4QLOA

Crystal structure of homoserine o-acetyltransferase from staphylococcus aureus
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
327
Chain Sequence
NYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRKDPAFLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of homoserine O-acetyltransferase from Staphylococcus aureus: the first Gram-positive ortholog structure.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords homoserine O-acetyltransferase
total genus 112
structure length 327
sequence length 327
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2014-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qloA00
2XMZA 4DLNA 3H18A 5T4HA 1Z68A 3R3WA 3V9AA 1Q84A 3G8YA 4L3WA 5K3FB 1BEZA 1BN6A 1MAHA 3TRDA 2AJ8A 5A7HA 2OCKA 4LIPD 1TCAA 2WIFA 4BAUA 4W1RA 5AM1A 3GROA 4UFOA 5AI9A 2VJAA 4J0JA 1QIIA 5CH3A 2HU7A 3WL5A 4BP8A 4U2GA 4KJXA 1XLWA 1Q83A 2C4HA 1R9MA 5AI5A 5HK8A 3ESCA 4E15A 1XZDA 4RNCA 1QIJA 5FRDA 3NUZA 1J1IA 2OAEA 2WHRA 1QLWA 3EF3A 4N5HX 4LKOA 5DYYA 1XZMA 2JGKA 1MJ5A 1UOPA 5A62A 5AI6A 3K2IA 4CG3A 1R9NA 5ALQA 5JZSA 1XZJA 3L1IA 1JJFA 4Y2RA 4B0PA 1YB6A 4QE3A 1QJ4A 3C45A 1UOQA 3FSGD 2I78A 2DQYA 2H7CA 1R3DA 4N8DA 1DU4A 3HXKA 2HA7A 2ECFA 3PICA 3H2KA 2VF2A 5ALKA 3WI7A 5JADA 3W9UA 3BWXA 1UT6A 1E5TA 2QOEA 4MEBA 1EA5A 1IUOA 5CH5A 3L1JA 2DCMA 1ZJ5A 4KAAA 1LPBB 1ODTC 4GHWA 4U2FA 3KOOA 1UKBA 4E46A 1UFOA 1QIFA 2NW6A 3E4DA 1EK1A 4BB0A 5AM5A 1JJIA 3WWEA 3C5WP 1FJ2A 1ODSA 4FLMA 2OGSA 2V98A 3I2KA 4UBNA 2WIDA 2WUDA 1H22A 2K2QB 2WJ6A 2XMBA 3DS8A 4X91A 2VQ6A 3F8SA 1XQVA 1ACLA 1J2EA 3WKDA 4MYDA 3CXUA 3ILSA 4J0DA 4WCVA 4CG2A 4MJ3A 4YPVA 2J3QA 3G0GA 2CMFA 5AI4A 1Y7HA 2WILA 4WY8A 1VOTA 3HABA 1CFJA 4C89A 2ZSIA 2X8BA 3QVMA 1ZD4A 3AIOA 4M0FA 1ZJ4A 2D0DA 4GXNA 1ZIXA 1XRRA 1IVYA 4CG1A 4CI9A 1A88A 2HRRA 5CT4A 1QONA 5KWIA 1DQYA 3RLIA 4X00A 1QIEA 1EB8A 1CUVA 4EBBA 4UHHA 4DGQA 2OQVA 2BFNA 3G02A 1CUYA 5SYNA 2JGEA 4QDXA 4EY4A 1CUWA 1LPPA 1EDBA 2G4LA 5FPPA 4TGLA 2QR5A 3WJ2A 2HA4A 1QO7A 5I9IA 1MAAA 2XUAA 3WL6A 3H17A 2VA9A 4FFVA 2Y6VA 4GBGA 5CT9A 5FKJA 1K4YA 1F6WA 1JU3A 4U2CA 2PVSA 2JEYA 4ZRDA 3GFFA 1CUAA 3ICVA 4WFJA 3PUIA 3RKSA 4V2IA 1USWA 4BE4A 1I6WA 2XUIA 1ZI8A 1PV1A 1ZD5A 2WFZA 2GYUA 4X6YA 3ZLTA 3D2CA 1OCEA 3DCNA 3BE8A 2IX9A 4Z49A 5BV7A 1L7AA 2VATA 2C58A 3WK8A 4BZZA 3SK0A 3G0BA 1E8NA 3VISA 2Z3WA 5C8VA 1RP1A 2HU5A 5HKBA 2VT6A 4PQEA 5EIAA 5T4FA 2GBCA 3WA6A 3H0CA 4UHDA 4X3CA 5C81A 4Y2PA 4F5ZA 4M0EA 4X85A 1XFDA 3LIPA 2LIPA 4UBLA 4G5XA 4P9NA 5HF6A 2G5PA 1CUHA 4Q1VA 3R3UA 3PI6A 5ALWA 4BAZA 1XROA 1E8MA 2P8SA 2WLSA 4L0CA 4FMPA 2AJBA 3GBSA 3ZI7A 4LYDA 1AUOA 4EY5A 1VXRA 3O9VA 5JATA 3U0VA 1UK7A 1W76A 4B0OA 1CUCA 1MO2A 4KR0A 4CCYB 2QZPA 4PSDA 2EEPA 1MN6A 3WZMA 4JYMA 4AZ0A 5LKAA 2XUDA 2WM2A 2Z3ZA 1H2YA 5EIHA 1AKNA 1NU8A 4OU5A 4JNCA 3BDIA 2W6CX 3V1MA 4K2AA 1EK2A 4DNPA 1TCBA 5FXMA 1LGYA 4G8BA 3WKAA 4G9EA 4KRYA 1GGVA 2RGUA 2J3DA 1R1DA 5CT5A 2CKMA 3S8YA 2XMGA 4XX1A 4S0XA 1LPSA 1QO9A 3RM3A 4QNNA 1SCQA 3MUOA 2QTBA 1WB4A 2XQJA 4JUIA 5ALJA 2ACKA 3O4HA 5ISMA 1CR6A 4X90A 3WWCA 2PSDA 1UKCA 5AH0A 1AQLA 4FDMA 1SOMA 4G1FA 3FAKA 1W75A 2PKYX 1WCYA 3WK4A 5ALLA 2H9YA 3SC2A 3VDXA 4IH4A 2G63A 4UBKA 1DT3A 3OOSA 2BUCA 2WG0A 3F67A 4QZVA 1HBJA 2XQFA 5JD5A 3PUHA 1EDEA 2ZVDA 3AFIA 5FDFA 3AIKA 4FOLA 2PSEA 1A8QA 3PFCA 3IA2A 4CCWA 3WYNA 5CT6A 4H7EA 2HRQA 1YS1X 1YS2X 2XMRA 4FBMA 3HJUA 1RYYA 5AK6A 5JAHA 1G5FA 4PNZA 5ALTA 1THGA 2QT9A 2RI6A 2PSHA 4H77A 4QWMA 4C01A 1U8EA 5AKEA 4F21A 5A2GA 4J0GA 4ARAA 4IHAA 5JZ9A 4CIAA 2EDAA 2ZSHA 2OLEA 3Q0TA 1XQWA 3ANTA 1VE7A 3ANSA 4JYPA 4DIUA 3M81A 5I8PA 2YYSA 3IUQA 5ALIA 3SX4A 1K8QA 3H1AA 2OCIA 3QMVA 3VVLA 3PFBA 2WU4A 2WTNA 4DYHA 5LZ9A 1QTRA 1ETHA 5D3KA 3W9BA 2Y2UA 1CUXA 2GBIA 2YXPX 5ALNA 4CCYA 2HL6A 3N0TA 4IH9A 2VAXA 3H04A 3N2ZB 1GXSA 1QZ3A 3EQ8A 2VJCA 4D9JA 5EHZA 2H7XA 5JD6A 3JWEA 1XRQA 1P0PA 5DTJA 3DNMA 3BIXA 3OG9A 3WKCA 1C7JA 4LXGA 1PFQA 2Y1KA 4YX9A 2Y6UA 1CUIA 2HIHA 2XQKA 3CN7A 2HDWA 3C6XA 5ALSA 3WQHA 5A71A 5AOCA 4K6HA 4N8SA 1FFDA 2Z8ZA 1UK6A 5C8ZA 4HRYA 4UHEA 3H19A 2XMQA 4Y2JA 3D2BA 4QLOA 5SYMA 3AUKA 1CUJA 3G0IA 3V48A 2CJPA 4B7ZA 4ZREA 4C4ZA 1EINA 1N8SA 4P92A 2I03A 4DMCA 3IDAA 2H1IA 4Y2TA 4QWWA 2ZYHA 1CUEA 3KWFA 1XZIA 4C6HA 1B6GA 1JI3A 2EDCA 4MQLA 1GT6A 2OXEA 2V96A 3WKEA 2C0QA 2VT7A 1CUZA 1YA4A 4MWTA 4FNMA 1X2BA 4KEAA 3HACA 5D7BA 2HA2A 2RONA 1A7UA 4BVLA 4WJLA 2PPLA 3VJKA 1DTEA 5E4TA 3AZOA 3FVRA 4KE7A 1AZWA 1IUPA 4YK7A 4K6GA 4UPDA 2DR0A 1G4HA 1Q0RA 3I1IA 5AKZA 3BJRA 1GZ7A 5HF8A 4H7JA 2QUAA 3R3XA 4DM7A 1LBTA 5ALYA 2ONCA 4E14A 5ALPA 3LS2A 2ZYRA 4EUSA 1XLVA 1UKAA 3DOHA 1HQDA 3V1KA 5CXXA 1MU0A 5HZGA 3O95A 1UWCA 2JIDA 4Y9SA 1YA8A 2O2HA 5AI8A 4DMFA 3K6KA 3EQ7A 2QUBA 3E1GA 2BUAA 4AMZA 1A8SA 4OCZA 3RK4A 3DKKA 3DL7A 4EA6A 3P2MA 1VLQA 4H7KA 2WQZA 3NGMA 2ZJ7A 2IIVA 4Y2XA 3WL7A 5DLPA 2QJWA 1UK8A 4HVTA 1IZ7A 2OCLA 5AK3A 1L7QA 4RE5A 5K3BA 1LBSA 4NS4A 7YASA 4KRXA 2OGTA 2HFJA 2I3ZA 3C43A 1QIDA 5AKXA 5AM2A 4GWLA 1FFAA 3LLCA 4P08A 4BCCA 3D4LA 4WDRA 1E3QA 4GLBA 5AI0A 4ZGBA 1LZKA 3C5VA 4G4GA 2DFPA 2PU5A 2HA0A 2BAGA 2WUFA 4Q3OA 2RHWA 4KYVA 1A8UA 2OPHA 2YASA 3AZPA 3TEJA 1VKHA 2CZQA 