4QLOA

Crystal structure of homoserine o-acetyltransferase from staphylococcus aureus
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
327
Chain Sequence
NYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRKDPAFLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords homoserine O-acetyltransferase
publication title Structure of homoserine O-acetyltransferase from Staphylococcus aureus: the first Gram-positive ortholog structure.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 112
structure length 327
sequence length 327
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2014-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qloA00
4U2GA 4X93A 1SFRA 4EB0A 3EIOA 3UUFA 2J4CA 1GZ7A 4FLMA 2ACEA 2VJCA 2ZSHA 1N5RA 3OG9A 3H2GA 2PSDA 3QITA 1YB7A 3BDIA 1XZMA 3IUNA 4EY6A 4V2IA 4G4IA 1UK7A 5DJ5A 4KAJA 1JFRA 1XZDA 5ALDA 1ZGBA 3QM1A 1VA5A 2WUGA 3C87A 5DYTA 5JANA 2WUEA 5ALRA 3M83A 1RP1A 4B9AA 1TCCA 4UHEA 1AURA 2XMGA 4OSEA 4H18A 4MXDA 1QIJA 1X2EA 2B9VA 4GI1A 1E89A 1CUIA 4X94A 1W1IA 2XDWA 4G9EA 1DX4A 2HRQA 3W04A 2Y1KA 1BROA 4LXHA 5FRDA 3HRHA 2HFKA 1EK1A 1CUGA 1TAHA 5IVHA 4YX9A 5AKEA 4H7IA 1U8EA 4QE3A 2IX9A 5ALHA 1RYYA 3FLEA 3TEJA 2WG0A 1ZIXA 2XUKA 5AM2A 4PF1A 2WU3A 1VKHA 1DWQA 1FFBA 1E66A 3ILSA 1XZJA 1JMYA 2AJBA 4Y2JA 1H2YA 2G63A 5LLSA 4AQDA 1OCEA 4B81A 4KAAA 3QPDA 2BCEA 1F0PA 1QIHA 3ZI7A 1ORVA 1FJ2A 6YASA 5LYYA 4TGLA 2HDWA 4WDQA 4K6GA 4BE4A 4U2DA 4X3CA 3FSGA 1H2WA 3STUA 1N8SA 2AJDA 3OURA 4LYEA 1XRMA 4BTLA 1LPBB 5AK3A 2V98A 5T4EA 4Y2PA 4Q82A 4EUSA 1JU3A 3RARA 2GYWA 3AZOA 2XE4A 2FX5A 1YB6A 4XIIA 4X91A 4N8SA 3GUUA 5FOQA 5T4BA 2RHTA 5AM5A 2HA7A 2AJLI 1A8UA 5ALPA 4FMPA 3WK8A 1M33A 3H18A 1ODTC 2VJDA 4RGYA 1GT6A 3TGLA 2Y2VA 1EHYA 5JD6A 1MO2A 5DNVA 3WYDA 3B3QA 1ZD5A 1FFCA 4ZI5A 1O6GA 2YASA 4J0DA 4UHDA 5AP9A 4X90A 4BDTA 2WKWA 4LIPD 1PV1A 2OLEA 1WB4A 4U2FA 2PSFA 1O6FA 4CIAA 4QLAA 5KWJA 1J07A 1U4NA 4AN1A 4ARAA 4ZRDA 4UBIA 2VQ6A 1DQYA 4KRXA 1GGVA 3KOOA 4J0IA 5EIEA 2G4LA 3O0DA 3HABA 1HPLA 1VZ3A 3H17A 3YASA 1W4LA 2OCLA 2ACKA 2HU7A 4QDTA 4BATA 3VJMA 4BAGA 2V9ZA 2Z3ZA 3E1GA 5A6VA 3QVMA 1VE6A 4LKOA 4WY5A 3SK0A 4CG1A 2WTMA 4LYDA 3W06A 4AO7A 2G5PA 4K6HA 3A6ZA 1E8NA 1CPYA 5AKZA 1XZCA 1UKCA 1DWPA 2PSHA 4JEIA 4M0EA 2JGKA 4DMHA 1ZJ5A 3AZQA 1EINA 2O2HA 3AIOA 1KEZA 3L1HA 1DT3A 1R9NA 3C8HA 4DMFA 1THGA 4Y2UA 4BCBA 5ALEA 1LPOA 1WM1A 5BWCA 1CFJA 3VXKA 1LLFA 3D3NA 2YH2A 1LPMA 2OCKA 5YASA 2C0PA 4H7EA 4X97A 2Q0XA 1X2BA 1UKBA 1X70A 4MYSA 2OCIA 3BDVA 2DR0A 2ZJ7A 3VVLA 4YK7A 1EXWA 4FBMA 3DKRA 5CT8A 2P8SA 4MYDA 5K5EA 3BIWA 3R3UA 5KWIA 3WZLA 1YS1X 4ZWNA 2WM2A 2AJ8A 4TPKA 5CXXA 3H19A 2OGTA 3EBLA 1H2XA 3WKDA 5CT4A 2OAEA 3I6YA 3W05A 4GXNA 4UHBA 2C0QA 5LZ8A 2Y6VA 3B5EA 4CI9A 1D07A 3I2KA 4P92A 1QFSA 3DLTA 4HXEB 3AILA 5LP1A 5DYWA 1R50A 5KREA 1GQRA 1QJ4A 1LGYA 3F98A 4H0CA 1TCAA 2PU5A 5K3BA 3WWDA 5AK4A 3STYA 3R3YA 4FNGA 4FOLA 2JGEA 4C4YA 2QTBA 4W1QA 2FUKA 4EY5A 5HK9A 1THTA 4E11A 1ISPA 2Z8XA 4GBGA 5I7UA 4Y2XA 3FVTA 1QO7A 1UZAA 2CEKA 1MU0A 1Q0ZA 1HDEA 1MAHA 3EQ8A 4L9AA 5ALYA 2DHCA 3R3VA 1CUVA 5DTJA 1ZD3A 1ZIYA 2Y6UA 1CQWA 2WIFA 4KE6A 4EHBA 3WKCA 1NU6A 4CCWA 2O2GA 3ESAA 3WL6A 4IH9A 1QLWA 5A7FA 1Q84A 2GBIA 4OCZA 3H0CA 1IMJA 3PE6A 4G9GA 4BVKA 2OG1A 4BP9A 5CW2A 3QYJA 4NMWA 2QOEA 4EZIA 5HKAA 2XUQA 4B80A 3G0GA 5HF8A 1XLVA 4IO0A 4EY4A 2JGJA 2XQIA 1BEEA 4BP8A 4BC0A 4BAUA 1DX6A 2WG2A 3GA7A 3WWPA 2AJCA 1H23A 5IVIA 4CG3A 2XLBA 2YXPX 5JYCA 2D0DA 3I2JA 2HU5A 3VKFA 4RE6A 1K6EA 4DNFA 2GYUA 3G9ZA 4X00A 4RNCA 3WJ1A 1L7AA 4FLFA 1Z68A 1CUJA 3CCBA 4GW3A 2ONCA 4L3WA 4DIUA 2H7XA 2WQZA 3PFCA 3RLIA 3WJ2A 1S8OA 4QDZA 3EQ9A 4XJVA 2XUGA 2XUFA 4W1PA 3E0XA 1JJBA 4INZA 1CRLA 3WK7A 3WWOA 3DKKA 5AM3A 2VJAA 3DL7A 2OGZA 3F8SA 1ZI6A 4X6XA 3H2KA 1R4ZA 3HSSA 4BTVA 3FNBA 4ZXFA 2XB6A 3KWFA 2PBLA 5LZ9A 4P93A 4WCVA 4O08A 2HA3A 1QIDA 4U2CA 5EGNA 1F0NA 4DNPA 4W63A 3PF8A 3PDCA 2HA2A 4B0OA 3IUMA 4ITVA 4IQ4A 1ZD2P 5AI8A 1ACJA 4G4GA 4JNCA 4BVJA 4L0CA 1NU8A 3GFFA 3V1NA 2G5TA 5FKJA 3WK5A 2WJ3A 4G8BA 4DGQA 4KJXA 3SX4A 3WK6A 2CKMA 1U65A 3QH4A 5FP0A 4PV7A 1EK2A 3DS8A 5EHXA 1R3DA 1QO9A 2UZ0A 1TQHA 1ZGCA 2O2IA 2RI6A 2WHQA 3QPAA 3QMWA 1ACLA 3Q0TA 3VVMA 2BAGA 2HL6A 5J3JA 2WG1A 3AINA 2WUDA 3FYTA 3D5EA 3WKBA 3R3XA 1UOPA 2DHDA 4AMZA 5DNUA 5LZ2A 1JT2A 1JJIA 2QRUA 2Z5GA 3QZUA 1XZGA 3ZLUA 1T2NA 3ANSA 2BUCA 4Z49A 3TJMA 2X76A 4BC1A 5DLPA 4Q05A 2WHPB 1DT5A 3AUKA 4BRZA 3I1IA 4Y9SA 1QFMA 3QBJA 2CB9A 1QZ3A 1E8MA 4Y2RA 3IULA 2H1IA 2IIVA 2VF2A 1BN7A 4BAZA 3PICA 4C88A 1H2ZA 1W6RA 2QUAA 1EVQA 2GZRA 3STVA 1LPPA 1C7IA 1BS9A 5A7GA 1QIMA 1L7RA 3H1BA 5AOAA 2QS9A 2GZSA 4NVRA 1GXSA 2CBGA 3VJKA 4F60A 5BWBA 3BE8A 4X6UA 3ESBA 3WKAA 2C58A 3FYUA 1A7UA 5ALXA 3WL7A 4KR0A 1JMKC 1LNSA 4UBLA 3K6KA 3SWWA 1BRTA 1XQWA 3DCNA 4UUQA 3FOBA 3R3ZA 5AKLA 2ZYIA 1BCSA 1XZBA 2OAGA 5C8XA 4XVCA 1LZKA 3G7NA 4OU4A 2QZPA 5AKIA 4MWSA 1GPNA 3C45A 1JKMA 5A2GA 4FLEA 5CH8A 1MN6A 5ALJA 1BU8A 4BZWA 4UHFA 5ALZA 2VSQA 4BB0A 5SYNA 1UFOA 3UMJA 2J3QA 1B41A 3F96A 3I2IA 4H35A 4N8EA 4FFWA 3JWEA 3G0IA 2R11A 2WJ6A 4IH4A 2AXEA 2Z8ZA 1QTRA 1E8DA 2B4KA 5SYMA 1CUCA 4Q3KA 4JH0A 2JEZA 5F4ZA 4TVKA 4N5HX 1T4MA 3WMRA 