2ID8A

Crystal structure of proteinase k
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title What can be done with a good crystal and an accurate beamline?
pubmed doi rcsb
total genus 106
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2id8A00
1NDUA 1BFUA 2HD4A 1HT3A 5JXGA 5FBZA 1GCIA 5JXHA 4OV6B 3TI7A 3GCWA 3HJRA 5K7SA 1THMA 1SUCA 2G4VA 3AFGA 1MEEA 3DVSX 3OSZA 2ZWPA 1EGQA 1BFKA 1TM5E 1OT5A 1SCAA 3DE0X 4GI3A 1A2QA 2ZRQA 1BE6A 2WUVA 2XTJA 1ST2A 3BX1A 3Q40A 4LVNA 3EDYA 1BJRE 2PYZA 4KB5A 1KE2A 1DUIA 1GTJ1 1VSBA 4LVOA 1KDYA 3D43A 3LXUX 3VSBA 1OYVA 3UNXA 5JMOA 3F7MA 2B6NA 1TECE 2DQKA 1R6VA 1PJ8A 1V5IA 4OMDA 2HPZA 1KDVA 4AKSA 2WV7A 1KE1A 3WQBA 3VYVA 3D9QX 1SUAA 4WOCA 5I9SA 4BWGA 1C3LA 5AMXA 1SCJA 1S02A 4KG7A 4RYDA 4Z2AA 1TMGE 1AF4A 1CNMA 3A3NA 2PRKA 5FAXA 2SNIE 3DW1X 4JP8A 1ZVJA 3DE6X 3SICE 1S01A 1AU9A 3PRKE 3VV2A 1C9NA 1Y9ZA 3BPSA 3I2YX 2E1PA 1SUDA 1WMDA 3I37X 4ZOQI 5AQEA 1BH6A 4J94A 1TO2E 3DW3X 3EE6A 2Z2ZA 1C9JA 1SUBA 1SBTA 1C9MA 4FONA 1T1GA 1CSEE 1OYOA 3H42B 1Q5PA 1KDZA 3DYBA 1AV7A 1V6CA 5AVJA 2TECE 3Q5GA 1TM3E 2PQ2A 4I0WB 3CO0S 3EIFA 1SIBE 1GA4A 1YJBA 3QTLA 2W2PA 3DE1X 2Z30A 1DBIA 2IXTA 2P4EA 1TO1E 1Y3FE 3I30X 3ZXYA 2WWTA 5B1EA 3ZXXA 3DE7X 4K8RB 1IAVA 1SELA 1TM1E 1GA6A 1Y3BE 1WMFA 2SBTA 5FFNA 2SICE 1AQNA 2QTWB 3DE3X 2ST1A 5B1DA 5AVKA 4M1ZA 1SCBA 4NE9A 2XRMA 1BE8A 2ZWOA 3T41A 3AJ8A 1P7VA 1SH7A 3DVRX 3GT4A 1GT91 5ARDA 1S2NA 4HX2A 1PEKE 1R0RE 1ST3A 1Y3DE 1WVMA 4H6VA 1SN7A 2IY9A 1Y3CE 2Z56A 1UBNA 1EA7A 1IC6A 1TM4E 3P5BA 1SBCA 3DDZX 2PWAA 1GTL1 3A3OA 3DE5X 3PTLA 3VV3A 4C3VA 1PTKA 1P8JA 2PMWB 3A3PA 3AJ9A 2PKCA 1TM7E 2Z58A 5JXIA 1SIOA 2Z2YA 3LPDA 1NLUA 1YJAA 1SBIA 1AVTA 3F49S 3SQOA 2W2NA 2X8JB 1NDQA 1Y34E 3CNQS 1WSDA 1ZVKA 5ARCA 2ID4A 1SUEA 3VHQA 2GKOA 1LW6E 3DWEX 1GNSA 1SUPA 1SBNE 1Y1KE 4DJ5X 1GTG1 1AH2A 1SIUA 1Y33E 4ZARA 2V8BA 1JEAA 4YN3A 4WOBA 1GA1A 5JXJA 2SECE 2DP4E 4HVLA 1T1EA 3TI9A 1YU6A 1T1IA 2WUWE 1PFGA 1SPBS 3QMPA 3DE4X 3BGOS 4C3UA 1Y48E 2W2OA 3F7OA 4CFYA 4CG0A 3L1KA 3DVQX 1GNVA 3WIVA 1R64A 4DZTA 1Y4AE 3GCXA 3LPCA 3QFHA 4KPGA 1MPTA 4H6WA 1SBHA 2Z2XA 1TK2A 2PWBA 3I34X 4B5LA 2W2QA 1P7WA 3WIUA 4H6XA 3TECE 1SVNA 1Y4DE 1XF1A 2W2MA 3GT3A 5SICE 1WMEA 5CW1A 4AKTA 4NE7A 4MZDA 3WHIA 1SCDA 2DUJA 4DWWA 1SCNE 2ID8A 1AK9A 2Z57A 5ARBA 4NMXB 2X8JA 1YJCA 3LPAA 4CFZA 3DE2X 3VTAA 4OMCA
chains in the Genus database with same CATH superfamily
1NDUA 3TOZA 5IVKA 1Q0PA 4IKEA 4RWEA 2EEZA 1IY1A 5DHTA 3Q5EA 5FIUA 2YXBA 2P0EA 1I8TA 2RGYA 4ZI7B 3IV6A 5AOCA 3T3NA 1TM2A 1P1JA 1KI6B 3G2NA 4FKMA 1WXHA 2GUWA 4YHHB 3ZVLA 5L53A 2C8JA 1NMYA 1CTQA 5EIAA 1ZK4A 3BHNA 5I7SA 1VCIA 3P2EA 3K1ZA 5AW7A 1EDOA 5EKTA 4RPCA 4ZCPA 5I47A 2PQ6A 1IL0A 4XSGA 1N1MA 1Z34A 1C9YA 3WO0A 2WJ3A 2B92A 4BASA 3CLSC 3B6JA 4E7PA 4CETA 2JI8A 2CNNA 3WKEA 2WM2A 1E7MA 1QVVA 1J0AA 1JNYA 5BR8B 5CT6A 1N2XA 1HM5A 1Z4JA 3WB9A 2NGRA 3G82C 3LBFA 2BD0A 2BJVA 3G0BA 2D2IA 3B7WA 1ZY2A 3A3KA 3RC2A 3QOXA 2GAFA 1E2BA 1Z75A 2IYVA 4PG4A 5LYJF 2DF8A 3AERB 3SS9X 1GPNA 2R85A 3NOXA 3TJZA 2RGAA 3R0VA 2OCBA 1PR4A 1XP8A 3DE0X 2HHAA 5CH3A 4ID3A 1QHGA 1Q22A 3BWDD 4ZOAA 4ZRMA 1PQPA 1ZSNA 3I42A 3QW4B 1XTTA 1YDFA 1GIAA 5T4EA 2HHHB 1DAEA 2H1VA 1V4NA 3IJRA 4H7DA 5HDQA 1P4AA 1E9DA 2V1XA 4G36A 2FZEA 4JIMA 4QHYA 3UV7A 4ZU1X 3L18A 1LBIA 2FN4A 3LHKA 4IO1A 1DS6A 1VE7A 2AG0A 3GJQA 3HCCA 4PNHA 4WNIA 2GZAA 2HUNA 4D74A 2CV1A 2ZQYA 1ZC3A 2FK7A 1YQEA 4OYLA 4C21A 1CHDA 1FDTA 1G8PA 2IY8A 5JE8A 2AN4A 4IDAA 3RDPA 4CI0B 4LVNA 4BTEA 1EE2A 5HTOA 5C4IA 4ZPXA 4I5FA 2IE0A 4OQDA 4REMA 4Q9JA 1G38A 2HC9A 2V7UA 1Y4UA 4R81A 1WBBA 4IJMA 5TE9A 2WTMA 5JNVA 4F2PA 2VC2B 3U16A 2J0QA 2R7AA 3HCAA 3TE7A 5DFAA 3TSYA 3LE8A 5C51B 1TUBB 3TQCA 2HMYB 3OQJA 3TTYA 5BWCA 5JZSA 5GIOE 3EIWA 4TVBA 3RFVA 1TYAE 2V4ZA 3LC1O 2FSVC 3KEFA 4RHTA 4BMOB 4G56A 2FCRA 3HVUA 2I76A 1EGMB 1SOAA 4FMDF 4AJIA 4C04A 3HJHA 4LJSA 4RJJA 3I39X 3HP1A 3RUCA 4O3FA 3R6DA 3GLGA 5LQNA 3JQ7A 2AXNA 2EZTA 2BEUB 3OLWA 1JG6A 3NM4A 4UE6A 3RE1A 1XTUA 1QR2A 3FPHA 1XT6A 3KB1A 3QUTA 4GP6A 2D3TA 4LMPA 4B3BA 1LQ2A 1HFJA 1OT3A 1QYDA 1M2KA 3NASA 4UE2A 3RC9A 1KDVA 4XCVA 3NIDB 4ENRA 2J9FB 3LCMA 4DLAA 5HKOA 3FYUC 5C80A 2QM3A 2ZIGA 4O33A 4QIHA 3H99A 1U0HC 2A0KA 2RKOA 4RZHA 1U8TA 4UC0A 1VLJA 4CEHA 1YS7A 1G8YA 4IQ4A 5K09A 1ESMA 2YX1A 1QVRA 4UNIA 3C6ZA 3VQTA 3VKGA 1DXHA 4HLCA 2IBSA 2BZ0A 4QGBA 1I13A 3DHYA 4TUYA 4NV1A 2CT8A 2Z6AA 1KIAA 3QOYA 3VR2D 4IDDA 4IDBA 3OEHD 3K70B 2Q5FA 3AXSA 4G26A 4TQGA 5CLQA 4UPVA 3TX2A 1ATZA 4JVNA 3A4VA 1T3HA 2VG8A 3BIFA 3VTFA 5JV5A 3DE6X 4WDRA 3LDHA 3QKTA 1V39A 1TJ5A 1AQYA 3AR7A 2R8RA 3R1IA 4LHXA 4ZU6X 9LDBA 1BJTA 4EJ6A 4N49A 1XLTC 5K8UA 2OP0A 4IEEA 4GOKA 3GU3A 4QWWA 4FR0A 1GV0A 1VHLA 4OQXA 4AZWA 4EO4A 3UAYA 1M7HA 2OBLA 5TPZD 2XMBA 4PZLA 4C4PA 1LF5A 3CUKA 3N74A 1CUVA 3O2NA 3F67A 1MAUA 4IIJB 1QGYA 2W00A 2FEPA 3DHEA 5MGBA 4UJ3A 2GYYA 2HRZA 3FJOA 4NENB 3MSXA 1ZISA 2N46A 2O2HA 2H4WA 3IBSA 2CFSA 1UIRA 4OGGA 2C99A 1T91A 2XXBA 4N5NA 3W9YA 3C85A 2AFHB 4B48A 1GJRA 5E0OA 1RKUA 3H83A 1YFZA 3EAQA 1E79D 3RYFB 1L7EA 2HY7A 2I5PO 2X0JA 4Z49A 5HVNA 1A5AB 3INGA 3EW9A 