1XRLA

Crystal structure of active site f1-mutant y205f complex with inhibitor pck
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVFRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 106
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xrlA00
1EB9A 5DYWA 3W05A 2V96A 4KAAA 5ALLA 3WA6A 1AURA 1QLWA 3DQZA 4Y2TA 4MYSA 3N0TA 3IDAA 4UBIA 3WKAA 3IUJA 4RGYA 3H0CA 1U65A 3HRHA 5AM1A 1TRHA 3EBLA 3G9UA 5C8ZA 2Z8XA 2QT9A 4JH0A 5C8XA 3HXKA 4J7AA 4E15A 3G0GA 3O4IA 5AK5A 1XQYA 2XUGA 3AINA 3K9BA 3BXPA 2DFPA 2RAUA 3WA7A 1QIGA 4KAFA 3BJMA 1EDEA 3PICA 2D0DA 2W6CX 3PFBA 1U8EA 3FLEA 1QE3A 4N8DA 4FTWA 3EIOA 3PE6A 5T4BA 2JEZA 5A71A 1XZBA 2CMFA 2ORYA 5A7HA 3DKKA 2XUPA 1Q83A 1WHTA 4BDSA 5FP0A 1CUAA 3WIOA 1R4ZA 3ANSA 4A23A 4ZRDA 3VXKA 5ALZA 2V98A 1CUSA 2XMBA 2DHCA 5AI0A 4DSAA 1MT3A 1XZJA 3LIPA 1QO7A 1U4NA 1R9MA 1H2XA 4B9EA 2G4LA 2X76A 4Y2UA 3QPCA 4BAUA 1TCBA 4CG2A 1IUNA 1FJ2A 3F96A 1EVEA 5K3CA 5I7UA 5FUMA 1DX6A 3H17A 3QBJA 2VAXA 1A8SA 2H9YA 3I6MA 4HVTA 3EF3A 1RYYA 4G4IA 2WUDA 2WHPB 4MYDA 3H19A 2JIDA 1B41A 4BTLA 1ETHA 4BVJA 3MUOA 5IH7A 4K5QA 3K2IA 3BJRA 4IO0A 4U2BA 1K8QA 2WG0A 1VE7A 5AIAA 4BRSA 3N2ZB 5ALGA 1CQWA 4FHZA 1YASA 1AQLA 3QVMA 3BIXA 1TKRA 3UUEA 1IVYA 1BEEA 3RARA 3WMRA 4DLNA 1GZ7A 1N1MA 4WY5A 2IITA 4U2DA 2QS9A 1MJ5A 3HEAA 2QMQA 2JGIA 5J3JA 1C7JA 1FFAA 2CB9A 4DMFA 1XZCA 1HBJA 3H2JA 5ALRA 5AP9A 3C70A 1S8OA 4ZGBA 1CLEA 3VVMA 3IULA 4QZVA 2B61A 3G0DA 2RGUA 1JFRA 3DOHA 1B6GA 3IUNA 2J4CA 1CUBA 3I2KA 4CCYA 5A62A 4TPKA 4HZGA 2Z3WA 1GKLA 4Y2SA 1DINA 1XZKA 2PBLA 4G8CA 4Y2XA 3TRDA 1ODCA 3LS2A 1ODSA 5ALHA 1QTIA 5BWCA 2WFZA 4O08A 2HRQA 2XQGA 3HC7A 5LP1A 4KE8A 2WUGA 2WIFA 6YASA 1BN7A 3FNBA 2K2QB 4K6KA 4CCYB 4HTAA 3G9ZA 4MWTA 1NX9A 2X5XA 4KJXA 2OGZA 3STYA 1VZ3A 1ZD2P 2PSFA 5AKXA 1UOOA 4CFSA 4DTCA 1P0IA 2QJWA 5LZ2A 3AZPA 1UFOA 1T4MA 4IQ4A 5KBYA 2QOEA 3AILA 5FLKA 4IH1A 1CVLA 3DLTA 3LCRA 3R3VA 2OCIA 4MQLA 5JD4A 3D59A 5HQ3A 2WIKA 1ZI8A 1HPLA 2ACEA 5ALIA 3AUKA 1K5PA 1EINA 1JJFA 5ALFA 1CIJA 4B81A 5LZ8A 2OCLA 4U2FA 2OQVA 3AFIA 2H7CA 2WU4A 5HQ3B 1W6RA 3I1IA 2GYVA 4H7EA 1ZICA 3WL8A 4AO8A 5EHQA 2CZQA 3IUMA 1P0MA 1QGED 2Z3ZA 3WK4A 4X95A 2PU7A 5CT6A 4M0FA 4EY4A 3VISA 4B7ZA 3DYIA 4P92A 4NVRA 1OCEA 1MX5A 4HXFB 1R9NA 2QKYA 4UBMA 3VKFA 4KE6A 3MUNA 2XI4A 4UHCA 3VDXA 2Y2UA 3H2GA 4HXEB 2WUEA 3ESDA 3WIBA 4F5ZA 2I03A 1GPKA 5K5EA 1XRRA 3OTQA 2Y6VA 5EGNA 1CV2A 1UK7A 1BRTA 1HLGA 4OUKX 1CUDA 1CR6A 3H1BA 4NMWA 4B6GA 4QWWA 1UT6A 2C0QA 5ALJA 3CXUA 5A2GA 1QOZA 4S0XA 2VEOA 1TQHA 1Q0ZA 4X71A 1MN6A 2ACKA 3TGLA 3C45A 4AMZA 3BWXA 5CMLA 2G5TA 4Y9SA 4FDMA 2DHDA 4X85A 5JAOA 2X8BA 5AM0A 2ZJFA 1CUWA 2I78A 2XDWA 5AOAA 1W52X 1JU4A 1XRLA 5DNVA 2HU5A 3CCBA 2DQYA 5FXMA 4I19A 5AO9A 5JZSA 4PF1A 2RIPA 3R0VA 2GBGA 1HL7A 2P8SA 1VA5A 4BC0A 3Q0TA 2EDCA 3ZWQA 2WIJA 1WPRA 2YH2A 1ZIYA 5ALXA 4J0IA 4G4GA 3C43A 3O4HA 3M81A 1ORVA 4KRXA 3E1GA 4U2EA 1CUHA 1ZI6A 3KSRA 1BS9A 1Y37A 1FFCA 4L0CA 5CH8A 3S2ZA 2XQKA 7YASA 1ACJA 5JZBA 2XLCA 4QDXA 1TAHA 4RE6A 1D07A 1ZJ5A 2C58A 3FAKA 3WWPA 4J0KA 2QRUA 1CUYA 3BDIA 1E8DA 4GXNA 4XJVA 1PFQA 3ESBA 3UMJA 4TGLA 4ZV9A 4KR0A 4G9GA 4UBKA 4Q3LA 2WUFA 4OPMA 3FOBA 2Y2VA 3ED1A 3PUIA 4ZV7A 4G1FA 4AZ3A 3EQ8A 5DNWA 4EY5A 1JU3A 1M33A 2WSLA 3BDVA 4X90A 3HABA 4W9RA 1EA5A 2HA4A 2IIVA 3KD2A 5AOBA 3DS8A 5YASA 3W9BA 1XRPA 2JGEA 1EB8A 1J06A 2RONA 3WK6A 4D9JA 3H2HA 1AC5A 1EHYA 4H7JA 2HFJA 5KWJA 2B4KA 3ZLUA 4ARAA 4QDUA 1K63A 3I2HA 3TJMA 4B9AA 1YA4A 2GYUA 4C4ZA 1ORWA 4YK7A 2OG1A 2YXPX 4DM7A 1CUFA 5HZGA 5AKIA 3D2CA 1XZGA 4X3CA 5HKAA 4EY8A 4AXBA 4BAZA 4OB7A 4PO3X 5D6OA 3EQ9A 4EHBA 3OC0A 4GECA 2PVSA 4ZI5A 2XQFA 3NUZA 4I4CA 1G5FA 3KXPA 5T4FA 3QH4A 4L9AA 1X2BA 1L7AA 3F67A 5AKZA 2XMDA 4AMYA 2XMZA 3OM8A 4QWMA 4LXGA 4KYVA 4E46A 1EVQA 2HA0A 4K2AA 1QIKA 2Z8ZA 3R3ZA 4M0MA 4UBLA 5AKKA 2V9ZA 5BOVA 3WK8A 4DYHA 1N5MA 4H7FA 4QLOA 3WKDA 2HA2A 2HA7A 2HM7A 5ALDA 3V1NA 5JARA 2XT0A 5T4EA 2DR0A 1FFDA 2CKMA 2VF2A 2XQJA 5FRDA 4BTVA 2O2IA 1IUPA 2Y1KA 1LBSA 5CH5A 5IVDA 1BE0A 3M83A 1HQDA 4MWSA 3KOOA 1GPNA 3FSGA 5BWBA 3BE8A 4X7BA 4Q34A 4UHBA 3OURA 1JMYA 3WYDA 5HK9A 3ANTA 2Q0XA 1AUOA 2HADA 1WPXA 1HKHA 3B12A 1VA4A 4G8DA 3ESAA 2GBCA 5DYTA 2QXUA 2WJ3A 4H7DA 1CEXA 4Q82A 3A70A 1KEZA 5IKXA 2PX6A 4WFJA 1A8QA 1XZMA 4P93A 4EB0A 2WKWA 4W1RA 5DWDA 4Y2YA 1YB7A 4BBZA 4EUSA 3K6KA 1JT2A 1U2EA 5K3BA 3G0BA 3CCCA 1AKNA 1UKCA 4G8BA 3QMMA 3WWOA 4Y2VA 4BZZA 2VJDA 3R3XA 3FWHA 2XUHA 5D7BA 5JYCA 3I2IA 4EBBA 4YPVA 3STUA 2J3DA 3SWWA 1XRMA 2PUJA 1A8UA 3O4GA 1R1DA 1A88A 2QZPA 1XZEA 3W9UA 5AM4A 3DCNA 4KE9A 2QUBA 1ZIXA 4KAJA 4OD0A 1CUGA 4DIUA 1QIMA 5HF9A 3DKRA 4J3JA 5HK8A 3DEAA 3C8HA 3A2MA 3H2KA 2CBGA 2AJCA 4BE4A 1KU0A 3ILSA 4DMHA 1DT3A 3MGAA 5AJHA 1N8SA 2WG2A 1YS2X 3QMWA 2R8BA 4J0DA 4JUIA 1JMKC 3R3YA 1THTA 1CRLA 3PFCA 1VZ2A 5JAHA 4AN1A 1ZD3A 5AKGA 5EIHA 5AK4A 2EEPA 4UBNA 4I3FA 2OLEA 1PV1A 1FSSA 3G0CA 3E3AA 2BCEA 2AJBA 3G8YA 3WJ2A 3C6YA 3ESCA 5D3ZA 3IBTA 5LKRA 3HSSA 4RE5A 1OXMA 1FFEA 4XVCA 1CPYA 1XROA 5HFNA 5E4YA 4FLEA 1XZDA 1OILA 4JYMA 5JAPA 4BP9A 1O6GA 5EHXA 1QIIA 5C81A 5CRIA 3DL7A 1IUOA 2C7BA 4DGQA 2PSDA 5F4ZA 5HCUA 