3FYUC

Crystal structure of acetyl xylan esterase from bacillus pumilus obtained in presence of d-xylose and sodium acetate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
316
structure length
316
Chain Sequence
QLFDLSLEELKKYKPKKTARPDFSDFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDGGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPKVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDKITPPSTVFAAYNHLETDKDLKVYRYFGHEFIPAFQTEKLSFLQKHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acetyl xylan esterase
publication title Structural and functional studies of Bacillus pumilus acetyl xylan esterase
rcsb
source organism Bacillus pumilus
total genus 117
structure length 316
sequence length 316
chains with identical sequence E, F, G, L, M, N
ec nomenclature ec 3.1.1.6: Acetylesterase.
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fyuC00
2WLSA 4QA9A 2D0DA 4S0XA 5JD4A 1L7RA 4KE7A 3BXPA 1CUXA 5ALHA 2XMGA 2GBGA 5AOAA 1QIDA 5FV4A 4E46A 2AJBA 4CFSA 4G4GA 3FWHA 3FLBA 1CUWA 3EBLA 4UHDA 4DMHA 2H7XA 3AZPA 2DHEA 3M81A 1WM1A 5FKJA 5K3BA 4WFKA 1CUAA 5DYWA 5H3HA 3CN7A 1A8QA 1W52X 3V9AA 2LIPA 3I6ZA 3PFBA 3M83A 1VKHA 3V1LA 4IQ4A 5KWIA 4OU5A 2VJDA 3IDAA 5A2GA 4UBKA 3DL7A 4HVTA 1UT6A 3V48A 1MNQA 3WYNA 3WK7A 4P92A 1XFDA 2HFKA 4I3FA 3STTA 4BRSA 2WUFA 4Q3KA 1NU6A 5HF8A 4J0HA 1ACLA 1XZJA 2HU5A 5C8VA 1DQZA 5AKXA 2QKYA 2OG1A 4AO8A 2ZSIA 1LZLA 4UBJA 3T4UA 2JEZA 1E5TA 4OB8A 4E14A 1K5PA 4KJXA 2AJDA 2XLBA 2IITA 2EEPA 2ZSHA 1CUDA 1D07A 1U4NA 1QJ4A 4Q3LA 4AX4A 5JARA 3O0DA 3NUZA 5DYTA 5DNVA 5EHNA 2C5GA 3FVRA 5F4ZA 1LNSA 3R3XA 2XMCA 4FLEA 1QONA 4LXHA 5HCUA 4RGYA 3TJMA 1GGVA 1MNAA 2JGJA 3HEAA 3C6BA 3LLCA 3STYA 2FUKA 4Q82A 4K5QA 5K3DA 1AGYA 1UK9A 3R3YA 5AKLA 3H1AA 3W9BA 3D2BA 3H2GA 5CH5A 4DIUA 4BVLA 3WK4A 1CUZA 2WFZA 4UBMA 4EY5A 2V9ZA 3HXKA 1Q0RA 1JJIA 1QIJA 1EB8A 2YH2A 4M0FA 2JGLA 3BDIA 3HI4A 5ALRA 5BWBA 1ZJ4A 1USWA 5JASA 4PSDA 1CUEA 2WG2A 5AH0A 5LP1A 4KAFA 3AZQA 4BAUA 5JD5A 1TAHA 4C89A 2XMSA 2UZ0A 2VT6A 4BATA 1UZAA 2PSFA 1G42A 4DSZA 3BL8A 4WJLA 1GT6A 1HL7A 5DJ5A 3LIPA 3GZJA 4IH9A 3P2MA 4HZGA 3X3HA 2V97A 4ZV9A 3I2FA 2OQIA 1OILA 2JGIA 2VTVA 3ZV7A 3WZMA 2HA2A 4DTCA 1E8NA 5CT5A 4Y2RA 3R3ZA 4HRXA 4N8SA 1IMJA 3FYUB 3C70A 3PUHA 2OXEA 5JIBA 1E3QA 5A62A 1CUIA 5ALYA 4XWGA 2WJ4A 1UK8A 2VQ6A 4HXGA 1Q84A 2VAVA 1QGED 1SOMA 4GHWA 4G8CA 3FOBA 4INZA 2XMZA 5AKYA 1R50A 5ALQA 2QXTA 4EUSA 2QM0A 4L0CA 5T4EA 2ES4A 4DGQA 4LKOA 5LZ4A 2BGNA 3BIXA 4QDXA 3NGMA 2HU7A 4LHEA 3WQHA 3G7NA 2DHDA 2HDWA 3E4DA 5ISMA 3G9TA 1Y37A 3H2KA 4B7ZA 2XI4A 3G0IA 3F97A 4XX1A 1KEZA 4JYPA 1CV2A 2WUGA 4JH0A 3DQZA 4BAGA 4M0EA 3STXA 2Z3ZA 5I9IA 3DOHA 4Q34A 2QUAA 3ZWQA 4BC0A 4OPMA 2JIDA 4C4ZA 2WJ6A 4W1PA 2VJCA 2XQIA 5D7BA 2OQVA 4BVJA 7YASA 1BEEA 3MGAA 2B4KA 5EIEA 5LKAA 2JGMA 4FFVA 2XUJA 1T2NA 1SFRA 5AI0A 1XZHA 3MVEA 1WPXA 1XRRA 4GWLA 3FVTA 4C88A 4F0JA 4WDQA 2PBLA 2PU7A 4TVKA 1X2EA 2DQYA 1N1MA 3G0BA 4JNCA 3EQ7A 4MWTA 1P0PA 3IIIA 4QDTA 5AIAA 1O6GA 3O4IA 2XMDA 4PF1A 3QMWA 3WYDA 4J0IA 1LPNA 5ALSA 2OGZA 3DEAA 3EIOA 4LXIA 3O9MA 4FDMA 5ALKA 3STVA 1CUYA 4ARBA 1H2XA 3AFIA 3FCYA 5AM5A 5HF9A 5DNUA 4PSCA 4NS4A 2XUFA 1XLUA 1LPMA 5AM3A 1TIBA 1CUSA 1PFQA 4CG1A 5ALIA 2QR5A 3KXPA 1RWQA 4MEAA 2V96A 1IUNA 5EIHA 4GEGA 4AN1A 4GBGA 1EX9A 3G0CA 1YB7A 4X6YA 2WFMA 5JZ9A 1MN6A 4CCYB 4W9RA 4G5XA 4UHEA 3WK6A 5DNWA 3OG9A 2J4FA 1YS1X 4HTAA 1G66A 1VLQA 2PSJA 1NU8A 4ITVA 1TKRA 3T52A 5A7FA 1LZKA 3WKAA 4BCCA 2CB9A 2GBIA 1E66A 1CUVA 5AK3A 1MX5A 1DWPA 5JALA 4FBLA 1W6RA 1XZDA 4PQEA 3W05A 2O2GA 5EIAA 5BOVA 3ED1A 1FSSA 2IIVA 3WWCA 5AK5A 3AZOA 2RONA 4KE9A 3WKDA 2V98A 1WB6A 2GYVA 5K3FB 1XRNA 1ZD4A 4K6GA 4K6HA 3H2IA 1QIGA 4B9AA 3DYIA 3ICVA 4B81A 4HRYA 2O2HA 1U2EA 2Z8ZA 1DWQA 1B41A 2BUCA 2XQKA 1XRLA 1R4ZA 1RYYA 1LBTA 3SWWA 4W1RA 2QS9A 4LIPD 4TGLA 2WIJA 3PFCA 4LYEA 1DT5A 5DWDA 5AP9A 4YX9A 1ORWA 2C0PA 1ETHA 4B85A 4CIBA 1DU4A 4U2DA 2I3ZA 5AI4A 2WHPB 4Y9SA 3I1IA 5KREA 1EDDA 1R9NA 1CQWA 2OCKA 3PF9A 3CCBA 4B6GA 4GI1A 4UBLA 4X93A 3V1MA 4DNPA 2QXUA 4WY8A 2ROQA 4FHZA 5AIBA 5AOCA 2VJAA 3R3UA 2WKWA 2XUKA 1CUBA 2WUDA 3WJ1A 3OTQA 4LXGA 4H7FA 2PX6A 3ANSA 2DHCA 3WWDA 4DNQA 1J1IA 5HK9A 3PICA 5AO9A 3W06A 2BFNA 1Q0ZA 3A2MA 1L7QA 4Y2PA 6YASA 3FBWA 4MYDA 1LBSA 4N8EA 2WJ3A 1MAAA 1XZGA 2AXEA 1XRPA 4FOLA 1QZ3A 1EDBA 5ALWA 2GYWA 3ZLTA 2C58A 5A7GA 3WL8A 3WWEA 4G8DA 5AM4A 3NOXA 5DTIA 3HC7A 4KRYA 5J3JA 1K63A 1ODCA 2WUEA 2JEYA 1MO2A 4PO3X 5AM0A 2WG0A 2PSHA 4QZVA 3AUKA 5YASA 1GPNA 2BKLA 2VF2A 1PJAA 2QT9A 1JFRA 4QLOA 1L7AA 4JEIA 1GXSA 5JAPA 4NVRA 2QRUA 1EINA 1IZ7A 1N5RA 2CJPA 3STWA 1TQHA 4BE9A 2QVBA 2GYUA 5HF5A 3UUEA 4BTVA 3VDXA 4C4YA 5IVKA 5K3AA 1HDEA 2ZYHA 2GBFA 2XT0A 5FDFA 4UHFA 2C0QA 1KU0A 5HFNA 4E15A 4ZGBA 1JU4A 1ISPA 1UKBA 3C8HA 4QWWA 2ZVDA 3VJLA 2XUAA 1C7JA 1BS9A 4WFJA 5I7UA 2AJCA 4UUQA 1UK7A 3O95A 5HKBA 4B0OA 5K5EA 3NWOA 4FBMA 4QEKA 3A2NA 1F0NA 3WK8A 3ZPXA 3LCRA 2QJRA 1W1IA 1DQYA 1XZEA 1J06A 1AZWA 1UK6A 2D5LA 3I28A 5ALFA 4PNZA 4XVCA 1THGA 1XLVA 2OLEA 4ARAA 4H18A 1VZ2A 3LIIA 1H2WA 1H22A 3SX4A 2OCIA 4MYSA 1FJ2A 2XUOA 4FLFA 1CUFA 2HRQA 4EY4A 1HQDA 3BF7A 5ALJA 4BCBA 3WL5A 3DS8A 3QPCA 1UXOA 3TRDA 4MQLA 