1BZYA

Human hgprtase with transition state inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
214
structure length
214
Chain Sequence
SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphoribosyltransferase
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title The 2.0 A structure of human hypoxanthine-guanine phosphoribosyltransferase in complex with a transition-state analog inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 1998-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bzyA00
2PS1A 1I14A 3LRTA 2FXVA 3O7MA 4LZOA 4QYIB 4RHXA 1UPUA 1XTVA 3M3HA 4LYYA 4P82A 3QW4B 4M0PA 1U9ZA 4RANA 2DY0A 4P81A 1Y0BA 2JKYA 4RAOA 4RV4A 1O57A 5IPFA 1P19A 4RQBA 2PRYA 3G6WA 1G9TA 4LZNA 4PAWA 4RACA 4KN6A 1ZN8A 2H06A 1XTUA 4S2UA 1O5OA 1I5EA 1TC2A 4QYIA 1I13A 4M0KA 1QK5A 1BZYA 2H07A 1G2PA 1QB8A 4ZFNA 3DMPA 4QRIA 4LYGA 4RHUA 1MZVA 4RHTA 1ECFA 1U9YA 1NULA 1XZNA 3EFHA 4P84A 2E55A 1G2QA 1P4AA 1I0LA 1A95A 3GEPA 1HMPA 1DBRA 1DKRA 2EHJA 3S5JA 1ECBA 1A3CA 4P80A 3NAGA 4P86A 1GRVA 1Z7GA 4IJQA 4WMLA 3N2LA 1ECJA 2IGBA 4Z1OA 1GPH1 1VSTA 4RADA 3LPNA 5KAMA 1TC1A 2YZKA 4P83A 4WN3A 1BD4A 1XZ8A 1VCHA 1PZMA 2JBHA 3DEZA 1UPFA 1P17A 1A97A 1QK3A 5IAOA 1NONA 3GGCA 4PFQA 1CJBA 1QCDA 5EUCA 3DAHA 2AEEA 1JLRA 2C4KA 2XBUA 5BQPA 2WNSA 1QB7A 1FSGA 3MJDA 1OPRA 1VDMA 1HGXA 2H08A 4OHCA 4RHYA 5K51A 5JSQA 1LH0A 1STOA 1ZN7A 4RQAA 1DQPA 4X44A 5BSKA 3MBIA 1YFZA 4MB6A 1A4XA 1JLSA 3OZFA 4TWBA 1IBSA 1OROA 1P18A 5HKLA 3ACCA 2GEBA 1ZN9A 1R3UA 4X45A 1V9SA 1A98A 1XTTA 5BQOA 1ECCA 2PRZA 2HCRA 1I0IA 3HVUA 1BD3A 4RABA 1DKUA 3ACDA 3OHPA 4P3KA 4LZAA 1L1QA 1D6NA 3ACBA 3KB8A 1OREA 1AO0A 4F8EA 1A96A 4JITA 2JI4A 4JLSA 5ESXA 2P1ZA 4M0UA 1DQNA 5E38A 2VFAA 5ESWA 1ECGA 4RAQA 1L1RA 1WD5A 1G9SA 5KAPA 3GGJA 3H83A 5BRNA 1J7JA 3OZGA 1UFRA 2JKZA 1QCCA 5HIAA 1QK4A 5JV5A 1W30A 4FYMA
chains in the Genus database with same CATH superfamily
2G04A 4QEDA 2GQ0A 3VKUA 2R00A 5J43A 5B1HA 1H0HA 5FWYB 5LC1A 5LQDA 2QSYA 4HWGA 3ZVMA 3ICVA 3PJGA 5AJYA 1LLFA 3CFYA 2ZDGA 4UW9A 4ZV9A 3H04A 3JVUA 2FE1A 4PNHA 5K3CA 4CMEC 4DJDC 1XRLA 1E99A 1TL7C 1JEQA 3PXXA 4OHRA 1QU2A 3EB9A 1Z0AA 1OFHA 2W71A 1A8UA 2C2BA 4G0VA 4RBNA 1EVEA 2RAVA 5DTRA 4AP5A 4EB6A 2C42A 3GBPA 2GBFA 4E7OA 4E14A 2OE2A 2O05A 4LBVA 4F4FA 2CZGA 2YICA 2Y4NA 5DM2A 1VB5A 3O21A 4CV2A 3ET5A 4IJ5A 4RLFA 1UKEA 2VPQA 4JEIA 2HPZA 4YCCA 5BW5A 4Q18A 4Z0NA 1KKMA 3V8RA 1E2KA 2PMEA 1A9PA 1DINA 3PJDA 1BXKA 4L16A 4IHKA 1IY0A 4HTFB 4DA9A 2BMVA 2CD9A 2G8NA 3ENZA 1J90A 4L8GA 4A0HA 4AY3A 1SCAA 4IICA 4C7VA 1YIAA 4PLHA 4OI1A 1B3RA 4GOJA 1K92A 1XU4A 2QTHA 1JHDA 2PH5A 1SC6A 4OQFA 3UKOA 1JR3D 5BWMA 2CKDA 2H1WA 1XMJA 1DMRA 2V6MA 3KD2A 3EZYA 3SQMA 4XJTA 1Z7GA 4CIXA 2EFYA 4HP8A 1XPRA 2XHEA 2DKNA 4BKMA 2V4UA 1IM8A 3A4TA 4XOIA 5LOVA 2O8FB 2FSVC 2OP0A 1O8BA 4F8YA 3NBXX 1O4VA 1SU6A 2WLTA 4AF8A 3IA2A 4JLNA 4AURA 4CKBB 1J56A 4R51A 3DWEX 4G4SO 3ZIUA 3EDQA 5CFZA 1KBOA 4F0JA 3EA5A 3ILVA 4FYJA 4Q21A 3BZBA 2AKAB 2XXAB 1QVZA 2AYYA 3F9CA 2QJOA 3G0GA 2QLLA 4J03A 2HMUA 1X86B 1OXBB 1QB7A 1CR4A 4HUQB 1C9EA 2W48A 1BE6A 1LBHA 1Z37A 4L4RA 4WTOA 2Y2VA 4KR9A 4DRZA 2ZIZA 4ETWA 5I7WA 5CIYA 1Z5ZA 3WYEA 1G8HA 5BNFA 3CW9A 2HCBA 1NXVA 1DKQA 4FMDF 2B20A 2C5EA 3A1UA 1ZM4A 3R2JA 2FPOA 1WBDA 2EYQA 1L7EA 4RXTA 3JQRA 1VBNA 3A1DA 1WABA 1NG9A 1LC0A 2A5DA 4UTZA 5K3AA 4IPTA 1DFHA 4YACA 2HJSA 4A92A 4P34A 3LHFA 4RFSA 4DCOA 5LMUB 4I6EA 2GCGA 1RR6A 4UBNA 3AUXA 4AJ1A 3OP4A 4I1UA 2JH8A 2WOOA 4LMRA 2Z2ZA 3G8CA 1K7FB 4R8LA 3NHFA 1HDRA 1P4RA 1X1BA 4OKNA 4YR9A 1VIMA 4AS1A 2VFAA 2SHKA 2OQRA 5JCPA 1L4LA 4WE3A 1ZM9A 2IBMA 3S2ZA 4LYFA 3ZD7A 2OFOA 3PRYA 2F00A 4N54A 4QYXA 3T3PB 5GY7A 5CA0F 2JBWA 4IR7A 2HM7A 5CVDA 5K3BA 4E33A 3LT0A 2WT9A 3ZU6A 4TM7A 4YJKA 5B7GA 4MKRA 2BBOA 2PV0A 4LN1A 2VIIA 2DSTA 2W8BA 1PJAA 1QRDA 1Z22A 2IH2A 1CJCA 2DETA 4N47A 2B83A 1CZUA 2E4UA 1GFWA 2QTMA 5JJIA 3L0DA 3F74A 3A32A 1GA4A 1AT1A 2EC5A 3Q8WA 3PFBA 4OREX 4PLTA 4Q1BA 5EHNA 4JVSB 1QF6A 3AKCA 3Q2IA 4RWEA 3QVMA 1IVNA 1MJHA 1AU9A 2NSYA 1TLLA 2PD6A 2PXXA 1MXFA 3QIAA 3QV2A 5CNIA 1SCKA 3KS9A 3TDKA 5KSOA 4A5SA 1PS0A 1PIWA 1X8XA 4D9EA 3SJ7A 3ELYA 2GVDC 1HUQA 3MAAC 4N8SA 3IQEA 1SZCA 5CDFE 1DIBA 2XUQA 2B7CA 5CNJA 1FDIA 4CT4B 2B5OA 2IYPA 4Y2UA 4CZ2A 4DQLA 4JB8A 5J23A 1SA0B 5MFPA 4ND8B 1ACMA 4NMMA 3INYA 1FNBA 2D8MA 4MMZB 2CXNA 2G4VA 2BUBA 1WXGA 3BEDA 4DIKA 3SQNA 4E31A 3JWGA 2HA5A 1UOOA 1NUPA 3Q9UA 3QVTA 3PJRA 1CDOA 4MVWA 4L5BA 2AKYA 2HFKA 3FSGD 3GEHA 4G5GA 4IQ4A 4MK4A 4B3HA 5A1JA 3QOXA 4ERXA 1V11A 1AS3A 3UAXA 1Z82A 2VSXA 2OENG 4FEEA 4YRQA 5FTLA 4ACAA 3L4KA 2XCLA 4N5NA 3FLMA 4HAWA 4NVRA 4ZIRA 1ZC3A 4D99A 5K0BA 1MO4A 4NS4A 4OB7A 2C57A 4DRYA 4M1WA 4LG1A 5LXTB 1VCNA 3DW1X 1BFUA 1KH1A 3AF3A 5C7LO 1WSDA 2G1UA 2YWEA 3D7NA 3CIFA 3MVEA 4CGYA 4D7AA 1SC9A 2ZUSA 5L7YA 4IH9A 2FTKE 3NDBB 1QBGA 2C95A 1UEXC 4IZOA 1O54A 3TSYA 1T8WA 2SKEA 2OO3A 3PZBA 3TLAA 2QLJA 1ZOSA 3EEFA 3II6X 2CEAA 1QLWA 2V7BA 3QWHA 3FVTA 5F98A 2OZVA 1AVTA 1I10A 1U3DA 2PGXA 2SICE 1DKLA 2FN9A 3N0RA 3OCXA 2PX8A 3SEAA 3RRFA 4POAA 5AUQA 4EG7A 5BMVB 5ENZA 4OHCA 2R6DA 3H4TA 4P5DA 2VHZA 5LCXA 4ILEA 3TOVA 1RAGA 5BSKA 