3EHEA 1XMVA 1ZUWA 2C5FA 4R8LA 5EMHA 1E0AA 1KVQA 1Q7CA 4IMIB 1WZEA 3DDSA 2ZSBA 1QR6A 4YMGA 1I0ZA 3E8XA 1LSOA 1T1GA 4NESA 4E5DA 3EIXA 4DANA 1UFVA 5KQRA 2BVNA 4RETA 3T7EA 1D1TA 3AIKA 3N5CA 2YV1A 1MOQA 4NEGA 4XB6B 3RIHA 2G8NA 3ER9A 1QF7A 4J0GA 3TG8A 3DYBA 2ORWA 2R0QC 1YACA 1NW6A 1YC2A 5KQSA 4P33A 1ESCA 3H8WA 1V6CA 2XB4A 3M4NA 4NZZA 4ZJZA 4ZMSA 5JRJA 3U7FB 4JJ7A 3ZY5A 5HZKA 3EW7A 3OTWA 3CVXA 3OC0A 4X63A 3UPUA 1X1EA 1E4EA 1PDWA 1X77A 2MSWA 2P3QA 1YTLA 2J7KA 2FWRA 2V9ZA 3AJEA 3GLHB 3GL9A 2CB0A 2JGKA 4HLUA 5D7NA 4C03A 4JIGA 2W43A 2VYVD 2GAJA 1I7QB 2B0CA 1A71A 4BB9A 5BURA 3WLSA 3EEBA 1DC7A 1Z2CA 3LA6A 4V1CB 1Y8QA 2RAPA 3ETGA 2NSYA 4O2LA 4BYGA 2WVJA 3HU2A 4NNOA 4CJXA 1MUUA 2ZJ0A 3LPLA 3HZZA 2B78A 3KR2A 3A1VA 1P0QA 4MDHA 2HT1A 2W6PA 2PA3A 3ZHSA 4RY9A 3DGEC 1HFKA 3PEEA 4KI0A 4JBXA 2EV9A 2NACA 2AXPA 4PTZA 1U6JA 2RFLA 4QYMA 2GDZA 1PUXA 2AZTA 3E3MA 2WIDA 5LQJA 1AA9A 3IL2A 1NHWA 4Q3NA 5ENZA 1GUFA 3PNYA 1CJVC 1IMJA 2DKFA 4A73A 1FLDA 3IB6A 2Q3DA 3P97A 3QX9A 4Z8XA 1QGAA 1VI6A 2JGDB 2PD6A 3HB5X 4K03A 2RD2A 4RD2A 4JUCA 4J1TA 4MYUA 2Q28A 1IJEA 1HOTA 2VDWB 2H8GA 2NU6A 3KZCA 4N5IX 1TF5A 1OX5A 2DBRA 4G07A 4IJ5A 1CP3A 2BDTA 3WGOA 1U7PA 4PEVA 3LW7A 3PGJA 2O4UX 3HU3A 4JELA 1VBMA 3H2YA 4XGRA 3C7TA 1PR9A 4ITRC 4ZAWA 3MGCA 1ZWLA 5B57C 1FK8A 1LK7A 2DKNA 3AHHA 4EHLA 1V26A 5KQMA 1V9CA 1KARA 1NN3A 1A9XB 1WRBA 2G25A 1T5TA 3I64A 4Y6LA 4B2PA 1RADA 2Q3JA 2PUWA 2XZPA 1GQQA 2J0EA 2X6RA 3VYSB 4CIYA 2PZBA 2Z4RA 3GN1A 4FCWA 2JDID 1CZOA 4C29A 1XC7A 3ABOB 4RMGA 1JHQA 1C5KA 1M74A 4BLSA 1E3IA 4ZDJA 2YFKA 1J2YA 1QG2A 3HJFA 1ZITA 5GV8A 4CM5A 4P5PA 2OXFA 4TRMA 5FBWB 3K53A 2B4YA 4IOMA 1EAMA 1Y3CE 2IHVA 4IRMA 2ODBA 1V5FA 3EVEA 1YUMA 3WGNA 3CY6A 1IUNA 1GFZA 4FOSA 2KJQA 3E4CA 1IC6A 3BE5A 2P5YA 3KEQA 3P5BA 3PBKA 2QT0A 4UU7A 3UAWA 4DV0B 1DKQA 5ANRB 3SXUB 4GNRA 3FCSB 3GGOA 4WASA 2YYSA 1LJ8A 5DTIA 3ZI4A 4EI7A 4YCMA 3KUCA 2Z2IA 3L7CA 1D9XA 3HJTA 4PG6A 1DHTA 1ELOA 1YXMA 2OZEA 3VNSA 3AHCA 4DMRA 2PR2A 3PR2B 3A3PA 4EGQA 2RB5A 2XMSA 1MCZA 1DBSA 2QM7A 3IAM6 4GXQA 3I58A 2NO9A 3OECA 3DPSA 2P5TB 3PJDA 5HE9A 4C2BA 4FHZA 3Q8WA 5CBKA 4UFOA 1RFLA 3DEZA 1SCKA 3PL5A 3MT7A 3JWPA 4KFSA 2Z2YA 1Z47A 4UXJA 1EESA 4CUKA 2PNJA 3ZXIA 3A4IA 3MTQA 2NT3A 2VSQA 3IQIX 4IFEA 2JGJA 4DQDA 3UJ6A 2EW1A 2QSJA 3BMOB 5DYGA 4EY4A 2IVFA 5KQGA 1VJ0A 1E3MA 5CEEA 2HCJB 3ZOZA 5GONB 1P5JA 2NSLA 1U98A 3ZU4A 2O8BA 3NS7A 4IQGA 5A06A 2IYSA 4S3MA 2WF7A 2ET6A 2YZNA 4G5SA 3ZC3A 4WBNA 2A7XA 1ZR4A 1IBKB 5F98A 1R4MA 1V2HE 2CGEA 5IK2A 5AW9A 3BCRA 5BWLA 3HGTA 3ZWBA 4L0MA 4MYTA 1B41A 3UC5A 2O3TA 2Z9DA 3A1TA 1Z5VA 3B9BA 4ID9A 4J9UE 1RBQA 4R1MA 4BTLA 3ZDXB 5KX5F 4V2UA 3GT0A 4MWEA 4CGZA 1UFKA 2HXSA 2YIMA 4L7VA 3TQRA 1G7TA 5AFSA 2G0AA 4OQFA 4G5HA 2C4HA 4FMPA 4TOIA 1RD4A 3UN1A 2PLWA 4WESB 1KQOA 1QS0A 3O4JA 4QPPA 4G01B 5AWFC 4XUGB 5JD3A 1EFPB 3DMPA 3ZQ4A 5CDTA 3GH3A 1MP0A 1FP6A 3M83A 5A6VA 4FW9A 3EUEA 3MTGA 2V54A 1V1RA 3AM5A 3AKDA 3K3PA 3UG7A 4PPYA 3KQQA 3HFJA 4C7BA 3SKVA 4FB4A 3UW3A 3DZ8A 4BAUA 4QJ5A 2JBAB 4I6EA 1DC6A 2YDYA 5KNDD 4X90A 1E6EA 2CCJA 3W3AH 2SCUB 5JCXA 1C30A 4B2LA 2Z04A 4FE3A 3HL4A 2LZ0A 2FY8A 5JJIA 4OHFA 5DGCA 4J6EA 4B84A 4M8IA 1VTKA 3R7FA 2H65A 1P4RA 4TQAA 4PLZA 4E3WA 3VDQA 4MV4A 4RY8A 1HV8A 4O2AA 4MW2A 5C8YB 4EHJA 2NUAA 2FPGB 5LJIA 3OZFA 3RLFA 4FHEA 1XCOA 2Q4BA 2YXDA 1P0IA 3ZYZA 2Q3EA 4OQZA 4D4IA 4C05A 2XXAB 2ASEA 3OVMA 1Y1TA 4MPJA 3OZUA 4JOSA 3D1LA 5FFFA 1SKAA 1RI5A 2QN3A 1KAHA 3E9YA 1GEGA 4CODB 2O5RA 4TYQA 3GJSA 5FJJA 1XU7A 4G0PA 5JSYA 2FP3A 3BFXA 4LDAA 4C07A 2PNFA 1L4UA 4R2WA 1S8NA 4Q3BA 1XRSB 5CDHA 5DTQA 4W5NA 1UPCA 2G17A 3KR9A 2AG1A 1NNEA 2Y0BA 1DJOA 1Z38A 2PCJA 3OO1A 1NF9A 4A3SA 3ZJTA 3JSAA 4J0CA 1XVAA 2ZJ4A 5FHQA 4GH5A 3CX7A 4F84A 4W5JA 3I3SR 3LKBA 3IIEA 3K96A 4KGVA 4JL5A 1Z3IX 3PUYA 2CMGA 1XXHB 1E8NA 3DXZA 4S1OA 3L4SO 3WIVA 5FULA 3O3MB 5M7EA 4OA8A 5ENVA 1GCOA 4UVGA 3EH2A 3H18A 3IDQA 2FN9A 3FHJA 3P9NA 3UFXA 2I2FA 4JK3A 3U44A 1A9QA 2VQ3A 4N0PA 3KFLA 2VUHB 2QQ5A 5AK4A 1X8XA 4PYLA 4XUDA 4E30A 3WYFA 3OE7A 5CHYA 5TSDA 5BR1A 2D1RA 4ZWNA 4M0PA 4CQMA 3KKOA 5JLAA 1E94E 4FJ0A 3AEXA 3B8HA 4QICA 4R05A 4D4LA 5CEFA 4BFWA 2V7WA 3OI7A 2GVDC 2JA1A 1BO6A 4WKOA 3F0TA 5L4SA 3UGQA 3OIFA 5E9JA 5HJ5A 3SYNA 2P6NA 1WG8A 5A4IS 4ZPJA 5SZJA 4R8KA 5IJAA 4DQUA 1W46A 2JGEA 5KNCA 2V3CC 2G1KA 2WF5A 2IK8A 2A88A 2XLBA 4RL4A 2FFQA 5L95A 2I1WA 1C1DB 3DOJA 4HFJA 4OL9A 4X9XA 3B6IA 2X8WA 4DSUA 2XF2A 2B1QA 3SYKA 5I7FA 2OZKA 4H6XA 1KC3A 4JI7B 3ZE7A 5L45A 3A9UA 1J7KA 4US2R 3KT0A 3DVAB 5EWMA 2H2FA 3BDAA 4J4TA 3ZGXA 4HS9A 2GTPA 1HO3A 1IEVA 2A0XA 2HKIA 3L7KA 3G3EA 4N6GA 4E33A 5GOTA 2D74A 1T9GR 1SHJA 3KVVA 4DCPA 1E1MA 4OJTA 4AP5A 3WNDA 3LBYA 4BATA 3NEJA 5E1OA 2AR7A 2PWPA 1M34E 3FGOA 4GQAA 4OQLA 5SICE 1DJMA 3D3EA 3E05A 1AXGA 1E1CB 4H7KA 3S8YA 4YALA 2NXWA 3FOAA 2JEZA 3IEPA 3WHIA 5JDIC 4ON9A 1UWCA 1O0BA 4ZYXA 3NEYA 1PTJC 1JMKC 3VSDA 3M3PA 3MYYA 2X5KO 3FYTA 3DLIA 2ZANA 4IDEA 1J0BA 4TTQA 4DBZA 2OCLA 4MQ5A 3V55A 1Z7GA 1ISHA 3AM4A 3A6GA 1VL1A 1XKLA 1Y6QA 2BBWA 3KLNA 2UZ0A 2ZSHA 4H4EA 4TTPA 1NBWB 2CHQA 3CZ5A 5D00A 5E6SB 5K1ZA 3SMVA 4DCOA 3LHIA 1I0IA 