4QLOA

Crystal structure of homoserine o-acetyltransferase from staphylococcus aureus
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
327
Chain Sequence
NYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRKDPAFLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords homoserine O-acetyltransferase
publication title Structure of homoserine O-acetyltransferase from Staphylococcus aureus: the first Gram-positive ortholog structure.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 112
structure length 327
sequence length 327
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2014-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qloA00
1QGED 4X95A 3RK4A 4U2DA 4BAUA 3OOSA 4P92A 1IZ8A 5AOBA 1GXSA 1WPRA 5LKRA 3PFCA 1EX9A 2AJBA 4ARBA 5AK6A 5CXUA 1EA5A 2JIDA 1K5PA 1EI9A 3CCCA 5A7HA 1BN7A 1QIDA 4RPCA 3HACA 1YB7A 2VF2A 1IMJA 1LBTA 3WA7A 1VXOA 1ZGCA 3AINA 1NX9A 3I2JA 1Y7HA 5AM3A 1HPLA 2XUOA 1DWOA 4UBMA 2QUBA 1DWQA 1XLWA 2VQ6A 2DHEA 3FVTA 3H1AA 3L1JA 3D4LA 4AZ0A 2DHDA 3W04A 1LLFA 1R4ZA 3TEJA 3CN9A 3WLAA 2YXPX 2V97A 2QS9A 3OPMA 1DT5A 2DFPA 5I9IA 2BFNA 4D9JA 4AN0A 3M83A 4C4XA 3C43A 4X71A 4Y2SA 1Z68A 1GPLA 3M82A 4F0JA 3E0XA 3QZUA 5EIAA 4ROTA 5K3AA 4LIPD 4QLAA 3OTQA 4EUSA 3H17A 3DKRA 1AZWA 3O9MA 5ALXA 4GEGA 5JZBA 3WKBA 3BF8A 1TKRA 1UOQA 1AX9A 1LPPA 4DMCA 2WTNA 3PUIA 2GBFA 2V96A 4QWMA 2HRRA 3V1MA 1N5MA 4UBJA 4FTWA 1S8OA 3DOHA 3OG9A 2WG1A 4ZXFA 3UMJA 2WFMA 1YA8A 1YS2X 3W06A 2GBCA 1RP1A 2WM2A 2PVSA 2AXEA 3A2LA 1YSCA 4NZZA 3D2BA 5IVKA 2EEPA 1BCSA 3HJUA 1IZ7A 4KAJA 2CMFA 3ILSA 3ESAA 2WIGA 1KU0A 3ZWQA 1CUSA 2XLCA 3GZJA 1XZFA 5HKBA 1WB6A 1G42A 1QOZA 1JJIA 1TCBA 2O2GA 1ZD5A 5A6VA 2Y6UA 1K4YA 1YB6A 4G5XA 3WA6A 1H23A 3VKFA 2OAEA 2Y2VA 4HZGA 2XUIA 2G5TA 1F8UA 3BDIA 4YASA 3G0GA 5JANA 4B83A 3WL6A 4W1RA 2QM0A 3WK5A 1P0PA 2I3ZA 3EQ8A 1X2EA 3WYDA 2JGKA 1A88A 3HRHA 4WDRA 2QXUA 4UHDA 1MX5A 2PM8A 1XZIA 3FLEA 2QUAA 2AJDA 5DTJA 5ALIA 4UBOA 2JGIA 1R9MA 4DMFA 2HA7A 3KSRA 3MUOA 3JWEA 1L7AA 5LZ2A 2HU7A 4TPKA 3M3DA 1FFAA 3AUKA 4ZI5A 3DD5A 2DQYA 1AMNA 1TQHA 2BUBA 4XJVA 1QIJA 4A16A 1FFEA 4YX9A 1TAHA 5CBKA 3D59A 4FBLA 1ODSA 4K6GA 4Q82A 4MYSA 2LIPA 3FLBA 1N8SA 3DKKA 4EA6A 1WPXA 5DYWA 4CCYA 4IQ4A 2HL6A 2OCLA 4KE9A 4DGQA 5C8XA 5AOAA 3STTA 3TRDA 3DEAA 3FYTA 3Q8WA 1XQXA 2FX5A 5LZ5A 3KWFA 3GFFA 2WJ3A 3FBWA 4HRXA 3VISA 5K3EA 1MT3A 4ZV9A 3D2CA 4BVLA 1MNQA 4DSAA 1XQVA 5D7BA 4X90A 3ESBA 1YCDA 2HA0A 2WHPA 4CCYB 1EINA 3DYVA 3SK0A 2XLBA 5IH7A 3DOIA 3WL7A 2OGTA 4B80A 2H9YA 3BIXA 4LXIA 2XQKA 3H2GA 4FNGA 2WHRA 4DYHA 1BEEA 3C5WP 1C7IA 4RNCA 2B9VA 2WILA 2QTBA 5ESRA 3ZV7A 4PSCA 1BE0A 3IA2A 4Q3OA 4AN1A 1ZJ5A 3T52A 2VJCA 4OSEA 3MVEA 3F8SA 4M0EA 3BJRA 1UFOA 5F4ZA 3K2IA 4B9AA 4F60A 4L3WA 3E1GA 2WLSA 1H2YA 2RI6A 3A2MA 2WHPB 2DSNA 3RARA 1ZIXA 3C45A 4LXGA 4PO3X 1QJ4A 3AIKA 1UXOA 5FUMA 5EFZA 3G0IA 1OILA 5KREA 3IIIA 5HF8A 2I03A 4G4JA 3MUNA 5JADA 1XZCA 3FCYA 2OQVA 4J0DA 2RIPA 4IO0A 2XUHA 1Y37A 4L9AA 5JYCA 3WK6A 2WU4A 5CURA 5DYYA 1QFSA 4BBZA 1G66A 1HKHA 1DINA 3QPDA 5DJ5A 3WWPA 4XVCA 5D3KA 4K6HA 4FWBA 1HDEA 2HRQA 3PUHA 2ZYIA 3A2NA 2PSDA 3O4IA 2PKYX 3DNMA 5CRIA 3DS8A 2JEYA 5JD6A 1KEZA 1LPSA 1N5RA 1XZHA 3FAKA 3HEAA 4L0CA 2WFLA 2XMDA 4K6KA 4DNQA 3WK9A 4X3CA 3QYJA 1XLUA 2J4FA 2XUJA 5AK3A 4DMKA 2OCKA 3WWCA 3PICA 4W63A 4OB8A 4BAZA 3V9AA 2HA4A 3G02A 4C89A 1CUVA 1E8MA 4FHZA 1THTA 2K2QB 1THGA 3Q0TA 5ALZA 2AJ8A 1FFDA 5SYMA 4BVKA 1MN6A 2WIFA 2C58A 3I1IA 4KAAA 2BGNA 4UBLA 4X92A 4QE3A 5LZ9A 3V1NA 3PF8A 2WIJA 3ANTA 2WFLB 3QBJA 2DCMA 4BAGA 1UKAA 3KDAA 4AX4A 1ZJ4A 1VLQA 4A23A 3ICVA 5T4HA 5BV7A 4MWTA 4IHAA 1R50A 1EXWA 2WUEA 4J0KA 5LIPA 1CIJA 2G4LA 1GKLA 1AC5A 5AP9A 1SCQA 3F98A 4IH1A 3H18A 4M0FA 4JEIA 1VKHA 1CQZA 1JMYA 3HLKA 4AMZA 1L7RA 1YS1X 1LPMA 3QMMA 1UK7A 1E66A 2QJWA 4QDXA 3R3XA 1QE3A 2XMBA 5EHZA 5K3BA 4MQLA 4QEKA 5JD5A 3WKEA 2ACKA 3WKAA 4WY8A 5FXMA 2W22A 3O9VA 5CXXA 3R3WA 1LPBB 5D3ZA 3S8YA 3EF3A 4ZV7A 2HADA 1ZI8A 4X6YA 1NU8A 1ZICA 1U8EA 3DDUA 5AKKA 3PFBA 1XZGA 2ORYA 1EDBA 3R40A 4KE7A 4BVJA 2B4KA 4GW3A 5BOVA 3FCXA 3H19A 3HXKA 3H2KA 5LYYA 4X97A 3WYNA 1J2EA 2FJ0A 4F21A 4PSDA 2QMQA 3I2FA 5FPPA 1U2EA 2C4HA 5YASA 4X93A 4PQEA 1K8QA 2CKMA 5HCUA 5DTIA 2OQIA 4X6UA 3H04A 2XT0A 2R11A 5ALHA 3QPCA 2HIHA 2VT7A 3DLTA 5JZ9A 5HKAA 1DU4A 4WFIA 3AIOA 4X7BA 1AGYA 4HVTA 4KYVA 3SWWA 2HU8A 1WHSA 1TCAA 4GECA 3ED1A 1CRLA 4UPDA 2XUKA 3WWDA 5FPQA 3MGAA 3DYIA 1QIKA 3O4GA 5EHQA 4G4GA 3LIIA 1J1IA 4BRZA 2HA5A 4AB1A 1VZ3A 3WJ2A 2Z3ZA 2OG1A 1R88A 5T4EA 1EDEA 3G9TA 1TCCA 4H18A 1YAJA 4W1PA 4KRXA 4B0PA 3OM8A 3HI4A 1WM1A 1ZIYA 1K6EA 5JAOA 1VE6A 2GBIA 4LXHA 3K9BA 2C0PA 4Z49A 2H7XA 3JW8A 5LZ8A 1MX1A 1BCRA 1A8UA 2ACEA 2XQIA 3DJYA 3C70A 5JARA 5AKIA 1P0QA 5DLPA 5AK4A 3RM3A 4V2IA 5E2IA 1UK6A 3BL8A 3G0BA 4B82A 1JJBA 2FJPA 1TRHA 2VSQA 4I3FA 4N5HX 2OAGA 4FFVA 3G7NA 2PBLA 3E4DA 2ZYSA 4ITVA 4AXBA 1W1IA 5D6OA 1GPKA 2WHQA 4QA9A 3IUNA 3O0DA 4ZREA 5DWDA 1JKMA 2G5PA 1G4HA 4MEAA 4H7JA 2VJAA 5ALLA 1RWQA 1CEXA 4GWLA 4U2CA 4HAIA 4BDSA 3CN7A 3I2IA 4RE6A 4AO7A 1RYYA 2QJRA 3RLIA 3HZOA 1F0NA 2XE4A 4FNMA 1UZAA 4UBIA 4GXNA 2BUAA 1FFBA 3F96A 3QPAA 3STYA 5CT4A 2GYWA 5ALOA 4EY4A 