5K0EA

Crystal structure of comt in complex with 2,4-dimethyl-5-[3-(2-phenylpropan-2-yl)-1h-pyrazol-5-yl]-1,3-thiazole
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
215
structure length
215
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal Structure of COMT
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 77
structure length 215
sequence length 215
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0eA00
5BP7A 4RSRA 1UIRA 2Y1XA 2OPBA 4KDRA 3THRA 4RYLA 1Q0SA 4GOLD 4AX8A 1AQJA 4HTFB 4V0QA 3HVJA 3EGVA 2ZVJA 3OZSA 3FRIA 1EJ0A 1NT2A 1QAMA 2QE6A 2YXEA 2G8NA 2G71A 1RI2A 1RI1A 1VE3A 3HTXA 2CMHA 5E9JA 1JG2A 3LCVB 2O57A 1KYZA 4XCXA 5E9QA 3DMGA 2BM9A 3C0KA 3LHDA 4R05A 5EMMA 5P8WA 3NVKI 5CUQA 4ISCA 3L8DA 2P35A 2IH5A 3M70A 3LX6A 4R6WA 5GP1A 3ELDA 1RI5A 2PBFA 2EG5A 1O9HA 4FT4A 3WSTA 4V0RA 4C08A 4BP3A 1FJXA 3FTEA 3T7TA 4P58A 3UWPA 5K0GA 5MHTA 7MHTA 3BGIA 5DTRA 4YV0A 4PYQA 4DZRA 3FPGA 5KYGA 3I64A 2YR0A 3KKZA 2ZWVA 3BWMA 2PWPA 1EQAA 3PB3A 1RI4A 3SVZA 1G38A 5DTQA 3TM5A 3DOUA 3O31A 4M38A 2KW5A 4QPNA 3F4KA 3RW9A 1WZNA 3PLAE 1ZG3A 2AVNA 2Z6UA 3HCDA 1NBHA 3M6UA 3O4FA 2G72A 3MHTA 3TOSA 1FP1D 1RJFA 2ESRA 5DX0A 1KHHA 3MTEA 3HA3A 4E2XA 5E8JA 4E33A 3OU7A 3GRRA 4QTTB 4CTJA 3MGGA 3EVAA 2AOTB 2AZTA 2JH8A 3LDGA 3G2MA 2I6GA 5GIOE 3G2PA 5CM2Z 4HGYA 3P9KA 4Y2HA 1PJZA 1L3CA 2P1DA 4PYJA 1X19A 2YQZA 4YUYA 1OR8A 1JG1A 1X1BA 4OA8A 1P1BA 2PX5A 3I9FA 5EZQA 3KQWA 3T7RA 5E1OA 3UFBA 4PWYA 1FP2A 1R74A 1TW3A 1VP9A 2PXCA 3C6MA 3G8BA 4RTNA 1D2HA 3B3GA 2XVMA 2WK1A 1KIAA 3DMFA 3LBFA 3P2IA 5CVEA 2PLWA 3DR5A 1XCLA 5E2BA 1D2CA 1RJGA 4CKCA 4OA5A 4RTMA 4E30A 1V39A 3CCFA 2ZULA 4QQKA 2AOVA 2QYOA 4XUEA 2VDWA 1SQGA 5K8VA 3DUWA 3FZGA 9MHTA 4C05A 3BGDA 3KPJA 4IWNA 5HIJA 3E23A 4MIKA 2ONZA 5JUWA 5F2OA 2PXXA 2UZ4A 1MHTA 1NW5A 4E70A 3KQPA 1NW7A 5DLYA 2NXEA 3FYDA 3SX0A 3GRYA 3CJTA 3HA5A 1B42A 5K0JA 5E1MA 5GM1A 3LSTA 3NJRA 5GWXA 2BH2A 4PIPA 4KIGA 3QOXA 2ZIFA 3G88A 5EMJA 3NW9A 5EPEA 4RTLA 1I4WA 5FUBA 4YUXA 1N7JA 4PIMA 2VDUE 1EAMA 2IDKA 3LGAA 1XDUA 4CKBA 5FTWA 1ZGJA 2WA2A 5EEHA 4E32A 3ELYA 5HIMA 2O05A 2B78A 3GXOA 4M36A 5FADA 3OFKA 3VSEA 4CXMA 4X63A 2YVLA 4AZTA 5LR6A 2OZVA 3M6VA 3TQSA 1NW6A 3EVDA 4ZTBA 3ELWA 5K05A 1TPYA 4YUVA 2E5WA 4OBXA 3DP7A 2HMYB 4RTRA 1YB2A 2VP3A 4PYNA 5LQRA 3GU3A 3GCZA 4RWZA 3AXSA 1EJ6A 5FULA 4RTSA 2OB1A 3DLIA 2XYRA 5FHQA 4RX1A 3B5IA 3EMDA 4MQ4A 3LPMA 4P7KA 4ER3A 4QVGA 3UJ6A 2HWKA 2JH9A 3GRZA 5CVVA 4R8RA 2IPXA 5HOQA 1NBIA 2H11A 1XDZA 2P3OA 3B3FA 5ERGB 5T67A 2DPMA 4E31A 1JR4A 2ZIEA 2BR5A 1I9GA 3DH0A 2AOUA 2FK7A 3EVFA 3Q7EA 2BZGA 1TW2A 3TKYA 5K01A 3OE5A 2DULA 3HCBA 4YV1A 2H00A 2IH2A 3EVGA 2AVDA 4KRGA 5FWDA 5HILA 3SSOA 3SM3A 3ERCA 1DUSA 3JWIA 2WA1A 3MCZA 3BGVA 5HIKA 5EQJB 1R00A 1Y8CA 3G7UA 2BR4A 4XUCA 3KQOA 3CKKA 3UJDA 4PONA 4RTKA 2VZ9A 2ZLBA 3TR6A 2Y1WA 3DXXA 5GIPE 3HCFA 3FPHA 3KPWA 3UJBA 5LQJA 2ZZMA 5EGSA 1XJ5A 3TKAA 3P2KA 2PV0A 2ZBRA 4HG2A 5GM2A 5B1SA 5T64A 2PT9A 4YUZA 5KQSA 3UA3A 4BLUA 3KR0A 4FGZA 5ICFA 4XUDA 4ER5A 3RODA 2ZW9A 3T7SA 4DKJA 2O06A 1IM8A 5CIYA 3A4TA 5E9WA 5H02A 2I9KA 4E2WA 2YX1A 4HRAA 2FYTA 1G6Q1 3AJDA 2PVCA 3R24A 1G55A 1BC5A 2GB4A 5KS2A 1NKVA 1BOOA 3ER9A 3LCUA 4LG1A 1SUIA 2FHPA 2HNKA 4L7VA 5EIFA 4AZVA 1O9GA 2PJDA 4RVGA 2NP7A 3HCAA 2XYVA 3FUWA 3TFWA 5DX1A 4DA4A 3FTDA 1JQ3A 4EMSA 5HFJA 5K0FA 2C7RA 4HH4A 3S68A 1AQIA 4RV9A 4PNEA 2GPYA 2O0LA 2IGTA 4X1OA 4HC4A 2GS9A 3CGGA 1KXZA 4P7FA 4RVHA 1L3BA 2ZFUA 5T6BA 5DXJA 5GINE 2QY6A 1JG3A 4KVZA 3O7WA 3LKZA 5EC8A 3T0IA 2V7EA 2P40A 3MQ2A 3TLJA 3DXZA 3K0BA 2EJUA 4GOND 2GA9A 2XVAA 1KPIA 1NV8A 3OU6A 4Z2YA 2NP6A 2OBFA 3HA7A 3K6RA 3VC1A 4DM3A 4BLWA 2OB2A 4C07A 2XBMA 3ELUA 3HP7A 1R8YA 4WXHA 3VYWA 3SR4A 4OBWA 2YTZA 5CVJA 4EVIA 3KPUA 3PVCA 2CKDA 3Q87B 1IY9A 3HM2A 3TMAA 4EQZA 3P2EA 4LWPA 2O07A 3G89A 3SSNA 1RJDA 4IV0A 3TM4A 3P97A 3LKDA 3FTFA 1JQDA 3PX2A 4FSXA 4GBED 2HV9A 1F38A 4U7TB 4U7PB 2P7HA 3LECA 3PT9A 1VIDA 3A7EA 5FA5A 4GOMD 3REOA 3EEOA 5K0LA 1ZQ9A 1L3IA 2NXCA 3MB5A 3ANXA 2AOXA 3MAGA 2PWYA 5ICEA 4PCAA 2EX4A 3BKWA 3HVHA 2AN4A 4BP1A 3A27A 3M6XA 5DSTA 3DTNA 2ORED 3BXOA 5K03A 5EKUA 2AOUB 4C03A 3DULA 2F8LA 3HCEA 3KU1A 5JR3A 1M6YA 4AUKA 1EIZA 2IH4A 4X41A 4MHTA 1XVAA 3LBYA 2EJTA 4CWAA 4OX9Y 3G5LA 3KPVA 5DT2A 2CL5A 3KQQA 2IFTA 2ZBQA 3D2LA 3P9IA 4KIFA 3GRVA 3HCCA 4KDCA 3PTAA 1F3LA 2NYUA 3KQTA 4OQDA 4EK9A 3KR1A 4RVFA 1SUSA 5K09A 1QYRA 3OE4A 2FCAA 2NXJA 1ZKDA 3AXTA 5CVUA 3NTVA 1XDSA 5C0OE 2GH1A 4KW7A 1HNNA 4RVDA 1R6AA 3P9CA 2QM3A 3C6KA 5KVAA 2PGXA 3I58A 4GEKA 4GQBA 2PX8A 2P7IA 2YXLA 5HIIA 2IBSA 2ZCJA 8MHTA 1X1CA 4PGGA 2QRVA 2YXDA 4QPPA 4KWCA 4AZSA 3EVBA 5DM1A 1WXWA 2UYQA 3FUTA 2P3LA 5E1BA 1Q0TA 3OZTA 2PY6A 3ORHA 1NW3A 1VP3A 4GC5A 4DQ0A 4YV2A 3PX3A 5LQUA 1U2ZA 2JHCA 1ZHFA 2H1RA 3LL7A 3B7PA 2NXNA 1FPQA 4PGHA 2P3QA 1T43A 4CKEA 3EPPA 2AN3A 3KQVA 1R8XA 1Z3CA 1KP9A 1AF7A 3FPEA 2OYRA 3KR2A 1JSZA 1P1CA 2JJQA 2P8JA 1QZZA 2OKCA 4ATNA 3CJQA 3FUXA 5CVDA 1UWVA 4C4AA 2OY0A 3IEIA 3VC2A 1YF3A 2R6ZA 1JTEA 2BM8A 4X61A 3UJ7A 5E1DA 4PYLA 3IV6A 3EMBA 4CTKA 10MHA 1IXKA 4R8SA 4OQEA 4Y30A 1L9KA 1N7IA 4H0NA 4RTPA 3G8AA 3MCTA 5HEKA 2YUIA 