5K0EA

Crystal structure of comt in complex with 2,4-dimethyl-5-[3-(2-phenylpropan-2-yl)-1h-pyrazol-5-yl]-1,3-thiazole
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
215
structure length
215
Chain Sequence
b'GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
molecule tags Transferase
source organism Rattus norvegicus
publication title Crystal Structure of COMT
rcsb
total genus 77
structure length 215
sequence length 215
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0eA00
4DKJA 2VZ9A 5ICEA 4LWPA 3VC1A 1UIRA 4BLVA 1P91A 4M37A 1BHJA 1M6YA 1WS6A 3HCEA 3MTIA 1XXLA 2EJTA 5CM2Z 2VP3A 5E1DA 3Q7EA 4HTFB 3DTNA 3BWBA 3PLAE 5C1IA 3OZRA 5KQRA 2OO3A 3C3YA 4PYNA 1N7IA 5FWAA 5ICCA 1YFLA 1INLA 1IXKA 3SVZA 3TFWA 1NKVA 3EVAA 2PVCA 3BZBA 3FUTA 3T7RA 1XCLA 2IFTA 4QPPA 2BR5A 5CCBA 4FT2A 3CKKA 4YUZA 3UBTA 1JG1A 2B78A 3EEYA 2PY6A 4C06A 3P2KA 4KDRA 4AZTA 4HTFA 4QQKA 5DM0A 4RVFA 3LX6A 3NDIA 2UYQA 1NV8A 2FHPA 3BGDA 3MGGA 5JUWA 5LQKA 4GEKA 4E30A 3FTEA 2G72A 2AOXA 3DH0A 3NJRA 3OE4A 4MTLA 3GNLA 1XDSA 5GM1A 3P9CA 5DM2A 4C4AA 4GQBA 2ZIEA 3HVJA 2ZW9A 4RYLA 3FYCA 4EK9A 2IBSA 1NW7A 3P2EA 1KPGA 2NP6A 1R6AA 10MHA 3GRRA 3BT7A 2P3QA 4X1OA 2AOUB 3DMHA 4RTQA 2AOTA 2N47A 4ER3A 1JQDA 4YMHA 5FCDA 4AZWA 3WSTA 2QY6A 4BLWA 3P8ZA 3UA4A 3T7SA 3CBGA 4E2XA 1ZG3A 2ZVJA 4IWNA 5EZQA 4RSRA 3PX2A 1FJXA 5GM2A 4ER0A 2XBMA 4GBED 2IDJA 2FPOA 5EC8A 1X1BA 4IKPA 3F4KA 3E7PA 1G6Q1 3KQTA 1RI3A 3OU7A 4GUAA 4K6MA 2EJUA 5E9QA 4FZVA 1NV9A 3FTCA 4DZRA 2AOUA 5BW5A 3P71T 5LQRA 3TKYA 2AOTB 4OBWA 4B17A 2JHCA 5K0EA 3B5IA 4RTOA 5CVDA 4CTKA 1VE3A 3KPVA 4HGZA 3HA7A 1XTPA 3NTVA 4PIPA 2QYOA 1X19A 3UJ8A 2GH1A 5CUQA 5LQUA 1DUSA 4HH4A 3UJ6A 5CVUA 4E31A 2CKDA 4KIGA 2B9EA 1N2XA 1YB2A 2OBFA 2P3LA 3FPEA 5DTQA 4MQ4A 2BH2A 2I7CA 4YMGA 3THRA 1XDUA 3KQYA 2R3SA 3K6RA 5T67A 3CVOA 3HP7A 4LG1A 2YTZA 4QPNA 3FYDA 2AN5A 3G2PA 1R74A 2GB4A 5K0NA 3GGDA 1F38A 1TPYA 2G71A 2ZBQA 3FUVA 8MHTA 1X1AA 3EVZA 1RI1A 3ER8A 3O31A 5DM4A 2PLWA 4QDKA 5H02A 4KIFA 4HSGA 3AXTA 3GRZA 3UJ9A 1SQGA 3NW9A 2YXLA 2ZIGA 3HEMA 3AJDA 3DLCA 2PX4A 4GC5A 5EMJA 3REOA 3RW9A 5KS2A 3CC8A 3ME5A 1UFKA 4GOLD 1AF7A 2V74B 1RJDA 2ADMA 3EVFA 1PJZA 3KKZA 3OCJA 3OPNA 4PYIA 5D1NA 4BLUA 1JG3A 2ZTHA 3SGLA 4PYKA 1ZQ9A 2ZSUA 3ELDA 3SX0A 2IH5A 3FPJA 2AZTA 1VL5A 4PCAA 3CJQA 4AUKA 1Q0TA 1H1DA 3ER9A 1B42A 4PNEA 3G5LA 4CTJA 3OE5A 4Z2YA 3BUSA 3EVGA 3FTDA 3JWIA 2G70A 3KPJA 4QQNA 5DM1A 2PXXA 4JXJA 5DRTA 2XYQA 3AY0A 3ORHA 5DXAA 5GWXA 2PSSA 4RTMA 3NVKI 3KU1A 4A6EA 2PX8A 4RVHA 2P8JA 1T43A 3UJAA 4IV8A 3BXOA 4PONA 2ZBRA 3SMQA 3FPGA 1KYWA 2ZIFA 3LCUA 3PFHA 5D1HA 4C03A 2OKCA 2JG3A 3NWBA 4OA5A 3HCCA 4YV2A 2NXJA 3OFJA 5FULA 4DA4A 2C7QA 2BR3A 5K0GA 3GU3A 5E1BA 2PBFA 5LQCA 2EFJA 2VDVE 3RODA 3LDGA 2NP7A 2AR0A 4CKCA 4BP1A 1WXXA 1NBIA 1AV6A 1ZGAA 2VDUE 3LSTA 2CL5A 1KYZA 3JWJA 1AQIA 2XVAA 3DMGA 2P35A 5HILA 4XUCA 4PGHA 1JTEA 5LQJA 1EAMA 5HIIA 4RX1A 2NNWB 4KWCA 5DWQA 4X60A 3A27A 4P7KA 2AOVA 1L9KA 5BW4A 1KHHA 5GIOE 3I5UA 3JWGA 3G8AA 1R8YA 1XVAA 3SSMA 2A14A 2OB1A 2IH4A 1QAOA 3VYWA 3GJYA 1ZGJA 3LHDA 3PX3A 1Q0SA 5K0CA 2JJQA 2R6ZA 1G8SA 5ICFA 4FSXA 2DPMA 3AWIA 5EMMA 4P58A 1XDZA 3LL7A 3GDHA 4LECA 2ZBPA 5E9WA 5EMLA 3KPUA 4FP9A 1RI4A 3H2BA 2IBTA 4KDCA 4XUDA 2QRVB 2AN3A 1SUSA 3TMAA 2PV0A 5EVJA 3AXSA 2HR1A 3ELWA 2BM9A 3KQVA 4IV0A 1IY9A 2FK7A 3BGVA 3E05A 2PX5A 4WVLA 2O0LA 3KQPA 4L7VA 2ZCJA 4F84A 2DULA 3CGGA 3LDUA 1P1BA 3C6KA 2PXCA 5F2OA 1O54A 5EZSA 3MHTA 3UJDA 3UFBA 4ER7A 1BC5A 1FBNA 3DOUA 3DR5A 5FA5A 3DP7A 3CJRA 5CCXA 4FS8A 2GA9A 5E2AA 4DM3A 4P7FA 3C6MA 4EQZA 4GOOD 2P3OA 2OPBA 1ORHA 3HVIA 1JTFA 2GS9A 1KIAA 1JSZA 3M6WA 2JH9A 2HNKA 2ORED 2LD4A 3CCFA 4CXMA 2Z6AA 4AZSA 2Z6UA 2EG5A 3B3JA 3G5TA 4R6XA 4ISCA 1QZZA 2P41A 4KRGA 4EKIA 2HMYB 1R00A 1BKYA 2YR0A 4XUEA 3HVKA 3P2IA 1WZNA 1TW3A 4QTTB 3MB5A 1G60A 2PWPA 1U2ZA 4RTPA 1FPQA 3HVHA 3I9FA 1EIZA 2Y1XA 5DPMA 5FA8A 4RTKA 2YXDA 4FR0A 4C05A 3KQMA 4UOEA 4GF5A 5CVVA 2IH2A 3GXOA 2PGXA 3UJCA 2OB2A 4F85A 4HC4A 5IKMA 2I62A 3KQOA 5G02A 4BY9E 3P9KA 3NMUF 1O9HA 3PT9A 3KPWA 4R8SA 5EIWA 5M5BA 3KQQA 5E8JA 3EPPA 5CVJA 1MJFA 5EEHA 1Z3CA 3DUWA 4Y30A 3HCFA 3I64A 4QVGA 5JR3A 2O07A 3FZGA 3V8VA 3G88A 2H00A 5LQAA 3B3FA 4RTNA 3EVDA 4DQ0A 3DLIA 1D2HA 1JSXA 2QRVA 2ZULA 3L8DA 1ZKDA 4EVIA 3G2MA 3T7TA 1VLMA 3FRHA 3HA3A 4OQDA 2B2CA 3CJTA 3Q87B 2C7PA 2ZZKA 5E8RA 1SUIA 3KR2A 2IDKA 2CWWA 2G8NA 4FGZA 3K0BA 4Y2HA 1YZHA 2CMHA 5HFJA 2K4MA 5DT2A 4HGYA 2JHPA 3M6UA 3OU6A 4YUYA 4U7PB 3UA3A 3FPHA 5K0LA 2NXNA 4CKEA 3P9NA 2IP2A 2YQZA 1KR5A 3SR4A 5CIYA 1NW3A 5EG5A 2O06A 2ZWAA 3DXXA 5CVEA 3TKAA 5LSAA 2KW5A 3GRUA 4M36A 1P39A 3TM5A 3MCZA 3PTAA 1SG9A 2AVDA 2JHAA 3GO4A 5K0BA 1JG2A 1NW8A 3VC2A 5C9ZA 2C7OA 5ICGA 4RWZA 3OZTA 4OX9Y 3HTXA 2ONYA 3TRKA 3NVMB 2PJDA 3M33A 3OZSA 4CWAA 4QDJA 4F86A 2AS0A 3BKWA 3E8SA 2AN4A 1R18A 2AVNA 3EGIA 1Y8CA 3KPYA 1YFJA 2IIPA 5K09A 2YUIA 1JQEA 4M38A 2YVLA 3ELUA 2HWKA 1RJEA 3EEOA 3TQSA 3S68A 4OQEA 1RJFA 3QV2A 5KVAA 2O05A 2UYOA 5E9JA 1M0EA 1VIDA 1KXZA 1JG4A 2WA1A 2ZWVA 4ZTBA 1MHTA 2P40A 1PRYA 1I9GA 3KQSA 3UJ7A 3E23A 3IYLW 2OY0A 1QANA 3LCVB 3P9IA 4PYJA 2E5WA 4YUXA 3GRYA 3HNRA 