1BZYA

Human hgprtase with transition state inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
214
structure length
214
Chain Sequence
b'SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title The 2.0 A structure of human hypoxanthine-guanine phosphoribosyltransferase in complex with a transition-state analog inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphoribosyltransferase
total genus 70
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 1998-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bzyA00
1JLRA 1I0IA 2GEBA 2HCRA 1MZVA 3HVUA 4JITA 4P80A 3N2LA 1QCCA 4RAQA 3GEPA 4P81A 1A4XA 3H83A 1A95A 1ECGA 1VSTA 5BSKA 1J7JA 1IBSA 4RANA 3NAGA 1GPH1 1QK4A 2H07A 1L1QA 2DY0A 1ECJA 1A97A 1ECCA 1CJBA 2JKZA 5IPFA 1P4AA 1BD3A 1ZN8A 2JI4A 1I0LA 3DMPA 1ZN9A 2PRZA 1VDMA 2XBUA 1G2PA 1G9TA 1NULA 3LRTA 1XZ8A 3ACBA 1ECFA 1BZYA 2AEEA 4LYGA 3OZGA 1UPFA 4P82A 4QRIA 4S2UA 4RHXA 3OHPA 1D6NA 2WNSA 1DQNA 4JLSA 2E55A 3G6WA 1BD4A 3KB8A 5K51A 3OZFA 1XTTA 1TC1A 1QK3A 3MBIA 4M0KA 4M0UA 1WD5A 1AO0A 4RAOA 4IJQA 1QCDA 5ESXA 1G9SA 1I14A 1QB8A 1P17A 2FXVA 4KN6A 1OPRA 4RACA 4RHTA 1STOA 1DKUA 4WMLA 3EFHA 5E38A 5KAPA 1A3CA 1TC2A 5IAOA 1DQPA 4X44A 4PAWA 1A96A 4P84A 1OROA 4TWBA 2VFAA 2JKYA 2PS1A 4ZFNA 1W30A 4RV4A 5KAMA 1QK5A 1YFZA 1PZMA 4RQBA 5BQOA 1Y0BA 4PFQA 1I5EA 3M3HA 1A98A 4RABA 4RQAA 4LZOA 4RHYA 2IGBA 4P83A 5BQPA 4QYIA 3ACDA 3ACCA 4Z1OA 5JSQA 1ECBA 2YZKA 1U9YA 4QYIB 1V9SA 1G2QA 4M0PA 5HIAA 4WN3A 1XZNA 5HKLA 3LPNA 1L1RA 1U9ZA 3MJDA 1XTUA 3O7MA 3DEZA 1O57A 1P18A 1UFRA 2C4KA 1JLSA 4LYYA 4P86A 5ESWA 3GGCA 1HGXA 1DKRA 4X45A 4LZAA 4F8EA 1UPUA 1ZN7A 4LZNA 5EUCA 3QW4B 1DBRA 1QB7A 4P3KA 4MB6A 1HMPA 1VCHA 1GRVA 2EHJA 5JV5A 1I13A 2JBHA 4RHUA 1NONA 1P19A 1Z7GA 4RADA 5BRNA 1R3UA 1XTVA 3S5JA 3DAHA 2H06A 4FYMA 1OREA 1FSGA 2P1ZA 4OHCA 3GGJA 1LH0A 2PRYA 1O5OA 2H08A
chains in the Genus database with same CATH superfamily
1JQKA 1B8VA 1IG0A 3JQ9C 2Q49A 1LPPA 3VKUA 3W3ZB 2B25A 3WZLA 5DRYA 3ET4A 4ZZ1A 5C80A 1OLSA 3D8BA 3H2BA 4Q4JB 1KYXA 1OFTA 4M1WA 4OL9A 3PUWA 2CBZA 1J8YF 4P81A 4C5BA 1TF7A 1H1LA 4M0CA 2E87A 2HHHB 3AIIA 4ZOCA 4XQ0A 3BOSA 3NALA 1FFXA 3UXYA 3PTLA 5AI6A 2QRVB 1GO2A 2YDXA 2YOGA 1R37A 4EY3A 4CCSA 3PWZA 4MA5A 4OUDB 1PR2A 2OM6A 2PJZA 2Q5QA 2PMKA 1BO6A 3DCYA 5IK2A 1VIYA 1ZM4A 4P9NA 3TI9A 4KXWA 2WU3A 5CAEA 1SUFA 4B4UA 3SQDA 2APJA 3AG6A 4UNPA 3DOHA 5JZBA 3LHKA 1TTTA 2NTVA 2WUEA 1O8BA 1X70A 3U40A 5FUQA 3F7NA 1LVGA 1TLLA 3R23A 2Y2VA 2UYGA 1MOQA 3PHCA 2WM9B 2DUJA 3W7AA 3D2CA 3T4UA 4LHYA 3HGQA 3T5MA 3G2KA 5F51A 4K1LA 1CFJA 3VVMA 2PG3A 1XALA 4J90A 2I65A 2NZVG 3SQWA 2O7VA 5KSPA 1M1UA 4CMHA 2HPVA 3BXZA 3VR6H 4MRNA 1SCUB 2FR0A 1ZGHA 3E6AA 1L7XA 1X86B 4W5JA 4FILA 1JIJA 1TC2A 3QKIA 1UBNA 4QX6A 1T25A 3RF7A 4DCOA 3KB2A 4L0DA 4BNVA 3CZPA 3DZDA 3EMDA 4FCWA 2ZSIA 5HZHA 1KZ1A 1W4RA 3D5EA 3KCNA 1Z8DA 4J8PA 4X61A 3RYIA 4AS2A 5HOQA 3RYCB 3ABIA 1OBOA 4C14A 5C5EA 5IVIA 4ZT3A 5I48A 1KRXA 5JTUA 1IWPB 1Y1KE 1K9VF 2HM7A 3IUBA 1E3WA 2VIIA 5BURA 3HJTA 3DHYA 2O7QA 3SI7A 1PLLA 1WCWA 2FZLA 2HK9A 1ZJ5A 3OJXA 3R7FA 1VA4A 1Z4JA 4PX3A 4AZ0B 1R50A 1WLYA 2QMUA 1L4FA 4EJ2A 1J09A 3LSTA 3NUQA 3AUXA 1L5QA 3NHZA 2H9IA 2J3MA 1HZJA 4JQZA 4DG5A 5TARA 2ZAOA 1CUUA 4DE5A 5JYCA 3WGUA 5J40A 5HIKA 3DEZA 3ORFA 1V3VA 4GICA 4QELA 4F85A 3E8MA 2KLBA 4HN9A 3EPPA 3ELYA 4EPXA 4HQRA 2Z98A 4MV7A 1DZ3A 1CZLA 1O9BA 5CDGA 4MQ4A 4ZEOA 3U3DA 3IAS6 4RPGA 1TO6A 2NT3A 4MPDA 4C3ZA 2XTNA 3BXXA 4OLFA 4QARA 3EXHB 5HIMA 2HX1A 4UM5A 5K0TA 5CDYA 5KYNA 2KBFA 2OQ2A 3AUJB 2GMWA 1OXXK 3FWYA 4IQ8A 3UNXA 4R1TA 1QAMA 3DAFA 4ZQGA 4CQLA 4ZEVA 3G59A 1RXUA 1VL5A 1AJEA 4YO7A 3QLEA 4X6XA 4D8WA 2BC9A 3IE1A 2OGTA 2Q1TA 3D3NA 3C8UA 1IHXA 2AX3A 3HJCA 4LQ4A 3TRDA 1XD9A 4WN9B 4EA8A 2OAQ1 4NH0A 1NX9A 3EYWA 5EUBA 4MKGA 4UDNA 1J0DA 4W7IA 3Q11A 1XZFA 1CJTC 4G5RA 4I8XA 5DK4A 5K3SA 4EVIA 1M2JA 3CONA 3QV2A 5FBZA 2CWDA 3A31A 4KX5A 2WRZA 1IQ0A 3GUUA 1IAQA 4OGGA 1PFUA 4KI0A 3EGOA 1CX9B 1K7XB 2JAPA 4KUHA 4Z53A 3BWVA 4HRVA 2OL4A 3DV0A 5MN5A 2GZ3A 2PUEA 3B3GA 2ZWPA 2RKOA 4UOQA 3EGVA 2R60A 2CLMB 1C7JA 2I6TA 1W36C 1J8DA 1WSDA 2J9FB 1LJ8A 3TCXB 2O7SA 2Y66A 2Q41A 2Z9CA 3M8KA 4TSKA 4CLRB 2QGNA 2PUGA 4RVGA 1M34B 4OA8A 4JGIA 5JWRA 2OEPA 2Z57A 3LFTA 5E9AA 4UC0A 4GVXA 4X92A 1EGQA 4UTOA 2RHCA 4NHEA 4YRBA 4YP5A 4Y2HA 2CFIA 1BG6A 4JJAA 4BWYA 1J5XA 2ZSAA 3ILVA 1B14A 4H6XA 4XWTA 5LZ4A 4IIDA 3TZHA 4E5SA 2I91A 1YQWA 3DYBA 3OU2A 3L4KA 1XZDA 1BQ3A 1FEZA 4MDHA 5SYAA 3RU2A 3L5OA 3WK5A 3O3NB 1RHRA 3HUFA 3WRYA 3UJAA 4YNBA 4QOGA 5F5XA 4CEIA 2ZM5A 3ORHA 2DHRA 3DO6A 3CB4A 1CIJA 1C41A 4LZPA 3CO0S 4MRRA 1IULA 2VK1A 2EYQA 3QTTA 1M10A 3VBEA 3ISJA 1QQ7A 3LUDA 4MYSA 2R6AA 4IDDA 2R25B 4LNUA 3L01A 4NQRA 3FJ1A 1U7XA 4DT1A 5AHXA 2E4YA 1SQGA 5KYUA 1OPRA 1I4TD 5B57C 4N6GA 3VDMA 4AD8A 1VE7A 1U11A 1IFXA 1F5SA 2F3SA 2HJWA 1M2FA 4QG7A 1EBFA 4MVYA 4OB6A 3JS5A 4NICA 2VJOA 2Q3MA 3DE3X 3VR0A 1Y9EA 1WKVA 1SKAA 1TQDA 3WJ2A 4V1CA 4HEJA 4Y2RA 4BZWA 3WNVA 4Q1CA 1IZ9A 2BLNA 4CDRA 1D09A 1ZESA 4LHZA 2F59A 3ENWA 4PWYA 4X93A 5AUOB 3IE2A 1V9SA 1L9KA 3VNQA 1YRBA 4LJAA 1BHJA 1X19A 1XWIA 2HD4A 3C6YA 1DEKA 3NHYA 3RC1A 