1BZYA

Human hgprtase with transition state inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
214
structure length
214
Chain Sequence
b'SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
molecule tags Phosphoribosyltransferase
source organism Homo sapiens
publication title The 2.0 A structure of human hypoxanthine-guanine phosphoribosyltransferase in complex with a transition-state analog inhibitor.
pubmed doi rcsb
total genus 70
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 1998-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bzyA00
1OREA 3O7MA 4X45A 3MBIA 4FYMA 1D6NA 1ECGA 1OROA 3ACDA 3GGCA 4ZFNA 1XTUA 1DBRA 1P19A 1JLSA 2PRYA 1XTVA 5IPFA 4P86A 1I14A 1ECCA 4KN6A 4M0KA 4RHYA 3OHPA 4JLSA 4LZOA 5BQOA 3G6WA 1L1QA 5HKLA 5JSQA 3S5JA 4P3KA 1VCHA 1A96A 1ZN8A 3KB8A 1I5EA 4QYIB 1NONA 4JITA 1XTTA 1A95A 4P82A 1P4AA 4MB6A 4RHTA 1ECFA 1A4XA 4RACA 1UFRA 4QYIA 1CJBA 1DQNA 1QCCA 3DMPA 2DY0A 4M0PA 1YFZA 1W30A 1DKUA 1DKRA 1IBSA 1UPUA 1BZYA 1U9ZA 4PAWA 2WNSA 1U9YA 4IJQA 1NULA 2FXVA 3OZFA 1OPRA 1GRVA 1GPH1 1MZVA 1DQPA 3ACCA 4P83A 4RAQA 1R3UA 5BSKA 1LH0A 2JKZA 2YZKA 3DAHA 1ZN9A 4RHUA 1I13A 1O5OA 1PZMA 2PRZA 3ACBA 3LRTA 4LYYA 5ESXA 4X44A 2C4KA 5KAPA 2AEEA 3M3HA 2HCRA 2PS1A 5K51A 1G2PA 1XZNA 2EHJA 1JLRA 1ECBA 1O57A 1AO0A 2XBUA 1STOA 1G9SA 1A3CA 2JI4A 5KAMA 4LZNA 1P18A 4TWBA 5IAOA 2H08A 4RADA 3QW4B 3HVUA 1A97A 1Z7GA 2H07A 1FSGA 3GGJA 4F8EA 4M0UA 4OHCA 4P80A 4P84A 2IGBA 1L1RA 4WMLA 1ECJA 1QB8A 3N2LA 1I0LA 1G9TA 2JBHA 3H83A 2VFAA 1QK3A 4RV4A 5BRNA 1HGXA 1HMPA 4LYGA 1QB7A 1BD3A 4RABA 5HIAA 2GEBA 4WN3A 1V9SA 3DEZA 4QRIA 1TC1A 4RQAA 4RAOA 4RQBA 4Z1OA 1J7JA 1A98A 1BD4A 1UPFA 1VDMA 3OZGA 1XZ8A 3EFHA 1Y0BA 2E55A 4RHXA 1VSTA 2P1ZA 5ESWA 4LZAA 5BQPA 1QK5A 1P17A 2JKYA 2H06A 3LPNA 1QCDA 1I0IA 5E38A 1G2QA 1ZN7A 3GEPA 3NAGA 3MJDA 4P81A 4RANA 5EUCA 4PFQA 1TC2A 5JV5A 4S2UA 1WD5A 1QK4A
chains in the Genus database with same CATH superfamily
3GRFA 4QO7A 4MB0A 4IRMA 4ZJYA 4BKUA 4FYMA 4O3FA 1ZD1A 4POAA 4CI0B 3G2OA 1CD5A 8OHMA 1FSSA 4RTNA 4D42A 4Z8XA 3X1DA 3NCHA 3R40A 5TJ9A 4D6XA 2O5RA 4Z7OB 4GSYA 3TNJA 2UV8A 2AW5A 3KQNA 2WY2D 4TYWA 1FMJA 2PRYA 2R8BA 4NOLA 3CGGA 5JRZA 1DFGA 3SYLA 4PQYA 5BN4A 2VZEA 3FPEA 4LA4A 4WGFA 1X7WA 2PZKA 3WR5A 5BQ5A 2QWXA 2WWIA 4GRDA 1CUVA 3TMKA 3FCEA 1K5PA 2GFQA 1EHCA 4DQLA 4FX5A 2VBCA 2VWGA 2I7VA 1KTIA 4DIBA 4NECA 2L19A 1S2LA 5JO9A 2WSLA 5LZ2A 1YGPA 3ZEIA 4QYIB 1KH1A 1R8JA 4LXTA 1BDBA 1F2UB 4JQYA 1XTTA 1QNLA 4DNFA 4PC2A 4YMHA 1EFRD 3OH8A 5IT4A 2QENA 5F12A 4K7JA 2OD7A 3O03A 4QYIA 1E9EA 3REGA 4IDCA 5B2FA 2HX1A 1Z4NA 3QE4A 3BGVA 4K9MA 1IHUA 4HDOB 3RFUA 4NCAA 3ZGZA 2RGRA 3D2LA 2GF0A 4HEJA 5LXTB 2IEYA 3DFFA 3H97A 4N5NA 4W1PA 4IDFA 4DMGA 5LD2C 1H05A 2DTDA 2JFOA 1IWOA 1KS2A 3QFHA 3C6KA 5K3BA 2QG6A 1H2AS 2CLIB 4ETIA 5JNUA 2AR0A 4D8YA 4XM1A 3HYCA 1ZCFA 3FFTA 3HFSA 1XL1A 3KQKA 4KUHA 1K7FB 1G3MA 4FUTA 5LYYA 4L02A 2I71A 4REQA 1OIXA 2J6IA 1VMIA 4RVOA 3WVNA 3SS7X 1NX6A 1N3LA 5DWVA 2Z6UA 2PUWA 1C0EA 3M4YA 5A4MS 2Q5FA 1X2EA 1CUAA 3WZLA 5LP6B 4N6NA 1ZSNA 2QRUA 1UADA 2G25A 5DHRA 2Y0BA 1ZX1A 3OI7A 2BGIA 2VA9A 4QWMA 5EHGA 4CMJA 3KTAA 4MUEA 2GJSA 2C3YA 3QRWA 2PWZA 2R79A 2VP5A 3QI7A 4FNOA 4KSCA 1Z47A 3HCAA 4M9CA 5I4CA 4BNFA 1G8SA 1WXGA 2CUKA 3FHCB 3QLJA 3UUEA 1THTA 1DIHA 2Q3CA 5JATA 4QXQA 4F5YA 2D2IA 2O1SA 4BNIA 4KHZA 4V39A 2X1VA 2XUFA 3UOWA 4Y0NA 5KI6A 2CK3D 2DC1A 1K7CA 4YT2A 3VI4B 1OBFO 4E5SA 2X5KO 4RVUA 3U49A 4XEUA 5EIFA 3V32A 2MTBA 2GZMA 3CA8A 2YZGA 4MHOA 1G291 5AW8A 1DDOA 3SSOA 4EHLA 1A76A 1JFFA 2GD6A 2HSDA 1N0VC 2SECE 3D2CA 1A98A 3DLIA 1Z5UA 1DAEA 4MV6A 3ER8A 2WKRA 1E63A 1TCUA 3EPRA 4WNIA 2RKWA 1D7OA 1BYUA 3LCVB 3PJFA 4U2GA 1PKEA 3OP4A 1M1XB 2DPLA 4IRUB 4WNCA 3TYXA 1RXCA 1CEYA 1CRPA 5CLIA 1Q3HA 3U5ZB 1IULA 2ODEA 4FBGA 4FB4A 3GLGE 4HYEA 2GZ3A 1IWBB 1YI1A 3JZIA 4IDNA 1XRRA 2F9LA 4JLWA 1JEDA 9GPBA 2XCRB 1KRXA 3HGTA 2RBKA 2Z3ZA 2WIAA 5JV5A 2HADA 5H8WA 1A8HA 3CLSC 2JIPA 5IG2A 1BRTA 3BD7A 4JYMA 4YHBA 1O95D 1QC5A 3DHNA 2D1FA 3WK7A 2V4UA 4R68A 2A9JA 1X8LA 2R7KA 1XRSB 3KR1A 3LGAA 3T3GA 4ZYVA 3EF3A 4DIDA 5BMVA 3Q6NA 5BUZA 5BSMA 1QC5B 1SUBA 3KQPA 3K72B 2Z09A 1XEWX 4GKJB 2P35A 4MP8A 3U3OA 3MGBA 1ORHA 1IPFA 2Z57A 3E23A 4DTCA 2HLPA 3C1AA 1Z2OX 3CZPA 3LCJA 3UJ7A 4Q3NA 3OJWA 2ODQA 1DEHA 1XR3A 2PX2A 2NSJA 3DE5X 1D8AA 3KR0A 4IHQA 2R6AA 2W2LA 4WLOA 1XEXB 3W2EA 1RLOA 1EK5A 2IYYA 2JIDA 1W5EA 2R1VB 1MC5A 3H05A 5ITZB 4ID9A 3RV4A 2W7TA 3JQ7A 4YRDA 1GIAA 2L82A 2YHIA 4J8PA 5JRJA 4YJKA 4C07A 5KKAA 4B3TB 4KL8S 2F9MA 2RHWA 3K0CC 2QJTA 3ZGNA 4UOZA 3Q7IA 3F9RA 4A6PA 1SXJA 2C4NA 2LZ0A 3EF1A 5HBGA 5C81A 4EKEA 4ZJUA 3MLBA 4BZWA 2OZLA 4RZSA 3LCUA 4LRYA 2QZ9A 4CW7A 2JDIA 4QBKA 1FFSA 1NBAA 5J1TB 3OESA 5MFPA 3GZNB 3ZDYB 3C3JA 4L2IB 1A8IA 2MSKA 1NNEA 2C2WA 1CQWA 2P6RA 3OD1A 1OI3A 1G4UR 1VE6A 4QOSA 2ODTX 3JD0A 4J0JA 4OQXA 4DB2A 5AJHA 3T7SA 3U3JA 3U4HA 4MV5A 2JFHA 3RUEA 3QU2A 4CNBA 2D74A 1JT9A 1XTKA 3ASUA 3ENKA 3G5MA 1TAHA 3LY7A 2LW7A 3RIXA 1JS1X 2ZANA 4UMDA 3RTBA 1G7SA 2H7XA 3W5SA 2BMFA 2EHJA 2I78A 1ISFA 2YZ2A 3D7NA 5SYAA 1N36B 3VKFA 2RAPA 3OHSX 3ZWKA 3DLPX 1SMKA 4C6SA 3DMYA 1JXOA 