1XRLA

Crystal structure of active site f1-mutant y205f complex with inhibitor pck
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
290
structure length
290
Chain Sequence
b'ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVFRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 106
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xrlA00
5EIEA 2XUJA 1ACJA 1VA4A 1CUWA 3R3YA 3SC2A 3OOSA 3WIOA 5CMLA 2HRRA 1UT6A 1ZD3A 4N5IX 1ZJ5A 1CVLA 1WB5A 4W9RA 2WTNA 3BL8A 3QZUA 1AUOA 4FLFA 3BDVA 1CUEA 4Y2UA 1ACLA 4UFOA 1WB4A 4U2BA 5AP9A 1IUPA 2C5FA 4L9AA 2D0DA 1THTA 1BS9A 1QIGA 3T52A 3ZI7A 2OLEA 3PF9A 3DKKA 4LXGA 3G0DA 1MN6A 2O7RA 4BTVA 4X00A 3PF8A 4FTWA 1ZI9A 1LZKA 4AMZA 2Z3WA 1SC9A 5IKXA 2XUQA 3FLEA 2QJWA 2XUKA 4X6YA 4EY5A 1ORWA 5EIHA 3WKBA 1MO2A 4UHFA 1FFEA 1ETHA 3F98A 1LPSA 5AH0A 4B0OA 4X71A 1N5MA 4Y2SA 4BZWA 1IUOA 4X85A 1H23A 2PL5A 4M0FA 4MYSA 1VJ5A 1N8SA 4C88A 4A23A 1R9MA 1BCSA 4MXDA 1CUIA 3HC7A 4ZWNA 1SCKA 4PF1A 1E89A 2V96A 2HIHA 3DKRA 4EY8A 2Y6VA 1FJ2A 1K4YA 2C0QA 3C87A 4BE4A 5E2IA 3DOHA 4EY4A 1Y7HA 5ALUA 4OPMA 3WL6A 1BU8A 1TRHA 4J3JA 1MTZA 1BRTA 4FOLA 5AKYA 3NGMA 2PSJA 3VVLA 4DYHA 1ZIXA 4BC1A 3G8YA 2OGZA 2QTBA 5HK9A 1YSCA 4YASA 3HSSA 2QZPA 3A2MA 3O4GA 4NVRA 4H0CA 4DIUA 3M3DA 3V1NA 2QMQA 1PV1A 3QVMA 1XZMA 1CUCA 3VKFA 1U2EA 4C01A 3G0GA 4DMKA 5A6VA 5FPQA 3IIIA 3R3ZA 1QIIA 2HM7A 4G1FA 4TVKA 4ETWA 4CG2A 2XUGA 5AM2A 3H2KA 3V1LA 4JYMA 1GKKA 2FJ0A 3B3QA 2XMSA 4JH0A 4HVTA 5LZ4A 4X95A 5ALSA 1GT6A 3W9BA 5ALOA 2BFNA 3BE8A 2CKMA 3C6ZA 3WWPA 4FLMA 2HRQA 3HI4A 2XUHA 2VSQA 1HLGA 3DD5A 5AK6A 5ESRA 4ZI5A 5CH5A 1XRQA 4IHAA 1PJAA 5JATA 4Z49A 4Q82A 2EDCA 2Z8ZA 5C8ZA 4BATA 1YB7A 4BAZA 1TAHA 1JMYA 5AIBA 1CQWA 1QONA 2YYSA 1RYYA 1DTEA 1UOPA 4ARBA 5JARA 1D07A 1E5TA 4DGQA 1JKMA 2PU5A 3FYUA 1YS1X 5HK8A 5AK5A 1QIMA 1EI9A 4L0CA 4UHBA 1R88A 3KDAA 4H18A 4EHBA 4WCVA 3F97A 5HFNA 3G7NA 4RNCA 3M81A 2RHWA 3ESCA 4G9GA 3WWCA 4Q05A 4P92A 2RHTA 3WKCA 5ALQA 3ZLVA 1LGYA 2Q0XA 2JGKA 3G02A 2DCMA 4G4JA 4MEBA 2HU8A 2PSHA 4E11A 5D3ZA 2ONCA 2PSDA 5A62A 3HRHA 3WK5A 3W06A 2RI6A 1P0IA 2FUKA 1PFQA 4B85A 3WJ2A 4OU4A 4KJXA 3H2HA 4BZZA 3PFBA 3WK9A 3TGLA 5D7BA 5CT9A 2XMZA 4U2CA 2Y1KA 5K3DA 1JJIA 4G8CA 1CUSA 2E3JA 5ALNA 4KR0A 2PSEA 1JT2A 3E1GA 1K8QA 2X76A 3C8HA 1MPXA 1UFOA 1H2WA 5CURA 4EY7A 3ANTA 5CH3A 3WK4A 2X5XA 1R9NA 1A8QA 2JGEA 3FAKA 3GUUA 1BE0A 2JIDA 1E8DA 4QDXA 1MX1A 4FNGA 3C43A 5ALLA 2OQIA 4EZIA 1UKAA 1WPXA 1SOMA 5HKBA 1QIDA 1L7AA 2FX5A 2WLSA 3I2IA 2WIJA 3V1MA 1U65A 5CH8A 4H7IA 5ALRA 3I1YA 1GGVA 5LZ9A 5JAUA 3PE6A 1XZIA 3QPDA 4ARAA 5ALXA 5JZSA 4UBMA 1TK3A 1BCRA 1LBSA 5EHNA 5DLPA 1M33A 5LKRA 3H2GA 5A7FA 1CEXA 1XKTA 3WYNA 3JYHA 3FSGD 4IO0A 4F60A 2WUEA 2WHRA 2VQ6A 4UBJA 5C7YA 1ZJ4A 5KREA 2WHQA 5HQ3A 1AX9A 1R4ZA 1QFMA 5JASA 3WWEA 4H7JA 5AI9A 3PICA 2VTVA 3MUNA 4QWWA 3A6ZA 3FCYA 5CXUA 1AGYA 3HEAA 5AM5A 1HL7A 1A7UA 3DQZA 3RM3A 1VLQA 2FJPA 2BGNA 3ESAA 3DL4A 3AZPA 4K6GA 4Y2VA 2AJBA 2NW6A 2GBFA 3M82A 4FBMA 4BYMA 3AZOA 3H18A 2K2QB 1C7JA 3F8SA 4CCWA 4BCDA 4C4XA 3C45A 4GDMA 4QEKA 2YXPX 2I3DA 2HA0A 2GBCA 1YB6A 4AN0A 1O6GA 1LPMA 5HZGA 5FRDA 1CUJA 3QPCA 5KWIA 2QXTA 2G5PA 1MJ5A 1GKLA 3NWOA 5ALYA 2HA2A 3VXKA 3WL8A 2HA5A 4PSCA 2OGSA 1EDDA 3PFCA 3C6XA 5ISMA 3EQ7A 4P93A 1CUVA 1LBTA 5ALHA 5JZ9A 3FCXA 3H19A 4X7BA 4J0IA 2WKWA 1A8UA 5AKEA 5JYCA 2WIDA 2XDWA 5AICA 5ALTA 4Y2QA 1YS2X 2OCGA 4OYLA 5IVDA 3IUJA 5AM0A 1CRLA 1AKNA 1XLVA 4UBNA 3CN9A 4CIBA 3FSGA 2JGIA 2EDAA 3QMWA 5CTAA 4DNQA 3QBJA 1E3QA 4FWBA 2WUDA 3K6KA 3O4IA 4NMWA 3ICVA 4CIAA 4X91A 3S2ZA 5AM4A 1X2EA 5IVHA 3NOXA 4P9NA 2C5GA 2QUBA 3WWOA 3V1KA 1K5PA 3E4DA 2AJCA 4QNNA 4LYEA 4YPVA 4ZXFA 1QGED 2IIVA 2ZSHA 2QUAA 1DX4A 5C8XA 4AMYA 3IDAA 1HKHA 3QH4A 1CUXA 1DT3A 4JUIA 4ROTA 3DLTA 2W22A 2CBGA 4E14A 3Q8WA 3UMJA 4U2DA 5DYYA 4IH4A 4K5QA 4CG1A 3EQ8A 2VEOA 2HDWA 2WQZA 5D3KA 3D2CA 3B12A 2XUPA 1VOTA 1WPRA 5JAOA 2GYUA 5A7HA 1JI3A 3WK8A 4BCCA 3K2IA 1XQVA 3WKAA 2Y2UA 4UHEA 5LZ7A 2GBGA 1X2BA 3DEAA 2W6CX 4I4CA 4AN1A 1P0MA 2JGFA 4H35A 4U2GA 3DNMA 3R3UA 3I28A 2BKLA 5JAPA 1TCAA 2WHPA 5ALMA 3SX4A 1ODTC 1P0PA 3IB3A 3C70A 4HZGA 2B4KA 4PW0A 1E8NA 5IH7A 2QKYA 2WSLA 3EBLA 3BXPA 4LXIA 4AQDA 1S8OA 1UKBA 2J3QA 3R3XA 5AKGA 3GZJA 3T4UA 2JEZA 2PM8A 4BBZA 4J0HA 3ESBA 5ALJA 3C6YA 4V2IA 4E46A 1UZAA 3ESDA 3RK4A 1J1IA 2XUOA 3H0CA 1XQYA 4HXFB 4G8DA 5CT8A 3D3NA 2QXUA 2Y6UA 4H7KA 4ZV9A 5FDFA 4X6XA 2HHAA 2C7BA 4KE6A 4AO7A 4ZREA 1AC5A 4AB1A 1U4NA 4F5ZA 1NX9A 3G9UA 5DNUA 4MQLA 2WJ3A 5K3FB 4ZGBA 1XKLA 2JBWA 2AXEA 3R40A 2V98A 2XQKA 4PO3X 4JEIA 5CBKA 3DJYA 5DTIA 4HRXA 4FKBA 5ALGA 3FNBA 3PUHA 4F21A 3BDIA 3I1IA 4G9EA 1XQWA 1LPPA 2R11A 5AKLA 2BGRA 1XZHA 4CG3A 2YASA 4MEAA 3JWEA 2LIPA 1QIJA 1VZ3A 4BVKA 5ALEA 1DWPA 4BRSA 4M0EA 4J03A 4PSDA 1P0QA 4OB8A 4J0DA 4QDTA 3HABA 2H7YA 1ZI6A 1BN7A 3AIKA 4RE5A 2DSNA 4C4YA 1W6RA 3RKSA 3WL7A 3X3HA 4PV7A 5AI6A 1EDBA 1WM1A 2HA7A 4GHWA 4B9AA 4G5XA 4RGYA 4OYYA 2PSFA 1GQSA 5DJ5A 4A16A 3BWXA 5AHXA 1LPAB 3KD2A 4ITVA 2QVBA 1FSSA 1KU0A 1QE3A 3G0CA 1T2NA 3F67A 2AJ8A 1Y37A 5AKXA 3LP5A 4DNOA 1AURA 4UPDA 3U1TA 2WFLB 3SK0A 4AXBA 2QT9A 5HF5A 2GZSA 5T4HA 