9KA 3NVKI 3KQVA 4P58A 1V39A 3BGVA 5CVVA 3BUSA 1L1EA 3EVDA 4PGGA 5HIKA 4RSRA 5D1NA 1UWVA 4PYMA 5DM0A 5K01A 3LBYA 3T7TA 4KDCA 2OYRA 2B3TA 4OQEA 5E1OA 3U81A 2CMGA 3HA7A 1XCLA 4CKCA 2XYQA 2FRXA 2VZ9A 4QPPA 4RTPA 1D2CA 3D2LA 5DM2A 5G02A 2JHPA 4PINA 2IBSA 1KHHA 3CJQA 5FWDA 4DMGA 1JSXA 3B3FA 5CIYA 3G89A 4H0NA 4CXMA 3MTIA 3LBFA 1D2GA 1NW6A 2FCAA 4YMGA 4OX9Y 1JR4A 2ZWVA 4U7TB 4YUYA 4R8RA 5HFJA 1I4WA 2YXLA 3C3YA 4YMHA 3LKDA 2PWYA 5KYGA 4YV1A 3ER9A 5LQJA 3S68A 1DL5A 5IKMA 5DSXA 5EVJA 5LQNA 1XTPA 4E2WA 1TPYA 3P2IA 2G8NA 4C08A 2BR4A 3DULA 1P39A 4OBXA 2AN5A 5FQNA 4C05A 1YZHA 1WXWA 3KPVA 5GOZA 1QAQA 1M0EA 1EQAA 1ZQ9A 3EEYA 3SSOA 4AUKA 3G8AA 3UJCA 4EQZA 1SG9A 5DTQA 2ERCA 4IKPA 1KR5A 2PBFA 3NDIA 3HCAA 5GIOE 5KS2A 1VPTA 5DXJA 5K0BA 4NECA 4YUZA 3AJDA 3DUWA 3DTNA 5EGSA 1P1BA 2B25A 3KQTA 4F84A 1RI3A 2HV9A 2P35A 2PVCA 4RVHA 3DH0A 1WS6A 1NW8A 2BH2A 7MHTA 1FP1D 3DOUA 5EPEA 5F2KA 4C07A 2Z6QA 4GEKA 2PX2A 4Z2YA 1XDSA 3KPYA 3KPUA 2NYUA 3OPNA 4QDKA 3NWEA 1PRYA 1RI5A 5GWXA 4RTJA 5FHRA 2P40A 3SVZA 1VL5A 3B7PA 2KW5A 4HC4A 2A14A 1JQEA 3LL7A 2OBFA 5ERGB 3LECA 3A7EA 2XVMA 2ZSUA 1XJ5A 3HCEA 4DCMA 2O06A 4R8SA 5E9WA 2HTEA 3Q87B 3B5IA 3I5UA 3FUXA 3EVFA 3GO4A 4XCXA 2PT6A 5EZQA 3IEIA 3PB3A 3UFBA 4PGHA 2H11A 3FUUA 3R24A 3B3JA 3A27A 4ZTBA 2K4MA 4GOOD 4RTSA 1FJXA 2JG3A 3LCCA 3OZSA 3SX0A 3KQOA 5B1SA 3SSNA 3UJ6A 4BP3A 2G1PA 2OY0A 3V8VA 2G72A 4GC9A 2YQZA 2NP6A 3CJRA 2YR0A 3G5TA 4QTTB 3DLCA 1L3BA 4R6WA 3O7WA 2JJQA 4M38A 5T6BA 3R9XB 2AR0A 2YX1A 3OCJA 2Y1XA 3LPMA 3HP7A 2ONZA 2EX4A 3G2PA 2OO3A 4RV9A 5FUBA 3KKZA 3LCUA 2HNKA 2P7HA 2ZBPA 2NXCA 1L9KA 1RJFA 3BZBA 3QV2A 1N2XA 5K05A 2EFJA 2I7CA 2IFTA 2GS9A 2WA1A 3BXOA 1AQIA 2BM9A 2HWKA 2FK7A 2QYOA 3TKAA 5IH3A 3MHTA 2P7IA 5FQOA 4IWNA 4FT2A 3UJAA 1VP3A 3PVCA 2Z6UA 3HVIA 1SKMA 5E1BA 1JTEA 4PYNA 3JWHA 3HA5A 3OFKA 3B3GA 4ATNA 3PT9A 5BW5A 5EMLA 5KQSA 3LHDA 4FR0A 4CWAA 3UZUA 3FUVA 2ESRA 2VDVE 3P8ZA 4BP1A 3HM2A 2AOUB 2GAFA 5ICFA 3HNRA 3GU3A 1I9GA 2UYCA 1X19A 2P8JA 5E9QA 4QPNA 1VIDA 3G7UA 3DR5A 3NTVA 2CKDA 3QOXA 4GBED 5K0NA 2P41A 4GC5A 3VYWA 4POOA 2YUIA 1N7IA 3KPWA 3GXOA 1R6AA 1JG3A 2ORED 2PKWA 1KP9A 2UYQA 2H00A 4FGZA 4FSDA 5ICCA 3FUWA 3P9NA 5F2NA 3A4TA 5CVDA 4B17A 1YFLA 2JH8A 2AOUA 1Q0SA 3C6KA 3OU7A 3RODA 4OA5A 2HR1A 1NBIA 1NKVA 4F86A 1OR8A 4R05A 3LGAA 4CKBA 2IH5A 2ADMA 4X61A 2QY6A 3G88A 1MHTA 1SVUA 2VDUE 3GRYA 3FPHA 3KR1A 3V97A 4X1OA 1RI4A 2PT9A 1Z3CA 3OFJA 4LG1A 4C03A 5EIWA 3ORHA 5HOQA 5K09A 1G6Q1 2GPYA 3UA3A 4LWOA 1DUSA 2DPMA 3X0DA 3GRRA 4HG2A 4K6MA 3CBGA 3UWPA 2IH2A 1RI2A 5CVJA 4RTNA 1YUBA 1F3LA 4HTFB 5E9JA 5C0OE 1O54A 1YFJA 2NXJA 1X1AA 1D2HA 2PY6A 2R6ZA 4HGYA 2PSSA 3PFHA 2AOTB 2HMYB 3KQPA 1RI1A 3G5LA 4PCAA 5CUQA 5E1MA 2UYOA 4PNEA 5K0CA 5DM1A 3FUTA 1VP9A 3TOSA 1AQJA 1R8XA 1AV6A 3GCZA 3EVAA 2B78A 2O05A 2NP7A 3FZGA 4BY9E 1P91A 3AXSA 3M6VA 4UOEA 2FHPA 1VQ1A 4ER7A 2JH9A 4HTFA 1TW2A 4E2YA 3M33A 3KQQA 2AOTA 4YV2A 3HA3A 1ZGJA 4KIGA 2ZBQA 2PXAA 1N7JA 3KPJA 3M70A 3M6WA 4PCLA 1Q0TA 2ZIFA 1BKYA 1JSZA 1R00A 1ZKDA 1NV8A 4C4AA 3LDFA 3OE5A 4ER3A 2IDKA 2PXCA 3WSTA 1FPQA 2BM8A 1F38A 5HIIA 2V7EA 4EVIA 2Q41A 1KIAA 3BT7A 5GP1A 2YVLA 4PONA 3ERCA 3LDUA 5T64A 4OBWA 3B89A 1ZGAA 2OB2A 3GRVA 1UFKA 3KHKA 4RTMA 3E7PA 2AOVA 3EPPA 4KRGA 5DT2A 1SUIA 3T7SA 4DA4A 4ER5A 5DX8A 3KR2A 4KW7A 5C9ZA 4OA8A 2VS1A 1JG4A 4QVKA 3FYCA 1G8AA 1RJDA 5HEKA 5K03A 3EMDA 3TQSA 2UYHA 4GQBA 4PYOA 3MCTA 3C0KA 1X1CA 2I6GA 3A25A 4FP9A 5EMJA 2GA9A 3JWIA 1MJFA 3IYLW 4DCGA 2ZZMA 5LQKA 3BKXA 2PX8A 3NMUF 3NDJA 2WK1A 3TM5A 3DLIA 3FPGA 4MIKA 4A6EA 2XYRA 3P9IA 4PYKA 2NXEA 3NWBA 3FTDA 3LX6A 5EZSA 1KYWA 3THRA 4MQ4A 3TR6A 3THSA 1TW3A 5C1IA 1L3CA 3OE4A 4V0QA 5HILA 3FYDA 3UJ9A 4BLUA 1IM8A 3FRHA 3T0IA 5KQRA 3G2OA 1SQGA 2AVDA 2BR5A 1KPIA 2C7OA 2ZULA 2I62A 2BR3A 2OPBA 2WA2A 3CGGA 3G2QA 3PFGA 4M7RA 5HIJA 4RTLA 2GH1A 3FRIA 1KYZA 5HIMA 4AZWA 4XUCA 2EJUA 4YUVA 3BWMA 5KVAA 4CTJA 1FBNA 5K0EA 3EVZA 2NNWB 3ELDA 4GOMD 2ZCJA 5FADA 4P7GA 3TRKA 3I9FA 4XUDA
chains in the Genus database with same CATH superfamily