5D1HA 2VS1A 5K0NA 3MERA 1L1EA 3SXJA 5BXYA 5C1IA 3JWJA 4A6DA 3M6WA 1XXLA 2ZZKA 2HR1A 2R3SA 2GAFA 3HVKA 3JWHA 3KPYA 2XYQA 3NMUF 3FPJA 3FUVA 3GO4A 5EHGA 3TRKA 1ORIA 4ER6A 4PCLA 5LQAA 1WG8A 4QTUB 4E2YA 2FK8A 3HEMA 4O29A 4UOEA 3BWCA 4B17A 5E8RA 3DLCA 4PYMA 2FRXA 4PINA 1X1AA 2ERCA 5EMKA 1QAQA 4IKPA 1ZGAA 1R18A 1YUBA 1DCTA 4QDKA 1QANA 3CVOA 2PKWA 4HSGA 2AOWA 3GIWA 3RIEA 2AS0A 5FQOA 4NECA 3UJ9A 4DCGA 3GGDA 1X1DA 3A26A 2PX4A 4K6MA 5EVJA 3X0DA 3NVMB 3QV2A 5DXAA 4G56A 1G60A 3BWBA 3PFGA 3BZBA 3P71T 4YUWA 3JWGA 3UJ8A 5LSAA 2JG3A 3CC8A 1G8SA 3ER8A 3SGLA 1HMYA 1UFKA 2B25A 4GOOD 3B89A 3BUSA 4POOA 5E2AA 5EEGA 3G2OA 4RTJA 2N47A 1AV6A 2C7QA 3LDFA 1JTFA 2AR0A 4C06A 5FCDA 3I5UA 5FQNA 5IH3A 3V8VA 1G8AA 1DL5A 3FYCA 3LDUA 3NDJA 3GRUA 4M7RA 2G70A 5DTMA 5DM0A 2Z6QA 1FBNA 4GF5A 5EKXA 5FWAA 4ER0A 3OZRA 4DCMA 3HVIA 3A7DA 4A6EA 3EVEA 4R6XA 3P8ZA 4RTQA 2GLUA 2QRVB 4E2ZA 3HNRA 1VQ1A 3DXYA 3E7PA 2FPOA 2ZIGA 3AY0A 1YZHA 3KHKA 2B2CA 3CBGA 2IDJA 2CWWA 3BT7A 2C7PA 5CCXA 1VLMA 4QVKA 5DSXA 5IKMA 3EEYA 3B3JA 3NWBA 4QQNA 5EIWA 3PFHA 1XTPA 3DMHA 3FTCA 4FZVA 3EVZA 2JHPA 3C3PA 3I53A 2JHAA 3OU2A 5M5BA 4FSDA 1N2XA 4HTFA 5KQRA 2ZBPA 3M4XA 3H2BA 1WY7A 1NE2A 4PYIA 4F85A 2B9EA 4DF3A 1RI3A 1JG4A 3M33A 3UJCA 3UJAA 3V97A 3A25A 2A14A 5D1NA 4YMGA 1INLA 3R3HA 3ME5A 4MTLA 5DRYA 4DMGA 3GWZA 3C3YA 3E05A 3CJRA 3EVCA 4EKGA 4ER7A 5BW4A 5BW5A 3EGEA 1BKYA 1D2GA 3FUUA 3KQSA 3KQYA 2P41A 1O54A 3LCCA 3GDHA 3G2QA 2HTEA 5FA8A 4F86A 4YMHA 4QDJA 5EZSA 1KPHA 4FS8A 4WVLA 5U4XA 4FT2A 2UYOA 2Z6AA 1KYWA 3IYLW 3KR9A 1VPTA 2B3TA 4LECA 4PYOA 1RJEA 1QAOA 1SG9A 5EHIA 3NWEA 2LD4A 3BKXA 4PYKA 3EGIA 3OPNA 1EG2A 5ICGA 2Q41A 5DM2A 5DM4A 1P91A 3SMQA 3OCJA 4EKIA 3SSMA 2PXAA 4LWOA 5LQKA 4RTOA 3MTIA 1WS6A 3E8SA 2IBTA 5DWQA 3NDIA 4GUAA 5DX8A 5EMLA 5LQNA 2VDVE 2OO3A 5DPMA 5CD1A 1NW8A 5G02A 3QOWA 1I1NA 3FRHA 2AOTA 4P7JA 3GNLA 4FR0A 1BHJA 5HZMA 2AN5A 5ICCA 1XCJA 2UYHA 2EFJA 2K4MA 3PS9A 5F2KA 3R9XB 2UYCA 1WXXA 2CMGA 1M0EA 1YFJA 2I7CA 1JSXA 2IIPA 2ADMA 1NV9A 2ZTHA 3ID6C 3P9NA 5K0CA 4GC9A 5C9ZA 4HGZA 1YFLA 1VL5A 2BR3A 1YZ3A 5EOVA 3THSA 3FPFA 1KPGA 1PRYA 3UZUA 5GOZA 4BLVA 3R6TA 4IV8A 4MWZA 3R0QA 3IHTA 2C7OA 2ZZNA 1MJFA 1JQEA 1ORHA 2NNWB 5DRTA 2IP2A 4BY9E 2V74B 3G5TA 4F84A 2PSSA 2ONYA 3TPZA 3GJYA 1KR5A 3BWYA 4C04A 3U81A 2OXTA 1SQFA 3OFJA 5LQCA 3UBTA 2G1PA 4AZWA 4JXJA 5K0EA 5FHRA 4FP9A 1SKMA 1H1DA 1SVUA 4X60A 2ZWAA 1P39A 3UA4A 1M6EX 5K0BA 3AWIA 2PT6A 3KQMA 5CCBA 2PX2A 5F2NA 4P7GA 1VBFA 5EG5A 2I62A 4M37A 2ZSUA
chains in the Genus database with same CATH superfamily
3PGLA 4F60A 1DGQA 4IXDA 4RYLA 4GOLD 5LP6C 4O4LF 3DLPX 3BZUA 3C97A 3F9IA 4LC1A 2FJPA 4FD2A 4YO7A 3JAMA 2BHSA 4TMFA 3GUCA 3Q6MA 5E4YA 3LRPA 5LN1A 1EHYA 3AERA 3SC2B 1JNXX 1NFRA 1P7PA 4YRNA 5BWBA 2FR8C 3R0VA 4V3BA 1JEYA 4FLFA 4URYR 5CYFA 2JI4A 3HDYA 4J0FA 4EENA 5LKRA 1JEQB 4HKTA 3I5YA 4IFTA 1JN0A 1V9SA 5CFLA 4CKYA 2F9MA 3DMDA 2BAGA 4TLAA 4R2IA 1PSDA 4JWTA 4F0JA 1MJNA 2BTOA 3HL4A 3ZJTA 1H66A 2CNWA 4ILKA 4PAWA 3FTEA 3KT0A 2R79A 4QUEA 4KO8A 3WLMA 3GA0A 4D4HA 3FWPA 1NQUA 4NFHA 4WZBB 3KKZA 1G38A 4JB8A 2H5LA 3LIIA 5JBNA 4DBLE 5IDQA 1TUBA 1D0SA 1CSEE 2NX2A 2RGNC 4A0RA 5J4YA 4DR7B 2CE7A 2WJVA 3USCS 1N77A 2JAHA 2OM2A 3OKFA 5KOJA 3QI2A 5DIZA 4C88A 4IS2A 4CEJB 1NONA 4B3BA 5CPBA 3NUGA 1XL0A 5BPHA 1QE3A 1RS0A 2N0SA 4GZ3A 3SJUA 2ETVA 1ZPDA 4MJXA 4QTTB 4IV5A 3GGSA 1NBMD 2JIZD 4DNOA 4RABA 3U6KA 1BGXT 1OMOA 1ZK0A 2JH8A 3K3PA 4UVGA 1VYVA 2I6GA 2P9ZA 3B1ZA 4IHQA 1ZRMA 4NCXA 2ZBVA 3M6LA 3ZXSA 1E79D 1U7TA 5I8PA 1KGDA 3AK4A 2W2KB 1CG6A 3I9FA 5ULLA 5E1OA 3LOQA 2QIPA 3DFUA 2LKCA 4PR3A 3EZ2A 3B3GA 1KAOA 3IQGX 3P2IA 4DY6A 5IPFA 1O8BA 3P0IA 1GVNB 4YAJA 521PA 4E30A 1V39A 5EJAA 1TJPB 3RVPA 1RYNA 2IBMA 1PR0A 1GG2A 3QA3E 3CEAA 2VDWA 3FX2A 5J43A 1PGNA 3FZGA 3DCNA 3HFRA 2EJBA 4UZEA 4C05A 4EY8A 2QL9A 1OAOA 1CUDA 1V8PA 2NUPB 3E23A 4EL0A 1K2VN 4KTTE 2AN1A 3SQOA 1R10A 4CUKA 3QNUA 4YJ2B 4RY2A 4DIFA 4Z9BA 4HY3A 1ENPA 5EIOA 2F8SA 3CJTA 3O95A 4ND3A 4PZDA 1QHXA 1JPNA 2GZHA 4WCFC 3D59A 3FGOA 3OIWA 3D9QX 2YV3A 4CDRA 1RR6A 2QUJA 2WWTA 3G88A 3K5IA 3C5WP 4HQOA 2PTHA 2XYPA 2H2AA 3IERA 4YUXA 4X8HA 4D9NA 1JGTA 1XK7A 1XQ1A 3SX4A 3BA1A 1IRXA 1N8KA 2OGZA 1C0EA 3M9LA 4OH1A 4UVEA 5CH8A 4WK4B 2BCGY 2WWXA 3ELYA 3EQ7A 3QF7A 3RUAA 2O7SA 2FFHA 2PSHA 2D5LA 4NMMA 2QZJA 2VATA 4FZ5A 1DV2A 1VM6A 1AB5A 1HDRA 3OQ1A 4M0LA 4PAGA 3ZE8A 4NE2A 4UAUA 4BEVA 3F97A 4XJSA 2AEMA 1Q50A 3H99A 4ZEMA 3GMTA 1ABBA 3D3WA 1VZ2A 5AKXA 4PQGA 5J40A 3DDZX 3H8JA 5ADUS 5F7XA 3H9CA 1K0FA 3W5UA 1NUAA 3FMIA 5CFQA 3LKBA 3RCBA 2D1QA 3N7TA 1UT8A 1L4EA 3JATB 1CVIA 3AYZB 4CLDA 3GMIA 3C15C 4QVGA 4YYEA 3GRZA 1GRRA 1QGAA 3CNOA 3LBHA 4FCVA 2Z57A 3BD7A 4R8RA 3VU0A 3AVQA 3V3TA 4AU1A 3HB1A 1RRFA 1R4AA 1HLDA 3AIKA 3ZH2A 1VRCA 3M3HA 1I9GA 5A4KA 5JEEA 2WAMA 1QHIA 3H1EA 1ZR2A 2GZDA 3TKYA 3TSOA 1K68A 1O95D 1VYTA 4TYYA 4JY7A 3E18A 1N7GA 1DUSA 3SQLA 5TB5A 3L1IA 1M8KA 2BR4A 4UNNA 2O0JA 2XJ4A 1Y8AA 5BN4A 2CCGA 1RVV1 1H4SA 2RIPA 1V6SA 1JYFA 4HBGA 3BSSA 3RSOA 1E99A 3UK7A 2YJ5A 1O4VA 1YS2X 2ZZMA 4K86A 4F4UA 4YPOA 4TSFD 3E9RA 4HDMA 3OF2A 1JLRA 2EFHB 2CZQA 3CPEA 3DVAB 2RHRA 