1P2SA 2C61A 2YOHA 5EP2A 3FLBA 5BYJA 2ZBVA 4ZMBA 1QVRA 3KNZA 4MJLA 1YR7A 4CTJA 3LT1A 3I9FA 3OO1A 4RUKA 5MDHA 4IIXA 4U7DA 1E0JA 3GOHA 4M86A 5IH3A 3ZLBA 2VXBA 2ZU0C 4OXYA 4MR8A 5AHRA 3CTPA 4WESA 3ILYA 3M6WA 3GARA 4PLHA 1PV4A 3PIRA 4IY1A 4C05A 1X80A 1FLVA 1E1YA 1AZLA 4Q4HB 2FW9A 3KV3O 4AF6A 4QDJA 1Z06A 3OLCX 5KJEA 2O7VA 4LHVA 3SX0A 1PZXA 5AKLA 2WICA 3R44A 3WJ2A 3I73A 5AVXA 2HK7A 4HS9A 4D57A 4I5IA 4XQCA 3PNVA 3U9TA 2XMCA 3NRJA 3QQ5A 4KQFA 3HP4A 1TJ3A 3A7DA 3EH1A 1GZ7A 2Q6LA 4OM8A 2MR6A 3T5MA 4NNJA 2HI0A 3KALA 4NAUA 4IEEA 1R8SA 5A2GA 3PWTA 3KZVA 3EQ2A 5A5VA 1PFYA 4ZOEA 3GYBA 3SXUA 1RYNA 4FMDB 4CL8A 1QIKA 1HM5A 1WQ1R 3HXLA 3BMXA 2AL7A 4FOLA 2Q7OE 3TRKA 3GLGA 2YMPA 3ELYA 1E2GA 4GW3A 4LWPA 4DAEA 2BFBA 3TNDA 2HCFA 5TVKA 2VSYA 3RVKA 4UM9B 1XBTA 4GMGA 4NEGA 5JI3E 2R6ZA 4GRIA 1Z8FA 3PD1A 4CLDA 4OQQA 2JAHA 5AJTA 3EDRA 3GBSA 1K0UA 4IL5A 4MZXA 2NU8A 3FUWA 4BUZA 5DM70 3GLFB 2UZ3A 3IP1A 2H0RA 1L5LA 2XMZA 4MDEA 2PIDA 4R2JA 4EF5A 2YS7A 4ZKEA 2VJYA 2I4LA 4JLSA 3LO5A 1EZ4A 4A2PA 4YQYA 3RVBA 1PIWA 2BM9A 5DVZA 2AJTA 2QHXA 1H8ED 4Q4JA 4YMWA 3RPEA 4DA6A 1SO8A 3KXKA 5ISMA 1E0KA 2WK1A 2VK4A 1N2CB 3ODPA 1P1BA 1QZXA 1XALA 1UM8A 2XUIA 3FSGA 4ZDKA 1ZJYA 2F59A 1UFRA 5JPDA 1NTRA 5IN5A 3PCTA 1X7DA 3I39X 5HKBA 1H3NA 1C7FA 2JH3A 1Y6FA 1AKYA 1GTJ1 3NORA 1IBRA 5LXTF 3ZNQA 3EIXA 3UQZA 1MV5A 4DA9A 3IYLW 4BNMA 4BCBA 2VXYA 2UYCA 1SOVA 1QTNA 2J09A 3PNLA 2BGLA 4N65A 4EHIA 1RCTE 4ZCSA 4DLRA 4JU9A 3T0IA 3WWZA 1JKFA 3ANTA 4HDSB 5CG1A 1N92A 2NW6A 4JX8A 3RROA 1T4BA 1A1VA 3QE9Y 2REQB 4KXNA 2VEOA 3WLFA 3NMUF 1Z9BA 5G1OA 1D7AA 2PRZA 4HDSA 3RUAA 5CW1A 1UZUA 1XGKA 2B83A 1KDZA 1X1AA 4CZ2A 3JQ9C 4KQKA 1R6BX 1WMAA 4JWTA 4E21A 5FAKA 4IDAA 5BN3A 4LZPA 1ODLA 2W2KB 2P4HX 4P4UA 4XGQA 2FPIA 4DWOA 4F92B 3MWEB 4ZTUB 1NG9A 1G64A 4D79A 1UPAA 2ZWAA 3HU1A 1OAOA 2FETA 2WUGA 5EUBA 4FE3A 4ZVLA 1CEQA 1DBVO 1KY3A 1OXSC 2VKTA 3L6OO 4FR0A 2CLCX 1YB1A 1OXXK 4K28A 4W5WA 4Z8YA 3MEQA 3I8XA 3UNXA 4NBTA 2ID8A 2JD2A 2FHPA 3DB2A 3L6EA 4OQEA 3UGTA 4DWWA 5CCEA 2Q4BA 1GQYA 2D3WA 1CJTC 1HDOA 3F47A 4MUMA 1C3OA 4QGGA 4U39A 3UICA 3ZD6A 5C9ZA 4AX4A 3D6NB 4BO8A 2WR8A 1MB0A 2MSLA 3VFDA 4FIZA 4B7ZA 1TZCA 4LGMA 2GFHA 1ZESA 4GG1A 4RK5A 3MQ4A 1WZUA 3SYTA 3WIOA 4TWJA 3EXG2 3LQ2A 4O4HF 1TK9A 4Y3UA 2I2BA 1FDVA 4QTTB 2R48A 4X9XA 3FETA 4HNTA 3H3FA 5LP6C 3EUAA 4EEKA 1KDOA 4K1XA 4FB5A 4ZZ2A 5A3RA 1DDGA 5KNCD 4YT4A 1I4EB 2JFGA 2KJQA 2R8EA 3KJIA 3F8SA 4S1WA 1S7CA 3CUSA 2HIMA 1G8YA 1EJ0A 1Q7BA 1EX7A 2VJPA 4DOMA 3N2IA 3LHSA 3WLPA 3SEZA 1U2DA 2PUHA 3U3KA 1HTWA 4Y0VA 1XHEA 3AZQA 3I9LA 4IUYA 4DTIA 1T9AA 3G2NA 2OP1A 4N41A 5IFLA 1K66A 3FDJA 8LDHA 4N76A 4KIUA 2PKYX 4ZQBA 2R85A 3LPLA 4LNUB 4RHEA 4EJ2A 3VR5A 3COZA 3Q8KA 1JFSA 2ZTHA 4GPBA 3USCS 4XZ3A 2QN9A 4K9PA 3FNBA 2VBIA 4PF1A 1TQ4A 3TM5A 3K94A 2AWOA 4I4LA 1XMJA 1LDMA 2ZRNA 5DBIA 3UT5B 1DTWB 1E5LA 2GEKA 2WILA 4GHWA 3OZCA 4ZVVA 1X6VA 2D5AA 5FV4A 1JDNA 4Y2VA 4C6TB 1TAUA 4GZ3A 2H65A 3VKHA 1L5YA 1AS3A 2O8EA 3FAKA 3WLSA 4J90A 1VLQA 3PXCX 3W6OA 4XWOA 5JSQA 2PUJA 1F6BA 1YZYA 2OGWA 2QSJA 3PWSA 3O95A 2IW1A 4HZUA 1WW3A 4WOJA 1AXGA 5DP2A 4HB4A 1GL6A 1KAQA 3S2GA 5B7GA 4JOQA 3BBLA 1TZBA 4MQMA 2W6NA 1ZVQA 4PQRA 3DMDA 4BO0A 2HRBA 1AN0A 2YXNA 2BKLA 1X9GA 1CZKA 1HYBA 3ZD9A 5LU9A 1COWD 4OOEA 4DN6A 2XE7A 3BGOS 3RVQA 4COOA 4RJKA 2J59A 1A5TA 3CZ9A 1E79D 2RH9B 2Q2QA 3IP8A 5ALVA 3U19A 1L5RA 1T4CB 2OMKA 3L79A 3MN1A 3N05A 4GBGA 5B4TA 1NVDA 2ZJ1A 4W5OA 2AYZA 3AM5A 4GSLA 1P1CA 3QYFA 1S3FA 3QXJA 3WGTA 3P0FA 4IAOA 1RWBA 3GPDG 3LFTA 2H48A 1E3MA 3NASA 1YR9A 1L2TA 2Y6UA 1IUOA 1J20A 4IIDA 3PQ5A 3KAJA 3OLVA 3N7AA 2JJYA 2QX7A 1RHUA 3CQ9A 4WRRA 1QKKA 1G21B 3EQ7A 1MB2A 4CV1A 4JP1A 4YP7A 3D8SA 2PTGA 1SD1A 2TSYB 4PR3A 1B93A 1XXHA 3ABRB 3VVBA 2I2DA 3DL0A 1J9EA 1F8FA 1PFGA 1XN1A 1NF8A 1FMLA 2GBIA 2WIDA 3D7SA 1XEFA 3FOBA 4PANA 4U5XA 3ICWA 3J80A 4JXXA 3BULA 4PZ0A 3F5SA 5FPKA 4Q93A 1LJ8A 4LOLA 3LXRA 4EO7A 1WTAA 1A71A 1ZUHA 3J7TA 2OXTA 4RTQA 3ZE0B 2OLEA 4CU5A 5LBIA 3EXHB 3QITA 3H2IA 1T9GR 1ZNWA 1PR3A 3I62A 4TQGA 4QJ4A 3B51X 1Z0KA 4Q3KA 2DHQA 2ZRHA 4JUBA 1LBHA 1ZS9A 3Q40A 3QNUA 5AK5A 3OX2A 5SY6A 1N5IA 2UUAB 4MA0A 5D3KA 5KUTA 2H4JA 5GVRA 1Y9EA 4R2IA 2D13A 5JXIA 5ALNA 1W6UA 1KYWA 1BCRA 1JALA 1MG5A 1YCGA 2NSYA 3GRPA 1VG9B 3WB1A 2IX3A 2J33A 4A4DA 4CMBA 4UM9D 4RTSA 2GZHA 2X15A 3KDAA 3BXPA 2BAGA 1BS2A 1UXKA 1NZDA 3QU7A 4NOKA 4M38A 2DULA 1R6TA 1PFUA 2WYVA 3O47A 3QPWA 3QZUA 4X5OA 3NBQA 5EVJA 1RC8A 3WBKA 1QCDA 4MS1A 4UQPA 5CBKA 3X1MA 2H54A 5HQ3B 4TTRA 3PX7A 4GL4A 1U1DA 2OZEA 5FL7D 1PX0A 1VP3A 1UJ2A 5JH7A 3ZDAA 1O95C 3CIFA 1WPQA 2REOA 3ND8A 2QU7A 3S1LA 1G60A 2Q1WA 2XUAA 2O2EA 2FFRA 3EEYA 1NN3A 3H42B 3QVLA 1SU6A 3COPA 1WKCA 1BROA 3RFVA 1VOTA 3W9YA 4EDHA 2GCIA 2QV0A 1T2FA 2CN1A 3DOFA 4YN3A 4EB0A 1OHHA 3IB6A 2DSNA 3VR3A 3TPFA 4P58A 2F9FA 1XLTA 3V3TA 3KJFA 4C4TA 1PW5A 1VE1A 3ANXA 2YY6A 4I3FA 1MJNA 4D41A 3P2YA 1XTVA 5CW2A 4J4BA 3K20A 3OX4A 1E7WA 3L07A 3A4IA 5BNWA 4URFA 2WM2A 1RLTA 4O0LA 2FPPA 4QNRA 4O2RA 5ESRA 1QX3A 1QNFA 1ACMA 1IM5A 1Y3BE 2ALJA 2QZPA 2XHEA 3GYGA 1W0KD 5CDFA 5B3KA 1KEEB 4IFBA 2B7BA 1IEVA 1LA2A 1YS4A 2GCEA 2JH8A 3PLRA 2DFPA 3V2HA 3ZOKA 