4QLOA

Crystal structure of homoserine o-acetyltransferase from staphylococcus aureus
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
327
Chain Sequence
b'NYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRKDPAFLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homoserine O-acetyltransferase
molecule tags Transferase
source organism Staphylococcus aureus subsp. aureus
publication title Structure of homoserine O-acetyltransferase from Staphylococcus aureus: the first Gram-positive ortholog structure.
pubmed doi rcsb
total genus 112
structure length 327
sequence length 327
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2014-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qloA00
1LZKA 1DQZA 3WIOA 3BJRA 5ESRA 1CFJA 3BIXA 2NW6A 5CT4A 1ODSA 4P9NA 4J7AA 1DQYA 3C6ZA 3VVLA 5CRIA 3EBLA 5IVKA 1E3QA 4EHBA 3TRDA 3PUHA 4X95A 2FUKA 5CT6A 3VVMA 2XLBA 2HA0A 5AKYA 2ZSHA 4AO8A 1SCKA 2BCEA 4Y2YA 1W76A 5EHXA 1YA8A 5ALHA 3B12A 5LZ9A 4OU4A 3SK0A 1UFOA 2CZQA 3NUZA 3DD5A 4FOLA 1ZI8A 4B0PA 4Y2RA 4Y7DA 2R8BA 2VAXA 1H2WA 4B83A 5AM1A 5EFZA 3IUMA 2WIDA 4OPMA 3FCXA 2DQZA 2W6CX 4H7EA 3KD2A 2BAGA 1P0QA 1BCRA 5T4HA 3WKEA 5EHNA 2QT9A 4TVKA 3QM1A 1A7UA 3PF9A 5AKEA 1XQYA 3V1KA 4QA9A 2WM2A 3WWOA 4HVTA 3PDCA 4U2EA 4DTCA 1K8QA 4JUIA 5ALXA 1HDEA 4BE4A 2C7BA 1RYYA 1K4YA 2XMZA 4ITVA 2PSEA 4B6GA 4LHEA 3Q0TA 4BCBA 4KE7A 3A70A 4G1FA 1N5RA 4M0FA 2ACKA 3G0DA 1CUZA 2B9VA 3R3ZA 4W63A 7YASA 3D2CA 1R50A 4UHHA 2RGUA 4Q3KA 4X85A 1Q0RA 4MYDA 1XRMA 3WKDA 2OQVA 5ALGA 4FWBA 4QNNA 5HFNA 1J07A 5EI5A 2XQIA 3KWJA 2PX6A 1UOQA 3NOXA 5K3CA 3WI7A 1THTA 4FTWA 1WB4A 4K6KA 1XZFA 2XLCA 1XRNA 3PF8A 4H7DA 5YASA 5JIBA 2FJPA 3ESCA 3WA6A 1ZD3A 1JJIA 3G9ZA 5AO9A 1CUDA 1QIDA 5C8ZA 2QJWA 2IX9A 4U2GA 2Z3WA 1MX5A 1R3DA 3PFCA 1QIJA 1I6WA 1UK8A 3GROA 2XUQA 5AM3A 3C70A 3DJYA 1C7IA 1WCYA 2LIPA 2ES4A 3ZWQA 2PU7A 1UKCA 1XZCA 1FFDA 2AJLI 1H23A 1LBTA 2QOEA 3IA2A 4HXGA 3OURA 3D5EA 1F6WA 5EHQA 4PQEA 5C8XA 5C81A 4BVLA 4QDZA 1EX9A 1MNAA 5FXMA 2IIVA 1GPKA 1GPNA 1E66A 1AURA 1TQHA 4L72A 1M33A 1RP1A 1L7AA 3BJMA 1N1MA 4G4GA 1MAHA 2DQYA 3C87A 3V48A 3DDUA 4C88A 2DFPA 4KR0A 3K2IA 1JFRA 1MO2A 1CUEA 4H7IA 5HF5A 2QUBA 3WKAA 2EEPA 3O9MA 3STXA 1E5TA 2GBIA 2PSFA 3C6BA 4FDMA 5EIAA 5AH0A 5JZ9A 1WHTA 4FHZA 3H2HA 2CBGA 3QYJA 3DKKA 4TGLA 3F96A 3HLKA 3WK9A 4FMPA 1SCIA 2XUKA 2HFKA 2ZYIA 4E11A 4QLOA 2DR0A 1ORVA 3DCNA 3AFIA 5EGNA 3I2JA 1QTIA 2HA6A 2ROQA 3I6ZA 4X6YA 1EXWA 1YB6A 4HRYA 1R1DA 2V9ZA 3ZI7A 4MJ3A 2JIDA 3QMWA 2OG1A 4WCVA 1G42A 2PL5A 1QZ3A 1ZGCA 3G9UA 5ALMA 4KACA 3SX4A 2DHDA 1F0NA 2I3DA 3G0IA 4B7ZA 3OPMA 4BP9A 1SC9A 4IQ4A 2XQKA 4BE9A 5FDFA 1IMJA 3BXPA 1EA5A 3KOOA 5AI8A 3WWDA 3IB3A 4GEGA 2AJDA 3R3VA 5IVIA 1CUBA 1GXSA 1IZ8A 3AIOA 4BTLA 2OCGA 1AZWA 4LKOA 2QR5A 3DYIA 3GA7A 2XUDA 3L1JA 4OCZA 3V1NA 3DL4A 4B80A 1JI3A 2GYWA 4GBGA 3EQ7A 4AZ3A 2JEZA 3GUUA 2BKLA 1UXOA 3IURA 5JZSA 4UHBA 1AMNA 4KAFA 1LPMA 1MT3A 2PVSA 3G0CA 2H7YA 2G4LA 2C58A 3WJ1A 4G8BA 5T4EA 1VE6A 4UFOA 4X71A 1ZIXA 4DSAA 5LZ5A 4ZXFA 1ZJ4A 4UPDA 2ZSIA 3M83A 1ODCA 4RE5A 1FFAA 4H18A 3KWFA 2XMQA 2V98A 5DJ5A 3E3AA 1VA5A 2AJCA 4LIPD 4QDUA 2JGIA 4PV7A 1XZHA 1X2EA 1FFEA 4O08A 5ALIA 4AX4A 4CI9A 4ZGBA 3CN9A 3FYUB 4IH9A 4QDXA 5HKBA 4K6HA 1BN7A 2J4CA 4GI1A 4UBNA 4BVJA 4G9GA 3EF3A 4UBLA 4NMWA 4F5ZA 1GKLA 1ZI9A 3F67A 4J3JA 4G8CA 3C43A 1NU8A 3WK5A 4DMCA 5CBKA 2OCIA 5FLKA 1FFCA 1FFBA 3C8DA 4INZA 3W9UA 4JEIA 3O4IA 1GT6A 2HU8A 3H1AA 1VZ2A 3GZJA 4BC0A 4EA6A 1W52X 3OOSA 1CIJA 1U65A 1EVQA 4Y2VA 4FLFA 1DINA 4H7KA 4N5IX 1QGED 3HACA 4MEBA 4BDSA 3DL7A 3KXPA 4YPVA 1XZGA 1MNQA 4PSUA 5LZ4A 1HQDA 3HI4A 4DYHA 1CEXA 1U8EA 2JBWA 4G4IA 4QZVA 4EUSA 3BIWA 2PU5A 4AN0A 1Y7IA 2B20A 4QEKA 1CUIA 2WJ6A 3DYVA 2Y6VA 4FFVA 4XJVA 4F60A 3QPDA 1QIEA 2BGRA 2CUTA 3ESBA 1UKAA 1LPOA 1AQLA 5A7HA 1TKRA 3JWEA 5D7BA 1GQRA 1KU6A 5D6OA 2ACEA 4N8DA 1VJ5A 5JARA 3RKSA 1KU0A 5DNWA 3FAKA 3EQ8A 1CUVA 3WK8A 3ZV7A 3HEAA 3SC2A 3RARA 4S0XA 3R3UA 3H1BA 1BCSA 4XX1A 4QE3A 3G8YA 4MEAA 1AUOA 5J3JA 5HF6A 5K3FA 3I1IA 4ZV9A 5KREA 2K2QB 4V2IA 1AKNA 3WKCA 2YXPX 1XRQA 4A5SA 3S2ZA 1LLFA 5A71A 1H2ZA 2HL6A 2G63A 3BWXA 2QS9A 4KRYA 4ZV7A 1DWOA 1ZD5A 3IIIA 4UHFA 1LPAB 1UK9A 4FLEA 4OB7A 1UOPA 1QO9A 1XZJA 3KDAA 5LZ8A 3I28A 1HL7A 4BP8A 4Q82A 1WB6A 2BJHA 3TJMA 5DNVA 5EIEA 5K5EA 3L1HA 5AICA 1F0PA 3IUJA 1EH5A 5K3DA 4F21A 2HADA 1CUCA 4KE6A 4Q3LA 1SFRA 3O9VA 1QLWA 2WG1A 1Q0ZA 3I2FA 4RNCA 3G9TA 4H77A 4AZ0A 3RLIA 5CH5A 5AK3A 1A8SA 3QVMA 4GLBA 1XZAA 2OAGA 3G02A 4DM7A 1CUJA 1IUOA 4BATA 1GZ7A 3E4DA 4X7BA 1TCBA 3ILSA 4H35A 2XMBA 2WTMA 2HRQA 2WHPB 1YS1X 4JYPA 5HQ3B 1YS2X 4BAZA 3ESDA 2C4HA 1JMKC 1QFMA 2Q0XA 1GKKA 4HRXA 2WIFA 4UFNA 4KYVA 1JJBA 2DHEA 3AZQA 4ZREA 1J2EA 3HZOA 4BAUA 3MUOA 4P93A 5ALDA 3HXKA 1TIBA 3W05A 4J0JA 5IVDA 3OM8A 2JGKA 5LZ7A 4UBJA 1T4MA 4CCWA 3T4UA 4BRSA 3VJMA 4L3WA 5AKJA 3LS2A 5K3EA 3DOHA 3WWPA 4LXIA 2QVBA 1UT6A 3K9BA 5ALWA 4QWWA 4IH1A 2VJDA 5AKHA 2OGZA 1P0MA 5ALPA 1ACLA 4AB1A 3QMMA 5A62A 1H2YA 1FSSA 1MAAA 3K6KA 5AM2A 4E14A 4WFJA 1E8DA 3QPCA 5ALSA 1XZKA 3I6MA 4B82A 4BZWA 5E4JA 3ZLUA 2OQIA 1UK7A 2Y6UA 3N2ZB 5AM0A 2WU3A 2PSJA 1YSCA 1MU0A 1TK3A 2BUCA 4U2FA 5AI9A 