3FYUC

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
316
Chain Sequence
b'QLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl xylan esterase
molecule tags Hydrolase
source organism Bacillus pumilus
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
total genus 117
structure length 316
sequence length 316
chains with identical sequence E, F, G, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuC00
4QE3A 1Z68A 2AJLI 4B0OA 3D59A 2LIPA 4KRXA 3N2ZB 2XMQA 1JU4A 3KWFA 2XLCA 4U2BA 2D5LA 5CURA 4J7AA 3H2HA 3TRDA 4X71A 3RARA 3Q0TA 3RKSA 1SOMA 4PQEA 1IZ7A 3G0GA 3WA6A 2ZYRA 4XWGA 3LLCA 2XMZA 3WK6A 4TVKA 3QMMA 1PFQA 4KE7A 4MEAA 1WCYA 3FBWA 2VT6A 3WL8A 1JFRA 4ZGBA 1CUAA 2PSFA 3PFBA 5FV4A 1UFOA 1AURA 4WJLA 3IVMA 1BROA 1WB6A 3I1IA 4FWBA 2Q0XA 1Y7HA 5AICA 4YPVA 1GZ7A 4A16A 4DM7A 3FLBA 1XQYA 2Z3ZA 3PICA 2PL5A 4JH0A 1LZLA 1TIBA 2O7VA 1E5TA 2HA5A 5JYCA 4G4JA 4HXGA 4LXGA 4X6YA 5T4FA 5AK4A 3STUA 3F98A 5T4EA 4GDMA 4AZ3A 1HPLA 1VE7A 3WL6A 5JATA 4YASA 1LPPA 4CIAA 5AM5A 2RHTA 3W05A 1OXMA 2GYWA 4IO0A 1CUJA 1H2YA 3H2KA 5ALXA 5FPQA 3STTA 3F8SA 4U2DA 4Y2SA 3I2KA 2RIPA 3SK0A 5KWJA 3G0IA 2PBLA 4DNFA 5DWDA 1E3QA 5IVIA 5CT4A 3O9MA 1VXOA 3WIOA 1LPOA 3QYJA 2WLSA 3D0KA 3TJMA 4F5ZA 1XZMA 4P08A 3C87A 3AJAA 3DNMA 2JGFA 1JT2A 3IULA 3LP5A 4B6GA 1G4HA 5HZGA 4QWWA 2VJBA 4BTLA 1YB7A 3OC0A 3FYTA 3H19A 4LHEA 1MTZA 1ZD2P 4AO8A 3WMRA 4GHWA 5JALA 3A2NA 4PO3X 1ISPA 4UFPA 3DD5A 3STYA 4N8EA 1WOMA 4PW0A 2BUAA 3B3QA 3P2MA 4UBMA 1EVQA 5K3BA 2W22A 1B41A 4BCBA 3IUJA 2QOEA 4Y2QA 4DIUA 2FUKA 1L7QA 4AN1A 3C6XA 1XZLA 5JD5A 1ETHA 2R8BA 4MJ3A 3WKBA 1JJBA 1XZEA 5AK6A 4PV7A 4PSCA 2WJ4A 5ALYA 4H7EA 1XRRA 1E89A 4JEIA 1QIHA 3NUZA 1FFCA 3KD2A 4UFOA 2I3DA 5EIAA 4HRYA 2XDWA 3DDUA 3FSGA 4K5QA 5HQ3A 4GWLA 3LS2A 4BB0A 1Q84A 5LZ4A 4K2AA 5LIPA 4I19A 3SX4A 2BGNA 1ZD4A 4AZ0A 2CUTA 4FLEA 3MUNA 2BCEA 4NZZA 2WFLA 3PE6A 5LLSA 2DSNA 5ALEA 1QIGA 3ZI7A 5AK5A 3SC2A 2ZYIA 5K3FA 1TCAA 1K63A 2WG2A 3A6ZA 4OYLA 1NX9A 5ALKA 1BU8A 1EK2A 3HI4A 4G9EA 4DMKA 5A7FA 1VXRA 5FUMA 5I7UA 1UOOA 1EINA 2OAGA 1G66A 5AOAA 4G4IA 3C8DA 5AOCA 3LIIA 2PM8A 1GQRA 5ALMA 2CB9A 2HRRA 5H3HA 1LGYA 1ZD5A 5C8VA 3RK4A 5JARA 3R40A 4H7KA 5DYTA 2OG1A 1RWQA 5JIBA 1XLVA 4DNQA 5JANA 4DGQA 3HZOA 1J2EA 2RGUA 4BC0A 2C5FA 2Z3WA 2C58A 2DHEA 1EDDA 3G0CA 3AUKA 5JZBA 4BC1A 2HL6A 4Y2PA 2H7XA 1ACLA 3BXPA 3OOSA 4QLAA 3QMWA 1YB6A 5K3FB 4FOLA 4J0IA 1HBJA 4JYMA 1DQZA 3PDCA 1EDEA 1EXWA 2VJAA 4KE6A 5A71A 2YH2A 2DQZA 3VVMA 1F0NA 3ESBA 2GZSA 4G8BA 3HRHA 1LPBB 1H23A 1X70A 2Y2UA 5HKAA 2CJPA 4LYEA 4A5SA 2DHDA 1CUUA 3AIKA 1EX9A 3MGAA 4O08A 4KAJA 2HA3A 5BWBA 4BVLA 3HABA 1FFBA 1SCQA 3WJ2A 5C8XA 3O95A 2O2HA 4L9AA 4Q3KA 4XJVA 3UUFA 3ANTA 1GGVA 1QFSA 1AKNA 3IIIA 5EGNA 1XZIA 3O0DA 2E3JA 2XMCA 4FFVA 2XUGA 4Y2JA 4Q82A 1ACJA 4PSDA 4X6XA 3FOBA 1JMKC 2JGLA 5AK3A 5FXMA 3F96A 3I28A 3H17A 2XB6A 1DX4A 1E8DA 2HADA 3GROA 5DNVA 1HDEA 3V1MA 5DYYA 2WTMA 1CUZA 1G42A 2OXEA 4H7FA 4KRYA 5CT6A 1YCDA 4OU5A 3WZLA 2OCLA 1G5FA 2HIHA 1QFMA 4J3JA 2JF0A 2HU5A 1CUIA 1R9NA 1ZOIA 4FMPA 3WJ1A 1HL7A 3T52A 4KJXA 3QVMA 1C7JA 1DT3A 1JU3A 5AIAA 5BWCA 4BRSA 3R3YA 3I2HA 3DOIA 1MAAA 1ODSA 3OG9A 5FRDA 1W76A 1R88A 2X76A 5A6VA 3FCXA 3IUQA 1W1IA 3H1AA 4FHZA 5HK9A 4OB7A 2ZJ7A 3AILA 1AGYA 2WIFA 1DWQA 2ROQA 3B5EA 4UHEA 4J0GA 3E0XA 1CUXA 1MN6A 4G4GA 4UHBA 3DCNA 1IUNA 3IURA 3TEJA 2PU5A 4C88A 5ALUA 1XRLA 1CUBA 2EDAA 1UOPA 3DYVA 1XZCA 3QMVA 2VEOA 5JAPA 4IQ4A 1UKBA 5A62A 3HACA 2QVBA 1A8SA 5KREA 1BCSA 3ESCA 5JD6A 2ZYSA 3DS8A 3KXPA 1CRLA 3WK5A 4M0EA 3A70A 3QH4A 3WK9A 3M82A 5AKIA 2OGTA 1ZJ5A 1MPXA 5ISMA 3G8YA 2RI6A 4BE4A 2C0PA 3K2IA 3IUNA 3AIMA 1MJ5A 3HSSA 4I3FA 4EY6A 2XUOA 2J4FA 3ICWA 1W52X 4OU4A 3WKEA 2IIVA 1XRNA 4AO6A 2WHPB 2QR5A 4UPDA 1DX6A 4BYMA 2X5XA 1WB4A 3RM3A 4MEBA 4QNNA 3GZJA 1ORWA 4BP8A 4QWMA 3BIWA 5D7BA 3R3XA 1WPXA 3FVRA 4QDOA 3WWEA 3C45A 1FFAA 1XZHA 1BN7A 4GEGA 2GYVA 4QDZA 3WKAA 2CZQA 4W1RA 4ETWA 5ALIA 1A7UA 2WFZA 3W9UA 5ALTA 3DKRA 3G0BA 4C01A 2HM7A 4B83A 1BRTA 2ZJ6A 2XUHA 3PUHA 3BE8A 1I6WA 2HA4A 5HKBA 4L72A 3AZOA 4UBOA 2VJDA 1P0PA 3R3UA 5HF6A 3I2IA 4BRZA 5AOBA 2QZPA 3OTQA 1PJAA 2ONCA 1TCCA 1CEXA 5CTAA 2WIGA 3WWPA 3ICVA 4Y2VA 3EQ7A 4W1SA 1L7RA 1U4NA 2QTBA 3MUOA 1YAJA 5A7GA 2C5GA 4HZGA 3Q8WA 5CBKA 1XLUA 1AC5A 4DMCA 4B7ZA 2VTVA 5AM3A 3V1LA 1DWOA 3K6KA 4CCWA 1QO7A 5HF5A 4LIPD 2Z5GA 3O4GA 2JEZA 4BP9A 2FJPA 3UMJA 5FP0A 4Q3LA 2I03A 3C6YA 3V9AA 2XUIA 1CUEA 3IA2A 4ZXFA 4BDTA 2DCMA 1QLWA 2CKMA 3I2JA 2OQIA 4IH4A 3F9CA 4Y9SA 4ARAA 1C4XA 1A88A 3FWHA 4J0KA 3JWEA 2CBGA 4ITVA 5ALWA 4DMFA 4DSAA 4D9JA 1T4MA 2QMQA 3DYIA 4L3WA 2Y6UA 1ZJ4A 3FYUA 4IH9A 4S0XA 1WB5A 5T4HA 4WDRA 2EDCA 2XE4A 4X3CA 4FBLA 1IUOA 3D3NA 1OCEA 4EY4A 1Y7IA 1QIIA 5J3JA 5ALSA 1CUCA 4BVKA 1UXOA 4MQMA 2VT7A 7YASA 4HXFB 1ODCA 5IVDA 3VJMA 4K6KA 3I6MA 3DLTA 4BZZA 1XZAA 1THTA 2XQJA 4AQDA 5E4JA 1CUSA 4GLBA 1JMYA 1YAHA 2O2IA 3WI7A 1XKLA 1ODTC 2W6CX 1BS9A 2GZRA 3WQHA 3H04A 4C89A 3UUEA 1E66A 2RAUA 2PUHA 4CI9A 2X8BA 3ZLTA 1VZ3A 2ECFA 1XZKA 5LKAA 1GKLA 3K9BA 1JJFA 3WK8A 2WFMA 3EQ9A 4FNGA 3OPMA 3QM1A 4GXNA 1OILA 3ZLUA 2NW6A 5AM1A 1XZBA 2WSLA 3QPAA 3ZWQA 