2ID8A

Crystal structure of proteinase k
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title What can be done with a good crystal and an accurate beamline?
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 106
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2id8A00
1PTKA 1T1GA 4AKTA 1T1IA 5K7SA 2PRKA 4ZARA 1TM4E 4LVNA 2W2QA 4H6WA 2Z56A 1GNVA 2ID4A 4KG7A 1SBIA 1WMFA 1KDYA 5SICE 1THMA 1TO1E 2Z2ZA 1OYVA 1ST2A 3LPDA 3F7OA 4WOCA 1BFUA 3WIVA 1Y3DE 2QTWB 4KPGA 1PEKE 4CG0A 2SICE 1ZVJA 2Z58A 1AK9A 1HT3A 1NDUA 2WUVA 1SH7A 1IAVA 1R64A 1P7VA 1SUPA 1YU6A 3DE1X 1SCAA 1Y1KE 5JXGA 2XRMA 1LW6E 1T1EA 2ZWPA 1SIUA 2X8JB 1C3LA 4FONA 4H6VA 2ST1A 1SVNA 2PWBA 4H6XA 3DE0X 3SICE 5AMXA 5FAXA 3AJ9A 3F49S 3DWEX 5FFNA 3A3NA 1SCJA 3VYVA 3WQBA 5ARBA 1SUBA 3PRKE 2V8BA 4K8RB 5B1DA 1GT91 1Y48E 1AU9A 1ZVKA 4GI3A 5ARDA 3A3OA 1AH2A 1Q5PA 2PQ2A 2PMWB 1UBNA 5B1EA 4DZTA 1NLUA 1AVTA 3P5BA 1PJ8A 4B5LA 1BFKA 3HJRA 1MPTA 4OV6B 3VTAA 3SQOA 1S01A 3Q5GA 1AQNA 2IXTA 1Y3BE 4OMCA 1CSEE 1GA1A 1GTG1 1P7WA 1KE1A 1OT5A 3BX1A 4CFYA 5FBZA 1SN7A 2X8JA 2HPZA 1SCBA 1GNSA 2W2MA 2W2NA 3EE6A 2G4VA 2Z30A 2WUWE 1S2NA 2SECE 1C9NA 4JP8A 5AQEA 4MZDA 2P4EA 5CW1A 1SUEA 4DJ5X 2PKCA 1AV7A 4LVOA 3TECE 3DVRX 1IC6A 1SUCA 5ARCA 2ID8A 1TECE 3AJ8A 1Y3FE 3QMPA 2SBTA 1Y34E 3VV3A 3Q40A 1BH6A 1BE6A 4HVLA 1OYOA 1YJCA 3CO0S 3I37X 5AVJA 1TK2A 4M1ZA 3F7MA 3DVSX 3GCXA 4NMXB 3DE4X 5AVKA 3LPCA 1KDZA 3L1KA 1SELA 3QFHA 4RYDA 3EDYA 3VHQA 2SNIE 2Z57A 1SBHA 2XTJA 3DE5X 1KDVA 3DW3X 1SBNE 2ZWOA 1R0RE 1TM1E 1Y33E 1CNMA 3TI7A 1V6CA 3I2YX 3AFGA 3DVQX 1Y4AE 3OSZA 1BE8A 3VV2A 1TM3E 3DE2X 4Z2AA 1V5IA 1SIOA 1SUAA 4NE7A 3T41A 3UNXA 3ZXXA 3I34X 3CNQS 2Z2XA 1GTJ1 1S02A 5I9SA 1P8JA 1SCNE 3BPSA 1KE2A 2IY9A 3GCWA 3DDZX 4CFZA 1PFGA 1YJAA 4HX2A 4YN3A 1TM7E 4C3UA 1MEEA 5JXJA 3EIFA 3I30X 4I0WB 1TM5E 3VSBA 1SUDA 1WSDA 5JMOA 4BWGA 2PYZA 4NE9A 2HD4A 4KB5A 3A3PA 2ZRQA 3DE3X 1SCDA 1GA6A 1WVMA 1XF1A 2WV7A 4J94A 1C9JA 1DBIA 1R6VA 2W2OA 1C9MA 2PWAA 2TECE 3D43A 2WWTA 1SPBS 3GT3A 4WOBA 3WHIA 1Y4DE 1BJRE 1EGQA 1TO2E 1Y3CE 1JEAA 3DE6X 3QTLA 1TMGE 2W2PA 4DWWA 1DUIA 1VSBA 3LXUX 1EA7A 2DP4E 3H42B 1GA4A 3LPAA 3TI9A 1WMEA 2B6NA 3GT4A 3PTLA 3WIUA 2E1PA 1WMDA 2DUJA 1YJBA 3BGOS 4AKSA 1SIBE 3DYBA 5JXIA 3DE7X 1NDQA 1Y9ZA 1SBTA 1ST3A 2Z2YA 1GTL1 1AF4A 4C3VA 1A2QA 3DW1X 5JXHA 4ZOQI 1GCIA 3ZXYA 2DQKA 1SBCA 3D9QX 4OMDA 2GKOA
chains in the Genus database with same CATH superfamily
1K75A 4LYAA 4AMYA 3GJ6A 2GJ8A 2WZQA 3KQNA 3CUWA 4KXMA 5FA5A 3DZJA 4EO7A 1SBIA 4RKYA 4B3HA 5J4YA 1QYIA 5K1ZA 3KKLA 2VJAA 4KPUA 1KBOA 1VJDA 4GI2A 5C7LO 2W9XA 2QL9A 2VTEA 4BNVA 1M0WA 1Q7GA 3V2IA 1IHPA 1DWPA 1U2EA 3CLHA 3GX1A 3QIVA 3SBEA 3QVLA 1ZVQA 1GTZA 4ZO7A 1Y9AA 3WL3A 3ZV4A 5DN6A 4YFVA 1DKUA 5I9TA 3ZXUB 5SYMA 3S27A 4P34A 3UV3A 1RWPA 5HR5A 3EIHA 2XT0A 1CP3A 1UCFA 3AY0A 3JQBA 1G8HA 3L4BA 2WZBA 2ZK7A 4DWOA 2PUFA 1T9BA 3VKHA 2C5AA 5LBIA 1I51A 2H48A 4Y8VA 1GR0A 4US1R 2A5LA 2KI5A 1N9GA 1ONSA 2F43B 2HT1A 3FDIA 1Y3HA 4L78A 2EWVA 1N6OA 3U56A 4KSYA 4JVNA 2EDCA 4CT0A 5DRTA 1TVKA 3BWXA 4KE8A 4WXMA 2HRQA 4R3UC 2YC4C 2H52A 3CKKA 1UBLS 3DA8A 4MITA 3BS4A 2IPAB 3LKBA 3BN3A 3OE1A 4OQMA 4TWZA 4JP1A 1XTSA 2Y1FA 3VNUA 4EGAA 1E7MA 4P2GA 2HFJA 3P32A 4ALIA 4ZDJA 1YOVA 4PGAA 5DGCA 4B2LA 2C2MA 4BQSA 5CB0A 2X13A 2W71A 2NUPB 3SF8A 4CMIA 1GAXA 4D0NA 2ZPTX 4JBHA 4JQCA 4W7IA 1N9GB 2F43A 3MM4A 3UMFA 3GLRA 4ZYWA 4B4OA 1P0IA 1PHRA 3ASVA 1YT5A 2A0UA 2CFOA 2K5UA 4EPRA 2PXCA 1JAIA 1MORA 1QS0A 1SXJE 2OLJA 3B1FA 3BULA 2FX2A 3CE9A 1FQKA 4URFA 3VKFA 1WKCA 3ZD6A 4RYDA 3EDRA 1TJ4A 1SCKA 1D09A 1U5BA 2VRCD 3OOJA 1AM4D 1II9A 1L7OA 4TWAA 4I1YA 4RWZA 3SVZA 2Q8QA 4F2HA 2FJPA 1PFVA 1SIOA 2D13A 2BY4A 5CJ2A 2CDRA 4Z99A 4EHFA 4KQXA 4A0SA 4KRFA 3P9SA 4LV6A 4IF4A 4RIGA 4UBJA 1QGED 2CHEA 4W1QA 4ZICA 1U63A 1OFUA 4LOJA 4AG3A 3KZKA 2GBPA 3PDCA 1JMYA 4R8VA 5CFNA 3DTVD 4ASUA 2OL4A 1SC4A 3N2EA 3E70C 2B2CA 3R0XA 3QUAA 4W99A 4B76A 4PN3A 4A6XA 4KYVA 3GC6A 4PF1A 3IO5A 3CH5A 5KVSA 3DUFB 4HQRA 4D0RA 2XCIA 1TJNA 3BXZA 3SLRA 3D6NB 3UGKA 1R6TA 4OQEA 1BSVA 2W0SA 1ES9A 1C7ZA 1ND5A 1XP5A 2Z0MA 5EMJA 1NGSA 3UANA 1UEXC 2ZP1A 4K0KB 4BECA 3H2BA 4CT5A 4C29A 4HZGA 1Z2CA 4NICA 5FADA 5G3ZA 4A2PA 2D7CA 2O0JA 1DCFA 2ZUDA 4ACBA 4CIDA 2BTEA 1W48A 2YQ5A 4D5EA 4XB6B 5A7HA 2OZPA 4K9MA 1OYWA 4DNOA 5G1OA 3Q85A 1WQ4A 2EJCA 3V1KA 5FYQA 4DA0A 4WZBE 1KO5A 2LIVA 2QPAA 4QXMA 2FSVA 3OIUA 3ILSA 1EB9A 1ORTA 4PZ0A 1G5RA 3FZYA 1T8WA 3QA9A 4JVMA 2QLLA 4HXEB 4HGPA 5FLXA 3ZEIA 1TFRA 1XK7A 2CNDA 3EXFB 1II8A 1G63A 3BGIA 4Z8YA 1VE5A 3B1JA 3WOVA 5AI6A 5ECDA 3RTEA 4EQZA 3UUFA 2CNKA 1A4IA 3PQ7A 3FPFA 3VISA 4A0HA 1U9JA 2DOKA 1KYXA 3FSJX 5EWMA 2ZE5A 4LFBB 2ZT7A 5IDYA 4RPIA 5DW3A 3OU6A 3PFWO 4HLCA 3TOVA 2ZWVA 4BNDA 4BOYA 1GRVA 4Y1GA 1KY4A 2H65A 3P2IA 1LGYA 4PV7A 3JQ6A 3FUWA 3LDAA 1RI2A 1CULC 1FW6A 4IYJA 1UOQA 1OXBB 2DKOA 4CNQA 4II3A 3PLAE 1SHTX 2AK2A 2AKYA 4LXIA 5JQGA 1P7ZA 1KVRA 2X3FA 2VDKB 2GD6A 1A4XA 3C5WP 3WDSA 1ZSNA 1W93A 2DC1A 3EN0A 3PI6A 1HM5A 4C76A 2XD9A 4XVRA 1HYEA 3L7KA 4MW9A 2V97A 4TMYA 3ZHZA 4R7ZA 4FHFA 5IKXA 1KZYC 3E48A 4XSVA 4IZ6A 5L3QA 3IT1A 