5SYNA 3RKSA 1MO2A 3IUJA 3QVMA 3N0TA 2VJDA 4J03A 4FOLA 4P93A 1QIHA 1A8SA 3P2MA 1FJ2A 3G8YA 2P8SA 2PU7A 2XB6A 1GKKA 2XQGA 4U2BA 4CG1A 4GBGA 2C0QA 5AKLA 1E8NA 1MPXA 1DT3A 1G5FA 3I2KA 5AK5A 3FYUC 2C5FA 3W9UA 4C01A 3W2TA 5A7FA 5AM1A 3D2AA 1BRTA 1SOMA 3O4HA 3PE6A 5AI5A 2X76A 5AKEA 3ZLVA 4PW0A 1Y7IA 1IVYA 2QOEA 4B9EA 3BXPA 1JU4A 3X3HA 2ZYHA 4KRYA 2DR0A 4MWSA 1T2NA 4BC0A 2HA2A 3CCBA 3LS2A 1A7UA 5CT9A 5BWBA 5LLSA 1F6WA 2QKYA 1VE7A 1IUNA 2O2HA 3B5EA 3C6YA 4XX1A 1ZI9A 1U4NA 5CT5A 5AO9A 2NW6A 5ALGA 2XUGA 3VXKA 5ALTA 1UKBA 4FLEA 4ETWA 5JD4A 2EDAA 4CFSA 4H7DA 4X85A 1CUJA 1ZD4A 1J07A 1DTEA 4U2FA 2Y6VA 5C7YA 1CUAA 1UWCA 2RAUA 1XZKA 3IURA 4WJLA 4DSZA 5AM4A 1QTIA 3C8DA 2WQZA 3HABA 1CV2A 1H2ZA 1UOOA 4J0CA 2EDCA 4JNCA 1HBJA 2BJHA 3H2JA 4N8SA 4BTLA 3WZMA 3G0CA 1DX6A 3I6YA 4CIAA 5HF9A 5HZGA 4GHWA 1XZAA 3C5VA 4C4ZA 1LPOA 4K2AA 3IULA 1O6FA 1OXMA 1EVEA 4DNOA 4Q3KA 1AURA 4BC1A 1LPAB 1DWPA 2J4CA 2YASA 2XMRA 2HHAA 1W75A 5HF5A 4OCZA 4JYMA 5JATA 4KE8A 3AIMA 2Y1KA 5I7UA 4LYDA 4X94A 1CR6A 2OCGA 1XQYA 2XMZA 3IBTA 4FDMA 4WFJA 5HK8A 1I6WA 3WWOA 4J0GA 5K3DA 4EY8A 4Y2RA 4DIUA 4J3JA 1TIBA 1ODCA 4QDZA 3G9UA 1A8QA 2WUGA 1XRQA 4Y2XA 1MAAA 1CUGA 1CUCA 2BAGA 2IX9A 2DHCA 3B12A 3ESDA 5AKZA 2H7YA 4FLFA 2H7CA 4FMPA 1Q84A 4QZVA 4EHBA 3TJMA 1QO7A 3OURA 3WMRA 4OD0A 3M81A 3WIBA 2QZPA 3QH4A 2IITA 2X8BA 2D0DA 2R8BA 3WK8A 1DQYA 2Z3WA 4MJ3A 3C87A 2VA9A 4Y2UA 5T4BA 2B20A 2Y2UA 1QLWA 3U0VA 3ZI7A 1BEZA 3VJMA 3C6ZA 1XQWA 4FFWA 2YYSA 4KACA 2QT9A 1GQSA 2HFKA 2ZJ7A 2WUFA 1P0MA 5E4JA 3PF9A 3STUA 1WCYA 3QMWA 3R3YA 1ODTC 2XUAA 1CPYA 4QWWA 5JZSA 1DQZA 4EB0A 3A70A 5CH8A 1UKCA 4UBKA 5C81A 1C7JA 4H35A 4E46A 4WDQA 1E5TA 4X6XA 4I19A 2OGSA 3DQZA 3U1TA 3E3AA 1QO9A 1YR2A 2WJ6A 3R3UA 1B41A 4HXEB 4YK7A 4ZRDA 5E4TA 1WB4A 1XKLA 5ALSA 4B6GA 5AI8A 4L72A 2V98A 5JASA 2PSFA 1ZGBA 4Q05A 3C6BA 5AM0A 4W1SA 2UZ0A 4N8DA 3SX4A 5AKXA 3WZLA 3AFIA 3D0KA 1YA4A 2HM7A 3T4UA 2XQFA 1CUZA 1FFCA 4E11A 1W4LA 4B84A 4WFKA 1XZLA 1QIEA 2XI4A 2ZVDA 5JALA 4X00A 5KBYA 5T4FA 2HU5A 2BCEA 3EIOA 3FWHA 1HL7A 2GYVA 2J3QA 3ZPXA 5EIEA 3BJMA 1JJFA 1MAHA 4M0MA 2RHWA 3AZPA 2ZSIA 2O7VA 1USWA 2PUJA 4J0IA 2C7BA 1ZD2P 4A5SA 1EVQA 5FOQA 3STWA 1EDDA 1XFDA 5A62A 4BZZA 2B61A 1YASA 2OGZA 2RHTA 5DYTA 4FBMA 3NOXA 2WJ4A 3IVMA 5CH5A 5E4YA 2XUFA 2VEOA 1AUOA 4JH0A 1SC9A 3WL8A 4IH4A 4BZWA 4XWGA 1JMKC 4BRSA 4K5QA 1ZI6A 1CVLA 3TGLA 3D5EA 2VAVA 4NMWA 4BYMA 1BN6A 3UUFA 2JBWA 5C8VA 4XIIA 5A71A 3G9ZA 3N2ZB 4FKBA 5AOCA 2ZSHA 1DX4A 2C5GA 3I6MA 5AI9A 1GQRA 1R1DA 4H7HA 4H7KA 4GI1A 3PI6A 2JGJA 3NUZA 1EB9A 4UHEA 3R41A 3R3ZA 3B3QA 5JIBA 4Y7DA 5AHXA 4BCCA 4W1QA 1XZEA 2Q0XA 1VOTA 4Q3LA 1H2XA 3K6KA 5ISMA 1LBSA 3V1LA 1QZ3A 2JGLA 3H0CA 5AKGA 4AQDA 5ALKA 4BP9A 1XRMA 2QVBA 5DNVA 4EY5A 2W6CX 3VDXA 1XRRA 5AM5A 3KOOA 4PSUA 3LP5A 2JF0A 1OCEA 1R9NA 2I3DA 2XMCA 3V1KA 5ALNA 3VJLA 1CLEA 4OB6A 2QR5A 2PL5A 1UOPA 4E14A 1ZOIA 2PX6A 4I4CA 4GLBA 1QIFA 4BDTA 4QDUA 5J3JA 2RONA 4OUKX 4OYYA 2JGFA 4AMYA 2CJPA 3YASA 5AH0A 3F67A 3L1HA 5CMLA 2WFZA 5AKJA 4PNZA 2HA3A 4ZGBA 1ZD3A 1ORWA 1XRPA 2PSJA 4GDMA 1SCIA 4QDOA 4C6HA 1MNAA 1J06A 4N5IX 5AJHA 4J0JA 2XDWA 2QXTA 2XMGA 1CUEA 1XLVA 4UUQA 2GYUA 4G4IA 1CUUA 2XUQA 3WWEA 4QNNA 3HYSA 2VAXA 5LP1A 2E3JA 2BUCA 2WIKA 3C6XA 5HK9A 3G0DA 4U2GA 4DNFA 4LHEA 4LYEA 5FRDA 3DCNA 1CUWA 4BP8A 4EBBA 3I2GA 1XZBA 4J7AA 2VTVA 3WIOA 4B0OA 4B81A 1VA5A 3F9CA 3DL7A 4OPMA 1XRNA 1QONA 2PSEA 1X70A 2RGUA 4LKOA 2WG2A 3WK4A 2JGEA 3FVRA 3IUQA 3F97A 4S0XA 2ZYRA 3IB3A 1XROA 3NGMA 5AI0A 2GBGA 3DL4A 3EBLA 2I78A 1BU8A 1PV1A 4N8EA 1PFQA 3ICWA 1H2WA 2PUHA 2H1IA 2ONCA 1GT6A 3QMVA 3QITA 1CFJA 4UFNA 3KD2A 2Z5GA 4Y2YA 4JYPA 5LZ4A 4Y2QA 2ECFA 5HF6A 4TGLA 4BTVA 5CT6A 1L7QA 4G8CA 5AI4A 4G9EA 1P0IA 2HA6A 4OYLA 1N1MA 5CTAA 3H2HA 4AZ3A 3I6ZA 1K63A 5JAHA 5BWCA 3ZLUA 1WHTA 1R3DA 3WK7A 1VXRA 2OXEA 3OC0A 3C8HA 1WOMA 4P9NA 3L1IA 5CW2A 1NU6A 2WU3A 3EQ9A 2JGMA 4Y2PA 1VA4A 4U2EA 5A2GA 1ACJA 4Y9SA 3O95A 1HLGA 1W52X 3AZOA 5AKYA 2JEZA 1EK1A 3W9BA 3VVLA 4OB7A 1EB8A 1SFRA 5DNWA 4DM7A 1CUBA 1ETHA 1Q83A 4QLOA 3IUMA 5C8ZA 4UFPA 4HXFB 4C4YA 4INZA 5FV4A 3KWJA 3ANSA 1BROA 4TVKA 5H3HA 5AI6A 4CIBA 2OCIA 5K3FA 3AILA 5AM2A 2X5XA 3FOBA 4ARAA 2WSLA 4G9GA 2Z8XA 2ROQA 5AKHA 3PDCA 1CUHA 2CBGA 2VT6A 5LZ7A 3LCRA 4BE9A 2GZRA 4HRYA 4IH9A 4G1FA 4Y2VA 4UHHA 1QFMA 5ALUA 2XUPA 4O08A 7YASA 4FLMA 4CI9A 5CT8A 1QIMA 3FSGA 3WKCA 3I1YA 1CUYA 1JT2A 2HFJA 3LLCA 1ORVA 2PPLA 1LGYA 1MU0A 5EHXA 5AIAA 2IIVA 1ACLA 5K3FB 2XQJA 2D5LA 4MYDA 3FLAA 1B6GA 1AQLA 4BCDA 3KXPA 3VJKA 1X2BA 3FNBA 2ES4A 5IVDA 2OPHA 4Q1VA 2BKLA 2PSHA 4RGYA 1EH5A 3V48A 3FSGD 2AJLI 5ALJA 4HTAA 2AJCA 4UHFA 3STVA 3BF7A 1GGVA 4KE6A 2HDWA 4KJXA 3G9XA 3H2IA 1QIIA 1GZ7A 5ALPA 5K3CA 1IUOA 3R3VA 1MJ5A 1ISPA 4EY7A 5FLKA 4F5ZA 2J3DA 2XMSA 1XZMA 4OU4A 5ALQA 1VZ2A 4B7ZA 4UHCA 3HSSA 3ESCA 4H7IA 4OU5A 1CUXA 1LZKA 4HS9A 2WKWA 2WUDA 1BS9A 1QIGA 5ALDA 1MTZA 4NVRA 5ALWA 1Q0RA 1CUDA 1MX9A 1W76A 2ZJFA 2VATA 1CUIA 2CZQA 5A7GA 1W6RA 1JU3A 3GELA 2PU5A 4CG2A 3HC7A 4C87A 5IKXA 5EHNA 4MXDA 4J0HA 3WQHA 4KR0A 3D3NA 4MQMA 1WB5A 1FSSA 1TK3A 2CUTA 1Q0ZA 5HFAA 4BE4A 2CEKA 3WKDA 2DQZA 1CQWA 2WIDA 3STXA 3AJAA 5ALFA 3GBSA 5FP0A 2G63A 4RE5A 