2AN4A

Structure of pnmt complexed with s-adenosyl-l-homocysteine and the acceptor substrate octopamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2an4A00
4CWAA 5DT2A 1AQJA 4HTFB 5ICEA 1KHHA 1D2HA 3PB3A 3RIEA 2NXEA 3EGIA 4C4AA 2Z6UA 3FUWA 4PIMA 3T7TA 3KQTA 3DMHA 5E1OA 4A6EA 3HM2A 3HCDA 4P7GA 4BLWA 1YZ3A 5GM2A 2BR3A 2AOTA 3LHDA 3P9IA 2XVAA 4B17A 5CVUA 3KPVA 2P3QA 3TFWA 1F38A 5DRTA 3UJBA 3ID6C 5EEHA 5EGSA 3ME5A 4YV1A 1QZZA 2BM8A 2P7IA 2NXJA 5IH3A 1VP3A 2QE6A 2ZZKA 4E30A 2Z6QA 5LQRA 4QPPA 2N47A 5EEGA 4CKEA 3AWIA 5E2AA 3KHKA 4ER7A 2BZGA 1KYWA 3Q7EA 1G55A 3SVZA 2P8JA 2ZFUA 2HNKA 3KQMA 3WSTA 4F85A 1RI5A 2A14A 5BP7A 1G38A 2OB1A 2EJTA 3MTIA 4CXMA 3T7RA 4LG1A 2PSSA 2C7RA 1EIZA 4HGYA 4FT2A 3A25A 3I9FA 4PYKA 3CJQA 5B1SA 3NJRA 5LQAA 1FPQA 2PBFA 4QPNA 5JR3A 1XVAA 3D2LA 5CIYA 3FTCA 1I9GA 2I7CA 3S68A 2CKDA 3MCTA 2EJUA 2P7HA 3VC2A 3HA5A 5HIMA 1JG3A 3JWIA 5EKXA 2EX4A 3I58A 3SMQA 5K05A 1TW3A 1WS6A 2EG5A 4AZSA 4CKCA 5M5BA 2IH5A 5DLYA 2AOTB 1VBFA 3MCZA 3P71T 3B3FA 1XDZA 3G89A 3QV2A 4IWNA 5DM1A 4PYIA 5DTRA 4DQ0A 3K0BA 1HNNA 4RVGA 5DM2A 2IIPA 3DTNA 3EVZA 3G8AA 1KPGA 2R6ZA 4RVDA 2IBSA 1WG8A 4PGHA 1KPIA 2PX2A 5HEKA 5GWXA 2OY0A 3KQVA 4RWZA 4BLVA 3EVAA 3M6XA 4NECA 3BT7A 1R00A 1X1CA 2V74B 3G8BA 5FWDA 3IV6A 5CVEA 3GU3A 3P97A 5EZQA 3VC1A 4C06A 4M7RA 2JHCA 3EGEA 4QVKA 4AZWA 2GLUA 10MHA 1EG2A 5T6BA 3PS9A 4L7VA 4PCAA 3RW9A 3UJ9A 1L9KA 3BWYA 1R6AA 2HMYB 3R24A 1JQEA 4C07A 3TLJA 3B3GA 3OCJA 4QDKA 3EEOA 4RTPA 3PFHA 3SXJA 1OR8A 3BWMA 3C0KA 3MQ2A 4RTMA 4RVFA 4EVIA 4YV0A 3HCFA 2NXNA 4PCLA 1RI3A 3O7WA 3NMUF 3KPUA 4QTUB 3LECA 2Y1WA 2OBFA 1YF3A 3ER9A 5DM4A 3BUSA 4WVLA 3R9XB 1BOOA 4PYMA 5LQNA 5DPMA 4RTQA 4DF3A 4KVZA 1NBIA 1VLMA 2PY6A 1FJXA 2YQZA 4FP9A 1NW5A 2P41A 4RSRA 3SSNA 2XYQA 1EJ6A 1KP9A 4OQEA 4U7PB 4ER6A 3AY0A 1YFLA 2YTZA 2PX8A 3P9NA 3UJ7A 2G70A 2BR4A 3NVKI 1KXZA 2H00A 2XYVA 2PX4A 5DTMA 2I9KA 4PYOA 4FS8A 4DMGA 3FZGA 3AXSA 1YB2A 3M4XA 1Q0TA 2EFJA 3G5TA 3DXYA 2ZZMA 3HNRA 2ZIGA 1L3IA 4GOMD 5GIOE 2UYCA 3R6TA 4U7TB 2O07A 3BXOA 5C0OE 3I64A 2AN3A 3ELWA 4DA4A 3AJDA 5GINE 1N7JA 1RJGA 2FYTA 3CC8A 4X60A 4C04A 1IY9A 5LSAA 3B3JA 1NV8A 1JSXA 1WXWA 2ZWAA 1FP1D 5E9QA 1ZKDA 3UA3A 4YUZA 3JWHA 4GOND 4GEKA 1MJFA 2O0LA 3NTVA 1SUIA 2G8NA 2YXLA 5T67A 3FYCA 3TOSA 4C03A 2PT6A 4XUDA 3SSMA 2P3LA 5EMKA 3GDHA 4AZVA 1R18A 3HVHA 5K01A 3PX2A 3IEIA 4RTSA 4FT4A 2IDKA 3CBGA 3SGLA 4DM3A 1NE2A 1Z3CA 2KW5A 5GIPE 2CL5A 4EK9A 4QTTB 1DUSA 1M6EX 2ZSUA 4ER3A 2AZTA 2ZULA 3GCZA 2B9EA 3CJRA 1O9HA 5CVDA 4M36A 5FA8A 1JG2A 3PVCA 3LCCA 4CTKA 1EAMA 1G60A 1EQAA 1NW7A 3EPPA 5GP1A 3LBYA 2I62A 1SG9A 3GJYA 4GQBA 4A6DA 1IXKA 4JXJA 5K09A 3R3HA 5HIIA 2O06A 3GO4A 1HMYA 3MAGA 5K0FA 3BGVA 3UJAA 5LQUA 3T0IA 3HVJA 3UWPA 3TR6A 4F84A 3GRZA 3BWCA 4WXHA 2ZCJA 3MB5A 5K0NA 2NNWB 1KPHA 5HILA 2ZBQA 2GH1A 1NW3A 3DMFA 4HGZA 2JH9A 4HRAA 4KWCA 3L8DA 2NXCA 4IV8A 5EIFA 2B25A 4PYNA 3G5LA 2JJQA 4HC4A 1QANA 1M0EA 2PWYA 1V39A 4M37A 3OZTA 4XUCA 1G8AA 4YMHA 1TPYA 3DR5A 2PV0A 4BLUA 1X1BA 5DX0A 4BP1A 1X19A 3FRHA 2ESRA 3DOUA 3OE4A 3UJCA 4DKJA 3SSOA 3TKAA 3SR4A 3A26A 2P3OA 3LCVB 2IGTA 4RX1A 1AF7A 1VIDA 1JTEA 3MGGA 3QOWA 4CTJA 9MHTA 4R6WA 2AVNA 4X41A 3DXXA 5DM0A 3C3YA 1EJ0A 4ISCA 5FULA 2DPMA 4R6XA 1KR5A 3FUXA 4RTKA 5BW5A 3BZBA 1P1CA 2PWPA 4OQDA 3MTEA 4KIFA 2IBTA 1JR4A 5E1MA 2VDWA 5D1NA 1RI1A 4ZTBA 2F8LA 5EQJB 4O29A 3EVFA 2AOVA 3E7PA 3P9CA 4GBED 1ORHA 3BGIA 5EPEA 3TPZA 2IH4A 1PJZA 3BWBA 3REOA 3Q87B 3KR9A 2B78A 2Q41A 5E8JA 3LX6A 4E31A 4RTRA 2GS9A 3E23A 2E5WA 4GC5A 1WZNA 1KIAA 1INLA 4P7KA 3G2QA 4R05A 3RODA 1FBNA 1NT2A 3UZUA 5KYGA 1QAMA 3FUTA 3I53A 2IP2A 4MIKA 1SUSA 1U2ZA 4E70A 2AOWA 1WXXA 3MHTA 5EHIA 1XTPA 1X1DA 4KW7A 3KQOA 5LR6A 5E9WA 1RJEA 1JQ3A 1X1AA 5E1BA 3HVIA 1R8XA 1TW2A 2CWWA 2OKCA 1MHTA 3KR2A 5DRYA 3A7DA 3O31A 4V0QA 2OXTA 1L3CA 1YZHA 3M70A 2G72A 4KDRA 4RTOA 5T64A 2VZ9A 4X63A 3KQSA 4PINA 4V0RA 2BR5A 1FP2A 1VL5A 5JUWA 1BC5A 3GRRA 2AS0A 1UWVA 5BXYA 3ORHA 2AN4A 3U81A 5FTWA 2AOXA 2IPXA 4P7JA 3G7UA 4YMGA 3A7EA 2WA1A 2YUIA 3KU1A 3PTAA 1H1DA 1O9GA 1NBHA 5E1DA 2OO3A 5CVVA 4EKGA 2UYQA 4E2ZA 3HCBA 5CD1A 3HP7A 3O4FA 5HZMA 5LQJA 3FPFA 2XYRA 5CUQA 3EVEA 3FPHA 3NWBA 4X1OA 5EHGA 2JHPA 2YXDA 5F2OA 3UJ6A 3DXZA 3IYLW 3OU2A 2PXAA 2YVLA 5MHTA 2IFTA 2ADMA 3I5UA 4OA5A 4CKBA 3KR1A 3BGDA 4RTNA 3G2OA 2QRVA 4KDCA 3ER8A 3P8ZA 3SM3A 1B42A 3GRVA 2P35A 2NYUA 3OU6A 1XCLA 5ICGA 5EMJA 3A27A 3C6KA 4GUAA 3V97A 2FPOA 2QM3A 4MQ4A 5FADA 3GRYA 3NDJA 3B7PA 3KKZA 3KPJA 1G6Q1 1RJDA 4BY9E 3B5IA 1JG1A 3THRA 4H0NA 2R3SA 1NKVA 4MWZA 3TM4A 3PFGA 1P1BA 3TRKA 4PYJA 3GIWA 5KVAA 2GA9A 1XJ5A 3G2MA 2JH8A 2XVMA 5CCBA 2C7PA 4Y2HA 4FGZA 4E2YA 5HOQA 3NW9A 3LKZA 2FK7A 2PLWA 3HA7A 3NWEA 2BM9A 3HA3A 1SVUA 5DXJA 1JG4A 2UZ4A 3UJDA 3TM5A 4E33A 2QRVB 4FSXA 4XUEA 1SQFA 3FUUA 1P39A 2JHAA 2VDVE 5EIWA 2ZWVA 3KQWA 2ZW9A 4F86A 2O57A 3OPNA 3DP7A 5K0CA 5K0JA 3PLAE 1BKYA 1G8SA 3NVMB 4C08A 5LQCA 1JQDA 2YX1A 1F3LA 1RI2A 2P1DA 3LDFA 4QVGA 5DXAA 3OU7A 4FR0A 1IM8A 3OFKA 4BP3A 4YUYA 3GRUA 2C7OA 4X61A 3CGGA 5E2BA 2PGXA 1NV9A 3LSTA 3X0DA 1WY7A 5CCXA 2GPYA 2ORED 3AXTA 4AUKA 