1UK6A 3NPMA 2CFCA 2PE5A 1P2FA 2NX2A 3H87A 4JUBA 4OJYA 1AKQA 2Q29A 2Y27A 2GYYA 1J1UA 3SMQA 2HL6A 1SVIA 2P9FA 1WEKA 1E4EB 1KSJA 2WV7A 2HF2A 3JXEA 4X90A 3RJ5A 4RHEA 1SUSA 1UL1X 2JIMA 2QVCA 4BKOA 2GAIA 2IH4A 1FFXB 2R2AA 4BQSA 4YCSA 3CE9A 2Z30A 1N5KA 2PR2A 2YWFA 4A91A 1VJ5A 2B0JA 5G4KA 4EB6A 1WBJB 4JC5A 1G64A 3JQAB 3PR2B 1R6UA 3M9LA 1YMVA 4YO7A 4C4OA 4CMKA 2JARA 4FXPA 2CFIA 4X0EA 1CR1A 2OM6A 3I39X 1U63A 2HBYA 2ZBGA 3H97A 5LBUA 1CY2A 1TZBA 2A5DA 5FBHA 3Q0IA 2WM2A 2WUGA 3U7GA 5C46F 5GM1A 5JROA 1Z4PX 1A5ZA 1D09A 3PRJA 4R2LA 5JC1A 5TJHA 3EISA 4HZIA 2R1UA 1P2BA 1YS1X 2IZOA 2MSNA 4HH0A 4BZPA 6NULA 1B74A 4BU0A 3D5EA 5IK2A 1FU4A 3AI3A 1Z34A 3G5AA 3I9MA 2IOFK 3EQ9A 1ISJA 3SS8A 2RIPA 4XOIA 4ZRNA 3SLGA 3BM5A 1TM5E 1SQSA 1J97A 5B1EA 1KJQA 1ZITA 4IP0A 4F6RB 5C5EA 1PSDA 3G8BA 1Y9JA 3MERA 2GSDA 2VK4A 4OFZA 3IMCA 4U7FA 5HJ2A 2XUPA 4RENA 3SC4A 4YRLA 3C3XA 3GJYA 3KLNA 5FO1A 1JQJC 1KEVA 3FYHA 3FGNA 1W6UA 4M76B 2A0WA 4BE4A 1KERA 1T1JA 2J0UA 3F3KA 2XMBA 3D6MA 3TUIC 3ICEA 3OZCA 4FFBB 4YUWA 4QA9A 4LJYA 2NU6A 3IAFA 1JHYA 4GLLA 2A86A 2JD0A 5TJ9A 3SE7A 4QJBA 1Q0HA 2QXYA 5GZ3A 4M83A 3V1KA 4FOPA 4K9PA 1JFRA 4HEJA 5I9BA 4MV4A 4OMFG 4RDHA 5T8KA 3ZWQA 1GGNA 4DJEC 5BMVB 1GTVA 5JQWA 5JO0A 2P2DA 1UANA 4C04A 3HDTA 4RPHA 1KYYA 1RPNA 5ITZA 1C1XA 2PH5A 3GLVA 1B14A 1KDPA 4BV8A 1LPNA 5JS8A 4V02A 2IY7A 3DF9A 3Q7PA 5SZHB 2IV7A 1FJHA 3WAKA 3U37A 2E6KA 1TDJA 4O4HF 4B3BA 4DMKA 4GOLD 2J30A 5JWRA 2QXUA 1BFUA 1LDMA 1Y8AA 2BMWA 5T4HA 2V98A 2GK7A 4NBSA 3O2JA 4UPDA 2DEUA 1VJ0A 2VHXA 1H8EA 2W2TA 5CK4A 5BQOA 1ECGA 3SZ3A 3HUFA 2IYPA 5E4JA 3IXMA 3TTSA 1X7WB 5M5BA 2VDWB 4ECAA 1K8YB 3JYLA 3A4MA 1L0BA 3L9WA 4RXMA 2EL7A 3TRHA 2FE1A 5U9CA 2G4LA 5AKZA 2Z3WA 1CCWA 2ZKIA 5KKCA 4KCGA 2Q45A 2WC1A 3KYBA 1KEZA 2JAQA 2K6GA 3OFND 4RGYA 1QCYA 3SR0A 3S81A 1CUYA 3KR9A 4IIBA 1IY9A 3KBBA 5CRIA 4BMPB 3DEKA 4UUBA 4I3GA 1U9YA 2MR5A 1CQJA 3JQBA 4AZTA 1FNDA 2A5LA 4EHAA 3DAHA 4ZO8A 3GJTA 3ELYA 1LI7A 3WL8A 4I8DA 5IEJA 2A57A 3MLEA 3M82A 3NM5A 4EG8A 2ZUEA 2MMGA 4B6EA 1EEXB 1R6XA 4KV9A 3DO5A 1DKQA 1T29A 5HTOA 2ZRAA 3INYA 4WPGA 1XNGA 1IONA 1NUHA 4FT4A 2AZTA 3DP9A 4JB8A 3X43A 5LJLA 1IHXA 1W4CA 2CL0X 1J0BA 1PE0A 3B5EA 1U80A 2IHBA 2MYNA 3NIGB 4GDMA 1I3NA 4H59A 1JVSA 3HVJA 4QJIA 1RQXA 2MWMA 3H6HA 3N2GB 1XHEA 4DG8A 4ZI2A 1A4RA 3ZIDA 4L3WA 5M29A 4Y1GA 3MJRA 2G7ZA 1MB3A 4BWYA 2QN1A 2BGWA 3VR6A 1IULA 1NFFA 1T43A 2VDNB 3ZW8A 3C3WA 1PNQA 5ADUS 5CCBA 2OCBA 1U7OA 1U81A 3E7FA 3QX8A 3T7AA 4AIRA 4BLPA 4L85A 1CUVA 1WHSA 3CCBA 5A4IS 1C5KA 1MO3A 4OUDA 3TS1A 3W34A 2PUEA 3HBMA 2O8EA 4LF7B 1SUEA 5DXAA 1M5UA 4FOOA 2XUZA 3IP9A 2WTEA 1C9MA 1RYZA 2O07A 2CSUA 3SHQA 1AXEA 1NF3A 2XSZD 3T54A 3OU2A 4BMOB 4N1AA 1KO8A 4KB5A 4M8LA 1JJAA 5EJ6A 4YIKA 3RV4A 1RFGE 3UFXB 1I4EB 5F73A 5CB0A 3Q6IA 5JT1A 1H1DA 3CRW1 1U6KA 3L0DA 5B55A 1XTQA 1G38A 5DP2A 2PL3A 1SU4A 2QRVA 4KKXB 4P98A 5C8ZA 5IXSA 5I7WA 5JAHA 2CGEA 1GKLA 2UZ3A 4FB4A 3L8DA 4M9SA 4OQXA 3D2BA 2X7JA 1QGZA 3QW2A 4L8WB 3BIFA 4MS4B 5CT6A 3TNJA 1JIUA 4WZBB 2RHJA 3SQOA 1ODJA 4Q9LA 2HCRA 5IG2A 5IS2A 3DZGA 3C4QA 1Q16A 2EXXA 3DKRA 2O8FA 3C45A 1DSSG 3U7IA 1GNTA 2JZCA 1QIIA 5AJHA 2C54A 2WYIA 4KODA 4LOHA 3RG2A 1ZNYA 3OWXA 3V9AA 1A98A 1R15A 2BGNA 2PKYX 2IODA 3BIJA 2A58A 1KZ7B 1RMYA 2QRHA 4UBJA 5K0LA 4AO6A 4CLRA 2C78A 4HMOA 3GLUA 1I1NA 5K8VA 5EEGA 1GNSA 3AOEC 4G56A 1USWA 3KOWA 1KAGA 5CR9A 3RVPA 4JV5B 2B98A 4B4WA 1QP0A 3F78A 1CFZA 1KJ9A 1WV1A 1P2SA 1P4GA 2IXGA 4YV0A 4F1JA 4HPWA 4EY5A 2VT2A 2A94A 3E3AA 5FHQA 2W58A 3NRJA 4TXLA 3L7OA 2DFVA 5AW1A 2QAJA 2PO5A 3ZUGA 1JXAA 3DLHA 1XZJA 2WHXA 5FI3A 2G1JA 3NHKA 2ZUTA 1K4KA 1ZI9A 3EVDA 4C43A 3ZXSA 3K31A 1RWXA 3IAUA 4OQPA 4YCDA 2QJWA 4I8IA 5EWMA 3JU3A 3TD9A 1DKNA 1L4NA 3T7TA 1KOGA 4ZU6X 3SXPA 4UE2A 2VJBA 4DCUA 4LW8A 4TSKA 3PRKE 3WO0A 1UBLS 3NTUA 3SSAA 4II2A 1V3VA 3A3OA 3C4VA 3HBNA 2YC2C 3MJCA 3PPYA 3H83A 4BAUA 4EITA 4ZMBA 1WX1A 1LS6A 3RFCA 3PXCX 4QASA 5BN4A 2GBPA 4RA6A 5K6TA 1KEPA 1U5BA 2R87A 3LBFA 2RBGA 1PZEA 5I4BA 3IDZA 1THGA 4NZNA 3W1EA 1UFVA 3ND5A 3TJZA 4OX9Y 3RC1A 1DAPA 3H0KA 3U3RA 5KOHB 5FLKA 1GKIA 1QCZA 3BRQA 4RVNA 3R9KA 4YMHA 2PWYA 4HXGA 2RIRA 4J2OA 4CCWA 5SZIA 1OILA 5JJIA 1Q2UA 1FUKA 1KYTA 3GMIA 4I99A 3TLZA 1L5MA 4HSEA 2Q7OE 2BR4A 3PQEA 1U99A 2Q6IA 4RS3A 1OLXB 1T5IA 5LZ9A 4RGQA 5EPOA 3WMEA 2VNJA 2SKCA 2F1HA 1V6AA 3ZCTA 1HQDA 5KWEA 2DR0A 5ED4A 1SG9A 2AC7A 3ZE6A 3BDVA 1E5XA 5DXJA 4DVJA 2EG9A 3UTDA 4ESHA 4NAVA 3H11A 2E4XA 3ZXYA 4ENSA 3WSVA 1L5WA 4Y9RA 5BOSA 2Y1CA 1AB5A 1RKBA 1ECFA 2JASA 3TQFA 2JLZA 1YR7A 2WWXA 4JVMA 2FW9A 1EVJA 4NRDA 1V7PC 4GEKA 1E7MA 3FYTA 3G79A 1L6IA 2Y1GA 1Q7TA 3COZA 3BJIC 4OHXA 3MWGA 1X92A 1YXMA 4KL8S 2Y92A 1RI5A 3BMNA 2WIJA 3PKZA 1W5BA 1YQXA 4OOFA 4RTJA 3G2KA 3B7PA 2F64A 3RSZA 4B09A 4BGIA 1JQEA 1JIXA 3ZNNA 1IK6A 3NAQA 2MSKA 3H4VA 2ZSUA 3QSYA 4DCSA 4DCMA 4D9HA 2PYZA 1SY7A 4R8SA 3LX4A 3W9SA 3AL0C 2VP9A 2V1XA 2ZE5A 3L93A 3OUZA 4KOAA 5TS3A 1F6BA 3STVA 3DVSX 1ZH8A 3LLUA 2AN9A 2AUTA 4UOZA 5MGNA 1XRMA 2WSMA 3H18A 5FV4A 4LOAA 4UOQA 1FS4A 1QH1B 5BT8A 2MHCA 3EIQA 3WLJA 5JVDF 2X4DA 4OSPA 4UXIA 1W52X 1SU8A 4HYYA 2AI3A 2YQZA 1D7AA 2QAGC 3U09A 1RKVA 1P0QA 1H3NA 1MRSA 2UKDA 1AZWA 3EZ7A 3ITKA 4F2GA 2WUVA 3O90A 5JYDA 5CNMA 1UUFA 3LPMA 4NAUA 1HDGO 3NXSA 4P3NA 3G2PA 4YECA 4GBJA 4CM3A 3NX4A 1ZX1A 3GEIA 