1XZDA 4JUIA 4BB0A 4G8BA 1GPNA 5FKJA 2YH2A 4UHBA 1C4XA 5ALMA 2XUDA 4Y2TA 5KWJA 4PF1A 5JAPA 5I8PA 2QRUA 3AZQA 3GROA 1E3QA 1CUFA 3BDVA 3GUUA 1XRLA 1M33A 1LPNA 4QDTA 3NWOA 1AKNA 4BCBA 4CCWA 5IVIA 1XZJA 5CH3A 1YAHA 2O7RA 1H22A 3BIWA 1UT6A 3I2HA 1PJAA 3WI7A 4WCVA 6YASA 5FDFA 3WL5A 4DMHA 3QM1A 4EZIA 3VVMA 1KU6A 4P08A 3W05A 4KEAA 3WJ1A 4DTCA 3FYUA 2BGRA 5HQ3A 4UBNA 5EGNA 3CXUA 1UK8A 4CG3A 3UUEA 5JAUA 1U65A 4KAFA 4DNPA 4W9RA 4H7EA 1UK9A 3IDAA 4AO8A 5ALRA 3SC2A 5LKAA 5K5EA 4WY5A 4B85A 3BE8A 4DLNA 1QTRA 5ALYA 5AIBA 1HQDA 3ZLTA 1LNSA 3A6ZA 3LIPA 3I28A 1SCKA 4H7FA 1EK2A 3H1BA 3FYUB 1O6GA 3R0VA 4C88A 2OLEA 1LZLA 5DNUA 5HQ3B 1XKTA 3D7RA 4HXGA 2GZSA 1EHYA 4Q34A 1E8DA 2ZJ6A 4ZWNA 2XMQA 5ALVA 1IUPA 1JFRA 2FUKA 4AO6A 4YPVA 1D07A 4H77A 1JI3A 4UFOA 4EY6A 4H0CA 4X91A 5ALEA 2V9ZA 1E89A 5IVHA 2CB9A 3JYHA 5EIHA 3S2ZA 3BWXA 1F0PA 2WG0A 3GA7A 5HFNA 4E15A 1T4MA 1VJ5A 2VJBA 2WTMA 4Y2JA 5KWIA 3O4JA 3EQ7A 5EI5A 2O2IA 2Z8ZA 4PV7A 5AICA 4NS4A 4G8DA 4MEBA 4BATA
chains in the Genus database with same CATH superfamily
3SVLA 1E4EB 3H4MA 3L1KA 1PFWA 2NTNA 1KDOA 1MHPA 1QDUA 4IIJA 3WB1A 5KPJA 1QGED 4Z86A 1HRDA 4B32A 3NEPX 3F0TA 1NR7A 3JWGA 2DM6A 1VYTA 3WYCA 3TMKA 1Z38A 5H1YA 1T6ZA 3VR4H 1G1MA 5LXTA 2G09A 1E9FA 3HL4A 1Q0HA 1G8YA 1M2NA 2BMFA 2QQ0A 1W0KD 3S55A 5FLXA 3O3NB 4OGFA 2AG5A 2CYAA 4DYDA 4I9FA 5CW1A 3ZLJA 1OIWA 4TTIA 5EOVA 4CU5A 1XDWA 2JIDA 4TWJA 5KTYA 4PZCA 1QIDA 2AJTA 3K9HA 1ECJA 3HACA 4YQEA 3HXQA 2VF2A 2ZU6A 3CKKA 3QUAA 1AZTA 1IMJA 2PGOA 4OREX 4OLFA 5BSUA 3SHOA 4B76A 2HMVA 2P0EA 4K7JA 3H9JA 5A4MS 3JPWA 1ZGCA 1BTOA 2O07A 3EYWA 4J4TA 1WY7A 4RH1A 5EJIA 5CJ2A 2OOSA 4O6VA 4R69A 3ST7A 1UCFA 5EJ8A 3FUTA 4X24A 2CVQA 1Y1KE 1HPLA 1BXGA 4DUYB 4R98A 5K8CA 1YTUA 2Y1GA 4XQGA 4RMJA 1DBPA 1DBIA 5EEGA 1DJQA 1KZGB 1XLWA 3WDMA 4Y1FA 3J81A 1CVRA 4EYKA 4EI9A 4ZAYA 3OSUA 2OXCA 1IQUA 2JCGA 5AW0A 2ZE6A 3W04A 1ZEJA 3RYHB 3OAAA 3SEAA 3TEJA 1ZQ1A 2F59A 2E5WA 3WMFA 1V7QA 2H16A 1WUJS 1S3IA 4MMYB 3O73A 1L9KA 3K0BA 1MR3F 2CHFA 2YXPX 2V97A 3NDRA 2JNWA 4MITA 1FNSA 1DC5A 3AVQA 4JZKA 1TYEB 3DWGA 3FGZA 4LGYA 2BFNA 3NP9A 1JR3E 3ND6A 4AN0A 2ZUFA 3C43A 4G25A 2XOKD 2ISQA 5ARDA 5THXA 4Z7OB 1P4HA 2DWPA 3WGHA 4CIDA 2X1MA 2IY7A 4MS1A 3AF3A 5C3UA 2M2IA 3KHSA 3RS9A 4YBZA 1ZO8A 3G68A 5TF4A 3IRUA 4BQFA 5JLJA 3H13A 5K3AA 1K4KA 1QCZA 3P52A 1R4MB 5FIUA 3FNQA 2J8ZA 2B2XA 2ZJAA 4HO1X 2POCA 4AYXA 1BHO1 1NMQA 2P3OA 4MEJA 4YV7A 5FTMA 4K9OA 4ZI7F 3BCUA 4KOAA 1XXHE 4O8ZA 3DHYA 4OBBA 4EDFA 3BB3A 4C21A 1EUDB 2VHQA 3C1OA 5I7FA 1TKRA 1UOQA 1AX9A 5K0NA 5REQB 5I7AA 1QF6A 1ZZEA 1A9YA 2VH2A 4L28A 1LPPA 5F5LA 3ZQ4A 1TLTA 3H5WA 4AZ0B 4DMCA 4LDAA 2YZKA 4LEIA 4JUCA 2WTNA 2Y27A 4YACA 1NVGA 1F51E 4A15A 1FQKA 1UWKA 5JRZA 1CC1S 2GBFA 2HXGA 5G02A 2V96A 2FZEA 5K1ZA 3D8UA 1ZC3A 4KSCA 2HRRA 1QYXA 1XTVA 2QN7A 4PPFA 4G0WA 3UMSA 1RADA 2A9KA 3KKOA 3M34A 2GH1A 4FTWA 3JYQA 4G37A 5KJFA 2H9IA 1QGYA 2HF2A 2I71A 3HS3A 3OG9A 2Y66A 4Q6WA 2AXNA 4KO4S 3VR5D 4DLSA 1YA8A 1YS2X 2X8AA 3H97A 1ISRA 4Q3EA 4BKOA 4F12A 3IJRA 1BJKA 1L8QA 1DG3A 2LP4Y 1ZH2A 3MBOA 2PWZA 2E37A 1JG3A 3A9CA 2HMSA 4RY9A 2JCYA 1RZ3A 1TUEA 4UZEA 4XDHA 3VZQA 3N05A 3TZHA 2R6JA 4EW1A 1VHDA 2XBMA 2OYCA 1UODA 1OTYA 4UCFA 1WCWA 1F5SA 3Q7IA 2V1XA 2GK7A 4FINA 1CERA 4W4TA 5BSWA 1BCSA 3ORHA 4ZQIA 3HJUA 1IZ7A 1WDLA 4HBGA 3V32A 4KAJA 4QUDA 3TO5A 1HL3A 1M2FA 1P5ZB 1SHUX 1WEHA 2GBPA 4MKZA 2PANA 4MRAA 3I01M 4M6WA 4DT1A 3AFNA 2OUKA 3ESAA 4YGYA 2ZI4A 3NYRA 2H4HA 1X15A 4YJHB 4BMDA 3AY3A 1NUUA 2W2KA 2FQXA 1SVLA 1DCMA 3F2IA 5HDBB 3DYBA 5DRYA 4P4NA 3K09A 1CUSA 4MV0A 1Z0FA 2OAP1 2WT9A 1XZFA 4KIWA 1Y6QA 2YIDA 4CQMA 2CCKA 3PVCA 4HTFA 1WB6A 1PO7A 3QPVA 5KHLB 4CN9A 4CEJB 1BMFD 3ZJTA 2O2GA 1ZD5A 2I4MA 5A6VA 3PSHA 4V39A 5CXQA 3TE6A 1K4YA 1KQPA 4J6FA 1MXFA 5DXJA 3FDIA 4ZZ0A 1R4NB 3HVJA 3THWA 4G5HA 2R4TA 3EVBA 1IUKA 3JQDA 5JSUA 3VMMA 3O26A 1H23A 3VKFA 1NIJA 4URYR 4RV4A 3A3NA 5JI3E 4OJTA 2Y2VA 1ZZGA 2RAFA 5G53C 1GKUB 4HZGA 2XUIA 2G5TA 4KWHA 4UNRA 2I91A 2ZT7A 4Z4EA 1VKNA 3JARA 4FX5A 4BFLA 1NFFA 1F8UA 2UUOA 3KJQA 4MWGA 1H0HA 1OSNA 2VDPB 5AHWA 4EGQA 4YASA 1DCKA 1H85A 4ER5A 4EJSA 1IPHA 1NC3A 5ESWA 2VQSA 2D13A 5FB3A 1FSZA 4AMGA 3UK6A 4E7OA 2FFQA 2NO4A 3GUVA 1OJLA 4IO1A 5BW8A 3EGCA 2I99A 3KYCB 5DP1A 1P0PA 4O4HF 5DNYB 4LWZA 1X2EA 2VRBA 1UT8A 3RBXA 5JEDA 2C4WA 3KTDA 2ZXFA 2VSFA 3F3KA 4HDSA 1N5KA 4QOJA 2ZIVB 2FWNA 1MVOA 1PEAA 2QXUA 4R16A 3S1AA 4XGRA 1MX5A 1ORHA 2AXQA 3WRWA 4DG8A 3NUGA 4UEJA 5DTJA 3S2UA 2WD7B 5KNDH 2JL1A 5F33A 1N78A 1N57A 3WE7A 4DYVA 5TV2A 3JWEA 1L7AA 1TT7A 3IUYA 5JCXA 1CDDA 3LWNA 3TIVA 2GLUA 3A32A 1DZ3A 1WU8A 2IVZA 2ECQA 4OKNA 4RVUA 1A5ZA 4TPKA 5FPYA 1FFAA 2AFIA 2CDRA 3AUKA 3CLUC 3P9QA 1B7GO 3IEXA 2PV7A 3PIIA 2VHYA 4FX2A 5HX7A 2CF5A 2IW1A 2DQYA 2YJTD 3LFTA 2EC5A 1G0OA 1Q6ZA 5I9LA 1OYWA 3N2YA 3TBFA 5JDCA 4ND8A 2HPVA 1YC2A 2I87A 3B70A 4DAOA 4XJVA 6AT1A 2OENG 2RD2A 3LHFA 1G8GA 1JFFA 4PCAA 3SR4A 3T0GA 3FPLA 3ZKWB 4YX9A 3P2YA 3D59A 3TNFA 1IN4A 1W2GA 5BN1A 3NKLA 1VYVA 4N48A 3L8CA 4YP9A 1XELA 4S3MA 2ZIWB 3MBIA 4FYPA 3NBXX 2UAGA 3CUUA 3ICPA 3FLBA 4EPYA 3EG5A 4LQLA 2B8TA 1LDEA 1P2BA 1B0PA 2RJ3A 1W4RA 5DYWA 4IQ4A 1RFGE 1ZJYA 5E38A 5FPSA 