3BF8A 1R4ZA 1J06A 3WL8A 3IUNA 1AC5A 1CUSA 3A2MA 1EVEA 4BVKA 1TIBA 3FLEA 2BGNA 3ED1A 1VXOA 2XQGA 2XMCA 3FYUA 1GKLA 4Y2UA 4GI1A 1ZICA 4ZV9A 1CVLA 1KU0A 4B81A 1XRMA 4E11A 4OD0A 3HLKA 3C87A 1NU6A 3WK5A 2V97A 1WPXA 2WHQA 4J03A 1J07A 3VJMA 1T2NA 2Q0XA 3G0DA 4P93A 2WUEA 5JIBA 1DWPA 3DD5A 3I2IA 3WK7A 3A2NA 1P0MA 4OB8A 5ALFA 3EBLA 1AX9A 1EB9A 4QDTA 5CH8A 3I2FA 1NX9A 2C5FA 4I3FA 1QE3A 5ALMA 4FLEA 1P0QA 3DJYA 5EFZA 3I6YA 4UFNA 3WYDA 1JKMA 1MPXA 4X7BA 5FPQA 4A16A 4C88A 4BC1A 2WUGA 3WZLA 2PU7A 2WTMA 3C6YA 3KDAA 4UBMA 3F97A 5DJ5A 5E4YA 3MVEA 1KEZA 4G8DA 5EHQA 3C6ZA 3X3HA 4DMKA 2FUKA 4BRSA 4BTLA 3HC7A 1Y7IA 4UBOA 5CW2A 2XUQA 3I2HA 5AKKA 4B83A 4U2BA 2XI4A 1XKTA 3FWHA 3EIOA 4RE6A 5K3DA 3DYVA 5JZBA 3OURA 3BJMA 3D59A 1TK3A 2CUTA 3QH4A 5BWCA 1H23A 5AKHA 4Q05A 4G4IA 2GBFA 5JASA 3FLAA 3NWOA 2BJHA 4H0CA 3QITA 5C7YA 4WFKA 1THTA 1XZHA 3D3NA 3M83A 3DL4A 1VE6A 3IURA 3ESAA 5IVHA 2HA3A 2J4CA 2WJ4A 3WWPA 1ZI9A 4FNGA 3B12A 5ESRA 5IKXA 3G7NA 2WKWA 1WB6A 4HAIA 5JANA 4FTWA 2VTVA 5JAUA 4J0IA 3STUA 2WSLA 4ZWNA 3QYJA 4BZWA 1CQZA 1SCIA 3HEAA 3AILA 4DNFA 4W9RA 3DEAA 4NVRA 5LLSA 3SWWA 4QEKA 1BN7A 5JAOA 2BKLA 3ESDA 2QM0A 1MNQA 4BDSA 4XVCA 4N8EA 2HU8A 2XMDA 4PSCA 2O2IA 1QIHA 4ZXFA 2JBWA 2VAVA 2OAGA 5CXUA 5ALUA 2ACEA 5I7UA 3UUEA 2ZYSA 4X6UA 4I19A 4EB0A 3R41A 1FFEA 3STWA 3V1LA 5K5EA 4BP9A 4QLAA 1LPAB 5H3HA 3KWJA 3B3QA 2WFLA 4UHFA 3I6MA 1VZ2A 4EHBA 1YCDA 5ALOA 3I6ZA 2XB6A 5HCUA 3GELA 1DWQA 1XRPA 3YASA 4HXGA 5AKGA 2XE4A 3G9UA 1EHYA 1M33A 1YAJA 4IH1A 5AP9A 5DYTA 4ETWA 4AX4A 4MWSA 2XMSA 1XZGA 4NZZA 1OXMA 4OU4A 2JGIA 3D0KA 1VZ3A 2WJ3A 1U65A 4PW0A 2B20A 1XZAA 1ZOIA 3CCCA 3O4IA 3QBJA 2ZYIA 1BROA 1ZGCA 2JGMA 5LZ7A 1BCRA 1HL7A 2CEKA 1F0NA 1WHSA 5AKYA 2DQZA 3A2LA 4CFSA 3BDVA 2VJBA 4DNQA 5AKJA 3IULA 3GA7A 3OTQA 5LKRA 3H2JA 4TPKA 3ZV7A 3E0XA 3QM1A 4LYEA 3VKFA 5CBKA 5AM3A 4Y2VA 2WFLB 2C0PA 4B9EA 2O7VA 5FOQA 4H18A 5D6OA 5AKLA 3C70A 3I28A 4OUKX 3IBTA 2BGRA 3B5EA 1EVQA 1EXWA 5AK5A 5LZ2A 4L72A 3BL8A 2ORYA 3FCXA 1SFRA 2FX5A 2PUHA 1IZ8A 4RPCA 4HZGA 4BCBA 1Y37A 1WPRA 4K5QA 5K3EA 5AOAA 5DNWA 1C4XA 2C7BA 1EX9A 4AO6A 1GQRA 4G4JA 1HKHA 1GPLA 3D2AA 1E66A 2XUHA 4UBJA 3U1TA 3L1HA 3EQ9A 5LYYA 1GPNA 3PF8A 3QMWA 1X2EA 3W2TA 5K3CA 1UXOA 3AJAA 2OG1A 3FNBA 3S2ZA 1XQXA 5DNUA 4A5SA 1TCCA 2XUPA 1CUGA 5AHXA 4N5IX 4BCDA 5AOBA 1LLFA 3WIBA 4FWBA 3R0VA 3ESBA 3OPMA 5JAPA 4FHZA 3WIOA 1F8UA 5HFNA 4EY7A 1XLUA 1JFRA 3O4GA 5FUMA 5HFAA 5FV4A 4KE9A 4ITVA 5C8XA 3DLTA 3JYHA 3BF7A 1CUBA 3BXPA 1R88A 2JGJA 2HADA 3R3YA 2HA5A 4EY6A 4OSEA 1ACJA 2QMQA 5BWBA 4FBLA 1TAHA 3IVMA 3LIIA 4HS9A 1MNAA 2ZJ6A 1BEEA 5CT8A 1WOMA 2JGFA 3CCBA 4L9AA 1SC9A 5HF9A 1R50A 4H7HA 4B80A 4PSUA 3G9TA 4KAJA 3Q8WA 3PE6A 3E3AA 1PJAA 1HLGA 4AN0A 2OCGA 3DQZA 1QIGA 3WMRA 4GDMA 4BDTA 5AM4A 5KREA 3A70A 1FSSA 1MX1A 1WB5A 1LPNA 4MXDA 4Q3LA 1JT2A 2B61A 3STVA 1Q0ZA 2QJRA 1MT3A 2AJDA 2JGLA 3ICWA 3IB3A 1WM1A 1U2EA 3FYTA 3CN9A 2PSFA 4AO7A 5CURA 1DX6A 2GZRA 1UOOA 3HSSA 2DSNA 2UZ0A 5A6VA 2Y2VA 5HK9A 4HXFB 4X71A 1YASA 2E3JA 5LZ5A 3VVMA 2WFMA 3WWDA 5JYCA 1X70A 4LHEA 3I1YA 4G9GA 1N1MA 3W06A 2G5TA 3KXPA 3UMJA 3MUNA 4X95A 4M0MA 2AJLI 5DTIA 1E89A 1DT5A 1BU8A 2XQIA 1W6RA 1CQWA 2AXEA 3D5EA 2J4FA 5ALGA 1YB7A 1XRNA 4B84A 1QTIA 5ALDA 1JMYA 4J7AA 3R40A 1WHTA 3LCRA 5LZ8A 4UHBA 1CUDA 3F98A 3TJMA 1DX4A 3QMMA 4RGYA 1EI9A 2GZSA 2Z5GA 1CV2A 1H2ZA 5ALVA 5AJHA 4HXEB 1MTZA 3RARA 3F96A 3FBWA 4Y7DA 3C8HA 2WIJA 2XLBA 2O7RA 5JARA 1TRHA 4MEAA 4X94A 3UUFA 2BUBA 1XZLA 3WK6A 5YASA 4GECA 2PX6A 1ISPA 5DWDA 3R3ZA 1FFCA 3T4UA 3FYUB 2DHEA 4F0JA 1S8OA 2RHTA 1N5MA 3OM8A 4BE9A 3PF9A 1E8DA 1OILA 5K3AA 3W05A 3M82A 4X97A 3ZLVA 2GYVA 5IH7A 4ZV7A 4INZA 2V9ZA 4DMHA 4K6KA 4W1SA 3LP5A 5E4JA 4WY5A 3R3VA 5AIBA 3DDUA 1IMJA 2ES4A 4W63A 2FJ0A 1UK9A 4IO0A 5A7GA 2HM7A 3AINA 2BCEA 4LXIA 5ALXA 4I4CA 1F0PA 3G9ZA 1YR2A 3AIMA 1QIMA 5D3ZA 4B6GA 4BTVA 1KU6A 4YASA 4QDZA 2OGZA 5E2IA 3H2IA 1CPYA 5ALZA 1DWOA 2H7YA 1MX5A 4G8CA 4PV7A 5JALA 1EDDA 1XQYA 4EZIA 1BS9A 5AICA 2HFKA 4Q82A 2X5XA 3WKBA 4QA9A 5CTAA 4AZ3A 1H2WA 3STXA 4BBZA 1HDEA 2XLCA 1CEXA 4ZI5A 1ZI6A 1MX9A 3QZUA 4Y2QA 4OYYA 5DNVA 3OC0A 3ZPXA 3FOBA 4GW3A 1GPKA 1XRLA 1RWQA 2WIKA 3GUUA 1XZKA 4QDUA 1QFMA 4OPMA 4AB1A 2PSJA 1ZD2P 3I2JA 4AO8A 3O9MA 4J0CA 4X6XA 3D7RA 3F9CA 4W1PA 3IUMA 2PUJA 4FLFA 1U4NA 3WWOA 2WU3A 2WHPB 1AMNA 4MYSA 5ALHA 1XZBA 4PO3X 3C6BA 1JMKC 2C5GA 2HA6A 4DTCA 1N5RA 4FFWA 3K9BA 1GQSA 5IVIA 1ORWA 1QFSA 3AZQA 5K3FA 4WFIA 4ARBA 4XJVA 2JF0A 3M3DA 4FKBA 4A23A 4KAFA 2WIGA 4H7DA 1K6EA 1YAHA 2XUJA 1ZGBA 4OB7A 2QVBA 1W52X 3BIWA 4H35A 4EY8A 5CMLA 3NOXA 3FYUC 1BE0A 1AURA 2B4KA 2Z8XA 4CIBA 4OB6A 1EH5A 4C4YA 5HQ3B 5FP0A 3O4JA 1C7IA 2OQIA 1AGYA 4Q3KA 4JEIA 2FJPA 1QIKA 1JJBA 3FCYA 3VXKA 1CUUA 4BVJA 5EHXA 2I3DA 2XUOA 4H7IA 2R8BA 5F4ZA 2GYWA 2QS9A 1TKRA 2CB9A 1LZLA 3QPDA 5BOVA 5AM0A 4WDQA 1K63A 6YASA 1T4MA 4KACA 1VA4A 3HRHA 4DSZA 1JU4A 2QRUA 4HRXA 4J3JA 3ZWQA 3QPAA 4AQDA 1D07A 3H2HA 1VJ5A 2CBGA 5ALEA 1O6GA 5EI5A 3HYSA 1H2XA 5J3JA 4U2EA 4J0KA 5JD4A 1LPMA 4Y2YA 4LXHA 4C87A 4X93A 3FSGA 3IUJA 3W04A 1XZEA 3H1BA 4JH0A 1UZAA 5HKAA 1B41A 5AIAA 2VEOA 1ZIYA 1CIJA 1DQZA 1XZFA 5FLKA 5LIPA 5T4BA 2ZJFA 4IQ4A 5CRIA 