1XRLA

Crystal structure of active site f1-mutant y205f complex with inhibitor pck
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVFRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 106
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xrlA00
3I6YA 5DNWA 2GYVA 4JYPA 2WFZA 2PKYX 2OAGA 3GFFA 3WK4A 3SC2A 3I28A 3BIXA 1GPNA 2XMGA 1Q0RA 3TGLA 1AKNA 4DMHA 1JI3A 3FYTA 4FFWA 5IVIA 1MJ5A 1SFRA 4OB6A 5AM1A 2WUGA 3WL7A 1C7IA 3QBJA 1N1MA 4PSCA 4DGQA 3LLCA 2FJPA 1QIHA 1J06A 2DHDA 3DQZA 3B5EA 4WDRA 3M3DA 4INZA 5CMLA 4WFIA 4AO6A 2J4CA 3DS8A 3HLKA 3R3YA 1ZGCA 1QIGA 3WWDA 4CG1A 3G0IA 1FSSA 1XQYA 2QVBA 3AINA 4Y2YA 1AUOA 3WA6A 3ZPXA 2XMDA 3AILA 4JH0A 4L0CA 3V1MA 1RWQA 3O4GA 4K6GA 4UHBA 4H7FA 5ALPA 4B0PA 4FWBA 3D2BA 2ZYHA 1UK6A 1F8UA 5JD5A 2VJBA 2OCGA 2VTVA 2WUFA 3QVMA 2ZSIA 3W05A 1U65A 4N5IX 2XQGA 4B81A 1A88A 3AUKA 1VKHA 2RAUA 4BC1A 3A2NA 4TVKA 1XZLA 1VA4A 1RYYA 2GZRA 4P92A 2C5GA 2WSLA 1JKMA 3C6ZA 1Y7HA 5HF5A 5JALA 3QITA 3L1IA 1MX5A 3VJLA 5DTJA 5KWIA 3FYUB 4K5QA 5AJHA 1HKHA 2OPHA 4X6YA 4EY4A 3T4UA 5FLKA 3SK0A 5ALFA 3TRDA 4RE5A 3AZQA 1YS1X 4W1PA 2AJDA 3PICA 5LLSA 1GKLA 3KWJA 2WHRA 4RNCA 3QMVA 1MNQA 1VE7A 3IURA 4BZWA 3PF8A 4HAIA 3RKSA 3BIWA 2I3ZA 3IUNA 4YPVA 3E3AA 1EK2A 3DD5A 4KAJA 2OXEA 1XZEA 2UZ0A 3I6ZA 4RE6A 1SC9A 4OD0A 4BCDA 2BUCA 1MN6A 4EY7A 4IHAA 5HFAA 5JARA 5JATA 4C89A 4FBMA 2H7CA 1OCEA 3KWFA 3L1JA 2Z5GA 1XFDA 1ZI9A 4JNCA 3ANSA 3PDCA 5CT9A 5CW2A 2QJRA 4OPMA 1CV2A 2VF2A 2XUIA 3ESCA 4N8SA 2VJDA 3OM8A 1LPAB 1ZGBA 3OG9A 5AM0A 4EUSA 4CIAA 2QKYA 5A62A 4B83A 3GUUA 3I1IA 5ALQA 4MXDA 3IA2A 5CT6A 4OYYA 1ORVA 1DTEA 4WY5A 5LZ5A 5CH3A 3STUA 5ALIA 5AICA 1XZHA 1Y37A 1FFAA 4KE9A 4B85A 2B9VA 3WMRA 3TEJA 3BF7A 3FNBA 1XKLA 3EQ8A 5LZ4A 2GYUA 3IB3A 1CR6A 2PPLA 5JYCA 2XQFA 2Z8ZA 3OTQA 4QNNA 1QIJA 1XRQA 4HVTA 2HRQA 3FSGD 1ODCA 4FTWA 5HZGA 1BEEA 2C4HA 1ZJ4A 3EIOA 2Z3ZA 5H3HA 2XQKA 3VVMA 2Q0XA 5AKIA 4PNZA 3HI4A 1CUZA 4B7ZA 4J0CA 4MQMA 5CT5A 4ZXFA 2I03A 1ETHA 2XI4A 5JIBA 1A8UA 4J0GA 3WWPA 1LBTA 1VOTA 5LZ8A 4C88A 2XUFA 4CG2A 2QM0A 5AK4A 3FSGA 1R4ZA 1QE3A 4QE3A 3MUOA 5ALHA 1XRRA 2PBLA 3D7RA 4PQEA 4XIIA 2ACEA 3JWEA 3VKFA 4X94A 2HU8A 4QDTA 4P9NA 1QLWA 4FMPA 4X6UA 1CEXA 1WPRA 5AK3A 3PE6A 2HL6A 1N5MA 4J0KA 5ALOA 1MX9A 4Y9SA 4FNMA 4YX9A 4LYDA 4DNPA 1XLVA 5ALKA 1CUWA 4X00A 5EIAA 2EDCA 1UT6A 3BJRA 1YASA 3SWWA 2GBCA 3G0DA 4KJXA 4OSEA 4AO7A 1IZ8A 3BL8A 5C7YA 1T2NA 1CQWA 1CLEA 3E1GA 3WYNA 1CUSA 3STTA 5A7GA 3WQHA 4WFJA 1GT6A 1P0MA 2V96A 1UOPA 5ALLA 2JGLA 5CBKA 1LNSA 3I2GA 1VE6A 4C4YA 1DINA 3PUHA 5AKHA 1QONA 1UK8A 5AKXA 5HF6A 1QO7A 2FJ0A 1FFEA 5FPPA 1XZJA 3WIOA 4ETWA 5AO9A 4UBMA 1F6WA 1EA5A 2FUKA 1AC5A 4KYVA 5HK8A 2HA4A 2WFLB 2GYWA 1A7UA 2ECFA 3H0CA 5AK6A 2B20A 2DQYA 1E89A 1GQSA 2XMQA 2WHQA 3QZUA 4BRSA 5LYYA 3DDUA 5C8VA 1TCCA 3H2IA 1USWA 4FFVA 1K5PA 3ZWQA 5FXMA 3DL7A 5ALVA 2WFMA 5C81A 1XLUA 2QS9A 1EDEA 2ZYSA 4S0XA 4Y2PA 3BDVA 1Q84A 5HKAA 4QDZA 1GPLA 3AIKA 4X6XA 1W1IA 4J0DA 3QPCA 3DOHA 2HA5A 1JT2A 3G9XA 3I2FA 1ZIYA 4AQDA 5HK9A 5D3KA 4H77A 5IVDA 1CIJA 2JGFA 4BC0A 5AHXA 3WL8A 2H9YA 3G0CA 5JZ9A 3C87A 4MQLA 1ODSA 3D0KA 1X2EA 4WFKA 3U0VA 3K2IA 3QM1A 3RLIA 2JF0A 1R3DA 1XZBA 3C45A 2XLBA 1R9NA 2NW6A 3HZOA 3EBLA 2J3QA 4ZV7A 1LLFA 3M82A 5J3JA 1WHTA 1M33A 3FLAA 4U2CA 1CUXA 2ACKA 6YASA 3H2JA 3KD2A 5AIAA 1XZMA 4KAAA 5ALRA 5ESRA 2JGKA 5K3BA 1TCBA 3P2MA 5HF9A 4DLNA 1DWPA 4OU5A 1TK3A 2CJPA 2LIPA 2QUBA 4IO0A 1P0PA 2WG0A 1LPBB 4H0CA 4GBGA 1LPNA 3HABA 1MO2A 1UZAA 1UOOA 4AN1A 1X70A 2WUDA 2AJ8A 3MUNA 4BTLA 1WOMA 1UWCA 1LZKA 2VAVA 4F0JA 4G8DA 1YB6A 4LYEA 1XZAA 4LXIA 4WJLA 1VXRA 5ALXA 5K3EA 1E8MA 1Y7IA 4QZVA 7YASA 3HXKA 3STWA 1QTIA 5I7UA 4C4XA 2J4FA 5HKBA 4CIBA 1BRTA 3HACA 4ITVA 3RM3A 3WK6A 1YCDA 5T4FA 2BCEA 3CCCA 3W04A 3CXUA 2HADA 2OGTA 3U1TA 2D0DA 4G9GA 1P0QA 3UUFA 3A2LA 4B84A 1WHSA 4EB0A 2VJCA 4CG3A 4U2FA 4H7JA 4X7BA 1PFQA 2YASA 5DLPA 3W9BA 5ALYA 3M83A 4D9JA 4OUKX 4JUIA 4G5XA 3ESBA 5JANA 1U2EA 2XQJA 4M0EA 5K3DA 1U8EA 3NWOA 4I19A 3H1AA 1AGYA 5D7BA 1WPXA 1KU6A 2HA6A 4GLBA 2PSEA 5K3CA 1HBJA 3STYA 4FLFA 1XRNA 2XUKA 5K3FB 1MX1A 5EIEA 1EXWA 3ICWA 5T4BA 3WLAA 3KOOA 4ZWNA 2CBGA 5A2GA 4DSAA 2OCLA 2JGMA 4J0JA 4BE9A 1MNAA 4I3FA 1H2YA 5AM3A 1A8SA 5E4TA 1CQZA 1LPPA 4EY8A 1X2BA 1XRLA 3O95A 1D07A 3O4IA 4E14A 3STXA 1EINA 5EHZA 2WIDA 1MAAA 3DKKA 1VXOA 1TAHA 4LIPD 3WJ1A 2CB9A 3HJUA 4BB0A 2XB6A 1CUIA 5EHXA 3D4LA 3VISA 4BCCA 2G5PA 1VA5A 1DX4A 4GXNA 5AI9A 5DYWA 1AURA 5CH5A 3UMJA 3LS2A 4V2IA 2O2GA 3BXPA 1N8SA 3H1BA 1UK9A 1K63A 4RPCA 2C0PA 1BU8A 3SX4A 4AMYA 3TJMA 1EI9A 1BN6A 1CUAA 5DYTA 2PU7A 2XUHA 2WTNA 4CFSA 1MTZA 3C6YA 3C43A 4UHCA 2H7XA 2AJCA 4BAGA 3AZOA 4IH1A 1S8OA 1EK1A 1EVQA 3L1HA 1CPYA 3I6MA 4X90A 3DJYA 1GKKA 4H7EA 2OG1A 4U2EA 3V48A 5EGNA 1XQXA 4H7HA 1XRMA 3I2HA 3ZLTA 4HS9A 5C8XA 3E4DA 2OGZA 5AM2A 1KU0A 4I4CA 4IH9A 4BVKA 1DQYA 3BWXA 2D5LA 3OURA 5A6VA 3ZLVA 1UK7A 5ALUA 3FAKA 4HXEB 5FRDA 3I2KA 3DLTA 3V1KA 3IBTA 4DYHA 1HDEA 2VT7A 5IVKA 1JU4A 5AIBA 2WJ3A 3DYIA 3R3UA 3QPDA 3R3ZA 4E46A 1C4XA 5ALMA 1YR2A 1EH5A 2XLCA 1EX9A 3AIOA 2CEKA 3H18A 4XX1A 4OU4A 5JADA 3C6BA 4J7AA 1IVYA 