3ESAA 2HA5A 3GELA 3A2LA 2H9YA 2WFLA 3UUFA 4GDMA 4QNNA 1EA5A 3JW8A 4P9NA 5FRDA 3IUQA 5IKXA 2PKYX 4RE5A 2B20A 3DDUA 1BROA 4X91A 3O4HA 3R3VA 5IVIA 3AILA 1KU6A 4QLAA 1A88A 1XQYA 2G63A 3QBJA 3R41A 3I2KA 3KWJA 4TPKA 1MJ5A 1Y7IA 1MAHA 4QE3A 5A6VA 3D4LA 4Y7DA 4UHHA 1VOTA 3WA6A 1UOOA 1AURA 1YASA 2JGKA 4ROTA 4NMWA 5C81A 2B61A 1PV1A 1CQZA 1ZOIA 2VSQA 5JD6A 4X7BA 5E4JA 3RK4A 2C7BA 5BWCA 1UKCA 3H18A 1SC9A 3WWPA 1HKHA 1VXOA 4UBNA 3VXKA 1CUGA 1YAHA 1XZIA 5ALDA 2XUHA 4QDUA 2O2IA 3WWOA 1CUCA 5FPQA 3B5EA 4OYYA 1Y7HA 4RPCA 3AINA 4ZRDA 4X6XA 4GLBA 4WCVA 5T4FA 1C7IA 4GECA 4KACA 4FNMA 3KSRA 1ZI8A 1QE3A 4OSEA 3YASA 4N8DA 2JF0A 4G4IA 1E8DA 1EHYA 3KD2A 3S2ZA 2AJ8A 2PUJA 2XMBA 5HZGA 2H1IA 3BIWA 2WM2A 2PU5A 3F98A 1N5MA 2RIPA 5AJHA 3IVMA 5EGNA 1XQVA 1FFAA 3DCNA 1XQWA 3A6ZA 1VXRA 3I2JA 5CH8A 3ZLVA 4WY5A 3C5WP 4FKBA 3FSGA 3OPMA 4BP8A 1WCYA 4U2GA 4QWMA 3AIKA 1QO9A 2Z3WA 2VJBA 4ZREA 2ACEA 3I2HA 5CXUA 2ORYA 3FNBA 1GQSA 3F8SA 1UKAA 1BRTA 4FTWA 4Y2XA 2HA0A 4BBZA 4W1SA 4C01A 2VATA 1WHSA 4AMYA 2RI6A 4DNFA 1LPPA 2GZRA 2HA3A 1YCDA 1GKKA 2GZSA 3JYHA 2PSDA 2EDAA 2XUDA 1O6FA 2ECFA 1DX6A 4A23A 1WOMA 4I4CA 3PUIA 3MUNA 3BJMA 1XQXA 3R3WA 1I6WA 1VZ3A 4H7IA 5JZBA 3C5VA 1JJFA 5SYMA 3GROA 3G02A 1DWOA 4U2EA 3WL7A 4J7AA 1S8OA 5FOQA 1WHTA 5EHZA 5LZ2A 1IVYA 1ORVA 3IURA 2I03A 2HADA 1QIFA 1CUJA 4B9EA 5AKIA 2Z5GA 4H0CA 1U8EA 1DX4A 3I1YA 1P0QA 2XE4A 1VA5A 4IH4A 4F60A 4AQDA 2PVSA 4PSUA 4F5ZA 2E3JA 3AIOA 1R1DA 2HHAA 5T4BA 4KRXA 4QDZA 1N8SA 3L1HA 1UFOA 1B6GA 1J2EA 2PM8A 3D0KA 2BGRA 3L1JA 1XRQA 3IUMA 3C45A 4J03A 3I6YA 3GBSA 3FYTA 5HFAA 4MJ3A 4FNGA 3VVMA 3G0DA 4BRZA 3N2ZB 4X94A 2VEOA 4M0MA 1XZKA 2XLCA 2XUQA 5AK6A 1FFDA 3R40A 3L1IA 4W63A 3W2TA 5FUMA 3QMVA 1Q83A 1ZIYA 2ZYSA 1QFSA 3HACA 3WJ2A 4X95A 1BCSA 3DKRA 3LP5A 4L72A 3DOIA 3H2HA 1WB5A 3HSSA 4KYVA 3FLEA 3PF8A 4UFPA 4Z49A 1XZBA 2XMQA 4P93A 2WFLB 1TCBA 1X70A 5FPPA 1EVQA 1BU8A 5JAHA 5FLKA 3QH4A 5SYNA 4BCDA 1F8UA 4IO0A 4J0JA 1XZAA 1JMKC 4CG3A 3FAKA 2OCLA 1F0PA 3O4JA 2IX9A 4FFWA 3QM1A 3WIBA 3FYUC 3U0VA 2YYSA 2W6CX 4Y2TA 5HKAA 3WMRA 1SCIA 5DYYA 1W76A 5JAOA 1EK1A 1E89A 1F6WA 2Y1KA 3G8YA 4Y2VA 3FYUA 4EBBA 5E4TA 3AJAA 1QIMA 1QIEA 3D2AA 3F67A 1TCAA 2P8SA 4EZIA 2I78A 4YPVA 3RARA 5LZ5A 4H77A 2DQZA 4C6HA 1QTRA 3JWEA 1R3DA 5KWJA 1W4LA 2DR0A 1IZ8A 5D6OA 2J3QA 1SCKA 2NW6A 4A5SA 2XDWA 3U1TA 1CLEA 5ALGA 2O7VA 3D3NA 1QFMA 2B9VA 4KR0A 4HXEB 4B80A 5AKEA 3C6XA 2PPLA 4PW0A 3HYSA 3HJUA 1JU3A 2J3DA 3ESDA 5ALUA 5AKKA 4IH1A 4X92A 1BCRA 4X6UA 5C8ZA 2XB6A 3VJMA 2OAEA 1MU0A 3WK5A 3EQ8A 1EH5A 5AICA 2DFPA 2QJWA 5CW2A 5IVDA 2RHTA 3MUOA 3OM8A 2HA4A 3D2CA 5HQ3A 2YASA 4UBOA 4UHBA 2WQZA 1MX9A 5AI9A 4GW3A 2PSEA 2QTBA 4X00A 4X85A 3S8YA 3D59A 4X71A 5T4HA 2X76A 3G9ZA 5D3KA 2XQFA 3HLKA 1Z68A 1T4MA 1TCCA 2XQGA 5EI5A 1JT2A 5IH7A 2OAGA 5CTAA 1ODTC 4X3CA 3BWXA 3CXUA 1ZGBA 3ESBA 4EB0A 3ESCA 3IUJA 4J0CA 1CFJA 4AZ3A 3FSGD 3I2GA 4B83A 4Y2UA 1P0IA 2ACKA 4J0KA 1QIKA 3ZLUA 4L9AA 3DD5A 4BC1A 3QPAA 4AO6A 4Q05A 3Q8WA 1MTZA 3QPDA 4WFIA 4BTLA 3I6MA 1E8MA 3QMMA 5AKGA 4K6KA 5A7HA 1XLWA 5K3EA 1CIJA 5AI6A 1K4YA 3H2JA 2X5XA 4J0DA 3G9UA 3W04A 2FJPA 4EA6A 4J3JA 3O4GA 1BN7A 4OCZA 4Y2QA 2XUIA 1A8SA 4H7HA 3DLTA 2Z8XA 1C4XA 4OUKX 5LYYA 4RNCA 3SK0A 1ZIXA 1TRHA 5AK4A 2WIKA 1QIHA 1ZD5A 3PI6A 4YK7A 1EDEA 2HFJA 5I8PA 4FWBA 2Y6UA 2HM7A 2R8BA 4DLNA 3GUUA 4NZZA 2FJ0A 3UMJA 4DM7A 2K2QB 4BE4A 4MXDA 1JI3A 1ZJ5A 3DJYA 1DT3A 3H19A 4U2CA 1FFEA 2JGFA 4BP9A 4CCYA 1QO7A 3K9BA 4UHCA 4F21A 5LIPA 2WU3A 3QYJA 2BUAA 1XZFA 3I2IA 5DLPA 1ACJA 4H7JA 3B12A 3RM3A 4AO7A 3DNMA 1VE7A 2OGSA 2QOEA 2GBCA 2RAUA 3EQ9A 1XROA 3A70A 2WTNA 1H2ZA 2VA9A 4Y2JA 4KAAA 5ALLA 3C8DA 1ZGCA 1LPSA 1XKTA 5CRIA 3LS2A 1VA4A 3CN9A 4E11A 1GQRA 2J4CA 5LKRA 5K3FA 1XKLA 3AIMA 4KEAA 2CBGA 3V1NA 4ETWA 2ZYIA 4X90A 5AKJA 5C8XA 1XZLA 3PDCA 3HZOA 5LZ9A 1HBJA 2QUBA 2WU4A 4BZWA 5HK8A 2ZJFA 4H35A 4XJVA 5IVHA 4WDRA 4OU4A 1QLWA 5CMLA 5LLSA 2FX5A 1YR2A 4Y2SA 3GFFA 1W75A 4CG2A 2EDCA 4ZWNA 2WG1A 4D9JA 4FLMA 5ALEA 1IUOA 2WHPA 4HAIA 4G9GA 1JMYA 4KE8A 4P08A 2DSNA 1UOPA 4OB6A 1GPLA 1A7UA 3V1KA 2QZPA 3IA2A 1QOZA 1JKMA 2VAXA 1YS2X 1UOQA 3B3QA 3DYVA 1A8UA 2BJHA 5HF6A 3VVLA 4B82A 4U2BA 4CCWA 4G4JA 4I19A 1EK2A 1EXWA 4H7DA 5KBYA 4ZXFA 5CT4A 1ZICA 3RKSA 5E2IA 2ONCA 1LPOA 3E0XA 5ALOA 1OCEA 3HABA 1EI9A 5FP0A 3WZLA 4UFOA 2C5FA 1RP1A 3IUNA 2CUTA 1VE6A 4OD0A 1YAJA 1AMNA 3GA7A 4YASA 1CPYA 2OGTA 3IBTA 2WILA 3C6YA 4EY7A 3QITA 1EB9A 3G9XA 2H7YA 1H23A 1X2BA 5ALNA 4BVKA 3TGLA 2XUGA 1ZD3A 4U2FA 4EY8A 5HQ3B 4G1FA 1VJ5A 4IHAA 1MX1A 3H1BA 3BF8A 2WIDA 2R11A 2Y2UA 1CUHA 2OPHA 1ZI6A 5FXMA 3N0TA 3WKCA 3H17A 5JANA 4MWSA 2AJLI 3KWFA 2RGUA 4JUIA 5JZSA 4H7KA 5CT6A 3WLAA 3K2IA 2WTMA 3O9VA 5CH3A 4L3WA 3C6ZA 1CRLA 4O08A 1OXMA 5CBKA 1YA8A 3WA7A 2G5TA 3TEJA 5EHQA 2HA6A 4PV7A 4XIIA 5ALZA 5ALVA 1AKNA 5CURA 4JYMA 3EF3A 2PL5A 4G8BA 2PUHA 1MT3A 3D7RA 4AZ0A 2O7RA 2ZYRA 3HRHA 5BV7A 4CIAA 1IUPA 2OCGA 3OC0A 4QDOA 4H7EA 3VKFA 5JAUA 4GXNA 2Y2VA 3SC2A 4MQMA 1XRMA 1LPBB 3R0VA 3VISA 4B0PA 4X97A 3DL4A 4BB0A 2HRRA 5LZ7A 4LYDA 1TK3A 3ICWA 4C87A 4AXBA 1BEZA 4HS9A 2HL6A 4Q3OA 1EVEA 1JJBA 5AKHA 1BN6A 3IB3A 1M33A 1K8QA 5C7YA 5ALXA 1ODSA 4N5HX 4BDSA 2G4LA 2ZJ6A 3KOOA 3IULA 