1L3IA 2XYVA 1UWVA 3FUXA 3G7UA 3O4FA 4RV9A 4E32A 5K0FA 3OU2A 3UWPA 4PYQA 1QAMA 4O29A 3KQWA 5KYGA 3MERA 5DLYA 1VBFA 4QVKA 3EMBA 4R05A 5F2NA 2O57A 2YX1A 2FCAA 3DXYA 3GCZA 3LPMA 5T64A 2ZLBA 5EPEA 3EGVA 1SQFA 3D2LA 1WXWA 3BWMA 3I53A 3MAGA 2OZVA 1RJGA 1EJ6A 2Y1WA 3KR0A 3LKDA 4LWOA 2CMGA 4EKGA 4R6WA 5EEGA 3JWHA 2JH8A 2H1RA 1WG8A 4FSDA 4FT4A 4NECA 5E1MA 4AX8A 2FYTA 3EMDA 4YV0A 4PWYA 1I4WA 4PYMA 3DMFA 2NYUA 2V7EA 4P7GA 1AQJA 5FHRA 1WY7A 5T6BA 4PINA 2VS1A 3ELYA 5FTWA 5E2BA 1RI5A 1X1CA 4DMGA 1TW2A 5E1OA 1L1EA 3LBYA 2PWYA 5GINE 1NT2A 2QM3A 1VP3A 4E33A 3LGAA 5HIJA 5FQOA 2ZZMA 5EKXA 5K03A 1YUBA 2PT6A 3LCCA 3EVCA 2YXEA 2C7RA 4PIMA 2FRXA 3GIWA 1M6EX 2ZFUA 4MWZA 4RTLA 3HCAA 2PXAA 4PYLA 5DSTA 2XYRA 1RI2A 4RTJA 3R24A 4G56A 4DCMA 5MHTA 4C08A 2B3TA 3A7DA 3NWEA 4OA8A 3R9XB 3DXZA 5EMKA 9MHTA 4H0NA 4U7TB 2Q41A 3X0DA 4RTSA 1D2CA 3FRIA 4X41A 5EQJB 4YV1A 4XCXA 1QAQA 5P8WA 5GP1A 1ORIA 3G8BA 4DCGA 3P97A 4ER6A 5B1SA 4YUWA 3G2OA 3ID6C 3PFGA 1BOOA 4HRAA 1XCJA 1XJ5A 3UZUA 3T0IA 3LECA 3SSOA 5FQNA 5HIMA 1O9GA 4OBXA 3PB3A 1OR8A 2B25A 1L3CA 3ANXA 3BKXA 3R3HA 4WXHA 5CD1A 2UYHA 3RIEA 1NW6A 5FHQA 4A6DA 2ONZA 2GPYA 2P1DA 3VSEA 4RTRA 5F2KA 1IM8A 3FPFA 3HCBA 2H11A 1EG2A 5HEKA 1HNNA 4PCLA 1SKMA 4E2YA 5LR6A 5FWDA 5DTMA 4BP3A 1G8AA 3M6XA 1KPIA 3DULA 2P7IA 3KHKA 3MCTA 1HMYA 3OFKA 4GOMD 4KVZA 1L3BA 2WK1A 4V0QA 1G38A 2Z6QA 1FP2A 5EIFA 2WA2A 3R0QA 5DXJA 1R8XA 3SSNA 5BXYA 2PKWA 1NBHA 1VPTA 3B7PA 4POOA 4RVGA 3KR1A 3UJBA 1NW5A 3BWYA 5DX0A 3HCDA 3B3GA 3G89A 3LKZA 3FUWA 3NDJA 4KW7A 5GIPE 1I1NA 1VQ1A 1YZ3A 3QOWA 5C0OE 5K01A 5HIKA 2BM8A 3I58A 4E70A 3R6TA 2P7HA 3GWZA 5U4XA 4AZVA 1YF3A 4C07A 5EHGA 2I9KA 1DCTA 1EJ0A 3THSA 1VP9A 3BWCA 4MIKA 1V39A 3A26A 4M7RA 4X63A 5DSXA 3G2QA 5FUBA 2VDWA 1ZHFA 7MHTA 3EVBA 5BP7A 2BR4A 3A7EA 3B89A 3EVEA 1KPHA 3M4XA 2NXCA 4PYOA 1QYRA 3C0KA 1NE2A 5DX8A 5FADA 5DTRA 2UYCA 5HOQA 3ERCA 1G55A 2PT9A 5DRYA 3SM3A 5KQSA 4GOND 4GC9A 5EOVA 3KR9A 3MQ2A 4MHTA 2UZ4A 5K0JA 2XVMA 3GRVA 4DF3A 3FTFA 3FUUA 2ESRA 2OXTA 4PGGA 4C04A 2IPXA 5LQNA 3U81A 2ZZNA 4X61A 2NXEA 5K05A 4R8RA 5EHIA 2ERCA 2GAFA 1KP9A 3A4TA 3LDFA 3HM2A 1FP1D 1X1DA 3BGIA 3EGEA 3IHTA 3TM4A 5K8VA 2BZGA 4YUVA 3SXJA 1DL5A 5EGSA 2I6GA 1F3LA 2AOWA 2FK8A 2EX4A 5DX1A 4EMSA 3MTEA 3TOSA 3O7WA 1P1CA 2QE6A 4QTUB 3LBFA 5ERGB 2HTEA 3A25A 3IV6A 4V0RA 2OYRA 3TPZA 3TLJA 3TR6A 4E2ZA 4ER5A 5IH3A 2IGTA 2GLUA 4CKBA 4E2WA 3V97A 3HA5A 3M6VA 1D2GA 5EKUA 2HV9A 3IEIA 2PX2A 3M70A 5HZMA 3C3PA 2G1PA 2F8LA 5GOZA 4P7JA 4RVDA 1JQ3A 4HG2A 1N7JA 4ATNA 3PVCA 1SVUA 1JR4A 1EQAA 3PS9A 3QOXA
chains in the Genus database with same CATH superfamily
3OPYA 5C81A 1U3TA 2ATVA 1I9CA 1T9AA 4TTAA 3GLIB 3K94A 1BHJA 3MCVA 2ZT5A 3WB9A 3B9RA 1P7CA 1LK0A 1M8KA 2VP3A 4OQ4A 4MI9A 4XIGS 4F38A 2BTOA 3LX5A 1YOVA 3WDKA 1KBZA 2WIAA 3AHCA 3C7CB 1IHPA 3WQSB 2XMSA 3SYLA 4TVKA 1K1EA 4DA8A 4PYNA 2OG2A 1V8FA 1M72A 2DQYA 2R1VA 3I6IA 4YQEA 2NVUB 2EKLA 5FPTA 4IKEA 4GZ6A 3ESZA 3NORA 3V8NA 1XVLA 1Y9ZA 4EHKA 4D80A 1P2SA 1XMSA 4J1SA 4KNWA 4KAJA 3GEMA 5EHZA 1G21A 2ZCVA 4JEMA 4JQZA 4R41A 3LQ1A 1MB0A 1O94D 3ZTWA 2TMGA 4GVLA 4RELA 4CMGA 1K7YA 1JIUA 1FDUA 2P4HX 3AF1A 2G72A 4LCEA 2JIPA 3DZGA 3ZU2A 3GNLA 4TSFA 5SY9A 3IERA 4CM8B 3KCQA 4QZVA 3Q40A 2YWCA 5BNZA 3PEVA 1UBMS 4FX2A 2PUJA 2DU8A 2QQGA 3D1VA 3KYCA 3SEZA 4ZZIA 1Q83A 4MRRA 3VR2A 3IVMA 1KI6A 4BKQA 5CA0A 4I4TA 2V6IA 4UQLA 3A1NA 5C1PA 1BU8A 2OCXA 1VMIA 4BB5A 1E2GA 2B7CA 2CXRA 2WP0A 1XWFA 3I2FA 1QQ7A 1COWD 4WCFA 1NF8A 3UHFA 4BCCA 2PE5A 4OHYA 4D9KA 5AIBA 1CRZA 3L0PA 4H1UA 4HDRA 4TL7A 4ADSG 1J0XO 2YDXA 3E3OA 5DV9A 1K5GA 1W1UA 3W4JA 3D4BA 2SICE 4XGKA 2O8DB 2QHXA 1GY8A 1JTVA 1N1GA 1P1RA 4H15A 4P80A 2JHCA 4XWWA 2WKQA 2XB2A 1SVKA 1VE3A 2I4LA 3I4FA 5I48A 1Z29A 2GK6A 4QT4A 4ENVA 4I8XA 2AR9A 5CH5A 1XTUA 3IJRA 4G5QA 1Z3IX 1AQUA 4QQFA 5TEWA 1GKYA 2IU3A 3HH8A 1KVTA 1K66A 3RJ9A 2WFLB 1H2AS 1SZCA 2I55A 2TSYB 4JODA 3ETGA 4R0VA 1XEAA 4MEAA 5HE8A 1ZM4A 2FUEA 3QW2A 5IAAA 4MWDA 1R74A 5D2CA 1GPWB 1NBWB 2ZRJA 16PKA 1ESCA 3IQDB 3Q3GE 2PS0A 5K0NA 1OXBB 2R5FA 2GVZC 2OMKA 2VAWA 3UQZA 2R44A 1CUBA 4IJWA 3UEOA 3LUFA 3Q15C 3OUZA 4HWPA 3TPCA 1LTKA 3WLNA 1CNMA 1JDBB 1BHQ1 3W7AA 4KXUA 2Q4RA 2AFIE 3B60A 3TEFA 3VPFA 4X00A 4BO3A 1XTKA 4K05A 1YS9A 3O5AA 3WDLA 1UFKA 3G13A 3WGMA 2V74B 5CB4F 2X4IA 5GTDA 3LVRE 1QPBA 4DWWA 4P53A 1X7HA 2ZTHA 4HGQA 4ON9A 4PYKA 4CL8A 1ZQ9A 3LWDA 3SX0A 1E2BA 2AZDA 5HF6A 2ICAA 1I7DA 2OP0A 2PQ6A 3JQGA 4PIVA 4Z0HO 2GN4A 1N32B 1KWKA 5H3LA 2GWRA 1GEGA 1V5FA 4G9EA 1JEAA 3RPEA 3RUHA 1FRVA 2VYNA 1IZ9A 3FTDA 3HB7A 5GWXA 3QEAZ 4LC1A 1ZBQA 1UMCA 4AM8A 1GAXA 4QX6A 1MPXA 3E03A 5GONA 5BWNA 1U6IA 3EXEA 5JO9A 2Z5LA 3RC9A 3ZWWA 5AW3A 1Z6PA 4C29A 2GZHA 2VBFA 2YVQA 3AF4A 1QQTA 4OFZA 5LQDA 5I7FA 1HDEA 2BT4A 3VKVA 2VT7A 3WXMA 1X39A 4FYHA 1XRMA 5KYYA 3TQCA 2XCQA 3ABQB 3FROA 3LSTA 3OMXA 1UH5A 2X9VA 3UHOA 3L6OO 2JK1A 1T3LA 2M9MA 4B71A 1T8RA 3W5DA 3KTAB 3O83A 3RS4A 1O4VA 2AQHA 5I4CA 3M7IA 5LB2A 2JLRA 2MU1A 3LHSA 1TO6A 2WJZB 2XX3A 1GQRA 4F8YA 1QV6A 4GMHA 5ABPA 2F1RA 2H3EA 4XLTA 3VOSA 2G80A 3CZPA 2A5LA 4ZZ3A 2XRFA 1GFWA 5CDFE 1DCFA 3LRXA 3S2UA 2JJQA 4EJ6A 3ZVRA 5LKAA 2JFVA 