4QLOA

Crystal structure of homoserine o-acetyltransferase from staphylococcus aureus
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
327
Chain Sequence
NYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRKDPAFLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homoserine O-acetyltransferase
publication title Structure of homoserine O-acetyltransferase from Staphylococcus aureus: the first Gram-positive ortholog structure.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 112
structure length 327
sequence length 327
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2014-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qloA00
3EQ8A 4BCCA 3AJAA 2XUAA 3H18A 5AO9A 4EY6A 1AUOA 2ZVDA 2H7YA 2GBFA 3M83A 3GELA 1JU3A 4FLMA 1SCKA 3NWOA 4DTCA 4HRXA 1CUAA 5YASA 2CEKA 3QMVA 3ILSA 3VKFA 3L1HA 4G1FA 4HZGA 4J0DA 3LIPA 1JKMA 4Y2YA 2JGKA 3HC7A 1ZI6A 3AILA 4U2EA 2CJPA 3A70A 2WIGA 1VLQA 1NU8A 1MT3A 5CURA 4DNPA 2ZSHA 3FYUA 3UMJA 2ZJ7A 1F6WA 1CV2A 4RGYA 4P08A 3WKCA 1C4XA 4EY7A 4JH0A 3ZWQA 4PNZA 1W52X 1VZ3A 4IH1A 2WIJA 2Y6UA 4BVKA 4K2AA 3PUHA 1MO2A 1CR6A 1XKLA 1ACJA 4H18A 4BRSA 1PV1A 4ROTA 1SOMA 2GYUA 3VXKA 4TVKA 2JGLA 5EIHA 3HRHA 1N5RA 3O4HA 3OPMA 4H7FA 4DSZA 2WU4A 5DLPA 5AM3A 3IURA 3N0TA 3Q8WA 5AHXA 2WJ6A 4PSDA 4XIIA 4QZVA 4BCDA 3PF8A 5AM2A 2V9ZA 2HHAA 2QRUA 2WG1A 3EIOA 2OAGA 3AFIA 1XLVA 5ALLA 1VA4A 1E89A 1QFMA 1CUWA 1S8OA 1P0QA 4BZWA 1FFAA 5AI4A 4GWLA 1CUVA 3ESDA 2BFNA 1XZMA 4AMYA 1R50A 3G9UA 4BTLA 5JZSA 4L9AA 3ZPXA 4GI1A 3G8YA 3R3YA 3WKEA 1MTZA 1CUJA 2HRQA 5JZBA 2PVSA 1G4HA 2XMZA 1CEXA 3VVLA 4AX4A 2HA0A 4KEAA 4EZIA 5AI6A 2RGUA 2H9YA 4UHCA 4P9NA 4CIAA 3B12A 3C6BA 1J2EA 2WJ4A 1AGYA 1HQDA 4FTWA 1GXSA 4U2DA 1XRPA 3MVEA 5DYYA 1XRLA 5CT4A 1FFDA 3ESAA 4Y2PA 1BEZA 1OILA 1L7AA 3ANTA 3CN7A 5D3KA 1GPKA 1WM1A 2JEYA 2FX5A 5CTAA 4DMFA 4KE7A 1YCDA 5D6OA 2WIDA 4H0CA 1N1MA 3PUIA 2AJDA 5AKYA 3HZOA 4JEIA 1LGYA 3R40A 1YA4A 2XMBA 2XUKA 3IUQA 2DR0A 5ALQA 5EIAA 2C0QA 4XJVA 2XUQA 5HKAA 3WWOA 3FVRA 4P92A 2VAVA 5E2IA 1MX5A 5C8VA 1IUNA 2BUAA 1VA5A 1FFCA 2Y2VA 1JJFA 4Y2UA 2QTBA 2OCKA 2OPHA 2FUKA 3T52A 1ETHA 4Y2SA 3STYA 1JI3A 2DHDA 2QT9A 2XE4A 5JAOA 4H7DA 2PSEA 4IHAA 3BXPA 4K6KA 1MPXA 4LYDA 3AIKA 5BV7A 2VATA 5K3FB 2Z8ZA 2JGEA 1GGVA 4V2IA 1DT5A 2C5FA 4UFOA 2V98A 2P8SA 3H1BA 3WK5A 4RPCA 2HA5A 5JARA 3FLEA 4DYHA 4LKOA 3W05A 2D0DA 3FYTA 4MQMA 2WKWA 5K3BA 4G4GA 1CUGA 3AIOA 3C5WP 4X91A 2JGJA 3V1MA 3RKSA 1KU6A 1ZIYA 2WG0A 4LXHA 3IIIA 2Q0XA 4EY5A 1C7IA 4AB1A 4QEKA 5KWJA 2WHPA 1ZI8A 2O2HA 3F98A 3G0DA 2BGNA 3KDAA 2OCGA 3WLAA 1VKHA 5T4FA 4YPVA 4I4CA 5EHXA 3A2LA 1FFBA 3C87A 2WUEA 3B3QA 1AURA 3GFFA 4W1PA 2XDWA 2XQGA 5CBKA 1WHTA 1DINA 5HF9A 4Q34A 1LBTA 4G4IA 1VOTA 3R0VA 4L0CA 1EX9A 4J7AA 3NOXA 1AMNA 5AKEA 1A7UA 4AO8A 3OURA 4GEGA 3DD5A 1XKTA 5ALFA 5LZ8A 2PBLA 2XLBA 3QMMA 4N5HX 4DMKA 5ALNA 2ZYHA 3G0IA 3E1GA 4W1SA 3JW8A 3QVMA 3VISA 1E8MA 1H2YA 1XZHA 1FJ2A 5LZ9A 3G7NA 4ZGBA 5EHZA 1LBSA 2VJBA 4CG2A 3STWA 4N8DA 5KWIA 4BAGA 4KE6A 3IUJA 4C89A 2JBWA 2WQZA 5AK4A 5FPPA 4TPKA 2WSLA 2DCMA 4JUIA 3V9AA 1QJ4A 5AM5A 4C4ZA 3I2FA 3MGAA 3I6ZA 1E66A 5HFNA 4HRYA 3DDUA 1DT3A 1TCCA 4EA6A 1TQHA 3CXUA 2OCLA 3ICVA 6YASA 2XLCA 4WDRA 3D4LA 3ICWA 3G0GA 3UUFA 5FP0A 4Q05A 5JZ9A 2FJ0A 5CT8A 5ALWA 5ALEA 4H7EA 2XQFA 1BROA 3H17A 3G9ZA 1QIKA 2VT6A 4X71A 1OCEA 2JGMA 2Z5GA 3DOHA 2DFPA 5JD4A 5JALA 2PSHA 4O08A 1R9NA 2ZJ6A 2ZJFA 3CCCA 5BWBA 4BZZA 1DWQA 2XMDA 1LZKA 4MXDA 4QDUA 3IVMA 3MUOA 2IIVA 2OGTA 5K3AA 3WA6A 4QLAA 2GBCA 2FJPA 4W1RA 2PPLA 2BJHA 4FFWA 3SC2A 3H2GA 4JYPA 1HL7A 1B6GA 1JU4A 4KE8A 2HA4A 4BYMA 3LCRA 5AM0A 2QXUA 5DNWA 3O4JA 3FWHA 4F5ZA 1W4LA 4WJLA 3LP5A 4B9AA 4B81A 3D5EA 2CKMA 4OSEA 4ARBA 4X6YA 4OB7A 3FVTA 2XUJA 4PO3X 4C88A 1ZICA 2DQZA 3I6YA 3STXA 5CXXA 1HDEA 1VE7A 3I1IA 4DNQA 3ZLTA 4E46A 3EQ9A 4CCYB 1BN6A 5JIBA 5C81A 3FSGA 2X76A 1BRTA 5FV4A 1R88A 4RNCA 2JIDA 1IMJA 3ED1A 2J3DA 4Y2TA 2G5TA 4ARAA 1IZ7A 5A62A 3BIWA 1U4NA 2RHTA 4G9EA 4X6UA 4LXGA 1ODSA 4BAZA 2AJCA 4IH4A 3STVA 2Y6VA 2J4FA 4BC1A 1A8UA 1EXWA 1UK9A 3WJ1A 4UBOA 1ZOIA 2DHEA 2OLEA 4ZRDA 3K2IA 5DYTA 1UKAA 1DQZA 4Z49A 5K5EA 1YB6A 1SC9A 1EK2A 1W76A 1UK7A 1K4YA 1MX1A 3BL8A 3FNBA 3WI7A 3PICA 1AC5A 1XRNA 3VJLA 2RHWA 5AIAA 3BDVA 3WYNA 4X85A 2R8BA 2WTMA 1HBJA 5ALKA 5ALUA 5AKXA 4MWSA 4BVLA 5ALTA 5LKAA 1F8UA 3STUA 3O9MA 2HADA 2LIPA 3EF3A 4PSUA 1GQSA 2I03A 4Y2QA 3L1JA 4FBLA 4B0PA 4QWWA 1QIJA 5JADA 3D2BA 4RE6A 5K3FA 4X3CA 3OC0A 4Q1VA 3E3AA 1WPXA 3ZI7A 1P0IA 5AKGA 1G42A 3VVMA 3CCBA 5HQ3B 4BBZA 3M3DA 2WIKA 3WK4A 2BAGA 1RWQA 5EGNA 1XLUA 4IO0A 4J0GA 4FDMA 1E3QA 3IUMA 1X2EA 3NGMA 3R3VA 3UUEA 1YA8A 1VXOA 4PF1A 2J3QA 1PJAA 2PU7A 2ZYIA 1XRQA 5AKZA 4UFNA 3M82A 1U65A 2NW6A 5ALVA 4UHEA 5I7UA 2VAXA 5AP9A 5FPQA 4N5IX 4BP9A 2PM8A 2ACEA 2WILA 4DMHA 4X00A 3IA2A 3B5EA 5BWCA 4BCBA 4CG1A 3H04A 5BOVA 2B9VA 1IZ8A 4AO7A 2PSFA 2PSJA 3PFCA 3V1KA 3C8DA 2WUFA 4Y2JA 1H2XA 3QITA 1TIBA 3DJYA 4GW3A 5ALMA 4MEAA 5H3HA 4KYVA 4X92A 1QIHA 3WIBA 3QBJA 2ACKA 1CPYA 2O2GA 1GT6A 1OXMA 3OTQA 4X90A 4FLEA 3U1TA 1DQYA 4DNOA 1DX4A 3R3UA 4HXGA 2XUFA 4L72A 3K6KA 3D0KA 1LLFA 4PW0A 3QYJA 3DCNA 4LIPD 1CIJA 5IVDA 2DHCA 3FLAA 