3H2GA 2XQFA 1ZGBA 4UHCA 4OD0A 1CUSA 1R9MA 2HDWA 3DNMA 2VTVA 5AK6A 4C4ZA 2H9YA 3AUKA 4G5XA 3H0CA 4C4YA 2ZYSA 5AI4A 3G7NA 2EDAA 3A2MA 4NVRA 4KAJA 5JAPA 2XMCA 1AC5A 1EB9A 1LNSA 4JH0A 2ZYRA 1PJAA 1DT3A 4Z49A 4OB8A 3HC7A 4RE6A 5CURA 3WZLA 5CXUA 2XQJA 4UBIA 4GW3A 4WFKA 3STTA 1VKHA 1G5FA 4JYMA 3O4JA 1JMYA 5SYMA 2XDWA 3C6YA 3PFBA 5LKAA 1B6GA 4Y2QA 3S8YA 5AIBA 3IDAA 2X5XA 4OU5A 3HSSA 1QIIA 2VT7A 3V1LA 1K63A 1OCEA 2C5FA 3KSRA 2XUAA 3A2NA 5JATA 1XQWA 2P8SA 3R40A 2WHPA 3O0DA 2JGEA 2VATA 4WDRA 4QLAA 3D7RA 1Y7HA 2WKWA 2O7RA 3LCRA 1TCCA 2O7VA 4MWSA 1BE0A 3IBTA 3R3WA 3C5VA 2QJRA 2XUFA 4XVCA 2CMFA 2J3QA 4H7JA 3GFFA 4Q34A 1MPXA 4QDOA 1XRRA 2JGJA 4DIUA 1ZJ5A 1PV1A 3OG9A 1CUHA 3ANSA 3H19A 2ZYHA 2PBLA 3CCCA 5DYYA 2XUPA 1WHSA 1EK1A 3C8HA 4HAIA 5FOQA 5E2IA 4X00A 2FX5A 1BU8A 4WY8A 1BROA 4CIBA 4IH4A 2PPLA 4J0CA 1T2NA 3WL6A 2GBGA 1Q84A 4KEAA 3QZUA 4KRXA 4Y2TA 2O2IA 4DLNA 5AIAA 1XZDA 2ECFA 1NU6A 4BRZA 1QONA 3C6XA 4G9EA 5IKXA 3DEAA 3E1GA 1XZLA 2QKYA 4BYMA 1OXMA 2VJCA 1YAJA 2HHAA 4PSDA 2V96A 3WZMA 3EQ9A 4RGYA 1BRTA 3WKBA 5ALNA 2HA2A 5K3BA 1YB7A 5DYWA 5JADA 2G5TA 1DX6A 4G8DA 1ETHA 1SOMA 1EINA 1ZD2P 1H22A 5CT8A 4N8EA 3N0TA 2HRRA 1CV2A 1UZAA 4XIIA 5A7GA 1E8NA 1QO7A 1KEZA 4NZZA 5CTAA 3I1YA 2I3ZA 3G9XA 3FSGD 5BOVA 5AKGA 3AILA 1WPXA 5CH3A 2VJAA 3MGAA 2OGSA 3I2IA 2Y2VA 3HABA 4X92A 3AINA 1YA4A 2AJBA 3M3DA 1X70A 1XZMA 3G0BA 5IH7A 3WYNA 5CH8A 2WU4A 5DLPA 3ICWA 4UFPA 4WFIA 4AXBA 5A7FA 5AI6A 4ZWNA 2I03A 1SCQA 2XB6A 2AJ8A 1VA4A 1JU3A 4K6GA 2YYSA 4IHAA 2HU5A 3G0GA 1J1IA 3QPAA 1LPNA 4OYYA 1W4LA 3PUIA 3WL5A 1DWQA 2QXUA 2WQZA 4UHDA 3WL7A 3PICA 3TEJA 1H2XA 5KWJA 2GYUA 2XUJA 2XUGA 3QH4A 2YH2A 1D07A 2WILA 3R0VA 1K6EA 3BDVA 4I4CA 1X2BA 4Y2SA 3ED1A 1U2EA 3ESAA 4B81A 4UHEA 3WK6A 4CCYA 2O2GA 2PKYX 1W1IA 4X94A 2QRUA 3AZOA 5DTJA 1R4ZA 2RHTA 3B3QA 2XMSA 4W1RA 1J06A 3QITA 2DCMA 2PSDA 2QTBA 4EBBA 1LBSA 4W1SA 5AOAA 4UUQA 5HK8A 4U2DA 2YASA 5LKRA 2WFLB 4K5QA 4X3CA 1BN6A 2WIJA 5AKXA 3ZLTA 1WPRA 3FCYA 3BDIA 3IULA 4GDMA 3BF7A 1MX1A 4I3FA 3QMVA 5BWBA 4B9EA 5K3FB 2WIKA 1B41A 2WHQA 4DNOA 1THGA 4PNZA 1LPSA 4M0EA 2W22A 2OXEA 2V97A 5AKLA 2ZVDA 3EIOA 4A16A 4BC1A 1JU4A 5DYTA 3B5EA 1CUUA 1Y37A 2ZJ6A 1DWPA 5BV7A 4PO3X 2OCKA 3W2TA 2XMGA 4Y2JA 3WK7A 2PSHA 4J0IA 5ALYA 2PUJA 4OSEA 4B84A 3HYSA 4ETWA 3H04A 2VT6A 1IZ7A 3F9CA 2WUDA 1G66A 2XI4A 2ZJFA 3OTQA 2HA4A 2JGFA 4Y2XA 2AXEA 5HF9A 1CVLA 4UBKA 1S8OA 1QE3A 3T52A 4X6UA 5DNUA 4ARAA 2WUGA 2BUAA 5FP0A 4OB6A 1QOZA 5DTIA 2PM8A 4Q1VA 4HXEB 1QIMA 2WSLA 1BS9A 5C8VA 4B0OA 4WJLA 4H7FA 5EIHA 5FRDA 3WIBA 3LIIA 4P92A 4EY8A 3FVTA 1W6RA 5I7UA 4W9RA 4EY5A 4MQMA 3YASA 3STWA 3NGMA 4L0CA 1XZIA 2QXTA 1XRLA 5AK5A 2D0DA 4MYSA 3IVMA 1VXRA 4CG2A 3UMJA 2BFNA 5LYYA 4RPCA 2WHRA 3JW8A 5CT5A 2BUBA 4BDTA 4DGQA 5ALKA 2J3DA 4W1QA 4CFSA 2JGLA 4P08A 5CW2A 1U4NA 2CEKA 5H3HA 4BCDA 1XQVA 2WUFA 3DLTA 5AHXA 4OYLA 3E0XA 5ISMA 5AOCA 5E4TA 5ALJA 5T4BA 4B85A 1BEEA 2GBFA 3DOIA 3BL8A 3FYUA 1XROA 1R88A 2D5LA 4EY4A 5AP9A 1IUNA 5K3AA 5F4ZA 2VEOA 5JAOA 1MJ5A 4AMZA 1YASA 3ANTA 4FFWA 3ZPXA 3LLCA 2Z3ZA 5AOBA 3FOBA 2QM0A 1VZ3A 2Y1KA 1WM1A 3IUQA 1MN6A 2B61A 1VXOA 2I78A 5FPPA 3P2MA 4AO6A 5HKAA 4UBMA 1CUAA 5CT9A 3WMRA 5AKIA 2VF2A 1EI9A 1Z68A 1PFQA 4XWGA 2WTNA 2WJ4A 4DNPA 2Z5GA 3M82A 3WK4A 4DMFA 1EB8A 4MXDA 4CIAA 5JASA 4X6XA 5JAUA 1A88A 4ZRDA 5HFAA 1CR6A 5JD4A 1XLVA 2JEYA 4PW0A 5I9IA 3DKRA 4AO7A 1TAHA 3F98A 4N8SA 4YK7A 3ICVA 3U0VA 4HXFB 2PUHA 1YCDA 2QMQA 1CRLA 1F8UA 4Y9SA 1G4HA 1ACJA 5AK4A 4Q05A 2VA9A 2WG0A 3VJKA 4X93A 5HCUA 4L9AA 3O4HA 1K5PA 4K2AA 4KE8A 2G5PA 3M81A 3PI6A 5C7YA 1L7QA 4Y2UA 3R3YA 1QTRA 3HJUA 3FLAA 2EDCA 1E89A 2HA3A 5HF8A 2HFJA 4EB0A 2B4KA 3FVRA 3CCBA 1GGVA 4EZIA 2C5GA 4MQLA 1QIGA 5ALUA 2WFZA 4FNGA 2H7XA 3WA7A 1O6FA 5AKZA 5FKJA 4BB0A 4FLMA 1N5MA 2RONA 2XUIA 3X3HA 4GHWA 1N8SA 5FV4A 3O4GA 4BBZA 4LYEA 1VOTA 1ZIYA 3BF8A 4W1PA 4F0JA 3W9BA 4AN1A 3I2HA 4LXGA 4X97A 5IVHA 3C5WP 4FBLA 5JYCA 3F97A 3STYA 2Z8XA 1IVYA 3I2GA 2UZ0A 1HKHA 2OPHA 5SYNA 2JF0A 2IITA 3VISA 4LYDA 1YAHA 2ORYA 1BEZA 5FUMA 3R41A 1CUGA 2C0QA 3BE8A 5ALLA 5FPQA 4E15A 3V9AA 2GBCA 2HIHA 1UKBA 2DSNA 3F8SA 3A2LA 1DX4A 4H0CA 3MUNA 4BZZA 1HPLA 5AI5A 4U2CA 1JT2A 4FKBA 3FNBA 2WJ3A 3L1IA 3FLEA 4DSZA 2R11A 2WUEA 5HK9A 4GWLA 3FYUC 4E46A 3D3NA 1EVEA 1USWA 1XFDA 1XLUA 4J0GA 4ARBA 3SWWA 3WL8A 4KJXA 1QIKA 4QDTA 4J0DA 3FLBA 4GXNA 1QFSA 3O95A 3NWOA 2XUOA 3I6YA 1ZICA 1LZLA 4MWTA 5AJHA 5T4FA 1IUPA 2VQ6A 5KBYA 4CCYB 1HBJA 1QIHA 4OUKX 4IO0A 5AI0A 3AJAA 2GZSA 3W04A 2ZJ7A 3ZLVA 5AM5A 2XMDA 2CJPA 5CXXA 3QBJA 1NX9A 3STUA 1UK6A 2XUHA 5ALOA 2CKMA 3D2AA 3AIKA 2OAEA 2WFLA 5JD6A 3UUFA 5AKKA 2J4FA 4HZGA 2FJ0A 2BGNA 2HU7A 2RAUA 4C89A 5E4YA 1ISPA 1XLWA 1MX9A 1A8QA 5ALQA 1LGYA 2XQGA 1XKTA 1R9NA 4YX9A 3A6ZA 4FNMA 5A6VA 2RIPA 4WY5A 1TRHA 4DNQA 5ALEA 2X8BA 1FJ2A 3D4LA 2HA7A 1C4XA 4J0HA 4U2BA 4ROTA 5ALZA 1JKMA 1EHYA 1EDEA 3C45A 4PF1A 2Z8ZA 1ZD4A 3FWHA 1RWQA 3DQZA 1XRPA 4CG3A 2DHCA 6YASA 1TCAA 5JAHA 4PSCA 5CMLA 4GECA 4CG1A 5BWCA 1AX9A 4KAAA 1WB5A 1CUXA 1LPBB 3LP5A 2CB9A 4J0KA 4DMHA 4LXHA 3UUEA 3FYTA 2QZPA 1E8MA 2XE4A 1YR2A 2GZRA 1A8UA 4I19A 5JD5A 5LIPA 4BCCA 2VSQA 2H1IA 3MVEA 4YASA 2XMRA 1W75A 1ZI6A 4Q3OA 