4M1MA 2XDWA 5AR1A 3QW4B 1PWXA 5EESA 1MC5A 3ZD9A 2AQIA 1CZUA 2XNSA 4X24A 5BN3A 3VR3D 2OQ2A 3FPKA 3PQCA 3HR8A 3WHPA 1WQ3A 4BE7B 4LDPA 2G70A 3ITKA 3BA6A 4O29A 4TXMA 2M6KA 3SQLA 4D9JA 3UYLA 1ZINA 2FPIA 2BKLA 1M75A 2EF0A 3GBSA 1E9AA 2C4MA 2CCGA 3K0AA 1YB4A 3GNLA 3JD1A 3QVXA 5FOTA 4P4TA 4DMCA 4U0JA 1ULBA 2H9IA 3P5SA 3DAGA 4OG2A 1WPGA 1L4KA 4B71A 1VZ2A 1NMQA 1ULAA 3HDHA 4GT1A 1TVMA 3ZVNA 3A1EA 1E2MA 4YJGB 3AEXA 4DCGA 4JI0B 2EBWA 4CTOA 4YRIA 1UEJA 2I1LA 3HCNA 1P2VA 2F8SA 1O95D 1VJRA 2O20A 4AXBA 2PGXA 2XNDD 2WSLA 3GZNB 2FV8A 2GCOA 5A04A 3F98A 3N0WA 1SEPA 3JQQA 4M9CA 4B9AA 1VA5A 1PR2A 3DMTA 1UZUA 3G8BA 4IJKA 4WY5A 5E3JA 5FX2A 5LJLA 3OHSX 5HUHA 3H5VA 1GZVA 1CUYA 5F3RA 4Y0VA 2QX4A 2WTAA 3C1TA 1H6BA 1JQLB 1E9VA 2X1MA 3GGSA 3HA5A 3U4AA 1M7GA 3W4KA 4W6ZA 3ZQJA 4K28A 1ZKMA 2CL0X 3PVZA 4DN6A 2IP2A 2HI0A 2APJA 3OLCX 1X94A 5AJTA 1UANA 4U7TB 1JKJB 5NLLA 5FYDA 1FFEA 2ZYGA 4E3ZA 1IK6A 4CM9D 4X44A 2QR5A 4HDMB 4AP5A 1YQUA 4G2NA 1G19A 1BXGA 3RG2A 3IAS1 4FFDA 4YCJA 1MNQA 1MX1A 3WI7A 4AU1A 4RNDB 1TUBB 1PP4A 3FTCA 5ICCA 4S35A 5ERGB 2GWRA 4AMGA 2JBAB 3K71B 3UXMA 4XWTA 3C3BA 3G7NA 3H97A 3BIJA 1JVSA 3FVVA 1XHFA 3OJEA 3HUEA 2Y1DA 2G76A 4LTDA 1FP4A 1OXVA 3R3ZA 4PEVA 4X61A 2V1UA 3DKKA 4WK6A 4CEJA 2OM6A 1YMVA 1DP4A 1DJOA 1LPBB 2VSFA 4GMXA 3OX3A 3PC2A 3CISA 3E8SA 4ZVNA 3QEAZ 1DBPA 1UC8A 1NNEA 3CNOA 2C8JA 2DBVO 3S6JA 1NXOA 1J7JA 1Q1GA 2P2NA 3GFPA 3KTAB 5CLGA 2ZWAA 1XF9A 5GONA 2QYSA 4D8VA 3D0OA 1BFUA 4GBMA 4IH9A 4QVIA 3JV7A 2C3OA 2QAGB 3FNEA 1GNPA 3M4ZA 3GZTB 1GNLA 1EFVA 3F6SA 2IEDA 5EY5B 3KB8A 1XQYA 1YBMA 2ZT6A 5HBRA 3V55A 1Z2EA 2OHJA 1T13A 4KQJA 2R6ZA 2IHTA 4Z2YA 2CKDA 2BI8A 2OV3A 2IYRA 2WILA 3O1HB 4I4NA 3GQBA 4W9NC 2PL9A 1V95A 3CZQA 3CWZA 3MJVA 3Q9LA 4LJYA 4U3JA 4D9EA 2IXFA 3I28A 3ICCA 4MVJI 5FRDA 5T4HA 4DR2B 2RGNC 4Q4AA 2KJQA 4K6KA 4UU0A 2L17A 5ADUS 5IU6A 3ZDZB 1WUHS 3WNQA 3A28A 1L5OA 2PR2A 3U37A 4FMCB 3HQ4O 2BR4A 4RNCA 4WUVA 1IWBB 3DLHA 1JSXA 3AY3A 3RH0A 1GUAA 2XOXA 5IAKA 1BXZA 2VH1A 1LSJA 1US8B 1V43A 1H0KA 1M1YA 2WUWE 4R0VA 4J1SA 5JH7A 3F5DA 3PUJA 5EFZA 2BFMA 5AQEA 1MO6A 2ORYA 5BW4A 4LI0A 2QLNA 1X3LA 1C9DB 1QGOA 3A4LA 3AXTA 3GGOA 1KP2A 1OKKD 2ZRFA 5IVDA 1FW8A 4WRRA 4N40A 3ZQUA 4MUJA 3IA7A 1N2IA 4P7JA 1Q7TA 2JLCA 1E3SA 1XZQA 1B73A 5THXA 5U9CA 1NG9A 2Y99A 1XTBA 1W36C 4CV1A 1PD1A 4YUZA 4JLNA 1VECA 1XZIA 1D4OA 2WKWA 3S5UA 3T7JA 1V4VA 3TRDA 3SVLA 3D1VA 5G02A 3CS3A 4B34A 1QDUA 4CE6A 2QL5A 3C5CA 3FJ1A 3IX7A 3M2PA 4B79A 1UFRA 4II7A 4OCZA 1SCNE 5FCDA 1ORIA 4QQKA 3SF0A 5BQ3A 3F9IA 1GRRA 3TLXA 5F2NA 2HSEA 4HP8A 2L42A 4P5EA 2OCPA 1W2HA 2XLBA 5FQOA 2AX4A 2FKNA 5JMOA 1M66A 2J9GA 4U8HA 2IELA 5L45A 5A0TA 3U4QA 4L9SA 1X9GA 4GX1A 4B3FX 1SU6A 2NSHA 3PBKA 1P60A 3GGCA 1LBTA 3ZWNA 2HU2A 2CVQA 1URPA 3TYXA 2P5SA 3A2MA 4JQYA 1Y6GA 2G09A 3IUPA 2BFBB 4AX8A 4CDMA 4ITRC 1H3EA 1OFIA 2QRUA 3O73A 4E2ZA 1YC5A 2VN8A 3RYCB 1AKTA 2O6LA 3UXEA 3MHTA 2A78A 2J67A 3K8YA 2PGAA 3U4DA 2H2DA 5JNVA 3T12A 5JD4A 1PG0A 4PG8A 3R3UA 4YAFA 2P2LA 4ZTBA 2FW8A 2QIOA 4AUKA 1CJMA 1OOEA 4F86A 2Q9AA 1GTL1 5DTRA 5BPFA 1WSWA 3BDAA 3LZDA 1MOQA 4GSKA 4C43A 4J16C 1Q15A 2VJMB 2ZYTX 3LIIA 5BW6B 4F3RA 4G84A 3G8AA 1I13A 1F8YA 9LDTA 3TZKA 2Z56A 3K0CA 4DEVA 2P9EA 1DIGA 4FNAA 5G4KA 3NXSA 4RVUA 1F3LA 3DHVA 5FNVF 3X0DA 1QRUA 4OHYA 1J21A 5EWJB 3ESZA 2P2SA 1GZDA 3JWIA 2C07A 3B85A 1TAGA 1YB2A 3B9RA 4UE2A 2CMDA 4Z7NB 4O4LB 1I6LA 2PGOA 3EGVA 1I2MA 3K32A 1H3NA 4WERA 4QGSA 2C9MA 2AQ8A 3F1LA 3SM9A 3Q7TA 4EEXA 4PSKA 4C4PA 2FAXA 1FSZA 3ZLJA 3O2QB 1P72A 2Q27A 1I0ZA 1FFXB 4H6XA 5AW9A 4DRXB 2VZ8A 3MT9A 2OXRA 4DE5A 4BFUA 5JD5A 1V8PA 4AC9A 3U19A 5HKKD 4DT1A 4YPOA 1KDPA 3OFNA 1R9NA 2X2PA 2Y0DA 4DIDA 1U2SA 1XGKA 2WIDA 2WUDA 1NY6A 3QFSA 2R6HA 1NLUA 1ONNA 1ZM7A 3I8OA 5G40A 2FFRA 2O7RA 4RAQA 2VBCA 4OHWA 3KT8A 3MN1A 3EQ6A 3QTTA 1ABEA 1CDEA 1N2XA 3JVVA 4IJQA 5AJWA 5HJ5A 3G02A 1C30B 5IHXA 4B09A 1G1AA 1L3CA 2GXAA 5CYPA 2X5JO 1KZGB 1RU3A 3DV0A 4Q15A 2J3JA 4F4CA 3N0XA 2P2CA 1DGQA 4WEQA 3QVMA 4M54A 2PXAA 3I04M 3T61A 4B75A 5TJ9A 1J0CA 3OF3A 4MZDA 3JTMA 2DMRA 4LIPD 4BMZA 3EAQA 2O23A 1LDMA 1R8JA 5IJ9B 4UHBA 3B8EA 3BTVA 4FGWA 4OKSA 5KNBH 3DZBA 2VXBA 3H5RA 1RM4A 4GOXA 2SBTA 4BKMA 4D3DA 3M6MD 1I1NA 1EM8A 4WOPA 3G9XA 4YCBA 2D0DA 4YLYA 2CK3D 3R7FA 2ZBDA 4Q34A 2P2GA 5E9QA 3RS5A 1JLLB 4L28A 3O2JA 3K9BA 5CT8A 3UH0A 1XR3A 3ZHUA 1I0LA 1ZD5A 3FZNA 4MPJA 3ANTA 3IP7A 2NU7A 2EKBA 3M6AA 4HFRA 2WF6A 1XHEA 4XSHA 1IHXA 5ALRA 4EJ0A 1ZKDA 4MQBA 3RRNA 3BWBA 5CFPA 3VDXA 2N9UA 4QUDA 2Z2JA 4ENTA 3D2LA 3O38A 1A4UA 3M3HA 4NBKA 4WLVA 3S55A 1CV2A 1YUBA 1PGJA 2GPYA 5JT1A 1KDOA 2FSGA 3L1VA 5JWOA 3PJFA 1ZD8A 3FOCA 2PZLA 3BIWA 4OL9A 5CT9A 5FWDA 3PWSA 4UFOA 1RVDA 1U3DA 4GXTA 1B15A 4BGUA 4B5KA 2QTVB 3G59A 4BV3A 2HRRA 2V6FA 3ZQ6A 4IIJF 2OCIA 5LC1A 4Z49A 2ZR0A 1CS0B 1LBEA 2CXXA 2ZTUA 4R1NA 3QY0A 5AVUA 1PS0A 1ZL0A 3KYCA 1XZPA 3IP8A 4EG0A 4RHTA 2YOHA 2R8PA 3DGFC 3TOZA 4FMDB 4L0CA 4AMVA 3SHFA 1RZRD 4UCFA 1AUQA 3USZA 2JEZA 1ILWA 1E6EA 1TMKA 2TMKA 2WTBA 3LLMA 3PE3A 5KYXB 1P29A 3A04A 4FHDA 2TSYB 4HB3A 1HQKA 5EUQB 3ASUA 2I65A 2GO7A 2I2FA 3KYJB 4M36A 4UEKA 3TJRA 2QRQA 1ODLA 