4EY8A 4DTCA 2O7VA 1IUOA 3DYIA 3DYVA 1CIJA 2B20A 1AGYA 2C5GA 5FV4A 1I6WA 1XRLA 2ZYHA 5JAHA 3F97A 1ZOIA 2WU4A 2XLCA 3STXA 5AHXA 3U0VA 1MNQA 1CUEA 4UHHA 1UXOA 2PL5A 1C4XA 1SC9A 1XRQA 3IUJA 3V9AA 4Y2VA 2XUOA 2K2QB 5CRIA 2C5FA 4OPMA 4PSUA 4ROTA 3X3HA 4AZ3A 2WFMA 4WJLA 1XRNA 2JIDA 1XLUA 2V97A 4K2AA 2QKYA 3DL4A 1A88A 3GELA 4B6GA 3FCXA 4OYLA 4W1RA 5CBKA 2DHEA 4C4XA 2E3JA 5HKBA 3BF8A 1CLEA 3FYUB 5CT5A 1Q0RA 4Q1VA 2JGLA 3HJUA 4H7HA 4FKBA 1B6GA 3G9TA 2HM7A 4J3JA 4GDMA 2QXUA 4HS9A 4S0XA 5AOBA 3AZPA 1WB6A 2WIDA 3I6ZA 5AI9A 1SCKA 3TRDA 3CN7A 3I2GA 2XUDA 4Y2TA 3V1MA 4UBKA 4C4ZA 1CV2A 1VZ2A 5CXUA 4J0JA 3AJAA 2ZJFA 1W76A 3D59A 2H9YA 2EEPA 4IHAA 4FBLA 4FNMA 1WPRA 1XZEA 3BWXA 2DFPA 4H7FA 5HCUA 1XKTA 3N0TA 5K3EA 1QTIA 1YA4A 3F9CA 1IUPA 4FWBA 2PSEA 3NWOA 1HBJA 2J3DA 2CUTA 5LKAA 3C43A 4BCDA 1CUWA 3O4IA 3PUIA 2VA9A 3PF9A 4F21A 5C8ZA 1VE7A 1YAJA 4GECA 2I78A 4B0PA 5AM0A 5JAUA 4RE5A 3K9BA 1AC5A 2VTVA 3CN9A 2NW6A 5ISMA 3BJMA 4KYVA 5AKKA 2WIKA 5ESRA 1N5MA 1LPAB 3DDUA 1XQYA 1CUSA 1AMNA 5E4JA 2DCMA 5A71A 4UBNA 4HTAA 3HC7A 1EDDA 1ORWA 2WFLA 3WQHA 3W9UA 4WDRA 3KD2A 1YS2X 5EHZA 5AI5A 3B12A 3C8DA 1F6WA 4C01A 5AOCA 2HHAA 1JJFA 1L7QA 3D2BA 4KE8A 5EIHA 2QUBA 3UUEA 4YPVA 2Y2UA 3C6BA 1P0PA 4QWWA 5JADA 5BV7A 1FFAA 3T4UA 5EFZA 3VJLA 4I4CA 2WTNA 3O4GA 3R40A 1R1DA 2XQFA 2PU7A 5AI6A 4AN0A 3GROA 2OCGA 2RGUA 1ODSA 4LHEA 2RAUA 1CUUA 1CVLA 4OB6A 3KWJA 1E3QA 1XLWA 1UOQA 4DYHA 4HRXA 5D3KA 4B9EA 3C70A 3M82A 5ALWA 1WHSA 4BRSA 4FTWA 2XUPA 1K4YA 4JYMA 1DTEA 2Z3WA 4UBMA 3WZMA 1VOTA 5CURA 4B84A 4QDUA 3ZLTA 4W1SA 1MX9A 3OTQA 1DWOA 4K6KA 3BXPA 1LBTA 3Q8WA 1VJ5A 4GEGA 4JYPA 2HA0A 4D9JA 4H7KA 4QWMA 4FDMA 2PVSA 1XQXA 2BFNA 2XMRA 2XUJA 5JZ9A 3WYNA 4XWGA 3HEAA 1Y37A 2WFLB 2QJRA 5E4YA 5HFAA 5E4TA 3O9MA 3VISA 1EI9A 4J0GA 4UFOA 5ALFA 5DYYA 5HF5A 4U2BA 5K3CA 4OB8A 3H1AA 1XRRA 7YASA 2ECFA 5C8VA 1ZJ4A 4FFVA 3BJRA 5DTIA 1WPXA 3IIIA 3DQZA 4PSCA 2WSLA 3IURA 3FYUC 5AKJA 1YA8A 1MT3A 3D2AA 1FFEA 3WWEA 3N2ZB 1C7JA 3LLCA 4OD0A 3O4HA 2PX6A 2VAXA 2XUHA 2JBWA 5JZSA 4J0KA 3G8YA 1WCYA 3H2IA 2OPHA 4DNQA 4DM7A 2DQZA 2X8BA 1MX5A 1EDEA 4BYMA 3C6XA 1UKAA 4DSZA 4X85A 1K5PA 1AZWA 1EB8A 4X6YA 4IH1A 1GPKA 1VA4A 1BE0A 4X7BA 4BDSA 3BIXA 2WHRA 2ZJ6A 3OOSA 2GBGA 3WA7A 1AX9A 4HAIA 1TIBA 1UT6A 1KU0A 4H7JA 4G5XA 5T4HA 5JD5A 1VLQA 5A62A 5EHQA 2QT9A 3E3AA 1ZICA 4L72A 3HACA 3WK4A 3ESCA 2PM8A 3ICVA 3ZV7A 4KE9A 1YR2A 1XZKA 1ZI8A 3BL8A 2I3DA 1BCRA 3MUNA 4Y2YA 4PSDA 3FAKA 3LIIA 4N5IX 1SOMA 4OU5A 3MUOA 1XZIA 2VT7A 2WLSA 3FLAA 5IH7A 3ESDA 4I3FA 1IZ8A 3WIBA 3HLKA 2QJWA 4J7AA 1LPNA 3U1TA 5K3AA 4DLNA 3V48A 2ZYRA 5ALTA 2XMQA 3D4LA 1ODCA 3EQ7A 1XZHA 5FLKA 1EDBA 3L1JA 2VATA 3SC2A 2WUFA 4A5SA 5LKRA 3HI4A 4E46A 5JIBA 1UK6A 2D5LA 2JEYA 2XI4A 1A8QA 1YCDA 4C6HA 1ZI9A 5HF6A 5JARA 4PW0A 4QLOA 2I3ZA 5CT9A 1CQZA 3S2ZA 1XZLA 3G9UA 4MQLA 2XT0A 2OXEA 1CUBA 4P9NA 3C6ZA 1CEXA 3RK4A 4E14A 4AB1A 1HL7A 2ES4A 4CG2A 4G4JA 4GWLA 2PKYX 1XFDA 2QVBA 2JGFA 3DNMA 3G9XA 4MJ3A 3FCYA 1TK3A 3WI7A 3I6MA 4HVTA 1EVEA 5CT6A 3R3WA 1CUYA 4A16A 1SCIA 2XQJA 3D7RA 3ANTA 5LZ4A 4CFSA 2OQIA 2RONA 2C4HA 1CUFA 4AX4A 2BJHA 1GKLA 1CR6A 2H7CA 4FHZA 2VT6A 3NUZA 2ORYA 2QM0A 2W22A 5AIBA 5JALA 4KACA 2VJBA 5A7HA 4AZ0A 3G02A 4MQMA 3C6YA 3K2IA 4Q34A 1OXMA 4MWTA 4C89A 5AI4A 4Y7DA 3KXPA 3I2FA 3WL5A 3H2HA 1JI3A 5JD4A 1CUDA 4X71A 4P08A 4ZREA 5HQ3A 5FPPA 2JGMA 2PPLA 5AICA 1G66A 1AUOA 4GLBA 3F67A 1W52X 4KEAA 1W75A 5ALQA 1QGED 3LS2A 3CCCA 1QIEA 4PO3X 5D7BA 3DOHA 1UWCA 2I03A 3A2NA 5I8PA 1HQDA 1Y7IA 1GKKA 1PJAA 1XROA 2HU8A 2V96A 5KBYA 4J0HA 3PI6A 4OUKX 1P0IA 3W2TA 4JUIA 3KSRA 4CIBA 1MX1A 5C81A 3G0DA 5ALKA 2WJ4A 1K63A 3LP5A 3IUQA 2HA6A 2OQVA 2HFJA 3WA6A 3H2JA 5AI0A 1MAAA 4UPDA 2ZVDA 3EF3A 3M81A 2ROQA 3RKSA 1R9MA 2FJ0A 5DNWA 3V1LA 2ZSIA 4M0MA 4QZVA 4MEAA 4PQEA 5AKYA 5JASA 1F8UA 1ETHA 1AKNA 3O4JA 4QDOA 5DWDA 1N1MA 2O7RA 4G8DA 3IBTA 3H04A 5CH3A 4ARBA 4ZV7A 2HADA 3IDAA 1P0MA 1J2EA 5ALVA 4OYYA 1QE3A 4DSAA 5H3HA 3NOXA 4M0FA 3AIMA 4UBOA 1UOOA 3KDAA 4HXFB 1GQSA 2XMZA 5HF9A 5ALMA 4AXBA 4BCCA 5LZ7A 2PSJA 1QIIA 1FFDA 3IA2A 3IB3A 2X5XA 2GBFA 4QEKA 4ETWA 1J1IA 3NGMA 3I2HA 5LZ5A 2BKLA 5D3ZA 3R0VA 5HQ3B 4UFPA 3R41A 2BUAA 1RWQA 2CMFA 3MGAA 2ZYSA 3W9BA 1FSSA 5AH0A 4UHCA 4BBZA 2XMCA 5IKXA 2WFZA 5AKXA 5FPQA 2R8BA 1IUNA 1LBSA 5ALNA 2GYVA 5ALIA 4BVLA 1HLGA 5ALUA 4BE9A 1VXRA 2BUBA 3FBWA 3LIPA 3A2LA 1XZFA 2XUIA 3OC0A 1JU4A 4HZGA 3WL8A 4DNOA 3ZLVA 4ZV9A 5E2IA 3VDXA 1CUZA 3QMVA 1XRPA 1SCQA 4Y2QA 3HZOA 4RPCA 5ALOA 5AKHA 5CH5A 3D2CA 5AJHA 2OGSA 2FJPA 3DJYA 5EHNA 1QIGA 3ZWQA 5ALSA 5JAOA 5BOVA 3L1IA 1PFQA 4LXIA 1UK9A 2BGRA 3OM8A 3A2MA 3FVRA 2CJPA 5AK6A 4Q3LA 2QMQA 5FXMA 5C7YA 1WOMA 3GBSA 3PUHA 4Y2SA 1MNAA 1R88A 2EDAA 5EI5A 1QOZA 4J03A 1YSCA 4I19A 4DMCA 4AMYA 4AO6A 2YYSA 4H77A 4Q3OA 4F0JA 1QONA 1VXOA 5AK5A 4W9RA 1E5TA 1USWA 2JF0A 5HK8A 4A23A 4PNZA 5JZBA 5HZGA 2XMSA 1XQVA 3HYSA 1HKHA 1J06A 4LXGA 3AIKA 3M3DA 5CMLA 5I9IA 1BN6A 1QIKA 4CCYA 1EH5A 3MVEA 1Y7HA 3I1YA 4UFNA 2B61A 1A8SA 4J0CA 3DOIA 2HRRA 3FLBA 4QDXA 2JGIA 3GZJA 2WILA 4EY7A 2RIPA 5AM4A 3IVMA 2QXTA 3QPCA 1EX9A 4F5ZA 1OILA 2CZQA 3O95A 5ALGA 1G42A 3FWHA 1MTZA 3CXUA 4KRYA 1EA5A 3DEAA 5IVKA 3P2MA 