2AN4A

Structure of pnmt complexed with s-adenosyl-l-homocysteine and the acceptor substrate octopamine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2an4A00
4YV1A 4L7VA 2PT6A 3G89A 5DTQA 3TLJA 2PT9A 3FTFA 1JR4A 5CCXA 1X1BA 2I62A 3P97A 3R24A 3KQYA 3TFWA 4IV8A 1EIZA 3OZRA 2PBFA 5DRYA 4CTJA 9MHTA 3R0QA 4HSGA 1JSZA 4F84A 4RTRA 1G6Q1 3MTIA 2AOUA 1VP3A 5HILA 8MHTA 3FPEA 2Q41A 2ZWAA 1TW2A 2O0LA 1VLMA 3P2IA 4LG1A 4DKJA 1AV6A 3DH0A 4E2YA 1V39A 4XUDA 3P9IA 3OU6A 2OPBA 1RJGA 5EHGA 5ICFA 4PCAA 2G71A 3EVFA 1RI1A 3DMFA 2I6GA 5EIFA 2VS1A 3E05A 2EX4A 5GIPE 2G8NA 2I7CA 3O4FA 4C07A 2XVAA 4GUAA 1EQAA 2ONZA 3Q7EA 5F2KA 3MB5A 1YF3A 5EMJA 5EG5A 3M6WA 5K0JA 3A26A 3AXTA 2B3TA 2PV0A 4EK9A 2PX5A 2AOTB 2ZZMA 3TRKA 3UJBA 2AR0A 3PX3A 3DMGA 3G88A 1TPYA 3NDIA 3EMBA 1X1DA 4X63A 1P1BA 3HCCA 3P71T 5FA5A 3OZTA 1EG2A 3P9KA 1WXWA 1NE2A 3EPPA 4CKBA 1UWVA 5C1IA 4E2WA 5EHIA 5E9QA 1Q0SA 2BH2A 3R9XB 2PY6A 2QY6A 5DX1A 4RTSA 4R8RA 1PJZA 3SGLA 2A14A 2AS0A 2G1PA 3SM3A 2IBTA 5DXAA 2ZW9A 2R3SA 3E23A 3FTDA 3GU3A 3NJRA 4F85A 1YFLA 2C7OA 3AXSA 4QDJA 2EJTA 3SX0A 3KQTA 3EMDA 4M7RA 3GRYA 3THRA 3I5UA 1RI4A 1KXZA 3UFBA 5BW5A 2P8JA 2P7IA 3ME5A 4HH4A 4KDRA 5EGSA 5EVJA 3S68A 3T7SA 3IEIA 3HCDA 4C04A 4ER7A 1VL5A 2PVCA 2PWPA 2PXXA 3OZSA 5DPMA 1YB2A 3TQSA 4BY9E 5HIIA 5MHTA 5B1SA 4AZSA 1G38A 5KYGA 1JSXA 2ZZKA 4HTFB 1EJ6A 3Q87B 3OCJA 1EAMA 1QYRA 2IGTA 4E32A 3HCFA 3DP7A 5CD1A 3A4TA 3B5IA 5K8VA 4PNEA 2Y1WA 3DXZA 4OBXA 4PIMA 3EGEA 3G2MA 5FQNA 3IHTA 4PYOA 3KU1A 1SUIA 2E5WA 1KPGA 2QE6A 3TM5A 4EKGA 5FCDA 1AQIA 5K01A 3BT7A 3FPFA 2NNWB 1VP9A 5K0CA 2ONYA 3KR9A 1ORHA 5DT2A 3GGDA 4C06A 4FGZA 3O31A 4E2ZA 3DOUA 3A25A 4M36A 4O29A 2OBFA 2ZVJA 4R8SA 5BXYA 1Z3CA 4Y30A 2I9KA 1L3CA 3LCUA 3GCZA 2UYOA 3HA7A 5C9ZA 2ZCJA 4RTNA 2PSSA 3NVMB 1NV8A 1RI2A 4GOND 4MTLA 3RODA 3BGIA 5EC8A 1KPIA 5E8JA 1UIRA 5EZQA 2PKWA 3EVCA 3I53A 4HRAA 2NXNA 2ZULA 3OE5A 4P7JA 4PINA 5EEGA 5T64A 5LQAA 3T0IA 3TPZA 2AN4A 3PFHA 2GA9A 5CIYA 3G2OA 3HCBA 4FZVA 1NW3A 3C6MA 1B42A 5F2OA 5GM2A 3BUSA 3VC2A 3NDJA 1DL5A 4OA5A 3TOSA 5DTMA 2IH5A 5FUBA 3SXJA 1I1NA 5DXJA 3VC1A 3CBGA 3DLCA 2BM9A 3UJ6A 1R8YA 4BLUA 3ER9A 5HZMA 1IY9A 3FUVA 1WXXA 4PWYA 5CVUA 5DX0A 2AVNA 5EMMA 3UBTA 5K0GA 2FHPA 3GJYA 2GH1A 2LD4A 3GWZA 4PGHA 4R05A 1KP9A 4BP1A 2QRVB 3EVZA 3KPVA 1YUBA 4Z2YA 1BKYA 1N2XA 3I9FA 4PYMA 1JTFA 4FS8A 3GRRA 4PGGA 3UZUA 5K0FA 4IWNA 1SQFA 3FUUA 3ELUA 4Y2HA 2XVMA 3RIEA 2IDKA 3KR1A 3SMQA 4YUYA 1ZQ9A 2VP3A 3LGAA 4RX1A 2Z6UA 1VE3A 3B89A 2VZ9A 1XCLA 2IP2A 2BR5A 3LCVB 1AQJA 5LQUA 2OKCA 4C08A 4AX8A 4HC4A 3ELYA 2P3QA 2PXCA 4KDCA 3C3YA 3KQVA 4K6MA 3R3HA 5ICEA 4LWOA 1WZNA 5EOVA 4RTPA 2C7QA 1SUSA 4GC5A 4RVGA 3PT9A 5E1MA 3ERCA 1F38A 1Q0TA 1INLA 2B9EA 4E2XA 2B78A 3T7RA 4RTOA 5DM0A 5JUWA 2JJQA 1G55A 1XTPA 1L1EA 4QDKA 5DLYA 4BLVA 3BKWA 3FYDA 3B3GA 1ZG3A 2P3LA 3NMUF 4IKPA 2C7PA 3KPYA 3LX6A 5DX8A 2H00A 7MHTA 4GF5A 1ZGJA 3BGDA 5K0EA 4P7GA 4YMHA 1BHJA 3HVHA 3A7DA 3LSTA 5DM4A 2H11A 3NTVA 2G72A 3D2LA 4GBED 1EJ0A 3HCAA 2NXCA 2ZIGA 4FP9A 4HG2A 4KVZA 3KR2A 3PTAA 1JG2A 5LQCA 4FT2A 1JQDA 3KPUA 3KQOA 5HIKA 1M6YA 4CXMA 4ER6A 2NP7A 3CCFA 4ATNA 4ZTBA 5KQSA 2WA1A 5FTWA 3ER8A 3SR4A 2PLWA 2HNKA 5HIJA 3SVZA 2ZBPA 3TKAA 3SSNA 1TW3A 4KWCA 5CVDA 1QAMA 1RI3A 3LBFA 3LHDA 5DM1A 5K0NA 3BWCA 4MIKA 5K09A 4GOLD 5LQJA 4QTUB 4RVFA 1FBNA 3HNRA 3KQPA 4EMSA 1KIAA 3E8SA 3MCTA 4M38A 4OQEA 5CUQA 3OFJA 4CTKA 3O7WA 1L3IA 3BWBA 5E9WA 3TR6A 5P8WA 4WXHA 2AVDA 3FUXA 1G8AA 3G5LA 3MCZA 4PYKA 4A6DA 3HVJA 4DCMA 4P7KA 3HVKA 2FCAA 3PX2A 2OO3A 2ZIEA 3IYLW 3IV6A 3UA3A 1SKMA 2P3OA 1YZ3A 4H0NA 2KW5A 2VDVE 3AJDA 3HA5A 1VIDA 1T43A 2FPOA 5EPEA 3JWGA 3BKXA 3P2KA 3ORHA 1KR5A 4HGYA 5HEKA 5BP7A 1XCJA 2NXEA 2Y1XA 2JHAA 2V74B 2IFTA 2ESRA 2ORED 3AWIA 4FSXA 2R6ZA 1M6EX 4PYJA 4U7PB 1QANA 2FK8A 4M37A 1QZZA 2ERCA 1MJFA 4FT4A 2H1RA 3CGGA 1JQEA 3CC8A 3NWBA 4KIFA 2YXEA 3FUWA 3KQSA 4KW7A 3GXOA 2AOUB 5CCBA 1H1DA 3NVKI 3M4XA 2Z6QA 1PRYA 2EG5A 3DUWA 4RVDA 5C0OE 4DQ0A 1KPHA 1SVUA 2FYTA 3LL7A 1XJ5A 2EFJA 4NECA 3G2PA 3SSOA 1WY7A 2OY0A 3V97A 2YQZA 3OFKA 2HMYB 2ZBQA 3K6RA 3I64A 5FQOA 3FUTA 2WA2A 4ER3A 2GS9A 2ZBRA 3HCEA 1JG1A 4G56A 1YZHA 4QPNA 2AOTA 3KPJA 5T6BA 2BZGA 1KHHA 2GPYA 4WVLA 3FZGA 3H2BA 3DLIA 2AOXA 3EGIA 4PYIA 4PIPA 5EIWA 3KKZA 5LQKA 1I9GA 1SQGA 1WS6A 5U4XA 3CVOA 5EZSA 5EKUA 5EEHA 5IKMA 1OR8A 2PXAA 1FP1D 3C3PA 5FHRA 4F86A 4LECA 2IDJA 1KYZA 2CWWA 4LWPA 3LDGA 3B7PA 1I4WA 1O54A 2P1DA 3MTEA 3UJ7A 4MHTA 1WG8A 5BW4A 5FA8A 1ZKDA 2O07A 4QTTB 4C05A 4GOOD 2NYUA 1XDSA 3DXYA 3FRIA 4U7TB 3GO4A 5ERGB 4A6EA 4C4AA 5LQRA 2YVLA 2JG3A 1P39A 1R8XA 5GWXA 4CKCA 5KS2A 2B25A 2OB2A 3LPMA 3PLAE 5EQJB 4KIGA 3KHKA 3LBYA 3EEYA 2PX8A 4BP3A 3L8DA 3GNLA 3ELDA 4QQKA 3G8BA 2O05A 3ANXA 3WSTA 1VBFA 2WK1A 2JH9A 2XYVA 5K0BA 2FK7A 3GRZA 3C0KA 2QM3A 3P2EA 5GOZA 3FTCA 4QPPA 3LDUA 4HTFA 1JG3A 1SG9A 3BWYA 1X19A 2ZSUA 5E2BA 2O06A 4MQ4A 4P7FA 4RTJA 1RJFA 4V0QA 5DM2A 5HIMA 5FADA 2DULA 5GIOE 1X1AA 2HR1A 1R00A 3X0DA 1ZHFA 4MWZA 3UJDA 2BM8A 4B17A 4QQNA 5K03A 1U2ZA 1XXLA 3JWHA 4P58A 5ICCA 2ZIFA 2AN3A 4RTQA 1AF7A 3EEOA 4X1OA 2AZTA 2XYQA 