2H7YA 5AKZA 2QJWA 2WHPA 3AZPA 2VA9A 2QMQA 2WILA 2EEPA 1CVLA 3GA7A 5ALTA 4G9EA 3W06A 3EQ7A 2XUQA 1A8QA 2PU5A 2QUAA 4BVJA 3K9BA 1OXMA 3DEAA 4UBLA 2RONA 2Y2VA 3C6XA 5AI0A 3V1LA 5DNUA 3IULA 2HA2A 5EHNA 1ZD4A 3FVRA 2HU7A 5LP1A 4GDMA 4UFPA 4N8EA 3G9UA 4DMCA 5BV7A 1QIIA 4KE6A 2XMRA 2VAXA 2X76A 4B9EA 3H2GA 4MWTA 3H2KA 2PSHA 3W9UA 3ZLUA 5HQ3A 4FBLA 3G0BA 2BFNA 5BWBA 1FFCA 3WYDA 3WI7A 4BATA 5CURA 1UFOA 4IH4A 1QJ4A 1BN7A 4EHBA 2HU5A 2E3JA 1Q83A 1IUNA 2G4LA 3FYUC 2DSNA 3D3NA 5AKGA 1N5RA 5FUMA 3LP5A 2XDWA 2ES4A 4AN0A 3AFIA 2WU4A 3EF3A 2AJLI 4X95A 3D5EA 1ZD5A 4F5ZA 2Y2UA 2OLEA 1CUEA 3Q8WA 2HA7A 1QOZA 4H18A 3W2TA 4A16A 4XJVA 1K8QA 3WJ2A 4UUQA 3UUEA 4B82A 4X97A 3F96A 4W1SA 1YS2X 4Q34A 2WUEA 3FOBA 1ODTC 1ZD3A 3CN9A 5A71A 4CI9A 4EZIA 2FX5A 4HRYA 3T52A 1R9MA 4BCBA 5AK5A 1K4YA 2PSDA 4CCYA 5HFNA 4HZGA 5CT4A 4AZ0A 2HHAA 2B4KA 1QGED 4BDTA 1DT5A 3G9TA 4FHZA 1U4NA 4BE4A 1LBSA 5LIPA 4BP8A 3F8SA 3HC7A 1P0IA 1W52X 1XZFA 2VSQA 2DCMA 4W1QA 3A6ZA 4FOLA 1CUJA 1ZJ5A 4PO3X 1CUUA 2I78A 3PUIA 3C8HA 2VT6A 2XUAA 1H2WA 4B9AA 2XQIA 3GROA 2WIFA 1G4HA 5HF8A 2WIJA 1GZ7A 4N5HX 4UBKA 1THTA 5IKXA 1PV1A 3JW8A 2AXEA 1XQVA 3PI6A 2IIVA 2V97A 3O9VA 1CRLA 2Z3WA 1DQZA 3BJMA 4X3CA 4RGYA 4OCZA 3IIIA 3S2ZA 3WK5A 4GHWA 4AX4A 2RHTA 1K6EA 3WK9A 1H2ZA 4G4JA 1QIKA 4LKOA 5A7HA 3C70A 5AOBA 2JEYA 1O6FA 2XUDA 4UBJA 3GBSA 2YYSA 5JD4A 1AMNA 3LIPA 3Q0TA 3R41A 5CXXA 2PSJA 4G4IA 4HXGA 3JYHA 2GBFA 5KWJA 1THGA 5ALDA 4DNOA 3VDXA 4C87A 5I9IA 1MAHA 1BE0A 2HRRA 1L7QA 2XMCA 4QLOA 3M81A 2RGUA 2HIHA 4WCVA 4Q82A 4X85A 3D59A 3FWHA 4Y7DA 5AM5A 4KR0A 2QTBA 4QDOA 1EHYA 1XZCA 2WIGA 3NGMA 2DQZA 4KEAA 3FLEA 1CUYA 5AI4A 4C01A 3WK8A 2VATA 4AO8A 2AJBA 5AH0A 3KXPA 4PF1A 1BCRA 2WJ6A 1TIBA 1H23A 3WWOA 3WKEA 1WB6A 5AI5A 1CUGA 1QFMA 1IUOA 2O7RA 3DL4A 2OAEA 5AKJA 2JGIA 2ZYRA 2PSFA 2VEOA 3FBWA 3G7NA 4K6HA 1JMYA 3O4JA 3PFCA 1LPMA 2V9ZA 1LZLA 5ISMA 4O08A 1L7RA 3VJMA 4NZZA 4K2AA 2BGNA 1O6GA 2C7BA 4Q1VA 1UKCA 3E0XA 4TPKA 2ORYA 5FDFA 5KBYA 2XUJA 4MEBA 3R3XA 2PL5A 5YASA 4DMFA 4BP9A 1YB7A 3WKCA 1CUHA 1FFBA 1DX6A 3MVEA 2PVSA 3I2JA 1ZI6A 4KACA 4UBOA 2VJAA 4N8DA 3STVA 1FJ2A 2ROQA 4HRXA 5K5EA 3WL5A 1NX9A 3KDAA 4FDMA 1LGYA 4LXHA 3DKRA 4DNFA 2C0QA 4PSUA 5EFZA 2HA0A 2GZSA 3RARA 3B3QA 2GBIA 3F9CA 5AKYA 2DFPA 3DOIA 3IVMA 1HPLA 4C6HA 4YASA 1QIDA 2ZJ7A 5AKKA 4F21A 4TGLA 4MWSA 1EB9A 3FYUA 4DMKA 2WQZA 5AI8A 1H22A 4X91A 1YAJA 3OOSA 1AQLA 1YA4A 5SYNA 2R8BA 1LPOA 1G66A 2RI6A 4GWLA 2RIPA 5CRIA 1E8NA 1G5FA 4J3JA 4C4ZA 3WL6A 3N0TA 3ESAA 1XQWA 2WKWA 4W9RA 2I3DA 4QWWA 3F67A 4H7IA 1NU8A 3H2HA 5FKJA 4YK7A 4X71A 3D2AA 1C7JA 4ARBA 3X3HA 1SOMA 2OCKA 1BCSA 1DWOA 4OB8A 2H1IA 3MGAA 4J03A 4G8BA 4WY8A 1YAHA 1XZDA 4DTCA 4EY5A 1E5TA 2X8BA 3HSSA 3G9ZA 4BRZA 2PUHA 1TQHA 1RP1A 1IMJA 4U2DA 2JIDA 4BVLA 4GECA 4G8CA 3ANTA 2J3DA 2JGJA 5IVHA 4K6KA 2QR5A 4MJ3A 4F60A 1TKRA 1YA8A 5JAOA 3C5VA 1ORWA 2DHCA 3KSRA 4G1FA 1XROA 1XZGA 2XE4A 4QEKA 4IQ4A 1UKAA 3PF9A 3DYVA 5LZ2A 4KRYA 3GZJA 1R50A 1AX9A 4OB7A 3V9AA 1JJFA 4B80A 2Z8XA 1CUFA 4UBNA 4QDUA 1ZI8A 2VQ6A 3BDIA 4Y2XA 5A7FA 4UHFA 1DWQA 4Y2TA 2QZPA 5JD6A 5DJ5A 4NMWA 4Q3LA 2ZSHA 4BTVA 2JGEA 5CT8A 1ZOIA 4A23A 4UBIA 4AZ3A 1XRPA 5AKEA 4Y2RA 5ALSA 1TRHA 1SCQA 4Z49A 4NS4A 3OPMA 1DT3A 2WM2A 3IDAA 2BAGA 2ONCA 3WKDA 1WB5A 4PSDA 2OCIA 5T4HA 2O7VA 4M0FA 3F97A 3YASA 3DNMA 4A5SA 3A2MA 4ZV9A 5ALZA 1QFSA 2WJ4A 5E4JA 1GXSA 4UHHA 3H04A 3WWEA 1IUPA 4J0IA 5CH8A 1CUDA 2C5FA 4KE8A 2XT0A 1ACJA 1BEZA 1HL7A 1BROA 2OGSA 3EQ9A 5E2IA 4FLMA 5I8PA 3FVTA 2PX6A 5LZ9A 2QRUA 4Y2JA 3N2ZB 1ISPA 2B61A 4L3WA 3BE8A 3CN7A 1XZKA 5LKAA 2XUGA 3B12A 1GPKA 5DWDA 5JZBA 3QYJA 1J1IA 3QMMA 4P08A 1MU0A 4GI1A 1T4MA 2HA3A 4DNQA 2CMFA 3I2IA 3IUJA 2R11A 5JAHA 3I1YA 5FV4A 4AXBA 4XVCA 5HCUA 2HFJA 5EIHA 1QIFA 1Q0ZA 3DCNA 5F4ZA 3FLBA 3ZI7A 2HDWA 1R88A 5BWCA 4FLEA 4XWGA 3RK4A 4E15A 2CUTA 1AZWA 1W76A 1KEZA 4BAUA 3IUMA 1W75A 5ALWA 1GQRA 4Y2UA 1YSCA 5DNVA 1CFJA 2YH2A 2G5TA 4Q3KA 4ARAA 4BAZA 1ACLA 1BS9A 1NU6A 2O2HA 1QIEA 3VXKA 2BGRA 1CUCA 5EHQA 3WWCA 1UXOA 5JAPA 5AP9A 5E4YA 2P8SA 3AJAA 3A70A 5SYMA 2CKMA 5ALEA 1UOQA 3R3WA 2WFLA 5DYYA 4Y2SA 3ZV7A 4KRXA 1XZIA 2HM7A 2XUPA 4Q05A 5EI5A 5AI6A 3FCYA 1ZICA 2QOEA 3QPAA 3D2CA 2XMZA 3ICVA 2BJHA 3R3VA 2XUOA 4UPDA 4X93A 1VLQA 3O4HA 1LPSA 3ED1A 4L72A 4KAFA 2ZYIA 4P93A 1XKTA 4HXFB 5AKLA 1F0NA 2XMSA 5T4EA 1MT3A 5BOVA 2WG1A 3VJKA 2RHWA 2Y1KA 1R1DA 5ALGA 4DM7A 2GBGA 1H2XA 2Y6UA 2ZJFA 3K6KA 1JFRA 4EY6A 2C58A 1ZIXA 2BUAA 4PW0A 1Z68A 4UFOA 5AM4A 1ZD2P 5FPQA 1WM1A 5FP0A 4FKBA 2PUJA 3R0VA 3WA7A 2WHPB 2WG2A 1EB8A 1HLGA 4B6GA 4L9AA 5CTAA 4UHEA 5DTIA 4J0HA 4W1RA 3NOXA 2IITA 2WU3A 3LCRA 4G4GA 2OQVA 3R40A 3QH4A 2X5XA 3H19A 4JEIA 3V1NA 4BDSA 1VJ5A 4H7KA 1CUBA 1QIMA 4EA6A 4Q3OA 2WTMA 1SCKA 4AB1A 3HEAA 5HQ3B 1F0PA 2BKLA 1UKBA 4ZRDA 1W4LA 4DSZA 2BUBA 4LHEA 2O2IA 1WB4A 1VZ3A 2IX9A 4B0OA 2QT9A 3WZLA 1J07A 3C5WP 3GELA 3AIMA 2HFKA 5FOQA 2EDAA 4ZREA 2ZVDA 4FNGA 2K2QB 1GGVA 2PM8A 4MYDA 5JZSA 3QMWA 4U2GA 1XLWA 4H7DA 4UFNA 1FFDA 1QO9A 4QLAA 3CCBA 1E8DA 1JMKC 1HQDA 4MEAA 5K3AA 4UHDA 1EDBA 1CUVA 3LIIA 4Y2QA 3PFBA 2WIKA 2XMBA 4MYSA 4JYMA 4QA9A 5AOAA 1PJAA 4U2BA 5ALJA 3G02A 4DIUA 3WKAA 4ROTA 5D3ZA 4QDXA 1B6GA 1L7AA 1I6WA 2JEZA 2QXTA 4PV7A 4BBZA 4CCYB 5ALNA 4LXGA 3FCXA 4OYLA 1J2EA 2Y6VA 4BYMA 1OILA 3VVLA 4NVRA 2V98A 2YXPX 1EDDA 3ILSA 2W6CX 4AMZA 5CXUA 1W6RA 5K3FA 1QZ3A 2CZQA 3NUZA 4GEGA 1SCIA 5JASA 4BZZA 1QTRA 2DR0A 1MPXA 1WCYA 4CCWA 5C8ZA 3S8YA 4QWMA 3WK7A 4H35A 1JJBA 3HRHA 4X92A 3G8YA 3H17A 3ESDA 5LKRA 5KREA 3BF8A 3C8DA 4Y2VA 4KE7A 5AOCA 3WZMA 1E3QA 2OQIA 5LZ7A 2QXUA 5IH7A 5JAUA 1EVEA 1VZ2A 3IUQA 3OC0A 4ZI5A 2JBWA 1JJIA 1B41A 1G42A 3G0GA 4GW3A 2W22A 3WIBA 3F98A 3WKBA 4EBBA 4HTAA 2WLSA 1TCAA 1IZ7A 3O0DA 4M0MA 2DHEA 3HYSA 4W63A 3O9MA 5D6OA 4ZGBA 2G63A 1DU4A 1JU3A 2ZJ6A 4E11A 1E66A 4WDQA