4ZOQI 1BU8A 3ZY4A 2Z1DA 3FCYA 1JU4A 1PHPA 4LOLA 1V6SA 1QFMA 2C04A 1QB7A 1RJ9A 1VA4A 4R9UC 3MB5A 1MIOA 3BBLA 3EC7A 2WY2D 1Y7HA 3RBVA 1UBCA 1Q50A 2I76A 2JAPA 3VJLA 3AR8A 4J7AA 1F8GA 3X3HA 3TQTA 3GAAA 1XMVA 2Y1XA 1IMJA 3GAMA 3QWFA 2HNBA 4FZVA 3O4VA 3WIVA 1Z0SA 3WB0A 2D5IA 1RHJA 1WCYA 5JH7F 4LJ6A 5IF3A 3WGOA 4QUJA 5DSZA 4DLBA 2PAAA 1P7YA 4OSPA 3PQ2A 4V02A 1E1QD 2XUIA 2O0LA 3VH4A 4KV9A 1DUSA 4BP9A 5ALJA 3RF6A 1GHTA 1DC3A 1ZOSA 4BL5A 2YRFA 4QO7A 5EIBC 3UV6A 1MO2A 1GT91 1RLIA 3K0FB 4MRMA 2VP6A 3WFJA 1INLA 1HH4A 4EKGA 4IQ4A 2IPLA 5AJXA 2PBRA 5D3KA 2PX2A 4IIHA 1AVTA 2BV3A 1YZKA 2IXEA 3E7WA 4QD3A 1PVOA 1F51E 2C7QA 3TSCA 3GFSA 2FB9A 3MWFA 5JD3A 1D2GA 3V8QA 2GEUA 3OUTA 1PR5A 1H6AA 1LWNA 2DGDA 4PTLA 4LC9A 1FMLA 1KHHA 2X77A 5BVHA 3M6UA 4Z54A 1Z6AA 4K87A 3T7EA 2OY0A 3U80A 1FLDA 3II6X 3Q2OA 4JI6B 1OREA 3K4QA 3NEYA 1NLFA 4AKHA 3CB4A 3ENQA 4MVJP 1K6XA 2Y0CA 4BVJA 4IJMA 4D2IA 2ZDHA 2VQSA 1OROA 2CK3A 2AOUA 3OJWA 5HJ7A 1GPWB 3HYCA 3NHZA 1ZRSA 1L7RA 4JB8A 4O1HA 1UJ6A 4Q1CA 3KTOA 1RHRA 5CEFA 1P9LA 1Q91A 3Q0EA 4MV4A 2WWRA 3OWOA 3EZXA 3TBFA 3PNMA 3JW8A 2ESRA 5IMSA 3D1JA 3B6JA 4IHJB 3FDFA 1P1JA 4HB4A 1PDWA 1GPNA 4P08A 3R09A 1D04A 4CBVA 1YVRA 3D3WA 1BS9A 3PHGA 4I7EA 4M9XA 3N2KA 4YLEA 3T41A 5LYJF 1YRLA 3H8JA 2PRJA 4Y67A 2C0PA 4GGPA 4UASA 2GAOA 4FVTA 4YAKA 2J3EA 3E3MA 4KQKA 3O2NA 1VG1A 1ODTC 5C52B 2XOKD 1YA8A 5ENVA 4M9QA 4U39A 2BGUA 1GZ6A 2FWAA 2RMKA 1CZRA 3R3WA 5E6UB 3RJMA 1FQOA 4BVBA 1RXVA 2JGAA 2VPIA 5JJLA 4ZANA 3WDKA 4IF6A 4F84A 3EXEB 3F71A 4Q5IA 2HA7A 3QXHA 1Y8AA 2K2WA 3ROTA 3VKWA 2OHIA 1EX7A 4R1LA 1BJRE 1XLWA 4DWWA 3HHPA 5F7JA 4TV9F 3TL2A 2C88A 2C29D 2BSQA 1XT6A 3OQIB 1GZ3A 1RXSA 3C8UA 4M0PA 1WTCA 1HTBA 3QV1A 4FYKA 3GEMA 4C4SA 4CCYB 5ALSA 1ZR2A 2D0PB 3DE7X 3EFBA 3PK0A 4TM7A 1L3BA 4U4AA 3W9YA 4B47A 5FWXB 1V37A 2H7YA 3AF2A 3J81k 2AUNA 5C7YA 1GQ2A 1U1DA 2B8WA 1M67A 4L0QA 3T3IA 1TJ5A 4AZWA 5HWSA 1NA5A 3KEMA 3UENA 3AWIA 2R1TB 3F5MA 4M0MA 2NU8B 2XUJA 2J09A 3WGUA 4UHHA 4BWYA 1FP4B 1P5HA 1OY1A 4TWBA 4QAQA 3M1AA 3O74A 1P1IA 2GEKA 4BO9A 4GOLD 4EJSA 2XVAA 3HNOA 2F59A 4WCFB 1FNBA 3TXYA 4RTQA 5G4KB 3DGEC 1Z9BA 2NZ8A 4A15A 4WN3A 1KK3A 2YZGA 4NATA 2PA0A 1PBNA 3UPTA 2QW0X 4FGZA 4NBWA 2ST1A 4OU4A 4P4GA 1M6VB 5IW8A 3RRMA 3ZXIA 1ZI9A 2H1CA 4IJ5A 1TX4B 1ZM2A 4DLSA 4OD0A 3KQLA 3FE2A 3FH0A 3SKVA 3UT5B 1DO2A 1JECA 1M2VB 1WNFA 1MXFA 1Q11A 4L95C 4YQFA 2PUWA 2YHBA 1TQ8A 2ZIUB 1DARA 3W6ZA 3ZZTA 5CBPB 5M04A 4ZJPA 4RTJA 3OO0A 3USES 1HI9A 3IP3A 1O1YA 3QF7A 1MU0A 4QTXA 4PWYA 1XTPA 4Y6PA 1YE8A 3ZHBA 5JBIA 4G4SO 2P6RA 2RH4A 2D1FA 3DFUA 3IBTA 1GNSA 5E8JA 1AQLA 1Q44A 3IUJA 4UUBA 4DCNA 2Q2WA 4HGQA 1VL8A 3PWKA 4RKRA 2IWRA 1QFSA 4AL4A 5T3YA 3OTHA 1A5BB 2EKZA 4BP1A 3HEMA 3OQBA 2A3RA 3RU2A 1ZQ9A 2I4MA 2JIQA 3K0BA 5JPCA 3L7AA 3VYRB 1NJ5A 2YNMD 2W2LA 3J7AC 4C30A 4ZMBA 2IZ5A 1NJ1A 1NRIA 1R1DA 1RAHA 4KLCA 1GPKA 3KT6A 4MIEA 4BP8A 3OMLA 8ADHA 4OO3A 1JFSA 1RWXA 4PSVA 1YGPA 3CMMA 3ROFA 1QRAA 3GFQA 5F2EA 2IPMA 3FX2A 3LOPA 1VE6A 3OIFA 1NLYA 4L07A 2AV6A 3PT5A 4N65A 3EJWA 5TV2A 4ILKA 1RPJA 4TXHA 3HFGA 4G9GA 4DLPA 5BN5A 3A32A 1U65A 4UUNA 1CEQA 1TLFA 2CJFA 4JLOA 1UL1X 3JQRA 3JAMA 1FDRA 2Z8YM 1UC5B 4AF8A 3ZYZA 4BKQA 2OQRA 5ALHA 4I08A 1TQ2A 4KDCA 2FXIA 1MPXA 1NVVQ 2ZJ6A 4QDZA 3AVXA 1PJQA 1QVRA 4ZT5A 3A3PA 1CQIB 1WHTB 1DFIA 1G4AE 1P2UA 3Q15C 3R77A 5F77A 3ONDA 4ASUD 2XA9A 4EHIA 4O1MA 1WDMA 2NTNA 3HXLA 4CCYA 1FVFA 4QXQA 2AB0A 1NC3A 4YRZA 1QAOA 3LT1A 4WV3A 4CV3A 3UAGA 1PW7A 2JS7A 5H16A 4DDKA 1YQDA 5JBQA 3NB0A 4BUJA 4MRRA 5KQRA 1UKAA 3SOPA 4OIMA 1FJXA 5F98A 3GFTA 4R71A 2GPWA 3GGDA 1VPEA 1WXQA 2WINI 1CR4A 4LJKA 5H9VA 3T1YB 1XRJA 4MO9A 3BT7A 4X85A 1T6ZA 1WCWA 2BFCB 2D4HA 1D9XA 1S3SA 2AJ8A 4KHZA 4LYYA 4DQLA 3EEFA 1SC6A 2EU8A 1KZ4A 3LT4A 4URUR 1NC1A 2FPXA 4MQLA 4NAUA 1II8B 1J2TA 3OSUA 2ZYIA 3JQAD 1JU9A 1AA9A 3DMGA 3UTCA 2XZPA 4RKQA 2FZKA 1ITZA 1JDBB 1MQ9A 1QR2A 1GJRA 3NM4A 4OGKA 1DPFA 1QYCA 3Q72A 4ZMRA 4YJ2A 1RXUA 2F3RA 5IBQA 5FA6A 5J58A 4HC4A 3BHNA 1GPAA 3RLIA 1CHDA 2IVZA 1Y1SA 2IZ1A 3E4CA 1QE0A 3IALA 3R5XA 4FK8A 2RI0A 3L40A 1HQYE 2ZAGA 4NK5A 5DWVA 3GLFA 3R8XA 3KQHA 3Q7SA 4LE1A 5K51A 4GUAA 3N53A 4MIOA 1O5IA 1A8UA 2WWHA 3CA8A 3ONWA 2ZXUA 2YZNA 1WABA 5ARBA 1JIKA 4MPPA 5AH0A 5A3VA 5DGDA 4CEJB 5C8XA 4Z0TA 2PDAA 3CB2A 4U9HS 4GL2A 1OFGA 1OX5A 2Q2VA 1VFPA 2C7GA 2FEOA 2ADFA 4DMFA 3MC1A 1XZJA 2ZVDA 3HJRA 4J0GA 1R5NA 2PLNA 3F96A 1JYSA 1T3GA 1OAAA 4Y2HA 4KYTA 5B6JA 2YDYA 1XTUA 3SX0A 3HN6A 1YZQA 3UT5A 3DHNA 1PS9A 4WXPA 3QJYA 1MDFA 5D2CA 2RCNA 2XB4A 2XNHA 5L6LB 2ZBVA 3IV7A 3KDPA 2C1EA 5B12A 1YHZA 5HG0A 4CLRB 5HRCA 3LUCA 1NBMA 3I04A 5DGXA 4XGKA 1OWMA 4ND7A 2CSXA 2HPHA 3V34A 4HV4A 1KWGA 2HH9A 2VAVA 1VBMA 4W82A 3TEJA 1ZU4A 1IY8A 4EPXA 1WZ2A 1T3LA 3GF4A 3MJFA 5A4AA 3CO0S 1CEEA 4CN9A 1D1TA 1YQTA 2AN4A 4OLJA 3ZDRA 3JQGA 4KQEA 2P6OA 5LQUA 1P2TA 2P9GA 2IL1A 2XWSA 3L1KA 3SSMA 1E94E 2DTXA 4BGDA 1YRYE 2BGJA 2HWYA 2W6PA 4WKBA 3ZJVA 3DF7A 3RD5A 3KAJA 2IOFA 4O2AA 4RK7A 1GDDA 5GV7A 4D3SA 4Q1VA 3B6IA 3E3OA 2BEVA 3MWJA 4MV5A 1B93A 3QHQA 1IH8A 3K2EA 1C8LA 1TQ4A 3TW8B 3ZKAA 4DCMA 4KRXA 4EB3A 3ROPA 2N1BA 1T2EA 2WAOA 