4QLOA

Crystal structure of homoserine o-acetyltransferase from staphylococcus aureus
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
327
structure length
327
Chain Sequence
NYTVDTLNLGEFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRKDPAFLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of homoserine O-acetyltransferase from Staphylococcus aureus: the first Gram-positive ortholog structure.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords homoserine O-acetyltransferase
total genus 112
structure length 327
sequence length 327
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2014-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qloA00
2CUTA 5EIHA 3C43A 4X91A 3FNBA 5CXUA 1UOPA 4NVRA 3B3QA 4HZGA 1CUWA 2XMZA 5JANA 4RNCA 5D6OA 1M33A 5ALHA 1ZIYA 5LZ4A 3LLCA 5ALQA 4U2FA 3UMJA 2VJDA 1ORVA 2BKLA 4N8SA 1XZMA 4MYSA 1XZJA 1IVYA 1ISPA 3E4DA 5ALFA 1ACJA 4E15A 4L3WA 1Z68A 3FLAA 4GWLA 1THTA 4X92A 3PF8A 5AI5A 3H1BA 4EY6A 2DQYA 4G5XA 3QBJA 2HRQA 4B9EA 2WHRA 3T4UA 3A70A 2YYSA 4BRSA 5ALNA 2PSFA 1E66A 3ZWQA 5ALTA 2WFZA 1N5MA 1R88A 2BGRA 5HF6A 4QZVA 2PBLA 3WKEA 3ESDA 3FSGD 4FBLA 5AH0A 4H7FA 4LIPD 2WQZA 5CURA 1XZHA 2JIDA 4GDMA 3R3UA 2XMRA 1QIDA 2XQFA 3DEAA 2I3ZA 4FWBA 4IH4A 1YASA 1XQVA 2HA2A 3AIKA 4Y2TA 4WY8A 4AX4A 1AKNA 3ED1A 3L1JA 3RARA 3WI7A 1VE6A 3OC0A 3IUJA 4UBIA 4N5HX 1OXMA 5AM3A 3I2FA 2D0DA 3EF3A 4BRZA 3I2JA 4J3JA 2XE4A 3W2TA 1H2ZA 3WMRA 1GZ7A 3IUQA 1UFOA 2Y2UA 4K6GA 1BS9A 4BZWA 4EY8A 3LCRA 3WA7A 1T2NA 2XUHA 5ALVA 2PM8A 3BF8A 3R3YA 3C6XA 3WLAA 2VATA 1AURA 1DQYA 1GT6A 2PSDA 3H18A 1AX9A 1DT3A 4NMWA 1X2BA 5HF9A 3H04A 2WUGA 1EK2A 5I9IA 4BATA 1E8NA 4AZ3A 5IVIA 1EB8A 2VAVA 4OYLA 2RAUA 4XWGA 5LKRA 3QM1A 4BTVA 3FVRA 3QPAA 2VAXA 2AJDA 3R3XA 1QE3A 3STTA 4X00A 2HDWA 1Y7HA 2V97A 4UBOA 3FVTA 3VVLA 2WM2A 5AI9A 3I28A 5CMLA 1GQSA 1JMKC 4C4YA 2UZ0A 4D9JA 3I2HA 2ZYRA 4UHFA 4Y2UA 4MWSA 1K5PA 2BCEA 