5EVJA 5HFJA 5EKUA 2ONZA 4RVHA 3HCAA 4POOA 4DCMA 3LDUA 2HTEA 3EEYA 3KQPA 2K4MA 4Y30A 4DZRA 4Z2YA 3LPMA 5EMLA 3FYDA 1JTFA 5K0EA 1D2CA 2Z6AA 3M6VA 3PX3A 2JG3A 2VP3A 4QQKA 4C05A 3SX0A 3JWJA 3T7SA 2IDJA 3HEMA 4HH4A 5U4XA 3PT9A 5FHQA 4YUXA 2WK1A 3P2IA 2HV9A 4P58A 5DX1A 1P91A 2DULA 2B2CA 2OPBA 2UYOA 3E8SA 4PGGA 5EMMA 2H1RA 4GOLD 2CMHA 4AZTA 1XCJA 3HCCA 4AX8A 5KS2A 2PX5A 4HG2A 3TKYA 4E2XA 3LGAA 3UA4A 4E2WA 1ZG3A 3LL7A 2PXCA 5DX8A 1ZQ9A 1AQIA 3CKKA 8MHTA 5DTQA 2FRXA 3CCFA 5EZSA 2VDUE 3G88A 3FRIA 1ZGJA 4GF5A 1KYZA 1QAQA 3H2BA 1RJFA 1L3BA 3ELDA 4MTLA 3HTXA 5F2KA 3R0QA 2FK8A 5FWAA 5FQOA 4XCXA 2I6GA 3KQYA 3V8VA 4OBXA 5FQNA 2FHPA 1XDUA 3OE5A 2C7QA 3KPWA 3FPEA 4YV2A 5ICCA 4RV9A 2WA2A 5FUBA 3EMBA 4EKIA 1VPTA 3UFBA 2PKWA 2PT9A 5KQRA 5K0LA 5F2NA 3P2KA 4KIGA 1JSZA 3M6UA 3DMGA 3VYWA 2ZZNA 4RTLA 1N7IA 1R8YA 1UIRA 2HR1A 2BH2A 5CM2Z 3UJ8A 1QAOA 2ZLBA 4G56A 1UFKA 1RI4A 4QQNA 4ER5A 4UOEA 3DUWA 1AV6A 1BHJA 3B89A 5GOZA 3OFJA 5DWQA 3HCEA 3FUVA 2CMGA 3EMDA 3FPJA 4HSGA 3FTFA 1VQ1A 4K6MA 4MHTA 1XDSA 2YXEA 3ANXA 3GGDA 4ER0A 3LDGA 5ICFA 4GOOD 2AVDA 4LWPA 2AR0A 2LD4A 2ONYA 2IH2A 5GM1A 3BKWA 4E32A 5K0BA 1XXLA 3EGVA 3KR0A 5HIJA 3ELUA 2G71A 5DSTA 4EMSA 4OX9Y 4OBWA 3TMAA 3HVKA 3KQQA 3LBFA 2QYOA 2OZVA 3ELYA 3MERA 3A4TA 3DULA 3CJTA 1NW8A 5FCDA 2ERCA 3GNLA 2OYRA 2FCAA 1ORIA 1SQGA 1Q0SA 4PIPA 4FZVA 2B3TA 4PNEA 2O05A 1PRYA 5FHRA 4YUVA 3P9KA 3BKXA 5H02A 2PJDA 2XBMA 3FPGA 3K6RA 2G1PA 3EVDA 5E9JA 5CVJA 2ZIEA 4R8RA 5K8VA 7MHTA 4IV0A 1DL5A 3C3PA 2ZIFA 5BW4A 2GB4A 5P8WA 2OB2A 3IHTA 4PYLA 2ZBRA 1SKMA 1DCTA 4PWYA 5ERGB 1VP9A 1Y8CA 5E8RA 3QOXA 3UBTA 2VS1A 3EVBA 4IKPA 3THSA 4ATNA 4EQZA 2NP7A 3GWZA 1T43A 1R74A 2AOUA 3NDIA 3P2EA 5FA5A 4R8SA 5C9ZA 5KQSA 4HTFA 1I4WA 5EG5A 2NP6A 1N2XA 5EOVA 4FSDA 1M6YA 3FTEA 2V7EA 2ZTHA 3FTDA 3JWGA 3OZSA 4OA8A 2ZVJA 2UYHA 3VSEA 4M38A 3G2PA 2ZBPA 2QY6A 4RTJA 4PONA 5HIKA 2GAFA 3ERCA 1NW6A 3M33A 5DSXA 5C1IA 5IKMA 3LKDA 4LECA 1O54A 5LQKA 3E05A 2P40A 3DLCA 3OZRA 3EVGA 4PYQA 3GXOA 4KRGA 4LWOA 1L1EA 3EVCA 4QDJA 5EC8A 3TQSA 4YUWA 3F4KA 1VE3A 2H11A 4RYLA 5D1HA 2HWKA 2PXXA 5K03A 3CVOA 1I1NA 1ZHFA 3C6MA 3LCUA 1YUBA 2Y1XA 2YR0A 5G02A 3KPYA 4DCGA 3DH0A 2PVCA 3M6WA 3DLIA 5K0GA 1D2GA 1ZGAA 4P7FA 2AOUB 1QYRA 1YFJA 4GC9A 2AN5A
chains in the Genus database with same CATH superfamily
4I1SA 2DRIA 4CWAA 1YZNA 1XEFA 1TKBA 2FUG1 3QBDA 4RJLA 2UU9B 3RKUA 3UKOA 3CWQA 4EJ2A 1U3VA 2A4MA 5E6UB 4OI1A 2IEIA 2Q3DA 3FBWA 3ZDQA 1UH5A 1YV9A 3DDHA 4M83A 4D8TA 1D6SA 5EIEA 5AH0A 2I34A 4RD2A 5JAPA 4V3CA 3TLGB 3QRWA 4TXJA 4URUR 5C18A 1YC5A 1WNTA 2ATXA 1JKMA 1FTGA 3LHDA 2WICA 2YV1A 2ENWA 1I2MA 1B7GO 3KTAA 1HURA 5DRTA 3UJBA 4B35A 1QONA 1ZPDA 4JFAA 3ZCRA 5B4UA 4WX2B 3FPBA 1F6BA 2FFQA 3RVJA 5I8PA 4IXTA 4WLFA 4O5OA 1HX7A 1H85A 1W30A 4OF4A 4YJHA 2J9ZB 5HVNA 2J3JA 4F4UA 5FPSA 3BSWA 2G7ZA 1VIYA 3RC9A 3RUCA 4IJVA 1VYTA 3ZHVA 1AQ6A 2HUNA 1C7ZA 5JMWA 5KJ6A 2ZFUA 1U6KA 4PZLA 2LWIA 4BPBA 2PXHA 2Z6VA 3ILHA 1E7RA 1RQXA 1TYEB 1D1TA 2O3QA 2OUIA 4RZUA 4CXMA 2L82A 2PSSA 2XD9A 4IFEA 4DLTA 2WJGA 3A28A 3SBXA 1FPQA 1WMAA 4P4LA 1CF9A 2NO6A 5CH8A 5T4EA 1I4LD 4B74A 2VLIA 1Z2OX 1MD9A 2YWEA 1A50B 1JI0A 3MBKA 2P7HA 4R9SA 2GZAA 3VYTB 1IBRA 2W0MA 2CD9A 4MR7B 1J24A 1FFBA 1ZRMA 2JAUA 3RVOA 3I58A 2VPZA 4GSKA 3FWKA 2H5LA 2OCLA 2CXUA 3P71T 2GEVA 1PJBA 1U0OC 1XMSA 2DF8A 2VHVA 4GQIA 4R69A 2ADOA 4RZXA 4KXLA 5AK6A 1EK6A 1HNNA 2BTEA 3FNRA 4HAZA 5D7BA 4GOXA 2VIIA 1KPGA 4KO3S 3OMWA 4NPAA 2ZUBA 1KF0A 1N6OA 3VPAA 5JISA 4C88A 5MFZA 3KQVA 3NAQA 4BLQA 3PPYA 3M6XA 1R00A 4QNMA 5EN4A 1PEKE 4JCCA 3ZHRA 1QM5A 2PYZA 2LKDA 3K0SA 1YQDA 3AP2A 1JB1A 4R2HA 2VWGA 4B48A 5TIIA 2PPLA 4G0OA 3GXBA 2FR0A 4JVMA 3U62A 3SC6A 5HCIA 1OTXA 1WULS 2WFLA 4KL8S 1IPEA 1XFDA 4EQ6B 1NPTO 2W93A 2AYXA 3NTQA 3VR6H 5HHTA 3SQMA 1H3EA 4QWMA 1FW8A 1GTVA 2FW1A 1CERA 2VFAA 1E2IA 5I4CA 1PZGA 1SN7A 3P5SA 5JOQA 4DJDC 5J23A 4OLAA 1Z18A 2C2MA 4QEKA 3WK5A 3MCAA 1V8BA 4UC0A 5DT9A 2YWGA 4WV3A 1FUYB 1NLFA 3VR4D 3H4IA 4IOJA 3EF3A 4Y98A 1RWVA 3H0KA 2DWUA 4LCBA 2PKCA 5ALGA 4RTQA 3UHAA 1OCEA 2ZXFA 1VMIA 4TL6A 1TF5A 1IUNA 4A36A 3OOEA 1Z6YA 2GN1A 3PL5A 4C0HA 1RIIA 4G2TA 1KKMA 4KAXA 3WL4A 3U1BA 3QG1A 1KWGA 3NRBA 4BGDA 3KJIA 5A4IS 2H00A 2D5AA 3VKFA 3Q8WA 4PCUA 3HFGA 4TT8A 5L4SA 4DLBA 4TYYA 1H2HA 2Q2VA 2RB4A 1SY7A 3WLPA 3EFHA 3T3DA 4CNBA 2EDCA 1JP7A 1QO7A 1T9AA 3I61A 2CSXA 4BLOA 3A6KA 4CDRA 5FPHA 4NAHA 3L0OA 3R7NA 1HDOA 1EGVB 4GP9A 4C04A 4X85A 5DNWA 2B20A 3X1KA 2DAPA 3LPAA 1RM5A 3BF7A 4N03A 4I3HA 3QEJA 4AMUA 4RSGA 1RXEA 1IHDA 2JCXA 5CM9C 4BO1A 3C1TA 3HDHA 1ZBDA 1T24A 4RKRA 2L2QA 1JL3A 1XRSB 2QD1A 4S2UA 1J8MF 1T29A 3E9ZA 4XEUA 5JVDB 3S2EA 3IO3A 3SR3A 3WLFA 4OI0A 1ZNZA 3KXLA 3REQA 1MIOA 1GIAA 1T8RA 1EGMB 3GDHA 3LTEA 2BEKA 3W8RA 3E4CA 1NE2A 4KO4S 4ZXFA 1M6EX 2ZSUA 3A3OA 4OKSA 1K5GA 5I48A 4GMKA 3ZLJA 4FMPA 3TQQA 2XNDD 1IDOA 1NVBA 2IA5A 4MHOA 4H77A 4QXRA 2BHNA 1UT8A 2HGZA 2Q5FA 2QW1A 3M6FA 1ORDA 1ACMA 1Q7EA 1SIWA 1T1RA 2EVWX 3ELBA 3E9YA 3L40A 1CY1A 2Z58A 1YUNA 1ODTC 3OAAD 3UJAA 4WZBE 2B82A 1G6KA 3VZRA 2O0JA 4IMRA 4S1TA 5C3MA 3T7KA 1S6YA 2B4RO 2QGZA 