5JNLA 3JQ6A 2ZZMA 1MAAA 4ZDJA 1QV6A 2XXJA 4KNVA 2P2SA 4Z7NB 2WAXA 1N6NA 1QCCA 4TWAA 1QHEA 1VPLA 1B2LA 1M74A 1RKXA 1YFZA 2VAVA 2QSZA 3WYAA 4DMLA 5IRCD 1A7JA 2CVOA 4EARA 1A8QA 1WMSA 1CWUA 1G5RA 2JGDB 3A32A 4AUKA 4DNPA 4RVHA 2C5BA 3HWWA 1MA3A 1HG1A 2CHFA 1K4KA 2PIAA 3AYXB 3N2EA 5HKKA 1R0CA 1VPWA 3MGCA 4X3CA 2P9YA 4KAJA 3CEPB 2VXOA 2UU9B 5MF6A 1T15A 2PX5A 5EWLA 1DT5A 1KJJA 2D1SA 3EVDA 3QKIA 5KQGA 1IHXA 4ZO6A 4YH1A 5FUMA 3M9WA 2J5BA 4ARBA 3W8EA 2Q3LA 3KLMX 1IXRC 1E5DA 1OE0A 1ADGA 2WJ4A 3DDZX 3KQMA 1ZVMA 4QDUA 3S4YA 5ALOA 4BVAA 5FWXB 1AKEA 1GSOA 2JZNA 4XSHA 1TMKA 5K2OA 1ZCJA 2JVJA 1SGWA 3IA7A 1JFTA 1C1HA 3FYUB 1C81A 5JDIC 4YRCA 1KMIY 2EZ8A 1PSZA 1IEWA 1Z33A 1J0DA 3D1LA 1GZUA 3ENNA 4EGFA 4TS4A 3FOWA 3HCWA 2RDMA 3UXEA 5HZHA 2BEVB 3WJAA 4LXQA 2H2DA 4HWKA 2VG8A 4LZNA 3ROKA 3RS2A 1NBEA 1TA4A 3F2IA 4JBNA 4I8XA 4JP8A 1JWLA 2XNSA 3EVAA 3VKWA 4Z1MA 2IODA 1ULZA 1YU6A 4BQIA 1B8UA 1QF7A 2J0SA 5FTLA 5EL0A 3O8OB 1S2MA 1L8LA 1QOPB 1WZEA 3OU6A 3QEMB 3NNNA 2IPMA 2IXFA 1EB8A 1VFNA 4Q01A 3C3CA 1OOEA 3VTAA 1U0OC 4WY2A 1OC2A 1K89A 5DNWA 1E5QA 3JQ9A 4DZRA 1LTHR 2Q49A 3WOHA 3ZEAA 2AV6A 2PGNA 5TQ0A 3ADOA 2EP7A 5LMNB 3FTFA 2V5AA 1ONNA 2ZM6B 4ZEMA 2JFWA 4PS0A 2ONJA 3QX9A 3QBEA 3FPCA 1N5MA 4CT4B 3FJOA 3LQRA 1J23A 4HWTA 1XZPA 4DKXA 1Y1SA 3TF5A 4KVGA 4BNUA 4ND2A 2J7KA 3O5AA 3PUZA 3RG2A 1Q0SA 4BVJA 1DBWA 4FOOA 1RWNA 2JCGA 4OQMA 3ZUGA 4OBWA 4GYJA 1UK7A 5E38A 1T0JB 2C7BA 3Q1KA 4GX2A 1Q1GA 2QT1A 3P96A 1W1UA 3I4FA 3UK7A 1VHWA 1M8KA 3AUJB 3IIJA 1IB6A 5JY1A 1MQSA 2IYNA 1G8GA 1NN0A 3B20A 4BDTA 4O4IA 3GAMA 4DMCA 1U8TA 3AF2A 4JC5A 2SCUA 1ML3A 3DDUA 3IUMA 3ZIDA 5BSUA 4E5NA 3IODA 2OSBA 1N6LA 4G5GA 1QGUB 2VHTA 4X6UA 2FI1A 3WYCA 4FI3C 2HBQA 4UZFA 1ZRSA 2H29A 1WDKA 3GDGA 2DQSA 4QOFA 2D2EA 2WIGA 4PRZA 2CMFA 3IFSA 2I99A 1KQ3A 4L16A 4L9AA 1VIVA 2PUVA 4MZDA 4NV0A 3OC0A 4P7JA 1PG0A 2HMSA 3IURA 3DZ8A 1M83A 1R7RA 1YCHA 4H77A 2IV2X 2FR8A 4HH4A 1DJOA 1XDGA 3WYFA 1IWPB 2Z4SA 4DQVA 5HEKA 3KOMA 3T9EA 3EQZA 2IPOA 3IULA 4NBUA 4RVDA 4BBZA 1ZXXA 4E2XA 3H4MA 2JLVA 3T95A 3B60A 5FUQA 5FWDA 1I4DD 1QH8A 2F1KA 4UMVA 5AW9A 3PPIA 1B7GO 3JWPA 3R3YA 1U7ZA 3X2FA 4LDRA 1X19A 4JUDX 5L40A 4A2QA 3WKEA 2KYRA 3ESBA 1EP3B 4ZREA 1RKBA 5FPYA 2NP6A 2GR9A 3AEUA 3PNQA 5JSHA 3H19A 3A9SA 1KYIA 4KZKA 3WJ1A 3FZNA 1U1FA 1V9CA 1ORIA 2J6BA 3IAEA 4A36A 5E9QA 4CT0A 5AO9A 3T7CA 3GNQA 1QMPA 2NUAA 2WLTA 3CINA 4L27A 1M6WA 1MZVA 521PA 3OQIA 1RT9A 2P6NA 4ODIA 3LC2O 5L8VA 5BSKA 3GUYA 3PUIA 4NICA 2H8KA 1P1RA 5G1PA 3CNHA 4C01A 1KFJB 1SB8A 4HB0A 1QH9A 4W1RA 2X13A 5HOEA 2OENG 3C43A 4CU2A 2CLDX 4XPIB 2AXNA 1L3CA 2BZ1A 5EUQB 3TZEA 2HQRA 4I2NA 2IU0A 1O77A 1PTJA 3PFGA 1JLRA 1M2GA 3LAWA 1AZWA 1Z74A 3ZV3A 1MRNA 1Z18A 1SHLA 3EVEA 1M9NA 4DMMA 4JEUA 4V2UA 1YGYA 2X0NA 3UMBA 5CBPB 3BSWA 3AR9A 3F3YA 3GT7A 2DWUA 3KPUA 4ABTA 4LIPD 1OI4A 1ZIDA 1CVIA 2ZPUA 1J8YF 3HY3A 4QBFA 4QTXA 1D2HA 4RKWA 3KSRA 4TV8A 5DASA 1O9GA 2JGDA 2FR1A 1DEKA 1SQGA 2H6EA 3AF0A 3MGKA 3UK6A 4JB8A 4PYLA 3N8GA 4CM8B 3BWCA 4MRRA 5F3DA 5LZ9A 4IJWA 2FU5C 2OQRA 3LOPA 5J4HA 4L9SA 4KXWA 4FE7A 5CJPA 1U0HC 4INOA 3QOYA 5IKOA 2PT5A 3G49A 3QX3A 1ZRHA 3IEXA 3PGLA 4GOKA 4MDYA 1R5NA 1KE1A 1E3WA 3L0DA 2OFFA 2RHCA 4HCJA 2IZZA 4M37A 3VR4D 4RAOA 2EZ9A 1T3GA 3PNKA 3PE3A 4ND8A 4WBNB 3NH6A 4RIHA 2QVGA 1FFHA 4JNCA 3LH5A 3QBTA 3BN3A 3D3WB 1T6NA 4N3AA 2PXHA 2R6CA 4KQJA 3R7LA 2IPLA 1ZRMA 1V5FA 5IFKA 3TTTA 4CM8A 3OOEA 3IX7A 4OJMX 1XJQA 1B6TA 1V1JA 1JQKA 1MH1A 1TDJA 3NHAA 2PG3A 4GU5A 3LVFO 4LPKA 5FEUA 3EMDA 3WK9A 4P3NA 1BHQ1 3HGMA 2JCSA 2PUCA 1T5BA 1SKMA 1V7CA 1U0JA 4C1BA 2P2CA 2R8XA 3ESDA 2GAJA 3LLMA 3TTYA 4EPVA 4Q9DA 2QVCA 4HXYA 5I3ZA 5IYZF 3ANLA 3FX2A 4YRQA 1QQ5A 2ANCA 3RVMA 4FMPA 3TBKA 4OI0A 4ZFNA 5B1YA 1KI3A 4AKTA 4FFWA 3KHKA 3P5BA 2V03A 1G6KA 2NNLD 3DFKA 4U6QA 4UBLA 4UZSA 4JBGA 3GLKA 4V0SA 5A5DA 1CCWA 1L4YA 3EGCA 4JI4B 3TE7A 1P7VA 5KSOA 2DFNA 1D2CA 1NZJA 4PBTA 4LW8A 5KYYA 1YR6A 1I7DA 2AFHE 4PX9A 2QLFA 4D56A 3KJEA 1F9AA 3QH4A 4GM4A 2BHSA 4D81A 3K9HA 4XEHA 1XNHA 1XMIA 2WHEA 5ALUA 2IKQA 1SAYA 3A4YA 3KD2A 1ULTA 4JKYA 4OL9A 1YS9A 2CNKA 3ILXA 4J9VA 5IBQA 4D80A 4DSAA 1WXQA 4IXWA 4IQFA 1Z34A 4JJ4A 4O2BB 3ZDCA 1QRAA 3GRRA 1AS2A 5KYNA 5IVIA 3RC9A 5IHPA 4GC5A 5LXTA 3E3LA 5CDFE 1U2DC 2DGDA 4EQ6B 3LG2A 2JAWA 3FXAA 4V3BA 1XEXA 3W5BA 4S05A 2PD4A 1ZVVA 4TS3A 3QPUA 1IATA 4UTZA 5DMHA 1MVNA 1X3LA 5EQJB 1ZXLA 3ZV5A 3Q3IA 2PYIA 3T3OA 5IYZA 4GI5A 3P0HA 2ZE6A 5KYUA 4AMBA 3NM6B 5D86A 3BBPA 3TZBA 7ABPA 4GWLA 4QOHA 1B00A 1Y3FE 3IQGX 3OT4A 2VR1A 2VDLB 3L84A 2QRVA 2V7PA 3MINA 2VDRB 4BKRA 1DAIA 1GKKA 3FZGA 4MRMA 3PGMA 3MERA 3AWIA 5LSAA 2P2GA 3JVIA 2Y05A 3B1FA 1VGQA 2GILA 2B4YA 4FCTA 4HEHA 3NYQA 4HEA1 3W5HA 1N8KA 2QX6A 3DMTC 3OE4A 4LECA 4CDGA 4DUPA 1EWRA 1P2GA 2NOAA 2AC2A 3K0AB 1SKAA 4MYHA 4IV5A 4R41A 4RGQA 2RHOA 5JIBA 3SR3A 3U60B 3L0PA 2X7HA 3KM0A 1JILA 1KETA 5KYKA 2Q3DA 3O84A 5BURA 4K6MA 3H2JA 4KFSA 1KHTA 5BNZA 4PGHA 1SXHA 4M2LA 4ARZA 4WCVA 1V3UA 1VXOA 2DR0A 5JEDA 4Y6RA 1AXEA 3L1JA 2II6A 2VP9A 2JLBA 2FG6C 2P9ZA 4HNAB 4MPRA 1G5PA 4NFLA 5JEEA 2P3OA 5JNWA 1T6ZA 1BD3A 2HPAA 2P9HA 3QEBZ 5BN5A 3O4GA 2CHVA 2DPMA 3IL2A 1VYVA 1CR1A 4HVTA 