5K0EA

Crystal structure of comt in complex with 2,4-dimethyl-5-[3-(2-phenylpropan-2-yl)-1h-pyrazol-5-yl]-1,3-thiazole
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
215
structure length
215
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Crystal Structure of COMT
rcsb
source organism Rattus norvegicus
total genus 77
structure length 215
sequence length 215
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k0eA00
2IBTA 2BZGA 4X61A 5EQJB 1X19A 3O7WA 4ER5A 5EKUA 3EVAA 3SXJA 5EKXA 3PT9A 3OU7A 2KW5A 5LQJA 3CJRA 1YZ3A 3EVFA 2PX2A 1JSXA 3HA5A 4U7TB 5EZQA 3G8BA 4C06A 5LQNA 2O06A 4FR0A 3A26A 3L8DA 4KVZA 1NW8A 5KS2A 2P40A 3BWCA 1XDZA 1XJ5A 3MCTA 4QVGA 3Q87B 3M70A 3FUUA 5EHIA 2H11A 2PSSA 1KXZA 1FP2A 4R6XA 2V74B 3E05A 2C7PA 4OBXA 1TPYA 3PFGA 4BY9E 2EG5A 2GS9A 2OYRA 4X1OA 3PX3A 5LQKA 2AZTA 4KRGA 5EEGA 5JR3A 1L3IA 5K0GA 1L3BA 2AVDA 3A25A 5HEKA 4POOA 3LBYA 2HV9A 4YUZA 3DULA 5DTRA 3LSTA 5DXAA 5FA5A 4XUEA 4P7KA 2DULA 2XYRA 4PIPA 4OX9Y 5CVVA 3M6VA 3RODA 5E9QA 4QPPA 3R9XB 3M6XA 3EEOA 2ZWAA 3NVKI 2VZ9A 4MWZA 4FT4A 4RTSA 4Z2YA 3FPFA 4FSDA 2PV0A 3B3GA 2Y1XA 2ZZNA 3K6RA 5CCXA 3HCEA 1FP1D 3EGEA 4IKPA 1JQ3A 3QV2A 4GUAA 4AZTA 4RV9A 3C0KA 2PX5A 3UJBA 3DR5A 3CKKA 4R8SA 2B78A 3DOUA 3BWYA 3FRHA 1VL5A 3GRRA 3GRZA 4Y30A 4FGZA 1ZGAA 3AXTA 1ZGJA 1MJFA 1WZNA 4RTNA 2P1DA 2QRVB 3NWEA 2AVNA 2B2CA 2PVCA 3G2OA 3G8AA 3I58A 3PVCA 3GCZA 5FQNA 4EK9A 2C7OA 8MHTA 1EQAA 1FPQA 4MIKA 3BGVA 3DLIA 4JXJA 1P91A 1BC5A 4BP1A 2H00A 4PWYA 3FTDA 4GF5A 1SQFA 2PXCA 3VC1A 1M0EA 3OU2A 3HEMA 3A27A 4PCLA 2GH1A 4KW7A 5CVUA 3VC2A 2FPOA 4G56A 3BGIA 2OO3A 2VS1A 3C6KA 1KYZA 1NE2A 1PJZA 2AR0A 4QTTB 5DSTA 5C9ZA 5EEHA 2ZIGA 2BM8A 3WSTA 5GM1A 4KIGA 3S68A 1ORHA 3FUWA 2YXLA 1QAMA 2V7EA 1RI4A 2ZIEA 5FUBA 1VP9A 3TRKA 2OPBA 3OFJA 5ERGB 1WXXA 3SR4A 1FBNA 3E8SA 4RTQA 5JUWA 5DM4A 5BW4A 1FJXA 3ER8A 2PY6A 5FCDA 4R6WA 4BLWA 4F85A 5F2NA 1Y8CA 4GOMD 5ICGA 3IYLW 1RJFA 3CBGA 3FUTA 3B89A 2I7CA 2AN5A 2ZBQA 5G02A 10MHA 4AZVA 5EG5A 5DPMA 3B5IA 3OE4A 5CCBA 2NP7A 1EIZA 3THSA 3BKXA 1JG2A 2G71A 2G1PA 1AQIA 4YUVA 3EVEA 1NV9A 2EX4A 1VLMA 3KKZA 3A4TA 4YUWA 1Q0SA 1T43A 5K05A 1NKVA 3M6WA 3GGDA 3TR6A 4C4AA 5E1BA 4YUYA 5GIOE 1Q0TA 2I62A 4ER0A 4LWPA 2VDWA 2G70A 5EMKA 4AX8A 2AOUA 1H1DA 4U7PB 4V0RA 3KQOA 3EMBA 3PX2A 3FYCA 3KQVA 1I9GA 4RTOA 2JHCA 3DLCA 1P1BA 1YUBA 5HFJA 3UA4A 1KR5A 5GINE 5K0CA 4AZWA 4PYQA 1VP3A 5FADA 5T6BA 4ER6A 4HTFA 2AOTA 1QZZA 3TMAA 2BR5A 3MTIA 1NW6A 1O54A 3P8ZA 4OA5A 2VP3A 3UZUA 5ICEA 1F3LA 1XCJA 1P1CA 5E2AA 5MHTA 4OBWA 1X1CA 2O05A 2O57A 2CWWA 2ZBRA 3ELYA 3OZTA 4OA8A 3OPNA 4QQNA 5DTQA 5EHGA 5K03A 5LQCA 4FP9A 1D2HA 2OB1A 4M37A 5K0NA 3M4XA 3RW9A 2AOXA 3IV6A 2JJQA 4PYOA 4HG2A 5FHRA 4HTFB 3KQWA 3M6UA 2AOTB 4HC4A 4X60A 5BP7A 2ZLBA 3C3YA 3QOXA 4YUXA 3FPHA 2CKDA 3MHTA 3P2IA 4DA4A 1XXLA 3BGDA 3LL7A 4DCGA 1R18A 3G89A 2WA2A 4HGZA 5HILA 3O4FA 2ZWVA 4BP3A 3GXOA 1B42A 1R6AA 2ONYA 3MB5A 1WS6A 3AY0A 3LPMA 2GLUA 3SSNA 1VE3A 1NT2A 1JTEA 1L1EA 1N7JA 4IV0A 3THRA 3SSOA 1NW3A 5EOVA 4EKIA 3NMUF 3HVJA 1JSZA 4GEKA 4M36A 3ERCA 5CUQA 1AF7A 5P8WA 1NV8A 1F38A 5FTWA 5E1OA 5HIJA 3V97A 3HNRA 1YZHA 2FYTA 5LQAA 1G55A 2NXJA 5E1MA 2NXEA 4F86A 5CD1A 3CC8A 2P7IA 3F4KA 4P58A 4EKGA 1WG8A 2PGXA 3HTXA 2UZ4A 5T64A 3UJ7A 4KIFA 5EC8A 3KR2A 2O0LA 3HCAA 3UJ6A 4QDJA 5B1SA 2HMYB 3NTVA 2PXXA 3UA3A 4ZTBA 4YMHA 4DKJA 2XVMA 2XVAA 2JHAA 2WK1A 3CJTA 3MQ2A 4HSGA 3HVHA 4FZVA 5DX0A 2AN3A 3EPPA 1TW3A 3KQQA 1XVAA 3LCVB 4RX1A 3KQSA 4DMGA 3NDJA 4PYJA 3JWGA 4BLVA 4GC5A 2P3LA 1P39A 1G8AA 1KYWA 1ORIA 1YB2A 2EJUA 2ZIFA 3BZBA 3HVKA 3JWIA 5FULA 3V8VA 4CKBA 4EVIA 3FTEA 3UJCA 3C6MA 3EGIA 1SVUA 3P2EA 5ICCA 2UYCA 2YX1A 1NBIA 3CGGA 2YR0A 4PCAA 2QY6A 4AZSA 4RSRA 3GDHA 2ZFUA 2YTZA 1VQ1A 2ONZA 2JH8A 2P3QA 3HA3A 4PGHA 2YUIA 1EG2A 4MHTA 5EGSA 1R8YA 4KDRA 1Z3CA 2HWKA 5DM0A 1R8XA 3UFBA 2ZCJA 1X1DA 1ZG3A 2O07A 3BWMA 1G8SA 2IPXA 4CWAA 2PT6A 3PLAE 3LKZA 1BKYA 2NP6A 2PWPA 2BH2A 2Q41A 3ANXA 3GRUA 5K09A 2CL5A 2XYQA 3EMDA 3ID6C 3BUSA 3KPUA 5BW5A 4RTMA 2WA1A 1AV6A 3GJYA 5LQRA 1AQJA 1R74A 3EVGA 3G5LA 4X41A 1KPGA 3ELDA 4E33A 2F8LA 1VBFA 5KVAA 4UOEA 3CJQA 2OKCA 2BM9A 4X63A 2Z6UA 1X1AA 3PTAA 3Q7EA 1YFLA 4H0NA 3LDUA 4C03A 3OZSA 2B25A 3UJDA 4GC9A 3GU3A 5HIIA 1RI5A 1JQEA 3JWHA 3SSMA 3NWBA 3AWIA 1QYRA 3HVIA 3T0IA 4E31A 3U81A 4BLUA 2FCAA 3HCBA 3LKDA 3GRYA 3KR1A 2EFJA 3OU6A 4PNEA 4PONA 1QAQA 4CKCA 4CTKA 4RTJA 1TW2A 3PFHA 2FRXA 3SX0A 1JR4A 2UYOA 4HRAA 5E8RA 5HIMA 3SGLA 3MCZA 3KPVA 4YV0A 2IDJA 3GIWA 3MTEA 5M5BA 5K8VA 1L9KA 5CVEA 2JHPA 2FHPA 2N47A 5CVJA 2PBFA 1M6EX 2IGTA 2GPYA 3KQMA 2ERCA 3NVMB 5H02A 3LGAA 3KPYA 2ORED 4DM3A 2G8NA 4GOLD 3TM5A 2ZZKA 3KPJA 5EMJA 5E9JA 1XDSA 3NJRA 5DX8A 3P9NA 5F2KA 3FYDA 5IKMA 2IBSA 2FK7A 3TM4A 3A7DA 4C04A 5CM2Z 4HH4A 4E2ZA 1JQDA 2YVLA 4R05A 5FA8A 3R3HA 4YMGA 4R8RA 3OE5A 3KU1A 3P71T 1NW5A 3TOSA 4E32A 5DTMA 2GAFA 4E70A 5EMLA 4M7RA 3LHDA 4EQZA 3DMGA 3HM2A 4A6DA 2AOUB 4L7VA 5HZMA 3EEYA 2Z6AA 4LWOA 3CVOA 3DH0A 3LDGA 4PGGA 4A6EA 1I1NA 4RWZA 3UJ8A 1JTFA 2GB4A 3TFWA 1RI3A 2VDVE 3ORHA 4RVFA 3KR9A 4C08A 3R6TA 3TPZA 4QVKA 2UYQA 1HMYA 3R24A 3GWZA 2QE6A 3FTFA 5DWQA 