4BP8A 3AIMA 1IZ8A 4QNNA 4WCVA 1QO9A 4GEGA 4H18A 5SYNA 4UFNA 3WK7A 3H2IA 1H23A 4ZXFA 5ALWA 4DSZA 3PI6A 4H0CA 4B82A 1DWPA 3WL7A 2XUDA 1IZ7A 4JNCA 3FCYA 2HL6A 2I3ZA 1NU8A 5DTIA 2V97A 1BCRA 1P0PA 1F0PA 2BFNA 3IURA 2DSNA 1H2ZA 3STWA 1C7IA 5CT4A 3OPMA 3ZLTA 3QZUA 3I6ZA 2AJLI 3AJAA 5AM3A 2H7YA 1LPPA 3O9VA 5FDFA 3D4LA 1CFJA 2VTVA 4GW3A 2ZSIA 5ALVA 4B85A 1DQYA 4OB8A 1GQSA 1LGYA 3WKEA 5ALTA 3V1KA 2OGTA 1EDDA 4ETWA 4HS9A 3L1JA 1R3DA 5CXXA 5LZ5A 5BV7A 1EX9A 2O7VA 4BZWA 3C6ZA 4N8SA 5HF8A 2XQIA 2E3JA 1YA8A 4KE7A 5IVKA 4Q1VA 1WOMA 3W04A 5JZ9A 3WL5A 5ALMA 1F8UA 1UWCA 4MEAA 4J0CA 1CUEA 2XMCA 4NZZA 4TVKA 2XB6A 4C88A 1GPLA 5C8VA 1DU4A 5AM2A 2ECFA 2H7XA 3JW8A 4H77A 2JEYA 2ZYSA 5JALA 3FLAA 2RHWA 1O6FA 3WLAA 2GZRA 1MAAA 1AGYA 5CH3A 2UZ0A 3I1YA 5AI8A 5EHZA 2YASA 1MPXA 5AH0A 3RM3A 2WFLA 1XQVA 2QTBA 4C89A 3AIOA 3LIIA 4GDMA 4AZ0A 5SYMA 1EH5A 4FOLA 2ES4A 5AKYA 4FBMA 4M0EA 2FX5A 3STVA 2PSEA 3O9MA 1SCIA 1XQWA 1E66A 4B80A 2DHEA 5JD6A 4XIIA 5EHNA 3QYJA 2XLBA 1F0NA 2QJRA 2WFLB 2PM8A 4BVLA 3QITA 4BDTA 5E4TA 3I6YA 2HRRA 2HU8A 1VE6A 2VA9A 5ALSA 1QJ4A 5DYYA 5LZ4A 2CUTA 3G7NA 1ZOIA 3FVRA 3RK4A 1W75A 1XLUA 3D2BA 1BCSA 1TCAA 4W1QA 4P08A 1MNQA 3FLBA 5LIPA 1E5TA 5A7GA 3WJ1A 3G9TA 1LNSA 1LZKA 4G9EA 1QFMA 1WM1A 1ODTC 4MXDA 1JJIA 5A7FA 3GFFA 4HXGA 4ITVA 3ICVA 1EK2A 2XUFA 3QM1A 1KU6A 4UHEA 3I28A 1CUXA 4OYYA 2WQZA 1GXSA 4QEKA 1J2EA 1GQRA 2YYSA 4AQDA 5JATA 3UUFA 4DMCA 2WFMA 3H04A 5A6VA 4Y2RA 4J03A 3BIWA 1DX4A 5CT9A 2OXEA 5IVIA 3WWEA 2HU7A 4IHAA 3C5WP 5JAUA 4C01A 1XZIA 5K3FA 4WFIA 2C4HA 5FPPA 4BCCA 2PKYX 1BEZA 1LZLA 3AZOA 4UBJA 1UK9A 2JGLA 4J0JA 4FKBA 4AO6A 5AI5A 2RHTA 4C6HA 5K3FB 5KWIA 1YAJA 5CURA 5JANA 4NS4A 5E4JA 4GWLA 4XWGA 5FOQA 4E14A 2OGSA 4A16A 1FFBA 4UPDA 3DYVA 1DWQA 1GKKA 4BCDA 3M3DA 3KWJA 5JD5A 1Q0RA 3ZV7A 2ZYIA 2O2GA 1ZD5A 4X6UA 3G02A 4F0JA 3HACA 1TCCA 4G4JA 3VJLA 2HHAA 4HRXA 4H7IA 5ESRA 2I3DA 4EY7A 5AK6A 2AJ8A 1CUJA 5T4HA 2BUCA 1EXWA 3FVTA 2WJ6A 4HAIA 3Q8WA 2W22A 3O0DA 2H1IA 4BCBA 2JGFA 2HDWA 3RKSA 3GUUA 5I8PA 5CTAA 1VXOA 3DL4A 3DNMA 1XRQA 2OPHA 1SCKA 3QMVA 1Q84A 1LPBB 1YAHA 2BJHA 2JGJA 1XQXA 3ZI7A 4U2CA 4V2IA 4LXIA 1R88A 4LIPD 3V1LA 5H3HA 3JWEA 3O95A 2BGNA 5AM5A 1ISPA 4J0HA 1Y7HA 4HRYA 4PW0A 1VKHA 4N8EA 1QIJA 4FBLA 1BROA 5I9IA 4CG1A 2QR5A 3P2MA 5CT5A 3GZJA 2AJDA 5AI4A 3F8SA 1VXRA 5LYYA 4ROTA 3W06A 1WB4A 2BGRA 1ZGCA 1XFDA 4QDOA 3O4JA 4QLAA 4DNQA 2D5LA 4IH4A 2GZSA 1JI3A 2GBIA 2O7RA 4Y2JA 4K6GA 4C4YA 4F60A 1YB6A 4QDTA 5ALQA 4BAGA 1JJBA 1UK8A 1E3QA 4BC1A 2J4FA 5DTJA 4C87A 1K4YA 1JKMA 2GYWA 4LYEA 2C5GA 5K3AA 2VJCA 3EQ7A 4WJLA 2FUKA 4DNPA 1XZLA 5AKJA 5ALOA 5EIAA 4Q3OA 1GT6A 3G0IA 4WFKA 1UKBA 2OQIA 1CQZA 1HDEA 1VJ5A 1MX9A 2JBWA 3BF8A 2XUJA 5JIBA 4B84A 4GHWA 3A6ZA 2J3QA 4EA6A 1G4HA 1AMNA 1T2NA 4MEBA 2XUKA 1SC9A 1K6EA 2CJPA 5ALUA 4RNCA 2ZJ7A 3IUQA 1MO2A 3IB3A 2ZJ6A 4FNGA 2WHPA 5DJ5A 4UHFA 2ZSHA 2ROQA 1XZFA 5DLPA 3W2TA 1EK1A 1EI9A 1CUUA 3L1HA 3R3UA 4OCZA 3E4DA 3SX4A 2OAEA 2JF0A 2WIGA 4C4XA 4DNFA 1Y7IA 4WY8A 2VQ6A 3GA7A 1W1IA 3T4UA 4AX4A 1ZJ4A 4FMPA 1QIDA 4BATA 2VAVA 4DMKA 3V48A 4FNMA 1C4XA 1XLWA 4X6XA 4X6YA 4BRZA 3I2FA 5IVHA 1UKAA 2WM2A 2G5PA 1P0QA 3FSGD 5AICA 5AKEA 2NW6A 2WHQA 5LLSA 5ISMA 3DJYA 5D3KA 2C5FA 2IX9A 2VJBA 2G63A 4UUQA 2WJ4A 4UHHA 2PSJA 2PSHA 3BL8A 2XMRA 5ALNA 3WYNA 3WK9A 4GI1A 2QM0A 5E2IA 4UFPA 2VSQA 3OOSA 3NOXA 3VVLA 3D2AA 4PSDA 4Y2PA 1YSCA 2DCMA 5CT8A 1I6WA 5EFZA 4FLMA 2DQZA 3HYSA 4GBGA 3R40A 4A5SA 3IA2A 4MJ3A 4ZREA 4CI9A 3VJKA 4CG3A 3OG9A 4Y2QA 5CXUA 1WCYA 3C6XA 4FLFA 3U1TA 3ICWA 3I2JA 3RLIA 4W1SA 2O2HA 3WWDA 3IVMA 2QUAA 4Q3KA 4BE9A 2PUHA 1MU0A 3R41A 1TK3A 3FCXA 1QIHA 1AX9A 1LPNA 3T52A 2ZYHA 5AKLA 1VLQA 2BUBA 3VJMA 2OAGA 1YCDA 4PSCA 1MAHA 3WZMA 1J07A 3C6BA 3A2LA 2VT6A 1MTZA 4FWBA 4X97A 4KRYA 1CUIA 4OB6A 5EI5A 4K6HA 3D0KA 2WLSA 4PSUA 3CN7A 3KWFA 1W4LA 1J1IA 3JYHA 4Z49A 2WU3A 2QVBA 4F21A 2FJ0A 2VJAA 2XUAA 3WKBA 3TEJA 1UOQA 1E8MA 3C8DA 2QXTA 1IMJA 3M82A 1XZAA 2HA6A 4FFVA 4X94A 5FKJA 2WG1A 2BUAA 3F98A 5AK3A 4CIBA 4OU4A 4L72A 1ZGBA 4X00A 1VOTA 1WB5A 3S8YA 4Y7DA 2EDAA 3F9CA 2ZYRA 1XZHA 4BVKA 1R50A 5AHXA 1DTEA 4JEIA 4PV7A 4PNZA 1H2YA 4L3WA 5AOCA 2VT7A 1PJAA 5LKAA 2Y6UA 1QFSA 4RPCA 1Z68A 3FYUA 2JGKA 3GBSA 5DNUA 3L1IA 4H7HA 3NGMA 5FV4A 2WHRA 3ZLVA 1H22A 4ARBA 1ACLA 3A2NA 1BN6A 3WL6A 1THGA 1WB6A 4X93A 1G42A 4CIAA 3FYUB 1RWQA 4CCWA 1SFRA 2BKLA 2WTNA 4AO7A 2XUOA 2JGMA 2RI6A 3SK0A 3R3WA 1G66A 4J0GA 1H2WA 3G9XA 4X92A 1QONA 1X2EA 1X70A 3FYTA 5ALEA 1QZ3A 3WI7A 4B0OA 2AXEA 2ZVDA 4UFOA 2PL5A 3YASA 1BU8A 4AN0A 2B20A 1CUZA 3DD5A 3BF7A 3WWCA 5JADA 4UBOA 2BAGA 2LIPA 1DWOA 3WQHA 4BYMA 3STXA 4KEAA 1USWA 2GBFA 4OSEA 2OCKA 5AI6A 2XUIA 3AZQA 4QDZA 4OYLA 4B83A 4X91A 3U0VA 3H18A 4N5HX 3D3NA 4LYDA 4YX9A 2XMQA 3KDAA 3LLCA 1MX1A 4XX1A 1LPMA 3C87A 4Q05A 4LHEA 2CEKA 4P9NA 4INZA 1F6WA 5ALPA 1QIEA 5KREA 4G5XA 5ALYA 5FPQA 3WK5A 1WHSA 2WTMA 4WDRA 1CUVA 3HZOA 1AZWA 4N5IX 5HKBA 3E0XA 3V1MA 1N5RA 4QE3A 3SC2A 4FFWA 3D7RA 5CBKA 1CUCA 3HLKA 4BB0A 1ZD4A 4PQEA 3PUHA 2ONCA 1UZAA 1DT5A 5AKHA 4KACA 4YASA 5HF6A 4E11A 1E89A 4QA9A 3B3QA 1ZI9A 3IIIA 4W63A 2PPLA 4ZWNA 4IH9A 1LPOA 2PU5A 1EDBA 1SOMA 3AIKA 3DDUA 3I2GA 2HIHA 4EY6A 3MVEA 4MQMA 4H7KA 3F97A 3PF9A 1YS1X 4W1PA 3QPAA 1XKTA 1A7UA 2C0PA 3QPDA 2HA3A 1YR2A 2WILA 2XE4A 5CW2A 1LBTA 5C7YA 3ZPXA 3FYUC 2XUQA 4AB1A 3DOIA 3STTA 1W76A 4LKOA 2VATA 3PF8A 3V9AA 5EIEA 4LXHA 2WIDA 1GGVA 1XRNA 4H35A 1L7RA 3X3HA 1NU6A 1E8NA 1QIFA 1SCQA 3NWOA 4DNOA 5LZ7A 4UHDA 1UXOA 3C5VA 4WDQA 3FBWA 3PDCA 5HF5A 1UK6A 5AIBA 2R11A 1LPSA 5K3EA 5K3DA 1L7QA 1QTRA 3HI4A 3H1AA 1LLFA 2HFKA 2XMGA 2XMSA 3CN9A 5AI9A 3GROA 1MNAA 4U2GA 1RP1A 4OU5A 1UOPA 2FJPA 3GELA 3WZLA 5LZ9A 3WKCA 1XLVA 2Z5GA 3D5EA 4B0PA 3B5EA 1DQZA 3HJUA 5ALKA 5JASA 2B9VA 2OCGA 1XKLA 1LPAB 5HFAA 3LP5A 2HA5A 4GLBA 1TIBA 4EZIA 4JYPA