3CRQA 1OZFA 3LVRE 1Q20A 4I55A 2EIXA 3B2NA 2V6IA 5KKCA 3NMUF 1N8NA 4AQDA 1P45A 2RH5A 3EXIA 3Q15C 5JATA 4RS3A 1K66A 3OD5A 2BR5A 1K5PA 3AF0A 1YS2X 1Q3HA 2NV2B 2M32A 5JXHA 3MA0A 5FNVF 3VU0A 3C43A 5D84A 1RRFA 1H0KA 3UF0A 2XF8A 3HJRA 3AZQA 2WE7A 3MJCA 4MCIA 1NUQA 2HX1A 1Q1GA 2W83A 1RQ7A 2B8EA 1DO2A 2PLNA 3MT8A 3DZHA 4CKWB 3U7HB 3K9WA 4QGGA 1RMQA 5TIIA 4BY9E 4KIJA 5DLYA 1P62B 5FR2A 1TVKA 3BRCA 4BX3A 4D99A 1WKBA 4R9SA 5DNVA 1QIIA 1R37A 1T0HB 1DE0A 3QNUA 1P91A 1ISRA 4MV5A 3IAM1 3PL1A 1TM5E 3HI6A 4DUZB 1QCDA 1QHEA 4FILA 1KZ1A 3CMCO 1ISJA 1V16B 3HYSA 3OO0A 3R5TA 3QBTA 4HEHA 4UXHA 1VCNA 4FEYA 4BFUA 2I3BA 2FWAA 2PUEA 2ZYWX 3DXXA 3RGGA 5INTA 3AR2A 1PEDA 3EVTA 1K7EB 3JQBC 1ADFA 2I22A 2DHRA 2FJPA 4YUAA 4BTVA 4CMIA 3EWNA 4PF1A 1AKUA 2W98A 3DEAA 2ZU6A 5H68A 4WXRA 4TMXA 5DSZA 3DAHA 1ESDA 2KM1A 1BX3A 2WJWA 3QXSA 2LVBA 4HNGA 4IIHA 4URWR 4B6GA 2EFHB 4BQSA 1CRWG 5E4TA 1K6MA 4ENUA 2V5VA 1NOIA 2P67A 3PG5A 3EDYA 4B6EA 3WHPA 2A3NA 2AOTA 1E99A 1PDOA 3D8UA 4KZPA 1M1YB 4OMFG 2FETA 1WO8A 1UFRA 2E4YA 1LD3A 4NQZA 3VSCA 2P9GA 2XH8A 3W8EA 4Q4AA 2JJ1A 4RV5A 4DM3A 4FS8A 4R51A 4AECA 3ASYA 3C1UA 2BKUA 1II9A 5JNLA 1M73E 2VHUA 1MFPA 5D6OA 1KDYA 4FR2A 1JFVA 5BSTA 2IEGA 1U3GA 2XGOA 3CRVA 3MTAA 4HB3A 2VJMB 4N54A 2O23A 2R1VA 3TX6A 3E5HA 1QXSA 4F7WA 4EJSC 1JR2A 2D5AA 3M4YA 2QV0A 1GT6A 4NOLA 4U2FA 3VKUA 4G5XA 4EEXA 4YJ2A 5GP1A 3VC2A 4R5MA 3QRWA 5CYOA 2PFKA 3FSGA 3TE6A 5DHSA 3U62A 2YMLA 3ONFA 1N3BA 2V59A 4UHJA 3EQ6A 2B4TO 1FNSA 2ZS8A 2DAPA 2VOJA 3NBKA 4YIHA 1R3DA 4LRTB 2FWJA 3L7OA 1KEKA 1UDCA 4MR7B 4UHFA 1VKZA 1GAJA 3T5CA 3TINA 1T4CB 4QZVA 1TC2A 2NO1A 1QIJA 2QRPA 3HWRA 2HF7A 1MORA 2W0MA 1GYPA 4Y2QA 3TCNA 3GMSA 4C6TB 2X77A 4X41A 1VCHA 2CHFA 1TC1A 3E9NA 4CMEA 2H31A 1R0LA 1D1PA 1QFXA 2C03A 3HCOA 1KERA 1A9PA 4IS3A 3DLPX 5LQCA 1E2PA 1V41E 1VLLA 3RYHB 3GXOA 4MQLA 3WBFA 3B85A 5KYTA 2SNIE 3AZOA 1DC4A 2GJ4A 2ZATA 3KZVA 1D6JA 4MUKA 2BDEA 4RF3A 3R7BA 2B9EA 5EVCA 3X44A 4KXNA 4L2IB 3ROFA 4A2CA 4CT4B 3ZV6A 2PV7A 3OD1A 3HDQA 1N5RA 4Q1CA 4C06A 4PS1A 4CUJA 1B0ZA 4DLTA 1JN0A 3RT1A 2WYHA 5FKJA 1X7XA 3PRJA 5KSYA 2OWDA 2RHRA 3JQFA 4FWTA 4BWYA 1QRDA 3BORA 5HK9A 2AQ8A 1YB1A 1DX4A 2Q5IA 4RXUA 3A10A 1M6YA 2IT1A 3ZEIA 2QRJA 1DJNA 4FC6A 1D2HA 3OT4A 4IF6A 5EFOA 1EHCA 4EJ2A 5EHNA 5F2NA 1UANA 2H18A 1E3WA 3GVPA 3PIRA 2GD2A 2J5QA 4FMCF 4EZBA 2ZE7A 3C8DA 3ICOA 4F9GA 1E77A 4V38A 4RMIA 2I3ZA 2GXAA 2YYAA 2C1ZA 2UUOA 2XW6A 3GF4A 4JEHA 1EP9A 2J3HA 3EMBA 4ARZB 1QK4A 3ZLUA 4BEVA 1JXAA 2C5GA 2ZRHA 4ZQFA 4EPRA 3U60B 2XA1A 1XZQA 3FMFA 3WAKA 2YV3A 3WJ7A 5FEUA 2AJ8A 3NIBA 3OKFA 3TL3A 1MX3A 1I7SB 3NTUA 4KXUA 3GVCA 3DFUA 3ASUA 5MN4A 1B8PA 4U5XA 1JWAB 4AZ3B 2JGRA 3C39A 4GYWA 1A3CA 1JBEA 4FCTA 4QHSA 3IAFA 3ODPA 4CEJB 2ZJ8A 3R6LA 4TXHA 3NDBB 3QWFA 5EXXA 5C1IA 1MH1A 3PR1A 4Z9XA 3QJYA 4ZYVA 3LGXA 4WVLA 3KOYA 3KD2A 1Y6GA 2LCFA 1CB7A 1E5VA 1TM3E 3TSWA 3UBTA 3NHMA 3SQNA 1KTIA 1KTVA 4JR2A 3RBZA 1FFXB 2ZTLA 4D9BA 3M8KA 4BNDB 1QNLA 4PS0A 2FQWA 2IYNA 3DTVB 3DHVA 1WETA 4RTMA 1U1EA 3M7IA 4EG6A 1ADCA 2R25B 2OYRA 3STUA 2JZOA 1DQSA 3QTLA 1OW3B 2W2PA 3QWBA 4PO9A 2GJ9A 2FW8A 3AP2A 2AS0A 1S0UA 3E7XA 3BRSA 3MLBA 4MKIA 1VLHA 5A9RA 3ZXYA 1ZD3A 4TS9A 3DM9B 2GSWA 1IHUA 1ZZEA 2ZJYA 5CCDA 3TZBA 3MS2A 2X0IA 1M1NB 4FHCA 3LX5A 4BX8A 2VT6A 3CEJA 3F1KA 2HV9A 2Q5QA 2Y1GA 3OLXA 4MXDA 4G0NA 2OHVA 3IR6A 1JU4A 1TT5A 1YQUA 3ROKA 3RNLA 2PGXA 1BWQA 4JQZA 3W90A 2IHKA 1BMDA 4KN5A 3EEQA 3BMNA 1K88A 5F12A 1NVWQ 4FYKA 4WA8A 3DKVA 5DW0A 5GADl 3DV0A 4NOKA 3UV3A 2VK2A 3JR3A 5GIPE 3MIIA 5FCDA 1G5PA 5KDLA 4AF7A 4HQ0A 3P2OA 4GLJA 5CD1A 2VJCA 2X6TA 2Z8YA 1V9LA 2ZAIA 4NK4A 3GLGE 3ISVA 1G5FA 4G1UC 3WQRA 3ZE2B 3CWCA 1CNEA 1QFJA 4YVFA 2Q46A 3UJ9A 3V00A 1BE8A 1M8GA 5AVVA 1UBCA 3KP1A 4JH0A 4DJTA 4CCAA 1CVLA 4PHTA 3GCDA 4RY0A 1NBHA 4LOAA 3IEIA 5K0FA 3DVRX 2IF2A 3K4PA 1H23A 3H4TA 1BSVA 4KH0A 3UK2A 2VUUA 3EVBA 1NYTA 5AHRA 4OYHA 4XEHA 4O4IB 6NULA 3B70A 1RQGA 2ZR8A 4Y6RA 4GKJB 2Y4OA 2FRXA 1L1RA 3OSUA 1C4XA 1Y3DE 2QRLA 1UPAA 2EFJA 4KE9A 5JQGB 3KR1A 1SURA 5LDGA 5BPHA 3QVSA 3L0DA 3UMVA 1QHHA 4JUFA 3G8BA 3P9YA 1PFUA 1ZLXA 4CQLB 4CM8A 4WA7A 3V48A 1YDWA 1SQ0A 2G6BA 4O3MA 1W93A 4MHOA 4MIOA 4N5DA 5ADUS 3VHXA 4B31A 4GUAA 2YYZA 2M2IA 2MYPA 5DZSA 4HRXA 4BBZA 2FYTA 4U6NA 2P0AA 1QH9A 1TEHA 4C7KA 1GG5A 5LL6P 1YL7A 4UM7A 3L5OA 1D07A 1C7JA 3HDVA 3UAZA 5G3ZA 5DN6D 2VTBB 1B6RA 1VB5A 5I9MA 4J07A 4JC5A 4DADA 5JASA 4X1OA 5JZOA 1Y1QA 3WYDA 1MVLA 2R751 3AG6A 4LGYA 3LPDA 3V1LA 1NF3A 5D5QA 5GQSA 3FPGA 1GUAA 3PGMA 4XTRA 4FUTA 5REQA 2HL6A 2QX8A 3QPWA 2R79A 4OX9B 3ZCRA 1SVSA 2DFTA 1Q1QA 2IHZA 2O3JA 4FDLA 4M1WA 3C6XA 4ALJA 4BYMA 4EY6A 1P5FA 3CNQS 1IM5A 1CQZA 1R0KA 2XQFA 1G8MA 4G1EB 1D4AA 1GNRA 1XTVA 3ETNA 2R8BA 3ZTYA 1E9AA 2R1TA 2Y67A 3MGGA 4XUCA 1XZFA 5TMPA 1DEXA 3VO2A 2PG3A 2CD7A 1DQPA 3ZS9A 5BYKA 3GBPA 1JIVA 3BB3A 4LDPA 3FD8A 3DMTC 1OCEA 4GOLD 4GRAA 2YWDA 1L6RA 2WY2D 3AGPA 2W8ZA 2XA2A 4TMWA 1GSOA 5CT5A 4M22A 2R96A 1MIOA 4BX2A 2A9OA 3KTAA 1FFBA 4L3VA 3CVYA 2Q5CA 4YQYA 1T2CA 2VH1A 4OGFA 2F3PA 1KMQA 4R1TA 4U8HA 1FP7A 1M33A 5H16A 3REQA 2WHQA 1RRPA 3RG2A 5TF0A 1UWLA 1DWPA 1CYEA 