1DINA 4UFPA 2PU7A 4DSZA 1UXOA 3KXPA 3GFFA 4DLNA 2ACEA 2B20A 1QTRA 4O08A 2VAVA 1XQXA 3STXA 4QLOA 2PBLA 2Z3ZA 1XZLA 5AI8A 3FYUB 4W1QA 4L3WA 3WIBA 1DQZA 2XQGA 4NS4A 5HCUA 4KEAA 3WLAA 5AKZA 3C5VA 2GYWA 1LPNA 4QDOA 3KWJA 4KAFA 1EK1A 4D9JA 3AIMA 3VJKA 3A70A 2PPLA 2XE4A 3GELA 1QFSA 2WG1A 2HFJA 2HU7A 1DQYA 3E3AA 1O6FA 4BDSA 3A2NA 5AO9A 1X70A 1ZIYA 3AIOA 5LP1A 1G4HA 3A2LA 4GW3A 1MX5A 3FBWA 3U0VA 4BC0A 1QIKA 5T4EA 2XMRA 3E0XA 4B82A 5K3AA 3BIWA 2V97A 1ZOIA 3LCRA 1XRPA 2DHDA 3ZPXA 1ISPA 3O4HA 1ZGCA 1MX9A 2VA9A 3W04A 2JGJA 5JALA 5AKIA 2CZQA 1XRRA 2VJAA 2CMFA 2J4FA 3TRDA 5FXMA 1FFAA 1OILA 2XQFA 4Y2TA 4EBBA 4KRXA 3AUKA 1B6GA 1QJ4A 2PUJA 4X90A 3ZV7A 4E15A 1N1MA 1WOMA 2VJBA 5LZ8A 5AIAA 4G4IA 1MAHA 2PUHA 2VF2A 1NU8A 5FLKA 3C6BA 2B9VA 3CN7A 5AI4A 3V48A 2IITA 2DHCA 2XQJA 2ZSIA 4L72A 4C89A 3GROA 2O2IA 3QYJA 1QO9A 1EVQA 3BF7A 3FLBA 4BDTA 2PVSA 3H2JA 1UOQA 4GLBA 2ROQA 5LIPA 1XRLA 2WIKA 4CCYB 3ICWA 4MQMA 4INZA 4U2EA 3WK6A 4B9EA 2RIPA 1TIBA 3UUEA 1EX9A 4J0KA 1LLFA 2P8SA 4LIPD 5ALZA 5HKAA 1MT3A 4Y2YA 1J06A 3DS8A 3O4JA 1RP1A 5DYWA 4P08A 1CIJA 4MJ3A 2R8BA 1AMNA 4H77A 3AINA 5K5EA 5AI5A 2Z5GA 2CEKA 3D5EA 4UHHA 4XJVA 4KE7A 3DCNA 1H2ZA 2HU5A 4Q1VA 5FKJA 3FYTA 2WUFA 3W9UA 3D2BA 2VT6A 1VA5A 1YR2A 3FYUC 3KSRA 3KOOA 2I78A 5E4YA 3WKEA 1F8UA 1KEZA 3HYSA 2QJRA 5LZ5A 2DQYA 3L1IA 5JADA 2WU3A 1KU6A 2WIFA 4UBKA 2YH2A 4X6UA 5K3CA 4F0JA 4K6HA 4HAIA 3WWDA 3IURA 1J2EA 1EK2A 4G8BA 4N8DA 2I03A 4Q3OA 4MWSA 4TPKA 1ZD5A 3V9AA 2OCLA 4QDUA 2HL6A 3DOIA 1VKHA 1CUYA 2DFPA 4OSEA 3QMVA 4FFVA 3O9VA 4FMPA 1BN6A 1XROA 3WZLA 2VJCA 1L7RA 4KE8A 3IUQA 2Z8XA 2WU4A 4IQ4A 4XVCA 4DM7A 1E8MA 4XIIA 1SFRA 1WB6A 4B6GA 1QOZA 4X94A 4X3CA 1IVYA 3C8DA 3G0BA 2G4LA 1R50A 1IZ8A 1MAAA 3PI6A 1CR6A 3N0TA 1GPLA 4DMCA 1C7IA 1Q84A 3YASA 1CQZA 4YK7A 5J3JA 5JD4A 5DYTA 5D6OA 3AFIA 4AO6A 3G9ZA 5BOVA 3VJMA 2XB6A 1EB9A 4EB0A 2ECFA 3HZOA 3WYDA 1ZICA 1Y7IA 5ALIA 2BJHA 2ACKA 3LIPA 3UUFA 3NUZA 4OCZA 3ZWQA 2OAGA 1QIEA 4PQEA 2JGMA 2PKYX 4Y2RA 4AO8A 2BUBA 3OPMA 5KWJA 4DNPA 5CT6A 3DYVA 3H2IA 2BCEA 1G66A 3C5WP 4MWTA 4DSAA 5AM3A 4AZ3A 4C4ZA 1FFDA 1W76A 5HFAA 3F96A 2DHEA 1MNAA 5AKHA 1UK6A 1UKCA 1W52X 1CPYA 5ALWA 2H9YA 2HA3A 5DNVA 3G0IA 4LHEA 1G42A 4DMFA 2VATA 4WDQA 1CV2A 1B41A 2ZYIA 2BAGA 3RLIA 1LPOA 4Q3KA 3STYA 5JANA 2V9ZA 4GBGA 1JU3A 2QM0A 3HACA 2JEYA 3O95A 5AKJA 3STUA 4BE9A 3WQHA 5I8PA 5T4BA 1GZ7A 2PX6A 3R3WA 4H7DA 1YA4A 4W1SA 3OC0A 3PUIA 3VVMA 5AOAA 1JMKC 2WHPB 1H22A 4FLEA 2H7XA 1HQDA 3H1BA 5DNWA 5DWDA 4J0GA 4NZZA 4GWLA 2ZYRA 4OD0A 2GZRA 7YASA 1IMJA 1L7QA 1CUHA 1HBJA 1WHTA 4QWMA 3QMMA 1UK9A 1XZAA 3PDCA 3FVTA 1SCIA 4EA6A 4BRZA 1JJBA 3WJ1A 4WDRA 3N2ZB 3BJRA 1XZEA 2HA4A 1XLUA 4UBIA 2J4CA 4IH9A 1CUBA 2DQZA 1JU4A 5AKKA 1SCQA 5EHQA 4OUKX 1XFDA 4Q34A 2ES4A 5AJHA 1EA5A 2ORYA 2OQVA 3IUMA 3EIOA 1T4MA 2RGUA 3WMRA 1J07A 3I2HA 1YAHA 1AQLA 3L1HA 4Y9SA 1UWCA 4WFJA 4ZV7A 4N8EA 1XZFA 3DYIA 1W1IA 4UHDA 4B80A 4FDMA 3HLKA 1GQRA 5A71A 3JW8A 5BWCA 1K6EA 1F0PA 2C58A 4QE3A 4X92A 4ZRDA 5K3FA 2O2GA 2ZVDA 1UK7A 4S0XA 3I6MA 1EB8A 5FOQA 4QDZA 2WG2A 3GA7A 4FNMA 4W1RA 2CUTA 2ZJ7A 1WHSA 2GBIA 5DTJA 2OCIA 4WY5A 4KACA 3EF3A 1CUDA 4FBLA 4QA9A 5A7GA 4W63A 1IUNA 1RWQA 3LIIA 3Q0TA 5CT4A 4BAUA 1YASA 2OAEA 4N8SA 4Y2JA 3CCBA 4B0PA 1Z68A 5EFZA 4W1PA 5EGNA 1CFJA 4UBLA 4Y7DA 1GXSA 3G9TA 1BROA 1YCDA 1XZKA 3STWA 1UK8A 3AILA 4TGLA 3LLCA 1CUAA 1CUFA 5SYNA 4K6KA 4QZVA 2OPHA 2GYVA 1BEZA 3SWWA 3VDXA 4H7HA 3FWHA 2WILA 4BVLA 2CB9A 4UHCA 1XLWA 4B84A 4GXNA 4WFIA 5JD5A 2C4HA 4YX9A 3WA7A 4FFWA 1VXRA 2XUIA 1QZ3A 4JNCA 2WIGA 3I2FA 3R3VA 2H1IA 4BAGA 1FFCA 3TEJA 2WFLA 1ODCA 4Y2PA 4EY6A 5BV7A 2O7VA 2XMGA 3I6YA 3LS2A 5H3HA 1USWA 1JJFA 3BIXA 5FPPA 4PNZA 1LZLA 5ALPA 5E4JA 2ZYHA 4HS9A 5CXXA 4BTLA 3QPAA 3K9BA 1ZD4A 3O0DA 2G63A 4KAAA 4LYDA 4J0CA 3FVRA 2J3DA 1CLEA 4UUQA 3DL7A 1EH5A 1ORVA 1C4XA 1H2XA 1XZDA 2AJLI 1DWQA 5AM1A 3QM1A 4DTCA 1XZBA 2XMBA 3OG9A 2VT7A 2QS9A 3WK7A 2BUAA 1YA8A 1R1DA 1EDEA 4H7EA 4CI9A 5LLSA 1BEEA 3EQ9A 1XZJA 3KWFA 2QR5A 3I2JA 4HRYA 2H7CA 3STVA 5HF8A 3OURA 1XRNA 3IVMA 5YASA 1XZGA 5C8VA 3MUOA 2D5LA 3R0VA 2I3ZA 2ZYSA 1ZI8A 1HDEA 2CJPA 1DWOA 2OCKA 1MNQA 4K2AA 5HF6A 2XI4A 2XQIA 3WI7A 2XMDA 3P2MA 1EHYA 2OXEA 2JF0A 1LPBB 3WL5A 1CUGA 2WJ6A 5ALKA 3STTA 1XRMA 4H7FA 3QITA 5F4ZA 3S8YA 2XT0A 1UOOA 3H04A 5JIBA 4WY8A 5LKAA 4J7AA 5BWBA 2WFZA 3OM8A 1W4LA 1H2YA 3ZLUA 1DX6A 3H1AA 3CXUA 5AK3A 3GBSA 1LNSA 4KYVA 4C6HA 2DR0A 1E66A 5JD6A 1WCYA 5K3EA 1JFRA 1CUZA 3RARA 3MVEA 5SYMA 4DNFA 2RAUA 5EHXA 3ANSA 2G5TA 4J0JA 4BP8A 5EHZA 1TCCA 4GI1A 4M0MA 5EI5A 4I19A 5JAHA 3O9MA 4KAJA 5LYYA 1VE6A 5A2GA 4U2FA 4B83A 4AZ0A 4CCYA 5HQ3B 2UZ0A 2HA6A 1VE7A 1I6WA 1Q0ZA 2ZJFA 2QOEA 1QIFA 5AOCA 5I9IA 3WA6A 4KRYA 3ZLTA 5E4TA 3D7RA 2VJDA 5IVKA 1NU6A 4RE6A 2WM2A 2XUAA 1DT5A 1AZWA 4AX4A 4XWGA 1QO7A 2IX9A 2XMCA 4CFSA 2QRUA 4OU5A 3FLAA 4LKOA 4OB6A 5ALDA 3IULA 2ZJ6A 4A5SA 1ZGBA 1ZD2P 3DDUA 3FOBA 1YAJA 1CUUA 3BJMA 4QLAA 1VZ2A 2XLCA 4HXGA 4X93A 2OGTA 2XUFA 3F9CA 2Y2VA 4WFKA 4X97A 5ALVA 4C87A 3B5EA 4RPCA 5FUMA 4OB7A 1EVEA 1U8EA 4MYDA 1TCBA 4Y2XA 2AJDA 5AK4A 1QLWA 2WFMA 3D2AA 4B81A 5FV4A 2JGLA 3ED1A 1K63A 3M83A 5AOBA 5ALFA 3R41A 3HJUA 5IVIA 2WTMA 1GPKA 6YASA 2B61A 1Q0RA 3IA2A 3I6ZA 2BUCA 3G9XA 3ILSA 1N5RA 1GPNA 3I2KA 3W2TA 4EUSA 1HPLA 1TKRA 3I2GA 1W75A 4LXHA 1A8SA 1XZCA 5EIAA 4FHZA 1THGA 4BP9A 3W05A 4JYPA 5AI0A 2WUGA 3BF8A 2WG0A 4IH1A 1G5FA 4PSUA 3D4LA 1ODSA 4DMHA 3VJLA 3MGAA 2O2HA 3IBTA 2X8BA 1Q83A 5CRIA 2HADA 5HF9A 4UBOA 4BVJA 1OXMA 2RONA 1A88A 1VXOA 1DU4A 4GEGA 4WJLA 2XUDA 2WJ4A 2EEPA 3AZQA 4N5HX 1TQHA 5JZBA 1R3DA 3WKDA 5CW2A 5LZ2A 3H17A 5C81A 2C0PA 4XX1A 1FFBA 4KE9A 5CT5A 3WZMA 3TJMA 4G4GA 3OTQA 1MU0A 5KBYA 5T4FA 2XLBA 3L1JA 4I3FA 1OCEA 2HFKA 3D59A 2XMQA 4GECA 1EXWA 4UFNA 3D0KA 3IUNA 4HXEB 3CCCA 1IZ7A 4BB0A 2OG1A 5I7UA 4B7ZA 3HXKA 5FP0A 4BCBA 5K3BA 1F6WA 1EINA 3AJAA 1QTIA 4HTAA 3VISA 2VAXA 1F0NA 4Q3LA 1QIHA