4GI1A 1YCDA 2FUKA 4HRXA 5KWIA 1LPPA 3OPMA 5LIPA 1BRTA 2PPLA 3I2GA 1XRMA 2RGUA 4G8DA 4N5IX 3CCBA 3BF7A 2OLEA 5E4JA 2HA6A 1P0MA 2O2HA 2ZYSA 4U2CA 3BIXA 3C45A 3DYIA 4WY5A 5AIAA 2NW6A 2AJLI 4ZWNA 2XLCA 3UUFA 2WFLB 4EY7A 2VJBA 4KAFA 4X94A 3V1MA 3AZPA 3KOOA 3F8SA 3O4GA 4BVLA 5YASA 3GFFA 4OYYA 1EA5A 4W63A 4G4GA 4J0KA 3FYUA 4DSZA 4BVJA 2ZJ7A 1EDDA 4Y2YA 4BAUA 3KDAA 5AK3A 5JAHA 1UOOA 3KXPA 5K5EA 1Q84A 1XRNA 5HF5A 5FPQA 2ROQA 4OPMA 1JI3A 4V2IA 1RP1A 2QOEA 2WG2A 3VVMA 2ZYIA 5C7YA 1ODCA 3T52A 2OGZA 3FWHA 1CUBA 3BDVA 4OB6A 1PV1A 1SC9A 2RI6A 3HABA 1RWQA 1G66A 1VA4A 1JFRA 4FFVA 2HM7A 3LP5A 3D59A 1UWCA 3CN7A 3L1HA 4MQLA 4PSDA 1Q0ZA 4H7DA 1T4MA 4QEKA 5C8XA 3KWFA 4BC0A 5JZ9A 2DQZA 3G0IA 4H35A 5DYTA 4W9RA 1CUSA 1CUVA 2XB6A 3C70A 4Q3KA 4Y2QA 4X6XA 2WKWA 3PICA 3FBWA 3GELA 3V1KA 2DCMA 4ZXFA 5KWJA 5CT5A 4WDQA 3NWOA 2CEKA 3WQHA 1IMJA 4IHAA 5FLKA 5FP0A 4K6HA 5AKIA 2QTBA 4DNOA 2CB9A 5EIAA 5H3HA 3ZPXA 2FX5A 1CUHA 1DINA 1VJ5A 3FYTA 1CR6A 5IH7A 3HYSA 1QIHA 1YB6A 2VSQA 1W76A 4P08A 3ILSA 1ZJ4A 4ITVA 1E8MA 4I3FA 4ZREA 1XFDA 3AILA 2Q0XA 5T4BA 2XUOA 4P9NA 4UHCA 1XRQA 4ZV9A 4XVCA 5ALLA 2R11A 2G4LA 4AN0A 1WHSA 3C6BA 1MNQA 5ALWA 3A2NA 4IH1A 4NZZA 5E4YA 5BV7A 5JD4A 3IIIA 1QIGA 4DMCA 1Y7IA 4G1FA 4BBZA 5C81A 1D07A 3KWJA 4XX1A 2IIVA 3E1GA 4EY4A 4KR0A 4QDXA 2GBIA 3ANSA 5DNWA 4DTCA 1BCRA 2IX9A 3B5EA 4J0IA 5KREA 3DNMA 1QO9A 1FFCA 5CT4A 4AN1A 3QMWA 1SCKA 3V9AA 3DDUA 4DNPA 3ESAA 3WJ1A 1XZCA 1A7UA 5KBYA 5FPPA 4WFJA 3QYJA 2X8BA 1HKHA 2ZVDA 3AJAA 3FLBA 2OAEA 3R3ZA 2QR5A 2XMGA 3EIOA 4W1QA 3H0CA 3G0CA 1X70A 1NU8A 5ALIA 1C7JA 3KSRA 4K2AA 5A7HA 5AJHA 4HTAA 3ICWA 4WDRA 4AXBA 2JGJA 4Q3OA 4FLFA 5JAOA 4X7BA 1GKKA 3STVA 4FNMA 4B6GA 1L7RA 4UFNA 3ESBA 1XQYA 3AINA 3R41A 2WHPB 2AJBA 5AK4A 4X3CA 5HKAA 4XJVA 4G4JA 2QM0A 2E3JA 4MJ3A 3W06A 4BCCA 1UT6A 2XMCA 3G9TA 3WIBA 4GXNA 3PUHA 2Z8XA 1QIMA 3QVMA 2HA7A 5IVHA 1DWQA 4CIAA 5CTAA 1XRPA 5F4ZA 2EDCA 1LBSA 2DHEA 