4QFMA 5EUBA 4Q3EA 1Q7CA 2ZI4A 2EFCB 1RRKA 2MSCB 1EBBA 1TM5E 3STHA 1XAJA 4OK6A 4X84A 2HL6A 4K9LA 1N5DA 4KQ2A 4WIAA 3Q7PA 5AK0A 2R7NA 1JHOA 2CVZA 5IDWA 4F04A 3RV4A 5SZJA 1G20B 3LGXA 1CHNA 2ZJ8A 1H65A 1G8AA 4J94A 1SKAA 4ZC8A 3EA4A 1ULHA 4WMLA 3D43A 4MGKR 3NQ41 2ZIZA 3ZDFA 3WHKA 3UIEA 4X1KB 4F72A 4JV5B 3EVTA 1VBNA 1XWWA 1ZY2A 3WWCA 5U4XA 3FKJA 2X2EA 4QYXA 2Q5IA 1L9KA 1NQOA 2PS1A 5AHOA 2V96A 3ROGA 3CKMA 3E9RA 2R8EA 4CQJA 2GZHA 1E2HA 4GBED 2J85A 4N3BA 4J91A 1W25A 3R3HA 1SG9A 4X7PA 3BWDD 2C4KA 3B1VA 3W90A 2M1ZA 1NNI1 1JR3D 4PIPA 5F4BA 1VDMA 4RY2A 5D1HA 3DXYA 1ADJA 2AOWA 2CZGA 3DKIA 2C59A 4AWBA 5B6PA 2Y92A 3GEHA 5D6OA 4OP1A 5E2IA 5EHQA 3FWKA 3TDKA 2ZQZA 3LSYA 2FRDC 2IPOA 1RACA 1L5YA 3DLAA 1NKVA 4RL4A 4BGIA 1CQIA 1WHTA 2YV3A 4GYWA 4U6SA 2JIZD 4BKRA 4BASA 1GITA 1IL0A 1TMOA 2D2VA 2UYQA 2PUVA 3I52A 3MINA 4GP7A 4H16A 4YJFA 3E3NA 3NBFA 2QTWB 4NCXA 1Z5PA 1VLQA 3OKCA 4MI6A 3JPWA 1ZVJA 2VPQA 2CKMA 1D4AA 1JDSA 4Y6LA 2W98A 2H1SA 1YQ9A 2RGDA 1T29A 1TXGA 1CW2B 3IEUA 1WUYA 2FN9A 3ZU2A 1OU0A 4OHUA 1ZL2A 1A8HA 4LGCA 4F1KA 1KO8A 1N0WA 2GRUA 4PSDA 5JYCA 4F96A 4N7BA 3O3MB 2JAUA 3B60A 3W0LB 1CS4C 2ZSHA 5GPBA 4ATNA 3QBDA 3L8CA 5F9HA 3UMGA 4PG4A 4E5KA 2FPSA 4LSMA 4X63A 4CLDA 1AU9A 1EP2B 5FEUA 5DYGA 1ACLA 1VHWA 1U2GC 3G2KA 3EGCA 3PJEA 2ZBFA 1JT2A 5AESA 5DTMA 3ELUA 1VCHA 1H9CA 2EG5A 1Y7IA 3ENNA 4UEWA 3AYXB 4KGDA 1MAWA 3RUHA 3F9CA 1NN0A 1VCIA 1BFDA 1TPZA 2HM7A 1JFFA 2O4CA 2QUAA 3K0FA 1ZGAA 3OPVA 1EJBA 1M1YE 4I55B 4LHVA 5FTNA 2YWHA 4CV2A 4WXEA 1ZD9A 2IXBA 4V0QA 4XJVA 3IQHX 4C7OA 4Z4CA 1XU9A 3ZNPA 4QHSA 2FVYA 1QKJA 2JGEA 4NU6A 4H1HA 3EPJA 2KLBA 2O2DA 4NCKA 5AVVA 3IHWA 2B5OA 3PNKA 1OMOA 4HLNA 3OQPA 4DJEC 2MMGA 4FYMA 1U0LA 3OFVA 1OLSA 1FXWF 2HIGA 2J33A 2RBGA 3NR2A 5EINA 4F3TA 2PZ8A 3KO8A 3A8TA 3B5JA 1KI6A 5IBPA 5FI3A 1XYGA 3ZWAA 4LMPA 1RJ9B 4KCGA 3X1YA 5ED0A 1D8AA 4YXWD 2CDCA 2ZSAA 3MFYA 2HQBA 3L6RA 3H2KA 3KQVA 4KWEA 5AT1A 3T5AA 2JFQA 1VB5A 1RI1A 1PFGA 1S8OA 3OZDA 1DRJA 3ZCSA 5LD2B 1XAIA 3V4PB 3JARB 5FAKA 1X2EA 1MX3A 3F2VA 3WC4A 1J9GA 1GNTA 4NBRA 2A0WA 1Z36A 1VRVA 2PL1A 3CGGA 3MXTA 4RTOA 2J3KA 4DLXA 2OORC 1SKYE 2OR3A 4G5OA 5BN1A 1G3UA 4RZ2A 2JLYA 5JPDA 1UQRA 2OMEA 2CLLB 2GPBA 1H5QA 2V7QD 3LX8A 4LNAA 4TKUB 3U17A 4WXYB 3VR4D 3K70B 1SK9A 4IZOA 5CM8B 3INNA 1TRHA 4WLFA 2PSSA 2IC5A 4BJ6A 1WE2A 3F4KA 2C2ZA 4LVUA 2BHRA 5BY2A 2YINC 1IDN1 3L8MA 4KX3A 1BXRA 5JAZA 2PNJA 3UHFA 4J90A 3SE7A 1FMJA 5L7TA 5CCXA 1XD2B 3UHAA 3OUZA 3WB1A 1IMOA 4DR1B 3ZS9A 5LZ9A 2HGSA 2CFCA 4R83A 1WDLA 2EIHA 3BE6A 4EPWA 4YMVA 1XMXA 1IU9A 3DH0A 3WA6A 1EHIA 1WPQA 1GPLA 1YI1A 1Z16A 2MYTA 3AIOA 3LBFA 2P4SA 4P7FA 4X7MA 1W8IA 2ZXFA 4L9AA 2PCLA 1LDNA 5JE8A 2YASA 4KOAA 1VHDA 4UCQA 3T94A 3WLIA 2GF0A 3CLUD 1KJIA 1DJPA 3E9EA 1M8PA 4V0NA 1PZEA 3NYWA 3A4VA 3JQ9A 1WV1A 3MNFA 3T35A 2Q2OA 4KUEA 2DZDA 5TY0A 3QIAA 2NSDA 1U8FO 1RR6A 2YDXA 5E9AA 5DASA 3QYPA 4WNYA 4WZAE 1N6RA 3C3CA 3LQQA 2WHEA 3HJAA 4QGGA 1U3VA 5KTMA 2YBDA 5F52A 4WUTA 4UD6A 1PFUA 1K7FB 3FMGA 2V9ZA 3PB3A 3PXBA 2IUUA 4CF3A 4AYWA 3QM1A 4FONA 1U0JA 3RHSA 4B0PA 5EIWA 2EJBA 1MZVA 4IHJA 2F3SA 3DWEX 3FMPB 3BH7A 1USWA 4G36A 3UUEA 1V9CA 1GGMA 1K8YB 1T34A 4TXJA 3T8YA 5FI0B 3G1UA 4TPKA 1Q7BA 2G9VA 2X22A 3QVSA 4POAA 4BMVA 2LXNA 1I14A 1BGXT 3AR7A 4JZYA 3OZAA 4OB8A 3KKQA 2I5PO 4Q7QA 4J76A 3RQSA 1ICIA 2VZLA 1NX9A 4LOHA 2BF4A 4P3OA 1GWNA 5ITZA 3Q6IA 4ZZ1A 1E3EA 1ZRHA 4QARA 3FOEC 1EX6A 2HLDA 3PPIA 2Z30A 4H7EA 4JYPA 3NV7A 2IV7A 3UWMA 2QT1A 5B2EA 5CNJA 4C4AA 2SCUA 4QOFA 3BREA 1AUPA 3CT4A 1NKTA 1QPZA 5EQJB 5A7GA 2HW8A 3F67A 2IIVA 3L6CA 2H3EA 3D0KA 4O4LA 2WSMA 1U9CA 2GNPA 2PKQO 2O9JA 5GVRA 4HVLA 3QX8A 1LQUA 2WD7B 2ZJAA 3DVSX 3L7DA 4OGWA 4KWCA 2PWZA 2VCEA 3W9BA 3GEDA 2ZAYA 3B1KA 1AKWA 2RC6A 3SDSA 1OXXK 5BWMA 1GARA 3E1GA 3LAWA 2WLSA 3WZ2A 1TYDE 1M1NA 2ZIWB 4UDOA 3G17A 3I34X 2V98A 2OVBA 1HQCA 1V8DA 1ZGGA 1X14A 3TDMA 3T4UA 2IZOA 1KBQA 3H2IA 1WBDA 2C5SA 3AERA 2QM7A 3GYBA 3A9TA 1DAKA 1AXEA 1S2LA 3IQWA 2P3QA 3JZMA 4WZBA 1L5HA 3VNVA 4GD3Q 2EW2A 4QG7A 4LBYA 5EHGA 3R7WB 4IDAA 1U04A 2B2XA 5H8WA 1AXGA 1T4DA 3G89A 3L7MA 2HADA 4C4TA 4OLBA 4AQDA 4YP0A 3VU1A 1XVUA 2PLFA 2DWQA 4OP2A 4EJ2A 3V4RA 3WKAA 3VYUB 4HL6A 5LJIA 4IVQA 1SBQA 1Z7BA 1COZA 4LCBA 4PX9A 4M21A 1XLTC 3T5TA 3EZ9A 4J4BA 3PRYA 2PMDA 3EIUA 2FPOA 3GJQA 3JTEA 2ZE8A 4IDEA 1PK7A 4OUDA 2XMBA 5E3HA 4F6RA 3U4QB 4ZAYA 3WNZA 3R75A 2BGTA 2C2XA 2PLWA 3U4IA 5TARA 4YRSA 5LIRA 3CTPA 4IOJA 1I5OA 4HPWA 2RGGA 1U1FA 1UMDA 2ZROA 2Q3DA 4NNJA 3KZVA 3QXSA 1J7KA 5H80A 5IZCC 5IKEA 4DREA 4K3UA 3KFXA 4I1OA 1L4NA 1EESA 2DUMA 3H2YA 5EERA 2I33A 1HURA 4C05A 2GKOA 3TNDA 3ZI0A 5A5EA 8AT1A 5IULC 1M1UA 2CXNA 3LRTA 4Z3KA 1RYYA 4RKEA 5KWEA 3KSMA 2FPUA 2XYGA 3W6PA 5C5IA 1A7KA 5AKGA 1MBZA 1CJUC 4LPKA 1C9YA 2AJLI 4ZJYA 1Q1EA 3LU1A 3MSCA 1UXGA 1S8AA 2O2HA 1QPBA 4P35A 4S1WA 3CEJA 3RRXA 3A1UA 3S2GA 5FJJA 3ZTTA 1HLGA 1XNHA 1GVHA 3FCSB 1R64A 2XJ9A 2FQXA 3KP1A 4PGGA 2HCRA 1HUQA 4GBGA 1SKQA 2Q3FA 4H7PA 4M0CA 4BN4A 3ZC3A 3ONEA 2CJWA 2YYAA 4MMZB 2KHZA 2D06A 3LM8A 3R0QA 2PKQP 5F3DA 3A10A 5EXTA 3VGJA 1YKSA 4BCDA 1KJZA 4A8HA 1Y3IA 4QLBA 2VYFA 3FGZA 1SU7A 