3HABA 2F55A 5LNK6 4N6OA 3CR3C 1M1NA 1ISRA 4PLFA 5FORA 4HC4A 2WDPA 2XYHA 1U7TA 5D5QA 5I4IA 4FDLA 2DERA 2FAXA 1ZINA 2JA2A 4MIOA 2D2FA 1P2TA 3D6HA 3K6SB 5HIKA 3HDQA 1XYGA 1I2ZA 2GCPA 2YN2A 3FRHA 4G89A 4KK4A 2A3RA 3CF4A 4MARA 4OIMA 4F1KA 4KQJA 1HOTA 1SC3A 5K8IA 3A26A 4ZVSA 4QJIA 3ND6A 3WZLA 1MX3A 3GRAA 5F4BA 3RVMA 2R79A 3EG9B 2NAFA 2ONKA 3MA0A 3TOXA 2P6MA 3I28A 3RWOA 1H2ZA 4GE3A 1CULC 4R6XA 4S24A 1JEQB 2I4IA 4GVLA 4L72A 2F2TA 4QARA 3ZBUA 3K70B 1TQ8A 2R1UA 2LW7A 4PC6A 5DWVA 3RUAA 3H84A 1DI0A 3ACCA 1J1ZA 5FL7A 3B3AA 1LRJA 2WMDA 4FD2A 4KE8A 1T91A 3WBKA 3ZGLA 3R5TA 4DLAA 1X9GA 4OB8A 4QUKA 3W7AA 3KR9A 4L8FA 2Q9CA 4L9SA 1NNUA 2W90A 1E0SA 1WZNA 4GI5A 3VOBA 4BQQA 3G2QA 4Z7OB 2BZ1A 3FCYA 1ZR4A 5M34A 3LQQA 1SUSA 3AUFA 1W5FA 3U60B 4V0SA 4H3SA 1N5RA 4XIJA 3M6AA 5B1EA 1M74A 2TECE 1WD5A 1LUAA 4B9EA 1S2LA 2ECPA 2OKCA 3LFUA 5AP9A 3KLNA 3R4CA 4FNAA 4K81B 1RD4A 2VZ9A 1RLTA 1QE5A 1DIBA 1VL2A 5GONA 4V0RA 5JXWA 1CF4A 3BB4A 2WNIA 5HQ3A 3THXA 1I24A 4J0KA 1BEUB 1Z5UA 3OKPA 1XWWA 4NFHA 3ADPA 1GGMA 1CYDA 3SYRA 1WAMA 4WERA 4GPTA 1E64A 2GZDA 1XX6A 3BXGA 3NORA 4LHWA 4BNLA 3AR8A 2HPAA 3NFRA 4LJAA 1N2SA 2Y1LA 3HP7A 1IZ8A 2Y71A 3QIVA 3D54D 2Z43A 5C8XA 2XW6A 1CEQA 1HYEA 4IIJA 5JQGB 4NBSA 1JE1A 2GPJA 1SOAA 2YVLA 4UE6A 4QE3A 4WKOA 4MDFA 3ZDAA 3TGWA 2JAWA 3MC1A 3FETA 1Z5WA 3ZH9B 2XXAA 1RHRA 2G40A 3BGDA 3PQ8A 2KHZA 4MAMA 5A4FS 4TXHA 3KAKA 4PSUA 1YJAA 3SM3A 4K3UA 1KE1A 3VPSA 4BGIA 3QIAA 3JD4A 1U9CA 1J09A 3L82B 5IT5A 4RLHA 1BN7A 4L0MA 3OM0A 3BTVA 2IYUA 1RFGE 1MAVA 3C7DB 3JY6A 1KRHA 2O2JA 3K1ZA 5CAEA 3RUEA 5THKA 3W8EA 1WTAA 4YV7A 2PUFA 2EHDA 4MQEA 1JG1A 1NG1A 5KYYB 1BVHA 1PJTA 1S1CA 1WUTA 4FC7A 4ZT7A 4DDWA 1YHNA 2XBUA 1J1IA 4YK7A 2QJTA 4ENVA 1P62B 3NG1A 1WHTA 5EUBA 1YJCA 1E2LA 5G4LA 2D1FA 1PJQA 3ABRB 4UUAA 3SS8A 1B6TA 4E09A 1P7ZA 1SRRA 2J3HA 3G82C 1QVWA 1AY0A 1AO3A 1I3NA 4MZDA 2BM9A 3HU3A 4FVTA 4YRGA 3GH1A 3BG5A 1U4OA 1T2NA 2QRVB 4MWBA 3O03A 3O4IA 3RSLA 3QUBA 5C5CA 3RYFA 4LBWA 3MIIA 4RV4A 1ZD8A 5BSHA 3NETA 4RHFA 2J3IA 3L4BA 1FJHA 3O1IC 1P1IA 1TTTA 4LEIA 1JKFA 4Y2PA 2OFFA 1UZNA 1FMLA 5LQCA 2IWHA 1RHKA 3HB9A 1F1BA 3LUGA 2PZJA 3O95A 4B1FA 1EUQA 3VYRB 1UQUA 3L4KA 1XXHE 3ENKA 3EFBA 3ZKWB 3RS9A 3N5CA 5EMHA 1JXAA 3DOCA 1E60A 2ZOSA 4V2IA 2ZBVA 3MJCA 1EVYA 1GDHA 4QYXA 3OQJA 4RS4A 2GM3A 2HAEA 4YDSA 3VOSA 3RAFC 4ZT5A 3T3OA 1Z36A 2CWDA 3V4OA 3ZXYA 1CFJA 1BS9A 1PI3A 2QQEA 1HE4A 1W9HA 1L5ZA 1R3UA 1WU7A 2CLKB 3FVQA 3AEQB 3BVPA 3L5KA 3DEJA 1YQQA 3K16A 3I45A 1WMSA 5ALSA 2AHRA 4C9BA 4TV9F 3ZVRA 2X3UA 2C4WA 3MOGA 4UTVA 4ZGBA 2WG2A 4US2R 1EBFA 4CQMD 4GP6A 1G3QA 2DKNA 3IOBA 4ZQGA 1JIXA 1QPBA 1RMQA 2A88A 2R6AA 1P91A 3PKIA 4H35A 4MUXA 4NZYA 2CMFA 2PS9A 3TBFA 4BFYA 2DWPA 2LNDA 2GSWA 4XASA 2FOIA 3LQFA 4LYDA 2GN2A 3HVUA 2DHEA 2CMHA 1RRCA 2DOKA 4ZOBA 3WFIA 4LRQA 1G8FA 2VK8A 4K9PA 2H2FA 1M75A 3CHYA 4GW3A 3BIXA 3FFBA 1GHTA 1GO2A 3JYOA 3VO8A 1K5HA 5FR1A 2G63A 5AKHA 1MP0A 1PT5A 2FSUA 3K2IA 4MW9A 2M6LA 2Y1OA 1QSGA 1QAQA 2HK7A 3F0TA 3Q88A 4BVGA 1YMQA 3R0QA 1Y3HA 3PI7A 3L1HA 1IZ9A 1J2YA 1MU0A 3MRTA 4QU9A 1KC3A 3OCVA 4HI0E 1CQIB 1KYQA 3OO1A 3RS5A 3AHGA 3ZGNA 3L8EA 5FEUA 2OFWA 2NYRA 5JD5A 4S05A 2IXEA 1ZW6A 2C2XA 2X40A 5FUBA 5ECYA 5C8YB 3B20A 3PXGA 5K0LA 4B43A 4ND6A 2WHPB 3NH9A 1FJ2A 4J9VA 4KGXA 2V6BA 4L8LA 1V8OA 2P2GA 4LZNA 3DHNA 5K3OA 2GPNA 3VR5D 2CXQA 2H31A 1IBCA 1CNFA 3TK1A 3ZCVA 2JD0A 1NP7A 1FW6A 4FYJA 3DUWA 4K40A 4ZOEA 4G3XA 1QQ7A 2BE7A 2FSPA 4JYPA 1DTSA 3SYTA 4BMCA 4X66B 1SGWA 4D0GA 1YGYA 3ZGXA 5KC8A 5LQSA 3ILSA 2VZ0A 3EF0A 3ZDZB 3MS7A 1B4DA 2CK3D 3N0VA 2ZIUB 2AVDA 2WTXA 1S2DA 3NHBA 4BTEA 4UTOA 1XAIA 3BFPA 5FIUA 3JARB 4IIYA 3GI1A 5LZ5A 4EMSA 4Q1AA 5CW1A 3DL0A 1RWOA 3KOXA 3RUDA 1NC1A 3QQ5A 1ZVQA 1QH9A 1B93A 2P3SA 5JPIA 5J2UF 5KJFA 1SR8A 1YI1A 3ZQUA 4HMOA 3LOUA 1FVOA 1U1CA 2QTFA 4EHAA 2O6LA 2O48X 5KI6A 3W4KA 4AK9A 3KQUA 2OYRA 4J0QA 4D25A 3W2GA 4AS1A 1KZ9A 2N75A 2EL7A 3DL7A 2R2GA 2TMKA 4B7AA 2PV7A 1Z7GA 2PLFA 1YQEA 2IYZA 1QGAA 3WNVA 4ENRA 4HH0A 2GAIA 8AT1A 1XL0A 2PVPA 1VI6A 2D62A 5AI6A 4YS6A 5J59A 3VUFA 4FCCA 1YQWA 4K88A 3RYHB 3S5JA 5K8VA 2R751 1V1RB 4GD3Q 2YXNA 3DKRA 1J39A 3FSGA 3QVSA 3LLVA 3K0CA 2XY4A 5J9FA 3SAJA 1PWZA 5BT8A 4RJTA 3KDPA 3MWJA 2O7RA 2X4GA 1M2KA 5AM0A 2PMFA 1OFHA 3T4UA 2FTKE 5CX4A 1UBEA 4YMVA 2ODPA 4S35A 1S1MA 3I04M 3AEUA 2GJAA 4HK4A 2JL1A 2VK4A 4OHOA 3UQYS 2V4MA 2UYHA 2WVGA 1AMOA 3QWFA 2NX2A 4I66A 1LW7A 4FWTA 2EP7A 4MI9A 3GCWA 1RPJA 2EKZA 4PQEA 5BRAA 1LX6A 4TGLA 2C94A 2I03A 4BGVA 4UJ3A 1XTSA 1FIUA 3PXUA 1BEEA 1E2PA 3AJ8A 2AJ8A 3BSSA 1U9ZA 4W5OA 4HFNA 1YZTA 2PMCA 2ZK7A 2ZVQX 1Y9DA 3GPBA 1SKYB 5EWMB 3PEWA 4GMGA 1YQTA 4FCWA 3UW1A 2ENUA 3LPCA 3T1OA 1DQZA 3ZJ4A 2Y1XA 2XNSA 3HC7A 3KAQA 2R8ZA 3DH0A 4MVWA 5COQA 3WLIA 3G9ZA 4I9NA 2I1WA 5HM8A 5ILOA 4D8YA 5H59A 2OK7A 5KNLA 2Z4TA 4GC9A 3AIIA 1EXWA 1KHHA 4DY6A 2YZ7A 3FFXA 4RULA 4U7WA 2HM7A 2VDLB 3LHKA 2QLBA 1ZC4A 4MA4A 1W4CA 1VB3A 3EQ7A 1DOAA 3PHBE 4JD5A 4A82A 2IV2X 3R7FA 2XGMA 3TD9A 3WMEA 4OP1A 1C80A 1GYPA 4GECA 4YBRA 4HLUA 3V3KA 1B41A 3IAXA 3WGZA 4ES6A 3QE0A 2AOTA 4KXVA 2FMIA 3AKDA 3NHWA 4LSWA 4HRVA 