chains in the Genus database with same CATH superfamily
3KP1A 1EX1A 1I14A 1KJWA 1OUMA 1B8PA 3DBRA 3OPYA 1TT5A 2OP0A 2XUJA 3ZHCA 1REQA 2G1AA 5D51S 1XA3A 4MARA 2GWHA 5T3UA 1UT6A 4QU5A 2NXJA 4XYGA 4EHJA 1A4UA 3FUUA 4XQ9A 2KB0A 5JBNA 3DDZX 3LZ6A 3QWIA 4RESA 5FAXA 4DCOA 3BERA 1Y82A 4KBYA 7REQA 2PUCA 5INTA 2GN4A 4UEJA 2OXIA 5J4HA 2MT9A 2PMKA 3D4BA 3BWVA 1E1RA 3KETA 1FJXA 3BDVA 4JQOA 2HDNB 5K8IA 3N74A 1CUEA 3R6TA 4AP9A 1R00A 4UFOA 3GAMA 1XXHB 4YMWA 1G6KA 2Z2IA 5E8JA 3TFQA 2FZKA 4U2BA 1XYYA 1M83A 1P6XA 2GCPA 4P35A 4ALMA 3L1KA 3C74A 2YXDA 5U1PA 1WCWA 2G09A 5F78A 1Z6YA 4MCHA 4PS1A 4WOKA 5GADl 2A7XA 3GJ5A 1BWRA 5DBEX 2D0DA 3WHIA 1F8FA 1THTA 2AXNA 3WOHA 3LSYA 1TU3A 2XNDA 3FUWA 1KI8A 2G9RA 1DUVG 3I1JA 1G6OA 5DN9A 4EVQA 4ISCA 1DZIA 2O07A 3MWGA 4ZYXA 1Y3BE 2ZRNA 3G0DA 4HAOA 4UOQA 3UMFA 1KO8A 3MWLA 1OLUB 3AJ8A 3AGPA 3PF8A 4X00A 1PZMA 3SKXA 1Y8RB 1NGSA 1R5OA 3HU5A 3VV3A 4AS3A 1I7NA 3THWB 3WAKA 4IEFB 2Z3WA 1MKYA 1L5VA 2NX2A 3QY0A 4P4GA 2XUQA 4MI1A 1NC3A 1KO5A 1MQ9A 2C2WA 1KZ6A 3F4BA 1O97D 3G2NA 2NAFA 4QYIA 3EAQA 5IBCA 5C46F 4EY5A 1ORWA 3AB3A 3OCXA 5EIHA 5TY0A 1SR8A 2N1MA 2XA9A 4K9RA 2PBRA 5JQGB 1M9NA 2AEEA 3VZQA 3DE7X 2IH2A 4JSTA 1H5NA 1TUBA 1ZCJA 5AVUA 1QANA 2FRXA 2W2TA 5JXHA 4B0OA 2ATXA 1CJCA 4X71A 4Y2SA 2QD4A 4JUBA 1IUOA 1GYPA 2P4EA 1UBRS 4RMJA 4DLUA 2IU4A 2IW1A 3CSDA 4QOGA 4AUKA 3ZWCA 1TYCA 3SHVA 2E2WA 4MHOA 3JXEA 4EKNB 2DFNA 4NMLA 4PE5B 4UXIA 1TL7C 3LSTA 4LDZA 4C88A 1Y9ZA 2YYZA 4MGKR 3OLCX 3WIEA 5JECA 1MBZA 1R9MA 2CXOA 2NO6A 2Q6TA 3OF2A 1GAXA 4MXDA 1NVBA 1NWCA 3SS8A 1X80B 2JFYA 4OQLA 5EFOA 1XV5A 3IFSA 4MW7A 2QX9A 2UU9B 2NIPA 4B3CA 1WL8A 4ZU3A 2J3EA 2VHEA 5P8WA 1Q95A 4QQFA 1KNQA 4DE5A 3KSZO 1BHSA 1ZHOA 2IS1A 2H1SA 2L2QA 1PJLA 3FCEA 2GI4A 3NT5A 2C5HA 2I6XA 4NL4H 2N42A 1QHIA 1QQ6A 2JFBA 5AW2A 2QT1A 3PRKE 2SCUA 2Y6VA 1M5RA 3PXDA 1NW7A 5DHRA 3WLFA 4YMGA 5BT8A 1II8B 1R8QA 3LY8A 2VK2A 4LQCA 5JTUA 3OPVA 1K4YA 2Q3BA 3ETGA 3ILHA 3CX7A 1EVYA 1J8FA 4PZEA 4M8IA 2I71A 1ZQ9A 2C2GA 1SMKA 2JGDB 3VU3A 1DJQA 2HJGA 1KH1A 5B3JC 3ZW9A 5L6MB 5ED4A 4XJXA 3W77A 3CFYA 4WA8A 5KHLB 1GRCA 4LMRA 2B6HA 1NOJA 2JH3A 3H8VA 4M1EA 2ASVA 1GLGA 1K9VF 1Y7HA 1T8WA 3K4HA 2HNBA 4PLTA 4YP1A 4OPMA 1BKSB 1HE8B 2BM9A 4RD0A 4I2NA 2C83A 3GAFA 4R0VA 4J3JA 3OM1A 1P61B 1VG1A 4CKEB 2HQSA 5IF3A 1BRTA 1VIYA 3GLGA 1HDXA 4PRZA 3K8YA 4LZPA 3QG5A 4AMUA 2HNAA 4K6MA 2AOTA 1LQTA 1HFJA 1ZIXA 4MVJE 5IAAA 2ZJOA 3CNOA 3R7LA 3G8YA 2Q0QA 3R5XA 4GOXA 2PUAA 6AT1A 1FTQA 5BMVA 4JT2A 1RAAA 4LY9A 3U0BA 4WKBA 1HE2A 3HSSA 4JDPA 4OFBA 1LLUA 3OE5A 3HZZA 3RFCA 3TYXA 1NR1A 1NURA 3B6KA 4WUVA 1GWNA 4D43A 4I36A 1XFAA 2IYAA 3BWDD 4RABA 1PFVA 1U0SY 1KIAA 5B6PA 2MSCB 1L5YA 4V0KA 2VH5R 3ND7A 3V1NA 4FP9A 4Q1EA 3W90A 1AGXA 1RWBA 1OIXA 1K3UB 4COKA 4QT4A 1FQKA 1LTKA 3CKLA 2GN8A 1YJQA 3JASA 2EX4A 1DC4A 5K0NA 3TRHA 1U2EA 3G0GA 2ETXA 2O7SA 4DMKA 1QE0A 1CIVA 1Z2CA 4Z8XA 3PR1A 2WINI 2I6GA 1ZN2A 1ONNA 3IUBA 4NDNE 1L4GA 4LRTB 5CYPA 3W2IA 4PYKA 4G1FA 4TVKA 1MJFA 4HPWA 4UVEA 2Y0PA 5D87A 2X2OA 4CG2A 1ZN9A 2FI1A 2XUGA 2RHJA 5AM2A 4J49A 4MLDA 5LQCA 2G88A 5EWMB 5SICE 1GKKA 1RHKA 4JVSB 1N7HA 2Q9UA 4G1MB 3HFJA 3M6FA 1JEYB 2ON6A 5DVZA 2AMJA 3OF3A 3TIFA 1TKAA 4DDMA 1WWKA 1CTQA 5C1DA 5IUNC 1FSZA 3EGXA 5E7IA 4C6TB 4YV2A 3JQFA 3V4VB 2RAVA 3R0IA 2CKMA 4FLMA 1V5GA 2Q5OA 1U9IA 3A6HA 4M86A 4DCTA 1J56A 1T91A 1RXSA 2NSHA 3WRWA 4IX9A 3MERA 1E4OA 2Q9CA 2XUHA 3ZZ1A 5CCBA 1FFXA 1XI2A 3DD5A 2CYCA 4IIJB 1WVGA 1W59A 2W2LD 3B7GA 5CH5A 4RQUA 2ARKA 3HMQA 5I9BA 4AG6A 4P6VF 2K7ZA 4IKPA 5JATA 2LTAA 5TS3A 3DE5X 3ETCA 3BKXA 4H6PA 3RS8A 1LSUA 2II6A 2Z8ZA 4KQIA 2WF9A 5CDFE 3JQCA 5C8ZA 4X8LA 3VTAA 2R1UA 4KNWA 3P8ZA 1QHFA 4YUZA 1YB7A 5IWCA 2AX3A 1NASA 5DI9A 4D0GA 4BAZA 3SYMA 1XZPA 3MMSA 2Z8YA 2B2NA 4CG0A 3KKEA 1EVIA 5TSDA 1JMVA 4Y1RA 4KB5A 3RSSA 3L84A 3TVYA 4RL4A 3IT2A 4CEHB 3ZHXA 4D3XA 1CQWA 3NM6B 2JFPA 2NT3A 1QHHB 3ROTA 3U17A 1U0LA 3UA3A 3F7OA 4KGXA 1DEHA 2LWIA 5JYBA 4ARBA 2YC4C 3NG1A 4MWCA 5A5EA 1KYWA 5JR3A 4D8VA 3N3BC 3QLTA 3A7DA 3RR2A 3NM5A 5HGJA 4Y9UA 1NRIA 3UGJA 3RRXA 4LWPA 4Y6SA 1Z26A 3OIUA 1NXTA 4ND4A 4EFLA 4OHKA 5G40A 1WLYA 5TV2A 3GRPA 1EUYA 2XRFA 2QTMA 4EHBA 1I2BA 1OSNA 1XD2A 1TYAE 1Y81A 2WWTA 2WKQA 3B3JA 3WNDA 3G7NA 2HF8A 2QEQA 4JB3A 4YQZA 1D2RA 1VPWA 2YW9A 4ND1A 1IBKB 4Q4JB 4AJ9A 1TJ5A 1KYVA 1X9IA 1H69A 2EFCB 4MITA 2C5SA 2REBA 2VXOA 