3LBFA 2AS0A 4P7FA 2EJTA 3IEIA 1V39A 4WXHA 5DM1A 4CXMA 5E9WA 5EMMA 3GO4A 3MGGA 4C05A 3JWJA 2PX8A 3MAGA 5GWXA 2PX4A 2I6GA 5F2OA 4E30A 3BWBA 4PIMA 3I64A 5DSXA 1G6Q1 5KQSA 4IWNA 3G88A 5GM2A 2IP2A 3D2LA 3DXXA 2OXTA 4RTPA 1IXKA 1KPIA 4C07A 4XCXA 2B9EA 3B3JA 2FK8A 3LCCA 2UYHA 3EVDA 4WVLA 4PYLA 5FWAA 5EIWA 4RVHA 9MHTA 1OR8A 3LCUA 2ZSUA 3ELWA 3IHTA 3LX6A 3TKYA 4DCMA 2P3OA 1XTPA 2IIPA 2NNWB 4HGYA 7MHTA 3GRVA 2OBFA 4M38A 1N2XA 3HCCA 1X1BA 1RJGA 2Z6QA 2OZVA 3OZRA 3A7EA 4E2WA 1YF3A 3O31A 4ER3A 1EJ0A 5GOZA 2LD4A 5CIYA 2IH2A 2QM3A 1U2ZA 4QDKA 5DX1A 1WXWA 2G72A 3FUVA 5E1DA 2NXNA 4XUDA 4DF3A 4RTRA 1G60A 3GNLA 1NW7A 2PJDA 4DZRA 4ATNA 4RTKA 2YXDA 2ZVJA 4XUCA 2P8JA 4PYKA 1SUIA 3TKAA 4E2YA 5LR6A 4MTLA 2ZBPA 3P9IA 3DUWA 1D2CA 3M33A 1BOOA 2ZTHA 1JG3A 3R0QA 5CVDA 5DRTA 2ZW9A 5K0FA 4CKEA 3C3PA 3G7UA 3UWPA 3I53A 5D1HA 3B7PA 2OB2A 3AXSA 3T7SA 2AN4A 3P97A 4YV2A 3KHKA 4IV8A 3E23A 3CCFA 4CTJA 3DMHA 3PB3A 2ESRA 3DXYA 3DXZA 2NXCA 4OQDA 5DM2A 5FWDA 5C1IA 1YFJA 3FTCA 4PINA 3REOA 3LDFA 1ZHFA 4FS8A 2P41A 1EJ6A 3FPEA 4RYLA 2QRVA 2HR1A 5K01A 5EIFA 5KYGA 1SKMA 2XBMA 1DCTA 3DMFA 4RTLA 2R6ZA 2YXEA 2YQZA 2PWYA 3G2QA 3K0BA 1UIRA 4GQBA 4O29A 3SVZA 3FZGA 2HTEA 3H2BA 3HCFA 3VYWA 1I4WA 5GIPE 2P35A 2ZZMA 1VIDA 2A14A 3P2KA 4GBED 3OFKA 5U4XA 2H1RA 1IM8A 3G2PA 4OQEA 3X0DA 3KQYA 3FPJA 2ADMA 2HNKA 3PS9A 5EVJA 2IDKA 5E2BA 5GP1A 5LSAA 5D1NA 1RJEA 5IH3A 2GA9A 3EVCA 3RIEA 1N7IA 2PLWA 1PRYA 5LQUA 1G38A 2C7RA 3E7PA 3VSEA 5ICFA 1XCLA 5FHQA 2PT9A 5HIKA 3G2MA 3T7RA 2ZULA 1KPHA 2E5WA 2OY0A 2Y1WA 3EVBA 3TLJA 1UWVA 3G5TA 1D2GA 5K0JA 3NW9A 3T7TA 5DXJA 1UFKA 1O9GA 2C7QA 2AOVA 3TQSA 5EZSA 3SM3A 2P7HA 1QANA 4GOND 4ER7A 5DRYA 1ZKDA 3LECA 1DUSA 3FRIA 4KDCA 4ISCA 1INLA 3AJDA 4P7GA 2B3TA 3DP7A 4QTUB 2IFTA 4QQKA 5K0LA 5DLYA 5FQOA 5C0OE 4PYIA 3FUXA 2JG3A 1WY7A 3NDIA 4FSXA 1JG4A 1RJDA 3FPGA 3HA7A 4YV1A 4RVDA 2PKWA 3OCJA 1BHJA 1R00A 5HOQA 3B3FA 1HNNA 3UBTA 4B17A 1M6YA 4Y2HA 3UJ9A 2VDUE 4GOOD 3KPWA 4PYMA 3BKWA 2JH9A 4FT2A 1L3CA 3MERA 1SQGA 4EMSA 3QOWA 5EPEA 3HCDA 1IY9A 2I9KA 2CMGA 3ER9A 5DT2A 3BT7A 4AUKA 2IH4A 4DQ0A 1MHTA 1SG9A 2BR4A 1JG1A 2CMHA 3P9KA 4K6MA 4KWCA 3P9CA 4NECA 4F84A 1KHHA 5K0BA 2XYVA 3ME5A 5T67A 4LG1A 2NYUA 3UJAA 4PYNA 5KQRA 2R3SA 1O9HA 1RI1A 1XDUA 1QAOA 3BXOA 1NBHA 4MQ4A 2BR3A 3EVZA 2IH5A 3KQPA 2K4MA 1ZQ9A 1EAMA 1SUSA 2DPMA 1DL5A 4P7JA 2AOWA 4RVGA 5E8JA 2PXAA 4QPNA 2QYOA 1KIAA 3DTNA 4LECA 4V0QA 5K0EA 3EGVA 3ELUA 4E2XA 1RI2A 3HP7A 3SMQA 1VPTA 5BXYA 3KQTA 3I9FA 1KP9A 3I5UA 3KR0A
chains in the Genus database with same CATH superfamily
1HL7A 4OAOA 2AXPA 4WLEA 2Q3DA 1X19A 2NP6A 4G36A 1TCCA 2REBA 3GX1A 1YS1X 5J43A 1Z2AA 2F1HA 1CV2A 3BK7A 3DFIA 3GB9A 4JJAA 2B8TA 4MWSA 2PX2A 4XI9A 2DU8A 5AW7A 3FOFC 3G8BA 2X8WA 4FR0A 1QH8A 2NVOA 3F3MA 1JDPA 4RE5A 5LXTA 3CLTD 3BMQA 5DHTA 3ZGNA 5JMOA 4KE6A 1FDUA 2CUKA 4NL4H 4FJ0A 1U9ZA 1VB3A 5LZ8A 1P9LA 1JKMA 1A5BB 2HQSA 3AVUA 1U8TA 1Z0FA 2VWGA 5C1BA 4LDJA 3OFND 2DE0X 4ZI2A 4OSOA 1TPYA 5IDYA 4UUMA 5LDDC 1PV1A 1DAOA 1ZXLA 3EJWA 3IPCA 3TLAA 3ZWPA 1EJBA 4PFSA 1ZOPA 3K96A 2RK6A 2TYSB 3GIDA 2P78A 1CTQA 3FH0A 4QSMA 5LYJF 4J0KA 3FDJA 1WQ3A 4URUR 4CKXA 1C8BA 2C3PA 2FW1A 4WKPA 4DM7A 4Z2AA 2O1XA 4RSMA 4RXTA 4XWAA 1J8QA 1GPLA 1OLUB 2HMWA 3MSXA 3I6ZA 4KWTA 4OJMX 5F4ZA 2JVIA 5J9FA 3NOVA 3JALA 2JCBA 1DFGA 1JWBB 2CVQA 3MZ0A 5FL3A 3KQUA 3HCEA 1G0NA 2D2IA 1OXKB 4K9PA 4M8IA 1KOGA 5JWRA 1BCSA 5EESA 1VCIA 4HAOA 4BZXA 4EYQA 4F9TA 4UM7A 5JSKA 4H9GA 4UQLA 3BWYA 3FRHA 3CRQA 3GRRA 2VK2A 5I51A 5KIAA 3FIUA 3U3MA 2P1DA 1L6IA 2QN9A 2WOOA 5C5IA 4KIWA 4RXMA 2JJ2A 3HJUA 4G3XA 3EY4A 1FPQA 1WKVA 3RAPR 1X7YA 1ITZA 3MQFA 2VAXA 1C0PA 2ODWA 1QP8A 2XF8A 3DAHA 3QU5A 5I4BA 1D1SA 3OM1A 2H00A 4QASA 4TTQA 1JDTA 4R84A 2X0NA 4DKXA 4MV1A 3F6YA 3BL5A 3BXGA 1NZDA 3PUKA 2VQ3A 4D98A 3V1KA 3AM1A 1KRXA 4B4OA 3CUUA 3B78A 4XRGA 2XD4A 4Q6WA 1E8NA 1E2QA 3MJCA 3PG5A 1SCUB 4NKRA 5A9RA 2GJ4A 1N2CE 4HH0A 3DOOA 4OUDB 1VA4A 2VYVD 4LXUA 1KEZA 1H8EA 1WP9A 4OREX 1ZU5A 4ZRMA 4EB3A 3HS3A 1XCGB 2FN3A 4JI7B 3PYLA 5SZIA 5ERGB 5JCOC 3M7IA 3PYMA 3A37A 3H4VA 2ZI5A 4F85A 3MFQA 1YHZA 3KM0A 1AKWA 3O2SB 1OZHA 4MWCA 2ZUUA 4O4LB 3OSZA 5AHOA 4YONB 4MPRA 4QDXA 4JJZA 4R9RA 3B89A 1TQ4A 3GFTA 5H68A 3OQJA 3WGKA 3VXKA 2PO7A 2QD5A 4PPFA 4MCJA 4G5QA 4N5NA 4QM7A 1VE9A 2ID8A 2JIBA 4UHCA 4RJJA 5CGZA 5FBQB 3RK0A 4ZYZA 2IXDA 3DUFB 5SZKB 3JYLA 2G1UA 3C87A 3VOSA 4QZVA 3HN2A 1JPJA 4EKNB 1YVRA 4OHKA 2GETA 3AHEA 2GAAA 4NENA 3VNAA 4IIXA 3L0DA 1UFOA 1SBHA 1NKVA 2X7XA 4NWIA 5HRCA 1PQYA 2GSDA 2R7AA 1CJSA 2FQXA 3D31A 5DCWA 1GPAA 3C7TA 3U5TA 2G70A 2WFZA 2JD2A 4V3CA 4E1BA 4LJ4A 4AY2A 4LYAA 1MUUA 2Z57A 3ZIUA 1EQUA 3G79A 4JQCA 2AYXA 4IMPA 1VKOA 3GPIA 1VB5A 5GGYA 1EVEA 3DLHA 3K8YA 2GCGA 4O8ZA 4YCDA 4JU8A 1J1ZA 1KR5A 2C57A 5FTLA 2P69A 4L78A 1K5PA 3D4LA 4E94A 4G0WA 4QM6A 4RFLA 2ZTLA 4Y0AA 3GYBA 3B1ZA 3MUOA 4NPCA 4RABA 3M3DA 3EIWA 4E5DA 1UBCA 5AM5A 4RHYA 3WLAA 3NAMA 3ELYA 4KFCA 3E3AA 1DS6A 3P9SA 2FEXA 4IZOA 1E63A 3Q0IA 4M37A 1MFPA 4QATA 1IU9A 1F14A 2BFCB 2V1XA 2GCOB 4EB8A 5B3JC 2A9JA 4XWKA 4GQAA 4DMLA 2Q9AA 5FHRA 4B82A 2O3RA 1DQYA 1DUVG 1GKIA 2J30A 5JNTA 3EG5A 3ABRB 