1XQXA 4MQLA 2Y93A 2EFJA 1RCFA 4WXRA 1EK2A 3BZBA 1CDZA 4PPGA 3W6UA 2IH2A 4YLGA 2VRNA 5PNTA 4ERNA 2BFEA 3RB8A 4OFXA 1AVTA 3GX1A 5J4YA 1MU0A 2QAJA 2YWDA 1L5HB 1U99A 3UH0A 5I7FA 2QD2A 3JVVA 4GBMA 3JWGA 1UDAA 1CY2A 1J8DA 3OWHA 5DSTA 2YV4A 3R0VA 4RJIA 2H06A 2FPLA 4BXOB 4G0ZA 3DKVA 1FFAA 5DN6A 2P77A 5JAQA 2PHZA 1Z4LA 1RKQA 3UJ8A 2QPOA 1R50A 1TUBB 2NUPB 2VHUA 3UFXA 4W5RA 3ZDXB 2AMFA 1FDRA 4GS5A 2W58A 1TQ6A 3OIGA 5C31A 2BKUA 5CXXA 3WRYC 2WTNA 1FTGA 3I2YX 3KT3A 3G0GA 5JMOA 3ODGA 1CB0A 4XB1A 3W8NA 2CL7X 2J3EA 2JBAB 3SD7A 5HF8A 3WGJA 4EP1A 2W43A 4AULA 4YACA 5DYWA 5CTAA 2VNSA 3ELUA 4FILA 1R64A 1RFGE 4TMXA 3DEAA 3L8ZA 1RWVA 2YICA 3FWKA 4PE5B 3BXZA 1G41A 3T9AA 3ST7A 3H4IA 3P45A 4UXJA 3I1YA 1RYZA 3AEXA 2IE0A 4OATA 4RQTA 3IQEA 4GKBA 4IGIA 1LK5A 3HU2A 5FF9A 3TL6A 3SR0A 3HY4A 2QYOA 2IC5A 2P5SA 3LWBA 5ALHA 4BJ6A 3HJNA 1JX6A 2N75A 5CB6A 2ZTLA 5C8XA 1JEOA 4DQXA 3GV0A 1WZCA 3VC1A 1FZQA 4HV4A 2B6NA 1YK1A 2OBXA 1UQTA 1RNLA 2Q9CA 4MK4A 1FNCA 2XKBA 3BF7A 4LV5B 3ES9A 3K32A 4UMEA 5ITZA 3TG2A 5GOZA 5NLLA 1LSOA 1KARA 1XU7A 4OUDA 4Y2GA 4CKEB 2PUGA 3U5TA 3VPHA 3OWXA 3W6PA 1XCMA 2FQYA 3CNLA 1LBTA 4UUAA 3UXMA 2ZIFA 1EFKA 2A35A 2JLQA 1KZ9A 4TKVB 3BIFA 2Z08A 3IUEA 1P0QA 3WB9A 4EI7A 2XTNA 1G98A 1SC6A 3TECE 3OT5A 4LF8B 3NZEA 3SHQA 2H9YA 4DSUA 3C4QA 4N3CA 3ZGVA 3BB4A 1Z4MA 4B3GA 2R68A 1TEXA 5EXTA 1XYGA 5L7TA 3W5CA 4DR1B 2UXBB 3NBAA 3CUVA 1AV6A 5JXJA 2IHJA 1FX0A 3AJ9A 3N2LA 3VX4A 1VKJA 3CCFA 1DLJA 3IAS6 1SK9A 2VYND 3ZHQA 3HUUA 4JQOA 1LDNA 2GS9A 4DHWA 2N0SA 4D6PA 2LXNA 3VAYA 3X1XA 5A6VA 4EKNB 3RAEC 3L4JA 2N1MA 4UZEA 1UINA 2GEBA 3HJGA 3LZCA 3RYTC 5H1YA 2BGRA 3PICA 2A5DA 1K06A 1WCIA 1K2VN 3N2KB 1HC7A 4HPJB 2J0VA 3N76A 2QDKA 4X85A 5H70A 1W8IA 5HM6A 2J3IA 4EYEA 4PSDA 3W4JA 4K8RB 3H9EO 5J43A 2IIPA 1ODSA 2R2GA 1T3LA 5B4UA 3T7EA 1YJCA 3QKWA 1L5NA 5ULLA 2ONZA 1V2GA 3W2HA 3DB1A 4OBXA 4KO3S 4YCLA 3H9GA 1BMFD 1U3CA 2JF0A 2QIPA 2I91A 3P8ZA 3FTCA 1WDMA 1GITA 3D3EA 3L4EA 4DLBA 3IEVA 2V3VA 5KS2A 1NE7A 1U2EA 4O4JB 4ZQFA 4A6XA 1E98A 4WXMA 4I3GA 5CIYA 1GAXA 4KPFC 3TI7A 4RZIA 4D9EA 4HWGA 4UNRA 2HR1A 1EU1A 3MBIA 4HK4A 2X0KA 3PXDA 2FGKA 1NVEA 3CTMA 4OV6B 4XJTA 3N2KA 4RHCA 4K6CA 4KGDA 1E1DA 2HUPA 2HU8A 3L92A 1U3UA 2VN8A 3JQFC 4B3RB 5K0LA 2GO7A 3DFUA 5T3YA 2A0FA 4CCSA 4RVCA 2XB8A 1DAMA 4S35A 3SY8A 1K9SA 4MKGA 1EIZA 1RC1A 4IXMA 5LQMA 4L5AA 5HF6A 1Q7GA 1F51E 3E3AA 2BSQA 1E7SA 3UUGA 2D2FA 5T3UA 4R1QA 3RBXA 3V00A 5ENZA 1LQTA 4KBYA 1EVLA 4MI1A 2EFCB 3PRYA 3PHLA 5FWYB 1EK1A 3RVJA 1FUEA 2V6GA 1PR1A 4ILEA 5DIFA 3IAFA 2PKEA 4H7PA 1IE3A 3IXMA 4JT8A 4XB2A 3TRDA 2CE2X 4PHTA 2CLSA 1N8SA 2F3TA 2ZVDA 4L0MA 2OGUA 4IDEA 3VNQA 4ERXA 4FBMA 1XZQA 4JVOA 1TUBA 4M0PA 4PAOA 1W30A 1TA9A 4KMMA 1ZQ9A 1O08A 2AD5A 2X7XA 4R0VA 5KWSA 2AKAB 3DE3X 5FAXA 2ODPA 5EWMB 5FLEX 3ICQB 3LWDA 4M9QA 4AO7A 3OZFA 3TJRA 4TL7A 1S96A 3FUXA 5LWQA 3X43A 1NVKA 2SICE 3CEMA 1PJTA 3IMKA 5ARDA 1SOMA 3AUYA 1IZ7A 2C2HA 2NN3C 2ZI3A 3LE8A 3RC8A 5BV7A 4KCGA 5EJFA 1P7WA 3ZHSA 4EBBA 1T1RA 2HRRA 2V74B 4IJMA 3H5IA 4C0HA 3BMQA 1UOPA 4D26A 4ZCIA 2D7DA 13PKA 4B7AA 1IRXA 3SQXA 1IY1A 1Q50A 1T3ZA 2C29D 2IGTA 2L2QA 4ZDIA 2O23A 3BMQB 2AN4A 3A4NA 1JBEA 3R3SA 3F97A 3ISVA 1TJNA 3LNTA 3MHTA 4DYVA 2P9TA 1XTIA 2QKYA 4PG7A 3AVUA 3E4CA 3N3BC 3NHYA 1QG4A 2YV3A 2BEWA 5DN9A 2YH2A 3MYRA 2GZ2A 1N2IA 1OASA 2REBA 4MQ6A 2WHPA 3O1IC 4B3MB 1T35A 4QBIA 3LF2A 1I6LA 3WYEA 4YP1A 3C3AA 3WP1B 1Z5NA 4DZZA 4RMGA 1GLNA 2EP5A 1MTZA 4Q3OA 2A9FA 1UEIA 5DRTA 1JR2A 2OXEA 2PH1A 5G2OA 1J24A 2QLBA 1KHHA 3RYIB 4EG7A 2G7ZA 1CS0A 2DSTA 5BVHA 3KSBC 1YVUA 4NZNA 4FP9A 4UM5A 4XGRA 3L4BC 2JK0A 2Q0QA 3WKBA 3SJ7A 1Y7HA 4I4TB 3VR4H 4DLWA 2PXXA 3ZXYA 3HC7A 1XYYA 5JJIA 4PX3A 4P7FA 4DIMA 4LY6A 2DWQA 1T8PA 2P2DA 1OTHA 4OGLA 3GH3A 3D8TA 3QXGA 4QLOA 3CPHA 5CVVA 2QR5A 5BSWA 1VSTA 1WXXA 1ZJ5A 3A1NA 3QM1A 5F7ZA 4NOMA 4C0LA 4DLUA 4O4HB 5AW4A 1L7RA 1MP0A 1UDCA 1I33A 3FVVA 2TYSB 4HDKA 5AUQA 5K1ZA 4YRLA 4NH4A 3KVVA 5G0TA 5JPCA 2YVAA 5DGXA 1BQ4A 2X58A 3EMKA 3PGVA 3U6KA 3HYLA 3K4PA 2NYRA 1G0OA 2ECKA 1N6OA 1SRRA 1YA4A 1BKSB 4IIJB 1XZIA 3VZSA 4ZTZB 3CWQA 4HMQA 1Z0IA 1D9ZA 3OEED 3IO5A 1ZRNA 1QGZA 1ZWKA 3CSUA 3FRJA 3GVHA 3OT1B 2BR5A 4H7HA 4U6SA 1LF0A 5E7QA 1O8CA 3IV7A 3RNLA 3DVAA 3KEQA 1M34B 1KU6A 1XN4A 5ITSA 3WLHA 5M7EA 4H4CA 3ABZA 4NG4A 4QXAA 5J5AA 2MSEB 2O0JA 1XE3A 3LUDA 4EH1A 1KP2A 3GFFA 3BIXA 5IMSA 3I9MA 5HK8A 1UC9A 4MRPA 5IBRA 1U65A 4P3KA 3ZBQA 3J81A 1J0BA 1JG7A 2BELA 4KQXA 3QTBA 2PSEA 3AM3A 4B5KA 3K7EA 3BORA 1PJ3A 1PR6A 3TLJA 2W2XA 4UHBA 1H93A 1Z16A 5CT9A 3QFRA 2D4AA 2IYTA 3T5AA 2BP7B 1LSSA 4NENB 2IOHA 4BE4A 4A2CA 2BRUA 2NQ8A 2ZRIA 1AQUA 1P0FA 3WL5A 4BFXA 4Y8VA 3BT7A 3WL8A 2WNHA 1QGAA 4JVLA 3VOAA 1RP7A 4EJ0A 2QAGC 1U2GA 2A59A 1P75A 3GEHA 4Q9IA 3ROMA 2HQSA 2ZKLA 4NWIA 5BPHA 2Y71A 2ZI5A 2Z8XA 3DYBA 5FD8A 3CRZA 1S89A 1GR0A 3DCYA 4KDCA 4LKRA 2EXXA 5FQOA 3DF7A 3DVLA 1JQEA 2JHGA 4M3NA 1G42A 1TEHA 4FGUA 4IZHA 1YZVA 1CU1A 4M55A 1XNQB 2W6JA 3UJPA 1LBQA 4JBLA 3W5UA 4Z4IA 1U63A 2F1OA 4FZJA 1T8SA 4X00A 1N2GA 3PENA 3AILA 2GA8A 3GJ6A 1S7GA 2PY6A 2VHVA 1XA3A 2P6MA 1S3GA 4C0WA 3BC1A 4EO9A 5J4KA 1XZAA 4QJIA 3THRA 2ATXA 1CHDA 1FPMA 1R9GA 