2CLSA 2V96A 4O4IA 5KSOA 4DM4A 4B7XA 4BCBA 4PZUA 3RASA 4CM5A 5LM3A 1OKKA 1MX3A 4UBJA 5EN4A 3KAKA 2D5CA 3GHYA 4GE0A 5EE9A 1E58A 2QT9A 3JQBC 5HGJA 1I1HA 1Z35A 3PEVA 1INLA 5CVDA 3BORA 4CMJA 1NKVA 4ESEA 4XUGB 2GPJA 2IYQA 1HTTA 2QWXA 4V38A 4ZAGA 1MB2A 3A8TA 2FN7A 2P9HA 2ZSFA 3QKSB 3VO2A 2ANCA 3VYTB 2HWXA 3GGPA 4UUMA 2HNBA 4OMUA 4PNZA 4MZXA 1N3LA 1JIVA 4RADA 3WHPA 1BU8A 1G20B 1S96A 4OHXA 1TAGA 4I5EA 1KYIA 3U2QA 1SA0B 4ZOLF 4FBMA 4IZOA 4WK4B 4HG2A 5ALGA 1QCYA 2DUNA 3E53A 1IH8A 3V1UA 4LQCA 4V0NA 3OY2A 4KWHA 1W5SA 5BN4B 5JD4A 4HDNA 4AI6A 3CUUA 2F55A 1DAGA 1IHYA 4BFTA 3Q3EA 2J0SA 4EFDA 2PBRA 3EQ2A 3IEKA 2BHRA 4BO7A 5KYYA 2XF2A 2P9JA 2Q5IA 1H42A 1PAUA 2BBSA 1O94A 1XZLA 1UMBB 4NABA 3STTA 3JQBA 1PW7A 3TZEA 4N9QA 1HRKA 5H8WA 3INRA 4A8JC 4WY8A 5FUXA 3SIXA 4AN1A 2BRUC 4TMYA 2QOEA 4OY3A 2WWGA 2ZIUB 2DULA 3SWWA 3MT9A 3TQFA 3AF0A 2XUIA 2GLTA 5B58C 3GRPA 1BEEA 1A1VA 2YJTD 3DMRA 3LQFA 4OHWA 4E12A 5KTSA 4MIYA 3Q8MA 2GEDA 3GHHA 1HE1C 5A3VA 4N6OA 2VSNA 3R44A 2ZYRA 4KYUA 4NCIA 4KYIB 1JA1A 1HEIA 1MQ8B 5G0WA 3UA4A 2ZAMA 4JD5A 4RM2A 3RK1A 4DZTA 1XTKA 3LT0A 4F2HA 3WNDA 3CZAA 3HL0A 3AVPA 4UAJA 5B1SA 1W87A 3OMXA 4GMGA 5AM0A 3WL8A 2RIPA 3IXQA 2J30A 4N8DA 4RTOA 2A58A 3O2JA 3TK1A 2G67A 3HN6A 4LKOA 2JGKA 4GECA 4GPEA 4I4NA 4ZCMA 3M6UA 1P31A 1NXQA 4FFPA 4W9RA 4Z0NA 4AURA 2DQKA 4A6XA 2O5EA 4A8JA 4D0LB 4ZAFA 5CEJA 3KQTA 1UH5A 1LS6A 2WFMA 2BJHA 2FFHA 3L6RA 5JARA 3MLAA 4KE9A 4K05A 4ZRDA 5C51B 1XMOB 2J07A 1J8FA 2PQ0A 4QHTA 3R7WB 3VTKA 3FY4A 1YDMA 4HK4A 1ISJA 3EOZA 3QBVA 3OCZA 1WZNA 3CUEF 3OZUA 5EKDA 3DTVD 4FBLA 4QXOA 4QLBA 2OKCA 2ZJOA 5CHYA 4XE5A 1I7NA 4GPZA 1NW7A 4QICA 3ER9A 1Z7EA 4RQAA 1GT6A 4UZEA 2WVJA 4U2BA 1TK3A 1ZCJA 1GZ4A 3EZXA 5DBGA 1XZBA 5I6DA 1HOXA 1U6JA 3HU1A 3TH5A 3D8RA 4G8CA 1U8CB 1Z6YA 3D4NA 3P2IA 4YHBA 2W6CX 3MNFA 1MEJA 2GNAA 3OCJA 4Q1DA 1R0KA 4ZYYA 5CB8A 4LVUA 1IRXA 1N0IA 3IJEB 5BWNA 5LKRA 3EPLA 2A1UB 1E5TA 5CYFA 3R76A 2ZYSA 1SULA 4ROTA 1JMYA 3JQAA 4EQZA 1IK4A 2WIDA 2IDMA 4MUEA 3ZXYA 3ROKA 4AY4A 3DL4A 2CXPA 3JALB 1WVMA 2OZEA 1QBGA 2ZCVA 3PNOA 5K6RA 5LDDC 1OWOA 1IHUA 4P3OA 1KBZA 1S89A 4MIKA 4B3SB 4WXHA 3FNGA 2H4HA 4PGGA 4OLBA 2DBQA 1JEQB 3QVOA 1KJ8A 2I4NA 4Y7CA 1C8KA 2AWOA 3GG9A 3F6EX 2HBRA 2FDXA 3SZGA 3NTQA 1KK1A 2CVFA 3F4KA 1ODTC 3ID6C 4CGZA 1Y5LA 2DFVA 4EK9A 3KXPA 4MLDA 3USCS 4AMGA 4YJ3A 1HR0B 1BW9A 1YA6A 2QD4A 2B1QA 4PPYA 2PRYA 2O2XA 4WKPA 4ZO9A 3CMCO 4EPWA 1ZMXA 2XF8A 1SKBA 2BHNA 4GI5A 4FCVA 1E5XA 4H18A 1QP7A 2PKWA 1TF2A 3NHRA 2IJGX 2JHGA 3FNEA 3KX2A 4GSKA 5AJZA 3RU3A 3VR5H 3WP1B 5LQMA 3JSAA 1W96A 2IYPA 3GUYA 5FUVA 4XVQA 4FB4A 1SUCA 1Z4LA 2X22A 3N2LA 1PTJC 3AJEA 3MPUA 4W5HA 3WS7A 2FI1A 1Z7BA 2XCLA 3HR8A 3S2FA 3GEHA 4TL9A 3WO0A 4AW9A 2I9KA 1XPUA 2R11A 2DKNA 1USVA 3CLVA 3FCSB 1QHYA 4M9RA 4M1KA 1UODA 2DJ5A 3VX4A 4DLLA 1XU4A 1O1YA 3USZA 4LE1A 4G0WA 4PZEA 4G4JA 4XKJA 3IURA 1CR2A 1QU2A 2PS0A 4HQKA 3LPCA 2OA0A 2WPNA 2CLKB 3JX9A 4Q01A 4U6NA 5CB0A 2Q62A 3MD9A 3OFVA 4TWRA 5ENDA 4ZOQI 1E2JA 3NCHA 1AURA 1RWOA 3CZ4A 4FZVA 4I19A 3RKUA 5EJ5A 3H9EO 4JLSA 3AKEA 1OH5A 2QQFA 3N0VA 1QM5A 3LDUA 4C2BA 3GLGE 1YB1A 5DW0A 3MTAA 1ACMA 4BIIA 1K7FB 1M1XB 1BU5A 2LCIA 4RO0A 4LYJA 4C0QC 1S3GA 4HBGA 5FPSA 4CQJA 2BSQA 4XW2A 1Z2CA 1PGJA 4U2DA 1KOJA 1LLCA 1FK8A 1U3GA 1DBVO 1FUIA 2E4ZA 2F1KA 1ORIA 1CY7A 3PIDA 5IAJA 4DZRA 2OV1A 3B89A 5ELLA 2WJVA 4TUYA 5HBGA 4TOIA 4DHWA 1IVSA 1Z0IA 4C06A 1GGMA 3BYZA 3DH0A 1GKYA 2OD2A 1K98A 1E1MA 1G5FA 3FSEA 5DCYA 4EHIA 1XDZA 3RREA 3GAFA 4I36A 4Y98A 2ZUFA 2ZIWB 1YCFA 1L5VA 3P94A 1PEYA 3TCKA 2P6PA 2XUOA 3BDIA 3ZJTA 1EM6A 1KMCA 5KPJA 2Q0HA 5AKXA 2VUIB 4ZV9A 1K4YA 5HUJA 3PEWA 4X90A 4CU2A 2NTJA 1RI4A 4XJVA 2TMGA 1WSBA 3TNYA 4YBZA 5J1TB 2DB3A 2XYHA 1NR1A 3T1HB 1VB3A 2OR3A 1PVDA 3FDZA 2X2FA 4QBTA 4YYEA 1OIXA 3C98A 4CT4B 2IPLA 4DV1B 5LIRA 3H5AA 2VOJA 4DMGA 4LCBA 1UMDB 2ZI5A 4ROSA 3N8NA 4Z9AA 1A50B 4KWIA 5KCMA 1L7VC 4RQTA 3ZU2A 5JJ5A 2WD7A 1R0LA 1XQWA 5EWLB 4X94A 4QUKA 2VXOA 2IBTA 2F3TA 2WKQA 4IJMA 4CEHB 4C7BA 1MAHA 1MTZA 1BKDR 4M99A 1KEEA 4LZNA 2ECKA 2EFHB 4RH1A 3CE9A 4XEHA 4ZCSA 2FFJA 2IXEA 2GSWA 3P2JA 4EI7A 3CEJA 1A7KA 1NYQA 5DIZA 2H3HA 3FPBA 2Q7OE 3ZE6A 4N4AA 2XUQA 5F4BA 5L40A 1KA9H 2JIZA 3GAZA 2ATIA 5DNVA 4PHFA 5EVJA 4EJSA 3K05A 3LF1A 5HDBB 1J90A 1T5OA 2AXEA 1D0SA 1PZXA 2H48A 3OKFA 2BM1A 4H6PA 3VYWA 1D6MA 4F7DA 2HQBA 3QJYA 3CH5A 4FFMA 5I7UA 1J39A 4OF4A 3OLWA 1BX0A 1BHQ1 1PR9A 3U31A 3UGTA 5JNVA 5LP1A 3KNZA 1A5BB 4KTVE 1XAGA 2D0DA 1G5IA 3KQMA 1D4FA 2A88A 2P0EA 4ND8B 4TL8A 3VU0A 1GN8A 3PQDA 2J3KA 3GP3A 4XH9B 2Z4SA 1LD3A 3NV9A 4X3PA 3RVOA 4CG3A 4EF5A 1HORA 1JJVA 5ECWA 4CM1A 1RKQA 4KE7A 5DMHA 2VYQA 3TW6A 5K0BA 2ZB3A 3RKRA 1OYYA 2H51A 3H2KA 1N57A 3TNLA 3KDSE 4QC2A 4O4LA 1A7JA 3X1XA 3WLFA 3F9CA 2QBYB 3OPQA 3VSBA 1CR6A 2Y0DA 3DPUA 3OPYB 4NSNA 2V3CC 4QFMA 1ZH8A 2FW7A 3SHFA 3CRVA 5IUKC 4Q37A 3IP9A 2X19A 3G0GA 4Q19A 3GUVA 4ML3A 4MVJE 2ZQZA 2WB2A 5LMUB 3B7WA 1JG4A 1L4HA 3OZVA 2QI9F 4US1R 3PJRA 2N47A 1JX6A 3FPEA 2LBPA 3M6FA 4FLMA 3SYKA 1P1BA 3Q40A 4PPNA 3TG2A 3ROQA 1ZD2P 2D8AA 2XE4A 4OSPA 3NBMA 4X7BA 1Z75A 3L77A 4OMDA 1YBMA 2JGEA 3QWHA 1EVEA 5ALNA 2DLDA 1D04A 2P6NA 