2NU8B 4ZFNA 1KVTA 4QPPA 1EFPB 4Q05A 4DPKA 3AHCA 3ZDBA 5IAOA 5LSAA 5DNYB 3MTGA 3VYTB 3ZBQA 2ODPA 3P0FA 3WRYC 1QHYA 2Y99A 1E3SA 1WDMA 2ONYA 3F3MA 3C8MA 4DV3B 5DCYA 2OZKA 4UE3S 1EYZA 1P5HA 2VXCA 2PXCA 3MYYA 3WAJA 1PFWA 2OESA 3HDVA 1TIPA 5EZ5A 3LXUX 3AVUA 1M1YE 4NV0A 2GSDA 1W44A 2BT4A 1IQ0A 1LW7A 4MEBA 1QUFA 1XKQA 1K8RA 1OX4B 2IP1A 2QMEA 1KARA 1KPGA 2WAAA 3L0PA 1W0CA 4QNRA 4E11A 5B37A 2XWQA 2A59A 1V8PA 2WMYA 1BHJA 2CFRA 3HVIA 3CLHA 1X42A 5K0JA 2ZI6A 4HPJB 5B6JA 2IGTA 1C1YA 3HRHA 4RTNA 1KRHA 4EA7A 4OHCA 3G2PA 5KYXB 1FF9A 4KXLA 3AI2A 2HQOA 3W06A 4W5JA 4JLVA 2PX4A 2RI6A 3DXZA 1PFQA 5AXAA 3L7JA 1D4OA 4O63O 4B85A 4N5MA 2VK8A 4NBUA 1E58A 3HB5X 4G5QA 1VQ1A 4YS6A 3UK7A 4IHJF 3H2HA 4GR5A 1N2CA 1S8NA 2IYPA 2P11A 3A9TA 2P9QA 3FYHA 3DMPA 4I4LA 4IOJA 2P4HX 2XAUA 5H4GA 3EPJA 1KI7A 2L19A 1OHHD 2GN2A 4EMTA 4CM9D 2ADOA 4BEVA 3RU7A 4YCMA 1HYQA 1U4OA 1IVSA 4DIKA 4M1TA 1V16A 4IGAA 5IN5A 5GZ6A 3I9V6 5DNEA 3S4YA 1U1EA 4DRZA 4HLCA 4HPXB 4M1YA 4QSMA 3U3MA 3NETA 2AZDA 5C7IO 1ZDMA 2E3JA 3HMKA 1UJ5A 2A84A 4J0FA 4P32A 2LGJA 4LRQA 1JBEA 3AHJA 4JC8A 5K2OA 4MS1A 4MVJD 5CVTA 3LUFA 4JY7A 3ND8A 1CQIA 4KDFA 5BVGB 3PHIA 8AT1A 1GTMA 2Y05A 2Q62A 1EVZA 4AL4A 2G7ZA 4X1IB 3EQ2A 3CNEA 5CURA 1ST3A 1QVWA 3V8VA 5K99A 1JEEA 3FWNA 3N6XA 3HR8A 4FMDF 1UP4A 3KM0A 1W0JD 5CH3A 2F1HA 1S9HA 2X5XA 1M0WA 1UFRA 2V4ZA 3MWEA 4LDRA 4RC9A 5EG5A 3KBBA 3RS9A 2X7JA 2Z1DA 1MC8A 2H06A 3BEDA 1NRXA 3L02A 5DO9A 3H65A 1KO7A 1MOZA 2ID8A 3C7TA 3G8BA 4MGEA 2AG8A 4CQMD 1E8DA 5MFZA 3DZBA 3IAFA 1C9EA 1Z0AA 1YZHA 4PPYA 2ZM6B 2PUEA 1O77A 3KVVA 4QDXA 1KOFA 3LT0A 4F97A 1CJMA 2GYYA 4KXUA 4ZTUB 1YZGA 4FNGA 2G9QA 2ODAA 2Q1UA 3A05A 3AW8A 3G6WA 3LUBA 1FXSA 3C43A 2PXHA 2C92A 2X23A 4OA5A 3S1AB 2HF7A 3VJRA 4DUGD 1TXGA 2Q8NA 4N9WA 2RE8A 1WPXA 3MD9A 2IUYA 5HKBA 2BEJA 3ROEA 4JB2A 2WLSA 1N2GA 3KJNA 4RY2A 1NVVQ 1WXHA 2JCBA 3R9IA 1XA0A 2JVJA 4JT4A 1GQYA 2ZJ8A 2DT5A 3ZY6A 4PR3A 1FRVA 4R2WA 3WIVA 2YHSA 3EPKA 1Z62A 4RD1A 1G0NA 5J40A 1PJ8A 5E6SB 4EGAA 1U9ZA 1QZUA 2FEWB 2VP2A 5JAUA 1ZA1A 1JG4A 5EMHA 3RODA 2J9YB 3FNGA 3IGFA 2IOQA 1SG0A 1O9HA 3VPBA 1RMQA 3QLVC 5G53C 3I8SA 4QM7A 5ALXA 1ZP6A 5KNCD 5EMJA 3IEUA 2ZAYA 4GKAA 2I7VA 1BCRA 2ILVA 5EHNA 1M33A 4IZIA 1DJPA 2PBZA 3TVTA 3BFKA 3WGVA 4NG5A 3H4VA 3JYHA 3BGDA 4F4UA 2JD2A 2WT9A 1Q14A 4MGYR 3K2EA 3F47A 1II0A 4X7MA 1J2TA 2E18A 5BYBA 2OCAA 1KEEA 2WUEA 2A1UB 3AJEA 1NQAO 2WHRA 3KZXA 3ZR4B 4EDHA 4N6NA 1G64A 1ZD1A 3AUYA 2UV8A 4MB0A 5KREA 5KWEA 2PYZA 3FOEC 3AM3A 1P2VA 3CC8A 4MVWA 3H75A 3PEEA 1E5XA 3KZMA 1ZLXA 5B2EA 1WUYA 5BSEA 1QFMA 2HXSA 4DW8A 3JATA 3OJFA 1IONA 4G01B 3K5PA 4H7JA 4BLOA 2HHJA 2Q5QA 1XMXA 2XYVA 4IIFA 3TBFA 4IFBA 1HEIA 1NLMA 1S2IA 2XJ4A 2FETA 4G81A 4GZ5A 3W0LB 3X1MA 1AGYA 5EJGA 3VC7A 4JBGA 1IMOA 1D6NA 3HEAA 1QP0A 4OHPA 5DM70 2H00A 3ITEA 4UOEA 2VRCD 3TMKA 1HL7A 3OZUA 4UU7A 2FE4A 4P0QB 3TPFA 1KMHA 2YC2C 1T8UA 3SVLA 3ZIDA 3PFNA 2AQ8A 4TMXA 1FS5A 3RM3A 3SC6A 5KPDA 4ARIA 1EWVA 3DMNA 2PPVA 1V4VA 3CTPA 2NW6A 3DAOA 1YQGA 1E2LA 2GRJA 4MTCA 1KJJA 3DE2X 3B1KA 4S2EA 4J29A 4URUR 1OHHA 4EVIA 2VNJA 2Y93A 4QTTB 4CM9A 1T5BA 3OU7A 5A5VA 1PUXA 5I8ZA 4ARCA 5DEIA 3TNYA 4U6SA 5KQSA 2NNLD 2Q7DA 3W34A 2VKTA 1U99A 1NV8A 1H0HA 4XUDA 1SCNE 3FDZA 2UYYA 4D74A 1ZKDA 5BNWA 1O8BA 5CK5A 2H3EA 2H1LA 2H54A 3UJHA 2O19A 3EC7A 4K9NA 2ZSKA 1HR0B 4HTFA 1F9EA 1P2FA 4QDJA 3I5MA 2P3LA 3E2MA 1YXMA 4S2UA 4TTAA 2H59A 4BNLA 4MUIA 4NICA 4HNRA 4BFWA 1KETA 1O6GA 1MIOB 4I9FA 5E95A 3IP6A 4X63A 5TMDA 5KX5A 2Z58A 4Q37A 1OY1A 2Q5JA 3GDGA 1CUJA 2SKDA 1FL9A 3NDPA 1ISGA 1W0JA 4HEA6 1DUIA 1K92A 4INOA 4OJTA 4YT5A 5FWAA 2ZCJA 5KMGA 2NPIA 1L5ZA 3UW3A 3H2YA 4PFJA 3WQRA 1D2GA 4HQOA 1WO8A 2G5PA 5FL3A 5K0LA 3KSMA 4P7GA 2EGGA 3LA8A 2H2AA 3UHOA 4CQMA 4RGQA 2BBWA 3L7MA 1IULA 3G5UA 2D7JA 3TTWA 2YVAA 2FR0A 2ZZMA 4QYXA 3B52X 5EWJB 3T5GA 4Z7JA 2MOKA 3E15A 4KAXA 3VXKA 2HJWA 5A0VA 2A0WA 3GP8A 7AT1A 4ZRMA 2OGSA 2GEJA 1YZVA 2ZJAA 3B60A 4DUGA 3SZLA 1ESNA 2OBLA 3UHJA 3TO5A 3C6XA 2DKFA 1IEWA 3CZRA 1IYZA 3EVNA 4XSGA 4YALA 3AF0A 1JLLB 4BMXA 1LBTA 1WQ4A 1UIMA 3AM5A 3VOBA 1MJHA 1ESCA 2BONA 4KQFA 4LY6A 4Q0MA 4KFCA 3ABZA 3FCXA 1GEEA 3KVOA 4J90A 5CHEA 4GBED 2HSWA 2HWKA 2DY1A 2JH8A 2QE7A 2O50A 4X7BA 1AKTA 4N3NA 3RGWS 5L45A 4G9BA 3OM0A 4L8GA 1J33A 1WQ3A 2Q6VA 3GAAA 5FI3A 2OQ2A 1S96A 4YV1A 1WCXA 2UYGA 3QEKA 1UAYA 4Y2QA 5ES3A 5DX1A 1SVOA 1YB1A 3FFXA 3H4IA 4OYLA 1NW4A 2ZBPA 4MJ7A 2JGNA 1AKNA 3NV9A 5IVDA 1UBEA 4OQNA 3Q8XB 5EYPA 5HG0A 1T3LA 3RROA 1WVIA 2FUG1 2GUGA 3CNHA 4I55F 4FHEA 4UBNA 5F3WB 2PV0A 3FUVA 1X0XA 4CIBA 3A1EA 4Y1FA 2FDCA 1CU1A 2QU8A 3WMGA 3P94A 1PL7A 1XZNA 3HN7A 2ZYWX 1EFTA 3SIWA 5HFJA 1FDOA 2NGRA 4O4HA 3OD5A 4OI4A 4XUEA 1L4MA 1NJ6A 1NPYA 4AJNA 1EP9A 1CK4A 2EX0A 3UGQA 4OFZA 3MHTA 3KQUA 1MDFA 3KYBA 1WMAA 2VCHA 4WESA 1Y3AA 1N9GB 1NR5A 3ZJ5A 4M99A 3K6KA 3O4IA 4NMWA 4GQAA 5G4KA 1SRRA 5CEJA 1T2UA 2P27A 3QWBA 1S4QA 3KDSE 2NV2B 4IWYA 2PS3A 1NW9B 1UKVY 3UV6A 5K0ZA 1KL7A 4WECA 1NFRA 2Q45A 3GEPA 3JQPA 3OX4A 2C5GA 4QUJA 5M34A 3WHKA 2NZVG 1DRWA 2QUBA 4MH0R 3WWOA 2M1XA 2NQ2C 4G3XA 4BX9A 1DHRA 2VRCA 3HKBB 1QGUA 2BTOA 1KKLA 1C7QA 5IUKC 4LYEA 2GNPA 