2XDWA 4F60A 4Y2SA 3WJ1A 3FLBA 3WA7A 4B85A 4B82A 4DNOA 4HTAA 3DKRA 2XUKA 3G0CA 5A7FA 3PDCA 1TQHA 5AKIA 5EIEA 3DOIA 5DYWA 3FVTA 3WLAA 1XKLA 1CLEA 1BCSA 4UUQA 3STYA 5AO9A 1YSCA 4XWGA 1GKKA 1LPOA 4UHCA 1HPLA 2XT0A 3QPCA 4QDOA 4BAGA 3TGLA 2D5LA 3C8DA 5EGNA 2B9VA 3MGAA 2XUFA 1O6FA 3ZLUA 2W22A 2WHPA 5IVKA 2VJDA 2VSQA 3G9XA 1LNSA 3STTA 3V1NA 5KBYA 1XZCA 4OYLA 1ODCA 4BC0A 4UFPA 3KD2A 4TVKA 4KE8A 5LP1A 4Q34A 1G42A 4BRZA 4H7FA 1W1IA 2YH2A 1K5PA 4BYMA 1L7RA 1ORVA 2PBLA 1ZD3A 4NMWA 1DINA 2QKYA 5IVDA 1QGED 5KWJA 5AK4A 1CUFA 2HHAA 2IITA 3A6ZA 2DHCA 2ROQA 2XUGA 5LZ4A 2R11A 4U2DA 4GEGA 1FFBA 4XIIA 4BATA 2QXTA 2AJCA 2PM8A 2RIPA 1CRLA 1VA5A 2QXUA 2O2GA 2WG1A 1P0IA 1SCKA 2WG2A 1IUNA 2PL5A 5HQ3A 2DHDA 4AXBA 4X92A 4AN1A 1QOZA 4KE6A 4B9AA 4W1QA 1G66A 3KSRA 2X76A 3DYIA 4MQMA 4DSAA 4UBIA 3GZJA 3T52A 5T4EA 4C4XA 4ROTA 1W4LA 3IIIA 5HF5A 3WK9A 3VJLA 4PF1A 3JW8A 3O0DA 5EHNA 4J0HA 4AMYA 1BRTA 3I2GA 3H2GA 2GBGA 3HZOA 2JEZA 2RAUA 4O08A 3HI4A 5ALRA
chains in the Genus database with same CATH superfamily
1KK0A 2PWZA 2Y0EA 4JOCA 1Z4MA 4I5FA 1Z22A 5SY9A 3R3WA 1Q84A 1YMQA 4NU6A 4PGHA 3ND6A 5DYGA 4I1IA 3P2YA 1BN6A 2Y27A 4R7TA 4XD7A 2AJ8A 4DHWA 3QWIA 1LQ2A 1F4VA 1ZG3A 1SCJA 2VLIA 5A7HA 3PJFA 1YGYA 1PR1A 3U3RA 1UBSB 4R1MA 2YR0A 4K88A 4N1AA 2NU7A 1Y8QA 1ZUD1 3FI0A 3GXOA 3NBMA 4REQB 2QZ9A 4K9PA 4D44A 3IAXA 3QLUA 1L8AA 3V8BA 3ZIUA 2PZGA 4DE5A 3PR1A 5AI9A 2VJAA 2LCIA 2PXHA 1YNOA 4GZ6A 4B2YA 4YAGA 2L69A 2MIIA 2R60A 2AOUA 3HBJA 4BN0A 2J5QA 4ITUA 2BEWA 2HQBA 4D0GA 1QIIA 3IAS6 2OHFA 4NBWA 5CH3A 5CFQA 1KI2A 1OX6A 1KEEB 2CXOA 2OECA 3HADA 3OHSX 4KJXA 1Q83A 4O59O 4EI2A 2C4HA 4A4DA 5A4JA 1TAGA 1R16A 4XQCA 3FIUA 1E1LA 2WWHA 2PVPA 4EMBA 1NLZA 1YUBA 3K8QA 1E2MA 3G2OA 3U62A 4E15A 4KREA 1WCIA 5D3MB 1FC0A 3PNLA 1QIJA 1U11A 2PGIA 2OWDA 4K7JA 1E20A 2IW1A 2XRMA 2FFHA 3ABRB 3NUZA 4KH0A 2WHRA 5FRDA 5T7BA 2OBBA 4N5HX 3EX7C 2FPPA 4A0QA 5FI1B 4DBVO 5TR9A 3I62A 4XVHA 1XZMA 5HM6A 1XEWX 4XDYA 1AQ6A 1KMNA 3M34A 2QMOA 2WB4A 3K15A 1ZM3A 1JJVA 2O1XA 2UUPA 1E3TA 1Y4UA 4JUBA 4A03A 2Z2YA 3ZIAA 1SG9A 3UMBA 1Y7PA 3ASZA 3H8VA 4OHBA 1UXIA 1MW9X 3JWGA 4CG3A 4DM3A 3GPDG 1VC2A 1XEFA 3GT4A 3DW3X 4BQIA 3PIIA 4EL0A 1UDRA 1FBNA 1JJFA 3CKYA 3WNDA 4II2A 5E7JA 4TMXA 4PIVA 1U8YA 1MG0A 2Y1DA 3IQZA 4QE3A 4BV8A 5KHOC 9GPBA 2E89A 2XSZD 3PKZA 1QJ4A 1XDUA 4P2GA 1ZMXA 2WHYA 5HDQA 3C45A 3H9GA 3JSXA 4DIEA 2KMLA 4CTJA 1QQ7A 2H1HA 2X0NA 3DFIA 1U1EA 5CXQA 2OZEA 3RSLA 1C7RA 1KJNA 3H1PA 4RZUA 5LA6B 1U3TA 2ECFA 2YV5A 4IJQA 5G4KB 4A2WA 2XTZA 3H2KA 2IXTA 1D2AA 2QZJA 3B3FA 4WBNB 4BMOB 1J9ZA 2JLSA 1FLNA 1H4VB 1Y1KE 2TYSB 5IJ0A 5CLGA 4B6JA 3D3QA 2HMTA 1DC7A 1BVRA 1Y5MA 1M8PA 1BQ3A 2HT6A 4MRRA 5GONB 3W9UA 5L7WA 1G20A 2BTEA 4MEBA 1DHTA 1RSZA 1GTVA 4OHWA 5F2OA 5JMPA 3JRWA 4PE5B 2FP3A 1F0KA 1IUOA 2HTEA 3B7GA 3OY7A 4KPFC 4QGBA 2DCMA 4Q1FA 1ZJ5A 1T35A 1CJVC 3KC2A 1ODTC 2FDXA 1D7OA 2H8GA 4LI3X 1EWTA 2VF5X 1YFJA 5EP3A 4UEQA 1B42A 1MEOA 4MA5A 3AJEA 1NJGA 2FLKA 5I3CA 1PJ3A 2L82A 3LY7A 2W6QA 4NV3A 5F9MA 4GOND 2E2WA 3BFKA 1H9CA 1JJIA 4AIIA 2N1BA 1X92A 3AUUA 2YY6A 3ECAA 3C48A 1ARZA 3B1XA 4G1VA 4GZLA 2Q7XA 1M1UA 1MAUA 5CM8B 1VRCA 2BMAA 2ERYA 2JDIA 4I55B 4EGQA 1SXIA 3DAFA 4YJFA 4KIGA 3OE7A 3MGBA 5CYOA 3T3DA 4EG0A 4MS4A 1GPJA 2VF7A 1W9MA 1P61B 1AGXA 3B9QA 1KQFA 4KNYA 1V9CA 2CXHA 2FSVA 2XYVA 5EJIA 1WDLA 4OI1A 1LDYA 1NATA 3HFGA 3CYFA 1ZUNB 1US8A 2WJ6A 2XMBA 1XEXB 4MGKR 1YQXA 4X91A 2CFOA 2GPTA 1YB4A 3VR6H 2P2SA 3CZMA 3WDMA 5BPFA 5CA1B 3ZDBA 1BWQA 2IIBA 2PKQP 2VQ3A 4HFJA 1ADGA 4Q66C 4TKVB 2QX6A 3F8SA 4N54A 3RTCA 1J09A 1PT5A 1UT8A 2YWFA 3KSMA 1CQIB 1OYYA 4PLFA 2HT1A 4QTXA 1VYTA 2VHYA 2X2FA 3VX4A 4OQYA 1D5CA 1EP9A 3ZD7A 1Z62A 1JE0A 3QVXA 3PCXA 1TYDE 1ADFA 1FMCA 3AXTA 4DGSA 1AHPA 5CCDA 1LNQA 3ILSA 2QQ0A 4OGWA 4EATA 4AK9A 2FZCA 4E2ZA 1U0FA 5JVDB 2KYRA 3GDHA 4G4SO 1NJ5A 4WCDA 2H4ZA 1TPYA 3GFQA 4YPVA 1NRIA 2JHAA 5KUTA 4XYGA 3KL4A 3H83A 1ODJA 2WILA 2WSIA 3GLFB 4L8WB 5DOZA 3U61B 3RRMA 1XZNA 3GOQA 1CFJA 4MUGA 1KJWA 1PF7E 3U7JA 1RLTA 2O0LA 2ZE5A 3M6XA 4MB2A 1N3BA 4WA8A 5JEEA 2FFBA 4DR5B 3THWB 2BD0A 2VXBA 1ZD4A 2M32A 2WWTA 2C84A 3AIOA 3I0ZA 4QVIA 4RO0A 1ZJ4A 3FHCB 5T8KA 1ZIXA 4CTKA 4IICA 4TN5A 1JDBC 2GCEA 1R5NA 1VTKA 2AKYA 2EFGA 1A88A 2PYDA 2PZLA 1G3QA 5TSDA 1NHWA 3V80A 1R0RE 4HAOA 1QIEA 1EB8A 4EBBA 3LBHA 1DXYA 3ETCA 1GL3A 1ULBA 3CH4B 4UE2A 1KWKA 4F5DA 2IY8A 3O4FA 3SC4A 5C5EA 2NQ2C 4Z4HA 1SU7A 4ZAVA 3F7TA 2ORED 2O2SA 1Z38A 4QICA 1NRXA 4YFYA 3ZNNA 4KAXA 5FOQA 1CDOA 1W5TA 3CNNA 5B55A 2B8WA 1G21B 2RB5A 4FYJA 4TWAA 1H6DA 4I5GA 1JL3A 1D6NA 4FX2A 3N6XA 2W6JD 3VBCA 4IRMA 2BWJA 1V1JA 1GWNA 4N3AA 2HCTA 3LXXA 2QRMA 4TGLA 1E4OA 1L1FA 3RTEA 3ZC3A 1CJBA 2BFCA 3N74A 4JBXA 3TB4A 7REQB 4U7JA 5FL7A 3NCTA 3OMLA 1NF2A 4UD2A 3TX2A 3PU6A 4DRYA 3N3AC 2PH5A 5C53B 3PNMA 1XMPA 3H17A 3HMQA 3PR2B 2CVHA 3K6SA 3H4MA 3JQ8B 2JFFA 2OXCA 4LHZA 1QE5A 4LWOA 3RYHA 5FKJA 1K4YA 4CM5A 5LN1A 1P4HA 821PA 2BBOA 3MRTA 3UATA 3FNIA 4PYNA 3B6ZA 3BRCA 3D4NA 1RQGA 4BRWA 4ECAA 2BKUA 1U0GA 1F4PA 2QD3A 2CLIB 2QX8A 4MUJA 2OM2A 4KV9A 4ZRDA 1KE2A 4J8PA 2C92A 1F60A 1YQQA 3G49A 3P5BA 2D7DA 1VGVA 2DXIA 5KDOA 4V2IA 5EERA 3AWDA 1VGQA 3T1TA 