1UZAA 1AMNA 2ZVDA 2G5TA 4Q34A 3QPCA 5LZ7A 4BE9A 2WIJA 1CUVA 5JASA 3D2CA 3WYNA 2OAEA 1YASA 2XUPA 4W1QA 5JD4A 2GBFA 2ORYA 1H2WA 2QRUA 5EIEA 3PUIA 2PUJA 3IUMA 4QLOA 5EIHA 5ALGA 4EA6A 1R9MA 4LKOA 2ZJFA 2IX9A 1DINA 1LLFA 5DLPA 5CXUA 3IDAA 3L1HA 4TGLA 4EY7A 3HJUA 3V1NA 4MWTA 2DQYA 4EB0A 1H2XA 4B82A 5ALLA 1R50A 4CIBA 5D3KA 1TKRA 4JNCA 5AIBA 1QIFA 2PX6A 1THGA 5CW2A 1JI3A 3WKCA 3QITA 3M81A 1L7AA 4Y2YA 5HCUA 2WG0A 4QDXA 2JGMA 1LZKA 3M3DA 2VA9A 5JADA 4EBBA 3O4JA 4ZWNA 2B61A 4X7BA 4INZA 5FLKA 2OCGA 5EI5A 1X2EA 4E11A 4DYHA 4V2IA 2HA0A 2QXTA 1W6RA 1QZ3A 2WTNA 3FCYA 3KWJA 4W63A 2QJRA 3C6BA 1C7IA 5HF9A 1F6WA 2JGIA 5C7YA 3NOXA 4C87A 1LNSA 4Q3OA 3PFCA 4BBZA 1SFRA 5D3ZA 5C81A 3DJYA 2HA7A 4WY8A 2Z8ZA 5YASA 3L1IA 4QEKA 4HRXA 2HU8A 2Y2VA 1EHYA 3M83A 1BEZA 4UBKA 4KR0A 4E15A 5AM4A 4WFJA 1YA8A 1WHTA 4MYSA 2XMGA 1B6GA 2OCIA 5CMLA 1CV2A 4YK7A 3EQ8A 2UZ0A 3CXUA 5E2IA 1XZGA 1XZJA 4DSZA 1DWPA 3W06A 2JGJA 3FYUB 4Y2RA 1W75A 3ZPXA 2OGZA 1P0IA 5IVHA 1XQXA 3ESDA 4BTVA 3NGMA 1EVEA 4U2FA 5LYYA 1CUHA 2H7YA 1BN6A 1DU4A 4C4XA 2PSHA 2WIDA 5AM2A 4E46A 5AHXA 1QOZA 1XKTA 3BDVA 3FSGD 2BAGA 4OD0A 1EI9A 3PI6A 1CUGA 4AXBA 1QONA 2BJHA 5ALNA 3WKDA 5JAOA 1IUPA 3IBTA 1CLEA 3FVTA 2WHRA 1AX9A 4MQLA 1R4ZA 4X90A 3C8HA 1QGED 5AKJA 2PKYX 5AO9A 3ZV7A 2HFJA 1CQWA 2PVSA 1EB8A 2G4LA 3R0VA 4X93A 3R3WA 4Z49A 5FKJA 3BIXA 2I78A 4FFWA 5AM0A 4F21A 3V48A 1WHSA 4Y2UA 4PSUA 1NU8A 3VJKA 4L0CA 3WL7A 4P9NA 1U8EA 1K8QA 3VKFA 1VE6A 1N8SA 3B12A 2AJ8A 3FAKA 1CUYA 5AI4A 3E4DA 4ROTA 3C5WP 4N5IX 1JKMA 2BGRA 4IH1A 5KBYA 1LBSA 5C8ZA 2OGSA 2WUGA 4GW3A 1KU6A 4WY5A 3ED1A 1RP1A 2JGKA 5ALDA 2WUEA 4BDSA 3U1TA 5IH7A 1ZGBA 5BOVA 3AZQA 1XQVA 5I9IA 4FNMA 1XZFA 2HDWA 4RNCA 3STVA 2QXUA 5AH0A 2VATA 3WWCA 1J07A 3F67A 2WHPA 4X95A 2WQZA 2VAXA 1PV1A 1NU6A 4C4ZA 4H18A 2V9ZA 4M0FA 4J0JA 2G5PA 1F8UA 4AO7A 2WUFA 5ALRA 2AJDA 3PF9A 2C7BA 4F0JA 5K3AA 2EEPA 4WCVA 1J06A 3CN7A 4H77A 1LBTA 4WFKA 3DQZA 4RE6A 1N5MA 3WYDA 3AFIA 1MX9A 1MNQA 5CT5A 4KAAA 1QJ4A 4OSEA 2ACKA 1Q83A 2ES4A 3VDXA 3WLAA 1A8UA 1EH5A 3R3ZA 2CEKA 2VAVA 4G8DA 1UK8A 2O7RA 2H1IA 1N5RA 5AKGA 3ESAA 3G02A 3G9TA 3A2MA 2QS9A 2H9YA 5CRIA 5D6OA 3R41A 6YASA 2WIKA 5K5EA 4K6GA 2WUDA 4I4CA 5ALQA 5FOQA 1T2NA 3G7NA 1K6EA 1ZI6A 4B85A 1EDBA 3WK4A 3QPDA 3ILSA 4WDQA 4BZWA 2XQFA 4PF1A 3H18A 4CG3A 3I2FA 4Q05A 2OPHA 3FNBA 4G1FA 2K2QB 3FYUC 4H0CA 1RYYA 4X85A 5AKHA 1KEZA 1YS1X 1CUDA 5FDFA 1CUWA 5ALFA 4B80A 4BATA 3W04A 4NMWA 3VVLA 4UBNA 2FX5A 1TQHA 5ALJA 2RHWA 2XLBA 1BE0A 3BF7A 3G9ZA 3W2TA 2AJBA 1P0QA 2DR0A 4HS9A 1WPRA 5K3EA 4UHDA 4AX4A 2BUBA 4G8CA 5ALVA 2DFPA 2HA6A 4GI1A 3KOOA 2ZSIA 4BVJA 2BUCA 4K6HA 5DTJA 4XVCA 5JAUA 4ZRDA 3H2IA 5AI5A 2DHCA 5AKXA 3O9VA 2RONA 5AP9A 4FKBA 1QIJA 4Y7DA 4W9RA 1YR2A 2AJCA 3I6ZA 4QDTA 4YX9A 1FSSA 1AZWA 1UK9A 2WFLB 2XI4A 1WM1A 2GBIA 2FJ0A 4HAIA 1S8OA 1VLQA 2GBGA 4UBLA 5HFAA 3EIOA 4UFNA 4Y2XA 1Y37A 3D5EA 1USWA 1H2ZA 2D0DA 1H22A 3WA7A 5A7HA 4CG1A 3BJRA 4OCZA 5LZ2A 1QE3A 2P8SA 1LPNA 1XFDA 2XMDA 2HU7A 2R11A 1CR6A 1SCKA 1LPMA 4BCDA 3L1JA 5E4TA 3WWOA 3GUUA 1XLWA 4J03A 1CPYA 5LZ8A 2VSQA 1IMJA 4MYDA 2WM2A 2Z8XA 4G9GA 4KE9A 2HA2A 1UT6A 5AI0A 3WIBA 1QIDA 5DNUA 4U2EA 2ZYHA 4MWSA 4UBIA 1YSCA 4B84A 1ZICA 3W9BA 4RGYA 2PPLA 1YS2X 2PSDA 2I3ZA 5SYMA 4CG2A 1X2BA 2QKYA 1AQLA 4OB8A 1ZIXA 1XROA 4J0CA 1QIMA 1VOTA 5DYWA 4U2GA 1QIKA 3D7RA 4UHCA 4QA9A 1JJIA 3ZLVA 2XUJA 1ORVA 4KAFA 1VJ5A 3JW8A 3BJMA 4C4YA 1UKAA 4F60A 5EHZA 1MAHA 1F0PA 5ALZA 2WILA 2QM0A 4UHHA 1MNAA 3BF8A 2BFNA 4A23A 5AI8A 5AKYA 4J0HA 3V1KA 2JEYA 5SYNA 1BEEA 2JIDA 4RE5A 5ALPA 3U0VA 4H7HA 3I2GA 3LIPA 2JGEA 3H2JA 3CCCA 3CCBA 4B0PA 2QUBA 5HK8A 4FBMA 3KSRA 2QJWA 5IKXA 5CH5A 5ESRA 4UBJA 1UOQA 4ZI5A 1EB9A 4U2CA 5AKKA 1XRMA 4N5HX 5LKRA 1VA4A 3HEAA 3E1GA 3VXKA 2OCKA 5BV7A 3HC7A 4J0DA 3G0DA 3WL5A 4OPMA 1N1MA 4X00A 3MVEA 1ZGCA 4EY5A 2J3QA 2OQVA 4FLFA 1A8QA 4NS4A 5ALHA 1ZIYA 2PU7A 1TRHA 2V98A 3TGLA 1DQYA 4FTWA 4QZVA 2HHAA 3GA7A 4DNPA 4LXIA 3DOHA 1GT6A 1U65A 4E14A 5I8PA 4OB6A 1KU0A 1IZ8A 4OYYA 3EF3A 4BAZA 5DNWA 1GPLA 1QTIA 3BWXA 1SC9A 1CFJA 3BL8A 4BAGA 1U2EA 5K3CA 3WK7A 1E8NA 4X91A 1VA5A 1UKCA 2VF2A 4HXEB 3I1YA 4KYVA 3C6ZA 3DL4A 5AKLA 1QIEA 1BCRA 3O4IA 3QBJA 1MO2A 1GKKA 3ANSA 4FLMA 3LCRA 5KWIA 2WG1A 5CT9A 2WU3A 3S8YA 1CQZA 1J1IA 4B9AA 5LP1A 4BCCA 4IHAA 5CH3A 5HF8A 4X6UA 2IITA 4N8DA 4XIIA 2XT0A 3STWA 1E8MA 4UHFA 3OURA 4DTCA 2WKWA 5FPPA 4GBGA 4ARBA 1K4YA 2QT9A 2XMSA 5CT8A 3C5VA 4EY8A 4H35A 3OM8A 4EZIA 3H0CA 4KEAA 1Q0ZA 5K3DA 4ZV7A 2C4HA 4H7IA 4WFIA 1GPKA 4X97A 3WWDA 1QTRA 1TCBA 3S2ZA 3SWWA 5LZ5A 2J4CA 5LZ9A 2XMBA 3FLAA 3H2GA 3D4LA 1VZ2A 3A2LA 1ZD3A 2AXEA 5AKZA 1LPSA 1ZI9A 1FFDA 3BDIA 4HVTA 1XQWA 2XQGA 1FJ2A 3WZMA 2V97A 2Y1KA 4Q1VA 3C43A 4KACA 1LPAB 2ZSHA 3NWOA 4LYDA 1TAHA 2YXPX 1XRQA 4TPKA 5JZSA 3AIOA 1MU0A 3HXKA 3VJLA 1CUFA 1XRPA 5CXXA 4CCYB 4UUQA 2B9VA 4X92A 4B81A 2HRQA 5DJ5A 3AZPA 2GYUA 4ZV9A 1EA5A 1GQSA 2XQKA 3DEAA 3GELA 4PNZA 1XZDA 2YYSA 1MX5A 1O6GA 1Q0RA 3G9XA 2C0QA 4JYPA 4MXDA 4LXHA 5EFZA 4CCYA 4QDUA 2CMFA 1VKHA 2XUQA 3HLKA 2YASA 3D2AA 1HLGA 3H1BA 2XUDA 4OUKX 3E3AA 4EHBA 1UK6A 4H7JA 2QUAA 2HFKA 1D07A 2PSEA 4RPCA 4N8SA 