1O6GA 4Y2PA 4KE9A 1XZEA 4QWMA 1XZBA 1UOOA 2OCLA 2WG2A 1ZOIA 5ALFA 1DT5A 2OLEA 3CN7A 3WYDA 4EY6A 2VAVA 2HM7A 3PE6A 1CUFA 4C6HA 4NS4A 3GBSA 2H7CA 3VDXA 2C0PA 4TPKA 4BVKA 1ODTC 1ORWA 4C87A 4B9AA 4G4JA 3FSGA 1Q83A 3DS8A 4JNCA 5ALVA 1UWCA 1DTEA 2E3JA 5LZ2A 5JALA 5KWIA 4J03A 3I2KA 2WFMA 3WQHA 4FBMA 2XT0A 5JANA 4UBOA 2X76A 1MTZA 4HS9A 1C7JA 5D3KA 5AM4A 3R3XA 3FBWA 1GPLA 2QUAA 3AZPA 5DWDA 1AGYA 5I8PA 3JYHA 2HA5A 4C01A 4H7HA 2O2HA 5LP1A 5D3ZA 3WLAA 1EK2A 4ZI5A 4WDQA 1DU4A 4DMKA 1CQWA 4X90A 5EHZA 1EDDA 4DNFA 3Q8WA 1P0PA 4BAGA 3AIMA 3RK4A 3WWCA 5JZBA 2GYVA 2JGMA 3VXKA 2ONCA 3HRHA 3H2KA 3H2JA 2WIGA 2WLSA 3V1MA 1EDBA 1CUWA 4M0MA 5HZGA 1QIFA 1LPPA 3H18A 5LLSA 3VJLA 3H2IA 4N5HX 1QJ4A 1XQXA 1JJFA 1L7RA 3LIPA 4BTVA 5HQ3A 2VJBA 3OC0A 3D2BA 4EY7A 3WJ2A 3D0KA 1GQSA 3D59A 3GELA 1CQZA 1VLQA 2RI6A 3TGLA 3IUNA 1CLEA 1WOMA 1CUYA 4X91A 4D9JA 1OILA 4HTAA 1VE7A 3VKFA 5ALTA 1HLGA 1XKLA 2OGTA 3H17A 4C4XA 1P0IA 3W06A 4A23A 3CXUA 2RHWA 2Y2UA 1CPYA 5ALRA 3RM3A 3WWEA 4AMYA 3U1TA 4AQDA 3STVA 5A2GA
chains in the Genus database with same CATH superfamily
3LJKA 5ER6A 4NMMA 1R5OA 4ZU1X 4IDGA 1L7NA 3HYTA 5EJIA 4BJ1A 4TYMA 1RQGA 4R6WA 4TQ9A 1CJVC 4K81B 1HNNA 3G2LA 1QKIA 1TJNA 4Y9DA 3BIXA 4IEEA 1TA9A 1XHEA 4YBZA 1JDUA 2XTJA 1MJHA 2GPBA 2WM9B 3CG0A 4GAEA 1ZMRA 4L76A 3K0CA 4P9NA 4HDNB 4QQRA 2YJZA 4IUYA 3VVCA 5DXAA 4JV5B 3DEJA 5FBHA 2P9YA 4YQFA 4IW3B 1QQAA 1SRRA 1N2IA 1YUNA 1Y5RA 4NWIA 5G3ZA 3ZCSA 2HYIC 1ECFA 3EBLA 5IVKA 3FZYA 2PUAA 1ZMXA 5GY7A 4EHBA 1VL6A 4LQCA 4J2TA 2IUUA 1ID1A 1MB9A 2P7IA 4XOIA 3TRDA 3PUHA 3O03A 1CR1A 2K4MA 2P3LA 3TUJC 5CVTA 4RACA 2JH8A 3N58A 2H0QA 2ZM6B 5DBOA 3K0HA 3VVMA 1OXKB 1PL8A 3TQHA 1JI0A 3AMVA 4Q3NA 2J32A 1G38A 2RIRA 2ZSHA 3JAKB 2NUBA 4GQIA 3PEYA 3GHHA 4DKJA 1PHRA 1ZVMA 3NAMA 1YA8A 4Y2YA 2G07A 3KYBA 5ALHA 1S3IA 3B12A 3UM9A 3ZBQA 5IT9A 1NUAA 3ANNA 5LZ9A 4OU4A 1RCFA 1UFOA 1HF3A 7MHTA 1JFSA 4FYJA 2CZQA 4E6PA 3NUZA 1A76A 2C1EA 3QU4A 3AM5A 4FOLA 5B6PA 4I8XA 2I6XA 2RCNA 4HLCA 2GJ8A 2O7SA 3GLFA 4CR6A 4BFSA 1N3YA 4DJFC 1T24A 2VAXA 2F43B 5K45A 2VYVA 2QTZA 4NI5A 2AHOA 4P3NA 5JBNA 3HZHA 4ZQFA 2FPSA 2FETA 2COEA 1ESDA 2XF8A 5JQGF 4FNOA 2IZ1A 4TSFD 2DQZA 2W6CX 5BVHB 1F2DA 3FFXA 4HD8A 3G9QA 4K8OA 5KWVA 4C2UA 1FDTA 2BAGA 2XKJE 4ZVUA 2ERYA 3RU9A 2PWAA 3W2EA 2HZBA 1X1RA 1AV6A 1XZPA 3JS5A 1Z63A 5LWQA 4LMPA 1FVOA 1PEDA 2I9PA 2J0UA 5GWXA 3RG2A 5CJPA 4MAMA 2PO5A 2CZCA 1K4KA 4J2OA 4B6SA 4IZOA 3OZEA 4HZIA 1X3LA 4ZODA 1CY1A 2VLIA 2FZ5A 1Q0QA 3BUSA 1JE0A 2GTPA 4TVKA 1AKRA 2O8VA 2R3SA 4B6OA 3VYUB 5LYJF 3FDXA 2RB4A 5BR7A 3B78A 1S2LA 1H2HA 1XQYA 2GBLA 2XZPA 4QA9A 3W5IA 2WM2A 3ZI0A 5JZMA 5LNK1 3W6ZA 3TLCA 4DTCA 5KOYA 5H82A 4DVJA 1K8QA 4AKEA 1ICIA 1P9NA 2J7PA 4D4IA 2YMMA 2NZXA 4MNTA 5ALXA 1JX6A 1XTJA 3VR5D 3K9FC 3MPUA 3L4BC 4KQFA 4RLFA 2C7BA 5GONB 1NW5A 4H1WA 1K4YA 2QN2A 3PNYA 2XPCA 2HJGA 1J24A 3RQIA 1VHDA 1E1KA 3UT5A 3OX3A 3LBNA 3NHZA 4OY3A 2XAAA 2WPDA 1JWAB 1MBZA 2IPNA 4LMRA 4LHEA 4DPKA 1XMVA 3D43A 2FFBA 1TZMA 4JA2A 5GJCA 1UPBA 5TRTA 1TO1E 3GH1A 1V1MA 4F8JA 2X23A 3PJRA 1B43A 1FFGA 3H6HA 1N9GB 2QLTA 1M6WA 4OATA 4QYIB 3ORQA 2ZVQX 2DCUA 2BEVA 3PR2B 4J0QA 4OH1A 2PMDA 1A98A 1SBIA 1N5RA 5K51A 2PYIA 3THSA 4GZMA 3GC6A 3ZE9A 1DO2A 2FSVA 5B30A 1Y3IA 1DAKA 2QTHA 2WTXA 3KRTA 1TC2A 3L7BA 1CUZA 2B9VA 3QEOA 3SZUA 3AKDA 2GCOA 3AEYA 1R50A 3FJOA 4UHHA 2YTZA 4DTIA 3ICEA 2A30A 3IE2A 2ZUEA 4JT2A 2BYTA 5EZYB 4YMIA 3VKVA 4ARZA 1BMFD 2R85A 2HGZA 4B33A 1U6KA 3ZU6A 4F9TA 5HFNA 3U7FB 1T1RA 5AMXA 2VBFA 1CP2A 3R44A 2XQIA 5EI5A 3TD2A 2E5WA 4NXMB 4GP7A 3DZJA 1TVKB 1K7CA 4GKJB 1XI2A 1QRSA 1PK7A 2CNWD 1S2DA 4FZVA 4O1IA 3REQB 2PX6A 3UJHA 1AQJA 3Q3GE 1XRSB 2OHHA 2GO1A 4LMBA 1KSJA 1JQAA 4IR7A 1P72A 1XOIA 2EJTA 3L7LA 4YGXB 3WI7A 3JSXA 3WNZA 3B52X 3VNBA 2OK7A 2ABWA 4LECA 3TLEA 4K6KA 1FCJA 4KV7A 5EQJB 4ENSA 4IXMA 3OWXA 3ZHQA 5COAA 1J23A 2JFXA 1FFYA 2Y68A 2UZ1B 4UM9D 3FWPA 2XLCA 4HAYA 4OVKA 4B71A 3SBEA 3RS9A 3P52A 3IT2A 4KXLA 3E7DA 3FBGA 4PRLA 2DUNA 4Q00A 4IFBA 1P62B 2CFCA 2FHPA 2ZYUX 3CUVA 2FI1A 3EF0A 3QLVA 5LQRA 1Z17A 4B2PA 3HE3A 1HE2A 1IATA 2XGMA 5JG7A 5TQ0A 1ZH6A 4KIWA 1X1QA 3G82C 1UM8A 2DOKA 2HTFA 1A5TA 4GO1A 3M1LA 5E3IA 1RVV1 4NU5A 1JFLA 3HCWA 1QIDA 5AO9A 2V0NA 3WY9A 4DQLA 3RVJA 5C8ZA 1Y7PA 2ZBEA 1SXQA 4GIBA 1QBGA 1Y6QA 1G7CA 2Z3WA 2NZWA 2GK3A 2IS4A 5ED0A 1TJ3A 3O2QB 3P1JA 1OFIA 3NIGB 4FZ3A 4BFCA 3EDMA 1XCPA 1YULA 1WZUA 2CDRA 2CL5A 2Q5JA 5H9WA 5AM3A 4N9WA 2FPIB 1W4CA 1YDWA 1ZVKA 2FPIA 4TXMA 5HKOA 5HQTA 1M5RA 4HLUC 4WCFA 1E1MA 3HGTA 4JEHA 1C7IA 4CHGA 1KZ4A 4JROA 2BLLA 1CLUA 1VPLA 2MHCA 3I8SA 2CVFA 4XB6B 2R8ZA 4Y0VA 3VPAA 2FOIA 1JZTA 3ZNNA 2ESRA 1GR1A 1XZCA 3CO0S 2F17A 3DDZX 1VB3A 3NWEA 3AP3A 1X7WB 2A0WA 3KKOA 1X7WA 3QPWA 4ID3A 4MVCA 2GM5A 5TSDA 3IA2A 1EXVA 1JHOA 3SDZA 4BFYA 5FHQA 2BW0A 3QVKA 1Z2PX 1K98A 2W6MA 2PJRA 2RAVA 3D5EA 1XA4A 1F6WA 4PQEA 1Z06A 2CWWA 4BVLA 3I9FA 4YUAA 3QYAA 1P77A 3NHJA 3W7VA 1WTAA 2OUIA 2RARA 3P9KA 2IIVA 3IPLA 4KQ1A 4QGFA 5FXMA 1WAMA 1D6SA 5TQ0B 1FU7A 3VOTA 2WT4A 2MTBA 3Q0IA 5BOSA 1GPNA 3LWBA 1E66A 3B38A 4QYMA 1YGYA 3RRFA 4Y8VA 1SBTA 4FSDA 5JWOA 1NJFA 4Z0TA 2NSDA 3OLZA 4TWZA 3O1JC 1M0WA 3SF8A 1UCFA 2O1WA 3DC7A 