3HA3A 3FYCA 3FPGA 4RTLA 3AY0A 1NBIA 1VPTA 3LKZA 3EGVA 3EVEA 3LECA 5KQRA 3CJTA 3GIWA 2PX2A 3G2QA 1R74A 3GRVA 1ZGAA 1R6AA 2P40A 5D1HA 3KR0A 3JWJA 4X41A 4YUXA 3M6VA 4QVKA 4R6XA 1YFJA 3V8VA 2AN5A 4R6WA 1XVAA 2P35A 2YX1A 5FHQA 1DUSA 3GRUA 2BR4A 4UOEA 3TM4A 1HNNA 4E31A 1O9HA 2G70A 5E8RA 2PWYA 3BGVA 4GC9A 3TKYA 1NKVA 1JG4A 1O9GA 3I58A 3UWPA 4GQBA 3NW9A 1RJEA 3KPWA 4RVHA 4AZTA 4HGZA 4JXJA 4PYLA 2GAFA 5DWQA 5E9JA 1R18A 2PX4A 3B3JA 4YUVA 4E33A 5GINE 1FJXA 4OA8A 2HV9A 3M6UA 4XUEA 3FPHA 4RTMA 5D1NA 3K0BA 3HTXA 4DA4A 5JR3A 3OU2A 1XDZA 3EVBA 3THSA 2CMGA 3QOWA 3FRHA 5T67A 1F3LA 3QV2A 2UYQA 4PONA 3OU7A 1NW7A 2EJUA 1N7JA 2YXLA 3G5TA 3ID6C 3P9CA 4RWZA 5EMLA 4YV2A 4GEKA 3F4KA 4EQZA 4RV9A 5HFJA 4YMGA 5F2NA 2QRVA 2PGXA 3LKDA 3NWEA 3A27A 3VYWA 5GM1A 2ZFUA 3DMHA 3KQQA 5CM2Z 3E7PA 4RSRA 5ICGA 1NW8A 3OE4A 2IBSA 4FSDA 5E2AA 2BR3A 3CKKA 2NP6A 3HP7A 1ORIA 2ADMA 5KVAA 2CMHA 1L3BA 3P8ZA 4ER5A 1G8SA 5EMKA 3R6TA 2GLUA 4V0RA 4E30A 5GP1A 4BLWA 3FPJA 1KYWA 2VDUE 2JH8A 2NXJA 3BXOA 2P7HA 3SSMA 1D2HA 4YUZA 3DTNA 4EKIA 3KQWA 5HOQA 1NBHA 5E1OA 5G02A 2OYRA 3PS9A 2AOWA 5IH3A 2B2CA 3UJAA 2N47A 4CWAA 4EVIA 4IV0A 5LQNA 3P9NA 5K0LA 1NW6A 5CVEA 2OXTA 4ER0A 5CVJA 1N7IA 5M5BA 3BZBA 3G7UA 2GB4A 3EVGA 4OQDA 3CJRA 3BWMA 5LR6A 2ZZNA 3G8AA 2JHPA 2K4MA 3QOXA 3PVCA 4OX9Y 1DCTA 2XBMA 3PB3A 2UZ4A 4E70A 3B3FA 1XDUA 1IM8A 4X61A 3VSEA 3EVAA 5EKXA 1D2CA 1UFKA 3MQ2A 3RW9A 2AOVA 4DF3A 3UJ9A 1D2GA 1RJDA 3LDFA 5CVVA 2P41A 4PYNA 5FULA 3REOA 3UA4A 5FWDA 4RTKA 3KQMA 1G60A 3TMAA 2CKDA 3HVIA 3JWIA 2IH2A 4ISCA 5DRTA 3PFGA 5E1BA 2FRXA 2YXDA 5E1DA 2YR0A 3LCCA 3DR5A 3T7TA 2IPXA 1FPQA 4YUWA 1NV9A 4PYQA 3DULA 1FP2A 1X1CA 1HMYA 4XCXA 1P91A 3U81A 3UJ8A 1JTEA 2OZVA 3HEMA 2Z6AA 3CJQA 2OB1A 3FTEA 4DMGA 4DM3A 1BC5A 2HTEA 4GOMD 2O57A 2DPMA 5DTRA 4YV0A 4DZRA 2C7RA 2IH4A 4FR0A 2ZTHA 4RYLA 4DCGA 2UYHA 4XUCA 1P1CA 3UJCA 4C03A 4QVGA 2UYCA 10MHA 2YUIA 1NT2A 1IXKA 2JHCA 1BOOA 3M6XA 2XYRA 2HWKA 3C6KA 3MAGA 5H02A 4CKEA 2VDWA 4X60A 1NW5A 5DSTA 2YTZA 5LSAA 1Y8CA 1MHTA 5K05A 2PJDA 3MERA 4PCLA 3HM2A 1VQ1A 2ZWVA 3M70A 1M0EA 2QYOA 3MGGA 4KRGA 4AZWA 3OPNA 2IIPA 1RI5A 3A7EA 2CL5A 3GDHA 5FWAA 1QAQA 1JQ3A 5DSXA 2F8LA 4AUKA 2V7EA 4AZVA 1L9KA 2ZLBA 3MHTA 3DXXA 1QAOA 4OBWA 3ELWA 3M33A 3EVDA 4POOA
chains in the Genus database with same CATH superfamily
2F3SA 3DDCA 1JDSA 1KQFA 1W5SA 4MVJA 4OKIA 1B0ZA 1PJRA 2CLEB 5FPPA 2I62A 5DCUA 2BFDB 3M49A 3PFKA 4I4TB 1M2OB 1Z5NA 4NAHA 4PO3X 4AF6A 3WIUA 1NSFA 3BRWA 4AO7A 1XXHE 3GZ4A 3SBXA 3K6SA 4OMUA 3NDBB 1UFVA 3L7MA 3K5IA 3NBAA 1A2OA 1IPEA 3ZH2A 1BFDA 1SVNA 4UXIA 1KOLA 4JYZA 2V4UA 3DH0A 3I8OA 1B2RA 2Q3BA 5JJIA 2IYZA 3NKVA 3OU6A 3FNFA 1LK7A 1YZNA 1DRUA 1JG7A 2Z8ZA 3MTQA 5FYDA 3VYVA 3ZS9A 3CF0A 3W8DA 2Y1OA 1NLMA 1JXMA 3H11B 5BWOA 3ZDZB 9ATCA 4UEKA 1U02A 2V7UA 4AZ3B 4E08A 1OLUA 3E05A 4Q4HA 1ESEA 3O2JA 4XPIA 4ZIRA 2HREA 4LE1A 1ZJ5A 4TUYB 1TL7C 1JEOA 3LWDA 1H8ED 1GIAA 2VRBA 3KXLA 3MB5A 3CSDA 1TO6A 3DE6X 3IXMA 3TLBA 3CUSA 2BFFA 1QGZA 5HXAA 2WIKA 2V7BA 1EWRA 3A26A 3AG6A 3TRHA 5K0JA 4QKQA 1KI2A 2JGAA 4LN1A 1QLJA 4HDSB 1OLSA 3RT7A 1ZC3A 2PV0A 3FMGA 1RWMA 3BWVA 3I45A 2ZZMA 3L1IA 5HNKA 1L4HA 1JAHA 3A2MA 1GAJA 2PDAA 1M7GA 4U9IS 3ZV4A 1EFPA 2X6RA 3CKYA 4GQAA 1YFZA 1WBJB 3IAS1 1JA0A 4GX1A 4M9ZA 4ND5A 4C7OB 4NPAA 2I66A 1RYEA 2V1XA 2IUEA 4IDDA 3ZCTA 2ZRHA 1MOQA 1LPBB 3GEMA 2B8NA 3K30A 4EGAA 2NU7B 2HWUA 1YQ9A 1XZCA 1DBPA 4KIWA 3EXG1 3UVEA 4F2DA 5K2OA 4BVHA 1IJFA 2KBEA 2VRWA 2ZW9A 3IERA 2G28A 2GCPA 3N8DA 5I47A 4MYHA 5KHLB 1UBFA 1ZI9A 1C30A 2AXPA 4FJ1A 1TZ2A 5K45A 5KTPA 1YR8A 1EVIA 5KVSA 4XARA 2XCTB 5CK5A 4CG2A 1SCKA 3VR6A 1YJQA 2WT8A 4PZDA 1HL3A 2P8JA 1G4HA 4H4DA 2UUPA 3A1WA 4P3YA 4QA9A 4W6ZA 4JKYA 3O0DA 3K16A 1SA0A 3E9MA 4Q5IA 3QLVC 3WC4A 2QSZA 3KJEA 4HEJA 3DKIA 3B1KA 2PL1A 5KYKA 2EWWA 5DDIP 3VX4A 4DAOA 5GONF 5JAPA 1CS0A 4GZ3A 3G2MA 1VL0A 2NTYC 4YC7A 2QE6A 3FBWA 3VKUA 1RKQA 1DX9A 4EG8A 2A7QA 1WUTA 4YI3A 3ZJYA 2F64A 3U5ZB 1WL8A 4M1TA 3H5NA 1E4EA 1ZNXA 1VHLA 4LOLA 3VZDA 1RYFA 1NU8A 4E6PA 4AY2A 1KMQA 2OD2A 3H1FA 3FGZA 1Z4IA 1ID1A 3K32A 2FWJA 2PMEA 4IIJF 4F96A 2VPIA 4P3OA 3ZXIA 2P11A 2Z8YA 3KQHA 1A8PA 2BKUA 3LCUA 3HA7A 4JR1A 4PGFA 1QG4A 4WBXC 2BM1A 3TRJA 4AB1A 4KYTA 3W5VA 1R12A 4P54A 3U7IA 1PNVA 1OXSC 1XD8A 2EBFX 3I05A 3HB7A 3KE8A 3KVVA 3SKXA 6ADHA 2PKWA 2XD4A 1U80A 1W49A 2IXAA 4K9QA 4HWSA 3RC3A 3H2SA 4FZ5A 4A8JA 5TSDA 4KQ1A 4DWOA 4GR4A 2Q8QA 5JO9A 1WZIA 2JLQA 1Z4MA 1KJJA 1PT6A 2ZSHA 3FZEA 3QELA 4MWBA 5C81A 5ALFA 5ABPA 1UOPA 4IUDS 2R8XA 5ES4B 2IS1A 1YHNA 3B6MA 2YS6A 5D5QA 4HPXB 1WTCA 3DSRA 5J23A 1ZJ4A 7YASA 1I7NA 2AX3A 3GJYA 4NAUA 4ODIA 4Y67A 1CUWA 3Q3JB 3BXPA 2WPDD 4G01B 1GDTA 4N6OA 2YIDA 5K0SA 2W6ZA 1NVMB 2AW5A 1NFQA 1WF3A 1QH8A 1D09A 4FC7A 5L6MB 3T8YA 3IUJA 3SYRA 4AMZA 1M1YE 2CBXA 2V58A 1MQAA 1CLUA 4D0NA 1LI7A 3WZLA 3LWBA 1TAQA 2F3RA 3Q8XB 3MM4A 1E2QA 1S96A 1QV9A 4KQ6A 1RYNA 3HSKA 1HKHA 3OOEA 2O5RA 4OAPA 2Q9UA 2EP7A 1NIPA 3PF9A 3TLCA 1FNMA 1QZXA 3C3JA 4U2CA 3V32A 2Z6UA 4ID9A 1RD4A 3B89A 3O91A 2J0QA 3SX2A 4KREA 1YC2A 2C9DA 2FB9A 5AQEA 3O8DA 3VFDA 1XO1A 5DBIA 3WYGA 2CLFB 