1DP4A 1T4GA 4ZXFA 1L8XA 2QQFA 4P34A 1FX0A 3W6ZA 5B58C 1P2BA 2QUAA 4ID9A 2P62A 2WYUA 4RQBA 1M2VB 3NEAA 5E0KB 3UF0A 4AMYA 4AI6A 1HKHA 1G21B 1JHZA 1V3TA 2PUVA 4S05A 4LFBB 5ECWA 4DCUA 1DDOA 3KZCA 1WAMA 4Q9NA 4E14A 4GS5A 4CKCA 5TLSA 1Y89A 4XRGA 2NU9B 4K5QA 1BRMA 1YIOA 2HBQA 3VSAA 4CG1A 3DXFA 1GY8A 4PYIA 3N05A 2VEOA 4HAYA 4YI5A 4JC4A 1I33A 2OZPA 2WQZA 1CDZA 2PX2A 3C3KA 4GP9A 4MHSA 3K9LA 1P7ZA 3TZCA 4AJOA 2VBGA 4QUIA 3L4JA 1QFXA 1ZHHA 3ZZMA 1G0OA 3X0DA 1AK9A 1CZLA 4EG7A 1VOTA 1EVJA 1TZBA 1IOLA 2L42A 3GT3A 2GYUA 3TNLA 5CB4F 3DM9B 2A78A 5JNRA 1S2DA 3IBYA 4WSOA 3RLFA 3Q3GE 2Q2OA 4PG7A 5D86A 3TRFA 4BCCA 5EJEA 3K2IA 1JI0A 3IKVA 1HDZA 3V5NA 1E6UA 1SVUA 3ORHA 3WWZA 3NB0A 3WGTA 4OHMA 5HIKA 1P1FA 4JI2B 4PBTA 3UFBA 4POOA 2XRYA 5KC8A 4WZAA 3IBFA 2GBGA 1V3QE 1KFKB 2QYSA 3LX6A 2GAOA 1UPFA 3G13A 2PWPA 4UATA 4RTMA 1Q7EA 3EEYA 1KI1A 3K9HA 1PTJC 4RHTA 3PJGA 4CLOA 3H11B 3IEKA 2P9ZA 3QXCA 5KJEA 3E2IA 4BNXA 3CVUA 1HK7A 2JGFA 3P52A 4V24A 4G8JA 3UWDA 3O8QA 2A86A 4R83A 3DGFC 3EW9A 4U2GA 1GSAA 3TXYA 2V3VA 3KKOA 4U3JB 1MAVA 3ZC3A 4HGNA 4LVNA 4H6WA 1QGZA 1M2NA 1O6ZA 2J0UA 4I46A 3DV2A 2Y68A 5AJZA 2C5LA 4FMCF 4LK3A 4FZ5A 4OLBA 3ZE8A 4HY3A 1LLQA 1JG6A 4N5NA 1TCAA 4AKSA 2PGOA 1N1GA 1C0KA 4IDCA 4YMVA 4MO9A 4Q7MB 1P0PA 2WEKA 3ANMA 4HZGA 1SD1A 3T7EA 1SXJA 2B4KA 2QVGA 4I5IA 2QTHA 4O4LA 3K8QA 1Q1NA 3O2QB 3ZX4A 2BHNA 2WKRA 3OHMA 1E8NA 4DADA 1MMFB 2QKYA 1T3TA 1AQIA 1RJWA 3VUFA 2WT8A 1A2KC 2A2ZA 2XIJA 3HADA 3AV3A 3F8WA 3BXPA 1QVRA 3SX2A 3PEVA 3KB1A 3Q11A 4AQDA 4DHWA 1VTKA 2B5OA 1JNXX 2HGSA 1VYHA 2B37A 4YT2A 3QBTA 1XCJA 2G7MC 3DZIA 4HSEA 2CL7X 4L5AA 3ZU3A 1RBZA 1JA0A 5B4TA 4JI5B 3D6FA 5I7HA 1RJ9A 4HEQA 4UASA 4AAYA 1Y1KE 3N28A 4E46A 4JEUA 4EB3A 4FYMA 2FUCA 4R2JA 3RK4A 4DAOA 2RD2A 1B74A 1YDFA 3P7MA 4WASA 2XUOA 3AVYA 1IJFA 2ZUWA 4IFIA 4WZBE 1JSCA 4QO8A 1EUDB 1WCIA 3O47A 5A4KA 3HKDB 3HP1A 4BGIA 3A9CA 3B20A 3NBKA 1DUSA 4P81A 4Y98A 2DWCA 1M5UA 5CIWA 4YRTA 3O7MA 4ZV9A 3NAZA 5G1OA 4X6XA 3ZE1B 5L9AA 3HI6A 5KUTA 1ZNZA 3CRQA 3EVEA 3G7SA 2I4NA 1SHJA 3M4JA 4KE6A 3GLKA 4ZREA 2DULA 3DHYA 4F5ZA 5IJXA 3G9UA 1VM6A 4B43A 2YS7A 3QOYA 3RWOA 3SEZA 1FMTA 1XVLA 4ACBA 3W8DA 4Y6LA 1BFDA 1BGWA 3EEQA 4V0QA 5B6IA 1EDOA 2VJPA 3BORA 3KWMA 1E3JA 4P2GA 2I91A 2J3JA 3G17A 3ASYA 1RSZA 1YL6A 4RPKA 1GQFA 4CN8A 3QKSA 1NMXA 4MDEA 2OD7A 3KKLA 5KAPA 1D1QA 3GFPA 2A14A 3RWBA 3V42A 5MN6A 1XKLA 1P0CA 4LA4A 2PEYA 4C7BA 1B73A 2W0MA 2C5BA 2DWPA 5EE1A 1CSEE 2GS9A 2XADA 4HQ0A 4UARA 1YOVB 2JHGA 3VPGA 1SVMA 1A5SB 4PO3X 3I04A 3T9CA 3OHPA 4KXVA 4IDHA 2VYQA 4AUMA 1JALA 5IC6A 3HJTA 4F96A 5F2NA 4CEJA 2YVKA 4FKBA 4RCVA 1BYIA 1G5IA 3FNBA 2IZZA 3CBGA 3X2FA 2PX5A 3RC9A 1HFKA 3LYAA 2ZRLA 5FTNA 3QFTA 3L4BC 3BDIA 3A4TA 4OAPA 1CZOA 2A0XA 2H63A 2OBNA 3B8HA 3DVLA 4D2IA 4D81A 2XB8A 1WTAA 3WP1B 1UJ4A 4CG3A 5CB0A 1F6BA 5KOYA 2OWDA 5K6AC 2NZYA 1P17A 2BY4A 3FGNA 4CNBA 3EOAI 1ECCA 2PXAA 1ZM7A 1WXQA 4V0OA 2OCYC 2P0YA 4RKYA 4ZOLA 3WLEA 4WBNA 2JAHA 3TAHA 1JHPA 3A0RB 3E35A 2AUMA 4B31A 3AFHA 3ZY5A 1Z8NA 4AIIA 1YZ3A 3QVKA 1YJ8A 5H8WA 1P80A 4R9RA 3HNRA 2W2QA 1DKQA 1EDZA 4ZVMA 4KQJA 3KD3A 3L40A 4WBSA 3UATA 2DLCX 3RUHA 3ITKA 1EK5A 3X3HA 4H1UA 1EDBA 1QK3A 4DLZA 3EXHA 2HCTA 3CINA 1PBTA 3Q5DA 3DZ8A 5H7XA 4OYYA 4ZZ1A 2GOYA 4R5HA 1H6CA 3O8NA 1J8VA 2OCXA 5DJ5A 1R8SA 3QEOA 5H5JA 4HNAA 2OBXA 1Y42X 5DM60 1VYVA 4L76A 4PWYA 5FUYA 4E88A 3K20A 1KAGA 3ENKA 1X74A 4EQ6B 3IR7A 3RVPA 5CLGA 4U63A 3ACBA 1R4MA 4FWIB 2ADFA 4ZDWA 2Y9MB 3NBUA 4D4JA 3G0HA 5IHXA 3KQNA 2G9UA 3F67A 4U7TB 1LJ8A 1HDOA 4RETA 2R8PA 5HJ7A 2V1XA 5LLTA 1RHMA 4MHTA 1M34E 2X1HA 2AXPA 5LBTA 3UCXA 3C3AA 4YXFA 1N6OA 1KSFX 2C03A 3BK1A 5AKXA 3G68A 5TC4A 1C29B 3LP5A 1CF4A 2JJYA 4CHTA 3PPWA 3PZBA 1AURA 4I2VA 5DBHX 1VE3A 3TLCA 3U1TA 2JGAA 5EWLA 3WLQA 3BD7A 2PKQP 5LQAA 2J9ZB 1RS0A 1E98A 2GZSA 3LZCA 4UFPA 4XVQA 1ITZA 4BVLA 2I4OA 3AV0B 4EFMA 4XX0B 3N6VA 4QPNA 1YRYE 2NYRA 5P21A 4FYIA 5T57A 5FCDA 3TZHA 3UG6A 2YJNA 4W6ZA 5DHPA 1VMDA 4K87A 5E7JA 5HTOA 3DV9A 3L0CA 4DLNA 3L46A 1AKQA 1U98A 3B1WA 5CA1B 2AC4A 5IXJA 3PFKA 1LRJA 1KFJB 3L0SA 4X84A 5BQFA 5AW5A 1IN6A 3IHKA 4REQB 5E7QA 4HQLA 3G9QA 3TLXA 2BKVA 1FBTA 1U0OC 3AT1A 2X3UA 2MTBA 2MINA 5KNDH 4EFDA 4O2AA 3D3EA 1PL6A 1XZLA 4QODA 1P1HA 3EX7C 1Y3CE 5AVRA 3QENA 3QUAA 2BFBA 5DPMA 3TGPA 2JFHA 1DQZA 1AQNA 1SZPA 4LBWA 4C4PA 3TCNA 4EP1A 1J22A 1G3IA 3B53X 2UUBB 1JAIA 5FTLA 3D54D 3FGOA 2D74A 4KEAA 2CWDA 4ZV4A 4DMGA 5LXTB 5C3MA 1TJ4A 1L3BA 4QDOA 3KWJA 4U8HA 3QVOA 5EOVA 2KHZA 3DFFA 1EK1A 4D9JA 2AA3A 1YQXA 1XMIA 3UB4A 5ECGC 5CITA 3UCFA 5IJWA 3UJBA 4XTRA 3MT8A 1A9QA 1KOJA 1QR2A 2CE2X 3IQFA 5CM2Z 3CX4A 3U16A 3ZV6A 2W8BA 2JZNA 4LZZA 3S3TA 5K9ZA 2RHGB 3L1VA 4HC4A 4LEIA 4LF6B 3AFNA 4R8SA 4FJ0A 4PICA 2HFJA 2QZ4A 3RVMA 5G0WA 3I9KA 3HKEA 2O2CA 3R4CA 4RYDA 2I62A 3D8UA 3VPCA 3GFTA 3IPCA 3PA8A 1H4QA 1A0OA 1FNCA 2W90A 4BDSA 5EXDA 1FX1A 2XNJA 4TXHA 2VDWA 3HJBA 2CHQA 2BM0A 2FEPA 2PL1A 3LQFA 1NXVA 3IT3A 1T0UA 3IUSA 3IRUA 2FTKE 2QAGA 4H0NA 1STOA 5L3ZA 2Q49A 2A9JA 2GCNA 2X9LA 5LP1A 2VHZA 3VU9A 5FI1B 2VZEA 3LUPA 4I5EA 1E6WA 3FBWA 3CEMA 4AMBA 5CBPB 3H5AA 4INPA 5E3IA 1FU4A 1ZBDA 4XOUA 