3SKYA 2ZI9A 5JSHA 3GLGA 3ZK9A 4ENUA 1U1FA 1X7WA 1HFJA 1PJZA 1VJDA 3BIJA 2ID4A 3CLSD 3T5TA 1FFYA 1PFKA 1KJZA 5EC8A 2H1VA 4HEA6 2VBIA 3W5SA 4HAVA 1U90A 4FFBB 4J0HA 1YZVA 2ZSEA 2FEPA 4WBSA 2DRIA 4JI8B 2D5LA 1ZJZA 3BHNA 4DM3A 3K4QA 4JLOA 3UUWA 3EXG1 3GMDA 1BJKA 1D7OA 2JAUA 1KPHA 4P3NA 1X7HA 1WDKA 2G82A 2WMNB 3LFUA 2J4FA 2OCKA 3EOAI 3R6GA 3VU9B 3QVKA 3L7LA 2AEMA 1JKFA 1Q3HA 2XVYA 4DIMA 4MQLA 3TM4A 2PU5A 4JLJA 2UUAB 4FSDA 4ERNA 2X8JA 1MW9X 7GPBA 1N8TA 4P4LA 5A3QA 1BS1A 4LBYA 1C1YA 1ZUIA 4WFIA 5M04A 3LYHA 1VPLA 4GMXA 2UAGA 5DN9A 2J5KA 2HPAA 4DXAA 1M5RA 3Q5DA 2BMWA 1YOBA 2P0YA 1D2CA 1LZKA 3GGCA 1EBBA 1E2UA 3OTIA 2H5JA 4G4SO 1THTA 2AF3C 4CMAA 2CC2A 4LDJA 1HTWA 1CP2A 3LWDA 3QLVA 2O8DA 1RQNA 3GNTA 1N9KA 1JG7A 5LYYA 3SEFA 4E15A 1CHNA 1E8NA 3DHVA 1S8OA 3VR4D 1LX6A 1VHTA 2OO3A 3NZEA 1W0KA 1F8UA 2GASA 3GH3A 4HB3A 4HDMA 4HPXB 1U8FO 1Z45A 2RGYA 3C6ZA 3LV8A 4Y6GB 1GUFA 1AB5A 3ZE2B 1PFYA 2PNJA 4CG2A 2CV1A 5UKDA 3HYSA 1C8BA 1DLJA 4WESA 3DP9A 4XVCA 1BOFA 1JRLA 2H1LA 2H65A 1AKNA 1HYEA 1B16A 2HJRA 3DSRA 3MUFA 4L5CA 3Q85A 4RD0A 1R7RA 4XX1A 1JVBA 1F4PA 4YREA 1MCZA 3W79A 4OI4A 1K3FA 2BMAA 1XZPA 1L4UA 2H08A 4EQ6B 4F8YA 1BWPA 1QFJA 4IQ4A 4PO9A 1HKUA 3VXKA 3EX7C 2V6MA 2AYYA 3IDSA 2X9LA 1HDYA 1RD4A 1AK2A 4OBXA 4MW5A 3RT9A 2HW8A 5H81A 4KFSA 5ESRA 3TE6A 4L02A 2RSLA 2UYHA 4QUBA 2JG3A 2A35A 3PNKA 1Z74A 3RAPR 1Y3FE 1SOVA 2OFFA 1RE1A 2ZIXB 1DCKA 5FV4A 7ADHA 1GTZA 1YWGO 3TIIA 4UXIA 1A97A 2C57A 5EERA 3JRNA 4BQFA 1JXOA 1BD3A 1KH1A 2ZRFA 3PZBA 4JBIA 4YP0A 3RC7A 4HAZA 4D3XA 4NMWA 5ALUA 3JVIA 1FU8A 3LUKA 1RI3A 1MO3A 4YWHA 2PIDA 4MVJA 4E7OA 1ZCZA 1T29A 3ZD8A 3QPAA 3RAGA 4DIEA 2N0SA 1W85B 4AQ7A 4HGQA 5B2FA 4MMZB 1P91A 1UBHS 3KJNA 4PZPA 5CIWA 4F93B 2VEDA 1YZLA 2QI9C 2YZGA 4A1FA 1AU9A 1YBVA 2QUBA 4AS1A 1KIFA 4XAQA 2GZDA 3RM3A 1XU7A 4AP9A 1XTTA 4MKRA 1CJKC 1MU0A 4IH4A 3RSSA 1XVTA 3R40A 3R9XB 3JYNA 2I6QA 2DPXA 4GF5A 2GQ0A 2D2EA 3FYSA 3JYPA 1SAYA 1AQIA 4P5DA 4S1OA 5HF5A 4ARVA 3VYRB 4ZAZA 2OKGA 3ROFA 5LNK1 3AX6A 3SC6A 3OWXA 1ZPDA 1VG8A 3BILA 3U0BA 2Z4RA 3B5JA 2QX9A 4GO1A 3OF2A 4BVBA 3VNUA 4UNQA 3URMA 4OO3A 3ENNA 2Q9BA 1YB7A 1Y8ZA 4PAWA 1LF0A 3EZ6A 2ZBEA 3PTAA 4KE6A 3UMSA 1FUUA 3EYAA 3EQZA 4FDMA 1SU7A 2XMQA 1XAJA 2WM2A 3B36A 4I9NA 1Q0PA 4TKMA 3C87A 3QEOA 4DGQA 1QF6A 4FQ7A 4IFIA 1OT5A 4GOXA 2V3VA 2FLKA 2NUAB 1XJWA 3DE0X 1VYVA 3PZRA 4N5LA 3V4ZA 3VDQA 2IK8A 5K0FA 3C3EA 2F3RA 1SVNA 3W4IA 4BGDA 1E2NA 3H04A 3QNMA 5EXXA 1UK7A 3KYIB 3UPTA 3FXAA 3KLPX 1MBZA 4G09A 4KHZA 1PYGA 2HU5A 4UAVA 4DWOA 5K0SA 3E22A 3QEMA 3FTEA 2ON6A 4FFWA 3WP0A 2F3QA 3WRWA 1RKVA 2QTFA 3H1EA 4PZYA 4OI0A 5BR8B 3EDMA 1Y80A 3TZ6A 2IF0A 1ZOLA 2CE7A 4X6UA 4UE2A 4BV9A 2BH9A 3AVOA 5EZSA 1UJCA 2OVBA 3V4OA 1CUDA 3U62A 1TXGA 3G7SA 1CD5A 2VT7A 3P9PA 5TV2A 1EK1A 1ATZA 5LQUA 1R0CA 1G98A 2C2OA 5IFLA 2PX5A 3SQXA 5E2IA 1YVDA 1NZJA 5EKUA 4P4SB 2SKDA 5G0VA 2FZ4A 1Y1PA 4FYXA 1EWVA 2I76A 2VP6A 1Y3DE 2IEGA 3GY0A 4HHEA 3U4CA 2VTDA 3OZ7A 3L0YA 4RBNA 3RSHA 4YRKA 3IB3A 4JUAA 3EGDA 2YHAA 3CY6A 4K6CA 1FA9A 3PCXA 3HHEA 2ZQ5A 4YECA 3ZE1B 4DQKA 2R97A 1PV2A 3K0CC 5FTJA 2WJ3A 5DP2A 1Q2UA 2RHOA 4P38A 4CLEA 2CWWA 4TN1A 2V9ZA 5E0OA 4O8ZA 3TRFA 1WMFA 3AONB 4JT8A 3QKUA 3ELBA 4JMPA 3DT6A 4YB8A 4Z0HO 4UU7A 1XMQB 5C5DA 1M2VA 3E5RA 5HF6A 3ZHZA 5LQDA 1BGVA 1KJ9A 2VJBA 3DAYA 3FDJA 4ZARA 5IDVA 1UOQA 2Z9DA 1NDHA 2BEUB 2J3EA 3O2NA 3OPXA 4MSUA 3ZHRA 4QXQA 4YH1A 3G5AA 3LECA 4LPSA 3HCWA 5BXQC 3JAKA 4ETIA 2DPHA 1MVNA 1NHWA 4HGZA 4JUBA 1RVDA 4ARBA 2FH5B 1P2VA 1H1DA 2YDYA 4MQEA 4L78A 5DTIA 1YBHA 3FVWA 2GN2A 4X6YA 5D6NA 1LUAA 4IX9A 3RDPA 4Q39A 4TMVA 3RJZA 3UJ7A 3ZGLA 4W1RA 4NJOA 2F1IA 3K0CA 1T8YA 3A1EA 4WGGA 2YJ5A 2NU9A 2UYOA 1CY6A 4TKUB 1EUCA 1NUHA 1V16B 2P5YA 3TOXA 3C6BA 5KOJA 5KWSA 5KYXA 3SF8A 4HNUA 1ZJWA 2XUDA 2B2CA 3F6RA 1GRQA 1J5PA 1DV1A 5BYKA 3KOMA 3QOXA 4HEA1 4OL0A 1IY8A 1YR9A 4YJDA 3T9FA 3HXMA 3MTIA 1WB4A 3FCYA 5E7QA 3G2IA 2DT8A 4NE2A 4V0LA 1LEHA 3MGBA 2FZWA 3TL6A 2XV1A 2TRSB 1FQOA 1Z2OX 3EHDA 4RFSA 1NIJA 1ZISA 1UPTA 2BFWA 1U1DA 4J3JA 3WTBA 5LUBA 5FEUA 2DWPA 1F4LA 2JKYA 1S01A 4QAJA 2YL2A 4PTYA 4QOJA 2HSWA 1FU4A 2O0HA 5E4YA 1SR8A 5DNCA 5E3JA 3QOFA 5EGSA 2BDTA 2VRCA 2X2PA 2OMKA 1A72A 4RABA 4BFZA 4ZDKA 1GSIA 1NBHA 4YLGA 1AQNA 4TYNA 1JDPA 4MZDA 5LWHA 2YQZA 1KIAA 1NQAO 1T6BY 3KALA 3H84A 3L7DA 2VNJA 4GEKA 1IAVA 1ARZA 4INJA 1GUBA 4RUKA 1BXRA 3RAJA 3TQRA 1UZAA 4DJ5X 2JH3A 5C7IO 2DUWA 3E1GA 2GGSA 4NBTA 2BYTA 1R0ZA 3TW8B 1SIWA 4PYKA 3EPHA 4KYVA 3R5KA 3ETHA 2FB9A 2QXTA 4K0RA 3RVLA 4YCNA 1XTUA 3RFFA 2PVSA 5M5BA 2Q3FA 5DSXA 2C07A 3H6HA 4C03A 2VP0A 2RGBA 1DELA 4MO2A 3IVAA 3TIGA 5M29A 2C5EA 4RMGA 3HDVA 1HF3A 2FX3A 4G3XA 3T3GA 1VJ0A 4C0WA 4D8UA 3MTDA 3FBWA 5JPDA 2IHKA 2I4LA 2XDYA 2MMGA 2XHZA 3F46A 1A8QA 3FTQA 1TVCA 1ATIA 3NT5A 5T3UA 4Z4CA 7REQA 2J7PD 4BY9E 3WV5A 5HGXA 1ZK4A 3L43A 2A0UA 5AW6A 2P2SA 1B2LA 5E4JA 2X4IA 1NMZA 1BH2A 3K8ZA 4URUR 1XTVA 4F9EA 1LK0A 3NT4A 3KO8A 1N75A 4LW8A 1QPGA 1TM1E 5DGHA 1FSGA 2QTLA 2YQ4A 1Z47A 3CVXA 1Y5MA 4CCYB 1V37A 3AR3A 1ZW6A 4CQMA 2AMVA 3HZHA 1P7VA 3R9WA 1THZA 2ZK7A 1ODCA 3RRXA 3CLRC 3ZLVA 5K99A 1H3EA 1VFPA 4DR2B 5FTNA 4IKEA 1CY8A 2ZVPX 4V0OA 