2WPNA 3NTXA 5FUBA 3SOPA 1IQPA 2I6TA 2Q1WA 4O1IA 4L16A 4TKUA 4YPFA 4EHDA 1THZA 1O7JA 2FWPA 2J3LA 4KE7A 2VHVA 5ALKA 2R44A 4ENPA 2AN1A 2VCEA 2JLBA 2NAPA 1N8SA 1ZM3A 4NU0A 4ARZB 3BJRA 1WUKS 3MC1A 1WP9A 3QIVA 2OQRA 4JKOA 1PR2A 1K27A 2R2GA 3RABA 4AUMA 4HVCA 3CF0A 3LW8A 4TRNA 5I01A 5IUJC 2C9BA 1JHRA 2I29A 1V45E 2HLDA 1U8TA 2OO7A 4PYNA 4F4DA 3F1LA 1X1SA 3M5PA 5KDLA 1NVVQ 2LP4Y 5IC5A 4C3VA 5KQSA 2AG0A 3QA9A 1JHQA 1NP7A 2YYZA 4QSMA 1M8KA 2FG6C 2HWYA 4YRIA 5KQPA 3U7HB 2AOUB 2BLNA 4YRDA 5LA6B 4M0DA 4QULA 3J80A 4ZOLF 2VHQA 4QWWA 2IV2X 3I5YA 3QOXA 1HK7A 4CKBB 3W3AA 3PQ4A 1ZISA 1TB4A 4HDCA 4MKGA 5JNLA 3GXOA 2WV9A 2HMTA 3L9XA 3QHQA 4EI7A 3GRKA 1GV1A 2LCIA 1BD4A 2QHXA 1ZJ6A 3VSCA 4LF8B 1VHTA 5LMCA 2OR3A 1SB9A 3CONA 4MVJM 1U2SA 3OECA 1R12A 4IVNA 5J9FA 1NKVA 4F86A 3KWFA 2H4WA 5GJWC 4K1LA 3KJQA 3KEOA 4FQ7A 3LUDA 4X61A 1JVBA 3G88A 3OWHA 1SVUA 3VR0A 2JBAA 1L4HA 2A5GA 1TA0A 4X3PA 3SC2A 3FPHA 3MBOA 4LF9B 3AEUB 4EGAA 4TUYA 5CM8B 4GSLA 2AMFA 3IDAA 4HNUA 3A05A 5FR2A 4BKPA 4QLAA 5KU1A 4IDNA 1EUYA 1E9RA 3QKWA 3V2GA 3K8YA 1HV8A 2VQ3A 4PZAA 5CVJA 4XSHA 4AU1A 2FN7A 521PA 4S1NA 2IUEA 4RPKA 5A6SA 1Z2PX 3EXHA 1GAWA 2G76A 4K9SA 3PFHA 4DCOA 3GNSA 4I50B 1XP8A 1VCNA 4TV8F 5F9MA 1FFEA 1GG9A 1H66A 5KSZA 4MCAA 4TQGA 2ZSHA 2XECA 5EJMA 3PC8C 2NP7A 2B21A 1RPJA 2Q28A 1K6IA 2XCRB 4M98A 5K4HA 5J3JA 4MQFB 2CC2A 2M1ZA 5F2EA 2HLNA 3CZPA 4HRVA 2B9VA 5G3ZA 4X65B 3U2QA 3RRFA 2LW7A 4NFHA 3RYFB 5AW8A 3Q41A 1P77A 4LNUB 3OAAA 5EIBD 1OV4A 3SF0A 5T3YA 1LSSA 2PZKA 2YN0A 3DB2A 1R00A 4UM9D 3GCWA 3ZCRA 4C4AA 1RQGA 2XMZA 5G40A 4ARUA 4XJSA 1J56A 5D3QA 4FFOA 2UVPB 4EGQA 4FHFA 1VKZA 5IBPA 1FTWA 1N2CE 1XJ0A 1ML4A 2Q41A 3GUHA 3I30X 3ICCA 4MYCA 1V71A 3Q88A 3AEKA 2IU6A 1C3OB 3PC2A 4M0EA 1JKJB 3QEJA 3A6EA 4UZEA 4O2AB 5C7LO 3G82C 3EPPA 1GZSA 1TF2A 4G1VA 4GSKA 4H6PA 4KRGA 4RA9A 4HRYA 4UUNA 2ZPTX 3D3QA 3PDJA 4MH0R 4BAZA 3E8XA 5IZCC 1UP7A 4JMLA 3KB6A 1RWVA 4U8HA 1UPFA 5DNDA 4IKEA 1EWQA 1QWOA 2M6LA 2UYHA 2W93A 4PYOA 4AXXA 4OH1A 1JU3A 3BH7A 4X20B 1PZXA 1F2UA 3L92A 4HPJB 5EPUA 3MWDB 4PC2A 1MJFA 1X70A 2YMLA 4J75A 4NV1A 4CCAA 1AHHA 2IEAA 3OPMA 4UU7A 2R8PA 3EPRA 2DWUA 3AUYA 3LX6A 2CK3D 1T6YA 1J2RA 1L3CA 2ZB7A 3FOAA 4RDCA 2VWQA 3FYDA 5AIAA 2GEKA 3RG8A 3VU0A 3B51X 3M6AA 3T0IA 1H23A 4DIMA 1FC0A 3R40A 4GPD1 2XNDA 5E6RA 3OO1A 4N0DA 2IIVA 4IL5A 5BR1A 2GUWA 4LXXA 4Z0PA 2PZGA 2ZT6A 1R0LA 2R86A 4WXPA 3HN7A 4Y7DA 5KIAA 1Z2CA 4R01A 5KX5B 4MQBA 2NQ8A 5JXJA 5IVDA 1CY6A 1Z2EA 3UANA 1UC4B 4J0KA 3BMCA 3Q0TA 3QTBA 3W90A 2I2DA 1ID8A 3TRKA 4NMXB 5DU2A 4FJ1A 4GPTA 4L5JA 3HY6A 5FPKA 4W1QA 5BV8A 3FDFA 3T3EA 4BLSA 1V3TA 3O95A 2CXPA 4IZIA 3JQRA 2I2CA 3RAJA 3ZKWA 4UVEA 3BIXA 1FK8A 3MB8A 4KO4S 3FM9A 4M54A 1HSOA 1G18A 2ZWOA 2QTTA 4A8JA 1BHJA 3ZW9A 2XITA 1UP4A 4BQNA 2VAPA 3M1AA 3U0VA 1XC7A 1M2NA 3IERA 3MWEA 1DUIA 5DULA 1N4AA 3IESA 1HNXB 1WULS 4C89A 5DCLA 1B1AA 4Y1RA 1UM8A 1RBQA 2B4TO 2JVKA 2QMYA 3PXDA 4MYUA 2VK1A 3NGXA 4LGVA 1MX1A 1RMTA 3EFOA 3PVZA 2W6NA 1SO8A 2CVFA 3IAS6 1DHTA 1EI9A 1OFHA 3FPJA 1P0IA 1NVWQ 3THWB 3PUKA 2O8BB 4V0OA 4EWLA 4JYMA 1UAAA 4JSRA 4BV3A 3WO1A 2FWMX 4FZ5A 4ID9A 2HQ1A 2QVBA 3AZOA 3HP4A 2OLEA 4JVOA 3AH8A 1H8HA 4LFAB 2IZZA 2JC3A 3HJNA 4R3WA 1U2TA 4IQGA 1O5OA 2GZDA 3B6IA 4LPKA 1G0OA 4XZ3A 3RFTA 4DNPA 4XIYA 4I5IA 3DL2A 4CMJA 1YVPA 1MW9X 5HKKD 3RUPA 1G3QA 5LB4A 2BPOA 1L9XA 1ZINA 2F9MA 3PEFA 1OTXA 2XHZA 4IF6A 4L5YA 4XQCA 1PNTA 2QZ4A 5K8UA 3WLHA 5A2GA 4S35A 1JHPA 2C5LA 1U3TA 1WMAA 1JF8A 1W76A 2QD3A 2PAAA 2QTWB 2JIZA 3PL5A 3ASYA 1I3KA 1IZ8A 1T36A 1JG7A 2R8EA 4EYQA 3A6PC 4FX2A 1KR2A 4DMUB 3O75A 4EARA 1MR3F 1U2QA 3U7JA 3TM4A 1Z62A 4I7EA 4DDHA 3DMGA 5EYPB 2PZLA 1WD7A 3I9KA 1O57A 2AC4A 4QDJA 1UK8A 4TQ9A 5COQA 1IJBA 5IVIA 1W0KA 4DXHA 3KZVA 4AX8A 4W1RA 3JD1A 1YHZA 3EVGA 5F77A 1XNJA 4HDQB 3SFZA 4EO7A 4KTVE 1YE5A 1Q83A 4TLDA 2R97A 2EFHB 4K5QA 4KLZA 1GADO 3TRIA 2QUAA 2AXQA 3B70A 1G1MA 5BSEA 4CIXA 2BBTA 1G3RA 2KSQA 4QJ3A 3OM1A 3FOWA 5CH5A 3F90A 1X42A 5L4LA 5GTDA 4HDRB 2IL1A 1G4HA 1F12A 2X0NA 3D3NA 3FPSA 1TUGA 3DHWC 3WTBA 4B4VA 1KC3A 1VHJA 2I6SA 2GEJA 3B6MA 1F5SA 4K9NA 5AJYA 5K8JB 4ND6A 2P4SA 4Z9YA 5KSYA 2AFHA 4E3ZA 2EFGA 3ENZA 3LM8A 1IXKA 3AHJA 2RBEA 4U7PB 2X3FA 1VTKA 5EJIA 3W05A 1HNWB 4KXUA 1LUAA 4GL4A 1N9KA 3EDOA 2A3NA 4RQUA 1I14A 3C3KA 4XUGB 4JLUA 4F7DA 2XD4A 3X1ZA 2CLOB 5IYZA 5GJBA 4G0QA 3OZ7A 4IS3A 1BU8A 3Q8KA 2W48A 2G71A 4WVFA 1VHQA 2QW0X 2NUTA 3VAYA 4LGYA 1G2PA 1V1MA 2J4FA 4Y0VA 4JEMA 1OA0A 4XVRA 5B37A 2X8LA 1V8FA 1ZCJA 3ND8A 2C2XA 4QPJC 5JWHA 1OU4A 3UEOA 2QDKA 2REXB 4QUJA 5JD3A 5AM2A 5BR7A 5FFFA 2G9ZA 3QG5A 5EY5B 4IJWA 2BCEA 4MV6A 1GGEA 1R16A 2B4YA 2ERYA 2R1VB 2VF4X 3DC7A 3ILSA 3Q9NA 2KLHA 