4JUBA 5CEJA 4IDEA 4OGFA 2XVMA 3U4MA 2JIMA 4FFNA 2JLBA 1IZYA 2BDUA 4EHLA 2R0QC 1W96A 3GHYA 2VAMA 2XIQA 5M04A 1XHLA 1CUEA 4C7JA 1EEXB 5KVQA 2YRFA 4F5YA 5ILQA 2Y92A 3VZQA 2X4GA 2GXUA 4NABA 5A9SA 2XMPA 2EEPA 3GGCA 2CUZA 5L3ZA 3T7KA 1NZJA 5JH7F 1P91A 3BAFA 1M1NB 1OB2A 4OHXA 3ULKA 1N5DA 4I36A 1VFNA 2RBKA 2PSFA 3BCRA 5CPBA 2PUDA 5EIAA 3FCUB 3B9PA 3FYDA 3NVAA 3TSOA 1RWNA 3E58A 1KAGA 3NETA 3RANA 3MXTA 5JZ9A 5LQAA 2Z09A 4FHZA 3L82B 4LPKA 1POWA 4QUKA 3WL4A 2IXDA 1IG0A 3A14A 3A3KA 3DKKA 1T5BA 4HB4A 4KH0A 1QORA 1RHJA 3FW1A 2Z6UA 1ORHA 3GWZA 1SVIA 5A5VA 2DBYA 1SCIA 1U3CA 3CEAA 3VNVA 3FPSA 4MI6A 3BWEA 2DHQA 2VK2A 1WQ1R 1NJ1A 1JXOA 4E11A 3NTRA 2R48A 3PHHA 1AO3A 4AJ1A 2DR0A 4X66B 2PUBA 5K0BA 2G08A 3ZV4A 1UJ5A 2X42A 4EI9A 1K7EB 4GLLA 4AJKA 1KFEB 3NVMB 5FYQA 2W2MA 4PG8A 1P2GA 1QTIA 1N0WA 2HA6A 2ROQA 3HDVA 3AERB 3B6KA 1E2IA 1DDOA 1U81A 3LUHA 3QFHA 1EXWA 2VUSA 2F3RA 4B31A 4JFRA 1UBSB 3CNQS 4PONA 1MA3A 3QFRA 4L8FA 3QPVA 3RHSA 3OZGA 1S2GA 2JIDA 1SIOA 2OG1A 5DIZA 1G5TA 4HGRA 1JQLB 1KO7A 2IEBA 3A9VA 3NDPA 5ES3A 1CEYA 3P0RA 4WXMA 1M2OB 2EHDA 1M2OA 3ENVA 2QTNA 3DBRA 5FPHA 4L5AA 4LVOA 4IYJA 1JSCA 3SX4A 3K5PA 5JCPA 1F0NA 1U7ZA 1D2NA 1H4SA 2WYIA 3P0FA 4W5WA 1HTTA 4RZQA 3SXUB 3ZOZA 4AJPA 1SC9A 3AWIA 4PZYA 2B4TO 2XQKA 4B7ZA 5BMVB 2ECKA 4H17A 4BE9A 1EK6A 4PZDA 1BFUA 2G9ZA 5A06A 4OQXA 3DZDA 4LHZA 1VJDA 4W5RA 1YMQA 4GOKA 4IOMA 2G1KA 1OYWA 4CKXA 1NOKA 4FFBA 4ROSA 4XWWA 2M6LA 1F5NA 5G0TA 2AJDA 2HI0A 3DTVB 3I6QA 4A0GA 4KPUA 3DXXA 4NJEB 3BDAA 1CUBA 4M1EA 1VI6A 2I4RA 3KOYA 4MMXB 4NQRA 1GNVA 1GXSA 3OLCX 3AIOA 4C7VA 1G8JA 1HE3A 2WWVD 5J2TA 4KR6A 4LKOA 2QR5A 4QPJC 2D59A 4EJ6A 3T3OA 2G1AA 3OU7A 4R2XA 3UICA 1TC1A 1RXSA 4RHUA 2XUDA 5CU7A 4Z4EA 2IUFA 1QE0A 4PGMA 1K0FA 2BSAA 1JS1X 2F59A 3OZTA 2XGGA 2H0AA 3DL4A 4B80A 4KO1S 4C30A 2GYWA 3FPGA 4CMHA 3TDKA 1L4EA 3EQ7A 4BVHA 3ORFA 2R86A 5TY0A 3GUUA 4AZ3A 4TWBA 1X7GA 4UJ3A 3GQBA 4ZQCB 1Q1NA 3RIGA 1QFJA 3HVRA 1Z82A 4B3BA 4B3MB 4U9IS 1RQLA 1CZLA 1K6MA 3CZCA 4MLPA 4ZIRB 3DOFA 1TDJA 2WAAA 3DEFA 4UHBA 4KAFA 5DGIA 4US2R 1MT3A 2PVSA 3UWPA 4XGRA 2H7YA 2O14A 5B53A 5AW0A 1AE1A 3MTQA 3INRA 3Q1KA 1IZ9A 3CJRA 2W2QA 2IEAA 3PEEA 3QVOA 2C96A 3F6EX 3MINB 3FDZB 4IICA 4NPAA 3I9LA 4DA8A 4GOXA 4UNNA 3T4PA 4OSOA 2R4TA 3K4HA 4X71A 4C20A 4HWTA 1VPVA 4UU7A 2O2YA 4UEWA 1BRMA 1OTHA 1DMRA 2WHEA 3AFMA 3NOVA 2FUNB 4JJAA 4QLBA 4Z1MA 1F8YA 1LUAA 3USZA 3O8OB 3PHJA 3T3HA 4S05A 1I30A 2PFSA 1BE8A 4JB2A 4RE5A 5DI9A 2K5UA 2M32A 2CF6A 2P77A 4JJGA 5TQ2B 2CV2A 1H42A 1R8YA 2QE7A 3OJWA 3T7JA 3RVMA 4B8YA 3GFOA 4P0PB 2ISCA 2WSMA 4JLVA 1P8AA 4FNAA 2RKOA 4KFCA 2GJAA 3AW9A 3D5TA 3QOFA 1VA5A 1I01A 4LIPD 2GPSA 6PFKA 2V59A 1NQ5A 4PYJA 1QHYA 4X0EA 1XA0A 4EVQA 4JQYA 2YINC 4RS4A 1X2EA 3F9RA 1FFEA 1R2QA 4YCCA 2IJGX 1PIWA 3N28A 3HZRA 5AVUA 1YZHA 3UCFA 3HUUA 2V7QD 3P2IA 5ALIA 1G1MA 1WP4A 4C08A 4L27A 2VA8A 4AX4A 1V5WA 2VBIA 1X1AA 1TF7A 3CN9A 3ZXIA 3FYUB 4Z3KA 2IOFK 4IH9A 3HXOA 2ZWAA 2YV2A 1L8LA 2QSUA 3A3PA 4PCVA 2Q4RA 2ZB8A 2QLFA 1BW9A 4I5EA 2QVCA 4NEQA 2ZJZA 5EPUA 3UJNA 3N39C 2UYHA 1PYGA 5H7XA 2F8MA 1YOBA 3PC3A 3Q3IA 1C0LA 1P4HA 2EXXA 3DULA 3W5VA 3GCZA 2XNDA 4CM8A 4M8KA 3NDRA 2J4CA 4O63O 1ISRA 5JEDA 4QFBA 1BHO1 4JKIA 3LLMA 5J4LA 1SKAA 3I9OA 3PU6A 1T6XA 3EF3A 3IPXA 4GI3A 4RZ2A 3R7WA 3ZDZB 2CXTA 4NMWA 4WOKA 2CYCA 4NOMA 4BNDB 4JLWA 2PMFA 2VK1A 1I2AA 2IEGA 2OENG 3UH0A 4ZU3A 1OSNA 5ARBA 3I9V6 3JQQA 2BH9A 3EDCA 4G9BA 1JEOA 4DS3A 3QK7A 4XQ0A 4F4JA 3O8CA 2BF4A 1E1RD 1Y80A 1ABFA 3GLVA 3KKLA 3MTGA 4XB1A 2X5KO 4N3BA 1FFBA 3GCGA 4NX2A 5FO1A 3ZE1B 1L4LA 3ON5A 1T3ZA 2JJ2D 3L7NA 3HDHA 4RD1A 3C8DA 4LGVA 4LXYA 4WH0A 1EJ6A 3VR4H 3VKHA 3WLEA 5DHFA 3D9QX 3IGFA 1GT6A 2MMGA 2HU8A 3IIKA 3IT1A 1YVPA 3WB2A 2RK6A 3NNNA 4ZT6A 1GZ4A 4DMUB 3CF6R 3RU3A 4EA6A 3OOSA 4MULA 1DIGA 4AK9A 2FRXA 1XNRB 3R5FA 2Y0CA 2VNHA 3DT8A 1OKKA 1U65A 1U5BA 4O2LA 2ZROA 4FLFA 1Y34E 3ESZA 2AMYA 3BBLA 1DNPA 5FA6A 3UT0A 1JPUA 4Q7JB 3ZK9A 3FKSA 1UR5A 1Y9DA 2XWSA 1VLHA 3TVTA 4OLAA 3ABRB 1H0HA 3HCOA 2QLBA 1SC6A 1V45E 3OA2A 3PXDA 4LDPA 3F6CA 3D8BA 4BDSA 4Z49A 1WEKA 4ESHA 4YPVA 1XZGA 5LZ4A 1V8ZA 2X22A 1IHOA 1B6RA 2HPAA 3GP5A 2C9OA 2QTVB 3HVJA 4JR2A 2HHLA 1H4VB 3LDUA 4HWGA 3HI4A 2ETVA 4O4LA 1OX4B 4Z4QA 1OX4A 1RXCA 3VTAA 3O0TA 4G4IA 3UPDA 2VNAA 4RD0A 1GNSA 3LKVA 1T2UA 3OOEA 4KRGA 3Q9SA 2FE1A 5ERXA 3U7IA 4ZI2A 3IVGA 1A97A 4GZ3A 2EIHA 1Y7IA 3P19A 3OCXA 3QLUA 4MGZR 3H9EO 1B3BA 1XDZA 5A4JA 1GY8A 4MMYB 1KKUA 1MUUA 2DH5A 1CUIA 3CLRD 3OUTA 4KK4A 1QCZA 4AWAA 2WJ6A 3FIJA 3DYVA 3EZ7A 4C6RA 1O0BA 2VHTA 3KEQA 3MOSA 3PFNA 1QO0D 4MTCA 4YAIA 4LX8A 1NR5A 4WOPA 4LHYA 3MJDA 2BP7A 2WR8A 4F60A 1QIEA 4JY7A 5LPNA 4PVCA 5K8LA 1RWMA 2IZ7A 2C57A 2BGRA 3DAHA 3DD1A 521PA 1GCUA 1KMMA 1UFQA 3D8UA 4GXQA 1WF3A 1XKQA 5D3MB 3WRWA 1U11A 4CPDA 3U39A 1NBMD 3BD6A 1KVUA 1MEJA 3R6LA 4QEDA 4TMFA 4ZOLA 5EJ7A 2ATEA 1GL6A 2QMHA 2JH3A 3FTPA 4RL4A 5F5XA 5LU8A 4KO3S 1GQRA 5D6OA 4HL6A 3SIWA 3TCKA 4TRJA 1R0XA 4I50A 3THYB 2QMOA 2E4ZA 2BHRA 4ETIA 4JI8B 2IY7A 4FHEA 3RKSA 1KU0A 1Q7GA 3QFSA 4KL8S 4EHJA 3O4FA 1ANKA 4I2VA 2PTGA 4IRUB 1XVIA 1F2UB 1YZQA 2Y0PA 4ZI3A 2FSVC 4TRRA 3ZV7A 1A72A 5L7TA 2P8JA 4Y30A 1A0OA 1E7QA 1KYYA 1TFRA 