1BZYA

Human hgprtase with transition state inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
214
structure length
214
Chain Sequence
SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A structure of human hypoxanthine-guanine phosphoribosyltransferase in complex with a transition-state analog inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphoribosyltransferase
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
total genus 70
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 1998-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bzyA00
2JBHA 1V9SA 3EFHA 5K51A 1HMPA 1TC1A 4RANA 2GEBA 5BQPA 4IJQA 1VSTA 3G6WA 4RV4A 4P86A 4RABA 4F8EA 1MZVA 1G2PA 4RHXA 1JLRA 1WD5A 1U9YA 2H07A 1Y0BA 3MBIA 2DY0A 4P82A 1A95A 1XZNA 4P83A 1O5OA 2JKYA 3GEPA 1L1RA 4QRIA 4RACA 1U9ZA 1UFRA 4PFQA 5KAMA 4RQBA 2PRZA 1L1QA 1XTVA 3ACDA 2YZKA 1OROA 4M0UA 1A4XA 5KAPA 4P3KA 4OHCA 1I0LA 2H06A 3DMPA 1GRVA 1A98A 5ESXA 1A96A 3NAGA 4RADA 5BSKA 1OPRA 5EUCA 1ECGA 2PS1A 1STOA 1ECFA 1IBSA 1YFZA 4RHUA 5HKLA 4TWBA 1VDMA 2P1ZA 1NONA 4KN6A 1JLSA 1ZN8A 1P17A 1QK4A 1XTUA 3O7MA 4ZFNA 1P18A 1ZN7A 4LZNA 4Z1OA 2FXVA 2PRYA 1BD4A 1LH0A 4P80A 4RHTA 3QW4B 2EHJA 1P4AA 5IPFA 1O57A 1G9TA 2H08A 3GGJA 4RAOA 4JITA 1AO0A 3ACBA 1TC2A 4X44A 1CJBA 4S2UA 3OZFA 1QB8A 4LYGA 1R3UA 4P84A 5ESWA 4LZAA 3OZGA 4MB6A 1XTTA 2E55A 4QYIB 1DQPA 4JLSA 2XBUA 1BD3A 1ECJA 1I0IA 2C4KA 5IAOA 4M0PA 3OHPA 3HVUA 3KB8A 4X45A 5BRNA 4P81A 1J7JA 3DEZA 1A3CA 5JSQA 5HIAA 1UPFA 3ACCA 2JI4A 3M3HA 1Z7GA 1ZN9A 4LZOA 2VFAA 3N2LA 1GPH1 1PZMA 4RAQA 5E38A 3DAHA 1I14A 1QB7A 1XZ8A 2AEEA 1W30A 1I13A 1ECCA 2WNSA 4M0KA 4WN3A 1QCDA 4FYMA 1FSGA 1A97A 1DBRA 3LRTA 3S5JA 4RQAA 1HGXA 3MJDA 1D6NA 1DQNA 3GGCA 3H83A 4QYIA 4WMLA 1I5EA 5BQOA 1NULA 1DKUA 1QK5A 1G9SA 3LPNA 1VCHA 5JV5A 4PAWA 1DKRA 1OREA 4RHYA 2JKZA 2HCRA 1BZYA 4LYYA 1P19A 1QK3A 1G2QA 2IGBA 1ECBA 1QCCA 1UPUA
chains in the Genus database with same CATH superfamily
4OHMA 5CDFA 2PX8A 3D7MA 3DWEX 2OXIA 1BJKA 1E5VA 1VYUA 1B23P 1DQSA 5GZ1A 3NB0A 2X40A 3OQIB 2RKWA 1KVSA 4N1AA 5E1OA 1XYYA 2WZQA 3AKCA 4HXYA 4CGZA 4AKIA 2SKCA 3VA7A 3T3NA 5J4KA 1HZZC 1UC5B 5TE9A 1NF3A 3WRYA 4DM7A 2GD1O 1HK7A 1R9JA 2OY0A 3RVJA 3VTAA 3FCUB 2WHXA 2VHUA 1RIIA 3F73A 2NSDA 3MN1A 3RVSA 2DT5A 4EK9A 4YT2A 4Z7JA 1KFJB 2QLLA 1M6VB 2NZYA 2RGDA 3LQFA 1K06A 1KMMA 1B26A 2I34A 1FMCA 2J9GA 3PA8A 1MJ5A 1XMXA 4HX2A 3T3DA 1QO0A 3F46A 3TZHA 4E1VA 1Z39A 3D02A 3FRIA 1J8VA 2GZ1A 2YZ2A 3LQ2A 4U8GA 1RWKA 2B1GA 2PFSA 1YJBA 2B78A 2J3HA 5FOUA 3RTDA 1AS2A 1YB2A 1YWGO 3V8NA 1DHRA 5K0EA 3Q3JB 1J49A 4ZO9A 4QQ8A 1BX0A 3T7JA 4GR4A 3ADCA 1OX4A 1P2DA 4PGFA 3A6ZA 3FGNA 3KB1A 4EYEA 2H06A 2GRUA 1Z83A 2XWQA 2QE6A 1YZUA 3SKYA 3TNDA 1I5OA 5LZ4A 3KUXA 2ZCVA 4FNGA 2OC9A 4JKYA 4EB0A 4O4LA 5E1MA 1Q15A 1I6WA 4Q3KA 2D0OB 4O0MA 2CB9A 2QGFA 2ZR7A 4ISCA 1M1YA 1A2BA 1HNWB 1C3LA 2PH3A 2GI4A 1Z0ZA 5JWOA 4HDKA 1ORRA 1I4TD 4PFSA 3BKXA 4NBRA 3S0JA 4AG6A 4LCJA 4DCNA 4EW3A 2O3QA 4Y6SA 4WNAB 3OO0A 1NY5A 5CW2A 3WK6A 5I7WA 5JXHA 1J56A 3KT3A 4OBXA 3W2FA 5TMEA 1ULZA 1ZXLA 4UREA 4OUDB 5JS6A 2G7MC 3AJ8A 3U16A 3EUWA 4XFKA 4POOA 3RWOA 2NOAA 2WV7A 2PX4A 1CZNA 1XFAA 2CDCA 4YRGA 5HM8A 1ONNA 4XJSA 1IM2A 2DRIA 2EC5A 5ALUA 4KQFA 4OM8A 1D2RA 4TMWA 5EQJB 4LFAB 1PQ4A 4QGHA 2BY4A 4D5EA 4PWYA 2Q27A 2XT0A 4KP7A 4TWIA 1KQFA 5ALLA 3BMQB 3L7DA 1JYFA 5CVDA 1D09A 1YZVA 2GJ4A 1P81A 4RY0A 1DAIA 1EUZA 2CVHA 1LLDA 2I8LA 2VUIB 1Y7HA 1SU4A 1DLJA 3CC8A 3HJUA 3JU3A 3KXIA 2IE8A 3L0DA 3NX4A 2A86A 3OLCX 1CIPA 1SZCA 2HWWA 4WUVA 2HK8A 1CDZA 1GPKA 1T0IA 3HXQA 5EHGA 4CLRA 4FB4A 1XTJA 3PTAA 1OVGA 3CUVA 2AEEA 4INPA 3N76A 4F1JA 4YIKA 5DYIA 1MO4A 3A9UA 3JD2A 4UC0A 3IQXA 1F2TB 3PLRA 3I2IA 3CEMA 3I01M 2OHHA 4YJ3B 5MFPA 3D0RA 9ATCA 2Z8YM 4PNHA 3PSAA 3CVJA 3KDPA 3DBOB 3PIIA 4EL5A 1K5HA 2OLJA 2C5HA 2JDIA 2P6PA 3N7UA 4XVRA 3C4JA 2ZU6A 3MTBA 5DM1A 2AZDA 3L0ZA 4B7ZA 2ZJ6A 3FFXA 4MQLA 2WOJA 4N01A 5KOHB 1PQYA 4FYWA 1GKIA 3D0OA 4FXOA 1S3GA 3LAWA 5GONF 2R6JA 3AEQB 4LVOA 1C3VA 5I48A 4MYCA 2N9UA 2OD9A 3JQ8A 1FTWA 1ZH6A 4WOCA 3T3HA 3LA8A 2RI0A 2P69A 1G42A 1K3FA 2WU1A 1QF9A 1TYCA 4J0QA 4XX0A 3ZWAA 3S1LA 3R76A 6LDHA 1QO0D 2R5NA 3I4CA 2VYNA 4NBVA 4RD0A 4DG9A 2L2QA 5KNCD 5C37A 1QYWA 1APBA 4Q3OA 2O3RA 4P34A 1BCSA 2CF6A 1D2MA 2DFVA 4JI3B 4MQEA 1R5JA 3BRWA 2AN4A 3MAGA 3NIWA 2OZPA 4KXFB 1NN1A 4OP3A 3I1JA 5DOZA 3OBBA 4F45A 2C7QA 2XXAB 5KI6A 1IUNA 2EGHA 4L78A 2WYHA 2YXLA 3C6ZA 2HA5A 4C89A 2V1UA 1U6JA 3UJCA 4EM6A 4DYVA 1EHIA 2OWEA 4GSYA 5DO9A 3FH0A 5DMHA 5A7HA 1JHDA 4GMKA 3VYUB 3WLSA 5TS3A 3HVKA 2X0EA 1FYFA 3VVBA 1EK2A 3EGDA 3K8OE 1TT7A 1IE3A 1U65A 3AERA 4LBYA 5DGHA 3MILA 1DS6A 2J41A 1MAAA 4P0TA 4DCSA 1VHWA 3LW8A 3RUIA 1KP2A 4WTOA 3AQ4A 2YJ6A 2JK1A 3HCWA 3KZKA 3FUCA 3ZN2A 4BFYA 6CHYA 1GZ6A 1GZSA 1YZTA 4W7SA 5GWXA 5I7UA 4RZHA 1W4LA 2IU0A 1QS0B 1V5GA 2PKRA 3STVA 4FHEA 1MGOA 4IRXA 5IAJA 5KYUA 5H8WA 4H6VA 5C8YF 1FLVA 4FSHA 2ZXUA 1ZWLA 1K5PA 1Q14A 1OLUA 2XMDA 4OSOA 4U3JA 5LP6C 4QGFA 4ESEA 1GXSA 2H11A 2OB2A 3QFCA 1PL7A 1XPUA 1NOIA 3N58A 4XDHA 4BY9E 1J2TA 3CN7A 3W8NA 3WSWA 4D4MA 1AOXA 4IUCS 1SELA 5ISMA 2M6SA 1H3EA 1MENA 2JLUA 