chains in the Genus database with same CATH superfamily
5IKOA 2AFIE 4NDZA 2CFCA 3A1DA 1Z0JA 2AWNA 3I6YA 4O2RA 2OSVA 2Z2KA 5DNWA 3BB3A 4W8OA 1LI7A 1N6HA 4KQ1A 4N6GA 1NXVA 2AYYA 4QYIB 4RA9B 1RWNA 1PZGA 2JFUA 2OAGA 3WK4A 1AGXA 1T4CA 3KQPA 3NTXA 3N0VA 2PUFA 1WMFA 5LIRA 3EJ6A 3TGLA 8LDHA 3NKVA 4EGCB 5AVXA 2V7GA 3WDSA 2QL9A 4IPTA 3V9PA 1D4FA 3R3SA 1EHCA 1N2GA 5EWJA 2O6LA 2ZBGA 2ON6A 3KYCA 5H70A 3BGVA 3PTZA 4UAJA 1YNOA 5CDYA 3ENZA 2GZ3A 1IL0A 1MJ5A 1RLTA 2ST1A 4R9NA 5K4GA 3LDFA 5D5QA 1UH5A 1T1SA 1ECLA 2WUGA 4Y1EA 3WL7A 3FB1A 4E70A 1I14A 2V03A 4FILA 3TEFA 4F06A 3INGA 5LQUA 1VCIA 1XT6A 4YRGA 2DPGA 1MDFA 5I3ZA 2W58A 2FMHA 2PH1A 2C1XA 1ORTA 1HH4A 1VJTA 1NM5C 2BMAA 1J06A 4E5MA 3E70C 5KYYB 4LTMA 1Z6QA 2W37A 1UWLA 4TTJA 3T7DA 2DHDA 4ND4A 2G7MC 4FUTA 3VPXA 3P9CA 4XD7D 3KSDO 1KQOA 1B8UA 4BIIA 4WCFB 3KLBA 2WPNA 2WNIA 2OORC 3EWAA 1OOEA 3OOEA 4P34A 1EFTA 2VZEA 3EYWA 1S01A 2WM8A 1F1JA 3ND9A 3QLVC 5D84A 1QVVA 1JPJA 2J4CA 3GEDA 1ZGCA 5G3YA 3A7EA 1CRQA 3KDPA 4ALKA 2DB3A 4CT0A 1I32A 3CO5A 1A9ZA 3HP1A 3U9LA 4M38A 3RTEA 1I2AA 1R0WA 2FZEA 2HGSA 4KJZA 3CLUC 3FAZA 2AMYA 1XQYA 2R7AA 4X7RA 4XYMA 3ZCSA 3TCNA 1M1XB 3GJ7A 4B40A 4DE5A 3D3QA 1KQFA 1AUOA 2VDWB 1CVIA 1MOPA 1G3QA 3U6BA 2ODQA 3WA6A 4M1EA 4WJZA 4MW2A 5TVKA 1ECCA 3AILA 3ABIA 3O2SB 4UAVA 5ICGA 3EX7C 3FY4A 3VR1A 5HNKA 2I7TA 2O2XA 4Q37A 2HCTA 3TOZA 1Z36A 2NAPA 5AVTA 4C88A 4HHEA 2DE0X 1VP9A 2PUWA 1SWWA 2FR8A 3VHQA 1CZOA 2JLBA 4JLUA 4N65A 3RFXA 1FFXA 4DV4B 1FLAA 1LK7A 1PGOA 1ZFNA 4UHBA 2ZUTA 2HT1A 3EODA 3CRZA 4B0PA 4JSTA 4K87A 4BEVA 1KTIA 1M1YA 3KYDA 4YR9A 4XD7A 3RIGA 3LDUA 1NIPA 4IWNA 4TT8A 4F46A 5JD5A 5FTLA 2PJZA 5FOSA 2OFOA 3ROPA 1GL7A 1SEVA 1OZAA 4OGKA 4DLBA 2B7BA 1XPUA 4C14A 1YGPA 4LHSA 2AKYA 1IIRA 4BVAA 3CUEF 4UQOA 1Z3CA 3M6XA 1IXRC 1CEYA 3EMVA 4JKOA 1IZZA 4M0UA 1MCZA 3LDHA 3WO0A 1DC7A 3MNFA 3WDMA 4HPJB 5BW6B 3A4VA 4LFAB 2DSTA 2FEXA 3IGFA 3D8NA 1XCOA 4JQSA 5FEMA 4ARZA 1N2SA 4CUZA 2FPLA 4IDFA 4D3XA 3KSMA 5IDVA 1VKHA 2YZ2A 3TKLA 4BC1A 1NNSA 4OFBA 3ETCA 1T3LA 1VECA 2OZEA 3N2EA 5B1SA 3SXUA 1I4EB 3NV7A 2EKPA 1B3RA 3NP9A 1RPAA 2CFIA 2G0TA 4MMXB 2D59A 4P92A 2C9OA 3NQ41 1KORA 3QOYA 2C5GA 4O2AA 2DEUA 1JKMA 3GPCA 4P38A 5HF5A 5FBVB 1Z2OX 1HT2E 2QRHA 2V74B 2ARKA 2OD7A 2I4TA 3QITA 4JSRA 1E5DA 3PKIA 4M7OA 2BSXA 3UT5A 4KPYA 3UW1A 2NOAA 2Q1XA 5ARBA 3T1QA 1A97A 1WQ3A 1SCUB 2I65A 4JSYA 3RVOA 5KWIA 3HO6A 1FYEA 2GK7A 3FYUB 4RJ2A 1R6XA 4WXEA 3BFVA 1NRWA 2A14A 4RVGA 4LNHA 1ULSA 3KUUA 1RYNA 2IX3A 2OPHA 1DOZA 5HR5A 4JBNA 4P33A 3EGCA 3WAKA 1GFZA 3PV0A 3FZNA 3M0EA 3PUVA 5AD1A 4MROA 5BV0A 1TU3A 3TRDA 2OWEA 3HUUA 1YS1X 2IXTA 4MMYB 4YALA 2EFGA 2AJDA 3DD1A 5FL3A 5KOHB 3PICA 5BV8A 1GKLA 1JFFA 2I2DA 2WAOA 1ZK4A 3U17A 3WADA 1NC3A 3ASZA 3GRPA 2FETA 2O0JA 1ZH6A 2BEVB 3IDSA 4N82A 3LVFO 7GPBA 5ER6A 5CA0A 2HMVA 4IJKA 3FFXA 2AN5A 1GRNA 3JTMA 4FYJA 4XCVA 4ZOQI 2I67A 5EQJB 1TL7C 3TLGA 1SQ6A 3CKMA 1K68A 4IGFA 4QLBA 3KJXA 1JEEA 4W99A 3RIEA 2I3ZA 5ADHA 5FAXA 3RADC 1DEAA 3L1KA 5TGDA 1MR3F 4JWTA 1XZNA 2C4TA 1EK2A 1Y1RA 3T99A 1EFLA 2V7QD 1NUAA 5DOZA 5IC6A 3ESYA 3L0ZA 2OXEA 1VMDA 1MB3A 2X7XA 3LKBA 1YDGA 1F4LA 1VPVA 5MHTA 2B4AA 1BXRB 4X7PA 3SLKA 4OD0A 2KS6A 3B1ZA 2CL7X 2HSDA 3SLRA 4BWFB 3L7MA 3R20A 1MN6A 3E3MA 4EY7A 4UNIA 4Q4AA 4BGUA 3EK2A 1VSVA 4TZKA 4JUFA 4BO7A 1E96A 1N8KA 2XZTA 4HVLA 2CVOA 2KYRA 3A9VA 1B16A 5DO9A 5HFAA 3NHZA 3ME5A 5JARA 2QSUA 3ECCA 4NMLA 5KNDD 1QE0A 5H16A 4CI0B 5D5HA 1QHHB 3AEQB 1OCEA 3RFVA 4WVFA 2EX1A 2ONJA 2ZIXB 3LC0A 4QG3A 1JAXA 2WJIA 3Q85A 1TU4A 4MO2A 2ODTX 1VPTA 5LLDA 1S02A 1W96A 4GZMA 2Q3EA 1XFDA 1ZI9A 5K0BA 5DHSA 3PRKE 2Q7OE 3PDCA 5F12A 5CT9A 1D2GA 1Z34A 3P2KA 1JYEA 3LCJA 5CW2A 2QJRA 4TXHA 3U7FB 2O8DB 2DF8A 3QUBA 4OPMA 3LA8A 3ZH2A 2OB1A 3ZU3A 3GQVA 3AOEC 5CDFA 4LDZA 4U5QA 3EVBA 2NU9B 2X2FA 5H9VA 1CZRA 2WEKA 3OQIB 3AF0A 4RENA 1QH0A 2VJDA 3PK0A 1TI7A 1ZGBA 2VJYA 4JQZA 1ECBA 1QZUA 4NZYA 4RETA 3WO1A 4ZYUA 1RHUA 4BFXA 2QMZA 3KVNA 1JR6A 5BRAA 4LX0A 4TRJA 2GD2A 4HNHA 1N2CB 4CIAA 1NVAA 1M54A 2IEAA 4EHJA 1W1WA 3TW4A 2FEAA 1SUAA 4TM8A 5EFOA 1KO1A 3ESXA 2CL0X 4GO1A 1P91A 2J48A 1SQ5A 5KNDA 4MVJM 3QYFA 1YR7A 1JG1A 1E3EA 2JAWA 1QO0D 4QXRA 4MKRA 4EG0A 3OQHA 2F67A 4RHEA 5F52A 1M2VA 3STUA 3AY7A 1R6UA 2CV1A 4ARSA 2QTRA 1EZ1A 2VWHA 2B34A 5H1YA 1BXZA 2PXXA 1O1YA 3RUEA 1Y37A 1T9GS 3C7KA 3ITDA 4DV3B 1AT1A 4FXOA 4LQDA 3P19A 5I5GA 3S1SA 2DQKA 1T1RA 5LB4A 2HRBA 1LQUA 2PE5A 1DKLA 