5GONA 1BCSA 3JQ7A 2F9FA 3K72B 2QYHA 3U48A 2BKAA 4QE3A 1CZKA 1PJ8A 3UT5B 1YQ9A 1JYSA 2GN6A 2Q1SA 2BFEA 1Y9ZA 4ND4A 3V80A 4A8TA 3WIVA 1C9DB 1PZEA 3VSBA 3BK2A 1Z88A 5K3FA 1T0IA 4CV1A 1Z22A 4YJFB 3ZW7A 3TTXA 3FNRA 4LJ9A 4F72A 5LQNA 3TMKA 1JT9A 1OYOA 3PWTA 2CF5A 1B8OA 1QYVA 1R18A 3NHMA 4OM7A 1GG9A 3KAJA 3OX1A 2P6MA 1LLFA 2VQEB 5MGBA 4OG2A 4GU5A 4CJXA 3JQ9A 4K26A 4B32A 4RIFA 2G63A 4MP6A 2CLCX 4F2HA 1CHNA 5CITA 4BQQA 3ZYZA 4M1TA 1UBLS 4I3GA 3WB0A 4YV1A 4ZV7A 1M0SA 1XMSA 2OSVA 3JWHA 1PWHA 3N7UA 3TLXA 2ACVA 1SELA 1RBZA 3RG8A 2VF5X 5BV1A 5HW0A 2LUOA 1XNHA 1MD9A 5J1SB 3O82A 5B58C 3EXIB 1PQ4A 1FRZA 4DDKA 4BO5A 4G84A 1E79A 1T26A 4M38A 3O7MA 3VR5A 4RIIA 3HXTA 4IDPA 2C2HA 1PKXA 3SQNA 1XA3A 3TJMA 5EIEA 2ZI4A 1SUIA 5BYJA 1Q1BA 3L1HA 2A5LA 2BZSA 4WY2A 1R9GA 2FEWB 3G1WA 5CYGA 3X1KA 3RBXA 2NO1A 1AGRA 1TQ8A 1EH5A 3LZ6A 5AW8A 2BFEB 2C95A 2GETA 4PZEA 3E7FA 1BDBA 1K97A 3ND6A 1I4EB 2Z5FA 1HFKA 2YDYA 4KE6A 4Z9XA 4QUGA 3W5BA 3IR6A 1LDEA 1OWLA 4CM7A 3V4OA 3F1KA 2QNIA 5LJIA 2TSYB 4RTSA 1NQTA 2X5JO 5DTRA 2WG1A 1AIPA 3ZJUA 3ZDDA 1GA6A 2Q1TA 2DB3A 1ZIOA 2ZYDA 1R5BA 4HLUA 1XZ8A 2W4QA 2D13A 3BFXA 3CLSC 3Q7EA 1N6IA 3FFTA 3HG7A 4ZD6A 3WISA 1AK1A 2I1QA 3GJ6A 3G2OA 3GGPA 1OLXA 4AF8A 5JJLA 4MS1B 3RF7A 1OZGA 2D3TA 1KDZA 4PG5A 3CURA 1EK0A 1KAQA 2DFTA 1XFAA 1QRAA 2AK2A 3IBFA 1A8SA 4FCVA 2JG3A 4W5NA 1YBMA 4LFAB 2X7JA 3QVMA 4ND2A 4BAZA 4RTPA 1E2JA 2R66A 3B9RA 5L3RA 4YRBA 2WB2A 3OQNA 4QYSA 5I5EA 1I3CA 1SHTX 1IUOA 2OBNA 1S3GA 3JY6A 1GZ7A 4X7RA 1F6DA 1D9XA 3PI7A 3VU3A 3A3NA 2GA8A 2QL5A 2OZLB 1KP3A 3W5HA 3ABZA 1WUKS 3ZTTA 3A1EA 4KR2A 4HN4B 3GDWA 2WWHA 1XU7A 3W3ZB 5CDYA 4LF7B 3GEGA 3DAFA 2W6ID 4H35A 2JJ2A 4LNHA 4Z5XA 1F9EA 4XIJA 3B60A 3PL5A 5U4XA 1HA3A 1OT3A 2VJKA 3JZAA 4L78A 1T9CA 1JR3D 1UFRA 3R5SA 4F5DA 3UFXB 4C7OA 3GV0A 1EBBA 1GPYA 2HRQA 4BO6A 3UA4A 3NO4A 2IDJA 4Y9RA 4R2HA 3PCTA 2A0FA 3WXMA 1WCV1 3U13A 1KSHA 1NM5C 3RGGA 1EXDA 1HV8A 1WF6A 3ESDA 3QKUA 5JRZA 1I2MA 3QW2A 2WIFA 3O1LA 4HGYA 1VJ0A 4YQYA 3TD9A 3J80A 3TRIA 5IF9A 1Z2EA 3HO1A 4YALA 4BN5A 2C2WA 2QTLA 3PYXA 3Q7SA 2YHSA 4NYJQ 1F48A 2ZZNA 2PIDA 2A3RA 3AZQA 2YYAA 1PT5A 3FPBA 2DFLA 1DXYA 4P3KA 1HFWA 4E2XA 4Y9UA 4D25A 5JSZB 3UPTA 1Z3CA 4PIVA 3WLPA 2QUJA 2ZYVX 3B1WA 3MUOA 5CHEA 1IJBA 3JV7A 3HYNA 5KQSA 2C4TA 3QEAZ 3R4CA 2PQ0A 5A6SA 1RI2A 3H7IA 2BMAA 4QJ4A 4D4HA 2ZEJA 4EGAA 1OWPA 3HXKA 3IMEA 1U90A 1MAUA 3RUDA 2Z1DA 1NVKA 3EXEA 4KFSA 1BXGA 1GFWA 4RZIA 3KZOA 3UC5A 3LPCA 3OM8A 2HC9A 3D0OA 4MUJA 4UBJA 3E81A 4PLVA 4QXQA 4JLJA 1VSTA 4WK0B 3IP5A 1GYQA 1UJ2A 2P9HA 5SZIA 2BONA 5TDHA 4MP8A 2I54A 1VIMA 1SH7A 3HUFA 4DLLA 1UT6A 3K9BA 4MWCA 4TRNA 5J2TF 3OPQA 4QWWA 3VKWA 1FUEA 4F85A 2W4IA 4IFIA 5F23A 2JFUA 2R1TB 3R0IA 5AKHA 1E5XA 1CJMA 1P0MA 1YB2A 1NG1A 1WW3A 3OT4A 4G5QA 1EWYA 1MC8A 2HWXA 5H1YA 1PDVA 2OCBA 2YVLA 1KJIA 1LLCA 2WI8A 4ENQA 3P27A 4AB1A 1L2TA 5C4MA 4MDEA 3QMMA 4JIGA 1ZPDA 4LE2A 3W4KA 3WGMA 1FSSA 1M73E 3K6KA 3AFOA 5CVUA 5GM1A 2IYYA 1GUZA 4CEJB 2CFIA 2TYSB 3QPCA 4KWIA 1HMYA 4MJLA 3NHFA 2GPWA 8OHMA 2CB0A 1CY0A 5L45A 1QVWA 5ALSA 1W9MA 1UPFA 1NXOA 3I9NA 3OHPA 5DHRA 2IYNA 3I6MA 1VL2A 4WOBA 4ONEA 2Z8YM 3JVDA 3VHRA 3ZLUA 1U31A 3GLRA 5DX8A 1ZA1A 4G89A 3GVIA 4AKHA 2IEYA 1G6Q1 2Y6UA 4ESOA 4HDNA 2KLBA 3IPYA 5E7IA 2JI4A 5B3KA 4O3MA 2O1SA 4UUBA 5A2QA 3TPCA 2BM8A 4N0DA 4YJKA 1YSCA 1F38A 2TECE 1MU0A 1XYVA 5EHGA 3SE0A 4U2FA 3JZIA 4L3OA 5AI9A 4EGCB 1UKVY 2ZSEA 2PKWA 3R09A 5CYOA 3VYSB 2FAXA 2VHXA 2IHUA 4Q3DA 4Q19A 4URHA 1R9MA 1CULC 3DAPA 3F49S 1T5DX 2AL7A 3I32A 4O0LA 4ZPJA 1A5ZA 5EKTA 5BNFA 1FUKA 3T5DA 3PX2A 2EATA 5L4LA 1TAQA 2YVKA 2HBYA 1EJBA 1QFYA 4QNRA 3T9CA 3BCSA 2C7OA 4QFMA 1TYZA 3ACCA 4PWYA 4O4LB 5EZYF 1NMSA 1YDGA 5J47A 1Y5MA 1J25A 3BHJA 3EWIA 4MW4A 5DF1A 4C4YA 5J4KA 4DG9A 2IWRA 4LI3X 3QKIA 3TNJA 3G7NA 4JYAB 3DGEC 3E82A 4NVRA 3V34A 4ND6A 3KLMX 1ISMA 4X1YB 2OYRA 3U1BA 3MWLA 5DCWA 2P1DA 1AC5A 1EB9A 3ZZUA 3G2MA 4E2ZA 3VI3B 4CMKA 1NXQA 4XVHA 3AR7A 1JDPA 2NYRA 3VBCA 4BOYA 3GFQA 4JI2B 3A31A 3TQQA 1XVUA 1YIAA 3LZCA 3ZY3A 1M67A 1I4DD 5HGXA 4CKCB 1B0UA 4LXQA 4FR5A 4I9HA 3EH1A 2B78A 3FE2A 4RE6A 3I83A 1MW9X 5GM2A 4GX2A 4X1IB 3ZU3A 1TMOA 1YL7A 3DE7X 3S1SA 4OBBA 4UEJA 3PUJA 2X15A 1CIVA 1MGPA 1EVIA 2ARKA 2GAIA 2ORIA 3ND8A 4OQEA 4TTAA 5KQLA 4CEIB 2PV0A 3GDOA 4HH1A 3UAVA 5DXJA 5IVPA 3IMFA 3OP4A 4WGFA 1RJ9A 2ZJYA 1QTNA 1ZCBA 4HH3C 4MUIA 1B6GA 4H7PA 1Z18A 3NIBA 1FL9A 2V45A 1BD3A 1LQUA 3V33A 3ZZNA 3IDAA 2ECQA 1NULA 2X5XA 3ECCA 2VJMA 4W9NC 5BN4B 2XDYA 2QIPA 2ZIZA 3GEMA 5FWAA 1WUIS 4Z4CA 3KAPA 3R0XA 4LTNA 2D8MA 3CF0A 2UV8A 2XTNA 1FP1D 2VJQA 3KSRA 1U2PA 5TQ2A 3BGWA 2XUAA 2GASA 1LNQA 3A2NA 5C2JB 4DDVA 3IV9A 4URYR 3VA7A 2ANBA 4PIPA 4XM0A 4BU0A 5BMOA 1N6PA 2PH7A 2LTAA 4C4TA 5DIFA 1W0KA 2RH9B 1N0HA 1NATA 2WHPA 3I4CA 4KN8A 3ZGZA 1ZGJA 4PG4A 3RC1A 2GTIA 3O0DA 4OJTA 1D2HA 1PJTA 3EG5A 4QOSA 4Y3UA 4EPWA 2FZGA 1DFIA 3KHTA 3KXDA 4FEYA 2O7VA 1J8DA 2GB4A 1UBRS 2DPXA 2FB9A 4HWRA 5EINA 3TKYA 3TSWA 3ZDBA 4GL2A 1BE0A 1NRWA 1TECE 3IBTA 3R3WA 1L5LA 3NAZA 4ARCA 3GLKA 4OUDB 2RH5A 2VDNB 4NP6A 3G0HA 1NYRA 4I1RA 2JFWA 5F7XA 5HIAA 1N6RA 1PUIA 1SHZA 2J3QA 3GFFA 3BJEA 4FGLA 3GPLA 2AN9A 2GRAA 3VKGA 4PYRA 3TW8A 2BFCB 