4AB1A 5CH8A 5EHQA 5A2GA 4EUSA 3EBLA 1CIJA 3IB3A 1FFEA 5EHNA 4GECA 4M0MA 5IVKA 4Y2TA 4DLNA 2O2GA 1GXSA 2Y6VA 3X3HA 4CFSA 1MX1A 5E4YA 5T4BA 2VQ6A 1UK7A 2B20A 2WJ6A 4DNOA 1DT5A 2V96A 3DL7A 2JBWA 2XUKA 5JZ9A 1UWCA 3DKKA 2XUAA 1QO9A 4ZREA 5AJHA 3F97A 4NVRA 2H7CA 1ZI8A 3N0TA 3HYSA 4JUIA 3G9UA 3KDAA 5F4ZA 4AMYA 5DTIA 4C6HA 5AI6A 4XX1A 5AI9A 3VISA 1GPNA 1P0MA 3C70A 1CVLA 2OLEA 3R3VA 2BKLA 4FDMA 1HQDA 1K5PA 1W4LA 4DMHA 3I6YA 1O6FA 1YA4A 4P93A 4X94A 3JYHA 1R3DA 1TK3A 4W1PA 2J3DA 2WU4A 3GBSA 5JAHA 4AMZA 4B9EA 2GBCA 1HKHA 4P92A 4G5XA 4H7DA 2PSJA 2VJCA 2WHQA 5EHXA 1IVYA 2B4KA 4AN0A 1R1DA 3CN9A 5HFNA 1SCIA 2WJ3A 4BAUA 2XQIA 2XMRA 2G63A 3GFFA 3RLIA 3T4UA 4HTAA 3FLEA 1EK1A 1MT3A 3QZUA 3D2BA 4KE8A 3AINA 3PF8A 2ACEA 5HQ3B 2XUFA 5AKEA 1M33A 1DTEA 3O4HA 3STXA 3YASA 1AUOA 5ALOA
chains in the Genus database with same CATH superfamily
3N9IA 2FX3A 2G80A 4HD8A 5CLQA 1P2DA 4U6SA 4WXMA 3WB9A 1YZQA 2EQBA 1SG0A 1ORRA 3CO0S 4E08A 4DY4A 2AOUB 4O4LF 4C14A 1M8FA 2EG9A 5LU8A 1KZYC 4GRDA 2XMQA 3VSCA 1PWYE 2O3QA 3HJRA 3L43A 4MQEA 4NDNE 5BUSA 1WTCA 3ICPA 3LFTA 3RIEA 1M2OB 2B2CA 5CURA 3ZZ1A 4EB8A 1BCRB 5ADVA 3IKLA 4X71A 3RKSA 1P5FA 5KSOA 3BSFA 3NTOA 1NQWA 5CD1A 1FP6A 1NLUA 2YXLA 3GFVA 4KO2S 4CLOA 2Z6QA 4KK3A 3B3FA 4JZKA 4ZXPA 1RDFA 5T41A 1VMAA 4E4RA 4H1WA 4FEAA 1P6XA 1L7MA 1SZDA 3I01M 1YZTA 1JLMA 1KH2A 3WK6A 4KPUA 1LK5A 4MA5A 1NLYA 1ZBQA 1PFQA 4MEAA 4PZPA 1DAIA 2D13A 4LWOA 3EVFA 5BO5A 4BVHA 1A9XA 1EESA 1S2IA 2OWEA 4GQAA 3WL8A 1JFRA 4CT0A 1U7WA 2WWTA 4CETA 4LGVA 4KIJA 3WRYA 2Z9CA 1U2QA 3PFBA 2A4KA 1CX9B 4II3A 4M1SA 5FV4A 2PO5A 3QUSA 2H1FA 2MDTA 3TINA 1T2AA 3HLTA 3H86A 5JPDA 2G9RA 4JJKA 3EG5A 4E5PA 1EZ4A 5JO9A 1V7CA 1S9DA 1MA0A 4HNRA 3KVYA 3OT1A 1RBZA 3MRSA 4MUKA 4FWBA 2G6TA 3DO8A 1CJUC 2Q0XA 1W88B 1HV8A 5AICA 1PJRA 3PNLA 3V8EA 2AQIA 2GJ4A 2E21A 2NP6A 2OQRA 3S7TA 5BXQC 3K6JA 1K1EA 2H1CA 1XQYA 2P3SA 4X62B 4FFBB 3DO5A 2DFVA 3C1TA 2WE8A 4BLUA 4OJTA 4J6EA 1AT1A 2X14A 1E5TA 3LBIA 3R5SA 4I4TF 3I64A 5JYCA 2YN4A 1L4YA 5DXAA 2UU9B 1O8BA 1US8B 4R8RA 4CM1A 3EDMA 3ETLA 3HKEB 2ECPA 4FT2A 2P9TA 2JGAA 2ZS8A 1P44A 3BTOA 3SF8B 1F1BA 4WLNA 3TEMA 4Z0HO 5K0NA 3F6PA 3FFBA 3QVOA 3K4PA 4XWYA 2H9AA 3DE3X 5H9VA 1P73A 4Q6WA 2F7SA 4YASA 4XYLA 2WAXA 3B70A 3DZDA 5JEEA 1D9XA 1EXMA 5EHIA 4U7TB 1ANKA 3F3SA 5AM5A 4NESA 5DSZA 2XDYA 3EE6A 3RUAA 2RHTA 1E61A 3KQLA 1PZXA 3HJTA 3F3MA 2DWCA 4EECA 3BRWA 3AGQA 5J4YA 4NNPA 8AT1A 4V0MA 2FOLA 1J6UA 4HB4A 1H2YA 3UMYA 2ZJYA 3H13A 1UJNA 5IYZF 5JCOA 1LDGA 2XB2A 4BEWA 4JI8B 3TNDA 1E1MA 2X8AA 3E9YA 1L1FA 3T6KA 3EVEA 1KHTA 2FP4B 2II6A 5F9MA 3C1UA 3NYIA 3A6EA 2YL2A 1XAHA 4AKSA 1D8AA 5EESA 1E7MA 3IDFA 4LC9A 3RVLA 2PN1A 1RXEA 3HFJA 2PBLA 2AK3A 1SD2A 2J46A 1I24A 3QEKA 2WWHA 4JJ7A 4XGIA 2QP9X 5ERYA 2WY2D 2XZPA 3PHLA 3LLMA 3PGXA 4XD7A 2QRHA 4Q9NA 4DNFA 5LQJA 1HMPA 1R6DA 3OZFA 4GZLA 5EE3A 2BEJA 2BFCB 1EJ6A 1USVA 3UC5A 1QQ7A 3ZOZA 3UBTA 2X9VA 5DHTA 3KLPX 1VXOA 1TMGE 2EP7A 3QU5A 2GZHA 4IVNA 5E7MA 3ZDEA 2ZJOA 1E7WA 4C43A 5K20A 4OP1A 2EJWA 1LPOA 1X87A 3AKCA 4L9WA 3BIOA 4UCWA 1VG1A 2V7UA 3W3AD 4UOEA 1P60A 5C32A 2BZ1A 4NU5A 3ZW8A 2JIZD 1TC2A 1YJQA 1NTRA 3ETDA 3PWZA 10MHA 4XM0A 1E4EA 3I01A 3O6VA 4CU5A 3L6EA 4DSTA 3W34A 4HLQB 5I5EA 2JHGA 2OWDA 1PT5A 1N6IA 1JQBA 3AHGA 3QKWA 4ESOA 3I6QA 3ROPA 1JT2A 4II7A 1HTWA 2JPDA 2XYPA 3A6HA 4ME6A 3RC7A 3PE4A 1G4HA 1XAIA 2QTRA 2XOXA 4P7JA 1FA9A 2HHJA 3RAFC 3HKEA 3QHPA 4TLEA 1G17A 4M88A 4YLEA 2G08A 3FHTA 6NULA 1YB7A 2I29A 3OC0A 2FWJA 1NJ8A 1IBMB 4A0SA 4QU5A 2J8ZA 2ONYA 2MIIA 3FKQA 3IAM1 3EXIB 5C34B 3SBXA 4CLXA 3W0LB 2I76A 1MTZA 4I1IA 5F12A 5TT1A 3TPFA 3WMRA 4AO8A 1HQCA 2WJIA 4D42A 1WUHS 1LY1A 2PZ8A 1POXA 1AHNA 2AR7A 2YC2C 2REQA 1ISPA 3A2NA 4PO3X 4S0ZA 2D4HA 3QLTA 3STYA 5AW7A 4NS1A 3Q6MA 3T9FA 4RD2A 2HO4A 2QUKA 3DWFA 3A6JA 2Z04A 4MINA 3HKDA 4P38A 3FMGA 4BO3A 2X4DA 3OQJA 4M9ZA 4KLZA 2BUAA 1HDOA 5DXFA 2COEA 3K2BA 2FSVA 2AFHE 1Z62A 2ZWPA 4MQFA 4WADA 2R86A 3DFZA 4LGMA 3L1KA 1Y8QB 2P3OA 4DSNA 5KS2A 1NMXA 4GXTA 3VPSA 3KKKA 4X3OA 3NI2A 4C1NA 1C81A 5B7QA 5AVYA 5DXJA 4YRPA 3IUJA 4Y2QA 2IYFA 4H4CA 2FUKA 4JB8A 3V6LA 2XYHA 3MOSA 3WGTA 3NHFA 2INGX 1AB6A 4NP6A 1UDXA 4TKVA 1AB5A 1M72A 1NONA 3CX3A 4HAVA 1L7QA 2PX4A 3K8YA 4B35A 3C6XA 1H4QA 1NP7A 1J7KA 1RT9A 3PDJA 1ETHA 1OWMA 1UPFA 4MJ3A 3PLAE 4HLCA 1NBMA 2D7JA 3W1EA 4CYMA 2B4TO 1XZEA 3LFUA 1VJ0A 1ZHFA 1Z39A 2VSOA 3MJSA 4YDQA 1AHHA 3GAZA 3BBLA 1VKNA 2YVKA 2ZR8A 3HGMA 3QWFA 4DCUA 4JEIA 4BQIA 3EFOA 3FGNA 3H5NA 3NUZA 3N0XA 4YJ3B 5A4KA 2W2TA 3SKVA 1VBMA 3U16A 1GYRA 1X6VA 2ZUSA 4R83A 1JALA 4UFOA 1QHNA 3M9WA 3BL5A 5EIAA 2MYUA 4ZO9A 4D45A 1W96A 3EIQA 1E60A 2FN7A 2X0KA 1XQ6A 5B3AA 1EUZA 3JAWA 4P84A 2G67A 4GWLA 5BQPA 4UTPA 4RMHA 4RX1A 1HYQA 2J9YB 1RRMA 3PRJA 1KPGA 5LZ4A 1I8TA 3ZU5A 3THXA 5DFAA 5I9LA 1N2CA 4HWOA 2ZZMA 4NHEA 1QV9A 2QRLA 4ZVOA 1V39A 5CHEA 1C0LA 4YYEA 3NBUA 4HI0E 4WKCA 3G17A 3PD7A 1GAJA 3VOSA 3OEED 2FVYA 2OLKA 4XA8A 1F2VA 2P5SA 2PR7A 2W00A 3BJIC 4ZPXA 2ODWA 1NBAA 2JIMA 5BSHA 1FSPA 1NY6A 3O2JA 2BGKA 4W5WA 2VJYA 2QTZA 4Y1RA 3SZRA 3KUKA 4LE1A 5ITZA 4IEIA 1O94D 3PRKE 4UEJA 3CLRC 5ALEA 1A7AA 1QIGA 4K7JA 