3DF7A 1ZH4A 3FVQA 1LS6A 2G1AA 3BF7A 3B13B 2CJWB 2VC2B 2VF5X 4RAQA 1DXYA 3R0JA 3A1VA 3OTHA 3C48A 1PS0A 4CM6A 1O58A 4KGDA 2M6KA 3EQ8A 1LDMA 2ID9A 3U3OA 4CTMA 4MWOA 1S8NA 4LUCA 3EXFA 3ET5A 4UD2A 1DXQA 1QHYA 4D79A 2R8ZA 3BFKA 3W6OA 2O3SA 1V47A 5JYCA 1G98A 2X1HA 1BNCA 1AE1A 1PK7A 2IEZA 4N1AA 4GOXA 4Q66C 5D00A 2J6CA 3G13A 5KSPA 1XRQA 1P9NA 5CVVA 4ITRC 2P68A 4F3YA 5I4CA 2WB2A 1TRKA 2C07A 5EPUA 2QLNA 1MQ9A 1Y1LA 1QO0A 2PLAA 3FSGD 3MWDA 1AZLA 1RXSA 4FFLA 4FTWA 4CG0A 5HZGA 4J43A 4M9CA 2F1HA 2C5EA 2ZIWB 1U2GA 3DBHA 3EIOA 2NQ8A 4NP6A 3VVMA 2RC5A 2Q0XA 3K9LA 1DAMA 4E5KA 4PNZA 5TQ0A 1W6UA 1H0RA 1BOOA 1N1GA 3DULA 3E5RA 3GOHA 3HKDB 4B8YA 3M3HA 4ECEA 4DDWA 1MHTA 4NPHA 5LJLA 4HL6A 3HJHA 3SQOA 2SICE 1SHZA 3IQZA 4MV3A 2H1FA 3H1TA 4B7ZA 4MQMA 5CT5A 3ZR4B 1E9VA 3THWB 3ZCQA 3IS3A 1FS6A 5DH9A 1JFTA 2Z09A 3GFBA 4QOJA 4C2BA 4O2AF 4D8YA 2RE8A 4CKBA 4P7GA 1A8UA 3IKVA 5ESDA 3SKVA 3ILXA 4UNNA 2XWBF 3RUCA 2O8CB 2QBYA 1IM8A 1MEJA 1VOTA 1XNHA 3OT4A 5LCXA 1M73E 2PBZA 3VR5H 2X6TA 5J1TB 4CG2A 4KTVE 5ECDA 4JA2A 2HSWA 1L7VC 5DISB 1RBYA 5EIOA 4DEVA 1N2IA 4UNRA 4HWTA 5E8RA 3GEBA 4CYMA 3FSGA 1RHQA 3C3PA 1QRTA 1R4ZA 5K8IA 3WHPA 3ZU4A 3LUDA 3W78A 4EITA 3K73O 4QE3A 5C5DA 1HZZA 1JAZA 5ALHA 3QWBA 1QS0A 2PBLA 3D7RA 3HCCA 2O07A 3LCUA 3ZZMA 2P3SA 1RQNA 2PWYA 3JWEA 5BNIA 2O3TA 3FYHA 3MB8A 3BMXA 2Q7XA 3A3PA 5DLDA 1JG4A 1TA9A 3QVLA 5J4LA 3SHFA 4X6UA 3E2IA 4CEJA 1HY3A 1OR8A 3TG8A 1ZAYA 3OIGA 3D8HA 3SXPA 5FI3A 4B3IA 2JHFA 5DNDA 3RGWS 4CUKA 2J3KA 5DM70 1W87A 2X0KA 4JDPA 1UMBB 2DJIA 3PE6A 4RJLA 4MDFA 3D6NB 1IJFA 4CMKA 1W4RA 4A1FA 1JFLA 3LWDA 4I3HA 1TTTA 1JB9A 1QVRA 4NNOA 4RY9A 1KJWA 2GQ0A 3KHKA 3L6UA 4EMUA 3BTSA 1TMGE 2DLCX 3ES9A 3EXEB 4LI3X 4QBIA 5G4KA 1W36B 1M6VA 3EGDB 1QQBA 1DHRA 3RK0A 3K72B 2D2XA 4QASA 3KAQA 1JEQB 2E85A 3N2KA 1VIDA 4LFCB 2W2QA 4C0WA 5EIAA 3LV8A 2YUTA 1OLUB 1UT6A 1WVIA 2H4YA 4LZZA 1XTIA 1EWVA 3UENA 1SC1A 3C3MA 5FO1A 3WYCA 5B1EA 3KSAC 2P77A 1D6MA 2GJ8A 4OAPA 3RRXA 4EABA 3SYTA 3OI7A 1YMVA 4MQFB 3NTRA 1YASA 5IBQA 1BE8A 2CLFB 2PS0A 3AGPA 4TTPA 3QFHA 2BC9A 2UUCB 4QSHA 3RC2A 1EK6A 5DMHA 1E1LA 2P9EA 3EVNA 3GUHA 1I94B 1ORRA 2GRAA 2P9GA 1EMDA 4E31A 5C0OE 1ZDMA 2H4ZA 1D5CA 4GBMA 2IKSA 3UA3A 1JB1A 1G8MA 2ODPA 4YS6A 1UQTA 1EX6A 2D1YA 2JI4A 3A1WA 3D6VA 2QROA 3HVIA 3EXAA 5DTRA 2GEKA 2PFKA 1C3OB 1D2HA 1W29A 1L5HA 4IMIB 1R6AA 2FUCA 1W5BA 2JS7A 5B7GA 1MOSA 2H4JA 4MV8A 4TWIA 5JC8A 1GT6A 1U2SA 2V96A 2VHXA 1XQ1A 1UOPA 3OZTA 3GXBA 1DKNA 2DOKA 1Y3AA 4W6QA 1WBBA 2JGLA 3MINA 1WD5A 3D6AA 1OQAA 2P9JA 5L4NA 3OZSA 4H1WA 3BXZA 1N5KA 1JZQA 5FBZA 5HE9A 1WU7A 1R10A 3DDWA 1LA2A 1R27A 2WC1A 4JGBA 5D01A 2K2WA 3FYSA 2NTJA 1JKJA 2AC4A 5CVEA 3OIFA 5AKHA 3RT9A 3KTDA 4ZYTA 5GJBA 5AW6A 2HK9A 3OFVA 2W43A 4AS3A 3P8ZA 3B2EA 2EP8A 1VDMA 5BSUA 1K89A 4WZAB 2GN6A 5HZMA 1QO7A 1V16A 2AFHB 1FXSA 2FJ0A 4Q1AA 1K4KA 3G2OA 2D1QA 5G0TA 1N7HA 4Z2AA 4TXLA 4AJOA 1XEWY 1LCIA 2XE7A 4RJJA 3L6CA 1CYEA 2XYQA 3NC1C 1Z63A 2EWVA 3ELWA 2WICA 3FGNA 3WIOA 4ETWA 3ER9A 1RBMA 1NXXA 1P2GA 4Z9BA 5AO9A 421PA 1L7XA 2MSNA 1ZXLA 4B1FA 1X7ZA 5FAKA 3A4MA 3JVEA 2UXDB 2GEVA 1J7JA 3UIEA 2A9JA 1JQLB 3U31A 4KAXA 2VN8A 4RC9A 2X13A 1M2NA 2AOTA 4Q1CA 2X9NA 4X66B 1CZNA 1S2NA 1XCPA 1P9RA 2HA4A 2CMHA 5EJ5A 3B6MA 3KV1A 3ORRA 5EOVA 1E2BA 5AK6A 2A1UA 4R9UC 5ENDA 2B20A 5G40A 2CXHA 1E89A 1HGXA 3BILA 2P78A 3RSSA 5CLFA 2CNWA 3K9HA 2V0GA 2XMQA 4IDCA 3UO8B 3HNOA 3O84A 1XDDA 2DJ5A 1KR5A 3R5FA 3LBHA 3JWIA 4NZ9A 4RHTA 3SIWA 5F3RA 1X1QA 3R8FA 4LJRA 3KJIA 2N42A 2CLOB 3KEGA 2JJQA 2WM3A 3QBTA 2OYRA 4YCLA 1BFDA 1IXKA 1O94C 5K7SA 1QDEA 1OC4A 1O95C 2QTNA 2WB4A 5FXMA 4F6LA 3LLMA 1BYUA 1LK5A 2P9BA 3Q88A 1BS2A 2V9CA 3KQNA 9ABPA 4B48A 2WFMA 5C81A 4FYXA 2QS9A 1IZ0A 1R74A 4L02A 5BN4B 2PLFA 4W5NA 2P1DA 3MF4A 1V45E 3CJQA 1Q84A 1X0XA 2O2CA 4NI5A 2XTAA 1USGA 3ZHQA 1GARA 1X1SA 4ZC8A 3I05A 5IHPA 3A8TA 4Z9AA 1NE2A 3BCHA 2X9VA 4YMSA 2O4CA 1ONPA 3UHAA 2D3WA 4BMDA 1WLYA 4DXDA 1R4NB 3C85A 4EO9A 1JBKA 4RF3A 4F8JA 4FE7A 3UCFA 3OBIA 4AP6A 5LP6A 3OJFA 3PQEA 4CW7A 1PJRA 2EFJA 3L9XA 1JT2A 1WLSA 1Z18A 2JC3A 1OFVA 2VF7A 1T8PA 1TJPB 4IL5A 5F33A 1XTUA 1E1RD 4DG5A 2IYVA 1KO4A 1KR2A 2P9TA 3BXXA 1TVMA 3PEYA 3HNRA 5IVDA 1E9BA 3CR8A 3UC9A 2VCHA 4MQ6A 2JGFA 3ERCA 1T2AA 3PXBA 2W0MA 5GADl 3DT6A 4DT1B 2H9YA 1UJCA 1N1DA 4YJFA 1F5NA 2R9VA 4P2BA 3H0EA 1K4MA 4MQLA 1JJVA 4F5EA 3NWBA 4WFKA 1X2EA 5L3SA 2I91A 3B1FA 3QM1A 3FPKA 4S1OA 1JFVA 3L0IB 3RLIA 1R3DA 2VKTA 3C45A 1I24A 3MJDA 2QX9A 3QI7A 3ZE2B 2HEIA 2R8PA 2BFCA 3HCPA 3I5AA 4V0ME 4H6PA 4B35A 2IXGA 2IWRA 3T5TA 4A2PA 4YAIA 1V8ZA 1Z4PX 3ZHTA 1Q92A 3EBLA 5LC1A 3W5VA 2EXXA 5C1IA 2P4SA 4OMDA 2OUIA 3RVKA 3ZW9A 4DRZA 1LLFA 1OAOC 3X1MA 1NVTA 1G21B 4CM5A 4E3WA 5JMWA 3HO1A 2RHHA 3EGXB 3FLAA 3JQAB 1V7PC 2DBQA 2R00C 5AOVA 4YWHA 1O96B 4N76A 1SK8A 1S4MA 4IIXA 4IICA 5JDCA 3SFTA 2X23A 4QYXA 4BU0A 4KAAA 1VSBA 2Y9PB 4YAOA 1MB4A 3ACBA 2QQ5A 4N5LA 1E1RA 1GAEO 2ISSD 1TCBA 1B00A 3QWFA 1UBGA 3C74A 4GZLA 4X24A 1KBQA 5HF9A 1IZ9A 1MQSA 2PHZA 3I8XA 4WPGA 4G5YA 4U02A 1UBMS 4IJVA 5EIBC 3WHLA 3PXUA 5CB6A 5EJ8A 4WHMA 1J33A 1ND6A 2EWMA 4I55B 3BKWA 2GEJA 2CJPA 