2WSLA 5E4YA 1LPAB 2BCEA 1YB6A 1LLFA 5A71A 1LGYA 2I3DA 3M3DA 4A16A 1CR6A 1FFCA 4UFNA 2CZQA 3G0GA 4DNOA 4DMFA 3OURA 3VJKA 4BZZA 5AKZA 3FCXA 3BJRA 5D3ZA 4J0GA 4AMZA 1QIIA 2C4HA 5JADA 4CI9A 4DYHA 1ZD2P 1NX9A 1AX9A 3BDVA 3D5EA 4AN0A 2W22A 3WKEA 1CVLA 2X8BA 4DMKA 1XZMA 4ZV7A 4KAJA 1CUUA 1R88A 3W9UA 5AI8A 2DCMA 5K3CA 2XUPA 4BDTA 1MPXA 4BYMA 3DKKA 4DSAA 5AM1A 4EY6A 1XZCA 2HU8A 2XQJA 1P0MA 3C43A 4RE6A 2JGEA 5AM2A 3WL6A 1AC5A 3C87A 5EFZA 4OYLA 4MEBA 5DTJA 4FMPA 3F96A 3E3AA 5ALTA 4BAZA 1J07A 1HPLA 3ZI7A 2BAGA 5LZ8A 3WK9A 3E1GA 3RLIA 2WHRA 1H2YA 3H04A 5CXXA 1GZ7A 1YSCA 3FLAA 1UWCA 4HXFB 3K6KA 2RHWA 1WB4A 1BE0A 4C4XA 1FFBA 1YA4A 4W1QA 2BUBA 3WKBA 4AB1A 1DINA 1GPKA 2ZJ7A 5ALMA 1DTEA 3BE8A 2G5PA 1CEXA 2JBWA 3KDAA 1AUOA 2CEKA 4Q1VA 2XMRA 1U65A 5ESRA 3ILSA 1WPRA 4V2IA 2WIGA 4UPDA 3M82A 1K6EA 3Q0TA 2CKMA 2WIFA 3QZUA 4Y2YA 5AHXA 5JYCA 1ZI9A 4DMCA 5AOBA 2HA7A 5CT9A 4KE6A 1QTIA 1GKLA 4N5IX 3STUA 4UBIA 5EHXA 5CT8A 1G5FA 3CCCA 2HIHA 2VT7A 3WIOA 2H7CA 2WHQA 3OOSA 3H0CA 2QMQA 4K2AA 4EHBA 5ALPA 1R9MA 3WI7A 3QVMA 1HLGA 3F9CA 3ANTA 4G9EA 2YXPX 2Y6VA 5AI5A 1G4HA 5JATA 1THTA 1SCQA 4B84A 2CMFA 2Q0XA 1AQLA 3PE6A 4ZI5A 4OB7A
chains in the Genus database with same CATH superfamily
1J2YA 4RKFA 1F8YA 2RGWA 1Q95A 2ZYDA 4I4TF 3EIXA 3NBFA 4DEXA 5LSAA 2BRUC 5KSPA 1Z0SA 1VECA 4Q6BA 5KOHB 1NY6A 1QAMA 4KE7A 2NG1A 3ORHA 4IDCA 2WU1A 1LDYA 2X4DA 5ALHA 2PRKA 3GLHE 2I54A 1GZSA 2BEUB 1RWPA 2DCUA 2XMGA 3IJ5A 4GS5A 3V4FA 2REXB 4CW7A 4MWDA 3V97A 2K2WA 3ZWDA 3EIWA 1Z82A 3DC7A 1EM6A 4CFSA 2ZSFA 4DQKA 1EXMA 1NUUA 3OIUA 4RZSA 3MS7A 3C0KA 3M6XA 2UKDA 5K0LA 3EPJA 4GKJB 2H7XA 3RVNA 4B3IA 3ZQ6A 1KGDA 3RODA 3S28A 1FP1D 4TM7A 3RK1A 3G5AA 3M81A 5FKJA 1JTVA 2YY7A 1PDWA 3F9IA 2UYCA 4ETNA 4YUYA 2VRCD 1VJCA 2EJCA 3OIDA 1GZUA 1VPTA 3L7BA 1M6VB 1FQKA 2JBAA 3A25A 3EXG2 1B0ZA 2LIPA 5G41A 5BR1A 4N7BA 4ZRMA 4JZYA 2HWXA 4IQ4A 3SEQA 5KWIA 4OU5A 5J2TA 2WJPA 1T3HA 2VJDA 1IDN1 2JCYA 2XITA 4IHJA 3TSWA 4BLRA 3WGQA 4P3XA 5DCWA 2G4VA 3SX2A 1MNQA 3GOQA 4Y8VA 5KHLB 2EIHA 3ITKA 1H93A 1V1MB 2QRZA 4HNAB 4U7FA 4CR7A 2JANA 1JLKA 1R12A 1EK6A 4YLGA 1BX0A 3NBZC 4FUQA 3BMXA 2JJ1A 4WLVA 4GSLA 4KIJA 1WU7A 2BMWA 1PD1A 2FU5C 1UC5B 1NU6A 2YWEA 4NULA 5GQSA 4JJZA 3TQSA 4ZHQA 1EZ4A 2P11A 4ZDIA 1HE4A 2E4YA 5IYZA 3GFBA 3Q7TA 4JX8A 4YFYA 5G2OA 1EWKA 3RG2A 4G6ZA 2MMCA 4JP5A 4TLCA 1JRLA 3A6KA 1SC1A 4X1YA 3U40A 4OP3A 1KI4A 1H94A 5LM3A 1L7EA 4KR7A 1V5EA 1LZLA 1W6UA 4IG9A 1EXNA 3H5AA 3LCJA 1UAGA 4F2GA 5JXIA 1S1CA 1E5TA 3X1DA 4OB8A 2PUFA 1JECA 3ER9A 1OIWA 1SVKA 2A0FA 4ZI2A 1SEPA 5G0WA 2ICAA 4QDJA 4UQPA 1VKRA 4GYJA 3E81A 4KJXA 4DE5A 4EQ6A 5CBPB 5MN4A 4AU1A 3GJQA 1R0BA 2BDEA 2QX4A 2WPNA 3U31A 1YRYE 2HMAA 1P5RA 3LBIA 4KR2A 1Z63A 1E62A 1TTHA 4Q9LA 1F4VA 4BJ6A 4Q3NA 4Y1EA 5CLHA 4IUYA 1VCIA 1U4NA 2HMWA 4PX9A 2F1RA 2QUKA 4E13A 1VBKA 2BV3A 2GCOA 1GILA 1AK9A 4J16C 3W8NA 1QJ4A 5K20A 2DLDA 2JAXA 4AX4A 2IYWA 1NRJB 2CGEA 4GM1A 3KEFA 4K8OA 3U1BA 5AJWA 2Q3MA 1Y6FA 5JMOA 4R7GA 3BB1A 5HKKD 5B1HA 2C3PA 3EZLA 4JVNA 4V1CB 1VYUA 3PQCA 3JQAA 3UHAA 2YHSA 3MEQA 1PQUA 3C3EA 1YJQA 1KJJA 2FA9A 4LPKA 3H8JA 5CAEA 4YRBA 3PRJA 2ZI6A 3T34A 2RGAA 2XMCA 3EVCA 3A36A 1Z8FA 2J07A 2XWQA 4FLEA 4WMLA 5EGSA 4OI1A 3MTEA 5I8WA 5IDQA 2YNMC 3V1UA 1IXSB 4LRTB 2QI9C 1UM8A 3E5HA 4H6XA 3AH8A 3OZGA 5JJ5A 3TMAA 1GFIA 2QVXX 1YMVA 4EW1A 1JHMA 1W29A 4LSZA 4D9IA 5GIOE 1S0UA 4WXHA 1D6MA 3I45A 1HR0B 2P2LA 2H1HA 1LNZA 5CHEA 5GINE 1OIVA 2FPPB 1AGYA 5BW4A 1PL8A 1U8YA 2ZYUX 3FHJA 1EFPB 3SJZA 1I5OA 3QXJA 3R3YA 3ZTTA 2BI8A 3HS3A 3IE0A 4N03A 2G9NA 3UH1A 2BN4A 5JBQA 1ZD1A 1Y5LA 4RMNA 1ZRNA 5FB3A 4RABA 1BKDR 2KBEA 3L6DA 1L5SA 1SRQA 4UUMA 4BJ5A 5KNDD 5KYWB 1RCFA 4BVLA 2CYBA 2QT0A 1XTUA 2WFZA 3ADPA 1FRVA 4YUVA 2JLVA 5JJKA 3D4BA 3HR8A 1NVBA 4W82A 2EWVA 1AVTA 5EWJA 2ZROA 3KP1A 4NYIR 4J1SA 2QUJA 3H5IA 1SG9A 1Q0RA 1JJIA 3EULA 4ZEOA 2PR2A 5CDFA 3MINB 4F4CA 4PLWA 1P2SA 4G0UA 1BXKA 5L3SB 5C31A 2OV6A 1DTWB 5BSVA 3QEAZ 1MUUA 1VE5A 5BWBA 4S1WA 2ATXA 3K5IA 3OH8A 1F7VA 1ZJ4A 5JASA 1RWBA 2AD5A 3KPWA 1IN4A 1CUEA 4ENUA 4RFSA 1CS0A 1WXQA 4RHTA 2GPWA 3ZJVA 1NOKA 1EGAA 5JNSA 5LP1A 4KAFA 4FYWA 4KXWA 5H59A 5TT0A 3I1JA 4IIJA 1B8PA 1BA3A 3AZQA 2NZ8A 1HFJA 2GXSA 4O25A 4BFVA 1HRDA 5JCJD 4C89A 3M49A 2NU6A 3R5JA 3EAGA 1F3OA 1AN0A 2QN6A 2UZ0A 4UU1A 3QX8A 2C5LA 2HQ1A 1G42A 1RTTA 3IAXA 4NONA 4QG7A 1GT6A 2NUPB 4HRAA 4NU8X 1UXGA 2CNNA 4K9KA 4OM8A 5DJ5A 3ZWVA 2OAP1 1KYQA 1UJ4A 2DTDA 3B13B 3LIPA 3TMYA 4CNBA 5JCPA 3GZJA 2D2XA 4NJOA 3TCNA 3X3HA 4LVOA 1Y4ZA 2P9GA 4MKRA 3HA3A 2O1WA 3HYLA 3NT5A 1YR9A 3MQ4A 1DARA 2ZUWA 3I2FA 5LFAA 3I73A 2PUAA 1PBTA 2MSWA 2ZBRA 1OILA 1WLSA 2EP5A 4WNAA 4CN9A 2VTVA 3ZV7A 3M5DA 1IN8A 1E9RA 1GSHA 1X1RA 5IJ0B 3PJDA 1T2EA 1E8NA 4ZXPA 3RS2A 3ED5A 3P9NA 5E4FA 3SQNA 5J1SB 3ORRA 4HGYA 1A9ZA 1C30A 4R41A 1DBPA 1MOSA 3FYHA 2Y99A 4NCNA 4BX9A 3ZV5A 1B8UA 3IXLA 2EZTA 2F43B 4TL9A 3ZU5A 3R0JA 4QT0A 5BMVF 1NURA 3A9UA 3ANMA 1ZM4A 3A6GA 1XL0A 1WP9A 2AQHA 5TQ0A 3AT1A 5IABA 1YQUA 3O47A 4JFRA 3A1CA 4QTZA 1RSZA 4CTNA 3AJ8A 1RM0A 4RETA 5HNKA 2XXAA 3FTPA 3PUHA 2BJWA 2Y4NA 3RSGA 1W85B 3H8VA 1QOQB 3VR6A 5JIBA 1E3QA 3GO4A 3FNRA 3OLXA 2CDAA 3U3MA 4XWGA 2FOLA 1ND6A 4A2WA 1U2PA 1U81A 