1BZYA

Human hgprtase with transition state inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
214
structure length
214
Chain Sequence
SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A structure of human hypoxanthine-guanine phosphoribosyltransferase in complex with a transition-state analog inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphoribosyltransferase
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
total genus 70
structure length 214
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 1998-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bzyA00
4MB6A 1GPH1 3GEPA 1ECJA 1UFRA 1D6NA 2AEEA 5BSKA 2EHJA 1XTUA 3M3HA 3ACCA 1DKRA 4PAWA 3HVUA 2JKZA 3MJDA 1A97A 1IBSA 1AO0A 5HIAA 4ZFNA 1TC2A 3O7MA 3H83A 5ESWA 4QYIB 4RAQA 1LH0A 1O57A 1ZN8A 5BQOA 4LZAA 4LZNA 2H07A 4RADA 2H08A 2PS1A 1XZNA 1Y0BA 4RHTA 1G2PA 1ZN9A 3GGCA 4RACA 1QK4A 2PRYA 1I13A 2JI4A 4P81A 1NONA 1ECGA 4JLSA 1PZMA 1Z7GA 3DAHA 3LPNA 4M0UA 5KAPA 4RAOA 4LZOA 1UPUA 1P4AA 1J7JA 1VDMA 1BZYA 1O5OA 4P83A 4PFQA 2H06A 2DY0A 1ECBA 1OPRA 4RHXA 5ESXA 1I5EA 4JITA 1G9SA 4QRIA 4RHUA 1XTVA 2WNSA 5K51A 3NAGA 1QK5A 1L1QA 3EFHA 2GEBA 1DBRA 1CJBA 5BQPA 4TWBA 1DKUA 1QK3A 1YFZA 3ACBA 1QCDA 3GGJA 1I0IA 1A4XA 1JLRA 4LYYA 3G6WA 4RQAA 1ZN7A 4S2UA 5IPFA 2IGBA 4X45A 4P84A 4RV4A 1DQNA 3DEZA 3N2LA 1MZVA 1QCCA 3LRTA 5BRNA 3ACDA 1R3UA 3S5JA 3KB8A 2HCRA 4P86A 2C4KA 1OREA 4FYMA 5HKLA 4Z1OA 1P17A 3MBIA 4F8EA 5E38A 1DQPA 1L1RA 4P3KA 3DMPA 4RABA 1XZ8A 4P80A 1ECCA 4QYIA 5KAMA 1NULA 1UPFA 1XTTA 5IAOA 4RQBA 1JLSA 2FXVA 2VFAA 2JBHA 5JV5A 3OZGA 1G9TA 1P18A 4OHCA 1A95A 4M0PA 4LYGA 4RHYA 1GRVA 3OZFA 2XBUA 4RANA 4P82A 3QW4B 1V9SA 4WMLA 5JSQA 1G2QA 1I0LA 4M0KA 1A96A 1A98A 1U9ZA 1STOA 1W30A 1FSGA 1VSTA 2E55A 1WD5A 1BD3A 1QB8A 2P1ZA 1HMPA 1U9YA 1VCHA 4X44A 3OHPA 1P19A 2JKYA 2PRZA 1OROA 5EUCA 1A3CA 4KN6A 1BD4A 1QB7A 4WN3A 4IJQA 2YZKA 1TC1A 1ECFA 1I14A 1HGXA
chains in the Genus database with same CATH superfamily
1GL7A 2FW1A 4PGAA 3IAS6 2FMUA 2HLNA 1Y8ZA 1JEEA 1XAIA 1X7GA 1R00A 3NBFA 1MOQA 1NURA 3I2IA 1KZ6A 3E58A 3F2IA 1HE1C 3DC7A 2Z8YA 3KAQA 1DI0A 3KC2A 1W0JD 4NPHA 3W6OA 1P4RA 4NFHA 3AIIA 2EC5A 4P7BA 3WK4A 5DCLA 2WB4A 1NLUA 3BH0A 3ZIDA 4O33A 5PGMA 4KBFA 3CG0A 3DM5A 3HWWA 5JWOA 4X6LA 5F77A 4GLFA 1UJ4A 2DT5A 3O03A 1N8NA 2O8FB 1LQUA 3FDIA 4YT2A 2OXEA 1QGDA 3ZYCA 4RJ2A 4L5IA 1NQ5A 4RVCA 2BGJA 4WJLA 2R1VA 2IXDA 1HDXA 4UBIA 3DZBA 2ZI5A 4M38A 4MPRA 5CBKA 4ZDWA 3AHIA 3QFTA 4MGKR 3I92A 1BCRB 5LQAA 1P8AA 1ZBDA 4NOKA 2HPAA 2ZYDA 5DNUA 2C99A 1A5SB 4QZVA 1E9VA 3O2SB 1AK9A 1THZA 2H4JA 4HBGA 4LYEA 1K7XB 3A2LA 1DWPA 2VEDA 4LYDA 1NG9A 1AF4A 3E7DA 2JH3A 1DAGA 3LT0A 3IAUA 5B57C 2UZIR 2QF7A 3ZS8A 3VKGA 3OAAA 4R01A 2JIBA 4WFQA 5KYUA 4Y0NA 4KG7A 1PL6A 4QDZA 5BV8A 2XZOA 2J85A 2VP3A 3S2YA 4DLNA 1E99A 1E5TA 2C9ZA 5BWCA 4BNDB 1DQRA 4MVJG 5HMLA 1OWLA 4XJTA 2PH3A 1FYFA 1P5ZB 5CYPA 5GAJA 3AR5A 2GUGA 2PBFA 1VPWA 4DMMA 1KBQA 4GKKB 5BOSA 1RCUA 2ZTUA 3U4GA 1YONA 4WZAE 2ZJ0A 1R4MA 2R62A 1LDGA 3DEZA 4TWRA 2AC4A 1KK3A 3GRKA 3RYFA 1Q83A 1QIKA 1E2BA 3P9IA 4UOQA 5TR9A 2X4IA 4RVNA 3S7ZA 4OA8A 4D9EA 4YAOA 1PR5A 4ZVQA 1P4SA 1RR6A 1OA0A 3FAKA 2EG9A 2VP9A 3REQA 2HYIC 3SR0A 1PV2A 1MRSA 3EBOA 3PPXA 4C7XA 4KR6A 4PCUA 4ZAGA 3W2TA 1PDWA 4OM7A 2BKVA 1XTBA 3QXHA 4JT8A 4BY9E 1QE3A 1VJTA 2D00A 3AP1A 4LV8B 3BDIA 3IT1A 5ICGA 1I4WA 1EHYA 2PIAA 5CA1F 3ZKAA 4YP6A 1EWQA 3GVXA 4QTUB 2DERA 3L18A 3V42A 2ZTMA 1ZHOA 1FTWA 2PUJA 5H70A 1OKKA 2WKPA 3X1JA 1YS1X 2WZCA 1DIRA 3L0DA 4YT5A 2WWRA 3LSTA 4L0MA 1W36D 4CGZA 2ODEA 2ZI6A 4N9QA 1E20A 1KJWA 4L0DA 1RT9A 4BBAA 1SQGA 2YS6A 3K8YA 3U09A 3DL2A 1J5PA 3UUWA 1P0IA 2QUJA 4KWTA 1BDMA 2JFVA 1XNGA 2IYEA 4R6XA 3H2ZA 5C53B 2A35A 4KREA 3QF4B 2BJWA 4TS1A 2WYOA 1KQPA 2YTZA 4U2GA 3OPQA 1EI9A 4KAAA 3RRBA 4AF8A 4EGAA 4EVIA 1EM8B 3CRZA 5JS7A 4ZK6A 2E4AA 3DYIA 2DBZA 3QVXA 1JAHA 1TCCA 3U7QB 1WCXA 1XXHE 4I1RA 3IBGA 3A6LA 2G9QA 3J7TA 3PFKA 1PL0A 1U3CA 1ZD5A 2EJUA 2IIBA 3NTXA 3O8NA 1L5VA 2XNJA 4RCZA 1MT0A 4C7BA 2XPCA 4EIWA 3N2KB 3TMKA 1S2MA 2VCEA 4QQFA 5KVQA 4X7MA 2W2OA 3GXBA 3I3OA 4LXGA 3EY4A 1XZIA 1R0CA 1EWKA 3JYPA 2Q9BA 4OOEA 1CS4C 4J0EA 3WOVA 2XKAA 5FPTA 3FFBA 3PPVA 4I3HA 4DV1B 2WB2A 3VSDA 3G9ZA 3I6BA 4IW3B 3NU1A 1TT7A 2QRKA 4QUJA 5CGQB 3SC2A 2A0FA 3L8DA 3HCFA 4JDUA 5F2OA 5TQ0B 5HQJA 1V2GA 2H2DA 3DDWA 3N76A 4BZQA 3GGDA 4GMDA 4KXXA 4B8WA 4FMPA 4BQOA 3VBCA 3DCYA 2WT4A 1NJ5A 1JEQB 4NYIR 4N0MA 4ZEMA 3C39A 1W0JA 3GHHA 3JVEA 3L9XA 3RIGA 1TM7E 3WJ2A 2QV0A 3HCPA 1JIXA 4FNOA 1RYEA 3IP8A 2WM2A 1VLZA 4KFUA 4GE3A 4C01A 3LQ4A 1VCMA 2E4UA 2VJNA 2WUEA 2VUUA 1X80A 4XSGA 4JMLA 5LZ7A 4OUDB 1U0GA 3W4JA 1LDEA 1M6VB 2BMEA 1YAJA 1I7LA 3W1WA 1S8NA 1QG0A 1Z4QA 3Q85A 4R8MA 3P2IA 5BSHA 5JC8A 3HDQA 1ZICA 2KSQA 1K92A 1KARA 4PZAA 1XZFA 2BKXA 1UMBA 2HPHA 2IOHA 1WF3A 2OQIA 4Y2TA 3WLMA 5ESRA 4B3GA 8LDHA 3EZFA 2AC7A 1PFVA 2Q99A 1MJGA 2P9QA 3GB9A 1KJJA 1V47A 4KH0A 4M1SA 4EKEA 5LP6A 2C9DA 2PKQP 4RQAA 1P0PA 1HDCA 2P1RA 4ENQA 5C46F 1B00A 1YWGO 2AG8A 3KR9A 1QTNA 3TBKA 4YV0A 3U0VA 1VG9B 4E11A 1IDN1 4Q7JB 4UNSA 1YZYA 3IAHA 2HCRA 1NATA 4XCQA 3O5AA 2CZCA 3MYRA 3W5HA 3N70A 