4MR9A 4RQAA 4FR0A 4ZQCB 1Y8QA 4YBZA 4IO0A 4Z0TA 2WG0A 2E89A 3L49A 4LW8A 3ZE1B 4BP3A 2C8JA 3ZVMA 3QYPA 2P1ZA 5DI3B 1QK4A 1EG7A 1GTJ1 1U9IA 1UZAA 4UHKA 3O8DA 1W48A 4RKYA 1CKEA 4AN1A 3RBAA 3DMTC 4C29A 3A6JA 3T1VA 3RF6A 1CF2O 1HMYA 3GCGA 1V3QE 4JP1A 4EGAA 4YJ2A 5TEVA 2D62A 2I66A 1U9CA 4K7JA 2IS4A 1UWCA 4FD3A 3D2LA 5ERXA 1BWRA 1TECE 3N58A 4MW6A 4NWIA 3HM9A 4Z3OA 1QPZA 2QTHA 2OHXA 1R6DA 1Y3IA 1LDBA 3NNDA 3CLKA 2FWIA 1GZVA 1XA3A 1XZAA 2EQBA 2ZK7A 4LXIA 4NH0A 4LZAA 4X54A 5FBLB 2ZAOA 4QUKA 2W70A 2VK4A 5BWMA 1DLJA 4WT7A 5DLQC 5IDYA 2JLUA 1Y7IA 4W9RA 3JQ8A 1II8B 2D1SA 1JIQA 7YASA 2FV8A 2MU1A 2Q6TA 1QMPA 3STWA 3DC2A 1UJ6A 1RD4A 1WMDA 2V59A 3MD0A 4HN9A 2HOQA 2JARA 2LV8A 3ND8A 4Q7EA 3SF0A 4ZZ3A 1Z4KA 2E48A 3PCRB 1B1AA 1TM7E 3RFUA 2GESA 3ZXSA 3PNVA 2P6PA 5B12A 3T7IA 1T35A 2J4FA 4NULA 2P5TB 2QV7A 1USUA 3DW3X 1HK7A 3UGKA 2FG6C 1OZ0A 5JECA 1LLQA 2F62A 2WF6A 2RBEA 3VKGA 1BRTA 1E77A 1TVKB 1AS3A 4FJ1A 3EARA 2FPRA 1Z0SA 2JCBA 2CWWA 1MW8X 4RPLA 4S12A 2J87A 5T4FA 3B51X 1RI3A 3GY0A 3W04A 3N6XA 4N41A 3WMWA 1IFXA 3EF0A 1K8RA 1HDCA 1S8FA 3H87A 2WHEA 3OCYA 4Y1FA 3OQ1A 1RJEA 3C3YA 3I73A 4TSRA 5AW7A 3CZMA 2OBXA 3ZY3A 4AKSA 2WTBA 1R2QA 5AXBA 4WV3A 2BZSA 3C7AA 1HURA 2IOQA 4L4ZA 3ITEA 3A2LA 1PL7A 2IZ6A 5A4AA 2VAWA 1QH1A 1KGDA 4EG3A 2VLBA 4GP7A 4B4VA 4X7BA 1PFQA 2NQTA 2QZZA 1ZL2A 4RPGA 1OI2A 2JK1A 4GXRA 3VAYA 4AY5A 4KITB 5AFSA 2XWPA 3SVZA 1Q57A 1OD6A 4DA6A 1D2MA 4X62B 3V4SA 1ZW1A 3P4UA 2G04A 1ZNQO 5ALYA 3M83A 3ZG6A 4DTIA 1BAPA 3NNNA 3EASA 3OFSA 4CTNA 3BOSA 1H42A 1UODA 2EBWA 3QBVA 5CB8A 4YRPA 3IALA 4LN1A 3KVRA 3ILVA 3GFSA 5JANA 5TXGA 4HKTA 1U2EA 2HHLA 4UXJA 2NT4A 3ZCRA 2IIQA 2MINA 1EX7A 1QHEA 2ZJ1A 4ESEA 4OP1A 3N53A 3BMNB 1G8GA 3NWOA 2FG7C 3N76A 3PLRA 1S9DA 2W98A 1D9XA 4DUZB 4M55A 3ET4A 1YOVA 2JDID 4TMVA 2QT0A 1H1LB 1T24A 4E2XA 1SCDA 5L4LA 2PO7A 3D8UA 4GLBA 2P2NA 3ZDCA 4MOWA 4HEJA 4KUEA 1QX3A 3FWYA 5H82A 2QTWB 2VZ8A 4PLZA 3RYFA 4YP6A 3STYA 1SU4A 1VSTA 4IV8A 3B38A 1L9KA 1B93A 1OLSA 2XX3A 2Z04A 1GAQA 3F7NA 2J0UB 3H2YA 3L7BA 1U0BB 3LVBA 5EXXA 3O2JA 4KDFA 4P83A 4CLDA 4HQRA 2RARA 1KYTA 1NFQA 3SVTA 4NFLA 4ZVKA 1KH3A 1MX1A 2NTYC 4H7PA 1KSHA 4KYUA 4DC1A 4CEHA 5EQTA 3VUFA 2OQ2A 4IIJB 1OAKA 5HM8A 3Q0EA 1PYGA 4H4EA 5LP6F 5CG1A 4URYR 1NN1A 4BQRA 3O4RA 2OCLA 2PA0A 2BFDB 3DLCA 3UMYA 4BE9A 4ICIA 1MNAA 2BTQA 4KBYA 4I3FA 3EIQA 1I4DD 3L1VA 4KX5A 4EKEA 2P2SA 1AB5A 3LC7O 4HMPA 4KDEA 1H2YA 5AM3A 1IY8A 2JRCA 2YYYA 2IUEA 4KB5A 1OTYA 5E2AA 2VK2A 5L3ZA 4CV2A 5B7PA 2R2AA 1W0JD 5EZYB 4DKJA 4YT2A 2ONKA 1FVOA 2AR0A 2CDAA 2GTPA 3CEAA 3O95A 3Q98A 2JDIA 4XDZA 1TD9A 3WGHA 3KHUA 4QAQA 1I3OA 1KYIA 5J63A 4EG8A 1KXZA 3E35A 3HJRA 4HWPA 1AMOA 3I5YA 4XZ3A 1N4DA 4NESA 3ITKA 3WGLA 5EHZA 4KR7A 1ABBA 2WIDA 4JV5B 3HV2A 1H6DA 2IQIA 3WQRA 4D4JA 4XSGA 2G71A 2H0AA 4G25A 1TAHA 3IBFA 4IRUB 3WJ1A 1YJAA 1DRUA 2IF2A 2VDPB 1IXSB 4W6ZA 1YJQA 1IAQA 1YUNA 1ZC3A 3AJRA 3CPJB 4BB0A 3FNGA 2K7FA 1J0DA 1A72A 1CUIA 2DH6A 2VO1A 1X7WB 3HA3A 3K05A 3OT1B 2WZBA 4NYMQ 5FORA 2O0MA 1AHPA 1XO1A 2J9FB 3MOGA 1WOYA 4RD0A 5EHXA 2O8FB 4NAVA 4QHTA 5IUKC 3KPWA 2BD0A 2NZWA 3MJFA 3QLTA 2G08A 3RDPA 3UHOA 1E1YA 1XMQB 1AKMA 4KVZA 3IHLA 5DHFA 3TZQA 1OH8A 2PK3A 3IODA 4EO4A 1F1BA 3MHPA 1CJCA 4Q5IA 1VIYA 2GDZA 2LTAA 3NJ4A 4G36A 5AI9A 8OHMA 1JH8A 2XXJA 2XIJA 3DVSX 5DYWA 3GLFA 1OYWA 5CM9C 4PO9A 1RZRD 2E49A 3CEMA 4V2IA 2R0QC 2O2GA 4XWTA 1G20B 2ZREA 3SF8A 4NCNA 3PIIA 1W0JA 4I9NA 1D1PA 1OIWA 1YB2A 1RZVA 5DCUA 4Z5XA 2X5JO 1JXAA 2WJGA 3QG1A 4D8XA 1GZSA 2C0PA 2XH8A 3J7TA 1PL0A 3L7CA 1IN6A 2Q5FA 2O50A 4PYIA 3TPCA 5KYVA 3SX4A 4LJLA 3TJMA 4AL4A 1JHVA 1EI9A 4MS1A 4AMYA 4BGDA 1RXVA 4TS9A 4CFSA 5HJ5A 2B4QA 2WF5A 1WSBA 3RW9A 1FB5A 4JN6B 5DFAA 2GKGA 1ZH0A 3D8BA 3DB2A 3OZDA 4PPQA 4YJ2F 2IEGA 1AUXA 3C43A 4WLOA 3L8DA 2B4TO 2QN2A 3H1FA 1F2DA 2OHHA 3BDAA 1IN7A 3O03A 3SC2B 2XHZA 4KGXA 5GGXA 3AZOA 2B78A 1S8OA 4IH1A 4KUHA 4Y3UA 3RG2A 3VU9B 5HKKD 4FYHA 1CQJB 1ONSA 1TA0A 1GG5A 1QMGA 2RKWA 3DT9A 1Z06A 4NNJA 4TSFD 5DBFA 5LN1A 4F5YA 5TV2A 3I6MA 4WNIA 2D2IA 1Q1ZA 2GAOA 4IJ5A 4I14A 2PLWA 4Y6LA 4QREA 2H2IA 4RY8A 3SS8A 1CLUA 1EE1A 4A8TA 1RZRA 4AKEA 1GKKA 1EBFA 4H7EA 3NRBA 4EX6A 3LY5A 1VPLA 2R6DA 4G56A 2WJHA 2RHMA 3FW1A 2AD5A 4MIKA 1XQXA 3BD7A 4R2LA 4JBGA 1W34A 1DAIA 4OM8A 1IY1A 1KAOA 4F6RA 1RWBA 3I2HA 5G4LA 3ZLTA 5FOTA 4HS9A 3W4IA 5BP7A 1K08A 4QL3A 4JC0A 1KHHA 1XTRA 3HQ4O 1YA6A 2FPIA 1S7CA 2W2KB 4HDRB 1W35A 2N1MA 1EM8A 1PWXA 4POAA 3W7AA 4QKQA 3RUPA 5CA1B 3ORFA 4BVBA 3OVMA 1ZLYA 1GRVA 1T2UA 1TTQB 4PQGA 3A1SA 1T13A 2VWQA 4I4CA 4BNLA 4EHLA 3EA0A 1BHJA 1Y1QA 2XAAA 1DQYA 3L8ZA 2HQRA 3GT4A 3GEEA 2GYYA 3AF4A 3BWXA 4YP7A 1QRUA 3OURA 1XSEA 3JWJA 3EJWA 3VU0A 5HKKA 4TYMA 3VNRA 5C80A 4TSFA 5ALUA 2CVPA 4Z4QA 2FDCA 4XWOA 1A2QA 1H3EA 1J8VA 3M9LA 4JQYA 5DGXA 5L51A 2J9GA 2HHCA 1TFUA 2IL1A 2RHJA 3O3NB 4JQCA 3T3OA 3EBPA 1NN3A 3L92A 2DPLA 1KI6A 1V6AA 3C3BA 3LF2A 4DYHA 3FDZB 2VWGA 2ZTLA 4QOIA 4XGQA 1BO6A 3T12A 1OC2A 1OA0A 2A30A 1TYZA 3P96A 1R5BA 3R3ZA 4NBVA 2FEOA 1CVRA 2VJQA 3ZUGA 1EP2B 1YIAA 4E46A 3WP0A 1UWVA 1Z4JA 4PQFA 1C4XA 1I7NA 4B3RB 5ER9A 6CHYA 2EOAA 2H9AA 1EH5A 