2XMSA 2QMQA 2WU3A 3GUUA 4F0JA 1BCSA 4UFPA 2OQIA 5HK8A 1Q84A 1KU0A 3LIIA 1QIFA 1CQWA 3MUNA 3QMWA 4X95A 1K8QA 4OB6A 4J0HA 5JATA 4BE9A 4J03A 2WFMA 4QDZA 1ZIXA 3JYHA 4H7HA 4J0JA 2QS9A 4WCVA 2HFKA 2Z3ZA 3RM3A 1ISPA 2DSNA 5LZ7A 2CMFA 5T4BA 2H7XA 3BE8A 4FMPA 5D7BA 3SK0A 2C58A 5DTIA 5C8ZA 5AI8A 4XWGA 5FLKA 4C4XA 1TRHA 4EBBA 2WHRA 4Y2RA 4HAIA 3DL7A 2XUHA 5DYWA 5ALJA 1QIEA 1ZGBA 5AJHA 4EHBA 3PF9A 5A6VA 3HLKA 5FXMA 1XQVA 2C5GA 2C0PA 1U2EA 4DLNA 4JYMA 2HL6A 5JAUA 5D3ZA 2HU5A 3WL6A 1UKBA 3V48A 4BC0A 1CLEA 2CBGA 2VJDA 4UUQA 1XLWA 4D9JA 2YYSA 5DNVA 3BF7A 4CCWA 4GHWA 1YS1X 2OAEA 2AXEA 2PX6A 2IITA 1EINA 2J4CA 4B85A 1BU8A 2O7VA 1CUCA 5ALHA 3FBWA 5AI0A 1UT6A 1QZ3A 4NS4A 5A71A 4P93A 4OYYA 2WUDA 1MJ5A 3K9BA 3I2GA 4J3JA 4W9RA 2HDWA 2GZSA 3ZLUA 1EDEA 3A2MA 2G4LA 4Q3LA 1XZFA 3WK7A 1ZD3A 3PDCA 1ZD4A 2ONCA 1SFRA 3KOOA 3W04A 3DYVA 3DOIA 4AQDA 1SCQA 3S8YA 1I6WA 1MNQA 2CB9A 4Y2VA 4U2GA 2XUDA 4FWBA 5I8PA 5AOBA 3G0CA 3AZQA 1XQWA 2VT7A 3HYSA 1G66A 1XZCA 3TJMA 1T4MA 4HXEB 1RP1A 3DQZA 3FLBA 4AZ0A 3F96A 3HI4A 3C8HA 2EDCA 4YK7A 3F8SA 1BN7A 5AI5A 4KRXA 3C6YA 1TK3A 1Y7IA 3H2IA 3C6XA 3OOSA 4ZREA 1Q0ZA 4DM7A 1LPSA 1G5FA 4PQEA 5CXUA 2C4HA 3FOBA 5IKXA 1CQZA 4KRYA 4Q3OA 1XZJA 2HA6A 4B6GA 4C6HA 5JASA 5FUMA 2QUAA 4YASA 1BCRA 2WFZA 2RI6A 4QNNA 1F0NA 3H2HA 4HS9A 4G4JA 5DTJA 1EH5A 3R3ZA 1MAHA 5AI9A 3A2NA 4ETWA 4ITVA 3W9BA 2VJAA 5HF5A 1LPMA 2PKYX 4KR0A 1TAHA 2BUBA 1EHYA 4X94A 3ESCA 5LLSA 4FKBA 1H23A 5HQ3A 5IVHA 4QA9A 4G5XA 4M0EA 5A7FA 2YASA 3EQ7A 1YS2X 1XQYA 4FNMA 5LIPA 1UKCA 4Y2XA 4PSCA 3KWJA 4J0CA 3RLIA 1IUPA 3QPDA 4A5SA 2O2IA 2EDAA 2RONA 4BDSA 1N5MA 1CFJA 1JMKC 1XZEA 1CRLA 2WTNA 4S0XA 1O6GA 7YASA 4LXIA 3C6ZA 1ORVA 1WPRA 3IB3A 1H22A 3D59A 5LYYA 1XRMA 5FOQA 3WJ2A 4XVCA 4OU4A 4G8CA 3DLTA 1XRRA 2RAUA 3W9UA 4A16A 1ODTC 2WJ3A 1ZJ4A 4MEBA 5KREA 1GKLA 1BEEA 4GLBA 2XQJA 3V1LA 1A8SA 2BKLA 3PI6A 3N2ZB 1VJ5A 3WZMA 5JD5A 4GBGA 5DNUA 4M0FA 5ALGA 1X70A 1A8QA 1GKKA 4FLFA 4INZA 4CIBA 5AKKA 1LNSA 2XUGA 2XUPA 1W1IA 1P0PA 1UWCA 2WLSA 1IUOA 4OB8A 1QFSA 1CUZA 4Y7DA 1QIGA 1LPOA 3GZJA 2GYWA 4J0IA 2W6CX 1IVYA 5I9IA 5K3DA 5ALZA 2VF2A 1ZJ5A 1Q83A 4B9EA 2JEZA 2Z8XA 4G9GA 3WWDA 1USWA 2H1IA 1UFOA 3VJMA 1LPPA 5EHNA 3E0XA 4KE9A 4GECA 3H2JA 2D5LA 4WDQA 1ZGCA 1QLWA 5CT5A 2ZSIA 3FYUC 4WY8A 3IDAA 2WHPB 2XMRA 4ZWNA 3WK8A 3DNMA 3I28A 4Q3KA 2RIPA 5C7YA 5KBYA 4JNCA 2QKYA 3G9XA 3KSRA 4H77A 4MYDA 1NX9A 3F97A 1EK1A 2QM0A 1BE0A 4C4YA 1LZLA 2CUTA 1XFDA 4UBIA 3WL5A 1THTA 4W1QA 4K6HA 1ORWA 4H7JA 3F9CA 4B80A 1CUIA 4MYSA 1KEZA 4WFIA 4ZI5A 3C70A 1EVEA 5E4TA 3HSSA 3C43A 2GBGA 2XUOA 4UHDA 4FOLA 5EFZA 3VJKA 1JJIA 4X97A 2OGSA 4OU5A 3O4IA 2AJ8A 3P2MA 4NZZA 5AH0A 4AXBA 1J1IA 3A6ZA 1AKNA 1LPBB 2HRRA 4GXNA 3I2HA 1D07A 2BCEA 4ZXFA 2B20A 4QDOA 4BVJA 5LZ5A 4YX9A 2YH2A 3SWWA 5CW2A 3AIMA 2XT0A 3C5VA 4C01A 4AN1A 1O6FA 1U8EA 3ZV7A 3IBTA 1CUFA 4N8SA 4BP8A 3H0CA 2OCIA 3SX4A 3KWFA 3TRDA 4FHZA 3TGLA 2GBIA 5CT6A 1DX6A 1DU4A 5ALSA 3WA7A 5SYMA 1H2WA 3QM1A 1VE6A 4F21A 2WIFA 5EHQA 5IVIA 3WYDA 1TCBA 1J06A 1E8DA 3WK9A 4OCZA 4HTAA 3I6MA 2XQKA 1L7QA 3RARA 2XMGA 4AZ3A 3HEAA 5HZGA 2ZYRA 3GROA 1XZIA 5E4YA 1L7RA 5HF8A 3I2KA 5CH8A 2WFLB 3QH4A 5CH3A 4BAUA 5AK3A 4MWTA 2BGRA 4KAFA 2QJWA 2VQ6A 5ALPA 1ACLA 3D7RA 4BB0A 5FRDA 5ALIA 2ZYSA 1QTRA 2G5PA 1UXOA 4G8BA 1CUEA 1NU6A 2V96A 2AJBA 4H35A 5HCUA 4AO6A 1YAJA 3S2ZA 4GDMA 5JAPA 1ODCA 3PE6A 4B84A 3OG9A 1MNAA 1THGA 4AN0A 4OUKX 3W06A 3BDIA 4FNGA 1MX9A 2QJRA 1TKRA 3H19A 4W63A 4DGQA 4QE3A 2VJCA 2QZPA 5FDFA 1Y37A 4B83A 1EDDA 2CZQA 1EA5A 3HJUA 4WY5A 5IH7A 2WG2A 2HA3A 2QOEA 4DIUA 3HXKA 3WWCA 1HLGA 2WUGA 5AKJA 3DS8A 2GZRA 2B4KA 1JT2A 2K2QB 2W22A 3RK4A 2ECFA 4OYLA 3O4GA 1HKHA 1EB8A 3W2TA 1R3DA 1WB5A 3DL4A 3LLCA 5JD6A 5JAHA 5J3JA 3I2IA 1K5PA 2VTVA 1YSCA 2QVBA 1N8SA 4LHEA 1P0MA 4UPDA 3V1NA 1WCYA 1WB6A 2HU7A 3FSGD 3R3WA 3DKKA 2VSQA 1XZDA 1QONA 2HA2A 3NUZA 2HU8A 3QPCA 3GA7A 1FFEA 4RE5A 5AM1A 2I3DA 4KAJA 2OQVA 1YB7A 4U2BA 4C87A 5C8XA 4BTVA 4FBMA 1JJBA 3I1YA 4DNFA 4NVRA 2R11A 1WB4A 4PV7A 3FCYA 1EDBA 1QO9A 5FKJA 3D2AA 1X2BA 5IVKA 3IUNA 4UHFA 1A88A 5HFAA 3STTA 5K3EA 4N8EA 4A23A 3G0BA 4J0KA 4KACA 3WL7A 2ORYA 3BJRA 4BATA 5T4EA 1R4ZA 4H7IA 1XZBA 1LPNA 3BWXA 4CCYA 3PFBA 4WFKA 4QLOA 2Y2UA 5CMLA 1UZAA 1DTEA 4E14A 1XZAA 3FYUB 2WM2A 4ZV9A 4E11A 2WHQA 5HKBA 4IQ4A 4IH9A 3DYIA 1WHSA 5ALXA 3CN9A 1GQRA 2XMQA 5A7GA 3WZLA 1R1DA 5ALDA 1XZGA 3BIXA 4BRZA 1XZLA 1RYYA 2AJLI 1F0PA 2ROQA 2OGZA 3O0DA 2VEOA 1CUSA 1QE3A 1CUUA 2OXEA 3FCXA 1E5TA 4CI9A 1YASA 5AIBA 4G8DA 2XMCA 5LP1A 1ZD2P 1M33A 5CT9A 1MN6A 5AKLA 4KAAA 5EI5A 4EY4A 3R3XA 1UOQA 5LZ2A 3E4DA 3WWPA 2PUHA 1QO7A 4UHBA 4K5QA 3C45A 5ESRA 5EIEA 1DWOA 3WIOA 3O95A 3AINA 4FFVA 2ES4A 4UHHA 1SCIA 2XQIA 5JANA 1H2ZA 1PFQA 1CUYA 1FSSA 4B7ZA 4L3WA 4EB0A 4QDTA 2PL5A 2B61A 1B41A 2BUCA 4X6XA 4AMZA 4CG3A 3AZPA 5DWDA 4OPMA 3OM8A 1HPLA 3BF8A 2VA9A 2YXPX 5ISMA 4TGLA 1W75A 1W6RA 4UBJA 4HVTA 5K3CA 2X5XA 5AK5A 5AOAA 3QPAA 4CFSA 1XROA 4NMWA 1EB9A 1GPNA 5T4HA 1Y7HA 5AK6A 1LPAB 2XI4A 1QOZA 3HACA 3ESBA 1BS9A 3WK6A 2C7BA 3H2KA 2PUJA 1QIDA 1CUXA 3KXPA 5AKHA 1DWPA 1K63A 2JGIA 2JF0A 1Z68A 2G63A 5LZ4A 3WKAA 1TCAA 4X7BA 1VXRA 1AX9A 1ZD5A 5AOCA 4OD0A 