1USWA 1JZQA 1GSOA 2RK6A 5D8DA 2XUIA 1K06A 1RCUA 1VL1A 1F9AA 1ZI8A 1DOHA 2RGXA 1J90A 3ZH9B 3BZUA 1OASA 4ZYWA 1TU3A 4NCJA 5BVHA 4X6YA 1FE8A 4EM6A 1C0EA 3WLOA 1F8FA 1ZXLA 2Q5LA 3BE8A 3WHKA 2IX9A 1L4GA 3BEDA 3BH0A 3H7AA 3B89A 3FPAA 4NG5A 4Z49A 2BEUA 1U1CA 3IPAA 3W3AA 5G4KA 1L7NA 3L4BA 4XWTA 1NNSA 1XSEA 2I0FA 4Y3UA 3WK8A 4EEKA 1PLJA 2F43B 5KTOA 5ENDA 2HQOA 2XOKA 2H07A 4R7ZA 3RUHA 1Z2OX 5B3LA 3GJSA 2CY0A 4L4UA 2HJHA 1QGUA 3MJHA 1RP1A 3HN2A 4ARZA 1V39A 3HVKA 3R74A 2P7IA 4B3HA 2V7UA 4B45A 1LUAA 3OCYA 3T7TA 3WIEA 2C77A 1E2FA 1IEVA 1NKSA 4RENA 5DLQC 3QYFA 4TTRA 3RSZA 3E8MA 3CLSC 3SKVA 5IKEA 3KXDA 2V1UA 5TMDA 4BMCA 3HGTA 4GOMD 2CMGA 2QZZA 1QRRA 4X20B 4BMYA 1JEYA 3LXMA 3ZYCA 3UH1A 4RXTA 1G8SA 1VMIA 1S2OA 4UTPA 4YJ2F 3B6MA 4O02B 3WA6A 3VPDA 3H0CA 5COQA 2CXUA 5C81A 3CWCA 4E4YA 3DBOB 4IDGA 3P9QA 1GOTA 1V0JA 1YL6A 2AT1A 4IJUA 3ISJA 4AY4A 4BFWA 1JSXA 4CT4B 2YHBA 1LI7A 2HF8A 1T9CA 1XFDA 4PPYA 4JJEA 5TARA 3UMCA 5LNK6 1WBJB 4G5XA 4QGHA 2DQSA 2G9UA 1JMVA 2VWGA 2HHCA 5HF6A 2OYSA 3WC4A 5IJ9B 4ND8A 1A9TA 3D0OA 2DEUA 2VCYA 1GGMA 5ABPA 2TMDA 3M4JA 3VDQA 5KPJA 4LY9A 3KVNA 1RM0A 3BRWA 3OZBA 1D0VA 2XZOA 5LD2B 2OMKA 3A06A 1Q1QA 1SGWA 5B3JC 4LKRA 2WLSA 5IG2A 1WB9A 3P0JA 2CT8A 5DBEX 1RHMA 1ST3A 3PXBA 1KOFA 3SSOA 1P45A 2QP3A 2EIHA 2QYOA 1HQKA 3LRXA 3GEHA 1ZSNA 1IJEA 2NO4A 3K6RA 4HAYA 1AUOA 4FS8A 1U9ZA 3DDSA 3JQPA 3CQ9A 1NFQA 1BAPA 2Q9AA 2YFYA 1KBZA 1QBKC 1JSLA 3KXLA 3O9VA 4FFDA 3CCFA 4AG3A 2BEUB 3PQ8A 5KNCD 1HG0A 3KXIA 2KJQA 4LSGA 1W76A 1GRCA 3AEKA 1MV8A 4B75A 1RLMA 2V7GA 3PJEA 5KTPA 4XR4A 4MMZB 3E6AA 3AW8A 4IDAA 2XWPA 3PFKA 1L4EA 5HX7A 5TJHA 4PICA 4EUFA 1MOZA 3WXBA 4PBSA 4TZKA 1D1QA 4CV3A 4OUDA 4YAJA 5J5AA 3WZMA 4ENRA 4DUYB 1MZVA 2H5EA 1V8BA 4UC0A 4AY5A 5HJ2A 5L3VA 3TZCA 1G7RA 2HNBA 1KI6B 1H2YA 1Z0DA 5ECGC 4ZTZB 1MD9A 3MS2A 3WGHA 3P9NA 1X7ZA 1W1WA 1GZ4A 3JRXA 2WOJA 2A4KA 4QBIA 5A3JA 5DM1A 4JBIA 3HNOA 4K9RA 1XQ9A 3HKEB 4JYBA 4LZJA 3Q5GA 3O2QB 1IM2A 2Q2WA 3LKDA 1CF9A 2I80A 2HKIA 4K2AA 4MWZA 2VRWA 2VDMB 4JZKA 2JHPA 2B99A 4DNPA 2Q2OA 2IH4A 1GCUA 3L18A 4GI7A 1SG6A 2X22A 5H81A 3ZCRA 1L7DA 2RDMA 4LOJA 3OFVA 1YQTA 1GGVA 2R1UA 1I6MA 4FN5A 4GR4A 2ADFA 4NV0A 1WCXA 3V42A 1S3IA 4DRXB 3UK2A 1J7KA 3L4EA 1R1DA 3DWFA 4Y6GB 1DKRA 3QUSA 4M55A 4QHYA 1RMYA 2KB0A 3T5GA 2QTNA 1T0HB 3VYSB 3T5AA 3S8YA 1XHEA 3BUSA 4IKEA 4XX1A 1ZRHA 5DHAA 2VHZA 1LPSA 5ELLA 5B1EA 5KSPA 3DHEA 1T8YA 1AHNA 4AJLA 1QO9A 2QSZA 4YDHB 4U3JA 3KZCA 4UU8A 2HRZA 1SCQA 1B93A 4IJKA 4Z9YA 4YO8A 1W36B 1WMSA 4R1TA 2JAHA 5GOZA 1OX4B 3FCSB 3B20A 3H9QA 1JDSA 2ACKA 2OFFA 1BE6A 4ZAZA 5ADUS 1AIPA 4GVPA 3BSYA 4X90A 4JN6B 1M1NA 1UKCA 2P68A 2R1TA 1JSZA 4HGYA 4JUCA 3BMOB 4R2JA 1NOIA 4DLXA 4JXZA 4MRPA 3BJIC 3BFXA 4DN6A 1OSNA 3C0KA 4YCCA 1E79D 1OC2A 3TLMA 3VO8A 3RU2A 2ZT6A 4L5CA 1PS0A 3LA8A 5T64A 1W88A 2OCBA 4YMUA 1NT2A 2ZXUA 3SC2A 1RQ7A 4DEVA 3VDXA 1P1BA 2F1JA 1TNDA 3KTAB 3SEQA 4IH4A 4DV2B 5TS3A 1O6ZA 2KBEA 6PFKA 2ADMA 4XFDA 1PL8A 4V3CA 3SOZA 5J4VA 4OHKA 1I4TD 2POQX 4UBKA 1DT3A 4WK4B 4EG7A 4EI7A 3OOSA 2BUCA 4H59A 5JNTA 1UJ4A 1SU8A 2J48A 1P17A 1XNRB 2OBMA 4PAWA 3F67A 4C2AA 5EKXA 4M53A 3WTBA 5TY0A 2XQFA 4MVJG 2EXXA 5A05A 3TLXA 2VH2A 4BQEA 3FPSA 1ZW1A 3DP9A 4RKRA 4Q9KA 2P9BA 2QTWB 1VGRA 1HOXA 3DOUA 4M7WA 2BFEB 2PSEA 1H6AA 1J2RA 3PFNA 5FFFA 5DM0A 4PN7A 1YULA 3ABSB 1ONNA 2J41A 2X0RA 2ZU6A 3F6SA 2D2EA 3PFCA 3KR9A 3JQAD 1NVUQ 4RVSA 2J9FA 1V8OA 2QM7A 4CCWA 3FDFA 5I7SA 1E1QA 4Z4EA 3HQ4O 1WZEA 1IZZA 3OLWA 1JAIA 1NP3A 4H7EA 2JBAB 1OBVA 2P30A 1SKYB 1E69A 2WMYA 4YEDA 1DXQA 4YRKA 2D62A 1YS1X 4FJ0A 1V16B 1KYIA 5B2FA 1WMBA 5IK2D 1JZSA 3OFKA 3GG2A 1F1BA 1UFRA 4FBMA 4UUOA 3QQ5A 4XD7D 1Z8DA 3V97A 4HAWA 5H83A 2WR8A 2FWIA 4Q9NA 4M3NA 3RASA 5K8JB 1OI3A 2JCXA 1EMDA 1D2MA 1JR3A 2W2MA 1YZGA 4A0SA 3JXEA 2V9CA 3DQPA 2Y4OA 1IH8A 1K8RA 2H48A 5HUHA 5AVRA 1L1EA 1DIGA 1ZXXA 2Q3CA 4IQ8A 1V45E 4RD3A 4JLAA 3CR7A 3OLQA 1RRKA 2IDJA 1O1YA 1IHDA 1Z17A 1J8YF 5G02A 3A6EA 4U7WA 1TLLA 1Y4AE 2IY9A 4JNKA 5CDGA 1UCFA 3O3MB 4FDVA 4ZVPA 5BQPA 1TI7A 2FQXA 1DEXA 4CF4A 5A2GA 3BHJA 4M9XA 4PSKA 4OXXA 4IHAA 5JZ9A 4CIAA 1N2GA 3CF6R 4EO9A 3H16A 2FU5C 3Q0TA 4XASA 3NUGA 1QTQA 2W93A 2PRZA 1VE7A 1SUCA 1W47A 1GXSB 5TLSA 4WLEA 4MQ4A 2Q3JA 3ZGYA 1EWVA 2WBLC 4D3SA 3EPJA 4YMIA 2EYQA 4Z1MD 4LY0A 4C22A 3CRW1 3ACDA 1DRVA 2GPAA 5DOVA 4EHAA 1ZMOA 1U3VA 3UHFA 1NVVQ 5LA6A 3H1AA 1EJ0A 4JI3B 2OCIA 3HTXA 1R3UA 3KB2A 1S2LA 4L8FA 4CV0A 3LUJA 3I92A 1JHDA 2WU4A 1WXWA 4KK4A 4XX0B 5E6RA 2ETXA 2D59A 1N6HA 4MGEA 4O4LB 4C4SA 2JLYA 1Z26A 2XA2A 3FX2A 2I2AA 2VBFA 5ER9A 2G71A 2RHRA 1L8XA 4LDRA 2ZVQX 3KAPA 1Q22A 3N0TA 5KC8A 5H3LA 4EOGA 4DQDA 1X3SA 3T7AA 5B37A 5JJLA 4DYVA 1GXSA 1QZ3A 3SNKA 2OC9A 2B21A 3IEKA 4BLSA 3I32A 2X4IA 2EP5A 3D6UA 3JD1A 4D9JA 1Y1SA 4V0ME 5EHZA 1GQ2A 1KXZA 1U9YA 2R8RA 4TWIA 5D51S 3U4CA 4L8LA 3R9IA 2ORIA 2F67A 2Q4EA 3K70B 2FFQA 2QEQA 2WE8A 1H4QA 3NDRA 1GYQA 1YXMA 4JQOA 5G2OA 4AIRA 3EXIA 3LG2A 1RTTA 4I1VA 1O0CA 2AG5A 4TL8A 3PUVA 2GZ1A 5C2JB 2DUJA 3LVRE 3L7BA 4G09A 1PZHA 4AZWA 4QYSA 1WXFA 4BO3A 4JODA 1NR5A 1XBTA 2C1XA 1YE3A 3I6IA 4KODA 3AERB 2JA1A 3ZHQA 1VPTA 1PFQA 2EBFX 1AS0A 2GBPA 1SXQA 4EEXA 4DLKA 5ERGB 1FFWA 2N0SA 