4DOMA 2HREA 4GEGA 4C0JA 4P5EA 1WCWA 9ABPA 3ZX5A 1HDGO 1MAUA 4QEDA 5BMOA 2XRFA 3X2EA 3PGVA 4EJMA 3O4FA 2JJ2D 4UBJA 4E11A 3HBFA 3WK6A 1QGED 1QU2A 3HJGA 3MB5A 3AY0A 4HNQA 3K0CA 1IE3A 1YFZA 3TL2A 2XOEA 1AKEA 2C2WA 1QH9A 2VWQA 4JYPA 3NMUF 7REQB 4KYIB 4Q34A 3IPLA 3TNYA 1F38A 4W1PA 4DV0B 1QH8B 3WL4A 5LXTB 4EMUA 2V7QA 3BMQB 2GPAA 1Z36A 2XWQA 4CDGA 4DDTA 3NCTA 1J9EA 3ZHSA 3IEPA 1JAHA 3KJFA 1DWPA 1H8ED 1KJWA 4JD5A 4BEJA 4E5PA 3ZWWA 3IBYA 4KXYA 4EBFA 4EH1A 4ZTBA 3G85A 4FXOA 4DSNA 5F73A 1I6KA 2JHAA 4HSGA 3DYVA 5IZCA 4GX2A 3AUAA 3AUJB 5E3JA 4DMGA 4FFLA 3V2HA 5KU7A 3JWGA 4OSPA 4QNMA 2D0DA 1G8AA 4FFSA 4XYMA 1IRXA 1BU8A 3BZBA 4S05A 1I4EB 2P9EA 5GJCA 1FYWA 1JXQA 3JQDA 4L08A 5HMLA 4EBBA 5KTRA 3G0HA 4JYMA 3PFBA 3V8EA 2OORA 1PSWA 1SCBA 4TPKA 5IJXA 3H5NA 3JALB 2PH3A 2X1HA 3TTXA 4TTJA 3UJ3X 1QWOA 3HH8A 1M8JA 4UAGA 3HA3A 1XGKA 2CNDA 5SZJA 1UPBA 3PLNA 2RHDA 4IY1A 1BCSB 1RYHA 2ZK7A 2BFBB 3F4LA 3WYAA 1TJPB 1U9IA 5IRCD 2EARA 4N5DA 2QZSA 1OFVA 4G0MA 1TYAE 1OWNA 2A86A 2HMUA 2VIIA 1KERA 2YWJA 4I55F 5CB4F 3U56A 3VH4A 1UXGA 2IPXA 3NIDB 4OP2A 4V1CA 3PFCA 1MEOA 1Q0RA 3RGGA 3BUSA 4QJ5A 1W76A 1X7YB 3CZQA 2WNIA 5M34A 3B1WA 1VLHA 2W70A 1LKZA 2X0RA 4LOKA 2X3FA 2RB4A 3CLRC 3HXLA 2J67A 5AJYA 3KAKA 1XTIA 1EAYA 1QBGA 4NV1A 2ORIA 1T6ZA 1QG6A 2R1VA 1JQKA 5BOSA 1SCDA 2D0IA 5EI5A 2C7BA 3BHIA 3WYCA 4R1QA 1ZSYA 1U9JA 4I9NA 1TKBA 3N5CA 4OK5A 1XRQA 4G5FA 4KX5A 3ZDQA 1KSJA 1NR1A 2YVQA 1TTHA 3PJEA 3UC9A 3VHXB 1UK8A 1LJUA 4IUCS 4GZLA 1SXHA 4V0SA 3VSBA 2HEGA 4PONA 3PWTA 2F64A 4PYRA 4NAVA 4ZRNA 5HQTA 3K70B 2M2IA 2ZJOA 2NO7A 1KAHA 3B7GA 1L5FA 2FMKA 3NM5A 3KPVA 2JFQA 3GEEA 4Q4LA 1XL0A 3RS8A 2YWCA 3U3ZA 2VPZA 5CVEA 3VO2A 2IGTA 4DGSA 2Q5EA 1ZMTA 2HYIC 4HLNA 4CKCB 3LOQA 1G2QA 3B12A 2V7QD 4YALA 3DTYA 5IN4A 5JNSA 4IMIB 2A94A 4R3UC 1NTRA 1MA3A 4NENB 3DGFC 3M89A 1CQXA 1GZ3A 3QVKA 4F5DA 4QVIA 2JD1A 1NDQA 4TMWA 2QF7A 3PDHA 3OESA 2PZAA 3VYUB 1TMYA 4IYJA 1FMJA 4JEIA 3TIIA 1JH8A 1N0WA 2C1ZA 3MLAA 2XCLA 4DEXA 1Z68A 1UUFA 3NBXX 3TDMA 2PSJA 3OC0A 5I47A 2WT9A 1QGUA 2PSFA 3OMLA 5K0SA 1PNQA 1T2VA 2IK8A 3OZDA 1LLCA 5L40A 3RC8A 3GNSA 4A8TA 1LPPA 4IJ5A 3AOEC 3EQ2A 1O95D 4QVKA 3MWJA 3R9WA 1TQ6A 4DXDA 5AICA 4F4FA 1E8DA 1V6SA 2PK3A 3FPLA 4ZGBA 1RVDA 2WVHA 1H1LB 3V3KA 2FZ5A 3EA0A 5DM1A 2Z4TA 2BN4A 1OAOA 2QL5A 4KK4A 4JI2B 1KGSA 3JWJA 5GWXA 4I8DA 1GYQA 3BULA 5F2OA 5AKZA 4YPFA 4WGFA 2JFNA 4LMBA 3HCPA 1E3WB 3UK6A 4A0QA 3A2MA 3N7UA 2VP4A 5TEVA 3TXXA 2XKJE 3K92A 1KPIA 3Q6MA 3B3JA 3DE6X 4ZK6A 3HFRA 4NCKA 4I1SA 1XLVA 2OLKA 1DGQA 1HZZC 2WYWA 3IEUA 1CERA 4KTTE 4D45A 1HQDA 2DAPA 2PZJA 4H18A 1ESEA 1KWKA 9MHTA 1KP2A 3DGEC 1DELA 1YR9A 3HSSA 1ACLA 1FNMA 1RKUA 4QXPA 1SHJA 2NNWB 5TNXA 3GRVA 1ZXXA 5EGNA 5LYYA 3VZPA 2WP8J 4H6WA 4DMHA 5BPHA 1JR6A 3OCWA 1XQYA 4CLHA 4WZZA 4E5MA 1GA1A 3BMNA 4E2WA 3DW3X 1OVMA 4GPZA 1JBQA 3X2FA 2KLHA 4WCFC 1GYRA 3C7CB 5DOZA 4PFKA 3LYHA 1WV0A 5HR5A 1U0FA 1YE3A 2I80A 3FNEA 1NW7A 3NP7A 2PJDA 1OC2A 4ATNA 1I6WA 5CX4A 1T8RA 1KEKA 3B7WA 3BJRA 3QFRA 2C07A 2O0KA 5IJWA 3NBFA 3C3PA 3DHYA 2INGX 3FDZA 2DFVA 2H59A 1IZYA 1XVVA 3LO5A 4K86A 3E23A 3BFXA 3W5AA 1BFKA 4DBLC 5K1ZA 2AJLI 1KYIA 3KT3A 3FTCA 3ICEA 3G2HA 4W1SA 3T5BA 1YB4A 3L0PA 4KQXA 2X9LA 1D6SA 2HR1A 1N0IA 2WU8A 1Z45A 5EIFA 1WU8A 1LDNA 4BAGA 3FA2A 2OT3B 3G0CA 3NM6B 4M0DA 3S8YA 5TJ9A 5KYXB 3K9LA 1Z5VA 4LISA 3ZE1B 4ESEA 4ZCMA 3FAZA 4N8SA 4D1YA 2ADFA 3DBVO 1O0SA 5AOBA 3IO3A 1JDVA 3HCWA 3EOAI 3FCOA 5BT8A 4I50F 1E9BA 5CXXA 5AVKA 1DEKA 1J1IA 1KXJA 1XU4A 1M9NA 4NBUA 3RVNA 3D7MA 1NYQA 1Y81A 4BVFA 4EX6A 2AW5A 3VPAA 3H3FA 4G0OA 5HIAA 5D1NA 3NV9A 5F1PA 5MGBA 3E9EA 5H5JA 4MDEA 4B3RB 2FUG6 1E0JA 2ZIWB 4OQQA 1XRMA 1P8AA 3EC1A 2W5UA 5LA6A 2C7RA 4Q39A 2G0AA 5FHQA 3LC2O 3TUIC 2PT9A 3AY6A 2H52A 1HYEA 1D4OA 2OY0A 1P60A 4W6ZA 2I2WA 4LRSB 1G21E 3A6ZA 1YZVA 5CJ2A 5DE3A 2XT9A 2XTNA 2BCEA 1R88A 3HY4A 1DAKA 2BMVA 2R1VB 3D6NB 2IELA 4GOND 4QBKA 4S35A 4Y2YA 4MQLA 5KYWB 1XTKA 3N1UA 4V2IA 3QVGA 4EHHA 4BMVA 4XVUA 1NJGA 2YFQA 3IJPA 4EFNA 2GBLC 2P9TA 5HKKA 5LZ9A 3N8HA 5J40A 3MWFA 4MVCA 2BFAA 2AW3A 3IOMA 3IUEA 5ULLA 4ALJA 3ETJA 3EGDB 3F7TA 5IDWA 5L3SB 1CRLA 1DUIA 1ZCBA 1QO9A 4BEBA 4L07A 1DHRA 3JATB 3F47A 3CGWA 2FF7A 2C29D 5CPBA 3P32A 4C43A 5HOQA 1I7SB 3GELA 4PVCA 5T6MA 1PZHA 3N28A 4LW8A 4XYLA 2ANBA 3ZLTA 1HQYE 1SUCA 3DAPA 1M2KA 3NBKA 4KR3A 4MGHA 4A1FA 2X8JB 1SVIA 1YZYA 3QMPA 4D6XA 2I9KA 3Q3CA 3SQNA 4I3FA 1K0UA 4EY5A 3PNKA 1BH2A 4EYSA 4DQ0A 5IUJC 3JR7A 4F97A 821PA 1ZOOA 1G5TA 1LDBA 4IDAA 1PFQA 1SUEA 3P9ZA 1KHHA 1NXQA 4O2BF 5LOVA 3IR7A 2H0QA 1J0BA 4IH4A 4L0CA 4IHQA 3O3CA 4PC3A 3RUFA 1Z2DA 1UDWA 1Q22A 5D5PA 3N39C 2HLDA 3OWXA 2BFWA 1RI1A 1D2NA 1NY5A 4B76A 2EYQA 3FVRA 2IXTA 2CHFA 1RR6A 4AF8A 2JHFA 3QI7A 1THGA 2L19A 3UOGA 2PWBA 3X1WA 4AC9A 2Q2OA 3L1UA 3CCCA 5E8JA 5ELXA 2ALJA 4OV6B 1T26A 5EJ8A 4LECA 4B75A 1R12A 1QHSA 1WTAA 5DN9A 3C6XA 2Q0QA 1T4BA 1BN6A 1JEEA 1BMQA 2F1OA 3D7KA 4GW3A 1HFWA 3E9NA 3IPAA 2D5CA 3Q15C 4MB6A 4YLGA 3AJRA 2HSWA 2XGOA 4OI0A 3L7JA 1Y98A 2IGBA 3ZDDA 3Q3GE 2GEKA 3UV6A 2O8NA 3A10A 4ZJPA 2SNIE 1MGOA 2C5FA 5J2TF 3RFCA 3SJBA 1MW8X 5EKUA 3EVAA 3GGGA 4DABA 2ATEA 5BQOA 4GDMA 