3FYUC

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
316
Chain Sequence
QLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 117
structure length 316
sequence length 316
chains with identical sequence E, F, G, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuC00
1ORVA 4TGLA 3AFIA 1UOQA 1F0PA 3ESCA 1R4ZA 1VZ3A 3IIIA 5I7UA 1QJ4A 2WFMA 3CN9A 1HBJA 2RAUA 4G9GA 3CXUA 2XUDA 4OYLA 4ARAA 4EY6A 2QKYA 3WKBA 3NUZA 2WM2A 5ALTA 2WIFA 5FLKA 5JZ9A 3B12A 3V1MA 2EDAA 2XMZA 2XUGA 5ALJA 2WTMA 1EDEA 1G5FA 1XLVA 4XJVA 1C7JA 1FFDA 3WKDA 2HRRA 1SCKA 4X92A 4N8DA 5T4BA 1LGYA 3IVMA 2CZQA 1DINA 3PF8A 5K3DA 2GZRA 5EHXA 4N5HX 5E2IA 3QITA 1WHTA 3CCBA 5HZGA 4FWBA 1EK2A 3JWEA 3AINA 1LPAB 4FFWA 3FLEA 1LPNA 5JATA 3QYJA 3V1NA 4J0KA 3LS2A 3DQZA 1QFSA 4KE7A 1BE0A 4BZWA 1ZJ5A 3O9MA 1MO2A 5JADA 2WIJA 2WIDA 2W22A 3ESAA 2WUDA 2ECFA 1GKLA 4G4JA 4YX9A 2ZYSA 1VJ5A 3G0GA 2WKWA 3KSRA 4DYHA 4I4CA 3D2AA 2DHEA 2C7BA 4BVKA 1X2BA 5A6VA 5AKZA 4QEKA 1H2YA 5K3FA 4QDXA 4HVTA 3F8SA 1W1IA 1YS1X 1L7AA 1CUSA 3ZV7A 1QIMA 2WTNA 4BB0A 3WL5A 3H18A 1CEXA 3H2JA 1EVQA 2NW6A 4AN1A 3DL4A 4P08A 3WYNA 1AX9A 4J0HA 2C0QA 3G9XA 3A2LA 2CMFA 4UPDA 1K6EA 3EF3A 4B85A 3ZLUA 4W1QA 4DNPA 1LPOA 4KE6A 4LXGA 1EDBA 3BDIA 4M0EA 4ZXFA 4G8BA 2ACEA 2WUFA 4AO7A 5ALUA 1CQWA 4U2DA 4C4YA 4HRYA 2HA6A 5CURA 3WA6A 3IB3A 4Q1VA 1JJFA 3DLTA 3KD2A 4KRYA 3WK6A 4MJ3A 1XQVA 3GROA 4NS4A 1USWA 5CT8A 1EI9A 3WWOA 1YSCA 2ORYA 4Q34A 3T52A 3I2FA 2I3ZA 4S0XA 2XLBA 4E46A 1YCDA 1WHSA 3PUHA 1EVEA 1U65A 4HS9A 2H1IA 4ARBA 2WFZA 3GUUA 5JAUA 4ZWNA 3WK8A 3UUFA 1ZGBA 1CUBA 5EIHA 4BCBA 2Q0XA 4BYMA 5HFAA 1ZIXA 5FP0A 3UUEA 3O4JA 3LP5A 2V98A 5DYYA 3HEAA 3U1TA 2JGIA 1F8UA 2WJ3A 4Y2VA 3AZOA 1XZEA 1YAHA 3OC0A 1RWQA 4OPMA 4MYDA 4K2AA 3PICA 2XMBA 3GFFA 4H7KA 4DGQA 3AIMA 1VKHA 4UFOA 4TPKA 4C6HA 1TK3A 2OLEA 4IQ4A 3U0VA 3VVMA 2ZJ7A 5AKIA 3TJMA 2VF2A 2HADA 4AN0A 4IH1A 1A7UA 3BF7A 1UK7A 3F97A 3STXA 5JAHA 5ALIA 2WUEA 3I2JA 5ALPA 1YA8A 1GPKA 2WHPB 4X7BA 5JASA 4UBJA 4CCYB 4B9AA 4QA9A 1Y7HA 1R3DA 3I2GA 4Q3KA 2UZ0A 3HC7A 5JD4A 3HLKA 3BIWA 2PSDA 1TAHA 4KYVA 4UBLA 1IMJA 2EEPA 5ALVA 3KWFA 2FX5A 4PO3X 5HK8A 4BATA 1YS2X 2QXUA 2QOEA 5JD5A 4L0CA 5ALSA 4Y9SA 4BE9A 4BBZA 4RNCA 1H22A 2IITA 3AJAA 2PUHA 1CUFA 5AKYA 1LBSA 4KE8A 2WSLA 4LYDA 5ISMA 4LKOA 5D3ZA 2OPHA 2VJCA 4B0PA 3G0BA 3FWHA 3WKCA 4LHEA 4AZ3A 4AXBA 5HF6A 1HQDA 4F21A 2WHPA 3O4IA 4Y2RA 1EB9A 3W05A 5AHXA 3YASA 3SC2A 3K9BA 4CCYA 5DNUA 4GBGA 5EGNA 3AIOA 1UKAA 2WUGA 4X94A 5FV4A 1CUIA 2YH2A 2XMGA 5K3CA 4Z49A 4HRXA 2VAVA 4MQMA 1BN7A 1CR6A 1T4MA 3EIOA 3OTQA 2XQGA 4B81A 5CRIA 1SCIA 5K5EA 1S8OA 5DYWA 5FXMA 2Z8XA 3WJ1A 2DCMA 3JYHA 1Q83A 1UK9A 1L7RA 5JAOA 1ACLA 4FKBA 3WK4A 2FUKA 5IVHA 4BCCA 4L9AA 4D9JA 5ALMA 3ZWQA 2JGMA 4BAZA 4CG2A 2JEYA 2BUCA 4H7EA 4JEIA 4PNZA 4OCZA 2O2HA 1CUHA 3VVLA 1XRRA 1ISPA 1JU3A 3C87A 3G0CA 1DU4A 4L72A 3N0TA 4BP8A 5ALGA 5SYNA 4GW3A 2OGZA 2Y1KA 3NOXA 2H9YA 4QWWA 3C43A 1ORWA 4X93A 2GBGA 3G0DA 2WU3A 3K6KA 3I2KA 5ESRA 1MAHA 3QH4A 5HKAA 3WL7A 1R50A 4Q05A 4GEGA 2O2IA 4J0JA 4JH0A 4XVCA 4N8EA 4ZGBA 1UK8A 1ZD4A 3WKAA 3C8DA 3QPDA 4E14A 4EUSA 2PSFA 1ZIYA 4EY8A 4BTLA 1JMKC 1LPPA 4MEBA 3WWCA 1HDEA 1BROA 1CQZA 1FJ2A 1N8SA 4WY5A 1DWPA 2AJDA 3C8HA 3E4DA 5A62A 4PQEA 2XUOA 5BWBA 5EIEA 3H04A 3QBJA 3R3XA 5AI8A 1CVLA 1LLFA 1THTA 4LIPD 3WZLA 1QIJA 5H3HA 3C5WP 3FSGD 3MUOA 4EZIA 2XUQA 2HIHA 2HM7A 4H77A 5I9IA 1H2ZA 5E4TA 3H1AA 4EY5A 3ANTA 4AMYA 1N5MA 1Y7IA 3H2HA 5T4HA 3H2KA 4LXHA 4QLAA 3QZUA 4F5ZA 3W9BA 3PDCA 2ZVDA 3STUA 2BUAA 5HF8A 1ETHA 1R9MA 4U2BA 1XZLA 5FUMA 3WA7A 3BE8A 2WHQA 3W9UA 4BZZA 3IULA 2XE4A 3R3VA 2ZSHA 2WIGA 1LBTA 5EHQA 2Y2VA 5AKGA 1QLWA 4X95A 2AJLI 3FSGA 3VDXA 2RGUA 5CXXA 3S2ZA 1DX4A 5IKXA 4HZGA 3V48A 4C01A 3STTA 3I1YA 5ALFA 4ROTA 4Q3OA 4BCDA 3R3YA 5AJHA 1OILA 3QPAA 2X76A 4RE5A 5C8VA 2I78A 1XZDA 5AK4A 3SWWA 1FFCA 1NU8A 5AKLA 1WCYA 3DKRA 4Y2XA 5CMLA 5JANA 2CEKA 5IVKA 1ZI6A 2J3DA 3PE6A 5CT4A 4MYSA 3RM3A 5K3FB 4J0IA 2QRUA 1XRLA 4QWMA 2DSNA 2PBLA 3WIOA 5I8PA 4X6XA 1XZMA 1BEEA 4MEAA 1K5PA 1YR2A 3FLBA 1U8EA 3DJYA 4B9EA 4WCVA 1F0NA 5F4ZA 1WB5A 4FLFA 4UBKA 3L1HA 4X00A 4Q82A 5E4JA 4DMFA 2XQJA 2H7XA 2X8BA 2HL6A 1E5TA 4FNMA 5CH8A 2XMDA 1QGED 3TRDA 3A70A 4I19A 2HA2A 2IX9A 4UHDA 4DNOA 3WK5A 1R88A 2OG1A 3A6ZA 2YASA 1EDDA 2HU8A 1EK1A 3GBSA 1O6FA 1W6RA 2GZSA 2PSHA 2C5FA 1JJBA 1IVYA 4W63A 4Y2UA 2B9VA 2ROQA 5CT6A 1WPRA 3G9TA 1CUVA 4OU5A 5IH7A 5JAPA 3WKEA 4WDRA 2VJBA 3OM8A 4QE3A 4U2EA 1PV1A 3WI7A 4AO8A 2FJ0A 3E3AA 3HRHA 3CN7A 4WFKA 1QIDA 2Y6UA 3H0CA 5ALYA 4W1SA 4K5QA 5CH3A 5T4FA 5C8ZA 4QDZA 4V2IA 5DYTA 5DNWA 4X3CA 1YASA 2J4CA 4P93A 1N5RA 5K3AA 2C5GA 3O95A 2HA5A 5AI5A 4AB1A 3JW8A 4B83A 3KDAA 5JALA 1N1MA 2C58A 2GBCA 5HF5A 1SFRA 3O4HA 3AZPA 4GI1A 1O6GA 3KOOA 1JI3A 1P0PA 2WJ4A 3GZJA 2VT7A 1EA5A 4C4XA 1WOMA 1XRNA 4UBMA 1GQSA 1QTIA 2AJBA 4PSDA 1UT6A 5JIBA 4U2CA 2QZPA 2Y2UA 2G5TA 3I6MA 4EB0A 3P2MA 3IUNA 5LP1A 3DKKA 1MT3A 3M81A 4H7DA 2Y6VA 4ZV9A 2YYSA 3UMJA 3F9CA 4U2GA 5FRDA 3IA2A 1A8SA 2V9ZA 3OPMA 4NMWA 1XZCA 1ACJA 3PUIA 4ZREA 4TVKA 4J7AA 4F0JA 5FPQA 5AIAA 4H7JA 4WJLA 1J06A 3HYSA 2CB9A 3V1KA 