3BE5A 5KJ6A 5ILOA 3JASB 1QRTA 1DADA 3LUPA 4KNWA 1CEEA 3ED1A 3EA0A 4BP1A 4NQRA 1IJEA 4KQHA 5HZMA 2CLHB 3IIEA 4D4MA 2ZSJA 4CKYA 4OU5A 3CSDA 5JO9A 2O9JA 5L3VA 2Y99A 4X45A 3PSAA 3BGWA 4Q93A 3UWSA 2GASA 1NJFA 2WD8A 2Z57A 5DTMA 4US1R 1UXGA 1RJ9A 1P5HA 1JU3A 3GUYA 3L46A 4R2JA 1WJGA 1NJ8A 1CBUA 3E1SA 1NMYA 4UBMA 3S7TA 1Y3IA 2JJ1D 2WFZA 3DUFA 4MI3A 4EP1A 2G8LA 1H3NA 5THKA 4NEHB 2QN9A 4QPCA 3ZOZA 4QUAA 4MDFA 1X8LA 2BBWA 1XA4A 1T35A 2FRDA 1WB5A 3IJRA 2KWIA 5FBQB 5GAJA 1KGDA 3B6IA 4RIFA 2FQ1A 3A1VA 5IP5A 2QM3A 4MR8A 5AK5A 4BNVA 1JDBB 2ACWA 1YZQA 2ASVA 3EYWA 2MR5A 5IJWA 2O57A 4G97A 4BQEA 2PA3A 4XWTA 5TC4A 1QWSA 1HKHA 1P5FA 3Q3CA 3SXUB 2J3EA 3RYIA 3UHAA 1U2TA 3I6QA 1KWGA 3F98A 4MV1A 4ANFA 2EFEB 2OM2A 1GOTA 2QRPA 1P9RA 2ROQA 2VTEA 3FCOA 5B3AA 3AY6A 3DXFA 3ETNA 3QENA 4G5SA 4QBTA 4Z86A 4ZCIA 4FEGA 2WD9A 1K6XA 3OY7A 3T1TA 1N2CA 2O0JA 2E82A 3EEIA 3HCFA 4NPCA 3T7JA 4AKEA 1I51A 4P3PA 4ZAZA 2P68A 4UBKA 1GNPA 1V37A 4YCAA 2CYBA 3ZHBA 4TTTS 1F3OA 3G6WA 4S05A 3MILA 2Q29A 3FGZA 3KOUA 5EWLB 1M1ZA 1C9MA 3GVHA 4KPGA 3UXMA 5H4GA 1RWXA 2ZULA 4D3YA 3E23A 1NXWA 3AI7A 1UAYA 3GT0A 3MRSA 3NTQA 4P33A 5CFRA 4D4IA 2ZT8A 1YQ9A 1LA2A 1PR3A 3HKEB 3WSWA 1OFUX 1BHSA 1SXGA 4CLOB 2WHPB 3UWKA 1XXHE 4TWIA 4E70A 1QHGA 2XWJI 3FMIA 3QVVA 3N58A 4MA4A 1BCSB 2GLTA 5FD8A 3W9YA 2XA9A 3ZCXA 1XEWY 2AZDA 5CA1B 2FMXA 1W1WA 1QIFA 3N5CA 4A0RA 1G8FA 5BMOA 2HBQA 4KWTA 1M2NA 4XQCA 3NAGA 4D92A 5D2CA 4KO8A 5DT2A 1LDYA 4DW8A 4UTVA 3PBKA 1S3GA 3VO2A 2H7CA 1BH2A 2IIBA 3GGPA 2G70A 4QJIA 2IDJA 5TS3A 4C78A 3FJOA 4D25A 3AVTA 1G5HA 1N2GA 1UMBB 4ZCSA 1UKZA 5F23A 2GN1A 2X76A 5LOVF 3UVEA 1MX9A 2O8BA 3VOSA 1YDFA 2I5PO 3W5CA 3NFYA 2VH1A 2QPTA 2RHCA 5KWEA 3R8FA 1VJTA 4HDAA 3NV7A 1ZISA 3GROA 2CK3A 2Z43A 4YCSA 2DTDA 2AEJA 5ITZB 1N34B 1PG5A 4N5MA 1AOXA 4XIJA 4HH4A 2NX2A 3JQQA 4DAEA 1I94B 4QQRA 5HTKA 2HIGA 3BF7A 1M10A 1T13A 2HA6A 4RVNA 1Q2UA 3AL0C 5K0SA 1YB4A 3PC7A 4YB8A 4OLAA 1SG9A 1E3EA 1U98A 1P2SA 1IOZA 4I4TA 2W2LD 4EECA 3OFND 1WL8A 4FHCA 4FGWA 5HKLA 4E5KA 1JDUA 1SNYA 3KT6A 4QTTB 2MYNA 3VPHA 2NP7A 4ND4A 2JAXA 4OH7A 1K4MA 1BWQA 4TL9A 4PW0A 3H5WA 3DT8A 3VXKA 2PEYA 2IKQA 4IJKA 1N8KA 5FUVA 4JJZA 5C8DA 3TI9A 4HATA 4EY8A 5I7FA 3A36A 4IDNA 2WAOA 3G8AA 2M2IA 3GFRA 1T0HB 3TZQA 5A9RA 1EBBA 2YZNA 4QO7A 3OSUA 2GTHA 3DP9A 3N6XA 1Q1NA 2ZP1A 3HWSA 1WW8A 4UE3S 5DHTA 3ZY2A 4DR6B 5AKKA 3VGPA 4M9RA 3EVDA 3A04A 3FNGA 3V48A 2J41A 3NGMA 1E1KA 3K35A 1MX3A 3U13A 2JFXA 4AROA 2IXFA 4IWYA 4JYZA 4OAQA 2PLWA 4ND3A 2C5SA 3CH4B 4H7PA 3LBYA 1Z0UA 1JV2B 5IT0A 4RDCA 4U0KA 1JALA 1IHPA 3TRDA 3KPUA 4JS0A 2P7IA 4ESOA 2UUBB 1UKYA 2F7SA 4E5MA 3UK7A 2JH3A 3LF2A 4JYMA 1RLTA 1XVTA 5FI0B 1FP1D 1QFZA 4DSTA 1PK7A 2QK4A 1IWOA 2RFLA 3H5VA 5LZ8A 2XWSA 4UU1A 1X7WA 2PUVA 3B52X 4GYJA 2YZ2A 1T6NA 1ZWKA 1L5HA 1ODIA 4DUZB 2ZRPA 5COBA 3IERA 2JCGA 3R09A 1HEYA 2Y05A 3AHDA 1U2ZA 2G7MC 4ZDIA 1I6KA 3M81A 1I3KA 2IPNA 4YQFA 1OVMA 1QB8A 2IXTA 2PL5A 3FDJA 2PK3A 4G1VA 4P53A 4F3KA 3IEXA 1LRLA 4F3NA 2P78A 4NYMR 4JLKA 1ENZA 4A6EA 1SCBA 4WCFB 3TN7A 4EJ2A 3VQTA 5FL3A 3JPYA 2ZI5A 5EI5A 3JYOA 2Q5OA 3N70A 4JUBA 2W6MA 3ZBPA 2FEOA 1QUFA 1YZVA 2J5QA 4BMSA 5KQRA 4XUCA 4LFCB 3IPRA 4GC9A 3RVMA 6CHYA 2VAMA 2IXEA 2PPLA 1W48A 1X0VA 3D3WA 1L7NA 1J9EA 2AMYA 4KNVA 4ZKDA 3J81k 1YVEI 2OBMA 3A4VA 1XTIA 4YMHA 2FWNA 5CT6A 1MPTA 3VNVA 3DDUA 2IXGA 3F1KA 3ROPA 1M74A 2WWYA 2BKAA 2Y0CA 3W1VA 2GPYA 2LUOA 3DDWA 2X86A 2GZ3A 4NBLA 5HRAA 16PKA 1K8RA 4J2HA 1QKJA 1YR9A 4WK6A 4V0OA 1SVUA 4YEDA 3W5HA 5K3OA 2K2WA 4QSHA 3RU2A 3I9V1 4IIDA 3HH8A 2I1LA 3LC7O 3OZAA 2EWVA 4AC9A 1M2FA 5GVSA 3LYHA 3VRHA 3LKZA 3K9HA 4KO4S 4A8PA 1AS0A 1J1UA 3PNMA 4JZKA 1E64A 3PE4A 4OAOA 5M29A 3TRFA 1W75A 2A33A 4RCVA 3O8CA 4EVQA 3CKYA 4M99A 1H6DA 1V4VA 2YWXA 3U0BA 2YIMA 1DAGA 3FPHA 4PRLA 4KR7A 2QGFA 1XFDA 1ZIYA 3FN4A 3AVQA 1I3NA 1SU4A 3FHLA 5ALWA 1JJAA 1GRQA 4NG4A 1U8AA 2KPOA 4ZC8A 3QF4A 1YZYA 3KPVA 2C84A 3CGWA 2AC2A 1TLFA 3MT9A 4NZMA 1FFDA 4HFMA 1FXSA 1NTOA 2XMPA 1IVSA 1RJEA 1U80A 3NYIA 3T5MA 4BNKA 1VBFA 4X7BA 1DG9A 1I8TA 5CDUA 4UJ5A 7REQA 5KBYA 4DJAA 1A77A 5GM1A 2VT6A 5JAQA 4G24A 4BDSA 1YNSA 5CEFA 1FDRA 3B3FA 4AQ7A 2J0QA 3BPSA 2UUPA 4WKPA 1QC5A 3F67A 4J3JA 1ISSA 4UVIA 2FFRA 1RQRA 3CRRA 1RQPA 2A94A 4K88A 1Z08A 1CEQA 2D5CA 2Q4BA 1XDGA 1OU0A 2G9VA 4AZ3A 2RH9B 4MWZA 4HLUA 3PLRA 4P54A 4TMYA 1KPGA 1OU4A 3BL5A 3S27A 4EPRA 3CF4A 2GF2A 5I48A 1NVAA 4DM3A 4TRNA 5D3MB 3S99A 1T0PA 4YALA 4ZZ0A 1REQA 3D31A 4MV8A 3VISA 2EBUA 1CHDA 1IBMB 2W43A 3EQ9A 1QP8A 3G13A 2JLCA 2BM0A 2P2GA 2ZI4A 2A0KA 4JL8A 3R7AA 4EMBA 2KBFA 3OBBA 5L4NA 1R66A 3LX4A 4F1WA 3DZGA 2BT4A 2R1TB 3O4IA 5AW8A 3ITEA 1JWBB 3SX4A 1C41A 3ZN2A 5BW8A 1YU6A 3ZWOA 2ZBDA 5FEMA 3OQNA 3NPMA 4HGNA 4CEIA 1MORA 1ZIPA 3KZCA 4KPEC 2EFGA 3L7JA 4KV7A 5KC8A 3HLYA 3BJMA 4IMIB 5EUMA 4RF5A 4WINA 4H17A 1ZJ4A 1U9IA 3EOBI 3CLUD 4DLBA 3PEVA 5ISMA 4DBLE 1W85A 4RKQA 2VHTA 3UMVA 1BA2A 1NKSA 4KU4A 1OI7A 1TW2A 3GUVA 3NHAA 4L0DA 1NQWA 4XWAA 3LG2A 4ZARA 3ZCVA 1ZY2A 2X3FA 4IGAA 1KRWA 3QX9A 4ZAXA 3UJBA 1RW4A 1MB2A 2YYYA 1FF9A 2NU6B 4ZEOA 4C4ZA 2V03A 1Z26A 3KLNA 1E1CA 1O1YA 3BJRA 4X1OA 3ZZUA 5BURA 2CV0A 4IXWA 5IJ0A 5JC8A 