chains in the Genus database with same CATH superfamily
2X7XA 1IU9A 3RC2A 1RYFA 1T8WA 3MC1A 4HGYA 5JPIA 1EUQA 5JSZA 2Z6QA 3KLMX 1Y80A 4KAAA 3FPKA 4M1TA 3AJRA 4QUDA 3V7YA 4HQ6A 4CM3A 1A9XB 2VDWA 4LK2A 5ALLA 3DWEX 3CMCO 3EMDA 2ZRQA 3T3IA 3TLEA 3DQZA 3I4LA 4RMNA 3WNVA 3NG1A 2OHOA 2ZSKA 1KJJA 1UM9A 5IC6A 5MN4A 2D7DA 3SD7A 4BNVA 5I9BA 1WIWA 4K0RA 4H6PA 1AK2A 1P2GA 2I8AA 3NYRA 3H0CA 3TIGA 4BGUA 1YZKA 3PXBA 1U65A 3DDZX 3HK2A 3ZDDA 3HRHA 1TRHA 4ZOLA 4M22A 2W2LA 3SNKA 1TAUA 4DFDA 3RVDA 4ZO7A 4PPYA 1HXHA 5I7WA 3EXIA 2R6CA 4RM3A 5IEJA 4RWEA 1VRVA 4ZEWA 2ZITA 1L4NA 4OMFG 5DTMA 5TRTA 3AR4A 1AHIA 1VGVA 2YUTA 3TLGA 4CM4A 2WWHA 4ENTA 1MOZA 1SQ0A 1DXHA 3THSA 2Y92A 3OZXA 4J7AA 1ZA1A 3KYCA 3SEFA 3TCNA 4BWVA 2XBUA 4RGVA 4TUYF 4DIEA 5B4VA 1FTGA 1I7QB 3AFMA 1TUBA 3FD8A 2YVKA 4ND2A 2QAGA 1WMSA 4K3UA 1JBEA 3O4IA 3MGKA 4GC5A 4I55A 2Q5EA 3L8DA 3ROGA 4BZZA 2EYQA 3KPYA 2VPQA 1DAOA 2R5FA 3UT0A 1M6NA 3LC2O 3JD0A 3IA7A 3NDIA 4HHEA 2ZYDA 3MHPA 1SHUX 4PNHA 3KZCA 4R31A 4CKBB 3AB8A 1FMJA 4Y1FA 4QT4A 2AE2A 5JCOC 3WB2A 2C1XA 3KVOA 1KQGA 2P2GA 2O14A 2C4WA 1DJLA 1Y8RA 2V7EA 4DXDA 3EX7C 4RZ3A 4MCAA 4F1WA 1WDKA 1OZFA 3UAZA 3ZDXB 1OASA 1QG0A 2EFDB 2EX1A 3ML1A 1M1ZA 4FTWA 5EPEA 2OXTA 3KB8A 3EXAA 3IMKA 3FNHA 1HQCA 3HDHA 1PDVA 1N77A 3SZ3A 4KZPA 3A9UA 1P3Y1 4B6EA 1JXMA 2PKWA 3DO5A 4TN5A 4TS9A 4JUDX 4R2KA 1BX1A 3TW0A 2W2MA 5FTJA 1DAGA 3LUHA 4RJTA 1I7SB 1D5CA 3WIOA 1IEVA 5KYWB 4RHEA 2WVGA 4NE9A 2QMHA 4UNQA 5BUZA 1YC2A 1BJTA 2DFNA 4R05A 1FVFA 2I34A 4UEQA 5EC8A 1U11A 4M4SA 3RVNA 3VXKA 1ABBA 1RIFA 5KYYB 4W5JA 4LDNA 1L5MA 1CQJA 1P72A 1CQXA 3CUSA 1OE0A 1CUSA 3D0RA 4I1YA 2ESRA 1DHRA 2YXBA 4IFTA 1IRXA 2UVDA 4RH1A 4UU1A 1ZUNA 2G0NA 4YJHA 3VC7A 3ZGYA 2OSBA 1XZJA 2AFIA 2AI1A 3HMQA 1WHTB 1X7XA 4RK7A 4E94A 1U4NA 2QNIA 3JZFA 3K2EA 5D1HA 3SE7A 3FSEA 4WZ6A 1Y3CE 3GIDA 3IT2A 4OKNA 5DI3B 2Q2VA 2YV5A 3K0FB 1XVVA 3A1NA 4Q19A 2ECOA 4BAUA 1TCBA 5IXYA 1NVVR 3N6RA 2J67A 3W5BA 1ABEA 4UEJA 1IUNA 2ZB4A 4I4TA 1Q44A 1FQWA 3V8PA 2QLFA 5IVPA 3AU8A 5C1OA 2B30A 5FUMA 5JHHB 4M99A 5ARCA 1DX6A 3FZYA 1CEEA 4IJ6A 3AEXA 3QBJA 3TLJA 2JC3A 2V65A 1A8SA 1LC3A 2H9YA 4XJTA 5BYJA 3AI2A 3R0ZA 4OFBA 4Q4CA 4RLSA 4F8JA 2O1EA 1LKZA 3KQOA 3KYIB 1RYYA 1TPZA 2PCLA 2R6JA 1M2WA 1ZXXA 4G4IA 3W2GA 3N8KA 4B48A 3DFZA 5JSQA 3T4XA 2UZ1A 3NHSA 4FSDA 1H05A 2BBWA 1HFJA 1NVDA 1YQDA 3DVRX 1TYBE 2J41A 1RWPA 2ZT6A 3ZHCA 4MYDA 5ED0A 4GICA 3EZ9A 3QBVA 1TE2A 1B41A 4GPIB 4BWYA 3HKBA 3K8OE 4BVJA 4BTLA 3SZMA 2XT9A 3Q8LA 3O38A 4B3JA 2O2YA 2R6FA 4L8GA 5J59A 3LPDA 3BJRA 4CMHA 3WC4A 3CWCA 3TOXA 4F72A 1K5HA 1H65A 3BDAA 5TGZA 4EI8A 2VAPA 3H5RA 1XEAA 3L49A 1QG6A 4BRSA 1R3UA 2Y1GA 1GSIA 1CQWA 1DP4A 2MU1A 1T8TA 1NRJB 3L0CA 1UDCA 3LUCA 4FHZA 4R9VA 4IW3B 1AQLA 2J3MA 3DEIA 3QVMA 1ZCZA 2QTAA 3WMEA 1CDZA 3BXFA 1IVYA 1T6YA 2VHTA 3EAGA 4H3HB 4GP9A 4X20B 1B6RA 5T41A 3RARA 3IMEA 1N4DA 4CU2A 4DADA 5ELLA 4EJ2A 3G2QA 2R7LA 4P82A 1VJCA 3GRFA 2XEDA 3UKJA 3BMOA 4IJWA 4K3VA 4Y2GA 3RODA 2CMHA 1KFKB 4V0NA 2GF9A 4MKHA 1ATZA 3EGEA 4B73A 2GPBA 1WDWB 2Y1WA 1WVMA 4R6WA 2PX5A 3IV9A 2X77A 1OKKA 4IEEA 4U2DA 3DMDA 2D59A 3OZWA 1MJ5A 1GZHB 2IYNA 5HP4A 1GUBA 2QMQA 2BI7A 1IQUA 2JGIA 2V9CA 2A0FA 1C7JA 3D4PA 2NGRA 1EVKA 4ADSG 4HQKA 4RD4A 1SRRA 3RFCA 1AGRA 3UYKA 4AURA 4DMFA 3MXOA 2CFOA 3AESA 4O2BA 4J2HA 1HBJA 3H2JA 5CHYA 1L7EA 5ALRA 3ZTYA 1U8XX 2CHVA 2P6MA 4BLOA 4Z9XA 4Y9UA 2IH5A 3RVRA 4FQ5A 2OV4A 4Y6QA 5E38A 2F55A 3K32A 3USES 3C70A 5B6IA 4CMKA 4FYKA 3SS9X 2BSAA 4QD3A 2X15A 3AUSA 1YU6A 3H42B 4WA7A 3IULA 3SX2A 4FNOA 3RHFA 1LWOA 2CDAA 2OWDA 3INRA 4G0QA 4WOJA 1K88A 5FBWB 5KWSA 4DLLA 2FG7C 2CVHA 2P6PA 4C7XA 2VOJA 1W9MA 2DR2A 3PQFA 3A6PC 2O6LA 2QJTA 2CVQA 2YCLA 3P4UA 3IEMA 4KIUA 4EGQA 5EY5B 5A0VA 3I2KA 1JJ7A 5E3JA 4BXOB 5C8YA 1DAHA 1BKDR 1TMOA 1I6LA 2R751 3FPHA 1EBFA 2QPOA 2WM3A 3FCSB 3GZ4A 1QHFA 5DCUA 5KJ1A 1RI1A 3ZCQA 2XDQB 2EP7A 2CL6X 4MUIA 4Y2XA 1XZKA 3TRDA 4JI6B 4OA8A 3VO2A 1R7RA 1Q1NA 1U9IC 2HSJA 3I05A 3BFXA 2AUNA 4MVXA 4XSGA 2E37A 2B8JA 4B40A 4MA5A 2C00A 1BXZA 5EOVA 5BWCA 2WFZA 3PNOA 2HRQA 3HC7A 4GF5A 2ZVPX 3BICA 3SKVA 4XEUA 4TM8A 1UJBA 3QNUA 4BX8A 2A2ZA 3TFOA 3CLHA 5BT9A 3X2SA 2TMKA 5F5NA 1BN7A 5C51B 1E1DA 4WINA 1YZQA 1NBWB 1NX9A 4WI1A 4B3TB 3FTPA 3KC2A 4L0DA 1AKRA 1QO0D 1F5NA 3HDQA 4CLOB 2BBSA 5DI9A 4D2IA 1B16A 4XYGA 2PSFA 2ISCA 4K7JA 3DEZA 5AKXA 4TMXA 3M9WA 3VI3B 4OV6B 5A4FS 1H3NA 4F46A 2JCXA 4WK0B 3T9BA 1QHIA 1V7ZA 