3WK9A 2LIPA 2WIJA 3WLAA 4WFJA 4UBJA 4DMKA 2DQYA 4AO8A 5AIAA 3QMMA 2BGNA 5ALLA 5IVDA 4QNNA 1IZ7A 5AKGA 4E15A 2GBCA 4WFKA 2HA5A 4GHWA 2C7BA 5D6OA 1TKRA 4KAFA 1H22A 1BEZA 5AM1A 2XQGA 1ZD4A 1TRHA 1QIFA 4C87A 2XMBA 5K3FA 3DD5A 2QR5A 5K3DA 1CUXA 3ZPXA 5CTAA 3RM3A 2DSNA 1IVYA 1WB5A 1Q83A 4MEBA 2IITA 1TCBA 5HFNA 5JAPA 5FUMA 4NS4A 4CCYB 3FSGD 1DQZA 1XZAA 1MJ5A 3E4DA 2H7YA 1GPLA 4BZZA 2WHPA 3BF7A 4N8DA 3V1KA 4EBBA 3T52A 4G8CA 2XUAA 4X92A 3C5VA 4HRYA 1U2EA 3S8YA 4YASA 1UK8A 3I28A 1G4HA 4B7ZA 2HA4A 3JW8A 4K5QA 3A70A 3ED1A 4G1FA 1DINA 1CUAA 5JATA 1K8QA 4XX1A 1AQLA 3JYHA 4OB7A 3C5WP 4EA6A 1YASA 1LZLA 5LIPA 1EB9A 4B82A 1LPSA 4X95A 4B83A 2J4FA 3HXKA 4WY8A 2VEOA 4WFIA 4QA9A 2RHWA 1NX9A 2EDCA 3G0BA 2PUJA 3OPMA 4U2EA 3D0KA 1CUHA 1MPXA 5AO9A 2PUHA 4ZGBA 5T4FA 3PFBA 3STTA 5FDFA 2XQKA 2XMDA 3AFIA 1YAHA 3WKEA 4B85A 2WIGA 5EIAA 3STWA 1XKLA 1KU6A 3G0CA 4KE7A 5K3FB 1G5FA 2VAVA 4HXGA 1WHTA 3O9VA 3LCRA 3WWCA 4NZZA 4H7DA 2HIHA 1P0QA 3WIOA 1DU4A 2W6CX 3ICWA
chains in the Genus database with same CATH superfamily
3TQHA 4EGSA 4EB0A 1I5EA 5D8DA 2PO7A 3UUFA 3WLMA 2XB2A 2J4CA 5CFQA 1RJDA 1GZ7A 1UAAA 3DBHA 4FLMA 1HFJA 2ACEA 2YHIB 2FEOA 2QNBA 2PE5A 3H6GA 3OG9A 1JDZA 2PSDA 3Q3IA 4HGYA 2VHEA 3EJ6A 4TMKA 3WE7A 5I4CA 1YJ8A 2CC2A 1XZMA 2VHVA 2F8MA 4UTOA 1UK7A 4YRJA 2LR0A 3K8YA 3QELB 3JARB 5FPHA 5AW2A 1C0LA 4ABTA 5JWHA 3VH3A 1WVGA 3A4YA 3T0FA 2OPBA 2WM3A 4FHFA 2PBZA 2EFGA 1E92A 3KUUA 3P71T 2YUIA 2W43A 4J0EA 1DG3A 5DYTA 2IEDA 2V0CA 1P75A 4GH5A 4IIXA 5LYJA 4GYWA 2W8ZA 4CW7A 1GLNA 3TH5A 5BSMA 5C4IA 5LQJA 5JBIA 2O0HA 2ZRBA 2WVHA 3M83A 5T8KA 4C14A 4AMVA 1TCCA 4UHEA 2IRWA 3AOEA 4NESA 3A6HA 2XMGA 3I1FA 3RYFB 1PNRA 4H18A 5HCIA 3S2EA 1YGYA 2BFEB 2EVWX 1Y5LA 3DE3X 1HTWA 3VAZA 4D4KA 4YRSA 1QC5B 1PGPA 3UGTA 2GCGA 3OZXA 5EJAA 1XK7A 2XB9A 2OSBA 1F6DA 2XB4A 4Z4HA 4NE2A 3ZD6A 1TW3A 1J8YF 2Q9BA 1EUDA 1J09A 5B6PA 5LPNA 1UQUA 3OX2A 1WQ1R 4JCCA 1V2HE 3AHHA 1NIPA 2XDWA 2I6FA 2AG5A 2XZOA 4QQRA 5EPEA 3R3HA 3KM0A 2G82A 2JLVA 4XQCA 1AQNA 2WVGA 5KNDD 1GKYA 2FRDA 3HRHA 3I23A 3PDIA 3QVWA 1E2FA 1O3YA 1ZU4A 1NZDA 5EUQB 4ER6A 2QB5A 1FTGA 1JZSA 3LHIA 4E22A 3DCYA 1T9GS 3FGZA 3EIEA 3HUTA 4QE3A 4B34A 5KCZA 4BZQA 3HZRA 3P0EA 1IZ0A 4TXLA 2WB2A 2XOKD 4YQZA 2ZXUA 1K9SA 2AD1A 1G55A 4P53A 4L4RA 4KQ9A 1GG2A 4LOHA 3KTOA 3TEJA 1H9CA 2NXJA 5BXYA 1LK5A 1ZIXA 2GJKA 2ZS9A 3DXZA 4PF1A 3WJ7A 3ZGVA 2FP4B 3ICEA 2BGIA 4R8RA 2I4MA 1VKHA 2Y1FA 4IJVA 4NU6A 3TX6A 5ER9A 3L7AA 4TUYB 1KJ8A 1ZNQO 2NADA 3H7AA 4L6CA 1XAIA 1IHUA 4FXOA 4D9IA 4ZYYA 4IGFA 5G0TA 3ZQKA 2QR2A 3DF7A 1L7BA 4F4CA 4YO8A 4F2DA 3T3OA 1PFUA 1WBJB 2ET6A 3QTLA 3SEZA 3UAXA 1SKUA 4NZNA 1AO3A 1MO6A 2YVLA 3N8HA 4BNWA 5B7GA 3R0IA 3EVNA 3KT6A 1JL3A 4R7GA 4Q7MB 4XSGA 1OCEA 4B81A 2VQDA 3QPDA 4WY2A 4M9XA 2H59A 4ZU3A 4AS3A 2BCEA 2QJOA 4KVAA 1Z37A 3RRNA 3RYHA 3B2QA 2O2JA 1GTG1 5HTOA 2YWBA 2BP7A 3G82C 1T9DA 3DEKA 4X63A 1FJGB 2ID8A 2P6UA 2YCLA 2Y71A 2Z4SA 3D6AA 2ZUEA 2HCFA 3KOXA 4HB0A 5A05A 4QQFA 4O2AA 1F2UA 2ZIWB 3H42B 1C29B 3FSGA 1U1DA 4MAAA 1IY1A 4R8LA 5K0FA 2YN4A 1RKVA 4RS4A 3RVDA 2WPNA 2PJZA 1HY3A 4KYTA 1N8SA 2A2ZA 5COQA 4QU5A 4YT8A 3KQUA 1OAOC 2AN3A 3I39X 4H4CA 3OFKA 2K6GA 1GWNA 5FORA 3V4OA 3MBOA 4NCHA 4NE7A 5K0ZA 1XRMA 4BTLA 3RS3A 1DE0A 3IPLA 3UANA 3AVWA 2GN0A 2XEDA 1SOVA 5CDTA 1RAFA 1MB2A 1CRPA 2YWFA 4HAXA 2PGAA 1GQYA 2GYWA 3KYDA 3PXUA 5G0WA 1LSSA 2IPOA 2BRUA 3NTUA 4I1SA 4HNGA 5BNWA 2IS6A 1V16A 4R31A 3TGPA 3U4GA 3I76A 2GEUA 2FSGA 3F4LA 3PE4A 5MFPA 2DR2A 4MYTA 5GJWC 3LWZA 4UARA 4QUEA 3B7PA 4N8SA 5E7IA 4I6JA 1OKKD 3CNEA 3B3AA 5THKA 3LUPA 2JBAB 3VQTA 3GUUA 1FVHA 2YBDA 3AJ9A 1OH5A 4ZIRB 3L92A 2B21A 4R3UC 3Q7QA 4I6EA 1RHKA 5AM5A 2PS3A 1XZQA 2HA7A 2AJLI 1VL5A 3WK8A 1N9ZA 3A9TA 2ZTVA 1OFTA 3JQQA 3T3NA 2HDOA 3H18A 2FSIA 2C97A 4UM9B 4PGGA 1E7SA 1V47A 2BOVA 1YZQA 4D4GA 3IR6A 1SULA 4RSHA 2B7LA 3KHSA 5GGXA 1E2GA 3WRXC 3BSFA 4YJDA 3AB3A 2RAFA 2A9KA 1JDNA 1ADBA 4DT1B 1FYVA 1EHYA 2E4UA 4HWOA 1MQ8B 3LSTA 4EVQA 5SV2A 3U48A 4F04A 2DFVA 3VGJA 1AHHA 2D4AA 4JP2A 1MO2A 3IP1A 2JAPA 5LWHA 1CZRA 1ZBQA 5DBOA 4KHZA 1PJ3A 4M54A 3WYDA 2FUG1 4D3XA 1RWNA 5CUQA 3QP9A 5CB8A 3N8KA 1YRQA 2EKPA 1REQA 5CCDA 1PLJA 2LDXA 3F4KA 5I7RA 5KZMB 5DSXA 1N5JA 4RD3A 4AF6A 2WKWA 4N41A 2WYWA 3OCWA 2WMNB 3F1LA 3LF2A 3UJHA 3WNCA 1X77A 2A5GA 3ZHYA 5KWJA 5CX1A 2IWHA 1U4NA 1XN4A 4AN1A 4IHJA 4WZBE 3TCXB 1RWPA 2D3WA 3PDUA 4PIVA 1BS1A 4XX0A 4Z54A 4UBIA 4MPRA 3PXEA 4YCBA 2JATA 3KOOA 4E5YA 1VIVA 3GF4A 3O0DA 4JEMA 5LNK6 1P8AA 1HPLA 1KVSA 3A4MA 3Q3EA 5HRAA 1LFDB 5A4AA 4Q7JB 2IU3A 3DMHA 2PGLA 2B7BA 1QYRA 3GT4A 4BO0A 2ACKA 2G8NA 5FH9A 1ZOOA 3K6JA 4LDAA 3U40A 3PFFA 3RYCA 3FA2A 4MVJP 4D8YA 3OFJA 1EX7A 3CPEA 4QFDA 2A5YB 3CF2A 3O31A 1V5EA 3BYZA 3E1GA 2EQAA 3QVMA 4URWR 5EIFA 1YA6A 1W48A 3S70A 2FYTA 3HFRA 3U44B 4HF7A 3RROA 1KNXA 1RJ9A 1UOEA 4P1ZA 4CL8A 4PNEA 3VKGA 3SK0A 3PWTA 2BDEA 4IUYA 4TMWA 4CT0A 3EEBA 5DN6D 2D7CA 4GD3Q 4LYDA 4POAA 4PVCA 5T64A 2DH6A 4K6HA 3A6ZA 5KVSA 3Q0IA 1E8NA 3DZCA 2R751 1X7XB 2YXLA 3DGFC 5AKZA 1MW9X 1WMFA 2IL1A 1YHYA 3GRPA 5CHEA 3SXUA 1P60A 4WKOA 1GUDA 1NF8A 1QE5A 3LPMA 1E3LA 1W88A 3PPIA 2PSHA 1VIAA 4MV6A 4I4TA 2OB2A 4DW8A 4DEXA 5IKEA 