2GBIA 4XWGA 2XMRA 3MUNA 4HTAA 5AM2A 4U2FA 2XMCA 2XQKA 3EQ7A 4Y2SA 2ZYIA 4A5SA 5HQ3B 2RI6A 4G8DA 5AOCA 4WDQA 4QDUA 4B84A 1BEZA 4G9EA 1GZ7A 4OB6A 1WPXA 1LPSA 5AK5A 1BS9A 4CG1A 5DWDA 4X6YA 3D59A 4Y2JA 4H7HA 4F60A 4BRSA 1PJAA 2WHRA 2K2QB 5LYYA 1QFMA 2WQZA 4PF1A 5AM5A 4UHBA 1ZI9A 3B5EA 5AK6A 2O7RA 1DT5A 1QE3A 3C6BA 3LCRA 3T4UA 3GELA 3AUKA 3EQ9A 1OXMA 2WU4A 1VZ2A 3RARA 4EA6A 1AKNA 2B20A 4ETWA 3QM1A 1VOTA 2H7CA 4LYEA 3HI4A 1VXRA 5EI5A 3WWPA 1JU4A 5E4YA 3BJMA 3M82A 3M83A 5DTJA 1GXSA 1CUYA 3ZLTA 4LXIA 1IUNA 5HQ3A 1QO9A 2VEOA 2AJ8A 5DLPA 1CUXA 5C7YA 3LIPA 2OGSA 2XMSA 5EHNA 5ALZA 2WFLB 5BWCA 1QTRA 1QIIA 1FSSA 3C45A 1LZLA 2VQ6A 5EIAA 1XKLA 1UXOA 3BJRA 5LZ4A 2QJWA 1QOZA 3D2BA 1W76A 5LZ9A 3EBLA 2AJCA 1LZKA 3FYUC 4JUIA 4UHFA 3I28A 1BCRA 3W04A 3WQHA 5HF9A 3FLAA 4UBNA 3D3NA 2W6CX 1E8NA 3AIKA 2ZJ6A 4JYMA 2BFNA 2QR5A 2XQFA 1NX9A 1ZOIA 1CRLA 4B0OA 1Q84A 3FYTA 3WZMA 2Z3WA 5JARA 5D6OA 1IZ8A 3N2ZB 2I03A 1DWQA 5A7HA 1Q0ZA 3G02A 5JZSA 2P8SA 2WFLA 3RKSA 3AZQA 1MX1A 3ILSA 2GYVA 1J07A 4MXDA 4BC1A 1G4HA 4KR0A 3BWXA 3EQ8A 2Z5GA 4OSEA 1EX9A 3HJUA 4G4IA 1ZICA 1DQYA 4IH4A 4X90A 1M33A 2VJAA 5AKXA 4WFJA 5LZ5A 1MTZA 4RGYA 1MU0A 2ONCA 1GKKA 5CT9A 1UOPA 5ALKA 5SYMA 2OCLA 4FDMA 1ZD5A 1XZAA 1QIGA 2WJ6A 4W1PA 3FOBA 1GT6A 1X2EA 1XZIA 5HK9A 2XUIA 2E3JA 1R1DA 5AKJA 1AMNA 2HA3A 4BVJA 4FOLA 3I6YA 4MWSA 1BU8A 4CIAA 1PFQA 2DQYA 1GGVA 3H19A 3VKFA 3R3UA 3I2IA 1I6WA 1UZAA 3DEAA 4X85A 1DT3A 1BRTA 3DYVA 5ALWA 2CBGA 4BP9A 5LZ8A 4A23A 4CG3A 1XQWA 3HZOA 1UOOA 2XB6A 3ED1A 2HRQA 3MVEA 5DNVA 5FKJA 1A8UA 5BOVA 2VA9A 1A8QA 2IIVA 2GYWA 1SCQA 3VXKA 3PFBA 1TCAA 4OB8A 5K3BA 4W9RA 2ZYRA 5JD6A 3W06A 4FTWA 1EH5A 4DSZA 1E8DA 3IURA 4H7FA 4CCWA 1H2XA 4UFNA 4G4GA 5IVIA 1K8QA 1QO7A 1KU0A 3WJ2A 3VJLA 1GPLA 4H0CA 2OAEA 2D0DA 1G66A 3BIXA 5AIBA 5ALNA 5ALOA 1JKMA 4J03A 1MPXA 2JGEA 2QJRA 5KWJA 3E0XA 4J0CA 2OQVA 3QMVA 1SC9A 3FVRA 5AM0A 4DSAA 3WIBA 4J3JA 3F67A 1A88A 3FNBA 4Y2PA 5AP9A 3BL8A 3STYA 2GYUA 5CTAA 4ITVA 2ES4A 5A71A 4ZI5A 3FYUB 2XMQA 3G8YA 2OCKA 3R3WA 1MX9A 3GA7A 2BKLA 3X3HA 1UK6A 4YPVA 3BF8A 4AZ0A 4OU4A 2XUJA 5AOBA 1TQHA 5AI9A 4YK7A 5BV7A 2G63A 2WG0A 4L3WA 4FLMA 4NVRA 3G7NA 3VISA 2HA7A 3LLCA 1TCBA 1EB8A 2BUBA 2OAGA 1XZFA 4KJXA 3PI6A 2XI4A 2HDWA 3Q0TA 3BXPA 1E3QA 2BCEA 5C81A 1BN6A 5KREA 2PVSA 4B7ZA 4FMPA 4MWTA 3QVMA 3I2HA 4KEAA 1X70A 4O08A 1FFEA 5A7FA 4INZA 5IVDA 1TCCA 1QIEA 2V97A 2JGFA 4P9NA 1XZBA 4X6UA 3L1JA 4EY4A 3C6XA 3FYUA 4QDTA 5AKEA 2CKMA 3IUJA 1DTEA 4Y2TA 1MJ5A 2J4FA 1BCSA 2HA4A 5CBKA 3ZI7A 5AI6A 4UBOA 5AH0A 3K2IA 1WB4A 5AICA 2OXEA 2CJPA 4BTVA 4Q3LA 3QMWA 4EY7A 3V1LA 1IUPA 2C0PA 2DFPA 4FBMA 1XZHA 4J0DA 1RYYA 1TIBA 3HABA 4DNFA 1P0MA 3S8YA 2YXPX 3OURA 4QNNA 2VATA 2V96A 3ZPXA 4BE4A 2PU7A 3F96A 5LKAA 4QDOA 3STVA 1G42A 2VAXA 4QZVA 1JT2A 1QONA 2JGLA 4BC0A 3OOSA 1XRMA 4M0MA 2GBFA 4IO0A 4DNQA 1CIJA 1LPMA 1ZGCA 4KRXA 3LIIA 1XZKA 3M3DA 3ESBA 2DR0A 5HCUA 4GHWA 4C87A 2AXEA 1CUZA 4DMCA 5FPPA 5CH5A 1GPNA 5JZBA 3DCNA 4C88A 1ZD2P 3F98A 2O7VA 2RHWA 3IUMA 1OCEA 4IHAA 1W4LA 2QUBA 2JGJA 3IBTA 5AK3A 5A7GA 4UFPA 2WLSA 5DTIA 3QPCA 5ALHA 4Y7DA 4OUKX 4GLBA 4H35A 3C70A 4OB7A 1VXOA 6YASA 4OYYA 4XIIA 1XQYA 5AOAA 1W75A 2PM8A 2QMQA 3C6ZA 4AMZA 5AM3A 4ZV7A 1SOMA 1UKBA 1DX6A 1MAAA 4UHCA 4KACA 1DWOA 1CUUA 5C8XA 4UHEA 5T4EA 4BRZA 2WG2A 2BGNA 2VJDA 1ODSA 4DIUA 1DQZA 3E1GA 5A2GA 1J2EA 5CXUA 2LIPA 1AC5A 4BDTA 1JFRA 1F6WA 1ZI8A 5ALXA 1RP1A 3DYIA 4BAUA 5LZ7A 5FDFA 1CUWA 3PFCA 4M0FA 2DHCA 2R11A 1VLQA 1QIFA 2VSQA 5AKHA 4N8SA 4I3FA 4DM7A 3FAKA 1THGA 1CUAA 2WILA 5ALQA 4QLOA 5KBYA 3KWJA 1MNAA 3R0VA 1UFOA 3O4GA 1CUJA 4AX4A 4DLNA 5AO9A 2PPLA 3FCYA 3VJKA 5CT5A 5LZ2A 4BDSA 1CUCA 2B61A 4NZZA 4K6HA 1YB7A 2B4KA 3O9VA 4WY8A 2EDCA 1MX5A 4Y2QA 1K63A 3VJMA 4DTCA 1ZJ4A 1JMYA 5ALRA 4C4ZA 1ODCA 3D7RA 1HLGA 2XUAA 3HSSA 3MGAA 3H1BA 5AM1A 4RPCA 4RE6A 2ZYHA 5DJ5A 3L1IA 2JGKA 2G5PA 1TRHA 4Y2YA 3NWOA 1C7IA 3ICWA 3V9AA 4YASA 1U4NA 3R41A 2PX6A 5AM4A 4FHZA 2ZSIA 3DS8A 5D7BA 2QT9A 4EBBA 1P0IA 4OD0A 2JBWA 1GQRA 3H17A 2PKYX 3H2IA 2RHTA 4JYPA 1EXWA 1EINA 1AQLA 4AO6A 2HFKA 5ALLA 2QTBA 3WWEA 1CFJA 4PSUA 1U2EA 2I3DA 5ALDA 4KAJA 4EHBA 2D5LA 3IDAA 1XQXA 3WWDA 3C6YA 4IH9A 3KXPA 2G4LA 1WM1A 4FBLA 1D07A 4DMHA 3CCCA 2BJHA 1CUDA 1HL7A 2CUTA 3B3QA 2C4HA 2XUHA 1J1IA 1TKRA 2X5XA 1NU6A 2JF0A 4HXFB 2ZJFA 5JYCA 1AURA 1HKHA 1XROA 5HKBA 3ZLVA 3D5EA 4PSCA 3DOIA 4CIBA 3R3ZA 3G0IA 1YA4A 4B82A 1JJIA 1T2NA 5ALEA 4KAFA 3I1IA 1XLUA 1QIKA 4PV7A 4HXGA 1CLEA 5J3JA 4DMKA 1H23A 1Z68A 3DDUA 1E66A 3HXKA 4N5IX 3DNMA 1CUEA 1AGYA 1C4XA 3DOHA 1E8MA 2HHAA 2BAGA 1YAJA 2QVBA 4FLEA 3WMRA 3RLIA 1UWCA 2WIKA 1CUGA 3OG9A 1MNQA 2XUKA 3TEJA 3FBWA 2OQIA 1EHYA 3DL7A 3A2MA 5AI0A 3G9UA 5LIPA 2RIPA 4BVLA 1IZ7A 2QM0A 3SX4A 4CFSA 2PU5A 3A2NA 5KWIA 1MN6A 1R9NA 1XZJA 4PW0A 3QMMA 4C89A 4X97A 3ICVA 4WFIA 4B6GA 2FJPA 4BAGA 2Z3ZA 1AUOA 4AQDA 1Y37A 1ZD3A 4CI9A 1P0QA 1H2WA 3WK7A 2OGTA 1KU6A 2XUFA 3NGMA 1VA4A 4UHHA 3W2TA 2WG1A 4W1RA 1B6GA 2H7YA 3ANSA 1VE7A 1ODTC 3O0DA 2O2GA 5HFNA 3WK9A 2VTVA 5LLSA 1K4YA 3H2GA 2J3QA 4GDMA 5EFZA 1VE6A 2JIDA 1L7QA 3D0KA 1XFDA 4XX1A 1IUOA 4X71A 2HA0A 4ZRDA 1XRPA 2JEZA 4HAIA 4FFVA 3C5VA 1HPLA 4E15A 3IUQA 3SK0A 4FNGA 4G8CA 4A16A 3D4LA 5K3EA 5LKRA 1CPYA 2ACKA 3D2CA 3PF9A 5YASA 4MQLA 1UKCA 4KAAA 2QXTA 4P92A 2XQIA 1XZGA 2VT6A 3AILA 3ESDA 2DHDA 4GXNA 4E11A 4JNCA 4GECA 2OCIA 4G5XA 3WYDA 5EHZA 4UBIA 1YB6A 3STWA 2XLCA 2PSJA 3Q8WA 4GWLA 5AI4A 4UUQA 3G9ZA 3FVTA 1LPBB 3DD5A 2XDWA 4J0GA 1QZ3A 1XRQA 1AZWA 4K6GA 5CW2A 1WB6A 1B41A 2PL5A 2BGRA 3WL6A 5D3KA 2HFJA 4G1FA 4H7IA 2R8BA 3TGLA 1CV2A 1KEZA 4X91A 3R40A 2HU7A 2OCGA 1Q0RA 4B80A 3RK4A 1FFBA 4K6KA 1XLWA 1QIHA 5FOQA 2QS9A 2Z8ZA 3WL8A 3HACA 1LNSA 2XUPA 4H18A 1W52X 2PUJA 3WLAA 2PSEA 2QUAA 7YASA 1VA5A 4KE9A 1FFAA 1E89A 5AKKA 2RONA 4HXEB 2HU5A 1XKTA 3I6ZA 2DQZA 2XT0A 3BDVA 3FCXA