2HQSA 4O63O 4C3UA 5F78A 2XD9A 3DZHA 4Q03A 5HMLA 3TK1A 1T4GA 1PSZA 2JFPA 3WWYA 4XKJA 4KMRA 3D3EA 1ZSNA 3QHQA 4KI7A 2ZE8A 2H0RA 3U62A 2JFVA 3UF0A 4AJ9A 5IG2A 5LL6P 3V4RA 3NYIA 5AKZA 3ZDQA 2NO0A 3AZPA 3PR2B 2QE7D 3AL2A 2VHTA 3C15C 3NASA 3H3FA 5CX1B 3K70C 4CLRA 3R4VA 2FLKA 5D1NA 1Y9JA 5JZVA 4GVXA 3VX4A 5LQCA 1HE3A 3AB8A 3A4LA 3CS3A 1I7LA 3GHHA 1F9AA 4MUHA 2PU5A 4XVRA 3CCFA 2QUAA 1KJQA 3N28A 4IQ8A 4J9UE 4EGFA 2KMLA 1KYZA 1GRRA 2XNKA 3LQ2A 1I4LD 1N0HA 3WLFA 3HLYA 1HYBA 1VQ1A 4I9FA 4UBLA 3FTCA 4RACA 2XSZD 2Y2VA 3C6XA 1VKNA 1SZPA 5BSTA 4D92A 2FW9A 4HRAA 3MOSA 1WZCA 2AE1A 1NVWQ 4ND3A 5DNUA 2HJVA 2Z2ZA 4XDGA 4E12A 1KZ6A 4NYIR 1YOBA 4FEGA 3RS4A 2HA2A 5EHNA 1ILEA 1NVDA 1Z13A 1NA5A 4OQMA 3BS4A 4GDMA 4WVLA 3RRNA 3KZXA 3DFKA 4LY0A 3G9UA 1YUBA 1QIIA 2J7PD 2QGNA 3BRSA 3IAAA 1P8AA 5LA6B 3ZWNA 3C5HA 3OTWA 4E5PA 2RG7A 4TXJA 3AR2A 3H2KA 2PSHA 1J2TA 4L1KA 2QE7A 4OAOA 3W9UA 1H6CA 2XYGA 1WE2A 1O54A 1KH1A 1VL8A 2ILVA 3ISJA 3D6HA 3UV6A 3BQ9A 3GOQA 4LCBA 2BFNA 4UE3S 1ENPA 4RKFA 3THRA 3I9KA 1H94A 3BAFA 1FFCA 2REXB 3IEUA 1HSOA 3IFSA 3R7WA 1GSHA 5DGHA 1RI1A 1W25A 5FJIA 5JG7A 3W5HA 3W7VA 1KEUA 1ULTA 1ZVQA 1QJ4A 3D3JA 1BN7A 3ROZA 1MABB 3JZMA 1ZBDA 2HBQA 2E3JA 2HU5A 2N75A 1L8OA 1TIKA 2XSZA 4A15A 1Q83A 1IUNA 2O2JA 2CHUA 2YHUA 4R7ZA 3BWYA 1ZUWA 2G0NA 3GDFA 1KFBB 1YB4A 2GGSA 3E48A 1S5PA 1F51E 2R1VA 2B5VA 1D3AA 2CNKA 3OIDA 2PEYA 1N0WA 1NJ6A 3K0AA 2OK7A 2G9RA 2P6MA 1N9GB 2AI1A 1E58A 1TTHA 2JCSA 2XF8A 1K86A 3CZCA 2XDWA 3RVNA 3TRKA 3PCXA 1FDIA 2J7PA 1PWEA 4HH4A 2VPWA 1YC2A 1NW8A 4BLPA 4F2DA 2UXCB 3A04A 4ILKA 4JITA 1H0SA 1ILWA 1B74A 1WDWB 2GAAA 3D5EA 4MUFA 4R51A 1SXQA 1LY1A 1X7HA 1VCNA 5F64A 3I72A 2X1VA 3KZNA 3LQFA 5GQSA 5FX2A 5FUQA 3LC2O 4UVEA 2PKRA 4EZBA 3JSXA 3W5CA 3MK31 4KV9A 1VBMA 2VZ9A 3DQPA 1JQAA 4NBLA 5LOVB 1I2CA 2QL7A 4U6NA 3W3AD 1C1DB 3SSOA 1Z8NA 2RK4A 1KY5A 3RC7A 3RTGA 4I1YA 3SM3A 2Z2YA 3WJ2A 2QT1A 5JEDA 4NABA 4CKXA 2IYUA 3K2BA 2SKEA 4UM5A 4QSMA 3G6WA 4HAVA 4G86A 1YB5A 3CH5A 2BI8A 2QN3A 4FGUA 4US1R 4X97A 5EEGA 4BE7B 3F96A 1AKTA 4OQFA 2ZE5A 5IJ0B 5KYNA 4KXQA 5AXCA 4Q34A 2AXNA 2D5BA 2O7QA 2P3LA 5PNTA 3ZS9A 5J4VA 1RHKA 2E7ZA 2Y8EA 1GVNB 3CN9A 3HU3A 5K8JB 4EZIA 3DMYA 2VHJA 2B1IA 1GNRA 2PJUA 3DFUA 3SM9A 3T52A 1R9MA 3U44B 4AVYA 3TNLA 2F1RA 5EGSA 3VO9A 4MTLA 3JQCA 3JYPA 1Y0BA 4IDNA 3S55A 3UWOA 4M2LA 3B2NA 1BIFA 3R5KA 1T0JB 3JQQA 1KJ8A 5CGZA 1WBDA 2NVBA 2PJRA 3AEZA 3ZIDA 3AP1A 3RG8A 2AS0A 4ZO6A 5JJKA 3PS9A 4XH9B 4YRTA 4TS3A 1FYXA 4ZP1A 1S4QA 1XMPA 4HBZA 3AF5A 1QXSA 4FHZA 1J56A 4OQNA 2W8ZA 3H84A 1S7GA 5ADUS 4YUWA 3WV4A 1Q16A 3W3AA 3WLPA 5CEJA 1GUDA 3SS9X 2M6SA 5DDIP 1OXKB 2B8EA 3D4BA 4M6WB 2PMCA 1FU7A 3IQHX 3GRVA 1W5AA 3GEIA 1ZEMA 2B8TA 4XB6B 4DEXA 1P0IA 1DNPA 4NC9A 4FQ7A 4YCSA 2XZLA 3CLTC 4JVLA 4QU5A 1RRKA 4S24A 3KD3A 3A6ZA 3LPMA 4FOLA 1CUJA 3VYRB 1FQOA 2NO6A 2Z5LA 2P3QA 2GUGA 3ORHA 1CUUA 3VX3A 4DZTA 4K88A 4KQHA 4UUOA 3TCXB 4C3VA 1VGVA 4ND6A 3BXGA 4ZCIA 1AHHA 2YHSA 4JI2B 1Q7EA 2H11A 1V43A 1SKBA 1T9BA 4BYGA 3MCWA 2GPAA 1OBOA 3IOYA 2IUYA 3L06A 4V0QA 3TINA 1MAUA 5HF8A 2WIJA 4MITA 2QG9A 2ZRFA 2VH5R 1GCGA 4DCTA 4CHTA 1FTQA 4UBKA 3RSOA 1THTA 1USVA 3BICA 3AJ9A 3NALA 3PQ5A 4OBWA 5A3RA 2VDOB 1NVGA 1PV1A 3EOBI 4Q19A 3MWKA 5EJ6A 5DCLA 3GD7A 1DAPA 1SQSA 1UC4B 2CFOA 5COAA 4LF9B 4DDTA 1NPDA 2BMFA 4DA4A 3VH2A 1ITZA 1TUGA 2Q46A 2IIVA 1K7SN 4MR8A 4MDEA 2EF1A 2NUTB 1AN0A 2V97A 1CRLA 3GLHE 3O9VA 5EZQA 3CVUA 2QPLA 1QKIA 3AMVA 1GTZA 1M2OA 4REMA 3BJMA 3AUAA 2JHCA 3T61A 2FTKE 5BQ5A 1RLOA 2HYDA 4B6QA 5KWVA 5DIFA 1ZMOA 2HJGA 4LGMA 4MUEA 1E62A 3QF7A 4LBVA 2X4IA 2WK1A 2CHQA 2RHTA 5KS2A 1ADFA 1B8NA 3E03A 4MPTA 1K6EA 3HXQA 3SY8A 6Q21A 3SICE 2ECPA 4ML3A 3TSZA 1H2ZA 1JS1X 4A7PA 1XL0A 2GPSA 1NW3A 2EWWA 1KMHB 1DG3A 3F46A 4V3BA 5IF3A 3DMDA 4X1YA 2IYWA 1E4EA 1V6SA 2NU8A 4XR9A 2F43B 4IUCS 5AOBA 1J24A 1V8PA 2JEYA 3CLRD 5M2QA 2A5GA 4TV9A 3UJCA 1EAYA 2OHOA 1U1IA 1KBZA 5JD4A 1FDRA 3JQ9A 1Y6ZA 5FWXB 1SIOA 2RJ3A 3IMFA 4G4IA 3ZHBA 4HXGA 4AMBA 4NRDA 1I3LA 3JYHA 4FEYA 1GZ5A 1Y8AA 3QVGA 5MN5A 2F8SA 5JXHA 3BQNB 4DR2B 1NJ2A 2YHIA 1HLPA 2VRCA 5B64A 3HKCB 1MAHA 4IVPA 1G8YA 2XMCA 2PGIA 3GG9A 4QLOA 1G7RA 3FD8A 3TRFA 4HWKA 4QYIA 4RA9A 3DLPX 3EXHA 1I51A 4HGPA 4MLCA 1VKJA 4B4OA 3ZCUA 3GLGE 2DY0A 1CULC 2QYTA 3K6RA 3Q7QA 2CY0A 2IPOA 3C3XA 5CR9A 4ARUA 3PC3A 1NW5A 1P7WA 4LC9A 4M7RA 4TV8B 5GGYA 2V54A 4NSNA 3DFFA 4LDJA 2REOA 2P9HA 4RGQA 4CE6A 4JUBA 2CZCA 3TOVA 3O8CA 4BQNA 4OX9Y 4RGBA 4O1IA 5K3OA 3W3ZB 2WIGA 4XWAA 4A1OA 3GP8A 3DLBA 1D4ZA 1JBEA 5GV8A 3I45A 4Z4CA 3RUFA 4B7AA 1UBUS 2OO5A 3UMRA 2YN4A 5BOSB 4ESVA 3QSGA 1WEHA 5IK2D 1GNVA 5IJAA 1NF8A 4AO8A 4EA8A 1MO4A 3FPFA 2QVYX 3LPCA 4MGHA 3R7FA 1X38A 5E6UB 1NKSA 2IHKA 3DR5A 4PLVA 4MRMB 4W7HA 3QU4A 5M3BA 1WUYA 1F12A 2OCAA 4UATA 4UZFA 1WXGA 5KYYA 1Z07A 1DBPA 2Z9DA 4LK3A 3SDBA 3WWOA 4BJ5A 3DO8A 3INRA 3H4MA 1EQUA 3W5IA 3ZWMA 3S2YA 1SKUA 1IUKA 1OLOA 3WQQA 4WCFA 1KC1A 4BMVA 1E2UA 1JDSA 1P2VA 2ZP1A 1CUGA 1QFMA 3DLAA 2XTNA 4L57A 5JDIC 4GP6A 4ZT4A 4IUYA 1KI9A 3JR7A 2J1LA 1T9AA 5DGIA 5JCOA 3S70A 4YXFA 4EWLA 1CDOA 2VEOA 10MHA 2QP9X 5B7QA 1M8JA 2C8KA 1XVIA 