4LRWA 3H9BA 4M1MA 1GKYA 5TVKA 3T54A 5C1PA 1MX9A 1NXTA 4L0MA 2PMWB 3V4SA 3HJNA 2FTKE 2W8ZA 5H02A 2X1HA 2AC4A 3OC0A 4NK4A 1TMYA 3A6PC 1DAMA 3KRTA 3MBOA 4Y2SA 5E38A 3SHVA 2UAGA 5A7GA 4HPJB 5AKLA 4RPCA 2GB4A 1IB0A 1ODCA 4KQ2A 4RY8A 3ER9A 3EQ2A 1DCFA 3P9XA 5DB4A 3K8ZA 1K6EA 3NWJA 1YRAA 2VBFA 4U5QA 4EECA 5F23A 4PANA 5FOUA 1FUKA 4QXRA 1YBVA 4EMSA 1KQOA 4ZZ2A 5KWVA 4BO6A 2I66A 2GPYA 5LBIA 4DHWA 1NX9A 4X1OA 4FYWA 4WY8A 3JSXA 3PFCA 3W2TA 5KVVA 1E4YA 1MEOA 3ZKWA 1NF8A 4IH9A 4NAVA 4XWOA 5IT5A 4ME6A 4KVZA 2EARA 4KPUA 1ZBDA 2OHVA 2I1VB 4HEA6 3C8HA 4IZIA 1C3LA 1SCUB 1U5BB 2MHCA 2PX0A 4DPKA 3C3DA 4Z2YA 2VF8A 3ITNA 2Y6VA 3OBBA 4L4UA 1YULA 5LYJA 3FGZA 1CEXA 1DEHA 2QG4A 4QOJA 3OEWA 3ORFA 4YTEA 4HDCA 3SXUA 3R7NA 2B1JA 4OATA 4MYDA 3SKVA 4EVIA 5CVJA 4NE7A 4P80A 1H0HA 3UFXA 3TGPA 2ZAOA 1CUJA 3PVCA 2QUZA 4L7QA 3ZW7A 5I7FA 3ICCA 2JPDA 3EIHA 1WD5A 1OC4A 2RGWA 3QLVA 4FW9A 1PJQA 3EIQA 1LJUA 1AY0A 3F0TA 3D0OA 3L7IA 2GUGA 1KMHB 5EHNA 3UOGA 1ZA1A 3RUPA 1AHIA 1KYYA 1QH9A 3CF0A 4X3OA 3LECA 2Q6TA 4UARA 1EGVB 3QPBA 4IIGA 4YQEA 4KXLA 2I67A 2OAQ1 1SVMA 3CNBA 5EIAA 2OGUA 4U2EA 1MDBA 1Z5OA 5ALKA 3KCNA 3MF4A 4WK6A 1K98A 1K7EB 1OFGA 2FWNA 3M6XA 5DBIA 5CCDA 1Z4OA 1U4NA 1VMEA 5NLLA 1I1OA 1RWMA 3FH0A 2YVAA 3AUUA 4LBZA 4ZEWA 3RQSA 2GILA 1G2OA 5F33A 2GFHA 3DC7A 1B73A 2FG7C 4OYYA 4XI9A 2WIAA 2J3JA 3BWEA 1XALA 3EWNA 1CUHA 2GVDC 4ZVLA 3E9CA 1P5FA 2D2VA 2HBZA 3UAYA 4YJHB 4A0FA 1XJCA 4AECA 4KIFA 1C3XA 3M2PA 5AI0A 3D3KA 3UMFA 3RTAA 1AC5A 4OQDA 4RZQA 1BD3A 4M0MA 2RGRA 4X94A 2ZYSA 2O3RA 5KYXB 4M87A 2OZKA 3QU4A 2X6TA 5JS1A 4MGKR 2E55A 2XNKA 3CF4G 4J29A 5AW4A 4LRTB 4MRVA 4I55B 3WXBA 4PZLA 4IDHA 3U48A 4MQFB 4ENQA 4PN3A 2IPNA 2NT3A 4EG1A 4RSGA 3PNVA 1LY1A 4NZNA 4QG7A 3G49A 4HDSB 4BXOB 3HWRA 3KZNA 2X0JA 3RSLA 3QJ5A 1HL7A 3ORHA 4RKFA 2IF2A 3RABA 3U3KA 3A1FA 1V3VA 4KQ9A 1TT5A 1ZUNB 1ZI8A 5JHHB 2ZBDA 2JHCA 5FI5A 1OLUB 1Z6GA 4HH0A 4M1TA 3ILYA 4IVQA 1TYDE 1OZAA 1B14A 1GEEA 3IIEA 4MUJA 4QOGA 1WMSA 3EPPA 2KLHA 1TYAE 4DLUA 3GVHA 5E6SA 1WF6A 4H1TA 4IIHA 1G8GA 5AH0A 4R1LA 5DN6A 1JSZA 2GF2A 2AFHB 3PJDA 3BB4A 3IJRA 2VXCA 3ZV7A 5I7RA 1P8AA 3D6VA 4N82A 3AEQB 4E4TA 4OSOA 4JNKA 4DDVA 5JARA 4QYSA 2J0SA 1U0NA 5LD2B 2I4RA 4QUGA 1H85A 3OM9A 4BX2A 3NJ8A 4UOQA 1ZD2P 3GEGA 4BVBA 1X80B 3RKRA 4MQBA 4CMIB 2QLTA 1SOVA 2FZWA 4AZ0B 2I1QA 5K0NA 3MERA 1YVPA 5IXJA 3DMNA 4PTZA 3WKBA 4DV3B 1C4KA 2O8CB 3U44B 5I51A 2P4SA 4XEHA 2GAFA 4IQ8A 1RW4A 4KZKA 1WE2A 3LWBA 4EEKA 1XD2A 3T3PB 2ATXA 4HYQA 3H2SA 4HEQA 2Z1DA 4EA7A 3UB3A 5I4KA 1YCDA 1YA8A 4DW8A 1BCRA 3AUSA 3LP5A 2KB0A 4HZUB 4Y9UA 4AY2A 4ZYWA 4AWAA 1XTTA 2ZJ2A 3UEOA 1UINA 3VTKA 4GMHA 4C6TA 2BFFA 3NYQA 4B17A 2HSZA 1EFDN 3PITA 1FTNA 1ZD8A 2ZCVA 1QAQA 1FS5A 3D3JA 4IDFA 4UTOA 3ZHRA 5I7WA 2CK3A 2XGMA 3B20A 3KKMA 2FPIA 1AMUA 1XNHA 1UWCA 3IB3A 4XE5A 3VUEA 1FFHA 2VP0A 3GFTA 4II3A 1GZDA 1NRIA 2QMZA 5HE8A 3T7CA 4FD3A 4EJFA 5BRAA 3O94A 3ZTTA 4G56A 4V39A 5JNSA 3P71T 3JWGA 5LNK6 1NJ5A 1XTVA 3R9KA 1C9DB 1NMEA 3SDBA 4RZSA 1M7GA 1DXHA 2VAWA 3GH3A 3K09C 1XRQA 4LBWA 3V8RA 5IF3A 2XWPA 2VI5A 1XR3A 3BUSA 1YKGA 4Q12A 2PBLA 4TLMB 1NDQA 1VL6A 2WHPA 2YZGA 4UZSA 4MAMA 1J33A 3I5UA 3PC3A 4N3CA 1NI4A 4P22A 5FQNA 3SQMA 2WE7A 4GSLA 4LXQA 5EJ6A 1P62B 1GQYA 2GVZC 1WEHA 4D9BA 1DC7A 2P0EA 5DTMA 1Q0RA 3CIOA 2H1SA 1PU2A 3MBKA 2KBEA 1SVLA 3E3AA 3ROXA 3FWHA 1QHNA 1W4CA 2OFFA 3KUKA 4GT1A 3S2GA 3UNXA 1CFJA 4NCIA 3EGXB 3TQHA 1LSUA 4FJ2A 4ISBA 4X9XA 2QZZA 1C7RA 3ZWQA 4E2ZA 3UW1A 3CLSC 1IE3A 5JU6A 4CIVA 1G20E 2WJHA 1J0DA 2Y71A 2GAOA 2IDJA 3L1UA 1Z2CA 1M10A 2Q99A 4DNPA 4ZP1A 3VV3A 2G9RA 2WD7A 3E9EA 5JPDA 2GBGA 1LI7A 4O4LB 4WN3A 5A3QA 2IYPA 1KETA 4BRSA 1RMYA 2BFAA 3BL6A 4H7JA 4WXPA 3VTFA 4TTPA 2QTLA 3BORA 3ENVA 3FCCA 1FTGA 1UWLA 2F6RA 4MVJA 3LKVA 1YJXA 2A0FA 2IUUA 1SOAA 3S99A 4OOFA 1TJ4A 3UJAA 4CLOA 4G5QA 2XCIA 5I48A 1LVHA 1VJTA 4G5XA 4LHYA 2ST1A 3H65A 2V6IA 1CQIA 3R3HA 4LBVA 1JEQA 1ODTC 1TKRA 4PE5B 1KFBB 3GFGA 4MK4A 1GZ7A 3PI6A 3S2EA 2DUJA 2NV6A 4XLTA 5D5QA 4EVRA 4GSKA 2JHGA 2WVGA 1NVAA 3C5EA 4LYDA 5FYDA 4N5LA 3CZ5A 4D98A 4CM5A 4FGSA 3AHJA 2RGBA 4NENB 4AKHA 1E0JA 3CT6A 1V45E 2HTEA 4IUDS 4UTNA 3ZWDA 2B35A 3LVBA 2D3WA 2CHFA 2G06A 2YHIB 5KSPA 1JI0A 5GVSA 5CX1A 1DFHA 1YIDA 1H0SA 1LBIA 3HS3A 1KYWA 4WZBA 4DQLA 1NBWB 1X3SA 2JI8A 3PXDA 3ND9A 4CPDA 3EAFA 3AY7A 3G5UA 1KVUA 4R9RA 3BRCA 4BFLA 2IS2A 4H7FA 4KO2S 4PLCA 3ZBTA 2ZRPA 3E81A 4RHEA 4RIIA 2O9JA 3PEVA 4ZCRA 4DM7A 4ZMSA 4CEJA 4ZOBA 2CLKB 5IKXA 3E8SA 8OHMA 1Y1LA 2PBRA 2QRQA 3TNYA 3H7IA 5H81A 2IV2X 5IT9A 1ZM9A 4JBNA 1KJQA 1LCIA 4TKZA 1Y9AA 4JVNA 1Z25A 3O2QB 1SOMA 3AZPA 5IC6A 2UYHA 1VRWA 2VQFB 2UXDB 4AKEA 2JIRA 3I92A 3UANA 2YHAA 4R8LA 2W2KA 3IA2A 3T3HA 2QMYA 4DBVO 1UPAA 3NIGB 1AK2A 1ULBA 1CS4C 3R4CA 4BNLA 3LNCA 1I01A 1EFRD 4OTZA 4TWAA 4AN4A 4QPJC 3WOVA 1C0LA 3JD2A 4XDYA 1X6VA 1ZXLA 3THSA 5JAMA 1PRYA 4NCNA 1KE1A 4LI3X 4HAYA 2GTIA 1DBSA 2XV1A 3UG6A 3VR6H 1WBJB 4QYIA 3PEWA 3U19A 2C2BA 3AP3A 2ZWIA 1KDTA 1GQRA 4QYTA 4OXNA 1IUPA 4CCYA 3E82A 3G5TA 4F84A 4AURA 2W4MA 3BFKA 1PKXA 2CXOA 3I8XA 3BD6A 3KHTA 1BKSB 2G1PA 2JLQA 1H9CA 1AQLA 1P0QA 4TKMA 3GV0A 1QE0A 1NVWQ 3LC7O 3ONFA 