1V8OA 4KDFA 3IOBA 3PUVA 3MT9A 3TZLA 1ZD4A 5THQA 5KQMA 5D1HA 3L0IB 2YCBA 5C8YA 5L7WA 3EH2A 3AVWA 2RGGA 3KOUA 2BBTA 4FCVA 2AC4A 2O0MA 3WK5A 2GYVA 4DSOA 1JXQA 1KZ1A 2FJPA 2RGAA 2IZ6A 2X8WA 3HO6A 3KD3A 4XFKA 3SHOA 4ECEA 5JD4A 5I7AA 3PC8C 4E2YA 4G36A 2VPPA 4HO1X 4L8FA 3DR3A 2RC5A 5DWQA 4GBJA 5DP1A 1EFUA 2CVQA 4ZQGA 1DWQA 4KH0A 3E7WA 3C3MA 3HR4A 1W52X 4BN4A 5FTWA 3E61A 4WADA 2WYOA 1DTEA 1QV9A 1XHLA 4NPCA 3Q72A 3ZD7A 3I1JA 1O89A 1T2EA 1G17A 3OWOA 3OCYA 3PPWA 4RTKA 3JU3A 4RK1A 4RY0A 4MCAA 2EGGA 1JB1A 2OQ2A 2QP3A 3B1XA 2HDOA 3E4DA 1S01A 4ZZIA 5A0VA 4ARCA 4DJDC 4UDOA 1BMDA 2BEKA 3EGVA 3FBGA 4KLNA 1VBNA 1EVYA 2AOUA 1NXWA 2I3GA 2YHBA 5I7SA 5H81A 2HCBA 2EC5A 1Z25A 1Z0AA 3E9QA 1ZK1A 3HBNA 3TN7A 1U8UA 4I9NA 4LHYA 3OCCA 1OY1A 5LQUA 2IU4A 4FGKA 1KAOA 3RTAA 3SZOA 1L5QA 2YWGA 3NVAA 1E3LA 1C14A 1T8UA 2D1YA 3DT9A 3RSZA 2Z04A 1Z2DA 3G7UA 1GFZA 1ZM9A 3DBLA 3UAZA 4CIDA 2LTAA 2PAAA 2NAFA 1WSDA 4F97A 2FKNA 3IAS1 1I2MA 1F8YA 3LP8A 2BFPA 3CCBA 2WF8A 3GJ0A 5CJ2A 4ARVA 1U7PA 3BF8A 4K6FA 1F7VA 5JVDB 1TVMA 4B2IA 4IQ4A 2P0EA 1Q7CA 4P86A 3LT4A 4M0KA 3VDRA 1UBLS 1WUYA 3SZLA 3Q10A 4KXVA 1J1UA 3GHYA 4X1OA 1HYQA 1X42A 4JGIA 4JFAA 1A72A 2A5GA 1K5GA 2J31A 3U09A 3ZH2A 4DR2B 2NGRA 4KE6A 4TV9A 2VUTA 2D4HA 3OF3A 2F8TA 2J85A 1MDBA 4A8JC 3H1TA 4C14A 2BZSA 4O02B 1GUDA 3GFGA 5EKSA 4QFBA 5L6MB 1PWXA 2G6TA 1N5RA 2AIRA 2RD2A 2ABWA 2O1WA 2IIBA 3WGOA 2WUEA 3BHJA 4E08A 4MYRA 1Y81A 1SEPA 4CIYA 2IJGX 8ATCA 1C9YA 5GJVC 2IIVA 4M1SA 3FOAA 1NBHA 2G0AA 2Y0DA 4L5BA 3WLEA 2A0KA 3ZJTA 2GEDA 1CVLA 4TN1A 5TF0A 4ZQCB 4MR7A 4TLMB 1KWKA 1I13A 1RI3A 4MKXA 4MLDA 4PO9A 1UXGA 3I12A 1QHGA 1JHXA 3DAYA 3U48A 2O8DA 2HWKA 2JANA 1Q6ZA 4X44A 1NJ1A 3O8RA 4TZTA 3LX4A 1PWYE 1WSAA 3MJTA 1XZHA 1YRYE 4RF3A 2IP4A 2O8DB 3FDFA 1UOEA 4OB7A 2XWJI 3DW3X 3HB9A 4OP1A 4OQNA 1LI7A 4DCGA 1O97D 3ANMA 4OFBA 2ZTSA 4YV2A 3NNDA 2P62A 5CVCA 2PGXA 2FPRA 4FC7A 4DIUA 1LLQA 1TUGA 3UN1A 4G56A 4F2GA 3GFPA 2AF4C 4KDEA 4J16C 4JL6A 3NC4A 2PRSA 2VJLA 3W5DA 1JAXA 5FEMA 4OK5A 3HN6A 4YI5A 3RIGA 3JQEA 3U4CA 4MJ7A 1E2NA 1GUZA 2K2QB 4Z3DA 1J6UA 4Q3AA 3M3DA 1BNCA 4TUYF 3G7SA 3WBJA 1OZAA 3CS3A 5E2IA 1T9DA 2H5EA 3MVEA 4RF4A 2BISA 2G5GX 3QU4A 3UMJA 2VFAA 4QASA 1QK3A 5BNIA 1GSHA 3R0JA 1ZAKA 4RD1A 1ZC4A 5H3CA 3ZTYA 1ZGGA 3FR7A 4HYYA 5ENVA 3HO1A 2E85A 3GA0A 1Z7WA 1XAIA 3I9V1 2EGUA 1GQFA 2WD8A 3KPYA 4MMXB 1NBMA 1CUEA 4U1RA 3TCXB 3CO0S 3C1TA 3LQFA 3R3XA 4BNJA 1RZUA 5EJAA 4FD2A 3MLAA 3RJTA 1K5DA 4KEAA 3W3ZB 1GEGA 4R8RA 3SEQA 1U94A 1R00A 4WXEA 3SSMA 1LNSA 2Z5LA 4AN4A 3AFIA 2ATCA 5GY7A 2UUCB 1Y4AE 1RLJA 3TLAA 2GYWA 5BMVF 4MVJP 3V8QA 3THSA 1QO9A 1Z6GA 3NC1C 2EVWX 1KQGA 2GK7A 2IWRA 4AY6A 4M0CA 2ISQA 5A3QA 1W4LA 4V0KA 2H3EA 2MSWA 5DULA 3U80A 3SQLA 1SVSA 2JFBA 1GU0A 1VLLA 1JR4A 1X77A 4JBIA 5LDGA 5HYVA 1CRZA 3VRHA 5A02A 3WLTA 3HBAA 4UBMA 3PRJA 1L5MA 1U2SA 5K3CA 1U02A 4FZRA 4AQDA 3L3BA 4KV7A 4IHAA 3TFOA 1E4OA 3FMGA 3RG8A 3LCMA 1NYQA 1DOZA 2WTEA 5EJMA 4AS3A 2ILVA 5HUQA 1TQHA 4XVQA 1YTLA 2OO5C 4K3UA 4II3A 3ZCTA 5AKJA 4ARUA 1ISIA 1LXCA 4UQLA 1ZNXA 4UBNA 1I7PA 1ZNYA 3K92A 3RK0A 1L7XA 2D5IA 2VC2B 1HOXA 1T4MA 1ZIOA 3IUNA 5DRYA 2QUAA 1P4AA 3WZMA 1ECFA 2A67A 1ADYA 3FCXA 2N9UA 1KYVA 3ILHA 3PX2A 3H7IA 5T4BA 5CT8A 2PT7A 3QVTA 221PA 4CN8A 1D0SA 5LDHA 3IQDB 2MCFA 4LOAA 4REQB 2CMDA 3IKTA 2J4FA 3DBOB 4PFKA 2EKZA 4R7ZA 2GH1A 5FV7A 2H1OA 3ZXSA 1QPBA 1CUDA 5FHQA 4B3SB 1SCNE 2I4IA 2OT3B 2PL3A 3H2SA 1QONA 3IAM1 2F1IA 4RGYA 3TLMA 4RAQA 1P0PA 4N3BA 5ALMA 4DJJA 3CHYA 5DX8A 3RK4A 4AURA 3UWPA 1S4MA 1H42A 2IXGA 2QMYA 4XFJA 4GLJA 4C4ZA 2Y1GA 4JB3A 3AWDA 3GRCA 3LBHA 3MPUA 3MD0A 1GVNB 3OY2A 4U0KA 5CLHA 1XIVA 1RVV1 3DMNA 3LQYA 1GG9A 3AFOA 5I5GA 3WP0A 3U31A 3PIIA 2WF9A 3GR6A 3VKGA 3EOAI 3PD7A 1CEEA 2BZGA 1GGJA 1T0IA 1KKLA 3NXKA 1PT5A 2OV1A 1KMHB 4MGZR 4R1MA 1A5SB 3MUOA 2PZ8A 2A1UB 2OZKA 1QYWA 2POQX 4I5GA 4ENVA 3COVA 1LC3A 5HDBB 1JIVA 1XWFA 1FVOA 3GF4A 4KPGA 2NO0A 2VXCA 4ZRMA 4BCDA 4TL8A 2LNDA 3HU5A 1Y1LA 2RIRA 3AIOA 2FCRA 3NWEA 3UFXB 3U9LA 2B2NA 1OWOA 4A0SA 1Y1RA 1WNFA 1AA6A 1B0UA 2HAEA 1O94A 2YASA 4HLCA 4QARA 1OLUB 4MUAA 1J06A 4XUCA 2CNWD 3IJPA 4EZEA 2C0CA 4P3YA 5GONA 2F48A 5DN6D 1GQSA 1P9OA 4MWTA 4AJLA 3SS9X 1V4VA 3PQ3A 4DBVO 4FFMA 3IUSA 2YWRA 1WQ4A 2VNAA 3BXHA 3OZUA 4RLHA 5HJEA 1QAMA 2O2DA 1Y3CE 3GFRA 3N8KA 4IHKA 4U0JA 4C7VA 2DETA 3NHRA 4FJ0A 4KIFA 1QDUA 1UEXC 4KTTE 1M2JA 1YH3A 5B64A 3HXMA 2FWPA 5HK9A 3HB7A 5SZJA 1VHQA 2OB2A 3Q15C 3KSMA 2VSNA 4V2IA 3UV6A 2J7PA 3Q88A 1LDEA 1PR0A 4IMRA 3OF2A 3LY9A 1NV9A 4F4DA 5DX0A 4D9GA 1LGYA 3C4JA 3PR3A 2IU6A 4LY3A 2RGNC 1O96A 1Y63A 2OVBA 4IJ6A 1L7VC 4JMPA 4R9VA 3ZHVA 4YXWD 4TZ0A 2QN1A 2BEUB 1WKBA 2GBPA 4K88A 4NZ9A 3MB5A 2WU8A 2XMGA 3O4HA 4RYLA 5BXQC 1IC6A 3D4IA 5K4AA 2PA3A 2P78A 3R24A 4RCZA 2O1EA 4OQPA 1I1QB 3L7BA 1E9VA 4KAXA 3SE0A 1MJHA 1U0SY 2XYQA 4K1LA 3PVSA 1M34E 3ASYA 1QX4A 3BHNA 3EXIB 5LWHA 3LU1A 3T4UA 4QU0A 4XGIA 2PLNA 3KKEA 3K9GA 2WTXA 2VNJA 3ONWA 1HG0A 1L1QA 2GZSA 3KDPA 5IK2A 5CDGA 4NJMA 3G2MA 5IMBA 3WSVA 3IEMA 1IOZA 5UKDA 1FBTA 1RRMA 1KR2A 1QS0A 1ZN8A 2ZB7A 1PEKE 2OHVA 3E58A 4RU1A 2O2JA 3A6DA 4BQSA 3UB2A 1IXSB 3G9QA 3E27A 2YHSA 5FHRA 3FFAA 3KAQA 