3VR6A 4F7WA 1OTHA 2XY4A 4FW9A 5A6SA 3BE5A 2YN0A 4KQXA 4URZR 4RD0A 4AMGA 4EG4A 5HFJA 1W8DA 2Q46A 2ZYIA 2BM0A 4YCSA 5IHXA 3M1IA 4Y6LA 2VWGA 1U02A 5B4VA 2ZR0A 1B00A 3FYSA 1OREA 3B48A 5IH3A 4A2PA 1QKKA 5EXEA 4AP6A 2VS1A 2AQHA 5B55A 3KQNA 5ALKA 1BU8A 4MV1A 1E0SA 1DXHA 1J9ZA 1JHMA 1G7CA 4G9EA 4N0EA 4DMKA 5A7FA 1C9EA 4DV2B 1P0CA 3IXLA 3LQRA 5J2TA 1J09A 1VLVA 1U9JA 4G5GA 4QUHA 1PR3A 2H54A 2OAGA 2IYZA 4I6JA 2IQIA 5CGZA 3FTCA 3PQ5A 4PFSA 5AOAA 2E4UA 4PO8A 4G4IA 1OWLA 3S2GA 5AOCA 4CUJA 1CXZA 1ZRHA 2CDRA 5HS6A 1TQ4A 1XRJA 1VIAA 4B45A 3V8VA 3CUWA 2PM8A 3ND7A 4OOEA 4K46A 4YNBA 5BNFA 1W34A 5CCBA 1DDGA 4AC9A 2BMWA 4RL4A 4EQ6B 1MCZA 2Y1WA 4JBGA 4LV5B 2YYYA 4WXPA 4XI9A 5ALMA 4NBWA 1SVLA 2F1OA 2IV3A 4CEHA 3FTFA 1UP7A 3MQ4A 4BQNA 1ZK0A 2PUVA 4I4NA 4FILA 3M34A 2FNAA 3LT2A 1RPJA 3F7MA 5CEFA 1DAFA 2WKRA 1HE2A 3ZV3A 1Y1SA 1PQWA 4L5YA 3T0IA 1X7HA 2PX8A 1A96A 1UDWA 1XCBA 4OQZA 3RFVA 2QV7A 5ULLA 3WBBA 4BJ5A 4Z4GA 2GHTA 5FNVF 5MN6A 2HEIA 5IAEA 5PNTA 4BLQA 4H7KA 2HQ1A 9LDBA 4Q19A 5JIBA 3UGTA 1ONOA 1W4RA 2VDWB 1JPJA 4MVWA 4QGBA 4X1IA 1KDZA 3SQDA 2FN4A 2JH8A 4AS2A 1FRQA 1TVCA 1XO1A 4DNQA 4LE2A 1QK4A 2YBDA 3ESZA 4R1SA 4YWJA 4C5AA 2HCRA 5CB4F 3U6KA 1S2DA 1SVOA 2GR9A 2RGUA 4OXRA 4TYMA 4ZICA 3PC7A 4BC0A 5D3MB 5IANA 2CLOB 3RSOA 1OZAA 2GCEA 2HOQA 2JIZA 1EDDA 4KI7A 4BS9A 1WOYA 2X41A 3FZYA 2K7ZA 4KXNA 3EGDB 4AI6A 3O1IC 1DAGA 2DH5A 4G0PA 1ACLA 4HNUA 1T43A 1X74A 2AF3C 4ZI7B 3GFOA 5AW9A 4IFIA 5DX0A 1T5TA 1PWXA 1VL2A 3SIPA 1GPWB 3B52X 1I51A 4IKPA 4LXTA 1HBJA 1T4BA 2BGTA 4Q6BA 2CUNA 1XE3A 3KSBC 2QB5A 4EFNA 4HP8A 1H6CA 1EUDB 2JLBA 2BY4A 2Q4DA 5COAA 4KPFC 4LOHA 3SCZA 1RI3A 2VHWA 2DQZA 2RGAA 1ECFA 4D3ZA 3B1VA 4O8CA 1KK2A 2VBIA 3ESBA 3KPWA 3QLVA 4EATA 3HRHA 5LA6A 4DV5B 2I1LA 1L4HA 2CV2A 2CUZA 1NNSA 3V7FA 4C0HA 3WNVA 1D6MA 3A8TA 4L9SA 3ILVA 3HADA 1WLSA 3PQCA 4LYEA 3HHEA 2D0PB 1Z2DA 4JVMA 4G41A 4ZI2A 3AIKA 4V0QA 5EJ2A 5IC5A 1EX9A 4GR9A 1E9RA 3KOUA 4I8IA 4KQWA 1T4CA 4ZMBA 4RZIA 3WLFA 2HNKA 3ROKA 1VI2A 2HA3A 5BWBA 3GGGA 5F98A 1CIVA 1JHQA 3QPWA 1U0GA 5J5CA 3NZEA 2GZDA 2LVBA 3IJPA 2PBZA 4L9AA 4MK4A 3WGMA 3ZYZA 4LQ4A 1L8AA 4Q3KA 1NTOA 5AQ1A 2LUOA 3QHAA 3HA2A 5BMOA 1YCGA 3QXJA 3EXEA 4TYQA 2CHUA 2F1IA 1AKYA 2NVUA 3EX7C 2MSWA 3GRVA 1QFSA 3RTDA 1I0LA 3GFGA 2HIAA 4Q66C 4F9GA 4KWTA 3ZE8A 4URWR 4ARSA 5EZSA 1Z16A 3PVCA 3H4IA 3K1TA 1DRVA 2Q9CA 3AI1A 4QOFA 3RVOA 8ATCA 1IULA 2YZMA 1X1BA 2XUGA 2MR6A 1Z0AA 4Y2JA 3RYHB 1M0TA 4BLRA 5IWCA 1SBZA 4W5HA 1FBTA 3FOBA 3T3PB 4C5CA 1LVGA 2IYRA 1MXFA 2QR2A 3K0HA 4A6XA 3U7RA 1YS9A 5IBRA 3RIGA 1Y4DE 3N2KB 3RYFB 1W87A 3HU1A 2B98A 4FEEA 2RK4A 3TQRA 2ARKA 2V7QA 3F96A 1WVMA 4JUAA 4Q37A 3H17A 4RTKA 1JHZA 4EFDA 3NASA 1BVHA 4DV1B 2HWXA 3JQ6A 4P8RA 5DM4A 2Y0CA 4QQFA 2OA0A 2CVPA 1E8DA 3S55A 4B3FX 4D3YA 5MHTA 4CHTA 4ZRNA 4QGGA 2WF5A 3KUCA 1CF4A 3JQ7B 4IG4A 3V1MA 4CFYA 3B9RA 5A5GA 4G23A 4L5AA 1G42A 4MA4A 2X0EA 2ZEJA 3D64A 4OH7A 3QI2A 4IHJF 4R0NA 5DWVA 4XZ3A 5JE8A 4ECAA 1MABA 1VHQA 5M5BA 1A04A 2QZZA 3BM5A 4EGAA 4LJ4A 2QGNA 5G40A 4S1WA 4EBFA 4F93B 3UAYA 1A9RA 5AESA 4OBXA 3DT8A 1YE5A 5CA0F 3I05A 3DTVD 5JTUA 4A0QA 5H8WA 1ZIOA 2JJ1D 3LT0A 1JWBB 1QYVA 2G71A 4C0KA 5KTMA 3G2MA 2FPLA 4LJ5A 4C6RA 1G5TA 1BXZA 1ZMXA 2QK4A 3TZQA 3TG8A 2OM2A 2WWRA 3LH5A 2W2QA 1L5QA 2J85A 2H4YA 3MINB 4IIVA 1K88A 4J3JA 5ANRB 5K8UA 4WGFA 5EMHA 4TV9F 1E4EB 3ZHRA 2VPZA 2QY9A 1OC4A 1Z2CA 4Y18A 2IU0A 3U4HA 4CL0A 1PAUA 4LYGA 1XJ0A 4XKJA 4UXHA 4ER6A 1D9ZA 4LJ7A 4LFBB 5A0FA 3VOTA 2R48A 1KEVA 3BKWA 2O8EA 1KIFA 1YJXA 4CT5A 3IC5A 4CQMA 1DHRA 1YQWA 3LDUA 2QW1A 3NKVA 3T52A 3SFZA 2BN4A 1IZZA 4QTYA 1QHFA 3MJHA 3I30X 4NENB 5BWCA 1Q11A 1UDAA 1ADYA 2PRKA 4UC0A 2IY8A 1HMYA 4EH1A 2WVJA 3Q7SA 2HTEA 4K9NA 3W6ZA 4FQ7A 5A5FA 1H3NA 5JT1A 1R2QA 2Z3VA 3F6YA 4DN6A 1C0EA 2O8NA 2VC2B 3FN4A 4IOMA 5FRDA 4M0KA 3WGNA 1R88A 1N8KA 2OFWA 2QQ0A 1WSBA 4LMBA 3RR2A 2XECA 3FCXA 2SKEA 3DAPA 3UG7A 1W1IA 3H1AA 4KQMA 1T0BA 3S0JA 4EW6A 1TYEB 4WZAB 2GTHA 1LW7A 3NC4A 4PE5B 1AGYA 4BO6A 2WIFA 2O8CA 4QXPA 3CVWA 4ETIA 4FDLA 1BVYF 3Q1LA 1R0SA 1FPMA 4Q7EA 4RVOA 3HWSA 3B5EA 3CZMA 2H17A 3HBFA 5HSGA 4CF6A 3OPYI 4K6OA 3L6UA 4NF2A 4J0GA 1E9SA 5EWLB 3E0XA 5G0SA 4KUGA 1JBEA 1FJHA 3DCNA 1T2DA 4TT3A 2LW7A 3WGOA 2DBVO 1Z73A 5ALUA 2GXSA 1NATA 2VP9A 2ZB8A 3R20A 1T8PA 2FSFA 1TM2A 4M8KA 1X80A 1EYZA 2VTDA 3MSCA 3RU2A 2ZXFA 1ATZA 2VEOA 3KQWA 2F90A 2WA2A 2I8CA 2QTVA 4JYBA 5BWNA 1YD7A 4OKSA 2IPXA 3HB4X 1JYFA 1UKBA 3DR3A 3WYBA 1L4NA 4ZJUA 4IOKA 1YL7A 1EVZA 1JEJA 4MUIA 4V0ME 2VK4A 2F1JA 3ND6A 1OMOA 1Z83A 2CXQA 2VOEA 2XXBA 4PYJA 2HIMA 3GUYA 5EMKA 3TXYA 1RWXA 1XTPA 2N46A 2A5GA 1BCSA 1OHHA 3LX8A 3PGA1 5JD6A 3FRJA 3SR3A 4XIYA 3ZWYA 4YRMA 5EE5B 3WRVA 3RT7A 1LBEA 3E3LA 4JT2A 4OHFA 4M0EA 3DUWA 1U9CA 3EFBA 5EIBC 1VCHA 1NW3A 1Z0JA 1NVEA 3M82A 5DHUA 3BHIA 4CCSA 2XA1A 5EZ5A 2LCQA 1J8QA 4PPFA 4GWKA 3N0WA 3HU2A 1NXSA 1ZJ5A 4RENA 1E98A 4TYWA 4HRVA 1ZCAA 4F6RA 1E20A 4DTIA 2HCJB 1NYQA 2EATA 2PL1A 2Q07A 4KSBA 4O2BF 4OHBA 3TAUA 3UJ7A 3UV3A 4BE4A 3U19A 2VI5A 4IIBA 1OZHA 2C0PA 3K2IA 3DFKA 2EXXA 2P2LA 3RRYA 3BJZA 3PL1A 3AOGA 3C7CB 3HSSA 5THQA 4EY6A 4M86A 4B3TB 1P1RA 2XUOA 4P31A 