4RIEA 4LYGA 4M53A 1SKBA 3AH8A 2XXJA 1M74A 1DC8A 1OFIA 4HCJA 4QHYA 5AXDA 3VJLA 3TUIC 5JZVA 2QKYA 1XTTA 2CNBA 1RJDA 1HL3A 1SVIA 3ZYZA 3SJZA 3PICA 4H7FA 5P21A 2XJ9A 3IAXA 5HKAA 3G8CA 2QEQA 3HCFA 4FPXA 2ROQA 3DPSA 1X7XA 2IOQA 2WUFA 3K6RA 2FRXA 4J3NA 1EXVA 4DNOA 1A3CA 3BH7A 3A7DA 5DBIA 1PG0A 5BN4A 2IYYA 1AQYA 1OAOC 3FTPA 1MOPA 3NBQA 1LV7A 2IHJA 2J3LA 4QDOA 4ZEMA 4HWRA 4GWKA 2NU9B 1PCXA 5EJEA 2X2PA 3PDCA 4M8SA 3H5RA 2F3TA 1HNZB 2VYVA 2Z5FA 4BJ3A 1B2LA 4G1MB 4ZPJA 4ECEA 1X7XB 3OZEA 1JW9B 2C3YA 2FEXA 3UMCA 4GWGA 5ENVA 1ZVMA 1TJPB 4TUYA 4Z3KA 2EBFX 1KI6B 3ONNA 4O2AF 5IJWA 2IS6A 3CUYA 3AT1A 4KXMA 4DTCA 4EHAA 1X7ZA 4MCIA 3BXZA 2P41A 2YCBA 1XWIA 3WSTA 4INOA 3TQQA 3A1NA 5C8XA 1QWOA 1J20A 3A27A 1Z6AA 5FBVB 2P3LA 1OZFA 2PK3A 3LHDA 3LOPA 2GTPA 4D98A 5AK6A 3OPQA 1AKQA 4L5AA 1H69A 2XUJA 1FK8A 3QJYA 3SR0A 5BWLA 2AYXA 2YWGA 3LNCA 2EBUA 1GZ5A 1RQPA 2CFOA 3L4EA 2FPGB 3D2LA 4IIJF 1V1JA 4L15A 4QQKA 5LR6A 3ZWVA 1OFHA 1CHDA 2B4RO 2DQ4A 1YUNA 2XRMA 2DX7A 1G6Q1 4PGMA 3O1IC 1I5RA 4D4JA 1BMDA 1VHLA 5JZBA 3L7IA 5CVEA 1FDIA 3EDRA 3FNRA 1DAGA 1EWTA 2IYLD 2PRIA 3I04M 3IV7A 1NVKA 4LXQA 4BQSA 2ZLBA 1QHSA 1CHNA 4IIDA 4R9NA 4UPVA 3F5FA 3M9XA 3IPRA 2EIXA 1WOYA 1EK5A 3BWXA 4XEUA 3ESAA 3GLGA 3MMSA 2P5YA 2PZLA 5AJWA 2A4KA 4U4AA 2BFFB 4AJJA 4BKUA 4F9GA 4F2DA 4X64B 1HEUA 5IAKA 3K0KA 1Q84A 5JECA 2WIKA 1AY0A 4JCOA 2O07A 3AOGA 2HSZA 1XA3A 1A4XA 2PGXA 3TQFA 3WYNA 3SZUA 4HWGA 5FLKA 5LA6A 3OQOA 4KHPB 3DOFA 2W6IA 4QAQA 3B20A 4WERA 2W22A 1LTHR 1IQ0A 3GNLA 4BLSA 1XCLA 4BUCA 1Z18A 3JRNA 4GL4A 5DPMA 2BGRA 4KK3A 1A9TA 3FWKA 3KLNA 1YS9A 2O8CB 1X2BA 2YBDA 4TWBA 4Y6LA 3WIVA 3WFZA 1N2XA 3ICQB 2BHNA 1JJAA 1U7ZA 1D5WA 4JCCA 4IXTA 2KJQA 3VR5A 2ZJAA 3L8DA 4TUYF 5J2UB 1Y5LA 5LBUA 4FOPA 3G5LA 4B7UA 1TMGE 2IW3A 1LK5A 3ZV5A 2ONJA 4QQRA 1KJQA 1TYEB 4KO1S 2RHDA 1ZAYA 3O91A 2B8WA 1WEHA 5EY5B 1ZRNA 4C1NA 2OZKA 2GAOA 5FPPA 4E22A 1XV5A 3DE2X 4MVJA 5D5QA 4CM8B 3ZK7A 5BV7A 1SG6A 1OV4A 4XVHA 4CKWB 4UZSA 1C9YA 1NNLA 4UHHA 5EE5B 3UPTA 4CV0A 1M5TA 4QQFA 3LA6A 2HBYA 4KK4A 1E0JA 5FORA 4EYSA 4BNHA 3TLYA 3FN4A 4MW4A 1VSVA 4HPJB 1HOXA 2NPOA 4JLSA 4FZ3A 2N75A 1CY4A 1HDYA 4HN2A 5PGMA 4OOFA 3NOQA 3KB8A 5TPZA 1GG8A 1ZXBA 1CZKA 3OJCA 2X3YA 1G8MA 3PC7A 3E58A 1VBKA 5C8YB 2ZJOA 3D59A 4BYGA 1WWKA 2HUNA 1JMKC 5FADA 4AF7A 1WLSA 1D1PA 4BB0A 2B1JA 3H84A 1LBQA 1WABA 4PIPA 1AUOA 4KGVA 4WKCA 3SS7X 4U5XA 1DBRA 1U7TA 4JYCA 3RC1A 3ASUA 1D2NA 4JLDA 3TL6A 1PUJA 4NDNE 3EIWA 3OT1B 2RBEA 3NWJA 1FNMA 1JEYB 3HBAA 3NDRA 1E3MA 1NR1A 1Z5GA 5IDQA 2E48A 1GITA 1VMKA 4PAWA 4YR7A 3FYTA 1P8AA 1RBYA 4FIZA 2NSYA 4H3HB 2OENG 4XIIA 3JARB 4KQXA 3KXPA 4C43A 3N75A 5K6RA 3NU1A 3L6EA 3T4XA 1WB9A 2Y1FA 3G6WA 5CA0A 1H65A 2QRLA 4YRZA 1TC1A 2PNFA 2PDAA 3CUUA 3OX4A 4EPRA 2UZ3A 3UG6A 3R3VA 3PS9A 3D54D 3UHPA 5F4ZA 5EJ6A 4HH0A 1GEEA 5CEJA 1H9AA 4OJYA 4GKKB 2Q1XA 3NEPX 4J6FA 2EFJA 4UCXA 1W4CA 1UF9A 4Z9BA 1G8KA 1L2TA 4UNIA 5B3AA 1AGXA 3U3XA 4C3VA 1H5QA 4BKOA 1V4VA 3C5VA 3ZCRA 4OQMA 1HDOA 5AJXA 3U26A 4CBVA 1N3BA 5LP6A 2D0DA 4FIDA 1K6JA 4Q0MA 4WZBE 1JEAA 1H93A 1KVUA 4ZV9A 3EF0A 5BSTA 3FPGA 5DEIA 3HKDA 3R6DA 3E84A 1SC1A 2RJOA 1QH8A 1NDHA 1F7UA 3WL4A 5F7JA 1L4NA 3VUFA 3CGGA 4RSRA 1QCYA 1G8YA 1R7RA 2VBIA 2VJMA 1GNPA 1JHMA 4DWVA 1YBHA 2KSQA 1RYEA 2CFCA 4OK6A 3AGQA 4WOPA 4F5ZA 1R5OA 4MUKA 4EYOA 3QYFA 1CJKC 1CJUC 2ACEA 2Z08A 3PHJA 4NCNA 2QPAA 5COAA 5HCNA 2Q50A 1H66A 1IU9A 2YHSA 5JG7A 1N78A 5IDXA 5L40A 1ZA2A 1SNYA 3K5WA 3H5OA 3CUWA 2X77A 1IM8A 2FZ4A 2RK4A 3EJ6A 1Z2NX 4DDMA 6GPBA 5EIEA 1NZJA 1BA2A 4MRAA 5ARCA 1K86A 4BZPA 1REQA 2H4FA 2VJBA 1M7GA 2BHTA 3OE1A 5BPHA 3R5FA 4ZVSA 2WG2A 4LWOA 3E4CA 1I7PA 5LXTB 4WOBA 2V1XA 5EMJA 2B69A 3Q7RA 4IIXA 2VIIA 2BGKA 2EKZA 3DE5X 4L16A 5BXYA 1EIWA 5J40A 3NNDA 4ENVA 1QHYA 4BBJA 5A3JA 4M9ZA 3BORA 1S9HA 1UAGA 1VJTA 1WQ1R 2XY4A 3BE4A 3GIDA 3OTQA 4I50B 2GCGA 4ND8A 4AYWA 4YMLA 4AG5A 1WDLA 2FUEA 3LOUA 4LNHA 4AZSA 1DQPA 5JAUA 3RT9A 1YB5A 3DT6A 4S0ZA 3T6KA 2WILA 1QC5A 1JVSA 1L7XA 3EBPA 4OQYA 3RD5A 2J6CA 3WXMA 5BRNA 2HWXA 1XI2A 1N92A 1TRHA 1NR5A 2BRUC 5DTJA 2DHCA 4UMEA 3PPWA 4R8SA 2NP6A 1Q1AA 5JARA 5IAAA 1IPHA 3FCOA 1CEYA 5KX5A 1F5NA 4U8HA 1Y8CA 3H75A 4PCAA 4YRRA 5DCYA 4I5GA 5ALRA 4AO8A 2HMYB 4DIKA 1DMSA 1JF8A 1MTZA 4G1CA 3UT5A 2QVGA 2V6GA 1R18A 3L7NA 1JG1A 3BB4A 2Z4SA 1CY7A 5HP4A 2YJTD 5C8DA 5I5EA 3STUA 3U4QB 4DG8A 3ZWCA 3MGGA 4KREA 1CLEA 2V7VA 2A14A 3IH5A 1ZLXA 4NZZA 3W4IA 4BEBA 1IRXA 4ZMBA 1QV6A 1JDZA 2ISSD 4XQGA 3ROEA 3U81A 3PIDA 4G01B 5EGNA 3U44A 2RH5A 4WLUA 5JS1A 2PQ6A 4GDMA 3WYGA 3N2GA 4F6LA 1MP0A 1S2IA 3ER9A 4QEDA 2JGDB 4DR5B 3PUHA 3IAAA 1NDUA 2A7XA 2VDJA 3WKDA 7YASA 1I7SB 1WZNA 1LTQA 4UHFA 2P62A 2G67A 4R8RA 2XUOA 5HX7A 5ECGC 3G02A 5EP4A 4BYMA 1AQLA 4FDTA 1PSWA 3K6KA 5F1YA 4TKVA 1KYZA 3GFBA 3LHSA 1CR4A 1GQFA 4FGSA 3ROTA 1AQNA 4AWAA 3MLEA 5BVHA 2Q5LA 4OH7A 3MQFA 4QELA 2CY0A 1LQ2A 4ZC1A 5I4CA 3DDZX 3O93A 2R4TA 4M7OA 4R1OA 2H7XA 2HMUA 4I1VA 4YPFA 1HI9A 5JS2A 5ER6A 3FYSA 4HQFA 2P75A 3DBRB 1TGVA 3OLVA 2VT2A 4G4JA 5B1IA 3SOPA 1U2QA 1VP9A 1CQIB 1CWUA 3A1SA 3KT8A 2A5LA 2VAVA 4UDNA 2NNWB 4PPGA 4RQBA 2WUDA 2BMVA 4TTIA 3FMGA 3LBHA 2GKSA 2AX4A 4CQMB 4LKOA 