3BDAA 5DBEX 3ZNQA 4FMCF 1VLJA 3MW8A 2QI9F 1N5OX 4XWKA 4UBIA 3VGPA 5FLYA 4QVIA 4U2KA 1Q0QA 4RJLA 3COPA 3A70A 2QRPA 2GN6A 3ZDBA 4YP0A 5TS3A 1R10A 3VOBA 1M3SA 3OKPA 2A9QA 5FAKA 1KY5A 4Y6OA 1N33B 5FPKA 5JROA 1T1RA 2R8EA 1KKLA 4LZZA 4XCVA 1DZIA 3TLEA 4AVYA 4BO5A 5A4JA 4K9RA 5CITA 1A72A 4C2UA 4DMRA 1XHFA 3JQ6A 1F6WA 2CDBA 3A4VA 1EK1A 4REMA 3TK1A 1MC4A 2BLLA 2WAXA 1V2GA 4TQGA 5IN4A 4FP9A 1K63A 1D1QA 1XEXB 2QX7A 2VQDA 2HK7A 2B0CA 2VP0A 4L2IB 4UBNA 5LUBA 1L5HA 1UBMS 4BCDA 3FR7A 1E1CA 3GGCA 1T9KA 3IUSA 3SR4A 2Q4OA 2C84A 1BAPA 1WY5A 3RVDA 3AR2A 3C70A 4X95A 3C41J 2VUUA 1EZZA 2V7TA 1KVSA 1N2CB 3L46A 3LIIA 1B93A 3R74A 2G40A 3QOYA 5B4TA 2GKGA 4O5OA 1EFHA 3LHDA 3IMEA 2YY7A 1KGSA 3IAS6 2IYWA 1AT1A 3MG9A 1HT3A 2F1HA 1U3WA 3I23A 3NWOA 4GW3A 5IDVA 2V9ZA 4BP9A 2Y0DA 1OASA 1Q0PA 4BO6A 2BEKA 3IP8A 2E6UX 4R9UC 4X1IB 2ZT5A 4BNHA 1XZMA 2W43A 2QUHA 3EW9A 3BGOS 1L3IA 1VHQA 2ASEA 3CW2A 3G13A 3G2KA 3AEQB 4N12A 5E9WA 3U4QA 4L15A 2UZAA 1X7YA 2NZVG 3P4UA 2WU4A 4JUBA 3DEIA 1DIBA 2YJGA 4TQAA 2WUEA 3NHWA 4B0PA 5T7BA 1ELOA 1HRKA 3B38A 3KWFA 5EAIA 1YKFA 3A1DA 1HFEL 1YS1X 3R76A 3LFUA 2WSLA 2AR9A 1BXRB 4NTZA 1Z4LA 3GJ5A 4V0NA 3F5QA 3VZQA 2ORED 4UE3S 1W4LA 4AULA 3BA1A 2WTBA 1QANA 4MPDA 3I2IA 2GM5A 2C5LA 4R83A 3LGSA 3MK31 2H1RA 1N7HA 3MJFA 4GPEA 3ST7A 5KYXA 1N92A 2K87A 2ZQYA 4NQRA 1V7PC 2AOUB 5EZ6B 4B32A 3ANMA 5BNZA 2PPVA 1THTA 4MVJH 2TMYA 5EXEA 4QREA 4ZQFA 3WTCA 1VIAA 3VBEA 4BECA 3RU9A 1GUZA 3UWOA 5AJTA 3ICEA 1TD9A 2ZKLA 1H2EA 3L0DA 3K0KA 4FFWA 1TT5B 2B8WA 3W9SA 1T3LA 2B1JA 1YJCA 1FA9A 5BR1A 1F5NA 1C3JA 1P2VA 4GHWA 2AOTA 4B4OA 5LU8A 1GRNA 1U9JA 2R96A 5EJ5A 2ID4A 2XY4A 2WU1A 2YC4C 1PNQA 3R3WA 2ZB7A 3NKLA 4Q1DA 3V6MA 1YACA 2JEYA 4JFAA 1Y7PA 4HDRA 5EIWA 4PC1A 3WWZA 4ZJYA 4P0PB 2JCSA 2RGUA 4MW4A 3GLQA 3AZQA 4F91B 1YI0A 3LQ2A 1J1IA 2WICA 4ITUA 2QE7A 4NV0A 3AJ8A 2ZXEA 1HLFA 2AD1A 3RYTC 3WMWA 4L02A 3BHMA 4BNMA 3UO8B 2XCSB 3PQ5A 4ALNA 2VT3A 2ZRDA 1MQSA 2XTAA 3BF7A 3ZKWB 4E12A 4EY5A 3H86A 1HE8B 5IK2D 3EBPA 4L78A 1EGHA 3S8EA 3D31A 1XDSA 3EXIB 3FRIA 1NX9A 3Q88A 5ERGB 5JNUA 1DP4A 2JPDA 3EIHA 5JNVA 1G5IA 1LX6A 5BMOA 2VNJA 1Q1BA 2QJRA 1GTMA 1PLKA 1TCCA 5TPWA 3G9UA 2VHYA 4EATA 5F3DA 3GG9A 1GYPA 1JEEA 4KIGA 1LSOA 3AEUA 2OBNA 3LBYA 4LBYA 3SJBA 4GYJA 1TLFA 4Q16A 5J5CA 721PA 3ICOA 3L8DA 3BGWA 4CU2A 1F4LA 1SVLA 4ZI2A 2BBWA 3TW0A 4BGUA 2DLNA 2VT2A 5FAXA 3PVZA 3B82A 1YBAA 4ALKA 5FEUA 1E1QA 4JI0B 1PQYA 1GILA 1FFHA 1VA5A 1TCBA 3RASA 4RL4A 1LVUA 4TLMB 2DGDA 2IYEA 5HF5A 3DW3X 1NRXA 3RD5A 1C7QA 5G0TA 1VSQA 4BQIA 2GK4A 4ZCRA 1AXGA 1N9KA 3H0KA 3X2EA 3CB4A 3JQ9C 1NJ6A 3WL6A 3KZMA 4ZK6A 1PFGA 3UQYS 1GPLA 3M9XA 4MKGA 1V47A 1IOWA 1PYOA 2ZTUA 1JEQA 1XRQA 2QX4A 3UXHA 3K15A 4ZHSA 4QSHA 3TLGA 4L74A 2GK7A 3ZGZA 3KTOA 1BE1A 1LDBA 3OC6A 1E3WA 2PSHA 2ZDHA 3CJTA 4LA4A 5LP6F 4TV8A 2VJYA 1R74A 4F2GA 5BSRA 3P32A 3FYUA 5I7SA 1YFJA 1XA4A 4R6XA 4AJ1A 4GECA 4B43A 2J3LA 1VTKA 3BRSA 3GCGA 4CF5A 1J8MF 1W44A 3AJAA 3F3KA 1ZM3A 1CYEA 2QNBA 2O1EA 4OUDB 3HE3A 3K4QA 3NRBA 4IBOA 1E2DA 3BGVA 2Z5LA 4JJAA 5L3ZA 1NKVA 3I5MA 3P5SA 4O4IA 4GQBA 3JARB 3NX4A 4BB6A 4GWLA 3PRJA 3CONA 5DWQA 4HOYA 4TLDA 5ALTA 3SI7A 3ZQKA 4BEJA 5H8WA 2RHOA 3KD2A 1T34A 1CRPA 2G5GX 4M0LA 3O9VA 4F72A 3IT0A 4UTXA 3PCRB 4C4YA 4KCGA 3JQ7B 2H4HA 1MIHA 1NW7A 1P0MA 2D2IA 3BK1A 2BJVA 3OIYA 4RWZA 2NSJA 4CDNA 3RVRA 4MQFA 3EGCA 4FCCA 3A27A 1JJ7A 1JFFA 1R27A 4C7XA 4MQMA 6GPBA 3OAAA 3QE2A 2DRIA 4HF7A 5JNSA 3D7KA 4Y6QA 3E7PA 4BUCA 5NULA 1QH1B 4TMWA 4BX8A 1XVUA 3KXPA 4F21A 2CLSA 3NTXA 4ER5A 1I3NA 3WGMA 4YAJA 4D4KA 2IRWA 4DDVA 5BQOA 4BLWA 5GJWC 1DXQA 5F12A 4DR3B 2IEBA 1NDQA 4GI5A 5DM70 2FPGB 1CQZA 4JV5B 4V03A 1UCFA 3HDJA 4L8VA 2XVXA 5G02A 2OYRA 2P2CA 1SUPA 1TF7A 4XQGA 4CT5A 1PR6A 4IHJF 1X7HA 1YDHA 3EXEA 1QPGA 3AJRA 4OJNA 5LB4A 3WHLA 4EW6A 3DDZX 1KK0A 2GJSA 1X7XA 4GYKA 4XD2A 1TYAE 1F48A 2W6OA 3WWYA 5B6JA 1XLUA 3V2GA 4OX9Y 3QI2A 2OV8A 1XG5A 1ZNYA 2C54A 1PR9A 4G1FA 1BD4A 3IIJA 4RANA 5IVHA 4AXBA 3UV3A 4XM0A 4IDQA 4CN8A 4GPAA 1RVV1 2EVWX 2VXCA 1P62B 2AUMA 1ML4A 3KQMA 4K9MA 2WF8A 3GFVA 3HVIA 1IY2A 3VISA 4H59A 3ZWNA 3PFGA 2F9MA 5HK8A 1F2UA 3H97A 2H5LA 2PGAA 2O8DA 2Q5CA 1IZ7A 4PYQA 3DULA 3JQGA 5CG1A 2JANA 1NVVR 4XCXA 5AK3A 1XLTC 2RCYA 3KOYA 2ZSJA 3U3RA 2XGGA 4CU5A 4ETNA 1KMIY 4YYZA 5B36A 2I33A 3P9XA 2EEPA 2I1VB 4HQKA 1DKRA 4YALA 3IQXA 4YQEA 1RRVA 4NP6A 4U0KA 2FFQA 1W75A 1Z17A 5B53A 1M5RA 1A4IA 4XDZA 4G8BA 1P1CA 1HC7A 5D87A 5DHAA 3W7BA 4Q9LA 4CFYA 4WD3A 2R5FA 3N6XA 1JJVA 4TXJA 4DYHA 4M1SA 3D0OA 5H02A 4R1TA 4GR5A 4H15A 1NW5A 4LRSB 4P1ZA 3O4GA 4YRFA 1CXZA 4EAAA 3Q7SA 5FTJA 3RVMA 3WWOA 4FFVA 4LMRA 1KA9H 3KRTA 1JJFA 1QUEA 1V41E 4AP5A 4ROTA 4HLQB 3PNQA 3F73A 2L18A 3V1MA 5AW9A 5K3CA 2D7DA 1RHUA 4LQ4A 1OD6A 2WZDA 4PR3A 1KQOA 2FA9A 3JYHA 4RESA 5GVRA 1DDIA 3ELWA 1IZ8A 3EVDA 4F84A 2ERYA 1CJMA 3AP1A 3C24A 3CN7A 3EYAA 1WP9A 3MWKA 5IARA 1AGXA 3TTYA 2IYYA 4BRUA 5C7IO 1OH8A 4YAEA 4I1IA 4GLFA 2VP5A 1DG9A 2C4NA 5EERA 4A0QA 4JHLA 1R0ZA 4RK7A 2N42A 1F06A 4P4SB 2FW9A 3ZU6A 5JLJA 4DR7B 1NVAA 4FHCA 3HL4A 3L7YA 4HV4A 1QTNA 3WKBA 3IALA 3KOWA 1L8AA 2TECE 