4BKRA 5ALGA 3A9RA 5KEIA 3I3SR 1FFCA 2B5VA 3C5VA 3JQCA 1ZH8A 2DE0X 5D86A 5THXA 3RBZA 3RVRA 5KX5A 3GLHE 1AURA 4TS4A 2I62A 3SHWA 1X9IA 5KJEA 5K6AA 1NBME 3T7DA 2G4LA 2LVBA 5K45A 3RFVA 3DE6X 4EYEA 4UHCA 3K6KA 2WZCA 1QP4A 3GRPA 2A0XA 3LQ2A 3CE9A 2G8NA 4IIEA 1H4TA 4DXHA 2XQFA 1QG2A 1VE3A 5A5EA 4CT0A 1W88B 2CMHA 3AFNA 4G0WA 3OH8A 1NZFA 3V42A 3K9GA 3WYDA 3TTVA 4B71A 2X4LA 3R9XA 4NQZA 1OX5A 2E18A 3F6RA 4EAQA 1ZISA 4WZAA 1BWRA 1WVMA 1YVUA 2I76A 1FP7A 2XMBA 1IBLB 3PC2A 3UHAA 4R0NA 4E51A 4OI4A 3RQIA 1H2EA 3G9QA 1WPGA 2DLDA 3OQIB 1XAGA 2HYIC 4V0RA 1HX7A 1WXIA 1SU4A 4PZYA 4EUFA 3U16A 1KJNA 4OQFA 4DA7A 1FJXA 1GQOA 2C78A 1UBUS 2FEPA 3JATA 1MTZA 3ZOKA 1B8PA 1PWHA 1UQRA 4KEAA 3K1YA 3BWMA 4L8GA 1EQAA 1FQKA 2C3YA 2POCA 1EB8A 4BKQA 3O31A 3KTDA 4EL5A 1JDVA 3QE0A 4A82A 1F20A 4UTRA 1JXQA 2VP9A 3FKJA 4B40A 5DX0A 1K08A 2GN2A 3PXAA 1VKOA 4M0CA 3HA3A 4PFJA 1W46A 3VYSB 4F06A 5L45A 3DS8A 4Z49A 4ARBA 3RRYA 4HT3B 1J8QA 2B2XA 4IGIA 4XDHA 5WRFA 1IBKB 4MW0A 4QJIA 1NDHA 2WYVA 2G07A 3G2MA 2IEIA 1J24A 4LDAA 5TJHA 4B7CA 1F9AA 3MWDB 3HBFA 4D82A 2P6RA 3FVTA 4FB5A 4BLOA 2ZAMA 1JQKA 4MW1A 2PX5A 4GDMA 1GGFA 5G53C 5AW7A 3ZV6A 3EWAA 2JJMA 1FZTA 4POOA 1TUEA 2FWIA 1K5HA 1PS8A 4MP6A 3AGPA 2GMWA 3DVAA 3SE7A 3WK7A 1YV9A 3TFOA 1MAHA 4X97A 4QARA 3CCFA 1E3EA 1GUYA 3EH1A 4MV0A 2PHZA 1E1LA 1BFDA 2GBFA 4G6ZA 1PVDA 4BTEA 2OGWA 4JIMA 3D5QA 2HA5A 2H2GA 2VPWA 3JD3A 2OQ2A 2VPPA 4JJ6A 4P98A 4QDOA 3FZEA 4GX5A 2ZRGA 4YB8A 3SSAA 4AF6A 1TJNA 1USUA 3O93A 5JNTA 2PRYA 1NW7A 2YC4C 1ZH6A 4RIHA 4A92A 1WIWA 4N6NA 1NJGA 1FSSA 4C3UA 1MGPA 5GM1A 2P6MA 1U9IA 2XY4A 4IDDA 4M8IA 4YR7A 1NNEA 3NHSA 2H1WA 2ZITA 2D8AA 4BJHB 4OP3A 2OXRA 1KTVA 1OIWA 1PWXA 2JVIA 1R0CA 4UUMA 1AHPA 1R6BX 1XDUA 2C03A 1FF9A 1XVLA 2GKSA 3HACA 1JXAA 5HIMA 4KACA 2Z8YA 1X39A 4AT1A 1DDIA 4QJBA 1SCUA 4TMXA 4AZTA 2X14A 5KNBA 2JJYA 1MBZA 2YZMA 2PWAA 2NSLA 1GPAA 1XI2A 3DE0X 3EIWA 1M2OB 1V9CA 4TMYA 5AKKA 4DYDA 3FCUB 3BDVA 3A2LA 1CJTC 5D00A 2P90A 4RY9A 2P4EA 2E48A 1QWOA 1H2ZA 4OBXA 4BQRA 4L5IA 4EMTA 4PYNA 4ZGGA 2PLRA 3GK3A 2GXQA 4GBJA 3D8HA 4U6SA 1KARA 1Z73A 1KMHA 5FWYA 2WJ4A 3K0EA 3DBRA 1O57A 1SC4A 2YYAA 1SUEA 4YMSA 1ZYUA 4KFSA 2RCNA 4JKIA 4P7BA 4FIDA 1GNLA 4KPFC 2WY2D 3TN7A 3K9WA 3NHBA 2VT7A 4JWKA 4PPYA 1Z16A 5KTKA 3L1JA 4P4UA 1MP0A 4LY6A 4YDQA 3ZJUA 3QLUA 4L57A 1AU9A 3DQQA 4RMNA 4BKPA 1FYVA 5IJ9B 2Q1UA 2QTNA 3G6KA 2Z3VA 5FT9A 5C8YA 5BVGB 4DV6B 1AXGA 3JQ9A 5ILGA 5BN1A 2VTBA 1J6UA 3LE8A 4RK4A 2ZE8A 2BKAA 1IK6A 3B2EA 1BEEA 3IEVA 4RHXA 1RAAA 4KRGA 4NOMA 1F9EA 1KI4A 2HJGA 1SC3A 2GPWA 1H6AA 1HBJA 3AMVA 4YJHA 1N3IA 1SC9A 4DARA 4CMGA 1XDDA 4F38A 3CRZA 2V7VA 4FR5A 1J8MF 4P93A 4ZYTA 1SHJA 5GIPE 2QTFA 4EY5A 3KPWA 3HP1A 3P2KA 3VNQA 2AG0A 4GXNA 4RCVA 4BAGA 1XLVA 5KYXA 2A9OA 2NTNA 3IEMA 4I55A 1NUSA 2CLMB 3BE8A 4YJGA 3R7FA 2HJWA 3T7SA 5EPUA 1M6WA 4RQTA 1YE8A 2DX7A 3UXYA 2QJRA 2G3YA 3EZ6A 3SE0A 4ZAWA 3O9VA 1G6Q1 1PR3A 4L95C 3V4PB 2ZJ0A 1Z2NX 2QXYA 4U7JA 1YS6A 1KGSA 1YB7A 1JMYA 2F64A 3PKZA 1OILA 4HZGA 1ZUNA 1D4ZA 3H2ZA 4LK3A 5TS3A 3RFUA 2QP3A 3VZDA 3WYFA 1C3EA 1OLUA 1W5TA 3H4IA 4X00A 3TE6A 4Z7QB 3QTBA 2PDAA 1PZNA 3GFPA 1YJ5A 2QL5A 4H15A 1X2EA 2PK3A 4RELA 3DE7X 5ALZA 5L6LB 4P54A 1YRQA 5FBZA 5JY6A 2ZXUA 3Q2OA 2AFHA 2SNIE 3FIUA 3ZDEA 5THQA 4RVOA 1P6XA 5KKNB 1X9GA 3AEQA 1A9XB 4QBKA 3ZIAD 1LV7A 3TI9A 3P9ZA 5ALVA 2UV8A 1JH8A 3D1LA 5CDGA 2C42A 2I78A 5L9AA 3FNBA 1W36B 2J0QA 5DXJA 2YWBA 1GGHA 5BQFA 2WWWA 1R3DA 1X80A 2LUOA 1G7RA 1SRQA 4OLFA 4H0FA 1KFKB 4Q66C 4DMLA 4MV8A 2QE7D 4AZ0A 4M9QA 1WW2A 4MVJI 4NG5A 5LP6A 2EJUA 2NPIA 1AGPA 1L1QA 1E2BA 2VF5X 4MKHA 3QEKA 4K9DA 4HI0E 1DX9A 1U8UA 3V1KA 3K70D 2QXTA 3BH0A 1WD7A 3CH4B 3JY6A 1RZUA 5EP1A 1VGRA 3RB8A 1BG6A 1DBVO 3ZCVA 2ZCUA 3W5AA 4Q1VA 3RYFB 1Z82A 3BN3A 3DJFA 3L7DA 3NT4A 2XRZA 3EWSA 4HZUA 1VIYA 2SHKA 1F38A 3U13A 1ZMRA 5LMZA 1DBQA 4V0SA 3TH5A 3ETJA 4LVNA 5EJ5A 3K20A 3CLVA 4R9VA 1IYZA 4HGQA 1L3IA 4S0XA 1U3CA 3ANXA 2W42A 3PSHA 1L7QA 3ETEA 4MGEA 1IZZA 4B3CA 4BFZA 2UUBB 1SKYB 2AN4A 3QP9A 3T1QA 5HGXA 1X1RA 1C0KA 1KAGA 1NP7A 1UBTS 2GF0A 4MJLA 3ODPA 4MI9A 3IEKA 4JVOA 1VE9A 1DJNA 4P2BA 3ZIDA 2WHYA 2CJYA 3LTEA 4YP0A 3NHAA 2ZIAA 3EH2A 4MVJG 4DRZA 2ZIWB 4UZFA 3UT0A 5DMHA 1KU6A 1E6UA 3CZAA 3ODGA 3P9IA 4QAJA 4XEUA 3WGVA 2HPZA 3HB7A 1EVQA 4FI3F 1Z7EA 1EP2B 1Y6QA 2ZYDA 3DAHA 3KR1A 4M0FA 1JZQA 4TPKA 3TLZA 3V7YA 1XCPA 1IQPA 1BYUA 3PQ7A 5LWHA 5DTEA 1NN3A 3AF6A 4HMPA 1EM8B 1KKLA 2VSXA 4UE2A 3H11B 5C2JB 4GEKA 4GQBA 1LPAB 1EYZA 2SKDA 4DA8A 2CC2A 2P7IA 4A4DA 1CJVC 2Z4SA 3AF1A 1MTOA 2ATIA 5ALXA 4EY3A 1I30A 2V4UA 1CUXA 3EGXA 4HEHA 3U0VA 7ABPA 1NVVR 1GSOA 1VJ1A 2W2PA 3ENZA 2CB9A 2D0DA 2DKOA 3A4YA 4P5EA 4PSKA 2YXBA 1OXTA 1IQUA 1RM3A 2C5FA 1C41A 4L5CA 1L4YA 4V0KA 5AQEA 1FQJA 4E46A 4GL2A 1QO0A 2AIRA 4KXXA 1IAQA 2PZ8A 2WJ3A 5JYEA 2IIQA 4RD4A 2Y4NA 1X1EA 5BR8B 3U3JA 5IHXA 3CH7A 4V2IA 2PVPA 1KE2A 3FAKA 1HTWA 3UWMA 1IHXA 4OAPA 1HRKA 3J81k 3GN2A 3WLFA 3FI9A 5G1PA 3N3BC 1ODIA 2XTAA 3O1LA 4PFQA 4I4TA 3FMPB 2VHCA 4PCVA 3Q7RA 1X1SA 3CX7A 4JAVC 4X84A 4HUTA 2ZREA 4KN6A 3A9CA 3PDIA 4B4KA 1P1RA 2R4TA 2FGJA 2ZDQA 2F9LA 1I3OA 3MCTA 3KLBA 1Y7LA 2VS1A 3RTGA 