2D1QA 2FE4A 3H4VA 1TK3A 5IC6A 2FFBA 3REOA 5C9ZA 4Q1DA 3K9HA 3ED1A 1ACLA 3QFSA 4M49A 4OHCA 4B3XA 2W43A 1V4NA 1RJ9B 4AURA 1ZITA 4V0QA 5EE1A 2E5LB 4Z53A 1M2NA 2GVNA 3O3CA 5D87A 3K94A 1QUEA 3CNOA 3CF0A 2EAUA 1Q16A 2WLSA 1G18A 4CLOA 3K2BA 4DPLA 3GFSA 4KIWA 4CU2A 4DJEC 5J58A 2ZE8A 3OMWA 4UATA 3ER6A 1M2GA 4QJIA 2Y76A 2NM0A 1FX0B 5IJ9A 1IZ7A 1B93A 3ZVNA 5FPTA 4LVNA 3ZIDA 4FKMA 2BMWA 4YB8A 4PF1A 4Y2GA 1X19A 3HSSA 1NP6A 4C78A 4CKEB 3AFGA 2X41A 3GRFA 3C5HA 3C7CB 3WLNA 3ZS8A 4MRNA 3MT7A 4GL2A 4TZ0A 3TE7A 5IFKA 5JFTA 4FEYA 1VL1A 4W5NA 4ZAVA 2IV7A 2HV8A 1LFDB 2Y77A 3PL1A 1SUDA 3O26A 2BFEB 3CWQA 4N0EA 4NBNA 1M76A 1P39A 2WWFA 3LIPA 3A7EA 2I7TA 3AUTA 2YYAA 3B1XA 3FPJA 4QPJC 5J9FA 4HB3A 3GCXA 1JLMA 1B14A 1BWSA 1YQWA 4P7JA 1JNYA 3JATA 1GNQA 5BYKA 1N7IA 2QVZX 5HQ3B 1CQXA 3EAQA 1LFAA 1O08A 2BJHA 4XRRA 1NN5A 1ZVJA 2IHUA 4UU7A 4TL9A 4X8OA 3UOWA 3FFWA 4ZYVA 4OXKA 5A6VA 2I6SA 1P2UA 1O87A 2BBSA 3NNSA 1F9EA 5LQUA 4WLOA 5FO1A 1HT2E 2ODBA 3DZHA 2PUEA 4ZAGA 3GJQA 3HCNA 2QUZA 2BUCA 5ARBA 1TKBA 1DCFA 1QGYA 3WK4A 2HWUA 2GPAA 2NWQA 2GAFA 4UU0A 4Q12A 3RHFA 1ZK2A 3JALA 3SZGA 3ROFA 1FVXA 2QLTA 4JBNA 4FYMA 1SXJB 2VEOA 1MO5A 4K9RA 5AKIA 2ZTLA 1BJRE 4WECA 4FQ5A 5FL7A 3VZRA 3CR3C 4D99A 4XDYA 2HRQA 2XTAA 1DEXA 5IVDA 1PQPA 4ZPXA 3X2SA 3D9QX 3DDCA 2JFHA 4W5RA 2EFYA 3TTUA 1ESMA 3AI3A 5JV5A 3B38A 5LDGA 3O5AA 2JHAA 4G5RA 3UWPA 2HHAA 3LUAA 4LJLA 1RABA 3B7PA 3KDAA 1RM4A 1KQNA 3L82B 5F7ZA 1Y3BE 2V5UA 2IODA 1Q2UA 2VWHA 1P31A 1K7SN 4OHKA 1PFQA 4D8XA 2Q8PA 1HQDA 3E18A 1K75A 3PFNA 2IZ0A 4RPJA 3PQDA 3JQBC 1DP4A 1YE8A 1QX4A 3AVWA 4MLCA 2WHPB 1VRCA 5GZ6A 4KIJA 3STTA 4ER3A 2E4VA 3LCUA 3RVKA 1UKCA 5DGIA 1V39A 1BN7A 2G25A 5ABPA 3AF6A 2OFPA 5K0LA 3UANA 2C7OA 3LWNA 5DN6A 4NF2A 5L3QB 1XAGA 3Q15C 1QGAA 4NCIA 3G0CA 3ZUPA 2E7ZA 1ODSA 1MABA 4EELA 1PZXA 2IW1A 3UCXA 1K8ZB 1P4JA 3T0GA 4UQLA 2F48A 3HLTA 3RRFA 1ZY2A 2Q1UA 4WZBA 3O3OB 3U13A 4CKEA 1CR0A 2ZRGA 5B64A 2UDPA 4AKTA 5FEUA 1XTSA 3CVYA 3UXHA 5CJPA 4RBNA 3IP1A 5JNTA 4RC9A 4B0OA 4PYMA 2BJVA 1JKMA 4MW6A 4D42A 5D01A 3KAQA 2C4UA 2QU8A 1FRZA 3JX9A 5HFAA 4C04A 1OXVA 4XWKA 2XRZA 1ODFA 1PT6A 3EDMA 2E4AA 2F64A 2Y93A 1IOVA 3GLHE 5BSUA 1SK8A 2DLDA 2ICAA 2FV8A 4ZJYA 5IXJA 3FHTA 3V1UA 3LF2A 5JISA 3PLAE 3ZNPA 2AKEA 4D0NA 5AVXA 4M1WA 5DFAA 1EP1B 4UKDA 5FFFA 1IN8A 1JQDA 1XWFA 3COWA 3Q40A 4JDPA 2NVUB 1MEOA 1AQ6A 1C3JA 3BDVA 2MU1A 4W9NC 4XVCA 3JY6A 4JHXA 3NV9A 5DHQA 4BECA 2COUA 4E2XA 5C4IA 1D9ZA 5C1DA 3OX3A 5CA1F 4HNRA 4X44A 1H22A 5EJ2A 2CV0A 3C5EA 3Q8KA 2YIMA 1CZOA 1DKPA 2NUPB 4WK0B 3TR6A 4CHGA 3EVFA 4F9TA 3R9XB 3UV3A 3BMOA 1SBNE 3C3EA 1HLPA 3MFYA 4ROSA 1OXSC 1UBHS 1ECPA 2XXBA 3CISA 3CJTA 3LYLA 3HSKA 4KZPA 3W2IA 4F3RA 2YRXA 3DCJA 3E9ZA 4BMOB 1E79A 3QW2A 3FXAA 1VBMA 4FC6A 1PX2A 4AF8A 1A9RA 4HZGA 3FZYA 4HDQB 3OUZA 3EPKA 1RLIA 2NMVA 1TUGA 2AOVA 1KBOA 3P2OA 3EGXB 2EG9A 4EA9A 2X8LA 1PW7A 1M2HA 2OAQ1 4O4LB 3PWZA 3AP1A 3NIFB 4JP1A 4WEOA 5HRCA 3FVTA 2VOJA 3I2FA 3RKSA 1AZSC 4YMHA 5CXSA 4DLYA 5D3MA 3HR7A 3MGAA 2OHOA 1XZKA 3C6BA 3PEFA 1CZHA 4NECA 3SNHA 3ZCSA 4WA8A 3STHA 3VPXA 1MJFA 1XDWA 4Q4JA 1FP1D 5B7PA 5C52B 2IIQA 1KFEB 3VBEA 4CW7A 2C5FA 4JGIA 1OLXB 1TPZA 4IDAA 4DLSA 2E4WA 4FEEA 4AW9A 4D3SA 3AF4A 2BHRA 4U63A 3KXKA 2Y1CA 4B6QA 2ZRPA 1H1LA 2PBZA 2BMAA 3SFTA 3NMUF 3PQ3A 1TZ2A 1ZH8A 3KAJA 4WWHA 1IH8A 1T25A 1YJXA 2M9MA 3HUUA 4RD4A 3SS8A 4Q4HB 3VBCA 3Q3IA 3GK3A 3EFHA 4D82A 2QJWA 4BB9A 4PAQA 3ZEIA 3P97A 3IEMA 1DUIA 1U80A 4WNCA 4INAA 1SVLA 1XVVA 3VR2D 1RYYA 4C1BA 4RPHA 4ZU6X 2OCIA 3DEYX 5FEMA 2FEMA 3VC3A 1N2IA 4G24A 3C1AA 4I3GA 2DCUA 3JYPA 4E2WA 4LMRA 2XCSB 3ZD6A 3WWYA 1U9JA 2W2LA 3N8HA 1Y8AA 4MQ4A 3LE8A 4L85A 4ZVUA 3VFDA 1GL6A 3D1VA 3G9ZA 3PR2B 1FLNA 4X6LA 3U1VA 3WL3A 3IOYA 3JD1A 4A9AA 1KPHA 4P83A 3UJ9A 5FPKA 3PA6A 2QQGA 4LZZA 5LKAA 1ZGGA 2RGNC 2OORC 4CIXA 1H2WA 4FFVA 1GZVA 3ZXIA 3DTVB 3UM9A 1KK2A 1RJGA 1NVEA 1W94A 4E6PA 1IFXA 3VPAA 1MW8X 3M6VA 4CETA 2D2EA 3C5WP 3TQRA 4N54A 2C31A 4BGEA 2JJ2D 3A0UA 5FI5A 4CKWA 1PFGA 3LT0A 3T9AA 3WV5A 2M1ZA 1VFPA 2C96A 1R8JA 1FVOA 1DKQA 1JFFB 2IIVA 2UVPB 2WKRA 4HGNA 4KN9S 3RK1A 3RIXA 1A5ZA 2FSFA 2RHTA 4MVJF 5A4DA 1X3LA 3BWEA 4RGYA 4OQZA 4XIJA 3H2ZA 4Q05A 4TRNA 3WJAA 3B82A 2QTVA 4ASUA 3PGXA 2QAIA 5FPHA 4PC6A 1I6KA 2WQZA 3CLUD 3WYCA 3KQHA 1C80A 1M33A 3BJRA 3OLQA 3NWPA 3H0EA 2PJRA 3JW8A 3O8RA 2H7CA 2PMEA 5FNVB 3CBGA 4X1KA 1ODJA 3LVBA 3M3PA 4CNQA 3R7WA 3K70C 4RH0A 2AN5A 2DBZA 2C8LA 2MSKA 4HXGA 1JU3A 4B6SA 3GAAA 1K7EB 3GJ4A 4S2UA 5FF9A 1XAJA 2W6NA 1ENPA 1SXIA 3O2JA 1HSZA 1UL1X 3AM3A 1SKYB 1IWOA 5LQKA 1LWOA 1XMQB 4F93B 2HF7A 4JU8A 1JV2B 1SB8A 1Q0ZA 2D4HA 2DR0A 2G28A 2JHCA 4CI9A 5GV8A 5THXA 1FPMA 3NHUA 4B75A 3A9CA 4IZHA 2HHCA 1SN7A 3PC3A 2OG1A 3GPCA 2B98A 2QD5A 3NH9A 1QYRA 2FJ0A 5H1YA 2C59A 2Z5GA 2HWKA 4KI0A 5MGBA 4DUGA 5GIPE 3KLOA 5EMKA 4ZCIA 3DR3A 2XVMA 4M8IA 4DQXA 5LOVB 1DINA 3MAJA 5GMOA 5E7IA 3GLVA 4N65A 4ZKDA 4R4JA 1MIHA 2ACVA 4AUKA 4ZHQA 2I9KA 1MAWA 5I45A 2IKSA 3P45A 2OT3B 2YUIA 5HIMA 1QRSA 2EKPA 1XCMA 4YJ3F 4IXWA 2WM9B 1XPJA 3T3GA 1GPBA 3KLBA 3CKKA 4TTQA 5H59A 2H48A 3IHLA 4CQJA 4OHWA 1ZFNA 3GJSA 3QU9A 2ST1A 3Q6IA 1N5MA 2E87A 2WAYA 3IURA 4TSRA 1DQNA 