2AH5A 3E9YA 4UTOA 1E79A 3ZN2A 5L51A 4HP8A 4HDCA 4EPYA 2PR2A 2IOQA 4ILKA 4XLZA 4KMOA 3HCFA 4PO8A 5B4VA 2O8BB 3CRW1 1DKRA 2XVYA 2R1VA 3K2QA 1XNJA 3EPKA 4A15A 3KHSA 1DQSA 5TV2A 5AKIA 4P32A 1E9RA 1AKWA 1U9IA 5F7JA 1RP1A 3TPCA 4I1IA 4JY7A 3T35A 3RKSA 3EULA 2HA0A 2MJLA 5JE8A 2C97A 5LPNA 3LDAA 5AW6A 1G9XA 5KWIA 5LLDA 2FEOA 1JDPA 4E51A 3WDMA 4MPPA 4ZKDA 3UW1A 1SZCA 3GH1A 2XNJA 4PC3A 5H83A 3QVGB 4MKIA 1KJNA 1SNYA 1XO1A 2IF2A 5FP0A 5F3RA 3GU3A 1JFVA 1W85A 4GNKA 1VA5A 4H1TA 2H1IA 1TM7E 2VDMB 4IJUA 4KIJA 3M0EA 1H3EA 1CEXA 4G0PA 4RY2A 1AO0A 2XBUA 4D8TA 1T13A 1HOTA 1Z2NX 1DKQA 4P2GA 4FJ2A 1EP9A 2H18A 1NRJB 3OY7A 1CPYA 3TR6A 1QQAA 4YP9A 4FFSA 1LCIA 4PZLA 4RJJA 2A7QA 1PEAA 4Z4HA 5EIOA 4JBXA 2DX7A 1D2GA 1H65A 1QFZA 3HJHA 4XSGA 3T0FA 1MORA 2QTLA 4AYTA 4TYQA 5E7JA 1FFCA 4YJFA 1LY1A 3L43A 3ZLTA 5IDQA 2FRDA 1RHJA 3HB5X 1GNTA 2FWRA 4IIJF 3ITDA 2H4XA 3EPPA 1QE3A 2W11A 4N49A 3DDWA 1TU0A 2O59A 1MR3F 1C1XB 5CURA 1KK1A 4XQ0A 3NLLA 1NKSA 3NHPA 1D0VA 2EKBA 4GEKA 4NYMR 3PEYA 1TKBA 4DPMA 4B87A 3E9ZA 1RRKA 2C1EA 2XW6A 2Y6VA 3IJ5A 3IQHX 1Y0BA 2HO5A 2QTRA 3NYRA 1TK2A 5IKEA 2EZTA 2BW0A 4J6FA 5H82A 3SF0A 4C3UA 4PYJA 3MCVA 1CVRA 3PBKA 2I9PA 5C8YF 4EA6A 2OHOA 1YRHA 3AXSA 5DYGA 1OAKA 3TXAA 2OZVA 2ZT5A 2CDNA 3THWB 1DQZA 3K9CA 3W4KA 4N0DA 2VJCA 4HZUB 4ZICA 1J0EA 2JJQA 2ZRDA 5DT2A 5DBEX 3BFPA 1LRJA 3THOA 3TS1A 4US1R 1W5BA 2FK8A 4EJSB 3AXTA 3TX2A 2P4EA 3QPDA 4C4RA 3I58A 4G9GA 3JWIA 2VPXA 5JFTA 4FHEA 3ACDA 5CD1A 3PCRB 1F12A 2Q8PA 3M6XA 3K5WA 1HRKA 2F90A 3D6UA 2D0IA 2OV8A 3CB4A 3D6HA 3OQOA 4CN9A 2XCIA 2MINB 1YASA 3IT2A 1B0AA 1MAWA 4F56A 5JCXA 3R6WA 2OAGA 3CRRA 4LRWA 1CUZA 3V1KA 1YZHA 1ZM3A 3HA7A 3QXSA 3LHKA 5I4IA 4F9EA 2XCLA 2F8SA 4FGWA 1GM5A 1IZYA 1A96A 4P4TA 2J3QA 3Q7QA 1VKOA 3LD9A 3UGKA 3OOYA 5IM5A 3NVDA 1NHGA 1IPHA 4QDZA 5LBTA 2NSDA 2HJGA 1PHPA 3HHEA 1XELA 3T5BA 3I09A 3RJ5A 1PG2A 2QL5A 1TFUA 3GLGB 3V8EA 1MIOA 2GQ0A 1YMUA 3BMNB 3DXXA 5B3AA 2XWBF 2HMUA 4D46A 3OCWA 4DLZA 1RRFA 1VYTA 3CXUA 3W9SA 1HH4A 1HK7A 3DOUA 1PT9A 1DWOA 4JP5A 4BGEA 2Z4RA 1QUEA 2NACA 3DP9A 4HQNA 2NPFA 2BUCA 3FCUB 1YONA 1YQWA 4YR7A 1IBCA 1J8VA 1M2KA 3ZXXA 1YJQA 3PA6A 3O2NA 4LYYA 4R1OA 4B45A 2QYHA 3AG6A 1Z28A 2E3JA 3OMWA 4HOYA 2X8BA 4IG9A 1J21A 2JJ2A 2P5TB 3IHLA 1ARZA 1VPEA 2QQ5A 3FLEA 4M36A 1A82A 1K08A 1G3UA 4OHUA 5KAPA 3BGSA 1KZHA 4YONB 3NOXA 4LXXA 2CCGA 1XZCA 3GFQA 3EJ6A 4MTLA 4O33A 3AR2A 1TVEA 3O8BA 2ZI4A 4P36A 2RJOA 3NIGB 4BP3A 3HN7A 4BU0A 2NUBA 4MH0R 3UMSA 3IIKA 2REQA 2IV3A 3S68A 3GZJA 2PWPA 3QFCA 4BGVA 4EW2A 3R9IA 1PJAA 3X2SA 1A69A 1HQCA 1KMQA 3O8CA 4LFAB 4OLFA 3ZDZB 1FFDA 1U2ZA 4DV0B 2PT6A 4JJKA 4NK4A 1V95A 3AUFA 3LK6A 2FLKA 3NX4A 1OT3A 4YJHB 1N5JA 2A9RA 4KWHA 3DE4X 1RWKA 2EFGA 3RIYA 1UPXA 3UMFA 4V03A 2NZ2A 1G8AA 3R6LA 4U9HS 1X94A 1JWAB 3ZHZA 1KP3A 2W22A 1U8CB 2XUJA 1JQ3A 4PW0A 2W6PA 1Y5NA 3QKRA 3AZPA 4D9JA 4G4SP 1JTFA 5I7VA 3SYKA 4RPJA 1FRZA 4XARA 2PQ2A 4M0EA 4BZQA 1BCRB 5KNLA 1KBQA 3ZHTA 1TO1E 3IMCA 3F4KA 3R76A 3KLBA 1GGEA 1F20A 3G68A 4L76A 3MMSA 3MXTA 4ZALA 2C5AA 3KYBA 2FSUA 2G4CA 2OKGA 3Q11A 4HAYA 4C3VA 3S8EA 2PKWA 5EN4A 3BKWA 1Y5RA 2C57A 1Z07A 2CXRA 3D8HA 3P9QA 2WE8A 2IOFA 1TC2A 2YIDA 4OHKA 1QH0A 1AUPA 1GG2A 4KXLA 4UCWA 2LR0A 4AO6A 2M2IA 2ZYVX 2JLSA 4YNBA 4OGKA 4C03A 3C6XA 4ZA2A 2I76A 3DEHA 5CP8A 5A3VA 3UYKA 4DSZA 1NUTA 1NQOA 4KREA 3O26A 3TJMA 5HTKA 4MVXA 3STUA 3IBYA 4L73A 1UMBA 3PQ8A 5AVZA 4Y6GB 2CXNA 3PDWA 4CUZA 3DWIA 1UUFA 2FRVA 3RYHA 3CEJA 3N8DA 4E13A 2FP4A 4IDPA 4NQZA 3IBFA 4MP6A 4NZZA 3FVRA 4M1ZA 3LRXA 2O4CA 5IXSA 5KQSA 1NQWA 5JC1A 1WE2A 4TV9F 3BIOA 5FOSA 5AVRA 1HY3A 5EKXA 4HNGA 4UJ5A 2PMKA 3GIDA 1NHWA 3TOCA 1GILA 5G4KB 3DH0A 5DHAA 1YZLA 3LHIA 2ZBFA 4CMAA 4TT3A 1TM2A 2C2YA 2Z2IA 2ZUUA 4BUCA 1Z15A 3EY9A 2ZDHA 2HF2A 5EZ5A 2CXSA 3JTEA 3ORYA 3QK7A 1SVIA 4Z99A 3R7AA 3EUWA 2GNOA 2YJGA 2YWBA 4M87A 5AM4A 4D43A 2FW6A 3UGQA 3RO7A 2BJVA 1TCVA 1TJPB 2AZTA 1GA4A 2HK8A 4MUKA 4QU5A 1B8NA 2GT1A 4B6JA 1QUFA 4X7PA 1EHYA 3JV7A 4I9GA 2INGX 3OTQA 5F35A 2E5FA 3AB3A 3EISA 1XPUA 1TX4B 1ZGZA 2ZSUA 2HHAA 1RKVA 4OY3A 5EJ6A 3UAWA 2RHDA 1Q7RA 1KO7A 4LPSA 2O8EB 1DARA 3O38A 4MQFA 2UYYA 1G20B 2W2VA 5B1IA 2PJRA 3K2IA 1D6SA 3HBMA 3KKPA 2A0WA 5DI9A 1NVVQ 1SCQA 3DZHA 2W70A 4BFWA 4MQFB 1VIYA 3MELA 4BFVA 1BVYF 1EHIA 3HMQA 1E1QA 2R751 3IEPA 2OFPA 1XPOA 2IH5A 4DRXA 6REQB 4QFMA 4CL3A 4IS3A 2G0TA 1RHQA 4WI1A 5TQ2A 5HZGA 5K4GA 4TTSA 3UB3A 2NU7B 1KO8A 4TTVA 3ZHUA 1QFXA 2FTKE 1MNQA 4E30A 4HAUA 1WD7A 4UHKA 4P84A 1II8B 1N78A 1J4AA 1P5RA 2KWIA 3T15A 4UTXA 2P9QA 3BDAA 5F7XA 3B6KA 1OFIA 2FDCA 4G07A 2G0NA 5EMJA 4Y18A 3W7AA 2M32A 4IGFA 1QOZA 1P6QA 4NSNA 5H59A 4BPRA 4LBYA 1KPHA 3ONDA 5D7BA 1V6CA 2AOTA 1ZY2A 5HXAA 1QRTA 4XW2A 2ZYDA 1MUUA 4L4UA 4DABA 1SU4A 4LJSA 4HFNA 5EZQA 3TQTA 3UENA 1M2VB 1NGSA 4RDIA 1Q0UA 3S2YA 3AI2A 2WIKA 3Q0EA 2NNWB 1PNTA 1I8TA 2PKQO 4RJ2A 2BM0A 4X84A 1CULC 2X9NA 5LA6B 1ISPA 3RS3A 2IHNA 2XNKA 1FA9A 3D6FA 3GAZA 4TMWA 1WUKS 2BUAA 3RSFA 3A1SA 4GMDA 1OH7A 1GGHA 1Q0QA 1J97A 2JARA 3FUVA 1W46A 3H6GA 3DBRB 5BW8A 2IY7A 3EXHA 2GN4A 3HA3A 2C2KA 2XJ9A 1MPXA 4ZRNA 1L7OA 3D1VA 3HK2A 1XVAA 1E69A 2FPPB 4EFMA 5AM1A 1L5OA 3VYTB 1GGVA 3WLKX 