2QG9A 3MMPA 1J2RA 4HLNA 3PKIA 1OXTA 4KXVA 3WV4A 4F8EA 3NONA 1USVA 1LS1A 1F3LA 2HJ9A 1XVUA 2NU7B 1L5HA 4F97A 5EJ9A 1NKTA 4Q39A 3WSTA 3NHZA 2XMZA 1R50A 5JNUA 1EHIA 4KMOA 3I72A 2ZB4A 2BFFA 4JYAB 3TTYA 1TIKA 4ZI3A 5JAMA 1DHRA 4L0CA 5EN4A 2YV1A 3B6IA 3N0VA 2XCLA 2WKRA 3UW1A 4XWAA 3P0JA 1A69A 2QM3A 4Q7EA 2VQEB 4M1KA 4ZU3A 4CIYA 1SCBA 1YS9A 2BGNA 5IU6A 4DYVA 2OYSA 3V7WA 1RPTA 1ILWA 1DBRA 1E0DA 1MBZA 3BQ9A 4MVYA 3RHSA 3UWSA 5BWNA 2UUCB 3IVAA 2FLVA 4JYCA 1Z2DA 4G85A 2HU7A 3WGYA 5LQDA 3H83A 4HB2A 1ZVJA 2DSTA 4JT2A 1L5VA 3MA0A 3NKVA 1SC4A 1VLHA 1KYYA 2J9XB 3CPSA 3BH0A 2VZEA 5CCBA 2HDWA 5TV2A 3TSAA 4C05A 1A82A 4QHSA 5A4KA 1YF3A 1N2JA 2R3SA 5A1JA 1MH9A 3M8KA 1XA0A 3QQ5A 1RPJA 3F97A 4UJ3A 3UOWA 4BO9A 1F14A 1KEZA 2FP4A 1BDHA 1QTNA 2EFHB 3DBOB 4LF8B 1BDIA 1E0KA 4OQ4A 4RA6B 5F1PA 3BXXA 2V59A 3QA3E 5BWMA 3KOYA 3URMA 3RS4A 4LRUA 4O8CA 4BAGA 4TVBA 4M0EA 1O58A 2PUVA 1W5TA 2A7XA 2GPYA 3UXHA 4ZYWA 2BGKA 2QLLA 3C8ZA 3DFMA 5FOUA 1GVNB 1Y5NA 5E6RB 2I7TA 4Q34A 4KGZA 3U49A 3OZWA 2WK1A 1ZNXA 4ZOLB 3ZWQA 1XV5A 4PVCA 3UZUA 4OK5A 2V3VA 2PVPA 1DIGA 4YCLA 3DXZA 4B76A 3IKTA 3QUCA 1NJFA 3CRVA 3KZCA 4W1PA 5LB2A 4EJSA 3OIYA 5ICCA 2JL1A 3PGXA 2O48X 4FDTA 4LJ8A 1YC5A 2OQVA 2NLOA 3ACDA 4RU1A 5FJJA 2R4UA 3U44A 2CNOA 1NVMB 5FORA 3CF6R 5B7QA 4NLLA 4XARA 3LFUA 7YASA 1IBKB 2PT5A 1KERA 3HCPA 4GPIB 3FRJA 5IM4F 3P2JA 4QFCA 4C6TB 5E3JA 1B1AA 1DKOA 2BFEA 4W8HA 2PS1A 3QVUA 3UK0A 2BLNA 2CK3A 1DXHA 4ZANA 2QTGA 1AQ6A 1XZHA 3MXOA 3PPXA 3B9RA 2JGDA 4FDVA 1YQWA 1ZWKA 1EZZA 3I4FA 1YL6A 1EFAA 2O7QA 3JXEA 4BU0A 4DLUA 4J3NA 1NNSA 1WCIA 1QK3A 1C0PA 3L6OO 2RFLA 2WT4A 2BTQA 1MB3A 1P2UA 4MH0R 1DFGA 2JFGA 4NV1A 5TT1A 4C5AA 1ULHA 2EKDA 1RPAA 2PU7A 2XD9A 4CTOA 5BW5A 4B7CA 2OM2A 1BVRA 3IAM6 4D4IA 4KKVA 1HDRA 3R9WA 1B6TA 1F0KA 3IVCA 3LUDA 4IQ0A 4YRIA 1MQAA 4G63A 2ZR9A 3IIIA 1NONA 4B71A 4CLHA 4MV8A 4J0QA 4JI0B 4WNYA 8GPBA 1DBQA 2SHKA 2YY6A 3FHOA 2XMDA 4P33A 3AFMA 3OJCA 3K8OE 4DXAA 2H48A 3CUSA 4D8XA 2OY0A 5A5FA 2IZZA 2Y67A 4C5BA 3JPYA 3NM5A 2DBZA 721PA 1EBBA 3IT2A 3PQ2A 1U3CA 5HR5A 1N6HA 1OFUA 1PG5A 1KK3A 2A5JA 5CLJA 5H7XA 1ZQ1A 4II3A 2V3CC 3WJAA 4YGXB 1KEWA 1NW5A 3VMFA 4JJKA 2WF7A 3PC3A 4C2AA 4OLBA 3CRZA 4RXTA 5HM8A 2XGGA 3FGNA 3NIBA 4UM9B 3F6PA 2Z6VA 1UMKA 3AL3A 4ARBA 3CPEA 1VL6A 4FK8A 1H2XA 2X5KO 3DULA 3UANA 4U6SA 4FFPA 5IH3A 5KNBA 1GADO 3FETA 4OOFA 3FCYA 2VPPA 2GILA 2UXDB 5AM5A 3VDQA 5DNUA 4H1UA 4NFLA 2OBNA 1J0XO 4OEHA 3DCYA 1XLUA 2Y1DA 1LPMA 2EQAA 1T0PA 1YDWA 3AERB 3CV3A 1ECLA 3DYBA 1VHQA 4IRXA 1X86B 4HNGA 2E1PA 2JJMA 4NAVA 2VDKB 2X6QA 4EO4A 5C9ZA 4RA9A 3M6UA 4FW9A 1BGXT 5F73A 3CH4B 3HU3A 3OPXA 4TKVA 2EFYA 2LR0A 4WH0A 5BO5A 2XAUA 4UUBA 1DV1A 1YE3A 1WOYA 4AN1A 1Z6AA 1HT1E 1JVNA 2EFCB 3RW9A 1YB7A 2HF8A 1VPLA 4TWRA 2JJ1D 1WBJB 3SVZA 3T15A 3UJAA 3ZKWA 3W5IA 1X7DA 1Y8CA 2AG8A 2FW6A 1M8JA 2WR8A 2Z1DA 2C83A 4UU0A 4DCTA 4YR7A 4UHEA 1NMXA 5MDHA 7REQA 4P58A 2VHWA 3NHFA 3GEGA 1KXZA 1C4OA 2YVKA 2XWSA 3HM2A 2CVQA 3GGOA 3QF4B 4Z9XA 5AUOB 2P3OA 2WFAA 1YS1X 1Z2OX 1VBMA 1DAFA 3QVLA 1WSWA 5HIIA 4BVBA 1I32A 1CEEA 2P4UA 2PSJA 4OATA 4ISBA 5L4SA 2W5UA 1SUDA 1X6VA 5DRTA 4E6PA 1PL7A 3ZS9A 1TYBE 1UJNA 2W6MA 1NVKA 1TKRA 4X44A 2AKEA 2OA0A 1YI1A 1HC7A 5A7FA 1S6YA 3FFAA 3ZWXA 5LMZA 1D4AA 4EA8A 4L74A 4RHCA 5H0IA 2VDMB 3C3XA 1H9BA 5AK3A 4QGBA 4LECA 4QXOA 4RADA 1HDZA 3AJRA 1Y3DE 2NSHA 2D2FA 5JALA 3D4IA 5IJZA 1XZDA 4PQEA 2DUWA 4WKCA 1E77A 3NWJA 1IB6A 3DG9A 1J8FA 1ZGJA 3SSOA 5JWRA 4ZI7F 4R1SA 5DWQA 3ZHUA 4KPUB 4E1BA 4LC9A 2CNKA 3LYUA 2PIAA 3WL4A 4U9HS 3TL2A 1UDXA 1SQ5A 4YMGA 3ZQKA 1D8TA 3JQAD 4WWHA 2QE7A 2ZIFA 5K3FB 4FMCB 2IE0A 4RKYA 1XRNA 3NAMA 2HQRA 3KVYA 5JS6A 3P7MA 2P7HA 3H2IA 3PGA1 1B14A 4BO0A 3FNIA 4B7AA 2QT1A 4FE7A 5AMXA 1HTBA 1YQEA 3T4XA 1QPGA 2R7AA 1XEAA 3QVGB 5EMLA 2BFCB 1QK4A 2H5IA 2OCPA 2P9TA 2PZMA 2R96A 1DWQA 1TO2E 2QV0A 5E6SA 3ZCTA 1S2GA 4NE7A 4N82A 2BUCA 1ZC3A 1P5FA 2HV8A 4DFDA 4E5YA 5C18A 5B2FA 2VDLB 1LBTA 5HVNA 2B7CA 2XTJA 1T6XA 4P7JA 2BFBA 3KBBA 3E22A 1YHNA 1XKXA 2J8ZA 4LIPD 5FULA 3TW0A 3PXGA 1SVIA 3EX7C 3HCCA 1NIJA 2I7VA 1OY1A 1K6XA 4LXTA 1KDRA 3EFOA 4HQNA 1C3VA 4TYMA 5IM4A 2IRWA 3CO0S 2LDXA 1DC5A 2OTCA 3PNOA 2B3TA 4ESOA 2BC9A 2NUTA 4EW3A 1OLOA 2WWWA 4B85A 3SZUA 4AS2A 1MHPA 2O6HA 4I5FA 1I36A 2YOHA 3K2QA 5AHKA 3K0EA 5FLXA 4E3WA 4FD3A 4HNSA 3I92A 1N4AA 3HBLA 5AI4A 1FEZA 4JUCA 1U9CA 4N3AA 3PC7A 1HFEL 2WHPB 4OXNA 4DIFA 1U02A 1T5SA 1JHZA 4P4LA 5CEEA 3W8EA 4BWVA 3NMUF 1PDVA 3BRSA 2OCYC 1UMCB 1POWA 1J0EA 3CKKA 1B8VA 1U2TA 2H4WA 1UBEA 3CCBA 4G0QA 3ZLBA 1R4NB 4CDGA 2Q5JA 1J9EA 4GGPA 1W7AA 5B4VA 4BECA 3KZKA 3V1MA 4K9SA 1GTZA 1P1FA 2BIFA 1JDSA 2QXUA 3KYCB 3NORA 4QSHA 1I01A 4DNPA 3CVYA 2I6FA 3OTGA 5HZHA 1R9JA 2PXHA 3IEXA 4MLPA 5AIBA 2Q3LA 4WBNF 1NVEA 1D6SA 2CDBA 1LW6E 4NBLA 1M7BA 4RY0A 4DA0A 2DPYA 2Q2VA 2XTMA 3QQPA 3LBNA 1DIHA 1KQOA 2LKCA 2XUKA 3KZVA 5L3VA 4KWCA 1HSOA 1AGRA 3LQ1A 1DAOA 1I0ZA 2O8FB 2NSYA 3ILYA 4BLWA 1PZMA 1SU7A 3CW8X 1B76A 2RJ3A 1N5OX 1N2GA 3OTQA 4V24A 4AZWA 5GY7A 1XEWX 2GCIA 4LXGA 3T1QA 3DE1X 4X9XA 4DDTA 1EQUA 3C4QA 1SKYE 4K28A 1UQRA 1CULC 2A0WA 4MARA 1HYEA 4P3KA 3RT9A 2R1TA 2R47A 1W96A 4PWYA 4QYXA 2FWJA 5FA8A 4C03A 1KZ6A 5HK9A 1RJGA 2CFOA 5FAXA 