4JFAA 4JB0A 5JR3A 2Q4TA 1RHRA 3G7NA 2EQ5A 1ONOA 4P5DA 2VDWA 3DEZA 2DWQA 5D3QA 3NX4A 4PAQA 2PS3A 3L43A 3AR8A 3U3XA 4BO1A 1TU0A 1EK5A 2I2WA 2Q5OA 1JUDA 3MYRA 2VEDA 2ZUWA 4XUGB 1FU8A 3A9UA 2WWHA 4NDNE 4O08A 5ESXA 3VR6D 5IK2A 3WBFA 3RS3A 3QK7A 2WJAA 4M9ZA 3A1TA 4TWAA 3KJGA 5FQOA 2BGNA 2OFWA 2GNPA 2V7TA 1HETA 3DDNA 5EUBA 5A9TA 2CE7A 2ORYA 4R2XA 4TPKA 4U5XA 2Q3JA 4CM4B 3R3XA 3DDOA 2WE8A 3MQFA 3IAS1 5A5VA 3W5SA 2WWIA 2HC9A 1JXOA 4DMFA 2Z1DA 3WKCA 2P2CA 3EB9A 4MAMA 3LBIA 5JFTA 1PJ8A 3NAGA 1OWOA 3WRYA 3AI7A 4GG1A 2FN4A 5HQJA 4Q7MB 4A8JC 2H7VA 2CT8A 2RMKA 1VBFA 5E7MA 2QD5A 1JDPA 1OW3B 1E1NA 4P4UA 3NZEA 2RI1A 3ECSA 2BDTA 2BJWA 3HB0A 4UUBA 1Q21A 5CNIA 3TH5A 4G81A 1FJ2A 4MZXA 4XIGS 2OP0A 4B3CA 4QQFA 4G0VA 4JI0B 1W5TA 3RC9A 1FUUA 1T0BA 2VH2A 4QOFA 5I9SA 1NVXQ 3QLUC 1MH1A 4K6CA 2PGLA 4LF7B 3CO0S 5H02A 5BMVA 1N8TA 1S1MA 1WUKS 4GE3A 1NX9A 4L8WB 2A6PA 3QOXA 2OCPA 3TGWA 2OXRA 3VZCA 3ZVRA 4G0QA 2RFLA 3KDAA 5EKUA 4AWBA 5HIKA 4IBOA 2R6ZA 1KC3A 4X8OA 4WNYA 4AIRA 4C0JA 1GEGA 2HWYA 3DKRA 5BUZA 3HJFA 2W93A 2VZ0A 2G5CA 4NJEB 5EFZA 1RIFA 2HA0A 1T2CA 2GZSA 3RLFA 5HFJA 4CZ2A 2WTXA 2BBWA 3VGPA 3ZC3A 5PGMA 2DFPA 2NX2A 4GUDA 3DOIA 1UIMA 4NK5A 4DSOA 3UMFA 1UBEA 1WV1A 3PD0A 4FYVA 2OR3A 3LE8A 1EEXB 2XPCA 4F21A 4KYTA 4BV3A 4TM7A 1L5GB 3V8VA 3PUYA 3DCIA 4YFVA 1UXKA 1Y4UA 4MUKA 3F6PA 2Q0HA 2P91A 4JC5A 3FYUA 3PWKA 2F3SA 3BE4A 1X9IA 5HHTA 3DEYX 4IP0A 1GCUA 1DBQA 5AI8A 1H22A 1NQAO 1PWHA 1ZM2A 1YAJA 5AESA 1SY7A 3B7GA 3TTSA 2QW8A 3EPLA 3AL0C 4HNSA 1E9SA 4ZTZB 1L7EA 2FDXA 3BXOA 3CUWA 4QNMA 3ZGNA 4WADA 1Z2AA 4E2ZA 3GLQA 2RI6A 5KOHA 4NMXB 3H9GA 4YRSA 2DFDA 3F7TA 5CRIA 3GAFA 3HS3A 4NDAA 4JI6B 2VQEB 3L0BA 4K86A 1BFKA 4QPNA 1XPOA 2KLHA 4D9KA 2KLBA 4Z4HA 2O3QA 2ZYAA 3JZDA 1V96A 1C1YA 3CVWA 3WIEA 3IJEB 5TJHA 4PX2A 4RUKA 3ISTA 2DERA 4QWWA 3F67A 4H7IA 3QE2A 2KJQA 3MMSA 1S2MA 2NV6A 2OOKA 3PQ8A 1Q0HA 1KSFX 2GHRA 2QYSA 3AHDA 2IH4A 3BRCA 4MV4A 4PZPA 4N01A 2HBYA 1CCWA 4AYWA 4JLWA 5HCNA 5BYJA 3BRWD 4TV9F 1F8FA 2KW5A 2CXSA 3PFGA 4ZJUA 1E3WA 3MLEA 1A4IA 3Q3IA 4RKRA 5FBHA 1JG3A 1Q12A 1R0ZA 1VJ0A 4IG4A 2OCKA 4Z8XA 1HO3A 2FMTA 1I36A 1TMYA 2P5UA 1BXRA 3JQBA 3NHBA 1TM1E 4OSPA 1NPTO 1RMQA 3FOZA 1V35A 5CFNA 4JT8A 1KK1A 4J03A 2R8EA 1XI2A 1YHYA 5CB0A 4R40A 4R5HA 1U7DA 5J4YA 5H4HA 2VDRB 4AN4A 1T36B 2JH3A 3BTUA 1JIJA 3GLIB 1EFCA 1XZDA 2V3CC 2B3TA 2DBVO 1QHHA 3AEQA 3IO3A 3NYRA 3CX6A 2ZIXA 3HSSA 1Y6RA 4HVCA 2GJSA 1CEQA 3UA4A 4B8WA 1O87A 2H5EA 1IMJA 1BGWA 1UBSB 3NJRA 1FP6A 1Y5LA 2ZR7A 1MC4A 3EZ6A 1IBLB 4JLMA 1AKRA 13PKA 3ANTA 3HM2A 3ROXA 4C7MA 4DIBA 3M4ZA 3NR2A 2XYPA 4FQ8A 4Y98A 2QR5A 1TJ4A 4TZ0A 2O8DA 1RLMA 1FPQA 1UDWA 3PXGA 5DMXA 5BV2P 1K9SA 1Z45A 2NU9A 3BRWA 3DAPA 1Q2XA 3O21A 3WY9A 1E9RA 3TRJA 1SOVA 3OQIA 1ORWA 4Q3CA 1O5TA 3EUWA 4G4SO 1P5ZB 2DHCA 2VTKA 1P62B 4F3CA 2XXBA 4OK3A 4G37A 4MRNA 4V0LA 4M7WA 4Q15A 2G5GX 4PY2A 3WV5A 2XVAA 1XROA 4OO3A 4MAFA 3VR5D 1N2CA 5FHQA 5FTKA 4CBVA 5JJLA 1SXIA 1NNLA 1BWQA 1PHRA 2GKSA 1LLUA 2PGXA 2OGWA 2QF7A 3D7MA 1UKAA 3A0UA 4IQ4A 1NJ8A 5LZ2A 4YP0A 1BE1A 3B5JA 4NPAA 1XVAA 1AX9A 3DZGA 4OB7A 2Z83A 3GBVA 2QTAA 3PYMA 3LAWA 2XKKA 2UUBB 1YVPA 2VSNA 2WYIA 5JXIA 2WVHA 2JASA 3CLSD 3KB6A 4MI6A 4QDUA 2B2XA 4HDOB 2QUZA 2ZBUA 3KOXA 1WF3A 2HIGA 5EJIA 3SBOA 2NQ2C 1VCMA 4HX2A 3BDIA 3N0WA 1QAMA 3HJCA 3IP7A 4YTEA 3NKFA 1VJRA 1MXHA 1T6XA 1HNNA 1XNGA 2QG4A 2VT3A 2ZB7A 4QHYA 5IZCA 2VDMB 4KUGA 1J39A 4IDGA 1KQ3A 4LSWA 3QTBA 4AURA 1ZD8A 2G77B 1QKJA 2B21A 3E9DA 1YCFA 4LJ7A 3ZZ1A 1U0HC 4DYDA 5DJ5A 1IHXA 2CJWA 4OYRA 4QXAA 1GQYA 3DMFA 1DIRA 3SEZA 3VU3A 4BFLA 2ENUA 3TX2A 3RT7A 4U63A 2JGEA 2G3YA 3UPTA 3OA2A 1G59A 4MA0A 4HFJA 5BNZA 4H15A 5M04A 3W5AA 3VR5A 3GN1A 4DYVA 3ZHUA 4Q6BA 2DFNA 4A23A 2QA5A 4TLBA 3B3AA 3OY2A 1BVHA 2FPXA 4DR7B 4P4NA 1NBWB 1IYZA 2JBHA 1XRPA 4Y2RA 5ALSA 1TXGA 2CVZA 5KNBH 3ELUA 1B8VA 4C20A 1HDXA 3E9CA 2WD8A 4NS4A 1A5BB 5DHUA 3OPMA 4ODIA 3DZFA 1Q3TA 1XTSA 3K0BA 2FNAA 2OD9A 3CUSA 2M98A 4QOHA 3TLJA 3IDAA 2NU7B 1TZMA 4E4YA 3S2EA 4F04A 3CNHA 2OCIA 3AETB 1ZCJA 2WAYA 4PGAA 4UC0A 4Q7QA 4I36A 5BMOA 4GL4A 5L40A 1PRYA 2O7VA 2IYYA 1PX2A 1Y6FA 1ARZA 3HKDA 4FX5A 3YASA 1GNPA 3MUFA 2GVZC 2XA2A 2OXTA 2XVYA 1U0JA 4R1OA 4ZV9A 1N5DA 5ALZA 1V26A 5IT4A 5DXJA 5BUCA 4II7A 3NG1A 2R48A 1LTKA 3EWNA 5E4JA 3THWA 1UEXC 2AHRA 2BFWA 3CVJA 3N9IA 2VBGA 2FPOA 3VR3D 2YOHA 1P7YA 4U7FA 3OZCA 4YWJA 1AKUA 1SZDA 1DGQA 1I10A 4MDHA 4PR0A 1YZNA 4PZUA 5FYQA 5IYZB 3QE4A 1CUDA 1M2HA 1WMSA 1WSWA 1YDEA 4KE8A 4TKMA 3DZDA 1W36D 3LUGA 4TVSA 2X42A 3A6HA 4D1YA 1ACJA 4D2IA 2WAMA 2R7MA 4LRXA 2H1OA 4POOA 3TXYA 4EHAA 2XNCA 3GRCA 3BWCA 4FPXA 4TLAA 5KTYA 1L6IA 1LX7A 3ZVKA 1WZUA 3LX5A 4LGCA 1EM6A 2H16A 4N9QA 2EKBA 4FZRA 4Y2JA 1KBOA 4B2LA 1RJ9B 4B6OA 4DG8A 2BZGA 3NHFA 1XK7A 4PTLA 5EKDA 5KVQA 2TMDA 4BP1A 4N12A 1PHPA 3PKJA 4N03A 3UFXB 1FX1A 4PX5A 3Q2OA 1UEIA 5TE9A 1NY5A 3AUFA 3O5AA 1TW3A 3BD6A 2XUGA 4MKZA 2NIPA 4CT4B 2B3DA 3FSEA 3SEFA 3L8CA 3TLMA 4AWXA 1KNQA 4A8HA 1Q1AA 3N8KA 3X1DA 3VNAA 4MINA 2AQ8A 1LRKA 2WMOB 1V48A 3RT1A 1U3VA 3BVPA 3VR3A 3FUCA 1UMBA 4GI1A 1QX4A 3JPWA 1VRCA 1V1MB 3IXMA 2ZCJA 1EFDN 2OPBA 4TROA 