4B4DA 4BC0A 4L9SA 1SC6A 4N3AA 4JI8B 2HQRA 1W36B 2OZEA 3EA0A 3D7KA 3A1UA 1ZOIA 3EIFA 3RRBA 3QIAA 2JIQA 2O3UA 3MXOA 4OSPA 3CW9A 2DHDA 2MYPA 4JJFA 2AEMA 3RAPR 2CBZA 3WNZA 1ZGCA 4YTEA 5B55A 2IYUA 3VYRB 1HURA 3CVOA 3AEQA 3OLXA 4AQYB 1MX9A 1HM5A 2UZ3A 2VRNA 2WTAA 1HZJA 1TAQA 2ZAOA 3A37A 3FZNA 1FNMA 5EE5B 4HQKA 2XQVA 3AI7A 2B4RO 1H85A 4ZU1X 4HDMB 3QFFA 3JQQA 2PZGA 4MSUA 3UPUA 5CCDA 1E5LA 3GMSA 3RHZA 2VT3A 2OBFA 4LISA 4UUMA 1XEWY 4EG1A 4TMFA 2IHKA 3TRDA 3K15A 1FU8A 2FHPA 2VPYA 4YMSA 3M1IA 1FFAA 4BNTA 1U2RA 4NEGA 4CLDA 3U7RA 3AOEA 4I9HA 1T3ZA 3USCS 5KTNA 2ZAMA 4QFDA 2QJOA 4WTOA 4BQIA 4KRXA 2FQXA 5DGTA 1KMQA 2P2NA 3RSCA 1OKKD 2NTNA 2PUJA 4HGYA 1QKKA 1N5OX 4BU0A 5FBKA 5LZ8A 4QQNA 4DQXA 1NDQA 1MO3A 2OKCA 5K03A 3NC1C 4DJEC 3IERA 4IGKA 1MAHA 2CDRA 3NHWA 1W5FA 5LA6A 1KFEB 3JQGA 4JLSA 5B5SA 1SK9A 1PJSA 3ZGVA 1T36B 4NQRA 4CLEA 4EUHA 4NARA 5K2MA 4JXZA 2VJQA 3C6BA 2B9VA 4A0FA 3EEIA 1C0IA 1A9XB 5AUOB 1M73E 4IDPA 4II7A 4AMGA 1YA6A 2C4NA 4OMDA 3N2KA 3BILA 1IG3A 1XTUA 3LDUA 3LU1A 2IHZA 4KPUB 5KNLA 16PKA 1UODA 4KQXA 3KQKA 5J1SB 2ZRGA 2XQJA 4TMWA 3U9SA 1XMQB 2NVOA 4L72A 3MTQA 3ONWA 4DDHA 5ILGA 3EMDA 3FLBA 4BDTA 2BGTA 2PVSA 3CR7A 3H2JA 2XF8A 4HWOA 4FC6A 3PZRA 1XRLA 2FPKA 1ID8A 1ZR2A 2SBTA 4EJMA 1NC1A 2CVZA 4GPIB 2VWHA 4ND5A 1IB0A 4Q3EA 3NOVA 5C80A 4PZYA 3RU2A 4MQMA 3BB4A 3WLTA 9ABPA 1G7RA 3NC0C 4RSGA 4HFRA 2X5NA 4ZTBA 5I01A 2F9LA 4WY2A 3OCCA 3PUXA 4M1OA 2RC6A 4XIGS 2B7CA 3WK6A 4AZTA 4B9EA 1TIBA 5KHOC 2ST1A 3KHTA 1ZUNA 4IUDS 1EX9A 3K0BA 3WAGA 3FROA 5KYYA 4DLWA 1MQ8B 1WDTA 4OL9A 1CRWG 1IDOA 3R7SA 3EH2A 4ISBA 3S7TA 2GJ9A 2RHMA 5K0TA 5EIBC 1AB5A 1EQAA 1R0XA 3PXGA 2ZWVA 3HE3A 1XDDA 5IZ4A 2XZLA 1GGKA 2PJZA 1KDVA 1X94A 4XEHA 1IY9A 4JP5A 4KFTA 3CB4A 4D8WA 4Y2YA 3NX4A 4JBWA 3REQA 4C5AA 5JDIA 2BFOA 3EE6A 4ZMRA 1C1DB 3PNPA 1PR4A 2HT6A 4NQZA 4M87A 4CETA 1A9YA 3ORRA 1NOKA 4K6FA 1XTVA 4RZ2A 4MJ3A 1XELA 3PCRB 3PFGA 4P0TA 2FPPB 3ET4A 4LNUA 4RV4A 4WT7A 5B7GA 2YMQA 4IQGA 5DCLA 5BUCA 3RAGA 1H9CA 3N0VA 1UPUA 2D62A 2CEKA 3KBOA 1C8LA 4QUAA 2OC4A 3QPVA 4UHHA 5T6MA 1CR2A 3QU7A 1DBIA 3HA5A 1EK0A 3UAZA 2WP0A 2X8WA 3LYHA 4NFHA 5FBHA 3GLIB 3U9LA 3ETHA 4MIEA 4IICA 1VSUA 3GRRA 4R8RA 1NN3A 3L7IA 2Q21A 1HRDA 4JR1A 3UYKA 1P6QA 4AMVA 8MHTA 3AJRA 1KI4A 1UINA 2CMGA 1VA5A 3Q2IA 1BHQ1 1YR2A 3DLPX 2I8LA 3C3XA 3WKEA 2BEWA 1YD7A 4QOJA 1U2DA 4TZTA 2TECE 3E82A 3EFOB 5ADUS 1KEZA 2W2MA 2I8CA 2FU5C 2FZWA 1GU1A 1OT5A 2L69A 2QJRA 4NZYA 3U2QA 5JDCA 1Z16A 4MVJM 2J45A 3HYCA 4RV9A 4EMSA 2D6FA 4IHKA 2R68A 4KXMA 3FPFA 3B7PA 3W5JA 1W88B 4AJ4A 3U4QB 3AERA 4UBKA 3IAM1 1V6SA 4D3DA 2Z08A 1SUPA 2YH2A 4X6UA 3FPKA 4A6PA 3EPLA 4V02A 5K3CA 5DBGA 4TTTS 3DSRA 3URKA 1JIUA 2P7IA 5EKTA 4WJKB 4EZEA 1C1XB 3OWHA 1T0PA 3U7IA 3VR4D 3EDYA 5L4LA 1E18A 1RHJA 2DYKA 2PQ0A 5EP2A 3WWDA 2IV3A 1SAYA 2JB9A 3TEMA 4AVYA 4N8DA 1GGHA 2I6UA 1ZJJA 1OKKA 2JJ2D 1JG2A 3AVVA 4FOSA 2Z1NA 1J24A 3L7DA 1INLA 2WVAA 3JD3A 5JVDF 1H4VB 2DRIA 3QBDA 4XCQA 5DWVA 2QPTA 2WQ6A 1JQAA 3K92A 1KRWA 3MG9A 5FBQB 2B3DA 1FTNA 3PG5A 3B3FA 4AJEA 2XWJI 4NU5A 1AQUA 3T5DA 2YCLA 1V96A 3IUPA 1PGPA 4EHAA 2DFPA 3LPNA 3M6LA 2FDXA 1ZG3A 3KEGA 5E38A 1QTNA 2QAIA 1XROA 4ZVVA 3OECA 1W36C 1L7RA 4GOND 1JW9B 3BL6A 1O2DA 3IXQA 4GX5A 1P77A 1TA9A 4KE8A 4OIMA 4PO1A 1UAAA 2Z8XA 1UXHA 3ZQ4A 3VNBA 3OCWA 1P33A 2NP6A 1Z4IA 2A3RA 1JEOA 5C8YA 1F20A 3RVDA 4ZMSA 2XVYA 1E8MA 1WZ2A 3VKHA 5G41A 2OC9A 2C9CA 4R2IA 1CWUA 3NEJA 4BVHA 2CLDX 1TFUA 4YAUA 4QU0A 2GT1A 3CPJB 4X94A 4KXWA 1PZEA 1Q1ZA 1G5RA 1UWLA 2ZYDA 5E1BA 2F7SA 2UAGA 1C7ZA 1J0BA 3BAZA 2FSSA 4WA7A 3KTDA 4Q66C 1R50A 4Q47A 4PPNA 2GEDA 1YU6A 2QRPA 5FL7D 3O8RA 2FSGA 2HTFA 621PA 1I7QB 4FXPA 4LOKA 3BCSA 3YASA 1TADA 4AKEA 3TTVA 2CHGA 3CQ9A 1NATA 3OOHA 3AMVA 1J2RA 3N8GA 4AO6A 1RBQA 2YZMA 3ST7A 3G9ZA 3B89A 1NNLA 2O2XA 3QKIA 2QUKA 4QX6A 2ID4A 1ZGAA 2ZK7A 1ZW6A 2GN0A 3MUEA 4RTPA 3QVWA 5AVJA 3FLMA 2NYVA 1P9NA 4TV9F 2AEFA 1P2GA 2AN9A 1E62A 2R6AA 4BV3A 9LDBA 5LPNA 1T6ZA 3QG1A 4X41A 3NXKA 5KOHA 2C61A 3HZOA 3MW8A 4AY4A 4BMSA 3WYDA 1JFFA 1PR9A 4C2BA 2OVFA 3ROZA 3HYNA 4KFSA 2DVMA 2YFYA 4A2CA 3ZCUA 3PVCA 3LIPA 4TTQA 4X45A 2P9FA 4M9CA 4MV3A 1XTZA 2R751 4DZRA 2OAGA 3CSUA 1E1QD 1E1CA 1X7YA 3KUUA 2NU6A 3L8HA 4KR9A 3ZWWA 4IXTA 3WYBA 4G26A 4RZIA 2D7DA 2C4VA 2I87A 2R1TA 4F2WA 4QXPA 1WB9A 1JFTA 3OPMA 3DYVA 4M53A 5ER9A 3I32A 1ZESA 3SDSA 1ZIPA 1SWVA 3JCZA 3C48A 4QEZA 5EJ9A 1S2GA 1IPFA 1ZLYA 1BXRB 3TQOA 3E3MA 2ZIXB 4MWTA 4KN8A 3T1QA 4LYHA 1EEXB 2IYOA 1W5BA 2VYVD 2IELA 3F49S 5DM0A 5AM3A 1AMOA 4B3TB 1TM4E 2JJ1D 3A6FA 4IDAA 3GQBB 2GD1O 3I4CA 1U0GA 1W76A 2OR3A 3OCUA 3B9PA 3RI3A 4CUKA 4UUAA 1LI5A 5AKHA 3L0ZA 4PSAA 4RZ3A 1I4EB 2GEVA 1W52X 1DG1G 5E1DA 3MJRA 4HT3B 4ZEMA 1XE3A 1JIKA 4IQ0A 5ERXA 2OV3A 3WLNA 2ZPTX 3M49A 4KO8A 4M60A 2XRZA 1NJ5A 3HU1A 3PENA 4EIWA 2SNIE 3I39X 4XRRA 4Z8YA 4U5XA 2B7LA 1OC2A 2BZGA 3JD0A 2W83A 4LE0A 4J7XA 2AZ4A 2H48A 1VL5A 1Z2OX 1WRBA 3G0IA 3LPAA 3O31A 2AFIE 1YRBA 5FI0B 1RYZA 3AUSA 3VR4A 4C0KA 1UBUS 4GOLD 5IDQA 1G19A 4M1KA 4B2YA 2R6FA 3OIFA 1V6CA 3KKQA 4FE4A 3RCBA 4DMFA 2DBQA 3GPIA 1CV2A 1BMTA 1NMZA 2CD9A 1UBTS 2JJ2A 5DWQA 1X7HA 2K7FA 