4J1TA 2CFTA 4EB3A 3AEUB 1T5LA 2FW0A 2IEBA 3RS7A 2LWIA 2H63A 2WV9A 2XY4A 1AGNA 1XRLA 3AJEA 3CX6A 1C4XA 3F5MA 4TN5A 4WEQA 1ETUA 5YASA 2AN1A 4A1OA 3K0HA 1PLLA 4KQCA 2Z3WA 1FL9A 4HLUC 4P93A 4S3MA 3ZZNA 2HNBA 3QEAZ 2CMKA 2YQ5A 2GB4A 4XJVA 5FWAA 3S2EA 3WLNA 3SWWA 3ICEA 1EP1B 4NXMB 1NUQA 2HHCA 1JHPA 1RM3A 4G41A 2HSGA 4GECA 1DX9A 1WLSA 2GHTA 3F49S 4RELA 4PX2A 4XXHA 1EJBA 2OUKA 3F6SA 3V1MA 1UJBA 1EX1A 4M8SA 3Q7TA 5CLFA 2HTFA 4LX8A 1T8WA 4ZAWA 2CLFB 4GLBA 4EENA 3U3DA 2FWMX 3JPYA 4L57A 4YREA 2E2WA 1GAQA 2XSZD 4FGSA 1IYZA 1C8KA 2RKOA 5TDHA 3U3ZA 3KSAC 3VPFA 2R66A 1JA1A 1QZTA 2YWHA 4JJGA 4Q34A 4DDUA 1P1KA 3R1IA 1KYTA 1RTTA 4IYJA 4YIHA 2W2TA 2OM6A 3P9NA 1IVYA 4KO1S 4OH7A 4N8SA 3RUIA 3DF9A 5E1BA 1UBRS 4MW6A 1Y6GA 4UU8A 1CQXA 4YRRA 4D9KA 4CUKA 2XDYA 2BY4A 1B74A 2UYHA 2QQFA 2I03A 1RZRD 2XBLA 3BFXA 4RJLA 1FP6A 2RG1A 5C35A 4NR0A 2AFHB 2WUDA 5IVKA 1D6MA 2C9YA 3GELA 2QR2A 1DC6A 3ZQJA 1ECBA 5DFAA 4ZVSA 3QEMA 4U8GA 2R60A 3SCZA 3TLEA 5CCXA 2GEVA 3AI1A 1FE8A 2YFYA 1WUTA 4IDGA 2BWJA 4DY6A 1VJDA 1UR5A 2HHHB 9MHTA 1W59A 3EF0A 2VJDA 3HGQA 4PM4A 4NG5A 3UCXA 4G5XA 1BKYA 4B84A 8ABPA 3QNWA 1DXYA 1UPBA 1D4FA 3CLRC 3R5JA 4XIIA 2Y92A 2Y0CA 4Q66C 1OX6A 1VL6A 1KFKB 3AL2A 2Z8ZA 2BHLA 4WJZA 1CY4A 2X9GA 3TTSA 2DR2A 3RVRA 4NXNB 1SUIA 4RENA 2ZE8A 3GUZA 4MVCA 5A4JA 2BV3A 3G59A 3VHLB 4C7JA 5EIEA 3CLHA 2VPZA 2FOLA 1M54A 3FTDA 3HBLA 1DRVA 3ZLJA 2FWBA 1CJKC 1JFRA 4QBHA 3F73A 3MFQA 1ZU4A 3G2LA 3PFWO 1U2TA 1E3IA 1VE9A 2CE7A 4DXHA 2DUUA 4Y6QA 3L8GA 3MOIA 1Y6JA 1ZH6A 4L5CA 3BZWA 4QJBA 4IJKA 1OLOA 2TS1A 5LZ8A 2GN8A 3ANSA 4KI7A 2ZIUB 4WLEA 2OGZA 1KMMA 4KYVA 4QSHA 4YALA 4BHTA 1B26A 5L3QB 1B16A 5LQAA 4FCWA 1ZDMA 2WG2A 5ENDA 4DREA 2PMDA 4ESHA 4J3FA 3C3YA 2DBRA 4QA9A 3GDHA 2ERXA 4WT7A 3D59A 1MKYA 5CLJA 5HRCA 3WL7A 4YWHA 3TLGB 4YDSA 5JPIA 2WJPA 1PWHA 2PKRA 1P45A 2ZCVA 3EDOA 3OIDA 3OTOB 4UNQA 1JL3A 3LYLA 2RH8A 1ORVA 3Q3JB 4RH3A 1R6DA 2O3QA 4LE1A 4X66B 1B73A 1OWPA 2QIOA 2VJBA 3HKDA 4FGJA 4WACA 3WWPA 2VQ3A 3C7TA 4LMPA 4JI5B 4XTCS 1OHHD 1VLVA 3OJXA 4OO3A 5J9FA 5KTNA 2FYTA 3AT1A 2ZQYA 3T3PB 5BXYA 3L18A 3LPCA 4I9HA 1HUQA 3BQNB 1X7XB 3DLTA 1XA4A 1FNSA 2HDHA 2JAOA 2IP2A 1K8ZB 5AKHA 2Q0HA 2JFVA 3HCOA 3LKBA 1OFUX 4RACA 1P9NA 2O7RA 2WFMA 5I9TA 4KVAA 2REXB 2X4IA 2LD4A 1E3SA 2A1TR 1LU9A 1NUHA 4QC2A 1MGOA 2XDAA 5EJ7A 3SHFA 2GK3A 2JA2A 3BK1A 2IYPA 2HMTA 1VSVA 4KQIA 4PAWA 2RGUA 4J7UA 1T5TA 4Q4LA 1NQ5A 4DT1B 4W5TA 3ZCQA 1Y6ZA 1JQAA 1QVWA 2DWPA 2FFAA 5E8RA 2GPAA 3A05A 3ZKWB 2OYCA 2BFMA 2LCIA 1GPH1 5EEHA 4AIRA 1NR7A 5A5EA 1OGYA 3FMVA 5C7LO 2I2CA 2CCKA 5DLPA 1MEJA 2G06A 1U8XX 2OO7A 2ZTVA 3ESAA 4AKIA 3EFOB 4PHHA 2HNAA 1KOFA 4N7BA 4TRMA 5HJ2A 1TAQA 1GPLA 1KI7A 2NZVG 3G2IA 3VC3A 4H7KA 1IXZA 1KFBB 3ZS8A 1N6IA 2K2WA 1O6BA 1X1DA 4BO9A 1CFJA 5TPZA 4LXUA 5JQWA 1TKRA 1P4HA 4TLCA 5CLGA 5LP6A 3TE6A 1ADCA 3DDNA 2OHIA 3A6FA 2POCA 3K8YA 3GW8A 1BXGB 1QH8B 3OICA 5E4TA 2YJ5A 3WL3A 2WWTA 1M6NA 3MAJA 5K0FA 1IONA 2QTBA 1M66A 4H0CA 4ER6A 3EZXA 1V39A 3T1NA 1K4MA 3EZ7A 1PD0A 3A6LA 3HA5A 3KLNA 3NKFA 2Q1YA 3R3ZA 4R2XA 4EHHA 4YUXA 4ZI7A 1KBOA 3KWFA 3N3AC 4L75A 4IBOA 4NCJA 5T64A 1AQNA 3H4TA 5AYVA 3A9CA 1YD7A 1AQ6A 3FTNA 2QN3A 4RLQA 5FYDA 1DDIA 4TLBA 5F1OA 1UBCA 5JSFA 1JDJA 2Z9CA 2DBYA 1F4LA 2I6TA 1T36B 2OQIA 4CEHB 5TGTA 4Y1RA 3LKVA 1ZVKA 4FMDF 4FKBA 5TGDA 2CZGA 2XCQA 5GZ1A 4BQOA 3V2UA 1NVVR 1BXGA 4Y9SA 2FZVA 3MTQA 3OG9A 2AD1A 1JPVA 3MCZA 5LLSA 4R2MA 3H04A 3WSTA 1T24A 3B3GA 3BMOA 4JUFA 4PG6A 1N7JA 3L06A 1RYYA 1X0VA 1WV1A 1JKJA 5KOIA 2CUNA 4FI3F 1L5HA 1HQYE 3D6VA 4OU4A 1T9CA 2M6SA 1NFRA 4J3JA 1C29B 1K6EA 3PD0A 1TJYA 4TVKA 4URZR 1YRQA 4DSNA 3IPCA 2EHDA 2FR8C 3PL5A 4LTMA 2KE5A 4QYXA 4V02A 2W83A 3B1JA 4EG1A 4URXR 4UNSA 5LMCA 4J0EA 2VQEB 4XWTA 1SBZA 3SQWA 1OYVA 1OTXA 2IXAA 4LYAA 5ESDA 2Z6VA 5J59A 4C78A 4JI7B 1PK7A 3PKJA 1T9GS 2PL5A 2R7NA 1EFPB 4LDZA 5K6TA 1PHRA 4JSTA 1KZ4A 4LJKA 5C52B 1T8YA 2E9SA 1IY2A 1D4OA 4CKYA 3R7WB 5JAHA 4QX6A 4H6WA 2BDTA 2FSGA 4GPAA 4M6WA 2O2HA 4H7EA 2H1SA 3VJLA 4ICIA 1YQGA 3TLBA 1FP2A 4X95A 2AXPA 3OIYA 1KFCB 5CAEA 2QLTA 2W6QA 1I5EA 3ROPA 5I9NA 2ZTUA 1E2FA 1WVGA 1NC1A 1MX3A 3ITNA 2ZJFA 1J5XA 4RMJA 2OYSA 2Z5VA 2QAIA 3DSRA 1ZI8A 1YVRA 3QWIA 4FNAA 5CYOA 4ZK6A 3ISTA 1TZ2A 2QRVB 3GMSA 3LP5A 4NJMB 3VV3A 1R0SA 3L0OA 4B3JA 5B2EA 2I4OA 2GNPA 3ZY2A 4XD7A 4RDHA 4B8WA 2EWVA 3RIHA 4OB8A 1KU0A 4I1YA 5J2TA 4GOOD 2XAUA 3JRXA 6CHYA 3QSYA 1JTEA 1U8AA 3DYVA 4GMXA 4Q05A 1GWNA 3M4XA 1Y42X 3FIJA 3QF7A 3W5AA 4LVNA 4PYNA 4UREA 1JR3E 2H2WA 3H5RA 1Q2UA 4EQ6A 4UUQA 4DMKA 3ZY4A 2FXIA 2QMHA 1XTSA 3DV2A 2MYPA 1E9AA 4UEWA 2FSPA 3BCRA 2VHWA 1ZUNA 3T9BA 4O08A 1GG5A 1P1JA 3NBMA 2WAAA 1ZN2A 1T8RA 1W29A 5DK4A 5G02A 2EARA 3ICVA 3WMRA 4YTEA 2BM1A 4INAA 1LW6E 1WCIB 4PAQA 1P5HA 2F8MA 1G7CA 2OZLB 2ZB4A 3ILVA 4BFYA 5J4LA 3OPNA 2GCOB 4IFIA 4NK5A 4O3MA 4FSDA 1K92A 3G7NA 4A9AA 3LX6A 4NYIQ 4R1PA 3SYNA 3K6SA 3L7AA 5IBPA 2QE6A 4BKOA 1LPOA 1TD9A 1DHRA 1FOEB 3N5KA 1SOUA 4M76B 2J30A 1UK6A 3GJ4A 3BWBA 1MLDA 3BD6A 3MRTA 3C87A 4JJ7A 3Q0TA 2ZREA 1C41A 4XASA 5DI3B 5DIZA 4Q6WA 1I4LD 1KO5A 1XCLA 3K31A 2I3BA 4FDLA 4PRYA 4H7DA 3T38A 4BFTA 4ZYXA 4HI0E 2OHJA 1AQLA 4JLJA 1V1RA 