5EMJA 4D26A 3I0NA 3PPVA 4XWYA 2JLWA 1KZ9A 2CMFA 2DT8A 2CDBA 3EXEA 3DMPA 4GR4A 4B4UA 2R11A 3EGDA 4H60A 2JFWA 5JAHA 5FV4A 3DDHA 1NSYA 4LZOA 5DXFA 4ZU6X 1JWLA 1AKEA 3NHRA 1I2DA 2P9QA 1JEQA 1ODFA 3UJPA 1ADGA 1JHUA 3CUTA 3MT0A 4L95C 5KQLA 1OLUA 1Q0ZA 3GGCA 5THKA 2YC4C 1GDTA 4J94A 3ZI7A 4EZEA 5MGNA 3WRXC 1OZHA 1MENA 2YY6A 4WKCA 5F1OA 3I34X 4IIDA 4MQFA 2ZU6A 4HNQA 1O9HA 1SBZA 4MNTA 5GJCA 4FLEA 5TQVA 2OHFA 4MB6A 4CIWA 1S96A 2C98A 2P75A 3QFFA 5C53B 1L1FA 2GRJA 3ZWXA 4XAQA 5EZSA 1AZWA 3W9YA 4PANA 4F85A 2ZUCA 3TQQA 3FOAA 2YFKA 2FYTA 4W8HA 3ZHRA 1JKFA 2WRZA 3HDYA 1YBHA 3HY3A 5BNFA 3T0IA 3OMLA 4D9NA 2P6OA 4ZGGA 5BW8A 1C3OA 1HMPA 1FNMA 1ZUD1 2YFHA 3QEJA 3C8ZA 2GARA 4J76A 1EWKA 1AZTA 4I1IA 4O1MA 3D7NA 5ALWA 1CJKC 1TM4E 1TVCA 1UL1X 3AUTA 1CFJA 2BE7A 3L7JA 3HHPA 4X41A 5DNVA 1WD7A 1TO1E 2YH2A 2ZT6A 4PS0A 5E2BA 1I80A 4MRPA 1JGTA 3FTDA 1PS9A 4EA7A 1V39A 2E55A 1U8ZA 1VLZA 3FA2A 3IAS6 4J2HA 4NV3A 1WDMA 3BIFA 4RPHA 5KCMA 3WNDA 5EJ4A 4BMYA 2GKOA 4JNKA 1U8UA 2H51A 5HGXA 1JH9A 1RW4A 4A2CA 5FEUA 4Q9LA 3BPSA 4F9FA 1BS9A 1KY3A 2R4TA 4KQWA 1NU6A 4R8SA 2BR5A 4FHFA 4WZAA 1AHNA 3GJYA 2AFHA 2GETA 3N7UA 1XU4A 3MWYW 3OLVA 4MHOA 3LNTA 4EYKA 3TR5A 2PAAA 3EGIA 4C1NA 1I30A 3KKKA 3EDOA 2ZKLA 1R6TA 1UXOA 4ENTA 3R74A 2HWKA 4DHWA 3D81A 2QVXX 3N2NA 4O4JB 5A5EA 3CHYA 4YT8A 3IP3A 1W1UA 3V3KA 5E4YA 2GHTA 1ZKMA 1CU1A 1CR4A 3AJAA 5LYJB 2GN2A 3GRYA 3MTQA 4IDDA 5SYMA 3X2FA 2RH8A 3L6OO 1FL9A 1E0AA 4GVLA 2I1VB 3EH1A 4LI0A 5ALEA 1HI9A 1UOQA 3R3WA 4EIWA 4ONEA 1C1XB 2WT9A 1ZIPA 3H99A 3IXLA 3WFIA 4QGAA 1WY5A 2HNBA 2VDVE 1BXGB 3LHKA 5C8YB 5T5QA 2OTCA 1Y3DE 2I99A 2FZCA 1B0PA 1MLDA 2QRNA 3UJBA 4EOGA 4PLHA 4BJ3A 2HM7A 2LKDA 2QP3A 3QXCA 4DBLC 1V5GA 4Q05A 1XWIA 3PJFA 3UV7A 3ZHVA 3K8ZA 5FR1A 1DO2A 3L79A 3AVTA 4Y9TA 2QOEA 1B0AA 1Z2DA 2OVFA 1SG0A 1WCIB 4GC5A 4L27A 1XF1A 4PHHA 4LF8B 3LXXA 3H9JA 3IBSA 3ZH9B 2PKQO 1L2TA 3QFRA 5L3QB 3UAVA 2D0IA 3ICVA 3WRWA 2EGHA 2XVXA 4J7XA 5HKLA 2JGRA 4UPDA 3GZNB 4GFDA 5KMGB 3N2GB 4XI9A 3VDNB 1HDOA 2ZW9A 4PSKA 3IVRA 1D0IA 9MHTA 2QAGB 3FPBA 1F2UB 3KQSA 5L53A 5BN4A 3EVGA 2AMFA 4P93A 2X1MA 1N4AA 5AVSA 5K03A 2QHXA 3C7DB 3NM4A 4IKPA 1FXWA 1H5NA 2KX7A 4OV6B 5LU8A 5CDSA 2DWOA 2JFHA 5B53A 4XDYA 1HLDA 4ZU1X 3AJEA 3FHCB 3SNHA 3IAEA 1AD2A 3PVSA 3JQAD 3ZGVA 3TO5A 2CNNA 1R4NA 1F17A 4RZ3A 5D5PA 2E1PA 1PEKE 3T1OA 4BLRA 2F4VB 3VJKA 3A9CA 1WCXA 2IEBA 3T7RA 2A1TR 3ZGXA 4JJIA 1OH6A 1ZEJA 4PNEA 1KP3A 5ALGA 1BHO1 3OH8A 2A5LA 1KAHA 4KH0A 3WNVA 3CC8A 1H2XA 3MT8A 1IN8A 3KIPA 1P39A 4RULA 1U7UA 1ISSA 1WXDA 3K96A 1Z5OA 2AFIA 1FNCA 1JFRA 2C5HA 2GTIA 2GZAA 3EZ9A 3K6KA 4MPRA 2C58A 4OGGA 3F6BX 3U4IA 1U2ZA 1QZTA 3JY6A 1ANKA 5LSAA 1SVWA 1JAYA 1IVSA 1Z68A 5LD2C 4HDMB 4AZWA 3PWTA 1GPH1 4D81A 2FPSA 3OBBA 4TTIA 3SHVA 2AQIA 3OOJA 2ZB3A 2ZBQA 1J21A 2YQ5A 4LFBB 1NV8A 3S1LA 2HCBA 3Q1KA 1DEKA 3KNZA 2IOHA 2P0EA 2VF8A 3N7AA 3EEBA 3GRUA 3T4XA 1GKUB 5I6DA 5B1DA 3ZHXA 1RAHA 5B57C 3N39C 4QGGA 2RG1A 2RGDA 3U3RA 2CYAA 2WABA 1BMQA 2ZITA 4PO8A 3E27A 3M4NA 2LCFA 5D1HA 3T1HB 1T6NA 2PANA 3IA7A 4B6GA 5IXJA 3EVAA 1G21A 4G2TA 3JQAA 3EGXA 1SK9A 4FC7A 4ZO4A 4I1UA 1D0SA 1O96A 4XVQA 2PZAA 5F21A 1PGPA 2R5FA 4PBSA 2IITA 1CFZA 3SMQA 2ZDQA 4QUEA 3S1AB 2JLXA 4OKIA 2WU3A 2VP0A 4PC2A 4EQ6A 3S68A 2NTVA 3FRHA 1TQ6A 3LCRA 2MYPA 3MUEA 1TAUA 2CCJA 4FDTA 1JFSA 3GRAA 4RANA 3T95A 3TTVA 1E2MA 3KZMA 1FTWA 3JASB 4I55A 5HCIA 5B5SA 5AT1A 2ZSJA 4ZAZA 3HVRA 4J7CA 2X5XA 1XWWA 2PT6A 4OJMX 4YC7A 4W82A 2VP6A 5L6LB 5T8KC 2XD4A 1ZM3A 2XE8A 2VVTA 3UK1A 3CZAA 3LQ1A 5K8LA 2IP2A 5DI3A 3X1JA 2GWHA 4OI4A 1VJ5A 4ZAFA 3CRQA 4E94A 3PUWA 5IU6A 4GOOD 3UG6A 1ESDA 2VNKA 3MFQA 1T4BA 3I9LA 3B7PA 3CW9A 5FOVA 3URMA 2A2ZA 3KRTA 1GV0A 4HLCA 1YFJA 4TVBA 3H3JA 2NAFA 3DWFA 4C30A 1KI7A 2HDHA 4A0SA 1SXHA 3HCAA 3H8SA 2FLVA 4F4FA 3DAYA 4BBJA 4F56A 2XY4A 2YC2C 3A1EA 1MD9A 5L4SA 2F90A 1RTKA 4I6JA 4B44A 1N5OX 1S89A 2AUNA 4GR5A 4B0OA 1JIVA 2B5OA 4C2AA 1O5OA 3TTWA 1II8A 1XVUA 2GMWA 1J07A 1M0SA 4I5IA 5DM2A 1OU4A 2Q3DA 2HD4A 2CV2A 4LJ8A 4YUYA 4D4KA 2J3HA 4N3GA 2HFKA 3LUBA 4B43A 3T3MB 5FOQA 1SKAA 3OP4A 2IW1A 3TUJC 4R8RA 5GIOE 3IAHA 2PM8A 1A8HA 5JZSA 2ZI6A 1OWPA 2BSQA 4ZVNA 4OREX 2XT6A 3IV6A 4WJKB 3D6JA 4WESB 2EJVA 3LYLA 4PVCA 2VUIB 2UVPB 1TVKA 3COYA 4H7DA 3RUAA 3RU7A 2QN6A 1FFDA 1QO9A 1KOGA 2CYBA 3BE6A 4GOKA 4UM8B 1IQRA 4OQZA 5IAKA 2C2OA 3E3OA 4NFHA 4UHDA 2IEYA 4YCCA 1NXQA 1UFVA 2HUNA 1QQ6A 1T9DA 3FGOA 1G3IA 4JUAA 4F93B 4V0NA 1PJLA 1ONNA 2ZBEA 1P4RA 3IJRA 3PRJA 4NU6A 5FI1B 1OU0A 1JA0A 3T5GA 3ZNPA 3NAMA 5FOWA 3E4CA 4IFEA 3ZWPA 1FLNA 3QOWA 1Q0LA 1QDLB 1O0SA 2A86A 5G2OA 2B1QA 2C7PA 5CP8A 4AUMA 3TJRA 3G2IA 1PJAA 5C9ZA 1XEXB 3TFOA 1QANA 5D2CA 3ZNQA 4ZEOA 1Z2CA 3TQHA 2D5CA 3EEOA 1JBQA 1PR1A 1I9GA 3F0TA 3KKOA 4Z3DA 3MELA 4G1EB 1XLTA 5HW0A 2PV7A 4M54A 3OECA 1AHIA 1B4DA 5DSTA 3CZPA 3EMKA 4Z0NA 3R5SA 4Q9AA 1RKBA 1DCMA 3P2IA 2I62A 3IPRA 4URFA 1PK9A 4JENA 1E0DA 1UADA 2NSHA 1Y8CA 3DKIA 4DSNA 4KSCA 1J1UA 1O97D 2QWXA 3WVNA 3C1TA 3FCXA 3BMNA 2CW5A 3UYKA 4GKKB 3LNCA 1DWUA 2ZJ3A 4OYLA 3ENWA 4UUAA 2RGRA 1Y6GA 2JGNA 1H1LA 3TNYA 4BFWA 4BO6A 1AU9A 2YNMD 3ENKA 3KLMX 4WUTA