3X3HA 2HIHA 4I19A 5A2GA 3DKRA 1YR2A 3WL8A 3WKDA 3ANSA 3GBSA 1WOMA 3Q0TA 4UBNA 2I78A 1UK8A 2EEPA 4MQLA 3WQHA 1MU0A 4Q82A 4LYEA 2QR5A 2Z3WA 3O9VA 2V97A 4BDTA 4MJ3A 3G9TA 1E8NA 4HXFB 5HF6A 3D3NA 2WFLA 1C7JA 5F4ZA 3EBLA 1JFRA 1UOOA 1J07A 4DSAA 5AKIA 1GZ7A 4M0MA 5LKRA 5AICA 5ALYA 1ZI9A 4X93A 1MAAA 1CUHA 3QZUA 4E15A 3G02A 3WKBA 3ZLVA 2H7CA 2QXTA 1QIMA 3FAKA 4UBLA 5HK9A 4H7KA 4EY8A 2HM7A 5AM4A 4QDXA 5CH5A 2PU5A 1CVLA 3HABA 2PSDA 3U0VA 1JMYA 3YASA 2UZ0A 5JYCA 2O7RA 3D2CA 5A7HA 3TEJA 1AQLA 4EUSA 4QWMA 5CRIA 4WFJA 3L1IA 4F60A 2I3ZA 5E4JA 3I2JA 4DMCA 1XQXA 4Y9SA 1CUBA 2HA7A 4B0OA 2QUBA 4U2FA 1EI9A 3JWEA 1QTIA 2GYVA 3WWEA 3R41A 3IULA 1UOPA 1Q0RA 3BJMA 4B82A 3F67A 4U2CA 4I3FA 2E3JA 3H1AA 1K6EA 4XX1A 2HFJA 5SYNA 4UBMA 2X8BA 1R9MA 3M81A 1YAHA 4BE4A 2Y1KA 5ALOA 2OG1A 4ZV7A 4UBKA 3T4UA 1CUDA 1QIIA 4KJXA 1UK6A 1T2NA 3AUKA 5DJ5A 3DEAA 3VDXA 1GPLA 1AZWA 3LS2A 3WMRA 2XUIA 5ALRA 4K6GA 3KD2A 2DQYA 1XZKA 1QGED 1VZ2A 2IX9A 2JGFA 2XB6A 3AZOA 1EVQA
chains in the Genus database with same CATH superfamily
1SGWA 1YJAA 3NHYA 3OX1A 4HDCA 1UJ5A 1YUNA 1GARA 3FI0A 4MP8A 3EZNA 1H93A 1NN1A 1LDYA 2JAHA 4OP3A 4RD2A 5H4HA 3SHOA 1NAIA 4ENPA 1RVV1 2XUAA 4IJ6A 4J9UE 5AO9A 3U26A 1L7DA 2V6BA 1NJGA 2Y4OA 3CURA 2AC7A 2P9BA 1Q1EA 3VR6H 3WMFA 1YRHA 3AUUA 1JAHA 3FJ1A 3WDSA 1OI2A 3M83A 4QDJA 4BQSA 1R8XA 3C3WA 3ZWOA 3Q6NA 3MTGA 4WAUA 1H4VB 3SBOA 1VYUA 3UB3A 4PNPA 2B4RO 3CNHA 3PS9A 2XSZA 3D3JA 1GVNB 1CYDA 4BXOB 4G5HA 1E9DA 1OPXA 4OLJA 4DARA 2BH2A 1NJ8A 3TPZA 4NIMA 3RIXA 8LDHA 2OCAA 5JJLA 2P2DA 2ECPA 1KEVA 1EQ2A 1KK1A 3DCIA 2PMEA 1F3LA 1Y6JA 5YASA 3HZRA 1IWBB 1OTHA 4JIMA 1G3RA 3EGCA 3ILSA 3EAFA 2XA9A 3VO9A 4QUBA 1P0FA 3A4MA 2HJSA 1TFRA 1HDZA 1GN8A 1PNTA 3T5AA 4BFCA 5D51S 2G9UA 3ZXYA 2G67A 2IE8A 3G5AA 2GCGA 1W36D 3WYEA 3NAZA 5H59A 1ZI6A 1HKUA 5DBFA 4HSEA 3DOOA 3N2KA 3SE7A 1COZA 4W8HA 2DKNA 3GLRA 2ZB2A 3ONNA 2XEXA 4MK4A 3KTOA 4YIHA 2XZLA 3ABOB 4Q6BA 4LEIA 5TPWA 3G2MA 4KRGA 2EBWA 2ZSHA 1CG6A 3TFQA 3G79A 1YTUA 3RS4A 3WDMA 1U9IA 2UV8A 5C5EA 4V3BA 1F60A 4RGYA 4YUZA 2CNWA 3T4EA 3ECCA 3IE1A 1TZBA 4P08A 1C4XA 2VBCA 2GESA 3WKCA 4B48A 5GZ3A 5KDOA 1JHVA 5EMNA 4EL0A 4EENA 1W7AA 4O5OA 3TL2A 3VDNB 1XN1A 1OAOA 2Y6UA 3GPIA 2J0UB 3JAKB 4HWSA 4B32A 5D86A 3CEMA 5CHYA 2PZMA 3CF2A 3E82A 5K4HA 3ET4A 4HGPA 4D41A 3G5TA 1B6SA 5JXIA 3SKXA 4PBSA 2RGDA 4OHPA 1NKVA 2GYUA 3KAPA 4OTZA 5CCDA 3RYHA 3UO8B 2JGLA 3V8MA 3VXKA 2FPLA 4GX0A 5IN5A 3K09C 1I4LD 1VIVA 4C43A 2CNNA 4I1RA 2ZBGA 4X64B 1IXZA 1J90A 3U3JA 3U4GA 1T6XA 1T9BA 5GGXA 4R1MA 4NPAA 4JJAA 1T0HB 1N5RA 3IB6A 3I45A 3OPMA 1OLUB 3LPLA 2V1XA 1WXEA 2PGOA 1OY1A 3FB1A 3HCFA 2I29A 2YWEA 3FSJX 1M2KA 3ORQA 4JUCA 4MIYA 4PXSA 5JMPA 2IV2X 3SS8A 1XYYA 2J3JA 3KG2A 3N0TA 4NY1A 4QOIA 4I5GA 2DTEA 1SKUA 3I72A 1X7HA 1QVVA 3ENNA 5AHXA 3KQHA 4Q5IA 4XIIA 1NE2A 4BCDA 7REQB 1RLJA 4J8PA 4ZCQA 5FLXA 4U3JB 2DFVA 4L50A 1Y4UA 4C1NA 4KLCA 1XJQA 4KX3A 5EPEA 1NXPA 2D74A 2V9ZA 3QI2A 3SC2B 4CF7A 2HHAA 5H4GA 2OLJA 3C24A 3L5KA 3P1JA 3MIIA 4DANA 3G6KA 3CX3A 1ZRNA 1SELA 2JAWA 1Y1KE 2XRMA 3OEHD 2R1VA 2WG1A 1MC8A 1GKYA 1TQ4A 2ZP1A 1XIVA 3JQ9A 2OAGA 2QGZA 4FONA 4ZAWA 2Q7DA 3DMGA 1XLVA 4FN5A 1VA4A 3C7TA 1CUWA 2FP4B 1P0QA 3LHDA 5LQUA 3TAHA 2VHVA 4LHSA 3NONA 1CJBA 2FHSA 2FQ1A 2VPQA 1WDWB 5AI4A 4A0SA 3CU5A 4FOPA 4BLQA 5ITWA 4R0NA 4BV2A 4GBJA 2YWHA 4C0HA 2AI1A 1TUBA 1V3TA 4M1TA 4I36A 4O33A 4H2DA 2XVMA 1NI3A 4JIGA 4F86A 3KQSA 4ZK2A 1Z6YA 3JASB 4AMYA 2GNOA 1FDSA 4FFDA 4I5FA 3UK2A 5KNBH 4L9AA 1JDVA 4QL3A 2W90A 1FMJA 5JI2E 1LJUA 4B3MB 1Z33A 2W2XA 5IJZA 1J1UA 2C9BA 1HDIA 1MTZA 3KBOA 3L2OB 3OICA 4R16A 3ZWCA 2Q21A 1TLTA 2I4RA 3AKEA 4U7JA 2Q46A 2PJZA 2Z4RA 1I4OA 3W6UA 3R9XA 5U1PA 3CRNA 4N65A 4X1KA 3TI9A 3H75A 2OHGA 2PVSA 3I9NA 3EEBA 1L2TA 5CX1B 2NUTA 3O47A 5HSGA 5FUQA 4QO7A 4IXWA 1AA6A 5A1JA 4D8WA 4B7CA 3MWDB 4Z4QA 2MSLA 1AS0A 1D8AA 1YZYA 3N0VA 4IAOA 3HS3A 3ELWA 4OJYA 3VVLA 1A7AA 3PEWA 2ZDQA 1WMSA 2XADA 1KIFA 2J3EA 4KEAA 1E6MA 1RSZA 3L18A 1KHTA 5DLEA 4CT4B 4DFDA 2WNSA 4EZIA 3BWYA 4PRZA 2IHTA 3IMFA 4UHCA 1T9HA 4EPTA 1RHQA 4XPIB 3TKYA 4ETNA 4CIAA 2UUCB 1T3HA 1ZH8A 1J2TA 1E5LA 2QX6A 4K9MA 5CM2Z 4KOAA 2B98A 3EYWA 3VSCA 5LN1A 2ZS9A 2D06A 1JRLA 5IC4A 1HQDA 1Y4SA 3AOGA 3QKUA 3REOA 4YMVA 3CF0A 4G56A 2JFXA 1QHEA 4II3A 4L5AA 4ND2A 5CX4A 5G02A 2ZJZA 4PN7A 2JJ2D 2F2TA 4DDUA 2REQB 4KXFB 1PDVA 2G1JA 4PG4A 1ZKDA 4Y2PA 1BEZA 4D45A 1L7AA 4D4GA 3WAJA 5D6NA 3R7AA 4DLVA 4ZA2A 3HKDB 3CN7A 4N03A 4R7ZA 3ZHYA 3TPCA 2IZ6A 2N3ZA 1I1QB 2FSVC 3KEGA 3PT9A 3SQWA 5NLLA 2GI4A 2J9GA 1KEPA 1NMYA 5TGTA 3CNOA 2JEYA 1G64A 3LY5A 1UDRA 3NGLA 3MD0A 1C50A 3VU9B 4DMFA 1YCDA 4LXTA 3UM9A 1ZZEA 1IEWA 4DIBA 3Q8KA 2J0SA 4FIDA 1LBQA 4CKBB 4B2PA 3NBZC 2OCDA 2AJDA 2BC9A 2HMUA 3HA7A 4OMUA 1RYZA 3JYOA 5SY9A 3ND6A 5AKYA 3IUBA 2Q2VA 2C98A 4RSRA 3U7FB 1PV4A 2AHOA 4JEIA 1PZXA 2QVLA 5FLEX 1GUFA 3L1UA 2XYPA 5FUWA 2XMBA 2XUKA 4OFZA 3K9FC 1CE8B 2DR0A 3DZ8A 2X9GA 1N6RA 3EEIA 1Z4MA 4G09A 4KSBA 4OYRA 2ZUBA 3WRYC 5EIAA 3G9QA 1T9CA 1UDXA 2QVYX 2XNSA 1JG4A 1KI1A 5F7XA 2XUQA 5CEEA 2GEKA 3HZHA 1PUJA 5HKAA 4BJ3A 5F9FA 4TV8F 4P92A 2AR9A 2YS7A 4UM8B 2NADA 1FVOA 1PJLA 2J0EA 2VAVA 1X7GA 5G0VA 3SOPA 