2XCQA 4XTCS 3AP1A 4KIFA 3KSUA 1RWXA 2MR5A 1XQ9A 3K2QA 2X0KA 3OKPA 4LK2A 1Z4QA 1FTSA 1FRFS 1OFUX 3H87A 1EJ2A 1B3BA 2G07A 1OI4A 2JI4A 1Q0TA 4WKOA 3STUA 1CP2A 5EP4A 4RVUA 1JKIA 5AVOA 1XTBA 3S2SA 2WE8A 4MINA 5A04A 5K8CA 3TOVA 2GO7A 4LZOA 5TF4A 5KTRA 3IOMA 3JAKB 1R4AA 4I4TA 3GRVA 3T5AA 1CVRA 1G3UA 1SCUA 3D3WA 4ZOBA 2ZTUA 2O0JA 3RYTC 4ZT6A 1U6JA 1AKRA 4DF3A 2HQBA 4TN5A 5TVGA 2J67A 3SF8B 3RYFB 5TPWB 3VR6H 2IGBA 3JZIA 3E5NA 3WDSA 2R66A 3GGSA 1YA4A 4G25A 4HAZA 2YVLA 3DW1X 3ZDXB 2R2GA 1K89A 2BKUA 3E58A 2G04A 2CXXA 2I65A 1HH4A 4FCTA 4DA4A 5AOAA 2Q1XA 1W35A 1CY0A 2MSEB 5J63A 1D9XA 3GLUA 3EAGA 4KFUA 2FA9A 1EFDN 3D5TA 3P4UA 4JJ6A 5E1OA 5GONA 5IM4F 1W87A 2WHPB 1WS6A 5A9TA 1SCJA 5FL7A 4ZKEA 3C8UA 5EVJA 3V1YA 4C05A 3HJFA 3T7TA 4A0RA 1IXZA 2KW5A 5I7RA 2ID9A 3H1BA 3MMPA 5DNWA 5DWDA 4QVGA 2ZUVA 5GVRA 2ZJZA 2X3YA 1FDIA 4O33A 3FI9A 2FSUA 1N3BA 4J9UE 2ASEA 3ZWOA 3U1BA 2VHJA 2ZYRA 3L8FA 3FW1A 4J4HA 4CFYA 4AKIA 4AT1A 1AQJA 1TLFA 2VSNA 3FBTA 4OD0A 1NAIA 1NRWA 3T7RA 3R0QA 2IS2A 3TF5A 1BFUA 2P78A 4D0LB 1XQ1A 2PLAA 4O6VA 1IMJA 2NO1A 2Y1DA 1YVDA 1G3MA 1JZTA 1B3RA 2KQUA 2ZSEA 4AWAA 4HAWA 4TMTA 4QJ3A 4QWMA 4LPKA 4PLYA 3NBFA 4DYDA 1K8YB 3HFGA 4KX5A 1L6RA 5DP1A 3E7WA 4A8PA 2RGRA 3A4MA 4QC2A 3FVTA 2Q41A 4ER5A 1E1QA 1EZ1A 4ZI7F 1YF3A 3BEOA 4FYJA 1W9MA 2CJWA 3P26A 3ND6A 1Q1GA 2H51A 2YXLA 2QX6A 4EA6A 1NUQA 4BNFA 1NG9A 2JATA 5I7OA 1C3XA 4QG3A 2AN5A 4WDRA 3BGOS 3LCUA 1SQSA 4LGVA 1H2RS 4PGMA 4G63A 5K09A 4Z53A 3R5FA 3BJRA 1E2UA 2PH7A 2P6RA 1XLUA 2TMDA 3LBFA 3IC5A 1N9ZA 1CY2A 2OXCA 3FDIA 4QG7A 3W5UA 4E1AA 3BMQB 2VYVA 3CT4A 3ETLA 4NV1A 1KKUA 1KQNA 1OWPA 1VIMA 2GTIA 4RJIA 3RUPA 3V6LA 1JU4A 2JJ1A 5KYUB 2F62A 3THWA 3DDOA 4B3SB 3NM4A 3IPAA 4MWBA 5EVCA 2IV2X 1SH7A 3L5KA 3OZAA 3IE0A 4GMFA 5EJAA 2NMVA 3HCOA 5K3SA 3V97A 1XFDA 1T43A 3QVVA 4S1OA 4BNHA 2AFHB 2ORYA 1N2IA 2WHYA 1RBMA 2AUNA 3HH8A 3NH9A 4WXPA 5FA5A 3T3HA 5HPYB 2CZCA 3IUMA 2ZIEA 2JAXA 4IDEA 4RENA 5B1YA 5JQGA 1NQTA 3EIOA 4CEJB 3OAAD 1T4MA 1CXZA 3OJ0A 3QVTA 1RWMA 4ZJYA 4RA9B 3MGKA 1UC8A 1HDYA 2HK8A 4PHGA 3ENZA 2OVBA 3ZKAA 3JQDA 1V39A 3SQNA 4AYTA 4C5BA 2FZGA 3SE7A 1QQAA 2PGXA 1W4AA 2CXNA 4XD7A 1GQOA 4L4XA 5DHQA 1AQLA 3SX0A 4E2ZA 2NXNA 4EABA 5A3VA 4ZO9A 1V8DA 5FUXA 1JLMA 3UHFA 3GRUA 3U81A 4HYEA 2SKCA 3ID6C 4WFJA 1LLDA 4RUKA 5JFOA 4BBPA 4C4TA 4ZV7A 3SKVA 3WRYA 4LMBA 2WT4A 4ALNA 2XODA 5BV0A 1I10A 1VCIA 3D6TB 1UMDB 2HBZA 2QROA 1FYDA 1PJ2A 3O82A 4NC9A 3WRXA 5AVWA 1OC4A 2C88A 1EFVA 1TUEA 4XQGA 1BS2A 1VP3A 2CLLB 5H59A 3QE2A 4B76A 4X62B 1GD1O 4LF7B 4HNHA 3NVKI 4F8YA 4K40A 4ZPJA 3FVWA 1Y48E 2H3HA 4LOAA 2RG1A 5G3YA 1QGAA 1JGTA 3A04A 4H1TA 5A71A 3JW8A 4LYJA 1U28C 2WWYA 5GGXA 3EZ7A 1H6DA 2C58A 1II8A 3HB0A 4QE3A 1Y8ZA 4X92A 2OLJA 5K3FA 4B79A 3R6DA 2O2GA 3Q87B 1HE4A 2ZVDA 4HN9A 3VO9A 4LTNA 2GHQA 2F1KA 3I6MA 4L5JA 1P7VA 5FOQA 2WG2A 5BRJA 2DHQA 2IEIA 5GZ3A 3EZGA 4W1RA 2QGZA 2ZQ5A 1FBNA 3L92A 4GZ6A 1WHSA 3A58B 5FB3A 5GVSA 1R9GA 4IHJB 2EQ5A 2CDBA 4GMKA 3ZJYA 3GLVA 4ZAWA 5LVAA 2GD6A 4HMQA 3LV8A 4RD3A 1EJ0A 4CKEA 1IY2A 1NDHA 4YRBA 4WY5A 4WVLA 3QLJA 1ZN8A 2IYLD 4Q19A 3RS0A 1CUDA 1E9BA 2EOAA 1K27A 3QKUA 5LQDA 5C51B 1B26A 3U5TA 1OXTA 1QQBA 4M89A 3P9RA 3MB8A 4W63A 4XOIA 3N5CA 1PZHA 1DAOA 1NP6A 1FYXA 5LUAA 3NXSA 5JW6A 1GRVA 1SD5A 2FRDA 2EJBA 1NYRA 4FQ8A 3OQIB 2ZTVA 3E61A 3AR3A 4MQ4A 5CT4A 2L82A 4IUCS 5HKOA 1I30A 2AYXA 1NUTA 1W7AA 2VZLA 2IXFA 2Z2JA 2ZBDA 3CCBA 3CM0A 4KQ9A 1P3Y1 1Z68A 1YB4A 2WB4A 3RRJA 3QXJA 1L4LA 3MT7A 4FMDB 1FJGB 4RM3A 3DE4X 2G1PA 5FTWA 4YAOA 4LI3X 2WNHA 1BROA 1G3QA 1LXCA 3E7XA 2C2MA 4RADA 3SSAA 3STWA 1JNYA 4CMKA 1XNHA 2F1IA 2H0QA 2Y1EA 4TLLB 2RMKA 3AX6A 1CUAA 1CUFA 2IHTA 4OHXA 4BEJA 1KZYC 2FRVA 2CLCX 3KV1A 4H27A 4W5QA 4C7VA 3F9RA 4FOOA 3RYHA 1VB5A 2V7TA 3ITNA 1BEZA 3DE0X 4MR8A 3VPDA 2X15A 1JYFA 2WJHA 4EW6A 2V6JA 3FWHA 2CYBA 4ON9A 1FXWA 1M1XB 1DRKA 5B12A 3QHAA 1B0UA 4UHCA 1X77A 4XYLA 1FYWA 4QD3A 4ZYWA 1JEYA 2HPVA 1NI3A 2PGNA 4GXNA 1KHTA 3FB4A 4WFIA 3DWGA 5CD9A 2C31A 3D43A 1ZOPA 3FHJA 5D85A 4C08A 1DC7A 3R5JA 3WA7A 1XCGB 4F5WA 3BB1A 1MOSA 2FPLA 3IP5A 4J94A 4JNCA 4R01A 5BOSB 1I2ZA 1CZKA 1M6HA 2VDKB 2B98A 3M2PA 2PLNA 3QLVA 1X7XB 1N6LA 1QF7A 2N46A 2SKEA 3JYNA 2YBEA 3KHUA 1Y5IA 2M2IA 3LK7A 3OAAA 3DH0A 4KRGA 4P4NA 4IIJA 5FUWA 5K51A 3SICE 2IXEA 4WGFA 3W79A 4Y6PA 2GRAA 4PHHA 4NULA 2QVLA 3TEJA 1UC5B 2WFLA 1HNNA 1ODCA 1Z5GA 3PXAA 3RQSA 4EY6A 6ABPA 3I6YA 3LS2A 3BQ9A 2WD8A 1JJFA 3BMXA 2VPPA 2GZMA 3G1WA 4BKOA 1ZXBA 1D6MA 3TMYA 3OIGA 1DO2A 3FMPB 3QBEA 1NT4A 4D1YA 2OORA 1R0KA 5CXXA 4BTLA 1NR7A 2B4AA 3IP7A 3VU0A 1U3VA 2FZCA 3W4JA 1QF6A 3BH6A 5CUQA 5EKSA 3G2QA 3HYRA 5JMWA 2DQ4A 4CEHA 1YDHA 4JLJA 2G63A 2P6PA 2X6TA 3C15C 3VGJA 3LYLA 4IF4A 1GDHA 2J3DA 4WN9B 3E9RA 3S2FA 2IYVA 2G6TA 2H2DA 5TGDA 1EGQA 2EL7A 1ORVA 2ZXFA 1C4XA 3PD7A 4XM1A 1DWQA 3QM1A 2RJ3A 5FJIA 1WF3A 3KJHA 1UKYA 2AFIB 4LZJA 3TDKA 4C06A 5GIOE 3F0TA 2XNKA 3PTZA 3MJHA 4MI6A 5IAKA 2DGDA 3MTDA 1SPXA 4A82A 4LUCA 4EBFA 2GLTA 4X65B 1G41A 4CIWA 3HWX1 3UXMA 3THXA 1GP2A 1EDEA 4OI1A 1CQJB 3GPDG 1VKOA 3BICA 5LLSA 4UEWA 4FONA 4DJDC 3J81k 5AXDA 3PQ3A 5T6BA 1IE3A 4PPGA 5CX1B 3PRJA 