1M34B 4Q0MA 4CTMA 3WIDA 4OU4A 1FFYA 1F4VA 1U8TA 3AHEA 1T8TA 3OM0A 1WHSB 4FU0A 4M98A 5COQA 5CTJA 5EQDA 2CHFA 3RUFA 3BTSA 4G2TA 4R8KA 3CMMA 3ZDXB 3T5TA 4EGQA 4RTLA 2OCDA 2JI6A 2C8JA 3G89A 3EZLA 5TIIA 3KJFA 1RI5A 4PHFA 4RY0A 4CHGA 3QOXA 4LJSA 1TA4A 2Q0HA 4NR0A 2PAFA 3OQHA 1FC0A 4O4IF 4RBNA 4CKWB 5KTKA 3GJXC 5LFAA 5T67A 5LLDA 1XMOB 3CZCA 2VT2A 4PY2A 2DOKA 2GRUA 3NS7A 4QNNA 3EGWA 5CXQA 2RD2A 2G04A 4QWMA 1UPUA 3MXTA 2XCTB 3NUQA 4LFAB 1DSSG 3ADOA 4G63A 5KU1A 3WADA 1I2ZA 3FVRA 1D03A 4IV0A 1B23P 1OUMA 1B76A 2BFCA 3NGLA 3R1IA 4QDOA 3S5JA 5LP6F 5MGBA 4YHBA 4WCDA 1H2HA 4Y98A 4KQGA 3WDKA 4ZMRA 5G3ZA 6PFKA 3Q7TA 3USCS 3DL2A 4ZFNA 2POCA 1Q16A 2P4EA 3PWKA 4NQRA 3OE7D 5TVGA 3ZE0B 4BFLA 4QNMA 1GFSA 3P9NA 5CLIA 3V34A 2ETXA 5I9MA 3F8WA 3WDLA 1UADA 3WKAA 1L8OA 4JR1A 5K0ZA 2OB1A 4MWZA 1XN4A 1GYPA 2F3QA 4MOWA 1E2JA 1JJ7A 4R01A 2OT3B 3GVPA 2AFHA 2LP4Y 1UM9B 3B78A 2KSQA 1PD1A 2JGNA 2WR8A 1E0JA 3PBKA 1OWNA 3L2OB 1NOIA 2C5LA 2KB0A 3EXAA 4TMZA 2OUIA 4JCOA 3WXBA 4B7UA 3UAZA 4D9IA 2W6NA 5GADl 2X8LA 2XUHA 1UJCA 4IY1A 1NMYA 5I01A 4EO7A 3AB7A 4LXXA 1KYTA 5B30A 3DV9A 3NHYA 2X22A 4YREA 2WAOA 2EX1A 1IJBA 4NV1A 5D5PA 4M9QA 4ZQIA 4GKBA 4GUDA 1YZGA 1J2JA 3H9BA 5TEVA 2JFXA 3IR6A 5B53A 1CY6A 4W8HA 1C9JA 2MWMA 3B3JA 2DHRA 4PZLA 3U40A 3I39X 5AOBA 1NJGA 1PT8A 1ZK3A 2QZPA 5B64A 3IPXA 3GEBA 3DG9A 3SF8A 1CEXA 2BFFB 3AI3A 4AD8A 2VXYA 2WIGA 4RK6A 4TMKA 2QUHA 3ICVA 2F9LA 1U4NA 3CSSA 3N6RA 2WNSA 3K8ZA 3BCSA 1BGXT 2W90A 4K28A 3GLFE 2NO0A 4ZVNA 1Z56C 3O7WA 1A72A 2BFFA 3Q8WA 2C84A 1Q77A 3EIXA 2G09A 4X3PA 4B7ZA 5BUQA 2VTVA 4GUAA 4EKEA 1DWOA 1TMOA 1YHNA 2JAUA 4PBRA 3GQVA 4ZOAA 3TW0A 5CNIA 1OBVA 4FOTA 4AWXA 3O4GA 1Q57A 2WC1A 3JZIA 2CBXA 3URMA 1IHDA 1Q6YA 4ARIA 1FYVA 1SUDA 1T8UA 2I66A 3II6X 3GDFA 1CYDA 3DE7X 2Q6LA 4LA4A 4B5KA 5H70A 1M2JA 3R9IA 1HH4A 3DOCA 5ES3A 1Y8RB 3EAGA 1Y9EA 1V5EA 2GK3A 2JLVA 2VHCA 4IJKA 4BE7B 4G8JA 3GY0A 1WXHA 2WJWA 4M9UA 3SE0A 3EFHA 4EJSA 1QLWA 1WEHA 1KYXA 4FZRA 2DTXA 4JR2A 4RTMA 2J9XB 4CMAA 2Y0DA 3WV4A 3TUZC 4IH4A 5KDLA 2FFQA 2OZPA 3FFXA 4BASA 4ARAA 3D0RA 2D2FA 1NI5A 1UBLS 1ULZA 3NDPA 2HXYA 1QZZA 2C2GA 3DDNA 1XTSA 2HLDA 3IAAA 2BFAA 4TV8A 4UUPA 4A0GA 1SG6A 1RJWA 3P2EA 2QVLA 2X2OA 1F8XA 5DGTA 3S40A 3QX8A 1T4MA 3QLJA 4GNKA 2GEDA 3WLTA 2UXBB 4D2IA 1XAJA 3D81A 1DBRA 4AY4A 4PHCA 1FP4A 2GBLA 1AO3A 3D3KA 2PKEA 1ZUWA 4IH9A 4JLJA 1NSFA 5F78A 2H0QA 1DAPA 4R9NA 3S28A 5I7HA 4G56A 3UJPA 4CQMB 1OA0A 3IGFA 1OV4A 1US8A 4UEWA 5AHWA 5HQTA 5K6RA 2NTNA 4FWIB 1M1XB 4LJAA 1W1UA 2HCFA 1RMTA 2HZBA 3IT3A 1U2PA 2J7KA 3LWDA 2GTPA 4MQ6A 3T5CA 2C5HA 1BGWA 2B2XA 2YJNA 1P4HA 3FXAA 3LRPA 3O91A 1IUOA 1Z07A 3HYNA 3GJTA 1RVV1 4LTMA 3CF4G 4ZPJA 2JIOA 4BNMA 3LI2A 3ZGYA 1PS9A 1H3EA 3B6KA 1QIIA 4EUFA 3U37A 1WD5A 4Q12A 3GPCA 4M2LA 2D4AA 3KPYA 5ALSA 1BMDA 4FJ2A 2EKZA 3COSA 4KOAA 2FFBA 3MYYA 4MS4B 4BVKA 3FBTA 1IM2A 2AN4A 1NAIA 5AVSA 5LQAA 2KS6A 3PR2B 2VT7A 1CE8A 4GRAA 3TOVA 4D44A 3PJFA 2VYFA 4XXHA 1R16A 2ZDHA 4RVNA 3ZHYA 1IY0A 3KB2A 4ZEMA 4LXQA 4J4TA 3OLWA 1WBBA 4NCBA 5FL7A 4BZZA 3CISA 4IXWA 5CX1A 4WV3A 1PR5A 1THTA 3DKVA 2OK8A 3LPMA 5BYAA 1CZUA 1RHJA 5IJZA 2ZWAA 1QO0A 1OI3A 5E4JA 2R3SA 1QDUA 3MGCA 3R9XB 1XOIA 2QI9F 3BA6A 2C57A 3GPIA 4QVGA 5BN5B 1IY2A 3A37A 5CVDA 3ZQJA 4MQBA 2NZ8A 3G68A 4GSKA 3DBIA 2Z5VA 2YOHA 2RAVA 3NTRA 2WP8J 4GRIA 1S7CA 2QROA 3IQXA 5IP5A 4AURA 1HKUA 2NU7B 3C3WA 5F7JA 4Y3UA 4QBGB 2CSXA 1E2EA 1BS2A 1ZSYA 3H04A 2QYOA 2FPPB 3LXXA 4OAOA 2RAUA 2PZKA 3ZWXA 4B6PA 5CFZA 3LYAA 4US2R 5C5EA 4IFEA 4CI9A 1SR8A 1NF3A 5AW8A 4HGPA 2PGXA 4DVGA 3KOZA 3GEIA 4NIMA 5HG0A 3QKRA 4OV6B 4NYIQ 4Q02A 1L9XA 2V6JA 5AD1A 2ZRQA 3BXZA 1OQAA 2R1TB 3JCZA 5HMMA 1H65A 3FMIA 2JFHA 4FNGA 1XNGA 3EJWA 1C3OB 5CEJA 5AUPB 1V4NA 5D87A 2PH3A 1O6CA 2YWDA 5EVJA 3ZY3A 5EJEA 3VVBA 3AJDA 4CM8A 2D7DA 4LHYA 1DRKA 3GNTA 2H8GA 1I4EB 2VUUA 4E32A 3GIDA 5JS1A 1I6MA 3QPAA 1FQOA 4RXMA 1T1SA 4OGKA 4TMXA 1U2TA 4YP9A 3TLMA 3ZWQA 5IMSA 5KZMB 2NNWB 1AMNA 1XYYA 2G5TA 3KT8A 4DB2A 4M1YA 3LF2A 1M5TA 1B6SA 3QPCA 2DBRA 2YWBA 5I7WA 5EKTA 1MO3A 2LZ0A 1ACMA 4Q01A 2AR9A 4KX3A 3NO4A 2W0SA 1JG3A 1KO4A 3A9RA 2A2ZA 4RZ3A 1XMJA 3EEOA 5THXA 1GPMA 1NVGA 1U28A 3D3WA 2AA3A 1Y3DE 5SZIA 5CB6A 1Y6FA 1UP6A 3HDVA 4YRKA 3GEHA 4LY0A 3RSHA 2FY8A 1SQ0A 1PNRA 3RTCA 4DCPA 1U0TA 2OAEA 3ETEA 3ES9A 4NONA 1CEYA 1PT9A 1BJRE 3ZGOA 3KS9A 4GP7A 1E4YA 1E92A 5KMGB 1MVLA 2JHPA 1H2WA 5DISB 4BO1A 2Z95A 4KKXB 2BFBB 5K1ZA 1XP8A 1ESCA 1Y3IA 1KYIA 3L93A 1XAGA 4Q7MB 1A0OA 2P9GA 1I9GA 3BZBA 4CMBA 5CJ2A 4RQAA 1DIHA 3C85A 4M9RA 4QLOA 4EHAA 1E58A 3ANMA 3WRYC 4YXFA 2PXHA 2YZKA 4ZIRA 2Q2NA 5ALGA 3MTDA 4DIEA 4EA6A 3B89A 3B51X 1MR3F 2O8CB 1I80A 2IYOA 3GJYA 3DPUA 4M6WA 5KEIA 1IM5A 1DINA 1LLFA 1G21E 4TUYB 3IDAA 4AXXA 1JGTA 2DX7A 4XRRA 5L7YA 1O5TA 3NKLA 3B60A 1DV1A 2W6JD 3BMQA 2GNPA 3HQ4O 3BC1A 3HJUA 3OJCA 4NMLA 3D3EA 4L8FA 3MSXA 5FUXA 3TB6A 3VX4A 2VDVE 3U7IA 1W581 3PGJA 2L69A 5KCZA 3BOSA 2XR1A 4DMLA 1XALA 4MWTA 1UM9A 5JNUA 3AKDA 3SXUB 5KPDA 4PCUA 5KJCA 3T3DA 4Z4CA 4HZIA 5DHSA 1Y1RA 2O54A 1YK1A 3E9DA 1V1MA 2BFMA 2QENA 5HZMA 4RORA 3U3DA 4AMUA 1RADA 1M9NA 3M8KA 2WRZA 4QYTA 5CW2A 4JI2B 1P4AA 3SZMA 