1LRJA 2PG3A 1E3EA 3IOCA 3H2ZA 4KBYA 1QDLB 4EMUA 1Q0LA 1QJCA 1C50A 1RCFA 1K1EA 3BGSA 4PWYA 3G68A 1Y8CA 3PDHA 4MXDA 4U6QA 4YRQA 3V8RA 3FTPA 4D0NA 1BS9A 1M10A 3R4CA 2ZIEA 2GBGA 1R8YA 2J5QA 1P33A 2XMRA 4URHA 5HQ3A 1U2RA 1ZH0A 1TLFA 2W7TA 3KE8A 5KOIA 4BU1A 1N3IA 3R5JA 2IZ0A 5BSVA 2YV1A 5L6MB 3CW9A 1QV7A 1GG2A 4KJXA 1G9XA 4ZPJA 3GP8A 4Q4DA 5FLYA 3WY9A 1UBTS 4Q93A 3FH0A 3OZRA 3BJZA 4QXMA 4GM4A 2M6KA 1GUBA 2UUOA 4A8HA 4EPVA 1EP9A 2DT5A 4BIIA 5IDYA 3M6UA 3P0FA 3EAGA 1CR6A 2UU9B 1MMFB 3E5HA 1DIGA 5FWNA 5BR8B 3RAEC 3FBTA 3OZAA 3PICA 4A8TA 1W5TA 1F06A 1T5LA 3BSSA 1YKSA 2J9FA 2WUEA 3D8BA 3H9BA 1LF0A 1L7OA 4I2VA 4MW6A 5TARA 1NLFA 4KYUA 3TWOA 4E88A 4C2BA 1XZDA 1IFXA 3RS9A 3ZGOA 2AE2A 4RLSA 3TTUA 1NPDA 4DLYA 2AE1A 2QI9C 2ZIXA 3I1IA 7GPBA 4YC7A 4LX8A 2AHRA 4IGFA 3DGEC 4ZVOA 4OO3A 4YR7A 2B82A 2PS1A 4OHOA 3PC7A 2P2GA 1QHFA 1KZ1A 1LC3A 4UD2A 4I4LA 3OH8A 2H5EA 1RXSA 4IV0A 4P5PA 5EP2A 2QW8A 5F9HA 1FQOA 1CY8A 2DPHA 3WQBA 4GZLA 1RHUA 5AHRA 5FT9A 2VDJA 5IBCA 3WWPA 2VYVD 4W8HA 5IVPA 1JT2A 4R84A 2NUAA 3EVCA 2P77A 1XRJA 3ORSA 3R44A 3LSYA 4K88A 1QVZA 4YP1A 5JS2A 5LKAA 3AGPA 2IGBA 4C87A 2Y71A 3BSYA 5C8YF 2ZUDA 5AT1A 1KWKA 4TTJA 3OTWA 4DLVA 1P74A 5DHRA 1W6RA 2E55A 3GLHE 3EXAA 2ZVPX 4CDRA 1XI2A 5J1TB 3WLQA 1EX7A 3O1JC 4XGIA 4E70A 2VUUA 2OXTA 4CQMD 1IOZA 4IDBA 1W8IA 2FPKA 1LKZA 1I3CA 1DCFA 1ZK0A 1AS0A 2GF0A 2W2QA 3L8CA 4OJQA 4Q9AA 1F5NA 3JYOA 1MO5A 4WA7A 3VX4A 2F43B 3WJAA 1L4FA 3ZBTA 1EUZA 4ZVNA 4A36A 4H2DA 4RSRA 1UWVA 4KXYA 2CY0A 3HFRA 3ZH9B 2VXOA 2ZBUA 2OGUA 1X7XB 3ZOZA 1IIRA 2B3TA 3SBDA 5AI6A 1L4YA 4AYXA 1YR9A 5K3EA 4BV2A 2IS6A 1NRWA 1ZDMA 3WQRA 3KJZA 3GLKA 1U8AA 1DJMA 1DO0A 1EGVB 1PYDA 3FKQA 5JXHA 2W2PA 4TKVB 4EZIA 1B93A 3WADA 1WPRA 3B36A 3SDSA 1RHRA 4BQQA 3JQ6A 4DLXA 5J5VA 2C61A 4BNGA 5KTYA 5M7EA 4G1MB 2IOFA 4HS4A 4WFJA 4I4IA 3ADDA 4NNJA 1XJWA 3FNHA 1G9SA 2XTNA 3EXIB 3SE0A 2RGWA 1A77A 4OP3A 2P2CA 4BB5A 3DAGA 1RLTA 3DO6A 3LKDA 4H6VA 2OYCA 4I4TA 3EZYA 3H65A 3ER9A 1TTTA 3JATB 5EVJA 1TI7A 3FWZA 1PBTA 1TPYA 4QGHA 5COBA 3ZXUB 4FMCF 5AKJA 5FDFA 1RM4A 4QM6A 2JGDB 1G17A 4MQMA 4IFIA 2C84A 2MT9A 821PA 2Z43A 3ZD6A 4JI4B 4EI9A 1DUVG 5IULC 1T6BY 5KKNB 1CNEA 1PJ8A 1NZJA 2WAOA 1E5LA 2YJNA 3KDSE 3DFFA 3JS5A 1GSIA 2J09A 3VZCA 3RV3A 4Z8XA 4DMCA 2OUKA 3F49S 3GGOA 1MX5A 5LFAA 3AIOA 3NV7A 3HJAA 8ADHA 1ORTA 4DADA 3QJ5A 1P4JA 5ELXA 3KZ1E 3ZZ0A 3PP8A 4DLWA 5E4TA 2KBFA 3PJFA 3M6FA 1LZLA 2VTEA 3EH1A 1HC7A 1I2DA 1UXJA 3AILA 3PNBA 1YQDA 2A6PA 1NYTA 2CDBA 1D6MA 5I4IA 3O8QA 4D0LB 1OFIA 1I6WA 1CQIA 1W1IA 1U65A 1LK7A 1XAIA 2ZB2A 4FDUA 4GGMX 4II3A 2CUTA 5A5VA 3AUUA 5AI9A 3AEQA 5DCUA 3ZEAA 1I3LA 4L0DA 5ECYA 1CEEA 3A7EA 3TKLA 4ETWA 2XVMA 4Z1MD 3C5HA 1EGAA 2ECPA 1PNVA 3FHCB 4N8SA 5E9WA 1K0UA 2J1LA 3BH0A 2QTFA 3B5IA 2WZQA 4RD4A 3RAPR 1DEAA 1RPAA 4NYIQ 3W8DA 1JEYA 3E81A 2PZJA 4AY4A 1MXFA 1VKJA 1PR1A 2WF6A 1XU7A 2WMYA 3TTVA 3G8YA 3R24A 1SD2A 2F6RA 4OHFA 1E3WB 4U7WA 4PX2A 2X8JA 5CW2A 4E07A 1NTOA 3KZXA 3ZTWA 3TE7A 1NN0A 1N6OA 1KYVA 3T5MA 4YT2A 3R8FA 2VSOA 2ZUWA 4WOBA 3CJRA 2EV9A 3KT6A 3LUAA 4QTTB 5DVZA 1L3BA 4MNTA 4H1WA 3NBAA 5NULA 4D9MA 3BQMB 4PZUA 1Z22A 1VKRA 4AJLA 4QTZA 1NN5A 5LCXA 4B4KA 1H2XA 4C2UA 1E60A 1WZUA 2QXTA 1QK4A 4QX6A 5GY7A 4GE3A 1I1OA 4US2R 1PLLA 1KP2A 2IYTA 2OHIA 2R8YA 4KUGA 3GLFE 3QV2A 5K05A 1KMCA 2YMQA 3FWPA 1Y1KE 3I3OA 2OA0A 3M2TA 3UXHA 1HGXA 4MRMB 4FT2A 5A02A 3PUVA 221PA 3SHTA 5J4YA 3IS3A 4EMTA 1OFUX 1H2EA 2XWSA 1OGIA 3PFNA 4GXTA 4L7QA 5A9SA 3F6YA 3PT9A 2IV3A 2HMWA 2A0YA 4FS3A 4HQ6A 3OPYA 4LQ4A 4EY3A 4PCVA 1SUFA 2WOOA 1YRYE 3QWBA 2GAFA 2PD6A 4CMBA 1AC5A 3VZSA 5CB6A 5JNWA 4C7OB 4J4HA 2IPNA 4V0KA 2FXIA 2QOEA 1EFRA 1H5QA 1P0FA 4J1SA 3NHUA 5JEDA 3FFTA 1C9YA 1QHHA 2CD9A 3C8MA 3ESCA 2JJ2D 1GIAA 1W49A 1CLEA 4LYYA 3ZYZA 2B1QA 4QPDA 1R6AA 4CTJA 4UTRA 5SYAA 4AG5A 4XDYA 1K75A 3C5CA 4Z4FA 2AH5A 1NHWA 2FV8A 2AMYA 3KAKA 5ALOA 2YHBA 3C6KA 1Z8FA 3KK0A 3RS7A 4P9NA 4YBRA 3UJNA 3T7CA 1ZCZA 1QLJA 3TZEA 1N2HA 5CB4F 4R05A 3W5AA 2DUUA 5EGNA 2CNWA 1A88A 4AICA 3OO0A 4QGGA 5LKRA 1Z3CA 4I66A 2Z95A 4OB8A 5EIWA 1HEIA 1IY2A 1ZEMA 4IIJF 1OXKB 3FWNA 4EEXA 1RWBA 4HEA1 4NATA 4ZQFA 4BVFA 5AWFC 3MAJA 1NLZA 4XWTA 5HX7A 4HEHA 4LBZA 4ROSA 1SXHA 2PEZA 1PEYA 4GR5A 1YUBA 5JASA 1DRJA 3LC7O 1KKMA 4RTNA 4MDFA 2GZSA 2NXJA 4HGYA 2R6ZA 3KWJA 3DEJA 2V6BA 3LDHA 2VYCA 4WFIA 5CXSA 2R4UA 5DM1A 3AFOA 4DDVA 4P4TA 4ZXFA 3EGXB 2FZEA 2HMUA 3IPYA 2FUKA 2ZRDA 2XCUA 3DHVA 1ESCA 3H04A 4FMBB 3COPA 4RNCA 3DDCA 4RQTA 3SEQA 2R6DA 3QUQA 2GEUA 1P9RA 3NAZA 1ZGBA 2JIBA 3JVIA 3KYIB 4PQGA 2F1IA 1DAEA 3GJ5A 3CWZA 2E37A 3KPJA 4OJTA 1N7JA 4LTMA 2XXAB 4Q4AB 1LF5A 1BX3A 2J8ZA 1UC8A 5DOVA 3S8YA 3HG7A 3WB9A 5FYQA 5AKHA 