3BERA 3OEEA 3PICA 3T9DA 3EEBA 3OPQA 4Q1FA 4HN4B 2YS6A 2QTAA 1Q0HA 4NH4A 2BFNA 3W6PA 1Q0ZA 1RXIA 1XWIA 1L7QA 4ZVQA 2HTFA 3BHNA 1QG4A 3WRXA 4R4JA 4V02A 1WJGA 3ZXUB 1N3YA 5JAIA 1XLTC 4PN7A 4OBWA 3AR4A 4N8EA 2HQOA 1BQEA 1VMAA 4GGMX 1MAAA 4DQVA 1R8XA 1XELA 1XMSA 1RLMA 3WBFA 4KV7A 4FBGA 1RW4A 3OBBA 2EAUA 4PZ9A 1Q1BA 3EMDA 3Q3CA 4Q9IA 2PT9A 4IJ6A 4ND8B 4CU5A 3U6BA 4EKIA 1PX0A 3BUSA 2C58A 3RD5A 3RI3A 3SZRA 3VR6D 3H6GA 4HQLA 4G8DA 3BS4A 1CRZA 2IHUA 1I0LA 1W0KA 2D7JA 1WL8A 1C81A 2FVXA 5KTSA 2Q8PA 4V0KA 2WM3A 4ZICA 1WXDA 2KLBA 1PGJA 1UP7A 3LWZA 4U63A 4C14A 4MRMB 5IMSA 5T7BA 1JYEA 3ZWBA 5EJ5A 3QIAA 5FNVF 5J3JA 5G53C 5FTJA 4FM9A 1V8OA 2JFWA 5AUPB 2GEKA 1OXBB 1G5HA 4JVLA 3ADBA 2J45A 2HPAA 5IN5A 4DZTA 1GD1O 2OP1A 2NYAA 4YP1A 1RLTA 2PRIA 2FGJA 4BNIA 3EZXA 4BQSA 3BVPA 5K2MA 2BP7A 1JHYA 1MO2A 4OH7A 1GYQA 2QD5A 3NHPA 4DYDA 3WGHA 1PK7A 3PWZA 1A9XA 2HTEA 1GP2A 3GRRA 4A8HA 2DJIA 3B3AA 3IXQA 4PX2A 1E9AA 1DI0A 3CLUD 4CWAA 3AUKA 1PJ2A 4GI3A 5BSFA 5YASA 1ZK0A 3KTOA 4OX9B 1GPNA 1FNMA 3CLSD 1Y7TA 3DUFB 3VSEA 4D56A 4L9RA 1PJAA 3UK2A 4DV6B 1G20B 1U0SY 2GKGA 2OESA 2A9JA 2V58A 2VJNA 3A4NA 3CYFA 5DKFA 4A8JB 4AW9A 4HLUC 2OFFA 3KR0A 4EKDA 2ARKA 2VSNA 4HWKA 4KXNA 4L5AA 3OCXA 4XTRA 4ZZ1A 1XAGA 1OHHA 1OIXA 1T3ZA 1O4WA 2EW2A 4JCCA 1A1SA 4DCNA 3DMTA 1BGWA 1L5FA 4IZ6A 2NAPA 4NVRA 1AQJA 2TS1A 4GR5A 4MA5A 4ZCLA 1EINA 1A5BB 2PT6A 5B2EA 3F5MA 1K9SA 1E9VA 3EFHA 3GEDA 4Y98A 5E3HA 4ESHA 1WSDA 2AJTA 1U2QA 1E7SA 5AVJA 3WXMA 2GEVA 2P0YA 1K2VN 2DT8A 5EE1A 3NC4A 3VDXA 1W5BA 2H85A 1TMOA 3L4BC 3QPUA 5IVKA 4KQ2A 3G68A 2C9BA 4LRSB 4TYYA 1NWHA 1YB4A 2BEJA 5FL7A 1QWSA 3N2KB 2ZXFA 1U99A 2GBFA 3KYIB 2WHEA 1W5AA 3NGXA 3MRVA 3L01A 3WZ2A 4U4AA 4DSNA 4CM1A 1IB0A 1NI4A 3BWVA 5HFNA 4LQCA 2H65A 2QVZX 2D2VA 4TRNA 3LE8A 3UHFA 1PTJC 1QORA 2Q5LA 3QSGA 1ZBDA 4ZGBA 1T0UA 2IP1A 1JU4A 2R00A 5H68A 1ISPA 4F9FA 1PNRA 1GTMA 3AF1A 2RK3A 4CLXA 4IEFB 3C8HA 2CHVA 1I1HA 3ZVLA 4EG7A 2CVFA 1CQXA 2UAGA 3S7TA 2G04A 5EKDA 5AVTA 2ZQ5A 3TS1A 1SUSA 3CE9A 2HI0A 2NNWB 1IY8A 1DJQA 1WZUA 5I7UA 1C4KA 3O2NA 5KWSA 1J90A 5KC9A 5KWEA 4O4JF 5TEWA 4P4TA 3UKJA 4AYTA 1BH6A 2CK3D 1EVLA 3AY7A 4HXYA 3TZQA 4B3CA 5JCOC 3RFUA 3OO1A 1LBIA 2DQSA 2QLNA 5K4GA 2ZUBA 1B0UA 1X7ZA 2QZJA 3HCWA 3FDZA 4B0OA 2Z2IA 4UOEA 3PJGA 3VR4H 4TTTS 1ND5A 1SAYA 2IPAB 3CVOA 2VXBA 4HF7A 4C3ZA 2VP0A 3A2NA 4QEKA 5JTTA 1LI5A 1NYLA 1Q91A 4QJBA 3ESRA 4HD8A 3RVDA 1KOFA 3HKDB 4KDRA 1OAAA 2OFXA 1IHPA 2IPOA 3P1JA 4ZYTA 4NV0A 4JBXA 1CY1A 2QENA 4TL8A 1WMEA 4B09A 1DOZA 2E82A 4JKYA 4ZGGA 3M1LA 3MJVA 1J06A 2VBCA 3FKSA 3B6KA 4K40A 1PFYA 2O2ZA 4EPRA 1P2GA 5ALFA 1G8SA 3I28A 2CJFA 4G97A 1N6RA 1LBEA 1NR7A 1OXKB 1TL7C 2SBTA 2Q3EA 3MTGA 5DO9A 4DV7B 1QV6A 2Q3BA 3TLKA 3UG7A 2OLEA 3UXYA 3HKBB 2X5JO 3BWEA 2WC1A 3PHCA 3UQZA 4H18A 1S2NA 3MBOA 3LP6A 4AECA 1VZ2A 3DDZX 5EY5B 3RS9A 4DN6A 3U4QB 2BHNA 3TD2A 3PDUA 2OCIA 2PKCA 4GWKA 2GD2A 1G5QA 1IHXA 1Y81A 3N8GA 4JI1B 4JJ6A 4N6GA 5JSUA 2FW0A 2WM9B 3SIWA 4Y0NA 2V4ZA 3BMCA 2NZXA 2PX5A 2H5EA 2WOJA 4MQ5A 4CFYA 2YJ4A 2HRQA 2E85A 1H4TA 1VLZA 3IPXA 1FDIA 2GPTA 4QAJA 4AJ4A 1ODKA 4LSMA 4E5SA 1XIVA 4EF6A 2FWRA 4ARIA 2NPIA 2R2AA 2FDXA 3RABA 1MH1A 4A2PA 4E5NA 1NN1A 2O1EA 2YR0A 5FWDA 5KNBD 4B6SA 2D5BA 4BCBA 2PKEA 4C29A 3UV6A 3MFQA 4ITRC 1NUAA 5DLEA 4CBVA 3QPCA 2EYQA 4NYIQ 1OTYA 1V16A 2ZDGA 3G2KA 3QWIA 4FI3C 3PX7A 1N7GA 3N39C 2CKDA 1YUNA 2XVMA 4I9HA 1A97A 5AXBA 4B4WA 3SNKA 2H9YA 2MSNA 3SR0A 4EEKA 4MPRA 2QW1A 2ZIWB 2NSLA 5FRDA 3OZBA 3IUQA 3H7IA 2PKYX 4UNSA 2F48A 1EDOA 2GAFA 1JB1A 4D1YA 2B20A 2FN8A 2P9QA 4HN2A 3I01A 3N07A 4LRYA 2I76A 2EZUA 1AKTA 1DKQA 2VSYA 1GUFA 1HDXA 4XJXA 1SWWA 3WYAA 4RK5A 3NT4A 2C9MA 1RT9A 4DUPA 4F93B 2C42A 1VHTA 1WW8A 1NUTA 2I71A 4CG0A 3IQGX 2G7ZA 4OHYA 3NRCA 5IVIA 2ZIAA 3AILA 1UBNA 3ORSA 2NO7A 1MOZA 1EUZA 2RAVA 3TCXB 3U19A 2OV1A 6PFKA 2R4QA 4HFNA 1QYWA 3QBJA 3GJ4A 4FCWA 5LCXA 3I2KA 3ZHXA 3KWJA 4TPKA 2R1VA 3K70D 3OKPA 1UMBB 4MQFA 1PV4A 4YRNA 5ICFA 3ZE7A 4CMIB 4EYEA 3DCIA 4GI7A 4ZYUA 1NJ6A 5IX8A 4UXJA 4D6YA 1LTKA 3ZHZA 4NENB 3THRA 4D3XA 1JEQB 2FVYA 4XUGB 4QULA 5T67A 3CNOA 2X5OA 1VOTA 3EDOA 3L7DA 3MT8A 4HQ0A 2PRJA 1KVTA 2Q6LA 4LTMA 1SZDA 3VBEA 2VDWB 3UMMA 1AURA 4NRDA 2ANCA 1YASA 1CQZA 4YRJA 1MAUA 2DWQA 4CIVA 4JJ8A 3O2JA 2PLFA 4EI7A 3RVMA 4WSOA 1ZXBA 1PX2A 2CCJA 2C7BA 2ZFUA 4M0LA 3JARB 5K4HA 4JJGA 4O0LA 1BRMA 3TW4A 2GETA 1JAHA 1SC9A 4DWVA 5IKEA 1VXOA 5SY9A 2ADOA 5EZYB 2OXFA 3THOA 4NECA 4EJFA 4P4NA 2P4EA 2A9QA 1YAHA 4PSVA 1XCGB 1XZIA 3GWGA 1E4YA 1PN3A 3Q2IA 2QE7D 2JD0A 5IJ9B 4E3ZA 4DMLA 1QCCA 4KRFA 2IYVA 3OTIA 2PS3A 4W9NC 3V34A 3U13A 5E6UB 3TX2A 1OR8A 2CE2X 3AINA 1XU9A 4YALA 2GN9A 3B1VA 1Y1QA 1OXUA 3SM9A 3SHOA 4X6XA 4S1VA 2OYCA 2YJZA 3K8QA 3I5AA 1ZZGA 5T4FA 3O4FA 3DHVA 5AJXA 3T7AA 3SF8B 3CC8A 3UJ9A 4WRRA 4FNOA 3N2LA 3Q3HA 2IOFK 1LJUA 4RXUA 3JS5A 4KACA 5D3MB 4QM7A 1LI4A 5KTTA 2C54A 5J47A 4LCEA 4UNQA 5JEDA 1I3MA 3Q7SA 5JROA 3CUUA 3GJSA 4QAQA 4Z0NA 3EUEA 3SYNA 3P52A 1DKPA 4O4JA 1QE3A 4YCJA 1MT0A 3Q40A 3SLGA 2F7SA 4HNRA 2IGTA 3OIFA 1YQDA 2JPDA 3LXUX 3JX9A 3GNSA 4JEHA 5LLDA 4F3TA 5JSQA 1WPGA 3SYTA 3WGIA 1Q0UA 5J4HA 4N8DA 2UZ1B 4MUYA 1UMDA 5TPWA 2RI1A 4KSYA 4FQ8A 3AF0A 1EHYA 1MEJA 3UAZA 