5A62A 1B76A 1YQGA 3CNEA 3BGOS 4MVJF 1UODA 3AUKA 4X1KA 3DZJA 3K0CA 1H65A 4KOAA 3OH8A 4KOEC 1ABFA 3FYSA 1NVEA 2YZMA 2AXQA 1M8FA 4QBHA 3TPFA 1CDDA 4JP5A 1C3VA 1UC5B 1NAIA 4IIBA 1H22A 3RG8A 2OD9A 5LR6A 3B12A 4EPWA 5I8PA 1QCZA 4LOHA 1CJCA 2O7VA 2R8BA 2VK1A 2IV3A 2NUPB 1OBOA 2QU7A 1ENPA 3H16A 3CT4A 4ZI5A 1JVBA 4N65A 4K1XA 4A91A 5IFLA 4PQGA 3A06A 1A2KC 3WL4A 1B3RA 4KIJA 2AXNA 1DBPA 1ZD2P 3GW8A 3WNDA 1CNEA 3WQHA 4BTEA 4C3ZA 1IZYA 3L8FA 1A98A 1IHPA 3IAXA 3JZDA 5YASA 5J4YA 5THKA 4CNQA 3UM9A 1YDGA 5AVUA 3KZKA 1VCHA 3IL2A 2EW1A 1H9BA 2OPHA 1W5BA 1RXWA 2E5FA 3QX8A 4XFKA 2O3QA 5LOVF 2J45A 4KGXA 4G3XA 5DTJA 1G0NA 2E9SA 2BMDA 3F9RA 2O5RA 4Q15A 4P4NA 4K0RA 1H1LA 1OBHA 1CUUA 1JHMA 2DPMA 2OG2A 4H7FA 1E6UA 4B4KA 1X14A 5ALKA 1JLLB 3FGOA 2ECQA 3CU5A 4HJXA 3DMNA 2HPZA 1ZW1A 1S2OA 1USGA 3LT5A 1NW6A 1PEAA 3SYRA 4A6DA 3HH8A 5TEWA 1Y6FA 4C29A 1P7PA 3A10A 1L2TA 2QGZA 4RDCA 3RJTA 1FTQA 1K7CA 1IU9A 4NBKA 1FOEB 2FGKA 3AUYA 3C3KA 1GY8A 2Q3DA 1EUCB 2HPVA 4N6NA 4A2CA 2WU3A 3JWJA 5K0NA 3EDYA 3CRRA 1DRJA 5KREA 4OI0A 3F6YA 3BWEA 1M1ZA 3ZV4A 1M6WA 3VYUB 1ESCA 2H08A 2JHFA 3PPIA 3QQ5A 3HADA 5AR1A 4M9ZA 1G6HA 3KZNA 1QP8A 3RKUA 1C7QA 1EX6A 2VT7A 1VSQA 4E3ZA 4K9PA 3WMFA 2OFOA 3OEWA 2MYPA 3B78A 3D0KA 3A1CA 3ICPA 3CRQA 4YTEA 5F7OA 2ODBA 4FW9A 4HUQA 4R2WA 1QUFA 1GZ5A 1XQWA 4M7PA 5LP6B 1UK7A 1G19A 3MPOA 4KAJA 5HCUA 1PYGA 4Z53A 1SOAA 1FVHA 4B32A 1YIDA 3AOEA 2Y3IA 3EPRA 3IR6A 3K2EA 2W6OA 2YZGA 5EMMA 2V9CA 4P34A 3SEZA 1YH3A 3DL0A 3JVUA 4MV0A 3AUTA 4QOSA 1F0KA 4WK2B 4ZAZA 5CFLA 2CT8A 1S3GA 1DKQA 1I3MA 2GJAA 1R0LA 1NJ6A 3L1JA 2WG0A 1O9GA 1KVQA 2R68A 2EQAA 5JH7F 3IMKA 3RODA 4EBBA 2AXPA 3TIXB 2FP4A 3HSSA 4B3TB 2BM8A 1PWEA 3AY6A 4G1BA 3FSRA 5F3RA 3LY7A 4PFSA 1I0IA 1RQRA 2GBCA 4L51A 4TYMA 4XWYA 4WT7A 5BQ3A 4CMEA 9ABPA 1JHQA 3JYHA 2F59A 3V34A 3B51X 1WXIA 4K88A 1V26A 3V7WA 3WIVA 3ZWCA 3T7JA 4P84A 3LUFA 4TUYA 4LXUA 4WESA 5FKJA 4K2HA 5HDBB 3SF8B 4PC7A 3ZNOA 5L4NA 3EK2A 5EJMA 2SICE 3GJ5A 4C4TA 2PCLA 2R8XA 4FYXA 3FDZA 4YA6A 1J0BA 4W5NA 2EF1A 3DD5A 4ZT5A 4JENA 4Q47A 1KMIY 1ZVVA 1BG6A 1MRNA 3AESB 3H1FA 1NY5A 1ORTA 1CEEA 3KWMA 1BS2A 5EKXA 4OMUA 4WBXC 1RYFA 1RAGA 4UBNA 2A4MA 3CNLA 3T99A 2VPXA 1MCZA 3BICA 3PIDA 1UZLA 3G88A 2V7XA 2Z1DA 3ZHUA 2IH4A 5KX5B 1ZI6A 1KGSA 3CF0A 2JW5A 4H60A 1QYCA 5GIOE 3UA3A 1TU3A 1CTQA 2VTBB 1A4UA 1IZ7A 4LDZA 3IBCA 3PWTA 2WTXA 3BK7A 4HCJA 3VOBA 3ZK7A 1W5EA 3MMZA 4QLAA 5H80A 4BUZA 4DA6A 4QPCA 2PH7A 3OWHA 3WB2A 1UXHA 2Z3WA 1Z0AA 3ITEA 4K9RA 4WJKB 4P22A 4QYWA 2I2DA 4YGXB 4BZXA 3JD0A 4KR0A 721PA 3QX9A 1RYZA 1P9RA 5LUAA 2ZYRA 6ABPA 1PYOA 3W2FA 2EAUA 1R9GA 2GCOB 1ZX1A 2PGIA 3FHJA 2VYVA 5C0OE 1ONOA 1OROA 1MEJA 1U7DA 2FSGA 2WHXA 3ILXA 3EVEA 1TJ4A 2VDQB 1M34E 1AKQA 3B7PA 1FTSA 3G9QA 5KUTA 1E6CA 1VB3A 2O3RA 1SBIA 2HX1A 4Q1BA 4YMGA 2XBLA 1NZDA 1U2SA 3P9CA 1KI3A 2WTUA 1T1GA 4EELA 1EVKA 4BEBA 3KCQA 1YRWA 3WGQA 1MXHA 4B46A 4AXBA 1UANA 2BFWA 3WGVA 4J43A 1ZYUA 1SB8A 2PKCA 1DRUA 1APBA 1AUPA 3THRA 4OVKA 2N42A 3LPCA 4UDOA 3F3YA 3F74A 1F3OA 2ZIUB 3GRVA 3VOTA 3BT7A 2PD4A 3PJEA 1ULTA 2W6CX 3LLSA 4N7MA 5DSTA 2Z3VA 1LRJA 1J0EA 1OXVA 1TL7C 4MV8A 2NWQA 1H69A 5AXDA 1RAFA 4M8NE 4C89A 2YDXA 1C3XA 2QM7A 5DBGA 4M3NA 4ISCA 5EJFA 1Q92A 2J3KA 3NHBA 2JFUA 2SECE 3NJ4A 1YJCA 1GG2A 2AJDA 4WY8A 1FP4B 3TSOA 2OVFA 1B8VA 2ZR7A 1T4CB 3PHLA 1POXA 2CUKA 3G85A 4DLSA 3DZHA 1JSXA 3JYNA 3L07A 5A3VA 3A6JA 4ZZ3A 2Y05A 2QTVA 4DMFA 2AZDA 4KMSA 3VV2A 3K05A 1VMDA 5F1YA 1DXQA 1IUPA 1PD0A 2Q8PA 2ZVPX 3DE7X 3VNQA 3DKVA 4HOYA 4BNWA 5JNWA 4GOND 3QVLA 5EXEA 3V4OA 3SHOA 3NUGA 2RSLA 2NU6A 5T57A 3WYBA 2NX2A 5A4JA 2OE2A 5A4DA 4K9QA 4A8HA 5BUSA 4J3JA 4D41A 3WX0A 3EB9A 4EYEA 2ZU0C 4QVGA 1P4GA 3KE8A 1HQYE 4ZVKA 4DSOA 2EKBA 4OMDA 1ZVJA 4EG0A 2VTBA 3DT9A 2AKEA 2YHUA 3QVSA 4RZXA 1N2EA 1ZISA 3O4HA 4JX9A 3E2PA 1GKIA 3FI9A 1XAHA 2E7ZA 2H17A 3HP7A 1F4LA 3OD1A 4H3SA 4I66A 5SZIA 4RSHA 3OPNA 3S1AB 5DT9A 4IL5A 3C45A 4AU1A 5JAMA 2QXUA 3HZZA 3ZGOA 4BPBA 2H1FA 2HCTA 3IKVA 4HDRB 4PAOA 5KAMA 1UPFA 3MRVA 1Y3AA 1J09A 4WBNF 1FY2A 3EJWA 5AVQA 3K6SA 4PLZA 3V9PA 3T4PA 3AEKB 3U44B 3OMLA 2C82A 3D4NA 3VYTB 4C78A 4WK4B 1IWOA 4N6GA 1C2TA 1UJ2A 3WZLA 4S05A 2YN2A 5IEJA 1YB4A 3KAKA 3GYBA 2ZRQA 5IJ9B 3G0HA 1PGNA 4ZDJA 4TLBA 1MB4A 5TS2A 3WGYA 3T7KA 2RCNA 1SC6A 2B2NA 3DM9B 4GYWA 4MTCA 4X62B 1RP7A 1USVA 5LN1A 3L0IB 1KJQA 1TA4A 4F11A 1K5GA 1UK8A 2NPIA 2SHKA 3BB3A 2M6LA 1LJ8A 3TLEA 4RJTA 1H4TA 1RC8A 5EJ4A 3ZZTA 1OXSC 1RWVA 2J5KA 4JLMA 1NV8A 4F56A 3KPJA 1S89A 3MBOA 1Q1BA 2JCSA 1JG1A 2XECA 3AQIA 4G89A 1QMPA 3WDSA 4BNKA 5JUWA 2XCUA 3H4TA 1LPPA 3ZOKA 3ZU2A 4FHCA 4CCYA 5AM2A 2RG7A 3PHBE 2QSUA 4INJA 3PFCA 4EKIA 1TQ6A 1Z4JA 2Q1UA 1BE8A 1DT3A 3MLAA 5ALMA 2BTQA 2PMKA 1ODJA 4MVJI 4YCNA 4KWIA 3TLGA 3NRBA 4OQXA 3PJGA 3IRVA 1WZEA 5ILQA 4UFPA 1QGUA 3OPYA 1R6VA 5HRAA 4A5SA 1K97A 4HDQB 4JROA 1HDGO 3SJBA 5I45A 2QA5A 4PQRA 3WXBA 2GEVA 3AZQA 3PL5A 1ZNZA 4C4XA 3RW9A 3Q72A 3DEAA 3TJZA 1HEUA 5KNCD 3BORA 3L6UA 5EOVA 4C4RA 4OV6B 1FFHA 4OI2A 4XIYA 1IIRA 1D9XA 4MUNA 4LF9B 3A6KA 1NW5A 1L5RA 3B6JA 3EUFA 3VSEA 5BMVF 2YXBA 4KLCA 1GA4A 1G8JA 1JEYB 3WE7A 3NTLA 4C0HA 2NSJA 5SYMA 2WFZA 3C5CA 4FVTA 4PRLA 7YASA 