4CQLB 1GCGA 1YI1A 1BOFA 5CA1F 1MX5A 4D5GA 5LP6B 1NONA 3AHDA 4JB3A 3DR5A 1ZK4A 4U39A 4XEUA 4CEHA 1LD3A 4O63O 3SIRA 1X7XB 1N9GB 5C8VA 2AMVA 2BUAA 6Q21A 3P0RA 3L7IA 4TLAA 2F59A 1ZSVA 4F8JA 4TTQA 1FFCA 4UD2A 1ECFA 4WXPA 1JJFA 5G0UA 4UE2A 4XA8A 5BSUA 2HIMA 1OH5A 1PBNA 3CT6A 3AFMA 2AQIA 3UY4A 4W5RA 5A4DA 4JQZA 4N5LA 3T52A 1XFAA 4ZCTA 4TLBA 2AMJA 5T7BA 2CLLB 3STYA 2YXEA 4JC4A 1UBLS 5MF6A 2ZVQX 3QBDA 2VFAA 2VT2A 1F4LA 2GA9A 4AKTA 1IEXA 4G67A 1ORTA 2GXUA 1EFVA 4CMBA 4K6KA 2H2DA 3MTBA 2P9JA 5ITZA 3FCUB 3C85A 2GHQA 3OMWA 2D8MA 4LYDA 4ZVVA 3UXEA 3TUIC 1G55A 1RRCA 2H9AA 1GCOA 2Z8ZA 4N54A 4XUCA 1RZRD 3B36A 3G0HA 2PZBA 2OBBA 3L8YA 3UAWA 4J0EA 3I64A 3ZHZA 4DEVA 4B3DA 1AQYA 4HQOA 2C5FA 1VL1A 4PFJA 2AFIA 1TA9A 2VXBA 3DBRB 4OBEA 1RQXA 5EP1A 3TW4A 4IDNA 3UV7A 5I01A 2V98A 4PC6A 2FPIA 3A8TA 4RW0A 3H1BA 4NXMB 4AJPA 2H2HA 2O2JA 4QOEA 1UJ4A 3UC5A 4DQKA 1E58A 1VL2A 4DYHA 1YZ3A 4YWJA 2HJHA 4FINA 3W05A 1QO0A 2ONYA 3EMVA 4FVTA 1XNGA 1I4EB 2QWXA 4QDKA 4YAIA 3RS3A 1I4TD 1I0IA 1N75A 1OW3B 3PX2A 4GBMA 4IRUB 3UA3A 5JDCA 3MW8A 1GGHA 1KSGA 5K6AA 1BOOA 3JARA 2NVOA 2VXOA 4QPJC 3RUFA 2P3SA 4EABA 2GKGA 4P38A 4CV2A 1F2DA 1GL6A 2QYHA 4X91A 1ZRMA 3EDYA 3V1MA 3OKFA 1SCJA 4II7A 3RC8A 3PX7A 3FA2A 4V1CI 2PS0A 1H9BA 3IIIA 3E7XA 2Q0XA 3CC8A 1DDIA 4EY5A 2YN2A 2IXGA 2IEYA 1D5WA 4U6SA 1GUAA 4PC1A 1CY4A 3HO8A 3LQQA 4ILEA 2W2KA 3IHLA 5DB4A 4D26A 5KWJA 3C3EA 5FO0A 4WK0B 3VSBA 1OR8A 2O2YA 4M2LA 1DKMA 4Q39A 4RBNA 2NO6A 1GNSA 2C5SA 2QPOA 2IPNA 1P4AA 2WT8A 4WZBA 5E1MA 4ML3A 5IM5A 2OCGA 2QTVA 3OIFA 4XCVA 3WLAA 4AG6A 5T4FA 4U7FA 2BM1A 4I4CA 3HNRA 2VTBB 1J7KA 1VKOA 3A2LA 1FFBA 3B38A 3C87A 4PIVA 2J9XB 5TSDA 4DZTA 3IQFA 1OZHA 1RWVA 2F90A 3HPQA 3NCTA 5K0FA 1F12A 2H4JA 2VNIA 4Q4AA 4BNJA 1WHTA 2BFEA 3CH5A 3CHYA 1N7JA 4G4IA 5LQSA 4DV2B 4TUYF 3K20A 4YJKA 4ZPJA 4L0CA 3P52A 4FT2A 3QKTA 1R8YA 4QTTB 1JXOA 1ZS9A 3NIDB 3OURA 4GEGA 3DD5A 3SVTA 1SIBE 1KDPA 4RV4A 2J6IA 2OWEA 5ALFA 5F5XA 4UNNA 4JT9A 1XELA 2OPBA 4HADA 3R7WA 4PGGA 5EKTA 1I01A 5G4KA 2GN4A 2VHJA 3KSAC 4M22A 3V4PB 3QX7A 4FGZA 1T5BA 3AEUA 5A3QA 1RCFA 3WLEA 1LFAA 4DVJA 2O6LA 4CQNA 2XBLA 3DWGA 1BHJA 1W5BA 3G0IA 3LCCA 4X1YB 4AQ7A 3M5PA 5JWHA 1I2DA 2V74B 4CGYA 3K30A 3GFOA 3MHPA 5FWNA 3QVMA 4HH3C 3WP1B 4EG4A 4NENB 1G5RA 1NJ1A 4FE7A 4OA5A 4GGMX 5DBOA 3W8FA 5GADl 2PJDA 1M8KA 1TJNA 3RHZA 3M4YA 4ZT7A 1E94E 2H3EA 4I9NA 3IKVA 4G63A 4LBYA 4CPDA 3KQKA 3DEFA 2WPNA 2OESA 4OBBA 2QZSA 4PQGA 4CN9A 4JOQA 2ZVJA 3AWDA 2QEQA 1PZNA 3N6VA 4HWTA 3GPDG 2JNWA 4H3SA 1ITZA 2XGOA 2ZIXB 4LSMA 4LMRA 1D4ZA 1HLPA 1G7RA 5EPUA 1TK2A 1XTUA 1KA9H 2FE1A 2WQZA 3NIBA 3LOPA 2X22A 4HFMA 4PQYA 5L4LA 3T5TA 2PLFA 2VEDA 3PEEA 1T4BA 1WJGA 5IEJA 1ICEA 5EESA 2DCMA 4RX1A 4AC9A 4UXHA 5EG5A 3FUCA 2BMAA 1AQIA 3CZ5A 2V4UA 3ZZUA 3FKSA 1ENPA 2BF7A 3DDUA 1R8JA 1XL1A 4QSMA 4TSRA 1E2QA 4XIYA 4XWAA 4FFRA 4XTCS 3ZYZA 2BISA 3CXUA 3DMTC 4IZIA 3L41A 3TQHA 1P2GA 2DLNA 3TLKA 4DBLC 2BLLA 5CFLA 3HM2A 4QBFA 3I1FA 4UUOA 5E6SB 5JO9A 3JVDA 1U7UA 3SKYA 5A5EA 3KD3A 4UTZA 3JS5A 4XYBA 3D6TB 3D4LA 6YASA 3EUAA 3DLCA 3UFBA 3G0GA 3HHPA 1G20E 2AKEA 3KFXA 4Q05A 1YQTA 2CXPA 1CVRA 5IANA 3FTCA 3HMKA 4ZO9A 1J0DA 2V7VA 3C3MA 4MEJA 3AVYA 3RS0A 1PVVA 1U4OA 2CL0X 1UKEA 1RM3A 4GBED 2QV0A 5AXAA 2BHLA 3O83A 3H17A 1J4AA 2KX7A 4LE2A 4DA9A 4E12A 3HY6A 2AEJA 1IFXA 1QQ7A 3OJLA 2AVDA 2CCJA 2NXJA 2DAPA 1CK4A 3DBHB 2YMQA 1VBMA 1H1LB 3EVEA 3O9ZA 3D6JA 4FFNA 3TR0A 3TZKA 4X71A 4A03A 2B21A 1AKUA 2OEPA 3DOHA 1PSDA 4PZCA 1THZA 2HQSA 4E33A 2WD7B 4C06A 2DFPA 3JAKA 2R6JA 4HDRB 4UEJA 4NCHA 3LLMA 3IUPA 1CP3A 2QP9X 4PLHA 3HV0A 4OFBA 4DV1B 3EH2A 3LA6A 2ZJFA 2JHFA 3CCCA 4BU0A 1T6ZA 3S40A 3KETA 1OKKD 3FDZA 3GFQA 4GX5A 3B20A 3ADOA 2JFFA 3EF1A 1IEQA 4KUEA 3GY0A 4BVHA 1AZSC 3TG8A 3AYXB 2OYSA 3QXJA 4RHUA 2I2BA 3AONB 5HS4A 4OI4A 1S02A 1E1KA 4AULA 5TF4A 1E20A 1OLUA 1JKFA 1VI2A 3D8BA 5H9WA 1AS2A 4PZZA 3GEPA 2CNOA 2ZQYA 4IHJF 4LSZA 2OXFA 4QDUA 1SD2A 2Y1DA 5LJIA 1XZQA 1P3DA 3IVMA 2JH3A 1FB5A 1NFRA 4GPD1 4LZJA 4PXAA 4BNTA 1GTJ1 2PX8A 4URYR 2FSUA 4MMYB 4JK3A 5K3AA 1EFTA 3WA6A 3MS4A 3E9YA 1IHUA 4NK4A 1GTRA 4W1RA 1WQ4A 1YV9A 2IUEA 4FEGA 3TJZA 5IF3A 4LHZA 2I8AA 3SC2A 2AMLA 3VR5A 1RKUA 4I1IA 3H2GA 3VZCA 4J90A 1BC5A 2O1SA 4JYPA 1HL7A 1X9IA 1B6GA 2C3YA 3DYBA 4DS3A 2HA4A 1JLRA 2R84A 5TEVA 1EFPA 4XOUA 3UK7A 1P8JA 2L82A 4N7JA 2P5UA 1CU1A 3V8EA 3FDFA 3VNBA 3F7TA 4LYGA 4D8UA 5K6RA 3SHFA 1NW4A 2IPMA 3H4IA 1I6LA 2V7PA 3DEKA 3Q11A 1DG9A 3L4BA 5IT4A 2JGDB 5JO0A 3THWB 1SD5A 2V65A 3GJZA 4JVMA 2IPOA 3O4JA 5IAOA 4QBKA 1M1YE 5ICSA 3FWHA 2CXXA 4EMTA 4YRSA 2YOGA 3GN1A 3I8OA 1MQSA 3GCDA 3VOAA 4BPRA 4FDLA 2J87A 1FE8A 4D4HA 3DZGA 4MWEA 3SN6A 13PKA 2B9EA 3D5EA 1G18A 1LX7A 4NNPA 5SZJA 2CKMA 4MUFA 3WIDA 5I5GA 2BGGA 2BBTA 1QS0B 1ZSNA 1JSXA 2AV6A 2XUJA 2ZB4A 3FVTA 3JASA 4IDAA 1JEQB 2ZVPX 4WHMA 4C88A 1D2NA 4HYQA 4BO4A 5KX5F 1GPDG 2B34A 4MYCA 1E77A 1HDEA 3EG9B 2W0SA 4GVPA 4Q7QA 3F46A 5DYNA 3FYDA 4DYVA 1VE7A 1SUFA 2LUOA 3JQBA 3IHWA 4DNQA 4J16A 4ZOLB 2QG4A 2N1BA 4E46A 4ZCMA 4J94A 4CCYB 2REXB 4R9VA 2W11A 4ESHA 4CETA 1Y81A 1M1XB 1D1QA 1Z6QA 2YYAA 3IVCA 1WVGA 1DEKA 4P36A 3G49A 3ND7A 2UYGA 2ZXFA 4KDCA 4RPIA 4M7RA 4U9IS 3ZX4A 