4PC2A 3DHVA 3P0JA 2XZOA 3W2EA 4KE9A 4DGQA 5HPYB 5AOAA 1PD0A 3KE8A 2XZDA 2WDPA 3JQ8B 4BMZA 3QUBA 2CXOA 1NYTA 1IXKA 3L0DA 4EO9A 4F6RB 1V0JA 2MSLA 4B7AA 4QVIA 1NVBA 1N6IA 2PGXA 4CR6A 2H00A 3DO8A 1Y81A 3LCUA 4QSHA 1IH8A 4DIKA 2Q2VA 3MTIA 1T2AA 3N8IA 2ZBRA 2CLKB 4DCGA 1UKVY 3T1OA 1RABA 4QDJA 1JHXA 4FDLA 4XIGS 2P0AA 2QAGC 3JQ7B 4P3KA 2C42A 4C6SA 2Y1FA 1E0DA 2IL1A 4U5QA 3LU1A 4RH3A 2VTBB 2I2WA 5JTUA 3NBZC 2BTOA 2WJ3A 3MGCA 5I47A 5CITA 3RS4A 1M9NA 2WYWA 1QORA 3BN3A 5FI3A 5IJWA 1M2EA 3K2BA 5K3EA 3IMCA 3ZE2B 4OP2A 3MGGA 2JH9A 2O9JA 4Q7MB 3FVVA 1VGRA 5F4BA 5E7IA 1EXVA 3TECE 3ANYB 1OA1A 1TIPA 6ADHA 2ET6A 3KUUA 2VYND 3B1VA 2X6QA 1Y4SA 2CD7A 1DDOA 4FKMA 2C78A 4LRTB 1HDXA 1A9XB 1KEVA 1Z47A 2WIBA 1J1ZA 1T3HA 2CVPA 1LC0A 2O0HA 2YXBA 3GRPA 3L40A 1NJ8A 3MLBA 5PNTA 1T1RA 3T7CA 1CEQA 4JDUA 1NHWA 2HA0A 1Z4LA 4CCYB 1W48A 3NRBA 2D8AA 2D3TA 1W88B 4HKTA 3RYTC 3VA7A 3R9KA 4N5MA 4IX1A 4I4NA 2IWHA 4MDHA 4NU6A 5TMEA 4R8KA 4M9CA 4TSRA 5IH7A 1T9DA 3B2NA 3FGNA 1U9IA 3DOIA 3OZIA 2GS9A 4XWOA 3DMRA 3HV2A 1TMOA 3LO8A 3M33A 1X7DA 3PEVA 1E6CA 1YKSA 2TSYB 3JZMA 1QH9A 3NHPA 5F64A 3RD5A 1XDZA 3L8FA 3IBYA 3R1IA 5ICGA 2SECE 4DQVA 1FVXA 4MZDA 4HNTA 2XSZD 3D8TA 1N9GA 2M1XA 4LJ7A 3M6AA 4MUEA 4TLDA 4C6RA 4DYHA 3TZCA 1E2DA 4L4SA 3RF6A 3L7MA 2CZGA 1C7IA 3F9IA 3BCRA 4GOLD 4OQPA 2M6RA 3EVAA 4ESOA 3AY6A 5BRNA 2R48A 1GKYA 2QTBA 3KWLA 2EXXA 4PHHA 4TYMA 4R2JA 1PCXA 1Z39A 1MEJA 3MLAA 1UF9A 5BN3B 3ZJVA 3UB4A 2IYRA 1YR8A 3QEMB 1G64A 5H7XA 5BMVF 3IX7A 2VJCA 5CDFA 3HJBA 3FNHA 3B6ZA 3PCRB 3IP3A 4HRAA 5KNBA 3BJRA 3D6VA 3EMBA 1RHJA 5JBIA 1D2HA 4F1WA 3HA3A 1YRHA 3K2IA 3W79A 1P33A 1KMIY 1TVKA 4QOEA 1JFVA 2RG1A 3E1GA 3EXIA 1VFNA 4L3WA 4LPKA 1MAWA 4QXRA 5BW5A 1Y9ZA 5TIIA 1DLIA 3A2MA 3V55A 4CFZA 2KPOA 2AUNA 2DSNA 4XQ0A 3RVMA 1IHDA 5INTA 3C45A 4GSYA 3CSUA 4LRSB 1YH3A 2B8JA 2RJNA 1IY0A 3AESA 4LXGA 4F2GA 2PGIA 3IQFA 2IP2A 3M49A 4J43A 3T94A 5DU2A 1XX6A 7MDHA 3AIKA 5KQRA 3PP8A 1DFHA 3W2HA 3KX2A 4ENWA 5F9MA 3VDNB 2C2GA 5FUMA 4RSRA 2BR4A 3BOSA 3G8CA 5HE9A 1LSOA 5KNCH 1WVGA 2ZAOA 3E9QA 2NTJA 4D9NA 2ADMA 3CUSA 1D4FA 1EP3B 1NR1A 1OILA 1GO2A 3R5JA 3IIIA 4BJ5A 3JR3A 2I03A 3QBTA 1AY0A 1TU0A 1T2CA 1Y82A 4G4JA 4UNPA 1KK2A 1JA1A 5JFOA 3ICOA 5DCLA 3GP3A 1G60A 1T5BA 3DBRA 3DZHA 1F2DA 1V39A 4C4SA 2NACA 2C8LA 4J0DA 1QM5A 2DWOA 3SFVA 1WWKA 2P67A 3FPJA 2GYYA 1HYBA 4QOFA 1TW3A 1UOEA 2NG1A 4YFVA 4IO0A 3GBVA 2XUHA 4HK4A 3VV2A 2QPLA 4Q7JB 3KHUA 3BAFA 1NLFA 1WOYA 4D6YA 1GTRA 1G59A 2O0JA 4ZAZA 4YMUA 3OWHA 2HD4A 1VCIA 1SU8A 1Y8QB 2QENA 3B1XA 4AJ1A 3IKTA 4PZZA 1EX7A 1LBIA 1XZNA 2JIRA 3JQ9C 3V2IA 4AL4A 2Z1DA 1T0IA 3L1VA 4RHCA 5DXFA 3K0FB 4K6HA 2ZRIA 3NASA 3GMTA 4GLLA 1Y9JA 5E1BA 4RK7A 2XR1A 4MLDA 5DM4A 1M66A 3SI7A 3N58A 3Q7RA 3VKUA 5JJBA 1YR7A 3E7PA 4MUMA 4TX1A 2JLYA 2J67A 1HTWA 4M1SA 3O4IA 3JQPA 4OGKA 3TI9A 1FP7A 2ORVA 1I1NA 3JZIA 3TN7A 1WXDA 4WOPA 1NUHA 1RAHA 4G1VA 4E32A 3NGXA 4F38A 3BJEA 2IOFK 3CLRC 4XSGA 3HM9A 5BV2P 4DKJA 1SKQA 1LPSA 3U4IA 3L43A 2DUJA 2FRDA 2WFLA 3L6CA 5COBA 1A04A 1KDVA 2FSFA 1NNLA 1SVOA 5F77A 4M49A 1N4AA 3HBFA 3A1NA 1P19A 5EE9A 3RFCA 1GNLA 2C2MA 1I9CA 4D4LA 3GF4A 4M22A 3OM0A 2HKIA 3HB7A 2FG5A 4LRWA 3I76A 1SGWA 5D5HA 1LK7A 2XUJA 1U9ZA 5JJIA 1G2IA 2V8OA 2VT3A 2MWMA 2TYSB 2A0XA 3MHTA 3WB2A 4KOEC 2WWTA 1N6RA 1O03A 3EQZA 4OB8A 5A05A 3QE4A 3QU5A 1K3UB 3RR2A 4YRSA 1K86A 4XWAA 2G25A 4CLOA 1O5TA 1Q1NA 3AFHA 2EJBA 4ZU3A 3JZFA 3VX4A 4BLQA 4C89A 4ZGWA 2RSLA 3E4CA 5B3AA 1THTA 4GXTA 3EZ2A 2X1VA 2K2QB 4R6WA 4ZVLA 3AI2A 4E6PA 4A0SA 4EX6A 3IA7A 4DCOA 3OOHA 2D7DA 2DJ5A 1ZQ9A 4IMJB 1WCIA 2ZBGA 4P4UA 4F92B 2O23A 1PS9A 4KAAA 1T3LA 4GFDA 4LMAA 2AMLA 4UBLA 5DTRA 5T41A 1DKUA 4EYEA 3KJGA 3LRTA 1SUFA 4WKCA 3EXHA 3LUCA 4CRWB 2BHNA 5BSKA 2WIJA 1ZKMA 4HNAA 1YJXA 1PZNA 2A92A 2CEAA 2NZYA 1W94A 3CX4A 2C84A 5AW5A 2P5YA 1FRZA 1U98A 2AV6A 3O9ZA 3IS3A 4XIYA 3KSAC 3K5WA 4QPZA 3UV3A 1DMSA 3NTXA 1DRVA 1R50A 1AQJA 3D2LA 3E61A 4IVQA 1E2BA 3SBXA 2IQ5A 1XPOA 2XE7A 4QQNA 5C4IA 4J0KA 3FGPA 1PHPA 2P62A 3W0LB 5LIPA 2C4TA 4PQGA 5ITWA 2FPIB 3UJHA 2BSXA 3MSXA 1VJ1A 3TRHA 2HJSA 2X0KA 2AMFA 4D0NA 3I5XA 3L06A 4KDCA 3I5AA 4UCQA 4KW7A 3WNBA 2FF7A 2PO7A 1XCPA 1JMYA 2P4SA 1NJGA 1ZD1A 2TMYA 2XYHA 4WKOA 1YS1X 5K6RA 1RJFA 3MINB 3U7IA 4GZ3A 1I3OA 4WX2B 1HORA 3B52X 3N3AC 1JVSA 1E66A 3KVYA 2GHQA 3QXGA 5JU6A 1I30A 1X42A 3DAOA 1JHMA 3R3XA 4RY2A 4D1YA 3DDCA 1O7JA 4KDEA 2EIXA 5G1PA 3VDMA 1LLCA 1MGPA 1R6UA 1R0WA 2XA2A 4JL5A 5DBIA 1JHQA 3TW8A 1VLJA 4XFDA 1W5FA 3SXPA 3WLEA 1K98A 2GHTA 4PIMA 5TT0A 1I2DA 2FEPA 1A95A 1CY8A 3EE6A 1GTMA 2B36A 3LT2A 2RGGA 3A4TA 2BVNA 2HT6A 3GLFB 1PJTA 1SO8A 1HA3A 4PBSA 3EF0A 1CJSA 1FLAA 4ND1A 1K6XA 3WGUA 3FPBA 4J16A 1JYFA 1S3FA 2WSSA 3B6IA 4X6YA 5FI0B 3PX7A 1SC3A 1L5QA 1L5ZA 4ZI3A 1NU8A 1QVVA 4NPAA 3VYSB 4WESA 2VKTA 4BO9A 1FW8A 7MHTA 3P9SA 2HAEA 1G2OA 1ISGA 2DUNA 1UM8A 1YRYE 1TEXA 4TQAA 5GJWC 3LRPA 4JLVA 4OLJA 5FL3A 2C95A 4AJ9A 4Z0TA 2AOTA 4N54A 2G04A 1I14A 5AVXA 5FH9A 1Y1SA 2JFUA 3U4MA 3ZGZA 1EDBA 3S27A 1HTBA 1V9SA 1BKYA 1QP4A 3BUSA 5IBPA 1G21E 1AB5A 1T4BA 4CLRA 2IP4A 2WSYB 2B4KA 2BEKA 2EFDB 3OJ0A 2GZDA 3SYMA 5LD2B 3FCXA 3MWGA 3CEHA 2ODNA 2A67A 4Y67A 3TD9A 2MTBA 