4CM3A 4K40A 5TT1A 2I6QA 3OF5A 3ZBQA 3K1YA 3HYCA 4PQRA 1G7RA 1T5HX 4XOUA 3O6VA 2PAFA 4KMMA 1LJ8A 2FW9A 1Y6GA 1Q0LA 4K03A 5LYJA 1KXZA 3KNZA 5B6JA 2A1IA 1JLRA 3O90A 1YH3A 5DBHX 5JRDS 2HSZA 2A1TS 4KI7A 1DINA 2QTMA 1XC7A 4BV2A 1OJ7A 3BMNB 5AO9A 4NNJA 1QHGA 3S8MA 4EA8A 2QY9A 1MAHA 4E1VA 4QT4A 2OGUA 3K6SA 4TV8F 5BN5B 4W6QA 4R1NA 1Z83A 3D1LA 5BRNA 3WGQA 5HKKD 2G9ZA 1PDVA 1LTQA 5G1PA 3LRXA 2ZZNA 4B3MB 3V00A 5TARA 1B3RA 2X8BA 3UIEA 3IDAA 3FDZB 5T57A 3GJQA 1E2EA 2XWJI 2KQUA 1YJBA 3QJ5A 1BQ4A 1V71A 1WA5A 4LCBA 3USES 3R8FA 1JR3E 4W8GA 5KCMA 1JPUA 2XUPA 3WAGA 1ZGAA 3R77A 2VHYA 4JQOA 1DG1G 1QHHA 1WZNA 1HNXB 1I2CA 1CJTC 3NHJA 2YW2A 3EGOA 4IHAA 2I65A 4L9AA 1DFIA 2A88A 2RJOA 3KSMA 5JMWA 1AB6A 1E9EA 1UPUA 1TYDE 3R3SA 4YAFA 4EI8A 4QKQA 1T9AA 4EPWA 2PFGA 1GZSA 4OH7A 3ZDYB 2HDHA 2FSUA 3NHBA 3O21A 4L7QA 3PPXA 2GH1A 1T8WA 4TXMA 5F1KA 3TTWA 1W8DA 3V8BA 2FVYA 2DF8A 3C6YA 2VS1A 2WFMA 1YJXA 4E12A 2CHVA 3QLVC 1EK1A 4CU5A 4RO0A 5ER9A 5LA6B 1L5YA 1R6TA 4WLNA 3U0VA 1ORHA 2I4OA 3GNQA 1S2LA 4XGNA 1FDIA 2HRRA 2ZIEA 3W2HA 3EDRA 3Q7TA 4LYGA 3RJZA 4IGFA 2ZVQX 4NOJA 1FBNA 2C59A 1OU0A 1GGKA 1VI5A 3SICE 5BW4A 5FCDA 4ZCTA 3C6BA 1LUAA 1E7SA 3DLTA 4RK1A 4BMPB 3P0JA 2XUZA 4QTYA 1U31A 1UL1X 1KEWA 5T3UA 4XJSA 2E85A 2Z6VA 10MHA 1V1MB 1G4AE 1MJGA 3JQ9C 1WU7A 4OSEA 5JI3E 1D09A 2NP7A 2G40A 5FD8A 1FSPA 1OBVA 2V1UA 1UC8A 3OQPA 4P0TA 3P0HA 4WDQA 4EWLA 3FKJA 1Y7IA 1I10A 1VOTA 4LOLA 4LYFA 4EI2A 4HGOA 4K9OA 1ZUNA 1U6IA 1G3IA 4X90A 4AZ0A 2FG6C 4YUWA 4FE7A 5I7HA 2OEPA 2QRNA 1U8ZA 2BKVA 1MEEA 1MMFB 2FEWB 3H0CA 3IDSA 4WKOA 3TJZA 2PCJA 3E8XA 4PAQA 4AF6A 1H8HA 3QFFA 5LVAA 1KEEA 2GHRA 4KK3A 3T3EA 1N2JA 4JP1A 3EIEA 4YAOA 1HG0A 1SC3A 5J2UF 3BG5A 3DLCA 2QX7A 1P1BA 1SD5A 2Q62A 4FX5A 3T99A 4ZREA 1GFWA 2Q46A 2RG1A 3EODA 4FINA 1R0XA 4PZZA 5HG0A 3ZHRA 1QV7A 1L0BA 2O8EA 1S3SA 1QFMA 3T3MB 5LOVB 4JBHA 3KKNA 2PANA 2VN8A 2G5PA 3URMA 2O05A 1Z6YA 3A1NA 3VTKA 2FLVA 4CJXA 2GA8A 3I2KA 4KWIA 5FTJA 4B8YA 2IHZA 2KLBA 3R3ZA 5KPDA 4N3BA 1WDKA 2JAQA 3KQWA 2AOTB 4OJTA 4UU7A 4RJTA 1LRLA 4II3A 4Q1CA 3SC6A 5KTTA 2C83A 2YJ5A 3GT0A 3DL2A 3KKEA 3QX7A 4QWMA 3MHTA 2J5RA 4KO2S 5C34B 4DCGA 2PUJA 3OAAD 3ZWMA 2DXIA 4OXXA 4N65A 4OAQA 3QVWA 4CYMA 3OPXA 3LUBA 1TT5B 1SWVA 3M6LA 1W73A 5BUQA 3AJAA 5IAJA 2O20A 3THRA 1Z33A 1DRKA 1NG1A 3SVLA 3PA6A 1JSLA 2ZRGA 3HVJA 1JSZA 4JMPA 4WERA 3KB1A 3MQ4A 2X8AA 4ZYTA 2GJAA 1MTZA 1E60A 2FYTA 1L7MA 3VNUA 1UOQA 2CJWA 1ESCA 1Q12A 2P7IA 3EY9A 2RKBA 1OFHA 2XRYA 2HC9A 3ROPA 3HTXA 2B6NA 2TMYA 2E21A 4XX1A 5LYJB 1K6XA 1EBUA 3HCAA 2IYAA 1RWXA 1VJDA 2IC5A 3G0GA 2OKGA 1N0HA 2G7MC 1UFQA 1LQTA 1G8PA 1U94A 2G1JA 2XVMA 3PUVA 4CFZA 5BN3B 1Z7WA 3ROTA 1MC5A 2BFNA 1L7BA 3AV0B 2B8JA 3KHTA 3IL2A 3R7FA 3DOHA 1PSZA 1R4MA 3KQQA 2P79A 3BJEA 5GONF 2XCQA 3WBKA 1Q7RA 1ORIA 2FW0A 3CIOA 3F2IA 3K6SB 4WXYB 4CKBA 2A6PA 1PS8A 1JG6A 1U0NA 3L79A 4TVOA 3F6BX 2VHZA 3UJCA 1JT2A 3JVVA 5JNRA 4H3KB 1M75A 5CB4A 4KRYA 4WW0A 1J24A 1VE7A 2W22A 1VG9B 3PNQA 3WAJA 4IM7A 5ARDA 1BWRA 3GI1A 4PN3A 4J0GA 2YUIA 1C9MA 2ZDQA 2GRJA 3I2YX 3Q7RA 4JI6B 5K0TA 2VNHA 4JYZA 5BNIA 2J5QA 3C3BA 5ILQA 2XOXA 4RFSA 1VJ0A 3ETHA 4EHFA 1QHHB 2H92A 4HNTA 2DB3A 4BJHB 3M1AA 4ZVRA 1G8GA 4MKGA 4F71A 3DDSA 2Q41A 2D4AA 3HCOA 1D07A 1BDHA 4TUYA 4UTVA 1VJRA 3FWHA 2OOKA 2ATVA 3OQ6A 3K9BA 4EYGA 1AQJA 1OQAA 3I83A 2HZBA 1TIPA 1RAHA 4KV9A 2QTVB 3IODA 3IUJA 3K9NA 3VR6D 3WIVA 5EKSA 1NLZA 1O57A 5ALVA 4QXMA 7ADHA 1CEXA 1JIIA 2R5NA 3ZDCA 1TAHA 1HTTA 1UOEA 4HUTA 3DC2A 3K9GA 3PVZA 3QHPA 2O6LA 5K4AA 3WA7A 2HDNB 4H15A 3QWAA 2R79A 1XIVA 1YQQA 4MX8A 3E48A 3LE8A 2ACVA 1RYMA 3CWZA 1VPWA 4NJMA 4YP1A 3SQLA 1QYRA 1P4RA 1B73A 3LT4A 3SYKA 4M9CA 4CCYA 3KL2A 3H87A 2ZRHA 4CLEA 1QOQB 1QAQA 3W06A 1XP5A 4G8JA 4MVJP 1P44A 2DUUA 3ZTWA 4DNOA 4OQYA 1KP3A 1ID8A 2ADOA 2OZLA 1Z4QA 4KFUA 5TS2A 3MTEA 6PFKA 3DBIA 1YA4A 1W5SA 1SU7A 1UBMS 3CBQA 5F3DA 5KX5A 1HBJA 5EFZA 1ZD9A 1CLUA 3NIBA 1ZK1A 2WJYA 1L8OA 3JQ6A 2II6A 1L7AA 1AKMA 1X9HA 3L8ZA 3ESCA 3LGAA 3M2TA 4K6KA 1O0CA 5I8ZA 2W2VA 1ZUNB 1ND5A 1P61B 4AZ0B 2OBMA 2RSLA 2IQIA 4U2GA 5JBQA 2H7XA 3AUFA 3VJRA 3OE5A 4YTEA 3DF7A 1XZCA 4L02A 3I73A 4MCAA 4XOIA 5EXPA 1S2MA 1I01A 2ZAGA 4Z0TA 3SBXA 3AQ4A 3I2HA 4EQZA 2UUPA 4L7VA 4TT3A 3BM5A 1KEEB 3D81A 3PE3A 3SZGA 2QDXA 1X74A 3EXG2 4CM4A 2OSVA 1KVUA 4LPSA 1C4KA 3G02A 3L4BC 2VYCA 4M6WB 2IEIA 4ZV9A 4DV6B 1XU9A 1NLFA 1NQWA 3EWAA 1BQ3A 4ZDKA 1ZY2A 2O8EB 4OI2A 2OCIA 3CEAA 4MW6A 5EQDA 4UKDA 1E5DA 1MXFA 2IXGA 5DBEX 1YQGA 3ZD6A 3U7IA 2AS0A 1T2FA 2EJTA 3I9V1 2Q6OA 2ES4A 4G1MB 3IHKA 1J4AA 2YJGA 1H4VB 4GYYA 4KFRA 3ND8A 4LQ4A 2EKBA 3TCNA 4U9HS 1ZGGA 4C0LA 4HAXA 4ZN6A 4JXKA 4C0WA 4HEA1 1CUSA 1KZ1A 1I7LA 4MVWA 2R4QA 2W6JA 4PIMA 3INGA 4MDFA 1M73E 3MJEA 4TLDA 4A6XA 3SS8A 3R5KA 1E7YA 2H8KA 2IP2A 2IU6A 4RC9A 2IEDA 1V0JA 3COYA 2PO5A 3MIZA 4C07A 3AIIA 3P0FA 5HFAA 4DJEC 1Y3BE 3T9EA 4MRPA 4ZQBA 2V7WA 3OVMA 1OFIA 4YJDA 1CJVC 3PQEA 3GVXA 2MSCB 4WOCA 1KYQA 3L2OB 4LYDA 3STTA 4AWBA 4D80A 4DLKA 2OP0A 2I66A 3DE3X 2RH9B 1HK7A 4H6XA 2QN7A 5F51A 3OA2A 3RUPA 4BNHA 1AHPA 4O2RA 3ZTTA 4MKRA 5AHWA 2H7YA 2NO4A 4JYAB 3PHCA 1Z5PA 1QHYA 1IJEA 3AHIA 3Q5DA 2ON6A 1NQUA 