1QO7A 2VTVA 2R8BA 4HRYA 3IUNA 5AI6A 2WG0A 1EDEA 1W52X 4DMHA 3DS8A 4KAAA 5BOVA 3FAKA 2WUFA 3W05A 4CI9A 2VA9A 1GGVA 1DX6A 4UBJA 1X2EA 3F96A 5K3DA 3GROA 5FDFA 3WK9A 3U1TA 3C8HA 1TCAA 1JMYA 1HPLA 3E0XA 3A2MA 4GECA 3ANTA 1E5TA 5JATA 3WIOA 2C4HA 1YR2A 5C8VA 1ZOIA 1JU4A 1XZDA 3HJUA 2OXEA 4GBGA 4P93A 4RPCA 3C5WP 1CLEA 2WTNA 3HACA 4BE4A 3O9VA 3ESCA 5AICA 2C5GA 4Y2XA 1WM1A 4J0JA 3S8YA 4WFKA 4Q82A 1C4XA 4C88A 4BE9A 3ZLTA 4B84A 5ALGA 1JJBA 2HIHA 4Y2SA 5AO9A 3AUKA 1R1DA 5JAUA 1XZAA 3R3WA 1K63A 1AGYA 5DYYA 4C6HA 3STYA 5D3ZA 3JW8A 4C4ZA 1MAHA 1USWA 5ALYA 3HZOA 2G5TA 4LYDA 2XUAA 1XKTA 1Q0RA 5IVKA 4J7AA 3RLIA 1XZEA 1OILA 4B82A 4RGYA 1XZLA 1L7AA 2GYVA 4Z49A 4DYHA 3C8DA 1G4HA 3D4LA 4K6KA 4FMPA 3BDIA 5HFAA 3PFBA 3G9ZA 4B0OA 1YS2X 4C89A 3EBLA 5CXXA 4F60A 4WFIA 3O4IA 3M3DA 3STWA 5AOCA 5LZ5A 1BN7A 1DX4A 1NX9A 3I6ZA 1BN6A 3PE6A 5HZGA 5K3AA 3DKRA 4ZI5A 4B81A 3MGAA 1TQHA 4FBMA 2O7VA 2QJRA 1QTIA 4U2EA 1J2EA 1EDBA 3F67A 2BUCA 2QS9A 1ORWA 1R3DA 4ZV7A 2HU8A 1YB7A 4H7HA 1VLQA 1ZI8A 1F6WA 2PUJA 1QLWA 2JGLA 1TIBA 1E8DA 5I7UA 3C6ZA 3STUA 2QZPA 4PW0A 2OQIA 3HI4A 2Z3ZA 1DT5A 1J06A 4KE6A 5CT8A 1CUUA 2J4CA 1XZBA 5LLSA 4ZRDA 5ALPA 3HEAA 1IZ7A 4QDZA 2OGSA 3O0DA 3G8YA 4G8CA 3AZOA 1CUJA 2IITA 3IBTA 4OUKX 1YA4A 3WWEA 2XUQA 1TKRA 1DWOA 1HLGA 1K8QA 2XLBA 4JYMA 4XIIA 2WU3A 3ZLVA 1WHTA 3WWOA 2JGFA 3C6YA 1PJAA 4N8DA 1H2XA 2O2GA 4PSCA 5AM5A 5EFZA 1FFBA 1KEZA 2XMSA 4H7KA 1JJFA 3AIOA 4Q3LA 1W75A 4PV7A 1CUDA 4X97A 4EY5A 2Y2VA 4ARBA 5ALJA 4UUQA 1YAHA 1U8EA 5AKYA 4FOLA 2OCLA 2W6CX 2PVSA 3WA6A 2PKYX 3WK5A 2QRUA 4BB0A 1MX5A 1QIIA 2J3QA 1ZD3A 5HQ3B 2GYWA 3N2ZB 1P0IA 2DR0A 4BVKA 1EK1A 3V1LA 3KD2A 5EI5A 3VJLA 1CQZA 2OCKA 3EQ8A 5EHNA 3JYHA 1ZIXA 1CUFA 1AQLA 4OU5A 4LYEA 4EZIA 2PUHA 1A8SA 4H7IA 1XZFA 3Q0TA 1KU6A 2ZSHA 3FYUB 1WPXA 4UHBA 1CPYA 1GXSA 2ACKA 1EXWA 3TGLA 4KE7A 1LPOA 2XUIA 1I6WA 5DYWA 1SFRA 5K3FA 1LLFA 4L0CA 3DYVA 3I1YA 1CUZA 3IVMA 1GKLA 4KRXA 