4RFLA 1VZ3A 2GHQA 1ECBA 4KLAA 2PXCA 3H5VA 2V7EA 1JA9A 2XWJI 1O95C 4UPVA 2AD1A 2C8KA 1IN7A 5CT8A 2FN8A 5PGMA 4OBWA 4Z9AA 3ML1A 3EGOA 3QPCA 4KDFA 2ZYUX 4ZYVA 1OY1A 3I9OA 1O6BA 2O0JA 5CTAA 3WGTA 4CV2A 4ZOAA 4BNWA 4J9VA 1HLPA 2RAFA 5DT2A 5BN5B 3BXHA 3TECE 1I2AA 3JALB 4BNTA 4B33A 1LDYA 2EKPA 2FX5A 4EOGA 2FZCA 2ECKA 2OC4A 2QEQA 3BTUA 1G8AA 1KI6A 3N58A 2IX3A 4CMGA 1S7CA 3PUIA 4WY8A 3RB8A 3LPAA 1M33A 5D3MB 1HZJA 4O5AA 3ILYA 4BZWA 1PR3A 2ZATA 1P81A 4RMJA 5AESA 3R41A 4OB7A 3AM4A 4RH0A 1FNBA 4WZAE 4A0FA 2RI6A 2PX8A 3H1EA 2VF5X 5TQ0B 4INPA 1CB0A 3DLIA 1YL5A 1KYXA 1X7ZB 4CMIA 3GARA 2WWVD 2QTVB 1XPRA 3G1UA 2OCXA 1T4CB 2NQTA 5ETJA 1KWGA 1FLDA 1LTKA 4G26A 5KTNA 1KO4A 4LRTB 5EE9A 3UUFA 5A5FA 2PUDA 4X92A 1SQGA 4L8GA 4BVAA 4BX2A 1QTQA 1ANKA 2MINA 1QHSA 3E1GA 1VGRA 1W75A 4YP5A 5G41A 4YS6A 1KY2A 2YWDA 2YVKA 2QB5A 4KAAA 3FPKA 3M5WA 1YRLA 4LCJA 5TY0A 4BGEA 5LXTA 1HYHA 2HRBA 2YZ7A 3JX9A 3KUUA 4XUCA 3B6ZA 5HM8A 1ESEA 1VA4A 5KNDA 1ULBA 2MR6A 1SXJC 4R9SA 5SICE 3U4MA 2ZCJA 4DV3B 2P6MA 1X7GA 1Z36A 3W5CA 3N8DA 4LSGA 5CA1B 1O3YA 1FQKA 1L5FA 1NFRA 3T7RA 4YH1A 1TC1A 4NABA 1GZDA 1Z8DA 2HJVA 1DBQA 2HIGA 1YKFA 4GX5A 1V8OA 2O2YA 3AHFA 3Q7EA 1JA1A 1LI4A 3TLBA 3BGIA 3HWSA 4Q9JA 3PXGA 3RVDA 4EUHA 4IDHA 4BN5A 5FBRB 1HDCA 2ZIUB 3EHDA 3O9ZA 4FWBA 5GM2A 3ZHYA 4ALJA 1QR6A 3FHLA 1CRWG 1PNOA 1PGPA 3CRRA 2DFDA 2XWBF 1SVKA 5KMGB 4FKMA 2O0LA 2XBMA 4ISCA 2G8LA 1KS9A 5DIZA 1JZQA 2WY2D 3UYKA 4JLSA 2OD2A 4R2XA 3RF7A 1G19A 1W25A 4L4SA 4DR6B 4B32A 5SY9A 4G65A 3I6YA 1XTIA 1QQ7A 1Z7WA 1QBGA 4V3BA 5GOTA 3WL5A 1SIBE 5CEFA 1JU4A 4IDAA 4O29A 1XJQA 3D1LA 1NF2A 4MDYA 5DXFA 5JSZB 3IMFA 4NOKA 1PZHA 5DM70 1II8A 4NOMA 4OX9B 3HWWA 1H0SA 3HR4A 3JYQA 3BXGA 5BR4A 5GVSA 5BY2A 1PV4A 4JBWA 5ALUA 4J2HA 3GLGB 1KBOA 1GNRA 1HQKA 3UENA 4B87A 5A03A 1NYRA 1SVSA 1E3DA 4LRSB 4PPQA 4V3CA 5HDQA 2V5AA 2IC5A 3VSAA 3WGKA 4MUYA 3SYMA 2QX4A 4Q7QA 3ZI0A 3MW8A 4OQMA 1X1BA 3STHA 4DDUA 1G41A 1CUDA 3RQIA 5FV7A 3W4KA 2ZWAA 4WOCA 3THOA 4BLRA 5L95A 4F72A 4QRHA 2AKEA 3W2HA 5TGTA 2FFHA 4NU8X 1WB9A 4C7MA 4PLGA 1IBMB 1X38A 4TT3D 4LQCA 1EUDB 2ZCUA 5FPHA 2WHEA 3UO8B 4I9GA 4QYIB 3OM0A 1CUAA 5FTKA 5F23A 2PBZA 3Q9LA 2A9JA 1WCIA 4L6IA 4P33A 1NQXA 2I03A 4PWZA 3TW8A 3IODA 5DBHX 1KJWA 1XRRA 5DTMA 1R8JA 4CRWB 1XEXB 2G04A 2I8CA 4F3KA 1ABBA 1S2NA 3F98A 1JECA 2BFWA 2F1JA 3KJNA 4G5OA 5KYXB 1EDEA 4UM5A 3MS2A 4X24A 5C1OA 2FYTA 4XA8A 1HDRA 1TKCA 5K6AA 3PPXA 4BNJA 1SUAA 1U0JA 3F67A 4EO4A 3P0RA 5AK5A 3EVEA 3PGA1 4UUQA 2NUPA 3UJ7A 2EWWA 1N5OX 3GFVA 3EWAA 2VJAA 4Q9KA 3K20A 1PQUA 1WPGA 2XGSA 2XUAA 4A4DA 4FBMA 1VE7A 4IUBS 1JAHA 1Z5OA 4XB6B 3X2EA 3SQWA 4RKQA 4AF6A 2A1TS 5C34B 3OE1A 3GRUA 5T6MA 2JL1A 3RBVA 2GESA 3EE6A 3BYZA 4PZYA 2JAHA 4FCVA 1ZXLA 1Z5GA 3VC7A 1ONNA 4PGFA 1MEJA 1JLMA 4OQDA 4H7DA 3O8RA 2XV1A 3MAGA 4OIMA 5F4ZA 2BKEA 2OAGA 3K92A 5A6VA 3WWEA 3L6UA 2GKOA 2X5KO 4H0FA 2NTJA 4KYTA 7REQA 4UM8B 3VVCA 1AQ6A 5EKXA 2MTBA 3VHQA 1BJRE 1JQKA 2VUSA 1SKYE 3T4PA 3HSKA 2W6ZA 5IUNC 3QKSA 2B8TA 1QRUA 2W6MA 4INJA 3C6ZA 3HRIA 5DW3A 4A1OA 2OO5A 1LH0A 3NW9A 1KH1A 2PX5A 3QTLA 4NQRA 3AHEA 2P3SA 3E3MA 2UYGA 3LDGA 3IMEA 4D1YA 1NBHA 4ZAYA 4Q03A 3PL1A 3D0QA 1KXZA 3OPXA 3TI9A 3ZVKA 1YB4A 2JA1A 3T1VA 3HXOA 1YB7A 4AZ0A 3LZCA 3M6XA 5C35A 4OL9A 5DWQA 4BFYA 1EIZA 1V47A 5LL6P 1RDFA 2JANA 2VNHA 3K30A 1PS8A 3LFTA 4D74A 4EB3A 2VLIA 3M6LA 2B36A 2HTFA 5E3HA 1JB1A 3MHPA 3JZAA 2JKVA 3EJ6A 1SUWA 2WYUA 3MPOA 3RSSA 2EHJA 3CXUA 2CLFB 3HJBA 5E3JA 5EP4A 3LCMA 3FR7A 3AY0A 3AR3A 4FS8A 2ZQ5A 4LY9A 2NW6A 5HKBA 5CT9A 2O8VA 4HDNB 1PEAA 1ODLA 4FILA 1PL7A 2PLWA 5ALQA 1SBYA 3LQ1A 5CXUA 2WIBA 3AU8A 1S02A 1H6CA 2FK8A 2Q5JA 2V7UA 2PH1A 4FDAA 3OM8A 1ZUIA 3F5DA 2DQYA 1E9CA 1C7IA 3I6ZA 1YASA 4AS2A 4C4YA 2Q8QA 4N48A 5B3JA 1RKXA 3CLVA 4DQKA 5HHTA 5AUPB 4G8DA 3I64A 2EFDB 2IITA 3BWCA 5BWCA 2HK8A 3CMMA 4HWSA 1UWLA 4I81A 4BP8A 4MO2A 4UHFA 4OQZA 1QRTA 2W6JA 2DBVO 1WP4A 4F2PA 3ZE1B 4X62B 2VATA 3MTGA 1IBSA 1TT5A 3LUBA 2YUTA 3BICA 3PGMA 4URYR 5E7IA 4ARAA 1EVQA 2IOHA 1AK2A 3A6ZA 2WFZA 2D4HA 4YJKA 2H9AA 4IOJA 1S1MA 3O47A 3WGJA 2YBDA 5E7JA 1PT6A 4M87A 4TL8A 1B7GO 4WFKA 2FOIA 1E2QA 2YHSA 4L3OA 1T5SA 3I34X 2FQ1A 2H2AA 4XRGA 4J76A 3O8CA 4B44A 3MIZA 4DLBA 2HF8A 4UHJA 3LF1A 5KHLB 1U5AA 2QSUA 1F20A 4GFDA 3GZNA 4KAXA 1PNRA 3PGVA 5LA6F 4GT1A 4RD1A 5ILOA 3SZLA 2H1RA 1GPH1 2A5FA 4TSFD 3ZU4A 5DB4A 2RB4A 4PR3A 4EUFA 1OVMA 4RK6A 4YJFA 2R8BA 1PL8A 2MSWA 2GNOA 3DYBA 1J8VA 1W59A 1FDTA 1O58A 1ZG3A 2XGOA 3EGCA 4FKBA 3WWCA 5I3ZA 1N0VC 1C4XA 2WJGA 5HFAA 2H59A 5TPZA 4KU4A 3PXXA 3TW6A 4B7UA 2R751 2I66A 1U7WA 3DWFA 2P9GA 3O0TA 1ST2A 2FDCA 1I8TA 4UUOA 5ALXA 5HRCA 4M60A 3B78A 1ZLXA 2BM1A 1W0CA 4JJ8A 5ALNA 