2IEBA 1V4VA 4C08A 5ADHA 4FXPA 1FNNA 5DBGA 1F3LA 1CLUA 2ZYDA 3QITA 2WWVD 4AJKA 1G9XA 2RHMA 1L7AA 3ZTYA 5HRUA 3EH1A 1KYWA 4Q4JA 4IDEA 1VMEA 2VH5R 4DJAA 1YTLA 1Y48E 3GUCA 1Q7RA 2C8VA 1XHEA 4ERXA 2Y9PB 3A4IA 2YQ5A 5K6TA 1QK5A 1JVBA 5JZVA 3HWX1 4CLEA 1IJKA 3TMYA 4UM5A 5AVTA 3O4JA 3I42A 2Y4OA 2B61A 1W4ZA 3HL4A 4X7BA 4B6FA 1ZN7A 1A4IA 2WZBA 3ASUA 4MRAA 2B4YA 3TBKA 2P91A 4MDFA 1JHRA 1G5HA 3U3XA 2GCOA 4RCYA 3UHJA 3V8RA 3PYLA 2FLKA 521PA 5ILGA 3VR6H 3W7VA 4D3DA 2JRLA 4WJKB 1SUIA 1X2EA 2XWSA 4H3SA 4YVFA 1RXUA 1IIBA 2AB0A 4E11A 2ZBUA 2RGRA 3TB4A 4DYHA 4CM9A 1OXUA 1SQFA 4U5QA 1LJUA 1W6RA 2GCOB 4P82A 4D4GA 4YUZA 4D8WA 2QM3A 4DB4A 1NN0A 4RPIA 5CA1A 4ZHQF 4W63A 4FOPA 4YAFA 1OFVA 4D4JA 1L5HA 3SU8A 1AE1A 1WKVA 4MSUA 2PY6A 5CCEA 2GM3A 4WNAA 1OA1A 5C1BA 1F0YA 1JKJA 2J5XA 2JCSA 4E13A 4KQ6A 5C7YA 2A1TR 1OIWA 1J9EA 1QHEA 4ZZ3A 1U04A 4BNKA 4NL4H 1U31A 3TLYA 3TZCA 4Q3OA 1JJVA 1IHUA 1Z26A 1AVTA 1ATIA 2IF2A 2MSKA 2NYUA 2EYQA 2Q0SA 3AUUA 3I92A 1WQ1R 4PTYA 3WHKA 3ZDBA 4R1LA 3HXMA 2EJTA 1V35A 1VRWA 3EEQA 4IDAA 4RKYA 5F7OA 2H2WA 2COKA 5C81A 6Q21A 2Q5CA 3W4KA 3LD9A 4UUMA 1F60A 1HXHA 4K03A 1HFKA 1JAYA 1BHO1 1TJPB 3FG9A 4LRSB 2Z8ZA 5YASA 5I45A 3JALB 1PFWA 3M1LA 4JKIA 3D6MA 1U7UA 3ZZ0A 2Z57A 3I4CA 4HRXA 2IHBA 1XQ1A 1PNQA 1T2UA 2P77A 5ARBA 4IXNA 3M83A 4MAFA 3R0XA 2X40A 3A9TA 4L4XA 5DHRA 4DZZA 1CERA 4DQXA 4C2UA 1R0WA 2C4MA 2PA3A 3OJFA 5IDWA 2GM5A 3WMFA 4U9UA 3PQ6A 4ZVKA 1S2MA 2XA9A 4JA0A 3LPAA 2F62A 1JG7A 2XCUA 2AC7A 1U9ZA 1N9GA 2XMGA 2OCIA 3EXEB 5ARCA 3TE7A 1CV2A 2FEXA 3T7CA 4NYIR 2HJWA 2JL1A 1O3YA 5DBEX 1QGOA 4ZVVA 2PE5A 4WOBA 3KB6A 4FYIA 4P34A 1VE1A 2X8JB 4JSYA 5I8WA 3R7SA 3S1AA 1ZKMA 2EARA 2CVFA 3OWHA 4DSZA 5KPJA 3ORRA 1A5BB 3FYUB 3NRJA 3L02A 1XCMA 2Q3DA 3DFIA 4GG1A 2QRGA 5JD3A 3RI3A 2QUJA 2YWFA 2IYWA 1KIMA 2CLFB 4FYVA 4WZAA 3VAZA 2VNKA 1P0IA 4KCGA 5B1EA 1SVNA 3GGSA 2BMJA 2Y68A 3BMOA 1LKZA 1II9A 1V41E 2G72A 1KXJA 3LWZA 5DOVA 4BLVA 3TLBA 5KINB 1REQA 5KYXA 4TWZA 4QHTA 1Z4PX 3N2EA 1DO8A 1N2SA 1O9HA 2GARA 2I7TA 1Q17A 2FZWA 3K35A 2IIQA 2NX2A 2QF7A 4YAJA 4Y1EA 5CPBA 2PQ0A 2FRVA 2CE7A 2W2NA 4KQKA 4LYAA 1Z2PX 3KC2A 3LHSA 4ZMSA 1MEEA 3OCZA 4UDYX 4KR7A 4KXMA 2R84A 4FKZA 4FB5A 5AM2A 1QOQB 4KFCA 4UATA 4KDFA 3O74A 5IBCA 1NW7A 2B3DA 2UDPA 4Q4LA 5DEOA 4DIMA 5BNIA 2OQ2A 3NAGA 1EI9A 5JDIA 3KD3A 3U3RA 2IX3A 2B4QA 3AERA 3E7FA 3T1HB 1CT9A 3EAFA 2BJHA 2BSAA 4EF4A 2V58A 1NF8A 5DCYA 5AUNB 1YZHA 1S4QA 1T91A 2QLMA 3TIXB 3V3TA 2IH4A 2HSWA 3FVTA 1PTKA 1GIAA 2HJ9A 4WLVA 1AX9A 1JAHA 1YT5A 4FGUA 3ZIAA 5JAZA 5LD2B 5JDIC 5U4QA 5JBIA 3LA8A 3C8HA 3GLHE 5AKJA 2FG7C 3NRCA 2QL6A 3OP4A 2HFJA 4CDRA 3RRBA 1SIOA 1ZK2A 4G5FA 2HDOA 3JXEA 3NT4A 1C3EA 2FQXA 5CVVA 3FGZA 2GRAA 3EK2A 3TLGB 3NM4A 2EFDB 2GRJA 3KX2A 1ZUIA 4CDGA 2ZSEA 4ICIA 1OLSB 3C5HA 3W8EA 2G0NA 3T5BA 2J5QA 1D7OA 2P6MA 4M1OA 4Z49A 2ATIA 2JCVA 1SUEA 1YZYA 2XNDA 5KTRA 3ZD7A 2Z2XA 4LV8B 2QGZA 3EUEA 1ZYUA 3KR0A 3C3DA 2BH9A 1Y6GA 4PPGA 2B25A 4EITA 2C77A 2GZ2A 4OATA 1IB0A 3SF0A 1FSZA 4ZDIA 3EGIA 2DVMA 4HN4B 3KTAA 5A3VA 3TQFA 5KMGA 1E2GA 2D1TA 4FMDF 1M67A 5T8KA 3QE0A 2QN7A 3VJKA 4B40A 2UZ4A 5EERA 1YB5A 1JVSA 1V7ZA 3CR3C 4MMXB 3WL7A 1X7YB 1F38A 1ZGHA 2IV2X 4TSKA 1PJ3A 1FXSA 3MJTA 4HN2A 3CLKA 2KX7A 4IKOA 1NWHA 2JFVA 2E0IA 1EGAA 2WZDA 3DC7A 1CULC 4O63O 2WABA 2R5NA 3D8HA 4BNYA 3EH2A 2DM6A 2ZS9A 4KN5A 1NUQA 5AI4A 1XVVA 3F6EX 2BTQA 3E4DA 4RO0A 3U44A 1CDZA 4EX7A 2W2PA 4HWPA 5JXWA 1RWNA 4AROA 4MVJM 4Y6PA 3CUYA 1AKQA 4AM8A 1M2VA 3KQTA 4DIBA 8GPBA 1IEVA 3IMEA 4JC0A 1OZGA 3QKSB 1KO1A 4BNHA 1XGKA 1Y9AA 5TPZA 1EAYA 3MCWA 1DOAA 1SHKA 2XD9A 4JHXA 2PD3A 4RGBA 2X2FA 4YJHB 5CNJA 3FD8A 5H83A 2OGSA 2CZGA 2WUGA 3W1WA 5TJHA 5C4IA 5GJCA 5B1YA 3LKBA 3PC8C 1M6EX 1VE5A 5K51A 3LDGA 4WK2B 4IYRA 3UJHA 5THKA 2ZUEA 2NQ8A 3NHBA 4O4JA 4PPYA 4TROA 5CPFA 3RUEA 3UWKA 1X1EA 1RP1A 3R0JA 1JG6A 1FLAA 4FCTA 3BRQA 3I4LA 4ETMA 1TXGA 4Z4HA 4A1FA 4ANFA 3JTEA 2IC5A 5BOVA 1XQVA 3Q7PA 2Z83A 1M0EA 1MZVA 3HZZA 1R4NB 4UVEA 5J58A 3BSYA 1NQXA 2QXUA 1J4AA 1OXTA 3BH7A 1E4OA 2VATA 3DCJA 3FRIA 5FIUA 3GH3A 5KKNB 1UJ4A 4G26A 5E1MA 5AW1A 1UDCA 2VH2A 4C21A 4GGPA 1VBKA 2VAXA 2GF9A 1A3CA 1NW4A 1X38A 1SQGA 3VU3A 2XD4A 3OX4A 2VYCA 4LJKA 1QZTA 4C4ZA 5AWFC 4M89A 4ESVA 1ICEA 2V9ZA 4W5NA 1UC9A 2H2DA 3M6LA 4J0JA 3V5NA 2BHLA 2O1XA 2EBWA 1QR6A 3N59A 1KGSA 3U81A 2WUFA 4AO7A 4XB6B 5ALRA 3H0EA 2REQB 3H42B 2C7BA 4Z99A 3HKBA 3ZWNA 2QPLA 2VQFB 1SCUA 2CB0A 1GTZA 1PNOA 3RHZA 4YCCA 1ECJA 4DLYA 3D54D 2PAAA 4Z3KA 4C0AC 5K8JB 3CNNA 4J0FA 3L7DA 1HNXB 2AOVA 2FN9A 4JQSA 1JQJC 4RE6A 3TTWA 3SPXA 4MGYR 4YAIA 4U7WA 3HB9A 1MX9A 2VDJA 4LTNA 5CT5A 1DL5A 2QGFA 5TV2A 3W6PA 3I58A 3ZV6A 2JH9A 2ACKA 3UFXA 1SXIA 4KXWA 3VDXA 1I4LD 3HJAA 2G1UA 3SXUA 4JUDX 1Z0KA 2DCUA 4UD6A 4B2YA 3DSRA 3VH4A 1LS1A 1N2IA 1OXBB 3PK0A 3MHTA 2EGUA 2JFFA 1JDBC 1TZ2A 3DBHB 1TO6A 3FVWA 4FI3C 4XRGA 5L8VA 3VSEA 2CXOA 2Z9DA 2OZLB 3IHWA 3HUFA 1CEEA 2ZXUA 2HRCA 3DKIA 5F64A 3S2SA 2QD2A 1MRZA 3M6MD 1YUMA 4G8DA 4KQFA 2RHLA 1GZ5A 2O7RA 2H1IA 4MVJG 2JFNA 3QNUA 3ESAA 4GE3A 2ZDGA 4TKUA 1XMPA 5FOTA 2G1KA 4CNBA 3VZPA 4OXIA 3A2MA 4GWGA 4Y2GA 3DDZX 4YB8A 3T3OA 4R54A 4E5NA 