5AIBA 2EEPA 4FFWA 1UK6A 5AOAA 4PF1A 5T4EA 3R40A 1KU0A 3K2IA 2Z8ZA 2BAGA 2Y6VA 1ZD2P 3WL7A 1DQZA 4UHDA 5ALSA 4OB7A 5JAPA 1EINA 5LYYA 2HFKA 3TRDA 2G63A 3G7NA 3IDAA 1QFSA 1W4LA 1ZI6A 2HA0A 3BIWA 3TJMA 1LBTA 4A5SA 2VJCA 3PDCA 1S8OA 2PSEA 1BEZA 4S0XA 3VISA 1EH5A 1L7QA 5AKZA 2H1IA 2ZJFA 3WZMA 3H2HA 3I2IA 1LNSA 1WCYA 4DGQA 3I2KA 5AHXA 3MUNA 4B83A 3LIIA 4DIUA 1SCQA 1CUCA 5ESRA 2K2QB 3BJMA 5BWBA 7YASA 5IKXA 1CUAA 3HSSA 3O4HA 3WK4A 1MU0A 2H7YA 3ZLUA 4K5QA 1WPRA 1IUNA 2XMDA 3PF9A 4JUIA 4B85A 1U2EA 2DHDA 1XQWA 2VF2A 3JWEA 4F21A 5JARA 1BEEA 1LZLA 3H17A 1UKAA 2D5LA 5A62A 4G9EA 2H7CA 4RE5A 5AP9A 1WOMA 4HXEB 3QMMA 5AOBA 2HADA 1XZIA 2XT0A 2B20A 4L9AA 1U4NA 3WL6A 4KEAA 5C8ZA 4W1PA 1U65A 2VEOA 2OG1A 1R50A 4H7EA 4Q1VA 2AJCA 1K6EA 2HFJA 3VKFA 5K3FB 2X5XA 1ZJ5A 2GBCA 3VJMA 4E14A 4B7ZA 1QIKA 3GBSA 3EQ7A 5ALMA 4DMFA 5AI0A 1CUEA 2WG1A 5ALEA 3WWCA 2GYUA 2H7XA 1TAHA 5I8PA 4MWTA 1EB9A 1JKMA 2B9VA 4C01A 1ZGBA 3SWWA 1J1IA 1WB5A 4OCZA 4CCYA 4OB8A 5JALA 5LZ9A 4I4CA 3MUOA 1O6GA 1CUGA 4H77A 5FUMA 4QLOA 3RK4A 3MVEA 4QDOA 3FYUC 5FOQA 2WJ4A 4WCVA 4O08A 1LZKA 1MPXA 1QIJA 4FLEA 2FJPA 1CIJA 5AKJA 1XRRA 3V1NA 3DJYA 4AO7A 1P0PA 3K9BA 4QWWA 5HK8A 1QONA 2PL5A 1P0QA 1E3QA 4UHEA 1UKCA 3ZV7A 1AUOA 2JEYA 3DCNA 2ZJ6A 4JNCA 3HC7A 1QIFA 4YASA 4IQ4A 3G9XA 4YK7A 1CUIA 4ZGBA 3PFCA 5AI8A 4A23A 1MO2A 3FLEA 5A6VA 3F98A 2OAGA 2BJHA 3LIPA 1LPBB 4HXGA 1VKHA 5AM2A 3DOIA 5HF8A 1E89A 3OTQA 2DSNA 5AKGA 1F0NA 4BP8A 4Q05A 5T4HA 1CFJA 5ALUA 4GW3A 3QH4A 4UFOA 2VJAA 1MT3A 5SYNA 5DNUA 1YS1X 4JH0A 3I6YA 1DU4A 5JZBA 3WZLA 3WK7A 3H2GA 3ICVA 3SC2A 4G9GA 5FXMA 1UKBA 1JJIA 2OQVA 4B9AA 4Y7DA 2H9YA 3DLTA 4CG1A 2XQIA 5CH8A 4PO3X 3FCYA 1CUXA 2C7BA 3DOHA 1B41A 1TCBA 4BCBA 1LGYA 2Y1KA 1MN6A 5K3EA 1A8QA 4AZ0A 3PUIA 2WLSA 1ETHA 2ONCA 3CCCA 4J0HA 4BDTA 2RONA 3NUZA 3PI6A 1QIEA 1CEXA 3SX4A 2YXPX 4U2DA 1QGED 4W1SA 4QA9A 1UK9A 3G9UA 1PFQA 2PX6A 4MQMA 3GA7A 5JASA 1HBJA 2C5FA 2HRRA 