4YT5A 5ALOA 1FQWA 1ZVKA 2IZZA 3FFWA 5GWXA 2AGVA 2FW6A 3RC9A 3U3XA 5IT9A 4RJJA 1K8XB 4F91B 3GFBA 1FYDA 5CDFE 3HCAA 2FR8C 2HIHA 1AN9A 2B4TO 3IVMA 4TUYF 4DVGA 2WAXA 3Q5GA 4FFNA 4S04A 3B3QA 1ORDA 1EDOA 2B35A 2B5VA 4QRHA 2PEZA 4RZUA 4XM2A 2IYPA 3WO1A 4MRSA 1JG4A 3W9UA 2B1IA 3QE9Y 4FEEA 1CUIA 5TVGA 2VYCA 5LB2A 1I0IA 1VIAA 2HLDD 3CINA 2W37A 4WNAA 1NFFA 4O4HB 1MJGA 1V71A 3QKSA 2ZRHA 1V1MA 5C1DA 4RK6A 2PPLA 4E0BA 5ALGA 2YZ2A 1B0PA 2HHHB 4MSUA 3K9NA 1Y5MA 3EWIA 2C77A 2QYOA 4K88A 5AK3A 4DSNA 4Y3UA 2BZ0A 2VUTA 1K9SA 2JGKA 3VHXA 2PZAA 4D9KA 2P9FA 2V7EA 2RGWA 3TI7A 2H1VA 3N2ZB 1U7TA 1ZH0A 2H5EA 2UUPA 2BLLA 1QUEA 3N05A 3ANYB 3STYA 5KNDA 1PJTA 3BZUA 3RC2A 3BK2A 3KJHA 4I9GA 2Z5FA 4N49A 3DV2A 4H77A 2J30A 2VOJA 5FO1A 5AQ1A 5A4KA 2WT9A 4FFVA 2QQGA 3I9KA 1W29A 2YIDA 5G1NA 3SK0A 4C4XA 2I9KA 3PENA 4HX2A 2QYHA 1ZRMA 1QG6A 3CQ9A 4H18A 3TSWA 3G6WA 3KLMX 4CMKA 3KSDO 2X0NA 2G72A 1RYDA 1ZWKA 3N2LA 4NJEA 4RTMA 1PV2A 4Y2PA 3X1ZA 2HEGA 4KR2A 1KQGA 5MFPA 3RRBA 4OHZA 5HF9A 1DIOB 2JFWA 3EB9A 3FWPA 621PA 4OF4A 3D59A 4S12A 3GVCA 2TECE 4O0MA 5TT0A 4HYTA 5J2UF 1F6WA 4Q3NA 1T5HX 1WL8A 3K5HA 4XIJA 4O4JB 4URWR 2J3LA 2GZ1A 3AUXA 4L2IB 3ZGNA 4Q6WA 5JWHA 1JQKA 4XLLA 1ZUD1 2AIRA 3FGOA 4N6NA 3WYBA 3WIUA 4WEOA 1S3FA 4KNYA 3KQTA 3BGOS 5H02A 1W5FA 1FUEA 3I0ZA 4MQUA 3KHSA 4FKZA 4DEXA 3RYCA 3IOEA 4PY2A 1LB1B 1QVVA 2OFWA 2QUZA 4F1WA 1VCMA 3HWRA 3MCZA 2F8LA 4YT2A 5JOQA 3V2HA 3CVYA 1HZZC 5HP4A 2FSUA 1F9AA 1NE2A 4L0MA 4A8PA 4DZTA 1FZTA 2JKZA 5I45A 2CFIA 3WIDA 1KEPA 1YA6A 2HEIA 1NFQA 2WFLB 5AXBA 4QUGA 2WRZA 3DAFA 3NS7A 4CM3A 2JD2A 3IEPA 3QVVA 3UKOA 4RJKA 3D3NA 3DB2A 1SRQA 1ZN7A 1CIVA 2OZLB 1Q95A 4YVFA 2XQIA 2WJVA 3SQMA 4GPEA 5L3VA 3HBJA 2XUAA 3UJBA 4B1FA 4JS0A 2YIMA 4JYCA 2AKAB 2G5PA 4G0NA 3NIWA 4FI3C 4JENA 1LUAA 4JVSB 4HEJA 2PYIA 5C3UA 4I5IA 3WRWA 2JLUA 4XH9B 1DL5A 2I1QA 4YALA 1VC2A 3GCZA 3I2JA 4GR9A 4L8GA 4Q7KA 2X8LA 3PYXA 4AIRA 4YT4A 3N76A 3B12A 3VAYA 2PRIA 1PFYA 1MT3A 5DSXA 1YC2A 1G8KA 4ZOEA 2MCFA 2JBAA 4EOGA 3T38A 4L5BA 4QYIB 4XEHA 5ECYA 3QBEA 3WGIA 5E8RA 3BFPA 3AR5A 4P53A 1ID8A 2ATCA 1HT2E 3LQFA 4HJXA 2W8BA 2XUHA 3T1OA 1SVWA 3JQAA 3WE7A 5JFOA 4Z4GA 4QYMA 4UVGA 5CBKA 3KKZA 1OLOA 2ZYWX 1UIMA 2PT5A 1SOVA 2XUOA 3U49A 2XMZA 2G4CA 3H83A 1FS6A 3L82B 4C07A 3L8HA 2D2XA 5IUKC 1EDDA 3PHHA 4XEUA 3CNBA 5EYPB 4IQFA 4OATA 1M7BA 5E1OA 3O4HA 5I7AA 3LCMA 4UATA 4KPEC 2FRDA 3SEFA 4YH1A 3DEIA 5K99A 5J2UA 3HU1A 1LS6A 4YTEA 1WW3A 1UKCA 1I1HA 4ZO4A 3RT1A 4AD8A 4EH1A 4DJTA 4KJXA 2CHGA 2UV8A 5KNLA 4OQNA 1NXPA 2QG9A 2DBRA 2XNKA 4FS8A 5JARA 4QHYA 4XTRA 3MGBA 4ZAXA 4C7KA 3EG5A 1WSAA 1LU9A 4Q01A 3RUEA 5TGZA 4RHCA 1V26A 3PL1A 5DM0A 5AVRA 4CHGA 4BMPB 4NG5A 5HFNA 2EV9A 5FNVB 4H7KA 3TPCA 5BV8A 2AZMA 3N2KB 3LX6A 1G5TA 2P8SA 2ZATA 4TMKA 4Z2AA 2YV4A 3BM5A 2IZ0A 3O75A 1WM1A 1XXHE 3S2SA 1NZFA 3EEYA 5JNRA 3EWNA 4KQHA 1ZUIA 3AEUA 3H11B 4RH1A 2DH6A 1GN8A 1I36A 3L8GA 4BU1A 1ZMXA 5LKRA 4EKEA 2PJRA 3AG6A 4RX1A 5FKJA 4ABTA 1U2GA 4I0WB 3B3AA 1CUFA 1NR7A 1Q77A 3S4YA 4A1OA 3D7NA 4BBPA 1MFZA 1B0AA 3G0OA 4ME6A 3M83A 2P62A 2SKDA 1P9NA 1FEZA 3NDPA 2DEUA 3L6OO 1GQOA 2WV7A 1MR3F 1E2JA 3EFOB 3MTAA 5JSYA 3TFOA 2O3JA 1T3HA 4Q9DA 1QTRA 1H4VB 1D6NA 3F8WA 4LFCB 1K8QA 2AEEA 3SJCA 3E5RA 3IAUA 1J2RA 2R1ZA 4TTVA 3TAHA 3TRIA 1P0FA 5CDHA 3U3MA 2HJWA 5ILOA 4JZKA 1UBSB 3D2CA 3D8UA 4M4SA 1DDIA 3TI9A 5K05A 3N0TA 1I2ZA 5KHLB 4EY4A 3CJTA 2ZIVB 3I5UA 3A6HA 3PC8C 1YS6A 3UKJA 1WHSB 4LY0A 1DTWB 1KEZA 4ETNA 3KZNA 3DEZA 3TOXA 4IHKA 1BX3A 1T4CA 3CUVA 3ZS8A 5L6MB 4AS3A 5ENZA 5JS8A 5JALA 3A4TA 4RV4A 2ODEA 3EXG1 1PV1A 1YUMA 1Y42X 2FPKA 2CN1A 2J3QA 2GUGA 1YFJA 2O8BB 4F5EA 1X7ZA 2ANBA 2C8VA 3ADBA 5B3AA 1DIBA 1L4LA 4F9GA 4RE5A 1WD7A 1W1IA 3CPHA 1QK3A 2BRUC 3CT6A 3TUIC 1SH7A 2FEKA 4RJLA 3GLGA 4DR4B 3WOHA 1P44A 3EHDA 3N28A 2JCGA 3O6VA 4MKIA 4QPNA 3TR0A 2H2IA 4I55F 4IUDS 4Q1AA 4XWYA 1CD5A 3KKPA 4R2HA 4B2PA 3PNOA 5EPEA 3H7AA 4UVEA 2R48A 2JASA 1SM4A 4NMHA 3VR6H 1UDAA 3A3NA 3DR5A 1UM8A 1HEYA 3B6EA 3CNLA 1SD2A 3E0XA 2IE0A 2XMCA 3GMTA 1MQAA 4D5GA 1RWBA 4L4XA 2ZI6A 4BU0A 2BHTA 3QKRB 1TGVA 4FBMA 3WYNA 3DLIA 5AIAA 3W78A 4W8HA 5E4YA 4CM8B 4XWKA 3OPYI 1P7WA 4K1XA 1SXGA 4CFYA 4N9QA 5DLYA 4D9IA 1F48A 3ISTA 1J00A 3AHJA 3F9RA 2VNKA 2P8JA 3GV0A 3IAEA 1SHUX 1YRAA 3NGLA 1SUEA 2HNAA 3NM6B 4OP3A 3I1IA 1J5PA 2D1YA 3PPWA 5GOZA 3FHJA 3ZE9A 3ZE7A 5INTA 5FT9A 3FHOA 2HJGA 1QK4A 2W43A 4PPGA 1ZRNA 3Q40A 3AK4A 5L3SB 3I37X 1KOLA 2JIDA 3ZJ5A 1SZCA 2Y27A 4NMXB 4D3ZA 5IJXA 1RAGA 4AJPA 1JJIA 2GA8A 2IGBA 1U2DC 2C2YA 1LCIA 2EYQA 1G59A 1KMHA 1UK7A 3AXSA 3SR0A 4EG8A 1JFVA 4UFPA 3SJZA 1R18A 1P1RA 3PUVA 5FP0A 1MJGM 1N5RA 4Q39A 3DVQX 3T9BA 1I7DA 2EL7A 1PFWA 2G82A 1LBHA 3GDFA 1X80B 3L7BA 1IZYA 3D1LA 3JWEA 3M89A 4Q93A 3A58B 2Z2XA 4JLUA 1N1MA 4B0OA 2DT8A 2X7XA 2OWEA 4AP9A 2PH7A 1IM5A 3AUJB 3NHAA 4PNZA 3KJEA 4UXHA 5EE9A 4OXKA 1SGWA 4R84A 1U7UA 4TTIA 4PG6A 3V9AA 5U4QA 4X65B 821PA 2QQFA 4INZA 3TM4A 1SRRA 1T43A 1NI5A 2WHRA 2F3PA 4CF7A 4QWWA 1FFWA 5CB4B 2QN7A 4IDGA 2JW5A 1C9JA 3O93A 4ZC1A 1T0JB 3MQ4A 4CIBA 2COKA 2WHPB 5DHSA 4QXOA 1QVZA 3NGXA 3VO9A 4HH1A 3HSSA 1LA2A 1R4NA 3EZ2A 2AJBA 