4EHJA 1Z7GA 4EUHA 2H3EA 4RH3A 4AIIA 1XMXA 1E58A 5I7EA 2VKTA 3H5OA 4UVEA 1ZJ5A 1LQUA 5DYIA 4RKQA 4RK5A 4OUDB 1P1IA 1OH6A 3GPIA 4FILA 4QYWA 2II6A 2W7TA 5CXQA 3FWPA 2QP4A 1LS1A 3CVUA 1U3CA 1GZHB 3X1ZA 4XGRA 1LLUA 4JIMA 1SQGA 4OIMA 1KE2A 3P8ZA 3S2FA 1GTMA 3BE4A 1PDOA 4JLKA 2GEBA 4Y2UA 2QW0X 3CE6A 5ALEA 3LKZA 2VS1A 5F7ZA 3H1PA 1R37A 4EJ2A 1Z47A 1JQJC 1KJQA 2DKFA 3NI2A 1HK7A 4GM0A 1XZNA 4KVGA 4NLLA 4PNHA 3K92A 2X2PA 5BWCA 1P1CA 4QJIA 5JS1A 4HCJA 2ORIA 1U7WA 1U6JA 2FPUA 2X40A 1Y5MA 2IPLA 2OCKA 5DN9A 2WWHA 3SM9A 3TR5A 2FKNA 4CDRA 4QYMA 2P6NA 2IXTA 1LRLA 1K0UA 1E4YA 4ZZ2A 2HCBA 5JS8A 4C5AA 1VL8A 3VH2A 1X2BA 2FZGA 2KPOA 3DZHA 1H65A 2J3KA 4D26A 2OCIA 4CU2A 1NNLA 2O3QA 2CLCX 2COUA 3BX1A 3RSFA 1LW6E 2DR0A 2MYUA 2ZJ7A 1QQ5A 4MWGA 4HEA1 1RC0A 4BEWA 2R00C 2UUBB 1FQOA 3E15A 4GX5A 1J23A 4PLGA 5CT8A 1Z15A 5ER6A 1UBTS 3KR2A 1UJBA 1E9SA 3BIWA 4G8JA 1TI7A 3LCMA 2HJSA 3ZV5A 1HFEL 3MGKA 1COWD 2Q3FA 3TZCA 5KWIA 3UWSA 2DMRA 1BDHA 4AC9A 2Z6AA 3NNDA 1FVFA 2WAXA 2AJ8A 2PJDA 4RPLA 4TPKA 3LNCA 4D74A 3V7NA 4LE0A 2PH7A 1C8LA 1QV7A 1QYXA 1RHJA 1BTOA 2B2XA 2XCOA 4HWRA 3UM9A 2OZPA 3EA4A 1M1XB 3TM4A 3HBFA 1FK8A 1WY7A 2C4VA 4UU8A 3EBLA 3GEBA 3BAZA 4RKFA 5HUHA 2PFKA 4A3SA 3F7NA 5J2TF 2NZXA 2RD2A 1JX6A 2Z5VA 2OAEA 2CFOA 1GR0A 3GFBA 1P31A 4JU8A 1Y4AE 1XCBA 2WJJA 3O6VA 1ENZA 3E05A 3QLUC 5EJGA 4NENB 4NOJA 4ZTBA 3I9KA 4DADA 1CDEA 2PMFA 3H5RA 3OM1A 5CNIA 1K7FB 3I2KA 4WZZA 3P0RA 1L7PA 1QFSA 2OFOA 3DLTA 3P2IA 1CS0A 1RPTA 4HXEB 2A7QA 1G20E 2QAGC 3AILA 2IEIA 4LRSB 4OGWA 5IUKC 4H1UA 2XGJA 4PYQA 1YR8A 3ZGNA 5LP1A 3RADC 3WLNA 1DKUA 3JYNA 3W1EA 5JH7F 5KYYB 1GQOA 3NW9A 2JLAA 4R3WA 5JISA 1NYLA 3QVVA 3DW3X 1RBYA 5LQDA 2B2NA 1AS0A 1T0BA 4F45A 2PX3A 2WTBA 1G5IA 3BWYA 5HYVA 4DL9A 2ZWAA 4TLAA 2BFCB 1YWGO 3SBDA 3CG4A 3WWDA 4F97A 5JLJA 5H59A 1K9VF 3STYA 1DIHA 1GZSA 1UPCA 2VH1A 4ASUA 3HJTA 3M1IA 1UBRS 1KY2A 4MB6A 3T7JA 3F6RA 3U9LA 3UJ3X 1NDQA 4MZXA 2JGEA 3HJRA 2HQBA 4I55A 4YJGA 1AXEA 2X8LA 3UWMA 4MHTA 2CVQA 5KAPA 4RZSA 1W2WB 4EY5A 5LQMA 2TMGA 3DAFA 3KSMA 3NBMA 1KQNA 3LLSA 1THTA 2G4CA 3HRIA 3HYRA 3RABA 1UBLS 5LDGA 1C50A 5B3JA 1VCIA 5EP3A 3QLTA 5F51A 4R71A 5F1PA 3ZDYB 1PJSA 4XSHA 3MSXA 3ZU4A 4RAOA 2EQ5A 4BB5A 2TMKA 1CFZA 4DUGD 1RS0A 1G3UA 1PTJC 1T2VA 2E82A 1HDEA 3EQ8A 3WO0A 4C3ZA 3LC1O 5THQA 1IEWA 1TQDA 4CTKA 3CWCA 5L8VA 2BGLA 4KNWA 3B51X 5ABPA 3ZHSA 1CUVA 3ON5A 5DTJA 2O4UX 2JCYA 3HU2A 2CVFA 1CQWA 3JQPA 4JGIA 2WIFA 5IJ9A 3HM9A 4EHBA 1N5IA 1FMJA 1WP4A 3JYLA 5CFRA 3R6LA 4OLJA 1QAMA 1MMFB 3HWRA 4P33A 5CNJA 4B6FA 2HBYA 3ESAA 3IRVA 3JQ7B 3QEMA 4K9SA 4K9RA 5CDFE 3HCOA 3D9QX 4P86A 4IDHA 4KC0A 5LUBA 2VQSA 1NN3A 5TF0A 2ZIEA 3UV6A 4BHTA 2CLDX 3UAGA 1HDRA 4ZMBA 3K71B 1XHLA 4GO1A 1V7PC 3LQYA 2PKWA 4UM9D 4RDIA 4XLLA 3BL5A 5ECWA 1IQUA 1T3SA 1WXWA 2IYQA 3PE6A 4KBFA 5JXWA 3H1EA 2M6SA 3DQQA 2BFBB 2YOHA 1IG3A 1PZEA 3KHKA 1D8AA 1FDVA 4JASB 4WBXC 5D5HA 1KZHA 1VHJA 3M3PA 4M7RA 3ZDAA 1NBIA 3VBCA 5LJLA 3RGWS 1LSJA 3CJTA 1RWXA 5J1SB 3QY0A 5LQCA 1PT8A 2CE7A 2BMWA 3C4VA 3JV7A 3U31A 5JWRA 1CNFA 4RGQA 3M6MD 5IAGA 3T6KA 8LDHA 3NIGB 1OLXA 4MP3A 1E7MA 1Z07A 4ZOQI 3PNVA 2W37A 5K8CA 5B1EA 1QP4A 2UAGA 1PT9A 4EY4A 5BR8B 3FDZB 1E96A 1EM8B 5A06A 4HC4A 4CF5A 2GTPA 3KXIA 1JP7A 1EFVA 1WG8A 2I1WA 2KYRA 3BC1A 1R8SA 4UTRA 5I5EA 5EZYF 1Y6FA 3LPDA 1GAXA 2KLBA 4ZYLA 2NO1A 4O2LA 1HQYE 1BEEA 5H4HA 4JLJA 2EATA 2IOFA 3TLJA 4EI9A 1L9KA 2FF5A 2YFYA 3IHKA 3SVZA 4BAUA 3RWBA 4EUNA 3WHLA 4EFMA 1EP2B 1JQ3A 3WWPA 4CKBA 1AO0A 5IVIA 3Q5GA 4JXJA 2LXNA 1QOQB 3L3BA 2P5SA 2DBZA 2WMDA 4IRUB 3G9QA 3ZEAA 2YFKA 4U4AA 2X58A 1V6CA 2ZTMA 2N42A 3EEIA 4W5OA 2P4UA 2BTOA 5KCMA 2D0DA 4XIJA 2JFVA 2HU5A 3JWGA 2NVUA 3T06B 1JQKA 2SICE 3VKFA 1T4CB 5FNVF 2J30A 4RE6A 3OQNA 2P0YA 1XMVA 3AP2A 2AV6A 2FEKA 2OHOA 3D7SA 4N3AA 4YJFA 4F2HA 4I1RA 2TMDA 4L2IB 5JDIC 4IIFA 4RNCA 1ZVQA 1Z68A 4KV7A 1CUJA 3ZK7A 4PRKA 3CZ5A 4RQTA 1T4DA 1Q3TA 3V4SA 4DIUA 1PAUA 2WQZA 1HORA 1T9AA 3NOOA 4MHSA 5A7FA 2OESA 2AI1A 2H4WA 1FE8A 2PT7A 5JDCC 5KTPA 3PFCA 1S1CA 3PEWA 1UKZA 1I9CA 1SZJG 3L0DA 1HM5A 2FW7A 1WNTA 1GV0A 5JCJA 1P4HA 3N2NA 1ZNXA 3REQB 4QDZA 3TR6A 1KHTA 4XJVA 3QX8A 1YDMA 2W00A 4QYTA 4NCBA 1DJNA 5D6NA 4BLQA 1NPDA 2IYYA 3GVXA 4XYMA 3UHOA 3TW8A 1BJKA 1EBBA 5AM3A 3GP8A 1HYBA 3OQPA 2VJAA 4FYJA 4BBAA 4PCAA 3KZMA 4WUVA 2MSEB 1PVVA 2NTVA 2OFWA 2ZIZA 1NXOA 3AUAA 3GRKA 1LBQA 1SBNE 4AF8A 1W73A 2KWIA 1FMCA 3B85A 2GK7A 3CRQA 3QBTA 4X6XA 4OI4A 2H16A 3LBHA 3VX4A 4BQNA 3DMGA 4BGEA 1AV7A 4GMDA 5A1TA 1PIWA 2QSYA 1P29A 1UZLA 1J22A 1LBIA 3M34A 4ZXFA 5IP5A 4EBFA 2OHIA 1H6DA 2XB6A 4CLXA 1SHLA 2XCQA 4Z4IA 1J0EA 1X1BA 1FNBA 2XE6A 4P93A 5KYVA 3R7WB 2O4CA 3CUTA 2G08A 4PG4A 2AKYA 4WCVA 4O08A 3KKKA 1QIDA 4A8JA 2AE1A 3D7MA 3QKWA 2OBYA 1EGMB 3OJ0A 4X7MA 3OE5A 5DE3A 5JI3E 5GVSA 2OZLA 2W6NA 2D5BA 1Y82A 1F60A 4KO2S 2ZE5A 3UJDA 5I51A 2A9VA 4G1MB 1ANKA 5D5PA 1ZD2P 3RU7A 1OGJA 3EXFA 3FR8A 2GDZA 1MB0A 2MR6A 3VZPA 4BVJA 2G1JA 3KIPA 3ZI0A 3AF6A 1WZ2A 4HYTA 1Q2XA 1ZMBA 3IOYA 4HAYA 3VZQA 3BIOA 3N0VA 1K2VN 5JNVA 1Q77A 2D2XA 1JHVA 3BMOA 2FW0A 3GUVA 1T9HA 1JBEA 5HS6A 3WYBA 5JAZA 1PFYA 1VLMA 3ASZA 3KP1A 2AF4C 1E6KA 2NYRA 1NI4A 1KVRA 2W98A 4LY6A 2E7ZA 1G64A 