3KWFA 4B7UA 3CG4A 3LWDA 4JKOA 5ADVA 2UZAA 3U4IA 2H7CA 2E48A 5HDBB 1RC0A 1HORA 3K1JA 4NBKA 2XEXA 4RKRA 2X0FA 1Y8CA 3LCVB 2E5WA 1VG8A 2NU8A 3NTOA 1EFPA 3KTAB 2O8CB 3PE3A 2YWDA 3PQDA 4LHYA 2BFWA 1JDTA 4HDAA 6Q21A 2XZOA 3GUZA 5DIZA 1JBKA 1OYVA 4C7MA 3CRVA 4B3HA 4HX9A 1QC5A 1PHRA 2HMAA 2D2FA 1CQPA 3E9CA 4E6EA 2IYZA 4ZAZA 1Y5RA 4BU1A 1WW8A 2FFAA 2WM8A 5DSZA 3ZVMA 1SB8A 3LPLA 1B6RA 2CL6X 4L51A 3KFLA 1ZMBA 2FWIA 2W4QA 3GFBA 4WWHA 4DIEA 1U11A 4R9VA 5FDFA 3M4NA 2CJYA 3BA6A 1OX4A 1F2UB 4LDAA 1MNQA 4WLVA 3ABOB 4BFLA 1SUFA 1QF9A 1Q1QA 4Y9TA 4TLMB 3I0ZA 4BVEA 2QRMA 3O1LA 4HRVA 3IO3A 2W6ZA 3TKAA 2X8JB 2OXEA 3TGWA 1SEPA 4LZLA 5KYXA 3WVNA 2JF0A 3C3EA 2QL9A 4BMOB 2Q5EA 2GERA 3W6UA 5FLXA 4JL6A 4EPYA 1JG3A 1O5IA 3IMFA 4LNAA 4C22A 2P3OA 3DG9A 3KFXA 4Q1CA 2ZP1A 3H2SA 2QMYA 2QE6A 2WF5A 2DH5A 5COAA 4LN1A 4BN4A 4OMCA 5AJYA 1VLVA 3EA5A 1GPBA 4GO1A 4BQFA 5BWNA 5F4ZA 1PD0A 4P3YA 4Q3BA 3DB2A 1K9SA 3H5RA 3H04A 1EUCB 4K26A 5JIBA 1IPHA 4OUDB 1H42A 4BWGA 1XN4A 5LKAA 4LAFA 4J7AA 4XQ0A 3K53A 3Q2KA 5BWBA 3DHVA 4AKGA 3OM8A 3BE5A 3EUFA 4R71A 4KWEA 2WVHA 3CRMA 1IJBA 1GA1A 2PIAA 3CXUA 3KTOA 3JRNA 3LBHA 2X0IA 1KZ7B 3AIIA 3PVSA 3DT8A 1LNSA 4PBSA 4E51A 4I55B 4KYVA 1HDRA 1DKMA 1Q3HA 1QYIA 4C6HA 1GCIA 3ZVNA 5JD6A 1E66A 1WCYA 4NH0A 3WBJA 3IDQA 5BVGA 3IA7A 1JFRA 3DC7A 5G02A 3PEWA 1KVSA 1W85B 1YBMA 2C8LA 4X1IA 2WJIA 3UXHA 5A4MS 3WO0A 2YZNA 3FSJX 2DECA 3GZ4A 5SYMA 1JECA 4DNFA 5H3LA 2GZDA 3SDBA 5LNK6 1Z22A 2D0PB 3ANSA 1HZZA 1RM5A 4BBAA 2QZJA 3FBGA 2IFTA 1PK8A 2QPOA 2R47A 3CHYA 3T3IA 1DL5A 4BNDB 4YAKA 5KJ6A 3U44B 4BP8A 4JB8A 1G63A 1TCCA 4GI1A 3SNKA 4ACAA 5JFGA 1RQLA 1YUMA 4JSRA 5JAHA 1QRTA 4IBOA 4G5OA 4YT8A 4RIEA 5A2GA 4IHQA 1QH8B 1YV9A 4CV3A 2ZANA 4R0MA 2D2XA 3CPEA 2ZB7A 1R7RA 1T3SA 1DAMA 1PVDA 2IS6A 3LBNA 3FWZA 4JA0A 1D04A 1TE2A 2XD4A 2ZCUA 1G6HA 4W7IA 2HMSA 2ZJFA 4K05A 4TQ9A 3SD7A 1G18A 4P83A 2JJMA 4HYQA 4LW8A 5KHAA 4BJ6A 4YMTA 3IAUA 3K6SA 3R4VA 3CF4A 1BTOA 1HRKA 2YS6A 4RK0A 4BLRA 1R3UA 4DMMA 1RLOA 1OIVA 2XD9A 5E4TA 1J2YA 1K7SN 2HCJB 1RZ3A 2QNRA 3GGDA 4CN9A 2Q4TA 3T1HB 4RDXA 3EXG1 3L0OA 1N3YA 3NHRA 4KUHA 1N8NA 3JQAB 3SIPA 4F6CA 2GA8A 3NR2A 3TVDA 3DULA 4F2GA 2NOAA 3U7JA 2VDUE 4F93B 1KYXA 1NSTA 4ZEWA 4D46A 3TQRA 4GM1A 4A6XA 3ZZTA 2QLLA 3LOQA 3UJ3X 3ZD6A 1NBMD 1YE5A 1SNYA 2B25A 4OMFG 1QO7A 4QGAA 2IX9A 3MA0A 3QKRB 1O96A 2XMCA 4ZO8A 4OU5A 2PG3A 1JIQA 3FJ1A 2QLBA 4OB6A 3PD0A 2A1UA 1F4VA 4FFPA 4TTRA 1ZISA 2ZJ6A 1GSHA 4H15A 1V11B 4YRLA 1VL8A 1N75A 5REQA 3CUWA 1ZD2P 4R9UC 3ZE9A 4A5SA 1YMVA 4OXXA 5CB4B 5THXA 1E92A 1Z56C 1ZGHA 2ORWA 4B74A 3GLHE 1C9YA 4INJA 1V37A 1YBVA 4E4TA 1Y6ZA 2ZE8A 2QRGA 1VBFA 3GJ6A 2XLCA 1XEFA 1DS6A 2PS1A 2I6TA 1QB8A 1RTTA 4RZQA 4X93A 4EB6B 1NNUA 2IT1A 5CXSA 1DB3A 2PRZA 3A3KA 4GZLA 3T34A 4B3DA 3DBHA 2BFMA 3F4LA 3VR0A 4ZYTA 1E2HA 5E6RB 3LNCA 1SVNA 2AI2A 1Y80A 2X2EA 1FS6A 3Q4GA 4X97A 1PTJA 1ODIA 1WY7A 4EEXA 2BHLA 3GLRA 5FUMA 1S01A 3ZHUA 4TKUB 2WUWE 4R51A 1TCBA 2AJDA 4HNUA 3DZDA 1QLWA 3GYBA 1GPAA 4U7FA 4CLRA 3FSRA 3D2AA 3N87A 4B81A 4BUZA 5C5IA 1ORDA 1SXQA 3NASA 4HADA 2WYIA 1H9BA 2EZTA 3ANLA 3UQZA 4YP7A 5I4IA 1H9AA 1CEYA 2KI5A 3ED1A 1RRKA 2PAAA 3M83A 4YAWA 5B7NA 4GNKA 1DFHA 3IQDB 1W73A 3O6VA 4W8HA 3R41A 3P9KA 2I5PO 2C7GA 1XG5A 3HKCA 3NLLA 3FNHA 5EZSA 2FLVA 1ZYUA 3R8CA 4PAQA 2BJWA 3HJUA 1XL1A 5EJFA 4BQQA 3IOCA 4FT4A 1YKGA 4RELA 4BE7B 3E5HA 1SZDA 2NLOA 1JIJA 2G77B 3FZEA 1Q17A 1QDEA 3PHCA 1N5RA 3MOGA 3FRHA 3P2EA 1C30B 4NJEA 1UXGA 2EARA 2HZBA 2POQX 3IQWA 1MB2A 1U31A 4RPHA 1SKYE 4OH1A 1EXNA 4YMHA 3RVRA 4FR0A 4WNAB 3EGDB 1W75A 1P45A 1EFUA 1CFZA 1MIOA 3PRYA 5ER6A 1NW8A 1U81A 5LQJA 4HFMA 3FIJA 3UY4A 2FMXA 3V8NA 4A91A 3DOCA 1C9MA 1THGA 1NUHA 2Z98A 4KMSA 3I58A 3LBYA 3N58A 5COQA 2A33A 5CDHA 2BGJA 1W5AA 3JWHA 4JYPA 2IXTA 2WUGA 5AI0A 3RNOA 2OP1A 2XWSA 1B14A 5TRTA 1SN7A 4B6FA 1N5DA 3HZHA 3WGYA 1J23A 1WLSA 4AXXA 1ZOSA 3IILA 4MRSA 4DMHA 5LQNA 2Q1SA 1F3LA 5EWJA 2JCXA 2YV1A 1M6YA 4KLNA 1L7OA 1WMEA 2O2HA 2NP7A 2O59A 4P1ZA 1DXHA 3BCRA 5ESXA 3UJ9A 2OOSA 5CRIA 4EELA 4PC3A 1X39A 2OV8A 4LOJA 3WGKA 4E5VA 4NK4A 5IDYA 3FTCA 2ZIAA 3B8EA 1JG1A 3SHOA 4EX6A 4IIVA 3W6PA 1SY7A 1KIMA 1OWOA 1TQHA 2DEUA 3MK31 4NABA 3AF2A 1APBA 1R64A 3LCCA 1R3DA 1LC3A 2R60A 1RQRA 1Q15A 2HJRA 3UNXA 4B4UA 5CFQA 4J1SA 7ABPA 1RRGA 3CUEF 3I9NA 1R6BX 1U7WA 2C2ZA 2Q8PA 5ELMA 4XKJA 4EO4A 3H17A 5HTKA 1QYVA 2C0PA 3H7AA 4CMIB 4TWZA 3NVDA 2VQDA 1NBAA 4HDOB 3AF3A 4AY5A 4DOMA 2BGWA 1SKUA 1NBMA 2VPZA 4YDHB 3KQHA 1BDHA 3U4HA 3H4TA 1F5NA 4DJFC 2YICA 1USVA 4XUCA 3IE1A 5DV9A 4DDUA 1S8AA 4V0RA 4EPVA 1O0CA 1GA4A 3I72A 2JJQA 4M21A 4WV3A 4TXMA 3U48A 1LQ2A 3V2GA 5EJ7A 3IVRA 3FKSD 3PNKA 4QIHA 1RWNA 1MU0A 1Z4LA 2E55A 3IE2A 3MLEA 3OQPA 4Q4HB 2MU1A 5JWHA 4YRSA 3NUGA 3F73A 1XCPA 4I3FA 3UENA 4KC0A 2PGIA 2IEAA 3F1LA 3L4BA 2HFKA 1OV6A 4RORA 2YZKA 4J4TA 3CLSC 3D6AA 2VZ9A 3LX4A 2XMQA 4F38A 2C04A 2OHOA 2OZLA 1EXWA 5AQEA 3CVYA 4Z3OA 1PVOA 3NTQA 4EI8A 4HCJA 1IH8A 5M7EA 5K6AA 3DAFA 1IN4A 1KNXA 1SG9A 3TTUA 2UDPA 3K0KA 4CT0A 4KK3A 1J49A 2O8EB 3JY6A 1LSOA 1TMOA 1I5OA 1NONA 2C9YA 3HKBA 2WU8A 3O21A 3PC4A 4A73A 5CM9C 3I34X 4UNQA 1E69A 2I4IA