4YRCA 4EJ6A 1TYZA 1XTZA 2WYUA 4R3UC 3THYA 1C0PA 3DEJA 3FZGA 3HKBA 4UHKA 4Y0AA 4QFCA 1JDJA 1QIEA 4CR6A 1FTYA 1WZUA 5D7NA 3UT5B 2CDCA 3G2QA 4G25A 1CB7A 1ZSVA 5AW9A 3CUKA 3CHYA 4RE6A 3IOCA 3LCJA 4KU4A 3B1KA 4LSGA 3GYBA 5DDIP 1ZN9A 3TZQA 1F6WA 4MIEA 2TMYA 1PJQA 3G0DA 2GO1A 2QU7A 3HEAA 4GGOA 3DOUA 3MS4A 4DCMA 1OI7A 4EG8A 1MC1A 1B0UA 2NIPA 1U8EA 3IE0A 1ZXXA 1HWYA 4ND5A 1X8JA 3ZHXA 4LTDA 4L5BA 1YU9A 1W5AA 1MN6A 1HE4A 4V3CA 2HHCA 4DTIA 1QRRA 5U4QA 2E55A 2IUFA 3ZLUA 1WKCA 4DJFC 4NAUA 2C7VA 4EKNB 2ILTA 4I50B 3ENKA 1E98A 1S5PA 2VTEA 3ILXA 1C8VB 5KDOA 1C1HA 5LQJA 4J91A 5M2QA 3I9OA 4JEMA 3CH4B 3ETLA 3DOJA 1CU1A 3EUAA 4F4IA 1IE3A 1Z36A 4UD2A 4YO8A 4UXHA 2FUG1 4GXQA 2WWTA 4ZQHA 3IOMA 5ILQA 1ZD1A 5ESDA 4XJXA 3IIEA 3AC0A 3B53X 3C5HA 3FKQA 4YLYA 2QY9A 2VFAA 1JAYA 1GARA 1W5EA 5GONB 2XT6A 4WA8A 3IRUA 3EIUA 5TJ9A 3DKVA 4RQBA 5IYZF 4GZ5A 1XXHB 2VQEB 2IHBA 2K2WA 3RS9A 2PGJA 4QJIA 4L8VA 3IB6A 2XJ4A 5HKOA 1FTQA 3Q3CA 4KQIA 1C1DA 1I6LA 1WULS 4D8VA 2IH5A 3HA7A 1V95A 2QRKA 1NFFA 4P58A 2Z1NA 1U2GC 2XQFA 1UFVA 3O2QB 2H1HA 1OHHD 1NYLA 1XE3A 2VCEA 2WZBA 3ZZ0A 2I66A 3SX4A 4AZ3B 3EGIA 1NVXQ 2VA9A 4Q66C 5CB4A 1SN7A 3KUXA 4GPIB 5IM4F 2XBMA 2O5CA 5C7LO 4IOJA 4N5HX 4UQOA 4YV0A 1MD9A 1N7JA 4H1VA 1EP1B 1HRDA 4LQDA 2FWPA 2P67A 3CX6A 3NVDA 2C2XA 5CUQA 2Q7XA 1OZGA 2OHJA 4UEJA 3V42A 2X9VA 3JCZA 4HMPA 5FR2A 3FCUB 1HFEL 1A9TA 4XR9A 3EF3A 1EPUA 2C3PA 1XZQA 1FDSA 2C88A 3MUEA 1TADA 2JHFA 1NGSA 3K53A 4MQBA 1EXNA 2WWIA 2PGXA 3BE5A 3JVEA 5FBKA 4G56A 4AKTA 4B7ZA 2H4JA 1N2EA 2JAXA 3FROA 4I1UA 4RIEA 3JATB 4OFZA 1Q3KA 1IY0A 1CQJA 3L8MA 4GXTA 2O07A 2Z5VA 5HZMA 2B92A 4B0PA 5D87A 3GEIA 1Z4QA 3UMJA 3GP5A 5JMOA 1QRSA 3O21A 3KQKA 2O4CA 5REQA 1N7IA 4Y0NA 3RRFA 1CRLA 1F17A 4KW7A 2PYIA 3MG9A 2QTMA 2FQWA 3TRIA 2ZIEA 2UZ3A 2AI2A 3TS1A 3JD2A 2W58A 2ZAIA 1J33A 3E05A 3LH5A 2ZT8A 5CU7A 1UC5B 4HNVA 2IX3A 4C88A 3AHGA 3HVUA 3EG9B 3DLHA 1VYTA 3W2HA 2OFWA 2P9FA 1ML3A 3JWPA 1X9IA 4GOJA 1A4XA 2VDRB 1WUKS 3L0IB 1XI2A 4G1UC 3U7QB 1EESA 1YD7A 3ZEIA 3PGKA 1Z0ZA 1GL6A 5JHGB 3OQMA 3W6PA 2ZUUA 3K35A 1P4AA 3FR8A 10MHA 2CMGA 2PX3A 2GZHA 4HMQA 3TTVA 1ZCAA 1OH7A 4MDEA 3ZWXA 4MGZR 3I5UA 1G9TA 5TMBA 1NP6A 3DV9A 4Y9DA 3U4HA 4MGKR 1D2RA 5EEHA 3BTOA 4JLPA 2CJYA 1YDHA 4PEVA 3I0NA 5EE1A 1G41A 3ETJA 1AUQA 1L4MA 5KVAA 4MRAA 1BDHA 2VKTA 4ZAVA 4WZBB 4E2FA 2JRLA 3NANA 4AKEA 1I2AA 2MYTA 2P4QA 2BY4A 3LNTA 4LY6A 4EA7A 3WICA 3HXPA 5FX2A 2XA1A 4RLHA 5COQA 4JT4A 1FW6A 1N5RA 2A1IA 3AZQA 5LA6B 3P0EA 4KEAA 3RYTC 5DM2A 1F2UA 3EVEA 2GBLA 4M3NA 3H4IA 1X74A 3GLSA 5B58T 4CL3A 1SWWA 4XPIB 4CF7A 3NBXX 1V45E 1U99A 1VYUA 2QM3A 1EGAA 1FJXA 2G25A 3WYDA 5C4GB 3UCXA 3REQA 4RA6B 3TRJA 4ZFNA 3DLCA 2IITA 4R0NA 1U4OA 5L4LA 2QNIA 3W9SA 4XVHA 2GRUA 2OENG 1FMJA 3PA6A 2J32A 3WLIA 1UPAA 4XWKA 5TQ2A 1V4BA 5CCBA 3UJPA 4Y1EA 4D8YA 1R4ZA 3G85A 3PGXA 1EDZA 5EZYB 3SGLA 1N4DA 1M5TA 2HSDA 3KKEA 3V1MA 3ZV7A 4CYMA 5BW5A 3V7YA 5L3RA 2WD8A 1E2DA 3MGCA 4R2HA 5AYVA 2MSCB 5COBA 2EX0A 3ITEA 4BMZA 2EAUA 1E79A 4PANA 4BBAA 3OIVA 3I5XA 2C98A 3I30X 3OOWA 4NNOA 4MKIA 2YMMA 2EEPA 3U7EB 4Z1MD 4FGKA 2GXQA 4DLZA 3B78A 4J76A 3H86A 2YJNA 1S2NA 3D3WB 4UMVA 3WKEA 2H1OA 2IHVA 2Z2XA 1BXGA 4ONEA 3EDYA 3O8RA 3GVIA 4F9FA 3S27A 3TZBA 3CS3A 3KZMA 1W49A 4Z3KA 4OX9Y 2W00A 1M2WA 3FUTA 3K8QA 4F11A 3UPUA 2GTIA 1CQZA 4M7RA 3PT9A 3F90A 1MRSA 4HNHA 2YNMC 1T3HA 3FOWA 2BAGA 1V43A 4H60A 5KNBA 1PWZA 2R8YA 3QUTA 1L1EA 4JEIA 1T2FA 3R0VA 2XB2A 2R44A 4QTXA 2Y1CA 1RT9A 2GERA 4LRTB 2SKEA 3PPWA 3L0PA 4RTMA 4TZTA 4D9EA 4LJLA 1DX9A 2P35A 2OORC 2RG7A 4LJ5A 4YJHB 5JJBA 5K8TA 4UEOA 1Q1AA 4RZUA 1T8PA 4MS4A 1IN8A 1HT2E 4YMWA 2IU4A 4AUEA 5HPYB 4MWZA 1WS6A 1Z3CA 4KQKA 2XI4A 4LE2A 2R1TB 3C3KA 1QIJA 2WAOA 3FZNA 4HN2A 5D85A 1U0BB 3O3MB 4Z49A 2A9FA 3EY4A 3AFIA 1E5LA 2AFHE 2XNHA 1C30B 3MJVA 4L07A 4OKSA 3TLKA 4GPAA 4LWQA 1Q3TA 3DD5A 4HNQA 3FHJA 1H2ZA 2VP2A 4ZRNA 3VDNB 3KHSA 1YUBA 4ISCA 2AG8A 1E1CA 4ASUA 1PQWA 3PFWO 2GHRA 1NR7A 2OV6A 4M1TA 2Z5LA 4N0PA 2GF0A 1T24A 4G0OA 4DEVA 4WDQA 4YFVA 3T06B 2PUHA 1X1DA 1WXFA 1DBQA 2JFOA 4C6TB 3ND5A 1Y98A 2J6HA 4TYMA 3X0DA 5CLFA 1URPA 3KSAC 1SXHA 4XFKA 3OIGA 2GN0A 2OCIA 3ZQUA 3OIYA 4B0OA 1KRHA 1PJLA 4DBLC 2O2ZA 1YVPA 3IFSA 1MGPA 3B6JA 2QB5A 3N86A 3QPWA 2J4DA 4OHFA 4BEVA 2ORYA 3U80A 5TMDA 2WUVA 3F8SA 5B1YA 3PFKA 5FLYA 2P2DA 2ZTMA 1X1SA 2QT0A 3OF5A 3FMOB 1HNWB 1L4EA 1ZA2A 5J2UF 3ZI4A 3TCNA 3JZMA 1J49A 1SKUA 4MVJH 3EXHC 3STVA 2GNOA 4MR9A 4WKNA 1D2GA 4C3OB 1KAOA 4JOQA 4LMPA 4US0R 1RWWA 1P80A 2GPWA 1YQXA 1GPLA 4QNMA 2AJBA 2Y4NA 5AKYA 4Z4HA 3IH5A 2H9YA 2ZRLA 4C05A 3SFVA 4DLPA 4IOLA 1D8TA 3B38A 4IIJB 3KXIA 1QRAA 1CY2A 4PS0A 4DA4A 2HHJA 2MINB 3E2MA 4OYRA 4B3FX 4DUGD 1EU1A 4GUDA 3MLBA 5IKPA 3RUAA 4ZJZA 3DBOB 2Y9MB 3IMGA 5A2QA 2QD3A 3EGXB 4MW9A 1KEWA 1NXXA 2WVAA 2YVAA 1JQJC 1NXTA 4OHUA 3D1LA 4P4NA 1Z73A 1VHDA 3WR5A 1D4AA 1GLGA 3HRHA 1RZRD 3A9TA 5F23A 5FWNA 2CVHA 5G40A 2PR2A 4PAQA 5KHLB 1SCBA 1Z0KA 3WL4A 1KDRA 5B3LA 3T5DA 5HRUA 1VP9A 3M4YA 2OHOA 3VMFA 3MSXA 4C2AA 3CF6R 4J0EA 5D3KA 4LJ8A 1O4VA 1N2CE 1QVWA 4QKQA 3GV0A 1DC8A 1DEXA 4V02A 4Z2AA 4JMLA 3HG7A 1G20E 3RYCA 4AN4A 1SHKA 2V59A 1RHKA 5TPZD 3SS8A 