1BG6A 1Z7YA 2WJ3A 5D3MA 2L69A 3QEOA 4ZVUA 4HB2A 4YAKA 5IJWA 2IUYA 2J45A 1W0JA 2AK3A 3ZZ0A 3ZXSA 4IVRA 4OFBA 1MC1A 2AOUA 2BE9A 5FP0A 1V1MB 5ILGA 5IZCC 1E2LA 4QODA 4BL5A 1N2SA 4DC9A 5EHXA 1JZQA 2E89A 4LXYA 2PZKA 1OB2A 2HLDD 3LXRA 2H2DA 4ZJUA 4CF7A 1SCDA 2ZITA 1TQHA 3BSSA 4PHFA 5TY0A 3TZLA 4IVQA 4ZANA 4M3NA 4BO4A 5L6MB 2C54A 4ALNA 1A7AA 2WPDD 4J1TA 3LFUA 4ND4A 3Q0TA 4E1AA 2QY9A 1ML4A 5HA5A 4RZ2A 4KFCA 3RC8A 3WBJA 2OGUA 1XEWY 3AINA 2WUDA 4O3MA 1V1RA 2FAXA 5MGNA 3BH0A 3LX4A 5DK6A 2KMLA 4MCAA 5AUOB 5BN3A 3GLGE 3IL2A 1VHLA 2PH5A 1TXGA 2Q3HA 3HHEA 2Z57A 4NOKA 3NJ8A 3SKVA 3WKBA 5LWQA 2X0KA 4W6QA 2LCIA 2NTYC 3FFBA 3FF4A 3K2QA 3QFFA 5K09A 3SQLA 4RA6B 4YJHA 4WA8A 2VJMA 3BDAA 1DOZA 1Q57A 1Q7RA 3ANMA 3DVRX 1Z18A 1E9AA 3IO3A 3BJEA 4DUYB 2IJGX 1YBHA 4OQFA 3DCJA 1BHQ1 3P9PA 5BQ5A 5AQ1A 3THYB 1PTKA 3O3NB 1EFHA 4XXHA 4BJ3A 2O8CB 3N74A 2UXDB 1JECA 3EEYA 2H2FA 1ULAA 1FQWA 1SWVA 3I5AA 3VC7A 3MQFA 2PKCA 3JD2A 2HBQA 4BC1A 5CVJA 2IYFA 4KDCA 4P7GA 4ND1A 2F1KA 3MT8A 4XCVA 3BFKA 1OGIA 5FBKA 4DN6A 1JDTA 2FLWA 3B70A 2HTEA 3WISA 3FPSA 3UCFA 4EWLA 1FNSA 3GQBB 3CXRA 1Y3HA 3L04A 2HNKA 1NQXA 1SIOA 3VR4H 2HV9A 3SBXA 4D3FA 4G84A 4GXQA 1TLLA 1P81A 2D1TA 1ISIA 4EA9A 1YONA 2GCIA 4GLFA 4MIEA 2DWQA 3ZGYA 2JJMA 1T0UA 2QGZA 3DP7A 3IKVA 4P82A 1Q1GA 4A36A 4MVYA 4DARA 4I1PA 2BR5A 3LKDA 4C0SA 2W6MA 1D3AA 1IPHA 1F12A 1WPGA 1A96A 2L17A 3Q7SA 2OO5C 1SBHA 2R62A 5I45A 1TK2A 5SY9A 5HHTA 4GYJA 5CK4A 1Y8QB 4B3BA 2HI0A 4HDQB 2Z4RA 4ENWA 5IKPA 5K03A 3COYA 2NPOA 4RH0A 5IFKA 1C7IA 3IPAA 1W8IA 5DP2A 1PYDA 3K5PA 2P9HA 4CKCB 1UP7A 1UPXA 5T6BA 5CU7A 4B6QA 2GVDC 5BUQA 1ZQ1A 1L7RA 3QXHA 4EPVA 2QS9A 5FL3A 4F7WA 5BSEA 2DUUA 4JI2B 3VX3A 1DL5A 1L4NA 1J42A 1YULA 4UD2A 3VJKA 1YCHA 3I0ZA 1SIBE 4S1OA 4MQ6A 1WCIB 3BE8A 2VBCA 2O1SA 3BWVA 3TB4A 5FNVB 2YOFA 3ZG6A 3IUSA 3WKAA 1LDYA 2I3AA 4FFNA 3TIFA 4UQOA 2DETA 3T3DA 3WL7A 5HPYB 1JMKC 1GD1O 4FX5A 2QK4A 4HQ6A 4PYNA 3PUVA 1Y3AA 4M53A 4QL3A 1BXKA 2YV5A 1WMBA 2QN8A 1KOJA 5JE8A 1LK7A 2WF6A 3FOBA 4BZPA 4HDMA 4M88A 3GGJA 3BL6A 4OQDA 3OKCA 1MJHA 4URFA 3MOIA 1BCSA 1DJLA 4DQKA 1ZA2A 4MO9A 5GZ3A 4KJZA 1RCFA 5C8XA 3B38A 4F4JA 3T5AA 1BKDR 1SG6A 3A1TA 4LJ8A 3MZ0A 5FPYA 3TTYA 1QHIA 2E9SA 1U2ZA 4TZKA 3LOQA 4JJFA 4OU4A 5AKIA 1KORA 1NVFA 1GPNA 4MWSA 1JKMA 1VL6A 5CH8A 3AP3A 5A2GA 2XKBA 5BWNA 4OI0A 4OX9B 5ALJA 4B46A 4BZWA 1G7SA 2QW8A 1Z35A 2VK8A 3E18A 1M8KA 1CU1A 4RZQA 1SHTX 5ECGC 3WGHA 1KAMA 1PQYA 3EQ2A 4AX8A 2RDMA 2NOAA 3L6RA 1RTTA 3SHVA 4LHYA 1G21B 2XRMA 2JIBA 4Y6GB 4IVNA 3ODGA 4N8EA 2QTFA 1P7PA 4LHSA 2WJ6A 3UTCA 2H5JA 2V5UA 1O54A 1Z5NA 4IH4A 4C22A 4ZDJA 3VO2A 2Z8ZA 1E8DA 1BYIA 1W94A 2A1UA 2CLEB 5HDQA 3VDMA 4LY3A 1U7DA 2WYVA 5EWMA 4LTDA 1N0UA 4P35A 4P54A 4Q3KA 4F9GA 1TZJA 4O02B 4TVBA 3WLJA 5I9NA 5KPDA 4MP8A 1T9ZA 1JAIA 2EFCB 3O7WA 4KWHA 5FCDA 3DNFA 4E51A 1A9ZA 1PL7A 1KQPA 2XHEA 4AFNA 4JXKA 3DOCA 1J90A 4RETA 3EPKA 5AW8A 1DDGA 2IOHA 4OL0A 2N75A 5EJ4A 3U7EB 3WQRA 1XU7A 4YT4A 2OFPA 1OWOA 4HG2A 1PCXA 1IN8A 1RSZA 2J0UB 2FA9A 1H94A 1KETA 3Q6NA 4LJ6A 2D1QA 2RFLA 1V45E 2QN3A 1DRKA 3EFBA 3HBMA 2VF5X 4YRQA 3DXXA 1RHQA 3W6NA 1VC2A 3U7GA 1PBTA 4XFJA 4KIWA 3P2EA 1R8YA 4LJSA 4X8OA 2A0XA 2C84A 2D3TA 1LQTA 1I6WA 4HLQB 4L15A 3VAAA 4H2DA 1SXHA 2IA5A 3NXSA 4G1UC 1A2OA 2FW6A 4IM7A 5I47A 3EW7A 3EIUA 2Q7XA 4P31A 4CMEA 1POWA 4IJMA 4Q4AB 1R4MA 3KJNA 2OA0A 2O8DB 2IHNA 1D2HA 4DXDA 1CUEA 3BHJA 1CSEE 4PG6A 4DV3B 4BFWA 1UJMA 1C4XA 1SC9A 2H11A 3TW4A 4B43A 4AY2A 4D45A 3GLSA 5CRIA 2C5FA 5IF9A 3LBFA 1NV9A 3ZJYA 1ZOSA 1JIQA 1FTNA 4HWGA 4FDTA 3ZEIA 4BFYA 2D6FA 1P9WA 4QO7A 2AT1A 4UNSA 1P2TA 5CDUA 2D00A 4YP1A 2XZDA 4YP9A 4BX0A 1OFUX 1NMXA 3I4LA 1M2OB 3TRHA 2EBHX 4MA5A 2QKYA 5KJCA 1T6NA 5LMCA 1RXUA 1QO0A 3DL4A 1SC1A 3UGJA 4F84A 3CVYA 2ACVA 3W8DA 2NQ2C 3UENA 2MINA 5TR9A 3UXEA 1IY2A 4DLLA 3FNEA 3FCXA 3RIHA 2XITA 5EG5A 3RVKA 3CVVA 5T6MA 3TSAA 1GXSB 1VRVA 3PWSA 4RAQA 4W1RA 3RS2A 2E21A 3NT2A 2DJIA 4C4XA 4K9MA 1J9GA 4RHEA 5HKBA 1NWCA 3VNRA 3BF8A 4JP3A 4RJJA 5KQSA 2VPWA 3IBGA 4I5DA 4DG9A 4DA8A 2FU5C 1YBFA 2D2VA 2I22A 4LX0A 2W93A 4IQ0A 1Q0RA 2ZB3A 2E37A 2VK4A 1FXUA 2QP3A 4LOLA 1A4IA 2CNDA 1POXA 2O1XA 3HJAA 3ONWA 4H7HA 1HLFA 4A92A 1G7RA 2FWPA 1NGSA 2V7BA 3INTA 2DERA 5JLAA 3G9TA 2NV6A 4YRGA 2Q6OA 1CULC 4Z1MD 3SICE 3OU6A 4OAQA 2ORED 3HVIA 4UM8B 5JRZA 2O8BB 3KPUA 4R1UA 3KS9A 3EWNA 3P9SA 4WKPA 5DIZA 1JLLB 3L7LA 3IQGX 2Y66A 4P2GA 2V3CC 1U7HA 1GCIA 3AEXA 3P5BA 1SPBS 2RJNA 5L3QA 5AOBA 1EVLA 5EKTA 5ADHA 1W85A 3D3KA 4Z6KA 1RRMA 4TYMA 1FFXA 3I6ZA 1XJQA 5AI9A 1Z34A 1RAAA 1OAAA 2JL1A 2QIPA 2R7KA 3CN7A 3H5NA 4RD1A 4Y0AA 3I2GA 2XXAA 2O19A 4C0HA 4NY1A 2A92A 3KYCA 2BCJQ 2P5YA 2ZJOA 1YZUA 3FI0A 4X1YB 2W2KB 3TO5A 5K8IA 5TQVA 4AY4A 3U3RA 1VZ2A 3AWDA 2N3ZA 3W8NA 1M2JA 2EP8A 4EDHA 3QV1A 3G2QA 1RACA 4AKIA 4K9KA 4J0JA 4FPXA 1TQ6A 4WVLA 5BNFA 5DHRA 3BXGA 2ZJFA 3MW8A 4FI3F 4GX0A 1I0ZA 3K9LA 1FUEA 4G0OA 2CKDA 4PM4A 4ZOLF 1QJCA 2VNHA 1JDVA 2QTHA 3ZGLA 2PCLA 1JWBB 2IZOA 2J6BA 3GJZA 4IV8A 4J7CA 4L51A 1DBSA 4D3ZA 1ORDA 1CJSA 1G9SA 4YLGA 1WPRA 3L6BA 2Y4NA 2YC2C 1L3CA 3NHBA 3SSOA 3PX2A 1KO7A 1L4BA 5HCUA 5B55A 3Q8LA 2QX6A 3R9XB 2DB3A 4DG8A 4YRCA 3N0TA 1Z26A 4A27A 3TRFA 