3EA0A 2H17A 4QUAA 2PKEA 2E21A 2EGUA 4KDCA 5EHXA 5KREA 3EX7C 2C9MA 4GU5A 1RNLA 1PLJA 2FRXA 4MUHA 1JLLB 2VI5A 2Q2QA 5CAEB 4GR4A 3SK0A 3WLSA 4DQXA 2CVQA 3WE7A 1CIPA 2VZ8A 5FLEX 2R6FA 5JG7A 1N1MA 2PAFA 2H29A 2RB5A 2ORWA 2X19A 4O6VA 1XO1A 3BG5A 4HX2A 2PUFA 4FYJA 3R09A 5IRCD 4OHMA 1V5GA 5CIYA 4LY6A 1WLYA 4IUCS 1BVUA 4WBNA 3TIFA 1JFFB 4EPYA 2V6GA 3D43A 5FNVB 2CSXA 2CCKA 2WD7A 5KYWA 2J0QA 4X3CA 2QGNA 4YMLA 5HFNA 3FDZA 5I7EA 4B7ZA 2R0QC 1PFWA 1DHRA 1FU8A 2XOEA 3LH5A 3OE7D 3PE4A 2ZITA 3AI1A 4H15A 3J7TA 4MYDA 4KNWA 1BJTA 1ZD5A 2G8NA 3KOYA 3MBKA 4WXRA 4X8MA 2XGGA 3KKQA 1WUJS 2AN5A 2VHWA 5EHZA 5I45A 1VE5A 4EQ6B 1HA3A 3ZZMA 1IDN1 4FU0A 1TD9A 1YDEA 3M5CA 3DOCA 2QJOA 4C5AA 3FOCA 1FRZA 3U1BA 1PJRA 1GNPA 1AHIA 2A1IA 3BREA 5JU6A 2LRHA 3AZQA 4XH9B 5A9RA 1DAFA 3DUWA 1HYQA 4HN4B 1NURA 3RUDA 4RZHA 5BQXA 1UJ2A 1YGPA 4M21A 4RWEA 3PC6A 4W7SA 1Q3HA 1V4NA 4HGQA 1B8PA 2GF9A 3ZTTA 1UBOS 4X6YA 2J7PD 1Z0JA 2WHPB 3OJOA 3ES9A 2B2XA 2OHHA 2WD9A 4E5UA 1W36D 1ZP6A 2HQSA 1Y1RA 4O2AF 2NYUA 2PD4A 3S2ZA 2BBOA 4YJ3B 5HUHA 4LOJA 1KORA 2ACVA 3WI7A 5HKOA 1XIVA 2QRGA 1ZMRA 3BFPA 4B3XA 5LWQA 3HCEA 5AVTA 1OXSC 2BE9A 4MV5A 5IF3A 3TG8A 5JQGB 3SLKA 2QQEA 2ZEJA 4PE5B 3OQBA 1V26A 4N3BA 3LYLA 4D8XA 1FYDA 1BS1A 4A5OA 2ON6A 1IN1A 2C5BA 2J5KA 4KQEA 4D56A 1QE0A 5KQGA 3FUUA 2PANA 4ZTBA 4CG2A 3LT0A 4GOOD 1G3IA 1MRZA 2E9SA 4LXYA 1GD1O 4MARA 5BRNA 2XYHA 1NA5A 5AKGA 3DV9A 5B12A 1DRVA 4R6WA 4YDRA 4OMCA 1RYMA 4NBUA 2ZWMA 5CDGA 1C7RA 1RAAA 1FFDA 3LNTA 2Z5LA 3RYCA 5F12A 4RF3A 4QU5A 1PT8A 3GD5A 3FTQA 1NBME 3DTTA 3D7SA 5KX5F 4JHXA 4F11A 4ZI3A 3GFTA 3MMNA 1VDZA 2C58A 2Z5GA 3QYJA 4TLCA 1US8A 5FFMA 1JLHA 2VKTA 4MKIA 3RASA 5LU8A 1D4ZA 3ZVLA 5JCZA 2WA1A 2JZNA 2FW0A 2CDRA 2QYOA 3N74A 3TKAA 2FWRA 2HY7A 2WWIA 3OZWA 1U3UA 1SEVA 4EP1A 2ZVDA 1R0SA 3DAYA 1HUQA 2WT9A 3UJAA 5TSDA 3M9XA 4E14A 1E92A 5B7QA 4JQZA 3S5UA 1ABFA 2H1LA 1WMEA 3D02A 2D06A 1ZN7A 5HG0A 1C80A 1KZGB 1S9DA 2W71A 3AOGA 3K1YA 4FR0A 1RQLA 3TLEA 4MV9A 1J0EA 1V16B 1XSEA 1UMDB 4H18A 4EX6A 4MV3A 3AW8A 4YP9A 5CLFA 1Z4JA 1Z56C 3TGLA 4MKFA 3IL2A 3SBOA 4C6RA 1BHSA 4CM4A 1AMUA 1E59A 1LQ2A 4DCPA 3WWDA 5JISA 3VX3A 1T6NA 1TXGA 3EMKA 2CKDA 1H9AA 2FH5B 3B9QA 3KQKA 4ZEWA 1TCVA 3X1DA 2O4CA 2UYQA 5LR6A 2ZI5A 3LQ2A 1YZKA 2CNKA 4FGZA 4L4YA 5FJJA 4F6LA 4KHPB 5JARA 2N3ZA 1RM5A 4FYKA 3D5TA 3IXQA 2RKBA 3PC3A 4KRYA 2LIVA 1XRLA 4TUYF 4ZRMA 3RROA 4YRAA 4IXNA 2DAPA 1GEEA 3GUZA 1EVZA 1CP3A 2P6PA 4L76A 2P1ZA 1PL0A 3NGMA 2DP4E 2NV2B 4QNMA 2HXSA 5JXIA 3WYNA 1ZUD1 1QGED 3QELA 3NEAA 3TNYA 2IZ6A 1GUZA 2HPVA 3R3JA 2B2NA 4OI4A 2XUJA 2F4NA 3WGHA 1JU9A 1YVUA 3IKMB 3QU9A 2I76A 4OMUA 3IPRA 1KHTA 2HZ7A 3WMRA 4ABTA 2XDQB 3CUVA 1RRCA 1Z4IA 3LP5A 4OD0A 1X8JA 4ZYWA 3CH6A 3QEMA 1P2GA 4OHCA 3QFFA 3IKTA 5E1MA 1Y5RA 1VL6A 4ZQIA 5B58C 1QG6A 3VSBA 2WKSA 3OTQA 1XD2A 2YWBA 1JB9A 3IPAA 3LIPA 1B6SA 2QVXX 4Q12A 4FZ3A 4JBYA 5DTEA 4KR9A 1P80A 3VR3A 2J67A 2J3EA 3BAZA 1MABA 2UZAA 3DBIA 1I01A 4IG4A 3INNA 4ZO6A 2I6UA 1X7DA 3BA1A 4C78A 2WSIA 4KREA 1EWYA 3WOVA 1YZNA 4E2YA 5FRDA 3WNVA 1CRLA 1N2IA 5D7NA 2PXAA 4UJ3A 1OBOA 3ZZNA 3DMDA 5ITZB 5CNIA 5G53C 5AVWA 5JNUA 1H4QA 1YA8A 1JSZA 2B5OA 2Z3ZA 3A58B 4TVOA 4DXAA 3QWIA 3ONVA 4UASA 4O02B 3HRKA 4BTVA 5I7SA 4GYWA 1SKBA 4HGNA 5JZMA 2VNAA 4UHKA 3L0BA 1Q1EA 4Q7JB 2O0KA 2I2WA 4ZVTA 1LTHR 3U7QB 3WVNA 4S04A 3N5KA 1XMJA 4F91B 1V8PA 4UM9B 1WBBA 2ENWA 1RE1A 1FDUA 2QD4A 2E4ZA 5T64A 3B89A 4D9GA 2R25B 3O4IA 4PNHA 5CVCA 2YVQA 4BKQA 5JSFA 4Y2QA 4W5WA 2WJZB 4QODA 4M6WB 4WGFA 1SWVA 3C7AA 1UBMS 4RHUA 3MGCA 3OJXA 2Q4RA 3RM3A 4CF3A 3A9RA 4KW7A 4CUJA 5IDXA 5IKPA 2EBHX 2BFFA 1AK1A 1LBQA 1NBMD 4Y9DA 2WNIA 3PYLA 3IA2A 3D8SA 3VU9B 1W96A 1X1CA 4V2IA 2IUYA 2G36A 4ZDKA 3FSJX 1ZJ4A 4URWR 3C41J 2QLBA 4GWKA 3W5BA 2WJ3A 1O5IA 1AHNA 4GG1A 4EVSA 3FTDA 1C0KA 4RYDA 4JBIA 1FBTA 3MT7A 4MCIA 1RIFA 4H0CA 2D1RA 3M4JA 4WNAA 4XWGA 5D2CA 3D6TB 2ZGVA 1IM8A 3K0HA 3TPCA 5KQRA 4BC1A 5EQFA 2BFEB 3SQLA 5BV1A 1AV7A 1FSSA 3GW8A 4KC0A 4CL0A 1KPIA 3K8ZA 1GO2A 2YASA 2EZ4A 3HYTA 4RVUA 3K9BA 3I9NA 1PK8A 1I13A 5IT0A 1HG0A 4GXQA 4YUVA 5KNBA 1OH6A 1OQAA 3NC1C 5BNIA 1ZAKA 2UZ1A 4HB4A 1Y37A 3NNDA 1QOPB 4PLCA 3ZV4A 5DNYB 1E5TA 4PQRA 1G8FA 1MC1A 2QTCA 2IYWA 4RSGA 5LPNA 3K5HA 3DDOA 3B6EA 5HDBB 3P1JA 3R3ZA 1XG5A 5DMXA 2V9PA 1W2WB 4OYYA 4TTVA 5GGYA 4RLFA 1EE9A 4M8NE 4DIEA 1Y4DE 5IJZA 1HMYA 2QV0A 3BGWA 1I10A 1DJQA 3BGOS 4JUFA 1T1EA 4O1MA 3A06A 1DOHA 1MZVA 1TCBA 3PCTA 4WY2A 2A9VA 1FDSA 4F4JA 3AP2A 3NKFA 1SRQA 1KMQA 2X8BA 1VHWA 3EGDB 4MI9A 4HL6A 3VZDA 1XELA 2BKUA 1LQTA 4BVEA 1HXHA 3CO5A 4MPJA 2FMHA 2MMCA 3KTAA 1IXRC 2OEPA 1QZUA 3B1VA 2H16A 1P6XA 4YJ2B 2PD3A 3H17A 3P20A 3ZNQA 2BFBB 4Y6RA 1DEOA 