3ITEA 5L51A 2XMDA 3EEFA 4OAOA 1FNCA 2QUJA 4TV9F 1JXAA 2DU8A 2PQMA 3K0FB 3L1HA 3OLZA 4WIAA 1JI0A 4GP9A 4YPVA 5FUQA 3K73O 1FRVA 1GPH1 2N1MA 3EGDB 4ITRC 1ZZGA 4RHCA 5CMLA 3WZ2A 1VL1A 5D86A 3H1TA 2XWQA 4WBNA 5GIPE 2VZLA 4LJ9A 1FFXB 2Q3JA 2RGGA 1MN6A 4WLUA 1Y7IA 4K6OA 3AUXA 1Q0ZA 3F8TA 4WK6A 5A7GA 4D8XA 1DWPA 4DMFA 3X1MA 3ZDEA 4TROA 5G0UA 3GUCA 1X1TA 1J0BA 3IBYA 4EK9A 5HRCA 4EHAA 2G9VA 3CX3A 5DEOA 3I6BA 2A59A 3GAZA 3R5FA 1NOKA 1MJHA 3KTFA 1P7VA 3UYLA 1Q57A 4EABA 5C37A 1Z0ZA 3QBVA 5SYAA 3HXLA 1XAGA 2D0PB 1PJ2A 4Y0VA 3IKLA 1DJQA 4CGZA 1OIVA 5DE3A 3RF6A 1P4JA 1N1DA 3ZTTA 2P2NA 3LQRA 1P0PA 1UMDB 3B8EA 5E9QA 2R8RA 1KF0A 1ZD1A 2J6BA 3GMIA 3NBYC 2E87A 4J0GA 4OF4A 5FPQA 4QOIA 3ZWVA 4CMJA 4JXXA 1PJTA 1X1RA 4RFLA 1RAAA 2VBFA 2EZTA 2JAWA 5JMTA 2BEJA 4HRXA 3SEAA 4GMGA 1EFVB 3QUQA 3QYPA 2Z5FA 4LNAA 2P6RA 2ZUTA 4FMDF 3GRYA 5EUQB 4AJPA 1RI4A 3SZUA 3JAWB 1QK5A 4L8YA 3UFBA 3OP4A 2FN3A 2X5OA 4O1HA 4CT0A 1W59A 2X23A 1OTYA 3TZEA 4CMKA 3O2NA 4KDRA 5L7TA 3P0RA 4HEQA 1RE0A 2G77B 3EAFA 1D5WA 1Q7TA 3PL1A 4PHHA 3VAYA 1T2UA 2IOQA 3K09C 5TNXA 3ZLBA 4AECA 4CQMA 3M5CA 2C8LA 4KXUA 1GTSA 1ZX1A 5K2MA 2AB0A 1DEKA 5B1SA 1O87A 4JMPA 1U2TA 4P5DA 2IGTA 2XKAA 3DP7A 3CH5A 3HFGA 5ALDA 3VDXA 1ULBA 2Y77A 2FW8A 2P6NA 4QUEA 4EBBA 4JB8A 5F1PA 4YRIA 3MELA 2E5WA 3Q9NA 1BMQA 2G4VA 1Z8NA 2GXUA 3BMNB 5FCDA 1DO2A 3ET5A 1T3ZA 3C15C 4XSGA 2LV8A 3R75A 5KPJA 1SAYA 3SFZA 2DPLA 5DT2A 3RUCA 4DRXA 4MKRA 4D8UA 3GFBA 1VLZA 2XCQA 3Q8LA 1CE8A 4P81A 5ITWA 3WNCA 3FCXA 4UM5A 2OMEA 2ZVJA 3CH4B 3WLPA 3I12A 2QLLA 1KDPA 3SBEA 4B6QA 1HMPA 2RGWA 3EC1A 4Y8VA 4QASA 1TTTA 4BVBA 1AHHA 1QK4A 3BIWA 1CSEE 2I8AA 3INYA 1YRQA 1DINA 3RT1A 2Y76A 4JT8A 3I1FA 3GUYA 3W05A 3MMSA 2Z2IA 1BCSA 1L4KA 2B0JA 1P0IA 5CIYA 1N2BA 1TQDA 1W19A 3IVMA 3LJKA 4GZ5A 1C3LA 1W5EA 5CEEA 1CHDA 2O5VA 3BFPA 4NZOA 4UJ5A 2ECFA 3RROA 3SZLA 1QHXA 2WINI 1SVSA 5DXJA 5CJJA 3X1ZA 4BLUA 3FBTA 1A1SA 5CP8A 1DTEA 3RVQA 4RJTA 4MSUA 3STHA 3VR2A 4E5KA 1KH3A 3FWYA 2VT7A 5K6TA 4QTZA 1RM4A 1N5RA 2HH9A 1USUA 1RADA 2VHJA 4YPOA 2QRVB 2BC9A 2TMDA 2G0AA 2O8BA 1YDEA 1XV5A 4LNUB 1EWVA 1VMIA 1Y1KE 4HYTA 2KSQA 2G9RA 3FAKA 3OJCA 4RVNA 3PGKA 2IELA 2GRUA 4IAOA 2O8VA 1R8SA 4DMCA 3FUUA 3ELUA 3JQBC 4Y2HA 3BFXA 2O3JA 3DVAB 3T9FA 3I9MA 2BKXA 1IY0A 4R41A 3WLRA 2JGFA 1GPUA 1HEYA 5DVZA 5J2UB 5LD2B 3HXPA 2OA0A 2OKCA 3ZZUA 3T95A 5KX5A 2RHGB 3GLHE 2QN9A 2SKCA 3VUFA 2NZYA 1WLSA 4H7IA 5ICEA 3QEMB 4B7CA 4HGOA 2O2IA 2F1JA 1EH5A 4TKZA 4DWWA 5I9IA 1VKOA 4EI9A 4XGQA 4L75A 1FXWA 4EYKA 2B6HA 1NJ1A 2ZYDA 3R7SA 3CPSA 5EJEA 1U2PA 1J49A 2LZ0A 2PV7A 4WACA 4D02A 1T5BA 3ROTA 3WWEA 1JX6A 5T3UA 1T2NA 3RWOA 3NIWA 5LNK1 3CKLA 2O54A 2AE1A 5H70A 3CS3A 2M6KA 3H13A 2B4RO 2NV0A 1V8ZA 4O3FA 2HMWA 2VPYA 1QYIA 1GPMA 2ZT6A 1L5OA 3EODA 3FA2A 3N0TA 3N3BC 4C14A 2C7PA 1E3DA 4INJA 4PFKA 3RLFA 3CBQA 4URYR 2WUGA 2QPLA 3LUKA 4BDTA 4P7GA 4Q19A 2GPNA 2RGNA 3PNKA 5FTNA 4D3DA 3RS9A 3HVHA 5ALZA 2XZLA 4N5MA 3VJKA 4CGYA 1OH5A 2QPAA 1U4OA 4NRDA 3IE1A 3DT9A 3KR2A 4PLPA 3T5BA 1JG2A 5D00A 2O19A 3JZAA 3T5TA 3I2GA 4ETIA 1G8YA 2EU8A 1IN4A 1EFAA 3R3UA 3ZK7A 1W88A 3RWBA 3SVZA 3RVPA 2DQKA 2HIHA 3F9CA 3OZXA 2F1OA 2E7ZA 1WZUA 4EF5A 3CLKA 2X1LA 1QAMA 2WF7A 2R2AA 5EJAA 3J81A 4HDNB 3L43A 4U2EA 1P9NA 3SHVA 5IT9A 1NVXQ 3OJLA 4L8FA 5LA6A 1PEAA 2E21A 4YJ3A 1Z34A 1KDYA 2HGSA 3W8NA 3DOJA 1Z39A 2HNAA 1JDBC 4FNMA 1G4AE 4Z0TA 3LI2A 4ZEOA 3O3OB 1YQUA 4QARA 1E2EA 4C5AA 3T7KA 2IXEA 5J4HA 4A0FA 3AUTA 2Q6TA 2AVDA 3VVLA 1O7JA 4KO3S 1U1GA 4NMMA 3G59A 4AJNA 1KQ3A 4GOKA 4ZT5A 2PRSA 3O75A 3F4LA 4WI1A 3L07A 2ONJA 3UB2A 5MF6A 2Y67A 1JU9A 3IYLW 4G2NA 4CL8A 3OY2A 2J59A 4UE2A 3UMRA 3ASUA 4C30A 4KZKA 1G7SA 1GD1O 3G49A 4BMOB 1M1NA 5MHTA 1SJ9A 1UJCA 2V74B 3IURA 4QJIA 3ZD9A 4WJKB 4AMVA 1SU7A 3E22A 4KVGA 4QNRA 1Y8ZA 1B3RA 3AUYA 3E27A 4HX9A 1JHPA 2BGUA 4FYWA 4RABA 3BX1A 3C2QA 3UOGA 5CCBA 3S1AA 2OG2A 1VMAA 5AVXA 4AMBA 4RVDA 1WTAA 3AX6A 3BMQA 2ADFA 3F1LA 2P79A 4UAGA 2HD4A 1XK6A 2O2EA 4M7OA 5GADl 4FMPA 1YHYA 1PJSA 3NATA 4MS4A 1NVEA 1TVKB 2GKSA 4V1CA 3U40A 1SG6A 1W85B 4LMPA 4J1TA 4MEAA 4MI6A 4BO3A 3LBHA 1V26A 3FHJA 2OQ2A 4ZHQB 3N74A 2HADA 2JLUA 1U4NA 2XZPA 2QUIA 1NXXA 3ZOZA 3DFUA 3L0BA 4IEFB 3DE3X 5EZSA 4ITVA 1EVEA 4L4UA 2J3EA 2OMKA 3QFTA 4RH0A 3VYSB 4LECA 1UK6A 1VYHA 4MUIA 3JZFA 4FEGA 3IPCA 3KTAB 1Q92A 2P5YA 1BYUA 2XTMA 1X0VA 4FYVA 1PJBA 4ZVVA 5BNIA 4U6QA 3DEHA 4MJ7A 3W2TA 3W90A 1XZHA 1LPPA 4LY9A 4YJKA 1TZBA 1ZP6A 1P60A 2BFMA 3SQLA 4DMKA 1R8XA 2CE7A 1JKIA 1V35A 3HYTA 4RY9A 5D6OA 1VDMA 2QTGA 3SHQA 3GJTA 3O83A 4CKBB 5JPCA 5BN4A 2DEUA 3CNNA 1XZLA 1EP1B 2ZJ7A 3EGOA 3PIDA 2JAXA 2AT1A 3ZJ4A 4PHFA 4Z7QB 5IWCA 1T9HA 2V03A 1GG8A 2ROQA 4ID3A 3DZHA 4QU5A 5AIAA 1BGXT 2FWAA 1PS8A 3N3AC 4MI1A 2XNDD 2FK7A 4U0JA 4O3MA 2P65A 5BSUA 2FQ1A 4HXEB 3GHHA 3LDUA 1UWKA 1SCJA 4PW0A 4QOFA 2O06A 4GSKA 1EJBA 4MYTA 3OMXA 1QHHA 2CHEA 1FFDA 1U2SA 4IR7A 4WFKA 5F51A 5HIMA 4B83A 3EDOA 4LF9B 5GIOE 2ZDQA 3SOPA 4PZZA 3QF7A 4QT4A 2OQIA 3MJCA 4OQLA 2R6FA 2RH8A 1P7ZA 1E9DA 4RTQA 2Q2VA 1L7BA 3NM6B 3D8HA 3IQZA 1RQXA 3PBKA 4BNXA 1KWKA 4XA8A 1A2BA 3LKZA 3EGVA 1FVFA 2A0YA 