4OB6A 1GZVA 1M0TA 1XEWY 3HZRA 1OYVA 3BTVA 4LSWA 2AUTA 3OZRA 4GBJA 2J6IA 4HUQB 4JGIA 4K28A 3S68A 3ZWDA 3NLLA 2P6MA 5ITZB 1B15A 3SMVA 4N0PA 4A03A 2XYPA 3HJHA 4GMXA 5IS2A 4DFDA 3F6SA 4ENWA 1HMYA 3KQHA 3P52A 5EKTA 1FDIA 2QB5A 1D4OA 3SYTA 4HDMB 2V58A 2IUEA 3MTIA 4V0OA 4WCVA 4C6TA 1L5HB 4MR7A 1H85A 3DO8A 5JMTA 4KR9A 3ZHXA 5JMOA 2G4VA 1NXVA 1JDTA 4UNIA 4AZ0A 5KPDA 4CDNA 3MGKA 4B3DA 4LOJA 5L4LA 1TMYA 3QKRB 3MGBA 4EPVA 2R44A 5JS2A 2DJ5A 3K72B 4F9EA 3R23A 1F4VA 2F4VB 5ALYA 5F1OA 1DAMA 3OFKA 4PPFA 1MPTA 3A1TA 4RLFA 4FYJA 3VOAA 3GQVA 1CJKC 1I3CA 3BJIC 1CULC 5CBPA 2RONA 1JXQA 1TLLA 1F17A 1GGKA 2PUVA 1ZXXA 2XTNA 3CXUA 3DNFA 3KQVA 4X3OA 5DDIP 4ER7A 4F2GA 4EHAA 1TQHA 4Q3KA 3QEKA 1YFKA 4GHWA 1CEXA 1P39A 4Q0MA 3NEYA 3WNQA 4AJEA 1N6LA 3WICA 4GL2A 1JR3A 3RKSA 2I2XB 2I87A 3RVLA 1CUSA 5K3DA 3TQFA 1XZQA 2OGTA 1LNSA 2V7GA 2YZ7A 3GJZA 3QLJA 4EUEA 4UTOA 4QJ3A 2F9FA 1HLPA 4KPFC 3C8ZA 1XVUA 4LTMA 5DI9A 2A84A 4E5SA 1H4VB 1HL7A 1WDLA 1O95C 3E61A 3Q11A 5JAUA 3FNGA 3L7IA 3OWXA 4CCYB 1P4HA 2PHZA 3C3EA 2YWXA 4MRRA 4N5DA 2XBUA 2G06A 1XJCA 3VYVA 2C7QA 2IYYA 4K26A 1KZ1A 4M0KA 4X90A 4XYMA 5F7XA 3ZXXA 1FW6A 4Z7JA 3KOOA 3G0BA 4BDSA 2ST1A 3F4KA 4Q66C 5D6OA 4F7WA 3MFYA 5KYWB 1EWTA 3Q10A 2R65A 1XO1A 1PL8A 2YHIA 3P9XA 4G2NA 1BXRB 2QY9A 2XI4A 3CSDA 2WWWA 3GU3A 3SY8A 3RVDA 4S04A 4OREX 4E21A 2BFFA 3RTAA 2BMAA 3SX4A 4BXOA 1TB4A 1AJEA 3E5RA 5JCJD 1W8DA 4EHBA 5FPPA 1R8XA 5KQSA 1DHTA 3MG9A 5EERA 5TLSA 2V6GA 4E5DA 1X1DA 3ORFA 5C1PA 4CL2A 3RJZA 2CBXA 2CLLB 3R8XA 5C8YA 3H1AA 3VZCA 4DSAA 3OCCA 3BMCB 2IVZA 2QN1A 1SELA 1VJRA 4LHWA 3TPZA 1BFDA 1Q20A 1TQ8A 1OJ7A 1YCFA 1MOSA 2ZYUX 4P4SA 4WK0B 5EXTA 3RYTC 5JJKA 5DYWA 2SBTA 2JCGA 4JT4A 3IEMA 3EXEA 4KO2S 3O4FA 2VHCA 2I4IA 4UC0A 3QG5A 4UW9A 3IB6A 1V2HE 4C6TB 3LPMA 1MJNA 1QCYA 2QW8A 2BMJA 1QVAA 1PTJA 2GVZC 2DF8A 5C5IA 4MLPA 5KNDA 1X8XA 3Q6MA 5CYOA 1L7VC 1FDRA 3PGA1 4BKRA 3AKEA 2GTIA 3L6OO 4IKOA 1NF8A 4EGFA 5LZ8A 4EHDA 1G9XA 1OC2A 2P11A 4TVOA 1EJBA 3OMWA 4ZTUB 2XTJA 5JEDA 5BWOA 4BL5A 4G1UC 5HKAA 1JPJA 5KTPA 3S81A 5ECWA 3VYRB 3FTCA 4TWIA 4KXFB 3EG9A 3TSZA 4AIIA 3ZVKA 1EK6A 1HT3A 2DFTA 3VU8A 5BN1A 3EBLA 1IWBB 1ECBA 1IONA 4PHHA 5KVAA 2J0QA 4MLCA 1SULA 1PR6A 1ZK3A 3LP6A 5E0OA 1FVOA 4CMAA 2AA3A 3E7FA 2LP4Y 3R3ZA 4RE6A 3BCHA 1G18A 4A26A 2FHSA 1UPTA 4WZAB 1E18A 4DEVA 2HA0A 4B76A 4ZYZA 1PP4A 1N6PA 4UVHA 1ECPA 1G17A 1LK0A 1ML3A 2RKBA 4PFJA 3HCBA 5CTJA 1JLRA 2H2GA 3G5LA 1FMTA 3F6EX 1WO8A 4IDDA 4X92A 2FPGB 2P2ZA 1C0LA 4C03A 2PE5A 3AHGA 4J1TC 1H4SA 4JUAA 1MZVA 2FDRA 1ZM4A 4ICIA 3DBOB 5FR2A 1RJGA 1D6SA 2J6CA 2FG5A 3IV9A 4GD3Q 4MA5A 4EM6A 4Z4CA 3A6FA 1E3WB 1W5SA 3F4BA 3K9GA 3L40A 2A59A 3NC0C 1SY7A 3A1EA 1EFCA 2YC4C 1M67A 4MDHA 5B7PA 1D2CA 1USWA 5AVKA 4BFYA 5KIAA 3BK1A 3E9EA 2PL1A 2AN9A 2QL9A 5F64A 3H99A 1IN6A 1DHRA 4LRQA 3WHKA 1GUDA 1I8TA 4ZQCB 4EG8A 3A4NA 1ES9A 4GR9A 4Q16A 5ECGC 4FIDA 3W78A 4JGGA 1P73A 2PS0A 3A1SA 1NXWA 3H9BA 3OQOA 1JBEA 3TOCA 3AVWA 1A2OA 2XCQA 1IM5A 2V7VA 3L5OA 4KYTA 2WFLA 2XLCA 4AO6A 3QLUA 2O3UA 2R7KA 1F0YA 1QDUA 1T3TA 3CLUC 4RK6A 5CVEA 4RTQA 1BC5A 1ECLA 2I1VB 2QYSA 3ZGYA 3A6PC 4QREA 5AESA 3LL4A 2HTFA 4LHZA 1VLLA 2JLAA 1RADA 4MOWA 2Q8QA 4BCDA 4DTIA 3HJFA 4YMLA 3SS7X 3HXQA 5ALOA 4LK3A 1CUIA 3G7SA 3B82A 1XCPA 3JQ8A 1N25A 3L7NA 1W5AA 2AR9A 4QECA 2YZKA 3J81A 1JQAA 4MQFB 2VHYA 5J2TF 2LCQA 2PQ0A 4B7UA 2CNOA 2NXCA 2REOA 3Q5DA 1C9NA 1NG1A 1WSDA 3KLNA 4NR0A 2VH1A 4R7ZA 4KUHA 3SBEA 5J2TA 4MUMA 3K9HA 3LUHA 4BLRA 4AJLA 2XB9A 1T2EA 1Z7BA 2IY9A 3FE2A 2JKZA 3OLQA 1TK3A 2G1UA 1RKUA 3PDIB 3HJNA 4FYIA 4B4UA 2ZIAA 1IPHA 3D02A 2F00A 3AEXA 1XMXA 3GJSA 2OR3A 3FNFA 4QICA 3ZLBA 4NU5A 4O4JB 3H5LA 1GAWA 3LFTA 5CG2A 4CL3A 2MOKA 3DL7A 4MI1A 4Q3CA 3BAFA 1E3LA 5IAAA 3NKVA 1NRJB 1XZLA 2MSWA 3QE4A 1E3MA 4FGLA 3COVA 4L5YA 4CF4A 3F4LA 1US8B 4CMJA 1P1FA 1Z75A 3IEKA 3BWBA 2WD7A 4CMHA 1I2BA 2ZVJA 1GZUA 4BN0A 2COUA 4JELA 5FNVA 1EVQA 2JI4A 4NS4A 1O95D 4Q3OA 4RD0A 5FUBA 5HSGA 5CCBA 4BRSA 3KOZA 4ZVUA 2HA4A 3VDMA 2Q1WA 1LRKA 2Y0EA 1XRNA 1D2GA 2Q5EA 2A9PA 1EVLA 1FP2A 2QR3A 4GOJA 5C7IO 3PPWA 1LLQA 5AQ1A 4XWAA 2W0MA 5CVJA 2VNAA 4GLLA 2OEPA 3QMPA 4B82A 1WKBA 4BGEA 4C2BA 4Z6KA 4IRMA 2ZUCA 4JITA 4YECA 2QL5A 2WQZA 3P0IA 3QUSA 5CJJA 1USUA 4AVYA 2E1RA 3AVOA 1BXGA 3RS2A 3ER9A 2PVSA 1ZK0A 4GI5A 2OV1A 3EFHA 3QLUC 4P93A 1X1SA 3BDAA 1JE0A 5ICSA 4GX5A 3NPAA 4OXKA 3ZYZA 1MU0A 2H1OA 4WCFC 4G41A 4N0QA 2O0MA 3UJBA 2Q7DA 2EERA 1MJHA 4J0JA 5G40A 2AW3A 1NBMA 2VRBA 3OQVA 5B2EA 3L41A 4YP1A 3NORA 4L78A 5K3AA 2BTEA 3DHEA 4IHAA 2P27A 3U2QA 2Z1MA 3K1TA 2OXTA 2O1XA 2ZM6B 3V8MA 3WWPA 3WNCA 4OIFA 4BVGA 5EIAA 1CPYA 2H00A 4Y9SA 5TEVA 4TS9A 4RPLA 1HI9A 1PVDA 1L5MA 4NATA 5FAKA 4L07A 3NIFB 4NMXB 4TSFD 2ZYSA 1AGPA 3F3MA 5E6SB 2NVUB 1P77A 4NH4A 1JDSA 1R5OA 4QFCA 2PY6A 1TA0A 1NULA 2H5EA 5HGXA 2CVQA 5IT5A 2YWFA 1KP2A 1QM5A 1U7WA 2D2IA 2XMSA 4MPPA 5CX1A 3QUTA 2JFBA 3A1FA 2VDWB 5KSYA 4XQGA 2Y1GA 2JHCA 4K6KA 5LA6F 5I7WA 5KYGA 1U5BB 4IIEA 4O5AA 4V03A 3QW4B 4IUYA 5DN6A 4WNIA 4COOA 2BEKA 3WWOA 3WOHA 5CFRA 4HMQA 5JTUA 3C3YA 4DF3A 1BW9B 4FFOA 2B4RO 4D42A 2ID8A 3GP5A 1SXQA 1C7ZA 1KQGA 1VE7A 2XYGA 1CR2A 1AOXA 1E7RA 4HDOB 3WK5A 