5TSDA 3SDZA 1ELOA 3CY6A 4QYIA 4PBRA 4F4UA 4P31A 4DLLA 4Z51A 2OLEA 3GN2A 4HO1X 1OREA 1X7DA 2J9FB 3Q3VA 2ZITA 1XPRA 3TIFA 1QVWA 1V96A 4S0XA 3O8DA 4NE9A 4RJLA 5A7GA 1E3LA 1E5TA 5JASA 1AD2A 2A92A 1H0KA 2FWIA 2GOYA 2XCLA 2ZWAA 3CHYA 4LQLA 2OL4A 3CZ4A 5I7SA 2H1SA 1P4SA 3D8BA 2BCGY 1RC0A 4ZCTA 3A6PC 2NU6A 4XYEA 1TM7E 4QOJA 2FG5A 5J2TB 3WWDA 2QJFA 4D96A 1MT0A 3B6JA 2DBYA 4DUPA 1U5BB 2EV9A 2Z3WA 4YRIA 3C39A 3C2QA 1JHPA 3I8SA 5KYNA 4LY3A 5L3SA 5BV1A 3TW0A 1A8IA 2CXRA 3PFIA 2I03A 5FQNA 3CXRA 4ND5A 1ISRA 4M0CA 4I9HA 1N36B 1QVAA 2XR1A 4XVQA 3BSWA 5KAMA 4BNUA 3EMDA 3VR3D 3GPBA 3HNRA 2Z30A 5DSTA 3U0VA 4PGHA 1JBEA 1VLMA 4F8YA 1JH8A 3K96A 1NN0A 4Q66C 1C0IA 3D3EA 3DFZA 1ZBDA 3GNSA 5GOTA 1IATA 3CMMA 1MO3A 2QTMA 2I67A 3E2IA 2O19A 3CUKA 4BO6A 3Q0IA 3LDFA 1AUXA 1GRVA 5DI3B 1YIDA 2HYIC 5FAXA 3VHRA 4DREA 4Q3LA 1G19A 3DEFA 5DASA 1QE3A 4LC9A 5CM2Z 4LWPA 5B2EA 2R8RA 1CQJA 1NXSA 3HBJA 1LA2A 1FPQA 2PIDA 1JGTA 2PKQO 4MHOA 5FUYA 1N2ZA 1QHHA 4BQPA 3PUIA 2Z5VA 4MMYB 1H3NA 1SVOA 5BUSA 1QQ6A 4DIEA 1N1GA 4IW3B 1SO8A 1O57A 1BVUA 4MS3B 3WBBA 4AU1A 4KSBA 2AJ8A 4GT1A 4LVUA 3WWOA 4CMIA 3RS3A 4IV5A 3WGKA 3E9CA 4MKXA 4PEVA 2XB4A 2YC2C 5KDOA 3FNQA 1XJCA 2FUG1 1J2EA 1LJ8A 2ZBPA 4FX5A 2GHQA 2HZ7A 3LRPA 5ECYA 2ZJ5A 2C7BA 4MGYR 3MTJA 4MB6A 3R3WA 4LF8B 1R8SA 4PO3X 2BYTA 2F00A 4JJGA 2OHXA 3G9TA 4HR7A 5T4FA 1KOLA 1OJLA 4A8JB 4A92A 3QPWA 3AG5A 5AYVA 3WB2A 4XDZA 1W4ZA 2PD4A 5K2MA 2F1RA 3RE1A 3LPDA 1EFDN 1G21B 3OIGA 3VNUA 4JYBA 5HHTA 3SHWA 2VCHA 2WAMA 1J6UA 1KDPA 3LYAA 4DSUA 2CLIB 3N3BC 4I8DA 1ZDMA 4OP2A 3A1UA 4EYKA 1U81A 5AVRA 3RSZA 4G4IA 3ZV7A 4R0VA 2J9RA 1ECCA 3QV2A 3AEUB 4ROTA 5LZ2A 2ORVA 3BWVA 3L8ZA 5FTLA 3UYLA 3IALA 1A9PA 2PL9A 5NLLA 4LPKA 1EVLA 1B00A 3GIWA 3KQSA 4FCVA 3T4UA 3HZHA 1VYTA 2LRHA 5JQGA 1JLLA 1U0OC 2P3SA 3ESXA 1GV1A 2OG2A 1MR3F 1QHEA 3N0WA 4G5GA 4IUDS 3P0EA 4L2IB 4WX2B 4URWR 4AULA 5K8CA 4ENUA 4UE2A 3EMKA 1V26A 3EF1A 4YA6A 2RARA 5LQJA 2QZJA 1QCZA 4KYIB 2GMWA 1OU4A 5JALA 3D81A 3BTVA 2FEKA 3QE3A 1K0FA 2P0YA 4PG7A 3ZE2B 4Q4CA 4YMSA 1NE7A 4C08A 5ICFA 3J7AC 4J29A 4R2MA 1JE1A 3ODPA 5J4HA 4P3YA 1IJFA 3IQZA 1BKSB 1W0CA 1U8EA 5JQGB 1OT3A 3A58B 2BWJA 2PWYA 2ZTHA 4B17A 3FWNA 2OM2A 4RWEA 1VHTA 1QJ4A 2HADA 5CPFA 4B34A 4LDNA 4LOIA 4PQGA 1Q22A 2I91A 2BTQB 1BXKA 1PGJA 3QGMA 3DBVO 2ZEJA 2FW8A 2ZVJA 4I5IA 5DEOA 1XZDA 3FPSA 5FOTA 1P5RA 1L8AA 2ECFA 4FMDF 4KE7A 1ND6A 1R6TA 1W35A 1VXRA 2OCBA 3BH0A 3I9FA 5SY9A 1E2HA 4WUTA 1G3RA 4K6MA 2Y0PA 2BKEA 3UJPA 1RNLA 3QPCA 3MD9A 3BEOA 4ZDIA 2A0FA 2CNDA 1KYTA 2GYVA 4AM8A 1AS0A 1G55A 3TNLA 2ZIZA 3F0TA 4MS3A 1D4OA 4C0LA 1RPZA 5KB3A 1SFRA 1ZW6A 5LQNA 1HY3A 2FPOA 1U2RA 4WL0A 2D7DA 5KNCH 1QBGA 4NESA 3FZGA 1T3GA 1SVSA 4AXBA 2EJCA 1JLKA 1MDFA 1NF9A 1X87A 1MG0A 1KSJA 3LFHA 3WLKX 2R8EA 5T6MA 3KQYA 2ZSKA 2ORWA 4ZQCB 1YZ3A 2WD8A 3I09A 4MQEB 1DKMA 4RHUA 3OPNA 2OPHA 3PC8A 5LYJF 3H97A 2BGLA 2B1RA 2JJ8A 2FZCA 1WMAA 1MB3A 3DKPA 5CDFE 2IXDA 4JK3A 3OZTA 4PLVA 1W1WA 1JDSA 4O4HB 3IELA 3OM1A 1KAHA 2M1XA 4MWOA 3H11B 1CUXA 4IOLA 3H2BA 2IP2A 2X9VA 3KVRA 4M0DA 3C74A 2XDQB 3L8FA 1R3DA 3KUUA 1XQWA 3GFPA 3O0DA 1Q0SA 4O2RA 5TY0A 4D46A 1YJCA 1GG9A 2PUDA 1E77A 3W34A 2VPTA 4GOXA 5KJEA 3ZV4A 1CRLA 1OC4A 5BWBA 1Z0JA 4N41A 1M8PA 1IOZA 5B1DA 1AIPA 2B0CA 2PO5A 4F06A 2WWXA 1XP8A 2VNSA 1ZD8A 1NLYA 1SEPA 2O9JA 4HBGA 2BUBA 2GPBA 1C7EA 1ZUWA 4GPBA 4PHFA 2QJRA 1BH6A 3IXLA 4KOEC 1E2IA 3U49A 2PXHA 2QR2A 5THQA 1C9DB 2BGNA 3I28A 4KQJA 2R1ZA 2G82A 1S4QA 2XWBF 3VTFA 2P3QA 2D8MA 2CCJA 1QAMA 3M34A 5JT1A 1CY1A 1GFIA 2ODPA 1NUQA 2I2XB 3MSCA 4R1TA 5HIKA 4BN0A 2PHZA 4Y1RA 2QUJA 1OB2A 1M67A 4OMDA 4AL4A 1E9DA 5LJIA 2MYNA 3TXYA 3UMGA 3N7AA 4LGCA 2YH2A 1I2ZA 221PA 1NVVQ 1HETA 4GI2A 4MVXA 1WDTA 2Y1KA 1X7WA 2BMEA 1FOEB 4OF4A 1OLSB 3UAZA 5I8PA 3LUDA 4X65B 2VYND 3M4NA 1YL6A 1HH4A 1TGYA 4K1LA 5BPFA 4QA9A 2V03A 1V5EA 3L92A 2WD7A 4K6FA 1KP9A 4C7VA 2APJA 1GADO 2CV2A 4LC0A 2YFYA 5TJHA 2WAOA 4KV7A 3GEEA 1OAAA 4UU1A 5FIUA 3S8MA 3VR4A 3K5IA 1MJGM 3WK7A 2FI1A 2P6MA 2ZBGA 1OKKD 4ZGGA 5E7MA 1CEEA 2NVWA 1G2QA 2R1TA 4PZLA 3QWHA 1CIJA 3B9BA 3SYRA 4KDEA 2X0FA 2SICE 4W7HA 5LZ9A 1Q1GA 2IWHA 4B7AA 1Q44A 3SVLA 4W9MC 4AK9A 4L22A 5FTNA 4JFRA 1K9VF 3F4BA 1E3WB 2OP1A 2WIFA 1UM9A 1YAHA 3TLEA 3UJDA 1DKNA 2II6A 2JEYA 4Y9TA 5BOVA 1KP3A 1Q0LA 2QZ9A 3C16C 4QLOA 2RB4A 3GN1A 3LQ4A 5TEVA 2GEDA 5AMXA 3AHIA 2J08A 3PQ2A 4OJKA 2QENA 1R6XA 4HEQA 1A8UA 3AJEA 4RETA 5EZYA 1M2FA 3U4AA 5DGTA 1AHHA 2JFQA 3AYZB 3QYAA 2WSIA 2OCAA 1SQSA 3PDIB 2Z2IA 4J0IA 1NVVR 2QNBA 3IUQA 2VBGA 1VHQA 1Z4OA 2ZU0C 5HS6A 3RS2A 4EHDA 1JQ3A 1CNEA 4ZQIA 3D3NA 1F6DA 4R41A 4AKEA 4F4DA 4EO9A 1ODKA 3UJAA 2ZS9A 1M2JA 2IU4A 5BN3A 2HAEA 4Q18A 2RH8A 2W37A 2W6OA 1IY8A 1V16A 2QJTA 5AXAA 4EG0A 1AK2A 1X9HA 5DE3A 1YCGA 3K0EA 1ODCA 3O8QA 4A73A 3COYA 3X44A 4YWJA 1M6NA 4H2DA 1JZSA 2Z6VA 4FYKA 4QXQA 3NGLA 4TVOA 3WAGA 4M22A 2FMXA 4G67A 4TS9A 2J0UA 4WESB 3QU7A 3U80A 3HI4A 2HSJA 2Y1EA 4YX9A 3T5MA 4PXYA 5TQ0A 2RK6A 4HQNA 3V8BA 3PQCA 1I9GA 1PDOA 2Q28A 4KQKA 4XQ9A 4BX2A 2QVCA 3F5MA 3OCYA 3RB8A 1LI5A 3DOEA 1UXOA 1ZK4A 2P2NA 3EPRA 4QICA 5AJYA 3G6KA 2ZRAA 2A6PA 3DEIA 3MSXA 4UDYX 5DTIA 3T5BA 3T35A 3WGZA 