2D1RA 3BSWA 2DH5A 3VKVA 4RIGA 3GA0A 5ECYA 3P2YA 5C32A 3DLHA 2K7ZA 1NUPA 4MKHA 2Z30A 4WFIA 4O25A 3UQZA 4EHKA 1VXOA 1T0JB 4IUYA 3H5LA 1S2DA 4W5HA 3TM4A 5LNK6 3A6FA 4U3JB 1D0IA 5BY2A 4HJXA 2FR8A 2M1XA 1IHPA 1RJEA 3DTVB 2QD2A 2OHGA 1LBSA 5CB0A 4GO1A 1B6GA 2LDXA 4B9EA 5DP1A 2R1VB 5JH7B 1AQYA 4UUMA 4R40A 3SQWA 4X0EA 3ND6A 3QNUA 3ZU2A 1KMNA 1HLDA 1TFRA 4U6NA 2OYCA 3SLRA 3UK1A 5EINA 1A71A 5C1DA 1YCHA 1ZN8A 1N7JA 3EIQA 1PUJA 4AUMA 2Q5HA 2J3JA 1K7YA 2RGBA 4WV3A 1N2GA 2P67A 3QU9A 5I48A 3SU8A 1PI3A 1KTIA 3I4CA 4KBYA 1ODFA 3DCYA 1LPSA 1AG9A 3VR5A 3E3NA 4LZNA 4PAGA 2PSDA 4GYYA 3UF0A 3COSA 3H8SA 1FQWA 1R9NA 1MABA 4OKSA 1W30A 3FSGA 3A05A 3ILVA 4QICA 4DDWA 5JAUA 2PR2A 1D6JA 5ENZA 4KRXA 4IILA 2PZFA 4GIBA 1I7PA 2R7KA 1WMEA 2L19A 2P77A 1K3UB 4WRRA 1D2HA 1JB9A 3SPXA 4K8RB 3HV2A 4ZMRA 5KREA 3UJAA 4IGIA 5B1EA 4RHUA 2GBLA 4NJMA 2OO5A 2UVPA 2PL3A 5C31A 2XUJA 1MVOA 1FSSA 1PFYA 1XRJA 5FV7A 5KBYA 3SYMA 1OGYA 4B7AA 1YDWA 2VH1A 3PQDA 3ICWA 4HAZA 4OHXA 4RLHA 3QU4A 4QWMA 2XT0A 1H22A 4Q4CA 1D2CA 2AFHE 3GGOA 1YHZA 3G0OA 2WWRA 2ZTLA 4POAA 4RGYA 2CD7A 4CMHA 4MA0A 1F8UA 3G82C 3V8QA 4BNZA 5LU9A 1DKPA 1ZH6A 3DC7A 1NHWA 3VDMA 3B6JA 4DNXA 2WNIA 3ITNA 3GQBA 5ESDA 1JHRA 1R0YA 5IAEA 5DN6D 4H2DA 5E6RA 3GT7A 4BVJA 3FWPA 2H51A 2IBMA 2K2WA 3BERA 3EAGA 2XMCA 3UJNA 1JTEA 5DGXA 2OZVA 1IJKA 5TF4A 2ZWMA 3EXHA 4V0MA 3IHLA 4FKZA 4FUTA 1X87A 1DC4A 2HIAA 3F47A 5JXHA 2UZ0A 1I8TA 3BQ9A 4D0SA 1OWNA 4W99A 4EDFA 4EUSA 3H5IA 3J7AC 3LSYA 1QIHA 1MV8A 1X8JA 4HXFB 1KE1A 3TIGA 4YCMA 3E7FA 3IPYA 2XF8A 2UYHA 1IUPA 2WSYB 2FJUA 2ZG6A 1GZDA 1NNLA 4ZCQA 1QF6A 3IOMA 1GG2A 3KJGA 4CT4B 1D7OA 1VFNA 1P61B 2JHCA 4PC6A 4MP3A 1JA1A 3RS3A 2PO5A 5FL7A 3Q7RA 2JZCA 4L76A 3IP6A 4KLNA 2YV5A 2C0PA 5I5EA 4GLLA 2W2KA 5LLTA 1P1HA 5JWRA 3QLJA 2AC4A 1OXVA 3HJAA 2FDRA 4G24A 4TTAA 5U1PA 3PA8A 1LA2A 1ENPA 3KSAC 1A9RA 1ZUHA 5TE9A 2BMFA 4WEOA 5K8IA 4J6EA 1V2HE 4DIEA 5LXTB 5E0KB 3G89A 5FT9A 3G5UA 1CJCA 5JSZB 1U0LA 2ZVQX 4XVQA 1MB0A 2H65A 4MO2A 1OXUA 4UQOA 5TMPA 3C6ZA 2EC5A 3R0QA 4TVOA 2G07A 2GMWA 3S7ZA 1VRVA 3VSAA 3DQQA 1SPXA 3MBKA 4EHDA 1ZJYA 2V3VA 1IXRC 3AP2A 4QDZA 4Y1EA 1JDUA 1F17A 5EMNA 5DNAA 2Z6VA 1J2UA 3TQOA 2BFEA 1DARA 1R0LA 1V39A 4QGBA 4MA5A 3VO2A 3WAKA 5K8CA 2GCGA 1J0DA 1XTTA 5EHGA 2H4JA 3EQ2A 3SE7A 1HNZB 1M1ZA 4Z8XA 1RPJA 4WFJA 1TK9A 2PNFA 5IAOA 1H93A 2WAYA 3OTWA 4QUGA 5FLKA 3CVUA 4RFSB 4HHEA 1U2GC 2A58A 1WKVA 5LYJF 1EXVA 1DC6A 1W2WB 2QAIA 2G8NA 4ZOCA 1U0TA 1Z82A 1Q3KA 3GMDA 5A2GA 3KZOA 4B6RA 4YQYA 1MDBA 4K81B 2N75A 1MO5A 3N0WA 1KKMA 1BQEA 2HLPA 1FTWA 3U3JA 1BKDR 1UXIA 1U28A 3H4TA 2HUNA 4KACA 5AHRA 5CGZA 2J9YB 3E4DA 4BMXA 5A9RA 4HAUA 4YRJA 1UXOA 1JKMA 2GN9A 2HJHA 5DASA 3UJBA 1IHDA 3NQ41 3O90A 1PV4A 1Y5MA 3JS5A 4OP1A 1UC9A 1CERA 2CFTA 4IQ8A 2PKQP 4EB0A 4G1EB 1PF7E 1SBNE 3HCCA 5FA5A 1FSGA 1KSJA 4RXTA 2ISCA 4M0MA 5AUOB 2GI4A 3KYIB 2Q6OA 5EXPA 3R9XB 2XOXA 1VPVA 3B3AA 5C1BA 4ZCSA 3OQVA 1XMQB 4NOLA 3QVGB 2AS0A 2EP5A 2R1UA 3I9JA 3WKAA 2W58A 3DE5X 1KEUA 3JASA 2AQKA 3INTA 4MIOA 2ZM5A 2CLHB 2I8CA 1BDIA 4HMPA 4XM2A 4J0DA 2Z57A 3A6HA 3PUVA 4PZCA 4MMYB 2F8MA 1JW9B 4B82A 4PO1A 1E96A 4JOQA 3LL4A 1UZAA 3DHEA 1G5HA 2P2DA 3AOEC 3CYFA 4XKJA 2O1WA 1PVDA 4G4IA 4XLLA 2IHZA 4YRTA 1EE1A 3KKPA 2F62A 2V7PA 3FHTA 5DHQA 1PLLA 2L2QA 5TMBA 2HK8A 2J8ZA 1LRJA 4CFZA 4DN6A 1CWUA 1PGJA 2ZZKA 1PR0A 3Q87B 5LQRA 3LVBA 3OCJA 3VR6D 3MQFA 5K3OA 3HCFA 1RZRA 3T3NA 3PEYA 1R4NB 2C3UA 2HV8A 4OK6A 2IHTA 2PA3A 2WWIA 5TPZA 5FQNA 3W8FA 3TW4A 2GWHA 1Z5OA 4IJ5A 3KU1A 4OSPA 3PTZA 5ARBA 1QGUB 4I5DA 1Y34E 1T1JA 1GRVA 2OORA 1L0BA 2ZBEA 4W5JA 2CHQA 5K8JB 1E2BA 5JCJA 3QKSA 3CF4A 3NC1C 3NHLA 5I8PA 1XZDA 1G20B 1B8UA 1UMCA 4HNAA 4UUAA 3UW3A 4TYQA 5I8WA 2H4WA 1M2HA 1W0JA 1UJNA 4ZMBA 1DZ3A 5AK0A 1QFYA 4OHOA 4JWTA 1E0SA 1QF9A 1USWA 2K5UA 2QMZA 3F5DA 4TSRA 4BBZA 2NXNA 4EARA 3A2NA 4O2BF 5BN3B 4Z51A 3T0IA 3O8OB 3TPZA 3ZLUA 1X8LA 2GA9A 4BHTA 5BV0A 1RHQA 1RAGA 1IRXA 4I2NA 1K5PA 1N5JA 1NQOA 2DCUA 2XPCA 1OZAA 2XEXA 2HB6A 2A35A 3IVXA 5AFSA 1E4OA 4Z0HO 2IEZA 1ZMOA 3ANNA 4B4KA 4C6HA 3GUVA 2JCBA 2IXTA 3B60A 3BC1A 2CXNA 5EY5B 4ZVPA 1MPTA 3U39A 4G1CA 4K6HA 3ZN2A 3OPYB 1EX6A 1PWHA 4ZYLA 2XGMA 1EPUA 2ZUUA 4Q3EA 4F60A 1V7ZA 2YVQA 2OM2A 3R5SA 3K1YA 4I3GA 5JQGF 1D7AA 3TJZA 3UMJA 2RKWA 3QTLA 3FKJA 4P6VF 3NP9A 4ZODA 4PGHA 4CKXA 1DG1G 3O7MA 2BHSA 3T35A 5BPFA 3EVZA 1SC3A 3EG9A 1IWBB 4D46A 1JFSA 1V4VA 5CLFA 2XRFA 1TA4A 2C83A 1G98A 3PE6A 5DYNA 2DBQA 1Q15A 1DPGA 2G17A 5SYMA 1T8SA 3SBOA 3KR1A 5F4BA 1DVRA 2Y1DA 1M0WA 3FUCA 2EX1A 2ZGVA 3FKSD 4Q18A 2NXWA 3S5JA 2DECA 2P90A 4PWZA 4DJJA 3LOUA 5D01A 3P0FA 1YAJA 3TOZA 4FEAA 4M86A 3INNA 2FVXA 4HC4A 1GU0A 4PBTA 3ZCUA 1W34A 1HYEA 2BTQA 4JT4A 1HYBA 3F6BX 2BFAA 3R9IA 3B6IA 2Y8EA 2VNKA 1EHCA 1KI1A 3L7KA 3L1JA 4LZWA 4CF6A 4F3CA 1URPA 4IIVA 5FNVA 3FDXA 3GFRA 3FYDA 3PK0A 4WL0A 1IBMB 4MYDA 4R54A 3RYFA 4EAQA 1E92A 3KPYA 2BGLA 4RMNA 5DX8A 2HGZA 3CUWA 4IH1A 3H2JA 4BZWA 3PJRA 7MHTA 1M6NA 4O4HF 4RKFA 3UFXB 4EYQA 1G5RA 4N1AA 4XYMA 3QWFA 3TTTA 5AI6A 2R0QC 1OHHD 4UBKA 4GBED 4LVCA 2ZR7A 1C9NA 4FILA 3NIDB 4DLZA 2OZEA 2BAGA 2W0SA 1L9XA 