5LMCA 2GHQA 4AW9A 2AHRA 2RBKA 1HT0A 2Q27A 3H0KA 5ICFA 4YRPA 1QG6A 2GF9A 3RVPA 2OLKA 3NUZA 3UCFA 4CG2A 3CO0S 2ZUUA 1TO1E 1N1MA 3QMVA 4C0XA 4JXZA 2YASA 4G09A 3B5JA 3UHAA 1JAXA 3INNA 3UPUA 2XOXA 1QV9A 2HA6A 3IUSA 3DB1A 3RYHB 2AEEA 3JQ7B 1SA0A 4P3OA 4UASA 1LLDA 1WL8A 1PW7A 1WPRA 2AOTA 3TW8B 3PUJA 3WKEA 3G82C 1Y5LA 3EUWA 3PVZA 4C9BA 3PC3A 4LBZA 1KRHA 2VJYA 1T1JA 1B93A 2GCEA 2YV5A 3EQ6A 3FGNA 3WYAA 5JAOA 1KIFA 4YC7A 5AI8A 5BNFA 3AY0A 5F3WB 2YJNA 1RBMA 2VUTA 3I8OA 4U9IS 1A04A 2TECE 2H54A 1K88A 3W3AD 3MN1A 1YKSA 4IFIA 3SVZA 1UZAA 1AVTA 3DYBA 4U2CA 3VSCA 2ENUA 4C0JA 3ZVRA 1KS2A 4HEA1 1BWQA 5LXTF 5C18A 1UMKA 1U5AA 2B83A 2C3MA 2AHOA 2CXUA 4UARA 4Z54A 2BUCA 4D46A 3QY0A 4K6MA 3EGXB 2BELA 2YR0A 2PRYA 3MAGA 1KDYA 2O7RA 3H2KA 4LUCA 4HLUA 3RSCA 4CVNA 5I7AA 4I55A 2RHBA 1ZUWA 5AHOA 1G6Q1 2IGTA 2H8GA 3AEUB 1ZI8A 4FHZA 1WRBA 1YKGA 2Y1KA 1XRQA 5G53C 3ZCTA 2EX4A 4YR9A 2P5TB 4F72A 1MX5A 3P0EA 4X1YA 3V5NA 5TARA 4R05A 3I37X 5KCZA 5C80A 2WKSA 4ERNA 4IOLA 5LOVB 4YLEA 5JO0A 4RMGA 2IDMA 1J70A 3A1DA 2X2FA 1QK5A 3LHSA 3ZK8A 4W5QA 1PJZA 2IZ5A 2NQ8A 2QGNA 2BHRA 3STTA 2YUTA 3P9NA 4UD2A 3TTTA 1DX9A 1Y9JA 2PH1A 2Y1EA 4G67A 3I1YA 1AS2A 2CC2A 2WRZA 4IDFA 3RAJA 3FYHA 3H9QA 4JYCA 4RWEA 4EPXA 1G7TA 3LZCA 2OFWA 2PZAA 3FVRA 5HVNA 2YZ2A 4OJKA 1SOUA 4M0MA 4XVUA 2P4UA 2VO1A 3KUDA 2VQFB 2C8JA 3Q7SA 3ZVMA 3WIDA 4URYR 4EW1A 1YR6A 2J7PD 3PNYA 4BKQA 3DEIA 4PXSA 1OXXK 2NZ2A 4KV7A 1ISSA 2XXAA 1BDJA 2Z6VA 2JVKA 4LWZA 5AVJA 2AFHA 3HY4A 1SUIA 4F12A 5IX8A 5KYXA 3GLFA 3GCGA 4GSLA 4S2EA 2BDTA 2RDMA 2M32A 1D03A 2OK8A 2OUIA 1ZH4A 4GP9A 4MI3A 1MG0A 1VJCA 3KT0A 2RH8A 4I9UA 3DVAB 2ATVA 1SCUA 2CDAA 1IUOA 5KI6A 4UVDA 5DHAA 4A2WA 4F5DA 5B5SA 5CFPA 2IS4A 2LUOA 3C48A 5ITSA 4DEYA 1G8PA 1A9PA 2OSBA 4HYTA 3G2JA 4OP2A 4A6XA 5BQXA 4CTOA 4BNVA 3JYOA 2OO7A 3JW8A 4O4JF 5CIQA 2PPLA 5ADWA 4B6EA 2FX2A 3ZD8A 1TXGA 4AS2A 1XN1A 2A8YA 4OQMA 4ALIA 2V7PA 1GU7A 3JQ8B 1AN9A 2OBLA 3FRIA 3M6MD 3RUPA 4F0JA 1W2WB 1PX0A 2E49A 1OWNA 1GXSB 2HCFA 3G7NA 2XKJE 3ZGZA 1U0TA 3D8NA 2DUJA 4TKZA 3HO6A 3WV4A 5GADl 4X95A 1IRXA 1TECE 3OD5A 3PQFA 4V0SA 1IPFA 2OKCA 2H5LA 5J4HA 3QE2A 1SM4A 2PCJA 5KVVA 2IITA 3ORQA 4GP7A 4OBEA 4ZP1A 4LRYA 3M8KA 3MJTA 3RUHA 4U7DA 1DLJA 3PFWO 1I6LA 2OT3B 5A02A 4IY1A 7MDHA 4OQEA 1L7BA 3EGXA 3GDHA 4ZYVA 3EDQA 2FXIA 4NOMA 4MQEA 2EZUA 3Q7TA 3DAFA 4ZO4A 4XZ3A 5EEGA 1L7EA 4QYIB 3DOEA 4MYTA 1Y5RA 3N86A 4DR5B 2Q9AA 1A8QA 5HFJA 1SEVA 3V4VB 3RC1A 5BQOA 4I4TF 1S4MA 4QSHA 2O3JA 3DH0A 1CJSA 3FMFA 2QZZA 4WW0A 1R9NA 3FYTA 2WWIA 3CLTD 4FXPA 2V54A 4R5HA 4D9MA 2Z6AA 2DYKA 4DSZA 2BTOA 3EH1A 1FDWA 2IZ0A 5HBGA 2ZRDA 1HLFA 1RKXA 4LGYA 1G4HA 1IJKA 5EY5B 2ZRGA 4MW7A 1JEDA 3L4EA 1VXRA 2ATXA 2ATIA 4EG3A 5JNLA 2PZGA 3KKMA 1D5WA 3MT7A 4KFSA 3NMUF 3C3BA 3Q12A 1V7ZA 3IEVA 2AFIB 3VPBA 4RE5A 3IUPA 1DAFA 4ABTA 3WYGA 1XXHA 1LJUA 3ZDEA 2NQTA 2DULA 7ADHA 1AO0A 3B6IA 1TCBA 1O2DA 3IE1A 4NICA 1CLUA 4CIAA 3GVCA 1YZQA 4L8FA 4EEZA 3HCNA 1XZEA 2C3OA 3D9QX 1L5OA 3QH4A 4LJ4A 4DKJA 1AQIA 3SX0A 1E1NA 4MUKA 2P75A 5EKUA 2MSEB 5FR1A 5TY0A 5CMLA 4P0TA 3WB0A 2R1ZA 3A04A 1L5SA 2QVCA 1TYEB 4B3BA 1QO9A 3KDPA 4LFCB 3CC8A 2DHDA 3IOBA 1FU7A 3PP8A 4Q1EA 3R09A 1ODKA 4PE5B 3VR2A 1NQXA 4ALKA 2GZAA 2WTMA 4FZVA 4DJEC 3MWGA 2UYHA 8GPBA 2GAAA 2ZSBA 5IT9A 4UCWA 3IQXA 4YWHA 4BVKA 3Q8XB 4HDAA 3DLHA 3OP4A 4EHLA 3CZRA 3GLQA 3ZE9A 2JGJA 4H27A 3LQFA 3X1YA 3ZXIA 2DUNA 3TLXA 3MUOA 2CHFA 2OCBA 3PC4A 4P80A 4X00A 4YJGB 1M9NA 2VPPA 4D8UA 1PQUA 2AQ8A 4RLHA 4K9LA 3TUIC 2RAPA 1H9AA 4H15A 3VO8A 2O1WA 2WJPA 4DY6A 2VDWA 4M88A 3HYCA 1E0KA 1SIBE 2KI5A 3OESA 3G02A 3ZWOA 5FLXA 1NUUA 1Z0KA 2GPSA 4Q7MB 2ZRBA 4RDHA 4BNNA 5B64A 2PBZA 1IM8A 3MJHA 3NBMA 1L4KA 2X13A 2Z8YM 4X9XA 1IMOA 2W71A 4BWGA 4HT3B 2VP4A 5I7SA 2IPMA 2OB1A 4FM9A 4CDGA 3HP4A 4JVSB 2WTAA 3ZWXA 4AIRA 3LHKA 1F2UB 1JJFA 1M6EX 1QF6A 4WECA 4I9NA 4LJRA 1AIPA 3NNDA 1R0RE 1R4NA 1P6UA 2G9ZA 3JQFC 4FFWA 4HEJA 4IZOA 4RMHA 4X8MA 4XVCA 1XP5A 2F2TA 4WUVA 4EI7A 4QLBA 1XJWA 1ZUNA 1CR6A 3GOQA 2NSDA 3AWIA 4WHMA 3BMQA 5IARA 6REQB 2ZBFA 3O26A 1NXXA 5AHWA 2FR0A 3RYHA 1U3FA 5IM4F 3H0EA 4Q3NA 4XARA 2DQ4A 3ISVA 1JMKC 3DE1X 8AT1A 2V0GA 1JFRA 1YU6A 3DP7A 1RJ9B 5J5AA 3WP1B 2FPPA 3NKFA 4L73A 2WKWA 4PHFA 2X4LA 3KFXA 4XDYA 5LXTB 4PCAA 3D7LA 1Z62A 5A7GA 2FX5A 5AD1A 1XTRA 4JODA 2O59A 3P0FA 3O7MA 3GEBA 3ET5A 2ZW9A 3KOYA 2ATCA 1WNTA 2W8BB 3ASYA 4JUCA 3H86A 4P98A 3HUEA 5ICCA 1T2VA 2I8AA 3UHJA 3BD9A 1D0SA 1SUAA 4PINA 1FTNA 1WZNA 2OESA 3TBFA 4WRRA 1ZD8A 2QWXA 3X44A 2NP6A 5FA6A 1NRXA 3UWKA 4UHEA 2EWMA 4Q7QA 2NYUA 3FYCA 4FP9A 4G5GA 3W8EA 1SBTA 1ILWA 2IBMA 2N3ZA 1IY2A 3KE9A 5JRJA 2IRWA 5AKXA 4RGYA 4BRWA 1BVHA 3KYBA 4W4TA 4DYVA 3KR1A 1IBMB 3IOCA 2K5UA 3UAGA 5JXGA 4GRIA 1T9AA 4H1WA 1RAEA 3LDAA 1TUGA 1TA9A 1D3AA 4EECA 2QKYA 4QNNA 5KWJA 2R60A 4HQFA 1T9GR 1C1YA 3DL4A 3NNSA 4E5NA 4GGMX 2O2YA 4GPBA 1PTJC 4JYBA 3ZGVA 1Q3TA 5H3LA 4R2JA 1JV2B 2Q45A 2ZBEA 3DYVA 1K7FB 4C4ZA 3ZW9A 2QORA 3TQQA 4REOA 4GVPA 1A9YA 4II3A 4RTLA 3E35A 3JATA 1JAIA 3CSUA 3AR3A 5E4JA 4GX0A 6ADHA 5P8WA 1W4BA 1ORHA 3KK0A 4IJ6A 2PU5A 1ZIPA 1J0DA 1CR0A 1ZOOA 2QVXX 2R6AA 3ON5A 2FUKA 5FI0B 4F2HA 4IO1A 5J4KA 4NU8X 3ZHCA 3UAYA 