3THWB 1T36A 2O2HA 3O4VA 3OZUA 4AKSA 3B38A 5A7FA 4E5YA 4IEFB 5GAJA 4YDRA 5JLJA 3FSRA 4Y2RA 1JJVA 2B1QA 4D96A 2W37A 2PL1A 3G0IA 3DT8A 1OBHA 4GIBA 1MN6A 2DFNA 5SYMA 3RFVA 4WJZA 2J46A 1WDMA 1FDOA 2QTTA 3F9IA 3Q7RA 4HJXA 4N49A 3QHAA 1JR3A 4R9RA 1P1KA 2PBFA 5JR3A 3LX5A 1E59A 4B3SB 1UJ2A 3H0EA 2ZUVA 4NS1A 3O9VA 4WJKB 2LP4Y 5B7QA 3AY7A 521PA 3DD1A 4QUAA 2OFOA 3RBXA 3WHPA 1MQSA 3FGOA 3GMDA 1PGNA 4GU5A 3SPXA 4DZTA 5A0VA 4Z9FA 2G6TA 1GL3A 3A0RB 5DYIA 4F06A 2GLTA 2DUMA 4EA8A 2R7NA 4ZOCA 5DM2A 3FXAA 3NHFA 1U2GC 2CLOB 4LDRA 2CJPA 5KJEA 3R9XA 5FUQA 1T35A 1U1GA 2RI0A 1Z6AA 3ZTYA 4WN3A 4HH1A 3KEGA 4M9CA 1E0DA 1GYQA 5U9CA 4CR8A 3D6JA 4P4NA 1J7JA 3BL5A 1R27A 2Z9DA 5JQGA 4NECA 3FDXA 4OMDA 1GZ3A 2V74B 2V03A 3GPLA 1MDFA 1RWQA 2JGFA 1K63A 2DX7A 4V03A 3TWOA 4AZWA 4CF6A 1XZPA 2JF0A 1KC1A 1WB6A 2W2XA 5EJ8A 3OOJA 4CQJA 1NWCA 2V9ZA 4C0BA 5F9HA 2HMYB 4PLYA 1S4MA 3H16A 4YR7A 2P67A 4AY4A 1IY0A 2CLLB 2Z2YA 3B3GA 4WA8A 4PCVA 1HG0A 3PFHA 4I14A 3SXJA 3CV3A 5CG2A 3E7XA 3NHSA 3IAM6 3JD1A 2C29D 2EP5A 2QLLA 2BELA 5IDYA 3W6NA 1TI7A 1ZH6A 3AZQA 1WQ4A 3HCFA 1Q14A 4GYYA 3C8MA 3IPRA 5EIOA 1GV0A 1KP3A 2RG7A 1ML4A 2C5AA 3NKLA 1YF3A 1IQUA 2QU8A 4ZKDA 3GT0A 1I5EA 2X4DA 3HSSA 3L07A 4DLVA 1XTVA 2GDJA 1EIWA 3BQ9A 2PMBA 3E5NA 3OHPA 1U2DC 3NTOA 1T3SA 2PKEA 2CXPA 2O8VA 1G3MA 4LWQA 5BXQC 1F8XA 3FKJA 2IS2A 3KIPA 1FC0A 1IHUA 4WZAE 1TKAA 1GZ7A 2Q3FA 2GFHA 3WHLA 2G0TA 2HO5A 3IPLA 3UAOA 4K6GA 2FKAA 3UGKA 1LLUA 1TOAA 5IZCC 3U4MA 4LTNA 1HNWB 4C6TB 1RZVA 4YAIA 2IS4A 1XHEA 4JY7A 1Y7IA 3FOCA 1FYFA 1JH8A 1Z17A 3R75A 4PYOA 1RQNA 3LC2O 2UZ3A 3BXHA 1E66A 1ZZEA 2C0CA 1KO4A 5DJ5A 1V37A 3OSZA 5FLXA 3OHMA 1GQSA 1V2GA 2IOFK 3BEOA 3HNRA 4CV1A 5CNKA 1U8UA 3I5YA 3ZKWA 2HFKA 3PPWA 5AM1A 4ZICA 1N6LA 1SHUX 2QTRA 1GITA 2VP9A 2GWHA 3PNSA 3ZWCA 3CN7A 1EWVA 2LIVA 4MUFA 2QHXA 4PC2A 1TFRA 1DIGA 1GQYA 4N7BA 2V4UA 1GZ4A 2OCDA 4CUJA 2IDZA 1HDYA 1PCXA 4D8WA 2P77A 3M4YA 1N0WA 3DDWA 2ISSD 1UXHA 1XC7A 1W4BA 5LZ4A 3C3BA 4AJKA 2PQ0A 3OPMA 3KSBC 3D6MA 1H1LA 1R4NA 3HM9A 3AY3A 2IH5A 1NJ6A 2VJCA 2R65A 4F3YA 2PGAA 1RWMA 1W73A 3QF4B 4UNRA 4UPEA 4I0WB 1G59A 3RGGA 1KI7A 1ZN9A 4F4IA 3WRYC 3BWDD 3PC2A 1QUEA 1IXKA 4BRZA 3EULA 2MIIA 2ZPAA 1RIFA 2QMEA 3M83A 4N1AA 4C14A 4S0ZA 4EI8A 1Y4SA 3HUDA 4EPYA 4KQ2A 4RACA 5BRJA 5K7SA 3ZDBA 4HQOA 2ZSIA 3CF2A 1YDWA 3ETJA 3U40A 8OHMA 1GFZA 1OH6A 1RCUA 5FUXA 3J81k 1UUFA 2FLVA 1XZLA 2NNWB 3K5HA 3QENA 1ZHHA 3I73A 2VQ6A 4OUDB 5K3SA 2NV2B 4RPGA 1VFPA 3DE4X 4D9IA 4ZPJA 4JBIA 1DAMA 4EYGA 1NLYA 4OJTA 2QL5A 3CRNA 4BCDA 1B6SA 2BP7A 3AEKA 3BD7A 4IMPA 4TV8F 1GQ2A 2QG6A 4GZ3A 5DBGA 1HG1A 2ZJ8A 2G25A 5BN1A 2HA6A 4HSEA 2ESRA 2QD5A 3B1XA 5KX5A 4EUNA 2WHPA 2RE8A 4FFRA 2C7GA 1K9SA 3TIFA 1GPDG 1VLLA 1X8XA 2HRQA 2P3OA 1J07A 1Z5PA 2VT2A 3D6AA 3EYAA 2GM5A 4KZKA 3OJEA 4FOLA 4OLFA 4LTMA 4PSAA 1JTEA 3L0CA 3MGGA 2YFYA 3B5EA 3CH4B 4I6GA 1IQ0A 4JQOA 1A9TA 1O96A 1JQBA 1ESZA 1NC3A 4RLQA 2PWPA 1FMCA 5JLAA 4CT5A 1IOLA 4HBGA 4NRDA 2WD8A 4URYR 2YMMA 3FSJX 4AKHA 3OTQA 3R1IA 3E7PA 2E89A 5DKFA 4UPDA 4J4BA 1Q95A 3JARA 2IV7A 1W29A 4PC3A 3ROXA 2B78A 4CEIB 5CFOA 6REQA 3D2BA 3IBTA 4Q7LA 3QWBA 4P86A 1QJCA 2WIAA 1BROA 4RLSA 4Y2YA 4ZVRA 2XB2A 4G4SP 3RG2A 4EHLA 2ZRIA 4J0FA 3KLMX 4M1ZA 1NN3A 1RYMA 1TECE 3L9XA 4CJXA 1JYFA 2MR6A 3ZK9A 5E9WA 1E2HA 1TA0A 2EBUA 4K9MA 4J03A 5TRTA 3RRXA 3AM3A 3PPXA 3A7DA 1JJAA 1Q50A 2AFIB 3HRKA 3OIFA 3AEZA 1Q0PA 1YZHA 1CW2B 1ZM3A 3CRMA 4BFLA 4DPMA 3H1GA 1N36B 4J3FA 3WHKA 3RYHA 1GEEA 2A67A 2HK8A 4XQ0A 4DRZA 3T7DA 2CE2X 1N5DA 4CM8A 5ED0A 3MINA 3GD7A 2ZCUA 4Q1VA 1T6BY 1JFVA 3TSOA 1KEKA 5H4HA 3ZTWA 2CF5A 5DIZA 4DIMA 4GL2A 4OHYA 1I7NA 3R5JA 2JEYA 1DAFA 1Y34E 2A84A 1I33A 1Z75A 5CVVA 1HT0A 2RHWA 2FE1A 5D3MB 5HZMA 1Q1AA 3EN0A 3FPFA 5CUQA 5LQJA 3CNLA 4DUYB 3SHFA 1E62A 3I9JA 2BEWA 4L74A 3EOBI 1JMVA 1IE3A 4Q7KA 2K87A 4ZD6A 4E7PA 5BT9A 1KSJA 3FVRA 2W2MA 3O1HB 3QYPA 1UINA 4FMCB 2IF2A 2FWPA 1VOTA 1D4FA 1HDCA 1T4MA 4I5EA 3V8BA 3I0NA 1GZSA 1B42A 2YIMA 4XM0A 1PBTA 2O3RA 1B43A 5B1YA 2QUJA 1JNXX 2EFEB 4GUAA 1ZNYA 4GQAA 4Y8VA 4MLZA 5TQ2B 3VSCA 4DIUA 1PG0A 3B7PA 4QULA 4RK6A 4BN0A 2LZ0A 1Z56C 2H18A 4J0JA 3GVXA 4KPFC 4AF7A 5HF5A 1R0SA 1IY1A 4QM7A 1AN0A 4AY2A 4Y3UA 1XA0A 5FH9A 1L4BA 1L5YA 1OFUA 1U2EA 4EEXA 4LISA 5KVAA 4M86A 1HEUA 5G1OA 2YNMC 3BXZA 4G0WA 4Q03A 5C80A 4BZPA 3DAYA 1WDLA 3SJ7A 4KXWA 5DYWA 2ZPTX 3B9RA 4D9JA 4ZQFA 2PLWA 3KE8A 5ALHA 1K6MA 4GLLA 1MIHA 2HK6A 2ACWA 2YYZA 3TSWA 4D4IA 1MGOA 3Q8KA 1N2HA 3FN4A 1AC5A 1ISHA 2QRNA 1KK1A 5D5PA 1Z2AA 2ERYA 2HSZA 1KH2A 4QBKA 1DC8A 4K9DA 4MI3A 2JHAA 4ZAWA 1Z5ZA 5FLEX 3U1VA 4MS4B 1RYYA 4K5QA 2XITA 2J4FA 1BTOA 1ENZA 2CEKA 1HNXB 1APBA 3FYTA 3C3JA 5CYOA 2E18A 3CG4A 4GSLA 4N12A 1T26A 3R8XA 3F3SA 3ZUPA 4JLNA 3DE6X 3KLBA 1P4SA 2IZOA 3DVSX 3EZ9A 4GNRA 3VM6A 2PSHA 4WT7A 4DA7A 1IRXA 3U9TA 5B12A 4DCMA 2HTEA 4DZRA 2L18A 4D0SA 5DNCA 1JKIA 1JLHA 1GPUA 4KQGA 2ZSBA 1V8ZA 1KY4A 2W2QA 2C5HA 2BOVA 4FFDA 2PUBA 3JVEA 3UWMA 4DYDA 3PNOA 4CM1A 3JVDA 4JKIA 3RHFA 3IIJA 4C87A 3C5VA 1H2FA 3T7SA 5U4XA 2RGXA 1HM5A 3DL2A 4X1KB 3AVOA 3NB0A 1EUDB 1QO9A 2A5LA 3B8HA 1RLMA 2B2CA 