1QTIA 5JQGA 2EGUA 2Z2JA 1F4PA 1ZVJA 1EFPB 1OJLA 5BQPA 1MHTA 2AR0A 4PAOA 1IUPA 3NKFA 3QFTA 1BQEA 2VZLA 1NFRA 2J3DA 1M34E 5DT9A 2W6JD 5B2ZA 4BCDA 1CUWA 5K6AA 3BK1A 5KKNB 3O4IA 2UZ4A 3A4LA 3CGWA 4PHGA 2YRWA 3UMMA 2VUTA 4F4UA 3QIVA 3W0LB 3L0OA 4YAIA 1HEYA 3VNQA 5KOJA 2RHMA 5CM2Z 1TADA 1SU7A 4BIIA 1T5OA 3CH4B 4DRXA 1CJTC 1VE7A 4TXNA 4UE2A 5ECYA 1YAJA 3AM3A 2ZPAA 1NVKA 1FS6A 1SK8A 2I78A 3RTCA 3VR6D 1ULSA 1G2IA 4R1NA 1K86A 3M6VA 3OUTA 2FGKA 4WRRA 5AM0A 3LQKA 4AS1A 1AK9A 4MW5A 4UATA 3URMA 1JKJA 2H52A 4IIVA 3D4IA 5CB4B 4R2KA 2I2WA 2JK0A 4FFBA 1AXGA 2A0FA 2O5CA 4QXPA 5CDHA 1QRUA 5JJLA 2VTVA 1CJBA 4HWKA 4G5GA 1P5HA 2FMUA 3FGNA 1FUIA 3VR2A 4GOND 1E1QD 3PC4A 3NONA 4I1UA 5IPFA 4XM0A 3ZCXA 1QH1B 2HXSA 5G4LA 2QE7A 3C3DA 3QBEA 4PLVA 5LFAA 1CQPA 2RSLA 2QTAA 1Y8ZA 3WWYA 2VHTA 1HO3A 4K1XA 1OXTA 4URYR 5JNRA 3GL9A 3IQHX 1KI7A 4KTVE 2J9XB 1QBKC 4ZGGA 2O8FB 3DD1A 2R6GA 1LPAB 2VF4X 1OQAA 3FOWA 2ONYA 3UGKA 4TKUA 3NDRA 3NQ41 3IP9A 2BKEA 3E2PA 4Q4CA 1FL9A 4AZSA 3WBFA 1XQYA 2J07A 3W5JA 2HD4A 3MTEA 4TVOA 3ZWYA 5BSFA 5JYDA 3DEYX 1E9FA 4ATNA 4QLBA 1CF2O 1N2EA 1EDDA 2Z43A 2RGNA 2JC3A 1N0IA 3ZW7A 4ZI7A 5JCZA 3BN3A 1RMTA 5E9AA 5C8YA 1UMCA 1A5BB 1AT1A 4Z4EA 3W9UA 1P2FA 1GGEA 2BEJA 2CL0X 3OF5A 4TZTA 4A0GA 4J2OA 4NNPA 3CG0A 1NW9B 5C37A 2OL4A 3PUJA 5AI5A 3B12A 4BLRA 4XWTA 3WGUA 2W8BB 3DV9A 3KTAB 1K5GA 4LDJA 2HSJA 3RE1A 4MWBA 1FDIA 2Q3CA 3C1OA 2HHAA 5JHGB 4BJ1A 1JJFA 3UA4A 3OICA 4BX9A 4QELA 1RRPA 4FUTA 1HDOA 4KE8A 3EEQA 2ZULA 5FQNA 3RRXA 5AR1A 2AHOA 4B2YA 4DLSA 2AG0A 5LU8A 1KMQA 3U3DA 5JO0A 2QD2A 2EQBA 5AW3A 1U7XA 1XNHA 4RA9A 3S1SA 1P0PA 2GEDA 4IXWA 4P4UA 4QWWA 4MPTA 3HEBA 1J2YA 1P61B 5BV7A 4QSMA 4EENA 3OKFA 3NHYA 4KIUA 2NU8A 3REFA 3ANYB 4FT2A 1G2QA 2AR9A 1MAWA 4UXHA 2Q49A 5F5XA 3C41J 3RSCA 3EULA 1DG1G 3UJ6A 4HX2A 1EVYA 1SVLA 4IXNA 5C52B 1E1CA 3N7AA 3RQIA 5IG2A 1ECCA 2GK3A 3I01M 1VE3A 4EA8A 2B36A 1QVZA 1R1DA 2W0MA 2XQFA 1NXPA 2ZWIA 2Z1DA 4FJ2A 4KPUB 5IAEA 1MAUA 3R7AA 5AW1A 5AI6A 2FX2A 3CLTD 2OZKA 1HC7A 4FYPA 1UT8A 2QL6A 4MR8A 1GGJA 4ZVPA 1UXKA 4AN0A 4XH9B 4I50F 1IHOA 1NUUA 2P30A 2RGUA 3SF8B 2EYQA 1XYGA 1ODSA 3PGVA 4LHEA 2RAUA 4OB6A 1OXBB 1TMGE 2QX9A 3LYHA 1MIOA 5B64A 1W581 2QZJA 4DYHA 4MOWA 1XCMA 1ONOA 1Y4ZA 2XRFA 1E9RA 1JV2B 5FBQB 4ZT5A 4YUZA 4N76A 3MTDA 1KZ1A 1ZHHA 4CT5A 3M82A 4RQUA 3FPEA 1WHSA 5L4NA 2PD4A 3IH5A 4RMGA 1NLYA 3WL4A 5JCOC 1AB6A 1AHPA 2XUPA 1PNTA 4FDVA 4JYMA 1X42A 4BEJA 2OLKA 2JRCA 4CKEA 3W78A 3CLKA 5FWXB 1U8CB 4C4RA 4R9RA 3LUCA 4MMZB 1Z63A 1UDWA 1ORRA 1STOA 3IO5A 4FP9A 2QTZA 5JROA 1MVOA 4N3GA 3VHRA 3GLHA 3OE7A 1MX9A 4FWIB 4JBYA 2C42A 1MEEA 2YWXA 3AY7A 2GO1A 2B4QA 4I9HA 4XYLA 5L4SA 4Z9YA 1R18A 2FMHA 3BMNB 4ZYUA 1VSBA 1N7HA 3RUEA 1LBTA 4A7PA 1Y7PA 4J07A 4PYIA 4GEGA 5BV8A 1ZO8A 4JYPA 4XD7A 3ZU2A 4IDNA 3ZV3A 4MJXA 3BBLA 4PFKA 3V2UA 1NHWA 3S2SA 3UUWA 3RHSA 4H7KA 1SKYE 2BI4A 1QCCA 3CF4G 3CLTC 4UMVA 4CHTA 2NWQA 4PAQA 1RHRA 1ADFA 2BFNA 1ZXBA 2PVSA 1MDFA 1QRAA 2PGDA 2RGEA 2XMRA 3Q88A 5C46F 5ESDA 3VPFA 3M6XA 3S4YA 1NZFA 1YI8A 4QC2A 1H0KA 1KR5A 3P9CA 1X1AA 2J48A 3UO8B 2IDMA 3AFHA 3L84A 2FHSA 1AKEA 3AY0A 3ID6C 1GP2A 3PIRA 4KGXA 1SVOA 2N1BA 1A7JA 3D1VA 2W4QA 3WP1B 3ZDXB 2DXIA 3DFIA 4WN9A 3IVCA 5DXFA 1PDWA 4XA8A 1VIMA 2BT4A 1RZRD 3VU3A 2HYIC 2ODPA 5HFAA 1M0WA 1F5NA 1TYEB 2TS1A 3OEWA 4XCQA 3NHPA 4EW3A 5KWEA 4DR4B 1EI9A 4UFOA 3FVVA 3F3YA 1OXSC 4LTMA 2IEZA 2BC9A 4KWCA 5DYYA 5HF5A 4OXKA 4U2BA 2AMLA 1WRBA 3CNNA 3PNLA 5HZKA 3AR6A 5E6SB 2WUWE 3MS2A 4RCYA 2M1ZA 3UHPA 7YASA 3M9WA 4FZJA 3DONA 5GJVC 3PUXA 3WS7A 4F8JA 5C8VA 4V1CA 4QJ4A 2YIVX 1SKQA 4D8TA 1JVSA 1LNQA 2NUPB 4DSUA 5DTIA 3KUXA 2X4DA 4OM7A 1WMAA 2Z98A 3BH6A 4LZZA 4Z9AA 2Q1SA 5BSRA 1JWLA 4IX9A 2IOFK 2J5XA 3PD1A 1Z6TA 2JNWA 1ILEA 1XA4A 3IURA 2ACWA 4K1LA 2RH8A 3ABOB 3DE4X 2AW3A 5FLXA 4TZ6A 4LGVA 3G79A 4FQ7A 5K0CA 1WETA 1GPUA 3VRHA 1X1DA 2Z6QA 1JJ7A 2DLDA 3OEHA 2F3QA 3EFOA 1MT3A 1T5IA 5D7NA 1EG2A 1RQGA 2AN9A 1F9EA 3TVYA 3BRCA 1ENOA 1M1YB 5BW4A 2A0YA 1D6SA 1E6LA 1UT5A 1US8B 1SURA 1YK1A 5EMLA 4IWYA 2CHVA 4MA4A 2IGBA 1YQQA 4E5KA 3JATA 3MTQA 1WCYA 2DTEA 2HF7A 4YCAA 5AHOA 4AY5A 5KTYA 1LV8A 5DCLA 1TEVA 1DBIA 3C3PA 3T1QA 4F96A 4KL8S 2WWVD 4RY2A 1WLYA 3C3MA 1I2AA 3ABSB 4TTRA 3EIFA 4HEQA 1I01A 3D0OA 1JR6A 2OHXA 4DBLC 4YS6A 1B76A 1A4RA 1DC7A 2AFRA 2ZT6A 3C6XA 3NAMA 3RSHA 3UMGA 4BV8A 3L8FA 3THWA 4X85A 2BHRA 1IU9A 1TLFA 4M9SA 5GOTA 4Q9LA 1G3IA 2WWTA 2ZSFA 3N39C 2HSGA 4HEHA 4XIYA 2D5AA 4AN4A 1GUAA 2FCRA 4D0GA 4MVJD 3W3AA 4LWPA 1GFIA 1M83A 3O9ZA 4XJXA 2BI8A 1C0KA 1HNNA 1ZN7A 3DYBA 4P4TA 4WIAA 4XGIA 4ZDKA 4RULA 2ZJ6A 3CW9A 4OL9A 1PN3A 4PSVA 1AQJA 2AFIB 4LHWA 3OCVA 1IRXA 3ONVA 4KI7A 1HYQA 3UH0A 4A0RA 1HFWA 4E4RA 1SXJA 3KD3A 1TNDA 2H00A 2EYUA 4XUDA 4XSVA 3ZY6A 1MQ9A 2UKDA 1TIBA 4AP5A 2K4MA 5BSVA 1KU0A 1XD9A 1NW6A 1R27A 2IXGA 2XX3A 3B2NA 3LDAA 4H7JA 4QNRA 3SFZA 5T4HA 3QQPA 2ZB7A 1W47A 3B2EA 2B37A 1T3TA 2W48A 4PRLA 2G6TA 3DW1X 3V8QA 1V9CA 3BTVA 5A62A 5IDQA 4FHDA 5K8LA 1Q11A 2V6JA 3IDQA 4O8ZA 1G4UR 3TQIA 4A2QA 3DBRA 3FHOA 1N9KA 1Y6RA 2ZE6A 3E3AA 1CXZA 3COPA 5A5EA 3OCYA 4L72A 1DAEA 1QHGA 1NAIA 3UCEA 5JXJA 2ZYGA 4OTZA 5CA0A 4NK4A 3D8BA 3UJ7A 5SZKB 4FMCF 1TT5A 