3ENQA 1Y98A 4EHIA 4NXNB 4X1KB 4N12A 5FLKA 5LP6A 1DTWA 2QMYA 5AKLA 3R5TA 1J9ZA 2JLQA 3QYJA 3INRA 4ERNA 1RRCA 4D9FA 1MR3F 2OVBA 2IL1A 3K16A 1P1KA 4FYPA 4LYEA 1A5BB 1UDWA 2PWAA 4Q1VA 3USZA 5I3CA 3K2BA 1BD4A 4U2DA 5JEDA 1X77A 3FYHA 3MWJA 3QF4B 5LA6B 4B6RA 3D0QA 3BL6A 2CNLA 4G1EB 4K46A 4K81B 3ZEAA 3SM3A 1UZAA 3F7MA 3IUYA 3MTAA 4MKXA 5ERGB 3U3KA 4Q9KA 3SGLA 5BN5A 3UK0A 3EXG1 1NSYA 1Y9ZA 3LCCA 2HQSA 7REQB 2XB4A 2EWMA 1ADBA 2RGYA 3IQGX 4H18A 4L02A 4EFNA 1QM5A 3KSDO 2A4KA 3LQFA 4P92A 3QBDA 3TLJA 4LQCA 3NTLA 4HMPA 4K05A 3VZPA 4GBED 1NKTA 4PZUA 4DM4A 3K6SB 1KY4A 3MINB 1DJQA 1HETA 1U7ZA 5ALYA 3TRIA 2YJ3A 1X7GA 4UD6A 2AUNA 4HNQA 1W49A 4K03A 4UUMA 5DW0A 3F3KA 1AHIA 1QZXA 1WSAA 2VWGA 3BB3A 4IX9A 3ASZA 1GUYA 4W4TA 4OMFG 3DMRA 3AK4A 1ABEA 3IOBA 4JQOA 4ZO8A 2HZBA 4I4TF 3Q0EA 4GF5A 1SZPA 4RPIA 3UK1A 3L92A 1I0IA 1V1RA 1J33A 3OZUA 2JARA 1GTL1 1PN3A 3JTMA 4TKVB 3TXXA 4DB4A 3ACBA 3ZHXA 2EJWA 4A36A 1UANA 1FY2A 4Y1RA 2XMRA 5EIOA 3FYDA 3V80A 5HKKD 1E5VA 5EJ6A 2GH1A 4KQCA 1GGJA 1MV8A 1ZUNB 2ZUDA 2ONJA 2JVIA 3T4EA 1H93A 2DTEA 1X7ZA 4L9RA 4YGXB 3T7AA 4CV1A 1ZR4A 1D9ZA 4KTVE 1V43A 2OR3A 2XHZA 3R6GA 2BFFA 2VKQA 3UB4A 5H9WA 4INOA 2ISCA 3K8YA 5CUQA 3JAKB 4P8RA 4LVNA 3EUFA 1U2EA 5BVHB 5KTOA 3OKFA 2H2GA 3WG9A 1R6DA 4HDKA 4DGSA 3HZZA 1QHHA 2IYWA 1YAJA 5TDHA 4CIWA 2X0KA 3BIXA 3FY4A 2DSNA 4ETMA 1QDLB 2YFHA 4LOHA 5LVAA 2B6HA 3P2OA 4JJKA 1OC4A 2WVGA 4YI5A 3OLWA 5BYJA 2IH5A 4GWKA 1KXZA 5A6SA 5ALDA 5LP6B 5EIBD 1ZGJA 3ORSA 4AY4A 3ITNA 3RSCA 3LHIA 3ENNA 2QUKA 5EP4A 3L02A 1AD2A 1V1MB 1ISGA 1YAHA 2JLRA 2UVQA 3F78A 3HDJA 1G20A 5TGDA 4B6GA 2O1EA 1SXJC 5I8ZA 3MCTA 3CUYA 3H8SA 4MRMB 1LWOA 4E5NA 4F6RA 2PKEA 1VL2A 2F48A 1MZVA 4QGHA 4UMVA 1FDUA 3KFXA 4ZT6A 5JZSA 1S2NA 1UMCA 3GVPA 5BN5B 3U40A 1IEWA 4R68A 2J0EA 3DG9A 3VOAA 3G0OA 1PJ2A 4LJ5A 1JMVA 2WV7A 1GU7A 2VDWB 2C2KA 1W4ZA 4MSUA 3RTBA 5AXBA 2PZMA 1LI5A 3CU5A 1SVMA 2R6ZA 4B3CA 2WYOA 5TJ9A 4OQDA 4YRTA 3ZYCA 1YVUA 3AIKA 1NJ2A 1U0TA 4UPDA 3TOCA 2P90A 2YOHA 1T1RA 3L4EA 5T67A 6YASA 2D06A 4P2GA 3TPZA 3D0KA 2BZGA 3KKMA 1SIBE 3BERA 2GAIA 4W1SA 4RYDA 4D3FA 5JDIC 3EPJA 1GSHA 2ZI9A 2UVDA 1EU1A 1GPYA 1ZVKA 4JKYA 3CURA 3RV4A 3TMYA 2X8AA 1RWWA 1YUBA 3FOAA 5IAOA 1E9FA 5A0TA 4NESA 5DI3A 1AHPA 3DEKA 2DLCX 2SECE 3R6DA 4CI0B 4ZYZA 2VZLA 4KG7A 3UJ8A 2D1RA 3EGIA 2AEFA 3IQXA 5A0FA 2VSNA 3ABIA 3F6RA 2WUGA 2MINA 4MS3B 5JSZA 1MW9X 3AR3A 3ZCRA 1LKZA 2PX3A 3CH5A 2FPLA 3BMNA 4L0MA 1OWPA 1UM9B 2HADA 1K8ZB 4OHZA 4EYSA 3NVAA 5JSQA 2FPIA 2AGVA 1WVIA 4WKBA 2P9ZA 1Q0TA 2EJVA 3T61A 5IG2A 1XD2A 2C7BA 2BFCA 2ZB4A 5IKEA 4O2RA 5KJ1A 3IMFA 1GZ4A 3ZNOA 1SOWA 1PG0A 3IC5A 5GV8A 5IBQA 3RIHA 1OXVA 1XZGA 4IDBA 4FFDA 3TZKA 1NU8A 1PX0A 3RVPA 5HF9A 1HK7A 1Z3IX 1YOBA 4H7KA 4C43A 5JLAA 2FB9A 1SCNE 1TO6A 4XFJA 3GJZA 1PGOA 2C00A 1O3YA 2RHWA 3KUDA 3RROA 3TZCA 1JI3A 3CUTA 1E63A 4WA7A 2ABWA 2PRSA 3A25A 1PT7A 3TBKA 5I4IA 2MOKA 2Z83A 4INJA 4FFBA 3LW8A 3ID6C 3PPWA 3WFZA 2XQFA 3QI7A 3MJEA 1VM6A 2EZ9A 2VN8A 4KXXA 4PSCA 3STUA 4HCJA 1VI6A 4GVXA 4ZT2A 2RHOA 1HF3A 1E8NA 4HAYA 5KS2A 1WEKA 3HJCA 2IDKA 2ZVDA 3WJAA 4D97A 5B7NA 3FCUB 4ZALA 3W2HA 2Z08A 5ALJA 4MLPA 2J8ZA 3THXB 2QRVA 2ZRHA 1HT1E 1EJBA 3JD0A 2PS0A 1DT5A 3QEKA 2J9GA 3QPAA 4XE5A 1T9BA 4L6AA 5DP2A 3EIWA 4BKOA 1E3SA 2YJZA 1QGED 1ZR2A 1L5VA 2IZ5A 5DX8A 2XTAA 4BYMA 3O7WA 4U8HA 1RLUA 4Q3AA 1IBCA 4FPXA 2HHLA 2NZ8A 2R4QA 4PV7A 4A10A 1CV2A 2OAP1 1T3GA 3OQJA 4HB2A 4FWIB 3VR0A 1X9HA 4M0PA 4O2AB 1W36B 5FO0A 3OLZA 1Q92A 1XJ5A 1T9ZA 2QSJA 1ML4A 1WMDA 1KYIA 2FG5A 3R0XA 1MTZA 5UKDA 1RCFA 2B5WA 4QSMA 1OLUA 4WFKA 1DDIA 2N75A 1TVMA 2QRQA 3VM6A 4DR4B 3FIJA 4HWOA 5FCDA 2HO4A 4NBWA 3OWOA 5I45A 2MDTA 4QRIA 5HJ2A 3HCOA 1MKYA 2AFHE 3TUZC 1PR9A 4EEZA 3RK1A 4QWMA 4CFSA 3LUAA 3OEYA 1ENYA 4GKAA 4CLDA 3FZGA 1QOQB 2VL7A 2ZBEA 3VNSA 4I3HA 1NR5A 1P8AA 2YV1A 2ADMA 1HMPA 2W2XA 3ZI0A 1NVDA 2Y0PA 1G21E 4PCUA 1ITZA 1HE2A 1S7CA 1S9HA 2AR7A 3OU6A 4YASA 3PD7A 3CCCA 3KTAA 5JRZA 1WTAA 4ND6A 4PVDA 2AZ4A 1GUDA 4JJGA 1ID8A 3MFYA 4H1TA 3HBFA 1EYZA 3PA6A 2MT9A 4JXKA 1CF9A 1ZK3A 1FS5A 1Z2NX 4WN3A 1CERA 1F60A 1DJOA 1T9DA 3UCXA 1IJFA 1KFEB 2FPSA 1USGA 1YQQA 1BOFA 3PE6A 4RL6A 3ROKA 4IQ0A 3RYCA 2BUAA 3HE3A 3Q8KA 1ZMBA 4M9SA 4FD2A 4F93B 2WWVD 3NFRA 5EIWA 1Z68A 4MPPA 3B1YA 3UXHA 2UYOA 5THQA 5C52B 2AFHB 3K0AA 4U7PB 5F2NA 1QU3A 2QLBA 3CX8A 3PXDA 2R6R1 1FTQA 4LYDA 3ZDYB 3R24A 1IPFA 1ES9A 2PGAA 2FR0A 3CRMA 1PTJA 1RRMA 3HSYA 3OEHD 5AFSA 5L40A 3T5PA 1ZDMA 3AVVA 5DGTA 5EPOA 1VGRA 4HX5A 4GLBA 3ULKA 3RRXA 3A1FA 3KQLA 1G21B 1RKXA 3CRW1 4ASUA 1NWCA 2P35A 1AHNA 4H08A 3TQCA 4ML3A 1JT2A 2FSUA 3BIWA 3CO0S 3DDHA 4TSFA 1B0PA 1FYXA 1P7ZA 1UC4B 4HRXA 3T94A 1ZCZA 1JT9A 2F1JA 3L49A 1XPUA 4HLDA 1VLVA 5H3LA 2UZIR 1AA9A 1ZNQO 1HTBA 3WWYA 3F6SA 3MHTA 2QU8A 5TQ0B 2QAGC 1LVUA 4RA9B 1I01A 5DDIP 3RHTA 3UA4A 1XEFA 3K9BA 4RZIA 3GLVA 1NJ6A 4BWGA 5JNSA 2FWJA 2X3YA 1E1MA 5AVJA 2H0RA 1HR0B 1LBQA 4J0JA 1FJHA 4RNCA 3ORHA 5G41A 3RHFA 3KZKA 5TQ0A 1PT8A 2ZTMA 1OLUB 2DWUA 3LFTA 3BGOS 3N0VA 3NR2A 4TMVA 2KBEA 4XVHA 4BEJA 4DCJA 4PO9A 4IS3A 5CB8A 2FX3A 3HN6A 1SXPA 3V8EA 2GLUA 4DYDA 2PS1A 4QBIA 4Q24A 1T29A 3IQWA 2JDID 2BRUA 1NW7A 