3ZY5A 5DYTA 5FTWA 5TRTA 1HI9A 5JO0A 1DBVO 1W47A 1SKQA 2MYPA 5TMEA 2IX3A 2YIJA 1M73E 5I7WA 4BAUA 5TIIA 4PAMA 4Q7MB 2X2PA 5EWJB 5CVDA 4YXWA 5DM1A 5MN4A 1VE6A 1K98A 3UBMA 1ZQ1A 4QTUB 3K9BA 1US8A 1FBNA 3ODPA 3L8HA 5HJ5A 3IDFA 4JR0A 1GQSA 3LZ6A 1EXMA 4GPD1 4N7BA 4ZU6X 2IIQA 4WCFB 1WMBA 3T3MB 3N6RA 4EMSA 3F71A 4XE5A 3F0TA 4JD5A 2C59A 3OFJA 1VJGA 4WESA 4UDNA 1DBQA 2I6SA 3H87A 3NUQA 2R6CA 1VRCA 4WXHA 1PK9A 3SCZA 1YR6A 1XROA 3RDPA 2XDAA 4B7ZA 2O7RA 4XEHA 2ZXFA 4YJ2B 3RAEC 1SKMA 2FTKE 3HKCA 1W0KA 4J0IA 4IRMA 3IEKA 2NUAA 1BWRA 4MR9B 2B4AA 2JJ2D 2PL9A 3L7BA 3LYAA 4Q7JB 5SY6A 1Y4UA 3RO7A 4AM8A 3ZHSA 4EY3A 3GT0A 2BN4A 5BN1A 2BGTA 5FB3A 3MINA 1QDLB 1COWD 1CUGA 1JG6A 1RBMA 2ZAYA 4LHVA 3UGTA 4KIFA 3H3XA 4OPMA 2QLMA 3T12A 1C2TA 4N3BA 1FTSA 1Y82A 3EXAA 1H2AS 3S70A 1GPKA 4N0MA 2P4QA 4OCZA 1YL6A 2IIBA 1IHYA 4LHWA 2QUKA 3EXFB 5KQLA 1DKMA 4FKBA 4P80A 1OV6A 1YSCA 2PMFA 3G2PA 3H3JA 4QU9A 2RIRA 3FDZA 1BQ3A 3EGWA 3OP1A 4L5BA 3BD8A 1IL0A 2GBCA 4WNIA 4FYJA 1FNNA 3I64A 3STTA 4MOWA 2ZYAA 2GS9A 4IZOA 3IUMA 3I30X 4JASB 4JA2A 1VSUA 4LPSA 4V0LA 5JFGA 1NR5A 2H1HA 5TGZA 3I1JA 1R5NA 3V34A 4NOMA 3W78A 4WLVA 3WHIA 3AIOA 1B2LA 1HLGA 4OQYA 4WW0A 1YE3A 1D9ZA 2X0DA 4DA0A 4JJIA 2O5CA 4MCJA 1HDOA 1UFQA 2ID7A 3CW9A 4F86A 3ANLA 3L8MA 1A9XB 4DY6A 1N2SA 1F1BA 1XZEA 2J08A 4I50B 3QTBA 5ANRB 5FR1A 4ZN6A 4WZAB 2O07A 3UM9A 1VKNA 3GJQA 4JJEA 1ZMRA 3FN4A 2R47A 4C9BA 4UVGA 1DJPA 4C7JA 3IEMA 4MWEA 3PJDA 1ICEA 1OIXA 1JR3E 5KS2A 4YRQA 1THGA 3ZD6A 2OB2A 3V1KA 4UKDA 5A5VA 3IVAA 4RF2A 2OILA 4JUDX 2WIGA 3WGUA 4YRNA 1UKVY 4L08A 2B2XA 1SXIA 3RHZA 2Z95A 1IJEA 1GQYA 1MU0A 1VCIA 1XVVA 5K0BA 3GFTA 3NTQA 3AEZA 821PA 1LF0A 4LRTB 4NOKA 1XQXA 3C3KA 1SG9A 1VFPA 1XU7A 3UGJA 3LY5A 2ZYSA 2WBLC 1JKJB 3WADA 1E2MA 1AZTA 2FUKA 1VRWA 3F3MA 2YOGA 5BMVB 1UK7A 4OHKA 3R3SA 1GPBA 2ZS8A 3BDIA 1LLQA 4LHEA 1RU3A 3A10A 5HJEA 4G0VA 3RTDA 4CODB 3GWGA 5EZYF 3L77A 4FZJA 5JD5A 4M9RA 3S99A 1I7LA 4XIJA 3MT7A 2BM0A 5GMOA 4OSEA 5HF8A 2XYQA 2CUNA 2ANBA 2ZJ2A 4WNCA 3IC5A 4B3CA 4EM6A 4K9LA 1Z07A 1WZCA 4OGLA 1Z2OX 1WW3A 5DWDA 2NUTA 1VGQA 4KWIA 2OCIA 5DZSA 3WLLA 4WZBE 3K3PA 3ZBQA 5BUCA 3RYCB 2BMEA 5D1HA 1N3YA 1XTSA 1UPBA 1B6SA 5K3FB 7GPBA 4LZJA 5FHQA 4X9XA 1ZVMA 4KR2A 3SE0A 1AQUA 2Z8XA 3SQDA 1X2BA 1Z13A 3D6HA 5BSWA 3BIFA 3OX1A 4JLBA 3RRMA 4PQEA 2I7DA 2YV1A 3KB2A 3TE7A 5C51B 4CV1A 4Z6KA 4IOJA 3C8HA 4UQLA 3ESCA 5H3HA 1Q11A 4KR9A 1Z6XA 4RTMA 2FSPA 4PRZA 3OI7A 3DBHA 3BDVA 4U02A 3R7WA 4NU6A 1N3IA 1IATA 4AW9A 1JDTA 1Q7RA 2CMGA 3QOWA 1V1MB 4WSOA 3KS9A 1QP8A 4P2BA 4ND8B 1R4ZA 2JJ1A 3ID6C 4I2VA 3UAZA 3EWNA 3OTIA 3F2IA 4DV4B 2ZFUA 3THYA 3D6TB 1NBMA 4W7IA 1ZVVA 4G5HA 2HJVA 3PA6A 5CH8A 2GDJA 4J0HA 1RYZA 3A1VA 2PLNA 1CJSA 1SFRA 4UMFA 4FYMA 5HF9A 4O4JA 3X1XA 4FYXA 1SUFA 2RHMA 3FMOB 3G7NA 4HVAA 3WMFA 5CFLA 4RK4A 2C9BA 3DMYA 3ILYA 1IEXA 2FZCA 4QEKA 3QE0A 1YS4A 1VGVA 2RAUA 4V0RA 1N1MA 1MX5A 2W71A 3LHKA 3OAAD 1NJ2A 1QWOA 2XECA 3HJHA 4WA8A 4OXNA 1ECCA 3EDRA 4I4TF 4L1KA 3L7CA 2WJHA 4M8LA 2HPVA 3DTNA 4FNGA 4I46A 2O50A 4D56A 3OIUA 2HIMA 3K05A 3AR3A 4EF4A 3II6X 4EGFA 2GO1A 4JLKA 1VSVA 1CQJA 3BCUA 1B26A 3FI0A 3MBOA 4V3BA 5CVEA 3TSCA 1K75A 5LPNA 1JF8A 3GH1A 4RL6A 1DMSA 3BWMA 1BCRB 3ND7A 2BKVA 3M6MD 1QG0A 4Y2XA 6REQA 5F7XA 2YVAA 3O74A 2CVQA 4JBLA 4FFNA 5IUKC 2I2BA 4BJ3A 3BMOA 2GEKA 3I5XA 1M0TA 3DE0X 4HLUC 2XRZA 4A10A 1ANKA 1EZ1A 4UTVA 4L4RA 2IXGA 3HI4A 4TQ9A 5G53C 4OATA 2ZBGA 4RWEA 3ZV5A 1YQQA 4F4UA 4EJFA 5ALPA 4UZSA 4GEGA 3W04A 1FQOA 3ONDA 4JEUA 3RUPA 3LMKA 4JOBA 1H9BA 3Q3IA 3SK0A 1WXIA 3DR5A 3N0XA 1P9WA 2IPXA 3T0GA 2I4RA 1B1CA 5G4KA 1R4MA 1RRMA 3P9ZA 3HCPA 4MPPA 1HMYA 4O0LA 5JNRA 5TY0A 2YHBA 3MJTA 4ZEXA 1TT7A 1XNQB 4HNGA 5KTNA 4NV1A 3CJQA 3LCMA 4NBLA 4YRPA 2QNIA 2CVFA 4V0OA 4B45A 3RV4A 2V7GA 2G67A 3OWOA 1K92A 2OEPA 3V46A 3I2FA 3U3ZA 4JJ6A 4Y6LA 2W2TA 3ESRA 3M5DA 4ZJPA 4XUCA 4RETA 2QTHA 3BD7A 5J4LA 1G19A 1N4DA 3GP5A 5G3ZA 2WHQA 2XXJA 4LQLA 4F4HA 3QHQA 2GCIA 4HWKA 4IVQA 3KUXA 4NCHA 5D84A 3ZZ1A 3G2HA 3PUHA 1IHOA 3DL7A 2L42A 4I1SA 4JL5A 1K5HA 1VHWA 1YR2A 2OHVA 4PPNA 4NENA 4AYTA 4DBLE 1H2YA 4BNGA 5B4VA 2QYOA 3NHMA 4IGAA 1WB6A 3CGWA 3GLKA 5KCMA 1L8QA 4TWBA 4Y6RA 4B48A 3F7MA 1NWCA 4NJEA 4YV7A 2QVCA 1TCVA 5C52B 3OT4A 5U9CA 1M6VB 2OUKA 2GYWA 3DYIA 5DI9A 1U2EA 3G85A 4XJVA 1HQDA 3C4JA 4ZVQA 1H3NA 3AERA 3EFHA 1KRWA 3ETDA 4BV9A 2O7QA 2PT9A 1V48A 2XDQB 3FTFA 1DAGA 1MC8A 1YVRA 2XNKA 5EP2A 3HCWA 2FUCA 2GZHA 4MMZB 3WKCA 3MT0A 3WGNA 5DRYA 3RSCA 5A6VA 3ESDA 3GD5A 3TIFA 1KI6A 2P78A 4HSGA 4BUZA 3V4RA 2Q9AA 5KMGB 1SHZA 1G6Q1 2EAUA 1AJEA 2QD1A 4LF7B 4XAQA 2GD0A 2I6QA 5JDIA 2ZR0A 3PEUA 1Z8HA 2Z1MA 4PTZA 1JIQA 1BW9B 3RKRA 5M3BA 2J31A 1A9SA 1I80A 2ZIAA 3HL0A 2DHQA 2HRCA 2RBKA 4XGIA 1ADBA 1J23A 1T15A 1BMDA 3LO8A 5JRJA 4ZAVA 5CEJA 1ZGGA 2BEWB 4UHFA 5EIFA 2NVUB 4XI9A 4NZNA 3TGWA 4AS1A 2QSYA 2HSDA 2W0MA 4QYSA 4OFZA 4G1BA 3JAKB 1KO8A 4I5FA 4CL2A 1S5PA 4OX9B 1WBBA 4JLAA 3CSUA 3REQB 1T3GA 3F78A 4ERXA 4R5MA 3JRNA 2CNLA 5AI4A 1YA6A 3CCBA 3U60B 2ZRNA 2HMAA 3QYFA 5A1TA 1PHRA 2B69A 1ZGHA 4A73A 4F93B 3AKYA 2JVKA 2VUHB 4JGBA 4PGAA 4AIIA 3WE7A 