1MR3F 2JD2A 1PEAA 2XUQA 3H6HA 3DB2A 3L8GA 3Q0TA 4MQEA 4GWKA 3U3MA 5JPCA 2BHSA 1H93A 1Z6YA 3CT4A 4X20A 3UPTA 4G0WA 1KGDA 3KVRA 4N0QA 3TMAA 4O02B 4BKUA 4E15A 3S2EA 3IIIA 4FYYA 1SMKA 4KE7A 3BYZA 5C8DA 1TF7A 2N0SA 4V0MA 2C5EA 4N76A 1AD2A 5DHQA 1S1MA 3H5IA 3K2BA 4FDTA 4HS9A 1Y98A 1XRLA 1CZOA 4F84A 2Z2ZA 1EM8A 1DG3A 1GKIA 3K8OE 3UMVA 3PFBA 1NJSA 1P6XA 2JJ8A 2CDRA 2XUJA 1WMFA 1MKYA 2GASA 1W88A 3DG9A 3H0EA 1UJBA 1R2QA 3MM4A 3MQ4A 3ET4A 5DCYA 1HDOA 4FR2A 1HNXB 3H2GA 4C01A 4C2BA 4NBRA 1HYGA 2XQFA 3E18A 3HDJA 1HG1A 4MVJP 1BS9A 2AI3A 1ZMRA 4Q9NA 3ZBQA 2I6FA 1FRZA 4CKWA 3U62A 2G1UA 4KXNA 1K7SN 1JSZA 4DWJA 1GPUA 3LBNA 3MELA 1WA5A 3P26A 3PD7A 1N5OX 3PNPA 4O2LA 2DHEA 2H16A 1MC5A 2NPOA 3TTXA 2GHIA 4WESA 3OIVA 4EKIA 5JTUA 2VFAA 1WCXA 3W2TA 3D0OA 1JA9A 4ZVSA 4CKBB 4DLNA 2PJUA 4HTAA 4JSYA 1N0VC 3H4TA 2PM8A 3OBBA 4OJNA 1KFJB 3A1VA 3RI3A 3ZEIA 3RADC 2ABWA 3QLEA 4LSZA 5REQB 4P31A 4P0PB 4E03A 3GOHA 4BO1A 1VBKA 1EVJA 3C14C 3L7BA 2WUEA 4JLDA 4WCDA 2WM2A 5H81A 1E5DA 4CQMB 2OB2A 1GGMA 2WUFA 3GUCA 3KSMA 4EIWA 1ZEMA 4FIZA 5KJCA 2PYZA 3A4YA 1G1MA 1XZGA 1Z45A 1UQTA 2BGWA 2HMAA 1H2ZA 1STOA 4IOLA 3EOAI 2WUVA 5JDCA 1KJQA 2WU1A 4J2HA 4UVGA 4ZCLA 4RLSA 2AI2A 5KSYA 4QARA 5EJMA 4UTNA 4BASA 5HJEA 3HXPA 3HFJA 3RSOA 4AJ4A 5FI5A 3PGKA 3NJ4A 4DPKA 1FU4A 2L0XA 1FDWA 3MSCA 4HVAA 3AVUA 3A6LA 1V35A 1DAPA 2Q5LA 3P0FA 2B2CA 4ETMA 3SFTA 5C8ZA 1WPQA 3PENA 1Y3CE 3ISTA 3HJBA 1J4AA 1P61B 3G9UA 3P4UA 4QSMA 4RY9A 3RVRA 3U4HA 4OYYA 1RE0A 2Q49A 3OWOA 5CNMA 2IEAA 3C3MA 3FVQA 5L4NA 3VU0A 3ZHOA 2JHPA 4LDAA 1AK2A 4ZGGA 2FWIA 2VATA 3TJRA 2GETA 2R11A 5C5EA 4IJ6A 2OG1A 1RWVA 5HMLA 3VU9A 5KNDA 2R85A 4FKMA 4IWYA 5CEEA 3IHKA 5K1ZA 4DLSA 1T2VA 3IJPA 2P2DA 2OVFA 3GFQA 2VTVA 1W35A 3NWOA 3RKRA 4QTYA 2GZAA 1QR2A 3MCZA 3ZDZB 4P6VF 4P3XA 4OB8A 2Y0BA 2PFGA 1NXTA 1NONA 4Y2VA 4JUBA 3ZWYA 5K4AA 3ZVNA 5KHAA 3A6KA 3OT4A 3ZNPA 1DAIA 2Q2QA 5IK2D 2GFHA 1YFKA 1XMVA 1UBCA 4EATA 3T9BA 1NUUA 4FC7A 1LEHA 1EG7A 1GNVA 2BLLA 2XQJA 3KEMA 1BXKA 3A3NA 3I3OA 3WBKA 4QATA 1DWOA 1QOZA 4HKTA 4BFSA 2VP4A 3EOBI 2F43B 3MTAA 2ZWPA 3TQSA 3MN1A 4I3HA 1RJFA 1ZESA 2HT6A 3S68A 3QZUA 4DSZA 4NU6A 3IOEA 4YMUA 2DKNA 3B2NA 1ZD5A 3WGJA 3L7IA 3W2IA 3TOVA 3KKKA 3D3WA 1J2JA 4Q3AA 2WA1A 4H1VA 5J5AA 3CW2A 1FSZA 2MWMA 2UVPA 1RRVA 5B3KA 5J4KA 4U3JA 4FWIB 1E2QA 5JYBA 3IYLW 4IIEA 1GZ6A 2FRDA 2VDRB 4ZEXA 4LHWA 2C8LA 2WUWE 2GZRA 3KYBA 4IQGA 4UBIA 1GITA 3GGOA 4LVCA 3N8DA 4WD3A 2GQ0A 4N5NA 4R8MA 3U26A 1PV4A 3U4DA 4WZBE 3OEEA 4B3IA 5AVZA 4XWYA 4II2A 1JVSA 3GCZA 3GAAA 3F2VA 5I51A 1IRXA 1SQFA 2F1OA 4OQLA 4W8HA 3UJPA 3BL5A 4C0KA 1UK8A 3LKDA 2P2YA 1L5WA 3CN9A 4JIMA 3T5DA 5IWAB 4HB0A 3SQMA 2PS9A 4B0OA 1SHZA 1IVYA 4JBXA 5IN5A 4JB8A 1A72A 3GHHA 3L6CA 1H0HA 5ECYA 5J47A 2ZB4A 4PYMA 1EE9A 4Q4LA 4G1UC 1AQJA 2C59A 3QLVA 1WY7A 3DKRA 5TIIA 1I2DA 6Q21A 3B85A 4YGYA 2XIQA 4Q7JB 4R8KA 4YO7A 3EQ9A 2HM7A 3E53A 1MOZA 1W36D 2CXPA 2J09A 1N5RA 1T2FA 4G5OA 4YXWA 3WJAA 4Q6WA 1KI3A 2TYSB 1L9XA 4TXHA 4MULA 3D5EA 3UKOA 3WWCA 3G5AA 1PFQA 1E3DA 2YASA 4G4JA 3NAZA 2Q9BA 3T4EA 2QUBA 4JWKA 2G83A 3DBLB 4I1YA 3MJTA 4IQ8A 5L51A 3B20A 4EYEA 1V5WA 1ZH2A 3BIJA 4LZLA 2GNOA 3HCAA 4MS1A 2Q2OA 3DC2A 3L1JA 3RC8A 1P9OA 2FUG1 3PKJA 1TF2A 3UT5A 4NPAA 3KOXA 1XNGA 2XQIA 3PICA 3VR5A 1MZVA 5EFZA 2GNAA 6ADHA 3TD2A 1QHFA 2Q0HA 4DNQA 9MHTA 1ORIA 4FGKA 4G0OA 3PWTA 3ENWA 1L7MA 1EKXA 1U0HC 3PT5A 3IKVA 1GNPA 1WVMA 4IDBA 4WEQA 3TUJC 2ASEA 2BFFB 1GWNA 3WIDA 5BRAA 1CVRA 1U7UA 1VE5A 2BBSA 2QZSA 4RABA 3O95A 3RD5A 3QVJA 1O97D 1CKEA 4N3CA 2JGIA 3AOGA 1TEHA 3O4IA 2VXYA 1SVSA 2ONZA 1DAGA 1VE1A 2GPYA 5JAHA 1NIJA 1MFZA 1W4RA 2JVIA 2NYRA 2XEDA 4N18A 4TTPA 1E3TA 1FFAA 1SEPA 2R00A 1L7QA 1RHKA 2EGUA 3OAAA 4M9QA 3VR1A 1W0JA 4BCDA 3CVYA 3M6XA 4TZKA 4WZAE 4Q7EA 2QPTA 1Q7CA 5FBZA 1G38A 1CUZA 3I0MA 1DTSA 2ZI9A 4MYCA 4E5KA 1EUYA 1DIHA 1DKLA 2R7KA 4MHOA 4K86A 4YRFA 5JG7A 3DHYA 1MJGM 1BQ3A 2X9LA 3I9V6 2A7XA 3AVYA 3L4BA 3DBHA 1M54A 1VPTA 2ROQA 4IQ0A 3T1HB 2CFTA 3H9CA 1CUSA 2DY1A 1Z83A 1ZJ6A 3BWYA 4OBEA 1NYRA 1J8FA 1SKBA 3B3GA 2C3MA 3LV8A 3RHZA 3QEBZ 4PQEA 5C53B 2LR0A 2YFQA 3F9IA 1NHGA 2BFNA 2P6MA 4M7OA 3BF7A 4XVCA 4Q37A 3GPLA 2YIJA 1BJKA 2XB6A 4REMA 1C4WA 3FXAA 2O1EA 4X8OA 4D3ZA 1ICEA 4TVBA 4FYMA 3QVMA 3L4JA 1XMXA 1G18A 1QDEA 3I6MA 4PV7A 1NVMB 1EWKA 1U02A 5IJXA 2JI9A 1SPBS 1VHLA 5CAEB 1VHDA 1N6NA 3B1XA 2C4NA 2QRMA 2IUEA 3MT7A 1CQIB 1NVTA 4XWAA 3C0KA 4B43A 3DSRA 4CMHA 3ITEA 3IVXA 3JZFA 4FQ7A 1T6YA 1Y3IA 2H57A 4XIYA 5HOQA 3ERCA 4MVJI 1SG0A 4TL6A 4O4HF 1CC1S 3VMMA 1Z22A 1JAHA 2R8RA 1EGQA 1ENPA 1GO2A 1UXKA 3RVPA 2LXNA 2P2ZA 1NMQA 1V2GA 1N2GA 1CDEA 1LS1A 3FUUA 2QTFA 2VUSA 5JNVA 2NXEA 1LPSA 1N5DA 3LFHA 4BWYA 2HV8A 3A2NA 5KWJA 2FJUA 3A4TA 1EQUA 2ZBVA 3B3QA 4RZSA 3RJTA 3FOFC 3BGIA 1DEXA 4YQFA 3SXJA 3NFRA 3FNRA 1XD2B 1ZH8A 2I2AA 2XWPA 1UJ5A 3L0OA 1O6BA 3PIRA 3R6WA 3OVMA 3GVHA 3CSSA 1HTWA 1BWPA 3GN2A 4ZOAA 5TQ0B 5ICSA 2A0FA 3LT0A 2UV8A 3MTEA 4E08A 2FOIA 4GR4A 1FXWA 4AQ7A 3T4XA 2IXFA 1HGXA 2EVWX 4NC9A 2Y6VA 3HA5A 3ZGZA 5L3QB 4KR6A 2E5FA 5AKEA 5HK8A 4EYOA 1LC3A 1TVKA 4IDOA 1O1YA 3C3PA 2QMOA 3JATA 3ZC3A 2ZPAA 3PWKA 2G9RA 4AAYA 2QXTA 3AM4A 1QH1B 4LBZA 