4HC4A 4V3BA 4RF4A 4YP5A 1FP7A 2VJMA 4MS4A 1CXZA 3D8SA 3TB6A 4AUKA 1JIUA 1WS6A 1ZGHA 4IG4A 4YN3A 3F98A 1C4WA 4HWOA 1N5MA 3HV2A 4NY1A 4CKEA 3ECCA 3IVMA 5EGNA 3MGCA 5ITWA 3BORA 3T8YA 4L2IA 3OX4A 5JQWA 5LQCA 3T5AA 1S01A 1LTHR 3DCNA 4RK6A 2PFKA 3BGVA 3PFKA 5B6PA 1VXRA 2CFRA 1F2DA 3AGQA 3KAKA 3SGLA 1JMVA 1SUAA 4Z5XA 4FOOA 4B46A 4WY5A 4Z4GA 2GFQA 2O7SA 4V38A 3FPAA 2OHOA 3M9XA 2E5WA 3A3OA 3NM4A 4FMBB 2XRMA 4IMPA 4FYYA 5F98A 3FSGA 4MRSA 4N0EA 3L43A 2UZ4A 3MWEB 1UXJA 3AIKA 5EQTA 2J0EA 1ESDA 221PA 2LTAA 4DC9A 4D41A 2NGRA 1DIOB 4PYIA 4ZREA 3EZGA 4QATA 2Q6TA 5CXUA 2ORYA 3RLFA 3GN2A 4MI9A 2B2NA 2CLCX 3FNBA 5HILA 1C0KA 1S4QA 3S2GA 4Z8XA 4CM7A 2A88A 4UU7A 4ZPJA 3OEED 1PT9A 1IRIA 2JAHA 3IT1A 4H4EA 4JBGA 4Z2YA 3SICE 1GRQA 1OMOA 2BBTA 1XD9A 2OENG 1P4SA 3C8MA 4OQDA 5KOHA 3SYMA 3PVZA 4L08A 4C01A 5KQMA 2V7QA 4IZHA 1E6LA 1K3TA 2VATA 3RAJA 4ARZA 4D46A 4DNFA 3KXIA 1KZ4A 5BUZA 4MTCA 3JV7A 1ZVVA 4IIYA 1BDBA 1YCDA 1GKKA 2BEUA 1ULSA 2VPTA 4IQ8A 3BCHA 5KDLA 1QYIA 3JYHA 2PSDA 5K0GA 5DN6A 3JD3A 3G2HA 3BHIA 4UEWA 3KKPA 5EJIA 2O2DA 3U3ZA 4A8TA 4I4CA 4J29A 4OLJA 1IAVA 3PUIA 3GCZA 2B21A 1HO3A 1XQXA 3QG1A 5EHIA 3O84A 4IIDA 3R3WA 3IALA 1M5TA 2QTFA 4MGHA 1W0KD 2VZLA 3GPDG 4BB6A 3GFSA 1V3UA 1I6WA 1WCWA 3H4TA 3PZRA 4MRNA 2JFZA 3VPHA 1D9ZA 3B2EA 5AW3A 5IKPA 2P90A 3G13A 3TX6A 1AKQA 3L8EA 4OFXA 1ULTA 3JWGA 2R48A 1M6VA 3FTQA 3IUYA 4WA7A 4TTJA 1NP3A 1SXJE 2W4IA 2ZRPA 1CVRA 3KUDA 5EEHA 3VTKA 3WL7A 5JXGA 3EIEA 1RWVA 2H4YA 4PC7A 4N49A 1KYWA 5CJJA 3K6SA 4HH4A 1HQYE 1IVYA 1N0WA 5EJ4A 1QF7A 3JU3A 1EQ2A 4HNAA 1SO8A 3AL0C 2H92A 3BG5A 4AX8A 3IURA 5A2QA 4G0ZA 2I03A 3AX6A 3A4TA 1CUJA 3N7AA 4IS3A 4OL9A 4DV4B 1N32B 1YBMA 1MC4A 4H0CA 4J43A 1BSVA 4I81A 1H1LB 1U8EA 2R7NA 4QTUB 5AJUA 2C8VA 4L6IA 5CLFA 1JHVA 3DAOA 4EL0A 1RAFA 3ABRB 3D5TA 2C99A 4GPD1 4PLTA 1OHHD 2BMDA 4HAWA 1VA5A 1Z2PX 1ZN7A 4G23A 4P7GA 5F5LA 4F60A 4QNMA 3IR7A 1GA1A 1WUKS 3C16C 4MGKR 2DEUA 1A5ZA 3NJ4A 1AKMA 1M5UA 2PVSA 3MF4A 3VKUA 4PSUA 2X9NA 4LRWA 5DHUA 1N57A 1ZUWA 1HWYA 2H5JA 1WY5A 4IDDA 3HJCA 5I47A 4UVEA 2ERYA 1CDEA 2IUEA 4HX9A 5IT9A 3AIOA 3A26A 1IYZA 3IPRA 3VZCA 1R1DA 3PD7A 5FL7D 5DHRA 1XNGA 5DRYA 2GR9A 4KMSA 4B48A 6CHYA 2CSUA 3CJRA 1UKZA 7MDHA 5K7SA 3F9RA 2O4UX 2ZIXA 4Y1RA 1MFPA 4TTAA 4MTLA 3L1HA 2I6UA 4JC0A 3USZA 3N5CA 1NQOA 2C97A 3GLHB 4AS1A 1Y9AA 2PM8A 5U4QA 4BVAA 3V4SA 1Z28A 5BQOA 1QH1A 5P21A 4CV2A 4MI1A 1TU3A 4L57A 3RSHA 2F3RA 3NC1C 4ZZ0A 3VH4A 3LLUA 3SQMA 2VJLA 3ZD8A 1FVXA 3IUMA 1MMFB 2VEDA 1XVVA 3OY7A 2NO4A 4J03A 3I6YA 3S2UA 2WDPA 3GBSA 1M1NB 2DECA 2P62A 4ZOLF 5HFAA 3ZDQA 4EGSA 3L6UA 3SLRA 1KEPA 1RQPA 1V25A 2ODQA 4MWEA 3G0DA 3LH5A 1L4LA 5IKOA 1BWRA 4BRZA 4CUZA 2ODPA 1ZOOA 1FTYA 1XFAA 2F3QA 3G17A 3LSYA 2BEWA 3QWBA 3HCNA 2P6PA 5I7HA 3D8RA 2FPPA 1TEZA 4R1TA 2VWQA 4FYKA 4CETA 2VAWA 1NJ1A 3MTQA 2XUQA 3DC2A 3CZ9A 2UXBB 2AEMA 4C20A 2O2YA 2E4XA 1U5AA 4ZCQA 3R40A 4IS2A 4W63A 1INLA 2ZI5A 3MJHA 1Q83A 1ZIYA 5FUMA 2ZYSA 5ANRB 4ND7A 2LCQA 3FKSD 4ZVVA 1KZ7B 5ELLA 3TR5A 5H9VA 2AT1A 1YA6A 1BVYF 2ATEA 3WHKA 2HYIC 2B36A 1WB5A 3QLVA 2O5RA 3FLEA 4G1CA 4JBHA 4LDNA 1DEXA 4U7TB 1FOEB 2O20A 4YJFB 4GYWA 5A4IS 5L3SA 1ZEMA 2O57A 2EZ4A 4C7KA 1CNMA 1YTLA 4URUR 5IEBA 5AW4A 5KKCA 2WFLB 3SVLA 1X70A 1QRDA 2V1XA 3QMPA 1WUTA 3AEYA 3K2BA 3AG5A 3RFXA 1BU8A 4DJFC 5ICMA 3O3NB 2VH1A 4PAOA 2ZRJA 5ER6A 2X14A 2ZDQA 3MT0A 3L8ZA 1E2PA 1VL1A 2XE6A 4K9DA 4ZT2A 2X58A 1LU9A 1P61B 1GG9A 2UZ3A 4BCDA 3M1YA 2YHUA 5DTRA 1XZAA 2FMKA 4AKEA 1RQ7A 4R2JA 1RLIA 1X0VA 2GEFA 3KFLA 1ODJA 2HGSA 2VHUA 3F90A 4J49A 5IAEA 1MW9X 3KQNA 4G56A 3RHTA 4CG3A 3A1WA 4C43A 3FAKA 4Q1EA 4XFKA 1VSBA 1TYDE 5TMDA 3FB1A 4GPAA 2HF2A 4PS0A 1JJ7A 5FA5A 2OYRA 3SDSA 3H4MA 3MMSA 5BSUA 2FEPA 4G4SO 2ZP1A 1B6RA 4IY1A 1I5EA 5AJYA 3DLBA 3OMLA 2H3HA 4NXMB 2YYSA 4LYGA 3IR6A 1Y42X 5HM6A 5HUHA 4Y2TA 1M1YE 5HKAA 4H4DA 4OHXA 4X0EA 1SCIA 3UUFA 2JFXA 4OJNA 3Q88A 4FHFA 2VJPA 3RRZA 1H1TA 2VS1A 3T35A 5IJ0A 3ZGZA 3LPMA 2J6IA 4IW3B 4GZ6A 4X84A 2AMYA 1AE1A 2PZLA 3B51X 3KSZO 1E2KA 4RK1A 5CLQA 4TS4A 3DO5A 1KRHA 3RVRA 5AW7A 1HF3A 1D2MA 5AVOA 1TF7A 4DPKA 2VSFA 3IX7A 2IHNA 1SELA 2NVOA 3B6EA 3KT8A 4F1JA 1L4BA 4DR7B 2QP4A 3GZTB 3F67A 1XVAA 1QQTA 3IDQA 4QPZA 5SZKB 4D57A 2ZB3A 2F1HA 2CJXA 2EX1A 1TCAA 4IDGA 1W85A 4Z54A 4EHIA 4WECA 4EZIA 2I22A 4X20B 3ZJUA 3BBLA 4XZ3A 2H4ZA 2ADFA 4KYTA 4UD6A 3OFSA 4H77A 4UE2A 1EPUA 3ICCA 2DTEA 1C7FA 4MW2A 2E21A 3UWPA 4LG1A 1IY1A 1VB5A 2A67A 3QE4A 4WK4B 1HE3A 3PC8A 2WQ6A 4M53A 3OQOA 1VG9B 2O8EA 4IYRA 1A5AB 1L5WA 5LP6A 3C8UA 1SKQA 3X0DA 3AOEA 3UAOA 4C9BA 1YQQA 2R751 2FMHA 2NW6A 4PQFA 5KHOC 1J0BA 1RC0A 1RAGA 2Q62A 1LX7A 2XDWA 3FMPB 3ESQA 3MN1A 3TDNA 5ITVA 3BX1A 3ZXSA 4GUDA 4KYUA 4JDUA 2NO5A 4L5BA 4HDKB 1LLUA 2W6OA 4YAEA 4JLVA 2O7VA 1YONA 3OMXA 3RO7A 1QFMA 2B9VA 4XH9B 3F3YA 2OZLB 1ZNYA 2Z5LA 2Z57A 4LMAA 4CF6A 3LT1A 3PUXA 1WG8A 5CDYA 1SWVA 3HH8A 4JBYA 4LBVA 1QVWA 2J1LA 3VR1A 4XWOA 4QBGB 2PPLA 2RAPA 4JMLA 4ZVNA 5EE9A 5HIJA 1ZY2A 3HYSA 4BLTA 4DLRA 1LF5A 3HJUA 4HN9A 2C3MA 4RH3A 1G8MA 5F2KA 3ITEA 5CG1A 3N76A 1EVYA 2IYEA 5AKKA 1ONBA 1CHDA 2IDKA 1KJZA 1UP4A 1XPJA 2ZUTA 1SHZA 3HVHA 5FHQA 3OZAA 3HZHA 2VQ3A 1FDSA 2QPAA 3P71T 3PR3A 3F5SA 4TKUB 4RLSA 3FY4A 