1MJGA 3LZDA 4XOIA 4MICA 3D2BA 1NMEA 5D5QA 2GUGA 4C89A 5IH3A 4IDOA 4OGFA 4GIBA 2B6NA 2H06A 2P40A 3BCSA 1MVOA 4HXYA 3ESQA 2AUMA 4CI0B 1IDN1 3H0CA 4GKBA 4GOLD 4DUPA 4MWCA 2OXRA 1T4DA 1ZX1A 1A04A 3QPUA 3AF2A 1KQNA 1EFVB 2MSNA 3RVMA 2IZ0A 3UGQA 4M0MA 1SBTA 2C9CA 4PRLA 4BNGA 1C5KA 3QE4A 5SZJA 3L7BA 4HX2A 4QDZA 1MZVA 3GZTB 5FNVB 4RZ2A 3STUA 1T5BA 5HBRA 1CDDA 1BSVA 2G5PA 3ASZA 3VHXB 4QO8A 1ZU4A 2Y0BA 2VNIA 3DW1X 3TKAA 2QQ5A 1WXEA 1AMOA 7MHTA 4KQCA 3PKZA 3TR5A 4ZRMA 2AFHA 1L0BA 3NUZA 1V35A 2UDPA 3T5BA 4QUAA 1GSAA 3FOZA 4AP5A 4EFLA 2BGLA 2RJNA 3BEDA 3GT3A 4UEQA 1GGHA 3A3NA 3FG9A 3DL2A 3ZKWB 2WLTA 1KEVA 1M8JA 3BCRA 4MP8A 5A9SA 3A58B 1E3JA 4ZVPA 1MHTA 5D5PA 1EGVB 4ZIRA 4PPFA 3SYMA 4EG6A 5DGTA 5TPWB 4NOJA 4TXJA 3I6MA 1PDOA 4Q7QA 2RBGA 5JPCA 1RRMA 3QXXA 2PRIA 3KS9A 3EBOA 1MB4A 1VPDA 2FRDC 3B6ZA 3RJTA 4PQFA 3BSFA 3AVQA 2YV2A 3NTVA 4X0EA 1SC6A 1N9GB 2IZ7A 1WD5A 5DSZA 1N0VC 2V7QD 4BFCA 3IXMA 4AECA 2FSUA 1EVQA 2QW1A 5JCJA 1YQEA 4OHYA 3BK1A 3N2KA 1MX5A 4NVRA 4NNJA 1PLJA 3EZFA 3HCCA 3ZY3A 2FMHA 3DUWA 1TA0A 5D3QA 1KO7A 1AS2A 2EFYA 2G0AA 3IIMA 3UHAA 2CVQA 1BJTA 3SC2B 3AJRA 1R4NB 2PS1A 4IVPA 2IUTA 3OX2A 5IAEA 5HKBA 3EIWA 5L7YA 3WGNA 4BLUA 2I1WA 3DGEC 3H8JA 3HBFA 3NJ4A 1RVV1 4Y67A 5A6VA 2VT6A 4ZEWA 1J2EA 4YP9A 1PT5A 1H69A 2C94A 3SYLA 4Z1OA 2QRJA 4NOKA 3OFKA 4A0FA 1X77A 4M0PA 1KH2A 1KPIA 3TSCA 3H7AA 4LSWA 3PE4A 3U9TA 2ZYVX 3G7NA 3HJRA 4WV3A 4ZTBA 3W5UA 1V47A 1WV0A 2VN8A 4PU0A 4E3WA 4LJKA 1NDUA 4UMEA 1XLWA 3LXXA 3PDIA 2AG6A 3K0KA 4XDHA 5KBYA 2ZLBA 2C8LA 2NPIA 3RLFA 3QSGA 4RJTA 5K01A 2ZUWA 1A0OA 3BK2A 1N1GA 4HH4A 4O1HA 3GT7A 4QBFA 1R5BA 1TMOA 2ZTUA 4UBIA 2ZJAA 4RTSA 4I9FA 1J8MF 1N2CA 1YNOA 3VR3A 3HSYA 1KETA 1RJEA 2HUPA 2QUHA 1E7MA 2HT1A 3IKVA 2X4GA 2QD2A 4MH0R 3H8VA 1G20A 4JSYA 3GDOA 4M0LA 3JQGA 4FSHA 3L9WA 1DKLA 1WG8A 3X1KA 2C4VA 5CGQB 4EO9A 5U9CA 4A8HA 2EFDB 2FG7C 1UJBA 4H0NA 1G8PA 2DQSA 5FUBA 4G37A 1TJNA 5DXAA 4TT3D 5HFNA 3ZHYA 3HXOA 3ERCA 3BD9A 2C3UA 1GGKA 1MHPA 1IBRA 5ALZA 4EBBA 4EX6A 1OPXA 4KRXA 1VKRA 4MRSA 2XKJE 4TV8B 4CKBA 2GEBA 2BTQA 2ZI7A 4WCVA 2AKYA 2RC5A 4YRPA 5KWEA 2NN3C 1VJRA 1QUEA 3C5EA 4Q00A 4L3OA 3L6EA 4XQ9A 2O54A 5CVTA 1KHHA 2JZOA 4IJWA 4BNKA 1ZK1A 1FZQA 1MJFA 3DC2A 2D54A 3AUYA 3I4LA 4RMNA 1WM1A 2GBIA 1UQUA 2JLYA 5JS6A 2D06A 2OUKA 5K8CA 5E6RA 3L41A 3VZPA 4ZYXA 3G23A 3GJ8A 3QVGA 3VPFA 1UBEA 1DX6A 4LV8B 4A82A 2ZB4A 1EX7A 3AINA 1JA9A 3ASYA 1KORA 3DEHA 3K2BA 5G4KA 4EYOA 2NUBA 2YCLA 1R0XA 2C0QA 3GPCA 1KTVA 2C3MA 2HADA 2IXFA 3ANSA 4H7PA 5AJHA 1C3VA 4MR8A 1L5HA 1SEVA 1P2FA 3KTOA 1G8MA 2WJJA 2IW1A 4S12A 5F2OA 4EO7A 5K4HA 3OPVA 1V8FA 1YAJA 5A05A 4JCCA 1E2LA 4G5OA 1UDXA 3W2EA 5A4KA 1YAHA 4RGVA 3LUJA 4YX9A 2VT3A 3FWPA 1ZUWA 1XKQA 3TSYA 2WZDA 1L5FA 2A86A 3QHPA 1UFQA 4GLBA 4JHLA 2HWYA 1H9BA 3DFMA 3M4XA 1IZZA 2CW5A 4BNTA 4B3IA 3DHNA 2NUTB 3C3AA 5CBPB 5F1OA 1MFPA 1SNYA 1QH9A 1UZNA 1U0TA 3I53A 4TLCA 2RMKA 3CO5A 4HY3A 3IBTA 4F92B 1MAWA 4LEIA 3KYCB 5KQGA 3ICEA 1H2FA 2R7AA 5EE5B 3D54D 3UM9A 2E4AA 4OIMA 3W2IA 3GDFA 2RI6A 4QDKA 5HQ3B 2G6BA 2HKIA 3TEFA 4QNRA 4Q47A 4OB7A 4D9JA 2A0YA 3OZWA 3BUSA 2LCQA 3NHKA 4B2IA 2E89A 1P9OA 1ZAKA 5GZ3A 4RK1A 3EEIA 2WWFA 3VTAA 1X15A 4A23A 4J3NA 1T3SA 3X1WA 5HKKD 5KIAA 4HTAA 3IJRA 1YK0A 4P92A 5AP9A 2W6JD 4UVIA 3DEFA 3HB9A 1KK3A 2YUTA 3IR5A 3NVMB 4K9SA 4TLDA 2QORA 2PX8A 1IQUA 2LXNA 4UQPA 5CCXA 3N2GA 4A6PA 3S1LA 3UT6A 3FPLA 3KHKA 2OV4A 5LR6A 2P6OA 2B8NA 1TJ4A 3A37A 4GVPA 4IHJB 4LJSA 3ADCA 3DBHA 2JAWA 4I6GA 3SVZA 3WXMA 3LUCA 2XUFA 2WP0A 2X58A 3P20A 3OHSX 3RYFA 4KRGA 4OBWA 3VUFA 1T10A 1E9BA 5IZCC 3V2IA 4E4TA 4LIPD 2O9JA 4TGLA 3ZCTA 1Z3IX 1OC2A 1XZCA 1VIVA 1ZM9A 2A5LA 2EARA 4H1TA 4QU9A 2Q5HA 3SPXA 4AY5A 4PPGA 2WKRA 1CCWA 4OXXA 4ISBA 2JFFA 4OX9B 1JEQA 2FPIA 4OXIA 2HU2A 4UHFA 1FTSA 5LQSA 5EXPA 2GO7A 1E2MA 1X9HA 3AKZA 3H99A 1VHLA 2Q9AA 2WSLA 1YR6A 2Z09A 4Y30A 2FK8A 3ESZA 1FNDA 1AVTA 3BHJA 3SBEA 3RVQA 3DLTA 2FR8A 3W05A 1VECA 2EKBA 1HMYA 2D5BA 1A88A 1LJLA 2HGZA 3M4NA 3P9CA 3WWYA 4B34A 4TQ9A 4DB2A 4JI6B 2OB2A 3K71B 5CFMA 3K3PA 1V3TA 1OVMA 3LG2A 3CWCA 2JLXA 5LMNB 1DX4A 1D2MA 4EHJA 3THXA 1PI3A 2IS4A 1UXIA 1U0HC 1ZK2A 2C2WA 4PW0A 2PKQP 4K9RA 4MVJI 2WTMA 1KERA 1MA3A 2AQIA 2QTTA 2JRCA 2IDKA 2MJLA 4Q4HA 1M3SA 3W9YA 1HT3A 2HTEA 2P65A 2HMVA 4BGVA 4YIHA 5MN6A 2HDOA 3OTHA 3KKPA 4YAEA 3V8EA 1Z6TA 4Q9NA 3CLUC 1FDTA 3QF4B 1FJGB 4UAGA 5H9VA 4AO7A 4RWZA 4FLEA 5DPMA 3LFHA 1FRVA 1TYDE 3NASA 3PFBA 4CKCB 2IZOA 2BGWA 3MJTA 3WWPA 5AVZA 2XW6A 3PQ5A 3TLXA 3U9LA 2R1UA 1NULA 3HA2A 4R8RA 1AK1A 1E7QA 1V8ZA 2JEOA 4GMKA 1SK9A 2QP3A 2DPGA 2VJAA 2WSYB 5U4XA 3TAHA 2XLCA 1YQUA 4FCCA 4IDBA 1GCIA 2YWCA 4L22A 3LU1A 3TTWA 4DUYB 2F00A 1TX4B 1NRJB 3R5XA 2QRGA 2YWXA 4BO1A 3JZFA 2BGKA 5H4HA 2X7HA 3PICA 4N5DA 4EECA 4D79A 3FPGA 2IWHA 2BGGA 4H7EA 3F97A 2C03A 3W1EA 3D4PA 4DC0A 5C1OA 4GRAA 1CETA 2I3GA 4R9NA 3ASUA 4K9PA 2V6GA 1Z17A 3FNHA 3E70C 3EEQA 1QH8A 1J70A 4N12A 5JIBA 1CVIA 1U28A 2Q8PA 3C3DA 4RH3A 5CYOA 2PWZA 1SC1A 5DEOA 1EWQA 2DHEA 4UULA 3ZZ1A 4B3MB 1L5MA 2FFQA 4FFOA 4FS8A 1K6MA 2YV3A 1UDWA 3Q3IA 1POXA 5IN5A 4UTPA 6Q21A 4XEUA 1V9LA 4BX9A 4U7PB 4LF7B 3LRXA 4MW4A 4AY2A 2VUTA 