5ISMA 1SVUA 5T3UA 2OCPA 3PEYA 1G4HA 1SWVA 1TO2E 5IAEA 3AETA 3EDMA 1Z25A 1JBEA 4LTMA 4MW0A 1AS3A 1XIVA 5A71A 4EG6A 2ZM5A 2JIBA 1HQDA 3MTIA 2FUNB 3JV7A 4NESA 4TSFD 2JLBA 1WHTB 3OICA 4P0QB 4FCWA 3UV6A 4F7WA 3FPLA 4LJRA 2I1LA 3RVNA 1SUPA 2ZAMA 5E1DA 721PA 3FRJA 4RIGA 1WR8A 2BW0A 1I4LD 4I50A 4CT4B 1TVEA 1JIKA 1VPVA 4TQ9A 2B94A 2ERYA 2WJJA 5AYVA 2A0YA 3I01A 4LC9A 1E7WA 1OYOA 4QKQA 4ZOQI 2XXAB 2CY0A 3MHPA 4MMYB 4I81A 2CW5A 3QMPA 4MKFA 2EJBA 1TGVA 2ZT6A 4M0FA 4RK4A 2ACEA 1N2CB 2WWWA 3EEYA 5CTAA 3DE0X 1KDRA 1NSTA 5DM0A 1F06A 1PTJA 1ZD8A 2OSBA 2ZI6A 1I1HA 2UYQA 2V4ZA 1N1MA 3LOUA 4FDAA 4K9RA 4W82A 4AMYA 4D5EA 1TAUA 3T52A 2VJMB 2B4RO 2HUPA 4WKGA 5C4IA 1Z0UA 1W2WB 1IVNA 3OE4A 3UATA 4B48A 4ZCRA 1A2QA 1VSUA 3VMFA 2B7LA 4P1ZA 2GNPA 2NP6A 3ZS8A 4BE7B 4X8HA 1RAFA 3PGXA 3Q3VA 4HB3A 4QYSA 5IUNC 3DMHA 1H2WA 2FE4A 4GGPA 4B3TB 3TYXA 3THWA 4GGMX 4UD6A 4D1YA 3VSCA 1AMNA 3UV7A 3QSGA 4EFNA 1NM5C 1IN1A 4KPFC 2FEOA 1GFSA 2IDJA 3LXXA 5EHXA 1FFSA 2GCOB 1FJGB 1XZMA 1XL0A 4AJKA 3W5HA 1ZXXA 3NYRA 4Q3LA 3TIIA 3ZHBA 4CKCB 2YWHA 3HUDA 1PHRA 3ZHZA 4DT1A 1DX6A 3NC1C 1IU9A 4OBWA 1ZUNB 4R3UC 3EASA 1U5AA 2AZMA 4NZYA 3IILA 1FQKA 5KYVA 2C04A 3RS8A 1GSOA 4MP6A 4LOJA 4KN5A 1RPNA 4KIGA 5EPUA 4RKQA 3KB2A 3ZHCA 4DNPA 2I7CA 4GYKA 4F9EA 3A9VA 5F7XA 4KFSA 1PEKE 3HJRA 3SR3A 3A1CA 4LG1A 1U28C 4KSCA 4IPTA 1EK2A 4YR7A 4QDUA 4E13A 4H7PA 1LQTA 2QW8A 5BN3B 1B41A 1GU7A 3EVZA 2G1KA 2DR0A 3AR5A 1I5RA 3M6LA 5DM4A 3UAZA 2O5VA 1RBYA 3NUZA 4QDKA 4TVOA 4HSGA 3TAHA 3QSYA 3ZK8A 2H8KA 2WHQA 3ONNA 4IDGA 2PLAA 3AJDA 3GRPA 3REOA 2P2SA 3A4MA 4BNVA 5BQPA 2IS6A 1YI0A 4FMDB 3ME5A 2FE1A 4OGGA 1RAHA 1R16A 1RJDA 3B7GA 1FNDA 1O2DA 2G06A 3CUYA 2JCXA 1PBTA 4FN4A 3C5VA 3IV9A 4URUR 2QTZA 1OXKB 2GK4A 3RTCA 3UVEA 1NL3A 3ELDA 4CDMA 2R84A 2IH5A 1DAOA 4Z9YA 3S1LA 3TVDA 1BE0A 4PCAA 4EQ6B 3P9ZA 2JLUA 2QTLA 2WYOA 4CFSA 5LQMA 1X14A 2XGOA 3LLMA 4JBWA 2GPWA 1MQSA 4D57A 1KMIY 2IOFK 2WINI 4AY4A 5AW4A 1E9EA 3QFHA 4X9XA 5G1PA 4JELA 3FCYA 1YZQA 2P8JA 1MEJA 1IUNA 2BBTA 1K3FA 1Q20A 3RRBA 3VPXA 2XCSB 2VHJA 1QO9A 3WLLA 2DC1A 3LH5A 2AWOA 1Z7WA 4QSHA 1ZO8A 1IIBA 1LKZA 3NHYA 4YV2A 3ADCA 1N2CE 2NNLD 4NATA 2QPOA 2IUSA 1K63A 2BR3A 4B46A 1J8MF 2JCYA 4G36A 5E1BA 1H3NA 2EGHA 3OF3A 4DCSA 3RODA 5K0GA 5EE1A 2Q1UA 2CNNA 5DN6A 1QE3A 1Q6YA 1XZQA 1YV9A 4WK2B 2BKEA 5IKEA 4Y67A 3QE2A 4R9NA 1ZXLA 4KWEA 5JRZA 2XWJI 4DRXA 1I3KA 4ZYVA 3EY4A 4JHLA 2NZ2A 4O2RA 2JIOA 1VM6A 3BHNA 3D8BA 5FFMA 2YMMA 1QLJA 4X1KA 5JJCA 3L7MA 4HH3C 5IYZA 3EDOA 3OE7A 1HLGA 4QREA 4TYQA 4UEJA 3UAGA 2DXIA 2AOVA 5HW0A 4LHYA 2HK7A 3QXHA 5EVCA 2IE0A 2IIQA 4LHEA 4F5ZA 2IBMA 4I5EA 3AEYA 2BM1A 5ESWA 1J5XA 3IUPA 5LNK1 3BDIA 5C7YA 5AI9A 2EF1A 1T2AA 1AKMA 2G6TA 1KY2A 1Z37A 3T1VA 4W5TA 2XCTB 1KK3A 5KKCA 2VRWA 3JTEA 3IXLA 3MWLA 2AHOA 2XMZA 5EMMA 2CT8A 4HUQB 4MPDA 4HFJA 2AG5A 2H2AA 1JS1X 2ZB2A 4UAVA 2VH1A 4AK9A 1BO6A 4LE1A 5FI0B 4HNAA 3SJZA 2OXEA 5C1OA 1Z2AA 4Y0VA 2A1TS 1P2UA 1JDZA 5FV7A 3U5ZB 1L5ZA 4BV9A 1J06A 1J6UA 1A8PA 3H6KA 5A7HA 1JEJA 4KK4A 3BAZA 2F00A 3W78A 3ETDA 3K6KA 3R7WA 2D3WA 3LWZA 2GYYA 3KYJB 3D7LA 1WEKA 2HXYA 1N25A 3IHLA 4QXMA 2FX5A 3GMDA 3VRHA 5LOVA 1EK5A 5K8TA 1XK6A 4WLNA 3QNWA 1WCWA 2AN1A 4C76A 1XKLA 4CLRB 1ULUA 2XECA 1JDJA 3M6WA 4PLPA 5ITSA 2GD1O 1SK9A 2RHCA 2ORED 3GJ6A 4MUHA 1K4MA 4E3WA 2DOKA 4KN6A 3SZLA 1H9CA 3ZH9B 4OXKA 1WMAA 5LXTB 4WJZA 2O19A 1UBKS 4C89A 4LYGA 2X58A 4UREA 1JHYA 4RHCA 4C20A 3OQ1A 1VPEA 3NAMA 1VJTA 1LLFA 4DWOA 1JWBB 2Y1XA 4Z99A 2OFWA 3I45A 1JNXX 1ODSA 5GV7A 4RD4A 5FFFA 4C05A 1PQWA 1JFRA 2IZ6A 1T8PA 2YJNA 3CTPA 1RC1A 4H6XA 3ORSA 4M1WA 4BFCA 4MWCA 3HYSA 4ZAGA 1ECCA 2OPHA 2AFRA 4U8GA 1M2KA 5T4BA 1UKVY 2IXEA 1EFCA 1CY1A 1RZ3A 3ZR4B 1BD4A 1TZMA 4BU1A 4L95C 1FYXA 5LCXA 1JKMA 4DNOA 2RHDA 4K87A 2BN4A 4WN3A 3L0BA 2ZQYA 5CURA 1XKXA 1SEVA 2R1VB 5FF9A 5JAMA 1OHHA 4GKKB 3KB1A 3EVDA 2CEKA 4P3PA 1V7ZA 3WGLA 4LBYA 3DVRX 2PUEA 1Z4MA 3JQ7A 5BMVF 1H9AA 2AXPA 3K8ZA 4I1RA 5ECWA 4CVNA 2ZROA 1VG8A 2H9IA 2HPAA 3JZMA 2ZU6A 3VTAA 1Z0FA 3HP4A 3IVAA 1V1JA 1XZ8A 3FOBA 3EHDA 4IOJA 1XDGA 1IOWA 4U6SA 2ZP1A 4I5FA 1O89A 3HJTA 4S1NA 4D45A 1MZPA 4BTEA 1Z8HA 4BN0A 4FLEA 1QIMA 3I37X 1OTYA 2WM3A 4BO9A 4EDHA 1SD2A 1VXRA 2W6IA 2QQEA 5IP5A 3EB9A 4O8CA 1YK1A 3TM5A 1H0RA 1YJ8A 2Q5IA 5K99A 1X7GA 4AC9A 2CLIB 4YAUA 4RK7A 2OHIA 3DWGA 4BLTA 2JFOA 2JKZA 4DQVA 3JAKA 3MGCA 4EZBA 2WYHA 4ZJZA 2A9PA 3HTXA 1NPYA 2HTFA 3R4VA 1AJEA 2CNKA 3OCUA 4LKOA 4V38A 1U6JA 2RFLA 4RQAA 4LRQA 3JQBC 1HF3A 1Q15A 4MP8A 1JLLB 1KC3A 3IQIX 3MTJA 4Z9BA 4HLNA 4XH9B 3IE2A 3E82A 3GLHB 3GYGA 3G85A 1IMOA 1XVTA 2HQSA 4YLGA 3NEAA 1P31A 1VTKA 2YZNA 3JQ8A 2A5JA 3C24A 1GLVA 4CG0A 2C2OA 1KK2A 4EF5A 2ONKA 2ZJFA 3TLXA 3LT5A 3LCVB 5A0VA 2QK4A 4MRMA 4KQ2A 2PGDA 5FORA 4IINA 4KL8S 5K0FA 2Z0MA 4KMSA 5L4LA 2WABA 2OZLB 4ESHA 2Q6LA 1B0UA 3PNOA 3UWPA 5TGZA 4QM7A 3GXBA 4O29A 4K88A 4QG3A 3IV7A 3NOVA 1P5HA 1V1RA 4QJIA 5THKA 1IXSB 3EMBA 4HDCA 3VPDA 1CG6A 3H11A 2IPLA 2GCIA 4JLAA 1Z6TA 2ZAIA 3NHZA 4P82A 1GZ7A 4MMXB 2XOKD 3C4JA 4H3HB 4F60A 3GJ7A 3PD0A 4BVJA 1EWRA 1OLUB 3N07A 1G8MA 1WHSB 2QG9A 1A9YA 1SBHA 2WJWA 2LCQA 3U7IA 5CLIA 2CMGA 3PHCA 4WZBB 3SZ3A 4EPTA 