1FJXA 5DZSA 3JTMA 4MDFA 2AXEA 1NUSA 2MT9A 3SQMA 3GRYA 1IXSB 5AW1A 2CF5A 1PNOA 3U3JA 4B7CA 1CUZA 4B4UA 4RM2A 4ZGBA 4DV7B 2WAAA 4FZRA 4Z4HA 4OJTA 5IARA 4Q6WA 3RT7A 4O2BA 4R54A 2JRCA 2ZPTX 4IUBS 4O4IA 1GRNA 2C2ZA 4QUBA 4R1MA 4XD2A 1WKVA 4P58A 1ORHA 3M83A 3WWZA 5L3ZA 3BMXA 4BNXA 2WC1A 2VZEA 1FMTA 4LMBA 4M87A 4MO2A 3OE7A 1QRDA 1EU1A 1ZR2A 4UQPA 1ULBA 2QRQA 4JWKA 2WPDD 2X1HA 4QGSA 3HFJA 1ZOIA 3M3HA 1X8LA 3GDWA 1UJBA 2HGZA 3UW3A 5CCDA 3PNKA 2XNDA 4FLMA 1EDOA 3E3NA 1I10A 5KEIA 3A4TA 1LZLA 1Z33A 3ZXXA 2PMWB 3MQ4A 3ETEA 2ZRMA 1W2HA 2P68A 4G56A 4RQAA 1ID8A 1HXHA 1PNRA 2FKNA 1OI7A 2FEOA 3THRA 3PFKA 3E27A 3PD0A 5AWFC 2QTLA 3EY4A 1XLWA 2VUSA 1GT6A 3TH5A 1NUUA 1KFBB 3MB8A 1JSZA 4LBWA 1H2FA 1JG6A 3TW8A 4RTRA 5FWAA 3DHEA 4RH3A 1RKBA 1QK3A 1WJGA 3A10A 3O9MA 4XARA 2YN2A 2O8VA 2ZR9A 2DPHA 3AL3A 4NCKA 3CNEA 1W9HA 1ZLYA 2NXNA 3AV3A 2AV6A 1XHFA 2WMOB 5KVQA 1KJYA 4YJFA 3VAYA 1L7MA 1CRWG 2HNBA 2CYCA 1X80A 3PHGA 4LAFA 5KWJA 2PT6A 4XXHA 1KDOA 1Z7WA 3L4BA 1RLTA 2X22A 1EFCA 3LFUA 3MBKA 3Q9SA 3Q9LA 3UA4A 4UPEA 3AHFA 1JKXA 4BP1A 1SIUA 1MF7A 3KYCA 3ZE7A 1YZYA 2IIBA 4D8YA 4EF6A 4WBNB 2HFJA 1BXGB 4DSAA 4I5DA 5CDYA 4CG0A 4DHWA 1FYVA 5BP7A 1UDBA 4HWPA 4IMJB 2VJLA 4ZCRA 2QI9C 2R8ZA 3CEJA 3IAM6 3F3KA 3R0ZA 1YZGA 1LY1A 1KEEB 3TKYA 4YP5A 4R6WA 3GV0A 2R7MA 2V7GA 4RXTA 3TPCA 3V7UA 4US2R 3AX6A 3MZ0A 1XIVA 3NBUA 4AX8A 1QTIA 2YZKA 1KOGA 3GRZA 4X95A 3VDXA 4DV3B 4TTSA 2QQFA 3P9YA 4JOSA 1JPNA 3QY0A 5EHIA 3E5NA 2FEAA 2DWUA 1DX6A 3IBYA 3EBOA 4WCFA 4EPWA 5KTNA 4OXIA 2BBOA 3KX2A 4XOUA 3EFBA 4OOEA 2VNJA 3RYCB 3AR3A 1V35A 5E4YA 1CPYA 2YJGA 3A1FA 3EW7A 3IHTA 3FHLA 3O94A 4Z0NA 3RV3A 1A2KC 1EGAA 2BR5A 1NONA 2C0CA 2QSJA 2ZIFA 1CF9A 3F6PA 3OJWA 4EG1A 5JCZA 5CG2A 5K09A 1R0ZA 2BT4A 1IHPA 1OI3A 1QK4A 3WYBA 2AUTA 4WXMA 4ZQHA 5IDWA 1O0BA 3QFFA 1QQ7A 3S1AA 4BN5A 1JJFA 1KZ4A 1GUAA 1LLUA 1VG1A 2HQRA 2QJOA 5HKOA 1EEXB 1QRUA 2R6FA 2EVWX 4TGLA 3IPLA 1Z45A 4MWTA 2NU9A 3EDOA 2WFLA 4HAUA 5DNVA 3TOXA 2OORA 3RVLA 2H2IA 2D06A 2NLOA 3KZNA 1KFKB 3THWB 1U8FO 2VZLA 4K9MA 4EJSC 5ALNA 4JV5B 1CW2B 1XZEA 2ZRLA 4MRVA 3K15A 1YULA 4LGVA 4ILKA 3U9LA 2HSGA 3W2GA 3AUFA 5KYTA 2CHUA 5FTWA 2GNOA 2JVKA 4Z3DA 3VAZA 5IZ4A 3W5AA 4RJJA 4ES6A 1JYSA 4ENTA 4H16A 1K8YB 4BAGA 4LG1A 3QMPA 3JQEA 5ESRA 4DCMA 1YDHA 1LI7A 3VZPA 4Z8XA 3E7WA 2WSMA 3R7AA 2ZT8A 1C7FA 3M6WA 4KXXA 4RD1A 3IDSA 3KWMA 2EZ4A 3H4MA 3W6OA 2PSFA 2P6RA 1TCUA 2W90A 4ZI7B 4EITA 3OLYA 3NHSA 2W83A 4HG2A 2PRSA 4O2AA 3LHIA 4OFZA 2J6IA 2FN4A 1QKJA 1COZA 1KETA 4Q1CA 3WLRA 5C8VA 3ROZA 5HWSA 3E05A 1KJJA 2PYDA 3Q85A 3RR2A 5KSZA 5D84A 1J0DA 1RXVA 2H0RA 3OTHA 2HQBA 1RWOA 1D2CA 2E1PA 1UZNA 2FHPA 1N4DA 2A9OA 3G8YA 4NNPA 1CIVA 1VE3A 5EZ6B 2RAPA 2EX1A 4JUIA 1T2CA 1V3UA 4H9GA 3JR7A 4M46A 2Y6VA 2ZRNA 4NTZA 4XR9A 5AK0A 1UPUA 1T9GS 3EQ8A 2ZGVA 2YWFA 1BHQ1 1GA6A 4DCPA 4DRYA 3HS3A 4BO9A 2PUJA 4X6UA 3AETB 3LY5A 4C6HA 2W71A 4X9XA 1R5NA 1RU3A 4TVBA 5IJ9B 4A0FA 1U8AA 3ZCVA 2VSQA 3R0QA 4B47A 4NAUA 2YN0A 3LDHA 1OOEA 5DH9A 5DJ5A 4DJDC 1E5XA 4IEEA 5CBKA 2Z1NA 5TQJA 1KORA 4B33A 3FHJA 3ZE9A 1NUHA 3HXOA 4KN8A 1FDWA 4M60A 2CWDA 3OJOA 3WBKA 5HUJA 4S35A 5LXTF 1GIAA 2X14A 1TW2A 2BFEA 4L08A 3RYIB 4AN4A 4NICA 1R9GA 2B3TA 1U2ZA 3ILXA 3RPEA 3U4GA 1NR7A 1I4EB 1XXHE 2YUTA 3FGOA 1U28A 4N5NA 2A0WA 3TSYA 5KNBD 1CRZA 3L8EA 1E7SA 1XN1A 2I2AA 3OA2A 2J0SA 4MNTA 5AHRA 1DPFA 3OZBA 4EKNB 4C6TA 3P5SA 3IJPA 1ODLA 5TARA 4G1UC 3WLFA 2B1IA 3M6IA 2IYRA 2VJYA 4WCFC 2IUUA 1W88B 2NZUG 4JSRA 3X1ZA 2ISCA 1MH9A 1WXIA 1XXLA 3QLUA 4I9UA 2WF7A 4I5FA 3FSRA 5F1OA 1QHNA 4D0RA 1EDDA 4UOZA 1G2OA 1G3MA 1L5NA 4YMIA 3IMFA 1F17A 3NANA 4UFOA 4FB5A 2GK7A 2ZYSA 2FLWA 4FNAA 1T26A 1G8FA 3IUJA 3LKDA 2EKBA 3PE6A 1YI0A 2FPMA 4LZNA 4NMLA 5EE0A 1TF5A 3DAPA 3QITA 4LRTB 3ZTWA 2A9PA 1FU4A 4AROA 3D6UA 2W0SA 2VLBA 1Y33E 5KYYA 1BXGA 4OAOA 3I8XA 5CA1A 4DUZB 3C3BA 2P11A 5DNWA 2VS1A 4OI0A 4WK4B 2VL7A 2NU8A 2FMIA 2VNKA 3SQDA 4HF7A 4E7PA 3OJ0A 3W5VA 4IHQA 4BLUA 3UJNA 2CBZA 2VTKA 4IF4A 3WI7A 3V2GA 4QOFA 2OFXA 4JJZA 3E15A 2JI7A 3TVYA 4BE9A 1II8A 1Z8NA 3AEZA 2NPFA 1ZEMA 2PA0A 3G2HA 5FBQB 1D07A 1GQOA 2H7YA 2YWCA 4GPTA 3IKJA 1QGOA 5HF5A 2ZREA 1GUZA 1OY1A 1S2NA 4H6XA 5KMGB 1SCNE 2FR0A 3K09A 4FD3A 2E82A 3EMVA 1W36B 4JXZA 3AI7A 3CPHA 3QKRB 4LPSA 2RFLA 5JW6A 2ORED 1J25A 1EXNA 1MPTA 1NL3A 4YV7A 1ETHA 1N1MA 5LDHA 1M1NB 3CX7A 1SXGA 3B85A 4GXRA 4Q1FA 3IAHA 2YQ5A 4RCZA 3F7TA 4S3MA 3SKXA 3ZHSA 4DIDA 1E7WA 1LVGA 6NULA 5JD6A 4NZOA 5TT1A 1UK8A 4DLVA 4YRTA 4NSNA 3T3IA 1R15A 1OYWA 2D8AA 2ENWA 2ZIEA 4R2HA 4XLTA 3NO4A 5G53C 2R87A 4YT4A 4RQTA 1X6VA 3H1GA 2XADA 3BFVA 2PG3A 4WMLA 5EIFA 4DM3A 4YJ2A 1C1HA 1PLJA 4MZXA 1M6HA 4LRQA 1W2GA 4HYQA 4LN1A 5L3SB 1IMJA 3O2SB 3EQ2A 3V8RA 3OQMA 2YJ4A 1EYZA 4Y6OA 4G0MA 4I6JA 4MEBA 5CB4F 4AY2A 1VECA 1G8GA 4N03A 4NQRA 4E5KA 3A06A 3ZW7A 2DC1A 2VNAA 3LI2A 3EY9A 1C1YA 1WAMA 2YV1A 4ZOEA 1EWRA 4TWJA 4ZVRA 1PJ2A 1VPWA 3NW9A 1WZEA 3BSSA 3ZWBA 4OU5A 3KP1A 4GDFA 4IKPA 2FZGA 2GVDC 2PUAA 1E5QA 2QF7A 4ZO7A 4HAWA 4OSEA 2C8JA 4W4TA 2CXUA 2NSJA 5C8YA 3H87A 1CJSA 4BOYA 1B6SA 5BORA 4JEMA 1VTKA 2JGAA 2YYSA 2VUHB 1UIMA 4E51A 1O2DA 5FI3A 2OLKA 1YCDA 1V1RA 5DULA 1N25A 5F76A 