1U7WA 2F64A 3SE7A 1T9HA 3TG8A 4NK4A 1K3UB 2HIHA 4LV5B 1QRTA 4QQNA 1V6AA 3EY9A 4EF6A 1KARA 1SWWA 2HDWA 1J9EA 1JDPA 4NMXB 4Y2HA 2VK8A 1T2UA 3THWA 3MJVA 1ISHA 4FCVA 3QFRA 4LOKA 3WQHA 4B6FA 3C3WA 3KB6A 3N2EA 1FFDA 2Z8ZA 1K5HA 2A4MA 3E1KA 3IUYA 4PAMA 3U5TA 3UANA 5F76A 1PWZA 4GP7A 4KBGA 4NFSA 2Y9MB 3W5DA 2YIJA 1JVNA 4C1BA 4C0XA 4R01A 4BKPA 1SQSA 2PMDA 3ESXA 4P7KA 5IM4F 1EVKA 5SYMA 3AHDA 2ZUVA 5EG5A 1O6CA 3K1YA 4HBZA 3J7AC 4XPIA 4NDNE 2NXJA 3G0IA 2PEZA 2WAOA 3ED5A 3V48A 1RYDA 4GKBA 2WPDD 4QD3A 4F4CA 1N8SA 2W71A 1T6NA 3HKCA 1GGJA 4NMLA 4RD4A 1JS1X 1TM1E 4UCWA 5EYPA 2R3SA 3VKVA 3ZWCA 5KOJB 2EHDA 4H4DA 1TW3A 4FUQA 1Z5OA 2I03A 4LEIA 3BXHA 2HMVA 4ZD6A 5I7OA 4RAQA 4M9UA 1KKMA 3B9RA 5JDCC 2H1IA 4D82A 2R7AA 1O97D 2Q46A 4MMXB 1NMYA 1OFGA 1YHNA 4P7JA 4EHFA 5CAEA 2ZYHA 3KETA 1I7NA 1OH8A 1RWMA 3GHYA 1E1YA 2YVLA 2XZTA 1NXOA 3URMA 1B6GA 2A0WA 1Y6FA 3RJTA 2NLOA 2IYAA 2C2WA 2BBSA 2OXEA 2V7QA 3MMNA 3CPEA 3PRJA 4JLUA 3TLGA 1EJ2A 3TXXA 3QE0A 3ZQ4A 5B1YA 1Z8FA 5KYKA 3PQ5A 3NPAA 3QEMA 3H5RA 5HE8A 1CUZA 2Z2XA 3LZDA 3W6UA 4WHMA 4FNMA 1C2YA 1FMJA 3PVCA 4CM8B 3AHCA 3HACA 4F6CA 2ACVA 4KIJA 2UYCA 1KFKB 1LDMA 2AJTA 2XVYA 2JZNA 3WS7A 1XDDA 1FVFA 5JY1A 2FSSA 3GVHA 3TLAA 1A7UA 2B8TA 3H9CA 4BVLA 5FCDA 3W6OA 4B3RB 3TIIA 1X7XA 5E4TA 4YBRA 1A95A 2NGRA 5LBTA 2KSQA 1IHOA 1FP7A 2FMUA 1ZMRA 2YXDA 5B1HA 1FUKA 4LX8A 4YK7A 2C5BA 2L0XA 2O9JA 2O2XA 4NDZA 5FPHA 2W6ZA 3N6VA 2EC5A 2LKDA 4UPDA 1RZRA 1B23P 1H94A 3I1IA 4AP9A 4D41A 2LNDA 1P77A 5AKZA 3BJRA 3MMZA 4QC2A 5HF8A 2I91A 2YWCA 3IEPA 4IW3B 3U3JA 4OHYA 1H2RS 4D3YA 4F93B 4QTYA 5JJIA 1KFBB 5K0GA 2YNMA 3ICOA 7REQA 3RTGA 2QUAA 2B4RO 4PLVA 4BJ6A 1MR3F 1W9HA 2NO6A 1KZ4A 3QK7A 2ZDQA 3RIXA 1V71A 3EZLA 1DTWB 1UQTA 1LH0A 1VBFA 4CRWB 4D3DA 5B6PA 1KRWA 1T10A 2FK7A 4JI1B 4S0ZA 1G9TA 4E13A 3KEGA 3ZHZA 2Q5HA 5ALPA 5KMGB 5JQGB 3LS2A 3AHFA 2DR2A 3O2JA 3HU3A 4EKYA 4D9HA 1IVNA 3MXTA 3TIGA 2YTZA 1PZEA 3AHHA 3RH0A 1P4RA 1GPYA 2VHJA 5F2EA 3V1KA 3A4LA 5EEHA 1ZAYA 1E0JA 4EH1A 3REOA 1Z4KA 5MN5A 4F9GA 1UWCA 1YB2A 4JLKA 5E1MA 2X0FA 2JIDA 4Y9SA 3W2IA 3PGMA 2BFBB 1R5BA 2Q2NA 2FF5A 5AI8A 3BE5A 3SSMA 4NCAA 1PT7A 1S2MA 5DGCA 3EQ7A 2BUAA 3BK1A 4Y6QA 2R7LA 4KR2A 4RZHA 1AUVA 2R0QC 4WZBA 4OCZA 3NWBA 3WFJA 4XTCS 3MELA 3OZAA 1RYNA 3DL7A 2YQZA 3UAXA 4LJAA 5ICFA 3OJFA 2ZBEA 1RZUA 4D99A 5DHQA 4B79A 5JYEA 4UEJA 1EFDN 1V1MA 3AGPA 4NDAA 3X1JA 3VA7A 2C7RA 5EQDA 1D2HA 1E96A 2Y1XA 4PG5A 3TKLA 4WXYB 1T9DA 4R9VA 5F5NA 2J3MA 4ZHQB 2IBSA 2IIVA 1UM9A 3ZZMA 4R5HA 4C4TA 3WL7A 4EENA 2VQFB 2IBTA 1U2QA 5CD1A 1OJLA 4U39A 4HVTA 1CZNA 1S4QA 3O31A 3NIFB 2VI5A 5DM2A 1DADA 5ECDA 3C3CA 5EJFA 5K3BA 4LGCA 5B57C 3NHRA 3NRBA 2I1LA 3FFXA 4NS4A 1MF7A 2YMLA 2I3ZA 1SRQA 1RHKA 3PFGA 4Q1DA 5IJ9A 2QL7A 3W5HA 3AERA 5JPIA 1QIDA 4Z53A 4EUHA 1SURA 1T1RA 3KYCA 2Q3LA 3UJ7A 2VHWA 2AOWA 2WYWA 3I04M 3HWSA 3RIGA 3SF0A 4DIMA 3KNZA 4EO7A 2DWOA 4EW2A 4LCBA 1YS4A 4RMJA 1Q14A 4LYGA 4LECA 1XZ8A 2D1FA 4ENUA 5MFZA 4Q4DA 1L6RA 3DVLA 5DASA 1XU7A 4QO7A 3UHAA 2YUTA 5DYNA 3MZ0A 4Z0HO 3ENVA 1T5HX 3EGEA 4DAOA 3D4LA 1JV2B 4F9TA 4GLBA 1GQFA 1XEWY 4CLHA 2H11A 3C5VA 1IY1A 3HUFA 2DKFA 2I87A 4G4GA 3CZQA 3B1JA 4QYTA 4AECA 4F97A 1RPZA 5DSXA 5AR1A 3KJHA 1PL6A 5JWOA 2JRCA 2CDCA 2I3AA 4CL2A 4U7DA 3M6WA 2BAGA 4EZEA 4NYIQ 4PG8A 1GL7A 2J3IA 1R5OA 4K9MA 3UHOA 4A8TA 2HIMA 1KZHA 5C0OE 4JI6B 2OPHA 2WV9A 3AZPA 2HHLA 4BO1A 4CYMA 4XRGA 1VKHA 5JSZB 4LS3A 4JA2A 1OD6A 2I4RA 4M76B 4HNTA 2GTIA 1E7QA 1F06A 3E9QA 3TBFA 3VC7A 4MCIA 4FYYA 1VBMA 5F3RA 1YCGA 1QX4A 4MS1A 3KB1A 2O1SA 3H5VA 3OJWA 5GONA 3GAZA 3IIKA 1AC5A 1SA0B 3EMDA 2BP7A 4FW9A 1BMTA 1CUSA 4CMGA 3BQMB 2JJ1A 1J33A 1MJHA 3NAZA 5HG0A 2H18A 1D09A 2NUTB 1EVEA 5F5XA 3SF8A 3SIRA 4YJ2A 4QPDA 2QGZA 4D8XA 3F9IA 5ECWA 4JY7A 4MRVA 3AL0C 3KJNA 4BVKA 1PR6A 2JI6A 1GR0A 1XNHA 5ILGA 4B3GA 1YZLA 3QU9A 3RS2A 3ED1A 3NC0C 1VXOA 1CS0B 3WLMA 3C74A 2GB4A 4NYMQ 3FYUA 2ZUFA 2CNWD 1VE9A 1WU8A 2A2ZA 1GKLA 3DTTA 4GOJA 1L7VC 4OV6B 5IM4A 3A6DA 4GI1A 4EY3A 1Z08A 1RJDA 4EMUA 3B2QA 3JQ8A 1KU0A 1ZJZA 4GX5A 2BR3A 1ZH8A 2M9MA 4Q9IA 4B81A 2XZPA 3BXZA 4RGBA 4XLLA 5JS7A 4DPMA 3NVDA 1E2QA 4JKYA 4E11A 3RVSA 1QRUA 3RUCA 4OD0A 3HLKA 4C6SA 3H3FA 3C87A 5B7GA 4CIWA 2WJGA 5BT8A 2WHQA 4RF5A 2ENUA 3S81A 1JB9A 4CMEA 4G67A 2Q0XA 1S1CA 1VJCA 4D9FA 4AMBA 3G0DA 1CZLA 3EXHC 4QKQA 5I9NA 3QKSB 1G8FA 4BO9A 4CUJA 1NF9A 3NB0A 3I2IA 5B1SA 4AF8A 2XWSA 3L6BA 1E9CA 3OFNA 1W30A 1W25A 3W3AH 4V39A 2OZLB 3HY6A 2X4GA 1V7QA 2HV9A 3WK7A 1P0MA 1V7CA 3QTLA 2J3JA 4OB8A 4C06A 3EBLA 5L3SB 2LXNA 3J81A 2CMHA 1A1VA 1EB9A 1KO5A 1VL5A 1G59A 4OQPA 5CH8A 3T7RA 4PGMA 1NX9A 4I3FA 1VYHA 3E61A 4H15A 3EJ6A 4FNOA 3WJ7A 3AI1A 1NUTA 1QE3A 4TT3A 1TXGA 2X9VA 3EW9A 4Y1RA 4BNTA 4C2TA 4PTLA 3GH3A 1IN7A 3QNMA 5D1HA 2RBKA 5EFZA 2IYRA 3LYLA 4MVJM 1PX0A 2ZBGA 4WKBA 2BKEA 5IAJA 1K75A 2EWVA 4WNIA 4X7BA 2NACA 5DHRA 1JLHA 4O2BF 2O07A 3GRCA 4BC1A 2WUGA 3F6EX 3WZLA 3ZWOA 3WIVA 2FPIB 3LUAA 2PU7A 4JT2A 4COOA 3D4PA 1O7JA 3GJQA 3G23A 5CFZA 2VT2A 2WTXA 3DWEX 1D4AA 2C1ZA 4LF4B 1IAQA 1M2FA 3EUEA 4G2TA 2WTMA 1IZ9A 3GVPA 4H3KB 2FB9A 3F97A 2QORA 4M0LA 4O6VA 1IEQA 2C95A 4A27A 3HZHA 3HR4A 1NJ2A 4PZAA 4BVAA 2F1OA 4KR9A 3MBIA 5IXYA 