2WLTA 3IHLA 4B5KA 4OM7A 2YMPA 2VHTA 3H2KA 5JS2A 4AI6A 2GF2A 3CISA 3ES9A 4OQLA 1GEGA 1MQ8B 4CXMA 3WNQA 4NFLA 1DC8A 3TNLA 3JALB 3V8MA 2VVTA 1C7RA 2WJWA 4GOND 3G2HA 4L9RA 1IY1A 1XA4A 2G4CA 3K0AB 3DT9A 5CG2A 3B36A 1YR6A 3LP8A 4BLPA 1YBMA 1PRYA 3ZU2A 1KVTA 4DQKA 4AROA 4F21A 5C1BA 2H0RA 4PSDA 3I72A 3I2FA 4X20A 4OKIA 2LPMA 2PH1A 1H4VB 1UXJA 1QGOA 3B85A 4MW9A 4Y9RA 3TLYA 3V34A 1RMYA 1ZA1A 1WO8A 5L7WA 3DD1A 3FNFA 2FLKA 2OSBA 4MO9A 1CVIA 4XD7D 1HZZA 2OY0A 4GNRA 1PYGA 1M0WA 4LX0A 2CV0A 2WVHA 4GAEA 3P2OA 2QJFA 4PQEA 1ZEMA 4U1RA 1Z6PA 2AS0A 2VJYA 3A25A 2XXAA 2WFAA 3GC6A 4N7BA 2RGDA 1YFLA 1TM1E 4HDRB 5HCUA 3F5FA 3CEMA 1HX7A 1MVNA 3UWSA 1RW4A 4XM0A 1N5DA 3VPHA 1UEJA 1CT9A 1VSTA 5JPIA 4H1WA 1KPIA 1XMSA 2XT0A 4B3DA 3HCCA 5LQCA 4EUKA 3BB4A 2FRXA 5ALHA 2FEOA 2VT7A 3D7NA 3LBHA 1SOVA 3CJRA 3FHCB 5JZ9A 2ZCJA 5HKAA 4MRRA 1ADCA 1UMCB 2XV1A 4QHTA 5CA1A 3GZNB 1YZQA 1FFWA 3RWBA 5C31A 4LCJA 4HVTA 8OHMA 4OL0A 4N76A 3VM6A 2F48A 1MOPA 4J1NA 2XHEA 1NRXA 3OD1A 4WAUA 3N5CA 2XTNA 4Q5IA 1SWWA 4CKBA 2BSQA 5EJAA 3D7LA 5HIAA 4L0QA 1Z6XA 3N9IA 2KM1A 1DOHA 2HGSA 5LUBA 3RGGA 3RSZA 1JEAA 1NBHA 4ENVA 5IT9A 4DFDA 1CRLA 2C29D 1Q21A 2XUKA 1WY5A 2ZBQA 3GJYA 3GGOA 4UPDA 3EUWA 1GZHB 2EJTA 3MGAA 2KBEA 3ZCPA 3GLGA 3DBIA 5DX0A 1SVWA 3S7TA 2WSMA 5EHQA 3LIIA 4WY2A 3TF5A 1UPCA 2M6LA 5MHTA 5DTMA 1SELA 3F6YA 4F1KA 2TMGA 4AWXA 3EQ2A 2E2WA 1DAOA 3QKSB 1H8HA 2FMIA 4JI7B 3H86A 1QPGA 2CHUA 4BFWA 2OG1A 4LF5B 1KI1A 5T4EA 1HDZA 4D9BA 4MYUA 2IUYA 3VU1A 3O94A 2GRUA 3OMWA 4YAWA 1M75A 1AB6A 1OIVA 1GOTA 2JLBA 3VI4B 4AKEA 3ZE1B 2FUEA 1TCCA 1A4XA 4YRQA 5I4CA 2JBAB 4G2TA 4Z99A 4JLBA 1FL9A 4OHRA 2AYXA 3AVXA 1GYRA 4B0PA 1C7ZA 2AE2A 4AF7A 4QJ3A 4Q1FA 1Y4ZA 4RX1A 2VP9A 2ZXUA 1SPXA 4CL8A 1QCYA 1M6VB 5BRAA 8ATCA 1LWNA 3SHFA 5K3OA 3JAWB 2Q1XA 1ZLYA 2I7TA 2B34A 3D02A 4TKVA 3ESYA 1VE6A 3U7QA 4LZZA 2OV6A 2UUAB 2QBYA 2REQA 1ELOA 1BWQA 2XKJE 4K9DA 1PFUA 1GZ6A 3JW8A 4NH0A 1CNMA 2OTCA 1ZD8A 2AH5A 4YP7A 1GZ5A 3EODA 3ROKA 4FGLA 5TMBA 1TEVA 2OWDA 1REQB 1JFTA 2IXGA 5IAEA 4A6EA 1R74A 4Q4JB 1PK9A 5JARA 1GP2A 1Z33A 3MXOA 1UK6A 4D3FA 3BE5A 3G0BA 1GZ4A 1D5WA 1QK3A 2BMEA 2FG6C 3HY3A 3UKDA 4PWZA 3O8QB 2FWRA 5ER9A 4WXHA 5D87A 5F9FA 4JJ6A 4CQJA 3TNYA 1KP9A 3C6QA 1U8UA 3O2SB 3A6JA 1TRHA 1GU7A 1N5LA 4YFYA 3V6LA 1GDHA 1X80B 4L22A 1KSHA 1SXJD 1VIYA 1WUHS 3MMPA 3PSAA 2QNIA 1VP3A 3EHDA 1C3LA 1LJ8A 2CGEA 4EKNB 2ZRKA 1USGA 4A2PA 3RQSA 4TKUB 3SD7A 2NXCA 1OXXK 4WJZA 1IM5A 4EHNA 3E4DA 2DPLA 1Z2DA 2HQOA 3KZ1E 2GSWA 4AXBA 3JSAA 5D6OA 2FWPA 2GJKA 3ENVA 1ZUWA 1VYHA 3LG2A 3JQFA 3CSSA 2WHQA 4P0QB 1B0ZA 1WXHA 5FNZA 2EARA 5JXJA 2PQ0A 1HFJA 1IZZA 2B99A 5DWDA 1OXUA 2HDOA 2VN8A 2O1EA 4U8GA 4TS4A 2CJYA 2V54A 3E3MA 2P6NA 3T9DA 2FXVA 2P41A 2VJAA 1EWVA 4TVOA 4KB5A 4Z4HA 5H4GA 3ENNA 1FPQA 1K7CA 4Z9YA 1RWQA 1QNLA 2ZAGA 4ER7A 1CX9B 1SD1A 1XG5A 2D0OB 3EXFA 4GWLA 5FNVF 2WAAA 1K6IA 3ZWKA 4AK9A 2YXEA 5EINA 2A3RA 5GZ6A 2IOQA 2J32A 3I2IA 4GOKA 1NPTO 5ARCA 3QV2A 3PEEA 4RE6A 1XRSB 2X86A 4CMKA 1P44A 3UN1A 3CONA 2H3HA 4H4CA 4ZN6A 3QTBA 4KLCA 1L4KA 1YHYA 1BX3A 2BFPA 1J9ZA 1MB3A 3K73O 3FBTA 4B75A 4ZI7B 1X1DA 4GMDA 3BA1A 1QUFA 1IEVA 4HGRA 2E0IA 1C4KA 4TMYA 4DADA 4H9GA 4LJ4A 4UBIA 2I6SA 3PNVA 1XLTA 5P8WA 1FFBA 1QFXA 3DE5X 3UT5A 3DAGA 3D4NA 3NR2A 4QC2A 3B3FA 5G3ZA 2JPDA 2MSCB 4CQNA 2GYWA 2NTYC 4MCHA 4YT5A 1YULA 1ENYA 4JQYA 2XF2A 2PBRA 2AZDA 3OPYA 3FHLA 3NOVA 4YJGB 3PC6A 1PR9A 3RUIA 1RLJA 2QTVA 4AT1A 1TT5A 1XEXA 4IQGA 3H4TA 4ZRMA 3HJAA 3VO2A 2EAUA 3DMDA 4OHUA 3AGPA 3RKSA 1QVAA 4HYYA 4R0VA 3K0HA 4EGFA 2A3NA 3ZUGA 2ZWOA 3QEOA 4Z4IA 4XR9A 4NJEA 2IHBA 4DEVA 4WXPA 4XASA 4HQOA 1QIHA 5IUKC 2P6UA 1WXFA 1IN8A 4C0XA 4EHDA 5HE8A 3EXG2 5JYBA 5L3QB 1C8LA 3PG5A 1OX6A 4IHKA 4DIOA 1M2KA 3ZNQA 1T13A 2CJWB 3M1IA 4CG1A 1U7TA 4UVGA 2W37A 3AJRA 4ND4A 3ZDFA 2QDXA 2I5PO 3OZAA 5CLQA 4H6PA 3P71T 4R9SA 2YWJA 4F04A 1KWKA 4A1OA 4PFKA 4HPWA 2JLRA 2FZKA 4HF7A 1JWLA 3JVUA 1FRQA 3DPSA 5TB5A 1ECLA 4WHMA 3UNXA 3D3JA 3KEGA 3FYUC 1N8TA 1P7ZA 2BKVA 2C5FA 4LAFA 2PY6A 3MW8A 3FVQA 1W87A 5ED4A 2Y92A 3DB2A 5I6DA 1E6WA 3ZJUA 1MO6A 3IALA 5A7FA 2ZT6A 2VQEB 3AKZA 1FIUA 3BULA 2QVYX 4AYTA 3R76A 5FTWA 4YN3A 5C5IA 1QQBA 2Q9CA 5FWYB 1SOMA 3OJWA 3ZZUA 2IH2A 1XRJA 2OLKA 1KF0A 1Y7PA 2V0CA 1U5AA 2JKZA 3TKLA 4BLRA 1Z4IA 4OMFG 2D00A 3I6BA 1P4JA 4MGHA 4X8OA 3TRJA 3ZOKA 1AJEA 3JWPA 3ENZA 3HQ4O 3T9AA 4LOJA 1LCIA 1NQXA 1RLMA 1HM5A 3K5IA 2CHEA 3DUFA 4FOOA 1JHPA 2CCGA 1E1NA 1F06A 3R3SA 4NULA 2IC5A 3R7LA 3BXPA 2Y71A 4YMVA 3X3HA 2GEJA 4C07A 2HCRA 1EYZA 1GCIA 5F1YA 2I67A 3ETHA 5A4IS 2ZM5A 2ZYHA 1PGJA 4LHVA 4U7HA 3JVIA 2B35A 2HIMA 3T5BA 1XTRA 1MC8A 4YCJA 4FVTA 1HEIA 3L0SA 4I66A 3CCBA 2X77A 5ABPA 5JPDA 2MSDB 1SM4A 3C3CA 4KSYA 5BWBA 1Q2XA 1WX1A 3C1UA 1VE7A 1PLKA 2HMUA 3OZFA 1IUNA 3PVSA 1NW8A 1KI8A 1I10A 2O2HA 2RGAA 2W4QA 2PX2A 2ZDQA 5F2NA 5CGZA 3SMQA 3ZWNA 3C6YA 1AKWA 1OBOA 1EMDA 1V4NA 3I04A 3OWXA 4XX1A 1DL5A 3IH5A 3S7ZA 1TMGE 3H3XA 4CGYA 2O8BB 1TPYA 3R24A 3SVZA 3VYWA 5JO0A 3AUYA 2OZLA 3R7WA 5GM2A 2XRYA 3ZWAA 1NW5A 1SBCA 4QBGB 2QMEA 4JBGA 1B1CA 1LDYA 1PBTA 2HK8A 1YIOA 3F8TA 1G8JA 1S1CA 4CIWA 2X8LA 3CRRA 1Y1PA 5ALGA 3A6LA 4Q1BA 1S8AA 3BICA 1V45E 3KFXA 3KS9A 