4BFTA 4MKRA 4MYCA 1ZITA 4X8MA 2QXUA 1HMPA 4R8LA 2ZR7A 4U2FA 4NY1A 1YZGA 2X7JA 2ZIXA 2VT7A 4LJ7A 3TLBA 1FX0B 1E1LA 2I03A 5F76A 2IX3A 4KQGA 2AE1A 2Q2QA 4WBSA 4LCEA 1A8PA 1HYHA 4E6EA 2PBZA 5IAAA 4HS9A 4XIFA 1UBKS 3D3JA 5JXHA 3EZFA 3ZD7A 3VZBA 3KYIB 4WLNA 2EVWX 2P1RA 4KU4A 1FTYA 4GE3A 4H4CA 5E6UA 5EJ7A 2VTBB 1GEGA 5ALPA 2BBWA 1JIVA 5ULLA 4XDHA 4TVSA 4QECA 2GRAA 3COJA 3PQDA 2G40A 4WJLA 3HFSA 4AP6A 3C7AA 3O4GA 3MWYW 5LQMA 5KQPA 4P7BA 4IGAA 2C78A 3PHCA 1WMAA 1WXIA 1IQUA 2P3LA 1IG0A 3MOGA 3RNLA 1E1QA 4B4VA 4KKVA 1KGSA 4UJ3A 5KJ6A 2C7PA 5B1IA 2BMVA 3CZCA 1LW6E 3K1ZA 2G6BA 3PFGA 1AZSC 2OE2A 3PTAA 1HDIA 1DAMA 2AJCA 1JLSA 3BJIC 1CUEA 1ZXXA 2WQZA 4FOTA 3Q8KA 4AXXA 5ALVA 2VAPA 4JH0A 1SULA 3JYOA 3ED1A 4K3VA 2BFPA 4KK3A 1NJ6A 4BQRA 3PC6A 2YJZA 1V1RA 3LPNA 3NW9A 1XLTA 1NTOA 5TQ2A 3G5UA 1FU7A 3L02A 1EFRD 4ZTZB 4DAEA 2QROA 2YNMA 3D4OA 3K9LA 1S01A 3W5UA 5KYGA 4HSEA 4LXTA 1E1YA 2Y1EA 1CY0A 1HDRA 2CXRA 3HSYA 4HRXA 4RPCA 3B51X 3U0BA 3W8DA 4Q66C 1Z4QA 4U5XA 4KOEC 4YCCA 5JW6A 2JGRA 3BVPA 1E3JA 2WNSA 3HB5X 2B36A 1T8YA 1KVQA 1RE1A 3C6YA 4KVFA 1IEXA 4RH0A 4UCXA 4W7HA 3AL3A 4KN9S 5CR9A 2H0AA 3VMFA 3IIJA 1CVRA 3WISA 4ARAA 2ZUCA 2CB0A 3UATA 3EXHB 3NZEA 5I9IA 4YYEA 3NWOA 1BWSA 1FSSA 3F4BA 3TW0A 4PG5A 4WKCA 3LHKA 2P65A 1IJEA 1EG2A 1PO7A 3HP1A 3JVEA 4FJ0A 1CT9A 1QG0A 1WPRA 2GCIA 2YY5A 1RQNA 3LKDA 3WIBA 4XZ3A 4BMNA 3L1UA 4O4IF 4RUKA 1VE9A 2LP4Y 2VZ9A 3QKSB 4J29A 1PJ4A 1V25A 1TEVA 5FBRB 4CMEC 2BSXA 5B2FA 3TLEA 4DIEA 4Y0AA 1PJAA 5EJGA 5CDUA 1XQXA 2WTXA 5K0GA 2NG1A 2ACEA 3UF0A 4OFXA 1XA0A 4ZYZA 1UZMA 3PSAA 2XKJE 4LZNA 3ODPA 1R3DA 1BE0A 3K31A 3BF7A 3ILVA 4RPHA 1XYVA 4FD3A 4ZFNA 2NW6A 1VIYA 3DCIA 3MWEB 3WJAA 4D9MA 4U2BA 4TYYA 5IPFA 4D8WA 4XGQA 1JQDA 4Q21A 1XJQA 5CLIA 1G5QA 5AHWA 1OGYA 4BJ5A 4W9MC 1RYFA 3E7XA 4W6QA 4C22A 5A4IS 4EG5A 4FX2A 1NUSA 1H1LA 1W75A 4QUEA 4B3SB 4R1TA 3RFCA 4CVNA 1FS4A 1KZ7B 3GRVA 4M0LA 1O89A 3ZDQA 1EQ2A 1D8TA 4G8BA 3DMYA 2H1FA 4MQMA 1FPMA 1HYGA 1ZIOA 2QN9A 3MCTA 2PVSA 1H2RS 2N1MA 2VIIA 4UPDA 1LI7A 3WLMA 2BMFA 2I8AA 4LCJA 1RQLA 4W5RA 2GK4A 3VO8A 5DYYA 3NIBA 1D0SA 1NWCA 3UUWA 4DCJA 4RDIA 1XI2A 4ZU1X 3TVYA 2FJ0A 4RQUA 3HZHA 4BNJA 3A2LA 2ZBQA 3LQKA 4JLDA 5B36A 4OMDA 2O8FB 4QNNA 3V8EA 3HVHA 1ZDMA 2OBFA 1PKEA 2I7DA 4R4JA 2WZDA 4TV8A 2B1GA 1ZC4A 3NTXA 3P9KA 1TT7A 3FFAA 4X0EA 3VTFA 3QPWA 4J0KA 4NVRA 4TS4A 2NZXA 4OU5A 2ZTVA 4PLGA 1WP4A 2NYAA 1X9IA 3K6KA 4PSCA 5IKOA 4YCNA 3JAWA 3K53A 5HS6A 4ICIA 5LUAA 4IXTA 4CN8A 3W8EA 3K4HA 4Z9BA 4UM9B 2ZB3A 4AF7A 3FPEA 4AFNA 1WU8A 4FEGA 1P1BA 4TLLB 4LI3X 5AW2A 4K9RA 3QKWA 1Q0QA 2XYVA 2EZUA 1RRPA 2VOEA 3I2GA 3RYIB 4RESA 1LNQA 2HPVA 3L43A 3A27A 3BMXA 4RGVA 2FG5A 4CLXA 4CZ2A 4UFNA 4DLKA 4LF8B 4B3TB 3DULA 2JD0A 1HE1C 2ETXA 2VUIB 3QPAA 3L0PA 4XDYA 2NO4A 4DHWA 3FPLA 3HPQA 3GIWA 1M73E 1E99A 4HUJA 4WXRA 3VR5H 3OCJA 5IJ9A 2CVPA 2LTAA 1B00A 4UVDA 2QIPA 2ZS7A 2UUOA 3D64A 4YHHB 3PGLA 3NCHA 4L5AA 1XIVA 4GEGA 2GAFA 1OH8A 2VDJA 2O8DB 5CA0A 3KJIA 2RE8A 2VKTA 5CB4F 2AN5A 2O2GA 2W2NA 1YZTA 4GRIA 1BVYF 4PTZA 5EJ6A 1TIKA 1HE3A 1R4MA 2DKNA 1C30A 3GRYA 4CL3A 1UDXA 2Q6LA 4UPVA 5DULA 4TZ0A 4M38A 4E46A 2IS2A 1E9DA 3IJPA 2BJHA 3RC1A 5IWAB 3AR6A 2YWBA 4UM7A 1UXJA 3OZSA 4Y9TA 4CKXA 3EVGA 1FIUA 4PWZA 2IS1A 3ZCPA 1CIJA 2XNJA 1T1RA 2QM0A 2DHDA 4PIMA 1P4AA 3KELA 3UWDA 4XSGA 8ATCA 2GZDA 1C2YA 3PTZA 1YDGA 2PXXA 4MS1B 2XR1A 1U5AA 1I2DA 4IIBA 3W5VA 5A9TA 2QL6A 3WJ2A 2C7VA 4OYLA 3PFCA 1MC1A 3VV2A 1IQPA 4JJ7A 5FLEX 2VPYA 3RGGA 2XB8A 2QBYB 2QUHA 1X0VA 2OBBA 2FDCA 2RGAA 1KBZA 2GBIA 3U6KA 2YV5A 3GP5A 3GDOA 1D2MA 1C7IA 1QFJA 1MC8A 3FLMA 2IA5A 3KCNA 3O03A 5AM0A 3H5AA 5AJHA 4LQCA 4RMJA 1PT8A 1WR8A 3HFJA 1VI6A 4J16A 2QJTA 4LOAA 4KSBA 4WZAB 3V42A 2CLIB 1SUFA 4B3XA 1XTRA 4LE0A 5KAPA 2YOGA 2YJ5A 4DLWA 2QMQA 2QQEA 4HVCA 1KS2A 5FUQA 1TVCA 3AQ4A 3H13A 4NBVA 5EP3A 1NUTA 4YA6A 1ISHA 2I67A 3H2HA 2OV4A 3O31A 3VV3A 1WXFA 2J9FA 2I3AA 2Z8XA 4WOBA 2VNIA 4EELA 1AQJA 1RIFA 3I72A 2A3NA 3IV9A 3AJAA 2DQ4A 1QF6A 5NULA 2VP4A 2CE7A 2ZAMA 3J7TA 4RV9A 2ZTSA 4LF7B 3CKYA 1OBVA 3C1OA 3EJ6A 3P4UA 1UODA 4DR5B 1VMEA 2IYNA 4KTVE 2WKQA 2CZCA 4A5OA 1J39A 4XPIA 4EJMA 3U4MA 1X7XA 1U28A 2A2ZA 3PUXA 3MWEA 3RRFA 1E8NA 2YWFA 1O3YA 2X5KO 4UBKA 1ZUWA 3N7TA 1Y1PA 3RJZA 4OAQA 5JS1A 4P86A 4WY8A 1ZO8A 4WAUA 3C3XA 2AC4A 3PWTA 1IYZA 5CVDA 3S68A 3H1AA 4OBBA 5IC5A 3DOHA 3N2GB 1NONA 4RD2A 4K81B 4PSUA 3TMAA 2WYIA 2D6FA 4UNPA 4LJ9A 1JR3A 1Z6ZA 4KIGA 2Z6AA 4JCCA 3O8OA 3C45A 1XZBA 1BDJA 3BKWA 2X1HA 3HJCA 4WOCA 5FLYA 3A9SA 4BGVA 3K16A 2M2IA 3G9ZA 1R66A 1PFKA 4FOSA 3C6MA 4UAJA 2NT4A 4B7UA 2D8AA 1KZ6A 3JVIA 2ZYUX 4KXNA 3ORFA 1ISGA 2ZWPA 3ZK8A 4H6VA 3F4LA 3EXAA 1FY2A 4IWYA 1CY2A 2CLCX 1DJLA 2FQWA 2Y71A 2OC9A 4E4TA 1X7HA 4RABA 1OTXA 5BR8B 4DV1B 1G8MA 2OXFA 3OWHA 4ZHQA 1IEVA 4ZT6A 3LRXA 5ARDA 3A3OA 1JB9A 4Z5XA 3D0RA 3R8CA 1I4TD 3K4PA 4D4KA 1AKQA 4UBIA 3HY3A 2FA9A 5KYTA 1N0IA 3FM9A 1M2OA 3QGMA 3I1FA 1R00A 4JT9A 3BMQB 5J63A 2A7QA 2DERA 2HMWA 2ZS9A 2FRVA 3O91A 4FNMA 1EVZA 1ESNA 1FVHA 1US8A 2NYVA 3SXJA 4R0MA 3KZ1E 5KO2A 1RBMA 4S0XA 3HGTA 2ZVPX 5BW8A 4NOMA 1KDTA 4L50A 1F2UB 1XPRA 3LHIA 1FP7A 4OEHA 