4EQZA 1WD5A 4GMXA 2A1TS 3GLIB 5HMLA 4BPRA 4BGUA 2QU8A 3LKVA 5AXBA 1QKKA 5GGYA 1Z4JA 2XKKA 1Y7IA 3MTEA 4MVXA 3UV3A 3G1UA 4MP6A 4TSFD 4AUNA 1U6JA 2N46A 5CW2A 3NBYC 3BSWA 1U9IA 1QHYA 1DKQA 2AQKA 1W5AA 1BHJA 1TE2A 2Q6OA 4U2BA 4II3A 2AI3A 1ZC4A 1BMFD 1F2VA 4E5YA 4AD8A 3DL2A 1BQ4A 1HNNA 1X42A 2N75A 2E7ZA 1X1AA 4Y18A 4RADA 4I3GA 3HWRA 4YBZA 1FFXB 3GJ7A 3WQQA 4W9MC 2IELA 5E6SA 5C1OA 5HGXA 3PWSA 4TKUA 1Z0JA 3EZFA 3H5TA 3IRVA 5JZBA 2HYDA 3DBRA 4I99A 4TRNA 1EUDA 1PSZA 3D59A 5EVCA 1PDVA 5SZIA 1UH5A 1PFWA 1TK3A 9ATCA 4D9CA 1F7UA 5L3ZA 4PYJA 4Q12A 2HMUA 3FUWA 4M8LA 4B09A 3KLNA 5IVPA 2CUTA 1QYWA 1Q95A 2IUFA 1N4DA 3EIWA 5JRZA 2O8DB 1H8HA 1M2VB 1YRAA 3KOWA 5AKHA 1PQYA 2GBFA 5IP5A 2OY0A 4DKJA 3HKEA 3O84A 4GX0A 3KQQA 3UENA 1KOGA 4R4JA 1H93A 2CL5A 2BH9A 3OPVA 2PSSA 4E5VA 2BF4A 5LR6A 1J49A 1KE1A 4UZSA 1NOKA 5C7YA 2CCJA 3B85A 1Z2EA 4FIZA 2ZTLA 4KMOA 1Q6YA 2NUPA 3VZRA 2JC3A 1IK6A 1VE6A 5P8WA 1NAIA 5TNXA 1C0PA 5D85A 2ZIAA 5LMUB 4FR5A 3TXYA 1I94B 1QHHB 3B9PA 3ESAA 3MB5A 1JIVA 1WNTA 4IL5A 4V02A 3QYPA 5DGTA 1Q92A 1CJCA 3PGLA 5JHGB 4YALA 2QTCA 1A4UA 3SYRA 4RJLA 3CVUA 1TW2A 5I51A 4BYGA 4Z7OB 2DM6A 2X2EA 3SSNA 1TZ2A 3IAFA 3QX8A 4UAJA 4ACBA 4FD2A 3T5BA 3QA3E 5HDBB 1SH7A 3B12A 2FDCA 1PT6A 4LE0A 1CY6A 1RZVA 4UNSA 1ZK4A 5TB5A 6AT1A 4KXNA 3ZI0A 1S2IA 3JCZA 1BS1A 4HAIA 4KQ1A 4MGIR 2O59A 2CF6A 2OHOA 4FK8A 1YRBA 1HO3A 1W34A 5DX8A 3RFVA 2ZREA 3KTOA 5L4NA 3CRZA 1IJBA 2FMIA 3GUZA 1X7GA 4US2R 3A6LA 3I58A 4QU0A 4RFLA 3E2PA 1LX6A 3QLJA 4LUCA 4HGPA 5FUXA 2WD7A 3PWTA 3T7CA 1XPUA 2W6ID 1K7YA 1C8BA 4MWEA 1W581 2OK8A 1WAMA 3DBVO 1POXA 1CQZA 2HOQA 1D0SA 1GD1O 3HEAA 3AILA 3JTMA 4E33A 1J56A 4MUKA 3K4QA 4LYFA 1DIAA 1L6IA 2IW3A 2EBHX 4QGGA 3ZI4A 3DO8A 1GL6A 1YH3A 5LLSA 4CNBA 5EJEA 3SWWA 3RKUA 5JAOA 4RTNA 3KKNA 3RBXA 4B43A 2BKLA 1BX3A 3VC2A 4ALMA 1WULS 2AS0A 1FTSA 1EX7A 3UJDA 1MNQA 4DMRA 1OR8A 3COYA 5IFLA 3M70A 3UJ8A 5CX1B 1SZDA 3DWIA 5FWXB 2WTAA 4PSCA 4D46A 1DAOA 1W35A 2WYOA 3I5UA 2X0JA 4C0KA 1EZ1A 4H0FA 1Y8ZA 2OAGA 1Z7BA 5ALUA 4ESVA 3OJEA 1Y8RA 3KWMA 1UBKS 1QG4A 4JQZA 5BR4A 8OHMA 1URPA 1IY0A 4P53A 4UDOA 2QLTA 4UATA 1E7WA 3PGVA 221PA 3K7EA 4TTQA 4TWBA 2P2NA 4EI8A 1C1HA 2IYUA 1HKUA 2BFAA 3EH1A 3V1LA 4BVHA 4LZAA 3UBMA 1AV7A 1LPAB 4QLAA 4URHA 4BP9A 3IQIX 3NBUA 5JH7F 5K0CA 3E22A 1X77A 1Z5UA 3GWGA 3OEEA 2JIQA 1O94C 4DCMA 3KEFA 1E3WB 4TL6A 2B7CA 9MHTA 2PX8A 4PS0A 2VQEB 1P9RA 4BNVA 2Q41A 2YDYA 3I6ZA 4YV2A 3K94A 1CYEA 1ONSA 2P9HA 3CZCA 1X39A 4KUGA 1WQ1R 6ADHA 2NU7B 1I4OA 4K2HA 3YASA 4DB2A 4FMBB 3KQKA 3CLVA 3NBXX 5GP1A 3T54A 5F9HA 1HL3A 2BR5A 2A7XA 4XSVA 4HRVA 5FWDA 2R8PA 3SQMA 1VJDA 4Z2AA 3PHLA 3VPXA 3PDIA 3I1JA 4IH1A 1UDXA 3U9TA 3UT0A 4DZZA 4ZOQI 4TTJA 5B12A 3CNQS 5JT1A 1V1RB 5AP9A 4ZHSA 2E21A 4D5GA 2Q2QA 1H4SA 2HZ7A 1WPGA 1FTGA 2PGOA 3BQ9A 3C14C 2FX2A 2R2GA 2DTXA 5EJ2A 1N0HA 2R6HA 1OXMA 1P7CA 1C3XA 3L0SA 4WNCA 5FUVA 1O95D 1XA0A 3LZ6A 4WZAE 2ZSDA 5LBIA 4Q7JB 1DEHA 3QEKA 3BICA 4F04A 3VPBA 2XTNA 4EK9A 2P0AA 2XBUA 4EPYA 1U65A 3SQLA 2GJ4A 2NPOA 3ID6C 3L3BA 3QSGA 5ULLA 4YHBA 2ILVA 3JVEA 4C05A 5LOVB 2AN5A 2V3CC 2O0KA 4MW9A 2HXSA 3VU9B 1KXJA 2W2LA 1P6QA 3TOSA 3ELWA 1AH2A 1RYZA 1V3QE 1Y63A 2B7LA 2C3YA 4UEKA 4CEJB 5ARCA 1HR0B 4EVSA 3DDNA 1UJ6A 4MUBA 4DLWA 5IWAB 4Z4CA 4CEHB 1HL7A 3EHEA 3UMGA 5IT4A 2GN1A 4K46A 1F2TB 1ST2A 4WN9A 3ZVRA 2VO1A 1OXSC 1KSFX 2ZRGA 1YL7A 2BGUA 2JFZA 3IAEA 1U80A 2ZWMA 5BRJA 4BB5A 3ML1A 1F0NA 3T1YB 2F1HA 1MQ9A 3W2EA 121PA 1J8VA 3EXG1 4TLAA 1KO1A 4EGFA 1JW9B 1XKXA 4LRXA 3RC3A 1TM4E 3V1UA 1RWXA 3EQZA 2Z58A 4K9OA 2P9EA 2ZJ0A 2X0DA 3HPQA 2JKZA 4PX3A 1SEVA 1NXWA 2CL0X 5T67A 4B7XA 2ZYDA 2C7VA 2YZ7A 3JSAA 1KYVA 2HK9A 1N2XA 3CUYA 4YDRA 3SDBA 3UUGA 3I5YA 1P6UA 2DX7A 1JEQA 1W59A 2NTEA 1XVTA 2VZ0A 4EX6A 1BVYF 3OTQA 3ZHOA 2ZT7A 3H2JA 4JLJA 1NNEA 5JAIA 4IHJB 1KI8A 3B8EA 3DF9A 3ZKWA 5JI2E 3E0XA 1HFJA 2FAXA 4LYEA 2AW3A 1LF0A 3HCOA 4HCJA 1ENPA 1EP3B 5AVKA 5EXEA 2WWWA 2FKAA 3K5WA 1GITA 3HSYA 3R7LA 3RVQA 5FR2A 3R0QA 1W5EA 2C0PA 1VPEA 2G7MC 3ADBA 2O7VA 1E1MA 1ELOA 3EVFA 4W5HA 1TD1A 1S01A 1CX9B 3CG0A 5DTMA 1W87A 4Z4FA 3L06A 2B83A 4EYKA 2DERA 2WINI 3K0FA 3BVPA 3TR5A 4ZEMA 3E3LA 1ENOA 2I8LA 2IHJA 4JROA 3IV7A 3OU2A 3TNFA 1J99A 4YMLA 4RJKA 3BKWA 3NOOA 2W2KB 4UDNA 4UMVA 2BLNA 3PGKA 4B1FA 5LOVA 2ZSJA 1SXJC 1YC2A 1EXWA 2D2FA 2VBIA 3ITKA 3PXEA 3RJ5A 1HYQA 3SSAA 1C0IA 3IAHA 3KQNA 1HNXB 1QWSA 2XF8A 1G0OA 2HHHB 3FCXA 1V2HE 5FJIA 4EYEA 3H99A 3TZHA 4TVOA 3AETA 3TW6A 3MWYW 1F1JA 3ABZA 3QNUA 4NX2A 3QE2A 1JE1A 1GNPA 2Q8QA 3SDSA 1CJSA 4BCBA 1GZHB 1OX5A 4B3TB 1WWKA 3T5MA 4C6RA 2XCOA 1XXHE 2R1ZA 3A32A 3BMOA 3OZ7A 3VPCA 1EUQA 1SK8A 2J08A 1KVUA 3FM9A 3ZW8A 4Y0AA 2H5IA 1YDWA 1C4XA 4DREA 5C1DA 4F3YA 1EX9A 2EG5A 2BT4A 1X1BA 3I05A 4UE6A 2GZ2A 4Q4CA 3MG9A 1AKWA 1FNNA 5I8ZA 1Q20A 4JFRA 3ZY3A 1TVEA 3TZ6A 5KNLA 1NUQA 1E66A 3AUTA 2XUHA 3N05A 4Q7LA 4QOSA 3EQ9A 1R6DA 3WV4A 1GPNA 4D4IA 3M3HA 4QFCA 4N7RA 3SJUA 2I76A 3ZH2A 2CEAA 1DBVO 1XV5A 4PVDA 1P4AA 2G5CA 1GLNA 1R18A 3PC6A 4IIHA 1MC5A 1TEVA 5DK4A 3V2GA 4HH1A 4ASUA 4DBLE 3WB1A 3TLYA 4MVWA 2VCHA 3W2GA 1CUGA 3ZWDA 5AHXA 1ZHOA 4MP3A 1FL9A 5IKMA 4BCDA 2J8ZA 2NUAB 5A5DA 5AVZA 1OTYA 2EZ9A 5EE9A 