4QELA 1E89A 3KSBC 3PLNA 4MUKA 1TPYA 5K1ZA 1NF2A 3GVCA 3ZXUB 1X1DA 2JGDA 4OAQA 3HBNA 3ZOKA 3MYRA 4D9BA 2LIPA 5E4FA 1I3CA 1WXEA 2G9ZA 2Q0SA 1I3MA 4NLLA 1WABA 2P6PA 3D7SA 2XMZA 2WHYA 3AFHA 4UFPA 4EKEA 5AVVA 3EH1A 3VI4B 2C58A 3PQFA 1HT0A 4JWKA 2G1PA 1CHNA 2QF7A 4F71A 1SWVA 2HDOA 4B6SA 1VLHA 4XCQA 5FBWB 3AESB 1PJLA 2R3SA 3L8ZA 1QHNA 2I76A 2C7OA 4GX5A 1C3VA 3AXSA 4PM4A 1P81A 3R7DA 2HLDA 5FOVA 5KYWB 3ZE6A 3K1AA 1JKFA 4DC9A 1S0UA 5H9VA 3E48A 5JPIA 4YFYA 2QXYA 1GU7A 3H4VA 1T0BA 2XT6A 4G5QA 5JYDA 3M34A 2V3CC 4HADA 2PVCA 2ODWA 5DPMA 3VTFA 3CCCA 3D7RA 3LA8A 3OTHA 3K9FC 1LFAA 1DQSA 1E7RA 4RD4A 4XFKA 1KDTA 4PLGA 2NTEA 2X0EA 3TZCA 2JLZA 5AR1A 2RHCA 4DLXA 1IIRA 5FI1B 3CEHA 5TVKA 1ZU4A 1BYIA 1NPYA 2ATIA 4GXNA 3TWOA 4D43A 4ANFA 1YBHA 4P3PA 5K6AC 1H6AA 1II8B 5KWEA 4CQMD 3L4BA 3RIXA 2CJWB 2Q3FA 2F67A 2Y1FA 1GU1A 4MW6A 1DEAA 1S8NA 2XOEA 4G0ZA 2X8WA 2GFIA 3KR9A 5E6SB 4BAGA 1QRTA 2GFHA 4FQ7A 3SHWA 2ORWA 1JMKC 4N41A 4E2ZA 3AWDA 4UCXA 3OEHD 1CQXA 3A25A 3L6RA 4RLSA 3JVVA 3KJQA 3HVUA 3CPHA 4I1OA 4MW2A 4R8SA 3RFXA 2IZ1A 6CHYA 3HCNA 4A91A 2FLWA 3BN3A 4I4IA 4RTNA 1RFGE 1TK3A 1Z4OA 1HE3A 1KMMA 2WSSA 2O2XA 2UDPA 2PMCA 5DT9A 4UCWA 2J3DA 4ZWNA 3D3WB 4H3SA 1FP4A 1BDJA 1J4AA 4BNJA 1A0OA 2DT8A 1ND5A 3C7AA 3FFTA 1QS0A 3PFCA 2YXBA 2J3KA 3EXHC 2GXQA 4EO4A 4ROSA 2O8FA 3PUXA 3LX4A 1A97A 3UWMA 3G02A 1M66A 5G3YA 4BX0A 3NDJA 4FFMA 1VBNA 3AB7A 3DCNA 5DTMA 1SIOA 3EQ7A 5BXQC 1GG9A 3HB9A 3ROEA 1SBCA 1C50A 1G8FA 2PRZA 3D6VA 4L85A 4ZOLA 4IL5A 4DCPA 1BQ4A 3AETB 1JYFA 1DOAA 1GTL1 3V9AA 3KOZA 4KQCA 3CW8X 4ERNA 4OXIA 3A6JA 2LD4A 2JC3A 4OI4A 3ZE1B 3C7DB 1KP9A 4R84A 3QE4A 2VBIA 3MUEA 5A9TA 4UVHA 5KOYA 1OQAA 1A8SA 2Q1XA 4MH0R 1R16A 1WF6A 2BWJA 1OPRA 3OKFA 2V5AA 5ALGA 1PNOA 3HKBB 1D07A 1UBLS 3MT8A 4LC9A 3K6KA 3T1NA 2J7PD 3NDPA 2NO1A 5JMPA 2KM1A 3RYIA 4C3OB 4QGAA 3FF4A 4G25A 4TVBA 1YAHA 2VBCA 3D7NA 3ZEAA 4DC1A 3PP8A 2P9YA 1KEPA 4GRDA 1XNGA 4DSOA 1AQJA 1NXOA 2RGDA 4F5YA 4UVDA 2R7NA 2GVZC 4I14A 3V4SA 2E4AA 1U7UA 2PXCA 1U7HA 2WJ4A 3QE3A 2O2DA 3KQVA 4X3OA 2BSQA 4Z4EA 1QQ6A 5EOVA 5DNYB 1M33A 5LP6A 1JFTA 2AKAB 1VJ0A 3D02A 3ERCA 3FOAA 1JRLA 1KVUA 3PYLA 3MSCA 4GLJA 3AHFA 5KOJB 2QYHA 2YS7A 1FPMA 1KQPA 3TB6A 3ZQ4A 3EUEA 4IJMA 3QENA 4LWQA 3E2MA 3QTTA 3TINA 2Y4NA 3W3AD 3E9DA 1W9HA 4AJ4A 3QX7A 2GTPA 3BE5A 3ENNA 2IY9A 3PPXA 3U3KA 4BC1A 2YRXA 3K2EA 3LSTA 4TYYA 2H11A 1E2NA 4M89A 4QYIB 4W8OA 1G41A 1C1DA 4N47A 1M6WA 1CP3A 2X9QA 2IODA 2MOKA 2VDMB 1H65A 2KHZA 2C03A 3V7NA 5HKAA 4D9HA 4HFMA 1U5BA 1GUDA 3RIGA 3D6UA 1MJNA 1U8YA 4YCJA 3A11A 3KQUA 2ZBPA 4A2WA 1U0EA 3PD1A 4Q05A 4EY6A 4PHGA 1M7HA 2PIDA 4YGXB 1XRNA 3C1OA 4YT8A 1RDFA 3CZCA 3QKIA 2LDBA 2Z83A 4OYYA 5EQFA 2N3ZA 2I3GA 1QRAA 4LGYA 5CXSA 2CHFA 2BL4A 2C2HA 1B0AA 3ESYA 3K6JA 1CUAA 4EKYA 3HNRA 1BVRA 2CK3D 2FF5A 2I99A 2X41A 2GZAA 2JGMA 2H5JA 3C3DA 2X7HA 4F0JA 1SCIA 2W4MA 4QXRA 4H1TA 3UT5B 3NYWA 4LSWA 3T34A 2OR3A 5CA0F 1Z38A 4B34A 1JR6A 2I4LA 5CNIA 3I3OA 5AHXA 4ARAA 4N03A 3RS0A 4IGKA 2X5KO 1MXHA 3U7QB 5ED4A 4URXR 2CMFA 4P7KA 3ESXA 1UM8A 3HVKA 1K3TA 2ZR8A 1PZXA 3TG2A 3FPSA 1RJWA 1C14A 3DT8A 4B6JA 1H0SA 2Y0EA 4YAKA 2C98A 4LS3A 4JHXA 2AG1A 4R98A 1TCUA 3PQ7A 3T7JA 4NBNA 1V16B 2VDVE 4W1SA 4MV5A 1AN0A 2UZIR 3C7TA 5CEFA 1XCJA 2MSKA 2Y1XA 4XD7A 3HR7A 3FBGA 4ML3A 2Z2YA 3HH8A 3TTWA 2HDHA 1PGNA 1KYXA 1L7PA 1VHTA 3EGXB 1L4NA 3N2YA 2CXSA 3R0IA 4TMVA 4WHMA 2X1MA 3U3MA 3V2UA 4WXYB 3GXOA 1NR7A 4JIGA 2WG1A 3DV2A 4JIMA 1L7QA 1FDIA 5F9FA 4K46A 1DT3A 4B74A 3VV2A 4HPWA 1W4BA 3GRPA 3WTBA 1V6AA 3GLIA 3GI1A 4GAEA 1KU6A 1SD1A 2EKPA 4K7JA 2WHRA 4K86A 4WCVA 5ALHA 5EHQA 3EIFA 3RTGA 3W5DA 2EGHA 3NR2A 4ZYXA 5AUQA 1Z7GA 3TL6A 1USIA 2HMYB 5L9AA 3K6RA 3SLGA 4Z3OA 3PC2A 3D9QX 3C39A 1TAUA 2QM0A 3W5IA 1UOOA 1LC3A 4LEIA 1LSUA 1SK8A 3IESA 2GJAA 2QVXX 4WVLA 5CT6A 3V33A 2AOXA 4C1NA 1CP2A 1OFGA 1SQGA 4ZAZA 4J91A 2V6IA 3WGZA 2W6NA 1YRHA 1UBEA 4QOGA 1NQUA 2PS3A 2XE7A 2F3PA 2Y05A 4IF4A 3H5WA 1PZMA 5DK4A 4QTYA 3LFHA 2YMQA 4D97A 1NUHA 3LDGA 5IT0A 1UFOA 4MHTA 2IOFK 1WOYA 1KI7A 1WG8A 5FA8A 4YJHA 4G4GA 4KSYA 4MJXA 2AZMA 4NEQA 5JVDF 3KBBA 5DLEA 3WQHA 1A9QA 4C4AA 1VBMA 3HYSA 4KAFA 5EVCA 3ZXXA 5BYKA 2NU9A 4WKPA 4D6PA 2YCLA 4IW3B 5GWXA 2XNHA 4N5DA 4W82A 3OA2A 1NUQA 2J3HA 5ARDA 3USZA 2CY0A 5EQJB 3WRYA 3H1EA 2ACVA 4BO1A 2QRLA 2IQIA 4JUIA 4BP3A 3Q12A 2E2WA 5CB6A 2NTNA 4L9RA 1M1YB 3VPFA 2OV4A 1ADCA 4QULA 1XWWA 4U39A 4XFJA 2X5NA 5FA6A 3U31A 3DBIA 2O0JA 2ATCA 3PDIA 2R6HA 1ODJA 4DMMA 3DQPA 3HWSA 1IIBA 2ODPA 3I6IA 3IRVA 1UEIA 4Z1MD 2DULA 2YHAA 5FPYA 1DWQA 1YB7A 2QGNA 3JALA 4LFAB 4F9GA 5EIOA 4C4PA 2FPKA 5FPHA 1X0XA 3OJOA 2JGRA 1HZJA 2ECQA 1Z2DA 1I4LD 3HA3A 2E85A 4TLBA 4X20B 4CM4A 3EPKA 1GJRA 4PZLA 2C77A 5F76A 1TTPB 2HQBA 3GAMA 2H63A 3GXBA 4HCJA 1WHSA 3WLMA 4BZXA 4E4TA 4L6IA 5AQ1A 2QM8A 3ESZA 2V1UA 1ZRSA 3TUIC 3B2NA 3H1GA 5IDXA 4ZO4A 3GF4A 2VQEB 1S9HA 1P5ZB 2OGZA 4I19A 4HVTA 4C4XA 3V8VA 3GLGA 3VNUA 4BFUA 2FG6C 3M4ZA 4I9FA 1HG0A 4AQ7A 4Q1VA 3BH0A 5A3QA 1K6JA 2VJBA 3BG5A 3ADCA 4RF3A 3IAM1 3KEMA 2CXPA 1JG4A 2P1ZA 3JQAA 5D7NA 2J1LA 1N2OA 1ZINA 2DTDA 2GM4A 1IVYA 1LFDB 2BLNA 2YKGA 