1UKBA 5K6AA 4KREA 3LYLA 2G28A 3WDLA 4FZRA 3ZZTA 4DABA 1M6WA 2HOQA 1VRCA 3EAQA 3TG8A 4ETWA 4F4IA 2OZVA 3M9WA 5JD4A 4JT4A 1PX0A 1E2UA 4O2BF 4PQFA 3C3WA 3FPFA 5KOYA 2Y6VA 1NVTA 3QOWA 3V4LA 3WJ7A 3IL2A 3D8SA 3EDMA 2CXHA 2QN8A 5C7YA 1UWCA 2RAUA 4YQFA 2CNDA 4H6WA 4XA8A 5BQXA 2GPWA 4E5KA 3ONVA 5HOQA 3PRYA 3OJXA 4QECA 3NVKI 4R8LA 4BEJA 1QQTA 2FN3A 4KWTA 2O3JA 1SBYA 3C8DA 1E79D 1V96A 3HABA 1BXRB 1UOOA 1TZBA 3T6KA 2CMHA 4FZ5A 2HGZA 1YVEI 2NU6A 3GWGA 1P2SA 3H7AA 1MQ9A 5F3RA 1ZH8A 3H2JA 4N8SA 1MJGM 1ZRSA 1Z63A 1J42A 3SJZA 5LNK6 1UKEA 2DCUA 1KS9A 1H1LA 1JIQA 5EZ6B 1BMQA 2A2ZA 3BRQA 4O3FA 1GNQA 2H2GA 4JBNA 4PRYA 1YBFA 1RRPA 3LWDA 3UJAA 1BGWA 3R5SA 5CVCA 3OP1A 2GPNA 4GHWA 3DSRA 3LX6A 2HI0A 1QHHB 1IN1A 2FQYA 3GAAA 4C4ZA 3BDAA 1DJLA 2A0KA 5EMJA 1Q0SA 1E6LA 4NHOA 2ZCVA 4TM8A 5CLHA 1MF7A 1LFDB 1YZTA 1R7RA 2HB6A 1OXMA 3U9TA 3E9CA 3SC4A 4BP3A 1I36A 1PW7A 3WB9A 1LWOA 4A8JB 4H16A 2BFCA 2G71A 2BI7A 4URVR 4RF3A 3WGIA 4BC1A 2I6XA 4DCNA 2QE7D 4UEKA 4XTRA 2DH6A 5HJ5A 2IU4A 5COQA 2YASA 1ZVMA 2HHAA 5HF5A 2VNKA 5IBCA 2BCJQ 3AIMA 4JLNA 2Y1KA 3DULA 2H0AA 4HWRA 3T7KA 3T7RA 5IAOA 5HZMA 2WF9A 2XMZA 1R0XA 2P9YA 4FDMA 1GY8A 4FEYA 1EU1A 1ZW1A 1MVLA 4DRZA 2B2CA 2IKSA 3SE7A 3T7IA 1DPFA 1VL0A 1LK5A 2JGDA 1DV2A 3UK2A 2XA9A 3ZD9A 4RIHA 4DEYA 5AW6A 5K0LA 1EFVB 3DOOA 4IOMA 2H31A 3K0FA 4Q47A 3TSOA 2BFBA 4EY8A 2P2SA 4Q7EA 3OLCX 3LLSA 4M53A 2WHXA 3RVKA 2GEFA 3W5SA 4H6VA 2IEAA 4NECA 1ODCA 1G5PA 1OZ0A 1Z8HA 2A1UB 4QDZA 4CNBA 5BNIA 4KQ9A 2YDXA 2IIBA 1JHYA 1QX4A 2GXUA 3EVNA 1DE0A 4KYTA 3TQOA 4C04A 4YUYA 5ITVA 1CUGA 2BH9A 5CYGA 4INOA 1CUCA 3FTCA 5DYGA 4IDAA 4R4JA 5AKZA 3AP3A 5DMXA 1QBGA 2HWWA 5DM1A 1SG0A 2D4HA 1M1NB 4OHFA 2Y0EA 3R7NA 3WV4A 4D82A 4HZIA 4GOXA 4QOHA 4AWAA 5AK0A 3TKAA 4EHBA 3TJMA 4RQBA 1QO7A 1Q7GA 1MOQA 3AEQB 4IZOA 5JQWA 1MBZA 2ZRHA 3E9ZA 1EX6A 3FZGA 3FF1A 1QFZA 3J7AC 3F6SA 1M0SA 2G5GX 4XLZA 5B1SA 3WIBA 4ZJYA 2Q2NA 2W6ID 5KDOA 4QARA 2J3JA 1QFYA 2IITA 5EZ5A 3VPAA 2X8BA 1UJCA 3TLBA 2ABWA 3DAFA 3AHCA 4MJ3A 4G97A 5KOIA 3KPJA 3Q9UA 3EC7A 5T4BA 1CQJA 4KAXA 2Y2UA 1QLWA 1D0VA 5LU8A 5FADA 5BSTA 4M8KA 4LOKA 4RLHA 3UTCA 4AIIA 1KZ1A 2OHXA 1TC1A 2J3EA 2ONKA 1E1DA 1A76A 2C54A 2CXNA 2QT9A 4FXPA 4UCWA 5E9QA 2HFKA 2JZNA 4FDAA 2AWNA 3U2QA 4P22A 1P0MA 3STUA 5DNEA 2Q7DA 1NWCA 1ZG3A 3QMWA 2C61A 3NAGA 5FBZA 3NP7A 1CDEA 3G13A 3ZY6A 2BEWB 2CNKA 3PCTA 4DHEA 2ZE8A 3DT8A 3SMVA 5JQGA 3I9FA 2VIIA 3LV8A 4R8SA 2AE1A 1KE2A 2VG8A 2H2HA 2PZMA 1JLSA 2GWHA 2RH9B 3D4IA 3Q3VA 1L5SA 3COJA 1N34B 1N2EA 1JW9B 5TGTA 5TDHA 4XZ3A 5B1DA 1SBZA 1CXZA 3A70A 2QRJA 1CQIA 3SG0A 2ECPA 5IJ0B 1UKCA 3I9JA 421PA 2JZCA 3DBHB 3MD0A 3V4PB 5C81A 1F2UB 1RXIA 4E46A 2XGJA 4KX5A 1E5TA 2QVGA 1SOUA 4X6XA 1QO9A 3DCYA 3URKA 2IF2A 2WJ6A 3F2VA 3QFRA 3R3UA 2Q5CA 4KQIA 1UQTA 2CFRA 3OMXA 5DF1A 1PK7A 2ZIEA 3DBLA 5EPUA 3K0CA 4WSOA 1KETA 1XKLA 2IHYA 3P5BA 4B6GA 4KWEA 4LY3A 4P80A 3K6SA 1ZN7A 3F1LA 4L72A 2FQWA 3TCXB 1RQ2A 5TQVA 3BE4A 2RBGA 4E5YA 2CE7A 1VHQA 2R2AA 2J9FA 5JASA 1OLSB 1MHTA 3QMPA 1Z17A 3NONA 1M2JA 1Y8AA 3ROQA 3VZSA 4BNHA 1EGHA 1KVQA 2JW5A 3OOJA 4QM7A 1CZNA 5AM0A 1ZXXA 4PG7A 4OA5A 4LQ4A 1WXXA 1UFVA 4X9XA 5LU9A 3SX4A 1PU2A 1U0FA 3OZVA 4ZVQA 3UWKA 4G4SP 5DCWA 5AKXA 2P9CA 4QNMA 1W36C 4I2NA 2ZB8A 2ZQ5A 3MJCA 3RC3A 1LW7A 3S29A 4QREA 1XMPA 3K09C 4BASA 1YA4A 1XTKA 4RA6A 1U0OC 2CFTA 1VCMA 2VTKA 5TMDA 1U7DA 4BO1A 3KQHA 5DOZA 2HM7A 2HEGA 3QFSA 2C0CA 2O4UX 1O8CA 4YAGA 5DLYA 3CRNA 1GKIA 2PNFA 4HDMB 3GLFA 1X1RA 3DZDA 5KSYA 4NLLA 2RBKA 5TGZA 4I14A 5CXSA 4RHFA 4L5YA 3RTGA 4AS1A 1H5NA 1USVA 4JIGA 8ABPA 5EKDA 1XTSA 1Z2NX 1C1YA 3T7EA 5KBYA 2FW1A 5F2KA 2DFLA 3P4XA 1HDCA 4CM5A 2WAOA 2P8JA 4BMSA 3AEKA 3EIOA 5GV8A 1VLLA 3ADOA 3UMRA 2F43B 3LNTA 4C4PA 3IR6A 2VHEA 1J2TA 3H2YA 1J8VA 2Z08A 5A3VA 1K2WA 2HCTA 2W6OA 1NVVQ 3SICE 2W6ZA 3ZE6A 2IA5A 2NV0A 5IARA 3A1SA 1E0JA 1JTVA 3EIHA 1FSGA 3FX2A 4GKKB 3EFOA 3K31A 4R2MA 1T5DX 5G4KB 1TVCA 3F7MA 4A9AA 4HR7A 2QSJA 4QPNA 4M0MA 3ZI0A 1JQJC 4QTXA 4TYYA 3QF7A 5EJEA 4OHOA 4PU0A 2O7VA 3OIGA 3S2GA 5HNKA 1Q1GA 3U3KA 2V4UA 1E1YA 4R81A 3UYLA 3U56A 4Q7KA 3JALA 1HE3A 4A5SA 4AUKA 3LPMA 2GN1A 5TSDA 3STWA 2XVMA 1GGFA 2CXXA 4IHJB 3KU1A 1XFDA 3FDZB 1GN9A 1Z5UA 1EUYA 4BZZA 5EXDA 3HUEA 2O5CA 5LP6B 2OGZA 1BS1A 4IHQA 5JNTA 4U7TB 1PJ8A 1RI2A 2RHTA 2JFWA 1VJ0A 3KLPX 2HY7A 3Q1KA 4K40A 1N6PA 2WJ4A 1V2GA 2XGGA 4O5OA 5CH5A 1UQUA 2PZ8A 4R9NA 3RIYA 3WLLA 2M6KA 3NXKA 4XJXA 5BNWA 3JX9A 4FGUA 4MSUA 1CDOA 1YVRA 4WXYB 3UMBA 2CSUA 1R5BA 3W8EA 2WE7A 2PDAA 3A6EA 3M6MD 3QIAA 4JYZA 3WL8A 4IH4A 3D0OA 5HZKA 1H2AS 2E87A 4BRSA 3EBPA 4K5QA 1ZI6A 4REQA 4E2XA 4YT4A 1CVLA 3SXJA 1L6RA 3J80A 3BAZA 2PKWA 4RJLA 5GONA 4DLAA 1D03A 3D5EA 2VAVA 4PN3A 2QTZA 2R1UA 1IBKB 1BOFA 2DOKA 3RRXA 4E07A 1JYSA 1F4VA 2GWRA 3G0OA 2GZ2A 3GFQA 1TAGA 4BYMA 1DADA 2YV2A 3KEOA 3NHYA 4PLZA 3IAUA 1CZHA 4POOA 3L7CA 2PTGA 3FPSA 3FFAA 5I3CA 2C99A 3V42A 2PHZA 2R79A 4OIMA 2YOGA 1FU4A 2BKUA 3B1YA 3GDOA 4NZOA 5EZYF 2FFBA 3PXBA 1T5HX 4C7BA 4G0MA 5A1TA 1S9DA 1AS0A 2ACVA 1E77A 4XPZA 3T1VA 1WPGA 3U37A 3V8RA 2FMHA 1GQRA 1MO5A 2W2LD 1DRKA 1P91A 3LVBA 3MNFA 4NNJA 4Q7QA 1NNEA 1RAFA 4H7HA 4ZQBA 3PKJA 4H7KA 4GI1A 4Q3BA 5HQJA 4ZPXA 