3AW9A 1JFTA 1OTHA 4CIWA 2H85A 5FR1A 2QI9F 4PAGA 5LD2B 1TCAA 4N0DA 3PUJA 5E1DA 3O8QA 2WAYA 4UUQA 4MUIA 3BPSA 3C24A 2AQIA 3R9XA 1P9OA 2WWGA 1TPZA 4CODB 3AZOA 3P9IA 2L82A 3U4CA 5DGDA 2ZW9A 4L8FA 3G7UA 4M9RA 4HDQB 1GLNA 1SQSA 2OB2A 2REOA 1GZHB 1PDWA 2VPQA 3K1JA 4LNHA 1GUDA 5PGMA 2O5VA 4IV8A 3LQ2A 4J03A 1LK7A 1FTNA 3RWBA 3TIFA 2I3DA 4I4NA 4OHVA 1G2PA 2PYIA 1A9YA 2F48A 1QR6A 2C0PA 3PQCA 3HB5X 4FLMA 1YOBA 2ZR7A 3LDFA 5DGXA 3VR5A 3A0UA 3P5BA 4BQIA 2HMVA 4EELA 1Z62A 1T3SA 1QV6A 2DR0A 2PZGA 3CU5A 4TM8A 1SCJA 3B20A 1KQNA 5CB4B 5CGQB 5HTOA 1FK8A 1Q7CA 5G2OA 1O6BA 3G2QA 3E2IA 2V6FA 1P0PA 1AUVA 1J2TA 2HA5A 2OR3A 3O75A 4IPTA 4JT2A 3M0EA 4PTZA 4QWWA 3WLSA 1QRTA 2RJNA 3OOWA 4BLOA 4DLRA 1VJCA 4KR2A 1ZC4A 1SBNE 5U4XA 3ZDAA 1I36A 1YVDA 4L22A 5LZ7A 3EW9A 2XWSA 1DMSA 4GI2A 4RFSB 2WWWA 4KZPA 1T6NA 2FEOA 4HB0A 4RGBA 3W90A 2HK6A 4AUMA 3AWDA 3QEMB 2CE2X 2GJKA 2PRSA 4IKEA 4EFDA 3HY3A 4EPXA 4KNVA 4TUYB 1M1ZA 1GCOA 3BXZA 2H07A 5FPTA 3G2MA 1EVQA 2EQAA 2QZJA 4RY9A 4RYDA 1D1TA 1UWVA 3A9TA 3G68A 4NTZA 4Q9AA 3RT1A 3LUCA 2Y9MB 1PG2A 5TMPA 1DDIA 2ZRMA 4V0ME 4CV3A 1EA5A 5CNMA 4FEGA 4NF2A 2VOJA 2RBEA 1O6ZA 4ISCA 4J3JA 4P3NA 1X2BA 2VKQA 3AJDA 4K28A 4MPDA 4XVQA 5ECDA 3FETA 4XB6B 1FTGA 3STVA 2O5RA 4J90A 3UGTA 3QYPA 4H1VA 3WLPA 3RD5A 3GHYA 4GVLA 2CXRA 3GUCA 3I9JA 1X7ZB 2ZSAA 4CCYB 1X39A 2YN0A 2CNBA 3X1KA 1C8VB 1DQPA 4PYIA 4AJLA 4JJGA 3DHVA 5A3SA 5A4KA 1JG4A 3HA7A 2FSPA 3KU4A 2VG8A 1UDRA 3G5MA 1Z25A 4QEKA 4G2NA 2XQGA 5HW0A 1EUYA 2OZLB 3W7BA 2GYWA 3VPFA 2ZM6B 2FFHA 2AG0A 3OOJA 4O2BA 3E3MA 5DBIA 3W2TA 1D0IA 1ETUA 2VR1A 4B4KA 4KH1A 3B85A 1BXRA 2C04A 3V4PB 3MWYW 5FDFA 5KX5B 1L1RA 1DOHA 4XUGB 1X8JA 3LBAA 2I78A 1IY9A 2BLNA 5DEOA 4PHFA 1N5KA 1DT3A 1JAYA 4AUKA 1JHXA 1AG9A 2R68A 4LJKA 4M49A 4U5XA 1E1RD 4A0HA 5JAUA 1FRQA 3EPLA 1U8FO 4LG1A 2NYUA 3ETCA 3V8NA 2RFLA 4Y1FA 2AA3A 4EUFA 4HVCA 2IX9A 2P67A 2QUJA 1TXGA 3SYRA 4CM4B 3ZLBA 3HI4A 2B2XA 1Y3HA 4W1RA 5I7OA 1SZCA 5J2TA 4ITVA 1E2NA 5DBFA 3MYRA 3TH5A 3UTCA 2EW8A 3U62A 2QYOA 3A1EA 2DRIA 3HC7A 4KXNA 2G82A 4RVOA 2IZZA 4WLOA 1C8KA 2WP0A 3W5JA 4HN9A 1K6IA 3OJFA 4E2XA 5DULA 2ZE5A 3HP7A 1KVSA 5AESA 2FSIA 2VYNA 2O7RA 4NX2A 1C50A 1O1YA 2W8ZA 4CG0A 4MUNA 3GMDA 1J1UA 4ITRC 3TBFA 2XRZA 5DLEA 3EVTA 4M1QA 2FUNB 2LDXA 3PQ3A 3QPWA 3OOHA 4FZ5A 2HWYA 3LQKA 3QJGA 4UOZA 1L7RA 5CA0F 1JSXA 2FDCA 2XCOA 4GKVA 3TTTA 1GARA 1N6IA 1KH3A 1PR9A 1XEWX 3AQIA 1DJLA 4C3OB 4EHNA 2B4AA 5LM3A 2ZUFA 5FUQA 3T38A 4OHMA 1W9MA 3C3WA 3M70A 3O7MA 5EHIA 4BX3A 3CVUA 1H6CA 3ILVA 3KYJB 2PRKA 3WZ2A 2QE7D 4ID9A 2B2NA 2I1QA 3T0FA 1QGOA 1T4CA 4HZGA 5FBRB 2DWQA 2I1LA 1FRNA 3IEKA 1M6NA 4R9UC 1B4DA 1L3IA 4FQ7A 3H3XA 4FDVA 3C6ZA 4B0OA 4KQGA 1JDNA 1YR3A 3P94A 2OFXA 1JLLA 2ZIAA 4HYEA 1EUZA 2DBYA 2JCSA 4MOWA 4QJBA 4Q18A 2PGNA 1JSRA 2FFAA 2CXQA 2FX5A 2YWDA 2XEDA 3GZNA 3O8QB 1PZXA 4WL0A 1MAWA 4ZPXA 4PFJA 1FE8A 3O1IC 3RUCA 3R9XB 1IN8A 1G3RA 1WVIA 2CDCA 3A4MA 3AI7A 4P98A 2EFEB 1NC3A 4Q3BA 4PSUA 3R7LA 1T0UA 2IU0A 4O1IA 1XNQB 1G291 1R8JA 3SNKA 1P5ZB 3H4MA 1K2WA 3DR5A 2FX2A 5KPJA 1ENZA 1A8PA 3WSVA 4RUKA 5CXSA 4K3VA 5A3VA 2O8BB 3K9QO 1F48A 4KREA 4L5AA 3GLTA 2P77A 1TJ3A 4I50B 3PT5A 2YOGA 4C5AA 2CZQA 4N5LA 1C7ZA 5EJ6A 1RPZA 2B4TO 4PSAA 1P2VA 2PH5A 2ZS9A 2REQA 5BSMA 5A04A 4Z4HA 1AT1A 3TLYA 1T25A 3DDNA 1D1QA 3UF0A 1DX9A 3L0YA 3BGVA 5M7EA 3I5XA 1OREA 4JXJA 3ND7A 4NNPA 2WAOA 4EMTA 1QE0A 4R0VA 4GF5A 4WI1A 5JC8A 1QIFA 1WMBA 3A27A 4LPKA 2FPOA 1YZFA 3S4YA 1Z56C 3OIYA 1I3CA 3VAYA 4N47A 1NE2A 1I5EA 4GLFA 5ALWA 3RABA 2WDPA 4HH3C 4DWJA 2FEPA 3HEBA 2NO6A 3N70A 4CUJA 5GM1A 1YA6A 3WDLA 4AJPA 3FFBA 2P11A 4H7DA 3BERA 4F8JA 4FWTA 2GRUA 1EHCA 3SYTA 1FTYA 1EE9A 4IF4A 5BUZA 3CW9A 1TVKA 3PDJA 3R8CA 2VDMB 4DIBA 3U1BA 4RD2A 1XQWA 5DN6A 4KYTA 5F2NA 4LZOA 1LC0A 3T3IA 4YCNA 1NR7A 3CBGA 4RJIA 4YJKA 4WUTA 2C00A 2I7CA 1I4OA 1RXCA 3F7MA 4GLLA 4HI0E 4E08A 1DKNA 4QQ8A 2XCIA 5E7IA 4TV9F 1FUUA 2CJFA 2FW7A 1H2YA 3AEXA 5HKLA 1OXMA 1GGFA 5LMCA 4HMOA 4RKQA 3H9UA 2WTUA 5J2UA 3A2NA 1FRZA 2IU4A 3CV3A 1I32A 4CMEC 3F7NA 2EJWA 1Q0SA 4W7IA 1T1IA 2HQ1A 2PLFA 2QN3A 4C4AA 4DVJA 4WN9B 3WE7A 4M87A 1UDCA 3WMWA 2CXTA 1KQ3A 4LWPA 1B8VA 2V6IA 2FEAA 1GGEA 1BVUA 4J4TA 3STYA 2B1JA 1ZXBA 4O2BB 5AKKA 4ZFNA 3AL0C 2XWBF 4E6PA 3JTMA 1NF9A 1BXRB 3Q7PA 3LWDA 1VYUA 4H1UA 1GNVA 1IEXA 1NNLA 3ACCA 4QE3A 1O4VA 2VDNB 1NHWA 2IW1A 5AKYA 2BVNA 2HV8A 3DVQX 1GNQA 4FYWA 1GJRA 2VHTA 1C5KA 2OZKA 4M1WA 4B71A 4GL4A 4UCFA 1E0KA 2JLWA 1XHEA 1AO0A 2C7PA 2Q2NA 1KS2A 4TYYA 2GZ3A 4MICA 3P19A 5EHGA 1CRPA 2BONA 3NPAA 5L4LA 1D2HA 3DWIA 3HZZA 4PO8A 1WULS 5EY5B 3ITNA 4Z8XA 4DW8A 4ROSA 4BVEA 4N40A 3Q12A 3AEYA 1NNI1 1QGAA 5J2TB 5B36A 1NFRA 1P2GA 3TRFA 2VT3A 3WX0A 5D85A 3FB4A 1UAAA 2WMYA 2J5BA 3NG1A 2QUZA 2QL7A 4HDOB 4Q3DA 1NTOA 5AM3A 4GNRA 4V39A 4ZO7A 4RDCA 1A7KA 4TYWA 2AHOA 5F5NA 4GYJA 1CR2A 4NBWA 4YIKA 4JBYA 3EZLA 3P2JA 2EC5A 1KJJA 4EENA 3VM6A 1O58A 3ZC3A 4NIMA 1SBZA 3MTJA 2QQ5A 5ECGC 2W90A 2Q4BA 1LB1B 1F5NA 3A6FA 3I12A 4K8RB 1KFBB 1W0KA 4MB0A 2JKVA 5ADVA 2HMTA 2P30A 1KWGA 3WGZA 3AI2A 3TLBA 1NV8A 4BFLA 1GPUA 4ZV4A 3L4JA 1S2NA 3P7MA 4TWRA 2VQFB 3G9TA 2GPNA 5T5QA 2I54A 1UOPA 3GEPA 