5K99A 1XRRA 1GDHA 5AVRA 5MN6A 3ZVNA 4LFBB 5BP7A 2JCSA 3BD7A 4O4LF 5KTRA 1CJCA 4DMGA 1N6LA 3F3MA 1JAIA 4MZXA 3WMGA 1HO3A 2PH3A 4M4SA 4JBIA 3EMBA 4BLTA 3DMPA 3ANSA 1ZW6A 4RHTA 4WERA 1IFXA 3NDJA 1LVHA 3RADC 2PBLA 1UC4B 2GLTA 1FDWA 2YIJA 4C7KA 1M83A 1OASA 3TZEA 4KXUA 4X63A 3COZA 4WLFA 3TPFA 1TYAE 2F3UA 3C8HA 4ZKDA 3CEMA 1SHLA 1UBCA 2NO4A 4N82A 2VUIB 3H3JA 4QC2A 1NLFA 1KY3A 1MIHA 2VNSA 1G9XA 3KOMA 2FX5A 4X00A 4BX0A 3GMDA 3LAWA 3PENA 3C97A 3ROXA 5KU1A 2HSEA 1M8PA 1Z5GA 3EDRA 4KI0A 4ZK6A 1PX2A 5TT0A 3E18A 4LKRA 3UXMA 3FPKA 1Z4OA 1XTQA 4XWYA 3OJFA 5KYVA 2CDAA 1LDYA 2IKQA 2PPLA 2VZEA 1P9OA 1QHIA 1JUDA 2GBGA 3DZIA 4NY1A 4F92B 2WAXA 1LRKA 1Q84A 1YUMA 1DKQA 1UEXC 1YR9A 4C78A 1HZJA 3VUFA 2IPMA 1GAQA 2O2IA 3T6KA 4MUBA 3JYPA 4DLNA 4DV5B 2CD7A 2OAP1 1RZVA 1GPJA 4ZOEA 4QQNA 3DOOA 1HYGA 3BORA 4QUDA 4BN4A 3KB8A 4PX9A 4AUEA 1QONA 4G9EA 2ZTVA 3OHMA 1SUFA 3E1GA 1RHUA 1IM2A 1IXSB 2J41A 2QKYA 3CUUA 2DR2A 5SY9A 2A5DA 2OECA 2HAEA 4M99A 4WMLA 1GPWB 2ZQZA 4QUJA 5DISB 4MVJD 1YAJA 2HHAA 2MYPA 2P7HA 4PSDA 3TOSA 1Z8HA 4CQMD 3WFJA 3WZMA 1JAYA 4JVSB 4X65B 1ULUA 1EVYA 4TTSA 3KSBC 3NC0C 4QECA 4PO8A 1XAJA 4S1NA 1XVAA 2N75A 3LT5A 1R8JA 4RGYA 5M5BA 3NCTA 1MJNA 1D6MA 3R7BA 2ID7A 5ALNA 1V5FA 1C0PA 4MYUA 3TO5A 2HA2A 4NNJA 3WC4A 3HKCB 2G5TA 5M34A 1I3LA 1RP7A 3ASYA 1SOMA 2F55A 2BMWA 1KMIY 3KJGA 1CJSA 3WMXA 4AM8A 2Q50A 1QV7A 4HH4A 2VHCA 3R7FA 1TQ2A 3ZVKA 3RK1A 5CDHA 3AJ9A 3H05A 1ZRMA 3QSGA 1I10A 1NQXA 1UUFA 1PJ3A 1VJRA 3G3EA 2H11A 4A5OA 4J90A 4K9QA 5JCOC 5A7GA 3FROA 3GLUA 3GNSA 3MMXA 1L5KA 1G9TA 2O3QA 2Y66A 4DC0A 2PL1A 4YCDA 1YE5A 1XMPA 2XTAA 3OE7D 1G3QA 1I0LA 4FOOA 4NEGA 4F4CA 2DWQA 3FOEC 5CTAA 2O3TA 1CCWA 1HH4A 2GZ3A 1FYDA 2P68A 3NH9A 2RC5A 2PS9A 3KZCA 2NUPA 4JX8A 4CKEB 4UZEA 1ZAYA 5AJXA 3DVAA 1ZGZA 4KO4S 1E2MA 4MV7A 2B1RA 1E3EA 2NSYA 4ZARA 4QHSA 3FX2A 3MCVA 5KOHA 5BYKA 3OLQA 3R76A 1H0KA 4W7IA 2WIBA 2F62A 3PNKA 2NXJA 4X8OA 4DAOA 3FMIA 3HY6A 4MA5A 4ZVQA 4QO7A 4NAUA 2EX4A 2FW7A 4WZAB 3LNTA 1E18A 3MWYW 5IM4A 2Q3JA 2X3YA 5JZVA 1DAIA 2Y2VA 3WNQA 2IUYA 2P90A 3D6JA 1IN6A 1FQWA 1YKFA 2XUZA 2QEQA 4KHZA 4BGVA 3G5TA 2AJBA 1MOZA 3INTA 1W94A 5K0JA 4BMSA 1R0WA 1A4XA 3M3DA 3OEYA 4FFPA 1XZMA 3FUVA 4F96A 3G0BA 3ZHYA 2IZ5A 3ZU2A 4UCXA 3WYNA 5EUCA 2WU4A 2NPOA 2XV1A 4TM8A 4URWR 5CB4A 4AMBA 1H93A 2QW0X 4EABA 1P2SA 2GVZC 1CY4A 2PX2A 1NJGA 1BYUA 2DUJA 2EKZA 5DLPA 5EA2A 4YWJA 3IKTA 3RS0A 1KWKA 4R1MA 2QL6A 1YI1A 2YYYA 3KEGA 5A7FA 2ZTMA 1PRYA 4C0JA 4F9EA 3ADCA 1JB1A 2A9JA 2RGYA 1K5GA 4HWSA 4NDAA 1VM6A 5IZCA 5J43A 4FIZA 1IDOA 5LDGA 5GZ1A 4F38A 1UMDB 2AJ8A 3HJBA 4IGKA 3EGXA 4PVDA 3O3OB 4M9CA 1G55A 4YCNA 3G6WA 3IODA 3NC4A 4WK2B 3PPIA 1Z4NA 2YYSA 4GMDA 4ZEMA 1RZRD 1WG8A 1T8SA 3KQPA 3MYYA 1SIWA 3DT6A 3KKKA 3QPAA 4I0WB 4DJ5X 2ZZMA 3BOSA 1H4TA 3HJCA 5D8DA 1G20E 3NTUA 3FPLA 5SYAA 3ZCRA 1DBWA 3LO5A 5HUHA 2ZUBA 1JXMA 1O8CA 1D4ZA 2O0KA 5DSTA 3Q5GA 3IRUA 3S28A 1UPUA 4DG8A 2QY6A 2E5FA 1B1CA 2WQZA 3CKYA 3CWQA 3ET4A 3EY4A 4HEA6 3TEJA 3AVYA 1XL1A 5HXAA 4UEQA 1FEZA 4R6XA 2MSWA 1I8TA 3ENKA 4K6FA 1JA0A 5KTSA 3VH3A 4PNHA 3ITNA 1HT0A 2XUGA 4QSHA 1II8A 5JTTA 4R5HA 4V02A 3BMCA 5EJ8A 1W36B 1HEYA 2YH2A 2BWJA 4XR4A 1WEHA 3RYFB 2ZVJA 2LE0A 3KVVA 5KVSA 2VZLA 2NYUA 4TL9A 3BDVA 2AOTA 1NUUA 4IWYA 3ZHUA 4O2AF 1OE0A 5IC4A 5FBQB 2G6BA 2R1VB 1ZK0A 4EEXA 3H75A 4UHEA 1OAAA 2K87A 3SQLA 3UTCA 3IEKA 2O2GA 4QIHA 3FVWA 3NHRA 3OZSA 4V38A 4YP1A 1TB4A 1EE2A 2HO5A 3FBTA 3M33A 4LJRA 1UDRA 4CLRA 2Y3IA 4LJ7A 3ZGXA 5B5SA 1P5FA 4MRPA 1J06A 1PR6A 3S7ZA 2FUG1 3E1SA 5EL0A 2QVXX 4RQBA 3W6NA 1ZP6A 1RFLA 3MCTA 2NZ2A 1UPCA 1VYVA 2NTVA 3B9BA 4EBBA 4E3ZA 1LBSA 3UGTA 1T15A 3DE3X 1X7ZA 4W1SA 4BLPA 4QUHA 1ISSA 1R4NB 2LCFA 2B8EA 4J7UA 5B4TA 2VZ9A 3N2GA 3KAQA 4CKBA 3M6IA 4KN6A 3SBDA 1VE3A 1DXOA 2HJWA 4YT4A 3FB4A 4RGVA 5EEGA 1SXGA 3VYWA 4CR8A 3QHPA 4H15A 1EUQA 4EHNA 4LSWA 3HA5A 3BZBA 2IOFA 2JHGA 4EPRA 3MEQA 1P1CA 1WPRA 5JEEA 1P7WA 1BW9B 5GQSA 1NVTA 4KVZA 1PNRA 2DRIA 4IKEA 1ABBA 1ZJWA 3RUEA 4WJZA 4LQ4A 5EZYA 4H6WA 2GLUA 5K09A 5BWBA 2NM0A 2EF0A 3P9ZA 4B9EA 1HORA 4BO4A 1BHJA 4II3A 1NI4B 1THGA 2ZAYA 4C7BA 5E1MA 1WABA 4PNZA 4Z0PA 3WGJA 3NHLA 3BRQA 3A58B 3H9CA 5C5DA 1U8FO 3AEZA 3C1AA 4GUAA 4M9RA 3VH1A 2X9GA 3LT2A 5B1DA 2QUHA 3ZWBA 4B45A 1RJEA 1SBCA 3EIOA 2C3UA 4MIOA 4R3UC 2F3QA 3EGVA 5JDCC 4EW1A 4D43A 5TT1A 1X1CA 2XHEA 2FR1A 3NH6A 5KKAA 4EJSC 2GD2A 5K03A 1CUUA 1Y37A 4DV7B 2ZJ6A 3ZDXB 2G9VA 3IQXA 4RC9A 2IELA 3PXEA 2OCKA 2P41A 3QFFA 3F2VA 3DZ8A 3KYDA 1TPYA 4QPDA 3T5GA 4GYYA 3WK7A 4JYCA 1ZN2A 2HXYA 3A4VA 1KQNA 2VDPB 1J20A 3HS3A 1A9TA 1GVNB 2P6NA 1RYNA 2WM8A 4IXTA 1WUYA 3RAEC 1K27A 1VYHA 2M6RA 2PUJA 3HYSA 4IQGA 4B84A 3SM9A 4M86A 4C07A 3A06A 2VT6A 3ITDA 1SK9A 5AWFC 1GAEO 2WUDA 5BSHA 3UQZA 4E22A 3WGTA 5CG2A 4HDQB 1V8PA 4G1UC 4E5NA 1QVRA 5L3QA 2JRCA 5C1OA 4OQQA 2QGZA 2O2DA 4UNPA 5HF9A 5J59A 1XPOA 1RCTE 1S8OA 3ZQJA 1BDMA 1QR6A 3VO9A 1EHCA 2JA1A 2OESA 3TLGA 2FW1A 4JENA 4LRSB 3PBKA 2VPWA 4DRXA 2YV5A 2EKDA 2C1ZA 2AI2A 2G9QA 3E22A 3V55A 1KC1A 4X6UA 1VMDA 3M89A 1LX6A 1NBME 1ZVJA 4GBED 1UBUS 2G40A 1Z13A 4XTRA 2X6QA 5DBIA 4EO4A 3JVUA 4QQKA 4BV2A 2WUGA 5FP0A 2C2KA 3QLUC 4N6NA 4NBUA 3QLVC 1KFJB 2Y0EA 4XDZA 