1F8GA 3STXA 2MJLA 1NSFA 3A6KA 4KL8S 3GJRA 3AM3A 4AWBA 2IYVA 3LGSA 3KPYA 1E58A 3AUJB 2D5AA 3A9VA 3FJ1A 5A3JA 2DSNA 3ZK7A 3HCRA 3GO4A 4J7XA 4NL4H 5K4AA 3D6HA 1QIIA 3PRJA 1U7PA 2Z83A 3N53A 1CR6A 4PCLA 3IPCA 1WX1A 1U2SA 4FYPA 1RTKA 4BWVA 3HCPA 3GQBB 4Q3OA 2EX0A 1VGVA 3H5VA 1P4SA 3Q7PA 2RH4A 4PYMA 1I8TA 1A3CA 2BDUA 2IWRA 3C3EA 3FVQA 4QJ5A 3X2FA 2Y1OA 1NU6A 4QDKA 1Y8RB 3G2HA 2FPGA 4AWXA 3UENA 4XOUA 3UJ9A 1EUCA 3ZU6A 1EHCA 1TZCA 3U0BA 2QZ4A 4K6MA 2P9GA 2ZDGA 3BBPA 1KSHA 3I6ZA 1N5IA 4M9RA 4QULA 1JFRA 4RPGA 2FLKA 2FSVC 4RESA 1P80A 1AHHA 3PFGA 3E35A 1N9ZA 5LSAA 5TARA 3IPRA 3V4OA 3NWPA 2GO7A 2LKDA 1EVIA 2HMSA 1HLGA 5JXWA 3TRJA 3W8EA 1LPPA 2XECA 1ZNXA 4RTJA 3L79A 3LC2O 2VCHA 4EJMA 3F7NA 4QE3A 4HUQB 1FVFA 4BVEA 4BBJA 4NIMA 1HDCA 2J9RA 1IWBB 1ZWLA 3HV0A 2QI9C 1Y3DE 3EIUA 2W37A 1X9HA 3DZDA 1CR1A 1ZC4A 1XPJA 2V5VA 1F0NA 2XWSA 3QU5A 3OZRA 5L3RA 1MORA 3AW8A 4YXFA 2OCPA 4A6EA 1DLIA 1RM0A 3BILA 4UKDA 1MB2A 5HTOA 2EJWA 4OQZA 3CRQA 4GR9A 1BE0A 3NOOA 1VQ1A 2GERA 3AR5A 1Y4AE 1QG4A 4C5BA 4WXMA 5CCXA 3FOCA 5DSXA 4QO7A 3ROGA 2V0CA 4RZHA 1G0NA 1YZTA 2JLBA 3U4GA 2J3DA 3EOAI 4GRDA 1EUQA 3OOJA 1E6WA 4W7SA 4YT4A 5C3MA 3PIDA 2ZT8A 3WLHA 5AK0A 3WK6A 4HRVA 1RJ9B 4CMEC 3K0FB 3CX3A 4KGDA 2V7QD 3HEAA 1XZIA 1X8JA 1GL3A 2GNAA 1U0JA 4TQ9A 1W88A 4XIJA 5LXTF 2ZUSA 4CKXA 1AJEA 1QYCA 3D43A 3EQ6A 2WINI 3RF6A 5CDFE 1NG9A 3W6OA 3MRSA 1TQ4A 1N36B 5JH7A 1FMTA 4KOEC 3AC0A 1ND6A 3ETGA 1CZRA 1OYYA 2RHOA 4BP8A 1P44A 3FTNA 3FNHA 4L0QA 2FVYA 1N2HA 3B1VA 2GKGA 4F86A 4YAEA 1T1RA 2XB9A 2VWGA 1XRMA 4B7UA 5JPIA 4LHZA 1KAHA 3UO8B 4WVLA 3ROTA 1L4GA 1V43A 2B6HA 4LQ4A 4W8OA 3BVPA 3T0FA 4EABA 1U0HC 2CVZA 1B0UA 1P72A 3MCVA 5DGTA 1PO7A 3C5CA 4BV3A 3RM3A 2V03A 4IM7A 3BKXA 3OPNA 3VBEA 1P4JA 2Q41A 1T25A 2B7LA 3C74A 3REGA 3ZQUA 4EGAA 2JKYA 3RFXA 4M9XA 2GI4A 4GR5A 5CDUA 3DNFA 4Z0HO 1PBTA 3S2IA 1K7YA 3IQXA 3U09A 2PZGA 3C85A 2QPOA 3F5QA 3LNTA 3V34A 2WMYA 4BJ1A 4DIEA 1UMDA 5CD1A 5DPMA 1QO9A 1GGNA 1THGA 3K1JA 3LZ6A 4I81A 3HB4X 3H97A 1OVGA 2Q6IA 4I8DA 2DM6A 2FPMA 1U0TA 3CWCA 5DW0A 4BBAA 2CMGA 1VI6A 1Q1NA 2XUIA 1K97A 3UN1A 4BTVA 1C8BA 2IOFK 2D8MA 5JBIA 1NQTA 2IHZA 2VTVA 2W0SA 1BD4A 2YN2A 1KRHA 2VIIA 1FFYA 4PXAA 2W6ZA 1G8KA 3FSRA 3ICVA 4MWZA 2ZZNA 2HX1A 4DZTA 2RI0A 4JXXA 1FA9A 2HC9A 2R6R1 1ORHA 2DVMA 3CKMA 1SU8A 1YACA 1E89A 1ETUA 3R44A 4LNUB 1PWZA 3T5BA 2YXPX 1JTVA 3C48A 4CCSA 6Q21A 3RKUA 1Z6TA 3A2NA 3ZWMA 2P4QA 3BWYA 1SELA 1O97D 4H1VA 2JFVA 3HR7A 2I1LA 1WDMA 3TO5A 3KV1A 3WVNA 5IABA 3AYXB 2QGFA 1SK9A 4QUIA 4Z7NB 3W8FA 1E1QA 3HO6A 1SNYA 2GJKA 3BE5A 4P08A 1P39A 4FN5A 4R31A 1LJ8A 5FL3A 2AI2A 3AZQA 1N5OX 3KOZA 4EG8A 3CE6A 3NM6B 4C0LA 1NSTA 1XZDA 3N8GA 3F4BA 3OAAA 4HQ0A 2I2CA 5ALQA 5FA6A 4COKA 4YR9A 4QBFA 5FI1B 2OV8A 5JFOA 1QP8A 3FHLA 4GPZA 2H63A 3OIGA 4IG9A 1J39A 2MSKA 3IAS6 3VRHA 3AFIA 3UV3A 5JASA 3HUFA 4D57A 3EFBA 5CIQA 2VJDA 2OBLA 5FBQB 4RH1A 3ZX5A 5KNCA 5HUQA 2JGAA 3WAJA 5DHUA 5FKJA 4CFSA 1EK5A 3EOBI 4JOBA 5JY1A 3ZGVA 1VPWA 2DFPA 4XZ3A 3HRKA 5C1OA 3EPKA 2DQ4A 3NO4A 5P8WA 4QUHA 4X7MA 1K5DA 2XZTA 4B43A 3UYLA 3FMGA 1R0YA 3A28A 1KOGA 4EG7A 4JOCA 4HPWA 5KC8A 1KYXA 3LPAA 3RS9A 3SIRA 4B8YA 3ESYA 1KH1A 3ZDXB 4DIMA 4DV0B 3H2HA 5AKIA 2OBMA 2C9OA 3UV7A 4HB3A 3IBCA 1HDZA 2WMDA 2YR0A 3MS2A 3Q0EA 4GQIA 4QIHA 1FSZA 2QVLA 3VISA 3QKTA 1Y6ZA 3MTQA 3DOUA 4M38A 4O2AA 4RZIA 5DTQA 4R2LA 1EXNA 1GN9A 3C45A 3QLJA 1KTIA 2QN8A 4G5HA 2G72A 3AVTA 4DJEC 2R8EA 5FOXA 2C4TA 4I36A 5BVGA 4XIGS 5FV7A 3TOSA 3E1SA 4UMDA 1WXQA 4PM4A 1C7EA 3G1UA 4HX5A 3AR2A 1OZFA 2XDYA 5JSUA 5ED4A 5CLQA 1IEQA 2Q1XA 1FFWA 3I2IA 4B6QA 2HDWA 3T8YA 3EPJA 3RADC 2BY4A 2Z8YM 1XEWX 4R0VA 3PNKA 2HRDA 4MUKA 5JDIA 3OFND 2GK7A 3OMWA 1EFTA 1VIAA 5IZCA 4EG5A 3Q8XB 1A95A 2ZYTX 2C9YA 4IXMA 1AUOA 4JQYA 3GMSA 2GETA 3S40A 4BVHA 4O8CA 2HQOA 3F3KA 2QLBA 3E4DA 4TLEA 2LR0A 4FYVA 5EIHA 4HNQA 2ZYRA 4MGHA 5FL7A 4ASUA 2D2FA 4W5OA 1I51A 1YKFA 3SJCA 3V8NA 7ADHA 4F2GA 2ERXA 4JN6B 1T3GA 3TMKA 1ZL2A 4R01A 1N5LA 2EOAA 4J0JA 1HYBA 2I80A 3BIFA 3PRYA 4JODA 2JJ1A 1Z28A 5DLYA 4TS9A 3FYDA 1IATA 3G8CA 3GRYA 4WOJA 3VVCA 2CDCA 3I01A 3DOFA 3IMCA 1PX0A 2QX6A 3R6GA 5DNEA 3L93A 3IO3A 2O8VA 2DFTA 4Z8YA 3RRBA 4W9MC 1UBCA 2R48A 1RPAA 2WD8A 3N2KA 1FDIA 3O92A 4TXMA 3TNJA 4URZR 4ARAA 1OWPA 1NF3A 2YFKA 4Q00A 1T8TA 5BPFA 2GFIA 3ESBA 2P68A 2UDPA 1DG3A 1NJ6A 2VQ3A 5KREA 2GZMA 4BV8A 5BYBA 2JCSA 4M76B 2L19A 2IY7A 2DG2A 2JZNA 3L82B 1R6DA 2X77A 1PQ4A 1VL2A 2ZE5A 3Q15C 3SY8A 4YI5A 4RL6A 3RUHA 1JA9A 5IKOA 4ZTBA 2R86A 1TPYA 3FUCA 2AC7A 2RHMA 3GP5A 1ZOOA 5F64A 4YUVA 4PO3X 3OCCA 2YMMA 1Y33E 2WG0A 1YB2A 4X85A 5CYOA 2ZKLA 5PNTA 3KEQA 4UASA 3RYFA 4UDYX 1WUTA 2VHZA 4WOPA 2CB0A 5KKAA 2FZCA 4V02A 3DMRA 2GYVA 4XVHA 1HYGA 3B5IA 5CLFA 3SR0A 1ESEA 2B1GA 4AC9A 1NOJA 1WOMA 2DPYA 2X23A 1YIOA 4IIBA 5AVTA 1LB1B 1PS0A 3KOXA 4J0CA 2E5LB 2XB2A 4WLOA 1NC1A 5B1DA 2B0CA 3CLUC 1UPCA 3NKFA 5KDOA 3GEIA 3U3XA 3T35A 4U2DA 2ZIEA 1EJBA 4J43A 4B85A 3VNUA 3VR2D 2H8KA 2Y4OA 3OUTA 1DC8A 1HETA 1T5IA 1OY1A 3IILA 1H8ED 4HP8A 4B3TB 3PSAA 5B4VA 5FWDA 1K5GA 1XF1A 3ZCRA 3F8SA 1CEYA 3BRWA 3A2MA 4ZI7F 4YLYA 3N9IA 3UK1A 1MR3F 1CZKA 2GSWA 1V95A 2D0OB 3BPSA 1DBPA 