1U9JA 5EJEA 2BR4A 1K7SN 1ESDA 2E82A 4IXDA 3S4YA 3AY7A 2GJSA 2JCBA 4OLBA 2JFYA 1IZ0A 1H1TA 1SAYA 2IXBA 1BSVA 1CZHA 1PJ3A 2ORYA 3ICWA 3NAMA 4HDKA 3CV3A 3LCVB 2C2HA 3SIXA 1X7YA 5H4HA 4PWYA 4ZAXA 1O0CA 3G0DA 2GMWA 3QIAA 1N6NA 4HQOA 4W8HA 3R7WA 3OQJA 1M34B 1PDOA 2AWOA 4AWBA 2ORVA 3JAMA 3BZWA 3B3GA 3FOAA 5TGDA 2ZWAA 2FFAA 1Z2NX 1C1XB 3OHSX 4MK4A 1KQOA 2LXNA 5H1YA 2HRZA 5TQVA 2UUAB 4CRWB 4MUGA 2YWGA 3VH3A 2OP1A 1QVRA 5A03A 5CD1A 2UVPB 4CLHA 1S0UA 1PTKA 4W6ZA 4FC6A 4XX1A 5DXJA 4I5GA 4HXFB 1PHPA 1UBSB 4ZVSA 4M8IA 3PHGA 3STYA 3DTVB 1JAZA 2WF9A 3UMBA 2TRSB 1N1GA 4D3XA 1RM3A 1J06A 3AB7A 2GRAA 3EZ6A 3ZH2A 4XFJA 2V0NA 5T8KC 1CIJA 1DC7A 1T2UA 3IVAA 3HYTA 2CNWA 3ZJUA 1BN7A 2E0IA 2HRRA 2IOYA 2Q4TA 2ZUSA 2DX7A 5AM1A 3SHQA 4CLRA 1OH7A 2VAVA 5IK2D 2CVPA 1F2TB 2B25A 1JMVA 3Q6IA 2EL9A 1H6BA 2IS6A 2IK8A 4KDCA 5F7JA 2WT9A 4Y18A 1JA9A 4XSHA 4RCYA 4PV7A 4LEIA 3FDXA 1GGNA 1NVDA 4JA0A 4MPDA 3SCZA 5LQNA 3FKSD 4LRTB 2YJ4A 1F8FA 1V5IA 4I2NA 2OORC 4MS1B 1RI1A 1EP3B 1Z5UA 1H6CA 2TS1A 1PG5A 3FLEA 3MM4A 3OLZA 4W5WA 5E8JA 5A4FS 1NVWQ 5J2UF 5BV0A 1H8HA 4KWEA 1RKBA 2P9BA 4G5FA 2W11A 4NENB 5TX7A 3I0MA 2WE8A 1YJXA 3QEOA 5IDYA 3WRYC 4E7OA 2ZUDA 3C7KA 3C4JA 3OJLA 5F23A 4ZMSA 4MUFA 3MGAA 3R7BA 3OU7A 5BPHA 3LBYA 1WE2A 3G7UA 5ED4A 2YBDA 1A0OA 3V4RA 3EXG2 1ZM2A 2HU5A 1AQYA 2ZUBA 3Q3VA 4TV9F 5DHSA 5B3JA 3WMXA 2GXAA 4TZ6A 4X8LA 5H9WA 2X5NA 4Z8YA 5EIHA 4KQCA 3JAKA 1N6OA 3B9RA 3M9LA 4FSHA 2HA2A 2AW5A 5DYTA 5FD8A 5CEFA 4BO6A 1EFAA 4DAOA 4DQXA 2ZJOA 1LF5A 3NBAA 5CCDA 3ZDRA 3EGCA 3HA5A 3OJXA 1GTRA 1SVWA 3FWYA 1QNFA 4FGUA 3SQLA 3HGTA 3GMSA 3U1BA 1G4UR 3NHKA 2QQ0A 3RVJA 1YZUA 1KEWA 1ZSVA 2ERXA 1KY3A 3I1IA 2GF0A 4J0DA 2C58A 3DBLA 5BT8A 1OI7A 4M53A 3FUXA 3KHUA 2AYYA 1N2ZA 2FUCA 5BVHB 3IDSA 3MTEA 3GLGB 1RRCA 2IC5A 1Q0HA 1FUIA 1UFVA 1NU8A 4B44A 1C8LA 3TUJC 1ISHA 3R5SA 4QXAA 5EIEA 2HV9A 2CCKA 3KFLA 1DKUA 3I6MA 4G23A 3BG5A 1JR3D 2EV9A 3UV7A 3I61A 4IZHA 2PZKA 3TQHA 4ZO6A 5EVJA 3TVDA 3D3KA 3QFRA 2BF4A 4YUXA 3WYDA 4Y67A 1J2YA 1ADGA 3CLKA 3F3SA 5AUNB 4AKHA 4P3NA 1QOPB 3H18A 3O8OA 4E5VA 1VXOA 3OZEA 4LRXA 3SZOA 4J7AA 5JJLA 4UUQA 2OO3A 5TV2A 2C84A 4KIWA 1DQPA 1XK6A 4DA8A 1VKOA 2DBRA 2H8KA 2PXAA 1WBDA 5IULC 1SFRA 1CYEA 1GPNA 4UBKA 5A5FA 2REXB 2LW7A 4D4GA 4ZCLA 4HNTA 3VHXA 1T2FA 4JQSA 2ZJ2A 4R1LA 2BRUC 4FMBB 5IAOA 3NM4A 1LBSA 3DC2A 5TB5A 4L6AA 1JQEA 4W7HA 1BKSB 2NO5A 5FTMA 4CFSA 1K27A 2JHPA 4Y30A 1YCDA 1XAJA 4PYNA 2ESRA 4UHFA 3L1KA 1WCYA 3OM0A 4HTFA 5DLYA 2JGAA 3SS8A 4J4BA 4OXRA 4HVCA 2E5WA 2OAP1 3I9LA 3AJ9A 3EGWA 1KYTA 5LA6A 1BDHA 5AW0A 1M2HA 1JR4A 3KJZA 1YO6A 3KL2A 2CW5A 3D3QA 2ZJBA 1BD3A 4JP1A 2VAXA 1G42A 1GL9B 4IO0A 4AZVA 2CL7X 3AF1A 3CINA 3J81k 2MCFA 1U04A 2DETA 2XHZA 2X1MA 4BLWA 1FFDA 1F7VA 2IX9A 2FEOA 2RGUA 1QH8A 4R0NA 1VE3A 4XGQA 6REQA 1E2FA 1U7ZA 5EJ6A 1RDFA 2A1IA 1EUDB 2IH2A 1RC0A 5DN9A 3GEPA 3SSMA 2FSFA 4RA9B 3T7IA 1XZAA 3UK7A 2F1RA 3G2PA 4CLEA 1RHJA 4ZQFA 4GKVA 3N3BC 1WZUA 3FR8A 4CV3A 1NA5A 1ZCBA 2PJRA 3R7NA 5DSXA 2Y1FA 4JEMA 2DWCA 3K6JA 2DUMA 5B4UA 5ESWA 5JY1A 1X7XB 2PSSA 1N5DA 1QHGA 4RMNA 1JIUA 1NBWB 4A0FA 3I9MA 4WKNA 2ZR8A 2VF2A 3K4QA 4Z7QB 1ZN8A 4PG7A 5FA8A 1YIAA 2HRBA 3O8BA 1KI1A 3BJMA 1PDVA 4D9NA 2JJ8A 1F5NA 3TS1A 1T4GA 3R3SA 2EX1A 1EXNA 421PA 4BV8A 3E5NA 1OLXB 2BMFA 4JVMA 2JLBA 2ON6A 2WG2A 3AUAA 3A4TA 3M0EA 3P9RA 4G5XA 1G7CA 4FFLA 4QARA 3LNTA 3T3MB 2ZE6A 2PEZA 3DHVA 4FGKA 1DRVA 3ZZMA 4Y6PA 3ZIUA 3RRXA 3WGJA 4Z4EA 4EWLA 1QHYA 3EGDB 4YUVA 4CCWA 3DT6A 3VO1A 4E4TA 4U39A 4KGDA 1VP9A 1PQYA 4O4IB 3KEOA 4EQZA 1YJ8A 5DGCA 3JZFA 3NEAA 2DFKB 1W94A 2M1ZA 3OFSA 1VRVA 1Q12A 2CLDX 1JSLA 1SB9A 4LG1A 3LO5A 3DUWA 3EH2A 4JBGA 5CH8A 3B6MA 5AW3A 3V00A 2FZVA 1P31A 4IHJB 3C6ZA 4LJKA 1YZ3A 2CCGA 3RVBA 5DCWA 2FUG1 1GFIA 3LGSA 2VEOA 4JEUA 2FMXA 4FFNA 2IZ7A 4K9DA 2XVAA 4R51A 1TT5A 5G0UA 2A2ZA 1YFZA 2CLIB 4TQGA 4EBFA 3VNRA 3ZDBA 3SQXA 4KHZA 3FHOA 1SKAA 1AUXA 4IX1A 1R4ZA 1P2FA 3A7DA 1MQ8B 3G6WA 3K9WA 4TGLA 4W6QA 6CHYA 4PSKA 4FOSA 4RV4A 3ZW8A 1FPQA 4Q4HB 4Y7CA 3Q3EA 4NZNA 4PZZA 3P1JA 3LVRE 5IPFA 3CBQA 4HTFB 4LQDA 4NZYA 5EPOA 1XZMA 1SD1A 2YXLA 3M70A 4YV7A 2HQOA 2VWPA 5KS2A 2E18A 4MV6A 2XOKA 4ACAA 2VTEA 2Q7OE 2C78A 4COKA 4KQFA 1FU8A 2XWBF 1IB0A 1LBIA 3EEYA 3BFVA 3GZJA 5F9MA 4E5PA 3UOWA 3WNVA 3CWZA 5JATA 2HLDA 3H7IA 3NNNA 1PK9A 3EA0A 5JQGF 4EJFA 1AK2A 5LIPA 2QLNA 1QGZA 1Z37A 5ED0A 2VXCA 3L0ZA 2KB0A 4U9UA 3W05A 2JLSA 1YB5A 3NT5A 4GOMD 2QSYA 4GM4A 1TZJA 3WLQA 4K9OA 4G26A 3OQNA 1CNMA 2JCYA 3PQ8A 3WIOA 2JFHA 2JLCA 4PGFA 2RGBA 2ZE8A 1OU0A 4EO9A 2BFCA 2ZAYA 1WXWA 5AJHA 4ZVLA 5K6AA 1OTHA 3WJ1A 4IAOA 1QMGA 4ARIA 2ZRFA 1OTXA 3CB4A 1DUSA 3KQPA 3U4QB 3KJIA 4MQUA 4QXQA 3SEFA 3T54A 1Q0PA 3O95A 4G1VA 3SNHA 5KNCH 2QTNA 3B89A 4XB2A 4BFLA 3PKZA 1ZSNA 1FLVA 3U1VA 5A4KA 2C95A 3DKIA 3DPUA 3JQAA 2HCJB 1HH4A 5B1DA 5L40A 4L4UA 4ETIA 2CHVA 1RPAA 3G13A 3GVIA 2BEUB 5DASA 1H0KA 4CPDA 3UUFA 2NO9A 3GLRA 2HTEA 3PYLA 4MKXA 2P9GA 3T38A 3CUTA 1KXZA 3U7IA 1Y37A 5K05A 4OEHA 4YDQA 1HE8B 5GM2A 1KHHA 3IHLA 2BC9A 2G17A 4XR4A 3VH1A 1YULA 4UU7A 3PUYA 4CKXA 1C1DB 1QHSA 3LOUA 5EZQA 4CM7A 3ROTA 1WW2A 3E18A 3GDWA 2DT8A 3ZHVA 2VDJA 4EW3A 4IOMA 4LMAA 3ER8A 4KMRA 