3DLCA 4KQ1A 4OXYA 4R1SA 4RKWA 2XHZA 3PXEA 1CJUC 4P36A 4NCAA 1HF3A 1EZ4A 3WGHA 4ZAXA 3T7SA 4C7OA 1O6BA 2ZB3A 3L43A 3TOSA 3NHUA 4R1UA 1SFRA 2Q8QA 5CR9A 3IX7A 4QO7A 2ZVQX 3T35A 4U00A 2G4LA 4WOBA 3K9NA 4KEAA 3DKIA 2OHGA 2IXGA 3X3HA 1WUKS 2J3KA 2QZZA 5AM4A 1JZSA 2VQ6A 1RZ3A 4FWIB 1NI3A 5KKNB 2AH5A 5ENDA 1T1IA 4XAQA 1QHNA 2NAFA 1SC6A 2TSYB 3E18A 2GT1A 4PZCA 1J22A 3SR0A 3ZVRA 5KMGA 1JUDA 1H1LA 2XUQA 5G2OA 1USWA 1HG1A 1LRJA 2P11A 4WY2A 3RYIB 8ADHA 4Z4FA 4OXRA 4ALMA 2UU9B 2HR1A 3Q3IA 1BQEA 5T7BA 3N8KA 1AXEA 1E2IA 1T2AA 3FNQA 1K89A 2O5CA 2B3TA 2HYDA 3AZPA 1OV4A 4CHTA 4GIBA 3JWJA 3QMPA 2NYVA 2AN1A 5ALJA 4KN8A 1HKUA 1ID8A 3IMGA 2Q4EA 3HCNA 4RKYA 1QM5A 3IKLA 2C2XA 3KCNA 4LAFA 2FU5C 3VC7A 4C0WA 2JLXA 3GGDA 5ALUA 4HZIA 1NPDA 1HNNA 2UVPB 5DMXA 3WLTA 1T9KA 1X0XA 3DLTA 4BJHB 3UWPA 4FZRA 5CLLA 4Y3UA 2XCIA 4CDRA 1U0FA 1LPSA 1LLUA 4A9AA 4F9EA 1DV1A 2GHIA 2PIAA 1L5NA 4U2CA 1T2FA 1IZ8A 2HGZA 5F4BA 2IY7A 2WILA 3KPWA 2PEZA 1L0BA 3CUSA 4RHYA 2B8JA 1MTOA 3O8LA 3R23A 1OKKD 3ZJVA 2PH1A 3NHWA 1P73A 4KXXA 5IFKA 5L6MB 5B4VA 4KN9S 2Y2VA 3D31A 4HGNA 2CCGA 1HDOA 3MWGA 1TCUA 3MPUA 5DO9A 1OXTA 3ICWA 5KSPA 4R9VA 3C3PA 5LXTF 4C0QC 1OUMA 2QR3A 3FZEA 4J8PA 4ZGWA 1LPAB 3C7DB 1XAGA 4JEUA 4QXMA 3W6PA 5AVWA 1ZMTA 2P90A 5BOVA 1IN1A 1VG0B 1R6AA 2ZRKA 1QP7A 1TQ4A 5TB5A 1KEEA 1CDZA 3RKUA 1CZRA 3BGIA 3VR2A 3FZGA 4CEHB 1JAZA 3OEHA 4FKZA 1R8XA 4RKEA 2BMEA 2VPXA 5F5NA 4KJXA 4OO3A 1E2FA 3IBGA 1QTQA 2W2QA 2A67A 2IYOA 4R40A 4X3OA 5FD8A 1FYDA 3RIMA 4AX8A 4DEXA 3K94A 4L6AA 2G5TA 2TYSB 1LNZA 4RD4A 4KSBA 3ITDA 1YFLA 4MUNA 1CR4A 4OJYA 2QTZA 2GN6A 3FWNA 3OLQA 2H48A 1IUOA 2BI8A 4JB8A 3ZWOA 4TN1A 3IKTA 5IVHA 2DPGA 2GZHA 4LJLA 3AHFA 3M5DA 1U0SY 3EQ9A 2OCDA 5LD2B 4C89A 1TL7C 2HF9A 3I9KA 5TPZA 1FB5A 1EGAA 2J3LA 4Z9AA 2X5XA 2ZYVX 2BKVA 1W5FA 5IJ0A 2NQ8A 5E8RA 1GR1A 2JG3A 2J4CA 5K51A 1BGVA 4AZ0A 5IN4A 3L1JA 1KH1A 1U2TA 2EWVA 4EQZA 1KQNA 1RPJA 5AW8A 4ZV7A 1EWQA 3G7SA 4KRGA 1XZAA 3UMRA 4BRSA 3QHQA 3GUZA 4W9RA 2MR5A 4Q3OA 1VIYA 2PLAA 1E79A 1PD0A 3HZRA 4QNRA 4DQ0A 1LNQA 4U39A 4K9NA 5EOVA 1YL5A 5SY9A 2YOHA 1B0AA 2HQBA 2AXQA 4U9IS 3MEQA 5A1TA 2QRMA 4MR8A 1AUXA 1Q84A 4Z2YA 1PYOA 1W7AA 1BYIA 5GJVC 4WECA 1LX7A 4KLRA 1I14A 3CT4A 5ALHA 2QT9A 2QORA 3TSCA 1L9KA 3LUBA 3BJZA 2JS7A 3MUEA 5G1OA 4BVJA 2OFXA 4NULA 3D0RA 1ZOPA 3AB7A 3LLSA 1WW8A 1ZUIA 1D8TA 4K7JA 3U3DA 2X3UA 5FNZA 3TXXA 2FSSA 1L7VC 3I9OA 2P68A 5EE0A 5IBQA 4CL0A 1T3ZA 3TSOA 3MBKA 4FMDB 4PTYA 2Z8ZA 2CF5A 3G0HA 2R1UA 1A98A 1FXUA 2WM3A 2BCEA 4RLHA 1MEEA 3DR3A 4YI3A 3T7TA 2HPHA 3BTSA 1M9NA 1QMPA 5SYNA 4NFSA 4JGGA 4MW7A 4U9HS 3EFOB 4DBLE 2VYVA 3QEMA 3AETA 3UATA 4LBVA 3MMSA 1T1RA 1ONOA 4MQEB 3K5PA 4BFYA 3QY9A 2L42A 2GCEA 2PN1A 4HRYA 1W4RA 1Z36A 2X0EA 4ZKEA 3K1AB 1FTYA 4OY3A 1S2LA 2CFRA 3KRTA 3LMKA 2X1VA 3LWZA 3PC2A 4MGHA 4W1QA 2W8BB 1QHSA 1Z39A 1ZUNB 3RTGA 1UXHA 3WX0A 3QK7A 2BBOA 4CTMA 1U9ZA 1TYEB 4FE7A 4NG5A 1WBDA 3Q7IA 2CEAA 4M21A 1USIA 4H7JA 1AJEA 3GMTA 3W5VA 3A9WA 1Y8QB 1D2RA 3BMQB 5HXAA 3QXCA 3BJRA 1VKJA 3M6XA 4H6PA 4EAAA 3P9ZA 3WNZA 5JY6A 5ADVA 4RFSA 5E6UB 2FFHA 1W4CA 1BVYF 3W5SA 2NPOA 1NT4A 4RK1A 3Q40A 3KKEA 1AOXA 2Q2VA 4MQMA 1RSZA 3H6KA 1GKIA 1I6MA 2JIRA 4OL0A 3GIDA 4PSCA 3BJEA 5THQA 5B1IA 5CCEA 2WKQA 4DT1B 3VR4D 3UUWA 1SD2A 1VI2A 4P4UA 4ZO7A 5K0NA 1GTJ1 3IHTA 1XMJA 4ARCA 2UUPA 1GFSA 1JPJA 1V8ZA 3TO5A 2VUSA 4QOGA 1O5IA 5CH5A 3JZAA 1SK9A 1E9SA 1A77A 1GNPA 1OQAA 2QJRA 3OPVA 3P2KA 3LOUA 4LVOA 3TZEA 3OETA 5DHUA 3OQOA 4QQNA 3BCSA 4RHCA 2EAUA 2ZCUA 1DLJA 3FMOB 1RWVA 1UXOA 4LXIA 5D7BA 5FI3A 2NVBA 2E87A 3URKA 5FWAA 5JD5A 2MINA 1MNQA 3CW9A 1DBVO 4X94A 1U2GA 1QRAA 5JMOA 4KCGA 1M76A 1F2TB 2J45A 5HHTA 1HBJA 2RCNA 2XIQA 2B6NA 1B8NA 1O6ZA 3IVRA 4NE2A 2JDIA 1UMDA 4OHCA 3HR7A 1KVSA 2B1IA 4CEIB 4ZVOA 1Q15A 2PMKA 3DMFA 1AY0A 3OU6A 5K0BA 2VNKA 4ZCMA 4YGXB 3ER8A 1LUAA 1LDNA 1GZ7A 4AM8A 2PZGA 3DDCA 3NRCA 1GG8A 5DBOA 4GLOA 4J1TC 2ZETA 4IICA 1X0VA 3UHOA 3HACA 3UMSA 3FI9A 5DT2A 1KEUA 1E6MA 4AKSA 3EXG2 4EA8A 2IQ5A 4N12A 3PX7A 4KIGA 1LLCA 4KR3A 3PFWO 1UM9A 4JITA 3LV8A 4ZVVA 2IXEA 3M9XA 4Q34A 1P81A 5FI1B 3CSSA 1W5TA 4NF2A 2VZ0A 4BLTA 1QYRA 3PK0A 1TMKA 1M67A 3RTDA 521PA 3QF4B 4XTCS 3MJ4A 1FUEA 1N92A 2PDAA 1EM8B 3C4VA 1TIPA 5IC4A 5HK8A 5E6RB 2ZE5A 3A3NA 1K92A 2PRKA 4O63O 2Z3VA 2ZBFA 3CF2A 3Q9SA 3O2JA 3G6WA 3AIIA 3QVVA 4YLEA 5EIFA 5FAXA 3ZBTA 2ZROA 2H7CA 2CXPA 2HYIC 1GSIA 3KSZO 4HJXA 1JDJA 1ZVJA 2IW3A 4LMBA 4EOGA 5EJEA 4M46A 3HYRA 3RAEC 4IH4A 1KKMA 1U8UA 3SICE 1YQGA 5IG2A 2DR2A 3IDOA 4UHHA 1A8SA 3W7AA 3ORYA 4GEKA 4RFLA 3KAJA 5FOTA 1JLKA 3PRKE 2ZB4A 1FDRA 1C3VA 1WD7A 2PTHA 1JW9B 4I1RA 4TKVB 1IWPB 4MEJA 4DS3A 5JAIA 2X5NA 4JA2A 1SVMA 3HVKA 1ZGCA 2NVWA 3DM5A 2FZVA 2O8BB 1Q1NA 2CLOB 2RGEA 5IKPA 3AW9A 1P0FA 3P2MA 4Y2SA 4WBNB 1NVGA 4ZOQI 3S44A 5L4NA 1R4MB 4JJ8A 5B1HA 2HB6A 4NOMA 2VF2A 4W4TA 2WHPB 5E95A 5FBKA 4QM7A 4BO8A 4J94A 1K08A 1PZFA 3WOHA 3UHJA 4DY6A 2ORVA 2P2LA 3DZGA 2HMSA 3W7VA 2XDQB 3QVJA 4EB8A 3OJOA 5IJXA 3FPJA 5BWMA 5ILGA 2H8KA 4WE3A 3S2ZA 1YZLA 4AJNA 3L8FA 5BN5A 4F38A 2YXPX 2WP0A 2ZRBA 2I4TA 4KQEA 5KNDA 4YRTA 4QRIA 1CSEE 1GWNA 4RPLA 1ZD8A 1WA5A 