4FZRA 5JPCA 4ZC8A 2PUWA 3STHA 4PPFA 5LZ2A 1FRZA 4YI5A 2E4VA 2O50A 4C1NA 1QAMA 3KO8A 1QKJA 1WLYA 1ZH8A 3C6QA 1WLSA 4RZUA 1FDVA 4MRRA 4EHKA 5KOYA 3SIXA 1FUKA 1EFVB 1SGWA 3CO0S 3FPAA 4ZANA 4C3UA 4DLWA 4JT2A 4G0XA 5FLKA 4LC1A 1SHKA 3KTFA 4ZK2A 2HU2A 2R1ZA 1X7DA 3LCRA 2GK6A 2OCIA 3S3TA 1YTUA 5BVHA 2WIKA 5KU1A 3JWJA 1P5RA 1X7GA 1PW7A 3IRVA 2EAUA 1TLFA 3TBHA 4FX2A 4JXKA 4G4SO 2ISQA 4WJZA 1G59A 2VKQA 1VIVA 3UV6A 2Y1OA 4C2TA 1C4KA 1MHPA 3QE2A 1K5PA 5K99A 5DGIA 4AYXA 1F2TB 1QTNA 2EW1A 1CDOA 1JJFA 3IP7A 3LX4A 4FIDA 2JJ8A 4J1NA 1Z73A 5AUNB 3MPOA 3C3KA 1ZGGA 1X1SA 3Q3VA 4B81A 3GJ3A 5LZ8A 1SD1A 5FL3A 3AFIA 5HQ3B 1YXMA 2FG5A 1J8MF 2DPLA 4DDVA 2RI0A 1DRVA 3D6AA 2Q5CA 3EXG1 4NJMB 4AUKA 4NCBA 2RHLA 4FOSA 2XB4A 3IUMA 4OKIA 5SZIA 5E6RA 1ZG3A 121PA 3FPLA 1UBOS 1S2IA 4FXPA 3E70C 4XQ0A 4F3NA 2Z3ZA 2UUAB 5EWMB 4F6LA 3FWZA 3QEMB 521PA 1JIUA 3ELDA 1YRBA 4PC1A 4D9BA 1XTZA 2FGJA 2NN3C 2PU7A 4N4AA 4ZMRA 5K0SA 2H2DA 1BMFD 4OFXA 5CT6A 1QFYA 3CVUA 1GAXA 3EVDA 5KVQA 3VISA 4XUCA 1PYDA 3L0IB 3TUJC 1OH5A 4B7ZA 5LD2B 1K7SN 4OA5A 2XOKA 4P92A 2IHZA 3A37A 1OHHA 3PZBA 4FQ7A 2QAIA 2QKYA 1R9NA 1Q5PA 5H5JA 3M5PA 2F8SA 1Q0PA 2ZBPA 3O8OB 5FHQA 1AJEA 4YRAA 1NQUA 3AVPA 1P1BA 4FUQA 4EGFA 5BXYA 3U3OA 1YOVA 2EBUA 1WQ4A 4NAUA 2X0KA 3FBGA 4P53A 1ULZA 4CF4A 4KUGA 4D4JA 3LUJA 5IEBA 4AVYA 1N2HA 3LWDA 4NHEA 2NG1A 2CNDA 4NU5A 5KOIA 1ZK0A 4MCHA 1NNI1 4AKSA 5HRAA 3OWHA 2H18A 3BM5A 4UHCA 5IHXA 4S04A 2Y2UA 2SBTA 4HXEB 5IJ0B 4RKFA 2YXEA 2WUEA 2QTHA 2VYVD 1XKQA 1T3ZA 2KLBA 2ZSUA 3ESDA 4EA7A 1O58A 4KXNA 3UJBA 2CD7A 1PYGA 3T9CA 3RUEA 3UB3A 2XCRB 1WF6A 3LX5A 4F5ZA 1GADO 3ZD8A 1LVHA 1XRRA 1NFRA 4WERA 3WGKA 2HIMA 5INTA 2G1PA 3WGMA 1E3WB 2QX4A 3OTQA 2ECKA 1VG0B 1NN5A 2DBYA 1GYQA 4J1TA 3FWNA 1J4AA 1X39A 4NMWA 4BNZA 3GP8A 1SXIA 1ZJ6A 2VYNA 5EMMA 3T1YB 1FLAA 1I2CA 1ZXLA 5ALJA 3UM9A 3VR4D 3CXUA 3ZTWA 2B92A 2FPSA 3RSQA 1KPIA 1QOZA 4DEYA 2ORED 1RFLA 4ZI7A 5C7IO 3N70A 2BOVA 4RCZA 1QC5B 2HMUA 1Q0ZA 3TOCA 3ZY3A 2AQIA 4DY6A 4WLOA 2NIPA 4BUCA 1Z4KA 4MOWA 3EGVA 1RWVA 4E07A 1ZY2A 4AMZA 2HREA 2IIPA 1RLJA 2VJMB 5BQOA 2WKRA 2JLWA 2IDMA 2VJYA 4YCCA 3CRNA 3WRXC 5IC4A 3LJKA 4TS1A 1WXDA 2DHDA 2E4YA 4ZC1A 5I7SA 3ZHTA 2XNKA 3OKPA 1E0DA 4IFIA 3U5TA 3W7VA 1AKUA 3IESA 2QRZA 3OZUA 2XZLA 1LSOA 3QVGB 4N0MA 2AFHE 2RHDA 5TMPA 3RS8A 1ZKDA 2RHJA 4D4MA 4TUYB 4YRJA 3TRIA 4IBOA 1ZR4A 3SZGA 4MCIA 1RR6A 3P4YA 1TW2A 4A2CA 2PV7A 3PFKA 2H4JA 3PYXA 2X14A 1YJAA 3B2EA 4FGUA 5IM5A 5FFFA 4FMBB 4G0OA 1SCUB 1XRLA 3V8MA 1S3SA 1SK9A 1ZM7A 2ST1A 3MSXA 5EGSA 4CLHA 2H92A 5AHRA 4OREX 1JIJA 1P2TA 3BOSA 3TIXB 3VDNB 4LZNA 1RE1A 1HO3A 1WO8A 2QN6A 3JARA 3O74A 4LQDA 5HJ2A 3IBSA 1J0DA 4BC0A 1FS6A 3DMFA 3JWGA 3Q0TA 3UC9A 1QYVA 2EDCA 1G6KA 3V4SA 4RXMA 3ZWQA 3CZQA 4QXPA 1WUYA 3BD9A 1J1UA 3QKIA 4EFMA 2DEUA 2WIJA 4HGNA 4UAVA 2DTEA 2JI7A 1WPRA 4DV4B 1A95A 2C04A 5JT1A 4IIGA 1KNXA 4RSHA 3T5TA 2V6GA 2G6BA 5B1DA 2Q9AA 3C5HA 1ONNA 1GPWB 4P34A 5FPHA 4BNUA 2EATA 1B74A 1L8QA 2O48X 1KTVA 2UDPA 2PGAA 5KOJA 4RVFA 3CYFA 3GVIA 2H85A 1Q1BA 3QG1A 3SY8A 3ZD7A 1P7PA 1K0FA 5J63A 4RPHA 1N0VC 4QULA 1D8TA 2QLNA 4CE6A 1KMCA 1HRKA 4EH1A 5I7HA 5F2EA 4GOND 1FP4A 3NIFB 1CJTC 3E1GA 3BJZA 3RCBA 4QELA 1XMXA 4JJAA 1ZI6A 8MHTA 3PVZA 1EXDA 5CH8A 5IDVA 1LQTA 3JR7A 3QTLA 1ZNZA 1G5HA 1ACJA 2CJFA 3F1LA 1DKMA 4HF7A 2XLCA 4FDVA 4QDXA 1VIYA 5DK4A 3L06A 4AZSA 1D07A 1ZJ5A 3LUKA 1QCYA 4B7CA 3E9NA 2CC2A 3PDIA 4OY3A 4GD3Q 2QRUA 4KH1A 4MSUA 3SXUB 5IZCC 2VHJA 4G0YA 8OHMA 3BDIA 3CE9A 5REQA 3CNEA 2B37A 2ID8A 2UVPB 3I5UA 1E8DA 3DW3X 4GXNA 2QSJA 4EW3A 2KB0A 3ESBA 5LD2C 1W1WA 4IMIB 3TZBA 1O8CA 1MGPA 2F43A 1AKMA 2HWUA 4JI3B 3TLBA 4YFYA 4U9UA 4G9GA 2IWHA 2EQ5A 1OWLA 1UJ5A 3KKKA 1SN7A 2FFRA 4EZBA 5LWHA 3FUWA 2IV2X 3W77A 4S24A 1ABFA 3DZCA 3PBKA 4KQ1A 3MWDA 4OPMA 4CW7A 1N2EA 1Z5PA 4FFDA 4GNRA 3SE0A 2EL9A 3ED1A 4FYMA 2KLHA 2VPXA 3LHFA 3CVVA 4BLVA 5DSXA 2ZRMA 4KG7A 1A5ZA 1OW3B 4LFCB 2FMXA 2A30A 1FS5A 3DZDA 4OSPA 4U8GA 3TDKA 3V3KA 3MRSA 2ANBA 1EXVA 1RCUA 3BDVA 3EUEA 1PNOA 2VWPA 1K27A 1IYZA 5PNTA 4NEGA 3V97A 3W2HA 1FIUA 1EA5A 4U1RA 1QOQB 3LQ1A 1YCFA 2AZXA 1M2OA 3E5RA 3PGVA 1KY2A 2HRDA 2IEGA 2B7BA 4LJ9A 3DS8A 2J6HA 5C1DA 2YC2C 4FCWA 4G56A 1IY2A 1XWWA 2V6FA 4UZFA 2MYNA 4JN6B 1TZJA 1EB8A 2D5AA 4L9SA 2W70A 3WRYA 4AZ3B 4D9IA 1XPRA 2B3DA 1XVTA 1N0HA 2CHQA 2EV9A 2RGEA 1E3LA 3H2HA 2RGWA 4I5IA 1RQXA 5BMVB 2DUWA 1EHYA 2A9KA 5EKXA 4HNSA 4QNRA 4RUKA 5DXAA 3LWBA 1K8ZB 2W42A 1WNFA 2F1HA 1R8YA 1N9KA 2CLOB 3ZLUA 2Q5LA 5LJLA 3CVOA 4D8VA 3I2HA 4CDGA 3TJMA 1DUSA 2FW7A 4FXOA 1TZKA 3SS8A 2IUSA 1YRAA 1YA4A 2EL7A 1D2GA 2I99A 1E1CB 1FQOA 2GYUA 4BNWA 5EXDA 1JDJA 1XB2A 2PZJA 3OIFA 2YX1A 4C07A 4F5YA 3NVKI 2WZDA 2XNJA 4DM7A 3VU9A 1XDDA 2WYWA 4UMFA 1H6AA 3IJRA 1Z2OX 2C4TA 3BMQA 5IX8A 3AXSA 3IQZA 3RIYA 2W6NA 4H3SA 1M54A 1FVXA 4TWIA 4EY8A 4BAZA 1PR2A 2W2QA 4FYIA 4QNMA 4C0HA 1XNRB 2O8CB 1PJTA 1S9HA 5EP2A 3WXBA 4ZVTA 3KVNA 2BGMA 4UULA 1ND5A 1WD5A 4PHFA 2E4XA 1C9EA 1L3IA 2AEEA 2NZYA 3OJXA 1SWWA 1WEHA 3EZFA 1KBQA 1SVLA 2GEKA 4J0QA 4A6PA 3FXAA 1U8UA 3DZBA 3UATA 2J0UA 1H2BA 4NBRA 4ZZ0A 1GLVA 3NTLA 4DA9A 1Y6JA 4GVLA 4YMTA 