1RC0A 1Y3CE 2C96A 1GL3A 1S1CA 3DV0B 2J9YB 2WIKA 3U4QA 1O6FA 3GLIA 5DN9A 1AHPA 3D4IA 4FFPA 4L78A 2O8CB 2ILTA 3RHFA 4WQMA 1HOTA 1RQNA 3RU9A 2C2MA 2H7YA 1XZHA 3LSTA 3G9UA 1RM3A 2EF1A 2EJTA 1DV2A 1B43A 2IDZA 4Y2XA 1WXIA 5AJUA 4Z4QA 2BONA 4IO0A 4OYLA 4RORA 5AI4A 2CW5A 2X2EA 3DEIA 2O0MA 3WG9A 4ML3A 3LBAA 3FDJA 3UK7A 1BE8A 3DR3A 3EF0A 3GC6A 3CLUD 3S2FA 3ZWPA 3P9XA 3ROMA 1V35A 4DQDA 4F2HA 4ZOBA 4Y6PA 1Z0IA 2YY5A 3PF8A 3RT7A 5B30A 4J1NA 4RY0A 2O8DB 2QR2A 1KAOA 2GVDC 3CVYA 3KQWA 4WMLA 4X7PA 1T3SA 1BVHA 1N1DA 3WGOA 4BO6A 6AT1A 3IJPA 2CB0A 3VPAA 2EP8A 3I6IA 3WNZA 1GSAA 3OY7A 4MA5A 3KQNA 3AFNA 4TXHA 5ERYA 2GHTA 3OLCX 1XD9A 2GRAA 2GT1A 1T0PA 3OLYA 1IXSB 4KI0A 4L74A 1MVOA 4PO9A 1J7JA 1OLUA 3W5UA 4KPYA 2W8BA 3LRXA 1NF8A 3QPAA 1I4OA 3FB1A 4KKVA 2QG6A 4WFQA 4RMIA 3UY4A 3OC0A 3WLNA 2XMGA 1P7PA 4WADA 3GELA 4KXWA 5JJCA 4YRGA 2HU2A 5BW4A 3AOEA 1N2CB 2DLNA 2W2VA 3V5NA 4RAQA 3ER8A 2JAOA 4X1KA 3LUGA 3M1IA 2BZ1A 4CKZA 2A0FA 3DMPA 3KKMA 4G63A 4PNPA 2LVBA 2PWAA 2RGBA 2FWJA 2RHBA 1SBNE 4NICA 2YKGA 3MD9A 4I50A 1HL7A 4RZXA 3O3OB 1RAFA 4JL6A 5IAEA 1P18A 3UAYA 4IDCA 2VJPA 4DIOA 3H5IA 1S2OA 3HL0A 2C4UA 3LPCA 1E2HA 4ZO4A 2E18A 3ISTA 3VDNB 4FI3C 2XT0A 3C97A 3DYIA 4GZ3A 4XPIB 3CC8A 1NUPA 5IYZF 3TQOA 3WGVA 1MGPA 2XD9A 5U1PA 3QLUC 4EKNB 5DLQC 2G1UA 4PFQA 2WMNB 5F52A 2IYEA 5FCDA 2JFBA 3ESXA 5BNZA 2GPSA 2D0PB 4JJZA 4WLVA 1Y48E 1RWKA 4X63A 4Q0MA 2QGFA 2QE6A 1GZ6A 3OOJA 4I8XA 4WN9B 2A1TR 2Q1YA 1T2EA 1P45A 4B6JA 3CH4B 4BNXA 1II9A 1CG6A 1C1YA 4RD6A 1IK4A 2GPBA 3ITNA 3LWZA 1SC9A 1PJCA 3CH5A 2OFXA 3K0FA 1ISFA 2V7QA 4F8YA 1REQA 3QF4A 5E6UA 3JD0A 2P11A 3FOFC 3CUEF 3LOPA 4DLSA 4HK4A 3TYXA 3E9ZA 3WHPA 4KX5A 1C30A 2ZREA 4ZGWA 4L9RA 2YJ5A 2IHJA 3G2MA 2LUOA 2X22A 3JVEA 2QIOA 4GLJA 4HYTA 4LHYA 4AB1A 4B6SA 1IPFA 2I6FA 3QLJA 2F3RA 2N0SA 1FRVA 4UDXX 4XCVA 5ESXA 4D0GA 1P9WA 3IR5A 1OZGA 1V7QA 3CUSA 3KU4A 2BGKA 4PLVA 5AVRA 2P2YA 2BEKA 5CYGA 5KVQA 1LSOA 4EDFA 1PS0A 3IAHA 3HJTA 4KIUA 4XUEA 3RS8A 1B0PA 1EDOA 4CTKA 4HBGA 1G0NA 4G8CA 4NF2A 5HF6A 5HF9A 4LFBB 4R7TA 1F3OA 1TT7A 3IB3A 3S27A 4KFCA 5IVHA 2YN2A 4RHYA 3LFUA 2WW8A 4H27A 1USGA 2AJLI 3GVXA 4HVTA 4RLQA 3ADKA 2Q9CA 3PFCA 4M0CA 4WNYA 3UWKA 4AP6A 2GJKA 1PWYE 1Y3DE 5GAJA 4DSUA 3B38A 3MN1A 1QNFA 3NRBA 2OV8A 3WIUA 5HQTA 4DR7B 1YCGA 1N9ZA 1L5RA 2CLSA 1HBJA 2Z9DA 3U1TA 1G7TA 3QY9A 1OH8A 3PNVA 5JLJA 3EVBA 1P3JA 2FETA 3UCXA 4EL0A 4Z5XA 1XMIA 3D3EA 2QAGA 3U9LA 2B35A 1QIHA 3QEKA 4OSEA 4YAUA 2HZBA 1MVLA 5AHOA 3QU2A 5AICA 4RVSA 3CJTA 5HR5A 4CKEB 1EX9A 2GTHA 4K9LA 4RH1A 4XGRA 3ZJTA 1WNTA 1C0PA 3TDNA 2Z5FA 4K0KB 3PQ8A 4MWGA 1U7PA 5IXYA 1QB7A 4K3VA 2JFZA 3N2GA 3N8NA 4KMRA 5E1DA 7AT1A 1E5VA 3AFIA 3ANXA 5FORA 5NLLA 1WPQA 1FUIA 1GZVA 2OBNA 4LUCA 4WEQA 3HCFA 1TU0A 2O2XA 4D98A 2B4AA 1QYWA 1ZR2A 1KPGA 5FWAA 4F1WA 1NSFA 1NF9A 5CYFA 1TVKA 3HCPA 1N78A 1AF4A 2QSYA 2XCLA 4RXTA 3EG9A 4RGBA 2F8MA 3TFWA 4DJFC 4V1CB 1GSHA 4FYVA 2ZVQX 4DSAA 3THWA 2HC9A 2BI8A 3DCIA 1LWOA 3HKEA 1TA4A 5DGDA 3UAVA 3FIUA 1SK9A 3QYPA 4DHWA 4CKCB 1PIWA 1EZZA 2DCUA 2C2KA 3IA7A 3RAGA 1CEYA 3JRWA 2GLUA 2M32A 4Z3KA 1ECCA 3OT1A 4UATA 4ZMRA 2I6XA 3A2LA 1J8MF 4CQMB 5IHPA 4YY3B 1WE2A 3K9CA 3N86A 5JDCC 5A9TA 1XTJA 4AAYA 1JAYA 4RBNA 3IVRA 1E1QA 1G5RA 1RYBA 2GCOA 1C1DB 2ZANA 4G9EA 5F33A 1GUDA 1KQNA 3S4YA 1B26A 2PGAA 1C9NA 3JAWB 5HRAA 1RACA 4QPPA 4LYAA 1NSYA 3L04A 1D2CA 1DFGA 3RC3A 3NYWA 1Y98A 5EUMA 4JOBA 3GJ0A 5B58T 3HKBB 3BMOA 4B46A 4I4TF 3K3PA 1GQFA 4UNPA 4CXMA 1WDLA 4ZCMA 1D2GA 1KJIA 1QQ5A 1QYIA 3D4PA 2P4UA 3BZUA 5I9MA 3TAHA 2R48A 3FSRA 4DV7B 2JNWA 3QFSA 4HQLA 5B6IA 5JCOC 5ECGC 3TFQA 1ZN9A 4LXUA 4WJLA 3C3YA 3UB4A 3I62A 4AKIA 4CN9A 1Z37A 2FQWA 1MJGA 2FWNA 5JZOA 2GZ1A 3QVUA 3R7NA 4CNQA 4EJ0A 4C08A 4OBXA 1EBUA 3UATA 1GHTA 1SCQA 3C6BA 5EXDA 5TVKA 4DRXA 1A9OA 4N7JA 5K3OA 3EZNA 4X84A 3OQPA 5DK4A 4RIEA 2XRYA 3UJCA 3KC2A 3HCAA 2HHJA 2XF8A 3FJ1A 1FP6A 3PC8A 3A32A 5I4CA 4D8UA 4YUZA 3VISA 1HO3A 2V7WA 1ZMOA 3RSGA 2XA2A 3MA0A 5KPJA 3JQFA 4R8LA 5EVCA 1QGYA 2EJCA 2PMWB 3L07A 2DWPA 2R6GA 4M9XA 1WS6A 3E0XA 5JCPA 5DMHA 1RP7A 1J2TA 1ZBQA 4LA4A 4MKXA 1GVHA 1Q7RA 1R50A 3RYHA 5K8TA 5LP6B 3LPLA 1B8NA 4LDPA 2NYAA 3OPNA 3ENKA 4P4UA 4E0BA 4F2DA 2N75A 2ZWPA 3INTA 4KITB 4QU8A 1ZR4A 1KNQA 2OG1A 3B7GA 1XAJA 4YJGB 5DYTA 4EDHA 1HLFA 3K94A 2Z8ZA 4EF6A 5FUMA 1O94C 4N0MA 4CEJA 2WYOA 4QYTA 2JF0A 3LHFA 4UNRA 1W19A 4WXEA 2C0QA 1AUXA 4FYXA 2HSJA 3VDXA 3O92A 1J21A 3OQJA 1BKSB 4KWIA 4LJ5A 3UHFA 5F35A 3FNGA 3OPQA 3M83A 1XZEA 1N5DA 1UJBA 1Y7HA 3VR3D 5LP1A 3HA2A 1MQAA 2CKMA 5TX7A 3ZD9A 2JBHA 1U4OA 4GS5A 1P5ZB 5EJFA 5IZCA 3TIVA 1KO5A 2WTNA 3AR6A 1YGYA 3EZ2A 3OIYA 5B1SA 1UMCB 4AJPA 5A4KA 1FFSA 3RJTA 1MTOA 4Y2TA 