1ENZA 1S6YA 2IYQA 3ZZ0A 1XEXA 1H2XA 1E8MA 1YRYE 2ZJOA 4FYVA 1SHLA 4I4TA 4K9OA 4RX1A 5ALRA 5DX8A 5D01A 5ED4A 2DCMA 10MHA 4MZXA 2RJOA 3MVEA 3CX4A 3OBBA 3PWSA 4GSLA 1ZU5A 2H59A 2NXNA 1BZYA 4ZJYA 2YWFA 5KTKA 1S5PA 4G2TA 4EM6A 4S2UA 5E2AA 4YY3B 1CIVA 2XAUA 5TLSA 5HS6A 2PUHA 5KYWA 1HQDA 1XCLA 3HJCA 4JC8A 7ADHA 4RDIA 2JASA 2X86A 3G0DA 4C9BA 1O0CA 2HUPA 2IEIA 4O2AB 1O4WA 2C0CA 4JLDA 2IZ0A 3VOAA 3RIEA 2DC1A 2PUDA 5L7TA 2ZI7A 2BELA 1WSAA 2FG7C 2PIDA 2ZRLA 3N0VA 4I50F 3JVIA 2F8SA 3B89A 4WOJA 3UH0A 2PZ8A 3I30X 2YOGA 3OX2A 1AO0A 4JENA 1OYWA 5H0IA 5L7WA 1EIWA 3WS7A 2V6JA 1Z88A 3EQ7A 4KK3A 4KLZA 2EATA 3LAWA 1E5LA 3ADPA 1WXXA 5JVDF 3KKQA 4ZV4A 5BMVA 4J1NA 3QA9A 4LY3A 1TAQA 3ORQA 3VKVA 2OM2A 1T0PA 3CZMA 4L57A 1HMPA 4ZMRA 2AE2A 5IDQA 1OV6A 1GZVA 2ORED 4TL9A 1IEXA 3ZOKA 4PLCA 3IDZA 2R4UA 5E9WA 2B7BA 1Y1PA 3CZCA 2VEDA 4KMMA 2JJ2D 5G0VA 4P4LA 5EHIA 3HU5A 1XWFA 1E4YA 3IMKA 4LS3A 1K6EA 3KAPA 4MA4A 3TAUA 4EA9A 1M2NA 2AE1A 3M5WA 3BSFA 1OOEA 4IHAA 2VHXA 1KC1A 3EARA 1UZNA 1ATIA 1G6KA 1QG4A 4LFCB 3WGTA 1GYQA 1QP4A 4ZXFA 1WD5A 2YV4A 3PJEA 2PS1A 4LF7B 1FP1D 4FLEA 2J9GA 4US0R 4F9FA 2OQ2A 1JWLA 2JZCA 1O8BA 4CQMB 4MV1A 1B26A 2R7LA 1MB4A 4WADA 1S2NA 3O93A 3V1NA 5AJZA 2VXCA 1T5DX 3FKSD 2LKDA 1KZ7B 4TS1A 2YMPA 4F45A 3NDJA 2E4AA 2WWGA 1JFFB 1JXOA 1QJ4A 1YD7A 4MTLA 3SM9A 1KSFX 2FAXA 1WMSA 1WVMA 3TLGB 1I6KA 3HVRA 1GQRA 1Y9JA 5IU6A 2JIDA 5DISB 1II8B 1T15A 1P9LA 4L8FA 3MWLA 1DUVG 3ANXA 2IF0A 3JD0A 5ALXA 5LP6A 5LQDA 1WSWA 1VA5A 3QVUA 5B30A 3VVLA 1OF1A 4J0HA 1NC3A 1L7RA 1SZCA 1Z0SA 2I62A 3NFRA 3N76A 1L7NA 4P86A 1KAEA 4NHOA 5EWMB 3H1GA 3F3KA 4C1NA 1XEWX 3CURA 2VZ8A 3BFPA 5J2UB 3PB3A 1GFIA 3UUGA 1VP3A 3VMMA 5J5CA 4C78A 5KYYB 2VYFA 1RKVA 1YHYA 2PMWB 1ZJZA 2IP4A 4IKOA 3IQZA 3RWOA 4A6XA 5BN4A 4OEHA 2V7QD 3EMDA 4LN1A 3KR0A 1KJ9A 4Y0AA 2WMDA 2LNDA 2Q41A 3PS9A 1SIOA 4XWGA 1A4UA 1RABA 2KBEA 2MOKA 4RACA 5BUSA 2FZ4A 1QFMA 3PGLA 3K1JA 4QPJC 3TDNA 4WOKA 3TVYA 2H1WA 2CUKA 3IV9A 4M9ZA 5FWNA 2PD4A 1SBIA 4NBRA 3TSAA 3QXGA 3NT5A 3IERA 3IVGA 3EA4A 2OZVA 3ROMA 3DV2A 3TXYA 1YI0A 1AXRA 3H7AA 1E20A 3RSSA 1TLTA 4YMWA 1SVUA 4D9NA 1NQ5A 3WBBA 5DM60 4EUEA 2GB4A 3WLKX 5LMUB 3U0BA 3W04A 4WOPA 1P1BA 3EIQA 1ZCAA 1LY1A 3QUAA 2ILVA 3HDJA 1R16A 3L9XA 2D0OB 1LX6A 5EGNA 3UANA 1QTIA 5MHTA 4QOHA 5F1KA 2R7KA 3LDUA 4EG1A 1LC0A 5AQ1A 3ORSA 1EP3B 2WJGA 2YCBA 4XRGA 4A8HA 1CQJA 1R4NB 1GNSA 1YZQA 1XZGA 4TT3D 1I10A 5DHPA 3SIXA 4QYWA 3NX4A 4GBJA 3OIUA 1BCSA 3SM3A 1SA0B 4V0NA 4B8YA 2FE1A 1KMHA 3HNPA 1SGWA 3E27A 3RRFA 3I32A 1Z7BA 3SBEA 1Y33E 5B7GA 2GERA 3PCTA 3W3ZB 1DEAA 2NUPB 1E62A 3OA0A 3LC0A 4YDSA 1QKIA 1NTRA 4Z4QA 4EYGA 1LPPA 2DHDA 4E1VA 4HWTA 1JHRA 1G21B 1Q7RA 2GILA 3IE0A 1POWA 3DUFB 3QP9A 5DTMA 3T9AA 4A4DA 4ENTA 1BMQA 5DM70 4W5OA 2VK1A 3PNKA 3RADC 3SQDA 3JWHA 4YRSA 4K6MA 4D9CA 3FTNA 3W3AA 4GC9A 2ETXA 1P31A 2CXTA 1V11A 4JX8A 5F78A 2A1UA 5IJ9B 4FGJA 1Z63A 3V7FA 1UXIA 5M5BA 16PKA 1AKTA 4K9KA 4TV9A 4CMIB 3E9ZA 3H1AA 3KIPA 1BE1A 3M4JA 4BV8A 3OAAD 1IBLB 3H8SA 2W6MA 5BV0A 5JLJA 2B98A 1VBFA 2M1XA 2N1MA 1IIBA 1RYFA 3DDWA 3T5GA 5CB6A 4E5NA 4IGIA 4E03A 3HBMA 4TM7A 4ZHSA 4KQ2A 5LA6A 4CTJA 3O9MA 4MWOA 1QYIA 6AT1A 2CLEB 3RUFA 3JS5A 2P1ZA 5M3BA 1DJLA 2C7VA 2JLRA 2CFTA 4I1UA 3G88A 4PYOA 1JIIA 3DG9A 4KI7A 3UTCA 3VOBA 3FTEA 1GGNA 1ADGA 1Z6GA 3GRRA 1RDFA 1PD1A 2JIOA 2VBCA 3B2EA 3GT7A 3PHBE 4P7KA 4XYEA 1D2EA 4NCKA 2DZDA 4R98A 4UFPA 4Q4AB 4I7EA 1QVZA 2ADMA 3GEEA 3SJ7A 4Z7JA 1ZUD1 2WJIA 2JJ8A 4H4CA 1LWNA 4QULA 2VP6A 1HEYA 3DO8A 4G41A 5CX1A 3LTNC 3AM1A 4XWYA 1FZQA 2P9EA 1OA1A 2I6TA 2B5WA 2H3HA 1ML4A 2CLIB 1LS1A 3Q3EA 2O48X 2EKLA 3OC6A 1IQ0A 3AMVA 3DT8A 1JHDA 2DQSA 3Q7TA 4P9NA 1HL7A 5COQA 3GCXA 3QFHA 4Y0NA 3OOYA 5BR4A 2Z0MA 3OHPA 5FPPA 1PNVA 1N9GA 2IEYA 4B8ZA 1YR3A 4YUWA 3GFSA 3SGLA 3TIGA 1TAUA 5I9IA 5CVTA 1MG5A 3CLKA 3DPUA 4FT2A 3JATA 2REOA 1PJQA 1V7PC 2E5WA 2R44A 3NLLA 1QE0A 1LNSA 1NPYA 3W2IA 2J5XA 3HKCB 3VC3A 3IT3A 5JEDA 3NYQA 3UYKA 5DXAA 2BHLA 2VJQA 5FNVB 5L8VA 1ZNXA 1BXRB 4HX5A 3FKJA 1ACMA 1Z35A 1E7WA 3SVZA 4E6PA 4PG8A 1FXSA 2QW0X 1F5NA 3FLEA 1U11A 3R24A 1QK3A 4GXRA 1U0GA 5LYJA 2BP7A 2YZ7A 1VL5A 3CYFA 2OVBA 3PC8A 3KZXA 3ZH2A 4LXHA 1GM5A 1PG0A 3MERA 1I51A 1E1NA 3RRYA 2V7EA 4EWLA 4ZO4A 3DHWC 4A15A 1GQ2A 3RRXA 2OR3A 1EJBA 3PNVA 4XB2A 1M6EX 3OQ6A 5LQAA 4YRKA 3K70C 5H82A 1N0VC 4OXQA 1EEHA 3GJ5A 4EL0A 3BFJA 1OC2A 2VNIA 3TOXA 1XQVA 1G17A 1PIWA 2EJUA 2R6HA 4N39A 4P4NA 5K3DA 1OHHD 3GJ0A 3NAGA 5KJEA 3UQYS 4OCZA 1KKLA 4PPNA 2AVNA 2PFSA 4IMRA 2DEUA 4EUNA 4N6OA 4JBYA 5DBEX 2W6CX 4G0WA 4ZTUB 1ZRSA 1UQRA 5HDBB 3IE2A 5JEEA 1Y7LA 1EP2B 2QD2A 4ZT4A 3SZUA 3FB4A 4C08A 1OJ7A 1SNYA 4Z1MD 1U6KA 5JAOA 2GCOA 4FKBA 4C7MA 2PGNA 3CHYA 1JLSA 1I4OA 3EDOA 2X8JA 2LCQA 2H51A 1Z0KA 4XLLA 5IASA 1E1KA 2YHUA 4OMCA 1XEWY 4DLYA 3G5TA 3RH0A 2FQYA 1O2DA 1EX9A 3VUFA 1QQAA 3BYZA 4MRVA 4QQRA 4DA6A 3F6EX 3JQFC 4RK4A 3OIDA 1YAHA 4JT8A 4CKYA 4YI5A 1MABA 5LIRA 2NVUA 4KAJA 4YRFA 3GGGA 4DC9A 4KPUA 2OXIA 2C61A 1IEQA 2FPUA 3NGXA 3O4FA 5DULA 4KFCA 5AW3A 2HWWA 4G5GA 4U7JA 4LCBA 5AK5A 1ODSA 3VO9A 2KB0A 3WWZA 3RVNA 3MQ4A 1XYYA 3VVCA 3FUUA 4WQMA 2AX3A 