4REOA 3AVTA 3ZGZA 1OYOA 4L6AA 5ADUS 3L6CA 3LOUA 5EA2A 1AZLA 1Y4AE 2QG9A 4FIZA 5IXJA 4CKWB 3DJFA 4J16C 3N59A 3BMOA 2J9GA 3BSWA 4HAIA 1VLJA 3A4NA 2QX7A 5JAMA 1QHFA 1ZHFA 1E1RA 2O8EA 5J5VA 1UDCA 1G8FA 3R3VA 4BJHB 4NCNA 5BV8A 4V0QA 1MXHA 4RJIA 1QOZA 2LKDA 3NHLA 2WU4A 1UMDA 1JKJB 1Z9BA 2NO5A 1IUNA 3A6HA 3DTYA 4KLCA 4QJ4A 1YDFA 2FPMA 2W0SA 1US8A 2VRBA 1L7QA 4JN6B 1JSXA 1YOVA 2FP4B 3RABA 3VJRA 1HOTA 4Q9KA 4CEHA 3ZK7A 3C8HA 4MLZA 4G1MB 4PLCA 2D74A 2AI1A 2CNWD 3GB9A 3QX7A 5E2BA 3KZNA 4F3CA 3E3AA 3ESAA 3RKSA 3OCUA 4P3PA 1P5FA 2IELA 2YFYA 4EY8A 4IG9A 2FWMX 1EWYA 2M6RA 3OFNA 1T9KA 1VCMA 2ETVA 4DV5B 4Z9FA 2VXBA 5FBRB 2EP8A 2P62A 4F5YA 1W8DA 3ED5A 3FTCA 3PXAA 1PV4A 1MG5A 4XM2A 1ND6A 1VMDA 2BM0A 4G9BA 3RU9A 1CEQA 1I13A 3HM9A 4IBOA 2XUKA 4M0FA 5AO9A 4YP1A 2YN4A 3K1YA 2EL9A 4MI3A 4OKNA 2EATA 4PVDA 5PNTA 1KFJB 2BSAA 3QFTA 4GQIA 5LDHA 3BREA 1IK6A 4YCJA 4FHEA 4MQ6A 2O8FA 3PQ2A 1KO5A 4W9NC 4UTRA 2WTAA 2P0AA 1NNEA 4N3BA 1I1NA 4W82A 1YHZA 1O5OA 3FRHA 3GMTA 3LIPA 1GM5A 2P9EA 2IW3A 1PFGA 1SIUA 1KDTA 2YC4C 3A6PC 1C3LA 2E6KA 2XRFA 5JNSA 1U2SA 2ZYTX 5KQLA 4UZSA 2O6HA 1ISFA 2GNPA 3NI2A 3CNQS 3QVWA 5FWAA 3VRHA 5F2NA 3A32A 3MWKA 3NEAA 4XD2A 2X9QA 1C3JA 5FPTA 1GKLA 2FPRA 3BE4A 1XZEA 4R16A 3QEKA 4OHRA 2PLFA 4CMBA 2BBTA 4JIGA 3O8QB 5D5HA 3DMHA 1T8RA 3A3OA 4G8JA 1SBQA 4LC0A 4D3FA 3NOQA 2C92A 4WXPA 1NFRA 2CXOA 4ZK6A 3CUTA 4JENA 2FG5A 4GWGA 4WFKA 2Z8XA 3AR6A 4HNRA 4K81B 1ZVJA 4L8WB 5DASA 4TMKA 1QS0A 2XMDA 3I2HA 5EMNA 1Q17A 4XGQA 1H23A 4ND6A 3G8DA 1U0RA 1I94B 3PJFA 1DQNA 2CL6X 2IBSA 2I7DA 1IN4A 2JBAB 1HK7A 2RB4A 3MTGA 4O2LA 3TW0A 2GF2A 1BS9A 2Y77A 1DQSA 3TJRA 1UJ2A 4BUZA 4GXRA 3WBFA 2I80A 3MGGA 1FRNA 1PD1A 2D2VA 2VF8A 4XUDA 5L4SA 5J23A 5HIIA 5CMLA 3KKKA 3PF9A 4QBIA 5D84A 1DTSA 2NSDA 1FFCA 3H5WA 2EVWX 4B6GA 4DR3B 4R2LA 1L8XA 1DQPA 2C2BA 4LPKA 2XADA 1CUIA 2HA7A 3MWFA 4L0CA 4LISA 2VUHB 4X5OA 3WB9A 1G8YA 2CHVA 4X1KA 3UG6A 3BM5A 4IWNA 3BWXA 4IYJA 4QFDA 2MYUA 1KOGA 4IEIA 3AVUA 4YT5A 3QUCA 1JGTA 1TF5A 3FWKA 1NAHA 2VLBA 2JGLA 4QQRA 4TSFD 3S44A 5BMVB 3QGMA 1JZTA 2V7GA 1AKTA 3M34A 3TTUA 2O0JA 5JNLA 3LYUA 1REQA 4P33A 3P4XA 3OAAD 3L6UA 3ROZA 1DAIA 1CR4A 1GU1A 1M6HA 5BYBA 4E2ZA 1U8TA 1V11B 4L3VA 3R3YA 1TUBA 4OQZA 4D99A 4J4TA 3FSGA 3NOOA 1U3VA 4TQGA 3ER6A 1Y5NA 2XWJI 1OWPA 2ZUSA 3IAAA 2P3LA 4P3XA 1UT6A 5LZ9A 1JMKC 1CQWA 4FDTA 4AUKA 4M9XA 4XYEA 3O4HA 3DWEX 1M1ZA 1Q74A 3TGPA 1IXYA 1E96A 4TLLB 4OHZA 1PT9A 3AESB 4MJ7A 3H5IA 4Y2SA 3ZWAA 4BHTA 8ATCA 5JZMA 5JZ9A 1RJ9A 2VR1A 2O57A 1VKNA 3I1IA 1BGXT 3VZQA 2ORVA 1TT5A 2R4TA 4GP6A 4JKOA 3WSVA 5JOQA 3U44B 1SU4A 1EZ1A 3RSLA 3A9SA 4D97A 2OCAA 3EXAA 1K4MA 4GD3Q 5I7RA 3CX7A 1WCV1 3PB3A 1HDCA 2BUBA 3OIWA 2OBMA 3IV9A 3GA5A 3KZCA 3PD0A 3GPDG 4HWPA 3V8MA 1RWNA 1A9OA 1N9ZA 2JHAA 3DWGA 3FYUA 2IY8A 1KDYA 4KR2A 1GQSA 1OI4A 1XZGA 2PSFA 5C1IA 3KPJA 3NR2A 4RS4A 1R4MA 1DAPA 1HG0A 1JJAA 3BS4A 3IP3A 1BNCA 3ML1A 3CXUA 3TTTA 2XUZA 2MSKA 3PXXA 5CH5A 3WQSB 4I1VA 1QRUA 3L79A 3R3XA 4QEZA 1M6VA 3N8KA 1GPYA 2Y9PB 1OB5A 5B7NA 1PL0A 3D4OA 2JGRA 2J8ZA 1YQGA 3ELWA 2JJ1D 3LC0A 5FBQB 2XWBF 2WKSA 3TLAA 3T5AA 5B6PA 2ZIXA 3KLNA 4K88A 3W1VA 4B75A 1MC5A 2HV8A 2PFGA 4O2RA 2QRUA 2C42A 4Z4EA 2H07A 3HE3A 1KOFA 5JS1A 1ZN8A 3EJ6A 3JQRA 1W93A 3LBYA 4X1IA 3WA6A 4C6SA 1I24A 1KI3A 4CFYA 5KX5B 4GZMA 1DSSG 1LPAB 5FQOA 1DC7A 3G2MA 3GAMA 2NO6A 2I2XB 4KDRA 3B6KA 2O7RA 1W76A 3U7FB 1NVTA 3EXG2 2PCLA 5DM1A 3T9BA 3W6ZA 3ZIAA 3IVCA 2O3SA 4BKRA 3FX2A 3EK2A 3ZGOA 5TC4A 3AOEC 2QPOA 4HTFB 4H1HA 2Q2NA 2DERA 2G04A 4IDHA 3G0IA 2KW5A 5L3SA 2PBLA 2QN8A 3KB8A 4K9MA 5AJWA 4EJFA 3EIEA 5JXWA 5C8YB 1AA9A 4R3WA 1FLNA 4AMUA 1HDEA 1IM8A 2ZSUA 3AI1A 5IH7A 1ZVVA 4DCNA 3N58A 5M7EA 1CLUA 1G1AA 3RU7A 4RZ3A 3SKVA 5KC8A 5CDFE 2P4SA 2VCHA 4BVAA 3W5CA 1UC8A 2DFDA 1XAIA 1JH9A 1XDBA 4YAWA 5LOVA 1XP8A 2HHAA 4JP2A 4RHTA 9ATCA 2KM1A 2ZE5A 1J1UA 2X4LA 1H5UA 1YVEI 2H2GA 3IUJA 3R0XA 4BVFA 5ER6A 2L18A 1CULC 1JSRA 3JVUA 2CXQA 3JQ7B 4TS3A 1D6SA 1F7VA 1R0YA 2D1TA 1TRHA 4BFWA 1EUDB 2OZLB 3ZHVA 1X8LA 1KNXA 2W2NA 2W6ID 1XKTA 4QUIA 4CUJA 1O6BA 2WJ4A 3QHAA 2ZCUA 3DTTA 3HDGA 1R6BX 5DLDA 5FULA 4G63A 3RYHB 4EG4A 5AICA 3O4FA 1SUSA 2G1JA 1TW2A 3GRKA 2P11A 5KINB 2KHZA 3BWYA 1O6GA 3ES9A 5JDIA 2PWBA 5IP5A 2NU8B 1Q0QA 1H2EA 1G9XA 1IHDA 3WSWA 1USWA 3TW4A 4KRYA 3WL3A 1JHZA 5K3CA 4KJXA 3WNZA 3T7IA 3HMKA 3OEYA 3L3BA 3N2IA 4G4SP 5TT1A 2ZDGA 1Z38A 2OCBA 1JHAA 3PL5A 1OFHA 5JO9A 2HA4A 3ZW9A 2NT4A 4QPPA 3W4KA 4Q24A 1OIVA 2HPZA 3BFPA 2LNDA 2PH7A 1JQEA 3FFTA 3FTNA 4AF8A 2MR6A 1HX7A 1ZJ6A 3DM9B 5DI9A 1LSJA 5EMLA 2JDID 4CTJA 3I5YA 3JPYA 4MRPA 3RE1A 1F6BA 3AXTA 2L17A 2FFAA 3UJNA 4OV6B 1O89A 3HYNA 4HQOA 2H2DA 1GAJA 2GVZC 1NOIA 2NUPA 4L8FA 1T6YA 1QFMA 3DMYA 5T67A 4I50F 1SKYB 2FPPB 4EFNA 1GSOA 3T4EA 3F8WA 3EFOA 4PZ9A 1RAGA 5DWQA 3JQFC 4KIJA 2IEIA 2XECA 3LBFA 1FCJA 4PX9A 3TLJA 1KVSA 1NUSA 2O2HA 2G76A 4OAPA 4W1SA 4OK6A 4LOAA 3TJZA 1UDRA 1Z26A 2QM7A 4PC1A 3ZXSA 5A6SA 3A25A 1H9AA 1B8OA 1WW8A 3SSNA 2C9DA 3HYCA 3ZUPA 3F7OA 1FNSA 2VDQB 2W6PA 3PJEA 2WTXA 2EBFX 4MB2A 5GONF 1V0JA 2F8MA 4JDPA 4ZQFA 3QLUC 4M2LA 2ZUBA 3RRNA 2WJIA 1XN1A 4O2AB 2WSIA 3RVPA 1P7PA 2OHIA 2Z1MA 1T2CA 