4PC7A 5CRIA 2BF4A 3DE4X 2XTJA 3NANA 2NUAB 5LWQA 2AE1A 2CWDA 2X15A 1C8VB 1WCIA 3DYBA 1TM5E 1XYVA 2X1MA 1ZC4A 3P0RA 4IIHA 4LDPA 1LXCA 2AN3A 2QTTA 5ALQA 1NT4A 1JA0A 2MTBA 3ZGZA 2XT9A 1NC1A 3VV2A 5ARDA 1ILEA 1I6KA 3EMBA 3G7NA 2W98A 4LZNA 3CNQS 3OWXA 5C7OO 1Z2NX 1IY8A 3H2ZA 4KGZA 2IT1A 2A94A 5CX4A 1F5NA 5F1OA 4JI3B 3KAQA 4B85A 5DLDA 3L49A 3QPDA 4KXVA 4ZI7F 4G2NA 1A77A 4P4TA 1HQKA 3QUAA 2BDEA 4HSEA 4KL8S 4OHKA 3KZXA 1FMFA 1OAOC 2XQFA 1Q1ZA 1JB1A 2WW8A 4F4IA 3H18A 3JS5A 1RWVA 4CG3A 1I1OA 3I2FA 1I3KA 2K5UA 2OPHA 4H17A 1T3LA 2WDZA 3PNBA 4Z0PA 5C4MA 4LF7B 4H0CA 4OLHA 2EBHX 1BX0A 1WXWA 2XWJI 1NWCA 1TUBA 3LUDA 4TKLA 3CZ9A 3WB1A 2C99A 4N0DA 2EQAA 5AVXA 1EX1A 4I50A 1WKBA 2JLAA 5EN4A 1S7GA 1KQFA 1PE0A 3F4BA 3WNBA 4DR7B 5K0BA 4HC4A 4TN1A 2WJVA 3UQZA 1ID8A 3I32A 1ND6A 2QMOA 3I5XA 1D1PA 2FPOA 1XA4A 4BMCA 3PGLA 4WLEA 1YB4A 3W04A 2ZSUA 2M1XA 1UWKA 1ZH6A 4NMWA 3VVLA 1G41A 1QAMA 1ULHA 3C8MA 1V5WA 3G2QA 4GLLA 3VU9A 2EP8A 3NYWA 1D5CA 1DX9A 2FX5A 4XQGA 4F3NA 1K7CA 1TQHA 3IQWA 1RQGA 4K3UA 4V0SA 1NPDA 3N2NA 3IOMA 2Y93A 4PC6A 3QXGA 4PXAA 1J2YA 4REQA 4B3JA 1WZ2A 3ENZA 1TYDE 3W2TA 1N57A 1QORA 3VO1A 4C2TA 1OLUA 4PX3A 3ZUPA 1CJCA 1JDNA 2UZIR 4CMIB 5JI2E 2GERA 4PZEA 1WPRA 5JJLA 4YLYA 1GZSA 3IEUA 3OUTA 2JAPA 3SJBA 4UHDA 3D31A 4DCNA 1IIRA 1DKPA 2IEAA 2ZWIA 3GT4A 2ZBQA 4GMXA 4TXNA 1NVVQ 2FUG6 5ALVA 4BB6A 2CEAA 3HN7A 3T9CA 3EVBA 4K0KB 2EG5A 4JCCA 1Z5WA 4TLLB 2O2CA 3WVNA 5BN5A 3KOOA 2GS9A 4IZHA 1F2UB 4I5IA 4K6HA 5FI1B 5JNLA 2FWRA 2FZ5A 1F4LA 4G0NA 4XVCA 5JAUA 5BYBA 2NU7A 1QRSA 3R7DA 3V42A 5KDOA 1YRBA 1YCHA 3EIHA 3N7AA 5H3CA 1D1QA 3L6CA 3TTSA 3SQWA 4DA8A 1XL1A 1DC5A 2VJNA 2XCIA 3JRWA 3EHEA 2ZR7A 3O9VA 4QX6A 2RONA 3C1OA 2G1AA 2FSUA 3HJNA 1ZY2A 4YAEA 4MCAA 4NBUA 1N7HA 1DBWA 4FKBA 3ZJUA 4W9RA 3ROXA 3UPTA 3ZVLA 1ZRSA 4I6EA 5D01A 1QRTA 4P83A 4JI1B 1FSSA 2GAIA 1Y9ZA 3VNBA 1KQOA 1WM1A 1J24A 1SXJB 2FJ0A 1BDMA 4OYHA 5BSKA 4OLAA 1Q6ZA 5HFAA 1M7GA 5ECWA 1AKTA 1AUPA 1G2OA 3OBIA 4H77A 3RFXA 4F2WA 3FMOB 3BUSA 3K9WA 3P96A 3L0CA 1CC1S 4YP7A 3T7AA 3B8HA 3Q12A 3EY4A 1QLHA 1UZUA 1USWA 3D5EA 4TLDA 2BONA 4FB4A 1ZITA 3WA7A 1NXTA 4A8JB 3R76A 3DE2X 4DPMA 3W7AA 2Q2OA 3K4HA 3BJRA 4TN5A 1JWLA 1E99A 4B4KA 3PLNA 4EF6A 1YQ9A 3PJRA 2ZBFA 1FTQA 4OCZA 4H3HB 4JGBA 5LZ2A 1P3Y1 2BRUC 1Z0FA 2WYUA 1YI8A 2XMDA 1PUIA 2HU7A 4MUAA 2M6LA 2IH2A 5IK2A 2QAGB 4TS4A 1E2MA 4XQ9A 3UICA 4UTZA 3PT5A 1RYEA 2XKKA 1IOZA 1SCKA 1LPMA 1PWHA 1UQRA 2ZI6A 3AG6A 1WMFA 1HDZA 3FLMA 1KI2A 3HYCA 1X7XA 2OECA 3GUZA 4OEHA 1FSFA 1NM5A 2I8LA 1KFKB 4YP0A 4WXRA 3GUUA 4JB2A 5M04A 4RQUA 5KYVA 3SJ7A 1MZPA 4M1QA 4CKWA 2Y77A 3P5SA 1TPYA 1G4AE 421PA 4AY2A 4UNRA 1I1QB 3GFSA 1QUEA 2CMGA 5JAIA 3OEEA 5LZ8A 5A9TA 2IE8A 3F47A 4RPJA 3RV3A 1JDZA 1OSNA 4BNUA 2WVHA 1H8EA 1PZFA 2Z8YA 2VSQA 3P4YA 1E1YA 4P80A 4PC3A 2DBYA 4WHMA 3V3KA 4LHVA 2A1TS 3DLIA 3VO8A 1GUAA 4HWGA 1H0RA 1WA5A 3EPPA 1PDVA 2Z8XA 4GVXA 4H60A 3ZNQA 5LNK1 3LC1O 2WB2A 4KO1S 4KE9A 3FKSD 2HA2A 2PJUA 1P39A 2XV1A 1V16A 3LHIA 4C7JA 5KYKA 4HDNB 4MDYA 3L4BC 1GLGA 1O6ZA 3CY6A 2B36A 4YV7A 1FSGA 1N4DA 1QWOA 4MUXA 2YRFA 2FMIA 4FHEA 2XX3A 1M76A 3SYLA 4UBIA 3KTAB 4RHFA 2OMKA 3CNLA 3PHJA 4HQNA 4JZYA 5IN4A 2KPOA 3K0KA 3VTFA 1XEXB 1VI5A 2NU6A 1P17A 1N2BA 4Z8YA 4TKUB 2I6FA 1V11A 5FUYA 3T7KA 4EHNA 4DDUA 2Z30A 1WF3A 4C0BA 2GM9A 2I3ZA 5EJ7A 3HKCB 1VIMA 4ZI7A 3KVOA 1RXSA 3I6IA 1JDJA 1TF7A 1YRYE 2G0AA 4LE0A 4C3UA 2D6FA 1T34A 1AGRA 1UC4B 1V1JA 1R8QA 2Y1OA 1G7SA 3AR7A 5J59A 1HQYE 3SIRA 1SO8A 4FYYA 4X1KB 2BFDA 1QIMA 2G9UA 4WXEA 1VOTA 3GRYA 5GVRA 1QCZA 5TS3A 5AVWA 4G1UC 4BV2A 4UHCA 3ABQB 3MWFA 5EZ6B 4QA9A 4MB6A 3BWVA 1JFVA 3EGXA 1IFXA 2HB6A 2XUJA 2GUWA 4MKIA 4L57A 4WPGA 3ZE9A 4BV9A 4KAFA 3E6AA 4R5MA 3ISJA 2IS6A 3VR5A 1MAHA 1XNRB 1UBEA 2JHFA 5ALZA 2FK7A 3SHWA 2ZJ1A 4OBWA 2PHZA 4UHHA 3ZBQA 4OXXA 2H5LA 3HRKA 3DMDA 1A27A 4BBPA 2QPOA 1NQTA 4A23A 2BBOA 4IWNA 4QATA 1PEKE 2I3BA 1VCOA 4O33A 4O8ZA 2FRXA 1BG6A 2M9MA 3E3NA 3LXRA 2IS2A 1M2GA 2QG4A 4PZUA 821PA 4RVSA 3KAJA 3R7LA 3V1KA 2DB3A 1F2TB 1NBOA 1M2EA 2JIDA 4WN3A 3UH0A 1FJGB 2DKOA 4FDTA 3W2GA 4H7HA 1XDSA 3I2GA 1DOZA 2WBLC 4DQVA 2BMDA 1F17A 2GN0A 3H2JA 5HX7A 1GPUA 1TK2A 5C2JB 4HTFB 4ZU3A 2DLCX 1LA2A 4IQ0A 5FJJA 2CNDA 3GA0A 3GLIE 3RC8A 4B0PA 1JAZA 3JZAA 3U4MA 1PRYA 1LDYA 1Z5GA 4RNDB 4P2BA 3L0YA 4FBMA 2C83A 3UGKA 3KSRA 5EUCA 3V4PB 5J2UF 4ITUA 3K9LA 2ZRBA 2QJWA 4TTSA 5AUOB 5KOIA 5IKXA 3BGOS 4P4SB 4AP9A 2WB4A 5EIXA 5CITA 3PNSA 2I71A 2XTZA 5ESRA 1XVLA 2DR3A 3E82A 1ZGAA 4QKQA 1NG1A 2FXVA 3DFFA 4Z0TA 2ZJZA 4KYTA 3TTYA 4C2AA 1OASA 3QVSA 1KJWA 4MV8A 3CRZA 3TOCA 1EB9A 2C82A 5JC1A 4CL3A 5HXAA 1KNQA 1WE2A 3QWHA 2ACWA 4X24A 2VP3A 4WKOA 1Z3IX 3IQZA 4H08A 2KQUA 2EJCA 2ZRFA 3CEHA 5CYFA 2O5RA 5LKRA 1S1MA 2R66A 3BXOA 5E2AA 4YRAA 5AJZA 5KO2A 2VDRB 5EJ5A 4MA0A 4B3CA 2OCKA 2Z09A 5T64A 5KQSA 3HC7A 3KKZA 4GPD1 3EMKA 3N05A 1H1LA 1MIOB 3BH6A 2ZREA 1V2GA 4OQMA 2P6RA 4J0DA 4PX5A 1JE1A 4QRHA 1WKCA 1SBYA 1YRLA 2WU1A 3A7EA 3WL5A 3NTUA 4RIHA 5J1TB 3IOEA 1KWGA 3O8QA 3ROZA 3GARA 3H3FA 4BQSA 2H29A 1KSHA 5AW2A 3AY7A 2I1VB 3P1JA 3QYFA 4L6CA 4HY3A 2OQVA 1RZUA 4X9XA 5HEKA 3ND5A 4FLFA 1FL9A 3FTPA 