1E0JA 5J2TF 1H2XA 2CXHA 3ADCA 1VIAA 5G53C 3W34A 2Q46A 4P4TA 4DLPA 1CR6A 4LUCA 5GADl 1WW3A 1JKJB 4KR9A 2PAAA 3VR4H 5BSVA 4YAGA 2PSDA 3TKYA 5AVJA 5C8VA 1BW9B 1YACA 1P18A 4DV2B 1U7HA 1C30A 3QLUA 1Z8DA 4TQAA 1DXHA 1YZYA 4QEDA 3L8GA 1H4VB 3MQFA 1ZD9A 3GBVA 2BKLA 3H2BA 5AD1A 1R6BX 1OZFA 2C04A 1SD1A 2XWJI 4G8JA 3FYHA 3TTXA 3R8FA 3HTXA 3EF1A 2REBA 3JZFA 3LUCA 1JYEA 1QUFA 4IGFA 5CXQA 3OQOA 5CK4A 3WBJA 1B3RA 1N6KA 1EWTA 4ZTZB 1AT1A 3QFTA 1V9SA 2V8BA 5D51S 4JUCA 3UFBA 3NVAA 1KRXA 3TBKA 3PLNA 3U3KA 3ZC3A 1P0MA 2H9YA 3EAFA 2PLNA 3W77A 1KDRA 1JQKA 2ZT6A 3DEKA 3IVRA 3LA8A 1D0SA 3LMKA 5H68A 4OV6B 2ZWPA 4LY9A 3TO5A 4CM3A 3I6MA 4ER5A 1UXJA 2OESA 2XKBA 4M22A 4XPIA 4EBBA 3B89A 3L7LA 4D5GA 1ZJJA 3JU3A 1QBKC 1DIHA 1SIUA 2NADA 2X2PA 3FPJA 4N0EA 5CH3A 4BX8A 2QSYA 2COEA 3T7JA 4F1WA 2XRZA 2FPWA 3T1VA 4MHTA 2JAQA 4TT3D 4EM6A 5BMVB 3DQZA 3NM6B 2W48A 3H5LA 3I9V1 1O6FA 1F7VA 1EP2B 4GOOD 2BKXA 2NU6B 2DTEA 5DGXA 1ZM7A 2BV3A 3D8RA 4P83A 5FPPA 3RS4A 1FE8A 1V48A 1XXLA 3W5HA 3ZXSA 5IAKA 4LF8B 1Z37A 3JQAD 3JTEA 2QBYA 1OA1A 3HVKA 3T5PA 1H2BA 5IXYA 2OZVA 4PS1A 1K6XA 4MV9A 3LTNC 3RIYA 1ECPA 1GN9A 3UJNA 4L73A 4E6PA 4TWBA 1N77A 1QIIA 3GNLA 4C21A 4X1IA 2CXNA 2FSVC 4GBJA 5DBHX 1GILA 2XMCA 4FZVA 3WYAA 4ZI3A 2WQZA 3OJ0A 4MQFA 4XGRA 1P5HA 2XT9A 4UHJA 3RUFA 1CUGA 2RGNA 4O2BB 3ZDEA 3TZKA 3L92A 1MHPA 2XNCA 4YPOA 3VPFA 2YUTA 1V7ZA 1WBJB 3MWEB 1NN1A 3PNYA 5KTMA 3OE7A 4DMFA 1O7JA 4LXHA 1S4QA 5E8RA 5JNTA 3D1JA 3AR9A 2YWXA 2CBGA 4U3JB 5EXTA 1A98A 4B7ZA 3QJ5A 1PJ3A 1UPUA 4CLRB 5FBVB 3OD1A 1AHNA 5ARCA 3MOSA 4OHZA 3I2IA 4I36A 3ESQA 4LS3A 4B3RB 2WAYA 1FSGA 4UEJA 3QF4A 2QN2A 3MNFA 4MRPA 3B5JA 4OHPA 5I9SA 5T7BA 4ND2A 4LZOA 2J85A 1PFWA 1FNDA 4IRUB 1A7AA 2ZJ2A 5K3EA 2P4UA 4E5PA 3D4BA 4EHIA 3DE7X 3KB2A 2JI9A 3ZEAA 1EMDA 3LDAA 5JTUA 1E1KA 5IANA 5LQKA 2QVGA 1V95A 2CNNA 2GEBA 4PYQA 1WHSB 3H3FA 2ADFA 1GZHB 1XQYA 1ZCZA 1UXOA 3FGPA 1CLEA 5AJTA 4OUDA 4JX9A 2QGNA 2VR1A 3TQSA 2OOKA 3V7FA 3KJQA 1Q2XA 4H7EA 2PXXA 2YV5A 1LVHA 1ULUA 1CP3A 3WJ1A 3LCUA 2R25B 2YR0A 3E1GA 2DQ4A 3C1UA 2W6JA 1E6KA 1RZUA 1XVUA 4PICA 4KDFA 4BO3A 1KGDA 3Q2OA 1A2OA 4CF3A 2FPPB 2ACVA 3ROZA 5K8TA 2EGGA 4NTZA 1B2LA 3OOSA 4Z9BA 3D3QA 3AWDA 1SBQA 3T1HB 2B5VA 3JSAA 1Z25A 4RPIA 4GM1A 4DMRA 3DMDA 2KI5A 4B46A 1L8AA 3KHTA 3U3ZA 4AO7A 3OTWA 1QO0D 4C0JA 1L5FA 1XHFA 4AYTA 4HXYA 2CXOA 4P7GA 4L9RA 1PLLA 2JRLA 4M1MA 1AGRA 4NAUA 3U7RA 2IQIA 1FFHA 2H2WA 2XDQB 4J1NA 4LRWA 5KAPA 4RYDA 2G77B 3WWEA 1ZICA 2X5XA 3KPVA 4OM7A 3DO6A 1KJJA 1WUHS 3IQHX 3UB4A 3JWPA 1EDOA 2DB3A 3QHPA 3TPCA 5DF1A 4F04A 3DV9A 1OPXA 2ZS9A 3PXAA 2D4HA 3ML1A 3JR3A 4V0NA 1Y5IA 4GGPA 2ZWMA 5DIFA 2BGJA 3AWIA 4PBTA 5DCWA 3VO1A 1U7ZA 1KYWA 4CLOB 4LZPA 1GTG1 3C24A 3R7WB 3SVZA 2WHRA 3T41A 2Q3EA 2VA8A 4F45A 3HO1A 3QVXA 3EGCA 1A9XB 4L15A 4MUEA 4GI3A 4HZUB 3ETHA 2YN4A 5ETJA 4RHEA 1HUQA 2GM9A 3OLZA 4J1TC 4JB2A 2AFIA 1DQNA 1LPPA 1XGKA 5L3VA 1DT3A 1PEAA 3RHZA 3ORYA 3ZQKA 3CB4A 4IM7A 1A4XA 1L5WA 4UCXA 1RLOA 4DR1B 4G4GA 5EQDA 4J43A 4LNHA 1EX7A 2G28A 4Y6RA 5K05A 3GFPA 4QYWA 3ZDXB 1CR0A 1OGJA 2EG5A 1FSSA 1MO5A 5DLYA 3R3JA 3P9QA 1YZVA 1IBMB 2M6RA 2FUCA 2I99A 2QRMA 3A4VA 3K0BA 1DXYA 2JI8A 2RJOA 3DW1X 4Q6WA 4ZVPA 5TPWB 3G8AA 3UENA 3O8LA 3UCXA 1E69A 4E4RA 1ESDA 1RWBA 3Q2KA 4BRWA 4Q34A 4BVJA 3JQPA 2F62A 1P5RA 2DQSA 2EATA 3HI6A 5BVHA 1D04A 3KXPA 2IPNA 2FN3A 4UBOA 2DTDA 2QRQA 3BGWA 2CHEA 2XQJA 2NZVG 1PEDA 3FHLA 5TQ0B 4E5DA 4MGKR 5JNWA 1F5NA 4MKFA 3NV9A 1E8NA 2ZVDA 4CI9A 5AKXA 5LA6F 2Q5JA 1DV1A 1H8HD 2PUDA 2GYWA 4KBGA 3ZGYA 3UAYA 5TQ2A 4BJ1A 5JWRA 5DHAA 4RD3A 4QLAA 4NYJR 1P2VA 4EL0A 5K8JB 1AUQA 1V16B 2ZI4A 3FZYA 3GUZA 4MCJA 1NFFA 3CZAA 2FQXA 1VB5A 3BWMA 1M8PA 2EIXA 1FF9A 3TW8B 3TLBA 2NXNA 2ZR0A 3ZE0B 4WLNA 2C2YA 5HOEA 4KQXA 1G16A 1VE5A 1F4PA 1TK9A 1Z07A 2FG5A 2XMPA 3OLXA 1U4NA 4Q00A 2A2ZA 2VEDA 2HPHA 4G24A 4P31A 2B0JA 1J99A 4BNGA 3L1VA 4LV8B 5HS6A 1TIPA 2W9XA 3KD3A 3EDYA 4DDMA 3AILA 1ECJA 4WK6A 2KBFA 1GLVA 1IG3A 1TM3E 4IICA 3PUXA 3ASVA 4OQEA 4FXOA 4QHYA 1HK7A 7ABPA 2WKPA 3I5MA 2X1MA 3INTA 4JFRA 4EMBA 2X7HA 4DM7A 2QLMA 4YCNA 1KXZA 1RXCA 4BX2A 5FDFA 3SYKA 3DBOB 5C5IA 2XODA 3AXSA 1YRHA 5TEWA 5DK6A 4ZQCB 1OVMA 3H9GA 2EFJA 3E2IA 1YVEI 3DXYA 3QKRB 2A5DA 4PPNA 2X8BA 2AUMA 5AOCA 3Q15C 3BXOA 3OQ6A 4IRMA 3TSZA 4Z4FA 2AN3A 1UBLS 3CZRA 1FS4A 4FONA 5JPCA 2G8LA 3H5AA 1AJEA 2ON6A 4KYTA 2HYDA 2AC2A 2ZWAA 1PAUA 4BZZA 1V6CA 1ZKDA 2NGRA 3AVUA 4QICA 4RKYA 2ZDGA 2WUDA 1HZZC 1Z22A 3K5WA 4P53A 2G8NA 2OORA 2A7QA 1D5WA 1SXJC 2XT6A 3GUVA 2EF1A 3ZXIA 2B4TO 1PK7A 3FNBA 5BYKA 4K9NA 2QVBA 2V7TA 4MKIA 1F2UB 4GVXA 1GT91 3H0CA 3HJCA 5JBNA 4HGNA 4E5KA 1PP4A 2KW5A 3BOSA 3QEAZ 2JGIA 4ER3A 1L7DA 2CFCA 4JLSA 1EUDA 1K4MA 3QX7A 1PJ4A 2NO5A 4J0EA 1Y8QB 2QL6A 2EERA 3PVCA 1P5ZB 2SCUB 2WYHA 4C0LA 3S70A 4LY6A 1OBFO 3WA7A 2C1XA 1E89A 1X7ZA 1UMCB 2V5AA 2F90A 1LDBA 1Z26A 4FFMA 1H2WA 1IBLB 1BW9A 1HEIA 4OXNA 2YNMD 4GI2A 4IVQA 2E5LB 4JC0A 1K27A 5K0FA 1UBFA 3BGVA 3PZBA 3L0IB 3N8IA 2DPYA 5FBKA 1Q7BA 3EODA 5F12A 4AQ7A 3VZSA 4ZI7F 5EJ5A 1W1UA 3RAJA 4PNHA 2VP6A 3I8SA 2VLBA 2LCFA 3F1KA 4LRYA 1TUEA 4M76B 4OFWA 4WFQA 