5AM3A 1YZNA 1TQ4A 1GQOA 2C7PA 3D6JA 4MNTA 4QOJA 5CRIA 5HZMA 1QZ3A 3WC4A 3QENA 1A7KA 1M72A 4R1NA 4FR2A 1HXHA 4KQ1A 2Y6VA 3DE3X 3QE0A 1G6KA 1JS1X 5AW5A 3ZVLA 1UOOA 2A33A 1YOBA 2J3DA 3LT1A 3LXXA 4ID9A 1BMDA 1BNCA 1P60A 1I1HA 2J0UB 3LPLA 2BMWA 2YYZA 1KY2A 3AM5A 2L69A 1T36B 1Y80A 1JG4A 3V1UA 2VL7A 4B6QA 4BP8A 1EA5A 2G28A 3RVKA 3ZLVA 1GPJA 1LX7A 2I22A 1J24A 5HA5A 4HX9A 5G41A 3ZU3A 2PMWB 4WBNB 3KR2A 4X7BA 3S44A 5FL7D 4KQMA 4RPCA 2FR1A 4G0ZA 3JQGA 2X9GA 1EGHA 4UUBA 5IAKA 3JTMA 1RRKA 4QUAA 4N7RA 5ELLA 1W88A 3O2NA 1E1RD 4HD8A 2C1XA 4B85A 3DFKA 3JQBC 5FTKA 1U9CA 1O6GA 3I6IA 1Z56C 2RBEA 3CZPA 4QXRA 4RXTA 2G63A 4C7KA 4F3CA 1OYWA 5E1OA 2WQ7A 2G77B 5AW9A 2CZQA 4BBPA 1A9OA 3R5XA 2ZJFA 4YGYA 4X66B 2A7XA 3VKWA 3R9WA 2P8SA 2OGZA 2XADA 1V3QE 1OE0A 5KNBA 2VPTA 4X8HA 4DB4A 2RKWA 3ZE0B 4EF4A 1SH7A 4QKQA 1CUBA 3SLKA 2JK1A 2ZXFA 4HQLA 4PO8A 1PO7A 2NO6A 4TMZA 4ZYTA 2B37A 2JFWA 1E3TA 5DRTA 5DCYA 2XE7A 4F4HA 2LTAA 1G1MA 3FTQA 2WSMA 4I1OA 5CXXA 3TMYA 3VDQA 1VPVA 2FXVA 2OWDA 4TL7A 5CNIA 3ZWPA 2IHUA 1MR3F 4V0MA 1CF9A 3EXHA 4K87A 3DR5A 3LYUA 3FR7A 4JX8A 4ZGWA 1MEEA 2R6CA 2AF3C 3KZMA 2XE6A 3OKAA 3KAPA 1ZJZA 3O8LA 4Z9AA 4US1R 2PBLA 3BIJA 3EPPA 3I04A 4KN8A 4MV4A 1AKEA 1OXUA 4R8VA 3NASA 4C7MA 4H59A 4P8RA 5IHXA 5EXPA 3W77A 1E5VA 2QX6A 1II8B 1NWCA 1ZC3A 1BEEA 2HEIA 2PLFA 4GU5A 3FSEA 4AG5A 3FYDA 1P19A 2JKYA 3ED5A 4DR2B 1V8BA 2WA2A 3ZGLA 5CT9A 4E30A 1LFAA 1I2AA 1TC1A 4O2AB 5CU7A 3KUKA 2HLHA 3C7DB 4G8CA 3EZLA 2W83A 5A1JA 1C3EA 2FUNB 4ZKEA 4KIUA 3HO1A 4IM7A 1V9CA 4EUNA 1BFKA 1E94E 1KKMA 1DKRA 2A0KA 3CW2A 3QVGB 4CG3A 4ARZA 4WOJA 2DXIA 2QMHA 1V35A 2W5UA 3M6XA 3A36A 1PSZA 2NO0A 4DXAA 4CEJB 3PNSA 3UHFA 4I4TA 5G3ZA 3E2IA 5JAIA 1O57A 2BR3A 2BVNA 3LL7A 3SHFA 1Q6ZA 5BUCA 1AKMA 5L7YA 2D6FA 5EZYB 1UKAA 3U3MA 2QLTA 1ZMOA 2YNMD 3HUUA 3PD1A 3LUDA 5GONB 3G1WA 1CNFA 1FNMA 2P5UA 4GUDA 4GPTA 4MGIR 4MQFA 4Q7KA 1JLLA 5E6RB 3VXKA 5ILOA 1X3SA 1CQXA 3KXIA 1EGAA 2FPRA 1E7QA 4IX9A 4MGZR 4O4IF 2XYQA 5H59A 4U6NA 3JD3A 3TI9A 2NUBA 3UGQA 4AFNA 5JNSA 3U7HB 1KDRA 3MWEB 3L2OB 3BIXA 3LUCA 4O4IA 3MJ4A 2H2FA 4LZOA 3A9WA 4PAMA 1CG6A 1BXRA 2E89A 2O2SA 2PX8A 2RG1A 3AT1A 1EVYA 1EU1A 2O52A 3CMCO 3E6AA 3MC1A 3WQQA 3I05A 3HB0A 4EEKA 1UT5A 2V7BA 1CJMA 3W1EA 1Y4ZA 4IDGA 5ESXA 2ZANA 4O29A 3WY9A 1RFLA 4DLPA 3GL9A 4FMDF 2WIAA 4NHOA 4EG5A 4KDFA 3OG9A 3P20A 4NJEB 3D8SA 3LP8A 3R4CA 2Q3BA 3DDZX 1REQA 2A0UA 5G4KA 1DXHA 1IHYA 2O1EA 1MT3A 4AYWA 2FRDA 2V4ZA 3DLIA 2B98A 1NOKA 2Y67A 3IIJA 4E32A 4MR8B 4S2UA 4JBYA 4LC1A 3C74A 3NGMA 4RPGA 5DCUA 4KNVA 3E53A 1N75A 4OU4A 1JGTA 1X15A 4PX9A 1SZPA 2KBEA 1LW6E 1KZGB 5REQA 4HQNA 4EEXA 4KK4A 2DHRA 2I1WA 3HU2A 3TFOA 2GTPA 1L9XA 1JN0A 4ENUA 3FBTA 3ZW7A 3L8YA 3FCSB 4YCLA 1W49A 1Z4NA 2J9FB 4U3JA 5AHXA 3FPKA 2AS0A 4MLDA 5BOVA 3N2GA 3RIMA 4G4SO 1FX0B 1HO3A 1WCV1 2IHVA 4OAOA 4WIAA 4PYOA 4D97A 2IU4A 4WESB 5EMNA 1K0FA 3FCUB 4YJ2A 4YAIA 3HR7A 4OHVA 3T52A 3SFTA 4Q48A 3L4JA 1NX6A 5F35A 5EINA 4GS5A 4Y7DA 3NYRA 1OX4B 1SBQA 3MIIA 5HIIA 1LTQA 2KHZA 1V71A 1LX6A 3IP3A 3LA6A 4ZV9A 4E51A 1YF3A 1DAKA 1F60A 3R24A 2Q0QA 4LECA 2C1EA 4G0OA 1P2UA 3F96A 4X44A 1VBFA 1WKCA 1YVEI 2NVUA 5E6SA 3FYUC 9GPBA 3P27A 3JQAB 3WK9A 3ZOZA 1KJIA 3C5WP 2NT3A 1Z12A 4TM7A 1V48A 3JALA 2MU1A 5KX5A 2QP9X 2D4HA 2VHZA 5C7LO 5GONA 1SKQA 4LJAA 4OATA 1A8UA 4ND3A 2AEFA 3TM4A 4DZRA 2REQA 2E4VA 3PE3A 2FMIA 4FYKA 4GH5A 4UEJA 2YBEA 2O07A 3FN4A 5ILGA 1B8PA 1P62B 2EGHA 5HRCA 2YX1A 1DGQA 1B8OA 4DBLE 5C5DA 5JHGB 1S2IA 4B4WA 4AECA 1OKKD 4K6CA 4R83A 3NYQA 4KNYA 3UGKA 1P61B 1JIIA 1GLVA 1Z08A 3DMTC 4WI1A 3W6PA 4Q1VA 2QUZA 1XLWA 4FFMA 4JOSA 4C43A 3LDHA 5LVAA 2ZETA 4K0KB 3UIEA 3V2UA 2BL4A 4URZR 3HEAA 5AK6A 5DK6A 5J1TB 4G24A 2ID7A 4P2BA 2DQYA 2KYRA 4Z3OA 1T5IA 1P1JA 1P1KA 2C0QA 4EUKA 5IXYA 4L3OA 3GJ7A 3T0GA 2P6NA 1T5SA 4CTMA 1RZVA 1IY9A 3OZIA 4RVGA 4WKGA 3ETDA 4RDXA 4QBTA 1Y89A 4FYPA 3L84A 2H92A 3MQ2A 1BS1A 3NIDB 5FI3A 5A5EA 4BNIA 3CUEF 1L8XA 3AX6A 1CJUC 3NTRA 3ZE8A 3L0OA 3R41A 4JLBA 4M2LA 1K3FA 2NMVA 4YRTA 3UENA 3GDGA 1VDMA 3IALA 1BCSA 2JGDB 1RWPA 4YHHB 1JLMA 1BAPA 1OXBB 2AXEA 1XVIA 2BBOA 5K8VA 4UXHA 2H9YA 2OOSA 1DDIA 3DBHB 1QFMA 1VHQA 3GQBA 3ROEA 3TIFA 3V3TA 4PYLA 2ZPUA 4AZ0B 1TJNA 4TKLA 4HRYA 4DKXA 1OT5A 1O89A 1SHKA 4PG8A 3T6KA 4EDFA 5JECA 1FU4A 3DTVD 1KERA 2HA7A 1WXFA 1S96A 3OEYA 3QKRA 4K8RB 3S2IA 4BFVA 1BVRA 2NLOA 3BM5A 2FPUA 5T5QA 3SBXA 3U62A 2ZKIA 2I54A 1JMYA 3UXYA 4HZIA 4LN1A 4QTZA 4C0AC 2HIHA 2R4UA 4BCCA 2AIRA 1SVMA 3KSUA 2CGEA 1SD2A 1RMQA 2QL7A 2PLWA 5ALPA 3VH2A 4DIDA 1R5BA 1Y6RA 3E15A 4O2BB 4OQ4A 2MSCB 3V1NA 1T6XA 3QXCA 5J23A 1FIUA 3S40A 2IYAA 4L02A 4MIYA 2C97A 1Y33E 2OC4A 2VXBA 1I32A 4RNCA 3ZDXB 2F1IA 3G2KA 3KTAB 4LHYA 2W4MA 4XYBA 1UZUA 3C1AA 3DAYA 2LWIA 3HDJA 2G8LA 5DF1A 1E4OA 2G5TA 1Y1KE 1DDGA 3WDMA 2DP4E 3OOSA 3DJYA 1G2IA 4FE7A 5DYYA 3G2NA 4C4SA 3IO3A 2DPGA 2AG0A 2PWAA 2FEXA 3O4VA 4R41A 5AVRA 4Q37A 3RI3A 2L17A 3QRWA 5ALFA 1K6IA 2G70A 1KFKB 2A78A 5GJVC 3TRJA 2PS3A 1EH5A 3LF1A 4M0PA 1JDJA 2F48A 3BHNA 4QDJA 1DVRA 5NULA 4EHJA 4EZIA 1UFKA 3HN6A 3B7WA 3VPDA 4ZTBA 2WJVA 1HE2A 1V5FA 3EVBA 3FLMA 3GJQA 2GB4A 1D04A 3CB2A 1II8A 4UREA 1DXYA 4ND7A 2Q2NA 