2OO5C 4LRWA 4NNJA 2XB6A 3EGDA 3FUTA 3R5KA 3CF6R 5G41A 2GN0A 4BLQA 4ALNA 4AKEA 1H2HA 1KPIA 3D3WB 1PYDA 3U5ZB 1UJ6A 2I0FA 3AKYA 3UK6A 4ZCLA 4E11A 1CDEA 3FM9A 3AF3A 3R5HA 4RVCA 1XTIA 3KWJA 4OHUA 1EK5A 2BUAA 4GLLA 4IJWA 5F1OA 3EZ2A 4PRLA 5HILA 1EK1A 2NZWA 3ILXA 1EDZA 5A0FA 4HNUA 1Z5PA 4LZLA 5KSZA 4ZVKA 4BGVA 1OFHA 2EBUA 2HJWA 3B5JA 3ICQB 3LBNA 1YCGA 3N1UA 1A9OA 5HS4A 4E07A 3STTA 4BO4A 221PA 2HRRA 2BFCA 3OWXA 3IOYA 5AKIA 4FU0A 5TQJA 4J29A 1J8DA 1HY3A 4YMHA 5CEJA 1CNFA 3A70A 3RU3A 3AIOA 2TRSB 3OZGA 1TJ4A 4NH0A 1K8QA 3DDHA 2JW5A 1O94D 2ZSJA 2RBGA 1TT5B 2XUJA 1G7SA 2J3DA 4G4GA 2E82A 4LPKA 5EMJA 2FPMA 1EK6A 3I9V6 1VM6A 3LZCA 4CN8A 4DXHA 1W44A 3LNTA 4HDCA 3FSEA 2GK7A 4F4JA 3HBLA 3GI1A 2I7VA 4UBMA 2Q4RA 3D4LA 3RJTA 3S7ZA 5A3QA 3PCRB 1WXQA 3CEAA 2XV1A 4REQB 4BBPA 3NP7A 2A5YB 4GBED 2PRIA 1NJ5A 4KDRA 2VQEB 1YBMA 3NVMB 1JHVA 1X7WA 3FVTA 2R6AA 1XX6A 4QX6A 3NHYA 1XRQA 3AVUA 5HGXA 3GLTA 4HDMB 1VJRA 1YVUA 4OMDA 5KPJA 3SEAA 4UEQA 1PJTA 2HLPA 3OZEA 4RORA 4F93B 3AKZA 1B23P 3AI7A 4E08A 4F06A 4PLVA 4RLQA 1NR5A 3L7DA 3N6VA 5ECDA 1J0CA 4UFNA 4BNHA 4J0KA 3COVA 4YACA 3AF6A 1N3IA 2QGZA 1ZI9A 2FMFA 3TRJA 3UB2A 2Q7DA 3G8CA 3M2TA 2PSEA 2I99A 3U31A 3T9EA 5J4KA 5HKAA 4U0JA 3ADKA 3GJ7A 5JH7B 1W4AA 4X3PA 1SCJA 2WAMA 1W2HA 4MVJF 2UYHA 4BLVA 3R5FA 2PBFA 4OXKA 5DXJA 1ZK3A 3NNNA 4ND8B 1FX0A 3DOHA 2OHJA 4JGBA 2M6LA 2VSNA 3NC4A 5ELXA 4R2MA 2B6HA 3IO3A 3EGWA 4BC1A 4OHYA 2XJ9A 2TMKA 4KQ6A 1NE2A 2X5JO 5JIBA 3ZGVA 3ZE0B 5ICCA 5ITZA 5TGZA 4AF8A 5D8DA 1G2QA 4XQ0A 2H00A 3X1MA 1UK8A 2FSUA 2DH6A 4G6ZA 3ND6A 4ZZIA 1HDGO 3LLVA 3RTBA 4DQVA 2I3AA 4DV3B 3NWJA 3KFXA 1TYZA 5AR1A 3CKMA 4IYJA 2D1QA 4E5MA 2PEYA 2O8CB 3VPXA 3MTJA 5ELLA 4QGSA 4N3AA 4ADSG 3V8RA 3E4DA 1JHXA 3HXOA 2ZM6B 1V5EA 3LFHA 4BB6A 5CNJA 5TT1A 3CJTA 4C43A 3GDFA 3C97A 4CE6A 4QAQA 3ZHBA 3ILYA 3FHCB 3PITA 3I37X 3NGMA 2W2XA 2ZDQA 3CPEA 4MRAA 4P7GA 1S89A 2I54A 2YJ5A 6ABPA 4Y6PA 5GOZA 1GTMA 2IZ6A 3D5EA 5I9BA 1JXQA 1VHJA 4J16A 3C6MA 2W6OA 3LYLA 3L1IA 2X8BA 3PPXA 3GPIA 2PCLA 4YMUA 3PUWA 5EZ5A 3KJXA 4YS6A 4DHEA 2YC4C 3AEQA 4D6YA 2CDNA 2YHAA 4KLNA 2Z2ZA 2IOFK 3LK6A 4QXRA 5TQ0A 1XZDA 1M3SA 1KFCB 3BF8A 1L5LA 4ZYYA 2VP3A 2ZJ2A 2P9HA 4ZZ1A 3Q0IA 1O0SA 4Q5IA 2XGMA 4Z1OA 1KXZA 2NWQA 5IBCA 1EH5A 2C8KA 2BKAA 5SY4A 5A5DA 4F5ZA 4GICA 4PGMA 1ZP6A 1Q5PA 2C2OA 3CLSD 1J7JA 2OYCA 1BXZA 3MMPA 2IHYA 3IRUA 1QPGA 2FR8C 3A2LA 1GTVA 3OP1A 4KE7A 2QUHA 4C7OB 4NOJA 2WTNA 5KC8A 1C9KA 3PGKA 4HG2A 4W6QA 4X7BA 3PKIA 4NABA 3Q4GA 3X43A 4DG5A 1M2GA 3T12A 2CJXA 2IEBA 2TS1A 3M5PA 4RMJA 4WJZA 2W2LD 3QW2A 5JAZA 2XZOA 2WLSA 2WYOA 1PX2A 4DMKA 4GVPA 5I4BA 1C9EA 2H63A 2PRSA 1BFDA 2XQVA 1G20A 3NUQA 5HBGA 3GLQA 3UKDA 1K5HA 3PRYA 3FRHA 1KEZA 1T8YA 4IX1A 1O77A 2AW5A 2JPDA 4FFRA 1JALA 4OFWA 3PFGA 5DJ5A 3MPOA 3VR0A 3WGMA 1URPA 3FVQA 4ZA2A 2E4WA 2JCSA 2ATCA 1F51E 5EWLB 4ZGBA 3PGA1 3CFYA 4FDAA 2XNDA 4QU0A 3A6PC 1D09A 2IBTA 4KQ9A 2RG7A 4MS3A 5H02A 3CT6A 2YWXA 1GG2A 5H3CA 3RC1A 4YAKA 3EXHB 3SLRA 3KQUA 5I4KA 1IAVA 1KA9H 2IXBA 6YASA 2IUEA 4L8YA 2XMDA 2IUSA 1U9IA 3EFBA 4C0XA 1C3OB 1U2ZA 3BWMA 3B1JA 3AG5A 5JARA 2FUNB 4EB3A 2JFNA 2IVZA 4BUJA 1XZLA 2FN3A 3JARA 1C1XB 1H8HA 1E9EA 1I4EB 1OKKA 3L9WA 3OE5A 4KVAA 5EESA 3GP8A 2A1TS 2GWRA 3CGGA 4A91A 5C5CA 3GA0A 2EKPA 3R8FA 2O1WA 3FBWA 1P3Y1 3FTQA 3PE6A 1DV2A 5A4FS 1D2CA 2BEWA 5KX5A 1NW4A 1FFAA 4NH4A 2F43A 3GFQA 4HEA6 4TMZA 5HE8A 3OIGA 3WR5A 4NE9A 4EB0A 1H42A 3PDJA 2QP4A 1L4LA 3LQFA 3B1YA 1KDRA 2AG6A 1P7VA 2IGBA 2J5KA 2V7VA 4JLPA 4Q93A 2NZ2A 4O5OA 1OBVA 1W88A 1JB9A 3KD3A 3COPA 5FL3A 4YRLA 1IXKA 3GT4A 4HDSB 3DC7A 5HWSA 3A7DA 1EVZA 4HGOA 1YZKA 1IXYA 1DTWB 1PG2A 2F1KA 4HX2A 1N33B 1GITA 3UJDA 3I9FA 3MJVA 3K32A 3GLFA 3ZXUB 2R4TA 1Y6JA 5D51S 3WDKA 4DB2A 2GD6A 3SFZA 3ZNNA 2DB3A 3EC1A 4JLAA 2REXB 4H6VA 2ONYA 1E3SA 2XE8A 4YJGB 3N8NA 1M5TA 4FDVA 3TLEA 1ZPDA 4LK2A 4GLBA 4LOKA 4F3CA 5BVHB 4BKUA 2QRUA 3CUTA 3O4HA 1GR0A 1ZD5A 2O06A 2B8WA 2QZ4A 4MVJM 4X64B 1KO4A 1FNMA 2C84A 3U6KA 1CX9B 3LZ6A 2ICAA 4UMEA 5AI6A 2VJLA 1MB0A 4C76A 4E2YA 3HM2A 3I9V1 4Y2RA 1P1RA 4MRSA 3R74A 1GTL1 2CWWA 5LDHA 1WE2A 2RGWA 2GQ0A 4IUCS 4RVFA 4WCDA 4ZAGA 3TLMA 2AMFA 2GA8A 4TZTA 2C95A 3W5JA 3KKLA 4EPXA 1Y6FA 1T0BA 2UZ4A 2GHRA 2G5PA 3LUKA 4KDEA 5IABA 1TM7E 2ZTVA 3N2EA 3Q85A 1AN0A 4WKCA 2EFDB 3DFKA 2LBPA 3HCEA 1JJIA 2G40A 3K0CA 4PSAA 4DF3A 4O6VA 1BW9A 3DC2A 4B46A 4GLFA 2IHNA 1TADA 1J42A 1U2SA 4ZT7A 3P0RA 3SMQA 1PWHA 2PKXA 4CMAA 3UICA 2WNHA 5BVGA 3GP3A 3OHMA 1G64A 3QXJA 1UBHS 4PHHA 2VXOA 3ESZA 4R69A 4AS2A 2WT4A 4N8SA 4ZQIA 3O8RA 5FQOA 1RI1A 3GNTA 4OHBA 3RG8A 4DOMA 3HTXA 5IKMA 1V1JA 4Y1FA 4YT4A 1W94A 2X2EA 2VSYA 3FLAA 3IKMB 3Q9LA 4HGRA 1PNQA 2OCXA 2P9ZA 3LC7O 3RVSA 5HPYB 2J30A 2D7DA 2WF9A 4NL4H 4ZO8A 4ND1A 3RTEA 4NBSA 4G5RA 5JYEA 1F2UA 2FP4B 2VJAA 2NU7B 2WV9A 4RZQA 2OT3B 3IQGX 1HL3A 2H2IA 3GFTA 1LI7A 2EL7A 4LRQA 2CXOA 3VTKA 4EX7A 3U56A 3EG5A 1GTSA 1RPAA 3AUJB 1ZLYA 2J59A 3G0OA 2CL6X 4R71A 4EKEA 2IHTA 1RXUA 1P4GA 1SBNE 1OZ0A 1UJMA 3WRVA 1ADYA 1OXMA 4R9RA 1NN5A 2BGTA 1N57A 1CP2A 3QTBA 2J5RA 2FMKA 2A6PA 4PIVA 1YS6A 1WZUA 1JIUA 2GOYA 2GPSA 4HB0A 1LPMA 1XTBA 2ODTX 