chains in the Genus database with same CATH superfamily
3EW9A 2BFBA 4NCXA 4O1HA 3TRHA 5KCMA 1PNRA 2NXEA 1G16A 1SVUA 2Y1OA 3NETA 5J4KA 1RBYA 4MR9B 3QVTA 4E31A 4R51A 1BRMA 1SG9A 1Z17A 2FMIA 1HLDA 2IP1A 2WAOA 4LZWA 5I7UA 1R27A 1YFZA 1QJ4A 2FW1A 1NW9B 1JDUA 4KFRA 1K7FB 3VTAA 2RAUA 3A1WA 3IV6A 1OW3B 3DLIA 1G17A 3N3AC 4PLZA 4ZVSA 3VPAA 4Y6QA 1M7GA 3CXUA 4V1CI 4OYLA 2AV6A 4M37A 2XYGA 5LQRA 3GIWA 2C2GA 4PQYA 3W2GA 1AH2A 2WIFA 3F4KA 1FU8A 4CIYA 1G21E 4JJKA 2GSWA 3MJEA 3PDWA 4Z6KA 2KX7A 1Y8CA 3DLAA 2KPOA 4MI6A 4AUEA 3LYUA 3X1DA 3MHTA 2B1IA 4AJNA 2H08A 3JQ6A 2YJ4A 3OCJA 2IVFA 1WUJS 4Q9HA 3X1WA 3RTDA 2JHAA 4DEXA 1O94C 2M9MA 1RMQA 5A5VA 8ATCA 1HRKA 3O4FA 3V5NA 1FFDA 4K6MA 2I2BA 3QOFA 2NADA 4HAYA 4P81A 2VOEA 3EH2A 2V03A 3TK1A 4ND6A 2FRXA 4IIBA 4P22A 4PHGA 1SCKA 2DFVA 3HM9A 1KAQA 1M1YE 3GYGA 4TV9B 3QUAA 3FFAA 4MB6A 2FNAA 5SZIA 4QKQA 3QVGB 1E5DA 4ZIRB 4D0SA 1O6BA 2MINB 1PRYA 1Z5ZA 4RTSA 1ZM9A 1B6SA 1VE3A 2H9AA 4N5HX 1WBDA 1RM4A 4NS1A 5HFJA 2GNAA 1W30A 4G1VA 4MYHA 2M1XA 2V9PA 4RPJA 1FMCA 4FZVA 4HG2A 2XYPA 1WHTA 2QV7A 1ZNYA 3KKKA 3VU9A 5HZGA 4QAQA 2ZBVA 5J1TB 3UGQA 3JALA 1EK2A 1TYEB 2NO5A 3DCYA 3JWEA 4F93B 1LPAB 5JAMA 2QE7D 3A6DA 2A92A 2Q3EA 2JKVA 1DRVA 4DCGA 2ZJ0A 3CX3A 5FI5A 2FG6C 5JATA 2BSQA 3GGGA 5D5PA 3V1NA 1JHVA 1M67A 1T36A 1R6VA 2BFDB 2RHGB 3UANA 2YFKA 1LSSA 2C1XA 4JT4A 4KE7A 1FMFA 5DM2A 1BE0A 3EVZA 4R7TA 1UZUA 5FL3A 1YZHA 1Z56C 3AYXB 4PYJA 4KQXA 3RVQA 1E0KA 3HVKA 4EG5A 1T5TA 5KOYA 1G8PA 3CA8A 5JADA 3I6BA 2VDJA 2BM0A 3BMQA 3JQFC 3TM4A 4NQRA 3DMHA 3I9V1 2WIDA 1D7OA 2BI7A 1QHEA 3ESAA 4I55A 5DEIA 3ZHQA 3PEVA 1T5BA 4HH4A 1RXIA 4ARIA 4XWAA 3HFRA 2JZNA 4E1VA 3DXFA 2AZDA 3WMEA 1KAHA 3LPAA 4IJKA 4LRXA 3V4OA 4P3OA 5JNVA 3DXXA 1GTMA 1RQ2A 1ULSA 3RS3A 2ZYSA 3N74A 4A2CA 5F3WB 5FOWA 4ALLA 1C3JA 1ONPA 2Z2JA 3NIBA 1NT2A 3NDIA 5EJ4A 3BB4A 1ID8A 3KEGA 1CF4A 2PYDA 4E70A 1IEVA 2GEBA 3CZCA 1O95C 1C9DB 3C24A 3TCXB 3DB2A 4G23A 1E58A 2DHEA 4PRZA 5JNWA 4MCJA 3ZW8A 2CL5A 2QAGA 1I1OA 2C7BA 1UDAA 3ZN2A 4DUZB 1E6MA 5AKZA 4B4VA 1H2YA 5K3FA 3TOSA 3WMXA 4C6TB 1GDDA 3A4IA 2QE7A 3HL0A 4UD6A 2V9CA 2XMPA 1NSTA 3F8SA 4J0QA 1W1IA 1YS1X 5JJKA 5CB4B 1NUSA 1CUSA 2HYDA 2KM1A 1QC5B 3ZV7A 3WGVA 3KVNA 3PIIA 1KVRA 2FPWA 4MKFA 4A10A 3RC1A 1CEXA 3H2JA 2V6IA 3E2MA 2HJ9A 2BEJA 4P58A 4ZCPA 3BHNA 1VYTA 1X14A 5IKOA 4ILEA 5BWLA 1ISIA 2F8MA 1DELA 3SKXA 4YV7A 4ZEMA 4GU5A 3HJCA 4A26A 1KDPA 2NW6A 3NRJA 4HX5A 4AN1A 2C7OA 1DC4A 2W2PA 1N9KA 4H31A 4JLPA 5BSWA 4NENB 3W1VA 3DL4A 3C1TA 3P2IA 4MVYA 1X1AA 2FRDA 2GHTA 3OPYB 3WYNA 5JO0A 2FP3A 1UPTA 3KOMA 4OHVA 2VTBB 4J0HA 3CVUA 1E2KA 4U6SA 1P5ZB 2ZRKA 5IC4A 3GJ8A 4GGMX 2IDKA 1UWKA 5BRAA 4YJFB 2GESA 3SDBA 5B1YA 1B42A 2R5WA 3D1LA 3LYLA 1QLHA 3B89A 1J8YF 1ULUA 2W2VA 3EYWA 3W90A 4FYWA 2PKXA 1THMA 4UE2A 5KDLA 5IUJC 3EXFA 2J5KA 2P0AA 3H6KA 3R23A 3ZCPA 1M83A 1K6EA 1R0WA 3P9YA 4EGCB 3KQPA 2BFAA 3IE1A 1QTQA 1JB1A 5E9JA 4B85A 3WLRA 1T9BA 3ZLUA 5F3RA 3JZAA 4OKSA 3ZK7A 4WLOA 1STOA 2FETA 3DFZA 4HDKB 4W1QA 2CMDA 4YA6A 3TZEA 1JIXA 3U3JA 3KKQA 4M22A 2OV4A 3UATA 5B2FA 3M6FA 1JFLA 1LPOA 5IABA 1M3SA 4BZXA 2Q1SA 2Q8PA 1P9OA 3NHRA 4LXGA 1D09A 1EDBA 4LSWA 4FDVA 2QUHA 4M1OA 1XXHA 1D2RA 3FRIA 3GD5A 5ULLA 2NACA 1TYDE 2FWAA 4KX5A 2HTFA 3LC0A 1CE8B 4Q4AB 1H42A 1Q11A 2E48A 4D9KA 1NAIA 1O4VA 2ZPTX 3GNQA 4MUIA 3JR3A 1AQNA 3DJFA 4GYJA 5IBPA 1MGOA 1F51E 4N5NA 3BSSA 4DGSA 1FNSA 1B0PA 2ACEA 5JFOA 1KYZA 4LRYA 1EVJA 2WUFA 1N1DA 2CF5A 5ES4B 3TMYA 4WBNF 4Q3CA 1JZSA 4F5YA 5LP6B 1W59A 2IU4A 2O0LA 1YBVA 2NYAA 3AJRA 3GFPA 3MJRA 3BDAA 3QKSB 3NGXA 1YR8A 4GI5A 1M6VA 5LC1A 3V6MA 5GQSA 3KQOA 5BW8A 2I2AA 4X6LA 2R6JA 3U7IA 4RHCA 3WA6A 1L4KA 1JJFA 2QY9A 3Q8MA 3WK6A 5BSMA 3DXZA 1LFAA 2RGYA 1FA9A 3GP5A 4PXSA 3TUIC 2G80A 1P4GA 4NJMA 1HZZC 3N0RA 3PUKA 5BQFA 4MROA 4UAUA 4OQNA 4A2WA 4QYXA 3EUWA 1VBKA 4G24A 4YJGA 1I3NA 3QX9A 4BLWA 3U16A 3ZDAA 2I3ZA 3DE6X 1YCDA 4EG3A 3OU7A 1NVTA 2HWYA 1J2UA 1U65A 3GJRA 4R8LA 3O75A 5JAUA 1ISRA 4OBWA 3WK8A 1ZGBA 3DE2X 3KDPA 3LRXA 4EYEA 1CUBA 4BCBA 3S2FA 2Q0XA 2R25B 8OHMA 4MQ5A 3ZVMA 1HI9A 1A5TA 4M2LA 5CVUA 3TX6A 2BTEA 3O4JA 1WUHS 2B3DA 4LI0A 2LNDA 1FLNA 1UM9B 3T5MA 3D8SA 3QLVC 3HA7A 4WA8A 5DYYA 4FOPA 3ZQKA 4TKVB 5BN5A 4F4FA 5E9QA 3WMWA 1ABFA 4RTLA 1OF1A 2GPBA 2OBXA 1FZTA 3V7FA 4PAGA 1ZU5A 3DZFA 2DF8A 1PJ2A 5HKLA 4L5YA 4Y9UA 1WY5A 3WDSA 1BH6A 2MSNA 2GO1A 1E2GA 1YI8A 3SQXA 2XMBA 3Q11A 5DHTA 2YKGA 3HXPA 