4PHHA 4TMKA 1ZM3A 4P3YA 3UB4A 3UJ7A 5AVWA 1ZAKA 3AR3A 3K4QA 3KR2A 4IGEA 1ZSVA 2YZ2A 3UGKA 4BO5A 1ML3A 5CFOA 2PMBA 4EGCB 3UK1A 1Z6TA 3K8OE 3ZY2A 3UA3A 1JJIA 2GN4A 2OK7A 1KDRA 3JARA 2XVAA 2ZQYA 3LDHA 4QOIA 1SUBA 4E13A 1QDUA 5LL6P 2WTAA 4JHLA 2IYVA 3IAFA 1IOZA 2H16A 2VNSA 8MHTA 4KFTA 1QDEA 1DEHA 1JLLB 1T5BA 2Q3EA 3MTGA 3RRYA 3V2GA 2XKKA 2V8BA 4E4RA 4IG4A 3LG2A 1GQFA 2QM7A 1Q57A 3CNOA 1JYSA 2F67A 3HL0A 2IL1A 3QUSA 4O2AA 2C20A 2NZYA 2VP6A 2WIFA 1HXHA 2FEKA 2ZRBA 3ITEA 1K5HA 4X1YB 1DOAA 1YJCA 5JU6A 3FLBA 2UUAB 3ZX4A 2VJYA 5C52B 2JFYA 3IVGA 3QH4A 4PGHA 4EPYA 3IQZA 2HPVA 4AS1A 3WLIA 1FSFA 4FCVA 4WINA 1Z3CA 3H2KA 3WYEA 3K1TA 4BV3A 4TVKA 1GSIA 4GBMA 4H59A 3HNPA 2FPPB 3S3TA 1EB8A 3IO5A 4YGYA 2RGNC 4IW3B 4G0VA 1KOJA 3PLAE 1Z9BA 1RU3A 2QTHA 3OX4A 1J23A 3EAQA 4S0ZA 3H5VA 4BZPA 1Q16A 3ANXA 3CSDA 4B6OA 2OV2A 1XQVA 2J4DA 4O6VA 4TMXA 5BWNA 3LYLA 2TSYB 2O9JA 3EVGA 1W19A 1KPGA 1ZUHA 4E33A 4L27A 4D8TA 1ORRA 1SA0A 2D7JA 2V9PA 4KLCA 3QG5A 4UDNA 4W5QA 5A3QA 1WRBA 4BFUA 5SICE 2G4CA 2PT7A 4J2OA 3RSZA 2BM9A 4JDPA 2ACWA 3BXHA 4FJ1A 4PLTA 5K3EA 3A06A 1NXTA 2ZI4A 2FRDA 4ENVA 2GWHA 3SHFA 4M7OA 4WFQA 5AVRA 3FY4A 3OP1A 1XEAA 5TB5A 1U1GA 2XMCA 2Y1EA 4U02A 5BQPA 2RAVA 4TQGA 3EDCA 4U2FA 1NONA 3C3MA 3IKLA 2QRMA 2B8NA 2XNJA 2VH5R 1NRWA 1LK5A 1TVKB 2NTEA 3BE6A 3NS7A 1OLSA 4R9NA 4J1TC 4X3OA 4KO8A 3W3AH 3P4UA 2PLNA 4AYWA 4MKXA 4P0QB 1KIFA 4ZVVA 1GL3A 1ZX1A 1SC4A 2CV2A 2CDRA 1C1DB 1V7QA 3OHMA 1SB8A 4Q7MB 3KT8A 3EXHC 4KI0A 2OD7A 4WJKB 4RF4A 4DJ5X 2CB9A 1L9KA 2VA9A 4XWGA 3WGUA 1W0KD 3DF9A 1M6EX 1ULAA 1E1YA 1WSBA 2AG1A 2NZXA 5TR9A 5HCIA 3WRXC 2C2XA 1GPDG 1N5JA 4BASA 1Y5NA 3WGGA 1VSVA 3JZDA 5J2UB 3IKMB 1V47A 4F1KA 3U31A 4Q3AA 1PL7A 5ALXA 3WJ2A 3MB8A 3WMFA 9LDTA 1WWKA 2GEUA 4MQEB 4IHJF 2Q1YA 2VEDA 4AJOA 2VPPA 4X6LA 3DMGA 3RGWS 1CF2O 3FOBA 5GZ1A 5HZMA 2I7XA 4OQPA 4B3XA 5HP4A 3PDIA 1RTTA 3VJKA 1GZ7A 2KYRA 2WU3A 3PR1A 4MVJF 5DIZA 3HFSA 3HFGA 3ECSA 3PF8A 2TMGA 3GMTA 3W1VA 5KQLA 3RBXA 2ET6A 3H6HA 2FRVA 5AVOA 4PZEA 3MWLA 1BEEA 2UYQA 1N2IA 3GWZA 4QGHA 3SQDA 3Q3VA 5ELMA 4MI6A 3LVBA 4C0AC 3MUFA 4A10A 3IQDB 3TECE 1JZQA 3PNSA 2DY1A 1QM5A 2IEBA 5AKLA 3RHSA 3UXEA 4YCCA 1TECE 2PX8A 2NO1A 2ZJYA 3ILSA 2HU8A 2YV2A 5BT9A 5LPNA 3ZHVA 2OE2A 4EHDA 4ARBA 2HQBA 1CEEA 2PVPA 2OD2A 3G88A 1RC0A 1P75A 1XLTC 3AGPA 2B9EA 3FFWA 2P9ZA 1NJSA 3Q7SA 4IBOA 4XM2A 5CLHA 3WO1A 2UYHA 2R00A 3L5KA 2WUFA 4NBKA 1US8B 2B4YA 1JKFA 2V54A 5IU6A 2F9LA 3PIIA 4H6VA 1WIWA 1ST2A 2QSYA 4CV0A 3CLSD 2IIPA 3TVTA 5JZOA 4FFPA 1G98A 1Q2UA 3NHAA 1Y8QA 5JHHB 2Z3WA 3IAS6 5CXUA 4FE3A 3JVDA 3QBVA 5EZYF 1PR1A 3W77A 1YF3A 2IHBA 2HXYA 3RVQA 5AW3A 3PX7A 1AIPA 1ISGA 1MOZA 5GY7A 2YDYA 1BGXT 2R11A 4XUDA 1YFKA 2ZJFA 5EQFA 3CUKA 1TEXA 5GONB 5HS6A 1TO1E 2HHJA 1K7YA 1O89A 1Q2XA 1X7HA 1J00A 2P8JA 4H16A 2JBHA 4K1LA 4ETWA 3V4ZA 5KJEA 1C9EA 4OLHA 5J5VA 1KVQA 3RIXA 2ZB3A 5CVDA 3JARB 5J3JA 1TD1A 3A3PA 1GADO 4U63A 2JPDA 3KCNA 3WGLA 2CFCA 3JRNA 3QJYA 4C87A 1Z5OA 1U2EA 1X9IA 2DJ5A 5ALNA 2ESRA 1MC8A 4ZK2A 3QHQA 2RAUA 1JA9A 1BU5A 4QA9A 1DG3A 2MT9A 4R2LA 2P9QA 1TEZA 2ZSIA 2QGFA 4ZEVA 3MMSA 4KXVA 1AQ6A 4OGFA 4O29A 1RKXA 3ZKWA 1IUKA 3N8KA 5GIPE 3DEHA 3MWDA 1C7RA 4Q4AB 4DJTA 3LC1O 3UCXA 5B30A 2NNLD 1AKTA 5JADA 1AX9A 3T3PB 4CG1A 1BA3A 5J1TB 4TMFA 1ETHA 4IEFB 3W9BA 1RJEA 1LI5A 3ZVLA 2FSFA 4TKVB 3ENVA 1PR0A 3D3EA 4MVJH 2EIXA 4ENTA 4GMFA 3RB8A 3BIXA 2Z95A 3QKUA 4FKZA 4M22A 4JJFA 5HIKA 4NBSA 4NFLA 4G09A 1WXEA 4J0FA 2PMCA 2QT9A 1SA0B 3W34A 3G49A 4ZJZA 1L2TA 2YVUA 3LZ6A 3G2KA 1R50A 1DTSA 2WUVA 2X1LA 4O2LA 5CDFA 2H5JA 4HNVA 3PFIA 2GZDA 3ZH9B 4M9ZA 2QPTA 2HU7A 3LQ1A 1UKBA 1BIFA 3NEYA 3G1WA 5IHPA 3LFTA 1Z4NA 2QHXA 3CWQA 3L8FA 1FDWA 4Z9FA 1UXIA 5JYBA 2KJQA 1AMOA 1VGVA 4P1ZA 8ABPA 3LUJA 1E9VA 2GYYA 5JH7F 1HPLA 4FSXA 4L4ZA 3C8UA 4H0FA 2BUAA 2GEVA 1C30A 1ZIPA 1MB2A 2GKGA 1YSCA 1JSCA 1A9PA 3B6MA 3E22A 3BC1A 3I1JA 4RVDA 1DBRA 5H4GA 3RC2A 2QQGA 3UBTA 2QAJA 4MCHA 5TVGA 4HY3A 5CU7A 2YYAA 4NQZA 4Y2HA 1MX3A 3KE9A 1JLSA 1VRVA 3C3CA 2J85A 4R4JA 5J63A 4ALLA 5IUNC 1RSZA 2DZDA 3I0MA 5BN4A 1P4AA 1TM3E 1QCDA 1Z0DA 2QP9X 2J0SA 5ALZA 4Y6PA 1JG1A 4HCJA 4UVHA 3ZXYA 1YOVA 2V9ZA 4MSUA 5JSZA 2BTEA 2RCYA 4RZIA 4A26A 1G8JA 1A9XA 5TQ2A 4GLBA 4TRNA 1ENOA 1LSSA 2BEUB 3K5PA 4JAVC 1KRHA 3MWGA 2R2AA 5KDDA 4YROA 4BVAA 2JJYA 7GPBA 3PDIB 4PTLA 3K20A 2OCKA 3TIXB 4F2DA 1HNWB 1J42A 3LP6A 2ABWA 1ZD3A 2JLSA 4RZ3A 2QG4A 4BX2A 3DR3A 3DDCA 2V6JA 3PL5A 2C95A 2IIQA 4DLLA 4W4TA 1X7WA 1NOJA 2PZBA 3VKGA 5A7FA 1Y6ZA 4KNYA 5H80A 5INTA 2CUTA 1Y63A 4G5YA 3DE7X 1NJ5A 1R0ZA 3N6XA 5BXYA 5JY1A 1KY3A 3L01A 1G64A 1N9GA 4B9EA 1L7OA 4WA8A 5EIAA 1M1YA 2H1HA 4OXIA 2CNNA 3RASA 3PT9A 4ACBA 4CR8A 1FFEA 1M2JA 2D74A 1Y1KE 3KB8A 4GSYA 5EUQB 3DG9A 3MSCA 4DV7B 3CPJB 4J0CA 2F3RA 3AX6A 4KVZA 3NHMA 1XJ5A 1ZUD1 2AFRA 5K45A 4MAMA 4U0JA 3CF0A 4GS5A 1OVGA 5COQA 2XY4A 4JELA 5DYGA 1KO8A 1ZICA 2R6JA 5HE9A 1OTYA 1RLOA 3FNIA 1AB5A 3K1AA 4GR5A 4HYQA 5KAPA 3ZCVA 4DPLA 4ZI7A 1QF6A 2PQ6A 1NPDA 3EWNA 4JCOA 4MYHA 2CMKA 1E9FA 1OUMA 1PJRA 1MJ5A 3VDRA 4D9FA 1JWAB 4AMYA 1NNSA 2QZPA 3DLBA 3WICA 1MBZA 4NK4A 4DZTA 4S04A 1Y4SA 5CBKA 1SHZA 6CHYA 1XZDA 2OLJA 4LSGA 