3AEXA 1P7PA 1EFPA 5D51S 4PFKA 4C3VA 5AJHA 4EJSA 3BXHA 4P36A 5C3MA 1UWCA 2VEDA 3GIWA 2XT6A 3N3AC 1QG2A 1Q11A 1XWFA 1ZK1A 3PQ6A 2DXIA 1MABB 3OCVA 5DIFA 3BBLA 4I81A 3ZHCA 5K0EA 5CD9A 2B1GA 4OHUA 4R40A 4KLRA 4PO3X 1TJYA 4TSKA 4XLZA 3SQOA 2XE7A 1MAWA 1J0CA 4X7RA 2F3SA 4RWZA 1P19A 3L1KA 2REXB 2QTCA 3MTJA 2VDMB 5JS8A 5DGXA 5IMBA 3QLUC 1KYWA 3A28A 4UXHA 1JDNA 4CQJA 4BVAA 3JQGB 5LYJB 1NASA 2Q4EA 4JQSA 1KDVA 4EKDA 5JZVA 3VHXB 4IG9A 3HO1A 2FQYA 4IDEA 3S7ZA 2P9EA 4BCDA 1Z5NA 4MWSA 4QU5A 3OTQA 3VR4H 2WWXA 4KNYA 1ZZGA 4M9ZA 2LKDA 2DQ4A 4MQ4A 5D87A 4LF4B 1NUTA 2XYHA 3FBWA 5A1TA 3UHJA 2C2OA 3UA3A 1JW9B 2QROA 1X74A 3CEPB 1DLJA 2H57A 3NHJA 4HNVA 4YRSA 4KP7A 3WSTA 4EF4A 3KXLA 5J2UB 4ALIA 5EEGA 1N8TA 3I9NA 4KDRA 3IH5A 4MV7A 3CEAA 1GTSA 3O3MB 3BC1A 2FUCA 3C7CB 3VDNB 4G25A 2BEWA 1BIFA 2GO7A 1KJNA 2DWQA 2P91A 5ARBA 1EGMB 3ESZA 3N8IA 1QANA 4IEIA 4LJ7A 5JJLA 1L8LA 3F8TA 3A06A 4W82A 3ROQA 1CRPA 2XCIA 1QVAA 4LJ8A 2IUEA 2QEQA 2AMVA 4KQGA 3UUGA 5CDHA 1XN4A 4R9VA 5KVAA 1UPFA 1LBTA 1P1IA 5JCOA 4AU1A 1DRWA 1JB1A 5K2OA 3A14A 5BV8A 1K5HA 1KVSA 3FWNA 4NSNA 1VJ5A 2GM9A 4XPIB 5KSZA 1H85A 1V5FA 2YTZA 4G8CA 3FPFA 3OQIB 4MB2A 4X7PA 3OIUA 3EVBA 2LTAA 2B69A 3NWEA 3UENA 1VMIA 2ZSBA 2QVYX 2WM8A 5IKXA 3W7AA 2IELA 4AK9A 2P3OA 4MEAA 2ECPA 1CUJA 3GRPA 3UJ3X 2ZR8A 1Z7WA 4WNAA 2YH2A 4NYJQ 4AMZA 4DCNA 1XZJA 4KK3A 3NH6A 4Z9BA 5A3VA 4D02A 5A4FS 1KA9H 2WVAA 3H4VA 4GGPA 2XGJA 2BHSA 2OAQ1 3RTCA 3N28A 4PX9A 4KDFA 3ZZNA 2JD1A 3PDCA 1R4MB 4CM5A 5IBPA 3KSBC 1PLKA 2HXYA 2GHIA 4EJSB 3FB1A 2O8CB 4G5HA 2REBA 2XUJA 1TT5B 4R2LA 3VHQA 4OI0A 1TGYA 1YRWA 4GXRA 1B23P 4GH5A 3PL5A 4KE6A 3THWA 3MT0A 4CCYB 4WL0A 2BF7A 2LZ0A 1G9SA 3AU8A 3ZW8A 1ZI6A 5FYQA 2IK8A 4N4AA 2ZUCA 4QBGB 1UP4A 2YW9A 2P62A 2YRXA 2HWYA 1BXRB 1GCIA 4JUIA 4IO1A 4RK6A 4PGMA 1GV1A 3O94A 3WXMA 4MIKA 1NMZA 9ABPA 2UUAB 3EZNA 1P7YA 2IA5A 2Y0DA 4H60A 3ZE0B 2WY2D 3FTDA 1NZJA 4EYKA 2TS1A 4R2MA 3ICEA 3IDSA 2FUG6 3SSAA 2RK6A 3DDCA 2Z2IA 3O9VA 3JD3A 5CTJA 1NLFA 1JHPA 3QQ5A 2N1MA 2AZMA 2F8TA 2XWPA 1JQKA 1E7WA 2I6UA 4FC7A 2GETA 1LSSA 4TTVA 3FWZA 3G5TA 1BU5A 1I36A 2OZLA 3FFWA 4RF2A 4PYRA 2EKDA 4RMNA 3S68A 1II9A 1XVAA 2Y67A 3OWHA 3SI7A 3EZ2A 2VTKA 3S6JA 3OOWA 4IGFA 3TR0A 4BJ3A 1H2AS 1I3MA 1VPVA 2I87A 4P7GA 1Q2XA 1E6MA 4BUJA 5HF6A 4O63O 2ZI3A 2Q5HA 5DYWA 2YMMA 5LNK6 3RSLA 3V8QA 3K0SA 2IQ5A 1RE1A 3LZ6A 4IBOA 1USKA 3I2FA 3D4LA 3EUEA 1GTVA 5KQPA 1IHOA 4LE1A 5KYXB 2RKWA 2X22A 3K4PA 1M5TA 1E1RD 1AKQA 2CHVA 1US8B 4W8HA 4A03A 4UM9D 2C4TA 5HJ5A 5IAGA 1OGJA 2A9QA 4EFLA 2HIAA 4B71A 2A9VA 1HMYA 3F5MA 1XOIA 2EDCA 4EA8A 2O8NA 3H1EA 3M70A 3P9YA 2PSHA 1JIVA 4MQEA 3NBUA 2ZRLA 3F5DA 1DKRA 3NNDA 3TLEA 2CSUA 2ZKLA 1RKQA 1KBQA 1UJNA 4MQBA 2IPOA 5AHWA 4R8KA 5AI8A 5JH7B 4RY2A 3O1JC 5EFZA 4YV1A 1ZVVA 2JJ8A 1G8GA 2WF9A 1UWLA 3ZWCA 4RJLA 4BQIA 1YJXA 5EMHA 5EERA 5A5EA 2Q9CA 4KK4A 2P9TA 4M0CA 5C5CA 5FHRA 3P9NA 1RNLA 2IFTA 5FPPA 5KTMA 2ZM6B 5TPZA 2VP3A 2JPDA 3EF1A 3NEYA 4WY5A 4G1CA 4OYRA 5EUCA 1RBQA 1O77A 2VF2A 4D6XA 2Z0MA 4D4JA 1XZMA 2PZBA 1FLDA 3ZDRA 3WNBA 4Z4IA 1HDEA 1T8TA 3LQQA 3KQVA 1FSGA 4LHSA 2H16A 4UU8A 2QUIA 2CCJA 1JL3A 1FTWA 1HQCA 2AG5A 5JRJA 2BBTA 2OP1A 5A9SB 2IVFA 3QU9A 3QVGB 4ZOAA 4JI4B 2QVGA 3NBAA 4UEQA 4FQ5A 1BNCA 2WPDA 5TMDA 5U1PA 1KQPA 13PKA 1S2DA 2VZ0A 2WTMA 1I1QB 2WZDA 2CXHA 3IDAA 3H2HA 1QIGA 1FTSA 4MZXA 1S4QA 4DDMA 1YS2X 3WGZA 5FIUA 2QXYA 1V5EA 2P5YA 3OEEA 2P41A 3DH0A 4MUFA 4HC4A 1VQ1A 2VCHA 1G3UA 1EHIA 3BMQA 4P3KA 2YQ4A 3SEQA 3P52A 1BW9B 4FGUA 3U4MA 1MC8A 1VG9B 4LGYA 4YNBA 1QVWA 3FYUB 4Z8YA 2GKGA 2NTEA 3PWZA 4M1OA 4RVUA 3MG9A 4GMXA 4DA0A 5K4AA 4AZ0A 4R1SA 4UFNA 1GTRA 3TQTA 3CM0A 1ISMA 1O87A 1P2VA 2B7BA 2KJQA 4UVEA 2X5KO 3GCZA 1I4DD 4J7AA 2VP5A 1R6UA 2IYUA 3G82C 3BCRA 3HCNA 1L6RA 3N7AA 4X7MA 4C0SA 5CITA 5M2QA 1OXUA 1DPGA 4ZVTA 1NIPA 3KVRA 1HE4A 1GPBA 1LSUA 5B6JA 1FFBA 1FP7A 4K0KB 1D1TA 3PEEA 4DIFA 4UHBA 4GKKB 2VJMB 3RNOA 5C31A 4M49A 1VMDA 4GLOA 2AQIA 4ZPJA 5FJIA 3T1HB 3CS3A 1TCAA 4ODIA 2RIRA 5DHSA 2QG4A 3DKIA 2NNWB 3MWDB 4XIIA 3DT6A 2UU9B 1KC1A 1SAYA 3TTUA 2V0GA 1WZNA 2I4NA 4WVFA 3SBOA 4YJ3B 1OBVA 1YK1A 4GQIA 4YAFA 1WBBA 2FP4B 4MMXB 2AN9A 1M33A 2RAFA 1RWNA 1G3MA 4M9QA 1KVQA 4YYEA 4AJOA 1OTYA 1DC8A 1RWMA 1EUDB 1FOEB 2YYZA 5T4FA 4Q9LA 1B76A 1BKYA 3COSA 4Y9SA 4NFSA 1MJ5A 5BV7A 2AG0A 3FKSA 2QMHA 5FQNA 5TMEA 3U62A 5MN4A 1P91A 4GFDA 4BX3A 4FI3F 1T1JA 5JZ9A 3L1IA 2V6GA 3DGEC 1CQIA 2HB6A 1ZWLA 4CUJA 2GK4A 2WAAA 3HFJA 5C46F 2YWBA 1L1FA 3THYA 2WM3A 4LX8A 2N1BA 2XB8A 4OGGA 4XUDA 1EE9A 5G3ZA 1B8OA 3KT0A 2GNAA 1D4ZA 2RKOA 1QZZA 3WNVA 5LFAA 4O0MA 3CPSA 3OESA 4NJMB 3H87A 2UAGA 4WX2B 2MMGA 3IVAA 2H2WA 4RHCA 5ERYA 5IN4A 4DV0B 1QIMA 2B4YA 4WMLA 1G0NA 4BVJA 4Q7MB 1CUWA 1NSFA 4CYMA 2HXGA 4XVRA 1MFPA 2FZWA 3UJ6A 1J2JA 2PTGA 4MV0A 3VVBA 3I37X 2JFNA 1DKNA 3SNHA 1MT0A 4KBGA 3TM4A 4F7WA 1SBNE 5LWQA 5G02A 2AR9A 3Q7EA 4C0BA 4KFSA 3PQDA 3N1UA 3U81A 5L45A 3W77A 4CTOA 4TKMA 3ADDA 3PP8A 2WAYA 1E2MA 4J76A 3NZEA 2HX1A 2XJ9A 4EAAA 1D09A 1VPLA 3KKZA 3VPDA 1Q83A 1O6ZA 4F97A 1ARZA 4V0KA 1GPAA 3DCIA 2F8SA 4HB4A 1W4AA 1N1MA 2A1UB 1V1JA 4EB0A 5BQ5A 2W6QA 3AV3A 2RJ3A 3A2NA 4Q3EA 2H2DA 2WR8A 