5EIXA 4JI8B 4Q7LA 4HAOA 4QBGB 5LDHA 1X7ZA 3FF4A 3W4JA 3HEBA 4C6HA 1TC1A 3SJUA 3AUJB 5JSKA 3GJSA 3Q7SA 4GPD1 1ZMXA 2X0DA 1EQUA 1NUQA 3N7AA 3KJZA 1GPWB 2NLOA 2VPXA 1Z25A 2QRJA 3FPGA 4IQ4A 2Z83A 4KW7A 1G6HA 4E3WA 4B3MB 2C8VA 3EW7A 3HSKA 3ILVA 1M75A 4MINA 1TK2A 1YHNA 3DEJA 5A5FA 2EFHB 3AWDA 4HWSA 3UT5A 3P5BA 2E6UX 3ZWKA 3GFGA 2ZB3A 4KDEA 2XIJA 4D82A 1CF2O 4IH1A 1KRHA 1SC4A 3JVUA 2PX8A 4TUYA 1UK7A 3F97A 3MWGA 4QPJC 2YFQA 5DHQA 2V1UA 1EMDA 2NSJA 3T1OA 4PZYA 4AZ3B 4RENA 4II3A 3I2JA 2FJUA 4YCSA 1HFJA 1YR7A 3ODGA 4I3GA 4WXYB 1PDVA 2IHVA 2WHPB 3CWQA 2GHIA 1TE2A 3KQKA 1U0JA 3ESXA 1HEUA 2QMHA 3D8HA 1I4TD 2A3NA 4PC2A 1XJWA 1E1DA 2HJSA 4A0QA 1VG0B 4KO4S 5GMOA 4TV8B 1S8AA 1RABA 3P2JA 5ENVA 5LYJA 4G1CA 4MCHA 1LC0A 1Z83A 1IZZA 2QLLA 3ORQA 2JHGA 4OSOA 1C9MA 4CCYB 4CLRB 4E5DA 2YIMA 1T2UA 3QVSA 1YOBA 3JD4A 5EHGA 1PD0A 1SURA 2HWXA 2EL9A 2PX2A 3PFIA 2HCBA 4Q3KA 5CVDA 4ZAZA 5BT8A 2RH5A 1YBHA 1E99A 4QUDA 2D7DA 2XKJE 5IPFA 3NJRA 4WSOA 3JS5A 3OQJA 1Z6PA 4I4NA 3ABSB 1M2VA 2YCLA 4MWDA 5JMWA 3TF5A 3CT4A 3VPHA 2WR8A 4U7JA 1D5CA 4WXMA 3L8EA 1OYWA 4ZCQA 4D9HA 2QN2A 4TKMA 4HYTA 3SS8A 2UVPA 3GPIA 4KDRA 4EG1A 1I2BA 2VPZA 3MGGA 1SBZA 2F62A 4I66A 1JZQA 2B1JA 4XB6B 3NP9A 4NBUA 1P1KA 5JD5A 4KGDA 3QEMA 3JV7A 3PVSA 4BE9A 2P2ZA 4IMRA 3Q9NA 1GG8A 1PFKA 3SOPA 3MEQA 2O14A 2RBGA 2Q6OA 1FP6A 3AJAA 1FXUA 1SHUX 2PUHA 3GC6A 5ILGA 5TIIA 4FDLA 5AKYA 2O52A 1M54A 3P27A 5F5XA 1V1MA 3F1KA 4H4EA 1KZYC 3E05A 4R2MA 5ISMA 1MZVA 1R4MA 4B32A 1A95A 4DUPA 4BNFA 1GKUB 3BTUA 4W7SA 4NCIA 2ZWVA 5EKDA 1Z4KA 4DPKA 2VJCA 1XTKA 4B0PA 3OHSX 1X87A 3Q5EA 1QVWA 4DJEC 2ZAOA 1N9GA 4YAEA 1DAIA 2JVKA 1N0VC 2WDZA 4JJGA 4YBRA 5ELLA 1HQDA 5HQJA 3AH8A 4XQ0A 5DXAA 1KSGA 3UPTA 2XOEA 1NDUA 3LQKA 4XLTA 3W05A 4O02B 3PD1A 2NU8B 2MJLA 1NI4B 3U31A 3FUUA 2X9NA 4KUGA 2IYWA 3AKDA 3P2KA 4CDGA 2MDTA 2XTMA 3RIGA 3T9AA 2Q3MA 4G25A 5HG0A 1L6RA 3OJ0A 5ADWA 2WUGA 5ICEA 2P2DA 4WJKB 1WAMA 2YH2A 2CFCA 2XMGA 1C2YA 3QQ5A 2A86A 5AW6A 1PR3A 2NM0A 3CF4G 2ZI5A 4IW3B 3QFTA 3E3OA 1C9JA 4HRXA 4IJVA 4IVQA 3J81k 1KO4A 1JWAB 5DT9A 4MQMA 4RK6A 1RXSA 1CR6A 2PMWB 1X7GA 3OZVA 4LV5B 4EHIA 2ZULA 3IR7A 4K6OA 3WYAA 3ZDEA 2XQGA 2A1UB 5KOIA 4HT3B 1YJCA 1CY7A 4L4ZA 4OX9B 3VR1A 5FA5A 1NBWB 4Y9DA 1W88B 1CQJB 1Z6GA 4EGJA 1SCIA 1WUIS 2YWRA 2IPNA 4W5TA 3HUTA 1ZIDA 2HF7A 4KQMA 1OZAA 2I1LA 2QL7A 4F72A 5JV5A 2I6QA 3EY9A 2OILA 1ZS9A 4HR7A 1GSHA 1HYQA 2CUKA 2ONZA 3LZCA 5J4LA 1WXWA 4L28A 3LNCA 1PG5A 1N0HA 3IODA 5CA0F 1WVGA 4YMIA 1UK9A 3OIVA 4PGMA 4XA8A 3PFKA 4RVOA 1FFXA 3CINA 3LUKA 3OEED 3IPAA 3QRWA 4N7MA 1GFWA 4PR3A 4Q4CA 4WRRA 5JAOA 3WS7A 1ZR4A 3CB2A 2RGNC 4PIMA 1O4WA 4KXNA 2O8FA 4UE3S 1YCHA 1BNCA 2C9DA 2O2EA 3GJ4A 3PFGA 4KGZA 4MLDA 4M8SA 4QD3A 2QR3A 5DSZA 5JDCA 2YR0A 1XJ5A 4REQB 3L49A 1SEPA 5GVSA 5FI0B 1LEHA 2I9KA 1HURA 1RI4A 3HR4A 1E60A 1WXHA 1MEJA 1ULBA 2PJUA 4ECAA 4UVGA 5MGNA 1SVLA 1Y3HA 2JGMA 4MR7B 2H0RA 1QZUA 4E2ZA 4GWKA 3WGGA 5MN4A 1W9MA 5DHFA 4BNWA 4CG2A 4DSOA 2PUFA 3GEBA 3ZYCA 5JRJA 3FAZA 1D03A 2DUNA 3R5XA 4JZKA 1G6Q1 5B6IA 2F67A 4L76A 4NMXB 3EVAA 4DUGD 2Q6KA 1WKVA 4DSUA 1XRRA 1ISPA 4J91A 3OZAA 1YULA 2ZWOA 4LDAA 1KP2A 4PAQA 4V0KA 4ZO6A 3UH0A 1YB5A 1DU4A 1I32A 3A32A 4EGAA 1SD5A 2YV2A 4IF6A 3RKUA 2B82A 5A9TA 4MGZR 4DDMA 5ALGA 5SYNA 4GW3A 3HZHA 2MSWA 3OVMA 4I9HA 2HQRA 3PC6A 3ZHRA 4DLKA 3VC7A 5BQXA 1TCVA 4LOHA 2ZJ3A 3OQVA 5IJXA 4DIBA 2QJOA 1KVTA 1EX7A 2W6ZA 3RGWS 1JIUA 1RHKA 3OLCX 1NGSA 3MZ0A 2GBGA 4PQRA 1LCIA 1JW9B 3KZXA 4RY8A 1IPFA 3EC2A 1MVNA 3SYTA 1Y89A 1RQGA 2AMLA 2ZR7A 1PQ4A 3K0BA 1QHHB 3H4MA 1S89A 1UMBA 1PR4A 1R0BA 2R1UA 2WICA 4JQOA 1R50A 1KARA 1NN1A 2TSYB 2W2QA 3PDUA 3PXAA 2FG5A 4FP9A 4HGPA 4ZT2A 1DE0A 1ZK2A 2PRSA 5I5GA 2E7ZA 4IIJA 3GUVA 3M6IA 1BA2A 1KFJB 3DZHA 3G5LA 2C4VA 5CJJA 3K9WA 4B3SB 4OOEA 2DFTA 3HP1A 1OZ0A 5CYGA 3WGOA 1UBLS 1WLSA 2CFIA 4N8EA 4ENUA 5BQOA 2GN1A 1LDGA 1RMYA 1UK8A 1U3DA 1ZD4A 1KERA 3DZKA 3H1PA 3RWOA 3AFOA 4ZPXA 4DUGA 1E63A 2EGGA 4I1SA 2D6FA 2XZTA 3QPDA 2WKQA 4Q37A 3G2HA 4QU8A 4OOFA 4XLZA 2VKTA 4E14A 4ER5A 5B1EA 2FPXA 4C7OA 1PP4A 5DNDA 5AHOA 3Q6IA 5DHAA 5ADUS 5LOVA 4HGYA 4EUSA 3FYSA 1VRCA 1A82A 1CG6A 1IEXA 1FYXA 1LA2A 2IYLD 4MITA 2IEBA 2NGRA 2ESRA 2I65A 4ARZA 1EBFA 1Z4NA 1JAZA 4D46A 1LPPA 3QV1A 4LJKA 2OSVA 3ITNA 3L0YA 3MIZA 5EOVA 2RHOA 2PO5A 3DEHA 3WWCA 2DR2A 1UMCA 1BROA 1CQZA 1FJ2A 2FKAA 2FXIA 1N8SA 1ZM4A 2G70A 2OT3B 3BS4A 3E3MA 1TMOA 3NBFA 4O25A 2G06A 5EWJA 4MVJD 1EUQA 1PG2A 1DWPA 2PDAA 3CRZA 3CEJA 4M0KA 3QEJA 2WT9A 2H54A 4N48A 2WHXA 3DQPA 5C35A 1G0NA 4AFNA 3RS7A 1L5RA 2ODTX 3LUPA 2CMHA 2A9FA 2Q8QA 3GA5A 1RWWA 2DWPA 4PAOA 1JAXA 5HBRA 1SU8A 3S2IA 3AXSA 4HATA 4RC9A 3B6JA 4HH0A 3ZG6A 1JEYB 4K9RA 2V5AA 1W9HA 5G4KA 2GAAA 1JBQA 1AN0A 1IULA 5B3AA 3RKRA 1KEKA 3VU0A 2GH1A 3AHDA 4LXUA 4UTNA 1A71A 2E85A 5H5JA 4M46A 4DRXB 3F6YA 2D2XA 4LIPD 3ND8A 2CYAA 5H3HA 3C5WP 3FSGD 3KLBA 3JATA 2IU3A 4O4IB 1NC1A 4U1RA 1NVVQ 4PSKA 4L9RA 4N18A 3IEUA 3AL3A 1E7MA 1OLSB 2AA3A 4C0QC 3Q0EA 5B3LA 1D6NA 4N6NA 3PGVA 4G01B 2QHXA 4MI9A 1ATIA 3ANTA 2CLDX 4V0NA 4QYSA 3X2SA 1N5MA 4AMYA 3OO1A 2PS3A 5DXJA 3UM9A 4BNUA 1WXFA 4LXHA 3G3EA 