3DCJA 3UHOA 1FSPA 1Z8HA 2J09A 1ZWLA 2AUTA 2IXTA 2PRZA 3O03A 3LT2A 5CNKA 4NOLA 4AF6A 2FLWA 2ZE8A 3LW8A 3ONWA 3SYTA 4H1UA 3HC7A 4NFYA 3E81A 5EQJB 2A59A 2A5JA 2I62A 1E2KA 4F4JA 1A9PA 2IXAA 2FEMA 3CEMA 1VBKA 5H83A 4INOA 4R2MA 1FUKA 2XVMA 4PGMA 3ZIDA 1WIWA 4IGFA 5JCOC 2C0PA 4AKIA 2FSFA 3UKJA 1RP1A 3P71T 4FOSA 4IV8A 1RC0A 4MUBA 4NYJR 5FL7A 1RQ7A 3HJNA 4WI1A 4WLOA 2A5YB 1UBTS 2QTVB 3N74A 4FFLA 2V7PA 5JC8A 3HPQA 4EZIA 1IM2A 2PT5A 3RRMA 3V8VA 3C74A 4JEUA 4FZJA 1E9SA 2QMEA 2ZRPA 3BDVA 3OLQA 3L4BC 4FOTA 4JSRA 3WIVA 3A1UA 3QI2A 4L72A 2QTGA 1H4VB 2BEVA 4I55B 1RLIA 3P19A 5CDFA 5T4FA 2YJGA 4S0ZA 5T4HA 3H2JA 2RJOA 5IUJC 5DNEA 1W4LA 3IMFA 4OH1A 5ALEA 5HYVA 1OB2A 2Q0SA 1D4ZA 2D13A 3LHSA 5EI5A 2PUTA 3UMGA 2QN1A 3D81A 3GJ7A 4RWEA 2OC9A 1Q2XA 1YMUA 1B6TA 4P3YA 2BUAA 3FCOA 4WVFA 5DB4A 8GPBA 4FD2A 4BJ5A 1Q12A 1VIAA 1FXSA 3IPXA 3QY9A 1UM9B 2PWYA 2A92A 3HCNA 1ODLA 3QZUA 4M1SA 4HNTA 3FUCA 2MSEB 2FFBA 5JCOA 4NTZA 4F0JA 1YHNA 4UBOA 3GF4A 2QROA 3FPHA 5TE9A 4AG3A 2XMBA 4O4HF 2Q2QA 2H5IA 2HL6A 2O0KA 1ZD5A 2HJSA 3TW8A 5K0EA 4HVAA 3PC3A 1YDWA 4MUIA 4NDAA 4C7MA 1AMNA 2HSGA 4TX1A 4EMTA 2G36A 4HNGA 1P1CA 4UPVA 1ETHA 1YMQA 1K5PA 3LT1A 3KM0A 4LG1A 4XGKA 6REQB 3WGGA 4GBMA 3WI7A 3OIUA 4DV0B 3SR0A 2CFRA 2EQAA 3X2FA 1SM4A 3I05A 4CLXA 4LAFA 4Y1RB 1TJ3A 5JY6A 3OM1A 2D4HA 1RMYA 1T1GA 2X40A 1NRXA 4R1MA 1J07A 2FLVA 1AHIA 1FJHA 2C7GA 4I5IA 4RYDA 5AHRA 3RAFC 2NGRA 1ISSA 3CBQA 3JPWA 1NATA 3PQEA 3EMKA 1HUQA 4HO1X 2BD0A 4PZCA 3ZW7A 2HU7A 3ZCPA 4BKOA 5HM6A 5K6TA 2JLZA 4CCYA 5FTLA 3H65A 4PIVA 1G59A 1CUHA 4TXHA 3VSAA 4CIDA 1V39A 4DDMA 4LYFA 3D3JA 1OFVA 5HW0A 1EE1A 1IBMB 1WEHA 4TKZA 4E5UA 4RVDA 1KAMA 3I3OA 5BUZA 5CEEA 3K31A 3FBGA 2H1RA 4EF4A 1MX1A 1NZFA 4P5EA 3CZ9A 4V3BA 2NQ8A 3IMEA 3EQ8A 4IIVA 2IU3A 4B7AA 4NCBA 1EFRD 3KE8A 2J9RA 2ODAA 3C5VA 3KPVA 3QMWA 2BGTA 3GEPA 4K03A 4UHJA 1V4VA 2W6NA 3VO9A 1WSAA 3ZWKA 2PYZA 2INGX 1P8JA 1WVGA 4JDUA 4HDRA 1YASA 5ALRA 3VDRA 1XYVA 3EVNA 2H2WA 2ZYIA 5I7HA 3EWSA 3DAOA 1IBKB 1Z4IA 2C5AA 1G2PA 3C48A 4H7KA 2FRVA 2V7WA 5EZYF 4W1QA 4P0TA 4TTSA 3CUVA 2IC5A 5DCUA 3RFCA 1M1YE 1PWYE 3IT3A 4ZT7A 3LGXA 4BP8A 3WHKA 1T6XA 4PFJA 5TDHA 3RARA 2CUTA 3OKAA 2TECE 1LC0A 4HAXA 5EY5B 2DY1A 5H70A 3ZEAA 1R9GA 4H7JA 3KQQA 3RHTA 3RWMB 1CF9A 1IUPA 2HCFA 2XVXA 4R1PA 2PKYX 1PL7A 5K3DA 4PBRA 5BOVA 3SSMA 2XQIA 2AMFA 3DHWC 4HH3C 4TPKA 3EDRA 1PFVA 3RFXA 5FH9A 1WB6A 1BS2A 1E9FA 1JR4A 4BFXA 5IJ0A 3IAFA 1VPEA 4OJMX 2FXVA 1PJ8A 3BF7A 2ROQA 1CYDA 1XBTA 1ZN2A 5JSZB 4FDAA 5GJBA 1JJ7A 2WW8A 1PKEA 2AOTB 3KPYA 4M8NE 3K9GA 3RTEA 2I8LA 3EJWA 3SKXA 3KQHA 4MV4A 1XXHA 1DCTA 4KSYA 2GYWA 1C9YA 4IIUA 1MC4A 5BXYA 5IEJA 1S0UA 1QHIA 1FX0A 4Y3UA 1YQTA 3MJHA 3COJA 3DKKA 4P35A 4G41A 3EEYA 1JHOA 4PWZA 4LY9A 1VPVA 5BQPA 1SRQA 7YASA 3UIEA 3ON5A 4LX8A 1Z0DA 4M89A 2FE1A 2I2WA 2I87A 4IDNA 2P7IA 2X0NA 4ZT4A 1J42A 4IQFA 2BKVA 3DAPA 4L76A 3VKWA 4B85A 1GCAA 5JD6A 3SBDA 5DNAA 3N6RA 4ABTA 4TS4A 1VKOA 2FMXA 3CG0A 3WL7A 2HHLA 5DM60 4TZ6A 2P27A 1CFZA 1GZDA 4DGSA 1WDTA 1P18A 3ZOZA 5H4GA 2LW7A 3WLOA 3I4CA 3AETB 1I8TA 2XE8A 3L06A 3GRAA 4GH5A 3W5AA 3G13A 1X0XA 1Q1BA 5AVQA 2D0PB 3FNIA 3IKTA 4L9SA 1LX7A 4JLMA 4YEDA 2QSUA 5EMHA 4GDFA 4O5OA 4WOCA 4DYDA 1OD6A 2QLLA 1GYRA 3H7IA 4H08A 4D9KA 5FF9A 3SQOA 1EYZA 3OURA 4DLTA 2PU7A 1R0BA 3NRCA 3RH0A 3AFHA 3F6CA 3R4CA 3ZLTA 5LKAA 3RO7A 1LLFA 1ONBA 2JFZA 4KODA 1SB9A 3EXEA 1YKSA 1C14A 4NR0A 4FKZA 1U9JA 4NH4A 4C4OA 3ZWDA 1TYCA 4K6GA 5JMTA 2CUKA 4NFHA 3W9UA 1BOOA 1UP4A 3F96A 3L1IA 4AZTA 4OK3A 4K3VA 1EDDA 3DKPA 3WFJA 1QGYA 2IP4A 1BMQA 3QU2A 4JLBA 3ZWMA 4ES6A 1NF2A 3HWX1 4OLAA 1RRGA 4ZANA 3UG7A 4YPOA 2VF7A 5JSUA 3VPHA 4N5MA 3I9FA 1ZQ9A 2JANA 2YJ3A 2AKEA 1V41E 3GFBA 1Z5WA 3SZOA 3QBTA 3DOOA 1C3EA 1JEEA 3MJCA 5BRJA 2RD2A 1JB9A 1CRWG 1Y7HA 4FJ1A 4R9RA 4UUAA 2H59A 4QYWA 1U0GA 1L5GB 1J9GA 1DRKA 3WMWA 2QRPA 1FLVA 3M1LA 5IJ9B 2SNIE 3FDXA 4BU1A 3P0IA 1AQYA 3E3LA 3NO4A 1PHPA 1KI6B 2R68A 5A71A 2O8BA 1EH5A 2G70A 1KFBB 2PPVA 3R3ZA 4IIJF 5LJIA 1J24A 1ZRHA 2V5VA 3SS9X 1ICEA 2LKCA 1DJPA 4IUCS 4F1WA 2VVTA 4TMZA 4ZI2A 2G09A 4YDRA 3CCBA 3FCAA 3ZXXA 4FGUA 4UDXX 4RVSA 5IEBA 4DIOA 3HUEA 3P26A 4PFSA 2JATA 5B7PA 4BNXA 1J22A 4DV3B 1M1YA 4IS2A 3M70A 4AK9A 5D6OA 1UFKA 3P2MA 5B1HA 4CM7A 3DTVA 3WMRA 4C43A 3PA8A 3HABA 3T9CA 3E9MA 3TG8A 5LA6A 3N05A 4DUZB 1IZ7A 1J1ZA 4R81A 2BFCA 2WJHA 3WIUA 3URKA 1QO0D 3A14A 3A7EA 1F1BA 1J7KA 2D1SA 3HB4X 4TXMA 4BTVA 2HA0A 2NVOA 1KARA 1DUSA 1UBLS 4PSKA 4AWXA 3ZHUA 1G17A 3MINA 5SY9A 2AEFA 5CG1A 5L6LB 1SB8A 2EFJA 2G4VA 5SZHB 1NQWA 4AU1A 1RM3A 1SIOA 3ZHBA 4FU0A 2XDQA 2FSPA 5LXTF 3EWNA 4QRHA 1L8LA 1ZY2A 1NVUQ 4EHNA 4QBGB 1YR8A 1YVUA 3IQIX 3Q15C 2PQ6A 4KO4S 5C4IA 2QZSA 3O4GA 4E6PA 4M9UA 3QUSA 2W43A 2WHYA 5IXYA 4UEWA 2GZRA 2UZ1B 5BR1A 8AT1A 5EJ8A 1CR1A 3CVWA 1DADA 2BMEA 3NW9A 3P9YA 5JSKA 1ZONA 1R0RE 1E99A 2V98A 3WKCA 5F21A 1SG0A 3U4IA 3C6XA 4RTPA 4YQZA 2YV5A 4ZI7B 2J67A 1UEIA 5FNVF 1VL6A 2VT2A 4LZWA 1B15A 2G9UA 3GRRA 2FEOA 3FUUA 4TRMA 5CT5A 3TKLA 2V7EA 2YMPA 3R5FA 1KI1A 2VHJA 5IVPA 1B42A 3GIDA 2XB6A 4C4YA 4RY0A 4KVAA 2NYUA 4WBNA 1O57A 4S35A 4IJKA 2CXRA 3K72B 4X20B 2Z08A 3ZGNA 1RZUA 1G7SA 4Q4CA 