4NZZA 3AHJA 4I4LA 3ZCTA 2P69A 1EB8A 4FJ0A 4N0MA 4UHDA 2QTVA 3V97A 4AYWA 3A9UA 2IOYA 4YROA 2JIQA 5I7UA 5EKUA 3UMCA 1Z47A 1KNQA 1W2HA 4YV0A 5HEKA 4L5CA 1CRWG 2JZOA 1WKVA 2NV0A 2OLEA 1OD6A 1Y6RA 3NAMA 2AX4A 2P7HA 3PIRA 3W5JA 5HKAA 4ARSA 4M1MA 1JSLA 3VSCA 1LRKA 2R9VA 2Q5IA 2V0CA 5GWXA 3V2GA 4KSCA 3KXDA 3R3YA 4RQUA 1N2SA 1DAEA 1MBZA 3HUFA 1DDGA 1R0WA 1U5AA 1KJ8A 2FDCA 4NKRA 1GFIA 4N8DA 3GJ4A 2RGXA 3PTAA 3O4RA 3K53A 1QNFA 2DLDA 1AXRA 4TXHA 5KAPA 3MGGA 1P1CA 1GGFA 3JYQA 4JH0A 1MIOA 3NXSA 3EAQA 4KQKA 1VPDA 1N0HA 1NXXA 3OTIA 3W5SA 5EJ9A 1C4OA 5CXUA 1OR8A 1BMFA 1LTQA 4Z7QB 3S3TA 2PH3A 1YMQA 2C2XA 2KM1A 2AFVA 4B80A 2IW1A 2PAAA 5IM4A 4QGGA 3OTGA 4LYYA 3CBQA 3VR4A 3BB4A 3WHIA 1WTCA 3IXMA 3H9CA 3MQ2A 3K6RA 3GMDA 2XF2A 1D2RA 1NW5A 4QUBA 5FFMA 1C7ZA 1GITA 1BEZA 2NZYA 5HIIA 2XNHA 3KV3O 1U04A 1UT8A 5G1PA 2QE7D 4KKVA 1Z2PX 3LNTA 5HQJA 2C2WA 5IDVA 1U8ZA 2PQMA 3OIYA 4GOXA 4MJXA 1KFJB 3EOAI 3DL4A 3CNNA 5DXFA 4C4XA 3KR2A 1NI3A 1C3VA 2VDRB 3I04M 1E4VA 2YUTA 1P6XA 1THZA 2FZVA 2VJLA 1MHPA 2OBBA 4N18A 2CXRA 1QIKA 2GK7A 1IJBA 3PICA 5FFFA 2Q1YA 1FP4A 1G291 1H6CA 4MX8A 3BMCA 5JR3A 2YWFA 3E3MA 3KEFA 4UNSA 3MRXA 2CHQA 2Q6OA 3SK0A 2CMKA 4KQXA 5MF6A 3E05A 2O7RA 1X8JA 5HZHA 1V8DA 4KQEA 4ZXFA 4CIBA 4IIHA 4I1IA 3U7GA 3OE5A 3D6TB 1U8TA 4U02A 4FE7A 3ZDQA 4FOSA 2VQ3A 3WIDA 4DLUA 3KSZO 2GFQA 2VNSA 4QDOA 3UCFA 2R84A 3H9JA 4O4HA 1C1XA 2VQDA 4YCBA 1W8IA 5HGJA 2FOLA 3OG9A 2X1HA 3I1FA 4QZVA 3W4KA 2E4AA 2ANBA 3T06B 1U1IA 4UDNA 1R6VA 2VXYA 3ZYZA 3BJZA 3UQZA 2C04A 3EDMA 2OM6A 3QVUA 5BSRA 1X8KA 3TS1A 1NJGA 3BN3A 3KL2A 4JEMA 4KIFA 4QU0A 2YHAA 4YY3B 2QLMA 2EAUA 3FFAA 2XIJA 3CZAA 4K9SA 1K5GA 5E6RA 2LXNA 1NBHA 3UHPA 1YOVB 3WIBA 1LF0A 3PUKA 2UZ4A 1F6BA 2IHJA 3K0CA 4HB3A 1EP2B 3ZXXA 1H69A 1N2ZA 1U1DA 1YZNA 3T0FA 2H7YA 1ZN7A 2KYRA 4HN4B 1A9XB 1RM0A 4ZVRA 2AXEA 2RCYA 1GG8A 1TTTA 1GLNA 2GA9A 1KRXA 2QW8A 1AK2A 3HNRA 4LPSA 1JQJC 5ALFA 5B1DA 3OP1A 1AN0A 1CUEA 1F17A 4M98A 4RGQA 3BUSA 4D81A 5GADl 1D4AA 3M4ZA 2PYZA 1CEXA 1I2DA 3L7LA 4L76A 2NTYC 4O08A 2PGLA 2ZPUA 4JBIA 4Z51A 3PEYA 5I7AA 4FOPA 4UD2A 1ZW1A 3CNBA 5EIAA 1H4TA 4WXYB 4A0QA 3WGJA 3JQ9A 1HPLA 1QX4A 3NBMA 4AD8A 4YRKA 1Q0ZA 2ZZKA 2W6PA 1P9WA 3E7WA 3FSEA 5DLPA 2XNSA 3WDLA 3S55A 2EEZA 2PT6A 3HCRA 4EHDA 2CDBA 5GZ1A 3D1JA 3I6MA 4ZV4A 4UTNA 1HSOA 2CFTA 2C83A 3N7TA 5BR8B 3L9WA 1J09A 3QBVA 4TYNA 2YDYA 1T2AA 4IHQA 4DV3B 2LRHA 2JI6A 4M36A 3VZRA 2GN0A 2IPAB 3C39A 3R7DA 5CYPA 3ZZ1A 4DY6A 1K63A 4BDTA 4F91B 2IHTA 3MC1A 2UZ3A 1TZCA 1H23A 4B73A 5JFOA 3TFOA 4YQYA 4QDKA 1EA7A 1PK9A 2OO5A 3LCVB 3PD1A 4RSRA 4AG5A 3QELA 1ZRMA 3EMBA 3SZMA 4M1QA 5LKAA 1Q91A 2YVLA 3GYGA 3OKAA 5A6VA 3ZU2A 1UJ6A 3PNOA 2YWDA 2DE0X 4QUHA 4C22A 1BYUA 4JAVC 1JXMA 1T26A 2HNAA 1NT2A 4MV6A 3AG6A 2CFRA 1FFSA 2ORVA 3ILSA 2N46A 3NWBA 3P9XA 1Y1TA 4O4LA 5FA8A 1XVIA 5J5CA 1O95A 2D7JA 3ZDAA 3RM3A 1HE8B 5T4HA 1GNTA 1D7AA 1RI3A 3FUVA 4HJRA 4P7BA 4C9BA 1QRAA 3QBJA 4JR1A 4Z99A 4C87A 5CB4B 5KYNA 2QR2A 2Q0QA 1X1RA 4G86A 1NR7A 1OV4A 3OJFA 4I99A 3KYDB 1J0XO 4P0PB 4JIMA 4EJ0A 2ZQ5A 2IEYA 1QX3A 3A1SA 1XB2A 5LB2A 4E32A 5BXQC 5JUWA 5JY1A 3AOEA 4D74A 1TF2A 4BEWA 1BXGA 4OQNA 5LU9A 4BMYA 1ECBA 2BFAA 1D4FA 1H0SA 5B3LA 2ECQA 4C7OB 4I5FA 2Q99A 1K0FA 1N75A 2WKWA 2GD0A 1WXFA 5U4XA 1YCDA 3BGIA 1Y3CE 1YJBA 2ESRA 3CZQA 3NDIA 3AMVA 4EW2A 4TZKA 4E6PA 2JEOA 3SF0A 1P7CA 3LBIA 3H2JA 4GP6A 4QA9A 4XARA 3VZCA 5DHPA 4RY9A 5AMXA 1TIKA 4FDLA 5DI9A 2IV2X 3URMA 5BN4A 2A5YB 4JN6B 4Z4CA 1SUAA 4L72A 1F6WA 2C9ZA 4OUKX 4N40A 5E7MA 1SBQA 1K8YB 4WN9A 1UJMA 2V0NA 2Y9MB 2IWHA 1NONA 2C3UA 1NVVQ 3I6IA 1XMOB 2C31A 4KXYA 4K9LA 4MKZA 3N2GA 3H6HA 3I2IA 2XQVA 3OCUA 1LDEA 5SZIA 2XI4A 3ANYB 1LF5A 3B2NA 3WB1A 4Q02A 4AY6A 2AFRA 3EIQA 4YJ2A 2ZAYA 2W42A 1O6BA 4RENA 2OBLA 1YZ3A 3C6BA 4GVLA 4E2YA 4IXTA 1TMYA 2ETXA 4JI7B 5KWJA 1SOAA 1K9SA 4ZEVA 1WCIB 4QPDA 3I5AA 4G0UA 1U0RA 2FFAA 5K03A 1VL0A 4OFWA 4DG9A 4R9RA 3N2IA 2JEYA 5TMBA 2HA3A 3EFEA 3GQBA 1UOPA 4IJMA 1DAOA 3VR2D 3SBEA 3WRXC 4QRHA 1Z12A 4YGYA 3RRYA 1WSBA 2D0DA 3GRKA 1CNEA 5EJAA 1KIFA 1O96A 4F7DA 1R15A 3CTPA 5IK2A 4ZO4A 1E2IA 4FCWA 2V7VA 2M6KA 1G64A 3LPMA 4Z6KA 3BILA 5IBRA 3R7WB 3AWDA 1UKBA 3S1AA 3HY6A 3CNLA 3B3JA 1AUOA 2PTHA 4S1TA 5EPEA 1YVDA 4R2KA 5H0IA 4BFTA 5JNTA 3F6BX 2R4UA 1X3LA 3I32A 3STVA 3DTVB 4JJEA 4ER5A 1VKZA 1XK6A 2KMLA 3AB3A 2I4IA 2AA3A 2G83A 4KQ1A 4PLCA 1Y34E 4LCEA 1EM8B 2OMEA 1BVHA 1KPHA 4NS1A 4JLWA 1DV2A 1YB5A 4HAZA 5J4YA 3T35A 3R3SA 3K94A 2EYUA 3DF7A 2IYVA 4JZYA 4EL0A 2VI5A 2Q3CA 4O1MA 3H1BA 2PQ0A 1KP3A 4GX0A 2VBCA 1DAFA 3K9FC 3DDNA 2P9HA 1V7ZA 3EBPA 3FHOA 5IM4F 3MTQA 4U6NA 4D42A 2QD2A 3I05A 3QJGA 2A88A 1LSJA 3OQPA 2IPXA 3GDHA 1FU8A 2DPXA 2HSDA 1GLVA 3D8NA 3L0PA 4LJAA 2R65A 2R7NA 3BXFA 3CE6A 1QH9A 2PO7A 2OLKA 3DMYA 3HG7A 4CF6A 3RWOA 4KCGA 1T2DA 1E7RA 2N47A 4FMBB 1EP3B 3BH0A 4M1ZA 4ADSG 1KF0A 2FOXA 3ONDA 4MYCA 3QMMA 4OXIA 1A4IA 4F2WA 4AXBA 2QM0A 3FDZB 1IN8A 4B87A 3HFGA 1F8GA 4RPGA 4WXRA 5ULLA 4C88A 1D3AA 3ZDFA 2YWRA 1GCUA 4C5AA 1QMGA 4TWZA 1HEIA 4PICA 1H6AA 1L0BA 1TRKA 4N5IX 3L82B 4IXDA 2J4CA 2CC2A 3U80A 3HYSA 3SLGA 2MSCB 1GPJA 1HDZA 2OYSA 2QJWA 5T5QA 3MT8A 4P6VF 1RM4A 1B2RA 1CUVA 