4FGWA 4F5ZA 4MVJE 4JJ4A 4CM9D 4QJIA 8MHTA 3U49A 1FTYA 2PWBA 4MPDA 4L8LA 2FSIA 3A3NA 3GF4A 1DSSG 1BZYA 1GPBA 2GCIA 2J7KA 5TY0A 4A8JA 4CF5A 1R9MA 4QFCA 5F1OA 4ZD6A 2RJOA 3SQDA 1L3IA 1XDZA 4MVJA 4US1R 3SSOA 4D44A 1CJBA 3IKTA 1HLFA 3C7DB 3A1UA 3JQDA 3WSVA 3W9UA 4BZZA 5BOSA 4MV6A 5HRUA 2H85A 3LWBA 4LAFA 4Q6BA 1QBGA 2CMGA 2VF8A 3QWIA 5ILQA 4O4LA 1Z5OA 4KWTA 1TGYA 2B34A 3SZOA 4L78A 4CE6A 4BMVA 3S44A 4AG6A 4HRAA 1WSWA 1VQ1A 3DGFC 2P68A 3FHTA 2F17A 2BWJA 2F1HA 4QUEA 4DLXA 5IT5A 3VUEA 7REQA 3V4SA 1XK7A 2M2IA 4JL5A 1C0LA 1OXXK 1KZ4A 5GJWC 1WX1A 1QLWA 2R7AA 4G63A 4ZQIA 3FSGA 1WPQA 3Q98A 2IQIA 1ENYA 2RGUA 2AN1A 2GA8A 2HSJA 4MP8A 1P2UA 3QLJA 4ZZ0A 1E20A 1UPUA 4NEHB 4ZANA 3UMFA 4BFUA 4JODA 2IV7A 3OZTA 1QFYA 2WUWE 3Q41A 5ICFA 3KU4A 3Q9UA 4RTOA 5EXEA 3AHFA 1Y1PA 1F2UB 1AZSC 1RBZA 3DV9A 1XDGA 3U7RA 3A05A 2IOQA 2Q3CA 2VK8A 3STTA 3GEEA 3WHKA 4AJPA 3ZWBA 1W48A 4CM9A 3S2UA 5LQJA 3O8RA 2VH5R 1A0OA 4FZRA 4UW9A 3K9NA 5AVWA 2ZAMA 1GRVA 4BO9A 1G9SA 3KYJB 3QPAA 5AJHA 5CJPA 4C7KA 1XYGA 4I5DA 2NV2B 4OK6A 2WF9A 2P2LA 3FNRA 4OY3A 1B74A 3GFTA 1QYCA 2ZRHA 4ZK6A 3DDHA 1YQXA 3W77A 3C2QA 4EFDA 4JLAA 3E1KA 4TN1A 4EHDA 3RVDA 1I1NA 3JWPA 4ZU6X 1IBMB 1KP9A 1IOVA 1IHDA 2GVDC 3LY8A 1FFCA 1YBMA 2JGAA 2AB0A 2ZT6A 3FNHA 4MV9A 1NU8A 3N7UA 2RAPA 1H2FA 1XMXA 3KZOA 4YYZA 3ZGLA 3DKRA 5IVKA 4Y1RA 1ZI6A 2IZ6A 3B9RA 2TS1A 1M66A 1VGQA 3PE6A 3WLFA 4F12A 3HO8A 5CT4A 3UQZA 1YZGA 4OHBA 5BVGB 1JIVA 2LPMA 4IHJB 5FPTA 1I2CA 3TIVA 3M3HA 3V4FA 3ICOA 2WAMA 3RHFA 2FFBA 2X0KA 1Z0AA 1ZH0A 4BO0A 1KYIA 3QIVA 2LCQA 3RHTA 5IZCA 1Q44A 2RB5A 1AUVA 1YF3A 1XZMA 3MS2A 4GWGA 3HJBA 3GLIE 2Q9UA 4R2IA 3NEYA 4YHHB 4UHKA 2ZWPA 4MEAA 4W6ZA 1K5PA 1YR2A 3FLBA 4NNJA 5I3ZA 3DJYA 3EGVA 3GGSA 3ORFA 3CZQA 3KUKA 5F4ZA 3BGIA 4KKVA 3DM5A 3TTWA 3BX1A 2W43A 3KTAA 2EKDA 4A15A 3O7MA 1RWNA 4M98A 3A2KA 3KPVA 4XDZA 4P3PA 4F4HA 5C51B 2X40A 5KSZA 1ZJYA 5E4JA 4V38A 2VWGA 3GT7A 2WB4A 3JQAB 4XSHA 4DMFA 1X0XA 2XQJA 4CKZA 5JDIC 5FOXA 1P7VA 1QHGA 4IXDA 4CZ2A 2VYCA 5J59A 4DN6A 4JXXA 1RM5A 3NEPX 3T0IA 3THXB 4ER3A 4LRUA 2ZB4A 4JT2A 3GT0A 1UL1X 4OHCA 1TA0A 2XNCA 3EHDA 1R0RE 5KOJB 1LDNA 3I9V6 3OZEA 1I4DD 1G7SA 2IX9A 4EM6A 1OYOA 3RF6A 4CEJB 5H83A 1ECLA 4X1YA 2OG1A 3DE4X 4RK4A 4R7ZA 5DH9A 3WGNA 1JHYA 3A6ZA 1YKSA 3NKFA 6AT1A 3ZC3A 1Q7BA 1EDDA 3C4QA 3NC0C 4CGZA 1Y42X 3D3WA 3ZV6A 4MH0R 3VDMA 4LK3A 1W6RA 2ZJZA 1RFLA 4F46A 2PSHA 5GOTA 5FWNA 1PE0A 1A7KA 5IDQA 1TD9A 2JC3A 3CVOA 3EZ2A 3FMPB 5TGDA 4CT5A 1WETA 3VR2D 4AD8A 1VL8A 3OCXA 4GD3Q 1NAHA 1US8A 1ZH2A 1E3LA 5EXSA 3KQTA 4NI5A 2KQUA 2YTZA 3ZTYA 2XDQA 4F1JA 1PBTA 5BNFA 1A77A 5LPNA 2H51A 2P9ZA 4FDUA 4ML3A 4QJ5A 4WDRA 2AN3A 1K5DA 3FPCA 3IFSA 3QNWA 4FUQA 2DAPA 3CISA 2VZ0A 1FU4A 1TPYA 5IU6A 4C04A 2NMVA 1IATA 3OHMA 1LW7A 3UMCA 1G64A 1PV1A 4RM3A 3WI7A 3D0RA 4R8RA 4OEHA 1II8B 4AO8A 2RBKA 3E27A 4TMYA 2VBCA 1T9GS 2IEAA 1DKLA 3NCTA 4LJYA 5EHIA 1QUEA 1GGNA 4R1TA 1PWYE 3WO1A 5CFPA 1PDOA 3ZYZA 2JCGA 5BR8B 3AP3A 4ID3A 1OWPA 2XBLA 2E4UA 4K5QA 4ESOA 5BSHA 4JU8A 5MDHA 2OC9A 2BN4A 2CFOA 3FB1A 5FYDA 2V6JA 3KPWA 1ZKDA 1CY4A 4CLOB 5DYTA 4N12A 3KO8A 2UYQA 4YBZA 2XGJA 2NT3A 2XTZA 3DXYA 4UUAA 1PVOA 1A1SA 4P93A 4AKGA 5K3AA 4GBJA 2C5GA 3LBAA 1I14A 1PNTA 3ZXIA 4F92B 2HA5A 2YXEA 1TJNA 4HNAA 1CWUA 2FLWA 4AB1A 3LOQA 4D4JA 3SMVA 4WK0B 4HOYA 3D0OA 4BMDA 4C0BA 3JU3A 3VR2A 4DREA 4FK8A 2H8GA 4NEGA 1F17A 1O6GA 2H9IA 3LY7A 4A0GA 3KOOA 3I39X 4RPKA 1JI3A 3SG0A 3KX2A 2Q5QA 3P4UA 2W37A 2WJ4A 3TYXA 1M6YA 3VX3A 4HNSA 3GZJA 2VT7A 2H1OA 2J59A 3B13B 5U4QA 4QQFA 2P0YA 1E4VA 2XGGA 2I7TA 4MIKA 1U6JA 3VAZA 1KY2A 3OY2A 3K09A 1SHTX 1ZUD1 1Z39A 1GQSA 2P79A 3TTXA 3G23A 1IY8A 3I5MA 4TWZA 4GNRA 3D6MA 2AJBA 2AI3A 4MVWA 3TOXA 3WXBA 3W78A 3AEUA 4C4AA 1EGVB 1SK9A 1UH5A 2PS1A 4PZ9A 4B6SA 4WZAA 3PR3A 5JIBA 2P75A 4WV3A 3WZ2A 3S0JA 1J23A 1O6CA 3KT0A 1XX6A 4HGOA 2G5TA 3QTBA 4CMIB 1IDOA 4TRRA 5JPIA 5H4HA 1RYHA 3H4VA 1DP4A 4YMUA 3IUNA 4MJLA 3OAAA 3WIDA 121PA 2HSGA 4JBWA 5E3IA 5EKSA 1IN6A 3HMKA 1BMTA 2Y99A 3M81A 4PGAA 2DR3A 3SICE 2A78A 1G5RA 4ND1A 1IN4A 5JWOA 3F9CA 4UTZA 5DX1A 3CZ5A 3HCCA 3O31A 1D1TA 4G6ZA 4W5WA 2JBAB 3G8CA 4JWTA 5B36A 3CVXA 4DV1B 4LFAB 5CX1A 4U7GA 4ZVQA 3KTFA 1DRWA 2VIIA 3TVDA 4BB6A 1P2FA 2GPSA 3PQ8A 3PUIA 4NMWA 4XUGB 4LCEA 3FDIA 4C07A 1PT6A 2EHDA 5BSVA 3EPLA 1Q1ZA 3A31A 5DF1A 4H7JA 5CFMA 721PA 1XB2A 4NZOA 3S1SA 5F9HA 1Y81A 1V11B 2GYYA 5EINA 1MT0A 4JOQA 2OHGA 3LBFA 2JLQA 4RGBA 5D87A 4C7XA 5EJFA 4D6YA 3JQ8B 4NBKA 3HYSA 2BZGA 2YOHA 3V1KA 4EJ6A 5L40A 1KDOA 1FDUA 2CUZA 2JIZD 4ZMSA 4IJMA 4KZKA 4XQGA 4FUTA 4ZZ3A 1V3TA 2GBIA 3GRFA 4BGEA 4KGVA 2WD7B 4Y18A 4ESEA 1UQTA 1KR2A 1UIRA 5EP1A 1SBHA 4AUNA 1SOUA 4HTAA 4G81A 4DR1B 3CLVA 3K0HA 3W6NA 3MN1A 2A84A 3GDOA 4J2TA 4TQGA 3UJPA 4YMLA 1T4DA 4L9SA 4K05A 1JB9A 3IHWA 2WMNB 3EQ7A 1ECJA 4OFBA 3F3KA 4Y2SA 4BRUA 1XP5A 1BVUA 3M4YA 1GXSB 4YFYA 1OASA 2AHOA 2O05A 2YJ6A 2Q0HA 2GJ4A 3CLSC 3D5TA 3OM9A 1E6CA 1ZRHA 5JSQA 4JASB 4BVBA 4MULA 3ZOZA 2FYTA 4G8DA 2DH5A 4GRAA 4WDQA 2NVUB 4OB6A 1PEYA 2XW6A 3PPYA 3L4BC 2ZIWB 2BP7A 1N77A 1R74A 3QXSA 3ZWNA 1VLMA 5B2ZA 5LXTB 2YVAA 3O7WA 2CNWD 5F12A 1BS9A 3K0CA 