4XYLA 3N8IA 5C5CA 3FSGA 2JLUA 5CX1A 1RYFA 4P7JA 4A4DA 2JRCA 4CMGA 1XZ8A 4EA8A 3UJ3X 3RSLA 4N01A 1ZH2A 3FCCA 5EC8A 2YBDA 3MS7A 1GP2A 4WKBA 1AQJA 3RSHA 3L1VA 1IMJA 4MUYA 4RAQA 4QXRA 2J6BA 4XPIA 4JP1A 4KQEA 4R2XA 4E7PA 1TUEA 4FCVA 1HSZA 2GDZA 2JFPA 2ZJ2A 2XYRA 1A2KC 5HRUA 4KFCA 3UANA 1PT5A 2EQBA 3O8OB 3R5XA 2YVKA 1KQOA 1PS8A 2O2CA 3MUEA 3QEJA 4LGCA 5CK4A 1WXQA 4LPKA 1G60A 1H6DA 1LW6E 4IDCA 4G9EA 4X6UA 4N9WA 1SKQA 1FJGB 2REQA 3O90A 3SEQA 4QQFA 4BAZA 5BN5A 2SBTA 1BGXT 4YCAA 3PDUA 1YI8A 2GAJA 4R2IA 4DOMA 3HKDA 2JAXA 5EQFA 2V7TA 2BRUC 1SQ0A 1JEDA 4EW6A 2M2IA 1BH2A 1T0JB 1UK9A 3K5PA 2LTAA 5LDGA 4UBOA 3VU9A 4GX2A 5CYOA 5BQ5A 3HG7A 1F20A 4H31A 1K1EA 3JZMA 5EZQA 5FBQB 4IGIA 3DTTA 3ZQ6A 4M1YA 3I76A 3MBOA 4ZRDA 3ZX5A 4CMHA 4XSVA 4QASA 2P35A 4TN5A 1GKIA 1V6SA 2FA9A 4MYUA 1E9BA 2IXDA 5LXTB 1KFEB 3T06B 1E7MA 3IMCA 1F17A 2QR2A 3A6KA 1CE8A 3PICA 4DQXA 4W5QA 3VJLA 3VR6A 1LX6A 4JBYA 2RHWA 1M8JA 4RHXA 5CNJA 4YUVA 1ENYA 4P3KA 3K70D 5KOJB 4RF2A 2LPMA 3WYNA 3LRXA 5CFMA 1FTYA 1U0JA 1U6IA 1IVNA 2ID8A 5D85A 1FA9A 4BN5A 1PZMA 3II6X 2IH5A 1PFVA 3DWEX 4KYTA 4EQ6B 1X0VA 5GY7A 5ALKA 3DL0A 5M5BA 2ATVA 2BMJA 3MC1A 1F2UB 2QRQA 1EFLA 4XDGA 3F6SA 2ZAGA 4QU8A 3IJEB 2MIIA 4TV8B 1XWFA 3HV2A 1N9GA 1PJ8A 2Z8YA 1S3GA 5TR9A 1KS9A 3WGHA 5LKAA 4HX5A 2QROA 5CA1B 3QX8A 1O5TA 4C7MA 1EESA 1T3SA 3O9MA 4KZKA 2PKWA 2D2IA 2LIPA 4PSUA 1GQQA 5CG2A 4DUGD 4YV7A 1E6CA 4HAZA 2MOKA 2I03A 5A9RA 3RQSA 1NP6A 2YINC 3E1KA 1YBMA 5EKDA 4LNHA 4IJUA 1ZP6A 1EQAA 1DTSA 3RFTA 2RGBA 1ADCA 3FNIA 5ICGA 1ZN7A 5I4CA 1AQ6A 3N05A 2MCFA 3D2BA 4EI2A 3LKDA 1KO7A 4AP6A 4R1PA 2PO5A 1HO3A 4W7HA 1GAJA 3HA3A 1J7JA 3SD7A 1ILEA 4GYKA 3G2IA 1MA3A 1XCOA 4RE6A 1H05A 3Q7QA 2A59A 2PQ0A 1DXOA 2P3OA 4GMFA 1NTRA 4JEMA 1TQ8A 3SY8A 5CTJA 3WRXC 2EW1A 3KZVA 3MT9A 8ADHA 4Y18A 1PLJA 2UVDA 5K45A 4JT2A 2MINB 1T25A 1W48A 1TTPB 2WF5A 3OCYA 5HPYB 3TG2A 3G2QA 1EX7A 3X44A 1UINA 2AWOA 5LCXA 3UTCA 1M2JA 3CCBA 1X39A 3ASVA 1WD5A 4PWYA 3KKLA 3DULA 2GCOA 3FGOA 1G5TA 4FILA 2CHQA 7AT1A 2BAGA 5EGNA 1GA4A 1XLUA 2WOOA 3EODA 2JI4A 5C3MA 5JECA 3I05A 4H0NA 1EM8B 3ZYCA 3NGMA 1V16B 4BGVA 3UW1A 3UUEA 1V6AA 3WTBA 1YA8A 2R8YA 3PFHA 1W19A 4GKBA 4K9NA 4PF1A 1LTKA 2DHRA 2HCFA 2UXDB 2PU7A 4BO8A 3L8CA 2X3UA 4WIAA 1XRQA 4UFNA 3M82A 3ITDA 3TDKA 1TYBE 1G8JA 3CVOA 2JLZA 3TEFA 1T8WA 2Q1SA 2WTAA 1W8IA 1A69A 3IJPA 3KHSA 5DW0A 3KPWA 1N78A 4DA7A 2GCPA 2P62A 4N5IX 1AO3A 1LS1A 2ACEA 4V24A 1KH1A 5C1DA 2HSGA 1U3GA 2ZJBA 3SC4A 1NBHA 3AETA 3DAPA 5JNTA 3L8HA 4CG1A 4EHFA 2HLDD 5BOVA 1AKEA 3GLQA 1IZ8A 4IG9A 2PKQP 4ZVUA 2VTBA 2ZRJA 1QH1B 2QG9A 5FWYB 2PSFA 2PSJA 3K7EA 3MELA 3PFCA 3V1KA 3VZRA 4CM9A 2OBMA 3CTMA 1U1GA 3AVPA 5G3YA 3VYUB 1HT3A 1GNQA 1RXEA 2GUWA 4B3FX 1P17A 1E18A 1E2NA 3CJQA 4OBWA 1G6KA 3EN0A 1SURA 1IWOA 4CIXA 3SSOA 4KNWA 4KSCA 5LLTA 4EJ2A 1W2HA 4ZIRB 2ONJA 1DXYA 1JV2B 1Y33E 4MH0R 4NSNA 1DKPA 5KMGA 5ALMA 1NUQA 1WWKA 2NU6A 5GP1A 3ZJ4A 2FN4A 2MMGA 3HYTA 1DX9A 2Z2KA 3BUSA 4NKRA 4TUYB 4WN9A 3WR5A 5FI3A 3OTOB 5JSUA 2OBFA 1T26A 5PGMA 3CUTA 3HCOA 3P9IA 2WTUA 1S3SA 5LQAA 1GR0A 1KO4A 5HDBB 3AFGA 5DIFA 2C57A 3Q8MA 3UICA 1ZISA 2VQ3A 2H5LA 4E6PA 1U94A 4EW2A 1SD1A 4XJXA 1HA3A 1OU0A 3KOWA 3K05A 4EYQA 1JLHA 3ABSB 4JJFA 4X1YA 3UAYA 3RVRA 3IQXA 1BHSA 4HGZA 5HKLA 4KJZA 4AZTA 1VIAA 1PVDA 3F74A 1J6UA 3R3SA 2P4HX 4NENA 4BQEA 2WZCA 4KIWA 1S7GA 3EPHA 1HG1A 2BF4A 3GB9A 2JLCA 3PQDA 4ZK6A 2PPVA 3OZRA 2ISQA 2NV6A 2GILA 4AQYB 5EJFA 1DAGA 4RGBA 2P9CA 4R8MA 1QPBA 3H5AA 3B3JA 3HKCB 3T7JA 3ICQB 2QLMA 3B5IA 3LBNA 4DEYA 3LT0A 3QPBA 1HOXA 3FN4A 5COAA 4ZVRA 3ZY3A 5JS6A 3K6KA 2ZIXA 1JA1A 1RQLA 1E3IA 3QYJA 3RG8A 3NDIA 2X0RA 2QQ0A 2ID9A 3AI2A 1Y80A 2G8NA 4ZAYA 1E1CB 2KM1A 1FXUA 3GEGA 2XRZA 4IF6A 2XMSA 4HAUA 4NH4A 2F7SA 1OBOA 4H15A 4PPGA 1BCSA 3D0RA 1O58A 3D8SA 4HNUA 3QXCA 1M0EA 4RH1A 5BN3B 1C29B 1Y4DE 5IF9A 1YVEI 4F4DA 4JI4B 3GXBA 3BBLA 3MUNA 4PRYA 4QAJA 5JCJA 5CGZA 3VFDA 3INGA 3DDHA 1T1EA 4MWCA 3RLFA 3AR6A 1M75A 2PMFA 1NW8A 1ZIPA 3K09A 1V7CA 1L5LA 1LLUA 4N0DA 3O8CA 1E0KA 3GAAA 3I01M 4J03A 3P9CA 2QN7A 1BD4A 2C2MA 1VHLA 2HMAA 5BSTA 4QM7A 4JBLA 4YONB 4OI2A 3GLFB 4A0QA 1Z15A 4R2JA 5EXXA 3S5UA 4F71A 2PD4A 1HQKA 3PLRA 4MAAA 1DEAA 2Z58A 4XE5A 3UMRA 3UH1A 3UMBA 4J0JA 1H1LA 3FOCA 2ESRA 3IPAA 16PKA 3T4XA 3ZK8A 2QLNA 2P0EA 4X8MA 1ISPA 1KR5A 1RXCA 1S8NA 3HU3A 4UVHA 4ZU1X 4YMLA 4QJBA 2GTIA 2V7UA 2PD3A 2Z6VA 5JVDF 1MJGM 4ITRC 4NMMA 1M6EX 5T41A 3ZZ1A 1KVTA 3IV7A 2VJLA 3IOEA 3ZK7A 4BOYA 3K1ZA 4JQSA 4RY9A 4MPTA 5ER9A 2YJZA 4XKJA 4A6EA 2Q1YA 1T4GA 1JHUA 2WHRA 4D80A 4EBBA 1TM2A 1YZVA 2AYXA 1Y3DE 2G0NA 2ZI6A 3K8YA 1U04A 4H0FA 2BFMA 5CB4F 5GINE 2H54A 1TZCA 4OLHA 5ALJA 3JSXA 1XEXA 1ZGBA 2Q6LA 3FETA 3KVVA 4IMPA 2HYDA 1GSAA 4LRQA 2GETA 5AJHA 1DJPA 5K0CA 5REQA 4DDHA 1L9XA 1U3FA 2DVMA 4ARVA 2PH5A 4EHBA 3PF9A 4C3ZA 1N2IA 4EMBA 3RVMA 1RR6A 1F6DA 4YAJA 1B42A 2HL6A 3HP7A 1CEEA 2CVFA 4KVGA 3Q4GA 1NOKA 2NTEA 4F2HA 1XZNA 2CFTA 3HUUA 1TC1A 1U2DA 4RETA 3F9IA 2OV3A 2WTXA 4UUQA 1DAIA 2FTKE 4OGFA 4DV6B 1J22A 4YDSA 3JAWA 3NV9A 2NP6A 1A96A 2YYSA 1JFFB 1SVUA 1AMUA 3DF9A 3E4CA 3Q2KA 1DC6A 1MC1A 3I5AA 4CCWA 1ESCA 2PMDA 2D1SA 3BFPA 4GHWA 1YS1X 4HLUC 5JNWA 3N7AA 4QVIA 