2ATIA 1RLTA 2VJNA 4FMCF 2PPLA 4JA0A 2XW6A 2A57A 2FF5A 5E1MA 3IH5A 5SZJA 3RT7A 1AZWA 3EMDA 2Z95A 1AS0A 4JX8A 2ECQA 3R20A 4MPJA 4DLVA 1SCQA 3LK6A 2WR8A 4LQ4A 1RLOA 5KKAA 2W6OA 2FXIA 3LAWA 1G6HA 4FEAA 1ZK3A 4OM8A 2VS1A 2PYDA 2CLOB 3ND9A 4CQMD 3OX3A 3NC0C 3C5EA 4U9IS 5IBQA 2GBLA 1TW2A 4MQMA 4BQEA 4UNRA 7REQB 5ADHA 3GBPA 1N2IA 4JT4A 1JHRA 4ZI7B 4FYVA 2R2AA 5F3DA 4A92A 1BE8A 1C81A 1JJIA 2G0AA 3B38A 3S4YA 5I7HA 3ZLJA 4OLBA 2WJ3A 5D3KA 2D4HA 1F8XA 2I8LA 1DIRA 3W8DA 1OHHD 2PJZA 1ZEJA 5DHUA 2J41A 2DSTA 3QM1A 3GJ0A 3NJ8A 4MV0A 1XO1A 2HBZA 1BHSA 3F46A 5IANA 2WC1A 3AESA 4YT2A 2XYRA 3E4DA 5IJZA 2OHGA 4FIDA 1DELA 3ICCA 2AXEA 4MB6A 4TKUB 4G9BA 1CP2A 4FXPA 4EO9A 2J7PD 2X76A 4L3OA 5FIUA 4AMVA 3IIJA 5DW3A 2JKVA 2PMFA 1VJRA 1QYCA 1GV0A 2IKSA 2JJ2D 4NNOA 1J56A 5EUQB 4DCGA 2HWWA 3HBLA 3U44A 1CZHA 1SUFA 4I6EA 3T0IA 1N7HA 2AK3A 3LUKA 4MAAA 2I3DA 4MKHA 1U3GA 4ATNA 1I2ZA 1PJCA 3M6FA 4JEHA 3HXLA 1PF7E 4CF6A 4CDGA 2JAQA 1N57A 1UADA 3VHXB 3ZY5A 1Z13A 3JYHA 2ZBDA 4IGIA 4B47A 3UH1A 3HCBA 2H11A 2OLEA 5HIAA 4RM3A 4FGSA 2OLKA 3KLBA 4H17A 5KYXA 1UAAA 1EHYA 3IB6A 1WU8A 5TC4A 1PT6A 2XTMA 3BIWA 3AERA 1YR9A 3LD9A 1PWZA 3QKIA 4W9NA 4L07A 3T5GA 1XZPA 1EVIA 1S2LA 2DKOA 4MK4A 1YULA 4IJ5A 4ZVMA 3P96A 3IVGA 2DTDA 1R0CA 1YUMA 3KB8A 3AUUA 2WIFA 4M4SA 5F33A 1RQNA 1JU4A 2QTRA 5LL6P 1AF4A 2RK6A 1G63A 2XTNA 1PDVA 3OT1B 4I2NA 4TRNA 5HQTA 1GVNB 1KI1A 3R5SA 2VHQA 2VSOA 4NBTA 4M9RA 2RHOA 4K26A 4REOA 4DMHA 3EG9B 3WL6A 2FUCA 4LJAA 1OGYA 2PANA 3Q72A 2Q0QA 4DC1A 3QUBA 1MJGA 5JCJD 5EHGA 1ZD3A 2E85A 2RAUA 2NZXA 3TLKA 2V6MA 2IQIA 4BX9A 1BTOA 4EF4A 2V0GA 4PZAA 5GY7A 1G19A 3AKCA 5EAIA 2XB9A 2OM6A 3URMA 1P9RA 4KAFA 1W94A 2C00A 1RKVA 1PV1A 1M34A 1A71A 3KTFA 4WASA 1QONA 4Z7OB 4NH0A 1L8OA 4FJ1A 1L4KA 1N5KA 1UP7A 3BF8A 3QE3A 4P4GA 2I34A 5B55A 3EZXA 4LDZA 1ZVQA 3IUEA 1YO6A 4Z4GA 5JROA 2B8JA 3VVCA 3EXEB 2RONA 5KQSA 1S3GA 3WV5A 1AQNA 4MGKR 2GO1A 4WZ6A 1ZM3A 2D5AA 1CLEA 2DGDA 3FWYA 1O95A 3I39X 3VO1A 1N3IA 1KJIA 2PTGA 4XOUA 3NIFB 1ZA1A 3C7KA 2QL6A 1UBFA 3AJ8A 4ZT2A 4M1MA 4CG3A 1NZDA 1Z26A 3H5LA 4ZAFA 1WETA 3QEJA 1ESEA 3V2IA 1AM4D 3FGNA 2Q3LA 4JP2A 5KYYB 3RFVA 1AQLA 4LS3A 1SC3A 3GLQA 3FB1A 4LGCA 5CLHA 1HFWA 2HNBA 3OIUA 4BQSA 1DL5A 4DJTA 1H1TA 2PDAA 1SIUA 1KSHA 1VHWA 1UDWA 5CD9A 5SYAA 2XSZA 5DLQC 9ABPA 1K6MA 1I30A 2JBAA 4JC8A 4YRDA 1JFFB 1SZPA 1SXGA 4E2WA 5B3LA 3QPDA 3T7JA 5AVVA 5KOIA 4HD8A 4EYSA 2PX2A 1ZMTA 4EG8A 2F8LA 3K9NA 1TIBA 2H4XA 4S3MA 3RAGA 4HG2A 2BY4A 1T8UA 2NPFA 3ORYA 4DG9A 1JKXA 1DQZA 1JKIA 1VKNA 4JLKA 3WB0A 2VJYA 3UOWA 2Q4EA 1UIRA 1P91A 5ITZB 3TI9A 3VQTA 1WS6A 3C97A 1X1RA 1NVKA 1PJ4A 1POXA 1TJNA 1DLJA 5JWOA 1LXCA 1RP7A 2EIHA 1PQPA 5DE3A 1R0YA 4ZN6A 2ZRBA 5JH7F 3IPXA 3GBVA 4K7JA 2DPYA 1QG6A 1U1GA 2QWXA 3BFPA 2PO7A 3BXXA 3IAM1 5KI6A 2H4WA 3RK4A 2FW0A 6REQB 1WXFA 4JXXA 3O82A 2WB4A 2AKAB 3FSGA 4LOIA 3SVZA 4HRXA 4ZVTA 3ANLA 3E2MA 2QTTA 3VR4H 1QQBA 3O4RA 3U13A 3FYUC 2O59A 3V6LA 2OV1A 3L82B 2YIMA 2PY6A 3H4VA 3QHAA 1N34B 1Z12A 2CSXA 3I6YA 4MV3A 3VJMA 1E8NA 1ST3A 1W1IA 2ON6A 4Q9IA 3PFNA 1GGJA 3RC3A 3FTEA 3BD9A 1B93A 2V9PA 3BDAA 4RKEA 1EINA 5GM1A 3K9LA 4GSKA 3UN1A 3OA0A 3U61B 5DM2A 2OYCA 2JK0A 3CG4A 3IUNA 1WXHA 4Z4IA 2C97A 1CRPA 4JEUA 1ZICA 4NAVA 3B6MA 5ESXA 5KOHA 4KMMA 4MS3A 3QY0A 1LX7A 4NEHB 3ZGYA 5JCOA 3CF6R 5CU7A 2RGRA 3IAXA 4D8VA 4IMRA 1YB4A 1OIVA 2KI5A 2WSLA 2DX7A 4J1NA 2ZUCA 1ZVJA 3JQFC 5GM2A 4BQPA 2B6HA 4FCTA 4OQMA 5AP9A 4FMPA 3VR4A 4J43A 2C77A 5IC6A 4ZJPA 1Y7IA 1X3SA 1F7UA 2Y0EA 1IHUA 3EJ6A 3H7AA 3OY2A 3KEFA 3T9CA 3MA0A 1A7UA 1T0UA 4L16A 1YR8A 1XTIA 3LQKA 3ZCVA 3LT1A 2VQDA 1YDFA 1L5HB 4BB6A 1VRWA 3GUHA 3PXDA 1B6GA 4CODB 4LYAA 5JSZB 2V4UA 4C22A 3PUIA 2H54A 4OL0A 2AEEA 4LYEA 2LP4Y 3KQYA 4YJ2B 3VDMA 2QT9A 2P8SA 2W6CX 2YZ2A 3HP7A 4QPCA 5AJZA 1OGIA 1BVYF 5CTJA 3KQLA 3T1QA 2C9BA 1KEPA 3U1VA 3IT2A 3ICVA 1W5BA 3F9CA 5ARBA 1V3VA 3MWYW 2RGCA 2ZS7A 3HU5A 1YHZA 3MUNA 4CCAA 5JISA 5JNWA 4K0KB 1NQ5A 1TZKA 4RPCA 3C6QA 4MCHA 1KZYC 2UUPA 4NCKA 3NW9A 1V8PA 1U7DA 1SU6A 2YXLA 1E6CA 2PX4A 3MCUA 4GC5A 5FBWB 3AYZB 3T5MA 3WL4A 3QOFA 2ZAOA 3EFBA 2VHVA 3OCJA 4G85A 2AFHE 3UAXA 5E4FA 1ADBA 3N9IA 4UNIA 1NGSA 4D3YA 4X8LA 2B5OA 1R4AA 3D6HA 1IZ7A 2BGMA 2CCGA 3KXPA 4XLZA 3RRMA 4MV4A 3WK6A 3I9V1 2WPDD 2ZBEA 3FDFA 1OF1A 3JRNA 4I55B 2CBZA 1U2GC 1P81A 5B7QA 5AW9A 1R64A 5JARA 1K0UA 3V8BA 5LIPA 2Z30A 1PR2A 4IV8A 5HK9A 4PONA 3O6VA 5CDHA 4KQ9A 2WM8A 3MGBA 3L06A 4CDNA 4G4SP 3X1WA 4J16A 3W90A 2FETA 4YXFA 1NDQA 3GRKA 3R44A 4IUYA 2ECKA 1N77A 5FULA 2HRBA 4UC0A 3EPLA 3LDGA 3KVYA 1RE1A 2C4KA 1PJ8A 4GX5A 4J8PA 3DOFA 3F9RA 3PNLA 2CXOA 5E6UA 3RIYA 3D8TA 4IDFA 1T8YA 4MWSA 4ZHQA 4NCAA 2GM9A 5CGZA 2JI7A 3HMQA 3U3RA 3PC4A 4PYRA 1XFDA 2O50A 2V6FA 4GW3A 1ZDMA 3VHRA 3K0CA 5HX7A 2G04A 5EJIA 2A78A 1KDTA 2E89A 1TI7A 3VNRA 3NTOA 3N0RA 3UPUA 3OD1A 3SQWA 1U9YA 1LBEA 2H1LA 2V03A 4IHJA 4P81A 4PVCA 5FB3A 1UC9A 1VXOA 2CE7A 3DNPA 3QLTA 4JP5A 2B0CA 2WV9A 5FOSA 4IXWA 1YHYA 3GJYA 4YQZA 3D64A 4RLFA 4CMKA 5TVKA 3QXXA 1JYEA 5TS3A 4O1MA 3DE3X 1PR3A 2XZPA 4FFDA 4YEDA 4N5LA 1ILEA 3TLYA 4LY0A 5DZSA 2ZBPA 3ASZA 1O4WA 1WX1A 3NASA 2GF9A 2Z5GA 1IDN1 4TWJA 1P2TA 4JB2A 4ZVRA 