5BN5A 2A1IA 3G2OA 3NZEA 4G01B 5AESA 2C3PA 3GRVA 5DHSA 3S28A 1BWPA 4UM9B 4F4DA 4UHEA 4EW6A 4WK6A 3B3QA 4V3CA 1PT6A 2VJOA 5JIBA 1QKIA 3TQSA 1R8SA 3H1EA 3M70A 1PWHA 2QRZA 3CLVA 4RFSA 5DNDA 4JJ7A 4A92A 3THXB 1VOTA 5K99A 1XHFA 4Q3LA 4XB6B 3EOBI 1KSJA 5K7SA 3FJ1A 3K6KA 5IXYA 2VNAA 4C7MA 1W1UA 2QI9C 4FILA 2AYZA 3RRBA 2IU3A 1LBSA 3ZWVA 2X15A 2GEBA 2QVCA 3KSMA 3VPXA 3H0CA 4ZJUA 2BFDA 2KJQA 3CLTD 4AQDA 1GTG1 3EJ6A 1Z2EA 2AFIE 4Q02A 2PGLA 1U0SY 3GGJA 3OCUA 1VMEA 5DNVA 4EOGA 5CBPA 4V02A 1G8MA 3JWJA 2R8YA 2R7NA 3IMKA 3N8DA 2V7TA 5A3JA 5JJ5A 3KOOA 4PSUA 2IUTA 2VQFB 5CK5A 4DWJA 4US2R 4C7JA 3IQIX 1OCEA 2P79A 4RHUA 6CHYA 3DZ8A 5KQSA 3GEDA 1U9IC 2I3DA 3VR5H 3ZU4A 4RJTA 1QRUA 4NU5A 3ZW8A 2NSDA 1KOJA 4HEJA 2FLVA 3NDJA 5ALNA 4E3ZA 4HNSA 4WOJA 1L5HB 1OXTA 2ZANA 2VK4A 3R2JA 5AVZA 1VCNA 3P1JA 5TQ2B 1XQ9A 3V4SA 4UATA 1XJ0A 3A28A 1IG3A 4BX2A 3L9WA 3PR3A 4K1XA 2IZ5A 2JVJA 2W2PA 1YR9A 4RZQA 4AS2A 1QIFA 4QDUA 3Q40A 3KLOA 1M2VA 3RC1A 1E60A 2H5LA 2AZMA 1E5XA 1MV8A 2Z57A 4OUKX 1DARA 4PLHA 1WXWA 2GN2A 2V7XA 4FBGA 3T7DA 3P20A 5A3QA 3BHJA 1YB1A 4EB6A 2PR7A 2FDXA 5AKJA 3ZDRA 4LRQA 1NZFA 3T41A 1GA6A 1ZD3A 2PSJA 1PNOA 3CUKA 2XCSB 5CIQA 5FHQA 4B3SB 3B51X 3ABOB 1NMSA 3E58A 1AOXA 4QG7A 5LWQA 1M8PA 2YWDA 4QDOA 4BVBA 2VXYA 1J06A 2BHSA 1JNXX 1P6UA 3HV0A 3Q6MA 1MQAA 1LS1A 2RC5A 1GAJA 1Q1QA 1BYUA 1Z8DA 3WBFA 3D43A 4RLSA 1P17A 3WQQA 2HPHA 3DMYA 1KZ6A 2XMGA 2YWFA 1CUEA 1ORIA 4FE4A 4K46A 2CNNA 1S6YA 1U0LA 2GYUA 3HUFA 3MWDB 4PG5A 2YJGA 4GMFA 5T64A 1CUUA 2ZATA 4NICA 1S0UA 4I4TB 3K2QA 3OT4A 1CB7A 1GSAA 3HMQA 3WWEA 1V11B 4C4AA 1AA6A 1FX0A 3HYSA 3JYLA 3B38A 1YQWA 4RORA 5F76A 2ZAIA 1QH0A 1ZYUA 2WIKA 2WSBA 4TXMA 3R4VA 3G0DA 3S3TA 4U2GA 5JWOA 3VHQA 4L51A 1U2TA 1RZUA 3FD8A 4DNFA 2DECA 1CJTC 4PPYA 4UAJA 2H8KA 3OICA 2I4RA 5CA0B 1EWRA 3VR4A 3TCNA 2DAPA 1Y1RA 1JPNA 2JJMA 2J7PD 3LDUA 4AMVA 4CQLB 1C7EA 4LFBB 3R6LA 2H57A 5JMOA 1KEWA 1ITZA 1NQTA 4U7PB 5KYYB 5LSAA 2CDCA 4FQ5A 2FSGA 3I2GA 4C0JA 1XZBA 4AM8A 5JSZA 2QF7A 4RKYA 3JVEA 4K0RA 3EVTA 1OGYA 4FCWA 4UAVA 4D9HA 2XYVA 3UMGA 1FY2A 4O4LF 1PT8A 1ZN2A 3DONA 4XFJA 5KTTA 4BEVA 3IPXA 4TV9B 1O6CA 1JFSA 3L9XA 4BUZA 2MINB 4R2IA 4RVNA 3WLSA 5J58A 4LOAA 2DXIA 3LC1O 4NCNA 1XVVA 3VMFA 1SC6A 1U5BB 5LQKA 3BHMA 3HJRA 1HO3A 5B7QA 4ENRA 4YJGA 1TAUA 1H2HA 3HXMA 3H6HA 4NBNA 4WCFC 4RQTA 4EPRA 5CDFE 3II6X 4LTNA 2F3QA 3IUQA 2PAAA 1MKYA 3F97A 2QTRA 2GJAA 1QP8A 3KTAB 3UXHA 3P4YA 1T26A 4ZICA 1FLNA 5HGJA 3T12A 8ADHA 5G0TA 5LIRA 3KCQA 4Q4HB 1TM2A 2YW9A 3Q3HA 4XW2A 3SGLA 4DG9A 1WW2A 2GBGA 1V26A 1GN8A 3DL4A 4KU4A 4WA7A 5AI0A 3VH2A 4BX9A 4EKEA 1IJKA 3S4YA 3SYLA 1KA9H 1UXGA 3TR5A 5AJXA 3KB6A 4RD3A 4C0LA 4BNUA 2WD9A 5TS3A 1OF1A 1J23A 1L4MA 4IIEA 3TGWA 4GMGA 2GR9A 2FRDC 3ICWA 2VYFA 2DC1A 3SSNA 2AD5A 2Q5OA 5J9FA 2FA9A 4P0TA 1H2WA 4O4IB 3VSCA 3N5KA 4AKSA 3ANLA 1FSPA 3MAGA 4Z54A 1CD5A 2PUHA 2R6GA 2H1IA 1YRQA 2ONCA 4UUNA 3THSA 1XE3A 3L05A 4RV5A 3I4CA 3QMVA 4HJRA 2X7JA 3NIGB 2ZB4A 1CFJA 2CUZA 2Q07A 4UFNA 2YYAA 3KD2A 3MMXA 3ZEAA 2B1QA 2LTAA 2GAIA 1SZCA 2EF0A 4L8FA 4LSZA 3GK3A 4L95C 4IILA 4MR9B 2F1JA 3FI9A 4G84A 1IHPA 2C8JA 1KMQA 1AN0A 1N75A 4LC1A 4L4UA 3LC0A 1B76A 1N1GA 4YHBA 1EQUA 3HP4A 3M89A 3JQ6A 4I5EA 5CDTA 1AU9A 5JNRA 2IS2A 1L7QA 3LDAA 1Y0BA 4ZZ3A 3ZCRA 1ISJA 1XJQA 2C9MA 2W93A 3INYA 5KOJA 2QX9A 4G8CA 4GS5A 3PPWA 2EBWA 5CLLA 1C8VB 2J9RA 4WE3A 4R1QA 5EJ9A 2HBZA 1OHHA 2ZUDA 4MKRA 3RC8A 1TF5A 1M1YA 2UDPA 4WLOA 4URHA 1HETA 1XNGA 2HA6A 2HLPA 3EVGA 1SQSA 1N6KA 3EXHC 2XCOA 4PO1A 4R5MA 4OYLA 4UNSA 5E4FA 3WOVA 1N1MA 1J90A 4JI2B 4PRKA 3DEHA 3A8TA 1E9RA 2RH8A 3A27A 2JASA 3TW4A 5IHPA 4BBJA 4KR3A 2A88A 3ER8A 2ATCA 1ECFA 2H2AA 1R3DA 3C98A 1GPDG 1I4LD 2VXCA 3AKYA 1V5IA 3DDSA 1IULA 4JT9A 4QD3A 3AOGA 3T9FA 1H4SA 4QUBA 3GDHA 3MIIA 4GYWA 2JDID 4OM8A 4BLVA 1RKVA 2OKGA 4CF4A 5ILQA 4ZVNA 3SSMA 2KBFA 5L6MB 4P9NA 3TLCA 3ZI4A 3L1IA 4LJSA 3RU9A 3EXAA 2GA9A 5CW2A 4ZVRA 1DCFA 4ITUA 4ZYLA 1XDDA 2P2YA 2WU3A 4TXNA 2JGMA 1NVMB 3TE7A 3U3JA 4HNQA 1O95D 5D3QA 2CLCX 3UA4A 1ACJA 2G1KA 2DY1A 4QU8A 3X1YA 4FHCA 4X1KA 3VBEA 4RY8A 2ZIAA 1GGKA 1RM4A 2OCBA 1K88A 3AI3A 3P2IA 3CYFA 3GDGA 4FT2A 3UK1A 1ILEA 3FOEC 4MVJM 2JFYA 2JEZA 3OF2A 3FPKA 4A6XA 3L92A 4WIAA 3PQFA 4OB7A 3W7VA 3WP1B 1OXVA 2AVDA 4DDUA 1KVUA 3DOFA 1SFRA 1Y8RB 4OXYA 5DNWA 5C7IO 2BRUA 5JVDF 1OYYA 4ZT2A 3ZZNA 2LCFA 1LI4A 2UZ3A 1D2NA 1PWXA 4QLOA 5AVOA 3IUMA 2ILVA 3QW4B 3PXGA 3ZUPA 3AR9A 1AHPA 3Q2KA 1A9TA 1JB9A 3GP5A 4Q00A 5A5EA 4G5RA 5CX4A 2WRZA 4C4YA 5BOSA 4LYGA 4IIUA 4J16C 2HSWA 5HMMA 5FV4A 3TLGB 1H0SA 2MMCA 4K9SA 4DMRA 5IPFA 5CB6A 3PHCA 1A5BB 1M34B 3FNRA 5EWJA 2FMUA 1GFZA 4RHXA 4TTPA 4IEFB 2WJVA 4ARCA 2GEKA 1V71A 2D54A 3ETLA 3BGDA 3WNCA 2R0QC 5DX1A 1VHWA 2FTKE 3AILA 2JAQA 4DA4A 3IE1A 5TPWA 3RG8A 1EWQA 2WM3A 1XF1A 2EW1A 3IOYA 1B14A 3L0IB 3OT5A 3QP9A 1Y1TA 2PRKA 4JB0A 4G9GA 4QXAA 4YCMA 1YIDA 1TUGA 2ROQA 2W8BA 1OFHA 1XTUA 3HGMA 1SXQA 3BCHA 1SIWA 5SY6A 1QU2A 1EX1A 1U7PA 1NG1A 3VC7A 4LV8B 3CMMA 2I7XA 3H1FA 3QUSA 1JDJA 2P4EA 3LGAA 3V4OA 2XEXA 4UE6A 4A8JA 3I8SA 1PNQA 1X7YB 1XI2A 3KPYA 4NBUA 1LLQA 3EHEA 2N47A 1Y7TA 4WK0B 2JFBA 2H08A 4JBLA 2QZSA 3Q3EA 2Z9CA 4YGXB 1CSEE 1CZOA 4PHFA 4EHAA 