1YDWA 4C4OA 4TWAA 3ZXUB 1DBWA 3B85A 3W9SA 4AMYA 2EKQA 2BTEA 1BJRE 1C1XA 4OAPA 3WP0A 4QWMA 3EC7A 1RXYA 1TI7A 3Q4GA 1JIXA 4KYVA 1E3TA 4NPHA 2V3CC 2UUOA 1B93A 1JA9A 5H81A 3WNQA 3O3MB 1SG0A 2FWBA 1VMDA 1XCPA 2Z8ZA 4P83A 4N54A 1EK6A 5JD3A 5AW3A 3KUXA 4HWPA 3RU2A 5A4IS 1OREA 2CLCX 3FCOA 2J9FA 2EJWA 3CQ9A 4UBLA 5AKKA 5E2AA 5BOVA 4Z86A 4BGDA 3H16A 2ZSJA 2WT8A 3ZV5A 4CM8B 3DLHA 1G6Q1 4NYIR 1RWXA 4H7FA 1NZFA 3AB3A 5M5BA 3X1YA 3TLXA 3QOYA 2EJVA 4LRWA 4EMUA 2C07A 4UXIA 4ZHQA 1II9A 2J5QA 3TK1A 3H6KA 5JJCA 3GVHA 4Z4EA 5J4KA 3U7HB 4P3PA 4B1FA 2W6QA 5JJIA 3OWXA 2P78A 3NGLA 3V1NA 4HH1A 4OXIA 2XPCA 4H60A 5T4EA 2WSIA 1NBMD 3D8RA 2VBGA 2CKMA 3EXFA 2VF2A 4PYRA 2E4AA 2PZFA 1F2DA 2EKDA 4D5EA 1ZM9A 1DUIA 1Y1QA 1GCOA 1IUPA 2Y1KA 3PHJA 2NXEA 4JOQA 4GZ5A 1LBSA 2R85A 1CY2A 3ANLA 3A3YA 5CH5A 1BH2A 1DMRA 1HQDA 1SC6A 2LTAA 3H05A 3L07A 3RPEA 1UBTS 4MWSA 5IWAB 1U1CA 3KOOA 4B46A 1GPNA 2OO5C 3H5VA 1NJSA 3IO5A 2J5RA 4DLSA 3GRCA 3GVXA 5BWBA 5LYJF 4B3MB 4BNNA 1OU0A 5I51A 2FW1A 1H85A 4JVNA 4C2AA 2BDUA 4Q34A 1NFFA 4LF7B 3O03A 4IIHA 1ZAYA 2I2WA 3KJFA 2R8XA 1PEAA 2PXHA 1NLUA 1K3TA 4MGYR 1T91A 3ZI0A 2YR0A 3ANTA 2R97A 1NJ5A 2YN4A 3COZA 1B2RA 3HFGA 4HLUA 4OP1A 4PX2A 2HADA 1AXEA 3DGFC 2AG8A 5JJBA 5AJWA 5TS3A 3V33A 4ZN6A 5L4NA 2G76A 3Q7TA 3PQ6A 1HKHA 3DD1A 4G8DA 4JT8A 5DYTA 4WBNA 4PE5B 2FDXA 4R2LA 4JLKA 5JXGA 3C8UA 1SZCA 2WJ3A 2ZYVX 5G3YA 4H7DA 4WBXC 4J3NA 5EJ5A 1CEXA 2FRVA 3E6AA 5EL0A 5IUKC 4Q82A 2J9RA 3A70A 2HWYA 3O2QB 4XX0B 5DM0A 4U3JB 4QBKA 4JGGA 3LZCA 4R2HA 4HTFB 5E3IA 1DDOA 1U5BA 3HZZA 3KM0A 3R5FA 2ZI6A 3S70A 1D0IA 4P93A 4B7AA 2IVZA 2CYBA 2WKWA 3F46A 2JFBA 3D3KA 1NW9B 2ZYUX 3HO8A 2X3YA 4I4LA 4V02A 4C5BA 1JT2A 3EDYA 4KGZA 5B1EA 4CL2A 4MDFA 4FC7A 2RGYA 3EGXA 4UU8A 5KSZA 4RMGA 1M34A 1XCMA 4F6RB 2WE8A 2P2DA 1Z75A 2DWCA 3G0BA 2A4MA 3N3AC 4B17A 1DL5A 2BZ0A 4EFLA 3U1VA 4QECA 5DFAA 5B58T 4KZKA 3MAJA 4OMUA 5FTMA 5LLTA 1PZNA 4NATA 2NUTB 1V9CA 3EVZA 3UPDA 3WWOA 2GZ3A 3MMNA 4HWOA 2AE1A 4OG2A 2PGXA 4BO2A 1U2ZA 1G3QA 3SHWA 3R3XA 3ENNA 1SC1A 1JPJA 4O02B 4NULA 4EGCB 4Z1MA 2ZSAA 4PSAA 3FCUB 4DJEC 4M1OA 3FWHA 4QT0A 3A6FA 3RSSA 3WDMA 1J8YF 2XUHA 2HQRA 5A3JA 4P7GA 1RQLA 3NXKA 4NPCA 2GXAA 3I2IA 1OBCA 3ICOA 4UCQA 1M76A 2R3SA 3HP4A 3AHFA 4DCNA 2BD0A 3IALA 1TU3A 3NQ41 2GAIA 4EBBA 3DBVO 1M2NA 4KV7A 2E5FA 4C7OB 3LTNC 5TQJA 1U3WA 3IKMB 4US1R 1D0SA 5D5QA 1XRMA 1Z0FA 2PUJA 2Q4TA 3I9NA 1RACA 4NDZA 4V2UA 2Q1WA 1A88A 2L0XA 1HYBA 4V0RA 2K87A 4N41A 4DYVA 3LE8A 3PEFA 2IEAA 4C7VA 3WGJA 4OXKA 4J9UE 1QP0A 2WC1A 1E94E 2O7SA 3HJRA 2VQEB 4O1MA 3HBFA 3VR5D 1EJ2A 3GEGA 3R0XA 5KVAA 2CMGA 4AS1A 4UAJA 1UWLA 2AEJA 1UFKA 5CGZA 3UWDA 3R8CA 1BQEA 3ZZUA 4QDJA 1JT9A 2IYAA 4I5DA 4XJSA 3TNFA 4AG5A 5K7SA 1IVSA 2H4HA 3L6BA 3ICQB 4D0NA 5AVXA 3IILA 1Z36A 1P7WA 1CUGA 1GTMA 4DUGD 1QIMA 3QJGA 2WK1A 3CJRA 2HNKA 3EXHC 3L0PA 3ER9A 3EWSA 1EVJA 4A2PA 2JKVA 2GJSA 1M2FA 1P2UA 4E33A 3IIKA 4YCAA 3HWX1 4F96A 5MGBA 3IBYA 1CX9B 3U81A 1MT0A 3N86A 2I7CA 3LC1O 1C30A 3ZDAA 3ILSA 2NYVA 1EFPA 3O26A 3OE7D 3VUFA 5ITVA 4KO8A 1D2HA 1BMDA 3MGAA 3SEAA 5JS6A 2IDJA 4D25A 4BPBA 1N8SA 2RMKA 2WG2A 4L7QA 2IYEA 3VYVA 2DBZA 2JKZA 4E7OA 5I9SA 1M7GA 2P2CA 2GZMA 1T2UA 1NFQA 2ZBQA 1ZH2A 4JUIA 4ZIRB 1GGKA 3UMSA 4GR5A 3X2EA 4HDKA 4Q0MA 1VJRA 4KDEA 3R9XA 2GFHA 1JL3A 1DQSA 1XTPA 3JZAA 1ZD3A 4KHZA 4NV1A 4A26A 3DV9A 3X1DA 4AN1A 3H4VA 3B7GA 1ADGA 2FHPA 4RZSA 3VZRA 4YLGA 3S4YA 1V4BA 2IODA 2QLTA 1R9JA 3GRVA 3O4RA 2FPUA 2EEPA 3GOHA 4BQQA 4I3FA 2HPVA 4PLTA 2EZ9A 4QU0A 4JJ4A 5CB4A 4JBLA 1U1GA 4B4WA 3L93A 1ZGZA 1V1RA 10MHA 2QU8A 3N6XA 1Q16A 2Y4NA 2A88A 1P4HA 1UBFA 4ZDWA 3K09A 2BCEA 2AJBA 5KCZA 3G5LA 2GM9A 2ZT8A 1DAKA 1RAEA 2VHVA 3AJ9A 5A4JA 3WJ2A 4MVJF 2Y77A 2VF7A 4V03A 1BO6A 3L7CA 4E2WA 3INTA 1F8YA 4PCLA 5KNCA 3HSSA 1AXGA 1Q1QA 2AFRA 2ZDGA 3LH5A 2QYSA 1Q3HA 1YVUA 5IABA 1JIVA 4JMLA 4YIKA 1U8TA 4YRMA 2GSDA 2HXSA 2R47A 3UHOA 5BNFA 2PL9A 4LW8A 1GPBA 2R7AA 1XROA 2Y68A 3BTSA 4MAAA 4KREA 4EJSB 1WXXA 1YVPA 4FK8A 5F4BA 1DKOA 1FQJA 1KP2A 1ZVMA 2PDAA 3Q6IA 4I6GA 1MB3A 4KKVA 4FM9A 2PT9A 4NYMR 3PNKA 3F6EX 4P5EA 1WZCA 2FE4A 4B6JA 4BMXA 1O9GA 3MILA 4GOJA 1A9PA 2CN1A 4EYQA 1CZNA 1VL1A 3NBZC 3F7NA 3MMZA 4HYQA 3OZVA 3O3OB 1BVHA 4H27A 5E6SA 3HYNA 1QHXA 5BV1A 1E32A 3HHEA 1YBVA 5HCUA 4GXQA 1PZXA 5A3VA 4EKNB 3BXZA 4PYJA 2DP4E 4HB0A 1X42A 1IZ8A 1AQJA 2FLKA 2OZPA 4RK6A 1SPBS 5DIFA 1QVRA 2WVJA 1JEJA 3AEZA 4QOHA 4YDRA 1Q7EA 3HB0A 3PDHA 1OR8A 1T9HA 1YKGA 3ZU5A 1H6DA 3KPJA 1M72A 2XVAA 3A3OA 3MAGA 2W43A 2AEFA 2BEUA 5ALWA 4OGGA 3ZWDA 1DWPA 1E9RA 3P5BA 4DREA 4RAOA 3BSWA 4TKUA 3ICPA 3I9V6 4FE7A 1CQPA 2AYYA 5JLAA 3PIIA 1XAIA 1SBZA 1VHLA 3OJEA 1H1TA 1WSAA 2HL6A 3GI1A 5THQA 2XCIA 4G6ZA 1HFKA 1SH7A 3L9XA 4M7OA 3PFNA 5HUHA 4ETIA 2ET6A 3FDZB 1ZMRA 4Z3DA 5K8TA 2V45A 1F0PA 5TF4A 1XYGA 3ME5A 2AFHB 2JFGA 2V6JA 2DSNA 3FKSD 2OE2A 5FBQB 5IN5A 2ZAGA 5THXA 5G4LA 4LYGA 3ZUGA 4AL4A 4QO7A 8ABPA 2A5GA 1QWOA 1VDZA 4O4JF 1XO1A 1JIQA 2X7HA 1A9YA 2ZRDA 5CK5A 1VJDA 3KE9A 3RS5A 4D81A 2X4DA 1FNBA 3I6ZA 4QGHA 1OTYA 1FDOA 1TT7A 5DB4A 4YGYA 3VR1A 2P3QA 5AM3A 1C7RA 3S99A 1LPPA 4MVJM 4JBHA 3ENQA 4R01A 