5IF3A 4E51A 2EARA 3H2SA 2GCNA 3PUXA 3Q8XB 1DBSA 4ZCMA 4CVNA 3OBIA 1NQOA 4M1KA 5F5LA 1MA0A 1G8KA 3ZCTA 1DVRA 3TDMA 1QIMA 3D02A 1RABA 2JCGA 3DEKA 4XLTA 4E33A 4F4HA 6ABPA 4BE7B 1P1KA 1U7XA 4G0UA 1V4NA 2Q3MA 3JD0A 1CYEA 4BFVA 3ZW8A 1XUOA 1GFIA 2BP7B 2QE6A 5KSOA 4RPKA 2X9VA 4GFDA 1P5ZB 3RSLA 3TKLA 5JC8A 1TEXA 1IBKB 1SXJD 2W2LA 1U0EA 1C81A 3BFVA 5EPEA 2CMGA 2Z95A 1C1YA 2QTAA 4CLOB 4EY8A 5I7UA 4NDZA 4HF7A 4MQEB 2IYTA 3BXXA 3EZFA 1AN0A 1L6RA 2DTEA 1T2VA 4EMUA 1C14A 2I2AA 4M37A 4XJTA 5KNBD 4NYIR 4ZO7A 3STWA 1Z0JA 4J1TA 5TJ9A 3TIGA 4CL3A 2EFGA 4L0CA 4KLCA 2W6NA 1XRLA 3Q1LA 2FA9A 2D0DA 4N01A 3P94A 4RTNA 2HNKA 2NXCA 4FN5A 2KW5A 2R6HA 4OKSA 4CG2A 3CG4A 4D9KA 3JZDA 3MOIA 2IY9A 4K3UA 1LC0A 5AXCA 2JI8A 1XAGA 4EF4A 2R8EA 4O2RA 1V16B 4HTFA 3QNWA 5CNIA 1DKMA 1CZRA 2DAPA 2C8VA 3T4EA 1GAXA 3TIIA 1Z0SA 3TAHA 4RKQA 1OGJA 1SR8A 1L8AA 4O8CA 4B46A 2WHRA 4RPLA 2JFOA 2FEKA 1JDBC 5H16A 3OD5A 4M8LA 3L0OA 4RO0A 1K0UA 3TD6A 1BG6A 1PQUA 3KKNA 3V00A 1JIIA 2J6HA 4X8MA 3TR0A 3GNTA 1K6IA 3W9SA 5JISA 1HEIA 1LF5A 3C3AA 4IWXA 1JW9B 2A1TS 1J7JA 1K3UB 4L8GA 3TXXA 3OF2A 3PZRA 4PE5B 5FOTA 3TWOA 1IY9A 2FQYA 4D8XA 4Z2AA 3KUDA 3B85A 4G07A 2JGLA 4P08A 3KLNA 1U4NA 2AQHA 2W58A 2XD9A 3FMOB 4OUDA 5IT5A 1QMGA 2XTMA 4KPEC 2A0KA 3QHAA 3OLXA 5H3HA 5I7FA 1KO1A 1WLSA 1JQKA 2ZT5A 3WWZA 1BVUA 2DF8A 1AS0A 2NUPB 4OHBA 1SKYB 2O5RA 2OC9A 2YNMA 4G65A 4AC9A 1QPZA 4N0MA 2C4MA 1RLTA 4FMBB 3E0XA 4KPGA 4OREX 3PRJA 2CXPA 4QXAA 2JFVA 2LXNA 5E4TA 1PT9A 3UK7A 3KLBA 5T4BA 3SSAA 1W0KD 5FFFA 4UJ5A 3ZKWA 3D6FA 4LDNA 3BGIA 2D5LA 3A10A 4PHHA 2P4SA 3CLRC 1J56A 1FRQA 3PJDA 4P4NA 1D7AA 2OAQ1 3EIXA 4QFDA 1M8KA 3GFSA 3X0DA 4JUCA 1IUNA 4ALKA 4F7WA 1KWGA 5A5FA 1RM3A 5K3AA 5F4ZA 2YQ5A 1E2LA 4AMZA 1QV6A 5TQVA 3ANTA 1N2CA 4B7CA 1E4EA 1V7QA 3CLUD 4E03A 3EVEA 2L69A 4WASA 3LLCA 1WW8A 2BIFA 1UIRA 2Z3ZA 2WVGA 2VT2A 3EGWA 1I13A 4HGZA 5AOBA 5FQNA 1VHLA 3KB6A 1OA1A 1SCDA 1B23P 1MC1A 1J70A 1ISGA 3OCJA 2ZUWA 4CZ2A 1WM1A 1E6WA 2E1PA 3PQEA 1MN6A 4R9UC 3VHQA 3OFVA 2I78A 1U2QA 3ASVA 1EM8B 2H6EA 3A6DA 1G20A 1IY1A 4RENA 2JFPA 3UWKA 5CDFE 4OX9Y 1G1AA 5FPYA 4F5ZA 1Q6ZA 1IHUA 1D2GA 1Z33A 1RI1A 2ORED 2QRPA 4WK4B 1EI9A 1RYMA 1Z68A 4HFNA 2VDVE 3WE7A 1PFQA 4R1OA 4KSCA 2QDXA 3KSDO 4RD3A 3GPDG 2ZWVA 3M82A 3ZD9A 5AVSA 3PHLA 1BXZA 1H5UA 2V4ZA 4GPAA 2ZKIA 1W2GA 4AKTA 1W6UA 4LXXA 4CNQA 4D7AA 5JAUA 2GDJA 5HFAA 1CR6A 1V5IA 1WL8A 1XTIA 2OGUA 4AZ3B 5CFRA 5JD4A 4KDCA 1OT5A 3KTFA 4JD5A 5LA6B 2C8LA 2B2CA 1KI6A 3QVLA 4JQSA 1XLVA 2HEGA 2JEYA 5K8VA 4PW0A 1SIUA 3TNFA 2C5BA 2R5FA 2OXCA 4QARA 2PRZA 4EB8A 3DKRA 4IX9A 1HWYA 1NUHA 1TAHA 3DW1X 2ZIXB 3HB4X 4CHTA 3EOAI 5C3MA 4M1WA 4OJQA 5AJWA 5JDIC 1E61A 4PBRA 1N4AA 1JHRA 4N8SA 2CMHA 4YK7A 5K8CA 5J5VA 4HXFB 4TLCA 1YTUA 2A9RA 4A8JA 5CFZA 1Q0HA 4JSRA 2YVAA 4H31A 4MHTA 2PUWA 1EGMB 1P4JA 4D99A 4U0KA 3EPLA 1F8UA 1Z39A 3NEAA 4MX8A 4XARA 4YLGA 1OV6A 4PEVA 1NZDA 1XCBA 4D9CA 4UOEA 1RQPA 3LW8A 3ZJTA 5FNVB 2IV2X 1UKEA 3LVQE 2H85A 1OFUX 4WW0A 4B7AA 4NDNE 2IBTA 3D8HA 4JLMA 1J90A 1Y3DE 3T7RA 1IG3A 4X93A 2DU8A 1EFUA 1LK5A 1L8OA 3O4HA 4I6GA 2P0AA 2QR2A 1SZCA 3CE6A 3NT4A 1A71A 2IU0A 5JFOA 4DR5B 4JT8A 1NAIA 2WKSA 1W8DA 4N0PA 4Y2UA 1Y9AA 4XVUA 1I9GA 1SO8A 4S1VA 1RIIA 3L07A 5PNTA 5IT0A 4F93B 3A1FA 4R3NA 5FOUA 3GGSA 3FLAA 2XNCA 2EDCA 3TAXA 2PXXA 1XYGA 3U7QA 2BY4A 2REBA 3N2GB 3G13A 1JQ5A 5HDQA 3P2YA 4UEKA 2HA3A 4FT4A 1Z0IA 2WJYA 5E0OA 2ZI6A 3ZQ4A 1P2TA 3D1JA 3RYIA 2W2TA 3TRKA 3K2EA 1JF8A 1TM5E 2PT5A 2QI9F 1PEKE 3OM0A 3CLSD 4IJQA 1DC5A 3OJLA 2PNFA 2UYOA 2NGRA 3W78A 1VJGA 2PX0A 4MQLA 1U99A 4QUEA 2NTNA 4B3GA 1O97C 1IQ0A 1OWOA 5AD1A 3K15A 1MJGA 5B55A 2WFZA 3TVYA 1FTGA 3FPCA 3BJIC 3I5YA 4TLDA 1Y3HA 2BVNA 5DTQA 4ER0A 3K20A 5JS7A 3T1YB 2RFLA 3C3JA 1ZL0A 4JBHA 4KYUA 4JGGA 4MPPA 3O8RA 1XDWA 4WECA 5JE8A 4C4AA 1ABEA 1KVRA 1SXJE 2RONA 2Q3LA 3B8EA 1Y1KE 3BRSA 4G37A 2ZSAA 4GHWA 3X3HA 5KOJB 1NQAO 1P73A 4CF7A 3ZVMA 4KLRA 2GD6A 5C4IA 2QL7A 1N8SA 1K5DA 3HMKA 2BSQA 4AN4A 3W4IA 1H9BA 4LYEA 1MVNA 1ZGGA 3L0ZA 4HXYA 3BF8A 1I1HA 1OC2A 4K1XA 4R0MA 3H11A 5DGHA 5BYBA 1LTQA 4IDNA 1BH2A 2XB9A 3EXG1 4CF5A 1UJNA 5I7VA 1H8EA 4I1VA 3E70C 3IAS6 2ZSDA 4AN1A 4R1QA 1NBMA 2V74B 1GPBA 4HWPA 2AIRA 1L7VC 3BSFA 2NVOA 3FNIA 3GLFB 5IVHA 4U7HA 4YWHA 1QWSA 3TLYA 4GYJA 1AMUA 3RAPR 5E9JA 1Y1TA 4INJA 4Z53A 4EPTA 1ZW1A 2BI8A 1ZN9A 4EK9A 2LRHA 1J49A 5F76A 5KAMA 1PTJC 2VJLA 2GZDA 4DRXB 3QX8A 3PLNA 4BNKA 1V26A 4TUYB 2Z8XA 2GN2A 3GDFA 1ZH0A 2E6KA 2XYRA 4KWEA 1IVYA 1Z36A 2Z8YA 3NM4A 2UZ0A 3IP7A 1K2VN 3KDPA 1JBQA 1H6BA 2EP5A 5K8IA 2F4VB 3LCUA 3IUEA 2OPHA 3UMRA 1YR3A 3T34A 1VI5A 1P9LA 8ABPA 5L3SA 4LVUA 2I8LA 4PO1A 2OG2A 3ZBUA 1VP9A 3M5CA 4LYDA 1YAHA 3U4DA 4IP0A 2BH2A 2CCGA 2YWJA 1S3FA 3DZCA 2A1UA 3MF4A 3UT6A 5JI2E 2CFTA 5H5JA 3ITEA 3JWJA 1F4VA 2QR3A 2WWGA 4IIEA 4KXQA 4RIHA 3FYSA 3IR7A 1IHXA 5FPQA 3LUAA 1SHKA 4QG7A 4NU8X 5F4BA 3HMQA 3NOOA 5C5IA 4LF8B 3VPBA 1H9AA 5FUWA 3OLVA 5IMBA 2HIHA 2F9MA 3A2LA 4NATA 3MHPA 3PITA 4H0CA 4YDSA 1NA5A 3QE3A 4EHHA 4BZZA 1HPLA 4IGAA 3WJ7A 2WYUA 3ZHCA 1IAVA 5CGQB 4MKFA 1G8HA 2GI4A 2XD4A 5T67A 4INOA 4I8DA 4HNAA 4J4HA 2UVPB 3FNBA 3NBUA 1M2EA 4OXNA 3L1IA 3FLEA 4R1UA 5C5CA 5LQMA 1XVLA 2PXHA 