2JB9A 5DGIA 2OXIA 4IDBA 5K51A 3NCHA 3C7TA 3W5IA 1FK8A 3IOYA 3GCWA 4MCIA 4JXKA 5AVVA 2G09A 1HDOA 2OGSA 5T4BA 3GFQA 4QHYA 4UD2A 3P1JA 4N7JA 5B1SA 1NE7A 2H9IA 1HDGO 3H11A 4NRDA 4V24A 5IYZF 3N59A 4DLKA 5ICFA 3UC5A 2YKGA 1XVTA 1P8JA 1YQXA 4MRPA 5I4BA 1LSOA 1XCOA 3LQ1A 5DOZA 2PNJA 4NV0A 1VMAA 3KFXA 5DHFA 2Z4TA 5I9IA 4MPTA 2GCIA 1RXYA 3KUXA 1L8LA 2KMLA 4BWYA 4F1KA 1WU7A 4GP6A 4DG8A 3DBVO 1SUIA 1VKHA 2FY8A 4NZ9A 1ONPA 4MH0R 5EIFA 1U1IA 4AZVA 4GX2A 4YRZA 3OQMA 1QP7A 1F8FA 3TR5A 3EJWA 4YHHB 2J67A 3HN7A 5FUVA 5KVQA 2Q0SA 4CQLA 2NU9B 3UQYS 2O3UA 2R9VA 1W35A 4PNEA 2OO5C 1M75A 2ODPA 4JJEA 5I7HA 1AKRA 2FR1A 3TGWA 1FW8A 3QEBZ 4P7FA 2C92A 1ZNWA 3T7AA 4JYBA 1Q19A 5EC8A 4RACA 4DQVA 5F9FA 1VI5A 2NO4A 3T0IA 4MAFA 1ESCA 4Z53A 4F71A 3W7AA 3G82C 4I1PA 1XX6A 4J6FA 2I6XA 2ZUCA 4MJ3A 1NV8A 3OU6A 5AI8A 5AJTA 2HLHA 3HA7A 3NASA 4E21A 4LHVA 1OGJA 5G4LA 1UBRS 3UMBA 5CD9A 5LQMA 5CB6A 3QX9A 4WXHA 3H5LA 1U63A 1H65A 3K5HA 2VUSA 5AP9A 2RGCA 5HCUA 4BB6A 3HM2A 4HJRA 4WJLA 5CBKA 3HYCA 4D02A 5IP5A 4F7DA 1KHTA 1L7BA 2JF0A 2JK0A 4IV0A 4U2KA 4Y0VA 3DFKA 2MR6A 5A5VA 1GUZA 2FUEA 5B6IA 5J2UF 1P1KA 3T34A 5M04A 1KJIA 3NV9A 4BUCA 5DGHA 1ZVMA 2YVUA 3DOHA 4FXPA 5NULA 1ARZA 2ABWA 1GITA 2F3PA 1UM8A 2IK8A 4HATA 4PRZA 1T5SA 4LW8A 3E27A 4I5IA 1XEAA 4KQMA 3VV2A 4OHMA 1QH1B 4AB1A 2Q5FA 4LJ8A 1GG9A 5IXYA 1U6KA 5AHWA 5EKUA 4X66B 3MJCA 2B4YA 2IZ5A 3ANSA 4JBHA 2E5FA 4DTCA 4R98A 3JPWA 4F2PA 1XK6A 1PT7A 2O2JA 4K5QA 4XYGA 5KVSA 1L7VC 1YB1A 5LDDC 4MW5A 4X41A 1JDPA 4LF8B 4GKKB 3AFMA 4DNXA 4YO8A 1I32A 1A4IA 4US2R 4Q3AA 1XA0A 3ZWBA 3T99A 1G8JA 3WS7A 1HL3A 4MW2A 4AYWA 5LBUA 4HUQA 4BATA 3U60B 4DLZA 4O08A 1ITZA 1WPQA 4NVRA 3S7ZA 5KU1A 2NXJA 4MMYB 4QFDA 1MQSA 3GJ3A 4JLPA 1M5TA 3P9QA 4G5FA 3MHPA 4HGNA 4O5AA 1UPFA 3ROKA 3ZJ5A 1V4NA 2FX2A 1VG1A 3TVDA 2DECA 1RE1A 4O8ZA 3EQZA 4XD2A 2XUKA 4AJ4A 2CMDA 4AZSA 1VHJA 4QM7A 4RD0A 3EGDB 5EKSA 5HM8A 2REQB 2PV7A 4M60A 2IYTA 3G8YA 3ZDYB 4YV2A 4TROA 3P7MA 4DSNA 2G40A 4P83A 4BMXA 4R0MA 1KK1A 2A84A 2QORA 1UBGA 2HY7A 2Q2WA 1L6RA 2AFIA 2VSFA 4J1TA 1SXPA 3KQVA 2FPPB 4KBFA 3P2YA 1AF7A 1IHPA 3R2JA 2V5UA 3HHEA 3VNAA 2IU6A 3GBVA 2ODEA 3K0FA 1LTHR 8ATCA 3QUSA 4C3ZA 4ATNA 3KJZA 4HEJA 3W79A 2TMKA 2VT2A 1PD0A 1Z38A 3E15A 4RY0A 1N5RA 2VTKA 3VZQA 3ZN2A 1Z17A 1JTEA 3F1KA 2D74A 1ISPA 3CVWA 1GXSB 4BWGA 3IV6A 1FRFS 1S8OA 1U2PA 2NO1A 4NLLA 4N5MA 3DD5A 5REQA 4J1NA 4BVFA 4KXQA 1EK1A 4KXNA 3OJXA 3L7AA 1DJQA 5BSWA 1OWOA 1XU9A 4AMZA 2PCJA 4EKYA 1CK4A 2O48X 2R7LA 1ZZEA 3AHHA 1YJ8A 4QBHA 3THYB 1VE5A 1CJKC 4K46A 4EHAA 4IIJF 2B4QA 1P0PA 2BTQB 5JNWA 4AY3A 3D4PA 1TF2A 1H6CA 4QDZA 3UHPA 3D54D 5MF6A 2IUFA 1CR4A 1V8ZA 2ZRBA 2RKOA 1OOEA 5J3JA 1E9CA 4XH9B 2J3HA 4YJKA 2GTHA 2NVBA 2OUIA 4Z0PA 1VL0A 1UBSB 1XTIA 1CY2A 1JLMA 4FKMA 4KXYA 4MRMB 1CE8B 1GTSA 1VJDA 1YCGA 3BWCA 2MOKA 1P9WA 2Y76A 2I3AA 3FYSA 4DIBA 1OXXK 1ZGAA 3ONEA 2GASA 2VP5A 3RJMA 1T26A 2AOWA 1N4DA 2AS0A 2CXTA 2ICAA 3GIWA 3CPJB 4G8CA 5HFAA 3S2SA 4GOKA 2GEBA 2IPMA 1JF8A 2H1OA 3HI6A 1USIA 3V7WA 5B64A 1TEZA 1HY3A 4G5GA 1XELA 3CS3A 2JIQA 2ZBUA 2RGGA 5KYWA 3AKCA 1UDWA 2YNMA 1NAHA 1TZMA 5ALHA 4W63A 1V6AA 2D59A 3CRVA 4GXRA 4G1FA 4LJLA 5F4ZA 1QGUB 5I47A 4RZUA 1E92A 4NPHA 2BJWA 1HMYA 2XEXA 1A76A 3OLVA 1B1CA 3Q7SA 5B2ZA 2OD9A 1E3LA 3DOOA 3PTLA 1X7GA 1E9SA 1P31A 1EX6A 1PDWA 1YASA 4TWBA 3X44A 3CTPA 3DWGA 5CT4A 5JMPA 4D2IA 4R9SA 3HJUA 2VPYA 4G0ZA 5FFMA 4YROA 5IH3A 2Y0EA 4AI6A 1U7UA 5K3OA 1X1QA 1JLHA 1I7PA 1XVIA 4ZKEA 2G70A 3MAAC 3CPHA 1QNLA 3V4VB 5BT8A 4GF5A 4OJKA 2Z6QA 4OREX 4XDGA 2J07A 5G1NA 5H82A 3RU3A 2YWDA 1Q57A 3EVEA 3QUAA 1NUHA 3DFIA 3W7VA 2GLUA 5CB4A 3SYTA 3OTQA 4QECA 3OPYI 3W1WA 3DXYA 5I8ZA 2WTXA 3GARA 1S2IA 2FPOA 1EE2A 2JLRA 4LZNA 5JAHA 3INNA 3BT7A 4TUYA 3EC7A 1RXEA 2NW6A 2A92A 4C6SA 3B3JA 3HKEB 1KI3A 1A72A 1RLTA 1J1UA 1FMFA 3LVFO 3EGCA 1CTQA 1KMMA 3RTCA 4WXYB 2CZCA 1GPKA 2XCTB 4PQYA 1O3YA 2A7XA 1R0ZA 1HLPA 3GAFA 1STOA 4D8UA 4YMUA 2CLFB 5KQRA 3M4NA 1X42A 2IHNA 1SXGA 4BMOB 1QRDA 1DIAA 2ID9A 4Y6GB 1H2XA 1JKIA 4EVSA 5F73A 1YIAA 4CV2A 3ABZA 1AHNA 3IAM1 4DB2A 2E4YA 5CFZA 3N7AA 1MG0A 1SIBE 1C29B 3I8OA 1T2UA 1WM1A 3IAEA 4W1RA 2XCQA 3HLKA 2PPLA 3PUHA 1GZVA 4UCWA 1VIMA 3AR4A 3JVUA 4M0KA 1YOVB 3HKDA 3TLYA 4QTXA 2J85A 5JI2E 4U0JA 1HT0A 1YDEA 2ZIVB 2QTMA 2XZOA 2HPHA 1H5UA 4DV7B 3LHSA 4HAVA 2AJLI 1TIKA 4Y9TA 2Z08A 4WBXC 3ZWAA 3KJNA 3HYRA 4G4JA 4KC0A 3SICE 2IP4A 4ZVVA 3ZI4A 3RSZA 1XHLA 1HTBA 3O91A 5H3HA 5A3RA 2QUHA 3USZA 4DJDC 3N8KA 2JLVA 3KJQA 1NPTO 1JIKA 3PQ4A 4OAOA 3PEFA 4TYNA 4PNPA 5FLKA 3NYRA 3I23A 4JR0A 2HD4A 1FDTA 2VJQA 4PQFA 4X6UA 3WHLA 2JH3A 3H2KA 2AKYA 4RFSA 3WBBA 1H94A 3MTIA 2B92A 3OFSA 3PF9A 1W4BA 4G36A 3ZCQA 4B4WA 3HQ4O 1GLNA 1E9AA 1Z39A 3LHFA 1MG5A 3V7UA 3Q5EA 2V6JA 2IE0A 2V7WA 4I5DA 4Y2PA 4XX0B 1GFZA 4D45A 1I1HA 4LF9B 2QN2A 1XLWA 2I2BA 4CBVA 2ZYIA 4ALMA 2K4MA 2C7GA 5F2KA 5ALJA 2X19A 4Q4AB 3AJ9A 1WAMA 4CTNA 4YCCA 3I61A 5K0CA 4GC9A 3GYBA 4RVUA 3D7KA 3M83A 2H29A 4MOWA 4IGAA 1OFTA 1D0IA 1RPZA 2CVOA 2YW9A 1UOOA 1J5XA 4HGRA 4JB3A 1N5KA 1SPBS 4MRAA 4RL4A 4U1RA 1R6TA 5AHOA 1DAFA 1ZH0A 4R54A 4BY9E 2OHXA 4YT8A 1T2EA 1Y5IA 5JZMA 3FOFC 5AVWA 3MJTA 