4FYVA 2C57A 1KBZA 2WJ3A 3G5AA 2VZ8A 3IQDB 3LGXA 4O8CA 2XTZA 1QU2A 1PEYA 1PWYE 3N6RA 5KOIA 1FYVA 4RIIA 1YE5A 2FRDC 3WGTA 4YMHA 1EFRD 1L6IA 3IOMA 1VBKA 1XDWA 3VPXA 3DEFA 1AHIA 4F60A 1O89A 3ZEIA 5KNBA 3LCVB 1A2BA 4K6FA 4N5IX 4MICA 4QOEA 4WNIA 4BE9A 4TSFA 4Q82A 4YRFA 3ORQA 1KOJA 2QB5A 4HQNA 2PD4A 1YULA 4ZJUA 4O4JB 3HEBA 2IUTA 2A9RA 4ISCA 2WJIA 3U7EB 2DPMA 5JECA 3JYPA 3A05A 4LZWA 4NG5A 4EUHA 4NBRA 3D7SA 3IAS1 1P1CA 2QLJA 3FD8A 1GAWA 4TMTA 4DCSA 2K2QB 4B3MB 1PVOA 5E1MA 2YJ3A 5JY1A 4DBZA 1SZJG 1FUUA 1DZ3A 4O29A 4HX2A 3H2JA 2N1BA 1J8VA 2H9AA 1OT5A 5AXDA 2Y27A 3PNQA 4URHA 5E8JA 5KJ1A 5CVDA 2WJWA 2Z3VA 3AC0A 1OXSC 4KLCA 4R5HA 5FTKA 1I10A 2XCLA 3MTBA 4WADA 4NYIR 2J33A 1NI3A 6Q21A 3PCXA 3NC4A 5TQJA 1TD1A 4RD1A 4CKXA 1BX1A 3IILA 1Y37A 2FSIA 4H6XA 4WESA 4XX0B 2GAOA 2J0QA 4TWRA 1HA3A 1TAGA 3ANLA 2HL6A 4YP9A 3QYJA 2OGTA 4TZ0A 2O5EA 2NV0A 2QGFA 2Q62A 2JCVA 2WV7A 3AHEA 1JXMA 2VRCD 3IUSA 3MWEA 4XE5A 5BSRA 3EIOA 1Q7RA 5DNAA 4GBGA 1O95C 4AJ2A 4DJJA 1BX0A 4YYZA 3T4PA 2CCGA 3I2HA 1Z47A 2ZTMA 4WK4B 3WL5A 1CNMA 1JECA 2V7GA 1LC3A 4L9WA 4TX1A 3ADBA 3JD3A 4U3JA 5AI5A 3VRHA 2UYQA 3OIWA 4UM9D 1MG5A 5AK5A 2Y0CA 1FNNA 2ZRAA 3O4FA 4JJ6A 2GILA 2YBDA 3RBZA 2FR1A 3U4CA 3EVEA 3C3MA 4RO0A 3U7QB 1FDUA 1I8TA 1ZK0A 3R0ZA 4ASUD 4BQIA 5B4VA 4J90A 4A9AA 2NXWA 1XRNA 1W2WB 3BAZA 1C2YA 3IYLW 4GZLA 1DMSA 2E48A 4ZYXA 2F6RA 3AI2A 4RTNA 4MDHA 1TM7E 5JRJA 3MRXA 2AEMA 2QPLA 3OCUA 1WB4A 1T8UA 3ONVA 3ER8A 1ZCJA 4OGGA 2P35A 1QHXA 3JQ6A 2R8EA 3W5BA 3VZPA 3A27A 1HYQA 1WHSA 1BXZA 2WT4A 4A2CA 3GRYA 2I1VB 3BZUA 1P60A 1OWOA 3U7FB 1KMNA 1SOUA 4EO9A 3HZHA 4IH9A 2Q1WA 4IILA 4TXMA 1C1XA 2GEKA 2R3SA 3KVVA 3PF9A 1MTOA 1XMIA 5AVKA 2YHBA 3GEIA 2P62A 1RTTA 5DCLA 1EWRA 1C1YA 3FPSA 1G7CA 3IEUA 3A2NA 3KUDA 1W4LA 5HKBA 1EM6A 1NXTA 3QBJA 3TSCA 4A03A 2VEOA 3CPEA 2FFHA 1K3UB 1OREA 2OC4A 4FGZA 4RHYA 4JXXA 4BQFA 1S2NA 1WTCA 3B2EA 4NMXB 1D07A 2YYAA 5LU9A 4IIUA 3TDNA 4D2IA 1I14A 2J5QA 2QZ9A 4NYJQ 4XXHA 4DCTA 1ZK1A 4HNSA 1JR6A 4HEA6 4XDHA 1ZD3A 4AYXA 2K6GA 4EITA 5A4KA 2M9MA 4DR2B 2JLWA 3STVA 1PTJA 2O8NA 3ANYB 2KPOA 2O57A 1IH8A 2PT7A 2QMHA 1IMJA 3T3PB 2A4KA 4MRVA 4C89A 5JXJA 3NVDA 3LDFA 1KDTA 3PNPA 1D2NA 1SVNA 2VOEA 4EGAA 2B83A 3VR0A 4AX4A 4E12A 1SQ0A 4CZ2A 1NV9A 1JHAA 3ETNA 4KQMA 4CLOA 3DNMA 1A8IA 1LZKA 4RLFA 1MENA 1A9XA 3HCAA 4POOA 1Y5LA 4F12A 5DULA 2AUNA 5CFMA 1AXGA 2JFWA 4R2WA 2WJHA 4RESA 4D3YA 1N9ZA 3LYUA 4GVPA 1U0RA 4NEGA 2QV0A 1RQ2A 2QN7A 3GL9A 4RF2A 1OASA 3KFLA 4OQ4A 1WR8A 4RCYA 1ZUIA 2Q1UA 4A8JB 1HFJA 1MX9A 2C9YA 5IDXA 3MMXA 4X8LA 1E9AA 5AOBA 4CF7A 3DLHA 4IZIA 2W83A 3IPCA 3DQPA 3ONWA 1CUXA 4LMRA 1QP0A 4AN1A 4EO7A 4PC7A 2JGEA 3UH0A 3H3JA 3QVUA 4MYRA 4OL9A 1MC4A 4FLEA 3F3YA 5CG1A 2HF9A 1WCWA 1KMCA 1ZI9A 4DQLA 1WVGA 4NENA 3HY6A 3TLMA 5TQ0A 2D2EA 2F3QA 4TN5A 4U9IS 4AAYA 4AN0A 5EWJB 1BVUA 1A9OA 3FRIA 3OHSX 4PFKA 2BDUA 3JTMA 2Z4SA 3ELDA 4V39A 1OBOA 1DO2A 3JQGB 4MIYA 4XCXA 5D3ZA 3V8VA 3BH0A 3N8DA 4N01A 2J5KA 3JQ7B 3NYRA 1YB4A 4ROSA 3FOBA 1AMUA 1X7YB 2J9GA 1V16A 5DNUA 3GA7A 1G6HA 1ZOLA 4LYEA 4L5JA 4UZSA 4EZIA 2A0UA 2J3QA 3DGEC 1MFZA 2VDJA 3LQ2A 2B4AA 1FFDA 2G04A 4IV5A 2JHFA 2OP1A 2P5YA 3JQ8B 1QAOA 2GARA 2XTJA 3OZEA 2FWRA 1SKUA 1SD2A 1WXDA 1RRVA 2Q9AA 3FG9A 4M1EA 3C8UA 4NSNA 2RGEA 3RTAA 5F3DA 1QC5B 2W6NA 2ZDHA 3NYQA 5TEVA 2PUAA 3RU3A 3WKBA 4AWBA 1L4FA 3A6HA 1Z4KA 5FL3A 3OD5A 4GE0A 4IFBA 2QT1A 4YJ2F 1I7QB 2W58A 1MFPA 3ELUA 4KHZA 3KKOA 3GRFA 1XEXA 3NASA 4RD4A 2I3AA 4H17A 3TIIA 2QE7D 3RQIA 4DRXA 3WGQA 5BPFA 3WXBA 5DEIA 2BF7A 2JLAA 5TX7A 3QKRA 1RSZA 5E4YA 1ZD2P 3TLAA 3RWMB 1GAXA 1MEEA 2Y8EA 4NH0A 2V5UA 1R66A 4J7XA 5EP4A 4UUBA 4DNOA 1Y80A 1YDFA 3BKXA 3D7NA 3H17A 1EE9A 5JMPA 4F11A 1BX3A 1ZIOA 3BGSA 4ND5A 3V3TA 2GJKA 5AW0A 4TWAA 5HKLA 3ZHZA 4KV7A 5BW4A 2GB4A 5TS3A 3QV1A 6CHYA 4Y6SA 1KAHA 3M5PA 5TGTA 4YXWA 1M34A 2FA9A 2FZ4A 1Y8CA 3FFAA 1USVA 2FEKA 3EBLA 2VS1A 2P9FA 4UZFA 1BWRA 4NYIQ 1KFJB 4H59A 1F2UA 3THSA 5KWEA 4LJ5A 5FFFA 5A9SB 4BU1A 1AUOA 1NDUA 2QTHA 2PAFA 3LY5A 4IDBA 4HTFA 1RVV1 4POAA 1Y8QA 4OL0A 1AZTA 2NP6A 2SCUA 3IIEA 4G5FA 1NHGA 1P45A 2VJDA 3IA2A 2AJTA 2D1SA 3ROPA 3TI9A 5C1BA 3CGWA 1UMCA 5DCYA 3G2PA 3DZJA 1GAJA 3LU1A 3N39C 5JI2E 2BSQA 1A9PA 1XHLA 2GNAA 2WTBA 1YR6A 1NW6A 2XBLA 2X58A 1W96A 2YINC 3M33A 2J45A 3U9SA 5KQGA 3T7TA 4DV1B 4TQ9A 4RHTA 1T5TA 2V7WA 3X2SA 4H7KA 2YMLA 5FOQA 1AA6A 3T61A 4UFOA 3CNNA 3I1JA 5REQB 1PKXA 4KRGA 2VF2A 4OKNA 1ULZA 2W7TA 3GJRA 4YUAA 1VE3A 3UT5B 4RYLA 3WGVA 5L4LA 4NS4A 1Z6QA 4OGLA 1T2DA 1ZHFA 5IK2D 3FA2A 5A0TA 4OEHA 4Z9XA 2VNHA 4IDAA 1C3LA 1I3CA 2AK2A 4DC0A 5LP6F 2VT3A 3DKVA 2GUWA 4Y9UA 1GNTA 1N7GA 3RHSA 1I51A 2JGDB 2AN5A 1TZMA 2JJMA 3N1UA 1KE2A 2LBPA 1HLDA 1OYWA 5FA6A 3UF0A 5KYWB 4UVGA 4B73A 1RYDA 3S99A 2IPOA 4O4JA 2M98A 4Y6OA 3DHYA 3S55A 3WGMA 1E1QD 1TJNA 1DKRA 1Y1KE 1XMXA 3HLYA 3NCTA 4MVJG 4W63A 3ZLBA 4FZJA 4DIKA 4DMCA 5LMCA 2F1HA 5AW4A 3L7KA 2D0DA 2DY0A 2GJ4A 3O3MB 1YL7A 3N28A 3P9IA 1RPZA 3UMGA 1SXJD 3AM1A 2D5CA 3BIJA 4M9XA 3DZ8A 2FSGA 4TSRA 3GEBA 3ME5A 1NRJB 3MTJA 1DADA 5BW6B 4EW3A 5AVTA 1V3QE 1YVPA 3L0SA 3O90A 5IH3A 4DVJA 2J0EA 4C30A 