1VYVA 1J6UA 4DUGD 5K0SA 5DNYB 1Z17A 3C3AA 2YWCA 4GR9A 1S2IA 3KU4A 2G83A 2C58A 2FRVA 2R6GA 2JBWA 4NBKA 3WNCA 3ZWWA 4R0VA 3ZQJA 4F6CA 5LXTB 1NFQA 4KUHA 4PFKA 1U99A 3L77A 4MRNA 1NG9A 2PQ0A 2YVKA 5ESXA 3C8UA 3DBHA 3U19A 3M6FA 2DP4E 1KOJA 1IXZA 1ODJA 2XAAA 3L02A 2XGGA 3DD5A 5DI3A 1L5HA 4G4JA 1A1SA 4IAOA 3V32A 1G4AE 4E15A 4WAUA 2R8OA 3I4CA 4BMPB 1IM2A 2XNSA 3QHPA 4V39A 1A5TA 1SZPA 4XM1A 5D3MB 3ZNPA 4BFXA 1KI8A 5J2TF 4XD7D 5BXYA 3FMVA 2I4IA 4YJ3F 2AMJA 3VR4A 4E94A 2IXAA 4O29A 1JLHA 1T9HA 5IJWA 3L04A 2YWBA 2BGLA 2HI0A 4PPFA 4WCVA 5F76A 3VYUB 3OTOB 3L8ZA 3T7RA 3UJ8A 1JJBA 4KQXA 1DC3A 1CKEA 5F3DA 5BQFA 1IZ7A 4H7IA 2H4HA 5BSKA 3QSGA 3Q2OA 3HZOA 3T7CA 5JAPA 1C41A 1I1HA 2E48A 3FKQA 3JD2A 3NTOA 4MUGA 4ER0A 2ONJA 1PP4A 4UTRA 5JS7A 5U4QA 1ULTA 4UUQA 3D6UA 4XPIA 1TZJA 1ZJ4A 4RXMA 2A57A 4CG0A 4CIDA 4D81A 4PO1A 2AC7A 2YRFA 5CG1A 3QYAA 1Y6ZA 4HQLA 1X7DA 2HK9A 4PYMA 2Q1SA 2XKAA 4E5YA 1KFBB 1PW7A 3HE3A 5JG7A 2O54A 2JLYA 5KSWB 1EWYA 3IBCA 2CZQA 1PUJA 1RXEA 5AI5A 5CFZA 5JNTA 4CIAA 3CF0A 3J80A 3CVWA 1XA4A 5TS2A 4KPGA 2E5LB 3D2CA 1MB3A 1Z8FA 4J2TA 5AUOB 3GRYA 2AEFA 1QRRA 3WJ2A 2QL5A 4RIGA 3BIJA 1V7QA 4NYMR 1CZKA 2QXYA 4XVCA 4H6WA 4I99A 2Q5LA 3ENQA 1T8PA 2OAQ1 2BDUA 3CM0A 3PNSA 1DBPA 2A9KA 5COBA 5HYVA 1DUSA 1GILA 1SHZA 2OB2A 2ZB7A 3MWEB 4D9GA 2GZ3A 3GJ4A 3PNQA 1RXVA 2R6CA 4HVLA 2JIQA 3SSOA 4L6IA 3RIGA 2QL6A 1UM9B 4FM9A 3USCS 2FW7A 1MZPA 2QW1A 4KOEC 1SWVA 1NNI1 1Q44A 2EF0A 1G42A 3DO6A 1T25A 3QIVA 4BWFB 4Y2VA 1NN1A 2W6QA 4JMPA 3VO8A 3FWHA 3SR3A 3JQAD 1JQ3A 4JMLA 4JA0A 4XX0B 2CLFB 3O91A 4EELA 1OVMA 2MJLA 4Y6GB 2HADA 5DEOA 3O4RA 3EY4A 4HT3B 4PLHA 2IUTA 3P9XA 3PYXA 5DXFA 5JS1A 1SXQA 2GN9A 4LNHA 5DYYA 4MWBA 2OFFA 3QPUA 2VHTA 5DOZA 1QOPB 1SKMA 1DFHA 4BV3A 4DCGA 4OJQA 3WMRA 3BXOA 5T6MA 2LGJA 3OJXA 2HPAA 3SLKA 1GXSA 5K3EA 1CFZA 1LK5A 2FE4A 3HRHA 4BN4A 2Q7XA 5TX7A 1OA0A 2Y3IA 3MB5A 1IQPA 2ISQA 3ZY3A 3NHZA 3TFOA 2DH5A 4M53A 4MX8A 1OMOA 1X80A 3T4XA 5A03A 4GP9A 2RHJA 2AN3A 4JCCA 2R1ZA 5CAEB 3VYWA 1EXMA 3L0CA 4YB8A 3IB3A 3GAAA 3NAZA 5HSGA 3EEOA 1AT1A 4JI3B 1BXKA 4B3XA 4ZP1A 5EXDA 3REOA 1DBQA 2XTNA 5CNIA 5C7OO 4LZAA 4AKHA 1MW9X 4PC1A 4Y2GA 3T34A 4IJQA 2Z57A 4WXEA 4UTVA 3F3YA 2BFDA 1EXNA 3I6MA 3VAZA 2P5UA 4LYEA 3DBOB 3ISTA 3RYCA 4R5HA 1XDZA 3LPAA 3NIWA 3SX2A 1YI8A 2HLNA 4FCVA 4LI3X 1ZMOA 3RBAA 3JRWA 4F5YA 5LQRA 1KYYA 4PRYA 4FEGA 3SU8A 2CVZA 4M87A 3MFQA 4LV6A 4TXJA 3SZOA 5TF4A 4FX2A 2EWMA 5DF1A 4CKXA 1V1MB 2VF5X 3K6SB 4XGIA 5EPOA 3TD9A 1EU1A 3VHRA 4D2IA 2X9QA 4I4LA 1I24A 2H7YA 1E7SA 5JMPA 1WUIS 2VCEA 1AUOA 4I2NA 3EODA 4GI5A 4AN4A 3BWEA 1UAAA 1PT6A 3AFGA 5CLGA 1DDIA 3PDCA 3R3UA 3I5UA 5B1YA 2GPJA 1I3NA 3CB2A 1FDSA 1XEXB 3FROA 1FTSA 4MOWA 2C5EA 4YA6A 1ML3A 4O8ZA 1WL8A 5FA8A 3ETCA 4JVMA 4Z4IA 2ZWPA 3DCJA 2K7FA 1M0EA 1I4DD 5EP2A 1X9HA 3O8QA 4O0LA 4CKEB 4AXXA 4RVOA 3V4OA 4HVCA 3ZBUA 1KSGA 2ZSUA 4BO0A 4TL8A 1FSSA 3CCFA 4EVRA 1V4VA 1RPTA 1AKRA 4KMRA 3PWKA 5KNBH 4NJOA 4OLBA 2O2GA 2HWYA 1GQYA 4WK0B 3PR3A 2CFIA 3GJ6A 3OEED 3RTCA 1OB2A 3DAFA 3ICEA 3WA6A 4UEKA 1GZ4A 5J2UA 1PQWA 3GEGA 1VSTA 4GRDA 1B8OA 4WK4B 5CVCA 3UT0A 1Z4OA 3IHKA 2VPTA 4ZEOA 5FLXA 4EB6A 3ZWYA 3AVVA 1I2DA 2GYVA 4C3ZA 3ANNA 2I1QA 1G8SA 1T3TA 3EGCA 2QLFA 4HXGA 4ZCQA 2PJUA 3EBLA 3H2KA 4NONA 1XDSA 1OXVA 2Y0EA 2JJ2A 3HCRA 2G8LA 3M1IA 4IZOA 2OV2A 3VNRA 4Y1GA 1I9CA 2XOEA 3WY9A 1TYBE 5BMVB 3EZXA 3BXHA 1D1SA 3M6UA 1KE2A 2FSFA 2NTYC 5CCXA 1XB2A 3FVRA 1NXTA 1GO2A 1X1TA 4YPOA 3BL8A 3L8HA 2O4CA 1JDUA 1P9RA 1XJ5A 4RV4A 1TZCA 4DIMA 5H9VA 5E4JA 3OZRA 3Q3GE 4TPKA 2WPDD 3GX1A 3E82A 2FV8A 3G5LA 4MUHA 3HUUA 4PIMA 1Q7GA 1PNOA 4TM8A 4U2GA 1NBAA 2EOAA 4YT8A 1XA0A 4X20A 1NQXA 5HIAA 4EJFA 2PS0A 2CXSA 1JYEA 1ORTA 4BMYA 1EBBA 1H4QA 3KOOA 5A3JA 1GKUB 1QF9A 4UATA 4B87A 4GMDA 3NHBA 4DN6A 5C5EA 3PUZA 2OB1A 1BROA 1MXFA 4UM5A 2DQKA 1VDZA 1ULBA 2AX4A 4IWYA 4NWIA 5DSXA 5CDGA 1Y8AA 3R0QA 5A9SA 3CVUA 1Z28A 4XFJA 3S5UA 4FPXA 4X8HA 3TQSA 2YDXA 1P75A 3L6BA 3OFND 1E32A 4MMXB 5FLYA 2XIJA 4RC9A 5CJPA 3AI3A 4AC9A 4ME6A 1N6PA 5LC1A 4R54A 3WLFA 1FTGA 3N7UA 1B7GO 1J5XA 5JU6A 2Z6QA 2IIPA 4L22A 3V1MA 5JRDS 1PGOA 2JCVA 4MVJP 4I1PA 3NNDA 4GPBA 4I5IA 5I3ZA 3WHLA 1RQXA 1BEUB 1Y9AA 2DWQA 3LHFA 3M5CA 3L0IB 1H5NA 1HDYA 3PC3A 5DGIA 4JUAA 1EWTA 3CW8X 3MJHA 2ZQ5A 3DZCA 4WNYA 4IOJA 3IYLW 4IG4A 2QM0A 4M1OA 1RRKA 4YBZA 1OXSC 4QYIA 1SC4A 2P79A 2O2JA 4LGMA 1NWHA 2GK6A 5HCUA 1XNRB 1RAEA 2GZDA 1E2LA 3SEFA 4C5BA 4X60A 3IUNA 5AJVB 1L4EA 1YJXA 4BNLA 1NBMD 3HR8A 3U13A 1AU9A 1ZGHA 1IDN1 4QJ3A 3KDAA 1IY0A 4RK5A 2O2XA 2ROQA 1LLQA 1EVKA 6LDHA 2VWQA 3D5TA 1NBOA 1Z8NA 4I50B 4K2AA 4ZO6A 4MWTA 2OD2A 5K3FB 4C88A 2GHTA 2P6OA 4QQ8A 1PUIA 5DCWA 4BBAA 1G2PA 1GD1O 2CHVA 3TZHA 4B47A 4BP9A 5IJZA 5JNUA 1AKMA 1LTQA 2CNLA 3OJEA 4RTLA 1ZMBA 3E8MA 4M1SA 1G3MA 4D8YA 1JZTA 1RTTA 2QU8A 5G0WA 4F3NA 4ZYTA 1NZFA 3ZWNA 1SVLA 1UL1X 1V3UA 3T9CA 5JWHA 3F73A 4OFXA 2NUTB 2HPVA 1GCUA 3UGKA 4BNKA 1HK7A 3CNHA 1QYWA 1U3WA 3B9QA 3OJCA 4DMUB 4B4DA 4HUTA 2X2FA 3OPYB 2LW7A 1NRWA 5EUBA 3U48A 3E5NA 4WGFA 5CH8A 1D2MA 4JR1A 4UD2A 2CNKA 2W11A 4OUDB 4RTJA 2XWSA 4F96A 2NTJA 4H16A 4IIBA 2GUGA 1WEHA 