5AUPB 3RVNA 1W48A 1G21E 1I13A 3PC8A 5C32A 1PS8A 2C4MA 2SKDA 3BT7A 2F17A 4DCTA 4FFPA 2YNMC 3ORQA 5JAPA 5FA8A 4RELA 3X1KA 3P5SA 4HK4A 2D3TA 4BOYA 3JRNA 4HRAA 1QYRA 5HFNA 4E22A 5M04A 3SHVA 3QI2A 4N76A 1E3MA 5HFAA 2QROA 3HCEA 4LHVA 4ITVA 2CFTA 4AUKA 2BONA 2QRHA 2C88A 2RI0A 3SR3A 2HNAA 5C8XA 3IHWA 2Q1SA 3L49A 1XMIA 3JYHA 3LFHA 2RJNA 4M7PA 1Y6RA 2WT4A 4O2AA 1R88A 2A35A 4FQ8A 4A26A 5F7XA 3CF2A 1S9HA 3TLZA 3NWJA 4DCCA 3U37A 1YIDA 4J1NA 1DBIA 3PSAA 3BMNB 3B2EA 3GLRA 2HA5A 4UOQA 4AM8A 4HYQA 4LZOA 4FC6A 4NCXA 2QMQA 4OSEA 2XF2A 1ZISA 1QC5A 3FCUB 2ETVA 3JQ9C 4L57A 4B4OA 1M8JA 1MQ8B 1E5QA 3MF4A 3FPKA 2PRJA 3AY6A 5CT8A 1KZ1A 4ND5A 3BA1A 3BFPA 3K6JA 2JH9A 1OLXA 2JI7A 2GX6A 3CSSA 4FOSA 2FNAA 4PYOA 3ZZ1A 2NG1A 4GNRA 4MWCA 13PKA 1JIQA 2ZB3A 4I2VA 2LKCA 4DSTA 3LFTA 1EFVA 3PE6A 3AUSA 1FJXA 3E3AA 3P2OA 2Q9BA 5ILOA 1QQ6A 4FIDA 3VFDA 1KYZA 3ZWYA 3O5AA 4YACA 4BDTA 3TCNA 1PNRA 3EW7A 4RDXA 1PJTA 5KREA 2OD7A 4DKXA 2O5EA 1U5AA 4N39A 4XA8A 2V6FA 1M2NA 1NYRA 2QF7A 1U02A 1D6JA 2N1MA 3EASA 3U31A 1SU6A 1WB5A 3FNQA 1DG3A 1WKCA 3IJRA 3UGTA 4B40A 2PZFA 2QVXX 1AF7A 3NOQA 4FGWA 3RUPA 2PMKA 5EIOA 1P72A 1JT2A 5I9TA 4TROA 4BVFA 2TSYB 2QW0X 4TWRA 1UEXC 5ER6A 3ODGA 1J5EB 2RGNA 2WP8J 1K88A 1MJFA 2INGX 3CJQA 3PT9A 1JVBA 4X1KB 5NULA 2CJYA 2AOTA 4FEYA 3FFBA 1WM1A 3DB1A 4GQIA 4I4LA 3Q3CA 3G2IA 3M4XA 2XEDA 4I5DA 1CEYA 3HKBB 2BM0A 3EDQA 4GWKA 5K0EA 3ZVLA 3PR3A 3VO1A 2DSNA 2UZ0A 4FQ7A 4D9IA 3VNUA 1CE8A 1MRSA 3PGA1 3AVWA 3GUCA 1YASA 3ZY5A 3BB4A 2DC1A 3K9HA 4TYNA 2LD4A 4F96A 1ZPDA 5FUWA 6REQB 2R6FA 1OBOA 3QI7A 2WQ7A 2C29D 4ME6A 1T9ZA 2IXFA 2QAIA 1M34B 3PX2A 4LJ9A 5EXDA 2YRWA 4CIDA 4D6PA 3CLKA 1AJEA 4UAGA 2OILA 3JQ6A 2Q1UA 1QGUB 3K2QA 3DOOA 1A8HA 1M6VA 4RDCA 2PR2A 1PU2A 1XD2A 3VU3A 4YV1A 5BWMA 1X87A 2X7XA 4Z3OA 4YQFA 3EFHA 1N1MA 4H6WA 3IOCA 4AZVA 3MYYA 3UMJA 4TT3D 4GI3A 3U39A 3NBKA 1Y82A 2JI8A 3KFLA 1ZN7A 4TV8F 3UCXA 2OLJA 2RKOA 1B00A 5IMSA 3L7YA 2IPMA 2LBPA 4M98A 1GQQA 4R1SA 5DTIA 3G2JA 3LQYA 1E89A 5DW0A 1CRPA 2WKRA 4RCVA 1BU8A 1IMOA 3C7CB 2QT0A 3LVFO 4F91B 2XQIA 2FP4B 1R5JA 1W6RA 4L02A 4HPXB 2VKQA 5TT0A 3SXJA 1NVBA 2B30A 1BC5A 3P71T 3L5KA 2IP4A 3NHYA 2FSIA 2RG7A 4ZO7A 5FTKA 2YW9A 5AJZA 2QTTA 4B84A 1NI4A 1I4WA 1UAGA 2YXLA 4KQKA 5E3IA 2CYBA 3VH2A 1FMTA 3BM5A 1KFJB 4CKCB 3SHFA 3U4IA 4LG1A 3R40A 3ZE9A 2F62A 1OPXA 4M1OA 3QX7A 2QRVA 4KXFB 4G1EB 1M5TA 2NV6A 1P19A 4UHBA 1OIWA 3DV0A 3FW1A 3WQBA 4RHEA 1HMPA 2OYRA 4HPWA 4F2HA 9ABPA 1JSRA 3TJMA 4B7AA 1UBTS 2IYNA 3RCBA 3WYBA 4Q3NA 3NRCA 1EI9A 2X15A 721PA 5FIUA 4ER6A 1B73A 2GZSA 4RHFA 3VV2A 1G5IA 2ZKLA 1TJ3A 2ZIZA 4JUDX 4EG5A 2ZJOA 4ESHA 3H2YA 4B7CA 1U0BB 1VB5A 4MW4A 3RGWS 3CPSA 4YXWD 1CHDA 3QLVA 2M6SA 1OPRA 1R00A 1BXRB 1ZQ9A 1QB8A 1ZNQO 2IUEA 2X9GA 3N0WA 4RY2A 3ZGVA 1E98A 5ALVA 5CB8A 3NXKA 3RYFB 3V2UA 2GN8A 4M4SA 3VR5D 4N0EA 3IP9A 4YRAA 1MTZA 3G5UA 3GCXA 2GUGA 4URXR 4M6WB 3EUFA 5EUCA 4YMHA 2DFKB 1T13A 3RQIA 4IZOA 1SZPA 2O7RA 1P39A 3FPGA 2HWUA 2G1KA 3GGDA 4AFNA 4DVGA 4CTNA 1IQ0A 2ZJ5A 2JL1A 1U2DA 4Q4JA 3VNAA 4P38A 1F3OA 3JD0A 1ZBDA 4W99A 3WLFA 3PTAA 1O94A 1TIPA 1XZLA 2BUBA 2VHVA 4LX0A 4ZEWA 3WK6A 4YP7A 5YASA 4GECA 1D9ZA 1ZWKA 4IJ6A 3K3PA 1YOVA 2BHSA 2IXEA 2PWAA 2ZIXB 4UEOA 3TXAA 1VL8A 2NTYC 4EJ2A 2DHEA 1NI4B 2IEGA 3FFTA 4RH3A 3ZHBA 1WABA 1X3LA 2RAVA 2BGWA 4CDGA 4MRMB 4A6PA 2YL2A 1DQRA 4ZOBA 2C00A 1E8DA 5TMBA 3B5IA 4HAVA 1OXTA 1U8ZA 3HCPA 5JVDA 5FV7A 2I33A 4GUDA 4G0WA 5F1YA 5TIIA 1YK0A 2REXB 1CR2A 1MTOA 1OGJA 1XMSA 4QU8A 4YP6A 4X97A 3KT0A 1X7WA 1WNFA 5BYJA 2GYVA 3HKDA 3KSZO 2Z4SA 2X40A 3KDPA 5E9WA 2BM8A 3HNRA 4GRAA 1TYCA 4O29A 4XB6B 1HDYA 4ZV7A 2G28A 4BFXA 2BSQA 3LWNA 1CB7A 4KOAA 1MORA 4LNAA 3ZU2A 2ODWA 2PJUA 1T0JB 2WMOB 3K4HA 4JJFA 4DMHA 3DZIA 4ERNA 3NBAA 4W1SA 1FP6A 2O5VA 1YIOA 3AF1A 4HMOA 4UNQA 4TKVA 2AZTA 4C9BA 1Y48E 1TOAA 1MA0A 3KFXA 3SR4A 3OFJA 3V8NA 2JLCA 2ZDGA 2A9PA 3OOJA 4JC0A 3G8CA 3PUJA 2R62A 5J2TF 3UJNA 2Q5FA 2P9TA 2V7QD 2B5VA 3OMXA 5AIBA 2P62A 4C1NA 3QHAA 2Z1MA 1KZ9A 2IQ5A 5DIFA 4YI3A 6LDHA 1V9SA 2FJ0A 2DP4E 1UK9A 1K4KA 2ZAIA 2WE7A 4S04A 4KN6A 3RC7A 2FMKA 1GYPA 2BKAA 3WRXC 2I6TA 4D9NA 5BY2A 2GILA 3NOVA 3OJCA 2YXEA 3KOUA 3ADPA 1XTQA 1ZD1A 1YR2A 3ROEA 4DCJA 3DCJA 4Q3KA 1EFPA 1QYDA 4YJGA 3TECE 3ZJTA 4QAQA 1M1ZA 421PA 2EQAA 4DZTA 1VLVA 2UUBB 4YTEA 5DSTA 1M1XB 1T5SA 4L2IB 2O52A 1X38A 1NW8A 1KORA 5T57A 3TSZA 1E6EA 1RQ2A 4IMPA 3VOTA 3WAGA 4DR2B 2AOXA 2WYVA 2CJFA 2OGZA 2UYQA 4QDZA 3L8EA 2X4DA 4HDRB 4YXFA 5IBQA 5B58C 2A58A 2I29A 2PFSA 4Z3KA 4OREX 1ZM4A 4JBLA 1EEHA 1KDRA 2H7YA 3CEJA 3QIAA 1UJ2A 1LXCA 2W6PA 2GGSA 3E58A 2PH3A 3BTOA 3N2LA 5FYQA 2XKAA 3ET4A 4BN4A 5KAPA 1U0HC 2V0CA 2ABWA 4PV7A 5K0SA 1UMBA 3THXB 1XQYA 1PJ8A 1IOZA 3BX1A 4RSMA 1PAUA 4D7AA 2P0YA 4AU1A 1GN9A 2PZBA 4P5DA 3JAKB 4UHJA 5K8LA 2QE7A 1UPAA 4QA9A 3IOMA 1MVLA 5LJLA 2J9YB 5I7AA 4AZ3A 5KC9A 3STXA 3I5MA 5CA0A 1NMZA 3WSVA 4BBZA 4XB1A 1PQ4A 1YNSA 1I5OA 1Q7RA 2EZTA 1B8OA 4YJ3B 1ONBA 3MHTA 3ZV4A 1I6LA 3O4RA 2CDAA 3MUFA 3UK0A 2VUHB 1RJEA 4X3OA 4QATA 5SYAA 5JDCA 2D54A 4TLMB 4HI0E 3VUFA 1QG6A 2Q6IA 1Y33E 1RI5A 1NULA 2BRUC 2RAFA 1C1XA 2ZCVA 3KLBA 1MX9A 3GVCA 1U9IC 4OMUA 4PBTA 5BNWA 1JXOA 4P34A 2MYTA 4P82A 