5SZIA 1JP7A 4NG4A 3OX1A 1MPTA 5JWRA 4KAXA 2VYQA 2R60A 3TDNA 3T7EA 3PL5A 4YDQA 1FQWA 1QYDA 4PS0A 5BO5A 1IQPA 3LDUA 3PUZA 1ZN8A 2X3YA 4BLOA 2PXCA 1M73E 5K51A 4Q1VA 3ORFA 2FMTA 2HRQA 2HHCA 4RHFA 1I7QB 1BC5A 1K5PA 1QIJA 3SJBA 4MIEA 2CFCA 2JLQA 5K20A 4UU1A 2KWIA 1V8BA 1VRVA 2XHEA 1IUPA 3GCWA 2OC4A 2PV7A 4I4LA 1KFKB 4O4IF 4CKYA 4TTRA 4F97A 9ATCA 4NONA 1H1LA 1DADA 4FD3A 4OIFA 3R0VA 3WJ1A 5BNTA 2EEPA 3F7NA 3CRNA 1T9GR 1NVWQ 4RESA 2XR1A 1TQ8A 4E5PA 5JXJA 2DBZA 2IS2A 1E1RD 3VR6A 3WXBA 5L40A 1E5XA 2PX3A 1QTNA 5K8CA 4EJSC 3SU8A 3KDSE 1J9ZA 2WV7A 4QTTB 6ABPA 4OHXA 3DE4X 1BXGA 3D6TB 1PK8A 5K4GA 4RTPA 1Q6ZA 2YVAA 3NBXX 3S7TA 4D26A 1UOQA 2K5UA 3H99A 3I9FA 1RRPA 1RU3A 1SUCA 2WRZA 1GSAA 2XMBA 2OV6A 3EZNA 1ZNZA 3QFSA 1LK7A 5DGCA 4L7QA 4KCGA 4AMGA 1GG5A 4PAOA 1Z7BA 4RD1A 2ACVA 3KXDA 1SCJA 2RHJA 3UJCA 5J9FA 5GVRA 3KJQA 2O14A 3F49S 3INYA 1JU9A 3V3KA 3UWSA 4JFAA 2DM6A 4XQCA 1ZWKA 1XZFA 1NJ6A 3CHYA 3K9FC 1ZKMA 2XYHA 4BPBA 2AMJA 5EEHA 4FBGA 5JBQA 1KYQA 2O2HA 3IHWA 1C4KA 2XUPA 2B1IA 2P0YA 3M2TA 3VR3D 4NBNA 1C50A 3V8VA 4YDRA 3RSFA 4JXZA 2V97A 3WL7A 2HRDA 4DSOA 2IOHA 3HGQA 3ZDEA 3A1FA 2WWHA 3ZWQA 4BNNA 4L4SA 2V8BA 4ZDKA 2O5RA 1ZKDA 2I2CA 1ZA2A 1OBVA 2NVOA 4JBHA 2PZKA 1JPUA 1NLUA 2PR7A 3UH0A 2GEBA 5H4HA 5BVGB 2GSDA 3ZWKA 1P2DA 4C0QC 1PGJA 3QLJA 5IXJA 2VPPA 3QIVA 3K0BA 4KWTA 4Y2HA 1YR3A 5CA0F 4ENPA 3BMQA 4V0SA 3DDSA 1QGOA 1AGRA 3OU6A 3CZRA 1LS6A 1Z5PA 3DNFA 3KAQA 1YAJA 3N8GA 3MUOA 1TUEA 4LTNA 3HZOA 4O1HA 2JFWA 2QZJA 1L5FA 2NXNA 3UA3A 1LA2A 2NXWA 4BMOB 2DFNA 1K9SA 3IR7A 4LZJA 1UOOA 5AM1A 1AUXA 1YFZA 3C16C 5JS7A 1MF7A 2O2IA 3GRUA 4EKEA 3FDZB 2WSIA 4AO8A 2Q5HA 5B2ZA 2GJSA 3RHTA 1RXWA 1JG2A 4E1BA 1JIQA 2BGIA 2QGFA 1L1FA 4TWIA 2RB5A 1UT6A 5KOYA 2YYZA 4D6PA 2ONYA 2V5UA 3AILA 2P9QA 3OZSA 4WTOA 4PNEA 6NULA 2ZJYA 4Q15A 3MJSA 4RQBA 3KBBA 3V00A 5F9HA 4H6PA 1LW7A 1PSWA 1BEUB 2Q3CA 3N2ZB 1MNAA 3NIBA 5FRDA 2NZJA 3NEPX 3R0ZA 4L0CA 1DPFA 2Z1MA 1YJCA 3TOXA 3UWDA 5J43A 3R7DA 2QMEA 4Q9KA 4FOLA 5M04A 1E66A 2VO1A 3BMCA 1HK7A 2VSFA 2Z2XA 2A7QA 2P0EA 2QZ4A 1MOPA 3EEBA 4NH4A 3SZMA 4KQJA 1EFKA 1HORA 4HADA 4LQDA 1NP7A 3U56A 2D5LA 4OQNA 4LF5B 4BMSA 1SOVA 1U8FO 5LBUA 2DFPA 5KHOC 1YIDA 3AEUA 2XCOA 4RV4A 3RSGA 1I7LA 4PX5A 1MQ8B 1O6ZA 3RRFA 3SC2B 3DFUA 2DY0A 3LOPA 1OSNA 2Q4BA 4ANFA 4M0MA 1LPAB 4WA8A 2ZIXA 4KQXA 5CMLA 5H83A 3GNTA 3RVLA 3BDVA 3GP3A 1Z0JA 3NANA 4IJUA 1NBOA 3RVBA 5AUPB 1IJEA 4L5YA 3FFBA 3ZG6A 5EEGA 5KVVA 1YRHA 5TY0A 1H2YA 1XZCA 3BE6A 3DUFA 2XYGA 5AJVB 2B9VA 4IXMA 5DOZA 1L5KA 3W8RA 3C1AA 4ALLA 2J7PA 3RJ5A 3VC7A 1QU2A 5F64A 4AN4A 1YACA 2Y1KA 1EHIA 3QXGA 4JJGA 1U0FA 4N7RA 2W2XA 3M4YA 4XOIA 3AMVA 4M0KA 5FOXA 2W4QA 4FC6A 4GG1A 2JS7A 2NG1A 3I42A 3SOPA 4LOKA 1IG3A 1HL7A 3ADBA 2ZBFA 3IEUA 2YZ7A 1IZ0A 3MOSA 4TUYB 1L1EA 1YR7A 2PWYA 4HNRA 2VYFA 5JNRA 4EB0A 3Q3HA 3BWVA 4ZK2A 3MTBA 3OY7A 2LKDA 4KXWA 2CLSA 2QN1A 1L7OA 2IP1A 3K1JA 4X3CA 3X3HA 3E7DA 3SIWA 3U3DA 2BUAA 3P20A 4DBZA 5K03A 3HO1A 3LCCA 3DD5A 1E5LA 4PRZA 1SO8A 2FRXA 5I9NA 2FZKA 1QZTA 2C42A 2ID4A 3NALA 4WOBA 4YJFA 1Y1RA 1U7WA 4C08A 4WV3A 4C7VA 5EZYF 2HLDA 1Q2XA 2QTWB 3UB3A 4H7FA 2D2EA 2A92A 3QU5A 1BA3A 3R7FA 4YUWA 3HCWA 1R6DA 3NNDA 4Y2PA 3VV2A 1XJ5A 5KQPA 1IY1A 1U1CA 2DTXA 5HE9A 2EBUA 4GOKA 4I9NA 3PB3A 4L76A 4YRMA 3WE7A 1OOEA 1L8QA 3QWIA 5DBHX 2HOQA 5FL7A 1UMBA 1B0AA 2Z4TA 3O2NA 4UDXX 4OQYA 5FHQA 3DEKA 1P1HA 3AF5A 1Y3HA 4F5DA 3W5AA 1XU4A 3ER6A 4MW7A 5K2OA 3FLMA 3A04A 3UWOA 1DB3A 2MSLA 2QTGA 3CU5A 4NICA 5TQ2A 3IODA 3LVQE 3ROGA 1FQOA 1JR3D 3UB4A 3FFXA 1PT8A 2WTNA 3DDOA 2EHJA 1H5QA 3VH4A 4NMHA 3JR3A 4WJKB 3S2YA 1YQTA 3CF2A 3GLVA 1MMFB 3TO5A 2FSSA 2FQYA 1KORA 1Y4AE 2JGRA 2ZJ0A 4IHAA 1AKWA 1ZOOA 2Q6IA 2YNMA 5GIPE 1TK9A 2A4KA 3Q41A 4Y6LA 3HABA 3T1NA 3GJ4A 5EXEA 4UASA 5AVQA 3EQ2A 4JI1B 3R40A 2QQ5A 2DUWA 1BAPA 4KV7A 2W2KA 4NJMA 2EF0A 4J4TA 3OZEA 1DCTA 5I4BA 1V5EA 2Q21A 3S1AB 3VOTA 4F6RB 5CB4A 1F8FA 4IWXA 4TTVA 5DYNA 2EXXA 5FUBA 1X87A 4J3FA 3U60B 4DLRA 3Q9LA 2BSXA 1U3VA 3M4XA 3DDUA 2VPXA 3IQEA 4FXOA 2BJVA 1F4LA 4JR0A 3C48A 5DX8A 3K5PA 4O2AA 5GMOA 4GWLA 3PIDA 4C4XA 5EJ7A 1D3AA 4FR5A 4Z0NA 3QTLA 2JIDA 2JIQA 3TMKA 3T5CA 1SA0A 3RTEA 2P30A 1CNFA 2RMKA 1CFZA 3IOYA 1FTNA 2Z4SA 4K9OA 4HATA 4WMLA 1NURA 4QUGA 1MC8A 4X61A 3UT0A 4D4JA 1AURA 3PP8A 2GAFA 1CIJA 4JEIA 1UKEA 4BGUA 3SHQA 1E7QA 1HBJA 1GT91 5EP4A 2QAGC 4B82A 5B7NA 1EP9A 5L3RA 1Q44A 5K8VA 4HK4A 3HZZA 3R5HA 3HR4A 4XYGA 2IELA 5EKSA 1QK5A 2QJFA 4MO9A 4F5EA 2H1FA 5TXGA 2RSLA 1WABA 4D99A 4QTUB 3DE5X 5F23A 4MR8B 2C2XA 3IBYA 4B7XA 3RBAA 3E9DA 1QKJA 4PGMA 3QG5A 4B5KA 2H2FA 5LZ8A 5JVDF 5C80A 2YY6A 5F1OA 1G8HA 1I10A 4XM1A 2G09A 3ZE0B 1Y1LA 1YKFA 5EIHA 3ASYA 3KVNA 3PVCA 1VSTA 3D6AA 2INGX 2R6FA 1X15A 3M1AA 3FYHA 4GRAA 4UBJA 4YAOA 2H92A 4YCMA 1B2RA 1GTL1 5ICEA 2HQ1A 3I5XA 1NBAA 4L51A 4ARSA 5GVSA 4XD2A 4NCBA 3HCEA 5AW0A 2I67A 3KVVA 3WLHA 4HNUA 3JSAA 4K9MA 5BSFA 4HYTA 3OTHA 4P34A 3CA8A 2I6QA 4KTTE 5E38A 5TS2A 3MYRA 2VUUA 4MQ5A 3QELA 5HF5A 1KDVA 3V8QA 1U2PA 3AM3A 2BJWA 3FNEA 2CVFA 3GLHE 1T26A 4AQYB 1GTZA 5C1IA 3AEKA 5EWLB 1GTJ1 2BGNA 4UNSA 3QRWA 5IH7A 4TTJA 1CUJA 1PKXA 2H5LA 1X77A 1N6LA 5DLDA 3TZKA 1TK3A 