4W9NA 1LD3A 2BF7A 3OJ0A 3AP1A 2XUPA 1JHYA 1KAEA 3FMFA 2FQXA 4WVLA 2YVKA 2FW1A 3FLMA 4W5QA 4FDAA 2QJOA 1AQJA 1Z37A 4F4UA 4RSHA 4BV8A 1RQLA 3T9CA 3UTCA 2WFLB 1DQYA 3G89A 4W9MC 5AW5A 3DBVO 2A5JA 2FE1A 3O4VA 2D2XA 3JQAB 3QOWA 2HYDA 4KNWA 3UAVA 421PA 4DVJA 2JLYA 3BMCB 2OTCA 5DHSA 1R4MB 1QPZA 3Q7SA 4KK4A 2JIBA 4HBGA 3PYLA 3FGNA 4Q1AA 3TL3A 2X14A 1X80B 2YFKA 4JVMA 3GLVA 1UANA 5ADVA 1A8PA 1MT3A 4ZZ3A 2XRFA 3UWOA 3LUFA 3UG6A 1WXIA 3V4FA 3RWMB 2IYSA 2FQQA 3L7DA 4QAQA 4BVLA 4EJMA 2D1QA 1ZH4A 1L3IA 2IHBA 3FYCA 4EHKA 3O1LA 4IWNA 4B0PA 1GZVA 3HDJA 1XT6A 1NMEA 2AJLI 4LRQA 1B14A 1H4VB 3RS0A 2HY7A 4D3XA 1E2QA 4ZAXA 3UHJA 4IO0A 4PINA 1WULS 2H2IA 2ZB3A 3D81A 3QWAA 2GWHA 4IH4A 1GOTA 2NZJA 3ZX4A 4HJRA 4TS1A 4XRRA 4Y2UA 3QKSA 3L7CA 5AHWA 8GPBA 5K8UA 1JI0A 5H4HA 4N47A 4EHAA 2OV4A 1FX1A 2WHXA 3D4PA 3M34A 3MIZA 2H7CA 4V1CB 5TPWA 5I7HA 3FYSA 2RMKA 3OE5A 3EMVA 4NHOA 3AFGA 1AT1A 3CGWA 3HLKA 4BCCA 4MINA 4YRKA 1JG4A 1W1WA 2BFBB 5CX1B 1G19A 3KK0A 2ZBQA 3K4QA 3EWSA 1NVMB 4MEJA 1RWWA 1H2EA 3AZOA 4DV5B 2XWSA 3WAKA 1H4SA 1RQGA 3TQQA 2XCUA 3L6DA 3IPRA 5F1KA 1DCKA 3GQVA 4YMUA 4ETNA 3SIXA 1VCOA 4A2WA 1YHZA 3AR8A 2R87A 4NF2A 3V9AA 3OE7A 2ID4A 1SBTA 1GNPA 3QKSB 5J63A 1MFPA 1E96A 3AB7A 3LUPA 2PJZA 4EY6A 2IXDA 3SDZA 1Y7PA 3WMXA 4AJOA 1OIWA 5D87A 3EWIA 5HW0A 1FRVA 2NYAA 2UZIR 2I5PO 2ZSAA 4AY4A 2M6RA 2IBTA 5JD6A 1W4CA 5GJWC 1P7PA 3A6JA 2LGJA 1W93A 3TQCA 2HMVA 5IJ9A 3E22B 3U61B 2ETVA 1XCJA 1NWHA 2RAVA 4MVJE 2B0CA 1QVZA 2GO1A 3LBAA 2F55A 3KWLA 2Y1EA 3OECA 5KSPA 3A3YA 3NB0A 1NLMA 4LF5B 3EVBA 3QVKA 4M0LA 2HLNA 1P74A 2X4DA 5KTTA 1E1MA 2WHRA 1PGNA 1Q15A 3MJHA 4W7SA 5FUBA 5EC8A 3W04A 4CV3A 3DD5A 4TWBA 3TUZC 4X8OA 3JASB 3SXJA 4CKEA 3QKRB 4IZIA 5B1DA 4LG1A 1BEEA 3CH4B 4FZ5A 5DCYA 1W5SA 5F7OA 4YC7A 1C4OA 1GA6A 4N0MA 4ZVOA 3GJXC 4FFRA 4KE9A 2V0CA 5CDUA 1E58A 1KJQA 2IDKA 1F6WA 3AIKA 3G5AA 4HQ0A 5JMPA 1Z6TA 3AQ4A 4PYRA 1C50A 1RACA 4URVR 2QD5A 4RZHA 1VJRA 3W77A 4ZAZA 4GX0A 5HDQA 5E6RB 3NV9A 1R2QA 3IBGA 4R0NA 3ER9A 3T5CA 2QAGA 3VISA 4ND7A 1RAGA 2O57A 4B7UA 1E3EA 1BD4A 4B9EA 1Y33E 2Z0MA 4BO4A 4L28A 4YB8A 3UXHA 4BMNA 2YMLA 4RXTA 4UNIA 5FQNA 1U9IC 3FGPA 4DEXA 5ERGB 3HVRA 1WU7A 1JG2A 2EJUA 2EZUA 1FDUA 2VRCA 4NBKA 3SX4A 4QNMA 4DXDA 4HNRA 4N9QA 5FJJA 3B85A 1XTBA 3FNEA 1I7NA 4FT2A 1R6UA 3P27A 1MW9X 3VHXA 1NAIA 1Z4IA 4C0XA 1TCCA 3KAPA 4UEKA 4C5AA 3I9OA 5TT1A 1ZD2P 1X8XA 3LPMA 4K9RA 4KGXA 5IJ0B 1A4UA 1PLJA 2GSDA 2ST1A 3DCIA 3OURA 1KNXA 1QQTA 4J0DA 4KIGA 4PEVA 4R9UC 5G3YA 4ABYA 3G6KA 4YRAA 5SICE 4BWGA 3WGZA 4K26A 4N7RA 1Y4SA 4A6EA 3AVVA 1W35A 4XCQA 1VP9A 4AYXA 3PF9A 2WDZA 4ZEXA 4MWSA 1TKAA 1ST3A 1Y8QA 4LI0A 2Y1KA 3CT6A 2CF5A 4ZIRB 3HG7A 5CITA 5IBCA 5ALJA 3KQLA 1AY0A 1TK3A 3L8FA 3PLNA 2WJZB 2F2TA 2JIRA 2HDNB 3ETJA 3V8BA 4NE2A 1DTSA 3UMRA 2GSWA 3JVUA 3SFZA 2ZYGA 4DJTA 2AG8A 3JQAA 2G1PA 1I51A 3CNEA 2Q62A 4JITA 2JDID 3RSQA 1AGYA 2EW8A 3L0CA 2IS1A 1QRDA 4O2AB 1M10A 3ZJ4A 1ABEA 4C22A 3E2PA 4G84A 4K05A 4P08A 4ZYZA 2P3QA 3N0RA 1XTJA 2APJA 2P6UA 4C4AA 1ZKMA 4U2EA 3UMYA 2AMJA 1O0BA 1FSFA 2GJ9A 2WKWA 4JP2A 1ONPA 2PPVA 1J2TA 1LK0A 1C30A 1UCFA 4O4IF 1LQUA 1XL0A 3L01A 5DYNA 3MCWA 2Y67A 1R9NA 2Z83A 1OXMA 1RXUA 1JYSA 2AXQA 2O06A 1IDOA 2W2LD 3IB3A 3L82B 5HPYB 1C30B 3NBUA 5ICMA 4DGSA 1VBFA 2YRFA 4QXOA 5ELLA 2WHPB 1VC2A 5EWMA 1SHKA 4MWDA 5J5CA 4BRSA 1RADA 1NW5A 1X7ZA 2EW1A 4NMHA 2H4ZA 4RM2A 3GXOA 4ZRDA 5AP9A 4F5WA 5IWCA 4R1LA 3EBLA 2Y4OA 2GPNA 3BTOA 1XMOB 2D6FA 3VNRA 4B6RA 2WW8A 1G9SA 3URMA 5TNXA 1PGQA 3ERCA 5L6LB 3KX2A 4L6AA 4Z4EA 3G5LA 4KGVA 5FUXA 5I8WA 2K4MA 3FUUA 3IE0A 4FLMA 5BN4B 1ADFA 1H0RA 4JEIA 2B5OA 3NWOA 4ZT7A 5TE9A 4KR2A 4ZN6A 2H85A 3KS9A 3P9RA 1INLA 2C2BA 4LJ8A 2XADA 1U6KA 3M6FA 5LC1A 4H1WA 4Y2XA 2HWXA 3PFHA 2JJ1D 3LZDA 5JLAA 1ZR4A 4NDAA 1SXPA 1DO0A 5T7BA 1OWNA 2AFIB 4DQUA 5KYGA 1D8TA 1XB2A 2ZYSA 2OCYC 1ILWA 3FOZA 1TO2E 3SLKA 1NWCA 4BJ3A 2X6TA 4PWZA 3F2VA 1XDBA 3HJCA 4B3DA 1KZYC 2OECA 4O4LA 3OZ7A 3N2YA 3PWZA 4P4SB 4P1ZA 4ISCA 4G09A 3ZUPA 1E4YA 1WNTA 2C2MA 2JLWA 2A1TS 1H9AA 1XF1A 4ZC1A 3GT0A 4I36A 3IP9A 4Q37A 2VSQA 1QQ6A 2Q9AA 3HJRA 3I9KA 4HVAA 2QMQA 2B8NA 3HRIA 4OHRA 3NIDB 3ZV4A 1FQKA 4BFLA 4EI2A 1ETHA 5FBQB 1UMDA 3P0IA 3TO5A 4LSZA 1KRHA 4I19A 4WD3A 2PD3A 2O48X 1RMQA 2NVBA 3QXCA 2WJVA 3NT5A 3TAXA 1JTVA 4FK8A 4N01A 4GWKA 1FY2A 1M67A 1C3OB 2E4ZA 1PZHA 3N0WA 3FCAA 1B15A 2N46A 2E4YA 2XLBA 3V4LA 5CB8A 4FUQA 2YWCA 2I0FA 4E70A 5JSZA 5HRUA 1JLLB 2X4LA 3NHMA 4FBLA 1HNXB 4I0WB 2QW8A 1NF9A 3U26A 2GARA 3Q85A 3LXMA 1H0KA 3PEEA 5AHXA 1JEAA 5L3VA 2GM4A 1XLUA 3HM2A 4ER7A 6GPBA 3LVRE 2JH9A 2Z2JA 3DS8A 5ARCA 2H2AA 4EJFA 1JLHA 1QSGA 4URUR 1PX2A 2AC7A 3GXBA 3NAZA 2GTIA 4MR7B 4ZT6A 5GV8A 3U62A 1P2BA 1OB2A 4K9QA 4DR4B 2B7CA 4MITA 1A04A 4DANA 4M9UA 1I5OA 3IUPA 2L69A 4P82A 5CUQA 4NCBA 4NVRA 3PRHA 2HT1A 3EXFA 4HPXB 3B5IA 4JT9A 4YBRA 1U1CA 3WNZA 4F2DA 1NPDA 2CF6A 2YWJA 2FX5A 4KWIA 3QLTA 5I48A 3G2JA 4HH1A 5K3DA 3N2ZB 2X3FA 4I66A 4L7QA 4EIWA 5KNDH 3RF7A 4JXJA 2VQDA 5I4BA 3ZWXA 3TGPA 1YE3A 3TLCA 3L1VA 4W9NC 2FPKA 2DRIA 4P83A 5E0KB 1SCKA 5EMLA 2EIXA 5HIJA 4BLQA 2ICAA 4M99A 4DNXA 4D74A 3A3OA 1YR2A 4HBZA 4BLOA 4E5YA 3LWZA 4RIIA 3TR0A