5E3IA 4YV2A 2EKQA 4WIAA 2UV8A 1R0CA 3OJEA 1X2EA 4GQAA 3ILHA 1YRBA 4K26A 3U40A 3RWMB 2XIQA 4FYIA 3FR8A 1L4GA 4RMIA 2AWNA 1KVTA 2Q7XA 1UOEA 3G1TA 3KPUA 4HWOA 3GWZA 3JVDA 4HOYA 1S1MA 1TO2E 5C81A 1V1MB 1M75A 3DZFA 5EYPB 4OQFA 2X5OA 1EVIA 2OD7A 2P78A 4LISA 1BMFD 2V7QD 2DUNA 2L18A 3G5TA 5DBEX 3LBNA 4H18A 4G1VA 1CVLA 3HDYA 2NU6B 4PGAA 3B6MA 4XB1A 3ECAA 4GE0A 4CRWB 4JYAB 3AO0B 4EY5A 1Q1EA 2EP7A 2QTTA 5HFNA 3GQBA 1A5TA 2XGSA 1WSBA 1K9SA 2CZQA 4NJMA 1KO8A 1YQUA 4URZR 1ORDA 3SIWA 2M2IA 4V24A 2ECKA 1UQUA 2F6RA 1Z4QA 2A78A 2CVFA 3ZVLA 5AP9A 5KPDA 3FLBA 4UDOA 3Q10A 1XQ9A 3BKWA 3KVOA 4F46A 1JQAA 1ZJ6A 3HY3A 1PS8A 1TCVA 2CUKA 1RI3A 2HL6A 4MXDA 1G66A 5BXQC 1IEWA 2ATEA 1HE1C 4IIJB 3PUWA 3IUYA 3LTEA 1W5SA 4ZJUA 3GO4A 3OVMA 3RIHA 4FP9A 4G36A 5BQ3A 2PN1A 3H13A 4D41A 3HKEA 4PO8A 1TIPA 1Y9EA 3ZHYA 3LYUA 2VT3A 4HNVA 3TBFA 1EIZA 1T2FA 1Z2CA 3CNHA 1O96A 4KRYA 3IQIX 4MP3A 3OZ7A 4P7KA 2H1OA 4ARAA 2L69A 2NU7B 3E1KA 5G2OA 3R09A 3R7FA 3ASYA 3SICE 4UBIA 4GNKA 2Y4OA 4EJ2A 2E21A 1OI2A 4Z9XA 5HR5A 3EZNA 3O8OA 3H99A 2RC5A 1H9CA 4R69A 3KUCA 4LHYA 5DTMA 2PBRA 4UE3S 4HLNA 4QYSA 2NV2B 2BC9A 4U2BA 5EPUA 4PFKA 5BQXA 4RTSA 4DEXA 3WZLA 4QPPA 4OX9B 2AW3A 2RB5A 4KMSA 4O4IB 3LP5A 4HRAA 5KC8A 1ZKDA 3DOCA 4N0MA 5FI1B 3D8UA 1MOQA 2WYUA 1A72A 1EJ2A 2FFHA 4R01A 5J5VA 3VHQA 5LOVF 1XLVA 4RHYA 1XWWA 4HMQA 4GLOA 5A05A 1ZN2A 4WADA 2D2XA 3VOBA 1W36C 1V47A 1BVHA 2VDOB 1YS1X 5JO9A 1VJDA 2I3BA 3IXMA 4IAOA 1YR1A 1M2KA 1SQFA 5HSGA 1QMGA 3QBEA 1CP3A 3SS9X 1O97D 4L28A 3VSEA 2X0RA 7AT1A 3UUFA 1ATIA 1YU6A 1DC6A 1GAJA 4LTNA 4ZU1X 1D8TA 2AFVA 1R8XA 3RARA 1M8FA 1WNTA 1DIHA 1YD7A 2FFQA 3GYBA 4TKZA 3FTCA 2I8CA 2RGUA 4ALMA 4BRSA 2R1TB 1SAYA 1MQ9A 5BYJA 1E1QA 1TVMA 3F97A 2C61A 1AVTA 5I9TA 2AB0A 1K4MA 1V1MA 3AM4A 3E3LA 3AHHA 5BUZA 4FT4A 1DL5A 5HS4A 4MAFA 3RJMA 1K8RA 3D8TA 3QVVA 1NC1A 4N6NA 1RI1A 2H85A 1W9MA 2IOFA 2IOHA 1QZTA 4ZTZB 3Q0EA 1PV1A 3QRWA 1JFVA 4GOKA 3UH0A 1RXEA 4BVHA 3RYFB 3VDMA 4FGJA 4PSVA 3LCCA 1YL7A 4EI9A 2I6UA 1U7UA 3HUFA 1DRKA 2C1EA 3HDVA 5KTTA 2O2IA 2Q45A 3S2SA 4JP8A 3LC1O 5HQJA 1W0KD 1MB2A 4N0QA 3QEOA 1EX9A 3R9WA 4IM7A 3TTTA 4IDOA 5LNK1 5CYOA 4WW0A 1R12A 4JI5B 2VSOA 1J00A 4KVAA 1GSAA 5JSKA 4AVYA 4UE6A 9MHTA 2YWJA 1BFKA 2C4MA 2DR2A 1NVTA 5KTRA 3ORRA 5BWCA 3QWAA 3E3MA 4JL8A 4BRZA 2GARA 4UEWA 3TB6A 2RGAA 3VO8A 3WK8A 2B0JA 2NV6A 4REOA 5ICGA 1EGVB 3PRHA 4Q3DA 3L9WA 4MARA 3PE3A 1RQ7A 1UBUS 4JVNA 4K6HA 2E89A 2P9CA 1YCHA 3NUQA 3WBFA 1UZMA 1RYBA 1VG9B 2AJCA 1IK6A 3GT7A 4B3IA 5IJ0B 1DKOA 2ZKIA 5F5LA 3EZFA 2O0HA 4HB2A 3GG2A 1VMIA 5KS2A 4ZTUB 4FYVA 1I7LA 2ZJYA 5AOAA 4V0LA 4IDEA 1BD3A 3FUXA 2WDPA 2Y05A 3SGLA 4E3ZA 3I9KA 3P0FA 4X45A 1BGWA 1YHYA 4CKCA 3H0KA 2REQB 1KSHA 3W8FA 1W4BA 1JZTA 1RJEA 1OCEA 1NATA 2BMDA 5EWMB 3DTVD 7REQB 5JS7A 3KFLA 4N9WA 2O59A 1AU9A 5F5XA 3C15C 3Q7SA 1F1JA 5A5DA 3OZSA 3FUWA 3PNPA 1NPTO 2Z5LA 3D2CA 1J4AA 3OEED 4JIMA 2QMUA 2FA9A 3L6RA 5A2QA 2MR6A 5A06A 2PCJA 2RGEA 4RZ2A 5KOJB 1CLUA 3ANYB 5H70A 5IU6A 4MWDA 5KHLB 1JMYA 3FFTA 3KTDA 3LZDA 1DXHA 4M7WA 1RQGA 4WJKB 2CJWB 3RK4A 1Y63A 3E1SA 3V4FA 2VPWA 1I1QB 3CV3A 3SJAA 3CEPB 1UEJA 1J06A 2EFCB 4MUIA 1UOPA 1JG4A 4FSDA 3EA5A 5C3MA 1ACMA 4C3ZA 4ZEVA 1OFGA 5KCZA 1J5XA 3CLRC 4K3UA 4LDAA 4AY4A 2C5GA 5E95A 2H18A 1O5IA 1YKFA 2AJBA 3IT1A 3L84A 2FPRA 1XCJA 3ND5A 3T7RA 2VF4X 4QXMA 4M1TA 3UQZA 1DAEA 1E6UA 1GU1A 3HR4A 1KAGA 1NTRA 2XKJE 4EJFA 3CH5A 1V8PA 1O94C 3LT1A 2Y1XA 5CT4A 3VOAA 5B6IA 1Q1BA 3ZZMA 3E0QA 4MGHA 3C8DA 4I1IA 1P73A 4MMZB 5IJ0A 3I4FA 3OEHA 4BZQA 4XUGB 4JJIA 1SBTA 2FDRA 1MC5A 3KYDA 3MCVA 4TQUS 3VR5H 2Q6IA 2X5KO 5JANA 2QT1A 4D26A 3T3EA 3AY0A 3RS9A 2N46A 3HN6A 4CMEC 1LD3A 2QM8A 4U2FA 3ZKAA 5BRAA 3V1YA 4G8DA 5ILQA 1OZGA 3TRJA 4CDNA 4JB3A 3I1IA 4YLEA 1LSJA 2WU0A 4TMXA 1CR6A 3GJ6A 4UHBA 1QU2A 1LWNA 1N2HA 5CVUA 3ROKA 3WL5A 4OFXA 2AG8A 2ZUEA 4PU0A 5BY2A 8MHTA 3V2UA 1N34B 4PZDA 4L5BA 3DEAA 1G9XA 1H05A 4D9EA 1YQEA 2DUUA 2VP9A 3LWDA 4KITB 1AZTA 1U5AA 2R84A 4JN6B 3AHJA 3EIUA 2Q3JA 5EZ5A 4DT1B 3WLEA 5F23A 3EHEA 3K5HA 2XTNA 3ZJTA 2A5GA 2NXCA 1OH6A 5BVGA 5HJEA 1Q95A 4IS3A 1UOOA 3N6RA 1CUAA 2JIMA 1D2HA 4XPIA 1JI3A 2IEYA 1QQ5A 1V7ZA 2W2KB 4S1PA 1M1YB 4O08A 4GPEA 3HWRA 4H60A 1DOZA 3LK7A 5HGXA 1J22A 1G0OA 1LH0A 3ZJVA 3L43A 1MX5A 3BEDA 5AJTA 4JJEA 2H08A 1ACJA 1IJBA 1BE6A 1PGPA 1SZDA 4LE1A 4Q4LA 3KQPA 4UBKA 2YZNA 3TN7A 3UMFA 4ZAWA 2JG3A 1W5AA 3A25A 5FLEX 5DBHX 2M32A 1YZQA 4XYLA 4K3VA 5HRAA 1A9YA 4B8WA 3S2IA 4Y6QA 3UHAA 1O97C 2SKDA 3OOEA 4M38A 2V55B 5KJFA 1Y3AA 4P5PA 1Y3FE 1B43A 2Y9PB 5EA2A 5BSHA 3X1KA 1XTKA 2XPCA 3B5IA 1NXWA 1FNNA 4FFWA 5GAJA 3SZRA 3TRHA 1RHMA 3LGSA 3N0RA 3C98A 2OFOA 1C0LA 4JNKA 4N8DA 4XYMA 3DF7A 2F17A 5FHQA 5I8ZA 1NXOA 4B44A 4BNYA 4FDLA 1N0IA 3R3YA 3TX6A 3SJBA 2WVJA 3D7LA 3ZLTA 1HE5A 4ATNA 4D4GA 5ADHA 2RGRA 5CNKA 1JDPA 4RZXA 4CV1A 1L6IA 1QVZA 1J33A 1DTWB 3V3KA 4OHVA 4N3NA 5KQSA 1KWGA 2I80A 4W1PA 3A3OA 4BKQA 5FNZA 4Y2RA 5JBQA 2KQUA 4CR6A 3ZY5A 5JVDB 1Y8RB 2I0FA 4OBEA 4ENSA 4ZYZA 2PGAA 4ON9A 2VCEA 2ZWVA 1ILEA 2CUZA 1VB3A 5ANRB 4FHCA 4PZAA 1U2DC 1YR6A 1PJQA 3EPPA 4ML3A 1OWOA 4NONA 4EMSA 1ZJZA 4K9DA 1T5IA 3BHMA 4LGYA 5L4NA 4C7MA 3GLQA 2VT7A 