3PNVA 2HPAA 3V55A 3UJNA 2DULA 4BMYA 2PYZA 2W2XA 2SHKA 4AY4A 2XDQA 4M0MA 1LV8A 2X0FA 1S8AA 2VZ9A 1G66A 3ZE0B 3EIOA 1EBFA 3VH3A 4AJIA 1QYXA 3EWSA 3NTRA 4JUFA 4WK4B 3FCEA 4IKPA 3FMFA 2ZU0C 2VUSA 4LBWA 3SHOA 4UXIA 5JVDA 1P7VA 5DW3A 1IHOA 1P6UA 3A4YA 4D8VA 4MARA 4F06A 3NVDA 4FYYA 2YJ4A 4J9VA 2OYCA 4R71A 1NMSA 2QTGA 4JKOA 3N2LA 3ZJ5A 3T1NA 1U8AA 1HKUA 1SXGA 2NZVG 3NTQA 4QUDA 4U8HA 3VHQA 1WAMA 2PVCA 2XYHA 3UCEA 4P3XA 1E0DA 2JGEA 4A27A 5AIBA 2PLAA 1EQAA 4JN6B 3WIDA 1YDEA 1FFXA 4NFHA 4YP6A 1FMLA 3IOEA 3ZKWB 2D7DA 3MWDB 2GX6A 4EB0A 3RVRA 3MBKA 3ZKAA 3LT2A 3OTIA 4L16A 4EGFA 1ZU4A 3FSGA 4AULA 1XHFA 3EEQA 2W8BA 4R5HA 3M81A 2D62A 5G53C 1U1DA 2CY0A 2B94A 1C1YA 1PL6A 5DSTA 5A5FA 2YWBA 4QU9A 2O0JA 3PNOA 4GDFA 2M6KA 2RKOA 2J0UA 3KKLA 2ZE8A 3OCZA 4I8IA 2QTRA 1QPZA 2YXLA 4FTWA 1QJ4A 4NCHA 5FLKA 2GASA 2QROA 1PX2A 1CK4A 1QQ6A 1VBMA 2OC4A 3BTUA 3E8SA 4B2IA 1H2WA 2EBUA 1CF4A 3VR4H 5DM4A 1PWYE 3QM1A 4UW9A 4IOJA 3IFSA 2HRQA 3KDAA 2O14A 3DZDA 4J6FA 1W36C 1RXSA 1U4OA 2FOXA 2Z30A 2AN5A 3AFGA 3ZU2A 1Z74A 4Z4GA 2AFIE 4YRFA 3ENQA 5C53B 1ENYA 2CLEB 2XV1A 1EX6A 4BN0A 2PBLA 1IAQA 3M1YA 3V80A 1GPYA 1Q19A 2GZHA 4HX2A 4BLQA 4ERNA 1JQAA 3QVMA 3LY8A 1GU7A 4BNYA 1QQTA 2J07A 2EU8A 1BD3A 3ORRA 4KR0A 2XNKA 5FO0A 1JFVA 3CZ4A 1R6VA 2VKTA 3P2MA 2P62A 3Q3HA 1PZFA 2QW8A 3UTDA 3E22B 3PJGA 5CD9A 1YMQA 3JD4A 1A27A 4Z1OA 2GLXA 3FBTA 3FNFA 3U4GA 3PNPA 4B73A 4YUYA 1CUGA 2WVJA 1TF5A 2VDWA 2WJVA 1EFVA 4WV3A 2K87A 4GWGA 5AVUA 2ANCA 3B9PA 3BE4A 5G0UA 4C7JA 2ZB4A 2RHLA 3GT7A 3MRVA 5H9WA 1NRJB 3GA5A 4EY3A 1N78A 1ODIA 2WY2D 2VT6A 3W8RA 4RTOA 1YRYE 2A7QA 3GF4A 1KMCA 4RZ2A 3TIGA 1MZPA 3U9LA 4U9UA 4ENUA 1VP3A 3GP3A 4HDSA 4US1R 1YOVB 2HX1A 1QP0A 5JSZB 3GLIB 1NN5A 2CD9A 4XSVA 1OILA 3K72B 1TT7A 3NKVA 4L3VA 4Y2GA 3OIVA 2FFJA 1A9XB 3LX4A 1XQ6A 2E4AA 1Q92A 1WKBA 3I1YA 3K0AA 3QITA 1Q0PA 4HAYA 3PXCX 4KKXB 4MUFA 4Q02A 3QTTA 3MT9A 3RW9A 2MWMA 3LKVA 3EZGA 5BXQC 2AOXA 2R8XA 4IVPA 3TOXA 4MJ3A 1TO2E 2VHVA 2XXBA 3NIWA 1YIAA 3RVKA 4YI3A 3WWDA 4HC4A 1YASA 2PGOA 2WMDA 4LXGA 5TRTA 4NBVA 4BEVA 1X7WB 4D4GA 3IERA 3VR3D 4HKTA 5CA0B 1ONPA 1ODCA 2CKDA 3T7IA 2VOEA 2P27A 1EYZA 3BTOA 1AU9A 1SRRA 3QLTA 4HPWA 4DA4A 3ON5A 2J31A 3P5SA 2A33A 2R66A 4XIYA 4Y7CA 5ICMA 2ZWVA 2J48A 3GPDG 3GUHA 1N9GB 1SPBS 1S7GA 3N86A 3ZWKA 2Y1LA 4O33A 1OW3B 1M1YB 2AR7A 1ORTA 2ONKA 2PGIA 1SZJG 5D7NA 1ZNZA 1YRLA 2WR8A 1O8CA 1UJ6A 4X94A 2XA1A 4ZKDA 3N2GA 2Z8XA 2WNHA 3ONDA 1GNRA 2WD7A 1P2SA 3RC3A 1HQCA 1NBMD 3CH6A 1C4WA 4OO3A 2QBYA 1UXKA 1HE1C 1NA5A 5JNVA 4H3SA 4TLCA 1TCBA 1E69A 1L8QA 3Q2IA 3DZGA 4C5BA 2I7VA 1F2VA 3QPVA 1JHUA 1TO6A 4YRDA 2LUOA 1AK9A 3ACBA 3N0TA 1MOQA 4FYXA 4C14A 2BCJQ 3TQHA 3R6LA 3K1AB 3L7YA 3NBMA 2DX7A 4G5XA 3TFOA 1BKSB 1D7AA 2IEGA 4OXRA 4YMUA 4ZPJA 4BE7B 5FOTA 4F96A 1IQ0A 4QG7A 1N92A 3EPPA 1W75A 1YL5A 4JQYA 3FUCA 1M8KA 1H9BA 2AT1A 4Y6OA 2PN1A 2FG5A 4MQFA 5JATA 5FULA 3ZV4A 3A9SA 4GZ5A 1ZL2A 5FV4A 3EOBI 2XDQB 4FWIB 4K3UA 3QKWA 4L76A 5DNDA 4XM0A 3GJZA 1PZGA 4K26A 4DCNA 2WQ7A 3S2FA 1KH2A 3HDTA 4BV8A 1F3OA 5MN6A 1IMOA 1V6CA 3BCHA 1PS0A 2DT8A 2ZFUA 3R4CA 4WUVA 4GP7A 5I9LA 3EUAA 2O2JA 4AZ3A 1NYLA 2YV3A 1BX1A 4JA2A 3JYHA 3ITDA 1PLJA 4L8WB 3IE2A 1LI4A 1IH8A 2BTQB 3LW7A 1ZRMA 2O8DA 1P9WA 4DBLE 2RK3A 4YRZA 4X7RA 2JLBA 4LJ6A 1P9NA 2ZEJA 4XR9A 4X7MA 2G76A 3BWMA 4G37A 3AEKB 3TNJA 5PNTA 2P2CA 4ANFA 4KRFA 1WVGA 2Z5LA 4RY0A 3GMIA 1MO5A 3STXA 4G26A 1N4AA 4BX9A 3RTDA 3MJHA 3LUGA 3ZI0A 5HUQA 2XYQA 2Q0HA 3H5LA 3ID6C 4BAUA 5BW5A 5K09A 1W87A 3QWHA 1R9NA 1ZH2A 1P4GA 1GZ5A 1R74A 1UMKA 1B2LA 3QVSA 3UMVA 4FNMA 2B82A 4ZHQF 3GLKA 1VBFA 5TF0A 1QQ5A 2QTLA 4R51A 5JALA 3KAQA 4A9AA 4YHBA 2W8BB 4YDHB 2FJ0A 3DVAA 3WADA 5IC5A 3WK9A 4K87A 4I9GA 3TLCA 1KY4A 1NI3A 2D0OB 4NPAA 1AGYA 4MDYA 3LS2A 3N6VA 3PHGA 1SVLA 4ZOLF 2V4ZA 4GM0A 4FU0A 1N0UA 2RONA 3RLIA 2GEDA 3QBJA 3PTLA 4BO1A 2HSJA 2BI4A 4Z1MD 1I7QB 1NF3A 3QNWA 1MLDA 2DERA 4E31A 4Q1EA 3UVEA 2E18A 4HNRA 1M2GA 5B3AA 1NBWB 2NZUG 1A8HA 2B92A 3KUUA 2G5GX 4PLHA 3U4IA 5AOVA 3TXYA 4B6PA 3LQRA 1LRJA 2OFPA 3HB7A 4KQJA 1Y7TA 5I9SA 3FBGA 1A50B 3IT3A 4LV8B 1JMYA 3RANA 3S1AA 3QXSA 4C2UA 2ONJA 4Y6GB 1MOPA 4ZDJA 3O4RA 3PVSA 3KVRA 5TPWA 2AQ8A 2PBFA 4EFLA 3NVMB 2OHVA 4JSTA 2WM9B 2ZUDA 4CEJA 3AVXA 5MFPA 4AP6A 3W7VA 3HR7A 4WIAA 1H42A 1OKKA 2IKQA 1BNCA 4KIJA 1RP7A 2W58A 2R9VA 2AGVA 3B2QA 1HLFA 2O2HA 3D3KA 1ZBQA 1VE5A 4MVJA 1RBYA 4FNGA 3TM4A 1TJ5A 2FN9A 2LDBA 5FNVF 1KQFA 2IIBA 3LD9A 3C5VA 3RFFA 1W88A 3P71T 1ZZGA 4B79A 2J4CA 2GAFA 4CMCA 4E70A 1HKHA 1EFVB 3H2YA 3LHDA 1ZRSA 1T6YA 4EDFA 3A4NA 3R40A 2QJTA 1D03A 1YGYA 1IY1A 3U19A 1EA7A 2PRIA 2JJMA 3K8ZA 4H7JA 4IDBA 4JUAA 5IT9A 5A0TA 4EW3A 4RS3A 2CWDA 5IJ0A 1F60A 4RL4A 4RPKA 1FXSA 1MP0A 4HDSB 2A1UB 1N6PA 2NV2B 3CVJA 3FCUB 1FDVA 1K8RA 3QUAA 1Z22A 1CQIA 2ZYVX 1U8UA 1QYDA 2ZJ5A 3HUUA 3K0AB 5EJ9A 3GO4A 1QHXA 1D2RA 1ONSA 2SICE 4FHEA 4HYYA 4RJKA 2FPMA 3OCYA 1TIBA 3AV3A 4FOTA 4HWPA 1V8ZA 3KXPA 3S2ZA 2XADA 5JZMA 4P4NA 3VU3A 1SMKA 1KVTA 3IAUA 4HH1A 2PGLA 2XMBA 3LCCA 1JDJA 3N9IA 4TL6A 3WFZA 5D00A 4RAQA 3ILXA 1E94E 4WVLA 3E7XA 1PGOA 1JFRA 3W6ZA 1N3YA 2WG2A 4TKLA 4F3NA 1OR8A 3MBIA 4D4MA 3B3QA 3JZAA 