2JLXA 5CDFE 1Z0UA 1GRRA 2Z58A 3U40A 2CHUA 4BDSA 1LNQA 3FCXA 3KO8A 4LI0A 4XOUA 3U56A 3L8FA 3K1ZA 3QE3A 1PTKA 1XDDA 2C8LA 2R00C 1QH8A 1P60A 2EX4A 5DHQA 4YRKA 1U9CA 3NHBA 2P7HA 2WSBA 4Q4HA 4PY2A 3T35A 4L4XA 3C3EA 1TRKA 3ICPA 1E3TA 2YICA 3GK3A 2BLLA 1NXSA 4IXDA 1EP1B 1M34A 2J59A 4JLPA 2EFJA 2FPRA 4JOQA 3HI6A 1ISPA 2FRDC 1P5FA 5K1ZA 4K81B 5KYNA 3IBSA 1MQSA 4KQJA 5B7PA 4Z9FA 3MSCA 2VSNA 5CA1F 3HVIA 4OV6B 4QU9A 2GR9A 3IP5A 3R9IA 5B2EA 5KC9A 1N33B 2ACEA 2YVAA 2YW9A 3N6RA 3PNSA 2PA3A 4DT1A 3S0JA 3P4YA 3OOEA 2I2FA 5GQSA 3IAM6 3C74A 4XGQA 4UDNA 3MCAA 1DS6A 2VDVE 4MS1A 4P38A 4PYRA 2E1RA 1S01A 4Z49A 4TZ0A 4BO9A 5I8PA 2Q62A 3SS9X 1X19A 1MIOB 4NMLA 3C16C 5E9QA 2R8OA 4GM0A 1SHLA 3O21A 2P41A 1ULAA 2ZUVA 4FHEA 4MPRA 1T3TA 1Q95A 1EDZA 1A7JA 1NZDA 1U90A 2C2OA 2O3SA 1KP9A 1BHO1 4H77A 4MEAA 5EHNA 5BSUA 5BVGA 5ICCA 4BMXA 4LSZA 4O25A 4DY6A 1OAOC 2GFIA 2V6JA 2B99A 2A9RA 2YMMA 4R7ZA 2AK2A 2EGHA 1I5EA 3NXKA 3EQ6A 4W63A 3T52A 4AXBA 4LYDA 1JHXA 4LPSA 4N9WA 1UEXC 3I6QA 5K3FB 1NBIA 2XTJA 5C3UA 1K08A 4B4OA 5I6DA 2HR1A 4YASA 3PR1A 3VUEA 3KTFA 1ZUNA 1TCAA 4H1HA 2QTHA 2CVOA 2JLSA 2P91A 1T0JB 4KVAA 5EESA 3V97A 1O6CA 1RI4A 2PWBA 4X44A 4CU2A 4BQOA 3A6LA 3ORHA 3M4NA 4NMMA 4ALKA 5EIXA 2A0UA 4RMNA 3I3SR 4REOA 1BTOA 3AVQA 1TJ4A 1L2TA 1KTVA 2EQ5A 2A1UB 4ETMA 3KSBC 2RHGB 1L5ZA 3C70A 3ORYA 5UKDA 2H3HA 1F2VA 2AOTB 2FDRA 3H5WA 2PRIA 2HEIA 4MIOA 2WMDA 2I8LA 4OK5A 5CDUA 1W1UA 4B35A 5K0CA 3J81A 4B34A 3KEMA 4QFDA 4BNMA 3TOSA 1AQJA 1AV6A 4LZAA 1ZH2A 1R4ZA 4LBVA 4JROA 1ES9A 2Q8PA 1BDMA 2I6QA 2JJ1D 5H1YA 1YOBA 3SCZA 3LJKA 4BECA 4EPXA 2EBFX 4Y67A 1J5XA 2SBTA 4HTFA 4NLLA 4PG8A 2ZRKA 2I3AA 4WE3A 5ADHA 3CH7A 3RSHA 5JWOA 5HUQA 1SGWA 2J3HA 3KVYA 4MUXA 1GEGA 5ELLA 1HEYA 2AG8A 3GCXA 2JGIA 4NBVA 4OHWA 2JGMA 1RHQA 3QVJA 1YDMA 4PW0A 1J9GA 1S9HA 1UXGA 1XCGB 1RP1A 2QJFA 1JIJA 2QVLA 3I0NA 5HMLA 1CX9B 1T5BA 3PSAA 2XWPA 3LO5A 2CE2X 3F3MA 3ZDYB 2O2IA 2D8MA 3LXRA 5K2OA 1PWHA 2SECE 2YV5A 4Q7MB 1V6CA 3WP1B 3FNQA 3FZQA 2G40A 3LUPA 5IN4A 4ALLA 4BNKA 5JMPA 1C7JA 1XFDA 3E7PA 2BF4A 3UA4A 2WVAA 3Q9UA 3ZU3A 2NVUA 4DMFA 1Z15A 3T3PB 1N2ZA 4ER5A 1Y8ZA 3LO8A 3RC8A 2ZB3A 3RIHA 5AFSA 1N57A 1WSWA 1GUAA 4MKZA 5KJCA 4DA7A 1D6JA 5HEKA 3DBLA 1T34A 4Y3UA 4ACAA 3MCTA 3PTZA 2CMFA 4LEIA 2QBYB 1RCTE 2EEZA 3DBHA 3Q12A 4MMZB 4UBNA 5EMJA 3OJEA 2VNKA 2XH8A 3WRXC 1BYUA 3R7WA 4B8ZA 2PO7A 2A84A 4MDHA 5JSHA 4CL2A 2ILVA 3FPGA 5LXTF 1DC8A 4NI5A 1MAWA 3BFKA 3IP8A 3CX6A 3NCHA 3PXEA 3TR6A 1RZ3A 2Z1NA 3Q15C 1RLUA 4IIEA 4R1UA 2JKZA 1M5TA 2XBLA 3UMBA 3DE6X 4OH7A 2G28A 2BEUB 4QXQA 5HIJA 2LCFA 4C0QC 4XFKA 1GJRA 4NE2A 1KOLA 3VO9A 1EWKA 1L4LA 3CLTD 2IHKA 3OZVA 1M8JA 1NYLA 1CQWA 3GPCA 1UT5A 3CRQA 4FMDB 5ALFA 1JKMA 1T2VA 3AKZA 3C3MA 3ELDA 1NSTA 3D0OA 3LQYA 3SBEA 3FCSB 2I4RA 1YMUA 2MU1A 2OQVA 4R1OA 3VPCA 4EBFA 2QTBA 3IB6A 3REQB 1R6DA 5A1TA 4EPWA 5A4DA 2CNBA 3ZS9A 3W6NA 2NYVA 1I2CA 4XWAA 5FUXA 2PGXA 2NSLA 5J58A 4YP6A 4LAFA 4OM7A 4DZZA 3Q7QA 2I2AA 5A5GA 3DDHA 4YRPA 1GPBA 2Q5QA 2GJ9A 1K7FB 5LBIA 2P9CA 3H19A 3HKDB 3HUTA 4U9IS 1J2YA 2ZYHA 2X9VA 4R69A 3QKIA 1W0JD 2P90A 2FMIA 3H5TA 2H0AA 3ISVA 1SC4A 3BIWA 2IYVA 2GB4A 4XIGS 1WAMA 2HD4A 2HA6A 3SD7A 5MHTA 5F5LA 1GG5A 2ZYGA 3UJ3X 1R8QA 3V7UA 4F4FA 3WIEA 2W37A 3F6BX 4I08A 2RHDA 4XW2A 4GOND 2YIJA 5K4AA 4R51A 4ABYA 1UFQA 4KH1A 3GBVA 3EZ6A 1KEUA 2DPYA 2FX3A 3B48A 2EIXA 3BL5A 4N0QA 3RVNA 5BPFA 4HN9A 5IJ0A 1NPYA 2HW8A 1YB6A 4FZVA 1NMQA 2H2FA 1V1RB 3EWNA 3NTRA 4CG0A 3QUCA 1TA9A 2F3PA 1GNVA 5JSUA 1XCOA 3THYB 1BVYF 4C2TA 3EGIA 2WPDA 4ZI7B 2FZLA 3V4SA 4K9MA 4A2QA 4UMEA 3GGJA 4PPYA 1M5RA 3E3NA 4HDMB 2C07A 3SM9A 4PCUA 4E7PA 1LU9A 1PGNA 4WK2B 4B8YA 3CN9A 2XA1A 2G1AA 4C4SA 5E2BA 3RS4A 3JVVA 1JPNA 1U94A 1YZ3A 4Q00A 1Y5NA 2V0NA 2OAP1 3PLNA 2EG5A 3NCTA 2F48A 2B83A 3EFHA 3LOUA 1QG4A 3VR4D 2XR1A 3DLBA 1XZFA 1AH2A 1EWVA 5A7HA 4P5EA 4ER6A 5BV2P 5FI1B 2FR0A 4F3YA 3QOYA 1EVKA 1VRWA 4NX2A 4M1SA 1W44A 4ER0A 5SV2A 1VJGA 3I53A 3NT4A 1J5EB 4RYLA 1ZC3A 2PUAA 2DB3A 4WLUA 3DEHA 1EM8A 4L5IA 1DXHA 3RJMA 1JVNA 3MJDA 5AKLA 4D41A 4W5TA 2AN4A 1JIQA 3H8VA 1GTJ1 2VH1A 4DQ0A 1SHTX 4WHMA 2OM2A 3CYFA 2YYSA 4HWGA 4Y0NA 4IMRA 2DZDA 4WZAB 3K9FC 1TQ2A 3HP1A 4FR2A 5IAGA 3R75A 3AWIA 1JG6A 4ZALA 5JHGB 3BIOA 5KVSA 1B15A 1YTLA 4Y2SA 4NONA 3OBBA 3NASA 3W4JA 3HJRA 3BBLA 4PQYA 3LLCA 2QG4A 3GYBA 1E89A 1KVRA 5H82A 1IWBB 1M8GA 1N9GA 3BWBA 3I45A 3OMWA 3QUTA 3ROXA 2FR8C 5LMNB 5CVUA 2Q3EA 5D5QA 3JWJA 4QQNA 2VDMB 5AXCA 5FPQA 2VNIA 1IJEA 3TNDA 3ZHRA 4BWFB 2OBYA 5EQTA 2XZPA 4MK4A 4ZEXA 2II6A 1WIWA 4IMIB 2OLKA 3I9JA 2V6FA 3NP9A 1IPEA 1JMVA 2HLPA 2WJHA 1BW9A 1H0HA 2AKYA 2KMLA 2X7XA 3BORA 4XYGA 1KMIY 2DRIA 5EG5A 4E6PA 2I78A 1IQUA 5DASA