4TL8A 4JJ7A 3SF0A 4CG1A 1IIRA 5COAA 3N86A 3TOCA 3AG5A 3RJTA 1VE5A 4N3CA 5A4AA 3QF4B 4X45A 3EX7C 1HDIA 2P6RA 4XUDA 5TJHA 1XDWA 2YMLA 4CKEB 1E2DA 5CDTA 2R2GA 4EG7A 2JIZA 2A5JA 1OLUA 2AVDA 2K2QB 3UG7A 5LYYA 3AW9A 3PITA 5EIOA 1NUHA 4CKWA 2WKPA 1O57A 5JJLA 2P3OA 1O5TA 4UHBA 1RPJA 4R54A 1S4MA 1VHJA 2JFWA 4HAZA 1SVSA 4AP5A 3D6JA 5ITZA 3IR5A 1JSCA 3IOCA 1E0JA 4LCJA 5C37A 1OB2A 2O7RA 2OBFA 1DT5A 3C6BA 3GEIA 4PNEA 2PLFA 2B1RA 5KTMA 1E7YA 2QL6A 3CVYA 4HWPA 4B79A 2CL7X 4JLJA 3AGQA 1QF7A 2H29A 4C76A 3V2UA 1LBQA 1OXMA 2WU4A 3VHXA 1VIAA 2B0CA 2BFWA 4V0QA 1ICIA 6ADHA 1TEZA 3NBZC 5JAIA 3V4RA 3FOFC 4LY0A 1R8YA 4H9GA 2AVNA 4RVCA 2IT1A 1AKNA 4WWHA 2WM8A 3K0FB 3IALA 3RU2A 4QAJA 1VOTA 5FNVF 4COOA 4XM2A 5HJ5A 3T5GA 3RCBA 2CNWA 2C9CA 1E5QA 2GGSA 2C2XA 3AV0B 3WADA 1J25A 5EY5B 4BQPA 1GOTA 1FDOA 1OSNA 1W5TA 1YK1A 2DRIA 2GCOA 3KE9A 3F0TA 5E9WA 4YRLA 3I4LA 4P3KA 3M83A 5LD2C 3Q7PA 2PIAA 4R3UC 1C30A 1I6MA 2FF5A 3O4VA 3ZBUA 1GUAA 1YBFA 2V6FA 2FVYA 3L2OB 4FN4A 4M0CA 6REQA 5AW4A 5F2EA 1VJ1A 1EWKA 3EAFA 1NG1A 3EVFA 5AJXA 3LBIA 4EY3A 4JYZA 1CR0A 4RMHA 4HMOA 2EQAA 3EXEB 1WXXA 1JU9A 2GJSA 3MINA 5DLPA 3CUYA 2AXNA 5C7YA 3GZNA 2Q62A 3QVVA 3LIPA 4FI3C 4DVJA 1NQAO 1AJEA 4WKCA 5LR6A 1JG4A 4YIHA 4J2HA 3WLKX 4OBEA 5CK5A 1KVQA 5EJ7A 4OTZA 2WFLB 4CU2A 4TMXA 5BWCA 7REQB 1IBSA 4S2EA 3PNSA 1XALA 1WZUA 3N5CA 1XTUA 4HDSA 3TI7A 1UPBA 3DV2A 5AJWA 1CFZA 4QGAA 3STHA 4PHCA 3B48A 3JZFA 1TFRA 3A6HA 2R00C 4ABTA 4GYWA 1QH1A 1L7NA 2FPPB 3VYUB 3EPJA 1LZLA 5IN5A 4KR9A 2J3JA 2CHUA 2QJFA 4WT7A 1FNCA 1W581 2QI9F 2X8AA 1WS6A 2YV3A 4GSLA 4N40A 3WYFA 3T4EA 2DUMA 3UJHA 4OI4A 1YB2A 3FOEC 1MOQA 2A94A 1QOZA 2XJ9A 2YDXA 1W76A 3ZIDA 1JI0A 3HR7A 4RFLA 1E3JA 1EUDB 1NVFA 3EBLA 2AJCA 1LZKA 3AR8A 4PNPA 4UZFA 4DPMA 4OHXA 2JD0A 3NDRA 5IXJA 3D9QX 3OT4A 3TQQA 4UTPA 2I2XB 2GHRA 3DCJA 2FZVA 2Q3FA 3FBGA 3OOEA 1TUBB 4C3OB 5H9VA 5I01A 2WYHA 1KQOA 4D9NA 4QT0A 2DLDA 2Q6LA 2IP2A 4CV3A 1OGYA 1WLYA 3GJ3A 1XTRA 3F7MA 3FLAA 1Z0FA 5FR2A 1Q1GA 2AC7A 3BH0A 1PVDA 2ZJAA 5TRTA 1WBBA 1L7BA 4TXHA 1E8NA 1FSPA 4M7PA 5DSTA 2A9OA 5BNIA 3F5DA 4N76A 4G67A 5GZ1A 2EARA 3TGWA 3ZQUA 1NJ2A 4JSRA 4IDDA 3NNDA 3T4PA 4FXPA 4I50F 3BAZA 1RHJA 1MABB 4IOKA 2M6LA 2CCJA 2I1QA 2ZRGA 5IDYA 1SELA 3ZGNA 1OREA 4CG0A 1IH8A 3L3BA 4YUWA 1ZOIA 4ETMA 3HNOA 4WOKA 2Z5VA 3FYTA 3UH1A 5JROA 2Z3WA 1L4LA 3VTKA 1BHSA 1A9SA 1L8QA 1VFNA 1G9TA 2X22A 2ZM6B 2YW2A 1BO6A 1IZ8A 2OD9A 3MTGA 3IMEA 5DULA 2YINC 5A7HA 1G18A 2RG7A 2IGTA 1WDKA 1I3MA 2V7WA 2VC2B 4WEQA 5EWMB 4W9MC 3RVBA 3G02A 3E2PA 5JZSA 4D45A 3KT3A 2ODPA 2P8SA 4PPNA 3QA3E 1MX1A 1WXEA 4DLSA 2FFAA 4PVDA 4RU1A 3LPCA 4C0LA 1A27A 4MXDA 3AUFA 4R0NA 4UASA 3UGTA 1PR1A 4YT5A 4PSAA 1LLQA 1NW6A 4KR0A 4MPJA 4RA6A 2FY8A 3BWXA 3EQ8A 3ZV3A 3MWDB 2E6KA 2NOAA 1EWYA 2YS6A 3QKUA 3WLPA 3IP9A 2HHLA 4A73A 4LTNA 3IUEA 1M2OB 4YRRA 2K2WA 4JUFA 3ZCRA 5EAIA 3GLHA 1NVVR 2UYHA 3WGIA 3GK3A 1M33A 1PN3A 1CYEA 4Y6OA 3ESQA 1QH9A 5DI9A 1EA7A 5LZ5A 3KVVA 2BV3A 4KSCA 3SZLA 4RGYA 1MU0A 1GKKA 1WP9A 1ZYUA 1AHPA 4M0UA 4WH0A 1CTQA 3D6VA 5CT9A 3PXCX 4K9MA 1JKJB 5CNMA 1V43A 2UUAB 4HYQA 1VBFA 1Q7EA 2WF6A 1TYBE 4JAVC 1QORA 4JD5A 1MA3A 4JLBA 1UT5A 3LC2O 4M1SA 3B20A 4UM8B 4Y9RA 5GGXA 3X2FA 4FDMA 3PXBA 1A96A 2HDHA 2W8ZA 3JARA 2DUJA 3UUWA 4IILA 3R9IA 3RTCA 2EQ5A 1LWNA 1QIGA 3JVIA 4A0HA 4W1PA 3L40A 4PLFA 5HK9A 4FGJA 3AF6A 1RC0A 1EYZA 2P9HA 5DTRA 4JVNA 3HYNA 4P5EA 3E70C 4KIJA 5DTQA 4D26A 3Q2OA 3UA3A 4N3GA 2HA3A 3WGJA 2AE1A 2FGKA 3ZHOA 1XYYA 3VI4B 4BLVA 3BHMA 4MW9A 3IO3A 1C3XA 1FL9A 2GM5A 3O1HB 4UNSA 4D25A 3LAWA 1S9HA 2DFKB 4GM4A 3B53X 3TNDA 4UPVA 3O83A 3LA6A 1UQRA 4RJ2A 3WLTA 4EF6A 3DMDA 1XNGA 3VO8A 1D1QA 1WMFA 4L4SA 2H17A 3IQEA 3H19A 5TT1A 3RH0A 1NQXA 4PZAA 5AFSA 4EA9A 3GUCA 3R3UA 1RTKA 1XFAA 4EPVA 1SQFA 4XGIA 2ZT7A 1AKVA 1FP2A 3KRTA 5LUAA 4KIGA 2O20A 2ALJA 3O82A 3GL9A 4Y6GB 4C30A 4HEJA 1BRTA 4GZLA 1ZH8A 5ALWA 1GPJA 2JA1A 2ZCVA 4I6EA 2DH6A 2FUEA 3A26A 3UJNA 3ED5A 5LZ8A 5TQ0A 4DILA 4HB0A 4YAUA 1C3VA 2OD7A 4DCTA 2CLIB 2YWXA 1DKOA 3FWYA 3KB2A 4AF7A 4GKJB 3A6JA 1IM8A 3LKZA 2W70A 2H65A 2ZB7A 2AC4A 3BSYA 5EZ6B 3DAPA 2HRQA 2BCJQ 3QKRA 1Q95A 1YNSA 4CLDA 4WN3A 3LHFA 4J6FA 1WMEA 5FI1B 3ND5A 1A8UA 2IX3A 1J6UA 1H9BA 1LS6A 2JARA 2JIQA 1C9NA 3WGQA 1KSJA 3UB2A 1RWPA 2IZOA 1Z7BA 2YIJA 1R2QA 1OUMA 2N9UA 2VA9A 3BC1A 2I2DA 4QXRA 4H16A 3AHHA 5DW0A 1VCIA 3HLTA 1JIJA 4RPHA 5BUSA 1UDWA 3BWVA 2FK7A 4L74A 2QMZA 3LVFO 2VL7A 2PSSA 4G3XA 3WGMA 3F7TA 4LX8A 1B2LA 1UMDA 2VWHA 4N1AA 5D6NA 4R2XA 4A92A 5JD6A 2R7LA 2W83A 5BRNA 5FO0A 4FTWA 1G3UA 1IIBA 1P1FA 3BQNB 4DSZA 2FTKE 5BNZA 5F7OA 2EWMA 4JX8A 1E0DA 4UEKA 3OP4A 1USKA 2VK2A 1U28C 5LD2B 2XBMA 2PYIA 4P53A 5H0IA 4MZDA 4QQ8A 1YZFA 3T5DA 1J9EA 4UFNA 4UU1A 1FU7A 2XIQA 2OR3A 3GT4A 3RVRA 3I0ZA 1Z6QA 2ZREA 4JNKA 3AG6A 4D99A 4YCBA 4DG8A 3IMGA 1ZK0A 4QHSA 3B5IA 4WX2B 5DOZA 3WJ2A 3DONA 2N75A 3LDUA 2WMOB 5FD8A 3GAAA 3KOWA 1K2VN 3BCRA 4G4SO 3RS5A 1Q22A 2D0DA 4QU9A 5JQWA 2P78A 3H0EA 3FPSA 4KMMA 4OYHA 4RGVA 5KNLA 1ZUNA 3GGPA 2SICE 5AIBA 3SVLA 4MTLA 3UAXA 4MRVA 1DUSA 4O0LA 3ISVA 4PLWA 1Q7RA 3PLAE 2JGEA 2QJRA 2H18A 3DO5A 1NV8A 1TKBA 