4BFVA 1E1KA 3IUBA 1OE0A 4AJ2A 5H16A 4TXHA 1EDEA 1LSOA 3R4VA 4PWZA 2OBFA 4I6EA 3X43A 4TZ0A 3H11A 3N2GB 2QW0X 4IF6A 4PS1A 2WD7B 4RDXA 2IYEA 4NZPA 5ALOA 1E1MA 3OZRA 2Z6QA 2ORVA 1YDMA 3TZKA 4LCEA 2KB0A 2AYZA 2IH2A 2YY6A 1RAFA 1WXWA 4G5HA 1QYWA 1KC3A 2B4KA 1T5SA 4MWGA 1SXJC 4DF3A 2FCRA 3HJFA 1G60A 1CLEA 1K8ZB 2XMDA 2GDZA 4JI3B 5KNDA 5IAEA 2WAAA 4G67A 4BQRA 2CXHA 1DWUA 1EMDA 3LJKA 1NUPA 3L1IA 3NKLA 5LR6A 4MTLA 2I55A 1PBNA 3GA7A 4A2QA 2DTEA 1S4QA 5C4MA 2EWVA 3RG2A 4GPIB 3SLRA 1CVLA 3ZYZA 1HG1A 1QZXA 2HUNA 5TGTA 3UXMA 4ARVA 3BB4A 4DIDA 5D3MA 3HUDA 2JFGA 1LBIA 3OJXA 3IE1A 1V35A 3DMHA 3ETGA 2N1MA 2YYSA 4NP6A 2A2ZA 2ZYGA 1CP3A 3ETEA 3FWKA 3ED5A 3G0OA 1RVV1 2F59A 2QRKA 3CONA 2VZ8A 4M88A 1A2KC 4M1KA 3RYHA 3D8RA 2JI6A 4F5YA 3ZD7A 2JFZA 1XRRA 2QLTA 3N8DA 4RIIA 2I4TA 4WTOA 3RU3A 3IQXA 3D0RA 1ID1A 1HDEA 4LE0A 5K01A 4LYEA 1PWHA 3NEJA 3EZ9A 5AM1A 2XBMA 1GUAA 2A35A 3TOZA 2YQZA 3A32A 4RK7A 1EFRD 1Q1GA 4JX9A 5AHKA 1AZSC 1UODA 2NGRA 4EQ6A 4PG4A 2BGTA 4QYSA 3L8YA 3K0EA 3ZCQA 3VGPA 1LJLA 1NXXA 3AY7A 3KZNA 4NAHA 4AX4A 2HA3A 5JJLA 3CT6A 2O8DB 4MITA 4FOLA 1DXQA 2XNSA 1RLMA 4H1TA 1V9CA 4X7PA 1TM2A 4D97A 3AKEA 4M76B 4MH0R 4B7AA 4EUEA 2AMFA 4LJRA 4U7GA 1FQKA 1NUSA 1X1QA 2OOSA 4Z4EA 4O0MA 2DCUA 3H5IA 2I99A 4W7SA 3UWDA 2YNMA 5G40A 3WK4A 3D6UA 3FHLA 3ZJVA 4ND6A 4PQYA 3CRNA 1XNHA 3NW9A 2PKEA 4M55A 4TN1A 4PSKA 3T9CA 1J06A 4EARA 2OAEA 1ZD5A 4KPFC 3RTAA 5IVKA 4ILKA 1ZKDA 5K6AC 2NUTA 3UWOA 2HCJB 3A9UA 4KPGA 3HP1A 1XXHB 1U7OA 4MWBA 5E3HA 1JVNA 3RRJA 4WK0B 5K0LA 2UXDB 5DISB 2HBRA 1L5WA 1QDLB 3N2YA 4UD2A 1HF3A 3ZZUA 1ECCA 5FQOA 2H7VA 2JATA 2OXIA 3ZW7A 3G6WA 3IP1A 3JQGA 1B0UA 1KAEA 4BNTA 3VU9B 1ZI8A 1SWWA 3KFVA 4I99A 5AJWA 3WJ1A 3IT0A 3UH1A 2R86A 4W7HA 3M49A 3S1AB 2OO7A 1XEWY 1I6LA 3O4HA 1ZONA 4KQ6A 4CEJB 1LU9A 1ZAYA 3LQFA 2OZEA 3RS7A 1E1DA 4H1WA 3TQOA 5ITZA 4UE3S 3TAUA 3V7FA 2OESA 3QVOA 4Q12A 3U9TA 5KNDD 1W88B 2XYVA 4XIJA 5T67A 4F93B 1MABA 5EWJB 3G2JA 4DLXA 5KQRA 1I2ZA 1EWRA 1JHMA 1W4CA 1OB5A 4UHFA 1G4HA 1VIVA 3BXOA 1Z4OA 4NE2A 5EJGA 1SEPA 2NSLA 3EVZA 4OYRA 2CHGA 5DI3A 2Z9CA 1RWBA 2PR7A 3AR2A 1N6KA 1DL5A 1QONA 4IO1A 4M0UA 4CF3A 2BDTA 5CPFA 2AJCA 2I6XA 2JVJA 3DZBA 3VV2A 4R9SA 1TX4B 1VHQA 2GPTA 1LVHA 3S0JA 1E6MA 1E5XA 4G24A 1Z16A 2RGDA 5L9AA 4RNCA 5LJLA 1GAQA 2YJZA 4FUTA 3MCAA 1CQIB 1P8JA 2FWMX 1PQWA 1G3MA 4FIDA 3SR0A 3IPRA 4CL0A 4KG7A 2B35A 1CQWA 1DXOA 1XALA 2QK4A 3GOQA 3KLPX 5EKXA 3EVFA 3LNTA 3OCUA 3DW1X 3CRRA 1F0PA 5EIHA 2WJPA 4WZBB 1NIJA 4FDMA 4L15A 3L06A 4ZCPA 5CAEA 4KRXA 3BWCA 4CR7A 1S2GA 2ZETA 1YI0A 3LFHA 4EPTA 2Q7XA 3BCRA 5TT0A 4GR4A 3GFRA 4TZTA 1I3OA 1E2GA 2V74B 3KHSA 1V8FA 4I9FA 5EP2A 1FOEB 1XD8A 2WUDA 2C98A 3UUEA 3H11B 1WPQA 2YNMD 3I8SA 3R44A 1W0JA 3CH5A 5IH7A 3CFYA 3OZFA 2EG9A 3IP6A 4FE4A 1B23P 2JARA 1PBTA 4C0KA 3AVPA 3HCRA 3U0BA 4OX9Y 1EVZA 2R8BA 2N75A 5KYUA 1XCPA 4FC7A 2FOLA 3NVKI 3M34A 5G1NA 4HDKA 1KO7A 4LRXA 3V8MA 4RTSA 1F8UA 1Y48E 3RVDA 2IYTA 2J6BA 2O3SA 3QV2A 1U7XA 1Z2PX 2GWRA 3SLGA 5D3MB 4E09A 5BNTA 4ZQHA 1LI7A 1JLMA 4BIIA 5EIEA 2HN9A 2Z2ZA 3FE2A 1VL5A 2FZEA 2Z9BA 3RYHB 3L4SO 1SVOA 2P91A 3WTBA 5I9BA 1MENA 4HSEA 2BMDA 4AG5A 3B6JA 4BXOA 1UMCA 1DEXA 2B2CA 5JISA 1UM8A 3IP7A 3LHIA 4K88A 3NBYC 5KNBH 1P1RA 4IH9A 2VNAA 4MIKA 2NWQA 5ALKA 4AQYB 4HJRA 1O2DA 1U8EA 2OBLA 1IWBB 3BN3A 4J9UE 1KJ9A 2QRGA 2XD9A 1FQOA 3VC1A 3OU2A 4M86A 1FFBA 4BNVA 4KW7A 1DAFA 4MIOA 1QVZA 1F6BA 4IO0A 4Q5IA 2GZ1A 4TWZA 2YVKA 4U6SA 5JEEA 3BORA 3U7EB 1H0KA 5C9ZA 1AGPA 7AT1A 1W7AA 1E3TA 2OYSA 1NY6A 4DR6B 3R09A 1QQ7A 4X66B 4YRCA 1DO0A 3D0QA 3MD9A 4CU2A 4XPIA 4RGYA 3DPIA 3TLZA 4I08A 4KC0A 3CT4A 2G28A 5DFAA 3MLBA 4LDAA 2HIMA 6REQA 2QGZA 3QOFA 5JH7B 4FXPA 5AJHA 1YNSA 2EXXA 4TWBA 4YVFA 4EG5A 5JXHA 5HDQA 2BHLA 2NUTB 3T4UA 4K9NA 3O3NB 3AVWA 4TTIA 1FTQA 1ICIA 4JGGA 3DPUA 4NDAA 2R6FA 2A0FA 3FCYA 3X1XA 1NYRA 4AUNA 3MMXA 2QJWA 5EPOA 4ZAZA 4MEBA 1YVPA 2EZ8A 3VBEA 5HJ5A 5UKDA 1EFPA 1DXHA 1BE0A 2CLDX 1CUVA 1JLHA 1ZWKA 2DSNA 1R0LA 2EX4A 2PX3A 1PWXA 2WIKA 3I9NA 1JVSA 4GRAA 3TBHA 1NVMB 2P9GA 4LHWA 1SOUA 3PQFA 2JJ1D 1LVGA 3GGDA 3SQWA 1WCIA 1JUDA 4RLQA 4BBPA 4EKYA 1E9DA 3FWZA 3DOJA 2IHJA 4ZAVA 4F3TA 1SKBA 5JNUA 4DUGD 4BFYA 2BGGA 4TMYA 3U40A 4I1OA 1TF2A 4QRHA 4H4DA 3HWWA 1I9GA 2G4LA 4R40A 1M8GA 5T4FA 5IWAB 4KQ1A 5ENVA 3TZEA 2ZANA 1M0SA 1Q50A 4LSWA 4ZAGA 5C7OO 1BO6A 5ITZB 1OX6A 4AFNA 4BQNA 2WE7A 2PIDA 3HXKA 1E32A 1R37A 2OV8A 2W2KA 3BHNA 4N1AA 5CA1F 4HTFA 4DLNA 5FOSA 1AK1A 3N0WA 1RYEA 2FFRA 3OBBA 1FDSA 3TZBA 3ZW8A 2AFHB 4MRMA 1KZ6A 1KNXA 2J5KA 4M1EA 4WEQA 3FYUC 5K03A 1G41A 1SPXA 3SC3A 4ZJYA 3EBPA 4FP9A 2OB1A 5DI3B 5BVHA 2YRWA 2YV4A 3M4XA 4TRJA 5C18A 2GXSA 2RGRA 2ZCVA 2W6ID 1X2EA 2ZJZA 1DC8A 2EKPA 4JI8B 3KQLA 2ZS8A 2C03A 2JIRA 2OHXA 1TUIA 3C3YA 1FDOA 4DXHA 2FPUA 1VL0A 3T06B 1H94A 2F7SA 1ANKA 3UICA 3H84A 3LL7A 5AQ1A 4JLAA 3VPHA 1CR1A 4BJ6A 4O4HF 1ZHOA 3GXOA 3MMZA 1YS9A 4HP8A 3RV4A 2RH5A 1Z75A 1F4VA 2C88A 1XRJA 2HUPA 3C8DA 4MV5A 1R5BA 3PXAA 2XZOA 2ZIZA 4M36A 1JKIA 2GNPA 4G9BA 4UPVA 1U1IA 3V34A 3QBEA 4A4DA 1AD2A 3IV9A 4S1OA 2WUGA 2UUOA 5CAEB 3GDGA 4NU5A 4WFKA 4HGRA 3HPQA 4AQDA 2IS2A 5AI9A 3R41A 1NMXA 4YAKA<