4IIJF 4EABA 3KB1A 3KEFA 1XU9A 2CL5A 1EGVB 1FMCA 3GLFB 1RHQA 3JU3A 4FFPA 4BEWA 4OJNA 1M2KA 2PT7A 2QBYA 4RHFA 3OPXA 3BIWA 5FWDA 1V16B 1PR4A 3IT0A 4GVLA 2ZE5A 1B6RA 1Z5ZA 2BZ1A 1NUHA 3DHNA 4TS3A 1U7PA 2RMKA 13PKA 5HE8A 2QTLA 1FP7A 1NSYA 3H97A 2HQSA 4IVRA 2GNPA 4PG6A 1OHHA 4UE6A 5AQEA 4ARZB 1OGJA 1P81A 4FI3F 2XV1A 3FOZA 4CEJA 3PBKA 5T3YA 4GG1A 4KRGA 5INTA 3N5CA 1EFRD 1KXJA 1LQ2A 2AF4C 4K5QA 5EZYF 4Z0HO 2UYCA 3K5HA 3V1KA 4H31A 5IJ0A 5EJIA 1PKEA 4RMJA 1YCGA 2PAFA 2Z9BA 3OVMA 2A3RA 3OZSA 4DNXA 1T9GS 5C4MA 4DR4B 1YU9A 3WBKA 4JZKA 4HLCA 3WQBA 4LYFA 1NR1A 3KXKA 3EMBA 1HYBA 2BGLA 1PT9A 1H42A 3IA7A 5K3CA 2AYZA 3Q8MA 1CP3A 3V8NA 1XF9A 3N7UA 4IPTA 1KYQA 1L4HA 2ISQA 4TS4A 3ZWNA 3TTXA 2H2IA 3DFUA 3QKIA 1EYZA 2B5OA 2FN7A 4QYMA 3MCTA 3WLFA 4CEHB 1GTVA 3OECA 4TL9A 1BZYA 2X0DA 1VL0A 3NWEA 4XAQA 4WY5A 4EMSA 1XXLA 3BWDD 4B3JA 4HEQA 2B35A 4TKUB 4JLOA 4F4JA 5AW4A 5ALVA 2P2SA 1RWWA 2YMQA 3IIIA 3MTDA 4IF4A 3P5BA 4WPGA 1N6HA 2HSWA 4Y1GA 2NV6A 3R7AA 3VTAA 6YASA 5JZBA 2JNWA 3URKA 4RD3A 3DSRA 4TLLB 4CM8A 3NTOA 3LXUX 1DC5A 2V3WA 4LY6A 4PRZA 1R6TA 4D3ZA 1X86B 2YOHA 5LZ4A 1N2CE 2PX2A 2PGOA 2IXGA 1V95A 2YZNA 4UATA 5H3HA 1JKXA 2PYZA 3LLUA 3SGLA 4UUPA 2XOKD 4R1MA 4U9HS 4YRBA 1W35A 3RNOA 2QTZA 4KB5A 2HO5A 4RIFA 4BVFA 2DCUA 1TFRA 1J6UA 2OA0A 4X5OA 3GEGA 1X1QA 1KYYA 3PGVA 5ADHA 3AR7A 3PXAA 1ACJA 5LQDA 5E0KB 1UWCA 1E3WA 3AUJB 1HBJA 1KI7A 3PEFA 4IR7A 5L45A 1GGJA 1HKUA 5I3CA 5JSKA 1SR8A 3TRKA 1LJLA 2EFJA 3JY6A 1VECA 3WLEA 2NXJA 3KSMA 1J0XO 3B48A 4TTRA 2EWVA 1FRZA 5AOCA 5TE9A 3ND6A 3UEOA 4E07A 2Q4RA 3OF3A 1JLSA 5I48A 3TZHA 1V4VA 2ZS9A 3QSGA 3RWBA 4J90A 1TAHA 3IE0A 4GPAA 1I4EB 2VZ9A 3W6ZA 5F51A 3S2ZA 4ZPXA 4JLUA 1EFRA 4BNFA 1H8ED 4TRJA 4S12A 5BY2A 3T7RA 1G98A 1JHVA 3A3KA 5DBIA 4KQGA 3N2IA 1E7SA 3O9MA 2ORWA 5EPEA 1W30A 5JBQA 5LLDA 4BO3A 2QN8A 4F06A 2CDBA 1FTGA 1FFBA 1XGKA 3CH7A 2ZVDA 4Z9XA 4ZO9A 2GBGA 4V1CA 2FYTA 1DS6A 3OM9A 4GPIB 2BV3A 2C4HA 2V5AA 2WD8A 3P9PA 3WBJA 1RRVA 1GPYA 3WDKA 2REQB 4IGEA 5K6AC 3HL0A 5K3BA 1XEFA 1QHHB 1F2VA 6GPBA 2WWGA 4BMXA 5CNMA 1HT1E 1QZXA 2AG5A 3MYYA 2Y8EA 3W5SA 4CQLB 4D9GA 4LRWA 2EFDB 3OO0A 4DDUA 2QTAA 1NMEA 1N2CA 2Q1YA 3L7JA 5T6BA 3KNZA 2VJQA 3ILYA 3OX3A 1KK2A 4M7RA 5EE0A 3D8HA 2YJ5A 3OZDA 5JAHA 3EVDA 5B6JA 5JSUA 1A5AB 3LFUA 4TZTA 5AP9A 1Z82A 2Z08A 4HHEA 5LCXA 5IZ4A 1AK1A 4IUDS 1WW3A 2HD4A 2JD1A 4DMRA 2XODA 4TTQA 9LDBA 3TD2A 1JU3A 5EP4A 3Q7RA 2EKPA 4NECA 3MILA 5HKBA 5J4LA 3EBPA 2J67A 4MQBA 1JEJA 3O94A 1FFYA 1MIHA 3IQWA 4NMWA 4DV6B 1H1DA 1M66A 3NEJA 2PMEA 1UDBA 1Y4UA 4M1OA 4CKWB 2UYQA 1GT6A 4GZ6A 4WLVA 5DGIA 2A88A 2C83A 2GZ1A 4A23A 2W6ZA 5FNVB 4Q05A 3TRFA 4GI7A 2GCPA 4YS6A 2X5JO 1SUBA 4ONEA 3H19A 1KC3A 4Z3DA 2JI7A 1RTKA 2IDJA 1GRNA 4JQYA 1FJGB 1XWFA 3N2YA 4L6CA 3EIOA 4E2ZA 5I7UA 4PTYA 1O5OA 1V8DA 2W8BA 1I36A 5AI0A 3F8SA 2DY0A 3SM3A 3DDCA 3ZLUA 2G9NA 3C1UA 3TQOA 4OLAA 3N87A 4IDOA 3JD2A 5JDIA 5MN6A 3QVJA 1JI3A 1GA1A 1L1QA 1QKIA 1Y82A 3LZDA 4LVUA 3CLUD 4ZOAA 4JLAA 5FPSA 2HJ9A 1SXJD 1U0FA 1UL1X 3ISJA 4RC9A 5E2IA 4Y9UA 3RBZA 1KMMA 3A9CA 1T10A 4EL0A 2CXRA 3F5SA 1KBOA 1PR1A 3RWOA 5CM9C 1U2RA 1UPAA 1LK5A 2QN3A 2ZIXB 4MV5A 2R1UA 5DHPA 2DQSA 2HJWA 4OHXA 4P7JA 3VSAA 4UD6A 4CF7A 2FQXA 3PLNA 5GV7A 1Y3DE 3P71T 1QUEA 4ZVRA 2PO5A 5HCIA 2LIVA 4H1UA 4V0QA 4AG6A 4YRRA 4HZUB 2GA9A 3GWGA 3FOBA 5CHEA 1HEIA 1Z5GA 1XLTA 2JATA 2PL5A 2VHVA 2XSZA 5E7QA 4G0YA 3W7BA 1SNYA 5BURA 4HLQB 1EBBA 5HQ3A 2HKIA 5JAPA 3JQQA 3S2EA 1M74A 5BXYA 1ENOA 4BTLA 3U13A 1BE6A 3AHEA 3LLMA 2HK6A 4RTMA 4LXXA 4D0GA 5DX0A 4B3MB 4EI9A 2ZR9A 5IABA 5K5EA 1WSWA 2JAXA 3UMRA 2R8RA 1N0WA 2IUUA 3SE7A 1NKSA 1FP1D 3JRWA 2IT1A 4HN9A 4WE3A 2Y1DA 2XJ4A 3QYJA 3L6CA 1I5OA 4OLHA 1BRMA 1C7EA 3IQGX 3IVMA 4HFJA 3D6TB 4MW9A 3HGQA 3R6LA 2OBXA 2ODQA 1HG0A 4M87A 2RHCA 3BWYA 1B1CA 1FLDA 4HQ6A 1U2TA 4PC2A 3ZE6A 3LY9A 2HA5A 4LV5B 3SDZA 4U5QA 1TK9A 4DQLA 4DJTA 1AMOA 1RE1A 4HPXB 1PZNA 4WN3A 1MHTA 4KYVA 2OCXA 4YY3B 1AZTA 2ZTSA 5A3SA 1BE0A 3OPVA 4TZKA 4Z51A 4A3SA 3ERCA 1Q1ZA 1IQUA 5GM1A 2ZJ7A 4B6SA 2QMYA 1C3JA 1RPNA 1ZGAA 3P8ZA 4JBWA 1FNSA 3WZMA 4F4DA 5KYNA 2BHNA 2G83A 3JQ7A 1DUIA 1U2GA 1WXHA 2CNWD 5ARCA 5F5XA 4CJXA 1MZPA 4IGIA 4OYHA 1OLSB 3VVLA 4TLDA 4XB6B 4B0PA 4BWVA 2QAIA 5MN5A 3E22A 4D98A 3EPLA 1Y7IA 3S2UA 1SVNA 3AMVA 3FOFC 3VNUA 3ZK9A 4O3MA 3GFBA 4EKGA 3SXUB 3UBTA 1B6SA 1UXJA 3M7IA 1N5LA 3V48A 2JJMA 2O14A 1ULHA 3CX3A 5AI9A 2XKKA 3CVJA 3UMSA 4Z7OB 2XMRA 2IXAA 4M1EA 4WNAA 2HK8A 3M1AA 5BSTA 4AMZA 1PZHA 2D2EA 1Z13A 3T5BA 4EPTA 5ALRA 3OMXA 1XMJA 3W5DA 5BP7A 3K70D 1GCOA 3A9RA 5FF9A 1YS4A 3IVCA 5TF4A 4CR8A 5TJ9A 4D4JA 4RK0A 4ER0A 2XOEA 4Y9DA 1E89A 1SU4A 1LDMA 2WJJA 5G0WA 1LA2A 4ARVA 4MRMB 2JARA 4AUEA 4DLRA 1ZNXA 1IWPB 1NJ1A 4FMCB 4WH0A 2QNRA 1X7WB 2CV2A 4PSVA 3QV2A 5KTSA 2E4XA 1HL3A 4HYEA 2WV7A 1L5GB 1OU4A 2LKDA 4M89A 2NU7B 3WZ2A 1TTPB 4J94A 2HT6A 4M60A 5J1SB 4MYSA 4ALLA 9MHTA 4MQ5A 4D8TA 4QGFA 3GOHA 3OU2A 4MB2A 1M7GA 1SGWA 5K0JA 1XQXA 1JDBC 2P2GA 2X6RA 3IH5A 4L3VA 2I6XA 5ALSA 1O5IA 3R9KA 2LIPA 4PX3A 2NN3C 3VKHA 2E5LB 2V74B 3EC1A 5IKPA 2XYRA 4LXHA 2GZSA 1XROA 2CYAA 1T4MA 4M46A 1ICIA 1K68A 1DQYA 1NVVR 4XGNA 4Y2HA 5TRTA 1M2VA 1F9AA 2Q07A 