1V6CA 1W0KA 3W06A 4LJSA 2P65A 2OCDA 3SEQA 4IV8A 2FF7A 1I2DA 4DIMA 5B7QA 1KPIA 2GR9A 2P2DA 2X5XA 3CG0A 1NBHA 2QN1A 2GZRA 5KOIA 2FRVA 4Z7NB 1GGJA 1EK1A 1MNQA 4QTZA 3S8YA 2QLFA 2IHVA 4JT4A 3KSUA 4PIMA 4R68A 2JH9A 1VCIA 1E1MA 4KR9A 2WJZB 4UJ5A 5TDHA 2X6TA 4XX1A 1K3TA 3E23A 4HVCA 2H5IA 1XZQA 4B4KA 4Z49A 1TL7C 4DV2B 3AWDA 1PS0A 3BULA 1R4AA 3E61A 4RDXA 1SHZA 1C9EA 3DZKA 1X42A 3FJYA 2Z98A 5ICEA 3D2AA 4YAWA 1UAAA 2BFCA 4Y2QA 3S28A 1VKRA 1JWLA 1SVUA 3AUAA 3H2KA 4GBED 1Z8FA 2I2CA 1I01A 2H7VA 3O8NA 5DI3A 2IX9A 4K6OA 3T7CA 5AW7A 4P4GA 4HUQB 3RG8A 2ES4A 5KYXA 5J23A 2ZR0A 1EK6A 1G7SA 4Y6GB 2LPMA 4Z4EA 1V11B 3N9IA 3I45A 4DYDA 2G4VA 4WN9A 4BN4A 2NUPA 4UD6A 2RHOA 4L02A 4EUFA 1TW3A 4ER6A 4K05A 2A5YB 1LJLA 2QN7A 4KWTA 1BW9B 2PSJA 3LXXA 5DSXA 1I3NA 3M33A 4JZYA 4M0FA 3RUFA 1KDZA 3WSVA 3ZGLA 3EW9A 1XJWA 3S2ZA 1MQAA 1NXVA 4F5YA 3GJ8A 4FGKA 1KI7A 4KN6A 3N70A 2TMDA 4D9BA 4LK3A 3I9V1 1P0QA 2Q3EA 2RH4A 2FNAA 3GAMA 5C35A 2CZGA 3QWIA 4MI3A 5I51A 2O7SA 2XKAA 5E9AA 1SC9A 2DVMA 2JLCA 3G0BA 1N3LA 3PZRA 4ALKA 5C7YA 3GLGE 5CP8A 1CFZA 1DAKA 1G6HA 1XMPA 1ENZA 1I1HA 1MX1A 3GNTA 4HZUB 1OXBB 2A88A 1ORTA 5EIXA 3PFWO 4Z9FA 1NMYA 4WDRA 4D43A 4QNNA 4UTXA 2H17A 4PC7A 4BX9A 1DG9A 1PEYA 2G1JA 3CLKA 4UTVA 4F21A 1QDUA 3MHTA 1O6ZA 2ZRFA 5I01A 5KOHA 5CT6A 3L9XA 4XLZA 2A94A 3SBXA 4CMHA 3IEVA 2QPTA 1QR6A 5AVTA 3A6FA 2CFSA 3C8HA 2JBAA 4GZ6A 4DC0A 4URVR 2CV1A 1CS0B 4QYIB 3TOSA 4ZK2A 2GTHA 2BRUA 2Y67A 3MRVA 2IH4A 2P2GA 4KFCA 1RE1A 3B78A 2IHYA 2EF0A 2DETA 1NU6A 5EEGA 3AFOA 4L95C 4O4HF 4BCDA 4AY6A 3E9NA 1Z74A 1E0AA 1I7NA 2IEAA 3DZJA 1JUDA 2FFAA 3NHYA 4D8TA 5L7WA 1PBTA 2B4KA 4WDQA 4FN5A 3C7AA 3BTUA 4Q7QA 4PLCA 2A9JA 4AJEA 1W5EA 1U3UA 3CW8X 4B84A 4L0DA 4MV6A 1BFUA 1DWQA 4ZOBA 2ISQA 3V00A 5DM70 1UWVA 3U61B 2W8ZA 1E61A 1P9WA 2ZULA 4L4YA 2WM8A 3H4TA 2ONYA 5B36A 1YTUA 1RRVA 2VF5X 4EB6B 2Q5EA 3QFHA 2VI5A 5LP6B 1UFKA 4ND3A 1NAHA 1Z0SA 4TL7A 4X7PA 1E6EA 4LA4A 2HB6A 3I6YA 1GEGA 5D1HA 3G88A 2WMNB 3ZJUA 3R6WA 1HYEA 3F5SA 2BEJA 5G0UA 1GTL1 3TKLA 4D6YA 5CT9A 4G0YA 2XUHA 3B5EA 1R16A 3AVTA 1Z07A 5EERA 1QIIA 3ED5A 3UB4A 3VGJA 4IDQA 1E6WA 2NO1A 5DLQC 3KQUA 4K03A 3TOCA 3X1YA 1M5UA 1KJWA 2ZQ5A 4TV8F 1PF7E 1L7BA 2BSXA 3G1WA 1I36A 2ZJFA 4PS0A 2ZYUX 1NHGA 2UZ4A 1WV0A 2HRRA 1QFYA 2W4MA 4Q3NA 1TD9A 2G04A 1KNQA 2JAQA 3I2KA 2X76A 4E1BA 1YS2X 4ER7A 3DS8A 4X7BA 4OIMA 5HF9A 2BHLA 1PKEA 4F2PA 2YASA 4WFKA 4G23A 2CJFA 4LSGA 3M5PA 3HM2A 3IO5A 3NTOA 1LW7A 4HDRB 2DEUA 5EQFA 4KW7A 5E9WA 5CLJA 1EESA 1YRYE 4HZUA 4ZRDA 5DM60 4YV1A 3DTTA 2G7ZA 2QT0A 4HQRA 4EVQA 1VIMA 1OROA 5EIBD 3RRNA 3UGKA 5JQWA 1Q2XA 3KV3O 4RF5A 2HMVA 1PR1A 4D79A 5A1JA 2W58A 1SKMA 1RPNA 1KWKA 2YW2A 4B4OA 2P6UA 3E9QA 3K4HA 3R3ZA 4FDMA 4H15A 5H16A 4QC2A 1ICIA 3ADDA 1M7BA 3OSUA 2ZYTX 3M1AA 5A62A 3EISA 3OT5A 1SJ9A 4QTYA 3U1BA 3EGXA 2C9YA 4A82A 4ECAA 1G16A 1TQ2A 2CNWA 1XD2B 4P93A 4D3XA 3KEMA 5JSYA 4PIVA 2Q6TA 3UJHA 2Q6KA 2DH6A 4KRXA 5DX1A 3DQPA 4EA8A 2VYCA 3HU2A 1M34E 2CWWA 5BV2P 1Q77A 2R1VA 3DNMA 3RM3A 2AA3A 3AB7A 5D6NA 3RS5A 2Y68A 3T1TA 5GPBA 2V58A 5K03A 4N3GA 1GGKA 1P44A 3AXSA 5ALWA 5IC5A 9ABPA 4GLLA 2JLYA 2K87A 1N9KA 4Q9IA 3KETA 2A67A 3K8YA 3KKLA 3GQVA 3KQQA 4EABA 3U5TA 2HJWA 2I99A 4FCTA 3STXA 3RTAA 1FF9A 4N49A 2VPYA 2VPPA 5ESWA 1RW4A 1VFNA 3D3KA 2WU3A 2YXNA 5EI5A 2HMTA 3ZNQA 4JBXA 4LRXA 5TR9A 3PUKA 1BCRB 4ZAZA 2XCUA 1PW5A 1NBMA 3OWHA 1SXPA 3BYZA 3GCZA 3WLQA 4DA9A 1KY5A 1Z6GA 1ISMA 2HDHA 2QL5A 2XE8A 1BGXT 3SHQA 2FR1A 1ZU5A 2ZYWX 4J07A 1MN6A 3O6VA 2B2CA 4KSCA 3KU1A 1GA1A 1NBEA 2VDPB 2ZJZA 3DNFA 4RFLA 4CEHA 4FW9A 8LDHA 1A27A 2I33A 1N8KA 1YQQA 3GELA 1HE8B 1XZIA 5AI4A 2VRNA 4BQNA 4A0HA 5DHPA 4ZXPA 2GO1A 4CEJB 1HYGA 3EE6A 3MS7A 1EHYA 1MUUA 3A9TA 2Q9BA 2EDAA 2N1BA 3QSGA 1DBVO 1U2DA 1ZGHA 1PFYA 4GGMX 4OJQA 4XIGS 4Y18A 2H52A 5HCIA 1TQ4A 3LECA 5A9TA 4C2AA 5TGDA 1HX7A 2C5BA 2FPSA 1N77A 1FS4A 4I55A 4J43A 3IOMA 2RHGB 4AMVA 4BJ6A 4DG5A 5F4BA 4M6WA 2PUFA 3EVTA 2EJVA 3D5QA 4ZRMA 1WP4A 1RDFA 2Q9UA 2GCOA 3VOSA 4Z4QA 5KC9A 4B73A 2UXDB 1E1RD 5FUQA 4FNMA 3HPRA 3P9IA 4EUSA 4BXOB 1MVLA 3F7OA 4KR7A 1BGVA 4A3SA 3RSGA 2WJAA 1C7RA 2WV9A 4ZRNA 4AJPA 4PLTA 1AKRA 2HHLA 1E0KA 1QZUA 1ITZA 4B3GA 5HZHA 4M7PA 5G41A 1Y4SA 3T1QA 3QEKA 3IEIA 2C4TA 1KIMA 2GN9A 3FTDA 3T3OA 3EHDA 5AESA 1M1NA 2QN9A 3RO7A 3VV2A 2EQAA 1Q3TA 3Q2IA 3DH0A 2E49A 4CVNA 1AKTA 1E2NA 4MWGA 3ZCTA 3KZMA 2YWXA 3RIMA 3ZWDA 2JGKA 5C31A 2Z8YA 3EAGA 1UXHA 2B35A 4A2PA 4DNXA 4L7QA 4L8YA 1KAOA 2JAWA 4M1ZA 4EKGA 3EZYA 1KIAA 2MSLA 4ILEA 4RIGA 1C14A 1K63A 1V11A 4RS3A 3C7TA 3WE7A 2WQ7A 4EP1A 5HKKA 1P2FA 3AR6A 1YACA 1FNDA 3I0NA 5TGTA 4EQZA 4IEIA 5CBPB 1E3IA 2J9XB 3G85A 3H4IA 4PCVA 1KSGA 1YONA 5K3OA 2GF0A 5BR1A 4GSLA 5IF9A 5FFNA 4AQDA 1KTIA 1U2GC 4U39A 3ZDEA 1QZXA 3BMCA 3H5VA 5C5DA 4GLFA 3DVRX 1AMUA 4EHKA 4Q37A 5HF8A 1MIOA 4UUPA 3KJQA 2LCQA 2HLDD 4Q19A 4RGQA 1ISPA 4OI4A 1A5BB 4BAZA 1R0XA 4G37A 2FKAA 3IQHX 3V8PA 2PRYA 2XOXA 3L04A 4AJOA 4B40A 4F96A 3WIDA 4J6EA 5BSMA 2BE7A 4CCYB 5K6AA 2AC7A 4MGEA 5EG5A 3PYMA 3HMQA 5B58C 5JYBA 3I61A 1T10A 1RBMA 2LDBA 1RHJA 2BE9A 3QJ5A 5T8KC 1SA0A 5EWMA 5TX7A 4TLDA 5JRJA 4WKPA 2FW9A 5FWNA 4HJXA 3QFRA 9LDTA 2XQJA 4Z2AA 