4D1YA 4IWNA 3NRBA 1D4OA 1QWSA 4PYLA 2ZSIA 3WTBA 4B85A 1DQYA 1Y5NA 3FVWA 1UZMA 3O8QA 3UCFA 4RV4A 4LUCA 5F12A 4E2FA 1F3LA 5HNKA 1Z2EA 3P71T 4DEXA 3TOZA 5K8IA 1U63A 5CX1A 1GL3A 3DE4X 1LF5A 2R65A 1OFUA 1O5IA 4I1RA 1IN7A 2ZWAA 4PN7A 4FEGA 2HRZA 5F1PA 5JW6A 5BWMA 2GCNA 2RD2A 1A7AA 3MOIA 2GLXA 1KMMA 2YVQA 4P0TA 2AMYA 2B1QA 5SY4A 4M21A 1YJ8A 3P9YA 5BSGA 3KQVA 3FYSA 2DLCX 3L1JA 4KWCA 3A1FA 4MR8B 2Y71A 5C3MA 3Q88A 2BVNA 4RETA 1C0KA 3C3EA 2C7QA 3HKCA 1NVXQ 2ZRAA 3DE7X 1U28A 1OWPA 2FX3A 4NMMA 2VP0A 4IUBS 4BZWA 4YMSA 3MPUA 4RXTA 1MRSA 2HTFA 3C6ZA 5KWVA 2BZ1A 2XQIA 1YA8A 2MTBA 3EJ6A 2ATCA 3DXZA 2DCUA 2CDBA 2X3UA 3BGSA 1E18A 3K5PA 3WIDA 1C8LA 2BPOA 1NLMA 2DQKA 5C4GB 3IPYA 3RFFA 2B1JA 4JROA 1G291 2UVQA 2ZK7A 3GJYA 1AZSC 3TQOA 4KO1S 3BIOA 1IWBB 3SEQA 5LU8A 2CT8A 1TA4A 2B83A 5DGTA 2IYXA 3X1KA 2QMUA 4BZXA 1VCHA 1G1MA 4NZZA 4TVKA 4QVIA 4TLDA 1LJLA 1JW9B 1ICEA 3L43A 3RYIA 3TPZA 1G5TA 4C88A 1VG8A 3FX2A 1P9LA 1QE5A 1P62B 1SHJA 1YB2A 1DU4A 3MS7A 3NYQA 4WZBE 1JDSA 2SHKA 1FUIA 4TT3A 2RJOA 3HUEA 3GQBA 3MGBA 3SIPA 5JI3E 4TL9A 1MJGA 3QF4B 1RWMA 2CXXA 2F17A 5FJIA 1R0WA 3ZHUA 1G63A 1JTEA 2WBLC 4KN9S 1PV2A 1QQ6A 5F7OA 1ZUD1 5DEOA 1TJNA 5JCJA 3VOBA 4LTNA 1U90A 1WZIA 4IKOA 4EJSC 5L53A 4Q4HA 2PWZA 4MZDA 3T7AA 1TM3E 2D2EA 4MWEA 2DC1A 2WJGA 3P0FA 4PZ9A 2PYZA 3HNRA 5DWQA 1IM8A 1GILA 1FBTA 2JBAB 1LU9A 4IDPA 3H5OA 1AGYA 3PB3A 1A5AB 2QY6A 2UZ0A 4N7MA 4E30A 1G9TA 2QQGA 1QDEA 1DKQA 4F71A 5LYJB 3FNEA 4RLQA 4EKYA 1P9RA 3OCYA 1OI3A 2W4QA 4DRYA 3VR3D 2BEKA 1KEPA 4AJOA 4BUZA 3FCAA 3RM3A 4MIOA 4PGFA 2QTBA 1RZRD 1G0NA 3AIOA 4LOIA 2Y8EA 2ZRPA 3LCUA 1ML3A 5CLIA 1E1MA 3VOAA 3V8NA 3OZFA 5JQGB 5SYMA 3P96A 1EH5A 1U2PA 3TLAA 5AKYA 4YHHB 1HOTA 4IM7A 2DFDA 2QP4A 5KU7A 5J43A 3BB1A 4W5TA 5EJ8A 2FZWA 5D3MA 5DKFA 1PNVA 1H2HA 2OFOA 2X6QA 1NNLA 3GDOA 2IUUA 1GKIA 4GDFA 3ZR4B 3L4EA 1HNZB 1WCIB 3LDAA 4OBWA 2BIFA 4DM3A 1V47A 3WGGA 2R7KA 5KSYA 4W5HA 3WAKA 2ZYWX 1IBRA 2XVZA 4IGAA 4PPNA 3IAS6 2ZSBA 1YBFA 1NI4A 2HRRA 2Q6LA 3W6PA 4PCAA 1J5XA 3ASVA 4L85A 5AJTA 1I13A 4Y8VA 5CFRA 1VCNA 3WFIA 1IK6A 3ELYA 2PCJA 4KDRA 4EF4A 4DR5B 1WW2A 1IBMB 3EVNA 2X1HA 3H0KA 2REXB 3ESXA 5KCMA 2CUTA 3W5JA 2QX7A 5I6DA 1BX3A 5HRCA 4ZCPA 3IP3A 1KKLA 2QLMA 2BF4A 4MB0A 1C41A 1D2AA 2VVTA 3RK4A 2C77A 3RO7A 2FWJA 3OA2A 2WT9A 4KLAA 2ZATA 4GOLD 4EHJA 3HM9A 3P9CA 1DC5A 3W3AD 1QYCA 3B82A 3U7JA 5A4MS 5B37A 5E4FA 1TYAE 3ZX4A 2XHZA 4ND8B 1IY8A 2XWPA 4NCHA 4UVDA 5KNDA 4LKRA 1F6DA 4OOFA 5HCNA 5A7GA 3QE9Y 3OMLA 4IIJA 2Z8YA 1SUSA 1LLQA 2ZROA 2O2XA 4RSGA 2FDCA 5FWAA 1SB9A 3CU5A 4G9EA 1QH1A 2GTPA 3KQTA 4KTTE 1SKBA 1DC4A 2Q8PA 4MUNA 2JFWA 1C5KA 3IUSA 4GZMA 4WX2B 2BKVA 4UHKA 4DARA 1KI3A 1ADYA 1VCOA 1XTQA 2V4MA 3LW8A 4PBSA 1VCMA 5LQSA 3E7DA 3UHPA 1RRVA 2QN8A 3AOGA 5M04A 1ZHFA 4OHRA 4L2IA 1EK2A 4IMRA 1QP8A 2VL7A 2VA8A 3CGGA 3KV1A 2XUFA 2ZZMA 5BR8B 4PN3A 2GWHA 3CPEA 5IKOA 3ETJA 4B5KA 4G2TA 3UK6A 4DN6A 2RE8A 2GHIA 2W6ID 2OXIA 1E7RA 4XB2A 2GILA 5BWNA 3V4RA 4GKBA 2RGNC 2UKDA 4J07A 1J2EA 3TINA 2FOXA 2NUAA 2HQ1A 2XCSB 1MZPA 1KDRA 3W1VA 2HHJA 3NOVA 1CVIA 4PVDA 4XARA 4F4UA 3ZCRA 4EWLA 4EYOA 1U0BB 4LMAA 3JQCA 3LBIA 4HAZA 3GGJA 3IEKA 4Q6BA 1X1EA 4CV0A 5LP6F 4YJ2A 3D7MA 3OQHA 4CKXA 3R3JA 1KF0A 5KINB 2JI6A 4DLKA 3PCXA 1GPYA 3N28A 1JDPA 4LCBA 2GPSA 5B4UA 2Q0QA 4AJ1A 1NG1A 2CL5A 5IVIA 5IHPA 4LWZA 4KSYA 2BHNA 2OHGA 1M9NA 1T26A 2O1WA 3K0AA 3QA3E 3SZUA 3WLTA 3WWEA 5C80A 4HZUB 1DG3A 1AS0A 2NYAA 3GFSA 3IOMA 3JD4A 2JFHA 1JR2A 1Q95A 1F4PA 2FMKA 2QTLA 3E2MA 3HCCA 3M33A 1DJQA 5K3FA 4ZP1A 1PEDA 4IDBA 5FPPA 3RU3A 3SDZA 5IJZA 2QPTA 4ZA2A 4AROA 5K0CA 2Y93A 4I2NA 1KYXA 1ORHA 3TQFA 4BCCA 4TKVA 5KQMA 1PV4A 2IZZA 4JYAB 2VYQA 3FLMA 3TFQA 4B74A 3LA6A 4H1HA 4QHSA 1CNMA 4P22A 1K4MA 1Z15A 1GTZA 5EIOA 4FKBA 4PYOA 2H9AA 3PFGA 4QPZA 1WAMA 4OOEA 2OCPA 3ZNPA 1ECLA 3QFHA 5KHAA 2MYPA 4DW8A 5CJ2A 4M0LA 4C6HA 2PT7A 2IZ0A 3OF3A 4NS1A 3ZY5A 3F90A 2D1TA 4HUTA 1H1LB 1HDGO 1G21B 2IDZA 3EDRA 3EIEA 1U0FA 3O75A 4M36A 2K7FA 1BSVA 3GJTA 3P9RA 1OYVA 3KT3A 3A6LA 2PS1A 1RYMA 3HH8A 3SQDA 1MC5A 2BYTA 5FOQA 1HI9A 2VR1A 2HEIA 2HK9A 3T7IA 1FFBA 3H1PA 4XCQA 2I4MA 3UPUA 3VYSB 3E8MA 1GKKA 5IJ9B 2NV0A 4OJTA 1GHTA 3M3DA 4IZOA 1SU4A 4K86A 2WR8A 3HLYA 1Z2DA 3KWJA 5B58C 1KE2A 3AU9A 2QL9A 5JS1A 2DAPA 2EWVA 4ALKA 1A2KC 2IQ5A 5CVEA 3MK31 4JSYA 1LI7A 5ADVA 1B26A 3S81A 1SM4A 1DV1A 4X6UA 2UYHA 3QKSB 1QRSA 2FN8A 5TJHA 3VZQA 3WLSA 2V1UA 3TI7A 4DGSA 2HHAA 4LYYA 1FU7A 2O0MA 4H7IA 2P5SA 2I3DA 2FKNA 4EY7A 4O8CA 5E6UA 2AW3A 2GNPA 5K0ZA 5BQXA 2NZVG 3RUDA 4WUVA 2GPWA 1S2MA 3IVRA 2OBXA 3ECAA 5IT0A 3CONA 3ID6C 1PQPA 4CCSA 4UJ5A 2ZKLA 1CUJA 5AJXA 1MEJA 1FP6A 2QRNA 3D7LA 4NOKA 1EXWA 1SHZA 5AHWA 4EPXA 1Y7PA 1N4AA 5TVGA 3AF2A 1NKTA 3B20A 3MJTA 3QYPA 3Q8WA 4GPAA 3AF0A 4HAIA 4HFMA 5I9TA 4DR1B 4CHTA 2FN9A 4TYWA 1HG0A 3EZGA 4ZQIA 5G2OA 5TE9A 2I1LA 4CDNA 1XMVA 4V0LA 4X8OA 3DFUA 1UJ4A 1E4VA 2GB4A 4DHEA 1QM5A 1KEKA 3RYFB 5FNVB 3FPBA 3UW1A 4OGFA 4Q3CA 2TSYB 1AKTA 2H4ZA 1TZCA 2A0WA 5B4TA 3WLFA 3GUUA 5K6RA 2GUWA 1F8XA 3HB1A 4GMDA 4PFSA 5FBKA 4AF8A 5I8PA 5KDOA 2HJGA 5LIRA 3AUAA 2D5IA 3FKJA 3W4JA 3LCJA 4D82A 2G4CA 