3Q7PA 2IWRA 4HMPA 4C88A 3COJA 5IAJA 3I3SR 1DP4A 3A31A 4OHFA 4AMYA 2RHMA 1LPNA 1Z4PX 2CL6X 3HY3A 2G4LA 3QUAA 2WSYB 1XFAA 5ALEA 4B81A 5I4BA 5KTTA 1JYSA 4DR6B 3JWPA 1GEGA 3OTGA 3IR7A 4AJNA 2CNKA 1QNLA 3BTUA 5DYNA 3DZIA 4E3WA 4CKBA 1DUVG 1H0RA 4GECA 1HWYA 2WJYA 4KX5A 4F1JA 4ZDIA 1IATA 3K9LA 1ZESA 1EFKA 2C9MA 2OZEA 4L7QA 4YI3A 2YV1A 3IUNA 3QMMA 1VCNA 1X0XA 4MUJA 1C7RA 3U6BA 2NO1A 1IEXA 3EOZA 2YV4A 4B6FA 2R2GA 3KQWA 5DI3B 1OAKA 4D4IA 3OF2A 2EBUA 4M0DA 1CB7A 4HDNA 5CTAA 4ND4A 2VBFA 2DFVA 1LDNA 3ROZA 4FX2A 1EB8A 2FZLA 2QE7A 3GUVA 1ZIDA 2DWPA 2H1SA 2WNIA 3A0UA 3L8ZA 3O3OB 1CETA 4WWHA 5ARBA 1UQRA 3SYMA 1KJZA 5FBKA 3D6NB 4R3NA 4WNCA 1MB9A 2I0FA 3SC4A 1C50A 2F3UA 3K6KA 1MXFA 1N1DA 1PG0A 3KJNA 3OICA 4NZ9A 2NPOA 1UJ5A 1R0KA 5GONF 2H4WA 5ULLA 4AJ2A 2REBA 3INTA 4CIXA 1E60A 3LWZA 5J43A 3KEMA 2R25B 4O4LF 5D87A 2X3FA 4FLFA 4ZFNA 2VPZA 4YRNA 2R6HA 5DGTA 2E3JA 3QPWA 4IV5A 3IV7A 1S4QA 3PJFA 2R79A 2W00A 3FBWA 2XQVA 3OWOA 4YAEA 3UOAB 4PSAA 1MW9X 4U6SA 1JFFB 3EVNA 3DPSA 4AJJA 3Q2IA 2V55B 1S6YA 4M9CA 4OH7A 1WUJS 3DZKA 4U7WA 5FJIA 1E1QA 3ELYA 4YJHA 5B6PA 2X14A 4CMKA 5KU1A 3KTOA 2Z83A 1N3LA 5ALXA 5FBQB 9ATCA 3ZQ6A 4KXLA 1HQKA 2ZB3A 1XD2B 4QXPA 1E9AA 2ERYA 2GSWA 4RAOA 4F38A 3O21A 3PLRA 1IN8A 5DXFA 2CHEA 5K7SA 3B9QA 3OE7A 1Q77A 3UKOA 4XYLA 5HNKA 4OX9Y 3GH1A 4P3PA 3H5VA 1EFVB 1GNTA 3PDCA 5CFQA 3A3OA 1ANKA 3ME5A 1AM4D 3UGJA 4LF6B 3HXTA 2WILA 4OFZA 4QJ4A 3N0WA 3R6GA 3MOGA 4AJOA 4NS1A 1W36C 2IP2A 4KRFA 3SVLA 4EI8A 1GLGA 3F49S 2OD7A 2YYAA 1PEDA 4QJIA 5D3KA 4XYEA 4DCSA 2XTMA 1RW4A 4LHXA 4RVSA 2CMGA 2DM6A 4IEEA 1KDVA 1AXEA 1A72A 2UZAA 5F9FA 3FIUA 4RTJA 4OK5A 1Z0SA 1Q1EA 1R3UA 1RCFA 1RZUA 3OIUA 2SKDA 2VG8A 2ZSJA 3QXXA 4FJ0A 3LF2A 3HU5A 4GWGA 4NCHA 5ARDA 3ZU5A 3OCYA 2D2FA 3FXAA 2C4KA 4UFNA 4YFYA 4ZXFA 5C34B 1UKVY 4TYNA 1J49A 4J0QA 2OV8A 2CV0A 1Q7CA 1TM4E 1JAYA 4JYPA 5IWAB 1VBNA 1ZOSA 5AI5A 3AKZA 2Y93A 5GJCA 4JI3B 1P1HA 2ID9A 4FKZA 3S8YA 1JVNA 4X97A 2QJFA 1E0SA 1KP3A 1MOZA 2DKOA 2I80A 2WVGA 5A05A 1IOZA 3F6BX 1JG3A 4ZCMA 4AZ3A 5C4IA 1Z6ZA 3R3WA 5DEOA 5J4VA 2FRDC 5JFGA 5JYEA 5IVKA 5KTYA 2AJBA 3ZJTA 4MVCA 1ULAA 1A8PA 1BWPA 1SUFA 4N03A 4XX0A 3DEFA 5ANRB 4CQNA 2F17A 3GMTA 1YR7A 4L0QA 1E2GA 2A1TS 3K8OE 3U4IA 4I8DA 3FW1A 4ZRNA 5IRCD 3HCCA 3H8VA 4K3VA 4IVPA 3UK6A 1V45E 3QNUA 2P62A 4O5OA 3HGMA 2XQIA 1VJDA 1PQ4A 4C07A 3AB8A 3T1HB 3HBAA 1KO8A 1L5WA 1YJBA 1Z8DA 2G40A 5C4GB 1AA6A 1YR8A 4K40A 1DAOA 4CFZA 2QTMA 5D01A 3DVAA 1JIJA 5FBZA 1GGHA 4JIMA 4AJ9A 5H82A 2CBZA 3GLGE 4HGYA 2V9ZA 3MERA 1X7HA 2GXQA 3W3AA 2WWTA 3UFXA 2JLVA 3Q8WA 1V39A 1Z38A 4UBMA 5FOTA 2JL1A 4ZYLA 3K32A 1M2GA 2CF6A 3GPIA 1ZVMA 4I5EA 4W9NC 3W5VA 4N76A 2DRIA 1QORA 2EKZA 4BJ6A 1PAUA 4ZXPA 1OHHD 2W93A 4LDPA 5FFNA 3AFMA 2F4NA 4PC3A 4N82A 3EYWA 3FYUA 4LWPA 1QP4A 3D5QA 3ITKA 1LQTA 2UAGA 4J29A 3TQRA 2I7CA 3B1WA 2VN8A 3KYCA 4U7FA 1ZSYA 4CCSA 1W47A 1XKXA 2FSVA 4G4JA 4MROA 3N0XA 3EEIA 1T4CA 4URHA 5CDFA 4XIIA 2PFGA 2J0SA 2A5DA 4NL4H 3MINB 3FCOA 4E0BA 2PX4A 4RYDA 5LQRA 2EQ5A 3IXQA 3KCNA 1T24A 3TLKA 4W5RA 1E6WA 1K2VN 1PZMA 1V11A 3O82A 3RM3A 3FFXA 3VJLA 2H5JA 5B37A 5D5PA 4CG0A 4Y6LA 1ZJYA 2H1IA 4GNRA 3SK0A 2EATA 2WP8J 1FRNA 1FDOA 3BD7A 4Z4GA 3RBVA 3NRCA 3N0TA 4F8JA 4UDXX 1Z2EA 3VI4B 4GIBA 1AB6A 1ILEA 3ZU6A 2ZZMA 1NXSA 5HIKA 4QHYA 5LQUA 5IH3A 1XNRB 1EHIA 4RPIA 3G5UA 1K6MA 2Z2JA 5HDQA 2CEKA 3TIGA 5CB6A 1U2DC 5H02A 1N2SA 2V0CA 1LNQA 3NEPX 1UEXC 4JLPA 4PYQA 3RC3A 4EH1A 5K4AA 2D5CA 4J1SA 1P2TA 1KVTA 2VRWA 1YS2X 4H7HA 5FOXA 3GIDA 3SZLA 2EL7A 3GT0A 3ZEAA 1DQNA 1UPBA 2VUSA 2WIBA 4DR7B 3JRNA 1I1QB 1NTOA 2AOWA 2OQVA 1W52X 4RVUA 2GHIA 1CE8A 2Z58A 3NPMA 5JZ9A 1XDDA 3KJQA 4QJ5A 1V3VA 2SCUB 4LOLA 3BSWA 4UVIA 3ZV5A 3HDVA 4BMSA 4C20A 3LDUA 4TWJA 8ATCA 1E7MA 3P2KA 4LJLA 1GWNA 1TDJA 4YNBA 2OVBA 1EMDA 5EWMA 4JI6B 4CMCA 2G1PA 2GCIA 4YB8A 4RD1A 2DSTA 1SCDA 4JJ7A 3HNRA 1F9EA 1YV9A 1YBMA 2B20A 3MJVA 3KHTA 4MIEA 4WV3A 3KPVA 2G1KA 4FYHA 1EVIA 1F6WA 2VT6A 3DOFA 4E15A 4DIBA 3RRMA 3MMSA 2XUPA 4ZJPA 3W9SA 2B2CA 3CLRC 3IUEA 3TRHA 5DHUA 4CR7A 2QRVB 5JS1A 1GGEA 5FADA 5L3SA 1D7OA 2IDKA 3CX6A 1NI3A 1U2PA 3HPRA 4KO1S 3OSUA 4WXMA 4UCFA 1ELOA 4XVQA 1E96A 4XQEA 2HFKA 1AMUA 3C14C 4YONB 4QQKA 2NZJA 4M1QA 1V37A 4GZ5A 2BFEB 1NMQA 1HMPA 2EKLA 2J9XB 3QEJA 1AV7A 2DJIA 4FE3A 4XTCS 3SBDA 3IOMA 2WHQA 3P26A 3ZWMA 4DG8A 4YPOA 4XWKA 1EIWA 2DBQA 6NULA 4IIJB 4EGJA 3LKVA 3JV7A 3TNFA 1ML4A 1Z2OX 2B6HA 2HDWA 1QS0B 4GWLA 1PGJA 1R50A 2ACVA 3ZHYA 4RZSA 1AHNA 5FTWA 1ZIYA 2FFJA 3EXHB 1BDBA 3OT1B 4I36A 4R1OA 3AVVA 3OQPA 1BO6A 4BFSA 1CUXA 2MYTA 1GGVA 2FFHA 1J2RA 2MJLA 4KE8A 4NNJA 4GMGA 3SQDA 3U3KA 2NADA 3ZJYA 1R10A 3NHRA 1WA5A 1XP8A 1H94A 3IPXA 3RYIB 2WM8A 3D2LA 2AN5A 4HV4A 3NHYA 4PR3A 3TL3A 4GMKA 2XCIA 3JWHA 1KPIA 3LU1A 2IYFA 4M86A 2HIGA 3GG9A 1NYTA 4AJIA 4JXXA 1VGVA 1W44A 2IX3A 5KHAA 4LXYA 1E61A 1RACA 2PXXA 4R9UC 1GKYA 1QYDA 1I6KA 4V24A 2KE5A 5MDHA 5AK0A 1EXVA 3M6WA 1XDWA 3PGJA 3V3KA 1VKJA 3MS2A 5KOHA 1LB1B 1GAQA 1ZR2A 1YQTA 2H48A 2FSVC 3OCJA 4UU1A 1SC9A 5JBNA 2M6KA 4OXXA 4DG5A 4DCOA 1FFXB 2P65A 5TPZA 1SUCA 3CF2A 1NLYA 5FO1A 3EFOB 5IT0A 4B3SB 3VHQA 4EMTA 4HNUA 5EHQA 1FL9A 1RP1A 2QSJA 3N2KA 3AI3A