3IDFA 4E14A 1X86B 1YFLA 2QX8A 2RI1A 1AMOA 3VGJA 1Z33A 1YI8A 4D3DA 1XZDA 3CTMA 4DUZB 2NYVA 3IPAA 4V3BA 1YKSA 2H5EA 3G02A 4EI2A 1KARA 3BGWA 4K9LA 1K6JA 4DBLC 4QQKA 2QV0A 4B6OA 2Z04A 4HZGA 4C87A 4Z3KA 1AU9A 2R8BA 4I4TB 8GPBA 5JUWA 1N5LA 4LV5B 1HYBA 4C4TA 3SIRA 1XDWA 2A67A 5DMXA 1J21A 4CM3A 3KEGA 1EGMB 4JJIA 1K2VN 2FFRA 1HG0A 4FONA 3J80A 1FFXB 2UUAB 3L4KA 3GRFA 4WVFA 3M3HA 4EKYA 1EBUA 3NEYA 3KJZA 3PQ4A 2IBSA 2HCRA 4JGBA 1T3TA 3P2EA 3WZ2A 2DPLA 4NSNA 5FH9A 3MMZA 4GYYA 2XV1A 3UFXB 1W36B 4WX2B 1T35A 2QM8A 5CCDA 1JQDA 1VLHA 4L57A 4LJ4A 2I2DA 3UQYS 1QFZA 4Z7NB 1YQGA 1ZG3A 3B1YA 5LZ9A 4KN8A 4RSRA 4YO8A 4F92B 9LDBA 3H11B 2D2XA 1E94E 4X6XA 1AK9A 1R6UA 3P2MA 2C9ZA 4IS3A 2HF9A 1Z9BA 1JVNA 3DFZA 3E7PA 4K6MA 4RGYA 2IHKA 2PFKA 2PXHA 3GJRA 2YV2A 2QF7A 3FTCA 4KLNA 4UCWA 3ZNQA 2HMSA 1CRWG 3W7VA 5G1OA 1T0JB 3RU2A 2Y9MB 5CA0B 2C7BA 1E79D 4E1AA 5FFNA 1XTSA 4DHWA 1CY4A 4LA4A 3G0IA 2GH1A 4B31A 2H7XA 2RI6A 3JQAB 4B4DA 4ZAWA 2BIFA 4GZMA 5EHQA 4BJHB 2CKDA 4CTMA 1CF4A 2BL4A 3NHBA 2Z8ZA 4MJ3A 1THGA 2Q4TA 1PJSA 4W99A 1AHHA 1QIHA 1FS5A 3K09C 1J0EA 2XGSA 1JYSA 2IV3A 4QPNA 5LA6A 5THQA 3NHSA 2VN8A 2W8ZA 4KJXA 1SBCA 2ZBQA 3WQHA 3Q9UA 2Z1DA 3BPSA 5BV7A 5T4HA 3SE0A 4TT3A 2E87A 2NVUA 1L1QA 1BWRA 1T36A 2JGDB 3B2QA 3QBDA 4FQ5A 3AOEC 1C0EA 1JIJA 3KUKA 1VMKA 3NOXA 3ZE9A 4KQKA 1M8GA 1E9AA 4JITA 5KS2A 4CBVA 4MAFA 3DP9A 4PFJA 2QT1A 4QLAA 3UXHA 1GEEA 1PFYA 1U8UA 1JB9A 4QPZA 4MR7B 3SQNA 1IHOA 2AZTA 1NX6A 3MLEA 2I7TA 1H1DA 2FI1A 5LWQA 2CBGA 4R68A 3QK7A 3WA7A 1AXRA 2Z8XA 1Z2DA 4Z2YA 1RHQA 4UEOA 3C98A 4AQDA 2ZUVA 4C30A 2G70A 2QUZA 3KPJA 1F5SA 2H63A 2JASA 1IOLA 3EA5A 5TB5A 2AH5A 4GDFA 3TR5A 2FQXA 3LGSA 1LF5A 4EECA 5EJGA 3OD5A 4I4IA 3TQHA 2TMYA 1TM1E 4XJXA 3VZRA 3MWFA 2QR2A 4C0SA 1XCMA 3LCUA 5JZ9A 3QPWA 1P7PA 4OA5A 3RV3A 4MUGA 5CW1A 1W0CA 2D59A 3KWFA 3LZDA 3BN3A 4IGAA 5CXXA 1IBLB 4E7PA 1D1PA 2XBLA 5DM70 5KB3A 1Z6XA 4PC6A 5JYEA 2H2DA 4YN3A 3DTTA 1CZLA 3U48A 1QFSA 1ZN9A 4BECA 3PWZA 4NOMA 2V7BA 5C4GB 1ZI6A 1GGKA 3KT0A 2VNKA 4RK0A 1ZSNA 5K6AA 1FP6A 4U2BA 1RD4A 1TMGE 5K8IA 2JLXA 4M7PA 2EU8A 3CLRD 4P7KA 4XVUA 3ZDFA 4A16A 1E59A 1XVAA 3D6MA 1U90A 3RYIB 1C4OA 2BDEA 3C1OA 3RGGA 1ZGJA 4ASUD 3AR9A 4EA8A 2BI7A 1YZTA 2DBQA 2FGJA 3ND7A 4H7DA 4RAOA 4OGFA 1F2VA 3CS3A 1OA0A 3KTAA 3LW8A 2WWFA 2DPMA 4O63O 3SIXA 1WPGA 1QC5B 1E2PA 2D1QA 4UUQA 3ZHXA 4Z1OA 1ZRMA 3AZQA 3LL7A 3IRUA 1M34B 2F62A 2J67A 1G2IA 5FO0A 3ZZ1A 1SUSA 4KO1S 1DAKA 3CWZA 3H5VA 4W5WA 2FX2A 3TLBA 1Z0KA 1I8TA 1BKDR 1T5HX 4CN8A 1OBHA 4R1QA 4F56A 4I1UA 1KZ1A 1LVUA 3N3AC 3NZEA 4IV0A 2FK7A 3Q0EA 2P9HA 2O7SA 2PX5A 4U63A 1K0FA 4DSNA 3L8MA 3A9TA 4PQFA 5G2OA 4RGBA 4DTIA 1JT2A 5LDHA 4Q9HA 2OQVA 1XROA 1TC1A 4DDMA 1FY2A 2KPOA 1SBTA 3MMXA 5BWMA 2JFUA 1M8JA 2GMWA 4GOOD 3V4VB 2FR0A 4V1CA 3R9XA 1Y9DA 5AUQA 1KIAA 2COKA 5DNWA 5KU1A 4IVNA 4DDHA 2Q0XA 1PJ3A 1Y63A 1KNQA 4KUEA 4MUKA 4PHFA 3NUGA 2AV6A 3EGWA 3U9LA 4QM6A 2RAVA 1US8B 5LXTF 2HKIA 4KRGA 2FQ1A 1RPTA 4MP3A 3GMIA 5AJTA 1GZUA 2RGDA 4DLAA 5KTPA 1ZAKA 2N1MA 4H2DA 1NI4B 3H9JA 3AVWA 3UANA 4O5OA 4XTRA 3QY9A 1REQA 1KAOA 3EUFA 4Q9DA 3BE5A 4ZYWA 1FPQA 3Q6IA 1HZJA 2Y66A 4IXDA 5JBIA 1Y8RB 4RTKA 1V7CA 3RRNA 5AXBA 2PA0A 5KYXB 4NDZA 4AS2A 4GF5A 2CB0A 2H2WA 2MSDB 3GXOA 5K3BA 2GJ9A 4X91A 1T5LA 1Y4ZA 3CRW1 3SXPA 3UK2A 2TECE 5C4MA 1HT3A 2ZOSA 4FZJA 3W4IA 1GKKA 3KZNA 4MVCA 3C41J 3ZQ6A 3IAM6 4R8SA 4KUHA 5E8JA 3DDWA 4Q5IA 2ZWOA 4G0XA 1Z3CA 2RG7A 3GCXA 4N4AA 1W29A 3BJRA 2EARA 2XTJA 3GEHA 4IFIA 4QVGA 4KAAA 1GFIA 1W5TA 3RVQA 3BXPA 1A5TA 3A9RA 5BMOA 3SC3A 2HU7A 1Y9EA 3B3FA 3BERA 5A1TA 1SD5A 2QT0A 1OROA 4FWBA 3RWMB 2ZULA 5CP8A 4LV8B 2O20A 1N3BA 1PJBA 4MGYR 3FRHA 1M2VA 2NO1A 1MQ9A 4WRRA 5CPFA 3T7TA 1R0KA 3WZMA 3ZX4A 2C7PA 3HADA 4MW2A 1A76A 1VBMA 4AP6A 1VC2A 4ZU6X 3OCXA 5HFJA 1E8DA 1WLSA 3MIZA 3CZ4A 1DAMA 5FL7D 3T41A 2YL2A 1MTZA 2Y6UA 2FMUA 4DLXA 2BTEA 1OT5A 4DG8A 1RJ9A 1FSPA 2ODPA 3H9QA 5IDWA 4Y2SA 3E81A 1VLJA 2QI9C 1PUIA 2O06A 3FMIA 2R6R1 4PAQA 4I6GA 1KYVA 3TRDA 4C6SA 3JXEA 2AXNA 4LK2A 5KTKA 1E1MA 1CU1A 3N5KA 2W9XA 521PA 5I7UA 3BHJA 5B2EA 2EYUA 1SUAA 2WTUA 2C7OA 2D8MA 4DV2B 1UKZA 1PNVA 4JOQA 4D0NA 1W581 1BRTA 4XSGA 1TM2A 1UPTA 1L7RA 4L27A 2L42A 4DDKA 1YFJA 2WIGA 4U9HS 1OJ7A 2QL7A 5KQLA 3USES 2V7XA 1KETA 2Q8NA 4JU8A 4Q1DA 5C32A 1ZX1A 3H8WA 1LSSA 1WXGA 3AY3A 1PSZA 2ZITA 4EM6A 4TN5A 3SBOA 3G9ZA 4OV6B 3GZ4A 4R1NA 4M99A 4HNTA 4IILA 4UFPA 1VJGA 4IIDA 1EUDA 4DIDA 5FBHA 2UUBB 1D04A 2RKOA 2XRMA 4PYJA 2IYNA 3ISJA 4C6TA 2Q1WA 5EJ8A 1RXVA 1UPBA 4OQPA 4V0OA 3FLBA 4BNYA 2HMTA 5ED0A 2YW2A 2G40A 1KH2A 4E7OA 3TZQA 2ZSAA 2Z57A 3EC1A 1VKZA 2BMAA 1H8HD 1R6XA 2MSEB 1TKRA 2JIRA 2ZTSA 3DBRA 3KQHA 1IPHA 1C8VB 1OZAA 2ODTX 5EXXA 2VPTA 2COEA 4BGDA 3V7UA 4K03A 3BG5A 1J1ZA 1WXWA 2J3EA 3L4SO 1Q1AA 4NK4A 3RUEA 2OZVA 1XVUA 1Z35A 2EW8A 2FPPB 3L04A 4LWZA 4I50F 3SZUA 5A2QA 2C4HA 3K7EA 3C85A 3H4IA 5AWFC 3X1MA 2RBGA 3CE9A 4Z1MA 3CRVA 1OT3A 1JPNA 1M0TA 1O8CA 2I1VB 2FDXA 1WZ2A 2NYAA 1RYBA 3BK2A 4OP3A 3ZCQA 3AVPA 5HM6A 2GJAA 1AHPA 1P80A 4YJHB 3K31A 1XLVA 3LVBA 2GJKA 3PXBA 5FTWA 1XB2A 3SZRA 1PVOA 1NJ8A 4Y1RA 3I1JA 2GAJA 3MBKA 4GI2A 4Q3OA 3CLKA 1K6IA 3U1TA 2FSPA 