4O4LF 4O2AB 3NFYA 3JQ8B 2IUEA 4MB6A 5AUPB 2C2MA 1BGWA 1MEOA 3EA4A 2I80A 5TV2A 1DOAA 1Z5OA 1PWEA 3EGIA 2CXSA 3PA8A 4WNAA 1XG5A 2B2NA 3TGWA 3J7AC 4O4JB 2JGJA 2JIMA 2WF9A 3M4JA 4W9NA 1X74A 4XPZA 4XSHA 3VR5H 9LDBA 2Z5LA 2AHRA 1U0TA 1XQXA 1EPUA 3QYFA 4G1MB 1J0XO 5IH3A 3T99A 4Q66C 4Q3BA 1U0EA 4FS8A 1KMHA 1V4VA 1H4QA 1Z3CA 3KXKA 4ZVLA 3C3WA 5E0KB 2SICE 3PEWA 3QU5A 3RK0A 1N6RA 4J4TA 3O95A 1ZH6A 2BGNA 3FGOA 2ZYAA 5JUWA 4NFYA 2WWWA 4M98A 1UBJS 1Y7HA 2NO4A 3IELA 1TO1E 3PU6A 4RBNA 1L7PA 4TYMA 4M1WA 4URZR 4LYAA 2C7GA 3Q2KA 3RRXA 4WESA 2J59A 4G5YA 4EZEA 1CS0A 3TR6A 4X65B 4JBWA 1KMQA 1TD1A 3A31A 5FA6A 2FUCA 3E15A 4FBLA 1SKQA 4TXNA 1SVIA 1Y6GA 3KLPX 1Z5UA 1OTHA 4HDRA 4D42A 1CZUA 3P2MA 1UC9A 4LTMA 5CT5A 1E2MA 5CFQA 4BBPA 4LBWA 2MSLA 3I45A 3ZTTA 2UAGA 3DJFA 4ALMA 3OAAD 1GSHA 3VX3A 5FYQA 1VXRA 5LYYA 5FUQA 4PHHA 1PG5A 4NZOA 1FU4A 3IDZA 2V7UA 4PINA 1WABA 3PUXA 1EUDB 1WPQA 5BW4A 2OO7A 3EGDB 4N5LA 2BGRA 2C2ZA 4HQFA 5ILOA 2O06A 1ODJA 2PA3A 3ILYA 3ZWNA 3D7KA 4QDOA 1T9GS 1EP1B 4DNQA 3BE6A 1AHPA 4CKBA 4ZKEA 4FMCF 1U0SY 2B1IA 3PR2B 4X41A 3I61A 3NWJA 4C4YA 5HIAA 1GTVA 2GXUA 2CLEB 5KJFA 1F12A 2BGIA 2X9GA 1Z39A 4PM4A 7ADHA 1JEYA 3QX3A 4E88A 2CB0A 1E3QA 3OCJA 2J4FA 5DTJA 1YV9A 4QYWA 4I81A 3TM5A 1U9IA 3LDHA 3LUBA 3KT6A 1GU0A 1EWYA 3V9PA 4GSLA 1MENA 3IEVA 1BQ4A 1HWYA 2WNHA 5EJEA 1HNNA 3CUUA 2OHJA 7GPBA 3AVTA 4WJLA 1QO0A 3EGOA 4DNPA 4YAJA 2GLTA 4C3VA 5KC8A 3AEKA 4MPJA 1QPBA 1J8QA 2YNMC 1W87A 5AHKA 3DE0X 4YREA 5HIIA 5AKJA 4DILA 4CLRA 3A3KA 5EIAA 4Q3OA 4ICIA 5MN5A 3KB2A 1O96B 2BFCB 2I1QA 3KXIA 3VC2A 2IXAA 2YNMD 2IZOA 4IKEA 2G8NA 1WVGA 4YA6A 3IDFA 1BXRA 2GN4A 2ZS9A 5DHTA 2V6IA 2WAOA 3THYA 2KYRA 2OECA 3C3PA 1I2BA 3D6JA 4QXRA 5DU2A 3T5GA 2XUJA 3HEMA 2XJ9A 4CR7A 2I2BA 3G23A 4JBIA 4QBTA 2UUCB 4G2NA 4LX8A 1USVA 2ATIA 2YFYA 3A6ZA 4GAEA 1FSPA 2WIBA 2HMTA 4C43A 3PUYA 4HY3A 4ZXPA 1M7HA 3II6X 4F85A 5B30A 2XYVA 1SZPA 4BB6A 4A73A 2A3RA 4M2LA 4KQMA 4RAQA 1AZLA 2JS7A 4IL5A 3CX8A 1K6EA 4V0SA 5FF9A 2OK7A 3LKBA 5H7XA 1O4WA 2W2XA 4RQAA 1DAFA 1XTVA 4DQKA 4RNCA 4B8YA 5ITZB 3EAQA 4K2HA 1G7CA 5LNK1 4IOJA 3EVGA 5L45A 3IJ5A 5K05A 2ZJ7A 5JNSA 5KYUB 3QY9A 5H68A 3NPMA 3UB2A 3R7WB 3W90A 3IB3A 1N25A 5EQFA 3WBFA 1XA3A 1J97A 3MWKA 4KK3A 1M2JA 4L15A 4MUJA 1OLUB 3AVVA 4OQDA 2JFXA 2TECE 3WJ7A 1YS6A 2XYGA 3RUIA 3IAXA 4JITA 4KQGA 5DYIA 2P2ZA 5HUQA 3QVKA 1CUUA 3CPSA 2G72A 3DTTA 1BMFA 3L1HA 2ZWIA 3R3UA 4FZ5A 4DQVA 4DUPA 2PXAA 3DMYA 3E4DA 4QL3A 1C7ZA 3WMXA 3GCZA 2XB2A 2OAEA 1G7TA 2BWJA 3FTCA 3RGGA 2Z2KA 4L73A 4DNFA 1Y7IA 4MA0A 3GNQA 2W8BB 1H8HD 4JA0A 4XLTA 3P9ZA 4GMHA 1W1IA 3CVXA 2YRFA 4WRRA 1JJVA 3L40A 1O1YA 3OSZA 1BXGB 1QIDA 1Z0UA 4X20A 2LCIA 1JQ3A 5EVCA 2C1ZA 2MR5A 4JQYA 1JHZA 1UBUS 5KYGA 1R0RE 3N05A 1QF9A 1UZUA 2ZRGA 2GMWA 2IPAB 5FA5A 2GEFA 3B6ZA 1SPXA 5IMSA 5EZQA 1QU2A 1F14A 5EP4A 3TTXA 4ER7A 2G67A 2ZWOA 2Z1DA 4X6XA 4LSZA 2Q3LA 1GZ6A 1JEEA 5DHRA 4P3XA 3K9GA 2HHHB 2VYVA 4WAUA 4WNCA 1COWD 2CJWA 2WM2A 1G55A 4OGKA 5E95A 3V7WA 4KWTA 3CTMA 3H5AA 2NPIA 1KAQA 3I64A 4TOIA 3GIWA 1L6IA 4RY2A 2AZDA 3UO8B 2A5YB 3E1SA 2D3WA 1A9SA 2FXVA 5D3KA 3LUPA 2OHHA 3L5KA 2D0OB 2WJ4A 2P75A 3D8NA 1N3IA 3M1AA 4UHHA 3PV0A 4AJNA 3UMBA 1KJWA 1ONOA 1D6NA 1QDUA 2P5TB 2JBHA 2X8JA 3BQMB 1IM2A 1YMVA 2AMLA 3IRUA 2DHRA 1PQUA 4LJLA 3QI2A 3OMWA 3IVGA 4TKLA 5C1BA 5CM2Z 1QMPA 1WMDA 1KNQA 2G7ZA 2IL1A 3PTLA 3DHVA 1QNFA 4Y6LA 5FI5A 1L9KA 3SU8A 3VR4A 1HGXA 2Q3EA 4WOCA 5MHTA 2AMVA 1KYZA 2R4UA 2DXIA 4HT3B 1ZJZA 3FR7A 1GNPA 2P5YA 2XIQA 4QODA 2FYTA 2ZUTA 3OPVA 1I7PA 1HV8A 1R4MA 2DUNA 3OJOA 2ZIEA 1PT7A 3D6MA 4JLAA 4G24A 4RS4A 5DBEX 2AQKA 2P9HA 3OZEA 2XDQA 4EI7A 3HDJA 4REMA 1GIAA 2CL0X 1Y48E 4ENUA 1UBHS 4Y2PA 1YSCA 2DCMA 1RKXA 4OGLA 1I6WA 2MYUA 1J5PA 1VBFA 4OQQA 5BSUA 5LP6B 2PJDA 2G0AA 4YFVA 1RRCA 1SXJD 3NUGA 4TLMB 1QP7A 2GQ0A 5JBIA 3DHWC 3IA2A 3OPXA 1NURA 2W6OA 1B6TA 2PY6A 1K7XB 5L3QB 3PCTA 4HX2A 3TTUA 5BSWA 1VPLA 1VJ1A 2ZR9A 4Y2QA 2P4EA 2O3QA 3U7QB 4C0SA 5AW8A 4N3CA 1XMJA 1ZN8A 3D4BA 5CXUA 4CLOA 2OA0A 1WCYA 4B2YA 4LSMA 2ZIVB 3VR2D 2Q1UA 3DONA 2H3EA 1KOGA 4F1KA 1GRVA 2WM9B 3ICWA 1WUIS 2D1SA 2CNWD 2NZ8A 1D04A 2GPAA 2BDTA 2PKRA 3KFLA 4N3NA 2NLOA 2WW8A 1IXRC 4W1SA 4LC9A 1G9SA 2R66A 4TRNA 5FAKA 4JC8A 2HUNA 1TVCA 3LRTA 3NBMA 1E2QA 4E0BA 3FYCA 2GGSA 1MRNA 3FROA 1BCRB 3CPHA 2QUAA 4Z2YA 2DLNA 2JJYA 3AO0B 3DC7A 4IRUB 4B3SB 5C35A 1RLMA 2A7QA 4ZO9A 3BQNB 2QORA 3UANA 1E77A 1E9DA 3K0CA 4IWYA 4F2DA 2FETA 4JL8A 3D8UA 3G88A 2YV2A 5TGTA 4NCAA 4BNYA 4DIOA 1FRNA 1XXHA 4GUAA 5GPBA 4F3TA 3VSEA 4RTNA 2W83A 4MO9A 2G8LA 4AJ4A 2BFDB 4JT9A 1UAAA 1NIJA 2GK3A 4YCJA 3IKJA 3WHKA 4YUAA 5JZMA 2GEVA 1P2SA 3PNLA 4NSNA 5LB4A 4B6SA 2F8TA 2AFIE 5EJFA 3ITKA 3T52A 3VNBA 3IC5A 4IJMA 1FJHA 3D8SA 5CX4A 3BHMA 3CS3A 3DOOA 3UYLA 4D3DA 2G28A 3VKHA 3GL9A 4CGZA 4KYIB 1X77A 4L28A 3EOBI 1QZZA 4QUIA 3ISVA 2A84A 3Q40A 4UTPA 4B47A 2Q5QA 5B3JC 1YS9A 1T9BA 3EFHA 1ZZGA 3P2OA 4ZU6X 4EG6A 4XVUA 2VT6A 2ZSEA 2R4TA 2P8JA 1HY3A 3LT4A 3OM0A 4F45A 1EGAA 4KIFA 4WT7A 4RPGA 3AEQB 2EFHB 1AF4A 1UH5A 1SULA 2QIOA 4OB6A 821PA 5EWMA 4IIDA 5EI5A 2VDNB 2X0IA 3EDOA 3AXTA 2WLSA 9LDTA 3SPXA 