2JNWA 5LP6C 2ZZMA 4Q19A 1UJ4A 5TQVA 4J3NA 1K0FA 4JI8B 1EDBA 1JT2A 1CJTC 3F74A 2QN8A 2AOVA 1MJGM 1XLWA 3OY2A 1NXXA 4JFRA 2I6UA 2X4LA 3ZV7A 4Y18A 4DDWA 5AHXA 1ZJYA 2UXCB 1NPTO 3SNKA 1X13A 3VVMA 4DMCA 2GFQA 3OAAA 1Y1RA 2HIGA 2J32A 1UADA 3M82A 3PXXA 2ESRA 2JFZA 3JQ9C 4C4OA 1Y89A 1V11B 5AJWA 4AD8A 2G1UA 2FKAA 2COEA 4WFJA 1RR6A 1X1AA 1XTRA 4FS3A 1KYIA 4RHFA 3LPMA 2L2QA 1KSJA 2IYXA 1CUDA 2R84A 4MVJD 1J2EA 4NV0A 2IZZA 4D9IA 4Z0TA 4WEOA 1Z6QA 2DYKA 2GWHA 4DRYA 4DYDA 2W93A 4MR9A 4OD0A 2WWVD 2EZUA 2FEOA 3MNFA 3U2QA 1RHJA 1UDBA 3HEAA 3R4VA 1RPZA 2XRFA 1VXRA 4ZCTA 4ZK2A 2PZEA 2JFFA 1JIKA 1RVV1 5T3UA 2X13A 1SELA 1TM1E 2GBLA 3VJRA 5KTRA 2ZRDA 4NMHA 3BXXA 3BTVA 1DBWA 1EYZA 2NN3C 4WJKB 3FG9A 3G7UA 3RK1A 3W7BA 2NXJA 1E1DA 1NMSA 2OKCA 1KEWA 2PR7A 2WKRA 3D7LA 4I5EA 4KUGA 1QB8A 4AJ9A 1JKMA 1FNBA 1EFRD 3D4OA 3JASB 3MTDA 3V4RA 4OKNA 3FCOA 3ZDRA 1QQ7A 2CCKA 5E2BA 1LDBA 3PEWA 3RC8A 3KKKA 1HQYE 1NKTA 2NG1A 3WTBA 3OF5A 3CCBA 1NJGA 2CXQA 4LZOA 1QGUA 2P9BA 1JKJB 4ZHQF 3HNOA 1TU4A 1RC0A 1GTZA 2X2PA 4LYGA 1SCBA 1L6IA 3RAPR 5BW4A 3RTAA 2JGNA 4PZDA 3ZDCA 1FFCA 2HNBA 3A6KA 1QNFA 3AJ8A 1SIWA 2RH8A 3QFCA 4E88A 4W5RA 1EFHA 2I7CA 3Q8MA 4W8GA 2EWWA 4AW9A 5L3VA 4P4SA 2CMFA 3HEBA 4H4DA 2F8TA 5HJ7A 2QP3A 2BTOA 2G9VA 2VDJA 4B6SA 3B6KA 2V6BA 3ITNA 2AF4C 2WMNB 3F7NA 3M1LA 4NQRA 4BQNA 3PHJA 2PZAA 1UEJA 3EGIA 3M1YA 4A5SA 3BT7A 3M9WA 3DGFC 1NU8A 1MAWA 5CXXA 1CRLA 2K5UA 3EAFA 4WK6A 2LTAA 3DONA 1SCUA 5CVJA 1VE6A 2BP7B 2Z56A 1G8JA 5DYWA 1HT1E 1P5RA 1AKNA 2P3SA 5IX8A 2PQMA 3BMCB 4UEWA 2NPIA 2AOWA 1RLJA 4XYMA 1OHHA 4BJ6A 3PUXA 3C8MA 5GZ1A 2VDKB 3ZLTA 3CINA 2CSXA 4HAOA 1IQRA 3A3OA 3HKDA 4A6EA 4H7HA 4BEWA 1JJVA 3PTLA 3PP8A 1UOEA 3TZKA 1QIEA 1W5EA 1FNDA 3OE1A 2VT7A 2XDYA 3OM9A 3JQGB 3P4UA 4LTNA 2FXVA 4Z1MA 2VATA 4EFMA 4EMUA 2WFZA 1BDHA 3BXEA 4PBSA 4YDHB 3E35A 1W75A 3E7FA 2CY0A 4HXEB 4CLOB 2DERA 1FJXA 4YEDA 4DCMA 2OVFA 2CK3D 3OOWA 3MLEA 3ANMA 4Q3CA 1AKEA 1I5OA 2CVFA 2F00A 3V4SA 3CQ9A 5AKLA 3VSAA 1RAAA 1Z4PX 1Z5NA 1VLMA 4QKQA 1OWLA 2GCOB 3NCTA 4ZT5A 4NV3A 2W2NA 1Y5RA 1FBNA 1JB1A 2X8JB 1X94A 4ZT6A 4EGJA 4Q7LA 2CL0X 3KQMA 3WGLA 3I8OA 1WSDA 3IODA 3ZKAA 1UBLS 3EPPA 2C7GA 1H05A 1VE3A 2XMPA 2XY4A 1HDZA 5CVVA 5DLQC 3O8DA 5JSZA 4UHEA 1LJLA 1OFGA 4YASA 5ECYA 1NRIA 3KPUA 4J90A 4V0QA 3ROTA 4B9AA 3VHQA 1W85A 3UCXA 4MROA 1G19A 1YKFA 2JARA 5ALKA 4XLTA 5EKSA 3H2HA 1MABB 3F90A 4CTKA 5DP2A 4ITUA 3A1UA 2MSKA 3C7AA 4O1IA 4OB7A 2NVUB 3VR5H 4DRXB 3KKPA 4BZWA 1QQTA 1UOQA 2BKXA 2JRLA 1RM5A 3C3WA 1CEEA 1EX1A 4TRNA 1VYUA 1JLLB 4L9WA 4XYLA 1TGYA 3K30A 3IUPA 2GESA 5EINA 3EGDB 4KV7A 2ENWA 2G70A 3WRWA 4EFLA 2IHUA 4DIUA 5CYGA 2IIBA 3HLTA 1OAAA 4IH1A 4KV9A 1ISSA 4CL8A 1Q74A 2BFFA 4CF3A 1ZM3A 2VPIA 5IN5A 4MWSA 4AJKA 1XWIA 2IZOA 4QQFA 3T3PB 1PZNA 1QHIA 4Z3KA 2F8MA 3NIFB 1WW3A 5AOAA 1Q0TA 3GFVA 3H9JA 2J9XB 2P7HA 2Q9BA 5A05A 2A9VA 2BMDA 2ZBVA 5J63A 4KBFA 3I23A 4Q00A 4UBLA 3F2VA 1G20E 5ITSA 2XYVA 4AJ4A 4ZGGA 1WCIB 2PLFA 3QELA 3AF4A 1HGXA 3EEIA 2MSNA 1GGJA 3IQEA 3PRHA 2NO0A 4IV8A 1RJ9B 1YR9A 5CLIA 1W581 1O94A 3F46A 2NTEA 1P44A 4QYXA 3D3QA 3HVJA 3V2UA 1J1UA 3WTCA 4TQUS 2WSMA 1DT3A 2UXBB 3RROA 1Q12A 1KU6A 2FUG6 2YVUA 3EUFA 1DKMA 3KZKA 4UUAA 1II0A 5EC8A 5B3KA 1ZH0A 4WUVA 1FMTA 3CVVA 4FOOA 2CMKA 1VHDA 2ZB2A 2B5VA 2MWMA 5DGHA 2I9KA 3V3KA 1XA3A 2XQKA 4CLRB 3K5IA 2QMHA 4RZ3A 4DSNA 4G84A 3HGMA 3DT6A 4C87A 3S68A 1KJYA 2OV1A 3WMXA 4N7MA 4C4YA 2NSJA 4B71A 1L7PA 1Z2OX 1U80A 3KV1A 1N0HA 2GGSA 4DTIA 1JR3D 1KBOA 1SVWA 1KH2A 1ODCA 1SMKA 1HDEA 2V9CA 3GJZA 3MWDB 4G9BA 4V3CA 3SPXA 1ZH8A 3DXYA 2D7JA 1DQRA 4O4HA 4ZI7F 3NTLA 1TLLA 2ISSD 5K20A 1T9GS 2V6MA 1FJGB 1G18A 3AFNA 3OFSA 1EM6A 3L92A 1QTRA 1NUTA 3ER6A 3AU9A 3HI4A 1DADA 5FAKA 3I52A 2QQGA 1WZNA 5EZ6B 1SO8A 4E46A 4MUFA 4RE6A 4BQPA 5C3MA 1V95A 1GP2A 5LZ8A 3TRDA 1YWGO 2AEJA 4UCFA 3TPCA 4KGXA 1Y8CA 4JT4A 2ZRJA 2X5OA 2OAGA 4O02B 4BNUA 1P2TA 2CNWD 3BL5A 1DCTA 1WVIA 1PSZA 1ZK1A 4RO0A 3KT6A 4LE2A 4P2BA 1ZEMA 3QYFA 1JVNA 4HDKA 3FDFA 2PT5A 3LQ2A 2ORYA 3HRIA 1JQJC 4UDYX 1ZN2A 4Y9DA 4IVQA 3GLFE 3HM9A 2PUCA 1EFKA 4ESVA 3FFWA 4QTXA 4HH4A 5E9QA 1Z37A 2AI2A 1I3OA 1ZVMA 1H2WA 4QUGA 2W6ID 2WHYA 1HRKA 1USUA 2EP8A 4CZ2A 3O0DA 2WD7B 3CZAA 2XD4A 4Q39A 4B4WA 2OQIA 2Y1WA 2H7XA 3FZNA 5K2OA 2BRUA 1FX0B 3TLYA 5AESA 1KKUA 5DYTA 5AVQA 2ZSDA 4EY5A 2A78A 1IHOA 1JU9A 3D6NB 3SDZA 4ED9A 4UTPA 3KSBC 1Z74A 3KPVA 1WDMA 4A27A 1JSZA 2D1SA 2JAHA 3R7NA 5A4AA 4S04A 2X9VA 4ES6A 3EJ6A 2BEJA 1A2BA 3NHKA 5JAUA 4BXOB 4CKBB 3ZBQA 1CS0A 3WYGA 2VT3A 4BQRA 3CRNA 2ERXA 2HQRA 2PH7A 2HZ7A 4PANA 2MYUA 1WMEA 4FFSA 1N6IA 4NP6A 5IHXA 4CEJA 1CY2A 3UY4A 3RAJA 2C2GA 1W2GA 3PSAA 1XDUA 2EEPA 2HM7A 3LBHA 3ZKWB 2BI7A 1J09A 1NI4A 5IDWA 5EJ7A 1QWOA 2R3SA 3NTRA 5A2GA 4IH9A 5ER6A 3KJIA 1WNFA 4MGIR 4MUJA 2YJ4A 3SWWA 4BBJA 3RREA 1XJCA 4RIEA 4RM2A 1E5QA 4AMGA 1KXJA 4OK5A 2BFBA 1XL0A 4L8VA 4ZOEA 1AGPA 2GRJA 5TEVA 3S1LA 3THWA 1L7AA 1HQKA 4XQGA 821PA 1E5TA 3RFFA 5IXSA 4IGAA 5IH3A 3TKLA 5JD4A 2WJ4A 4PSUA 2WOJA 4MDYA 1A50B 4KGDA 5EUCA 4HMQA 3AEQB 4CL3A 2BR4A 4PCVA 4EG8A 1OROA 1QCCA 2BV3A 4MW9A 4ZVLA 1DOZA 1WQ1R 3CUUA 3UZUA 3BB4A 4DQLA