1T5OA 2GUWA 2R11A 1BH6A 3SPXA 3U0BA 4KX5A 3NANA 4D57A 1K66A 3ETDA 3RYFA 1LD3A 1JRLA 2IQIA 4L5CA 1TJ4A 2J3KA 4YIHA 2V3WA 4IGFA 2W37A 2A5FA 1NXTA 4ZV4A 5JSFA 1QFZA 5FEUA 1K88A 1CK4A 3TOCA 4J0GA 2XCOA 4DR3B 4FUQA 4KJXA 2FZEA 1KAMA 2R25B 4J0DA 4R2IA 4UMEA 1E96A 3SYKA 4YV7A 1GUBA 3FLBA 1IONA 2B0JA 1Z4MA 4F9FA 2DPGA 3JVVA 3HRKA 4B7UA 5JNSA 1N7GA 1O9GA 1QCDA 1S5PA 4B6RA 2PT6A 2AOXA 3SXPA 2JD2A 1JLRA 4MWTA 1LZLA 3AXSA 3SXJA 4BLVA 2NLOA 3II6X 4IM7A 4N3NA 4OLJA 4PNPA 3T95A 1UDCA 1S9HA 4NQZA 3QUBA 1IUPA 3S5JA 1DXHA 4TYNA 2DFKB 1C7RA 3DMFA 1MO4A 5LC1A 2YXNA 2DQ4A 1QIHA 2K2WA 1Z12A 4KSYA 4AMGA 4TTVA 5IAJA 1N5KA 3K4PA 4OXKA 5AI0A 3H86A 5DASA 3UW1A 5HG0A 1YR8A 4YV2A 2KWIA 1FTWA 3FCEA 4OHPA 4TTIA 1E5DA 5KVAA 2GXQA 2AOVA 3M9LA 2Q4TA 1TZBA 2VQDA 4PQYA 1ZOLA 3ZLVA 1Q12A 2G88A 5AM5A 1ETUA 2IIQA 3E27A 2AG8A 1PT8A 3CGGA 2QJOA 3BS4A 3ILVA 3DOUA 3G7UA 1TLLA 1GUAA 4EUHA 1QHHB 2VOJA 4MV8A 4YN3A 4AROA 1PJRA 2G04A 5CYPA 4KFTA 3I72A 1TK2A 4GP6A 3E7WA 4YR9A 3MAAC 2AMLA 2CNKA 4QGBA 3U4GA 1SOUA 2MSDB 5EWJA 2QHXA 3D2AA 3NVKI 2RGWA 4POAA 5IANA 4ZHQF 3TKAA 4ZICA 4F2GA 1QRTA 4ZO6A 4E6EA 2NYVA 3O92A 3OY7A 4CCWA 3VR5H 2J4FA 2J0EA 3RVBA 3ZI4A 4PXYA 3MFYA 1FSPA 3TLGB 4LCBA 3FDFA 2GRUA 2WJVA 4R16A 3ZCUA 2XNDD 1PL6A 1W88B 4EG8A 1ZO8A 3HVUA 2WIAA 1KEPA 1DFHA 3ND9A 3BXFA 4HK4A 5EIXA 5IJ0B 1KI9A 4K9RA 4G41A 4A1FA 2O20A 4KGZA 1AUQA 3OTHA 1JP7A 1JR3A 1ESEA 3HRIA 3QOWA 1LGYA 4C0QC 5BPHA 4QVIA 2DXIA 3TRHA 5L6MB 3D6NB 3UKJA 4OOFA 4QRIA 2OBFA 4LX0A 5AJTA 2QG9A 5CAEB 3K6SB 5FLYA 2RIPA 2OVBA 1UFKA 3ONEA 4H1TA 3B36A 2JJYA 3QJGA 5EP2A 4KITB 2QX8A 3DKVA 4Q3AA 1VL5A 1X92A 2VP9A 2X8BA 3AM1A 1GZHB 3FHLA 3JRWA 3QTTA 2C5LA 3A2KA 3WGLA 3FOAA 5ALZA 1FTYA 1ZOSA 3JARB 4K1LA 4NSNA 4RJKA 3DUWA 5B6JA 4CLOA 1EHYA 1LBIA 1EEHA 2GVNA 2ZJ4A 3CJQA 4DADA 5C51B 3G2HA 2O8FA 1FY2A 5KJEA 4PF1A 3AYXB 1YCFA 4UHKA 1T6YA 5EWJB 3ZNOA 3ZV6A 2FLWA 4IHJA 5BSGA 1RWPA 3GIWA 1RWKA 6YASA 2DHCA 4DIMA 3LP8A 3ZE0B 1K9VF 4HUJA 1EYZA 1R5NA 2HSDA 4M9ZA 4PSCA 2YHBA 1GSHA 2GN0A 2OV3A 3IBCA 1ES9A 2LZ0A 4XQEA 3EWNA 5CMLA 1Z2NX 1EIZA 3RRYA 1N3LA 4P22A 1CJBA 3I61A 2UXDB 1GU0A 4BFXA 4KAAA 5KOIA 2NOAA 2BFFB 1R0ZA 3ICQB 4Q66C 4DCNA 3DB1A 1X7YA 3A25A 1BDJA 3B70A 4Z7QB 4J0KA 1SPBS 4MS3B 4DMHA 2VDJA 2VNJA 3OC6A 4X41A 5K6AA 1QAOA 1E5QA 2HLPA 3OIFA 1IOZA 2QZPA 2H5EA 5A9SB 1GYPA 1UP6A 2XZDA 4EKNB 2G06A 1YR2A 3OPVA 2JD0A 4GG1A 4UUOA 2AHRA 1GQQA 2J3JA 2QW8A 4JOBA 4LV5B 4XH9B 2IS2A 1WY7A 1A8UA 3H5LA 2I55A 4NH4A 4IEFB 3LGSA 5A9RA 1TTQB 5TF0A 4MO2A 4N7JA 4ATNA 1JHXA 1AKTA 4BECA 2EGGA 2R6DA 2DPYA 2H48A 3QG1A 4INAA 2QN3A 4BCCA 3CKKA 5JO0A 4AKSA 2D2FA 2CWDA 3GJ5A 3U3OA 2Q6KA 2IYEA 1G2QA 1EP9A 3AI7A 1ZI6A 2FK7A 1SHJA 4OOEA 1SWVA 4CKZA 5CBPA 1LFDB 2JKYA 2HRDA 4QWMA 4PGAA 1UOOA 1WZIA 1YH3A 2VK8A 2WG2A 2ZPTX 1GQ2A 1ZOIA 3H1FA 3G79A 1TU3A 2BN4A 3WDLA 1YI8A 3CN7A 3ZGOA 2BFWA 3DDNA 1PSWA 3SMQA 1YZ3A 2RGDA 4BNVA 1GKYA 1N2OA 4P84A 4C6HA 1U3UA 4EEZA 1S7CA 2EWWA 3B53X 4BKPA 1IQUA 3WRYC 4BVKA 3IBGA 1B0AA 1T3HA 4BWFB 4COOA 1ODTC 3ESQA 5I9TA 1GNPA 4IMIB 1OBHA 4ZI7F 1QOPB 2FX2A 2AEMA 2BR5A 4FB4A 4QASA 4PN7A 3R7SA 5KSZA 3KD3A 1BE6A 4N7BA 3RUFA 3V1YA 3CUYA 1IN4A 2KB0A 1DEAA 3BXZA 3DS8A 4LVCA 2ZAGA 4X7MA 5KPDA 4BNWA 1G0OA 1E9EA 4NCNA 4UZSA 1RHRA 1IULA 1DEHA 4G36A 4JNCA 3ASUA 2EJWA 2GX6A 3C3BA 5ALVA 3EMDA 2VDLB 3I9JA 1EVJA 1IB6A 2QUKA 2YQ4A 1OI7A 3P45A 3T9FA 4C4SA 3PQ7A 4RK6A 4DJAA 4EO7A 5D86A 1QQBA 1EFHA 2VL7A 3W5AA 1NW6A 5LP6B 4DV1B 3K1YA 3PRYA 2O0HA 2B34A 1RQNA 3TMYA 4DE5A 1T0HB 1F7VA 2WFMA 1DC6A 1K6JA 5IKMA 1M0EA 5DBHX 3WQHA 4FYVA 2XT0A 5C53B 1I94B 1NVWQ 2X76A 2HW8A 1MTZA 2H31A 2PUTA 4W9NA 3RIHA 1B6SA 3GMTA 4JJFA 2PO7A 3RS7A 1FIUA 4A8HA 3LBIA 1R7RA 3R3XA 1Z6YA 3FBWA 2E4XA 2HK8A 1GPLA 4EVIA 1AGYA 2N47A 2IIBA 2NG1A 4EWLA 4E5PA 3IAAA 1Z2AA 1C50A 3A0UA 3C74A 1UBEA 4GVPA 4HN9A 2J5XA 5E9QA 4H7HA 5KTTA 1GPH1 1DKPA 1YBVA 2GN4A 3RRMA 3N2KA 1P6QA 1WS6A 4MGHA 3DFFA 1C3OB 1U0OC 2OHGA 2YHAA 2YZNA 4MKRA 2IBMA 3Q8KA 4FFBB 1EK2A 5K9ZA 3AEXA 2WKQA 4EDHA 3EUFA 4KIJA 1CXZA 3AB7A 1N6KA 1NDQA 4G56A 4NBWA 1WHSB 4DC1A 1GDDA 1NNI1 5HWSA 5JY1A 1YJQA 2WSBA 3MWJA 4NJEA 5T4EA 4X90A 1PWEA 1EDDA 1FX1A 1W73A 3FSEA 4DNFA 1M7HA 3T3EA 1P0PA 1M6VA 2JI7A 3GRUA 2CNBA 2X86A 4WKGA 1RQ2A 5CTJA 4N1AA 1TMGE 3V32A 4BQFA 3KUXA 4WN3A 1CF2O 5B2ZA 5C7IO 2PYZA 1MVLA 1XDDA 3IALA 3GH3A 3CBQA 4GLFA 5DM1A 4HGNA 3HK2A 4RETA 4I1OA 5JYBA 3HRHA 1E0DA 1HYBA 3H2JA 3HWX1 4UM8B 3Q85A 3V8VA 2ZR7A 4DREA 1HNZB 2YXDA 2JDIA 4Y1GA 4UPVA 2I7VA 3OTIA 4N54A 2UXCB 3MT0A 4OH7A 5BSFA 4PAQA 3TIFA 3GRYA 1KRHA 1J9ZA 1C1XB 3URMA 4IQ0A 5ABPA 2GJSA 4FEAA 2PZKA 1UAYA 3R8CA 1QJ4A 5EAIA 3W5CA 3TG8A 4DBLC 1J0AA 2EJVA 2VSOA 5NLLA 1XCOA 4RKRA 2OSBA 1E64A 3HB1A 3P8ZA 3QV1A 1TEVA 2GN1A 1I1QB 2X1MA 5DN9A 4MTLA 2PN1A 3BEOA 3N2KB 3OQBA 3E9CA 1DP4A 2H4WA 2JIBA 2Z4TA 1RKBA 4P35A 3TJZA 4MAFA 4CEIA 4A8JB 2AZXA 4JVLA 1QZTA 3HBLA 2COKA 4X45A 2Y99A 1ADYA 3JQGB 4R2WA 5BO5A 4F2PA 3D59A 4RVHA 3GELA 3OSUA 3OWOA 1XTVA 1FQOA 4DQDA 2VPIA 2SKDA 1PT6A 3M6UA 2Z1MA 1D2MA 3IESA 1P31A 1U8ZA 3MJTA 2J0VA 1CERA 1RAHA 3A4LA 3IUNA 1XDGA 3GVPA 3WLMA 1CLEA 4WL0A 3F8TA 1OBCA 2GCEA 4NNOA 4W5JA 4MV6A