2PM8A 1CP3A 4BQSA 3ZV7A 4BLSA 4KE9A 3VYRB 2UVPA 5JC1A 2YIDA 5CYOA 1U0EA 1ZI8A 3PHCA 2QTTA 3EX7C 1AVTA 2I3DA 1BCRA 3A7DA 5KWSA 3LTEA 4RMJA 4I5IA 1PG5A 4OMCA 1KMCA 3BSYA 3DBLB 4XUGB 4PSDA 3SSNA 3U7FB 3UAYA 2WP8J 5T57A 1GTZA 4N5IX 4BJ5A 1U4SA 1I7LA 2ZBDA 1PJ8A 4BQOA 3U0BA 2WLSA 1FLDA 3FLAA 3EXHB 1ZA1A 4LMRA 5FULA 2X4LA 3HV0A 2PD3A 3C39A 3ZZNA 4DPKA 3F5DA 5DBEX 5FBZA 3S81A 4LRUA 4M55A 5LB2A 1YR9A 2F4NA 5A3QA 1NBEA 2JW5A 4I50B 5AQEA 3ZXYA 3DDOA 2P9CA 1QPGA 1RRFA 3VOSA 2QTLA 1OA0A 1S89A 1WNFA 2ZYRA 3M4NA 1EAMA 3D4LA 4YO7A 2V55B 2WD7A 1I4WA 1ODCA 2NLOA 3EQ7A 3F0TA 1ZVMA 2JFXA 4UAJA 3PXCX 1XZHA 1TKCA 5EE0A 4L4YA 3WNDA 4D0LB 3EWAA 5K0LA 2PUBA 4GKKB 3IVGA 2BVNA 1KPHA 3V3KA 4DLKA 1A76A 4Z4FA 3DOOA 1NP6A 3C8MA 4XOUA 4D5GA 2IDZA 5F7OA 2FHPA 1UZMA 1ONPA 1Y63A 2OCYC 5LKRA 5C53B 4HN4B 5TQ2B 3O3MB 2CFIA 3OSZA 3SNKA 1P18A 5JIBA 1QHFA 3HB9A 5CD1A 4WZAE 1YH3A 4LBWA 1UK6A 4S1NA 3QU9A 1S3GA 4OQNA 1EEHA 1ZXXA 1NQOA 1MDBA 2Q9CA 1THMA 3MMXA 5I9TA 4ZEXA 2Y1CA 1QU3A 1GA1A 4GQIA 4J4HA 3KK0A 1S4MA 2MCFA 1TJYA 1FDOA 4QLOA 2D0PB 1DI0A 2I3ZA 1KYYA 1CQZA 3AHIA 3QUBA 2C7GA 3M6IA 4AJJA 4BKOA 4D8XA 1NRXA 1B2LA 1J0CA 1BW9A 1GL3A 2GO7A 2OBFA 2RJ3A 3DBOB 3ND6A 1JDBC 3HNOA 3PXBA 4JVLA 4MQFA 5G3ZA 1V5IA 1DDOA 1XD8A 2C83A 4IEFB 1KVUA 4Q00A 2MMCA 2OXEA 3EMVA 3UHAA 4W9MC 2QVYX 2WBLC 1RTKA 4ZQBA 3LCVB 1CEXA 1HLDA 4CMIA 5I9MA 4E14A 4PN7A 2K7ZA 4AB1A 5F2NA 2ES4A 2QMUA 4YUYA 1O03A 1GTSA 3V2GA 1TM5E 2DWPA 1XRSB 5DBGA 4MWOA 1Q7BA 1AGRA 1PFVA 5F7JA 3KE9A 4GWLA 2PKYX 4YECA 1W30A 4M0PA 2QVBA 2A4MA 1PLKA 3P52A 4WBSA 4KXLA 4QAJA 3G9XA 2VWHA 4YP7A 1KDRA 1CQXA 3IILA 4FUQA 3BZBA 5F1KA 3WGIA 1TK3A 2F00A 5DMHA 4W5QA 3GVHA 1L8QA 3UK6A 3C7AA 2NGRA 2HU2A 2H2HA 3DWFA 4JZYA 1KYXA 3K94A 5EJ8A 1BWSA 3KB2A 1OROA 2QG9A 1BGWA 5TEWA 4GMKA 3K05A 1DV2A 2IHUA 3VNVA 2XQJA 4NDNE 5EZ6B 3VKVA 2NO9A 4RS3A 3CLHA 4WXHA 3DWGA 3V2IA 3L07A 4B3FX 3NBYC 2F3PA 3OPYI 1A1SA 3ETGA 3UZUA 3GNSA 1KJNA 4IDOA 3NEPX 2BR4A 3WHKA 3GI1A 2JDID 3COVA 2BJHA 2GCOA 2O2XA 1CR6A 2G40A 2C29D 2RAVA 1R4NB 2CEAA 3L7OA 3QXGA 3GU3A 4FHZA 3PVSA 2ORYA 2R1ZA 2QM0A 3OZVA 2QPTA 3A1FA 5JALA 2JCSA 1MKYA 1NSFA 4EJSA 4ZU1X 1QF9A 3C3YA 4MICA 4UEQA 5J2UF 1RYNA 2XEXA 3GT0A 4K8OA 3BXZA 1RWVA 4WV3A 1XJ0A 1YUBA 4JA0A 1L7MA 4V03A 4LZWA 1L1RA 3WHIA 5I48A 5I9SA 3G02A 3WXBA 2ZRKA 5JZOA 1MB9A 2WOJA 3F90A 4Q34A 2B35A 2AX4A 4M0KA 3LO8A 3BFPA 5AUQA 5FOXA 1UANA 3TMAA 1TQ8A 5HOQA 5EP4A 3PP8A 2IS1A 1GDTA 3BRWD 3I2FA 3PFKA 3WL5A 2NZ8A 3H2HA 4M1QA 3H8SA 1JI3A 4P58A 3M1LA 3ZX4A 2GNPA 2VQEB 4P08A 1C8VB 1GSOA 1OF1A 5HQ3A 1V7ZA 5KTRA 4GGPA 5FA6A 5KNLA 3CKKA 4P2BA 1N5KA 2AI3A 1AUOA 4D4LA 2UDPA 1Q14A 2BIFA 1W52X 1RJGA 4E33A 4KEAA 1ULZA 5ALQA 3PX3A 4PLZA 3E8XA 2EIXA 2ZRFA 2QQ5A 5JI2E 4DQXA 3ZXUB 2GPTA 3DOHA 3GJYA 3NTRA 4J8PA 5EXEA 3CZPA 3MJ4A 2I03A 4YYZA 3QVJA 1R0XA 2C31A 1Y7IA 1OVGA 1S9HA 3THXA 2WSSA 4BEVA 4YQFA 2CLMB 5H8WA 1PJAA 4RLSA 5KTOA 4J0HA 3PI6A 5AJUA 1EUZA 1WJGA 3K53A 3E9MA 4JR0A 4TWAA 1CQJB 2AL7A 3L82B 3LT4A 3R23A 4OA8A 3RSGA 4CTNA 5JTTA 4WOKA 2VQFB 4LG1A 3G0DA 3KVVA 3O75A 5ALKA 1PX2A 3NHRA 4Q4DA 1B74A 4IYRA 2A57A 3WWZA 4ZYZA 5ITSA 1K63A 1E69A 3LP5A 5KVVA 2OQVA 4TS4A 2HFJA 3RIMA 3H2JA 3VR5D 2PANA 1FYEA 5CIQA 3O8RA 3DXFA 5SY6A 4XJSA 5B1HA 8ATCA 1MAAA 1U8UA 4RY8A 4PBSA 1VSTA 4R01A 4B2IA 2JASA 2ZVDA 2WYIA 3EF3A 4UE3S 3OMLA 4ZI3A 4D3YA 4DCGA 2F90A 1GITA 4R98A 2HWUA 3GK3A 5DNWA 3DZGA 5DYNA 4KXMA 4HUQA 4P4LA 3TSCA 1U2SA 3P4XA 3ZBQA 2ZU6A 2XVYA 5TX7A 1JIIA 1NW7A 1RLUA 3FCCA 4OGKA 4PGFA 2XTNA 3OQBA 4MEAA 3SZMA 4MUMA 4CM6A 2QENA 2D2IA 1Z2CA 3ZHBA 5BVHA 1F8UA 3A11A 2AXQA 2XWSA 4TSFA 3PGA1 3KEFA 3U17A 4QDOA 2AEFA 3L7BA 2O7RA 4G8DA 4R1QA 1RBQA 3A6FA 4RZUA 1JN0A 1NLMA 2ZRAA 3OFND 5CH3A 2JPDA 4B3JA 2P2LA 1DC5A 3K3PA 4ZV7A 2EKBA 3ROMA 2W2NA 4AP6A 1HZZC 1JR3A 1HV8A 1SCNE 5H82A 4I8XA 4DLZA 2LWIA 3HDGA 3CEMA 1N2GA 2A9RA 2G9VA 3G2HA 5CAEB 3THRA 3ZCTA 5E2AA 2IY8A 2GR9A 3GC6A 2AZTA 4PNPA 1WEHA 4X60A 1N7GA 1NW4A 1VFNA 1JHAA 4DSAA 2COKA 2CD9A 2LP4Y 1NY5A 2CK3D 1FW8A 4GT1A 5HMLA 2KLHA 3AIMA 1K06A 3KDAA 4PLCA 1C1DA 1UBGA 3GY0A 1SEPA 1QG6A 1SPXA 1GQSA 2OO7A 3TVTA 4HQFA 2QM7A 1FRNA 2M98A 5IBRA 4DS3A 1E3SA 5E1DA 2ZEJA 4IV5A 1JB1A 4C1BA 2CMKA 1DTWB 4DV5B 4NXNB 4WXYB 1XI2A 2WIBA 3JZMA 3EXAA 3VSBA 1U6IA 4RORA 5ALMA 2EGGA 1E79D 3BGIA 3ANNA 3NBZC 5LZ7A 221PA 4QOFA 1H2AS 1NKVA 3FKSA 4ML3A 4EJ0A 2FZLA 3H83A 3HUUA 4ZJZA 1KDPA 3JRXA 3IDFA 3R4CA 4RPIA 4S3MA 1G41A 1KAOA 3DAHA 4HH1A 1WXDA 5H9WA 4BXOA 4EO7A 5A3VA 1W4RA 3V00A 4YMUA 2AFHE 4EW6A 5G2OA 1A9XA 1DBWA 1S2OA 3D5TA 4NZYA 3PZRA 3I2HA 3R0QA 1SCUB 4HDSA 4KWEA 4N0DA 3BERA 5LZ5A 3RSSA 5BN4A 5A3RA 3R0VA 3IYLW 2EL7A 4QQ8A 3V34A 3FUTA 4IDCA 3A32A 4ETMA 4UFPA 5BPFA 1IVNA 1I1HA 1DTSA 4D9GA 2H4YA 1ILWA 2ZJ3A 2DFKB 3VYVA 2C5SA 4AD8A 1CEEA 2FMXA 3R5FA 3L4JA 3ZBPA 1R74A 1EX6A 2QG4A 2IIQA 4BNNA 1E2JA 1J5XA 3T5BA 5AH0A 3RS5A 4UHCA 3TPZA 1HE4A 1XVLA 2ZBFA 2I1VB 3P9RA 4BBZA 2NUAA 2RE8A 4EY3A 1P4SA 2R8BA 5HUJA 1AKUA 2CWDA 2GYVA 2OCDA 2XAAA 3OZCA 3ELYA 3QYAA 3CJRA 4BVLA 3U6BA 3JRNA 1E20A 2YS6A 3AHJA 1RPNA 2QW1A 3SAJA 4FB4A 1VXRA 2WZQA 2O6HA 1OA1A 3L0CA 4HQNA 4XQEA 5FUQA 4KR7A 4ZAGA 