1PNTA 4YJ2B 4Z7NB 2OAEA 3OTOB 1FNNA 1R15A 4LXXA 4LV5B 1EH5A 3WGKA 2CHGA 4Y6QA 2OD9A 1PR2A 2DFPA 1P2BA 2QJWA 2AZXA 3LKDA 2PGIA 4RD4A 1N2EA 1MB9A 2OO5A 2P5UA 1A4UA 5F7ZA 1E2UA 2ZANA 3ANYB 1SBTA 5JXWA 4OAOA 3R8XA 8MHTA 4URZR 5EIFA 5GOTA 2IW1A 3U3KA 1Q0SA 3ZDXB 3GLIA 1O87A 3FCAA 5LC1A 3WBBA 4CTKA 2B2CA 1XEXA 2FE1A 2X77A 5AW8A 1T2AA 3HNRA 4M1TA 1VYVA 2E48A 1XMXA 4UHBA 4C4RA 2D06A 4HB0A 4E2ZA 2BGTA 1FSGA 3BD8A 1WMDA 1KPGA 3I8OA 3OVMA 5AI9A 1ECCA 2BGMA 4QBTA 3CX7A 2CHFA 2FQ1A 2GO1A 1LLCA 2XKAA 3X1MA 3HY3A 3S8YA 3D59A 1K66A 1P74A 2FMFA 4JL5A 4O4HF 1X92A 1MZVA 2ECKA 2YWXA 3C3JA 1GAQA 3KOXA 4X71A 1EXDA 2GYYA 4MZXA 4A36A 5BSGA 1S9DA 3G9ZA 2VAMA 4IVNA 5CPFA 4C6TA 1QH0A 1ULAA 1J23A 1ZC4A 3DDCA 2FEMA 4JA0A 1EFTA 1TCCA 2HPHA 3DOEA 1NC1A 3EXAA 4HR7A 1XRJA 3JZIA 4LJAA 5M5BA 1QDEA 3QKRA 3WIVA 5IH7A 5KSWB 4IJUA 2OAGA 2RHBA 1I4WA 4IKEA 1VIYA 3CZ4A 1LUAA 4RGBA 2B1QA 1C8BA 4M2LA 1DAMA 3QSYA 1L4KA 2FHPA 4JR0A 4JLDA 3ESBA 4JB2A 4EB0A 5L40A 3P4XA 3IT0A 2G9QA 3LC0A 4MV0A 1BVHA 2ZUDA 4JBNA 2P30A 4G5OA 4B32A 3AP3A 3FSGD 1PLKA 4TRJA 6REQB 1YUMA 3FI0A 3PNLA 1Z73A 4B83A 2PMDA 3V32A 1CJMA 3RRJA 3RTEA 2OHIA 3EXHC 1NPYA 4J0KA 2E4UA 4JJEA 1JR6A 4K9RA 4L9AA 3I1FA 3O73A 5A1TA 1NVAA 5ITSA 1NQAO 3RFTA 3QPAA 3ZTYA 1E79A 1HY3A 2CWWA 3RBAA 3ZXIA 3K73O 5KTOA 3K71B 4JB0A 3S8EA 1O9GA 5G02A 4YUAA 4XCXA 3EVTA 2P77A 2J0SA 1CQIB 1SUEA 3Q8WA 4PQGA 1V4NA 4RV5A 1RJEA 621PA 4BPRA 1MTZA 2E55A 4P5PA 1NBMA 4C0AC 5DTQA 2HZBA 1HZZC 2WKQA 5KJEA 3ZHSA 4RJTA 5LOVA 1V47A 1WF3A 2AUNA 4C7OB 2FPIB 4PIPA 4K6KA 2QM8A 4EHFA 1OGIA 5DBIA 5JYBA 3WB1A 2I6TA 1ZMRA 3X1JA 4DVJA 3IPYA 2A6PA 4NG4A 1NXOA 2GK3A 5A9RA 5EJEA 1GFZA 2FSHA 4HTFA 2CWDA 2G77B 3OKAA 5DN6D 3G2MA 4J76A 2Q29A 4KNWA 3B7GA 3ROMA 1W36C 3W04A 2RGNC 3C14C 3OJEA 4J3JA 4RBNA 1WUIS 1PT7A 1GDDA 4QFBA 4Z9YA 1GG8A 2XUIA 1LH0A 1A8SA 3H97A 4IKOA 5A0FA 3Q9UA 4JL8A 3ZYCA 5THKA 4A0HA 2Z8XA 1C4XA 4JSYA 4OUKX 4AULA 1K5DA 2V03A 4IIBA 3PTLA 3HFGA 1IQUA 1GV1A 4J7CA 4R1OA 5EIOA 3AERA 4ARVA 3COSA 2AK3A 1W1WA 3PI6A 4M1EA 1ECJA 3N87A 2W6QA 3SAJA 5I8PA 4FWBA 5AVXA 2Y6UA 3AVXA 1G60A 1JEEA 1IHYA 2HM7A 3P9RA 2RH4A 4GUAA 3HU1A 4TUYB 4WUTA 4EM6A 5FH9A 5FWNA 3R9XB 4NZZA 2FJ0A 4F4HA 4AWXA 4I1VA 3DP9A 2NACA 2ZYWX 3UUWA 4Z53A 2OK7A 3M5CA 3S70A 3WMEA 1MDBA 1OASA 3JD1A 1X3SA 1NX6A 5M7EA 3DJYA 1XN4A 1DT3A 2OOKA 3CTPA 1AXGA 5H81A 1E2QA 1E63A 3MJFA 4Q19A 1FFEA 1I24A 4MYCA 4BP9A 2JI4A 3MQ2A 1OYWA 1Z56C 4S1PA 3ZBPA 2BF7A 1EWQA 1QO7A 2X2OA 2X1LA 3AIIA 2E87A 3I05A 3KAQA 4MB6A 3VU1A 4E12A 5HOQA 2FPUA 2WTEA 5LIPA 4NV3A 3QYJA 2Y1EA 4KN8A 4V0NA 1IHOA 2RBEA 5FI5A 3QF4A 4GXQA 3IH5A 4G9BA 1U1GA 1EJ2A 2XKBA 3CCFA 4L4ZA 2O0MA 3Q6MA 2FUG1 3BTOA 3DHEA 2Q6IA 4KN6A 3RVOA 4EDHA 3GRYA 1GDHA 5F2NA 1X1AA 3M70A 2EW8A 3L0ZA 2O8BB 3PIDA 1LC3A 5I4KA 3RM3A 2I1LA 2IYPA 2AQKA 2YUIA 4MIYA 4QUKA 4EO9A 4YHHB 4FSXA 1US8B 2DYKA 3TQIA 4CLOA 4RS4A 2GJ4A 2AMVA 3UKOA 2BEVA 2BHSA 3OM1A 3UJ6A 3VC2A 3KDSE 2PFGA 1V4VA 2CDNA 3F74A 2OVFA 2WTNA 4UHKA 3EPKA 1LBQA 1U11A 1H2ZA 4KNVA 3TR0A 3VO9A 3UJ7A 4NZPA 4KAAA 1FDTA 4OVKA 4RPLA 3C3YA 3ITDA 5I5EA 1WR8A 1EHCA 4M8SA 1AA9A 1TE2A 3NJRA 5CRIA 3PHGA 2CXQA 2FWBA 2GN2A 4PPYA 5CIWA 5EG5A 4NI5A 4DY4A 3UB2A 5J4YA 3JAMA 4W5RA 5IF3A 2YWCA 2R8YA 1Q1QA 3M4XA 4NZOA 2ANBA 4BNTA 1P19A 5K3FA 4J4BA 4F2DA 1PGNA 4MRVA 4HNVA 2HCTA 2XJ4A 1YRAA 1DUSA 5GJWC 3T7KA 3Q12A 1O95C 1OZHA 3OSUA 4IVPA 3HO6A 3Q3IA 5LYJA 4BQPA 3IMEA 4M7RA 3VO8A 4N3CA 3KS9A 1PFVA 2MR6A 3DAPA 1ZN9A 4WAUA 3FOAA 1R5OA 2M1ZA 3CX4A 3QVGA 3EHDA 4X90A 3TUJC 4AN4A 2BFCA 1U0RA 5C8XA 16PKA 1PGOA 3JQBC 2W42A 1OBCA 3HZOA 3HGQA 1HBJA 2WU4A 3FPJA 3P97A 4BZWA 1T2UA 1G55A 4H35A 4LVCA 4O4HA 2GBLC 4FZRA 1GQQA 1I7NA 3ET4A 3P2YA 4MUXA 3LTNC 4K03A 2QIOA 1G3MA 3ZY2A 5LLSA 1QLWA 4KQGA 4DBLC 1A4RA 1QU3A 4ME6A 3I9V6 3DFUA 4G86A 2AC7A 1T9GS 3AW9A 3ONDA 2IUUA 5FR1A 2DPHA 3C7CB 5AW0A 1EEHA 2W70A 2I55A 1R6XA 5C8YB 4NNPA 1LRLA 3RBVA 1V96A 4GEKA 5CA0F 2AR0A 4ZWNA 5JQGA 2HD4A 4I4LA 2J0QA 1P62B 4OJYA 2FF7A 2WHPA 1EFCA 4LEIA 3GLFE 5H5JA 2E4VA 4PYOA 4RQAA 2V4UA 3E84A 2YVAA 1NXVA 2R8RA 3HV0A 4P08A 2GAIA 2DSNA 2QUIA 4LWOA 4X61A 4XLTA 3G0OA 4OQNA 1GPLA 2X9VA 1WW3A 4ZU1X 2COKA 1A7UA 1QH8A 2WTUA 3KYCA 1TJYA 1IZ0A 2JH9A 2P1ZA 1D9XA 3D8UA 3KQWA 4FW8A 4NDNE 4ZKEA 4I1UA 1KI1A 5GJVC 1VG0B 2J87A 4DLPA 4MS1B 4H1HA 2JARA 4JB8A 1QOZA 4US0R 1JKMA 2PLWA 1GZVA 3GGCA 1UPTA 1AQIA 3LBAA 1RJFA 3GXBA 5B30A 4HFMA 4JLNA 4LCJA 5EYPA 4I9NA 3IPCA 2ZJ1A 3P9PA 5TB5A 1TQ6A 5J2UB 2HLDA 1PNVA 3B3QA 3DYVA 3DOJA 3Q9LA 4MS3B 5L3RA 3BMQA 3NT2A 4E2FA 3D02A 4B82A 3PT5A 3TW6A 3C3PA 4CCWA 2M1XA 1ZO8A 4PLGA 1SY7A 1NP6A 3ZQ4A 1D6JA 2IF2A 2ODNA 3ZHVA 2NMVA 2WW8A 1KYTA 4Z7OB 5KYYB 1K3FA 1PT5A 5CT4A 4I50A 2ZXUA 2X86A 1E1YA 5JZVA 4TZKA 2OBFA 1KK1A 3K1YA 4P36A 4YO8A 3U4CA 2NUAB 3VOTA 1LPOA 4NEGA 5ALOA 1VIMA 2C00A 1CQJA 1KRWA 4NMHA 3ZDYB 5IXSA 1J5EB 2X2EA 2OB1A 2IY8A 1ZMBA 2HPZA 2Y8EA 5BQ3A 2JKYA 5EL0A 1TUGA 2P5TB 1EI9A 4WCFA 3GEIA 4PXSA 4ZVUA 3DAYA 2C94A 4BQFA 3SYKA 3VV3A 3WHPA 3WZLA 5J43A 1HH4A 1UBLS 4AKSA 2C5FA 5D8DA 3QXSA 5EWMB 2O59A 1RP1A 4ND8A 4ZO8A 4DRZA 2H63A 5FPKA 4BUJA 4N18A 1SXQA 3IUNA 1D0VA 4QOIA 1MENA 1N1EA 5DYIA 2DPGA 2H16A 4ZJUA 