4CE6A 3BCHA 3PC6A 3CE9A 3I04M 4HNVA 3THWA 2IITA 1EINA 4CM6A 1HYQA 1RYMA 5LQNA 2CYAA 2J4CA 2XCQA 4B85A 1DADA 5IDVA 1LSUA 4DMMA 1FFXA 1JTVA 2X4GA 3FBWA 5KU7A 1L7XA 4A2WA 3CZRA 1R6TA 5ETJA 2XYQA 1E1QA 2FMFA 4UOZA 4B8WA 2IYOA 3MMXA 3G7SA 4TZ0A 4IUCS 1DFGA 2YWRA 4OXRA 1OI4A 1XJWA 1QS0A 1KZ9A 1BQ4A 3BCSA 5A71A 4E2WA 5JH7A 1SUDA 2HYIC 1FRQA 4EB6B 1TEHA 1SUCA 4KWEA 1GPH1 3KR1A 1MJFA 3GMDA 2V3VA 1MO4A 3JZFA 4P31A 3ZE9A 5KX5B 4ZOLA 2IZ7A 1N77A 1V5FA 3TMAA 1L7PA 1RHRA 2GZSA 3ZLUA 2HZ7A 3DHNA 3OWOA 1ZVMA 4YO8A 1EDEA 1P7VA 2G4LA 1EP9A 1NDUA 1UDCA 2SECE 3WB2A 1ADBA 1IIRA 2WM3A 4IINA 4AICA 1TRKA 2OZEA 4KR2A 1J70A 1B1CA 1EMDA 3CNNA 3HCDA 1IBRA 2QAGC 4WBNB 1A8IA 2OL4A 1OH6A 4ZMRA 3DWIA 4EW3A 3PDCA 4EZEA 4F92B 1SFRA 1VJCA 1SUPA 2B30A 2R9VA 4UUMA 4Y6PA 1X1QA 1DC7A 1X1BA 2LR0A 3BTOA 1SHZA 2CJYA 1USGA 3AG5A 3F1KA 1ABBA 2YHBA 2Z1NA 2VZEA 4YQYA 2VHCA 1XF9A 2Q0QA 1UJ6A 4BX8A 2FWAA 3S8YA 1CZRA 2CB9A 3HJNA 4MRMB 4Y2VA 1LQ2A 3VPDA 4YCSA 4KR9A 2BHTA 3O8OA 3P2IA 4HSGA 4J0QA 3HL0A 1HEIA 3F71A 2RFLA 5K20A 1GEEA 2APJA 2PVPA 4ER6A 5J1SB 2WP8J 1HNWB 3AUYA 1NBIA 4KGDA 3KSUA 1XPRA 1BGVA 1QTNA 3AZQA 1U6KA 1XQWA 5HJEA 1U8YA 3AC0A 4Y3UA 1Q1BA 1G66A 1P62B 3ZHQA 3FNHA 3D4IA 1M73E 3MJ4A 4NZNA 4XJSA 1I3KA 2JFZA 4P53A 4NH0A 1R6DA 4MDEA 4GGOA 3H6KA 4LJRA 2AN9A 2Q3MA 3FLBA 3C7AA 4AZ0A 2DERA 3U3MA 3ZCQA 4L4ZA 3JQ7B 1VP9A 2YWGA 3AF3A 4AJ9A 1WD7A 2HT1A 1R5OA 3WIEA 3KHKA 4NNOA 3HA2A 5F7JA 5LMUB 1W44A 2PL1A 2WZBA 2QLLA 3GJYA 3AOEC 3QUAA 4YQFA 5LXTA 5HUJA 3A6PC 4Q9NA 2NVUB 3EZLA 4CEIB 1NM5C 1Y7IA 1JFVA 1DFIA 3H2IA 4OV6B 4TQ9A 1IQPA 3OA0A 5JBNA 4OHMA 2PLWA 4KXMA 4EYGA 2XYGA 2PL9A 4WNCA 2XZPA 1YKSA 4HNSA 1G5FA 2R6GA 4MARA 4ER0A 5IX8A 5AD1A 1T5HX 1F5SA 1HZZA 2WVAA 5HJ7A 4PQEA 3VI3B 5KKCA 4DIOA 1V5GA 3VNVA 2GX6A 4EQ6A 3OU7A 1RJWA 4G4SP 2NO1A 3TGPA 4INAA 5AXCA 4ZJUA 1O4VA 3M6FA 1MEEA 5EIBD 3A6DA 1F2UA 5BR8B 3D6HA 5EIWA 4TV8A 1CRPA 2Y1WA 4HNAA 5BSWA 3CLRC 2O8FB 3ZHBA 3AFHA 3NJRA 1NRWA 2HA6A 2ZRAA 5CA1A 1A97A 1KFKB 5A1TA 3PJEA 2XCSB 3EZYA 2QUAA 2CE2X 1I1OA 4HQNA 1LJLA 1ZJJA 2XV1A 4YASA 2PT5A 2CLIB 1YL7A 2QL9A 2EFEB 3WO1A 2WFZA 4BKRA 5I7SA 2PUFA 2PS1A 1EBFA 1FRVA 3GFBA 3VAZA 1C2YA 3OFVA 1E92A 2VC2B 5IEBA 3CBGA 4DLXA 1QRRA 1J0BA 5A5GA 2H1LA 4G4JA 3GUHA 3QJ5A 4NC9A 2N9UA 1PJRA 3R3ZA 1XMXA 2NMVA 4P6VF 4FHFA 4NMXB 4RVUA 1MAHA 3PR1A 5HQJA 1N1DA 4TZ6A 1OAAA 2WAYA 2DPLA 3OZGA 4MIKA 3UGKA 2AQKA 3LBHA 3W9BA 2LCQA 4TYWA 1FPQA 3PNLA 1ZVQA 3NTUA 1GRRA 1NTOA 2WPDD 4E94A 7GPBA 4MVJF 1LPMA 2OQRA 1E1RD 2HWXA 1BWRA 2WZQA 2MINA 4RZQA 3K1AB 3VDRA 3ESCA 4BMPB 5CFPA 3OEEA 2H2AA 1WVIA 1OFIA 1Y3BE 3KS9A 3V7WA 5DU2A 3KM0A 4B4OA 4DR2B 3R8FA 4G84A 2AYYA 3UB4A 2FFJA 4TRMA 3TLBA 5JT1A 1U8UA 5EXPA 3LUJA 3P4XA 3VHXB 2F1OA 2Y1GA 4QA9A 3TTXA 1W8DA 2Z5FA 3NM6B 2Q3EA 3IVGA 5H3CA 3IKMB 1U63A 1JG2A 1CIVA 3F4BA 1U2RA 3GNSA 4FS3A 3V55A 3WLPA 5JZMA 3K71B 1EM8A 1H85A 2AR0A 5EE3A 3W6OA 5IAJA 5IUKC 4INOA 1MOZA 4F6CA 3FDJA 5KNDH 1YNOA 1N3IA 2RGNA 3JYNA 4I5EA 1A71A 1JLLB 1Q3TA 4MWBA 2W98A 2BLNA 2ODWA 2WLTA 2R7LA 3CR3C 3H3JA 2IODA 4Y2XA 3RLIA 3A9SA 2RONA 2XVZA 2PDAA 1SOVA 4RF4A 1CFJA 1JX6A 1K5GA 3C39A 2JFUA 2OZKA 5B6JA 1CB7A 4QU0A 4G6ZA 3WQBA 3WFZA 2RI0A 3ZOKA 3H11A 5IAEA 4IJVA 1HNZB 2CUNA 4LXIA 1ORVA 2B36A 3EOZA 3PLNA 1EP3B 3IILA 3ST7A 1Q7CA 2OV6A 4J2OA 5K7SA 5F23A 4BQIA 4P0PB 3WFJA 2BEJA 1H22A 2YV4A 3VPFA 1C4OA 1D7OA 4G5OA 4L8WB 5FPYA 4WASA 1QH1A 1EJ0A 1PIWA 4O5AA 3W1WA 5FWYA 1JZSA 1T2AA 4N5NA 3I09A 4OU4A 4G8CA 1OSNA 1XP8A 3BB3A 3DLTA 3EASA 3VV3A 4CLDA 1GV0A 1XRRA 1ZQ9A 2G06A 2RH4A 3LF2A 2FOLA 1RAIA 4A16A 2AZXA 4JJ7A 5HGJA 1CW2B 3WSTA 1Q19A 1E1LA 3NDPA 2OR3A 2P4UA 1ZJ4A 3PDJA 4PPFA 5LWHA 2ZUEA 2H29A 2R62A 4UCWA 5AOVA 5DE3A 4CNBA 3ZIAD 3SDBA 3LFHA 3D7KA 1QP8A 2Y1FA 1Y9DA 4NBRA 4YHBA 1WF3A 1PAUA 4LQCA 4EJ0A 2PH3A 1LUAA 1Z74A 3PI6A 4RS4A 4BHTA 1VJ5A 3DOCA 4G81A 4NL4H 3H9GA 2AF3C 5T57A 2KBFA 5FWXB 3UWKA 4KG7A 2Q3JA 2ZCUA 2EKPA 1KZYC 1ML3A 2O8DA 1V25A 1UXGA 2PZLA 5ALGA 3FTFA 1PR6A 2IDJA 4LC0A 3QVJA 1A8QA 1GKKA 4INZA 1ZMBA 4RKYA 1NVMB 4E03A 2ETXA 3HNPA 1FS4A 3LFTA 5AKKA 2XUGA 3H5LA 3V1UA 5KVAA 4OI0A 4U7GA 4BMXA 2Z5VA 2L42A 2J32A 2E6KA 3K0KA 1W1IA 3ZHCA 1T6BY 3NHJA 4B3HA 4P5PA 4YP1A 2J9YB 4TYYA 1U9ZA 3QJYA 4H6VA 2G09A 3KTAB 3QJGA 3RVOA 4BQNA 5KYUB 3CF4G 1CS4C 1NMQA 2VJQA 1PFUA 2M6KA 2CLEB 4AMVA 3CIOA 5J9FA 2EAUA 2PYZA 1L5YA 3T3MB 3UGTA 4B3JA 1P7ZA 1QIGA 5DFAA 3B51X 1E1CA 1PR9A 2GYWA 1IMOA 5I9IA 2C2YA 2W6CX 1BS1A 3A27A 3FPCA 5ALZA 4WI1A 3ISJA 4X6LA 4PYOA 2WJIA 3C3BA 3PCRB 4R8VA 5JOQA 2X0DA 1R6XA 4OL0A 5KIAA 1EFCA 1CJCA 1Q5PA 1NLUA 4MHTA 1T29A 5BN3A 1Q11A 2XYVA 3F7NA 3DMDA 3QPUA 5JY1A 3FNEA 3A6EA 3ABZA 2H1IA 2WF6A 3SJZA 1R27A 3PKJA 1HE8B 1OLXB 3LP8A 2ZI5A 2EATA 2Q4DA 1UFOA 2A14A 4XIGS 1LPPA 5DCYA 1KHHA 5B5SA 2FDRA 3ZDZB 4IIXA 3KJHA 1XCMA 1IDN1 3K73O 1ZVJA 5BW8A 4OK6A 2D5LA 2Y05A 4OHFA 3TNLA 4CM1A 4YXWD 4U7TB 3LWBA 2TECE 2BHRA 4BIIA 1KMNA 4E2XA 2GN0A 4LJ6A 1JHMA 3B70A 4GLOA 1OWLA 2GM5A 3DAYA 3L43A 4BEWA 1A4IA 2BR4A 2P6UA 3NBQA 2N46A 3NI2A 2ADFA 1XTBA 2YC2C 5EKUA 3HO6A 2WVJA 2QA5A 1G21B 4ZT2A 4NF2A 3WK8A 5KNBA 3C3XA 4E5UA 1SCUA 2QVCA 3HBAA 4C6RA 5A9SA 2DULA 