2X76A 4D41A 5DB4A 4B7CA 2O8EA 4NKRA 5TPZA 1R10A 2GPNA 1H9AA 3T5BA 1AE1A 3GRFA 1RHQA 1SQ5A 3GWGA 2W6QA 4GDMA 1NQXA 2HDWA 1KI8A 3GIDA 3T3GA 4TYNA 1XZFA 2I4NA 2RHLA 4HN9A 4KNWA 4BO0A 4B3GA 3NDBB 4C5BA 2A0YA 3GEGA 5IM5A 1UAGA 2BZSA 4RKWA 1YGYA 4R7GA 1MMFB 1BMFD 4EA6A 5MDHA 2EW8A 3AUSA 3RIGA 4J1TA 1U9YA 4D1YA 3UW1A 3AF3A 1MLDA 1X70A 3I9LA 3IS3A 2HFKA 1L5KA 3UK1A 2QRJA 1OB5A 1AXRA 3MCVA 4H31A 3T9DA 2J0EA 3COYA 3EZNA 1DELA 1L5VA 2GDJA 4DUPA 4QGBA 1U5BB 4K6HA 121PA 4HO1X 3QU2A 1P3JA 3LK7A 1C50A 2YV1A 4ECAA 3BQMB 4JNKA 3QKUA 1QIJA 5H4GA 3HKCB 4O8CA 3A2NA 4HMPA 3U1TA 3LYAA 2C61A 1O77A 3NONA 5L53A 3EEOA 1TL7C 1HFWA 4KLNA 3E3AA 1W4AA 3M1IA 3FKQA 2P77A 2E85A 2IUYA 1U8YA 2Y67A 1ZXLA 4G0ZA 1I1OA 3S81A 1JIJA 2AFIE 1LLCA 1YA4A 5K3DA 5CA1F 2XUDA 4TZTA 2ZI9A 3WXMA 5JS6A 1JQ3A 1RZUA 3KKNA 1N2CB 1Y5NA 4J07A 4KN5A 4V24A 4OJKA 1JE1A 2GYWA 3AHIA 3X43A 2CHQA 2W6ID 5IK2A 1TNDA 4BQPA 4DLTA 2XCUA 2GVDC 2WMOB 4FXOA 1FSFA 4ENRA 4LVCA 4FQ7A 2WG0A 1KQNA 1COWA 4B8ZA 4BZQA 1ZOPA 2Q46A 3IEXA 3DXFA 3DQPA 3ORQA 1KU6A 4HDMA 3ACCA 4HGNA 4IKPA 4IV5A 4BEBA 1VMIA 4GLLA 1C7FA 2J46A 1OQAA 3MINB 4EM6A 2JC3A 4G1CA 4ARVA 5I7SA 2ZRMA 2IXAA 3K09A 4JXJA 4UXIA 3JQCA 3V1NA 1TD1A 3WB2A 4B3IA 5A6SA 2LZ0A 5ADWA 2PUCA 3X44A 3UPUA 4F5WA 4O2RA 4OLHA 4REMA 1E5LA 4JSRA 2ZAOA 1E2GA 1Y6ZA 2BEKA 3DFKA 3BD7A 2P9JA 2VF2A 4Q4LA 1S8FA 7YASA 3I32A 2PRSA 2QTCA 2R9VA 1NLMA 1XDZA 3DZKA 2HT6A 2X5NA 4ZMSA 3PQ8A 4A0FA 3DEFA 1KI4A 5LMNB 2GESA 2PANA 4R1QA 4XM1A 2IKSA 3TW6A 3EOBI 3MHPA 1XEAA 4LNUB 3K6SB 2J0SA 3LXRA 4BLUA 3LC1O 4JODA 4RK5A 4GL4A 4TN5A 4DPKA 3SI7A 3SQNA 5F2KA 1BFKA 1O5OA 2I8CA 4Z51A 4GWLA 3LUBA 2GK7A 5HEKA 1GT6A 3S2IA 4KIWA 1FUUA 1WS6A 3X2EA 3BIFA 2H1RA 3MUOA 4WL0A 1ISJA 3HGQA 5AKXA 2Y1CA 3QWHA 3ESCA 4G07A 5C8DA 4INOA 3H18A 1GY8A 5BUQA 2AHRA 4GSLA 4CR6A 3ZTWA 2Q0HA 2OHFA 2VJPA 4ML3A 4BMYA 2DM6A 2C3UA 3K9QO 3TQRA 4DUZB 1WW8A 5BT8A 1XX6A 3CRNA 5JSUA 2CFTA 3IOYA 1MTOA 1Y5RA 2V4ZA 2YN4A 3NTOA 2FF7A 3HACA 2AMVA 2VI5A 4N3CA 2H4XA 1JPNA 5K3CA 5BYBA 3BMCB 2YXLA 3Q9SA 1KMQA 4BX9A 2VSOA 3GXOA 1TK2A 4GQIA 3ULKA 2ZAIA 2UXDB 3ELDA 2G88A 3LRPA 1BW9B 4IV0A 2OKCA 5C31A 2VDOB 3BXHA 5IANA 3EGDA 5FOWA 1F2TA 4LRQA 3BL5A 3B48A 1JEOA 5CLQA 2YMPA 4ED9A 4RJTA 1V5IA 4MQFA 3VC3A 1ZLYA 2Y66A 4U63A 1Z8FA 1S02A 4KQMA 4X8LA 4XLZA 1ZD1A 3W1EA 3GLFE 5TVKA 4G8JA 3OC0A 3RS9A 4HDCA 2A1UA 7ABPA 3TQSA 4HQNA 2VK4A 3PNYA 3S8YA 2OXEA 4UTZA 2QKYA 3CW9A 2PFKA 5K0EA 3WP0A 2CLHB 1A97A 2YNMC 3A6EA 3KAKA 2WT8A 4ENPA 1ML4A 3OH8A 3SZUA 4E12A 1DB3A 2D2EA 1PLJA 4H1TA 3T0IA 4B44A 1C3VA 1L5QA 2B7BA 1Y5LA 3DC2A 4YDQA 1P18A 3EGIA 5JECA 3LSTA 4ISCA 3YASA 3WHIA 5KBYA 5KTOA 2BPOA 1TU3A 3BICA 1WSBA 3SC2A 3U7QA 3LP8A 4B6RA 1TZKA 3F47A 2R4QA 4FBLA 4ZOLF 5B2ZA 4MDEA 1E2IA 1JH8A 2DP4E 3IKTA 5BNIA 1S9HA 5HCNA 3TEFA 4JELA 3Q9NA 3TCKA 1NJSA 2W6IA 4PLPA 5KJEA 5DI9A 4D42A 2VK1A 4ZQBA 4L51A 2W70A 4I3FA 4E7PA 1QCCA 3JQBC 5D86A 3TD2A 3ZWOA 5JY6A 4HJRA 3SHOA 1O97C 3MMZA 4IRMA 4XX1A 3L7LA 4MOWA 4UDXX 1PJ2A 2LKCA 1MT0A 1QZTA 2XYQA 3EGEA 4FC6A 3L6EA 5DHFA 1S2MA 2VEOA 3LC0A 4MWOA 2OHGA 2XRFA 1E18A 1N2HA 4G86A 5ES4B 1YJXA 3CVWA 3B7GA 4JU9A 3OOSA 3C7KA 4QXAA 2GI4A 1H0SA 2X5OA 1UDCA 1T9GS 3R0IA 4KBFA 3ZGVA 2D3TA 4JT8A 1IB0A 1PEYA 1NW6A 1ONOA 1SCAA 3OPNA 1T8UA 2HREA 3HJNA 2NVBA 2A94A 2LUOA 3WFIA 3RIXA 3DHWC 4PNHA 3SICE 3AESB 3C6KA 5AOVA 2Q6IA 1MENA 2CW5A 4R5MA 5JAQA 3ILXA 5GIOE 1M6YA 1UH5A 3HVIA 2R751 1R0SA 2CT8A 3BBPA 1R6AA 1AV6A 1TW2A 2XQJA 1S6YA 3OX1A 3WGNA 1CRLA 3DOOA 4I2NA 3UXHA 3IL2A 1L4MA 3R3YA 5FTJA 2GEBA 2R8YA 4NBUA 1LW7A 1TA9A 4BATA 2QP9X 3IQEA 3QJ5A 4IIVA 4FHZA 1OXTA 2WKPA 1VMKA 2XXJA 1ACJA 2AEMA 2GCPA 1JQBA 2HOQA 3F6RA 3IQXA 3OOYA 3IDAA 4KIJA 4QYIA 1XZHA 3TZ6A 3K2QA 5JNWA 4W5QA 1BDIA 1KETA 5GONF 1VKZA 1EZ1A 1M33A 5LLDA 1KAEA 5K5EA 5SY4A 3DZHA 4HEA1 4MR8A 1EAMA 1A82A 3B5IA 3C6XA 3E7DA 5WRFA 1ZGHA 4I99A 3ZU4A 1JTFA 5IEJA 5K0CA 1A9RA 1NVTA 1DQYA 2CEAA 3JALB 3MLBA 3UMYA 3ZDCA 1G5FA 2BKEA 1E7QA 1E60A 1B1AA 1Z6PA 2Q5OA 2R6DA 3CZMA 3ADDA 2Q4BA 4EQ6B 2PKEA 1E8MA 2QDXA 2FTKE 3I6BA 4HWSA 3UNXA 4H3KB 3G0BA 4Q9IA 4PE5B 5ESWA 4DB4A 1UK8A 1P61B 1TDJA 4HAVA 2D7JA 5I8ZA 4CFZA 1T3TA 1B3BA 3PNQA 5G2OA 3TB4A 2WP0A 5B7NA 1WUJS 3HA7A 1J9ZA 2XXBA 4G01B 4MYHA 3ZHXA 2ZBUA 2AMJA 2RJNA 4L2IA 3DE3X 3AVQA 5KU1A 4Z4IA 3A31A 1LBIA 3HZZA 4OJMX 4RJIA 4Y1FA 2BTQA 3NKLA 2PTHA 4NOJA 4PFQA 3OT1B 3I83A 2O8EB 4EATA 3D6UA 1QDLB 3AONB 1SVIA 1U1IA 4KQ1A 4B3MB 1P3DA 2PJZA 1MN6A 1WP9A 4HX9A 4DNQA 5DBOA 4M1EA 4X90A 4EK9A 1GA4A 2OAEA 1SB8A 2ABWA 3E05A 4B43A 3B1XA 5ENDA 4V38A 2P90A 4N47A 2FWJA 1H05A 1DVRA 1FDWA 3I1JA 4FSHA 1C1XB 5AW3A 1EYZA 3GMDA 5HDBB 2O57A 4F46A 4WBNA 3WAKA 5LWQA 2MWMA 1C9KA 1H2WA 1HT1E 2XGGA 3DLCA 2ZUEA 1T1IA 4OXNA 2X4IA 5FPKA 3IR7A 1UDBA 2WIAA 4ZEVA 4K9NA 1Y8ZA 1JXOA 1FRVA 1TF7A 4L6IA 5LQNA 3V8VA 5ITVA 3QVOA 4N6OA 3W5CA 3ZBPA 4I4TA 4L7QA 1UEIA 3KXPA 3CZ9A 5CAEB 3STXA 4BO5A 1P6UA 3HUDA 1Z74A 1F0KA 2VF7A 3DE1X 5JATA 1KSJA 1Y1KE 2I3GA 5FI5A 1NW3A 4V2IA 4ZOLA 1M6EX 4ROSA 4AWAA 1ZG3A 3CR7A 1EFAA 3FCXA 2L19A 1GDHA 1ZCZA 3OESA 3ZY3A 4JHLA 1YDFA 2WA1A 1K5DA 