3GJ8A 4G5FA 1CB0A 1XRLA 4GBJA 1K86A 2CFRA 1R6XA 4XRRA 1XZKA 4Y30A 5AJVB 2OXFA 3JY6A 4QDUA 4RIIA 3T94A 1QFMA 1C41A 2QVYX 4PZDA 3J7TA 4DIFA 1OVMA 1Y8CA 3CONA 2O06A 1T6BY 3I2JA 2V9PA 4BGDA 2REOA 1CFZA 3GBVA 2IHTA 1C30A 2H1WA 4BX2A 3UXEA 4FDUA 3GNTA 1ZUWA 3FZGA 3G13A 3T0GA 5DGIA 4G26A 3F9CA 4KPUB 2IU0A 5FLXA 2X86A 1KGSA 5T3YA 3RE1A 3HR8A 4PRZA 1WPQA 1Z0SA 3EC7A 1Q3TA 1E9FA 3JWPA 2BFPA 4GO1A 3TLCA 5KYYB 1A1SA 4R2XA 3Q1LA 3WWOA 4LF5B 2WU3A 3SKXA 1LNZA 4ZMSA 4JOQA 2E48A 2NSLA 4OQLA 1DAPA 3RD5A 1M8GA 2G6TA 3WRVA 1X1QA 4YR7A 2YJZA 2IUYA 3P9IA 4URWR 4LVCA 1LLUA 2AOUB 3H8WA 3PNOA 3IDZA 4CMAA 4DQUA 3IJEB 3O6VA 2ZAYA 4PZ9A 2MMCA 2O0JA 2AHRA 4RJIA 4DTIA 2IGTA 1KJQA 4KLAA 3ZDRA 2EW2A 4AJ2A 3NZEA 1N5RA 3I34X 4FFWA 3V7FA 4HAZA 1AO3A 1PZMA 2E4AA 4JJ7A 3G0HA 4CR6A 2QAGA 4PC2A 1O03A 3ANYB 2IYWA 1JLMA 1NV8A 2CFCA 5CVDA 3K9BA 4V0KA 2R1VB 3IKTA 5CDUA 2HRCA 3N8HA 4OGKA 5IVIA 4OQDA 1QV6A 5TF4A 3VAAA 5LP6B 4EAQA 4CM8A 4IM7A 1NE7A 4WFIA 1A5AB 4WECA 3EXHA 2H6EA 2NMVA 2IXAA 2O57A 5K6AA 2A94A 3A11A 1RKBA 4CMEC 1UZUA 2H4YA 3KCNA 4NAHA 1XHLA 4RF3A 2ZROA 1Z7WA 3OEYA 2J3EA 4KAFA 3CW8X 1YBHA 1Y5LA 4PYRA 3B2NA 4Q9DA 4UUMA 4YY3B 1JTFA 4B31A 4ZHQF 5B5SA 5H8WA 4FFSA 2OUIA 1Z2AA 4WOKA 1P62B 1W2GA 3AM5A 1H2HA 2R00A 2XB4A 4RHUA 1PFYA 2QVBA 3DMTA 1OYOA 1XAHA 1M2HA 2JKYA 2PFGA 2VHQA 3OQIA 4LJ6A 4ZO6A 2E4YA 2QN9A 1W52X 3D9QX 4G0OA 4PS1A 5C1IA 4ALLA 2V1XA 1YFZA 4H3HB 2GAIA 2RHDA 3M6LA 2ORVA 3GT7A 1SUDA 1Z73A 3VR3D 2AC4A 2E4VA 5LQAA 2YZNA 3FYUC 5KZMB 2UUAB 2C54A 2HK6A 3MWEB 3MWJA 3NHUA 1T2FA 2GEBA 3OIVA 1ZGHA 4N5LA 4WESB 1L1RA 1E9SA 3GLVA 4CLEA 2WB2A 1EH5A 1IPFA 3M4YA 2ERCA 3HEMA 4NARA 5CB4F 2AF3C 3O4JA 4WX2B 2OO3A 3P8ZA 3L7LA 1FQOA 2VTDA 2OQIA 4IDEA 1AGYA 3PJGA 1YBFA 4M1WA 1YB5A 4ZDIA 5ITSA 2XGGA 3KO8A 2Q5EA 5EZQA 3ULKA 1WSDA 3FMVA 3VXKA 1GEEA 2FWAA 1NQUA 3C6QA 1JUDA 3IH5A 2FMTA 2HPAA 4BVJA 4O4JF 1CULC 1JLLB 4LXYA 4P33A 3AQ4A 1BU5A 3RFXA 2RGCA 4H7IA 2Z56A 1TO1E 2NZWA 2R8BA 1Q2XA 2ZS9A 1T8PA 5BV8A 2FWJA 2UUCB 5F4ZA 1RWBA 3VR4H 1M67A 2OC4A 2QS9A 2VTEA 4I1RA 1AVTA 4YJDA 2VRCD 4NZOA 4EWLA 1QP7A 1H0KA 5KCMA 4YYEA 3OM1A 2RC5A 2I4OA 1ZIDA 5T3UA 3KUDA 4P36A 2W7TA 1AZSC 1RDFA 5DN6D 2C5SA 3MTGA 1V8DA 3PXXA 1K5DA 1HT3A 1RJFA 3OLVA 3EXIB 1OBHA 3SEAA 3A1SA 3DUFB 4HYYA 1X74A 1DO2A 4HWTA 3W3AD 3QPAA 1XN4A 3BIJA 4FNAA 4QPZA 5D5HA 5KINB 1GGKA 4C0SA 2RGDA 1G8HA 1RWPA 3AUYA 2JDID 2W0SA 3BCUA 3BD7A 2O14A 3OMWA 3P4YA 5FT9A 1L5RA 1IXKA 4KRGA 3ZNQA 4P7FA 2HK7A 4IDQA 1MB2A 5AW6A 2PO5A 4JP1A 3WQSB 1GZ3A 2QR2A 3CGWA 5C7OO 4J0KA 4ARSA 3DH0A 2DLCX 1T6ZA 2YZKA 1G8GA 1FS4A 2QM3A 1LPMA 3A9WA 5JLJA 3CS3A 4ZQGA 3L0CA 4C87A 3A1FA 3CMMA 4ZHQA 2A0KA 3HXTA 4LC1A 1MAVA 1NUHA 1ML3A 2VK1A 3W04A 1BYUA 3OQMA 2A33A 4FP9A 5MFPA 2Q5OA 3P9CA 4HEA6 4ZJZA 4HQRA 1T36A 1A2KC 3H8JA 1VSQA 3ORFA 1HDIA 1KL7A 1LD3A 1VE5A 2QRPA 3EZ2A 4OBXA 2W98A 2Q0QA 4W7HA 4EFMA 2FVXA 5HKAA 1DKOA 4DR7B 2OOSA 3IUSA 1ZOOA 1DQZA 4ILEA 1C3EA 5FLKA 5T4BA 1P0CA 2H2FA 3MMXA 2HW8A 4DUGA 1SHTX 1E92A 2JZCA 3NUQA 2XDWA 1BJKA 1M2KA 1IFXA 1NT4A 1RLUA 2HQSA 1SKUA 1RI1A 1VKZA 4TQ9A 3S0JA 3GLTA 1CY7A 4KXYA 5FBZA 1L8OA 3FYSA 3HJTA 4IYJA 5CGQB 4D42A 2HJVA 4MV3A 3G0CA 4CKWA 1F8YA 1IB6A 3L02A 4ZVSA 3OZFA 2NTJA 1TQHA 1EKXA 5EIEA 3DOIA 5DYWA 1JX6A 1O94D 1QYXA 2AD1A 1FIUA 2EYUA 4MYHA 1ZJYA 1IWOA 3I01M 1CLEA 1BDBA 2HLHA 4UUQA 1MKYA 4BJ5A 5AO9A 4F85A 1S5PA 4FDTA 1UKYA 2Q62A 3DZFA 4ZQEA 4B4KA 1JEJA 1CQPA 1P8JA 3ANLA 2D4AA 4GYWA 2ICAA 3SU8A 1YJQA 4H16A 1LPOA 3ZHVA 1U31A 4ZOCA 4DUPA 3IEMA 2SHKA 4NMMA 4JBNA 2XT0A 3NVKI 4NRDA 2NYVA 3DLPX 1O9GA 4EMSA 3QPCA 4RQBA 5HJEA 5LXTA 1Z6QA 2BW0A 2YJ5A 3WMGA 3NHZA 2VYQA 4P3PA 4GC9A 3TW4A 1EWRA 1OHHA 5BOSB 3OX4A 3F46A 1IB0A 4OEHA 2A9VA 1E7RA 1EEXB 3HJCA 4P4SA 2A9QA 1XNJA 3K9NA 1Y6JA 3NHBA 1NVDA 5B3AA 1HEIA 3RROA 1N33B 2J9FB 2HNKA 1O6FA 2FA9A 2RJ3A 2FDRA 3U9SA 4ON9A 3X2EA 3BOSA 3HP4A 5EJ8A 2FW7A 2GH1A 5BYKA 2FHPA 3EQ2A 4K9NA 2Q28A 3ZLUA 1ZMBA 2XRFA 3UQYS 1MFZA 2WHPA 1QGZA 2GZ3A 4JC4A 2VJDA 5IVKA 2OVFA 1IN8A 1Y5IA 4MVJI 3G9XA 2GLUA 4P3NA 4Y0VA 1XZCA 3ZY4A 4R31A 4Y2GA 1HT0A 4BFTA 4BC0A 4UFPA 2WYHA 5IYZA 5TQ0A 1H2BA 3B36A 1HV8A 3A6KA 3D8TA 4QAJA 1ZINA 3ORHA 1XCJA 2W58A 1WRBA 2OV6A 3BE4A 3ISVA 2DFVA 1T3SA 3CT4A 3JYOA 3QPBA 4F8EA 1HLFA 1WVGA 1KSJA 2JW5A 3A1NA 1PTKA 2YY7A 1W1IA 5JTTA 3HN6A 1TU0A 3IV9A 4HFRA 4XVQA 1F4LA 1TF7A 1WXIA 1CHNA 2C2ZA 4BYMA 1YHYA 1D9XA 2P9QA 3PK0A 2GEUA 1NNLA 2EGGA 3E82A 4KI0A 4OLHA 4CG0A 5IJZA 4OX9B 1KTVA 1BWSA 3LCJA 2ZBFA 3ISTA 4W7IA 4NMWA 4BZQA 2AWNA 3DE5X 3P0RA 4YS6A 5D2CA 5AJWA 4URUR 2JNWA 4HDCA 4PZPA 1MGPA 4HDMA 3AGQA 4RIEA 4TWZA 4UU7A 1GT91 5FWNA 3O8BA 5AK4A 2BZGA 4D8VA 4BQOA 3LPDA 3W5SA 5KWJA 1JU9A 1E0AA 2BMFA 1Q12A 5JW6A 3W5VA 4IEFB 3G3EA 2IPXA 3NT2A 5EJ9A 5BWNA 3PPIA 4CKBA 3FBTA 2ROQA 4PHGA 4C3OB 4E12A 1QF6A 2MSEB 3I3SR 3HVHA 3I4CA 4WZAB 1ZVQA 2ZIVB 3K05A 4GXQA 4KQGA 1TC2A 1X7DA 3PITA 4ND4A 2ZE8A 2YIDA 1RCTE 2ESRA 1VKRA 1FFBA 1XAGA 3GYBA 3S44A 3TINA 3AFOA 1PEYA 2QXTA 4DDVA 4UNNA 1CS4C 2A67A 2FE4A 1CRLA 5DK6A 1NUPA 2QXUA 1CNFA 1VLJA 4F5YA 3GVIA 1BHQ1 4GYYA 1OXVA 4X63A 5FR1A 1FNDA 3WL3A 3R1IA 4XARA 4OP3A 3S2UA 4AXBA 5M7EA 3HJFA