1HE2A 1BYUA 1L6RA 2GKSA 2QVXX 4X44A 3LIPA 2HO4A 1M9NA 1QF7A 3I04A 4O2BB 1TC1A 4Y2GA 5JY6A 3AVVA 1JU4A 4I4NA 2QRHA 1FFYA 4ZYTA 4U6SA 1FS5A 1QYDA 3PG5A 3PUZA 1XU9A 4HZGA 4NF2A 2Q3LA 3TZ6A 2OG2A 3WL8A 3COZA 3EZGA 1E2BA 1L7VC 1QGAA 2A4KA 3QF7A 4QQKA 3FWYA 4EI8A 2ZGVA 4W9NA 5E4FA 3AF5A 5E2IA 1GZ5A 1QNLA 3P2KA 1NQ5A 3JYPA 5KMGA 4RJ2A 3X1XA 4QGSA 1X7ZA 3SMQA 1SG9A 4GUDA 4Q24A 3ZVNA 4Y2QA 4XQ0A 1E18A 1N6PA 1SOWA 4JSYA 4L5IA 4P6VF 3IE0A 3RTGA 3STTA 1HSZA 3Q40A 4EMUA 1FW6A 1TO6A 4FVTA 1BDBA 3A6EA 3CONA 3MINB 3SQNA 3B1FA 3SFVA 1NNSA 2LRHA 2P65A 2HHCA 4DVJA 5EHNA 2O3TA 3EGWA 1T2FA 3WADA 4B1FA 1N3YA 3E7DA 5TE9A 1X7HA 2Q3EA 3HDYA 4NV3A 3DLAA 2JKVA 4BMCA 5A1JA 5BMOA 3CJQA 4PC7A 1Z12A 3L1IA 4O29A 4IIJA 3KEQA 4DKXA 4RVHA 4REQB 3UWOA 4M83A 1K8RA 2ANCA 4OAOA 4YCJA 2CJPA 2MYTA 2V6FA 1IHXA 2FWMX 3HJCA 2XADA 3JXEA 2H2IA 4MKIA 1N9GA 1FTWA 3JQ9A 3AQ4A 2C5EA 2VR1A 1IB0A 2X1HA 4Y2SA 5DTQA 4YYEA 4UTPA 3BK2A 3CY6A 4B3CA 2GH1A 2OCAA 1C30A 1FF9A 5SICE 2XYGA 3JD4A 4GNKA 2Q3BA 4IG9A 5G1NA 5GQSA 3NHLA 5ICCA 4B7UA 1PZGA 2PZGA 4LC9A 5IJ0B 1QOZA 2HIAA 4V2UA 5JSYA 4CFSA 5AVKA 1T9GR 3FTNA 5EQFA 5C3MA 4DMCA 2HCTA 4AMYA 1PRYA 5CVUA 3CUUA 1GEEA 4JB0A 1SUDA 4P4SA 1QONA 4D97A 5M2QA 4L8FA 3V8BA 2HX1A 3EVGA 1C7QA 2IYTA 3E7WA 1YMUA 2H1SA 2CFCA 4YAEA 1U2GC 2C96A 3ZBUA 4A23A 3QLEA 5KJEA 2OXRA 3S44A 2GERA 4CQMA 3EG9A 1T4CA 2EG9A 3SP1A 4G0UA 3ZHRA 2XMSA 4KXFB 3GDWA 1K7XB 4WOJA 2NP7A 5HXAA 4L2IA 4JT4A 4LXGA 3DB1A 4CLEA 4BRWA 3HP4A 5CMLA 1S2GA 2PWBA 1BN6A 1QIKA 2AJTA 3NP9A 3V8MA 3LX6A 5E0KB 5IWCA 2NTJA 3N59A 5I8ZA 4DMGA 4F4HA 1EH5A 4DDUA 4MQ4A 1T6BY 2CNBA 2J7KA 3ORYA 3WNZA 3K70B 3ZZMA 4FCWA 5EVCA 4BN0A 3CUYA 4AUKA 1AZLA 3DOIA 3IERA 2HRRA 5MF6A 4RHYA 2Y0CA 3PC6A 2QMHA 3ABRB 1ULUA 1C3OB 2FRXA 3BKWA 3ZD8A 2BMJA 2YZ2A 3ED5A 3FOFC 1EAYA 3GGDA 1M2WA 1Z6AA 2JGIA 2H1WA 3GZJA 4DF3A 4HMOA 3G8AA 4P3YA 2Z8YA 3H65A 3T9CA 3G1UA 2WY2D 4CM8B 4N47A 2G09A 1Y5IA 2R6ZA 3CT6A 4JC0A 3OQVA 4WQMA 5AM4A 3IVMA 3NMUF 3FYCA 2G1KA 3INYA 2J0SA 1A27A 2E5WA 4I4LA 3GAMA 1QLJA 3K0FB 2POQX 2QXTA 3DEZA 4HAUA 3QPCA 4KFSA 3X2FA 1EX9A 1QR6A 2I65A 3RGGA 1ZIOA 1EIZA 2YJ4A 2E18A 3O74A 4M87A 1DXYA 2FUNB 2H5LA 2IQIA 1TTPB 5K8JB 1Z3CA 1QM5A 1SUEA 2RKBA 4IDQA 5FA8A 3A1SA 5J2TA 3TUIC 1YQUA 4UVIA 1L6IA 3FWHA 3L0SA 1XPOA 1KOFA 1K6JA 5CHYA 1W5TA 3RB8A 3CF4A 2W6OA 3FHTA 5EUBA 1F4VA 4DJEC 1KPIA 4XYBA 1D2EA 5IVKA 2PKEA 4YALA 3P20A 4MS3B 3L6CA 2G7MC 2Z9DA 3TUJC 3WLAA 3WK9A 4DLTA 2B5WA 4UBJA 3GN1A 2QROA 4IR7A 3ROFA 1QXSA 7ADHA 3GFSA 4OK3A 1SA0B 4I2NA 3A4IA 3ZZ1A 1KVTA 4AO8A 2GK4A 4IS2A 4PXSA 2DT5A 6ABPA 1L4KA 2QD1A 3DKPA 2LKCA 5MGBA 1LTQA 1Z4KA 4EF6A 1XPRA 3KJFA 4HD8A 4MCJA 4DLUA 4LF9B 1I5OA 2P2YA 3AVQA 3F3SA 2G04A 5JH7A 2BBOA 5DT2A 4JI0B 1L5RA 5IVDA 1IZ7A 5LCXA 4K9LA 2H4ZA 3K9CA 4HH3C 2XCUA 4GQAA 4W7SA 5BRAA 5KC9A 1JG6A 3SFTA 3UOGA 1AH2A 5E38A 5HBRA 3HDVA 5TEVA 2GEKA 3CRNA 6CHYA 5LMNB 1SB8A 1X14A 1N7IA 2HA5A 2NPFA 4HS4A 5F2KA 1XR3A 4JX8A 1EBFA 3T35A 1B6RA 3UT0A 4C0WA 3A58B 3KB6A 3WRVA 3ZW9A 4UMEA 4YEDA 3T9AA 1H22A 1HL3A 1YK0A 4DLPA 4XLZA 2O6LA 3FSEA 4OP1A 4IV0A 3EFHA 4WOBA 4BNVA 2IP2A 2QRJA 1O94A 1RM5A 5A4MS 2I29A 4NK5A 1ESZA 3E58A 3CNQS 2XQGA 1J8DA 4QTXA 3GEEA 4M0DA 3H5AA 5D01A 1T5DX 3T5DA 3WLFA 4PX5A 1NVXQ 1G5QA 4BNJA 4C87A 1BHJA 5JYBA 2IBSA 4BEBA 3DD5A 3NRCA 1SKMA 1QB7A 2TSYB 5K3DA 3AHCA 1N8TA 4UCFA 4J7XA 1ZUHA 2Z04A 3QE9Y 4N39A 3ZPXA 4E70A 2CXQA 4E1BA 2LD4A 2R2GA 3DDCA 3RM3A 4NZOA 1Q22A 1PWXA 2C2GA 3S28A 1N78A 5I7AA 4EB6A 4DB4A 1IVYA 2VNJA 4CMJA 3F78A 5F3RA 3SQOA 1AKYA 1Q83A 2G70A 4J2HA 5ENVA 3PJDA 3OZRA 4CU5A 2PLNA 5KJ1A 5C51B 1FNCA 3PEYA 4JAVC 4Q16A 5HFNA 2PJUA 3SHOA 3FPFA 3LC7O 2GI4A 2XIJA 4EFKA 5FUMA 5K8UA 3ZGZA 3CA8A 3NM4A 4LJ4A 4NS4A 3QBVA 1WABA 3PZBA 3RNLA 3A1EA 1QDEA 1T4BA 2CVHA 1R5JA 1JIJA 1FUYB 4ZTZB 3AQIA 3T9BA 1Z74A 2Q45A 2AN5A 4ACAA 4O1IA 2QM8A 1GNSA 2ID7A 1A8HA 2B98A 2VQ3A 1F1BA 3O4FA 4DPMA 2MHCA 3DV0A 2HHHB 3A9VA 4Q1AA 4Q6WA 4ER0A 1MRNA 3GCDA 4B4KA 4EBBA 3BHMA 2OHFA 2X0DA 2ZR9A 4G8CA 4EJFA 4IMPA 1QKJA 2W6PA 1P44A 1ZJZA 3C5VA 4Q9HA 4ZZ1A 3RLFA 1C41A 5JRDS 2O2ZA 3BMCA 1Y4DE 3KT0A 1NVMB 3MGBA 4H6PA 4FGWA 3DQPA 2FPLA 4YCDA 4KRFA 1Y9DA 3KZCA 2GYYA 3FRIA 4KYIB 4LCEA 3ROKA 1KSJA 1UBKS 4K5QA 3IKTA 2P2SA 3TD2A 1DRJA 3T1OA 1BX3A 2HEIA 3GOHA 4YAUA 2ZJ4A 3A70A 1YL5A 4HAWA 3ZK8A 2QRPA 2M6LA 2IKSA 4GSYA 5EJMA 2C8KA 5JATA 5EZYA 2O2CA 4B3XA 1JXQA 1LRJA 1AQLA 1RYDA 1XDSA 2OO3A 4JODA 1VSVA 3USCS 3EAQA 2X3UA 2ON6A 3KRTA 4BO3A 4ID9A 1P1JA 4N12A 4EUKA 1HYEA 4BGDA 1ZJYA 4JLMA 3EXG2 1LZLA 5LIPA 5GADl 1GARA 4YA6A 1II8A 3UXHA 3DL2A 5LYJF 2JKYA 2VDNB 2YINC 4JROA 5JMPA 2UUOA 3IEKA 4DUZB 4GICA 2J4FA 3HXKA 4C05A 4DGSA 5ICSA 4WY8A 5AXBA 5DWVA 3BXHA 4MEJA 2PRKA 3ABIA 2GM9A 2FPIB 3E35A 3OPMA 4LXTA 3BHIA 1DQPA 4TLLB 4N65A 3PC7A 4IKPA 5HQJA 1T5SA 4QT4A 1N2OA 3TJRA 5AXAA 1IK6A 1T5TA 2PRSA 2B1IA 1YQDA 2HWKA 1FS4A 5AO9A 3V8NA 2XJ4A 3WV5A 4HWTA 3X2EA 3AEUA 2WWRA 3ZXIA 4ZGBA 1D6MA 1VB3A 1X8JA 1AGXA 2CW5A 2EFYA 2GKGA 2CN1A 3EZ9A 1IJKA 4JJ4A 4KWTA 2PJRA 4PYLA 2VDOB 4BN4A 3OOWA 1OHHD 3BWEA 2FZ5A 3E2MA 3GVIA 3GWZA 1ZN8A 4J6FA 1P2GA 2P9EA 1D5CA 3B6EA 1WZEA 2WYUA 3BPSA 4LHXA