3HR4A 4N6GA 4P1ZA 3EUAA 3EZNA 3KAPA 1YXMA 3HN7A 2Q4RA 3GDWA 4BO6A 3U6BA 1TVKB 1JRLA 4JVLA 4XJSA 1CUWA 1DEKA 1UDXA 3P9XA 1G55A 1O5OA 3EIQA 1LNQA 2OPHA 1YNSA 1G38A 3GFSA 3TXYA 1SNYA 3MMSA 1ISPA 5DLDA 4ABTA 2ATEA 1XL1A 3LD9A 3LHIA 4WVFA 4XX0A 3WL8A 2C0QA 1ZM2A 3R5SA 2X5OA 4OAQA 1I36A 1RWWA 4EPTA 3MT8A 4JJ8A 1LDMA 1OI2A 2DKOA 2I7CA 2NSLA 2XCIA 2PX6A 3P7MA 3E9MA 4M1OA 1J0EA 4S1OA 4BJ5A 5B7PA 4PZAA 2Y1DA 1YA4A 5BWMA 1DJOA 2GCOA 5EKXA 2ATVA 4NQZA 5KVQA 3ZVMA 2CHUA 1TB4A 4J91A 3R3SA 1VBNA 1ZAKA 4BBJA 4JI4B 1TT5B 13PKA 1VDZA 3VZQA 4GFDA 4BKRA 2PRZA 1TMKA 5CB6A 5IAEA 1ECGA 3TUZC 4F7WA 3DTNA 4LJRA 1L7NA 1XCGB 4RPKA 3P0JA 1VTKA 3G23A 2QYHA 1GR1A 3PJDA 4ZVTA 5IT0A 3DWGA 4XYMA 3CR7A 3U7QA 1P5FA 3M9LA 5L3QA 3G9XA 1CEEA 3IT3A 1KIMA 4Q9IA 2CLIB 2HRCA 3G8BA 1GRRA 5CHYA 3HXPA 2VCYA 3D7MA 5CVEA 4UFPA 2ZM5A 3U44B 1SCJA 2ZQ5A 5ALVA 2XDYA 3CIFA 3EUWA 3ZWQA 4H7PA 3NNDA 3WJ2A 5D85A 2A30A 2P5UA 3NJ8A 4EGJA 4REQB 2LVBA 1ZH4A 1Y1PA 4JUAA 1AIPA 5PGMA 2ZJ4A 2MYPA 1ZWKA 4IQ4A 3KQKA 1EZZA 2IY8A 1B8OA 4JLJA 4KRYA 4HO1X 3GLKA 3JATA 4BFCA 3G8DA 3IXLA 2F00A 3C0KA 1DTWA 3K0EA 4QJ4A 5AQEA 4RVFA 3TJRA 2GVZC 1LBEA 3HU5A 2PH1A 4EVIA 3BXXA 2PE5A 4QRIA 4D6XA 3H6KA 2UVDA 3GVPA 3KPUA 4L28A 2Y1WA 3K6JA 3K20A 3I05A 4QTZA 4HP8A 2A1TS 2BGLA 2P8SA 2SHKA 3IUQA 1C8VB 2REOA 4E51A 1M10A 1JWLA 1O58A 2YIVX 4UBIA 1VPEA 5A4JA 4AN4A 1NBIA 1BMDA 5BNZA 2PY6A 3RF6A 4M8SA 5C4GB 3AEYA 2L19A 4PX5A 2ZT5A 4DA0A 1EJ6A 1CIJA 4XVQA 4J2OA 1Z0UA 1E4EB 2QT9A 4BMPB 4RIGA 3L4BC 1ENOA 2H6EA 1NVKA 1O95D 1NAHA 3PC8A 2XYVA 2C2BA 2TMYA 4QNNA 3IJEB 4RVUA 2F43B 2R5WA 2YC4C 2C3YA 4P98A 3BDIA 4EWLA 4FDUA 1P4JA 3R9IA 3P4XA 1LEHA 1Y4AE 3AFOA 2UYCA 1O97C 4TLCA 3UAWA 3R6TA 1ES9A 3GAZA 1X8KA 2ZRPA 5BN3A 1ZIDA 3Q3HA 1CS4C 2LCIA 2DXIA 2QUIA 3IUJA 5CLHA 4RCVA 5DASA 3K9QO 2IYEA 4RL6A 4IO0A 5GJCA 4URVR 1YS6A 3HRHA 3TQHA 2PQMA 1FXWA 2ZSKA 1MJFA 3MYYA 2V0NA 4G5YA 2OCKA 4IS3A 1CQJB 3VX4A 3ZE8A 3GY0A 2YY6A 4B85A 2WYOA 2FNAA 4Q12A 3SSMA 2ZYSA 2IYXA 3ZH2A 1LNZA 4A8JA 2A9KA 1FTQA 4U6QA 2B35A 4O1HA 3P52A 4JUDX 2C58A 2XAAA 1N5LA 4MPPA 4IFIA 4QU0A 1I6MA 1REQB 3S2SA 1O6ZA 2R84A 2K5UA 5F1OA 4EK9A 1XMQB 1VHJA 1YS7A 1RM4A 1TIBA 5DNYB 5DGCA 3PNLA 3SDBA 3WB2A 2FUG6 4ALNA 3WJAA 4A4DA 4JXJA 3L2OB 2XMZA 2XXBA 4RHCA 1UBRS 4Y2XA 4Z4IA 2WSIA 3PG5A 4KGVA 1EUCB 2Q45A 4XDYA 3TTYA 2ZSJA 3ITDA 2N0SA 4RMIA 1NBME 2H4XA 3W2EA 1QR6A 1KYVA 2WI8A 2ANBA 2X76A 3FYUA 3LLCA 4X20B 3LIIA 2JJ8A 3PVZA 2XB6A 2ZR7A 5AICA 5EWJA 2ZI9A 3BWCA 2QZZA 4BIIA 5LOVA 4MEJA 2QLFA 5HILA 1Q91A 3K1JA 5JARA 3DMFA 5H80A 2PKQP 5IEBA 1IZYA 3K15A 3N86A 3UUGA 3ZWNA 1AXEA 1G20B 1L5QA 3CA8A 4R2XA 4TZ6A 1U04A 3L49A 3UXHA 2VP4A 2J31A 1X7YA 3DZFA 3LUFA 1Q3KA 5A0FA 4HB0A 3H9CA 4IIGA 1PHPA 2V0CA 2VN8A 1Z7EA 4YWJA 3AR4A 4H1HA 1IWBB 1E32A 3GG9A 4F91B 4ZGWA 4P5PA 5EZYB 4KZPA 4L9AA 1VIDA 3MELA 5DHSA 2OQVA 4R6WA 1HRDA 4MW2A 4JU9A 1QDUA 5DM0A 1F6WA 3HJTA 2OQ2A 4XB6B 2WF8A 5FP0A 2WEKA 4LDAA 5FV4A 2FV8A 1IJEA 1CUBA 2GN8A 2O1WA 2YWHA 1ZWLA 4JBWA 4BP9A 2XE4A 1TFUA 5D6NA 1IB0A 3C45A 4RQTA 2EFHB 2IPMA 3I9KA 4FJ0A 4MYSA 2EBFX 3PR2B 1L4NA 3REOA 1F20A 3S27A 3X1DA 4B31A 4DMUB 1E3IA 1UP6A 1VGVA 2GS9A 4KH1A 3TH5A 1K7SN 3PFNA 4MA0A 4CQMB 4EY8A 1C3EA 3TTWA 3FPLA 1C9DB 4IWXA 3WC4A 7ADHA 4JYBA 4I3GA 3CZCA 3ZG6A 1EK1A 4UVIA 3SD7A 4P3XA 3SQLA 1R6XA 2HWXA 4KW7A 3F90A 1JQ3A 1G0OA 2Y92A 3D0RA 3IUNA 2QRGA 1MMFB 4FDTA 4K2AA 4KWHA 4YT5A 5KQMA 1Z8HA 4W5HA 1Z0KA 2G72A 4X63A 1T9BA 2HMUA 3K0CC 4IPTA 1XI2A 3VBEA 3WTBA 4CF4A 1F8UA 1GUDA 1UWVA 3L1UA 4Y1RA 4QA9A 5FTWA 1RKVA 4ETIA 2DT5A 2IPXA 5B55A 3QUSA 2VDWB 3QP9A 5ALEA 3L7BA 2XCOA 5B3LA 4PLHA 3IDSA 4NNPA 3MS4A 2FOLA 4YFYA 4YI3A 5JZBA 2IPAB 3OZAA 1N0HA 1RM0A 1RWNA 2J09A 3OQ1A 4FE7A 4FS3A 4MYHA 3UTDA 4DGSA 2P2CA 1OZ0A 1TEZA 2HDNB 1M73E 1VHLA 2RGAA 2AYZA 4P3KA 16PKA 3S6JA 4COKA 4QDZA 2WP0A 2F8MA 1PFVA 5D00A 4WCDA 2OAQ1 3VR4A 3PUIA 1IONA 4KJZA 2CXSA 4JJ7A 1AKMA 3LRTA 4TQUS 5REQA 1DHRA 3MLEA 4O1IA 2JK0A 5HBGA 4DSNA 1B76A 5FADA 1QZUA 4OH1A 1CEYA 1EJBA 2JH3A 1UBOS 2XKKA 4Q4CA 1QVZA 2IYSA 4MUJA 1EVEA 3GEDA 2C2KA 2M6SA 3R3VA 4L8WB 4YAJA 3DO5A 4M1KA 2B3DA 4DUZB 1YQ9A 3GEMA 4KRXA 4MH0R 1B0PA 4E21A 3ENNA 1MAUA 3AIKA 3G2MA 2Y4NA 3LXRA 2AFHA 2QPOA 4NL4H 2JGDA 1PQPA 4WKPA 2AXNA 4UUMA 2DWOA 4Z8XA 3DFZA 5E3IA 5I9BA 4JI8B 1GPH1 3FI0A 3OZBA 2EC5A 4YP7A 1E9BA 2ZTSA 4YRJA 4D4KA 3LT4A 1LPSA 3PKZA 3TEJA 1JG4A 4HLUC 2UUBB 4XUEA 4IX9A 1OGYA 3M82A 3SX4A 1MJGM 1JLMA 2FCRA 1HE2A 4NNOA 4RZHA 4DSTA 3LBHA 4HB2A 3SOPA 2VDVE 4R98A 5F1PA 4XM2A 3CUVA 4BUCA 9LDBA 4OJNA 5F5LA 5KNCH 4PRLA 3HI4A 2NSHA 3ROGA 4PAWA 5DBEX 1J8QA 1DP4A 1OI3A 1QGOA 2GNPA 3EC7A 3NTUA 4EPWA 4FOTA 2C8LA 2DPLA 3CYFA 3DZHA 2AMYA 2ZYTX 2CY0A 3ANTA 3GGGA 2J6IA 3IULA 3E8XA 1TVKA 3KVNA 2DFDA 4KR7A 1T9HA 4LOLA 3VSBA 4BO9A 2HNBA 4F9GA 1A2QA 2BONA 4RDCA 3EQZA 5HFJA 3NPMA 1N2ZA 4UCQA 5JSZA 1TF7A 1VRWA 2AG1A 1ILEA 3Q3JB 3FYDA 4YRQA 4D92A 1UFRA 5K0EA 1QMGA 5KTYA 4DEXA 2UKDA 4KR2A 4HXFB 4UHEA 5LKAA 3GGPA 4EKEA 1UZUA 3NP7A 3ZDDA 3ZZ1A 5ARBA 2RHJA 1G2IA 1T8WA 1DLIA 2NU9A 2HLDA 3BMXA 3PT9A 4YLGA 1GSAA 