2VK2A 4PTLA 5AK5A 1KZGB 5DHAA 1QRAA 2XB6A 3AHDA 2R8OA 3E5RA 5LQCA 1PSZA 3A1WA 3CZPA 4ZCSA 3TTSA 4HYTA 3LC1O 4MYRA 4WT7A 1KMQA 3WADA 2XUAA 4G0QA 1AV7A 1P7ZA 1V3QE 1W34A 2IEBA 3V1TC 5T4FA 1KP3A 3KQMA 2VSOA 3HZHA 4AM8A 3C8UA 1XRLA 1Z7WA 1S0UA 4IEFB 5EG5A 5JAPA 3BMXA 2IUYA 1VTKA 4CQJA 2OPBA 2INGX 5ALWA 3EYWA 2ZDHA 3EG9B 2QTTA 5IJAA 4FPXA 2WLSA 1H3EA 4JJKA 4GW3A 1G8YA 4TXJA 4C78A 2GAAA 3OICA 1AIPA 1A97A 1M72A 1ZOIA 3AFHA 3DMTC 2UUAB 3WWYA 4HDAA 4RF3A 1RXWA 4D0RA 3EXHC 3NP9A 4U9IS 4NJEB 3CN9A 4GZMA 4I8IA 4Z99A 4HNTA 1U81A 2ZTVA 4J1QA 2RGAA 3M70A 1RI5A 1W1UA 4C4ZA 4FT4A 4M1QA 1JEOA 4H9GA 3V6MA 3TQTA 1GUAA 4E14A 2JIMA 2BE7A 1DIGA 3KSUA 3W5VA 4V0ME 1UQTA 2XWJI 5ALNA 5IULC 2ORWA 4N3AA 5DTRA 5AO9A 1YZQA 3NAGA 1IPFA 5E95A 4UQLA 2J1LA 1EWTA 1EX1A 2G0AA 1YC2A 2WFLA 3C4VA 3DZKA 2XH8A 4LSWA 1D9ZA 1OIXA 1TFRA 3HEBA 4YWJA 4F5YA 5I8WA 3I01M 5JNUA 5DVZA 2C3MA 2AVNA 2EZTA 1BVUA 1ZMXA 3JASA 1I3CA 1WDTA 1JDSA 4D96A 1BAPA 1POXA 4YK7A 2Q7OE 1XVUA 1OBOA 4C2AA 1VGQA 4QGHA 1Q1ZA 4TL7A 1FCJA 4TVOA 5LZ5A 2JBAB 2BUCA 3JQ6A 2YIVX 3B1YA 5KTPA 1P4HA 2WT9A 4G5YA 5SYAA 4EATA 5BURA 5C8VA 3TD9A 1SC1A 2AQHA 1R0BA 3KEMA 5YASA 2Y05A 4W1PA 3UXHA 4MQLA 1VBKA 3LXMA 3T7RA 4ZYZA 2GHQA 3U7EB 1RYBA 2FH5B 1P77A 1PL7A 2GJ4A 4RW0A 3IKJA 4NNPA 1MRSA 4N39A 1D2HA 3LBFA 2ZTSA 4FFPA 4A1FA 2G5PA 5A03A 4RA6A 5L6MB 2V1UA 4BNDA 4MWEA 3HO8A 1W44A 4TYMA 2CJWB 1NQAO 2XXAB 4HYYA 3DEAA 4WLEA 2BP7B 2PVSA 4CG0A 3TPCA 3VO9A 2EL9A 1THZA 1UXGA 4ESEA 2WQ6A 3ZTWA 1Y48E 4J0QA 4G89A 4CEHA 1AT1A 2QPTA 3DBHB 3MILA 3PQEA 5HQJA 2PLAA 1Y4ZA 3E4CA 1EINA 1KJJA 2F1HA 4RGYA 4DLNA 3KT3A 4ID9A 3LOUA 2PUAA 4WESA 3VU9B 1BE1A 3KHUA 4X3PA 5BNWA 2XZLA 4WNIA 2BF4A 3HCWA 3U37A 2Q9AA 1I4WA 1GPJA 4OVKA 1VSVA 3I6BA 5GONB 4BMSA 5DI3A 2M98A 4TN1A 4OJYA 2A8YA 3I28A 3L9WA 1G9XA 7YASA 1Y9ZA 2E1PA 1HG0A 3X1ZA 1DAKA 4R2HA 4MVJD 4I4LA 2PJZA 4LZWA 1WU8A 1SCBA 3TQSA 1NW6A 2C82A 4J0EA 5EWLB 4B44A 3WWOA 2A5LA 3I73A 4MP3A 5JRZA 2PU5A 1GZ4A 4CM3A 3QY0A 1ZIXA 1X14A 3H0CA 3F6SA 3U4AA 3CX8A 2I71A 1HXHA 3NIFB 4N5HX 4INPA 3WK5A 5CVCA 3R20A 2UZ0A 3C6XA 3GU3A 2ZB2A 3ABOB 4QT0A 3CVXA 4ARCA 3UY4A 1KJWA 3C8DA 3OOSA 1Y4UA 1MDFA 4ZPXA 2D2IA 3ILVA 3QX8A 1UXJA 2QW0X 4FNMA 4RKEA 4BKOA 2JS7A 2VL7A 2HWKA 3H17A 4BE7B 3K6SB 1LNZA 3BFJA 4BNTA 4WGGA 4CYMA 1B23P 3BHJA 4DCSA 5I9LA 3PPYA 3RIMA 3EPRA 3GT0A 4DLAA 4GKVA 2I6TA 1H2RS 1QH1A 1M2GA 4QOSA 5T67A 4K8OA 2BGRA 2RJNA 2I91A 2QQ5A 1U3FA 3HSYA 3L92A 2N46A 3DH0A 3FOWA 1I4LD 4OSPA 2FK7A 1ZRHA 2O5VA 3PHCA 4FFDA 4D4GA 2FDCA 2FZEA 1WVIA 1N0WA 5AICA 2X5OA 3A36A 2GCEA 1CETA 3DPIA 3U39A 2XQVA 4PZ0A 4LZZA 2JIDA 3ELBA 5EQJB 5B1IA 2FVXA 1FS4A 3CKKA 3IMFA 4K6HA 3UJDA 2X3UA 2VZ9A 1C30B 3KUCA 3MN1A 1FIUA 4FOLA 5DE3A 1GPDG 1P2FA 4C0JA 5MFPA 4IIVA 4L22A 2B8NA 1DIOB 1NF9A 1C8VB 2I54A 4EP1A 1MIOB 1WUKS 3ABRB 4NHEA 4P81A 5JFTA 3V1MA 2B3DA 2I2FA 3SD7A 3TW8A 1S2LA 2W2XA 3BJZA 3LPNA 4CMEA 4BMNA 3IFSA 3E6AA 3RODA 2ZW9A 2XCSB 3OZIA 3PQ8A 4K28A 5SV2A 1J8YF 1TKBA 4ZO4A 4BNGA 2YX1A 1L1RA 4U63A 2X6RA 1FDVA 3EGDA 4GPBA 3OOYA 3PHIA 4ML3A 4A1OA 1G55A 3GC6A 5JQGB 4F4HA 3CU5A 4BBZA 5K2OA 4BIIA 4NBWA 2QMQA 3ECAA 3KJGA 6REQB 1PFVA 1QMGA 3GUYA 5GPBA 3RHTA 2NP7A 1W1IA 4UMVA 1UJ6A 1TYZA 4FBMA 2AMFA 3FFBA 1AM4D 3FTDA 4J2HA 4RZXA 4N8EA 2ID4A 1OV6A 1R0KA 4HAUA 3UWSA 4YRIA 3QFFA 3KXIA 1USKA 4MGIR 5K6RA 2PL1A 1HT2E 1IG0A 3SYRA 3VDQA 2FWPA 3KYCB 1GXSA 4WKCA 5BW6B 3U9LA 4A8TA 1WB6A 2A9FA 1C1HA 1KI2A 2AC2A 3WL7A 1QLJA 3L8ZA 2EWVA 2HQ1A 2Q8NA 1T5LA 2I4OA 2ZYVX 2WMOB 3AUTA 2XITA 3OD1A 2QBYB 3HDTA 4QPCA 4B75A 5BV2P 3O8QB 1SURA 3T9FA 2BTQA 2VKQA 3QE2A 2ETXA 1T9DA 4L50A 4KQGA 5HOEA 1XNRB 4FUTA 3KPUA 4U39A 3TD6A 2MINA 2ECQA 1SY7A 2KHZA 3RVNA 2BM0A 5CDTA 2OVBA 3BAZA 1GPNA 4U7FA 2RHTA 3LKDA 5E6UA 4UDXX 1KI7A 1UIMA 2BTEA 1DKUA 2FE1A 1CE8A 1RM5A 3PT9A 3CY6A 3EY9A 1CHNA 4FFSA 3M3PA 4IMPA 2GZ2A 5KOHA 1US8B 4B6FA 4D8TA 2GJ8A 1BEUB 1G1AA 3FF1A 1R4NB 1Z8HA 2XI4A 1SKUA 3I12A 3KOOA 4LSMA 3TSZA 1M66A 4CF6A 2W43A 3RK4A 3ZY4A 4C29A 6AT1A 1Y89A 1QBKC 1T8PA 3D64A 4W5TA 2R6HA 1N6RA 3M4JA 5DSTA 4XWGA 2Y68A 1MB9A 4D74A 3QIVA 2AOUB 3OLZA 4DLBA 5FAKA 4ZK6A 1UXIA 1YNOA 3WTCA 1XZFA 2CHUA 3NRCA 4TKVB 1XKTA 3F5FA 4LMPA 3COWA 2FMTA 4FMDB 1BFUA 4MDHA 2V4MA 2OAP1 2CDAA 4DUYB 3C5HA 3I3OA 3IURA 1TA0A 3TVTA 2WSLA 3AT1A 2GJSA 4OP2A 3QWAA 5C0OE 5C5DA 4YAOA 3HKCB 1R6AA 2QIOA 1NFQA 4M6WA 4ZEOA 4ES6A 5AM1A 3AB7A 4QUAA 4RFLA 1Z5UA 1EK2A 3ZZNA 1BU8A 2DWCA 1E2JA 3U26A 2REOA 5ITVA 1M2EA 1UFVA 1P81A 3DT8A 1KKMA 3IVAA 1T13A 1XZLA 5J5CA 2GF9A 2O3JA 3PNMA 4MV5A 1Q7BA 2PFGA 3N8NA 2NXNA 1JDBB 3W8RA 2XAAA 4MS4B 3IIKA 2ZI5A 3K72B 3PQ3A 5CT8A 1KP9A 4UVIA 2GBPA 1ZN2A 3R0XA 3ZHZA 1OHHA 2JJQA 4Y0NA 4LF7B 4QBTA 5BNIA 1QZZA 1ML4A 1PGOA 3CJQA 3FYHA 3JQAD 3L5KA 4UU0A 4DNQA 1E0AA 1N3YA 3OZVA 3V8MA 4KYUA 3TS1A 2IDZA 3ND5A 3HXQA 4MINA 4XVQA 2O8BB 5DULA 4QGGA 2IX3A 2DEUA 1M1NB 4XTRA 1AKVA 3ZHCA 1WMEA 1NAIA 1FMCA 2R96A 1NX6A 1T34A 4H0NA 2HL6A 2WB4A 3TW6A 2YQ5A 4NMWA 1ZNQO 2XAUA 3OHMA 3HXLA 4OQYA 2RGXA 1DC5A 3P4UA 2FOXA 1TL7C 5FTJA 4DCTA 3WGTA 1KZHA 1IBSA 4O4IF 4XGKA 2R8ZA 5A3VA 4J6EA 2IV7A 3GLIE 4DC0A 2D6FA 