1MTOA 1TM3E 1NURA 3C85A 3OU7A 3E7FA 4BGDA 4FGKA 1QPZA 2WSLA 1Y1LA 3B89A 1T0JB 4RZUA 4MLCA 2J08A 5FPQA 2BISA 5SYAA 5TQ2B 3TM5A 1Y1RA 4O4HF 4NRDA 3U4GA 4C2AA 4JC8A 5AKJA 2H18A 1Z8HA 2C59A 3B51X 4AYTA 3I8SA 4I8DA 2FG6C 1N92A 5E1DA 4KE7A 5G4KA 1X7DA 4UUNA 1J5EB 2W6JA 1AQIA 1Q7BA 2PGJA 2QVCA 3VO8A 5CLFA 1E3MA 5JXHA 3L8ZA 2D6FA 1FEZA 1QS0B 1UPAA 2QE6A 3EJWA 3AHCA 1OPXA 5L3RA 3NMUF 2ECKA 3ONFA 3QKSA 2E3JA 2AE2A 4KV9A 2Y1CA 3FYTA 1W5EA 2Q5JA 2QD4A 4OBBA 5E6SB 5IC4A 2XKJE 4TYWA 2QB5A 4CCAA 1F4VA 2UZ0A 5SZHB 2HYIC 1EAYA 4PSVA 3FD8A 1AO3A 3MWFA 4LOJA 3NHUA 2NSDA 1C0KA 1LXCA 2VPWA 3N86A 5ALPA 1OAOA 2GPNA 2IS1A 4IJUA 4H27A 1E6LA 2YY5A 3R44A 3ADOA 4K6OA 3ZWQA 5ED0A 2GXAA 2CLLB 3G68A 3W3AH 2A9PA 2OUIA 3BYZA 1DC3A 3KE9A 2AH5A 2FZ4A 2R5NA 1ETUA 5FHQA 3VU9A 4RMGA 5K9ZA 4C5BA 4COOA 4DNXA 1K66A 5F35A 1OKKA 5I5GA 5IKMA 1A9ZA 1HRDA 4D3ZA 5JPCA 4CMIB 1XEXB 2Q5EA 4XIFA 2TMKA 1HH4A 3JR7A 4P4NA 2NUAB 3SJUA 4YDSA 3U16A 5CAEB 2EQAA 4J2OA 3ZY3A 4Z4HA 1HDXA 4W9NA 3QWAA 5HK9A 3NI2A 3NNNA 4UU0A 3O90A 4ZCMA 1F20A 2Q5FA 1JSCA 2G9ZA 2O20A 5H3HA 1Z8NA 4XR4A 4CF4A 1TW3A 2GD6A 3ISVA 4OK3A 2ARKA 1ZG3A 4G36A 4X60A 2FA9A 3H5LA 4OX9Y 4BMPB 1U3GA 2VF5X 3U7HB 5I9SA 2FXVA 1UBJS 4QYIB 1N2EA 3WGQA 2OCYC 5AK0A 3ZK7A 5DU2A 5BWLA 5IHXA 1AZLA 2FV8A 2GKSA 3CZ4A 3EGDB 3HM2A 4O2BB 2XRZA 3Q8LA 2ZAMA 1EGAA 4IIVA 3OZVA 4EAQA 2V7QD 4P2BA 5IVPA 1KMNA 4E2WA 2I67A 3DVLA 4QNMA 2WNIA 3MXTA 5TV2A 5KUTA 3RIGA 1NNLA 1JZQA 1WUKS 2HXSA 5KCMA 4KO3S 3IAM6 3OURA 3I1JA 4V3BA 1JG1A 3AIMA 4B3XA 4F45A 4ZJUA 5C8XA 3LGXA 2DWOA 2F3TA 2WVJA 5DJ5A 3T3NA 1NLZA 5HX7A 3HKDB 1Y1KE 2AD5A 4LWOA 4C4PA 4DNQA 4JBXA 4LJ9A 4O4LF 2BEUA 2H1IA 3A4MA 3F8SA 2Y1XA 4UTPA 1DKPA 1G4UR 3R5JA 1EFAA 5JBNA 2QI9F 4HGPA 3DBIA 3QKWA 3MW8A 1GZHB 1QGYA 1VG0B 1OFTA 1E1QA 3U26A 2OKCA 3ZD8A 5IWAB 1B43A 1L7VC 4UE2A 3NALA 4XM0A 1PWYE 3P97A 4DV5B 3HB7A 1QHYA 1M1NB 1ULUA 3N2EA 1EX9A 1PL0A 4U63A 1W2GA 4UEWA 4ZOEA 5IZCA 2H00A 2JGAA 4HZUB 1E2BA 1CY4A 1Z6GA 1DHTA 1FNCA 4MUJA 2J9FA 1IY1A 3UFBA 1B0AA 3DAFA 3P0RA 2J30A 3CKMA 4K9NA 5J5AA 2QNIA 1FDSA 3FPAA 1BJKA 2PPVA 2GAFA 2QW1A 2RHLA 1P17A 1N1DA 4HBGA 1PNTA 4DZZA 1E2LA 1DXOA 4DIUA 6NULA 5ICEA 1Y6FA 1YBAA 3GMTA 4A0FA 1CJBA 4K6MA 1JFFB 1E2GA 4P4UA 1S6YA 3TQIA 3ZHUA 1N78A 2I6TA 4W1QA 1DL5A 2PANA 2VXOA 1X1CA 2X58A 5FADA 5K2MA 4FCVA 1I3OA 1W46A 2IYTA 3EISA 3OX1A 3SYKA 1Z4JA 2QMEA 4OP3A 1D1SA 1QZUA 1WM1A 3SF8A 1E2DA 2NVUA 3PB3A 4YJ2F 1MA0A 2V65A 3NVKI 2FZ5A 3K7EA 1Y4SA 5ICMA 1OC2A 2MSEB 2HDWA 2WILA 3RKUA 4NG5A 4GZLA 4C6RA 3ECSA 3LRXA 1U65A 1TJPB 2WINI 3W4IA 1R8YA 1V9SA 4J0QA 1VFNA 4MUKA 2ZRKA 5FBLB 2PIDA 5A05A 2YWGA 3BWBA 1MC4A 1ONPA 3IIIA 4E12A 2RJNA 5EJ2A 5DZSA 4EKNB 2BYTA 2I8CA 5KVVA 1X70A 1BFDA 1N6HA 3DVQX 2IOFA 3E5MA 2MTBA 2BMWA 4AUMA 4QT0A 3ZI4A 2H17A 4MS1A 3JATB 4A1OA 1BCRB 1H94A 5CW1A 5H80A 1RQXA 5LD2B 4FVTA 1OUMA 3BDAA 3IBYA 1SR8A 3DHYA 1LNZA 4HAOA 1SKBA 3UT5A 1KI7A 3WMFA 3DMNA 4QPNA 2QTLA 1TMOA 3CEHA 3ITDA 5BRNA 3JS5A 1RYDA 2HDOA 3H5RA 2AN1A 3DBRA 1YR2A 4YIKA 1YRHA 2EBFX 1XKQA 1LSOA 3ZY4A 2HLDD 2WZBA 4WZAE 3C6KA 3QOFA 1F2UB 2WYIA 1UBLS 4R1MA 1EEXB 4IUCS 4TXMA 5JOQA 5HF8A 3MIZA 4P82A 2X0DA 5F2KA 5H16A 2MSWA 1N4AA 3ENWA 2IP2A 4KIGA 2AFIE 2A4MA 1FYVA 1N3IA 1J8QA 4OUDA 4IF4A 1S5PA 4QUJA 3REQB 1PWZA 4B32A 4R71A 4HXYA 3ZTYA 2OBFA 4CIYA 5I4CA 3P4YA 4AF7A 3BORA 1IZYA 1DUVG 3LOPA 1ZJZA 1H3FA 3FCAA 1T5TA 3FZYA 1LW7A 1YD7A 5K8CA 1VBKA 4JX9A 4RV9A 2P0AA 2GPWA 4MW5A 1H2HA 5TPWA 4PONA 5DHAA 1Z6XA 3UB2A 3S0JA 4WBSA 1OTXA 4EG4A 3P19A 4E51A 4U7WA 2QUBA 2IY9A 4JP5A 4PPQA 4OIMA 8OHMA 4ABTA 3BZWA 3SKVA 1KOJA 1L4GA 1VI5A 2J3QA 3DLBA 4CJXA 1QTIA 1NULA 5DP1A 2C77A 1OH6A 1EFRA 3ZJ5A 1MH1A 4HQ0A 4JX8A 3ABOB 2IJGX 2FWRA 3B2QA 1S96A 3E9YA 4WZAB 5FA5A 2M1ZA 3PNQA 4K9KA 4MVXA 5AKZA 4IDHA 3BRSA 3O73A 4LTDA 2Z1MA 3PNLA 5FL7D 5ALOA 1UZNA 2AFIB 3TEJA 2H5EA 4DVGA 2XD4A 3CRQA 3C45A 4J4BA 4CF7A 2V3WA 3GL9A 4LNUA 4Y6QA 1GUBA 3H11B 1RWPA 5F2EA 4QKQA 4L8VA 1WOYA 2W6ID 1RHJA 5DISB 5DTEA 4HYYA 1RCUA 1A8HA 1VCHA 3DS8A 4HFNA 3MERA 5B3JA 4OQMA 2VF8A 3WGKA 1TCVA 2WB2A 4FFSA 3AG5A 1IY2A 1G8PA 4KVAA 2HA7A 4H7EA 4ICIA 5AJUA 2C20A 3SYNA 1TO1E 3Q6MA 4PHFA 3RT7A 2FWAA 4ZQIA 5K3FA 2VK1A 4K9RA 4WCDA 1POWA 4WOBA 2UYQA 3CF2A 3NJRA 5F9FA 2QYOA 5T4BA 3KBOA 1HFJA 3GFPA 5K4HA 3C14C 2WK1A 1RVDA 1LTKA 1T1EA 4B6QA 4BQQA 2PZ8A 1A5SB 4NV0A 1QR6A 3KJXA 3GLGA 4MVCA 1H5NA 3OZFA 4MNTA 1BWPA 3L7DA 4LQ4A 1Y8ZA 1P18A 2Z56A 2OHOA 4N3NA 1N7HA 2COUA 4OHVA 3WLNA 4ITVA 1S8NA 5KTPA 3P96A 4G5XA 5H81A 5FWNA 3EPKA 1B8UA 2O2JA 3REOA 1PJ8A 4HF7A 2ODBA 1Z2DA 5A5DA 2F43A 1ZSNA 1ZD3A 4AWAA 3UJCA 1ESNA 1P0IA 4ZVSA 4WFQA 1MQ8B 1TA9A 4AS3A 2FZGA 4WA8A 3PQ8A 2VPZA 5GVRA 2R8PA 3RPEA 2F3PA 4ID9A 1I6LA 2HQBA 1RIIA 2J0UB 5AI0A 4C6SA 3GFFA 3LE8A 1AMOA 4WKGA 1UJ4A 2WV9A 2BHRA 3GG9A 3SC2A 3FVRA 4EARA 3V7YA 2ZRNA 1JXAA 3VVLA 4BRSA 1PR1A 4QBFA 4KAJA 2R48A 1TMKA 1R0LA 3PXAA 3W6OA 5MN6A 1QE5A 1YI8A 2E21A 4XW2A 5E2IA 3IEPA 4RHXA 3ADCA 2TMGA 5DYIA 1VCOA 1Q1BA 2C3MA 2QMOA 1HNXB 5EUQB 2IYRA 3I09A 3KYIB 1BQEA 4RORA 3KVOA 1YVRA 1MRSA 3RFFA 1PR6A 2I3BA 3IEKA 4KXMA 2XB2A 1Q95A 4YMVA 5C53B 2WTEA 