1SKYB 2O20A 4NEGA 1TUBA 4OI0A 1CU1A 2EFCB 3IV6A 4NV1A 5KNDA 1QYRA 2HK7A 3TMAA 3DWEX 1BX1A 4R9UC 2OB2A 3WV5A 1BJRE 1U0RA 4S1PA 5EG5A 1JE1A 1DV1A 5M7EA 3LLCA 3ZWBA 1ORVA 4KQHA 3ESZA 4TTRA 4CNQA 5FBRB 4V1CA 5JH7A 3JD3A 1N8KA 4HADA 4P81A 3T1HB 1JL3A 1PYOA 1CJCA 2CN1A 4LZNA 3O82A 2IIVA 5AIAA 1ACLA 2XQJA 1II9A 3INTA 4GT1A 1NQWA 4CM4B 1K7YA 1QP7A 1Z06A 1VG8A 2YQ4A 2D5LA 2C57A 5E3HA 2VDQB 4J1SA 5EN4A 4MYDA 621PA 1HFEL 4Q37A 1E3SA 5BNZA 1AQLA 1FDUA 1N4DA 2RK6A 3MOGA 1CS0B 1Z07A 3CNNA 3QWAA 3F78A 4X54A 2W6JD 3PFGA 4HWGA 4PSAA 1P9NA 2FH5B 3LHKA 3NV9A 2QW8A 4Y6GB 1N3YA 4UTZA 3FNBA 3TIXB 1WG8A 2OPHA 3DP9A 3Q7TA 3S5JA 3VSEA 3OH8A 2HMTA 3AHJA 4QEZA 4QRDA 4BKQA 3PQ2A 3CCFA 4ZHSA 4L6CA 4IIBA 1PDWA 2ZS8A 3GVPA 3M9XA 4D7AA 3D6JA 3CUYA 1APBA 4RK0A 3JQEA 3QVJA 1WSDA 3IDOA 1RYMA 2FUCA 2DFDA 3JD2A 2JAHA 4YRJA 1L7VC 4LK2A 2OPBA 2AB0A 4I5FA 5EP3A 5EWMB 2FPPB 3PITA 3EX7C 1ISHA 4LE2A 5CR9A 3HLYA 3PJGA 5LLTA 2V3WA 3VZCA 3N8NA 2ZYTX 1AUQA 2AGVA 4UEOA 2Z6QA 3NHWA 5I4BA 1U9CA 1G6HA 3STVA 1Q20A 4B8ZA 2FW7A 4GZ6A 5HRUA 1JA0A 1GGVA 1WTCA 3AERA 3AT1A 1Z2OX 2YIMA 1E3LA 4KE6A 3CQ9A 2YHIB 4OHXA 2P9TA 3N0VA 2AOUB 3O4VA 3PNOA 3ZHXA 3PFIA 3NU1A 1X7GA 3G9XA 1ENOA 4G5SA 4ZHQF 3OVMA 3DKPA 4FIDA 3MT9A 4AWBA 1ZA2A 3LLVA 2R8PA 4HVCA 4LK3A 1NV8A 4V0RA 3TRFA 2Z2XA 3KSBC 3CEAA 4HQFA 4RLFA 5IAGA 5K3CA 1OBCA 3R3VA 4UXJA 5IM5A 2WWXA 5BNTA 5JT1A 1YDGA 1MT0A 4OYRA 1PGPA 3L2OB 1V48A 3C3AA 1DLJA 4NYIR 3Q8XB 4V0QA 5TEVA 3SS7X 2XPCA 3TEMA 4FB5A 4EY7A 4IWNA 1S5PA 3RVJA 4URXR 5GGYA 1MLDA 2IYSA 2HRCA 3BG5A 2HEIA 1AQYA 3I09A 2A0WA 2BEUA 3CB2A 2FE4A 1DO0A 1NY6A 3BEDA 2VUSA 1I1HA 3IAAA 4EFKA 2PKQO 3FNGA 3AR5A 4W5NA 3OKFA 3HPQA 4MVJE 3HYNA 4MYHA 4FDVA 4DBLC 3IMFA 4OU5A 3W1VA 3HB4X 1N6HA 1LLUA 2WUDA 3V1UA 1QS0B 3F4LA 1M8GA 1MTZA 2QAIA 3DT6A 5JC8A 3EIWA 4EGAA 2ZI6A 1O9GA 4XUCA 1B16A 4OJYA 2OHIA 5EWLA 1JXOA 3DLIA 4TUYF 1L5KA 2F1IA 1U1CA 4QJBA 3PHLA 1ADBA 1XTJA 4PEVA 1DHRA 1GVNB 1J0AA 4WT7A 4BU0A 1CUIA 4MCIA 3K8YA 3OCXA 3SQWA 1W6RA 3D3WA 3GELA 4NPCA 3TI7A 4RESA 1RKUA 1MAUA 4X7PA 3FYDA 1YVUA 3ZE8A 4NRDA 1D1QA 5TVGA 4CG2A 3HC7A 4C87A 1U1IA 4KI0A 4HGZA 2O8EB 4YS6A 5IKXA 3NPMA 1OFGA 1YB4A 4MXDA 2VCYA 5AVRA 3GLGE 3W5IA 1TO2E 4YJDA 1YA6A 2WMNB 2W9XA 2Q62A 3NC1C 5L7TA 1WB5A 3UTDA 2C5BA 2B6HA 4IW3B 2X6RA 3P0EA 3EDRA 4JOQA 3W5AA 1W5BA 4JKYA 121PA 2RCNA 2MHCA 2V7WA 2B2NA 2QRGA 2CUTA 3JQFC 4TZTA 4ZAVA 1H05A 1KYXA 2XQVA 1KDZA 5LQAA 3GLIA 1FJHA 2CEKA 3IAHA 3WKDA 3PWSA 4EEZA 1HYQA 1ZH0A 5A4KA 5A5VA 1ID1A 3EB9A 1CQWA 2JFGA 1D2CA 2J08A 4TRNA 5E9AA 4EG6A 3SEQA 3STXA 3ZU5A 1ND6A 4NV0A 5KNCA 1YZKA 2QG4A 4PZDA 2F43A 4WH0A 3TSCA 3QJYA 4LMRA 5CU7A 4HH3C 4C14A 1GUDA 3D1VA 4CPDA 5FP0A 5CD9A 2ZBFA 4HHEA 3MPOA 3L7DA 4UU1A 3DTVA 1RQPA 3RU2A 3MOIA 3UBMA 2I80A 1DRUA 1K6MA 1GTL1 1TZCA 4GPBA 3HVHA 4ZANA 3WY9A 4BB0A 4F4CA 1QAMA 1RC0A 4Q9DA 3C8ZA 4CUKA 1X1CA 1ZNYA 2XUDA 4BVFA 1GADO 4LBVA 1Y3CE 5GJVC 2NXJA 1G0NA 5BQFA 3GROA 1KIFA 3R77A 4AJOA 2ESRA 2I1WA 3IQWA 3TOVA 3G2IA 1DO8A 1N2JA 1KHTA 2DRIA 3IBSA 2J85A 3DV9A 5JS7A 2ECKA 3ZV4A 1XLTC 4D9GA 2UXDB 2HQRA 3OE7A 5E1DA 4XYMA 4PBTA 3ICQB 1LNZA 5IJ9B 3NC4A 4C5CA 3LWBA 3ZDZB 3AV3A 5L4NA 5CH3A 2GVDC 2HSGA 2YS7A 3I04M 1YAHA 4N3BA 1QANA 1VI6A 3ELWA 3WWZA 5KYWB 4MAFA 1N3LA 1RZRD 3QNMA 5DCUA 3JD0A 1GGMA 3NIBA 4OX9Y 5J4HA 1VQ1A 1XKQA 4BO8A 4CW7A 7GPBA 3I2HA 3BMOA 1Q17A 3GB9A 4BQQA 4YCSA 2DQSA 1E94E 1EJBA 1GQ2A 3N8GA 5IKOA 1C3OB 4GG1A 1FYVA 4K9LA 2FR8C 1YUMA 3H2SA 4WCVA 4EG0A 4EEKA 4YRZA 3AFOA 4J49A 4LISA 4N01A 1TYAE 4OBWA 1E64A 1LRLA 1E1CB 5HA5A 1GYPA 1X1SA 3KB8A 3LSYA 3MSCA 4RHEA 1KE1A 2P4HX 2GJ8A 4EZIA 1Z28A 1YGPA 1JEQA 1KU6A 4RNDB 1B2LA 2FEMA 1JN0A 1OPXA 2Z9BA 4H31A 3W05A 1NONA 1KY2A 3ITKA 2QZ4A 5TY0A 2O05A 3TPZA 1HWYA 2BGRA 4MCAA 3MWLA 2XWJI 2EJUA 5HKOA 4O4HA 2NN3C 4MHOA 3CHYA 1OWNA 3OMLA 3WQBA 4IRMA 1WMSA 1T1IA 2FGKA 2BM9A 1ICEA 2H2IA 4FXOA 5HQ3A 3ZQUA 5JJLA 3MUEA 1N2BA 4KMRA 3CXUA 1KJIA 5EGNA 4A10A 3LOUA 2RARA 4K86A 1UK8A 2IYQA 3OC6A 3MQ4A 4H08A 2XTJA 4RK1A 5DW0A 1JVNA 2IE0A 3TW0A 4M9UA 2Z4SA 4YDQA 1DTWA 3IVCA 4H7EA 1WUTA 1E99A 3KQYA 3PUKA 4RYLA 5IJZA 3OEWA 3QVOA 4MO2A 1NKTA 3WIEA 5AW3A 4EMUA 2QNBA 3QVVA 2OXFA 2E1RA 3H9EO 4DXDA 1R2QA 3SN6A 4B85A 2BY4A 4JP3A 3RFVA 1QYWA 2FPUA 4DXAA 1Z26A 3B1FA 3RK1A 1XAGA 1P7PA 2PXHA 8MHTA 5ALYA 5AUNB 3INGA 5LQSA 4ZYZA 3TLXA 1ODFA 2G9UA 4GYJA 1LRJA 3ZLTA 1Z6QA 2BBWA 3PD1A 4EHJA 1LNSA 3A6ZA 1WMEA 2ZJ0A 1AT1A 3LIPA 4N0EA 4N3NA 3GYBA 1W1WA 1C5KA 5JEEA 3R44A 4H59A 2DX7A 1RP7A 1LEHA 3H1BA 5T6BA 2VT2A 4UOQA 3SBDA 1UWVA 1O6GA 2P77A 3R0VA 5HCIA 4CM7A 3DVSX 4KRGA 1AKUA 2VF7A 3E3NA 1U3WA 4KXMA 5HIKA 4PYOA 2WK1A 1FFGA 3RT1A 5CCBA 3D7RA 1ZINA 2IS4A 2HNBA 4AY5A 3GRUA 2ZYVX 3JATA 1EHYA 3IPLA 4GQAA 3GMDA 1JH8A 2Z8YM 1E8DA 3O0TA 1ABFA 5JAZA 3DL2A 3QX3A 1DNPA 3HDQA 1D8AA 4EQ6B 3K9LA 2PUFA 2O5EA 1A7JA 2AXPA 2WVAA 4IRXA 4P3NA 1JFRA 2BW0A 2R6DA 4M9SA 4IKPA 3UMCA 1T6XA 2FUKA 4BL5A 5K6AC 2FWIA 4AO6A 4YPVA 3EPJA 1NE7A 2Q3BA 3RCBA 1PK8A 1ABEA 2JI6A 3KZOA 2VXBA 4M89A 5CNJA 4I4LA 3DV2A 4RY0A 1D0IA 5CIWA 2PZGA 3GGGA 3RSSA 2CL6X 5UKDA 4D57A 2B1RA 1ZVJA 5AMXA 5J2TF 3MRVA 2OHFA 3R74A 4EY6A 1BDHA 3IT0A