1MEJA 3MLAA 1KZHA 4P58A 1E5QA 3R5HA 5LIRA 1TL7C 3WKAA 1Y4DE 2OWDA 5JT1A 1NRIA 2PUWA 4CMBA 3HO6A 3JQFC 3NTLA 2ABWA 1SHLA 4R0MA 1L2TA 3SFVA 1PYOA 5AI8A 3DV2A 4J6FA 4C43A 2YVKA 3NWJA 2HIHA 4PXAA 3CLHA 3CRRA 3A1VA 4R1MA 5T41A 4OK6A 1NQVA 2EW1A 2PH7A 4H1VA 4PWZA 3P96A 4RFSB 1H6AA 4JC4A 5J63A 4P0TA 4GF5A 3U9LA 4WIAA 1P0IA 3CRVA 3S29A 5L3SB 2CBXA 4IYJA 1PFYA 4M9QA 4B7XA 3GUHA 4R3NA 2H85A 4CMIB 4HMQA 3TFOA 2ATCA 3OE5A 2XZDA 2OBLA 1U2QA 1QJ4A 2EWVA 3D3JA 4E14A 4OXXA 1GGEA 2X0RA 5ICCA 3TGPA 1DIAA 2WA2A 5JXGA 3HKEB 1TC1A 5I6DA 2BKAA 2QRLA 2OP0A 1RHQA 2QSZA 4F9FA 5F2NA 5LP1A 2FH5B 2HHAA 3PFIA 1EVJA 1WZCA 2P9GA 3A1UA 4MVCA 4RTLA 1JLKA 5JDCA 1XA4A 3D2CA 4O2AB 1RPAA 2HJSA 1J2EA 1HE1C 1ISIA 1BXRB 3QVLA 4DR5B 1PK9A 3R9KA 2Y6VA 1RYNA 1ZMTA 3UC9A 2GN4A 3CNBA 1E2JA 3NRJA 5K3BA 2YOHA 2JD2A 2YXEA 3KLOA 1Z2EA 4Y6GB 2D1QA 4WUTA 3ZWDA 4KKVA 4RK1A 5HA5A 1IIBA 5ICFA 1Q1NA 2WT8A 4R2MA 1E4EA 3IAEA 3CX4A 1P73A 3N53A 3CXUA 1MZVA 3ICOA 1AKVA 3JRXA 2A94A 2GAAA 4DREA 5I7SA 5IT9A 1W49A 4JOCA 3GLIA 1FFXB 2F43A 3QBVA 1QGUB 3DE2X 4H7FA 2JIPA 3UK7A 1X1SA 1NW8A 4Q93A 3ZBPA 1XTZA 1J21A 4GT1A 4LF9B 1RDFA 4CM9A 4P0QB 2IPLA 2IF0A 4FGWA 4KFSA 5CJJA 3NAGA 1ORIA 1U28C 2XX3A 4HNTA 4KITB 3RC8A 3HKDA 3ZWWA 2B3TA 3AT1A 5CLLA 5AVUA 4MVXA 4AUNA 1HXHA 3P9KA 4K0KB 3H97A 5KSYA 1M76A 2ETXA 1IN6A 2P9ZA 2IEYA 2XQVA 4KMMA 3WICA 2JGNA 4UKDA 5LBUA 2IYRA 5LP6C 2J0UB 3KZKA 5AIBA 2NUBA 3IHTA 4NZ9A 3EZGA 1EB9A 1TCUA 3HACA 4Z53A 4PWYA 4QLBA 4BNWA 5JDIA 4L50A 3EVBA 2Q4TA 4FSHA 2BW0A 3G3EA 5ADHA 2NG1A 4FM9A 1FTWA 5FXMA 2FSFA 4B47A 2F4VB 4A73A 2W2LA 3ZDFA 3OKFA 4OB6A 2PSJA 4A8PA 1DG1G 3TD6A 1WQ3A 2NZXA 1T1IA 3G7NA 3O1LA 4UM5A 2R6FA 4AM8A 1U94A 4HCJA 3AVYA 4Q1DA 2XZOA 3EAQA 4WKCA 5H70A 1AK1A 3GAFA 3RKSA 1B0AA 3RVPA 4LXYA 2N46A 1RXIA 1P80A 2GK4A 5HCUA 3WLMA 3SWWA 1WZ2A 1M6HA 5F21A 1BKSB 3LKDA 2PBLA 4GI1A 4G1BA 3MCUA 1I1HA 1IZ7A 5H8WA 2P40A 4B3IA 3BJZA 4IIVA 3EVGA 4GYWA 1LBTA 1XQVA 3TTTA 5EC8A 3AESB 3TTSA 1QQBA 4KNYA 3GAAA 3MSCA 1DKMA 4TTAA 3SYMA 2P6RA 3WE7A 2PD3A 5EJAA 2WY2D 1JT9A 1Q0QA 1AGNA 1Z82A 5LB4A 1LI7A 2PVCA 3F6YA 3QOYA 2GHIA 3RGWS 4JHLA 2FUEA 4QO8A 3JX9A 5JS7A 2NUAB 4JQYA 3ZHSA 4F56A 5BQ3A 1Q16A 4IL5A 4MMYB 4RMNA 1O97D 5EJFA 1RWPA 5EZYA 5JG7A 3WOVA 4BKUA 1L7PA 3CU5A 3EXHA 3LUHA 4QRHA 4TUYF 2Y9MB 2Q1XA 2E7ZA 3X1WA 3FUWA 3BM5A 1F6DA 1ZM9A 4KCGA 1J6UA 1YVDA 1I5RA 3AB3A 3WYFA 3ZVNA 4ZP1A 1ULAA 1ZNXA 3M1AA 2KM1A 3GFFA 2OMKA 5LDGA 3REFA 2QI9C 2FEPA 4TPKA 1GJRA 1UIMA 4ZZ0A 3QW2A 3R0XA 3RC7A 2MTBA 4JHXA 2WWYA 3H1EA 3F6SA 3HXKA 4XUGB 4X9XA 4ZCLA 4CQMA 4E88A 5JAMA 3IP8A 5DXFA 4Q4JB 3TAXA 1WPGA 1BD3A 3LT2A 1QRDA 2IYVA 3PPIA 4P8RA 1V7QA 1RI5A 5LKRA 2VXOA 2Q7OE 1S3SA 3WTCA 4LE1A 1TO6A 3I8XA 2JZCA 5EXDA 1EIZA 3UXYA 3FOWA 3HP1A 3LG2A 5AW5A 5LQAA 4CT0A 5BV1A 4YDQA 1BQ4A 1FNMA 1ZVJA 2QNRA 4GOJA 1R0WA 2ODNA 2IX9A 1U0GA 2YWDA 3GUYA 3LWZA 2DLDA 2IHUA 3FVWA 3ISTA 5FI3A 4EDHA 2XBMA 2F64A 5FI5A 4BEWA 5A3RA 4CDGA 1CV2A 3HLTA 1SFRA 3SK0A 5KTNA 1XALA 2AH5A 4D4LA 2NPIA 1YZLA 4DA6A 5CK5A 1ZW1A 3UGQA 3EEFA 1UDAA 3N2NA 2WJVA 4MITA 1WPXA 4G25A 3EVZA 5SZJA 5U4QA 2R1TA 4AJ1A 4JJAA 3IJRA 3IUEA 2PX3A 3OI7A 4HDRB 1UOPA 3NHAA 4Z7QB 5EWLB 1GADO 4B40A 1NUPA 3U17A 5I9LA 3ZV3A 5FUWA 1P6UA 4NU5A 4CKEB 1KDYA 1GTSA 2OY0A 4F38A 1N0IA 1Q3TA 3FHCB 5HMMA 2J87A 2RIRA 3L0DA 3DVAB 1N5KA 3IV6A 2C9ZA 4M87A 2D4AA 5E6RB 2C98A 1BJKA 4YI5A 1VG9B 2IOYA 4YJGA 2QJOA 1EG2A 3BFXA 1QQTA 3G0DA 5DV9A 4P4UA 4CLXA 2QBYB 1U0HC 4EEZA 5GMOA 3EA0A 5CH5A 3SBEA 4RHUA 2QJWA 1TU3A 4BLPA 4JXKA 4D79A 2YRWA 5DNDA 1ZRHA 2ILVA 3JR7A 4KV9A 3LNTA 3K05A 5CP8A 5IAAA 5E0OA 1ODJA 3B70A 1JXQA 4N9WA 2WUWE 4NH4A 1JALA 5ALQA 2WJZB 3WK4A 4ETMA 1JA1A 4AWAA 3ROQA 2J67A 2W0SA 3H2GA 4YRAA 1J22A 2XQKA 4JQZA 4DF3A 2XIQA 1OJLA 5CEEA 1ZSNA 4Q3EA 3OBIA 1UZAA 4JJFA 1S2GA 1XJCA 5KTKA 1Y48E 1VCOA 4RY2A 3UK2A 4DJ5X 3SSNA 1R5JA 5DBIA 1KP9A 1IM5A 1N9GB 1PTKA 4MR8A 1DDIA 4M8LA 4BN5A 3R3WA 1SBZA 1JA0A 1Z4JA 2OQRA 1P9RA 4ZHQF 1Z39A 4QOJA 4XQCA 4DMGA 3RF7A 3AM4A 5G4KB 1SCAA 3EPKA 3KG2A 3S2UA 2BRUA 1ZLYA 3PHIA 3S7TA 4AKTA 5AUOB 1DX6A 4ZARA 3ITNA 5AUPB 3D64A 3IIMA 2A0FA 3H2YA 5I45A 1JSCA 2H06A 3ROMA 1I6KA 5JJBA 2IUFA 1FFEA 2G5CA 1N7JA 1U8ZA 1A4UA 3BA6A 3LQKA 1PDWA 4JIGA 3DEYX 1K4YA 4J3JA 1YR9A 1U1IA 4EARA 5CVTA 2EZ9A 4BAZA 1XQWA 4EKYA 5DP1A 4MKHA 2PRSA 2CNKA 5TS2A 2ECOA 3A3NA 3D3WB 5IABA 2YW9A 4XAQA 1QHFA 1Y6ZA 1DBWA 1R88A 3IEIA 3U6KA 2Q7XA 3SGLA 2EP8A 4J7AA 1FYXA 1MO6A 1AXRA 3RRZA 1XZGA 1P7VA 3M2TA 3M5WA 1C2TA 1ARZA 3ESBA 3QTTA 3SC4A 4Q3AA 4F0JA 3E15A 5DP2A 3O8CA 1E8DA 3DDUA 1G60A 4FX5A 4Q9AA 5ALDA 5CGQB 4LGMA 5FPYA 1S9HA 1C0LA 4KFRA 1FP7A 3UHJA 5T5QA 4HL6A 3QLUC 3UAZA 1UK8A 5E3JA 3WGYA 3ZD6A 1T1EA 3EEBA 3T3NA 3Q41A 3UWPA 2Q0XA 3LLSA 5LU8A 2FX2A 1L5KA 5IBQA 2FW0A 1ORWA 3GRZA 4RS3A 4WXHA 2PWAA 2GJSA 2ZCJA 1PUIA 3FLMA 3DZKA 3GBPA 3RTEA 4IG9A 2XZTA 4URFA 3OTHA 2PL9A 4KWCA 5L3SA 3IQWA 1XAHA 2FGKA 3I42A 4MROA 3T4XA 2B25A 4PYNA 1I2BA 1S96A 3K73O 4DWVA 1QANA 4M37A 1BWPA 4EA7A 5LWQA 4B0OA 5BV8A 1MXHA 1SURA 4XUCA 3HKEA 2JJ1A 4JDUA 1OUMA 5JZVA 4HFJA 1EWQA 2EZ4A