2A5JA 3PUXA 1S2NA 2IELA 1R6UA 1E3WB 1T29A 4W4TA 4XVCA 4CIBA 4QLBA 5TMDA 2VNKA 5CEFA 3LIPA 1YCHA 1IUNA 3DLCA 3GLUA 3WSVA 3ZHTA 1L5LA 4G9EA 3AIIA 2GX6A 2Y77A 1E4VA 2AN9A 4MS3B 3IT1A 5CU7A 3D7RA 2FPRA 1Q3KA 3HN2A 5BSVA 2B4AA 3QFTA 3CURA 4RMIA 1GAJA 2WKPA 4EFNA 1QFMA 2WF7A 3GGDA 4W7HA 4PPNA 4BPBA 3CNQS 2C0QA 3IALA 2PT7A 5B1YA 2EKBA 4ZALA 3BCUA 3F3YA 3C3AA 1Z88A 3EGOA 2BGTA 1G60A 3TOZA 1N2CB 3NU1A 5I7VA 4QM6A 4B83A 3BA6A 3UC9A 1SCAA 1TDJA 3CUKA 2R4QA 4DJAA 5ALFA 5JDCA 3A70A 3AI3A 1C50A 3HNPA 1UK9A 5AW9A 5JD3A 1RJWA 5IN4A 4CCWA 1ODKA 5DW3A 1BMQA 4YP7A 2ERYA 2E9SA 1GGKA 1LF5A 2GJAA 3LZDA 1UF9A 3AR7A 4F2HA 2FF5A 1UFQA 3UMSA 3LDUA 2P5TB 4Q9IA 3J80A 1SEPA 4M8KA 2ZRIA 5FR1A 4P4SB 4UBOA 1IM2A 2NV2B 3H6KA 5EKXA 1C1YA 3JD1A 3K5WA 5DXFA 2Z2JA 1MC1A 1UR5A 3ZQ6A 1IPHA 1LDYA 3L7LA 4QRHA 1RYYA 1KXJA 2ISQA 3LBNA 5AVUA 4ACAA 1PNOA 3KVOA 3NAQA 3ZWKA 1H05A 4JLWA 2DY0A 2HF7A 4FILA 3BSYA 4RV5A 3Q3JB 2R6JA 2XKBA 2H85A 1WPRA 3QLTA 4P4LA 5HBGA 4ZYLA 5IKMA 3H5OA 2NTJA 4OKNA 1YQUA 2PM8A 3C7DB 4YECA 1X7XA 3L7NA 3EG9A 3EIEA 1M33A 5KKCA 1L8OA 4IX9A 1RKBA 1W47A 3MYRA 4IOJA 1X7ZB 1NE2A 1QYIA 1EFKA 1PI3A 3MRVA 4ZDKA 2DFLA 1EWQA 3Q10A 2E2WA 2QZ9A 3T9BA 5L7YA 3V6LA 4DQKA 1RI3A 1NQOA 3M33A 3UJCA 1QYXA 1SCDA 3A25A 4RADA 4RCYA 3OTIA 4A27A 1Q92A 3FYUC 1JHMA 1MXFA 1XJWA 3R9WA 1CT9A 2FNAA 2V6GA 4HO1X 1WZIA 1BE6A 1U1GA 3GAZA 1RBZA 4IFBA 4TV8A 5D3ZA 5FUXA 4EKGA 4TTTS 4AQYB 3IP8A 4A26A 2X0FA 4D8VA 3FUUA 3SXPA 4KJXA 4M3NA 2Q5CA 2MSNA 3G2QA 2C8LA 3NATA 4K9SA 2GHRA 1DU4A 3BXXA 4IWYA 3ZUGA 3I6MA 1ACMA 2H1HA 3WOHA 3KR9A 1RLMA 1U99A 1R15A 3E58A 4UXHA 1TM7E 1YB6A 2WPDA 2ILTA 3U4HA 4B3MB 4YQYA 3DCJA 1D2AA 2HMAA 1F5SA 2VDOB 2B0JA 3B70A 3BC1A 5FTMA 4F4DA 1XZEA 2CL7X 4ZOAA 4ZV9A 3SMQA 1FUIA 2AWNA 4BGVA 5GADl 1J5EB 2CKMA 1WS6A 1ND5A 3NM5A 1I4EB 2JBAA 2YMQA 3KZMA 1RMTA 4GUAA 3W3AD 1CF2O 2G4CA 2II6A 2XBUA 3BB1A 3RAPR 5JFGA 1NW8A 4F45A 5KMGA 3FOZA 1A9OA 2UUPA 4I2VA 3A2KA 2ONCA 3GNLA 1ZRSA 4N5IX 1H4QA 1ZM4A 5JYDA 4X20A 2BCEA 3AHGA 1DDOA 2EFJA 2FLVA 2NO9A 3ZZTA 1W2GA 4P5DA 3ZWXA 1M0EA 2IYRA 4LX8A 3WNVA 3EDYA 2R2GA 3KFLA 4W8HA 2XHEA 1MV5A 4Y6QA 4FHGA 4KLCA 1E1RD 1KDPA 4I50B 3GG9A 3DONA 2CJWA 2Q3MA 5J4LA 4NOJA 1IY2A 2OO5A 3RUIA 5IT0A 3N0TA 5BSUA 1DRVA 5KINB 2NNWB 2OFPA 1Z74A 2HRZA 2IP2A 4PSUA 2V98A 5KDLA 4CUZA 2I6UA 1SFRA 4D43A 1PL0A 1WSAA 5LZ7A 4CL2A 2WOOA 2NT4A 4KO4S 3TXAA 3V1YA 4C04A 3D1VA 2W6OA 1PL8A 3DBHA 5LBTA 4YCNA 1KU0A 1O1YA 2JIOA 2OVFA 3NHYA 4J75A 2RC6A 4JLUA 5K0EA 1IN1A 2ATEA 2GN9A 3BGOS 1VCNA 3LHIA 2I2WA 3UAXA 3UFBA 4C6RA 2DFKB 2PGDA 1H5QA 3PYMA 4PAQA 4Y2TA 1WCXA 4RVSA 5KTOA 2VNHA 6NULA 2BKXA 3E7FA 1V48A 3OZBA 1P7WA 3BMNA 2WKRA 3ONVA 5GONA 2ZPAA 2FZGA 3L0CA 1JHXA 1WY5A 2VLIA 4PHGA 1GU7A 1AXRA 1NOIA 1PDOA 4B3IA 1HNZB 1P2TA 1LBSA 3DF9A 4YCDA 1RAHA 1CS0B 3FPLA 3E3LA 4BU1A 4EYQA 1B8OA 3UPTA 3HM9A 5G0TA 3HWSA 3QMVA 2QXUA 4NBRA 5J5VA 5A4IS 1E2EA 4K0RA 3W2GA 3M6MD 1JG2A 3A14A 3OX4A 3FMOB 4TTQA 1ZSVA 4Z5XA 5EWLA 2RIRA 3C0KA 1JSLA 1SKBA 4Q3NA 4F5WA 4I9NA 3Q40A 2HO5A 3RVJA 2FEWB 4IHAA 2DWOA 3DDCA 1YGPA 3DKIA 4A16A 3L5OA 3Q5DA 3RPEA 1G8FA 3CZMA 4RQUA 4EPYA 5MHTA 4YMVA 2P91A 7MHTA 1TF7A 1G21B 4H35A 3BTVA 6YASA 1EWRA 1O58A 2QG6A 4BNWA 4TN5A 4ESVA 2C2GA 3H42B 2I22A 5CM9C 1T4BA 1UPBA 1B6SA 4G8JA 4KQCA 2J5QA 2OCGA 4C5AA 2JLAA 2L0XA 4OM7A 3OJFA 1NN1A 4CG3A 2Z2YA 3AVYA 4DB4A 2ESRA 2H7VA 2CXNA 1OLOA 2AEEA 3MFQA 3AHIA 2OZLB 1F4PA 1Q1AA 1ZH4A 2IUSA 4UNSA 2G0NA 5EJIA 3UT5B 1B93A 1JH9A 4DANA 3NAZA 4Y6SA 4LJ4A 4YRDA 4LAFA 2OP1A 2QT9A 3TAHA 4PGMA 3BCHA 1G21E 2DQYA 2W6PA 1C30A 3MIIA 4YMWA 4Y2HA 2HO4A 2P1DA 4PYJA 4XDZA 2YQZA 4C43A 3BJRA 4Q19A 2NV0A 1Y3BE 2OGTA 3PGKA 3DYVA 3KQWA 3QNWA 4PSCA 1KYTA 2OBXA 2QJWA 1WDLA 1XZBA 2KSQA 1CU1A 1Y5NA 2R7KA 1KZ7B 1R4ZA 5CVEA 3TTXA 2AXEA 5BWMA 2PLWA 1XCLA 1C1XB 1MNQA 2CGEA 2GPSA 2RAFA 3HP4A 3AKYA 3Q7QA 3CB4A 4XWKA 5BVHA 1EXDA 3JZDA 1UC8A 4PICA 4XWTA 1G20A 1DKMA 5JCPA 2E4VA 2BFBA 3LLVA 5F76A 1ORDA 4TKLA 1U0BB 3QYFA 1T8RA 2C95A 3B53X 3E9QA 4XXHA 5IDWA 4H3HB 5DTIA 2XKJE 3S8YA 1QE5A 5JQGA 4R83A 5F2OA 1UMCB 3SR3A 4AJ9A 3GAAA 3GGOA 1MQ9A 2OK7A 3HMKA 2A5GA 1VL1A 2DCUA 3I9V6 1OVMA 4N3GA 5AR1A 3SM9A 4OI2A 4EFDA 1Q74A 1E1CA 2AYYA 2R60A 3D8RA 3VI4B 3CYFA 1C3VA 1DHRA 1M54A 1Z26A 1X74A 4Q4HB 4C4OA 3WGUA 4CV0A 4KR7A 1QCZA 5FNVF 3B52X 5CJ2A 2Z2IA 1U0EA 2ZVQX 1KMNA 1U7ZA 5LMNB 4Q6WA 2ZKIA 2L82A 3IOMA 4II7A 5EXEA 4FI3C 2GN4A 1WA5A 5FUBA 4E1BA 3STWA 3KYCA 5FTNA 3ZHSA 4QEDA 2RKBA 2OM6A 3DO5A 4TWZA 4HWKA 1XOIA 4DMMA 2TS1A 1PR5A 3NNSA 1LKZA 2O05A 2O2CA 2YZKA 3GXOA 1JPUA 3OCVA 5IAJA 2XLCA 2R97A 3HNOA 4X0EA 2J48A 4JROA 4TV9B 1I2CA 5AT1A 2XE4A 2QBYA 2HU5A 1ULAA 3EVDA 2OECA 3NG1A 3O8QA 2IYYA 2AUMA 1V26A 1AKYA 2RI6A 4J0KA 1MMFB 4AJHA 3GJSA 3H1TA 2OLEA 4A6PA 4F8YA 5GV7A 4FX2A 1TD9A 3QI7A 2VR1A 3NTUA 4JEMA 3AXSA 5ENVA 3LQKA 4RPHA 2OB1A 1FDRA 5B3LA 1IZ0A 3BE4A 3EXFA 4JHLA 1U8CB 1HWYA 2HWWA 5F77A 1US8A 4DSOA 1Y5RA 2JH9A 1DO0A 3HO1A 1BIFA 4Q02A 2DWUA 1H0RA 4PO1A 3UJHA 3W5JA 5KWJA 1EB9A 1GRVA 5DYYA 4B09A 1TZJA 5ERGB 1JR4A 5T6MA 1C9EA 1GZ6A 1PX2A 4RDCA 5KTRA 1MA3A 1ZU5A 2AOUA 2MSWA 4MMZB 2BYTA