1YGPA 3I72A 1ZN7A 4IDEA 3NYQA 4R9VA 1F2VA 5AMXA 3GN1A 1YONA 1A4UA 3AEQA 1OLSB 4RM3A 3WGOA 3WY9A 1KBOA 1EFDN 5FOXA 3MWDA 2ZJYA 2NZUG 1H1LB 5KSYA 5BQ3A 4OSOA 4CV3A 3AL3A 3KUUA 5JVDA 1Y6JA 3F5FA 4X54A 1XHFA 3B2NA 1KJYA 4G5HA 3STXA 1KMQA 5CVUA 3C97A 4GYKA 1I7DA 4QOFA 4B7UA 2IPOA 4GLOA 4GOOD 3EQ9A 1IY9A 4RD1A 5HVNA 2CDRA 1BMTA 5CAEB 1N77A 1HZZC 3U4DA 2AFVA 1LDGA 2C84A 3IIJA 4JL8A 1YC2A 4KPUB 4ZYLA 1KJJA 1W7AA 2WP8J 1ZH4A 4JI7B 2OECA 2VS1A 1DIGA 1PE0A 3A4MA 2HLPA 1JWLA 4JLDA 5BWMA 1DCFA 1EDOA 1YJAA 3I45A 4AXBA 2MHCA 5LBIA 5JYEA 5LMCA 1B0ZA 3AHIA 4R1UA 5J4YA 1EZZA 1G4HA 2UZ0A 1U8ZA 1XRLA 4ZWNA 1JN0A 1ECGA 2Z6AA 1UKVY 2QIOA 4AXXA 3Q8KA 3ISVA 2IDZA 1L1QA 4BXOA 1N7HA 3ZCUA 2JKZA 1S2IA 4UOZA 4M1MA 2ZT6A 4FEEA 1UPBA 3NVKI 3E84A 3LY5A 1GPJA 5DHPA 2C7PA 1ZXBA 5TF4A 1SHJA 2CFSA 3WNCA 4YJ2A 1QORA 4H16A 2GD0A 1XK7A 4MPRA 4E2YA 3TEMA 2Z4TA 4ZVUA 2YWRA 1XPOA 2ERYA 3H3XA 3KL2A 2EQBA 2PBZA 2R48A 4FONA 3BTVA 4ZCTA 4S04A 1RRVA 1CYEA 3MQ2A 2IA5A 3A1CA 3RYIB 2F8LA 1MC8A 3IQXA 1F8FA 4HX9A 1TM3E 4JJGA 1HNXB 2QTRA 4HQLA 3VSCA 1I2CA 1P6QA 3B1YA 3UBTA 5F7XA 2OFOA 1LV7A 1E3WB 3AEXA 2VDNB 3HVHA 3M3PA 3E2IA 5DN6D 1P62B 1MB0A 5ALYA 4HFNA 3RT7A 4Q3EA 3K70B 3GLIE 2RK4A 2FW8A 3G3EA 3K32A 2X0KA 1YZKA 3DEYX 1A4IA 3GRYA 4F38A 4KWEA 3LKDA 1M73E 2ZE6A 3OT5A 2AQ8A 4MARA 1E60A 1NJSA 4INAA 1SVSA 1O95D 3KYJB 2ODWA 1E3QA 2X1LA 1P2UA 4UCQA 1O6ZA 5AKGA 4RY9A 4ZV7A 2FRXA 4QOHA 1Y9JA 1ILWA 2VH2A 4JU8A 5J5AA 1WCIB 3NP7A 5JFGA 5DLQC 1P0PA 1R5JA 5ALPA 4BV2A 1V2HE 2NO9A 3IP8A 4F6LA 5JZSA 4HS4A 1QP4A 1Y6GA 1G8GA 2QLNA 1J2UA 3QVUA 1SXJD 4BNIA 3FGZA 5GZ6A 5LMZA 1SVUA 2YTZA 1D1PA 1MB3A 2Y1KA 3G9ZA 4MCAA 4GOKA 3VR6D 2NMVA 4BB6A 3PFIA 4CQLB 1G2QA 4IDPA 2GHIA 3R0ZA 5HKLA 1S4QA 4LFAB 3CINA 4FI3F 3HJAA 1P60A 3OCYA 2C99A 3I83A 1JNXX 1H2HA 4HDOB 5I3ZA 1RPNA 4BNHA 2EJBA 1GIAA 2J6IA 3D8NA 3UV3A 5GMOA 4EI9A 1CZOA 1G5HA 1H0HA 1GCOA 3HDTA 3OX1A 4UHBA 3K2EA 4MI1A 1U7HA 2JGIA 3KYDB 3PRYA 3NKVA 3ILHA 3HJBA 3P45A 3U3JA 4KZKA 5EJAA 1GG8A 3TXAA 4U7TB 4U9HS 2C4HA 3CNHA 4FGJA 5FR1A 4CIAA 1E1KA 1U8UA 3DE5X 3DV0B 3NBUA 3PR3A 3FMPB 5KVQA 3TVTA 1H4QA 4NONA 3HDYA 1WZEA 3K1ZA 2O1XA 4Y9TA 1RM5A 2B1JA 4GP7A 1P9WA 2YY7A 4ACBA 4Z54A 4FZRA 1C7FA 5JNUA 4QECA 4Z4FA 1P2GA 4DDUA 3C70A 2O59A 2GWHA 3MWJA 3NRJA 3UAZA 5C2JB 3O90A 5EP1A 1MG0A 5E7IA 2FSSA 3G1TA 1P3DA 4RTQA 1C7RA 2YIVX 4GYYA 4OGKA 3EPJA 2FGKA 3R0JA 1G66A 1BAPA 5ULLA 5IX8A 1IONA 1GGEA 4K8RB 2EW1A 4RCVA 5GIPE 2P3OA 1GITA 4O29A 3SYNA 5DM70 1U63A 5EKSA 1FXWF 1Y34E 4GDMA 5E6UA 4CEIB 4KR3A 4DCPA 3ZKWA 5YASA 1TZJA 1ECCA 3BFVA 4IO0A 4A2WA 2W98A 4JLVA 1G7CA 4LNUB 1G2OA 5FYDA 2CJWA 1VE3A 2ZBRA 4L73A 4RIFA 2H16A 5F5LA 4KAXA 4XSVA 1RWPA 4BLPA 2YYZA 4TXNA 2XEDA 3AJ8A 1RYBA 3HSSA 5A5VA 3RFTA 4PX2A 3T7DA 1N36B 1P6UA 3UAWA 4DOMA 2J3IA 3OETA 4JVNA 3ZNPA 2XQVA 1CNFA 1SURA 1Y6QA 1N2GA 2ZWAA 3O91A 5H82A 4IZ6A 1BE6A 4Z0TA 5G0UA 2CLHB 2WIAA 2EW2A 3BULA 3OWOA 1RXSA 4RXTA 2B4TO 3RUPA 1SPXA 3D6UA 5EEGA 1NUPA 1AQLA 2NZXA 3LJKA 3GLIA 3H11A 3YASA 5BT9A 3VGPA 3SHWA 3TFWA 2JEYA 1JHRA 4O4IB 3U4GA 4DB4A 1Y7LA 3SJUA 2G9ZA 4M38A 2HF9A 1TO2E 1Q1EA 4IMRA 3ECAA 4TMFA 3UUGA 1MO6A 3V9PA 3BA6A 3T94A 2AZXA 3BIWA 3BB1A 3ZIUA 2QKYA 2C1ZA 4MEBA 4J07A 4BO0A 3ZDYB 3IAM6 2PO5A 1J00A 4ZT6A 3RVDA 4RIHA 5AUNB 4ZVMA 3JQCA 3M5DA 3VR4A 2WAAA 4G97A 1Z4KA 4EKYA 1EK0A 3LW7A 2Q1XA 4TVSA 1K6EA 1YA4A 2RHRA 4IV0A 5DHAA 3V80A 5TB5A 5CG2A 1XA0A 2AX4A 2Q1WA 4ZVRA 2ZRQA 3OJFA 4M9QA 1CTQA 1K5DA 2Y05A 3CZ5A 1GT91 2P1RA 3KUCA 3GELA 5DX1A 2CD7A 1CZRA 4ZYWA 1EQUA 2DG2A 1RHQA 3LY7A 5AXAA 1P9RA 4KV9A 4QHSA 3I9V6 3HUDA 1IWOA 2ZYUX 5L8VA 4BO6A 1YE3A 4QGAA 4FMCB 3UK2A 2F8SA 5E4FA 3DVLA 4HDNB 3G2OA 1Q0ZA 3Q7SA 4U2GA 4DLBA 4L27A 4HVLA 5KYYB 2YVQA 4CEJB 3QVMA 1QIFA 3H97A 2DZDA 3FPCA 2GBPA 2YIJA 4EO4A 3L1JA 3RANA 2NO1A 4B40A 4S05A 2XCRB 4AO6A 3PUXA 1R4AA 1AQ6A 1AKRA 5HMMA 3WYNA 4RFLA 1USKA 1KVRA 2YVKA 3BPSA 5JAPA 4ZAWA 1FRZA 1J99A 3QEJA 1BRTA 1NBEA 3O3OB 5LQCA 3VAZA 2FW6A 5K2OA 3PFGA 3L92A 4AJOA 2VWHA 5A1JA 1K7EB 3ZU5A 1VXOA 1BDBA 4NBVA 4TV8A 3QY0A 1R12A 2R8XA 1JILA 4LC1A 4WOKA 2G1PA 1XNHA 4ER6A 4Q1AA 2XGOA 1G38A 3VC3A 4L16A 4C07A 1AN9A 2VH1A 2CUNA 2PQMA 3TGLA 2WTEA 1N4AA 5BSWA 3T3PB 1UJ5A 5L7TA 3BWDD 1H4TA 1OTXA 3OLCX 2HBQA 4L0MA 4KVZA 1RKXA 4L15A 5ECDA 4ARAA 5KQSA 1UBSB 4FOPA 4IP0A 3S4YA 1JIIA 1A95A 5DP1A 3RC8A 5CT6A 1IOVA 1MA0A 1XQVA 1LTKA 2Q3BA 4CM9D 3FHLA 5JQGB 4MHTA 2DSTA 3DBRB 3QW2A 2V6BA 4J0FA 4A8JB 5DWDA 4II3A 1BEZA 1VSUA 3DMPA 1PK9A 1R8YA 3AEZA 2IUYA 5EXTA 3NTUA 4YUVA 3AERA 3LRTA 2VI5A 3MOIA 4EPYA 1FTNA 1N33B 5J47A 2CF5A 1EFPB 1ENYA 3IHWA 4PQGA 5EQFA 1ULHA 1YFJA 5DIFA 4LK3A 4RHXA 1WBBA 3MWEA 4I46A 2PSHA 2PM8A 1MNQA 1E4OA 3N0WA 4AJLA 3GLVA 2D2IA 2IE0A 3J7AC 2A0KA 4RJJA 3EQ6A 1I1OA 4OJQA 1PEAA 2P41A 2VDOB 2XOXA 3KKQA 1NZDA 1YRLA 4LBZA 4ENRA 3ONNA 2GXAA 3BBLA 1WLSA 2R8ZA 2H11A 3RC3A 3FJYA 1M6EX 1PW5A 1KMNA 5I5GA 4IGIA 4KR9A 1EG2A 2KE5A 2QDKA 1FQJA 3INYA 4XVRA 2GB4A 4RJLA 2YY6A 3DF9A 4D80A 4EEKA 2Q3HA 2VTBB 4ND7A 2QUJA 5HE8A 3PUKA 2BKEA 2E4VA 2EZTA 3CRZA 4L5JA 1P1RA 4WFJA 2XXJA 1GLNA 4X91A 3M81A 4JLUA 3TEJA 1CE8B 3OLZA 1D0VA 1ZXLA