5ALHA 3A4VA 3DEHA 4XYEA 3A4MA 1IRIA 4X44A 4R68A 5BSUA 3UWDA 1TT7A 3OCWA 4Y0NA 2AX4A 4IVQA 4CN8A 5EVCA 4D9NA 1ZRMA 1KY5A 1R0BA 4TRRA 2JA2A 3HV0A 4FTWA 3R7FA 2HLDD 4DBZA 1RJ9A 2HHAA 3AUJB 1RAEA 4PZ9A 1JZQA 4LQCA 5TC4A 3O75A 1R6BX 1DBQA 4NOLA 2ATXA 1R0LA 1G5RA 4PG4A 3BGSA 4E14A 3QE3A 5SZJA 4MQ4A 2QBYA 2PH1A 4OB6A 5B57C 1CP2A 3OPVA 5K2MA 1EVKA 1SN7A 1IZ8A 4NYJR 2B6NA 2PGLA 3EF3A 4AG3A 4F56A 4S3MA 5DNWA 1G60A 1ZJJA 1EWYA 2PKCA 4ZVPA 1OF1A 1UIMA 1SC9A 3CF4A 2RFLA 4N0QA 1I9CA 1U2EA 3ABSB 3PVZA 4WKBA 2BGMA 3VBEA 4AQYB 1CJMA 1P1BA 2VDPB 4HNSA 4X91A 3PQ3A 1G8KA 5CNKA 5FYQA 3U60B 3G5MA 3MMZA 3UMBA 2E5FA 1ZM4A 3AOEC 4HXEB 1OBHA 4KYVA 3LKDA 1L7DA 2GAAA 1DIAA 4X6LA 2QTNA 3CF0A 3S2FA 2RGWA 4ZHQB 1W4BA 3QBJA 1O87A 3TN7A 3DXZA 4DMMA 5A5EA 1BO6A 2QAIA 4BMYA 1D2AA 1KEUA 4JDUA 3BKXA 3LP8A 1FQJA 5EY5B 1G16A 5HHTA 1GKKA 3ZVRA 4Q4CA 3LCRA 2RBGA 5A03A 4HDSA 2PIDA 3JD4A 5CT9A 4DIKA 1Q0UA 3OEYA 2CJWB 1PWEA 1T9GR 3OIUA 2ZBGA 4FP9A 5CH3A 3H9CA 3WLHA 4LBWA 1CJBA 4YY3B 3TOSA 3KQUA 4MGHA 1CB0A 3VU0A 3STWA 5AVVA 1E8MA 5DH9A 1K97A 2IUYA 1TCUA 2ZI3A 1YXMA 1X19A 2A67A 5KNBA 3OURA 1XMSA 2IQ5A 1AXEA 3PXXA 5FPPA 4RY8A 3ELUA 1V8ZA 4DJJA 1G3IA 2HT1A 3RYIA 1JEDA 2ZTSA 2XCRB 4MW9A 3WAKA 3DMTA 4K9LA 3G6KA 5A1TA 4IJMA 3UQYS 1JFFB 1E2FA 2H85A 2QTWB 2WLTA 1RYZA 4I14A 1KETA 3FCUB 2JJ2A 4EZIA 5KNCD 3RBAA 5C0OE 4KEAA 2JIBA 5D3MA 1LLUA 4MS1A 1E1RA 5JPIA 1ULBA 3JASA 4PQRA 3CW8X 3A9UA 5FBVB 1M5RA 1Z8HA 3EQ2A 1NXOA 4A9AA 1YUBA 4LJYA 5KWEA 2ZLBA 2QJTA 1J90A 3ADCA 3ZS8A 3LHDA 2Q9UA 4YGXB 1R00A 1QTRA 2L2QA 3M89A 4MS1B 4QOJA 4CVNA 1TCBA 4EJFA 3S2ZA 3SWWA 1G8YA 1W5TA 5LZ5A 4YP6A 2AVDA 4ZRMA 1K3UB 1E2DA 1WXDA 4OG2A 4YV0A 4ZV4A 4V1CA 5LZ9A 4B73A 4NCKA 4OREX 4EYSA 5MFPA 1N0UA 1LC0A 2CLEB 3WBKA 1HWYA 2D1RA 1NVBA 1SHZA 2FF5A 2FTKE 3C3YA 3H2GA 3ND8A 4JWTA 5D00A 3A2LA 1QQBA 2PH7A 4P0QB 3B2EA 1E62A 3GRRA 2IHVA 5CDYA 3P2JA 3U3MA 1LPSA 2A0XA 2KLBA 2QG9A 5L3QA 2FWNA 1K9VF 1N4AA 3WS7A 1KKUA 1Y8ZA 2WSSD 1Q1BA 3AM1A 2IBTA 5J4KA 1A9TA 1F2TA 1ONSA 3E4CA 3G2JA 3B7PA 5BWOA 1ZCZA 2IODA 1JLLB 3FI9A 2VZLA 4PZAA 5I9IA 1KAHA 4HL6A 1GHTA 3JX9A 1AN0A 3KSMA 1Z7YA 5IT9A 2GZ3A 2FZKA 5LJIA 4B3BA 5GJWC 2WWFA 3C5EA 1WG8A 3ZZUA 4A4DA 2H6EA 3C43A 1IY9A 3HH8A 5KYUA 3OESA 2VT3A 4QXQA 3UXMA 4L74A 3RGWS 1M6HA 5B4UA 2FEPA 1NBHA 5JSUA 1DAOA 1GG5A 1J2RA 3JQRA 5BV1A 2Q7DA 3PXBA 5JZSA 3LSTA 3AIOA 2ECQA 4BJHB 5KYTA 4K1LA 5LQRA 1MU0A 4F4UA 2CLDX 1CUFA 5CXXA 1CNFA 4K2HA 4LUCA 5HCIA 1WEKA 3EFEA 3D3WB 4ASUA 3GGCA 4B33A 4B44A 1GTMA 4CCYB 4UUQA 4Q4AA 1ESNA 2FVXA 2V6MA 1MUUA 4IQGA 2DHQA 3E8XA 2PL3A 2WQ6A 4PLVA 4FJ0A 2WIAA 3AKZA 4IIUA 1GRQA 2CNLA 3LBFA 1DS6A 4A15A 1KQNA 3DLBA 3OD1A 4ZV9A 1ZA1A 2H8KA 2ZB4A 1EUCB 4XR4A 5BSRA 3BWDD 3EASA 3L82B 3OPXA 1CS0A 4O4LB 1TEVA 2G07A 3CG4A 4WA7A 4QEZA 1O94C 1HOXA 2Z4TA 1QANA 3P9RA 1DARA 4GAEA 4Q1DA 4R7GA 2C9DA 4AJLA 4C03A 5JYBA 3AVYA 4F97A 4WH0A 2J3EA 2Y92A 4JLPA 5PGMA 2C95A 2H2HA 2HPZA 4BOYA 1SZCA 1B16A 3BE4A 4GVLA 4ENPA 2QTMA 4C4SA 3IX7A 4RKEA 4YH1A 3BSWA 1GNVA 1H69A 5FAXA 5B58C 5F2EA 4BFXA 3DGEC 1YQQA 3RVJA 2RARA 2ZJAA 3UMFA 1QHSA 4ER7A 1BD4A 1NI3A 1E2QA 2VRBA 4TL7A 5JJKA 1NF9A 2VRCA 3N7UA 5AJTA 4EHBA 3M70A 1MC5A 4MIEA 5LA6B 1UK6A 5CA1F 3B6EA 2NQ2C 4KBGA 4H7JA 4JC5A 3HJBA 3SYRA 2A92A 5IJWA 4Y6GB 3LCMA 1D07A 4LHWA 4WUVA 3SC4A 2V7VA 2R85A 2PSEA 3OQOA 4RPCA 1QPGA 4XQCA 4FFDA 5KYWA 5EHQA 4JBLA 1KERA 2GDZA 4BKPA 1N36B 3ML1A 3REQB 2YTZA 3G49A 3HU3A 3P27A 3WNCA 1H2RS 2CLIB 3S3TA 3ZDCA 1CIJA 3I09A 4GXQA 1U6KA 2GEKA 1UXGA 4ZVSA 5TMDA 3FOEC 2ADMA 4RIFA 5BUZA 4OJQA 1K75A 1SRRA 4QQKA 4DDWA 4MHTA 2QL7A 1YUNA 1GGMA 3HFRA 1YIDA 3ZCRA 4RHTA 4COKA 2PX0A 3P0EA 4DCOA 3DDSA 3ZVMA 4MI9A 3M3HA 5D2CA 2FUG1 1GT91 1C4WA 4JUCA 1SY7A 3KHUA 3CS3A 3GQBB 3MYRA 4CFSA 5IUNC 1DRJA 4G0UA 3EUWA 4K0RA 1T6NA 2VQ6A 2AR0A 4TMFA 3JQ8B 3TAHA 3O8OA 4IYJA 3ZV4A 2B20A 4D99A 1UBRS 4BMNA 4BVJA 1DT5A 1STOA 3PFNA 1UXJA 4KWIA 2ANBA 2ESRA 3DL7A 1YR9A 2LCIA 5B7NA 5H68A 3RS7A 2XUKA 2LD4A 5DVZA 1L8XA 3TSAA 3IP3A 1GQYA 2VF8A 5KTOA 3MCTA 4DXHA 3PENA 1IN6A 3QV2A 4MI1A 2O6LA 1GG8A 2CZCA 2XNKA 3GT7A 2N1MA 3MBKA 4QBHA 3EXIA 4DF3A 4JI4B 4CGZA 4BFVA 3NBQA 2UZ1A 1DEKA 1WCXA 4PLHA 5AJHA 4OXQA 2IGBA 2OOSA 3C4QA 4HRAA 3I61A 3F97A 3QI7A 4NVRA 1NDHA 2I1WA 2YINC 2B4RO 3NNSA 1FX0B 1ZI8A 4BNGA 1XEWX 2G6BA 1OB5A 4L51A 5LXTA 2C07A 5F4ZA 3DHWC 4AMYA 4N3GA 2BEWA 1WL8A 4P7GA 2CVOA 5DTIA 1XV5A 4EUEA 6ABPA 3ODPA 3ESYA 2JJ1A 3L92A 3UWSA 4HVCA 2FN8A 5KTYA 2E87A 4C6HA 1PL7A 3FIJA 4C05A 3VC7A 2D1YA 2KE5A 4MKRA 4LF6B 1UZMA 3BTVA 3KLMX 4I5GA 4PAMA 4Q15A 4B3RB 1C0IA 1CZNA 4GR4A 3IDQA 2VZEA 3JQQA 1FP4B 2JJ2D 3L4SO 4H6PA 4QTTB 2JCBA 4UUBA 4POOA 2XA2A 3C70A 1DVRA 2WAMA 1E18A 3ILXA 2IU6A 3LT1A 4I66A 2DQSA 2CXHA 3UT5B 4UU0A 1E3MA 2BKLA 3QQPA 2I2AA 4PSVA 3ZKAA 4FDMA 4DLAA 2WQ7A 2XJ9A 2VQDA 3NNDA 3AVTA 2EV9A 3SI7A 3VNSA 1K5PA 2ET6A 1Z0UA 2VPYA 3TR5A 4D92A 4K05A 4JMLA 3VX3A 3M5PA 5JSZB 3GG9A 4DMHA 1M2HA 1CW2B 1O6FA 4L1KA 3ZU3A 4FGLA 3L4KA 4RF4A 1P2VA 1YA4A 1WABA 4Z2AA 4G1CA 5JJIA 4BV3A 2QUIA 1PF7E 2P7HA 1U1DA 3W3AA 4L76A 4OHWA 1R3DA 4TTIA 4JNKA 1Y34E 3AR8A 2RHGB 4TRMA 1PR1A