3OSZA 5GINE 3MA0A 2IITA 3FPHA 5IYZA 3WAGA 1GA4A 2AEEA 3B2QA 4P0TA 4EQ6B 5COAA 4J0JA 2Z1DA 2NO4A 5LZ7A 2OYSA 1E6WA 1EQ2A 5KKNB 2CV1A 4BEWA 2ETXA 2W37A 1N9GA 5A06A 2YHIB 1BTOA 4CKEB 3G5TA 1KO4A 2I78A 2ZYUX 1Q14A 4A82A 4GEKA 3F4KA 4L0MA 5J4KA 3W5CA 3H9BA 1GYRA 2JD0A 1CRQA 3FIUA 2HU7A 3BB1A 2ZKIA 4PZPA 2O52A 3RYHB 3I6MA 1FYFA 1BEUB 3HBMA 3LKBA 3H0CA 5AM3A 2YNMA 1BWSA 3B1VA 3ITDA 4G9GA 1E9RA 1PVVA 2B3DA 1NW8A 2C2YA 2JASA 4LJ8A 5IVDA 4COKA 4FSDA 5E2AA 1N8TA 1N6RA 1HUQA 3TDMA 3L79A 3G2LA 5FBHA 2NP6A 1QVRA 2LKDA 2PKXA 4CIWA 4MICA 5KVAA 5KIAA 2VDPB 3AVWA 4LRXA 4CL3A 3V3KA 3FSJX 1NQ5A 4YQZA 3Q6NA 1Y7LA 3H5TA 1HYHA 1F2TA 4OB6A 3L93A 3FPJA 1KYWA 5EIHA 3VR5D 3P52A 3OIGA 4KQ2A 1NGSA 4CIVA 3C6BA 3W8EA 2LWIA 3D4IA 1SRRA 5JY6A 5AKHA 4OHFA 1D1PA 4WNYA 3P9NA 4MO9A 2EFHB 3R8CA 3VRHA 5C5EA 5EP3A 4ZJZA 4GFDA 3DBLB 1NVTA 3MCVA 4L4YA 4E15A 4RLFA 1RQNA 1J9ZA 1OT3A 4RZHA 4BMYA 4E07A 1QCCA 2OTCA 3UCFA 4MQ6A 2WTMA 4KE8A 3DMTC 1MB3A 5DYGA 2AFIE 4BGEA 2JCVA 2I2FA 2X3FA 4DF3A 2CNOA 4IIXA 4M2LA 4UTOA 2MWMA 3LPAA 5FULA 2WD7B 5FWNA 4BCBA 4XPIB 5JD3A 1I32A 4Z8YA 2H2IA 4C1BA 4RTKA 1NLFA 5DJ5A 4W8HA 5BSFA 3D5QA 1IN7A 3L7OA 4ZZ2A 2R48A 3U19A 1DE0A 2QWXA 5EWMB 2JFXA 3U4QB 3VR3A 1QTQA 2JI7A 5KNCH 4JXZA 2XGSA 3TDNA 4MYRA 4P32A 1XD9A 4PNZA 1BIFA 2WJJA 3L06A 1OLSB 2IOYA 4LIPD 4TYMA 3WYEA 4DLYA 3T0FA 2FX3A 1DCKA 3T7EA 3WO0A 4JP5A 4EL5A 5CXUA 4FR0A 1UPXA 2HU8A 4Q4JA 4R8LA 3ZJUA 1VCOA 1Z56C 1BZYA 2XWJI 1EFPB 3ZTYA 1K7CA 5FPTA 2I71A 1K5GA 2TSYB 2I03A 5DSTA 5KDDA 2G08A 5MDHA 1RHKA 4OXXA 5D51S 1DRKA 4NICA 5JZBA 1NJSA 4J0CA 4TRMA 1ZOPA 4YRBA 2V7VA 2XWBF 3WGIA 5L45A 3R3YA 4FHZA 3FSRA 1JDZA 1YS9A 3AVPA 4RNCA 1GGEA 4MV7A 4RJKA 1KYTA 3OUTA 2WOJA 1C30B 3AB8A 2F8LA 5CHYA 2A1TS 5FL7D 1L9KA 3MHTA 1WX1A 2HCTA 1CUUA 2YINC 2Q1TA 4B76A 1TADA 1NASA 2RHHA 3VOSA 2QTBA 2XEDA 1E5XA 2G0TA 5DCWA 5GJBA 1FLDA 3D4OA 4NCJA 1G21A 3JRXA 5HRAA 3H4MA 3N39C 1SZCA 3R0XA 2EL9A 1O6FA 3IQFA 4H08A 1E6LA 1SA0B 4LDQA 2FMTA 2MINB 2PZAA 3ESBA 3H7IA 2WIAA 3GFFA 1H3EA 4W8GA 4XWAA 2D3TA 3MUNA 4BN5A 4PQGA 3QVWA 2GWRA 4Z3KA 2P4UA 4R9NA 2XSZD 4KBFA 4Q66C 5M29A 3HKDA 5HFNA 1CS0B 5H80A 2GEBA 3LT0A 4RE5A 1JN0A 4OIFA 4C6TB 2QN7A 2ZI6A 1X6VA 3URKA 2VSFA 4CCWA 4NZPA 3N59A 1CJKC 2P6MA 2R86A 2Y1GA 1W5FA 5F23A 5ULLA 2I6GA 2I1LA 3C6QA 5KOHA 3ZDDA 2V96A 1CK4A 1LDGA 1IM5A 1NN3A 4C07A 1PQUA 2NWQA 2ONZA 3H84A 2CFOA 2WAAA 5I7FA 1SXQA 1ZZEA 2VPQA 3COWA 3QW4B 1OKKD 5JYCA 1YF3A 4JP2A 3M6WA 4DMLA 2PU5A 2E37A 1IZ9A 4IIJB 3PHHA 1ZN2A 3Q6MA 4NCXA 1R6TA 3ZQ6A 2CFIA 4WWHA 2WB4A 3V2HA 4KK4A 3JW8A 4A8JB 2AR0A 2N0SA 2GJ9A 3IAM6 3LVRE 3PX3A 4Q1EA 2QRKA 4WOCA 2H48A 3VJLA 2I9PA 4W9NC 2PZJA 4G0UA 4GMFA 1JAXA 3DE1X 3QELB 3IAUA 2QTCA 3ICCA 1WXWA 2K7FA 1I2CA 5C1IA 3LC7O 3M2TA 1QFJA 5IU6A 1ZU5A 2JS7A 2P9GA 4M0FA 4DREA 4OUKX 3GGPA 1JNXX 2OL4A 4ESOA 1JEYA 3MGBA 2BGMA 4MQEA 3FLBA 4NBTA 4QAJA 3GU3A 1U1EA 5I5GA 4IDOA 1HWYA 1QVAA 3IAAA 2ADOA 4MZXA 5CYPA 3L7LA 5HVNA 2IDZA 1E1RD 3SHFA 1QH8B 3R4VA 3AM5A 4K3UA 4EA8A 3EPLA 2EZUA 1ZM2A 3PHCA 1UMKA 4V0SA 1GZ5A 4TRRA 1FYWA 3V2IA 2XKKA 1DIHA 4MV3A 4NNPA 3SICE 4EPVA 4LHZA 3IEIA 1UK8A 4O4LA 3RR2A 3TQFA 2R44A 1SO8A 3QF4B 1LPMA 1YB2A 4X66B 4UNIA 5THKA 2GRAA 1PV2A 3QWBA 5LZ8A 5J2UF 3CX7A 1HXHA 2FMXA 2RG7A 2YWRA 3KYJB 4NCIA 3ZHCA 1M6HA 3TECE 2AFRA 3COJA 3WLHA 1ZVKA 1FZQA 3R5TA 2QD4A 1GKUB 1K8YB 4PPGA 4A36A 1UXHA 3IHTA 2DSTA 4Q24A 2PBRA 5LBIA 2VTDA 3ONWA 3OQIB 1LB1B 1AF4A 4BXOB 1A1VA 4FMCB 5C46F 2OBXA 5DCLA 3SC2B 1JQ5A 2YJ5A 3DOUA 2DFPA 5T6MA 2VRCD 4ZI7A 3R9WA 2E4WA 2X4IA 3K20A 3ORFA 1V8DA 1Z3CA 1PWZA 2IUTA 4U7GA 2IV7A 3WDMA 1WVGA 2ZUCA 1KYQA 2ZCJA 4LMBA 5JCXA 1NLUA 5IPFA 3HWWA 3ZLJA 1F1JA 1GA1A 1KAQA 3PEVA 1JHXA 3T9CA 3G8YA 1J8YF 1JSRA 4U4AA 5KYVA 1T5HX 2VOEA 2WJYA 3A9VA 5A03A 4UNNA 1I6WA 4GGPA 5JEEA 4ND1A 3V4PB 3IR6A 2OGWA 3PFWO 1P3DA 1LV7A 4MV9A 4OTZA 2XXBA 4D3YA 3FFBA 4A26A 1YOBA 2HF7A 3VC2A 2F55A 1PCXA 1UOQA 3AVTA 3SXJA 4BMVA 2W8BA 3DLCA 1B0PA 4LGMA 2VHXA 5DX0A 1U3DA 1F7UA 2YOHA 3RJMA 4WDRA 2Q0XA 2FZVA 5KVCA 3DAFA 1E1MA 2FVYA 3GWZA 3UMVA 2P62A 3ZTWA 2KE5A 4P4GA 1CR2A 4CM6A 2V7QA 2VXOA 2YV3A 2ISSD 5AKZA 5GPBA 5KYYA 5JHHB 1BKYA 3FNQA 2Q2NA 3RFFA 5L3SA 4LCJA 1UAYA 1YS2X 3PWSA 5A2QA 2FP3A 2I7XA 4XQCA 4KNYA 2H0RA 2OHIA 4EJSC 4IHKA 1HDRA 3G9XA 4G0OA 1HURA 2LP4Y 4WASA 1KVQA 1GRCA 2CT8A 4MEBA 5LBTA 1O8BA 1U99A 3ZVKA 3HXTA 4Y2YA 1RZVA 3EARA 3KVYA 4AX8A 2O6LA 3PWZA 2FPXA 4DIDA 3AEKB 1ZCFA 1E0AA 1EEHA 2Y71A 3NCHA 5AUNB 4AQYB 1PEDA 4KMRA 4LYJA 4MVWA 3ZGLA 3LW7A 4YUAA 1D2NA 5TQ2A 4O08A 4BRZA 4LOAA 5KYXB 3QBJA 4HAOA 2CUTA 1UKZA 1ZM7A 1NFFA 2Q1WA 3W6OA 3EDCA 3AFMA 1MB4A 3TTSA 4ZICA 2FXVA 4FD2A 1MJ5A 1FDUA 1DKLA 5KTKA 3UAVA 1YQTA 4WE3A 5AVWA 1JLSA 1RT9A 1CBUA 1L5SA 2HW8A 1OGIA 1M54A 5FP0A 2FZLA 2OOSA 2NO7A 1JAZA 1K6MA 2HY7A 4P36A 4CLHA 1L7OA 3BGDA 3G3EA 3BL8A 2FW0A 4LYAA 4ONEA 3VR4H 1AS3A 1DFGA 1O77A 2VHCA 1EIWA 2PCLA 4OH7A 1MLDA 1X70A 4JR2A 4E3ZA 2PZ8A 3N0VA 4HDRB 5IJ9A 3A9UA 2C2GA 5EJIA 4C21A 2EJWA 5ADVA 1ONOA 3LPLA 1KTVA 4FT2A 4BS9A 1EUDA 1AKTA 4P4LA 5KQSA 1XU4A 2WA1A 1NKTA 2WMYA 2ZRAA