4M7RA 3INNA 3QYPA 2LCQA 1MRNA 4I55A 2Q3MA 2FSIA 3DMHA 4I9UA 3OFJA 1XTUA 1J00A 3I28A 1FVOA 1Q6YA 4IGEA 3TQRA 5CEJA 1GA1A 3AZQA 3G2NA 1CZNA 4HNAA 1QRUA 2OILA 3EFBA 5J5VA 2JAPA 3OCCA 4TKLA 1DIRA 1GKKA 3VDRA 4EYOA 3SS7X 1V8ZA 5CYFA 4OL0A 5A7GA 5T3YA 4CR6A 1O0CA 1I7QB 3E70C 3HCAA 4NH4A 1M2KA 2JCSA 3C15C 3I1YA 1MLDA 4ACBA 1PZFA 3DAOA 1QTRA 1RXWA 2FSVA 1RQNA 2JGMA 2JHGA 3LECA 5DNCA 1MEJA 1DBWA 4PIPA 2CDCA 3C87A 2OXEA 2I9KA 4KI0A 3C74A 3DLPX 5TX7A 2IZ6A 3N0XA 3V7NA 1A3CA 1DO2A 4KSBA 2PO5A 4KWEA 2GBIA 4D2IA 4M76B 3G9XA 3G2IA 4QE3A 2FSGA 3ODGA 5TNXA 2ZWAA 2QX8A 2Q3HA 1W35A 1XTPA 1PJ4A 2C8JA 4RETA 3P9PA 1AKYA 3RBVA 1CP2A 3O8RA 3RW9A 1E0DA 1G2OA 4GQBA 1X15A 1KTVA 1YNOA 1A9YA 1XQVA 3G2HA 5K1ZA 1YL7A 4XD7D 3W3AA 2Y3IA 3PT5A 4ZANA 5FWAA 4LNHA 5LP1A 1WAMA 2X4DA 2R96A 5EY5B 3WAKA 3MQ4A 3VZQA 3K71B 2ZIXB 3E58A 4DRXA 3AERA 4PG8A 1Q6ZA 3GPDG 4LBYA 4P3OA 1VE1A 4LMPA 4BXOA 1ODJA 3R4VA 1QH1A 4XWWA 1WA5A 1XA0A 4DBLC 1GADO 3USES 5ABPA 2PBZA 3UUWA 2R1VA 2HTFA 1QPBA 2OZEA 5EQFA 1V4BA 5JE8A 3KVYA 4E4RA 4MVJA 5FLYA 2OPHA 4B4DA 4MLDA 3A0UA 2PMBA 4D4KA 3ZU4A 1HXHA 1E9DA 3Q1KA 1CEYA 2OAEA 4Q3LA 4TLAA 4W9MC 1EJ6A 5CURA 3V42A 1V16A 3DVRX 3VV3A 1P73A 1AO0A 3L77A 3QSGA 4OP2A 5JCZA 4NBVA 2R7LA 4U2KA 4ZVQA 4BQPA 5CEEA 2F55A 4DJJA 2AOVA 3D4IA 3C41J 2B61A 1ZLXA 3DFIA 2C5BA 4N39A 4PS1A 4V0NA 3WJ2A 1P0FA 3GDWA 5AW3A 5L9AA 1LLQA 3DE3X 1KI4A 4YLYA 1Z75A 2FPXA 5ALIA 3WZMA 5KYTA 2AQHA 5TEVA 1JQ5A 2K7ZA 1TUIA 5CFPA 4WASA 1KJQA 4GSKA 5DBHX 5EQDA 3ROXA 1Q0LA 2YC2C 2GLXA 4F1JA 1B6GA 1W88B 2HREA 3F9RA 4TYQA 4TPKA 3UEOA 4Q6BA 5DN9A 5FP0A 4IHJB 3E9CA 3CNEA 4OYLA 3V46A 1ND5A 1UCFA 1UMDB 2IEZA 2WKSA 4PQYA 1B6RA 4TS9A 5KSPA 3RHSA 2IUSA 4GI2A 4II7A 5KNBA 5LR6A 3ESAA 1JFLA 1E3JA 4PZYA 1FU7A 4OJKA 5A4MS 1L4HA 2OG2A 4ISBA 1FFXA 4RAOA 3NYWA 4RGYA 3F49S 2YC4C 4CKCA 3KHSA 3KVNA 1L5FA 4LKRA 3IESA 1FFYA 5AK3A 4PVCA 4MUNA 1OA1A 5BORA 2ZBGA 3WR5A 5T64A 2K4MA 1D6JA 1TK9A 1H2WA 2FH5B 2WLSA 2NTJA 5JXIA 4IDAA 4K9DA 4K6KA 3K2EA 2OG1A 4EF5A 1FFCA 5TJHA 1R5NA 3TLMA 4QIHA 4F5WA 3PXCX 5LDHA 3IB3A 3OE1A 3UV3A 1NBOA 4DC9A 1N0WA 4ENPA 3NG1A 3WYBA 4FMCB 3F3MA 1NPYA 5JBIA 3CNOA 1DEHA 4KODA 4PLFA 3RF7A 2GN9A 1IVYA 3ADBA 2ZIWB 5E1OA 3W5VA 3ST7A 1AJEA 1IH8A 1QSGA 1YRYE 1P2DA 5JARA 4HGOA 1GZDA 1ZCAA 3C5CA 3LT4A 4PLWA 4R9UC 4KLNA 1T2UA 2X0EA 3L3BA 4OHBA 4DT1B 3PEUA 3WYDA 3KKQA 4IRMA 1P0QA 2YY7A 5EWJA 1G55A 1L5OA 5BR4A 2I0FA 1TRHA 1GKYA 4PGHA 4I1RA 2HU2A 1M83A 3X1WA 1GYPA 2BI8A 2ZREA 4H3HB 2R1VB 3A9RA 1G60A 2H2HA 3HCPA 4TL7A 4XEHA 3TIGA 1PZMA 4J6FA 3NCHA 1BGXT 1ZK4A 3ZIDA 4WBXC 1T8RA 1YKGA 3GLQA 3P0HA 1B16A 4JCOA 5IT5A 5CFOA 1X2EA 1FLAA 1FFEA 2IE8A 2GYWA 2HEGA 1LQ2A 3CIOA 3E9MA 2ZYIA 1CZRA 3RRZA 3A37A 3B7PA 5K6AC 3DE7X 2DT8A 5DYGA 4ER0A 4DQXA 5I8PA 3FOEC 1YQUA 3GUUA 1OXSC 2IY8A 1Z25A 3GIDA 4ONEA 1VGQA 2H7XA 3OVMA 3O8DA 4YAOA 1JG2A 4DADA 1YFZA 4YAGA 2ZGVA 2R60A 3WGGA 3DE1X 2FSPA 4F5EA 2QAIA 4Y6GB 5HFAA 4BOYA 4OYYA 2J9ZB 5HRUA 2QN1A 3ZR4B 1HA3A 2KHZA 4RTJA 4DWOA 3IMKA 3TQHA 4LXXA 4EZIA 3C2QA 4H6PA 3TG8A 1HDCA 4MUAA 3P2MA 4NCJA 4EGCB 2PU7A 1FUUA 1LX7A 2ZT5A 4L95C 2EATA 2JCXA 2R3SA 3C48A 4HNGA 4DBVO 4RJTA 2ISQA 3I23A 1L1QA 1UBTS 5KX5B 3AUKA 3GZNB 3TIIA 4JITA 1R4ZA 2RGWA 2L17A 2JVKA 2BAGA 1QVVA 5AJXA 5LIPA 1MV5A 1JPUA 3BE8A 1C3OA 4I3FA 4NCKA 1VSQA 3LCRA 3RUIA 5JVDA 3OH8A 3WHPA 2FQWA 1M0EA 4XEUA 3FW1A 1SQFA 1MO6A 1A0OA 1UK9A 1Y4UA 1Q74A 1Y48E 3OPYI 4N76A 3LFHA 2ZJZA 2BFOA 1QOZA 3JQFA 5AUNB 4DLRA 4G5FA 1PV1A 4F11A 4G67A 1TYAE 2BJWA 4C2BA 1NMQA 3AP2A 4HGRA 3SJBA 2H7VA 4R81A 4PO1A 3VMMA 1XQ1A 2FPKA 3FNHA 4MW6A 5ALSA 2J5XA 4QX6A 5BV2P 3OI7A 1CUAA 1YV9A 2QVLA 4DMGA 4E6EA 4XJXA 4LMAA 2B7LA 3RIEA 1V2GA 3U7IA 2HR1A 3SIPA 2DY0A 4EEXA 3IR7A 3I61A 3PKJA 3EDCA 1LU9A 5ICCA 1PNOA 3SDSA 1M2HA 1OFVA 2HAEA 4H3SA 3C1TA 4MO9A 5AJVB 4IIBA 3QSYA 2V8OA 1V8OA 2VCYA 1W36C 1HYGA 2VC2B 2XE4A 4LRQA 3ROTA 1XDZA 1WY5A 1P8JA 1DEXA 3MJCA 3I12A 2RGAA 2P9QA 3HYCA 2DQYA 4I55F 5ELMA 4ABYA 1L5NA 2R751 1Z5WA 2PT7A 3VA7A 4L3VA 4RVGA 3JWIA 3PCRB 3PPYA 4XTCS 3U9SA 1R0KA 1DPFA 4DYVA 4R2WA 2Y68A 4E30A 3EK2A 5HFNA 2J46A 1HKUA 8AT1A 5BV1A 1T5HX 1WD7A 1I6WA 1UJ5A 1XEAA 1QV9A 3R41A 4MPTA 3SICE 4KC0A 2VNJA 1R37A 4TRMA 2NWQA 4IRUB 3U17A 4BV2A 2EHJA 1ZA1A 2J6BA 2YWJA 4I66A 5F5LA 4FW8A 1KJWA 3KL4A 2A9RA 1R6BX 1M6EX 2V9ZA 5KSWB 4RH0A 5EZYB 4J90A 3UHOA 2DC1A 2HMYB 1FXUA 4WVLA 3HVRA 3FRIA 3HRHA 1H22A 5IUJC 1OIWA 4G2TA 1C0PA 1TF7A 3DBLA 3EXG2 1RC1A 3JCZA 1TCUA 1TIPA 3R5FA 4BNGA 1F7VA 1YDHA 2V7UA 4YS6A 3RYIB 3PQEA 3PENA 5FUWA 3RFTA 4EOGA 5BV0A 2LBPA 3AX6A 5KKAA 3AHGA 3D9QX 2VJYA 2WHQA 221PA 2XBUA 3N2KA 3QJYA 2I4LA 3OE7A 4Y98A 1XRJA 1YQDA 4XR9A 4ZQEA 1GTJ1 4RULA 2EW8A 5ARCA 4AG3A 4CMJA 2AF4C 2HV8A 2ANCA 2ZBUA 3GFGA 4D8UA 2IUUA 1J42A 3H8JA 3I64A 3D81A 5FPSA 1PYGA 1UFKA 1O9BA 1P62B 4BJ6A 4M8IA 1K88A 1A4XA 3U3XA 1DI0A 4I50A 1PD0A 4G6ZA 5ALKA 1LLCA 1I9GA 5H5JA 5IU6A 4W8GA 1G63A 3H9UA 4LHXA 3CWQA 2JF0A 1EX7A 3M1LA 1N3BA 3H65A 5EJGA 3MZ0A 1BWSA 3RLFA 4HAXA 4X3CA 3DMFA 4G1BA 4Z0HO 4MVJF 3DKKA 4QQ8A 3COWA 3WB9A 1ILEA 4B2IA 2XYVA 4H4EA 3T4PA 3TRKA 2Q9BA 4B3RB 1Q3KA 1VHJA 2O7VA 