4LY3A 3Q88A 3NOVA 3S3TA 4BKOA 2HF9A 2WTXA 3WIBA 3FPEA 2YYAA 3DBOB 3DA8A 1G21B 1TYCA 3PL1A 4LJ7A 3F71A 2J3LA 5LQNA 2DKFA 1QE0A 1UPXA 1N5KA 4R81A 3U56A 2G9VA 1D0IA 3DOFA 5K0SA 1X9GA 3GBVA 4RETA 1OYYA 3D6NB 5EMMA 1U7OA 2R6FA 5EN4A 3IHLA 2EP5A 4LMBA 5TPWB 2P6MA 3VVCA 3D6HA 4FGLA 4L6AA 3G2QA 3ROQA 1ZHHA 4HAVA 2Y4OA 2EL7A 1SOAA 3P26A 1H6DA 3R3WA 3M2TA 5IJ9B 3X3HA 3HB5X 1H2BA 3BCUA 2NUAA 1UK6A 3T5TA 1RFGE 3QEKA 4GO1A 1T6ZA 1DAPA 3LQ4A 2ZE5A 4U2KA 3W6ZA 2J3HA 1M1YB 2XUJA 5A04A 3UK2A 4YK7A 2ZI6A 1YBAA 3DDSA 3SI7A 1HDYA 2G63A 2X23A 2Y1FA 1ZGAA 2N42A 4FMBB 1LLCA 4NDZA 4TXLA 1EGQA 2VVTA 3SHFA 3D5QA 3RRZA 4I14A 4Q1AA 5BN4B 1MEEA 3VISA 2YQ4A 3TRFA 1DMSA 3K0EA 3G2IA 2LBPA 3G2PA 4O4HA 1YV9A 6NULA 3AVPA 1B8NA 1NYTA 4EIWA 5CLJA 4C5AA 1EB8A 1QGYA 3SHQA 2FWIA 2CBXA 1IDN1 4NX2A 3W6UA 1YDFA 3V7YA 4DPLA 2J67A 1RKQA 2ZQYA 2OAGA 4QLBA 2A1IA 2CWDA 1XZFA 2J33A 1W2HA 3PGLA 4MRRA 4JCOA 1NVWQ 1H8ED 3A9RA 4IIUA 4IFIA 4TROA 3PC2A 5EIWA 4NRDA 3VOSA 1Z18A 4ZQGA 1UJ2A 1UXIA 2BKUA 5AVVA 2PQ6A 2BCEA 4JLVA 3CHYA 1QHSA 1XMVA 3NYIA 2IF2A 4B3RB 1SM4A 3THSA 1DXOA 4NCKA 3RRFA 4B6FA 1LDBA 3T1TA 3NATA 3I76A 2ZE7A 3T12A 2B99A 1PR5A 3W5DA 1M34E 4KR7A 3TE7A 3O8NA 3L01A 3QVMA 1JQJC 1P1RA 4I55F 1K7SN 3O47A 4IUYA 2X0EA 4RLHA 2PUDA 1HK7A 1LF5A 2Q4BA 3V4LA 1J2YA 5AJTA 4DRZA 1M34A 1WXIA 3LPDA 5FTWA 4EATA 2JGFA 1II0A 3WFIA 5LA6B 4EDFA 2V7GA 4NARA 1Q92A 1S1MA 5PGMA 5LJLA 4IUDS 2IXTA 4KTVE 3Q3HA 4CQJA 3C6XA 2BEVB 4CMHA 2BFFA 3EOZA 3ODPA 4QDTA 2QX8A 5D3QA 2D5BA 3SD7A 3HM2A 3ZQJA 2CKMA 2P30A 4KRFA 2Q5HA 4ZDIA 1Q3TA 1Z74A 2X14A 3WWYA 2R97A 3G13A 1BKDR 2ZUCA 1G1MA 1KGDA 5AW5A 4H3VA 3AETB 1EAMA 2EWVA 1MP0A 4IR7A 1RXVA 1G4AE 1V47A 1VECA 3QK7A 5FL7A 3DLBA 2JANA 1H8EA 4OYRA 1JKIA 2GPNA 2CHFA 4TYWA 5AH0A 5CDYA 2O5RA 2NU7B 4G84A 3JPWA 4ARVA 4ZT7A 5IS2A 1OE0A 1RDFA 1QHYA 3L6RA 2Q46A 5F1KA 3TQOA 4NEQA 4AY5A 2ZSUA 4BTVA 1SC3A 1L0BA 2C92A 2VCHA 4U3JA 3WLMA 3TPFA 2FDRA 3G82C 1I5OA 2O59A 4FBMA 4UDOA 4S1TA 2IUYA 1RYYA 4DY6A 4MO2A 1UC9A 3B52X 4DNFA 3U80A 4C3ZA 4YJ3B 4DLZA 4NDNE 3K9GA 3N6VA 1DG9A 1UBHS 1FF9A 2HWUA 1U2GA 2NTJA 3SF8B 3PQ6A 3UXHA 4AF6A 1QG2A 4KX3A 2G1PA 1HSOA 2CVQA 2FSUA 3LHDA 4M8NE 3ZPXA 2XWBF 3PGA1 1BX0A 4BE4A 2PU7A 2FE1A 1R12A 2D54A 2HJWA 3DZCA 3H84A 3OF3A 1WZCA 3NOQA 3ZNOA 4CFYA 3WIVA 3UPUA 5JS8A 5IUNC 4JP3A 5LMZA 3STVA 3DYBA 1ZWKA 2FEAA 2Q21A 4JJ8A 1PJQA 3KCQA 4LY6A 2AW5A 3LH5A 2QSJA 4TTJA 2XAUA 3OOSA 5EP2A 1KJQA 2OKCA 4M0MA 5M7EA 2UZ4A 2G9UA 2HT6A 3ZWCA 1EGAA 2GCGA 2LV8A 3WP0A 1KKMA 4KH0A 4ZHQA 5BN1A 4F1WA 4Q19A 1RI1A 4TTTS 1JG3A 3OFSA 2X9VA 1XZKA 3REGA 3U62A 2IYFA 3EDQA 3RFFA 3DE0X 3OIGA 5E6RB 1FB5A 4BNDB 3QHAA 4DV4B 5JSZB 5JYBA 4CMEC 2AXEA 5EXTA 1A5BB 4IX1A 4HLCA 3NRBA 3OJCA 3MOSA 4NYMQ 1YIDA 5LBIA 2ZVPX 4L2IA 3C48A 3W3ZB 4QG3A 5JXJA 4B35A 1M8FA 5IANA 1Z38A 2C31A 2PKEA 3DV0A 4NL4H 4A03A 3L1UA 2JRLA 4YUYA 3UV7A 2LRHA 4R9VA 4DA9A 1ADYA 2W4IA 3FWNA 1UPFA 3X1MA 2I6UA 1XA0A 5DSXA 5JRDS 5JZBA 1JTFA 5DBHX 1ZD2P 2NQTA 2QLTA 3CTPA 4MK4A 1N2HA 2I3BA 5F33A 3GDHA 3EK2A 3U3ZA 3LRPA 3TX2A 3DSRA 4MV3A 1GVHA 3PCXA 3CRNA 4GMDA 1OI3A 1TJ5A 3N9IA 1E4YA 2JVIA 2O7VA 4JI3B 4DF3A 3IP6A 3EY4A 3R2JA 4IHAA 4KODA 3DTTA 3U40A 4F9GA 4QARA 3A8TA 4E21A 3AHEA 1W5AA 1YUBA 2JGJA 3IBTA 3Q3JB 4GOMD 4JEUA 4AURA 2WM9B 4ZCTA 1GCAA 5DTIA 4P4GA 5A0FA 2PX0A 4YR7A 4OGLA 3KKNA 3OOYA 1GQFA 2GD2A 3FHCB 2IOHA 4XYEA 1CB0A 4YIKA 4GX2A 1ESEA 2QN8A 5G41A 4B2YA 5A1TA 1JQAA 2YHIA 5F5NA 5ICGA 1KDVA 3KVYA 1ZSYA 2DPYA 1W75A 4PAMA 1IHYA 4IL5A 3KFXA 4Y7CA 1EBBA 3UK6A 1FPMA 1G3MA 1PSZA 3OLVA 1M6EX 2ZRBA 2XPCA 3DTVD 3VR6D 1IY0A 3HGMA 5HYVA 3PXDA 1PGNA 621PA 3GRRA 1CD5A 1XMPA 3PDIB 2FFHA 4XX0B 4EX7A 3K70C 1SOMA 3OZ7A 1WTAA 1X80B 3K9QO 2QBYB 4RZSA 3QXXA 3M6XA 1BXGB 4KFSA 4XCXA 3UWPA 5C8XA 1P6XA 3DEYX 4K7JA 4AY2A 1H3NA 1OOEA 2FP4A 3CZMA 4NOKA 1N2JA 1UP4A 4BRZA 3PLNA 3RREA 2HT1A 2YV4A 1U3CA 3BCSA 4N39A 3B6IA 1OFUA 3EXHA 4KPGA 1FIUA 1W4ZA 4DIUA 3GUYA 2HQSA 4J0EA 3JQ7B 3TUJC 1HORA 1U1FA 2GM3A 2QK4A 4U0JA 4N0MA 5CNIA 4BO3A 3AEXA 5DASA 5CBPA 4KYIB 5KCZA 4NNOA 1L5HA 4TTAA 4EAQA 2QGFA 3EVBA 3T7AA 2PV7A 3OICA 1SIBE 3D3KA 2BMDA 2PX3A 5DTMA 2DFNA 4Q9JA 4BEVA 1A3CA 1K08A 1SCAA 2L2QA 3RO7A 5BV2P 2C2WA 1D8TA 2FPKA 3AVQA 3KHUA 5FPKA 3OQPA 4BAUA 4QT4A 1E0SA 5LZ7A 1Q0PA 2E18A 5GONA 3PHBE 4PLTA 2C9OA 1AGXA 1KAEA 1XEWY 3M5CA 1TU4A 3E6AA 1U5AA 1DX9A 4F85A 1ZXBA 3UFBA 4E88A 3IBCA 5EZYB 1SQ5A 2Z2KA 3UMSA 3O91A 1FRZA 3DTVA 2R66A 3N2GB 3QW2A 4TUYF 1Z7EA 3PDHA 4YMWA 5ERXA 1VLQA 3TBHA 2IYQA 3TCNA 4AWBA 3CW9A 1TT5A 1DI0A 1WUTA 2VSQA 3Q7QA 4I3FA 4N8SA 3CRMA 1CUAA 3TNLA 3PNPA 1MHPA 3K1YA 3QFSA 4PG5A 4QLOA 5AW0A 3AR2A 1AD2A 4JX9A 3D7KA 1DRJA 1SKYB 1P91A 1SBQA 4H6XA 2OZVA 3E7FA 4KQ6A 1KZ1A 1NURA 1IY9A 2QWXA 2XAAA 2H5EA 2Y93A 3NJ8A 3O4GA 1AO0A 3RSSA 2CVPA 4P7KA 4D97A 5LYJF 4S05A 1NFRA 3DAYA 1R5OA 2B4YA 5I7AA 4DLNA 1NXPA 1VPWA 2VDRB 2QVCA 4F9EA 4NIMA 1RC8A 3GUHA 4IZHA 2MSEB 4NWIA 2JAOA 5K2OA 2A5LA 5LJIA 2IH2A 2WC1A 3VC1A 1NVUQ 2ZAIA 4NYJR 3TZ6A 3FOWA 3QE0A 3SM3A 3VJKA 4PPFA 5B7NA 4M1KA 1AA9A 4F56A 2NU6A 2O7NA 4YCMA 3CEMA 3KLMX 1J2JA 1GRQA 