4RHXA 3CN7A 1IY1A 3KWFA 5TXGA 3QIAA 1D8AA 1CFZA 3N75A 2O0KA 4M76B 1WXHA 2OBMA 2YWFA 3O84A 1FFYA 1CK4A 1J39A 1BYIA 1JAIA 1FTWA 2C2GA 4F21A 2CLHB 5F73A 5EJIA 3G82C 1HT3A 3WKBA 3HV0A 1XDWA 3FPSA 1VI2A 1YRQA 4ZOLF 3D9QX 2CGEA 4GMXA 3WQSB 4HNTA 2Q3JA 1DQNA 5DW3A 3O8OA 1P9OA 3C8DA 4FFNA 2FPGA 4C30A 4ETNA 5KIAA 3M82A 2JGDA 3SM9A 4UC0A 2B34A 4UQOA 3GGCA 2GZ1A 4XW2A 4ZVMA 2YVLA 2WG1A 2W6PA 3R3SA 4WLNA 3D1JA 4ME6A 4OU4A 3M6IA 4FYHA 5HDQA 1ZGBA 4ID9A 1ZUIA 3CRZA 5EJ2A 1ZDMA 2DZDA 3BA6A 4YWJA 4LZPA 4QQKA 5EIXA 2BGLA 3S8YA 1NYRA 4IXWA 3J81k 2ZYRA 1FFSA 1WXGA 4KQ6A 1WXEA 4A2WA 5JCXA 1XZNA 2CE2X 4L0QA 1NXWA 2I3BA 1K7FB 1JQDA 3ND9A 4RYDA 3SQMA 3OF2A 4NPAA 1VSTA 2VHQA 3JR3A 3NV9A 4ZCRA 5CVJA 1DZIA 4N1AA 3SBXA 1A0OA 3AF3A 1H2YA 3UPTA 1MA0A 4W9MC 1FXUA 2W2OA 2BHLA 4P3YA 2QR3A 5FO1A 1HDCA 3HKEA 2WE7A 1GJRA 4LMPA 1PJAA 4P3OA 1LWNA 2QP9X 1LDYA 2R1TB 2NO1A 5LKAA 2Y6UA 2EZ4A 1VGQA 1X1QA 3HY6A 3JVIA 1ZMOA 2ID9A 5J4LA 3IE1A 1QGUA 1UPUA 1Z68A 1AN0A 3GA5A 4NK4A 1MXFA 4XFJA 4R2XA 1B15A 1DEOA 2OEPA 2ZPAA 3GBSA 3G8DA 2DWOA 1PL7A 4IS3A 3SDBA 4EA8A 3HVJA 4AW9A 5LP6C 5A0FA 4C4TA 2A0YA 5I4BA 4EMTA 3BTVA 3CG4A 1H22A 1L7OA 3N2NA 2D1RA 3CZ9A 3U4IA 4ARBA 5M7EA 1ACLA 3A2NA 3ZZ1A 2PUDA 2EJTA 4UTRA 1PJ3A 1N33B 1II0A 2EP5A 3GRAA 3RUHA 3KQNA 3DW1X 4X66B 1K68A 1W581 2HLDD 2L2QA 1RWQA 1XVIA 3FYUB 3QVGA 4PIMA 2XNDA 3UKDA 1FDSA 2BKLA 1UBSB 4N12A 4TUYA 1BDJA 1PX0A 3VSAA 1P7ZA 1T2VA 4CM9D 2OBNA 2VRCD 1G66A 4QPNA 2XTNA 3DV0A 2PZAA 5JCOA 2PV0A 3ORRA 4JJFA 1DCMA 1QONA 4X92A 1X2EA 1X70A 5B1SA 1QZ3A 3F5MA 1B0AA 2IY9A 1N2GA 2EOAA 1Y82A 1D2RA 2AXEA 3FDXA 2OKGA 4LN1A 1QBKC 4GLOA 1USGA 4UD6A 4ENWA 2PL5A 4BN0A 1WV1A 5A3QA 4KXYA 1MR3F 4ZVKA 1FDWA 5DM60 1AGXA 1JALA 1YZUA 4FMCB 4Y18A 5DYNA 3NM6B 2PMEA 3EC1A 1K7EB 4OIFA 1C4OA 4D4GA 3BJEA 1XWIA 1QFJA 2XNHA 2VDPB 4WCFB 4RK4A 1IHDA 3NASA 1OTXA 5JADA 1C7QA 4MPTA 1EGHA 2M32A 4DIKA 4QJ3A 2BAGA 4DR6B 1NW8A 1SCBA 2XOXA 1PX2A 5CTJA 1KDZA 4WECA 3R7FA 3STXA 4KEAA 4PAGA 4TYYA 1DHTA 2GBFA 4GKJB 2GEJA 2OCKA 3OZAA 3DWIA 4E1AA 1PGJA 2FZLA 3VYWA 4AP6A 5JXWA 1NBMA 3RBAA 3AZQA 5GOTA 4RCVA 3N1UA 1QFXA 2GARA 5FAXA 5CLFA 3MAAC 4EVIA 4K9OA 1OLXA 5K6AC 1DNPA 2HPZA 1JTFA 2IE0A 4IG9A 2BH9A 3D3NA 2BV3A 4LYDA 1OXKB 3N7TA 4ZT3A 1EESA 3P94A 1Z2PX 3TXXA 1GZ4A 4JB3A 1L7VC 2YHUA 3FZGA 4ZYWA 1MIOA 2KHZA 1QYWA 2CEKA 5KOHB 1WCWA 1XU9A 1M1YE 4WXMA 1JAHA 3SXUA 4KX3A 2OO5A 3F5FA 1EGMB 1YJCA 5FQOA 2R6ZA 3Q72A 2E87A 3DDHA 4CUZA 3SF8A 4D7AA 3PRYA 2QMEA 3W2IA 3E22A 1Y34E 2PTGA 3W0LB 2C59A 4UTOA 4ENQA 3WNZA 3SLRA 4G5XA 4BNJA 5JH7F 4XCXA 1RQNA 4U7HA 5FPQA 4MS1A 3U4DA 4A1OA 1AS3A 3I1JA 4PIPA 3AL3A 3HZOA 1T4CB 5A02A 3R7BA 3E0XA 2W9XA 3EVEA 2PZMA 3R20A 4RMHA 1EX7A 3HVHA 4YH1A 5FLEX 1CF9A 4GMGA 3D7RA 4G1CA 4WLVA 3FFTA 1UCFA 1T3SA 2OCDA 1P5HA 4WVLA 4AIIA 4F8YA 3BH6A 1JQEA 4DC9A 3C3DA 4W4TA 3WLOA 2Z5FA 3IAFA 4IO1A 1GLNA 3NMUF 3WGQA 1TT5A 1ZD4A 4GRAA 4JEHA 2FP4B 1WD7A 2QRMA 2XF8A 5ELXA 1Z2AA 2QY9A 1M5RA 3A9TA 4D3XA 1UBNA 3QQ5A 2PAAA 4H6XA 2Q41A 2JRCA 5FIUA 3R7NA 1O2DA 2MSKA 3H9BA 4FONA 4W8OA 5L3SB 3WAJA 3GEMA 2YQ4A 3MWJA 4LVCA 2POQX 3QY0A 4UPEA 4DLRA 3HVKA 4I8DA 4E11A 2FVYA 1L1RA 2D2FA 3A6GA 3D6NB 1NWHA 4KBYA 1YZNA 3T7DA 3ABQB 4OAQA 5MFPA 2BBTA 5CFLA 1U8FO 1RBMA 3LRXA 3ETHA 4MUBA 3B3QA 4NG5A 4KR9A 1KDOA 1YUBA 3N5KA 2E2WA 3GCXA 2FK7A 3TL3A 4L78A 3WP1B 3ZWCA 1FDIA 5JYEA 1HDXA 3BK2A 3KJGA 4NF2A 3OM1A 3VYUB 4IH9A 1LPOA 2PN1A 3ASYA 2B7LA 2ZAOA 3LT5A 1EDBA 1MEEA 1R37A 3DDUA 3I2GA 1NQTA 1E2NA 2HZBA 3A14A 5FTLA 5J5VA 2F62A 3MVEA 1I1NA 4DDMA 4TRRA 3VC3A 3GAZA 4H7KA 5AVYA 1G19A 1E1CA 3PR3A 1NZJA 4TZKA 3ZWVA 1HH4A 5IKMA 2BFMA 3CE6A 3QPAA 3T41A 1N1GA 2XBMA 2C0PA 4EKGA 4DV7B 2CXHA 4M1YA 2HA3A 1HDRA 1ZH0A 1YR2A 3UT6A 3L05A 4FKMA 4V38A 4YRGA 1G20B 1WW8A 3WB1A 3GLFA 3H5LA 3FYUC 5DBFA 3UWSA 3FHJA 4F84A 5ICMA 4HVAA 4IPTA 1AK1A 4EOGA 4RF2A 2I8LA 3VR5A 2XODA 1PNQA 3STTA 1UODA 1L5VA 2GHQA 3RS4A 3U7IA 1UXIA 1KZ6A 1UQRA 2OV1A 4BVFA 3LU1A 3Q0IA 3URKA 3VMMA 2G07A 1W76A 3FHLA 1S0UA 3NH9A 4U5QA 4BLSA 4N5MA 4BX2A 4BFVA 3V9AA 4P1ZA 4C7MA 1TGVA 3JAKB 4LXHA 2UUPA 4F5DA 1JLHA 3EBPA 1Q1EA 1F0KA 1JDTA 4H35A 3LXUX 4RA6B 5HXAA 3OZRA 1MMFB 4HFRA 4K8OA 1CSEE 4FILA 1G8HA 1BJKA 4R83A 3CNQS 3C14C 2NOAA 3D8BA 1IG3A 1DIBA 4HNVA 3BXHA 1E2IA 1OBHA 1ZKMA 4K6MA 3K73O 2PGIA 3EXHA 5L7YA 5DM70 4U6QA 2SCUB 3RKRA 8ATCA 3B13B 1ULHA 2J3KA 4J94A 3EA0A 3MTIA 4CM8A 4JODA 1RAIA 1IWPB 2PVCA 4A6XA 4MWZA 1KA9H 3DMRA 3BX1A 2JLCA 3MYRA 5LQMA 5K3EA 2QJFA 4Q7MB 5K3DA 1FZQA 2F3QA 4PXAA 5IJAA 1E63A 2XWSA 1KE1A 3C7DB 4LSWA 3ZZNA 4C22A 2XMGA 4AKTA 2QSZA 5TPWB 2C96A 2IPNA 3LT1A 4AMGA 2AN4A 1C80A 1Z4IA 5EESA 5AI9A 4LXXA 5H02A 2Z4TA 5JXIA 4KHPB 3NT2A 2Q29A 3EQZA 2XZPA 5GZ6A 1LK7A 5JNWA 2GEBA 4NBTA 1SQ5A 1MAWA 5I45A 4AI6A 2FJPA 1UXJA 4P58A 3SZLA 2Y27A 4NU0A 4LMBA 5LZ9A 2HHCA 3D4IA 3ED5A 3CZAA 5L3ZA 1F2UA 4X24A 2Z08A 2J87A 3CLRD 2EGUA 2FDRA 2HMAA 2IIBA 1KJ9A 1G5RA 2A58A 1BW9B 2Q45A 4B5LA 4K6FA 1XLVA 4PLWA 4BWGA 1I0LA 2FPKA 1T5SA 1DQZA 1VPVA 1WXIA 2EFEB 3GR6A 1E7YA 1LBIA 1MO4A 1N92A 4S0ZA 1IL0A 1BU5A 1HK7A 1WXFA 3R8FA 4REQB 1RBQA