3I52A 3U0VA 4EFDA 1B6TA 4CW7A 4XOUA 2RHBA 4OHKA 3TQOA 1BX0A 4WK0B 1GU0A 3M9LA 4DV4B 1XSEA 1TIBA 2GAJA 3ANLA 3F96A 4UCWA 3I39X 1EXMA 1HG0A 1QKKA 2IOFK 3AYXB 3BFXA 3KFVA 4H7HA 4QU9A 5ES3A 1T24A 5CXXA 5JECA 5JANA 2NU7A 4R16A 3SWWA 2IS6A 5CGZA 4TRRA 2H2AA 5A2GA 4D9NA 4NU6A 1FSPA 1H2BA 2YQ5A 3LRTA 5IT9A 5J40A 1QIHA 2EKZA 4KUEA 3DDOA 2BBSA 1NJ5A 2NZ2A 1B7GO 1GZVA 4QTYA 1G7RA 4OD0A 1UFOA 1G18A 3O4GA 1V48A 1IB0A 3AZOA 5B37A 2ZTVA 1DP4A 4C0AC 4M7WA 3BSFA 4U8GA 3MK31 3LKVA 1E7QA 4NHEA 4F4DA 1XROA 2DERA 3ZDDA 1EM6A 2WU8A 3CLTD 1F4LA 4CM7A 2B4KA 2J85A 1QZ3A 3N5KA 1Y5LA 1UK7A 4IV0A 1VP9A 3T15A 1YB6A 3Q41A 3ND9A 3DOFA 4CM1A 1Z0IA 1T15A 3JQ6A 2P5SA 3MXOA 3PUHA 2O2HA 3QUSA 3COZA 5F1YA 4QOFA 4DBZA 3GNSA 1DXYA 1P77A 2ADFA 2J9XB 3I4CA 4IQ8A 3Q9LA 5A02A 4LE2A 4ZK6A 3RSSA 3AHFA 3HJNA 3JQCA 4B7CA 4R8MA 8GPBA 3PNBA 3U56A 1DOHA 3DE6X 2QF7A 5TVGA 2AK2A 4EPXA 1Y7TA 3WVNA 2AQ8A 5D6NA 1W6RA 1XAIA 2EL9A 5GJVC 2H65A 3N2KB 4W6ZA 3GJXC 2NSJA 3OAAA 3MGAA 1FRFS 2PSJA 3TXYA 1CUYA 4PC1A 1IY8A 1ONBA 1YR7A 2HOQA 2P5UA 4KSYA 3ZJYA 3HJGA 4I1PA 3LT5A 2BPOA 4AJPA 3C6XA 1JSXA 3S2YA 3HWWA 4RVSA 4ZI7B 3OIWA 4X41A 2BGLA 1KMMA 3JX9A 4TLEA 4O59O 4GP9A 9MHTA 1H9AA 4GHWA 2CL6X 3LDGA 2OQIA 1ZESA 2PGNA 2Y1WA 4LTNA 4OLJA 3ZCQA 3E22B 2QX9A 3X2SA 3JXEA 2Y9PB 2JZCA 3PVZA 5EPUA 2FZCA 4AZWA 1OBHA 2OORC 2HBYA 4J0FA 1T5SA 1L5YA 3PUZA 1L3BA 1JPVA 2JFOA 1BKSB 3RS7A 3WE7A 3C1UA 2P1RA 2VDJA 1O9GA 5M3BA 421PA 5CBKA 1E4EB 5ITWA 2Q6KA 1WLYA 3OD1A 4RCZA 1IBSA 1W0JA 3BXEA 3G85A 4FFOA 1OLSA 1XLUA 3WMXA 4ZICA 5AJWA 5K05A 1X13A 1AB5A 1ZUIA 3S2GA 1D6SA 5D3QA 1D7OA 4B3FX 3ZDZB 4C3OB 3IPXA 1SK9A 1T4DA 3KUXA 4XCXA 3REFA 3VAZA 4F6LA 5A5VA 4D0SA 2J33A 5FDFA 2PSDA 5E95A 3GA5A 4C08A 3EXFA 2I7VA 3QLJA 2JGEA 3G2JA 1Z17A 3F46A 4K28A 1ODFA 1SVSA 3M6FA 3SIXA 5KMGB 1P60A 5KYWB 2KLBA 1NBME 1ODKA 4BP9A 3LC0A 2Q0HA 1OZAA 1OZGA 4J1SA 4BTEA 3OCWA 2ZCUA 4BP8A 4UNQA 2ON6A 3WJ1A 2X8LA 4RL4A 3CTMA 2Q45A 3Q5DA 2AMJA 3EGEA 3VZSA 2VKTA 5BRJA 1G1AA 5JJBA 5L53A 4OXRA 5JVDF 2P67A 3EVTA 3QUBA 5DT9A 1HWYA 3L8CA 3VYRB 1GUAA 2FPPA 3V4RA 1Q77A 1QMPA 3RUCA 1CG6A 2XNDA 4I8IA 3STWA 3LO8A 1TKRA 3H1GA 1YFJA 2V3CC 3WGVA 2Y27A 5AW5A 2EVWX 2DM6A 5EEHA 3QPWA 4V3CA 3UW3A 3RIYA 1Y5NA 1T6BY 4TWJA 2B25A 3ZV4A 3AJAA 4BZPA 1COWA 2P75A 1SCUB 3Q2OA 3KYCB 5IPFA 2AD1A 4PHHA 3BWVA 4FNGA 4JODA 1KDZA 2AXPA 3UYLA 1A9OA 3U4IA 2HRRA 3IJPA 4TYYA 2JVJA 4ETIA 1NHWA 1U0OC 3HVIA 3BFVA 3ZS8A 3FWYA 2CXTA 3M5WA 1JSZA 3U49A 2CK3D 1NY5A 1BTOA 2DJIA 2QV0A 1XBTA 2CJFA 2C8VA 2ZB7A 3FOWA 2PQ6A 1X7XB 2XZTA 4Q4HB 1EIZA 1Z5GA 3DC7A 1ZGGA 3T34A 2X42A 3UK2A 1XMQB 1UBGA 1T5LA 1HE5A 2VPYA 4FXPA 4OQYA 4DNFA 3B13B 5DHFA 5KYUA 4LSZA 2XGMA 3D5TA 4IFTA 1CUXA 3EGXA 5C51B 1ECLA 3QE4A 3L6DA 4JBHA 3NAQA 3QVXA 1D2AA 1OYYA 3KHKA 3PLAE 1MB0A 1NJSA 4IVPA 2WUFA 5TXGA 4U3JB 2CXQA 2AC4A 3GPBA 5AYVA 5JADA 4INAA 2WUWE 2DZDA 3L5KA 1EE2A 4QUKA 4HO1X 4JI6B 4EUNA 2WJAA 3KR0A 3NCTA 4GM0A 4IMJB 3NATA 3U9TA 3GP3A 1NFRA 4RHEA 1M72A 3RUFA 2WWTA 3AZPA 3IVGA 4KW7A 1CIVA 3ZHTA 4EG6A 1VA5A 4TL6A 4HPXB 5DM4A 3LYAA 5GGYA 5MFZA 3K9QO 1BKDR 3PD0A 3U7QB 3Q7TA 1UZLA 1W1UA 3LQRA 3ZWVA 4OFXA 3K6JA 9GPBA 2QL6A 4Q1CA 5IJ9A 3UGQA 4QXMA 1ST3A 4XRRA 4KPFC 4KXWA 3QVKA 4XGKA 3V8PA 5AW6A 5A4JA 3MAJA 1I1NA 3X1KA 4FFLA 5EGSA 4ZYYA 4RPHA 2QG6A 1N25A 3UMYA 3T7TA 1FUIA 1P2FA 1QIDA 2YVAA 3JQDA 3NHBA 4HZGA 5IC6A 1Q7RA 1VIYA 4EY7A 4I50F 2BFNA 2IZ7A 2ZXEA 1V5GA 4XYBA 3L8YA 1C0EA 5HE9A 1ULSA 5IVIA 3Q9SA 4XAQA 2AJCA 4MHTA 1Z6QA 3FYSA 3EWIA 4HNRA 3DFMA 2O2EA 2ZYRA 4B81A 1NNI1 2CXSA 1BJTA 2VDKB 4K6HA 1IHXA 8ADHA 4JLSA 4L5YA 2PZKA 1EFCA 1FW6A 2VYNA 2VXCA 4W1PA 5DM60 2PG3A 1OQAA 3E15A 3ML1A 4LI0A 4M0DA 3RVBA 4GPTA 5EZSA 2BL4A 1JLLB 3IE2A 2PLAA 3KAQA 3FYUC 5E9QA 5DWVA 1R0CA 3DP7A 5F2OA 5TMPA 3LUJA 4Q4JB 1KSGA 3VR3A 3KP1A 3U60B 4Y67A 1JAYA 2XTJA 1SELA 3KHUA 4JI2B 1Q22A 1S01A 1NWHA 1R8QA 2IYFA 1I4EB 3QEMA 4HAIA 5ENDA 4QGBA 3KQKA 1GRRA 4I5EA 5KJEA 1D8AA 5HCNA 1GXSB 1NFQA 3WK4A 3FETA 5LQCA 3IPYA 5BSFA 2JI7A 4PCVA 3FFTA 1PCXA 1SMKA 3P4UA 1SQ5A 2Z98A 1SXJA 4JI8B 1N9ZA 2H52A 2H4ZA 2I2CA 3F7OA 3C4VA 3M7IA 4KN6A 1W2WB 2B6NA 1ZMTA 1F51E 3T3GA 4DSNA 4X66B 3IAM1 1HTWA 3N2NA 3PRJA 4IZ6A 2G5GX 1IL0A 5A5FA 5AVWA 5LBUA 2DFVA 4GXQA 5AVQA 1ZZEA 1LI4A 3CPHA 1EVKA 1EGVB 2LWIA 1NP3A 3AILA 2H85A 4M86A 1R5OA 2GA8A 4WZZA 4TV8A 2JGKA 2RD2A 2EZ8A 3WWZA 3UICA 3WK6A 1KC3A 2ZANA 1QGOA 4D57A 3IV9A 2YRWA 4N5LA 5JDIA 3M3DA 4PC6A 4LHEA 3HEAA 3TRHA 4X6UA 2QL5A 2EFHB 3EG5A 2XOKA 4GDMA 5DTJA 3JALA 5JCJA 4Z49A 3LWBA 4HRYA 3T5AA 1U28C 2FW9A 1WXWA 2W2KA 4Z4GA 2DUUA 4G4SP 4PRZA 4W9RA 1P7VA 4EI7A 3FDXA 3LS2A 2XADA 4IOMA 4HS9A 4M1KA 5AKEA 2Z9CA 3RIMA 1ZH6A 2YZMA 4NX2A 1ZD4A 1YZFA 3AEKA 5HOEA 1XZ8A 3FMFA 1BSVA 1EVIA 5HNKA 5BVGB 4M0MA 2G1KA 2YYSA 1Y63A 4IDCA 1Z4PX 5EWMB 3CC8A 5T3UA 4QGAA 5LN1A 3W1WA 3RREA 2CJWA 3UY4A 1ABBA 1KOGA 4C4TA 4K0RA 4NYIQ 2R85A 4RLHA 2UYGA 3UXYA 2HK9A 4AS2A 2Z9DA 4QUIA 4YX9A 1QE3A 3AESB 3TE6A 3BRCA 2R86A 4J29A 3VH4A 2I65A 1FQWA 2CXPA 1WR8A 1RAEA 3DBHB 4CDMA 4WJLA 5CFLA 1JYEA 4A91A 4XWKA 3RFXA 1OROA 4EHHA 3NHWA 1Q0RA 1N5KA 2DBYA 2FJPA 1M1UA 3C8DA 3ZNPA