2QJFA 3OQ1A 1LEHA 1VE6A 4M55A 4OAQA 3B9QA 4KH1A 1Y9ZA 2BBOA 4FXPA 3ORFA 1EVKA 2RDMA 3D8BA 1BA2A 2WILA 4MRMA 2C2WA 3C6YA 3MJ4A 3PV0A 5ABPA 3KJFA 3ORYA 4BO3A 4OUDB 3BMNB 1ISJA 4O33A 1DJOA 3NVDA 2HSZA 3CRMA 3G9XA 5DDIP 1ZUHA 3SS9X 4DLTA 4PYRA 1I94B 2H7YA 1X80B 3O26A 2D4HA 2BH2A 2OUKA 4AWAA 4JAVC 1KMCA 1E1NA 3AYZB 4BVKA 3HJRA 5G0SA 1PWHA 4U2FA 2GZAA 4OL0A 1I13A 5G4LA 1AXEA 2VUTA 4B3RB 5EJFA 2CY0A 4G1FA 3MLAA 1DBWA 2HJVA 3DUFA 4IHAA 1MX1A 4P6VF 2LWIA 5TS2A 2Y2UA 3KB6A 5KNLA 3EEIA 1E3TA 2DFLA 2O3QA 3VTZA 3RC9A 4DJJA 5K0SA 1XMVA 5KIAA 1TM1E 2NV0A 1KR5A 3MMZA 3W3AH 2BGGA 3R23A 5IF9A 1JIKA 4KPEC 2ZRAA 4D9FA 5JANA 1YGPA 1RD4A 2O0KA 1S02A 1W4BA 2Y05A 3LSTA 4MWSA 1DC3A 3IVGA 2X0KA 4ALIA 3TD9A 3TD6A 2WWYA 5L4NA 2Q99A 3OEWA 3QGMA 2AN5A 3WLMA 1HFKA 4MUKA 3K32A 4JUIA 3RDPA 4AYWA 2NWQA 2R62A 1NRIA 1M6HA 3KV3O 4H7KA 5BT9A 1CDDA 5CM2Z 1SURA 2RGCA 3N2EA 5EZYF 1P7WA 4NYJR 3PTAA 4G0PA 4YR9A 2X5NA 3H8SA 1N2HA 3UMRA 2WB2A 3CT6A 5L45A 1SCDA 1JVBA 3CEPB 3GAAA 1Y8AA 4NOMA 2JRLA 4IBOA 4O08A 4KO8A 2AYXA 3N2KA 5HZMA 2XZTA 3LT2A 1TF5A 2G5TA 3DAFA 3PBKA 1M7GA 3WLNA 4AJJA 1JG4A 2R1UA 3WNBA 4Z0HO 3QX9A 3PKZA 3E70C 1OTHA 2VOEA 4XIIA 1GFSA 4E6EA 2GARA 3BGWA 2X1MA 3I04M 1P72A 2REQB 4WZBB 4ZVPA 1JHXA 2YYYA 1OZGA 1S3GA 2GS9A 2IYXA 3FMOB 1ZH2A 3A6DA 4YNBA 3PRYA 4XEHA 4ZDKA 3MC1A 4G8BA 1FTWA 2MOKA 5CP8A 4BWYA 3WDMA 4CL3A 3RH0A 2PJDA 2BBWA 4CL2A 2O7RA 1JQEA 1P7YA 5K99A 3HRHA 5AW9A 1Z0KA 1EUDB 1OLSB 4UVIA 3WFJA 1CZKA 4WZAE 5LUAA 1IUPA 2VVTA 4QGHA 1ZFNA 3WISA 4G0WA 4IDNA 4JSTA 2HLHA 3MOIA 1E5DA 4IVQA 3SDBA 1EP2B 1B0PA 2H52A 3L7IA 3A58B 3HBJA 3TNDA 3VNQA 4EJ2A 2RH8A 4U0KA 1Y1LA 3KJHA 2Y0EA 2HSJA 3A06A 5A5DA 3A4YA 2CCGA 3SC2A 2DM6A 2W4QA 3LUHA 5JSKA 1AUXA 1XWWA 4FC6A 4JXXA 2ID4A 1WCXA 4L51A 3A7DA 3HCEA 4YMSA 1W2HA 3X1XA 3ZN2A 1U0OC 3RTGA 2R6R1 1N2CE 1E79D 3BB3A 4LV6A 4ZQHA 3HVJA 3Q6NA 4IOLA 3PC4A 3N1UA 1YMUA 1U2SA 2DP4E 1ZW1A 2I4TA 3K0FB 4XAQA 3ZK7A 2HSDA 2WBLC 5J63A 3ZHYA 1TAUA 3L7AA 1RYDA 1EVEA 3ZUPA 4XPZA 4UULA 3SCZA 3GNLA 3NB0A 4ZIRB 3AM4A 4EVQA 2EBWA 1GUYA 3CRW1 1Z4NA 3EJWA 2YQ5A 3IB3A 4IGFA 3ECAA 4JUAA 4ZVOA 5K51A 3VR4A 1UOEA 3V8EA 2EZ8A 3V33A 4QSMA 4O2LA 2OR3A 2PWBA 2XTAA 3C3DA 3B7PA 5C7YA 1OVGA 1I14A 2QORA 4YYEA 2QEQA 4N5HX 2G4LA 5AXDA 2ZJ6A 2HBYA 4B3DA 4PCUA 2F55A 1J8QA 2GFIA 2GEDA 2I29A 2AFHB 1C3OB 2C2ZA 3GCXA 4UM9D 5EKTA 2IU0A 3EG5A 4MV5A 4MYUA 3VYUB 3ZTWA 4BEVA 2FMUA 1LPAB 4OGKA 3U0BA 2OM6A 2AE1A 4D4HA 1YB6A 3FPFA 1CB0A 1G8GA 1LLFA 3D2LA 5A71A 1PT8A 4K9QA 2I3DA 4QIHA 1OGJA 1U7PA 2Y0PA 1J56A 1ZM3A 1OYOA 3QF7A 4LNUB 2HBZA 2WY2D 3TOXA 1FFCA 2Q5OA 2IK8A 3QBDA 3CJQA 4PAQA 4TT3A 2PO7A 3NWPA 4NAUA 3KVVA 2VP5A 3OURA 4LJYA 4NBSA 3TE7A 5CW1A 1JQ3A 1E2FA 3COPA 3WRYA 1J1UA 4PYKA 5IAJA 4E5KA 2WT8A 1OYVA 5KCZA 4DCUA 2D54A 3E03A 2OHJA 5GONF 1YRHA 2WAYA 1HNWB 2C4HA 4FFBA 2XB8A 1ZK2A 3QOWA 4JDPA 4L8GA 4YCBA 3COVA 5BR8B 2IWHA 1RKQA 3WWYA 4XIYA 1AX9A 2IH4A 3IKVA 3W8DA 2BELA 3D5EA 3TLCA 3ENKA 4UUPA 2W22A 5JC1A 1SHJA 5HBGA 3X1YA 1PNQA 2C57A 1RJ9B 3C4VA 3N9IA 3LHKA 1CF2O 1R64A 5LA6B 4XX0A 4DJAA 2R8OA 4KAJA 1CUUA 3DM9B 3LQ4A 4LE0A 4LUCA 5IC6A 4IOMA 1RE1A 1YR3A 4BNVA 1R88A 4ZMBA 3M2TA 5BW8A 3DVRX 3LECA 2PZAA 3Q3VA 4U7HA 3U7IA 4B75A 3VNUA 3E15A 4I5IA 3O38A 1EP3B 3BD7A 4EATA 1UMBA 1O1YA 2N3ZA 3WLTA 4O5OA 8AT1A 4CMIA 1GNTA 3VNSA 2X13A 4GMHA 4PAGA 1RRMA 4BO4A 1MJNA 4P22A 2G8LA 4Z6KA 1IL0A 1XZCA 3GP5A 2VQDA 2Z4SA 4NENA 2ID9A 4FDLA 2AG5A 2XQJA 4GOJA 4M87A 5FJIA 4QLBA 1G21E 3D0QA 1OYYA 3M5WA 4FS3A 5I7RA 2HSWA 5K0TA 4O2AA 1OU4A 3PWKA 3RC2A 4RE6A 3NV7A 5F9MA 3U9TA 2BFMA 1UFKA 3FWNA 4JWTA 1VJRA 5FEMA 5AM2A 3B6ZA 3C87A 2E4WA 2HXSA 4MYRA 3SPXA 4R9SA 4WLFA 1HDIA 2NO6A 4HWRA 4M46A 5IMBA 3RWMB 4EI9A 2B4RO 3WRVA 2XSZA 5DTJA 2XYPA 3AEUA 4MVJE 3UOAB 5IXYA 2EWWA 3REQA 4WGFA 1JQJC 1JDVA 2C2MA 3HKEB 5ALTA 4DR6B 1QUFA 2VPZA 2W11A 4X1KA 4X8LA 1J07A 1QQ6A 3NPAA 5EZYA 3ZI7A 4Z0PA 4AG3A 4EYQA 1XMQB 3BGDA 4D82A 1OA1A 2V4MA 5LZ8A 4CEHA 5IJ9A 2CV1A 3KLBA 1NF3A 3PIIA 4GVPA 1QH9A 3GLUA 1LVUA 4J6EA 3TOVA 1Z74A 4F04A 4DR4B 1E1CA 1N1GA 3H04A 4I8XA 4NCKA 5E6UA 5LU9A 1WXEA 5TQ2B 4CLDA 1L8LA 1W0CA 2YQ4A 4OJKA 1APBA 4HXFB 4PSKA 2ZVQX 1GR1A 3DT6A 4Q4HA 2RHWA 5JS2A 3JQ9A 1WB4A 2GF9A 1BE0A 4C4XA 1FFBA 1V5IA 2C8JA 5BV1A 4NCJA 4DG5A 1SBIA 5E0OA 1F12A 1YA4A 4XGIA 3SF0A 3SF8A 1DBVO 3WB9A 1QPBA 2R7LA 1JQ5A 3WKBA 3CNHA 5I7AA 5TMEA 4C0HA 3ROXA 1PEDA 1JAYA 3GWZA 5IXJA 1E0SA 1JDZA 1KI9A 1PJ4A 2PYZA 2VYCA 1G0OA 3D6TB 2XVZA 3R6LA 5D3MA 3T3IA 2RARA 2JG3A 5KEIA 1M2JA 2HUNA 2IEZA 3BE8A 1JEAA 1XTZA 5JO9A 5ITZB 5AFSA 3RIMA 1ADGA 1EIZA 3EW7A 2JBWA 3NRBA 1YMQA 2Q1TA 1SBNE 3Q5EA 4XIGS 4Q1VA 5DGIA 1U65A 1H0KA 3OZSA 3HJNA 1KO5A 3DONA 3PVCA 3ILSA 1U9YA 4G0XA 1WPRA 4QO8A 3VC7A 3ZUGA 4BLPA 4LF6B 3V46A 4WBSA 5EQFA 4US2R 1YDHA 1N6OA 4OXQA 4V2IA 4B73A 2YIMA 2WIGA 3DAGA 2NVUA 3G82C 3M82A 5TNXA 3KB2A 4JL6A 1KY3A 2WHYA 1LVGA 3PE4A 3F6YA 2P91A 3OBIA 4HRVA 1F6BA 1Z36A 2PZJA 3U3RA 1ECFA 4BGEA 3AEXA 1WP4A 3QZUA 5AHXA 3W1EA 1QS0A 1GRNA 1AK2A 4L4YA 1HT2E 1ZQ9A 4U7WA 5KPDA 2JIMA 2G1AA 2W2XA 1KSHA 1DUIA 4NEHB 5AUQA 3VKWA 4P4UA 1PEKE 2B5WA 4RVGA 1D4FA 1YB2A 2VO1A 2ZQZA 2JIQA 1BKYA 1GKLA 3NV9A 4M8LA 5DEIA