3TSYA 4CQMB 4DMMA 4R2LA 4F86A 4NZZA 4Y6SA 2BISA 3A04A 1DFGA 1TDJA 2YNMC 4ZVLA 1Z47A 1Z62A 2ZS7A 1EIWA 2FR0A 2HXGA 2R7KA 4LE1A 3OEWA 3ZCTA 1IXKA 4WY8A 2HW8A 2FPGA 1HNNA 3Q85A 2PO7A 2ZJYA 1E96A 4M87A 4BJ1A 1HRDA 4ZZ2A 1GFIA 4D3FA 4LBZA 4EBFA 3HCAA 5ECYA 2BR5A 3VJMA 5KYWA 2QTTA 2WNHA 1JMYA 1VJGA 1W87A 5ALRA 1ETUA 2AZ4A 3PKZA 1Q17A 2BLNA 3K05A 2E0IA 3E8XA 4W82A 3L8ZA 5KZMB 4F3CA 1XA4A 5DGTA 3OJOA 3IIEA 2XWJI 4DA6A 1CB7A 2XT6A 4EB6B 2O2XA 4N03A 4L8GA 1CX9B 4RPCA 2ZYHA 5EP3A 5EJ2A 3D4IA 1NYRA 3WNZA 4F2WA 5E1MA 3PXEA 4QPCA 4Q9KA 4EGFA 4OVKA 5LQAA 1BA3A 1RQLA 4TLCA 4UJ3A 4WOCA 1TYAE 1YH3A 3KSAC 4HAWA 5DMHA 2A0UA 1MUUA 5C34B 4EF4A 3BREA 4BKRA 4EYOA 4FCCA 3V2HA 1JKFA 3V9AA 3R41A 4IINA 2OHIA 3CPEA 2EIXA 2D8AA 4QTZA 3EZ9A 1TLTA 1E1KA 3WLOA 2IUEA 4RY0A 1QRRA 2BD0A 4TLBA 1JTVA 3HKEB 3CWZA 2H4JA 3B1KA 1P29A 2YRXA 1AQYA 3ETEA 1ELOA 1ODLA 5CB8A 2B94A 3C4JA 3IJPA 3RV4A 2BRUC 1DZ3A 3DGEC 2WUVA 4EFNA 3GWZA 4JR2A 1HG0A 5D1HA 1GQRA 4YV0A 1TXGA 2I4NA 2PKYX 4IUCS 3WLQA 3H2IA 1FTQA 2XWQA 3BWEA 4JYPA 3JTMA 1K98A 2BFMA 1YMVA 3C74A 4OFZA 4URWR 3U4GA 4Q24A 1AQLA 2OXCA 1JHPA 2EFCB 2IEGA 2F3RA 3O0TA 4IS3A 1USVA 1X1QA 4ENWA 5A6SB 4KPUB 4BJHB 4CEIA 3HUUA 1AM4D 1CZUA 2OCDA 3FYHA 5HJ2A 5FQOA 4P4NA 4Q4HA 4G09A 1LD3A 3DMPA 3IDAA 4D9MA 5KX5A 1XQXA 3DLPX 2AQHA 3PJEA 3SMQA 4RTPA 2JS7A 2WTEA 3MD9A 3PLRA 4TS1A 5DIFA 1OFHA 4ISCA 5JO9A 4N7RA 1WM1A 3LGXA 1H3EA 2C59A 1F8GA 4FBLA 4TRNA 1E9SA 1R7RA 3CCCA 2BJHA 2NT4A 4IXNA 4NFYA 3GLFE 4DJDC 1HL7A 1OX6A 1F8FA 3EC1A 2CUTA 2DUUA 1HQYE 3I53A 5E6UA 2X41A 2C4HA 3CXRA 3OQIA 5C1OA 2Z4TA 1PUJA 2FPLA 3BHJA 1OFIA 3NLLA 1NU6A 3CH5A 3SJCA 3VX4A 4HXFB 2X7JA 4RXUA 2WYIA 3GLFA 1AURA 2JAHA 3ABQB 4D7AA 2WA1A 4LX0A 2JBHA 3H4TA 2Z2XA 1VLHA 2FFQA 3ANLA 2X6TA 3TTUA 5L51A 5FOTA 4DBVO 2UXDB 4K8RB 2UYGA 1BHO1 5A0VA 1L1QA 2QSYA 3H5IA 2WJHA 3G0IA 4H1VA 2QAIA 5IC5A 3ZU5A 4A9AA 5IC6A 4JLNA 4JC8A 1LJ8A 4KAFA 4I4TA 2O6HA 4K0RA 4OMCA 5G3YA 4OA8A 1C0IA 4BN4A 1FTWA 4DBLC 4G0OA 3DVAA 3I1IA 4NE9A 4JI2B 4IP0A 1QIKA 3VMMA 4ZZ1A 3EOBI 5KOHA 2IHNA 3I62A 1OJLA 2Q6IA 1KBZA 4YCLA 3FJYA 1Q7CA 1SKMA 2ZIXA 2WWWA 3ZXYA 2UDPA 3E9YA 3MTAA 2GZDA 3ICCA 3OECA 4QGFA 1XVVA 4QODA 3ZDCA 4G2NA 1BH2A 1GITA 1KTIA 1ZN2A 3E03A 4N5IX 4P1ZA 1V5WA 3CX4A 4QUAA 3DW1X 1CUEA 1Y63A 1YZ3A 4WTOA 3Q12A 5EUCA 2HCFA 3HP4A 1C4XA 2ZRMA 3ES9A 3EWIA 2OCAA 1GZVA 3LLSA 2H3HA 3TLZA 1GM5A 2O9JA 1TFUA 4YUXA 3U6BA 3HUDA 4FLEA 1SMKA 2JI8A 5I7FA 2O8BA 3RLIA 1ZA2A 1XCPA 2CCGA 3QFRA 1XVIA 2GR9A 3OD5A 3OQHA 2XUKA 3Q5DA 1LX6A 1EHYA 3V8PA 2GK6A 1MDFA 3A2MA 3ZDQA 2N47A 3G9UA 5DGDA 1IHPA 1U0FA 4LE0A 3T0FA 5AW9A 4B83A 4Y8VA 3NEAA 1V7PC 3ZJTA 4C2AA 3BIOA 1P2DA 1GNPA 3K31A 4MW0A 5EMJA 4NJEA 4AS2A 4CFSA 5C3MA 5AJZA 1RM0A 2QRZA 3AM3A 1T2CA 3K0KA 3K9HA 1M0TA 4KIWA 2QN6A 3TZBA 1A7JA 2R1VA 2YHBA 4IIJF 1SA0A 4QGHA 4G0ZA 2UZIR 4R69A 2WHYA 3USCS 5HGXA 4MDFA 1MN6A 3MTEA 5A2QA 3FGNA 1AO3A 1VIVA 1U8TA 4HJXA 2ZAYA 4M0DA 3QMMA 3PSAA 1VSUA 1IL0A 4BZPA 3JAKA 3LRTA 4HNQA 4I9NA 2OOKA 4L3OA 4WW0A 1A76A 3I45A 4X97A 1UMKA 2ZXUA 1C3LA 1HY3A 4WESA 3GZTB 1JFVA 1EUCA 4GMFA 2FJPA 2XZPA 5C52B 4R9SA 5K0BA 1OBOA 1WDTA 2OY0A 5LOVF 1Q57A 1Y5MA 3G7SA 2YVKA 1ZD3A 3AEQB 4CI9A 2ZITA 1MQSA 4IAOA 1XWIA 1P0QA 1H2WA 3I6QA 4G4SP 3HXTA 3EFEA 3BGSA 3FKJA 3WK7A 2X42A 5FADA 5A4MS 2OGTA 1P2TA 2AMYA 1KU6A 3TW6A 4RMIA 1U1IA 2XGSA 1VA4A 3W2TA 4ARUA 3AM5A 2Q28A 2X7HA 5JVDB 2FSPA 2H7YA 3ANSA 3E7WA 3ROFA 2VYQA 5K0JA 2PS0A 2MYNA 2VF4X 4HD8A 1CQIB 4KAXA 5HFNA 3WYGA 5L9AA 5DM70 3WK9A 4F2GA 5TEVA 4PZ0A 3CH4B 4AWAA 1GUZA 3HN6A 4A0FA 1CS4C 1K4YA 2Y0CA 3ZZ0A 3R9WA 4LJSA 1YIAA 4B6OA 5FPYA 3KG2A 1HZJA 2W6MA 2ZE6A 2I4OA 1VE6A 3PC4A 4W7HA 3ZWVA 3FG9A 1UINA 1XFDA 3GVCA 4QOHA 5C1DA 3CUTA 4XX1A 3OUUA 2FHSA 4R1NA 2A0WA 5SICE 1H69A 2JIRA 4ZRDA 1RHMA 1SD2A 2J9FB 2YWDA 3B7GA 3LGAA 3TB6A 3GRUA 16PKA 4JBLA 5CEJA 5DBEX 2X2OA 3U44B 4TKUB 3A4VA 4Y0AA 4LOKA 1NXVA 1UDBA 4FNGA 5UKDA 1RZUA 4LECA 2OXRA 5K3EA 4IDNA 1U80A 2PJZA 1Y8QA 2RG1A 3KE8A 4RHYA 2J6CA 2B4QA 2Y27A 4HDCA 3C1OA 3D2CA 3U6KA 2Z95A 1EFCA 1N6OA 5K4GA 3GJ7A 2P77A 3LP8A 1EM8A 1RJ9B 1BDHA 2DHQA 2F7SA 3OZXA 2ILVA 1KYYA 1PQPA 1XXLA 3SZUA 2CDRA 2QXTA 3IUYA 3OY7A 2VT6A 3AILA 4Q9LA 3CSUA 1W36D 2DHDA 5GAJA 3TLCA 4YLEA 5K7SA 2QU8A 1RPTA 5A0TA 2VYVD 1E1CB 3DVQX 3IMFA 3PHGA 4MVJF 3OMLA 1K7YA 4FFBB 1EFTA 2OVFA 1PLKA 2XNSA 3ORSA 4FEYA 4DCUA 1LK0A 2I87A 1VKJA 1K86A 4G89A 4BB9A 1Z36A 1OU0A 3JQ9C 3GAFA 1B1CA 3WISA 3THWB 1BQ4A 2AOTB 4MW5A 4O4LF 4YCNA 2QW8A 4I8IA 2GEJA 4LGCA 5BQPA 2NYUA 4EL5A 1UKYA 4XVRA 2V59A 2IY8A 5ITVA 4Q15A 4GPEA 2DP4E 1X92A 2GTHA 2D2VA 1TM4E 2XLCA 3HCPA 4PG6A 4BFYA 2AZXA 2UZ1A 3OQ1A 5KSYA 1M2KA 2O8EA 3BD8A 2F1IA 2OLKA 2DWOA 4M6WA 1QRTA 1L5LA 2FI1A 1A9QA 3MWJA 1Y4SA 3OQMA 1AZLA 3C85A 3REQA 4V2UA 1JNYA 1WB6A 1B41A 5G1NA 4P82A 4ZV9A 1PL6A 2PL5A 3QELB 3UMMA 3DFFA 1UJ5A 1V3QE 4MV8A 1V16B 3WLLA 3J81A 3BWMA 1E2FA 2YY7A 4FYHA 4GI2A 3WL6A 7MHTA 2AEMA 3WLSA 5DHSA 3OU2A 4LJLA 5DYIA 3ZZMA 2QGNA 3F4BA 2R8BA 4XYGA 5TJ9A 4M76B 4IYJA 5KVAA 1DAHA 1Y9ZA 2NUPB 3MFYA 5TC4A 2VYVA 3F47A 4OMDA 3RWMB 3TLXA 2VNIA 1CV2A 4EOGA