3JXEA 3GJ6A 3WBFA 4CM4B 1PG2A 1USKA 3F49S 2OAQ1 5KVQA 2QKYA 3KO8A 4KH1A 1VQ1A 4P4SB 5AW1A 3EIXA 4MA5A 4H77A 4MVXA 1X92A 5CVVA 3HBLA 1V39A 1Y6FA 1X19A 4Q01A 4DR6B 3CE6A 4MVJH 5JVDB 3RK0A 4J2TA 2BDTA 4YJDA 4DVGA 5AW2A 1XJ5A 1ZW1A 1EK1A 2GERA 1F14A 4ATNA 3GGPA 3R7SA 5IBCA 3CQ9A 1C9DB 2BGJA 2J9RA 3N28A 3SG0A 3GJXC 2CUTA 1PT6A 5B4TA 2O8CB 1H0RA 4UBIA 3TVYA 2MMCA 4L0MA 1QYIA 3FDXA 2H65A 4XCQA 1AZLA 4BBPA 2H2GA 4BE7B 1PNRA 3U7JA 1THTA 1KRWA 1UZMA 1P3Y1 1JNXX 1HK7A 4DDKA 3W4IA 5CB4B 1JHOA 8AT1A 1AD2A 1WE2A 5ES4B 1HEYA 3L6UA 3LL7A 3UBMA 4ZYLA 5J4KA 2CLSA 4J49A 5EHGA 2EX0A 5E7MA 1RKBA 1POXA 5EP3A 4F9EA 2H1WA 2RBGA 3UUGA 1KI4A 1YH3A 4MYSA 3T4PA 2LKCA 4L02A 5KCZA 1TADA 3H9JA 4A6DA 1MB4A 4Y6SA 3OLXA 1E3EA 1JFFA 1X3SA 3C43A 4YBZA 3U3RA 4BS9A 4YRAA 2R6ZA 3SLGA 2ZTUA 2VRNA 4O4JF 3PNOA 3D6MA 4JKYA 4EUFA 3GR6A 4AUNA 5AUPB 1IRXA 4UHDA 3VA7A 1PNOA 4F1KA 2QNBA 1X1RA 4Z4CA 4QARA 2A2ZA 2NAPA 5EAIA 2ZATA 2JLSA 3NHZA 2V7QD 2FG6C 3X2SA 3E61A 5EFZA 1JJIA 2JA2A 2QAGB 1ZBQA 2PTHA 2PS9A 2WJPA 2GM9A 4A1FA 5JJKA 2OGSA 2OHFA 1KQGA 1YQXA 2YC4C 3OPNA 4IFEA 2ZXUA 3GLIA 2V7XA 4W9NA 2AG6A 3ZD8A 3K6SB 5K0NA 3UHPA 4JP2A 1OYOA 3EHEA 1XDZA 2VLIA 4OJNA 5IMSA 2IF0A 3LK7A 5A4MS 3THYB 3DV2A 4YJHB 2PYIA 3G68A 3JPYA 3LBAA 3U13A 2A6PA 4ZO6A 4QBHA 4TRRA 1N34B 5KDLA 1TAUA 4EB6A 1J1IA 3LX5A 3S27A 2HJWA 1MFPA 3G3EA 2HU2A 2NPOA 4FR5A 4GXNA 1U7HA 4CQMD 5IBQA 2Y1CA 3KE9A 4R68A 1K6JA 3B6EA 2RK6A 3CKYA 4R3WA 3AHFA 4ZXFA 3ROMA 1ZK2A 5KWVA 2UYOA 3LW7A 1PEDA 3HN2A 4CZ2A 4J1SA 4NABA 1KMMA 4QDOA 2IC5A 3L93A 2GJ4A 1BE6A 1L1FA 3RFXA 1OFTA 4BKQA 3FCAA 1FQWA 2FFRA 1UEJA 4JLWA 5LZ5A 4KXXA 3ZS9A 1KTIA 1U7DA 5H16A 3V32A 3GLGB 2TS1A 1DZIA 1NJFA 2X0KA 3O91A 3AIMA 5DMHA 2XT0A 3ZWAA 1B74A 1QNLA 1Z6AA 3C5VA 3IT1A 1K4KA 4JT4A 4AN1A 4X41A 4CLOB 5BP7A 2JK0A 2CW5A 4MGEA 3ZKWB 4I4IA 4CG0A 2VP6A 1MRNA 2IP2A 2JKYA 1OXTA 2FYTA 2VDOB 3IBTA 3QVGA 1CUFA 3R0QA 4WLVA 4JKIA 4X5OA 5EMHA 3KWFA 4MRMA 3VR2D 3KQTA 5CP8A 1TM4E 3AQ4A 1K97A 2AVNA 1ZD1A 3DT8A 1IXSB 2WD9A 3DDNA 3NFRA 1SKAA 5JXGA 3H5NA 5ALSA 1A9YA 3WA7A 3E3LA 3PX3A 2VG8A 4G85A 3QOXA 3N70A 4RIEA 1FLVA 1FX0B 4JEHA 1SG0A 5K0SA 4F21A 3FH0A 4J7XA 3WYDA 4YVFA 4A8TA 2R00C 5DNDA 1J06A 4E1VA 2WWGA 3A28A 3USZA 3D54D 3D3WB 4FWTA 3E9RA 1XTQA 1HTTA 3JQ7A 1GPWB 1TJYA 4LJAA 4HTAA 5FJJA 3QY0A 4G0ZA 4KDRA 4L8YA 3EDOA 4AWXA 1C1XB 5HRAA 1XK7A 1XMIA 3CR8A 4U63A 5LWQA 3HEAA 1ZHOA 2ARKA 3M9LA 2ZYRA 3GROA 3GFRA 2NVUA 1NQTA 1K0FA 4CEIA 2ZT7A 2YWXA 4KXWA 2FPRA 3CRZA 2IYLD 4IVPA 3H2SA 1ZUIA 5CH3A 4TS1A 5AK3A 2BGRA 1W9MA 1AY0A 1U8CB 2WRZA 4UNPA 5DM2A 4BFLA 2G9QA 4GO1A 3TQRA 2P5YA 4BB0A 1NVKA 1NIPA 3WMXA 1NUTA 2Z09A 3HXQA 5BSKA 2VHYA 4ENTA 2FW0A 2G5PA 1JTEA 1Q20A 1Z4OA 3HU2A 5CDSA 3C2QA 2X2PA 4FQ7A 3KUKA 5BYAA 2PUCA 2ORED 4G8BA 2FHPA 3BGVA 3GVCA 2V96A 1DSSG 1Q7EA 3L79A 4EO7A 4WH0A 3RV4A 2O8FA 1T8RA 1K89A 2IS6A 1VLHA 2OM6A 1E79D 3I0NA 3ZY4A 1WZCA 4ZZ1A 4WUVA 3TFOA 5IAKA 4IMJB 4EHKA 2GXSA 4GPBA 1IBMB 1U80A 1SY7A 3BMNB 4RTJA 5TQJA 3UPUA 1UBFA 1XCJA 2IVFA 4FX5A 4R6WA 5JAPA 4ZDJA 5AW8A 1GNTA 3HDJA 3PE6A 2NWQA 4WGGA 1R37A 4RDIA 2J7KA 3ZHUA 1THGA 4PAOA 4QFCA 2PCJA 2Y67A 3GUVA 3TR5A 2IDMA 4I4LA 4PGMA 3UJ7A 3W06A 4U4AA 3BDIA 4FNGA 4IUYA 2QJRA 5TGDA 2V7BA 5IABA 4ZDWA 3IBYA 3H19A 5EWMB 1I7DA 4XXHA 3HJBA 1JHAA 1T2EA 4W5HA 4W63A 5FL7A 3TTSA 4WOJA 1LRJA 3I9OA 3B2QA 2XKBA 3LSTA 4Q9HA 1FDVA 3GLSA 4R0MA 4BO0A 2QZPA 5FDFA 5BW4A 2OGUA 2ZULA 4B83A 1EFDN 2ZBUA 3WISA 1JHQA 3EHDA 1KY5A 1EA5A 1A77A 2IYQA 1BVUA 2VAPA 3CEJA 1P9LA 2EFGA 3DE0X 3HJUA 4LRXA 3U4CA 4WY5A 2VF7A 4A0FA 4BLWA 1ABFA 3CVUA 3W5AA 1NVVR 2P9FA 2W6JD 3PK0A 3DUWA 4U6NA 5KTNA 3N5KA 2HA3A 2AUNA 3B5JA 4PM4A 3FUXA 2V5UA 1BMFD 2WAOA 3K1AA 4V39A 4AL4A 4PHGA 5ICEA 1FXSA 3MJFA 1LF5A 1E6EA 2GZRA 3OFJA 1UPCA 2B4KA 3GIWA 3HBFA 1GO2A 1JT2A 1GSIA 4GM1A 5B58T 2OYCA 1CCWA 2AI3A 1XC7A 2AN5A 2CFIA 4EBFA 3A9UA 3V8QA 3KQMA 4AUEA 4Z3KA 3FVVA 1N3YA 2ET6A 4FFBB 4ICIA 4YFYA 5DGTA 2QMYA 2R8RA 3AP1A 3HH8A 4U7HA 2ECFA 3I3OA 1KK2A 1NE7A 1C0KA 1X38A 4MUXA 5EQTA 1JIJA 1SPBS 2I6FA 3X1XA 1EB8A 2H5JA 1KVUA 3ZI0A 1FCJA 1QNFA 4RTOA 1R3DA 5LOVF 3S44A 1M5UA 1WB5A 3VR3D 1Y6ZA 2BFCB 4BRWA 3IEIA 1VHJA 2VDRB 3N2EA 1JZQA 1OHHD 3OF5A 2AG0A 1U7ZA 3I6BA 5J3JA 3Q72A 2VTVA 1TVKA 2Z6UA 4BXOA 3C3KA 3VQTA 2IX3A 4HN9A 2XIJA 3NOQA 1BWSA 5I8WA 1FP4B 4HWOA 1N6KA 1QZTA 1TIPA 1YBFA 3ZN2A 4YP9A 3VPXA 3RI3A 2CMKA 1ZPDA 4UPDA 2CNDA 2QX7A 2VRWA 4OM7A 2R87A 1XNHA 1FU4A 3D8NA 3TD9A 3V1NA 1ID8A 4ASUD 2DPGA 2IDKA 1KTVA 4O2BF 3WGNA 1IBSA 2HU7A 3B48A 4CVNA 5L7TA 4KDFA 4O3FA 3GJ0A 2XE6A 4PPQA 1SOWA 1U7XA 1P4JA 2VSQA 1QONA 3PC3A 3TSWA 2V6JA 4RHFA 3H5IA 2JRLA 3BWBA 4UU1A 5A5VA 4C7JA 3OC6A 2HU8A 2YVQA 2QNRA 1FFEA 1FDTA 1D04A 2Y71A 4H6PA 4LJSA 3F6PA 1Y8RA 1U3UA 4KWTA 4CQJA 2OKGA 2GK3A 4OM8A 2V54A 4C4TA 1S2MA 1TF5A 4ANFA 4AG5A 1CR1A 1P91A 3OQ6A 5C8XA 4C21A 4CT5A 1EGVB 2B5WA 2O52A 5GIPE 4DY6A 3PL5A 2BH9A 5LR6A 3IVAA 2YNMC 3UJ6A 1AA9A 2R11A 2BJVA 3WNQA 4A2CA 1R8QA 1YTLA 2J45A 1OREA 4GZLA 1OZFA 3DGEC 1H0HA 3I39X 4R83A 3OLYA 5DNYB 2OWDA 4YACA 3BA6A 1YR3A 1U1DA 3KXLA 4YT2A 2CE7A 3O73A 4MQ4A 1C1DB 2D8AA 4TMFA 3AR2A 1EDBA 4N5DA 3EMBA 2H1FA 