3DYIA 2X9NA 3TUZC 1JSCA 4CIVA 1VG0B 4I3HA 3DBHB 4TV8B 2ZTUA 4KR2A 3R3XA 2NQ2C 2VPZA 2HU7A 5TJ9A 4M0PA 4OYRA 2CVQA 4MX8A 3TZ6A 2YWEA 4QWWA 3L7AA 2RCYA 3QG5A 3NDIA 4I19A 1T9HA 4G4SP 2I62A 4TRRA 3PQ4A 3ENZA 3L7CA 5JMTA 4QUJA 1Z7GA 4WI1A 1XEWX 1PEDA 1IEVA 1NMEA 3CE6A 5ITSA 3C3KA 3TSOA 3B12A 5HA5A 3KO8A 4IDDA 3NJ8A 2YJNA 5I47A 4GX0A 4AZ3B 4DMKA 5KINB 2JFOA 2C3UA 4QBHA 4IH1A 2VHVA 5DM0A 3TIIA 1PR6A 1WLYA 4K9QA 1VC2A 4Z99A 5FOXA 3U3ZA 3LUPA 2DH5A 2OECA 5IT5A 3GU3A 1UKEA 1YTLA 1KGSA 2PPLA 3OHSX 5B3LA 3MBOA 4PONA 4ZHQF 1CT9A 1GRQA 1YB1A 2BFBB 5IT0A 2LIVA 4LIPD 1B6TA 5H3LA 4EY7A 1E2BA 1SU6A 3IDOA 2B8EA 3PFCA 3OQ1A 2P7IA 1JYEA 1UBKS 3VKVA 2GZDA 4P4LA 1AKYA 3ODGA 1N33B 1CR1A 5B7NA 4TSFD 3U44B 2FLKA 4Y9DA 3T52A 2ZAGA 2IY9A 4JOBA 1YB6A 4RGVA 3IXQA 2X4GA 3RGGA 5U9CA 1M1ZA 4C6RA 4DLAA 3B6KA 1MB0A 5IMBA 3DE1X 4EJSB 2ZE5A 3ZDBA 3AU8A 3RANA 2H4XA 3AHDA 4ARZB 3A6HA 3VU3A 1JN0A 2KLHA 5D7NA 3ELDA 2ALJA 4RHXA 4CUJA 2XYPA 1O96B 1Q50A 3BQ9A 3CZAA 4CMGA 2CL5A 2AEFA 1XTRA 3TM5A 3H8WA 2QIOA 3QOWA 1SBQA 5DNAA 3M6MD 4Q47A 3U7IA 3WGHA 4B2IA 5HUQA 1ADJA 3MJ4A 4KR3A 3JRXA 2PD3A 1V8BA 1HDCA 2BR3A 1AXGA 1EB9A 3HEBA 4V0NA 1JU9A 5LQMA 2IEIA 2WBLC 4XW2A 2CKDA 2XMZA 3PV0A 4BNNA 1WE2A 1JKJA 2GLUA 2VBFA 1L5MA 2QTVB 2OO7A 1UQRA 1A2OA 1S4MA 1H94A 4FSXA 1R0KA 3HVJA 3H5WA 2ZJ8A 2OBXA 3DBLA 3PXXA 2ZBUA 5EJFA 4ZAFA 4LNUA 1ZQ1A 1DRWA 2C95A 3ZY2A 3WHPA 2VEDA 3DTNA 1OXKB 3RKUA 2Z6UA 2ANCA 3ELBA 1QQBA 4Z0TA 2O4CA 1T4MA 1JRLA 2ZKLA 1PV2A 2VVTA 3KV1A 1M3SA 3RUEA 1U8CB 4BFLA 2I4OA 5UKDA 3Q5GA 2VQDA 1JTEA 2WWGA 4RFSA 1S8FA 4B6PA 4YRKA 5JCJD 4WOKA 2OGTA 1JIQA 5K01A 3E9YA 1K92A 5K4GA 2AG5A 4EDFA 3B6ZA 4MW0A 4EARA 4EEZA 4ZOQI 3R75A 4XVUA 5B4TA 2BSQA 1UH5A 3PYXA 3THSA 3O9ZA 4KB5A 3IEKA 3PNOA 2YVUA 4ZWNA 4B71A 3DEHA 4YRDA 1PJCA 2XCRB 3UIEA 1OZ0A 2BCEA 1TCCA 4HGRA 1GGNA 1VMEA 2CB0A 5FBZA 4EW6A 1GL3A 3WKCA 3PDIA 2WTUA 5T64A 1HTTA 4L5CA 3C3XA 4JI2B 2XBUA 3L4SO 8GPBA 1Y1QA 4GNRA 1IAQA 3QK7A 1I4OA 2IELA 4EB3A 2HA0A 1J7KA 3AEKA 1KFCB 3WJ2A 2CBXA 4BFCA 1EX1A 3R6LA 4JL5A 4CFYA 2HRZA 3BF8A 2J48A 4ARIA 2O2DA 5AJUA 4NMXB 3PUYA 4HWSA 4CEHB 4ZN6A 1E96A 1YH3A 4HB0A 4X8MA 4QX6A 7REQA 4R9RA 5EXSA 4QUEA 3E8SA 1NFFA 2CLFB 3GRVA 3L2OB 3GMSA 2ERYA 5E4TA 2FQWA 1JECA 1SC3A 4BBZA 4HB4A 5AVKA 4TXNA 4PV7A 1KMCA 5GGYA 3SG0A 4DA6A 2F3SA 2YWRA 4X92A 1U11A 1FYWA 2AZ4A 1OIVA 3IP3A 3PF8A 5ALXA 1GNVA 2A9KA 2E4UA 2QUHA 5AIAA 3UXEA 3ZHVA 2HPVA 3OLWA 2PSSA 2CUNA 2AZMA 4B81A 4ZVLA 2D54A 2QXYA 2ZUDA 1GYPA 4W9NA 5K0TA 3M9LA 4FD2A 4MP6A 3V48A 3UJ3X 1HO3A 4FW8A 2FAXA 4RJTA 3QHPA 1EVYA 4RDHA 3EVCA 3PJEA 3ZJ5A 1T43A 4DJFC 1B41A 1E60A 3V4RA 2HA4A 1RFLA 3K0FA 3AESA 3UY4A 1O8CA 4H4DA 3SDBA 4BX0A 2OV4A 5JOQA 2I6GA 2WT9A 4KYVA 1FVFA 1UBJS 2WFAA 1NT2A 3B2NA 3W1VA 4II3A 1YBMA 5IYZB 4EB6A 3ZCXA 5ELMA 3ROPA 2GUGA 3M6FA 4HH1A 2P2YA 1JG2A 1WB6A 2QRVA 4NE7A 1N3YA 3NVAA 4RMHA 3JZDA 5HOQA 1ZJJA 2ZJ3A 5E9JA 4IMIB 4ZA2A 1WEKA 1J2YA 1RI2A 1R6DA 4K46A 4D74A 1CSEE 2AWOA 3NTXA 4IL5A 4II7A 6REQB 5DHFA 4GSKA 1U2GA 4RESA 1KU0A 4YRCA 2HK6A 3U7JA 5EXTA 4EAAA 2Y66A 1C9KA 2PS0A 2DPMA 5F9FA 3RF6A 2POQX 1TJNA 1Y3CE 2H5LA 4M8LA 4ZVPA 3J7TA 5KZMB 5BW6B 3DMYA 4UBMA 5ALKA 4N7MA 3AP3A 1E2DA 2AYYA 1DC4A 5FOVA 3OTOB 1DJLA 1EGHA 1T5HX 2PPVA 3E2MA 1WV1A 3IPYA 3DO8A 2PH1A 1DX4A 1KRHA 2PZJA 3H2HA 3HO8A 3KPJA 1RLMA 1UWCA 5CFPA 1UZAA 4V3CA 1LSSA 1QHFA 2WJVA 3MWLA 3UVEA 4D8VA 1ADYA 4C7OA 3OIYA 1UDCA 5DLYA 4CL3A 3HA5A 1PL0A 1SKAA 4PZZA 4AS1A 1PWZA 1O95C 2D2FA 1MTOA 1ZMOA 5DI9A 1TM3E 3FPHA 3U9TA 3KRTA 4LZLA 1U8UA 2XYQA 1E69A 3P2MA 3R23A 5BW4A 1R3UA 4KN5A 2ZR8A 3B6EA 4J91A 3QVLA 3OZGA 5C3UA 3BIFA 3E22A 4FMBB 2PXCA 4E5NA 2R68A 3L1UA 1QIFA 2J3JA 5H02A 2XVYA 4DUYB 4A23A 3NCHA 4M89A 5A3QA 3PGKA 3GJYA 3SD7A 4D9MA 3NQ41 4EL0A 1XPOA 3PDWA 3SZOA 4QATA 1Z0IA 2ZRIA 4P81A 2PIAA 4Q3AA 4LFCB 5CDHA 1FA9A 4YYEA 4H7IA 1FP7A 3T4EA 4BNZA 1RCFA 2FXIA 2WJ3A 4K81B 4EHHA 3W6PA 5AJHA 4DQDA 1AQJA 3OWXA 1KO1A 4XIFA 5BN5B 5C1PA 4EFKA 5ALJA 3SE0A 3HCOA 1PJBA 4G1FA 1PKXA 3SWWA 1LDGA 4Q4AB 5DBGA 2H0AA 4WLEA 3B7GA 4YUYA 3OMLA 1D6NA 2LD4A 3TVTA 2C77A 1J09A 3IYLW 5JZMA 2IYVA 1NMXA 1QK5A 3IE1A 3DLHA 5BURA 1SIOA 2BGIA 2WZBA 1U0LA 2D00A 3AV0B 4LV5B 4UVHA 4J7UA 5AM3A 1HLFA 1Z5UA 4QXOA 4QOGA 1B74A 4O4LF 3RS7A 5LLDA 1NKVA 2P9TA 2C7GA 4AJ4A 5LD2B 3KJIA 4CUZA 1O8BA 3GC6A 4M0EA 4BE7B 2OILA 2IUFA 4MWZA 4RANA 4R71A 5EJ7A 1RRCA 1XMOB 1C50A 3I05A 2FSSA 1IG0A 3IR5A 1XZFA 4B46A 3TINA 8ATCA 1X7WB 1JHUA 4OSPA 2F67A 3A31A 1C3OA 4Z7QB 4OMFG 1MZVA 3D5TA 3Q12A 4LJ8A 4RY8A 4DQLA 1ENYA 3VPHA 3O95A 2WKPA 2V97A 4COOA 3WMGA 3QI7A 4C3OB 2CC2A 4OH1A 1XF1A 1NP7A 1SC4A 3DT9A 3G23A 1T2UA 4BL5A 2GM9A 4QDZA 3D43A 3NETA 3U09A 1GL7A 1K7FB 1USGA 1X1SA 2C00A 2BZGA 2PQMA 4LX0A 2PY6A 5DM2A 1ZS9A 1T9CA 1L1QA 3I76A 3P4UA 4RTLA 1Z6ZA 5A9SB 4JX9A 3Q7EA 1P7PA 4JBYA 3BXHA 3THWA 1VKOA 2EW2A 4JXXA 1JFLA 1OPXA 5JCPA 2AGVA 1XZCA 2OVFA 5CT8A 5KJ1A 3I30X 4F8JA 4AMUA 1Z2EA 2ZRCA 3PCTA 5CB8A 1EBBA 3L01A 3OPMA 3QFTA 3TI7A 4K7JA 3ZK9A 3GXBA 3EUAA 3DHVA 2R85A 1GL9B 4S1WA 4TPKA 4DCGA 1XXHB 2F3RA 4DEYA 1N2GA 3KC2A 2QBYB 5AUQA 3VR6H 2ZQYA 2ZT7A 4U3JB 1UJ2A 3O1LA