3EUAA 3QVKA 4WNAB 3IESA 1W4LA 4GM4A 1DEOA 3EK2A 2ONJA 5DF1A 2IUFA 1XZLA 2JJ1D 2EGGA 3ML1A 2V65A 1KRXA 4XD7D 2FSIA 1DKOA 1G41A 2A86A 2EFDB 1GG9A 3HKEB 3SQOA 2VATA 3MGCA 1QBKC 2C9ZA 3NNDA 1Y1TA 3H6KA 5TR9A 5AUOB 2CV0A 2WA2A 2IYAA 1ODJA 1PWZA 4MS3B 5C34B 3UMBA 3CUKA 3M6FA 1YCHA 5HA5A 3I62A 5T8KC 1JXQA 3NAQA 4W5OA 3AVYA 2B78A 2QRGA 3KWLA 3KOOA 4JA2A 2V55B 5E2BA 1E3LA 2BMWA 2C96A 2IE8A 2JHPA 1IC6A 3K0CC 3TMKA 2O0HA 2FPPB 2ONYA 5AO9A 1JFTA 1OFUX 2ZSUA 2FWPA 3A05A 3AIKA 3U7JA 1PV4A 3OD5A 5HTOA 5FL3A 5KOJA 4MROA 3WGMA 4B6EA 5DLQC 1C0KA 2UYOA 2XD4A 3DT9A 1WMBA 2NXNA 4JJGA 4R9NA 2AXEA 4XFJA 2QG6A 4TMFA 3O8QA 2VUHB 4DV7B 3B5EA 4BO4A 1X19A 1LK0A 2NIPA 3AU9A 5CK4A 5FFMA 3QX3A 1X8JA 1R0RE 1TM1E 3HBNA 1NULA 1S4MA 1QHIA 3UQZA 1DQSA 2PX0A 3H5NA 4AO6A 4D3FA 1MOPA 3FAZA 5B30A 3I2HA 3K7EA 4C6HA 3D7SA 1N36B 1H4TA 3L0OA 3AM4A 5E1MA 2VVTA 2W22A 3WLKX 4GX5A 1R6XA 5F2OA 1LFAA 4DZRA 1P73A 2C8LA 2YXPX 4HWGA 4IVNA 1P5JA 2QTAA 1QM5A 1DPGA 3Q7QA 2J4FA 2XDQA 4O5OA 5FV7A 4B84A 4CEIA 3ABZA 1EP1B 1CB0A 2C7BA 3LWZA 1QYXA 4H4EA 4J8PA 5TQ0B 1N25A 4EVSA 2C1ZA 5K3EA 1Q3KA 1WWKA 4OUDB 4AJ2A 1F8FA 2VTDA 4MVXA 1K08A 4GMFA 2WJ6A 3WGHA 5FORA 5EP4A 3TKAA 5ESDA 1U8XX 1ZOLA 3V9PA 3WX0A 3NBXX 2BKAA 3BWCA 1WZEA 1KSHA 3DHYA 1E5QA 3GLQA 1CX9B 1ZNWA 4TVOA 3T3HA 3OX4A 2AZXA 4EW3A 1U0EA 2J0UB 4KREA 1U0HC 3LF2A 5E4TA 3JD4A 4RQTA 1PEAA 2YTZA 2H4FA 1E79A 3C2QA 4E2YA 1LDEA 1R2QA 4TX1A 7REQA 2OO5A 1GPJA 4AURA 1G2QA 1NM5C 1JHQA 1E9FA 3LUHA 4BFWA 4BNIA 1MVNA 3ORRA 3TJMA 3G2PA 4KK4A 1RLMA 3M3DA 4QQ8A 4UE6A 3RYFB 1H69A 3V8BA 3KQKA 2ZUSA 4MCHA 1TW3A 4DQVA 3UTDA 3ZUGA 3ZVKA 1QIFA 4KR9A 1MOZA 2O5EA 1E2KA 4EY7A 1T6XA 2BGKA 4G0UA 4KXVA 3U3ZA 3ONFA 3VZSA 3OKPA 3DXZA 2OCXA 3O8BA 3QU4A 4UTRA 2QUKA 4LY9A 3QUSA 2VR1A 1J8DA 2CMGA 5JADA 4GHWA 2FUG6 3DYVA 4MA5A 3LTNC 2BBOA 1U4SA 1LQTA 3BWMA 4B8WA 2WD9A 5BUCA 3H9CA 3R1IA 3M9WA 1JXMA 1KAQA 2ZSIA 2P91A 3ZLUA 3H6GA 4MWBA 1NV9A 1MPTA 1XEXB 4BRSA 3HHEA 2FMUA 4CKEB 5JTUA 3OI7A 5FXMA 2I2BA 5KNDH 1OI2A 1S2IA 3RU3A 1BS2A 3RUAA 4U5QA 1KWKA 5CIQA 1U3FA 3G2HA 4BWFB 1G7CA 3K96A 4PAWA 4HNVA 1YS7A 3DJFA 3AETB 4URZR 3DEJA 3IKMB 4ZAGA 4G25A 4AQ7A 4TM8A 1VLZA 1WVGA 4HN4B 3TVTA 2G3YA 1A7JA 1W36B 1Y98A 2YWRA 3OPYA 1O0CA 3QMPA 1QP4A 5BR4A 4KGXA 3H4TA 1XDGA 2FPGB 4GLJA 1Q17A 5K6TA 1EFRA 5M29A 3VR2A 3WLAA 2F48A 4PQRA 1SU4A 3ZHTA 4MUAA 1XLUA 2C83A 2ZDQA 3GCXA 1NP7A 4HCJA 4DYHA 3LPCA 3OWXA 1X77A 4XTCS 2XA2A 4P0QB 4A26A 3ZXSA 1PR3A 3KVOA 4HAOA 1ZJ6A 2I6QA 1EEHA 1WOYA 4BY9E 3SMQA 4M1TA 4NYJQ 3NDJA 1E4YA 1IJKA 5CPBA 5BORA 1Z6XA 2WMNB 1Y9JA 3E84A 1Q2XA 2OKGA 3HR4A 2Z83A 3OKAA 4FEAA 5FOXA 3THYB 2QNBA 2W7TA 3L46A 5EJAA 4A0RA 1T35A 3RSLA 4IDNA 2NTVA 2V1XA 2XE4A 3HI4A 4EA7A 4MW7A 1RBYA 2QZ9A 1GGEA 5I7EA 5ICMA 5HUQA 4D4LA 4LDZA 3R24A 1W73A 4GIBA 1KQOA 1BXRB 1YASA 4PQYA 3VR6D 3CUEF 1CUCA 2ORWA 4OJYA 2YL2A 4PXSA 1Q0SA 3TQQA 4C2BA 2IF2A 3H17A 3IEKA 4TMZA 5C8YF 1VM6A 3RVLA 2XBUA 3N8DA 1W88B 1UBUS 2CUZA 2I6FA 2R2AA 2DHEA 3G3EA 1JEEA 4L74A 2C3YA 2Z3VA 5JBNA 2L18A 4LJSA 1N1DA 1CZKA 4FW9A 1H5UA 4KQFA 4MR7A 4DY6A 3Q3GE 3MPOA 4E08A 4JI7B 1BWQA 2OO7A 2VHJA 3QLTA 3JPYA 4DSTA 1IN5A 3G8DA 4HNTA 4RMIA 2ZRDA 2Q3JA 4IILA 4AKSA 5AW6A 1D2CA 4YBZA 5KSOA 5L7WA 1TA4A 1Z37A 1KJNA 3BRWD 5FBQB 4UOQA 1MO4A 4K26A 5EIHA 2KMLA 1Q1ZA 5AVKA 2QMUA 3GLTA 5FJIA 5LOVB 3JD2A 3E35A 3KWMA 4GWGA 1TU0A 2J8ZA 3SPXA 2B83A 1GKKA 1FDSA 1BYIA 3A9UA 1J0BA 5EIEA 3KV3O 1D2EA 2H00A 2CJXA 4OYRA 2Q8NA 3FTDA 1WA5A 2PMEA 3GAFA 1U0OC 3L8EA 4FN4A 1MQSA 1VSVA 2GAAA 1M1XB 1I6KA 1NW5A 1PJLA 3GEIA 2CYCA 4M53A 4DMHA 4XWWA 3MMSA 4HX5A 3HL4A 3GJ3A 3I0NA 4QTUB 5HM8A 4XD2A 3NHRA 4KXFB 1NN1A 5JISA 4MB2A 4CEHB 2E5LB 4WASA 4MP6A 4D0LB 1A1SA 3KU1A 4A0QA 2D3WA 4U9UA 5AMXA 4AZVA 4LF4B 4MS3A 2C4TA 4WKPA 4BLRA 2HDOA 3BH6A 3U9SA 1A50B 1D9ZA 4DG8A 4GF5A 1TIPA 4TV8F 1LSSA 4Q03A 1XPUA 3OM0A 4G5GA 5GTDA 3AEKB 1BO6A 2ZJ3A 4BLVA 1RM5A 1UBJS 2FLKA 3EBOA 4XJSA 1RHKA 4YO8A 4ZO9A 1W35A 4D81A 4EB6B 3D6MA 1ZCBA 4HPXB 3UFXB 1KOJA 3NCTA 4M98A 3C4QA 3LLVA 4D4JA 5L3ZA 5A71A 3T52A 4X1YB 4LF5B 2IU4A 3WADA 2CDBA 4L15A 1Y4SA 4C7MA 5GAJA 1DKNA 1QRDA 2ECFA 1ANKA 1T2AA 2OBYA 3ZE6A 1IHOA 5CYFA 2CHVA 1YVDA 2VJLA 5A4FS 1O96B 3NRCA 4REQA 3DVRX 4YJDA 1ODKA 4I4TB 5CM9C 4FR5A 3S2FA 3VVBA 4DF3A 2IYYA 3A6LA 5IBCA 4K6CA 4YS6A 5I4CA 3W3ZB 2CYAA 1G2PA 3STTA 3TL6A 4XGNA 3DBRB 5JDIC 3MF4A 3CF6R 1KAOA 3VI3B 2FEXA 4BX8A 4OHPA 4BNHA 1N77A 2J0QA 1GIAA 1QUFA 2XTJA 4ND8A 3WL7A 1KI2A 2QSUA 2VPZA 4JJ8A 5CH3A 4D56A 2GASA 2IIBA 3CEHA 4FYPA 4X6LA 5DOVA 1X1EA 2O2XA 3C4JA 3VU9B 4DDTA 1ACMA 1HTWA 3NOVA 5I8PA 5JASA 1M2JA 5JSFA 3P20A 4ZCTA 4FT4A 5DYWA 5EUMA 1K63A 5KVQA 5EXPA 2ZTMA 1OW3B 3CU5A 4Q7LA 3ETEA 1OCEA 4RV5A 3BGSA 1F0YA 3I58A 4O4IA 3L8FA 4OH7A 1NSFA 2JJ1A 1SMKA 1SUDA 1W0CA 4ZAWA 4KUGA 1NI3A 1U7OA 3FNGA 4EFLA 3L7OA 2WBLC 2DCUA 2JIOA 2XA1A 5EKDA 2NV2B 2Q6KA 2BTQB 2Q50A 3EIQA 3MGAA 3W2EA 3I9OA 3PDIA 4DW8A 1NHWA 5GZ1A 4LYFA 1F17A 1DOHA 3DKPA 5AOCA 1DKLA 4MEJA 2GKGA 2Q4OA 1UPBA 5AYVA 2FPLA 1DMSA 3KQWA 4OQFA 4ZQCB 1H3FA 1TOAA 2Y1OA 5K0TA 1N2EA 1UQTA 3PUWA 4FFBA 4MMXB 3CLVA 1YIOA