3UV3A 1HNWB 3KQUA 4U4AA 1ZJZA 3K0KA 3N3BC 1ZR2A 4AT1A 2QENA 2P5UA 2RBEA 2M1ZA 3ROZA 4R4JA 2VDLB 4R98A 1UWKA 4BMVA 3IELA 3Q88A 4EENA 1OH5A 2YXEA 2I9PA 3GEEA 9LDTA 4LZAA 1EFHA 2ZI4A 4B8ZA 1PCXA 5AM4A 1JR3A 4A03A 3JD3A 4RF5A 2X1HA 1QWOA 2OQIA 4GYWA 3RROA 1UOPA 3WNCA 4H16A 1PX2A 1VA4A 1C3OA 5BYBA 4RTSA 2YDYA 1J7JA 4PHTA 2BFCA 3JASB 3NLLA 4XCXA 3WMXA 3HI6A 5SYNA 4MSUA 1R4ZA 4LGYA 2KM1A 4Y2UA 4KK3A 3D6FA 3VYSB 1AUPA 5I7EA 4BCBA 5D6NA 4NOJA 3E22A 5FQNA 4CM5A 3KEQA 4A26A 4K6HA 4OHWA 3UT5B 3FWNA 4HZUB 2HYDA 1TDJA 3V4OA 1L5HA 3QF4B 7YASA 5JQGB 3QEKA 2HN9A 1DIOB 2K6GA 4G2TA 4IDDA 3LQFA 3QFCA 3G3EA 4WZAB 1RPZA 2OR3A 1YE5A 2C1EA 3L01A 2BFEA 2CLHB 2RCNA 4L2IB 4NYJQ 2J6CA 4MVWA 2H1VA 2HRCA 3HYRA 3K8YA 4R1LA 3ZCTA 1P2VA 5JCPA 5IW8A 1YQWA 2IK8A 1R8XA 2RDMA 4PXYA 5BXYA 5CB8A 4RPIA 1W0KA 1YJXA 2WTMA 5BORA 4CQLA 1H5NA 2HMWA 4MW1A 4CM4A 2NZUG 5EXPA 3EWAA 3TZBA 1HT0A 3LUDA 3W6UA 1TU3A 1U9IA 5K3CA 1VL0A 1K5HA 4B5LA 4EUSA 2D8AA 5C1DA 1QH0A 4RK6A 2HSEA 2WIDA 2XVZA 2QR5A 2OD2A 1GPAA 3GWZA 3QUAA 3W9SA 1ORWA 4C07A 1KZ7B 2EWMA 2Y1FA 4A8TA 1D2MA 3DGFC 1VP9A 3ZS9A 3BWCA 3U39A 5A4JA 1CF2O 1K06A 2PEYA 3UJ3X 3F71A 2JGNA 2JI4A 3PEEA 1Z28A 2A1UA 4RA6B 3OLXA 3PNBA 4F06A 2TRSB 1J42A 2H4ZA 1NN5A 3B89A 3H1BA 4RJLA 1OXUA 4FD2A 4F8EA 3Q1KA 2C5HA 4IGEA 5LPNA 3LX8A 1G5HA 2I5PO 3DT9A 1XN4A 1R66A 2D1RA 1GG9A 3K0EA 2FDRA 1CB7A 1G55A 2OQRA 1JF8A 2P75A 1QKKA 2WTBA 4C3UA 2DLNA 1NNSA 4II7A 1WW2A 1T0HB 1DC5A 1ONOA 2QD3A 3AKZA 4QOEA 2Y71A 3OOWA 2I2WA 3OTIA 2NTYC 3LCJA 4ZDIA 2KHZA 2HEIA 3FDIA 4ZO4A 2BZ1A 3R1IA 5BQ5A 2FG7C 3D5QA 2PKEA 3N2LA 2A5YB 2R9VA 1D8AA 3OF2A 3TLZA 2E37A 4B34A 2J3KA 1D1QA 4EHDA 2LCIA 3DZBA 3ANNA 1HR0B 1QFJA 2RGEA 4R9SA 3TG2A 5ER9A 2K2QB 3WL5A 2CVQA 4ZWNA 2KMLA 2WZBA 3AETB 4EW2A 2QLBA 4XYMA 3C39A 1PYDA 3AB3A 3D8RA 2OD7A 4Q3DA 3LDAA 2B8WA 4ER5A 3SEAA 5JT1A 1JI3A 1LD3A 2P2LA 2PIDA 3TUZC 1QQAA 4M1QA 4FHEA 4ENQA 4KACA 4RCVA 5CEFA 1N9KA 1DXQA 1P8AA 4CM9D 2CHQA 4DA6A 2WQ7A 2IHYA 3NNSA 3E9RA 5K7SA 1GNQA 4QBIA 4UZFA 4TXNA 4V24A 3U2QA 1GUZA 5TPWB 3W6OA 1EQAA 4RQUA 3V5NA 4AW9A 1U2EA 3L4EA 1HKHA 2ZEJA 1TM3E 4K6OA 5DP2A 3S28A 2VA9A 4LZOA 3DHEA 1ECBA 3LO5A 2PO5A 3OBIA 5LUAA 3LUPA 3WHLA 4PSUA 2ZUEA 1J0AA 1M10A 3WMGA 4DA7A 2IZ1A 2BAGA 4H1HA 3PE6A 1II8B 4GM4A 3H9GA 4RETA 3UCFA 2W6JA 4CMEC 4MV1A 4NAHA 1V11B 1NQXA 1PNTA 4H1TA 1C7ZA 3ZOKA 1G2QA 1SOAA 2RBKA 3VX3A 1J2YA 1E4OA 1KS9A 1TJ5A 5EE0A 4CF3A 7GPBA 3AR6A 5GJBA 1MP0A 3HSSA 3KOYA 4C4RA 5DVZA 2F90A 5BSTA 3ICWA 2GLXA 3ZE7A 1PIWA 3ZJ4A 3K70B 1DVRA 2I7VA 4LY3A 4V2UA 2VWHA 4I50B 2BGJA 5AJUA 2RG1A 5EIBD 3RSQA 4JA2A 1V26A 2X2EA 5HQ3B 2QA5A 1T4DA 2G28A 1J39A 4FLMA 3NGLA 2GESA 4ASUA 4NCIA 2D5CA 2V7TA 1XEXB 2ATXA 2J48A 4P36A 1JH8A 3TNFA 1YQUA 4RIFA 3P9CA 3PGLA 3THXB 4EB3A 4FNAA 2ZIEA 2UXCB 1HZZA 2HK9A 4YRGA 2BGTA 2J3IA 2AOUB 1Q17A 2VTKA 4BWGA 1H6AA 2G82A 1ZUNA 3ITNA 5CHEA 3ZE8A 5FCDA 4ZTZB 2ZBUA 2VHZA 3BWEA 3EBLA 3UA4A 4ECEA 1NTOA 1R3DA 4C4PA 4QEKA 3R9WA 2CUNA 3FB4A 4IFTA 3ROEA 4IW3B 4L22A 1X2EA 5EC8A 1UJ6A 4QUEA 4R2LA 4K28A 2C99A 4MVJG 1ETHA 5JFTA 1J1IA 3VFDA 1ZGBA 4DZRA 3GFBA 4WCFC 2ZYVX 3P71T 3ZCXA 2Z3VA 4YAKA 1HLFA 1VDZA 2YZMA 4B17A 5KWSA 4EEKA 4WNYA 3VU1A 3U6KA 1DGQA 3HA7A 1N6PA 1OTXA 4YHBA 2CZGA 1XZJA 2C5FA 1PW7A 3IPRA 2HB6A 3ZWNA 2OFXA 2AC2A 3NIDB 1JQJC 1XYGA 3S5UA 1QYXA 4DJJA 4YMVA 2W4MA 5AJHA 3WLMA 4HL6A 1OB5A 1USWA 1TKAA 1XDUA 3AH8A 4LMAA 4NMXB 2Z2KA 4CLDA 1TC2A 2VP0A 4BFUA 3QE9Y 1BW9A 2REBA 4LRSB 4MUEA 4D8UA 2ATCA 2AN5A 1PDOA 3AHGA 3H05A 3L1UA 1XXHB 3LSYA 1DBWA 1X1AA 2CMDA 2V7WA 2O2JA 2Z43A 4URWR 4KHZA 3W0LB 5EGNA 5LYJF 1DKMA 3UJ9A 1N2CA 1JIVA 5EN4A 1ZCBA 4B2LA 3GLGA 2OCLA 1GPBA 2P1ZA 3EVFA 1KDPA 2CWDA 2BWJA 4IAOA 3SQOA 4MJXA 1ULHA 1RQRA 4NP6A 3OCZA 1LLCA 5KINB 4X7MA 1GILA 3CLVA 4MA5A 5F77A 5J59A 1BMFA 3VPHA 1D6MA 3S6JA 2DBRA 1ZRNA 4QQNA 3JWIA 3F3MA 1TCCA 4FLFA 4PRLA 4Y1EA 2JC3A 1TT5B 1VA5A 2BLNA 3Q1LA 4MLZA 1D09A 4MRAA 2ZDHA 3TKLA 3ND6A 1AUOA 1T43A 1ISFA 3BXOA 4KQWA 3AVXA 4TKMA 4LV6A 4DLLA 3CM0A 4GLLA 4C03A 2XDYA 4C1BA 1J24A 4YVFA 4ZQFA 1Z63A 1Z4KA 2FSFA 4LF8B 1II0A 1DEAA 3EC7A 1QB8A 3GU3A 1ORRA 1QG0A 2OFOA 1DIGA 1COZA 1O96B 2PBFA 2B1QA 2VDVE 2WSYB 4HEA1 3KZVA 4CKCA 1IQ0A 1WF6A 4XJTA 4BP1A 3G6KA 2C57A 2O1SA 2PAFA 1TYCA 3W2GA 1R3UA 2ORWA 3D7MA 2CL5A 5A9TA 2FRDC 3VKGA 2NTJA 1N75A 2VBCA 5HIIA 4R9VA 1U2RA 4RX1A 4IUDS 4UE3S 4C2UA 1NOJA 5FAKA 4JVMA 4KWCA 2E49A 3WBFA 1X13A 2P4EA 1E7SA 1KJWA 3LYHA 3DAFA 3UAVA 1W73A 1YBMA 1YQEA 1VKHA 1Z5ZA 5ETJA 1T3HA 3WIVA 1ID1A 1L5RA 4V0LA 4EX7A 5BWBA 1T0IA 2WJ4A 2IH4A 1QAOA 1IEWA 2IZOA 1Q7EA 4FFOA 3BTSA 4Y6SA 3ZDQA 1KQPA 3EHEA 4CJXA 1Y80A 3PUWA 2R6ZA 1Y1QA 2FR1A 5BN3A 1D1TA 5AESA 1P5FA 1KOFA 2VK8A 5L3SB 4D2IA 1XG5A 3GDHA 1RLJA 3V7WA 4Y9DA 3KPUA 4DRYA 4HYYA 1HFEL 3N8KA 3A3OA 3EGDB 5A4KA 1RLMA 1PSDA 1SVIA 5LOVB 5EJ2A 2GEVA 5FKJA 3FOWA 2Y4NA 1IY9A 5DH9A 1Q0QA 2FMXA 3F6YA 4GPD1 4ZV9A 4EG0A 5BWLA 2EKQA 3VNUA 3HFRA 1D5CA 4KP7A 1YASA 5KNDD 2OM2A 2VHWA 4J6FA 4DLTA 3E9EA 4X90A 1KMHA 1BOFA 2CKMA 5BW8A 4IG4A 4DY4A 3GRCA 3AFNA 1FUYB 1Z6GA 2OORC 4LFBB 3KZOA 3HVIA 1U7TA 1YTUA 3ZWMA 1U8TA 1X8LA 2PH1A 3AI1A 3FYUB