3F3SA 1QO9A 3K0BA 4FYHA 1N9ZA 4MPRA 3AJEA 5FWXA 1X2BA 4WGFA 3IUNA 2H2IA 2VBGA 2JFNA 4KR6A 3U17A 1RIFA 4Y67A 1KI3A 3BXFA 4Q1FA 3STTA 2ECQA 4N8EA 2ZZNA 4ECAA 3MD9A 3G0BA 4AZWA 4KACA 5LUBA 1Z83A 4XB6B 2PTGA 3I92A 3WL7A 2NZ2A 4FHEA 3AFNA 3BJRA 1P18A 5T4EA 4G5SA 4B3BA 3IXQA 1XZBA 3KTAA 3P7MA 1K4MA 1B0PA 5KYUA 4QODA 1RBMA 1P2VA 1UKZA 3A3KA 4KQMA 4RDHA 3WLHA 4TSFA 1SU8A 1F0YA 4YRLA 3Q40A 1UJNA 2P2LA 4FC7A 4G2NA 4LYJA 1UZAA 1DTEA 2IJGX 4E4RA 1QDLB 1FFHA 2IEIA 1MDFA 3T95A 2INGX 1TD9A 4E14A 1QVRA 3BTVA 3BQMB 4J29A 2MSDB 2WM2A 1Z5UA 5F1OA 3TO5A 4NG4A 4L75A 3UIEA 4A26A 4M83A 5AJXA 1M3SA 4MZDA 1FVXA 4XSGA 3D9QX 3AR8A 4RL6A 3DYIA 3MWYW 5TE9A 4ZQFA 1GQRA 1ZK0A 2XMQA 3FMPB 4LV6A 1DL5A 1P31A 4NICA 1IK4A 4L6AA 2QTNA 1OLXA 2ZQZA 4MMXB 5JYDA 3BIXA 3Q0IA 2BM8A 3QGMA 1GIAA 3OMXA 1RYYA 1KAQA 3W8NA 2GPSA 4NZMA 2EWVA 1F0PA 2ROQA 3K15A 4F6LA 3KYCB 3I0ZA 1KAMA 3DOEA 1C0EA 2FMIA 1Z2PX 2ISSD 1YR6A 2VF4X 5ILGA 1Y9AA 5GJWC 1NVGA 2Q2WA 1CUSA 3GEEA 4LGVA 1ONSA 4A0GA 5JV5A 1I80A 2PR7A 1KJWA 3B6MA 1K3FA 4BMDA 4NMLA 2NXNA 3Q87B 1WP9A 1MDBA 4HPJB 4C0BA 3I4CA 3ZY6A 2QL6A 2FETA 1WU8A 2VJKA 3GVXA 3KDPA 3VTKA 1E5TA 2X8JB 3HDVA 1G21A 2BHSA 4PPYA 5K8TA 5KTKA 5A2QA 3NTOA 4G8DA 2J4DA 2XCLA 3V33A 2EFDB 4CM4A 3D6NB 3KSMA 4A2QA 4OXIA 5BNFA 1DC8A 4ENUA 3R7FA 3SEAA 1M5TA 3M6LA 4HGOA 2P5SA 3DGFC 3DFIA 4RJLA 4ZALA 4G97A 2A9PA 2OFWA 4HLUA 3SC3A 1CD5A 4KO3S 3R3XA 3M6VA 4XW2A 5JVDA 2JG3A 1JDUA 2C83A 1II9A 4X20B 2COKA 2IY9A 1KZ6A 2EHJA 3QMPA 3NBXX 4Z7OB 3QYFA 3TF5A 3LX8A 2PVCA 3D3EA 1BVRA 4JOCA 4K5QA 2O8CA 1LC3A 5I9SA 3GFGA 3C45A 4V0RA 4EFNA 5ESRA 4ZO7A 2N42A 5JI3E 3HUTA 4H4CA 2QZZA 3JALB 3RT9A 2ORVA 3OP4A 2RHRA 5KEIA 4QU9A 3MILA 2EZ9A 2O3QA 2UKDA 3T0FA 5JWOA 4IUDS 2UUPA 1YHZA 2YZ7A 1EGMB 1UC8A 5KYGA 2GOYA 3PYLA 5KYXB 3U7QB 4IWNA 1OYVA 3WDLA 1JJAA 2ZRMA 3CRMA 3IOYA 4L3WA 1EE9A 4QDTA 4RCVA 4UEOA 1XWWA 1RMYA 3RBAA 2B61A 1Y8AA 2NO5A 3SEZA 3T54A 4LRTB 1R6BX 4OLFA 4LZNA 3W5BA 4Y9TA 5BUZA 4CG3A 5IKEA 4PSKA 4OKSA 3AZPA 3M1YA 1B73A 2FEOA 3UT0A 3H97A 4OPMA 1VCMA 1IPFA 1SHJA 1HPLA 1PZEA 2HWKA 1WZNA 4GMXA 4BLSA 4ZYYA 1LF0A 2CHEA 2AFIE 2ZW9A 1GTSA 4L4YA 2VA9A 5IJAA 4HT3B 3MCUA 2P5TB 5E2BA 1V1MA 1PL6A 4O4JB 1NZFA 2ZM6B 2XKAA 4R2LA 1E6LA 1Y1LA 3DWFA 3GGDA 4JLOA 3RUCA 1W75A 2PT6A 2C4UA 4GNRA 5KNDA 1W1WA 4D9MA 4UPVA 3PNKA 1ATZA 3X1JA 1HDRA 2X5OA 1QB8A 3OAAA 3OOJA 4WZAE 4BNIA 2O3SA 4YJHA 2X5XA 4PHTA 4RGVA 4DDTA 1L7BA 5CBPB 3OBIA 4R8LA 3NTXA 3RRZA 4X65B 2WJZB 3ZBTA 2WTEA 3BWMA 3WLQA 2QN6A 3E05A 3TTWA 1EB9A 3G2OA 1U2ZA 1F8GA 3TL6A 2FY8A 1W4AA 3BXHA 1SXJC 5AK6A 1YQEA 1D6JA 3A1FA 4J4TA 3BQ9A 4F4HA 3UV6A 2IHZA 3ESBA 3L40A 1XTZA 2WJGA 2V03A 2PQMA 4RA6B 3WK6A 4Q47A 2C7BA 3H2KA 2Z4SA 2E1PA 2VCYA 3WMGA 3QVTA 3V3TA 1BFDA 3U1BA 3A6GA 4XZ3A 5AKHA 3MT8A 1P2UA 1OXXK 1WXDA 1VIYA 3C3YA 4B4DA 3Q1KA 2CXUA 2DMRA 3CRVA 2V59A 1Z68A 2G63A 3HDQA 3P9YA 4M9UA 4TXHA 4H60A 4N39A 1FF9A 4UULA 2FZVA 2G71A 3N2NA 4X7BA 3EZGA 2DPXA 1CHNA 1X8XA 1CIPA 3KCQA 3I73A 3TOCA 3G0OA 1PR0A 1BG6A 2KMLA 3X3HA 5AJZA 4MS4B 3K0HA 5ECDA 2ZJAA 5AVOA 4M54A 1RP7A 2FAXA 1LNQA 3FSRA 3SYKA 2CKDA 2VIIA 3GCZA 5EEHA 2OHOA 4LRYA 3RIEA 1EEHA 1XMSA 2D5AA 1Y7PA 3HXTA 4DWVA 4WCDA 4ZZ0A 1FX0A 2V4ZA 4GI3A 3IP9A 3U4QB 2C2ZA 5H1YA 1VPWA 3GJSA 1NG9A 4UBNA 1UK8A 1NAHA 5DHRA 3WQHA 1FNMA 3D3WA 5DPMA 3A26A 5EJ6A 1MU0A 3MMPA 4Q82A 4GIBA 1RRMA 4BMVA 1SG6A 4WOBA 3HN7A 2ZSFA 4TYQA 1JDNA 2HV8A 4ZVQA 3G2LA 3L0SA 3LGAA 2Z3WA 4TWJA 1C1XA 5JDIA 1UFVA 2YMLA 4A8HA 3THOA 3L7MA 5E2AA 2FN8A 2V97A 1EZ4A 1BJRE 3MXTA 2O0LA 1E8NA 4IQFA 3WHLA 4E5SA 4EGFA 4AKGA 5HF6A 2KLBA 5JC8A 5INTA 3VDQA 1C7JA 3NYWA 1GGEA 2CXHA 1L4EA 2NO7A 1D9ZA 2G04A 2DWQA 3M4ZA 5C1OA 5D87A 3PWZA 4IJKA 4AG3A 1UWLA 2JJ2A 1OB2A 1T0UA 2QLTA 3DCJA 1VPVA 3MCTA 4FHDA 4H7PA 2GSDA 3L6CA 2BI7A 3CF6R 1DFHA 2VDJA 2NZJA 4M21A 1UZLA 1ZI9A 1JR6A 1P2BA 4X93A 5DTQA 3V8NA 2JI6A 3B3AA 1OAKA 4K9LA 3VOSA 2O7QA 4G1BA 1CUHA 1RAAA 3VM6A 1VJDA 2A5YB 3K53A 4E15A 5IVPA 4IJMA 4KBGA 3VH1A 1NXSA 1V9SA 3LDGA 2Y1OA 3GWZA 2YCBA 4O8CA 2JKZA 5TEWA 4AY6A 1QRTA 3QHAA 2GBLA 4PY2A 2DH6A 2W2OA 4RJIA 1KAOA 3IT2A 4QDXA 5LU8A 3JVIA 3NIFB 2EYQA 5CH5A 4R71A 1AV7A 4LHXA 4LX0A 5FTLA 2GEJA 4TWAA 3TZBA 2PBZA 4RFSB 4HMPA 1Z7GA 3D8RA 3PPIA 2F9MA 3KR9A 5HFJA 3ZGLA 3YASA 3ONFA 2J5BA 2ZUFA 1NRXA 1YZUA 3COSA 2O7RA 1QYCA 4D43A 1BX0A 1KQPA 1NXVA 4D9CA 1DIBA 3S1LA 1N0VC 2D0IA 5CU7A 2JAPA 2X42A 1P77A 3BB4A 5EWMA 3HBJA 4JI3B 3U31A 4QWMA 2GZAA 3ZIUA 1KWKA 4HD8A 4XWKA 5JG7A 5B6IA 4KITB 2E82A 3JQQA 2I2CA 2FR0A 3ON5A 4PG5A 4X44A 4DR7B 4ZEOA 4BFZA 5TXGA 5IU6A 1TCVA 1QUFA 2ZBFA 3E3MA 2I3ZA 5I8ZA 4E5PA 5KU1A 2J67A 1ULZA 3ROZA 1NVWQ 2X1LA 2CT8A 3PXCX 2AL7A 1CUBA 3CZPA 3OHPA 1NBAA 1Z7YA 5HE8A 4HLCA 3IXLA 1XTVA 2Y9PB 1VM6A 2YWFA 2FWRA 2H48A 4QC2A 4RLQA 1O95C 4JI5B 1XAJA 3MTJA 4MVJA 1QTIA 4BY9E 2A0FA 4AJOA 2BKEA 1KO8A 1UOPA 1Q0RA 1Q1AA 1RWWA 2HXSA 2GPNA 2NLOA 1R5JA 2HMYB 3QPWA 4FFBA 5C4GB 3F6RA 2A5LA 4RVOA 5EHIA 2OHXA 1T5DX 2DUWA 2JVJA 2Q7XA 3N7UA 4XX1A 4BNYA 4TVSA 3KQPA 5E7IA 3W5VA 1S2DA 1IB0A 2O2XA 1FMTA 4NWIA 1OFGA 3AVVA 1XEWX 3DAOA 2PKXA 1RZRA 4EJSC 1UAYA 1B8NA 1ZD8A 2PZKA 1EVJA 4LHWA 5ALOA 4R2KA 4BWGA