4W1RA 3ZI7A 1GPLA 3WYDA 1XZGA 3WYNA 3OURA 3D2BA 1EHYA 1YAJA 5A71A 1B6GA 1BU8A 3G0GA 3YASA 2I03A 4QDTA 2RHTA 3H19A 3D5EA 4M0EA 1THGA 1AZWA 5A7GA 2WIJA 4P92A 5LZ8A 1K4YA 5T4FA 1LPNA 2YASA 1MJ5A 5JADA 1F8UA 1MNAA 3D0KA 4A16A 3W9UA 2ACEA 2QXUA 4YPVA 5E4TA 4OU4A 4IO0A 1SCIA 3IUMA 1NU6A 3VJKA 1TK3A 4BCDA 1FFEA 4KJXA 2WSLA 3LS2A 3QPCA 3WWPA 2XMBA 2EDAA 5AKXA 1W1IA 1YSCA 4UBNA 4X85A 2B4KA 4QE3A 4IH9A 5HCUA 1G5FA 4H7JA 5EHZA 5ISMA 1VXRA 5HFNA 2XQGA 4X6UA 3DKKA 2BUAA 1DWPA 2PSJA 4LXGA 4BYMA 4AB1A 4C87A 1EX9A 4EBBA 5JIBA 1ZGCA 4HAIA 4BAZA 2QJWA 3H2KA 3N0TA 3WL8A 2I3DA 3HRHA 4FNGA 4E46A 3FSGA 3P2MA 4FDMA 2HU7A 1XLUA 4Y9SA 4YX9A 3WKDA 4RE6A 3OG9A 4EUSA 4KYVA 5CT9A 3D3NA 2XI4A 4ROTA 4Y2RA 2V9ZA 2O2IA 3B12A 4HXFB 1QFMA 1H2WA 1RYYA 4KAJA 3R3VA 1QTRA 5LKAA 1A8UA 3TEJA 5D7BA 5E2IA 3WKAA 1XROA 4GEGA 3O4JA 3STXA 1IUOA 1Y37A 3BL8A 4B80A 3NOXA 1UOQA 2PU7A 1XLWA 5K3CA 4MXDA 2W22A 4INZA 5A2GA 1TCCA 1N8SA 2C58A 3WL5A 2QUBA 3VDXA 4BP9A 3U0VA 4DSAA 4LHEA 1EVQA 5CW2A 5JYCA 1MX9A 4UFPA 4UBMA 3F97A 2HA3A 2JEZA 2BGNA 3OM8A 5ALRA 3FCXA 1GQRA 2P8SA 4AMZA 2OPHA 2WFLA 2JGIA 5HQ3A 1UK7A 4ETWA 1W6RA 4M0FA 5AKEA 2QUAA 1F0PA 1JU3A 3HXKA 4QNNA 1VA5A 4N8EA 2QMQA 3G0BA 4DLNA 3OOSA 1CQWA 4Y2PA 4BTLA 4J0DA 3UUEA 1N1MA 4AMYA 2WIFA 2WHQA 3BWXA 4KRYA 1FJ2A 1CUYA 1OCEA 1R4ZA 3DD5A 4G8BA 4MYDA 4B0PA 5IVDA 5ALZA 2J4FA 2XUJA 5A7FA 3E3AA 5FKJA 3WKBA 1XRLA 1VZ2A 2WTMA 2Z3WA 2GBGA 2AXEA 5EIEA 1H2YA 4X90A 2Y6UA 5ALOA 5CH5A 5K3BA 5AK5A 3QITA 2JGKA 4ARAA 4PQEA 3IULA 5BWCA 4X93A 2O7RA 5CH3A 3R0VA 1A88A 4X95A 3AIMA 1ZI9A 3CN9A 2CJPA 4H0CA 2QT9A 4TPKA 2XUDA 3BJRA 3I1IA 2CMFA 3X3HA 2WIGA 4LKOA 3QZUA 3G02A 2HA5A 2BUBA 3H2IA 2WUDA 5EHQA 1ODTC 5FV4A 1C7IA 2XMQA 1ZD4A 1MX1A 1VE7A 5AKLA 1UZAA 5DTJA 2OCGA 5AK6A 2ES4A 4CG3A 4FTWA 2VQ6A 4J0CA 6YASA 1FFAA 1AC5A 1HDEA 3DQZA 5AI4A 1DTEA 2VT6A 5DLPA 2XUFA 3V48A 2JF0A 4UPDA 3O95A 4FLMA 2HU5A 5JZSA 3L1IA 4PSUA 4F0JA 5J3JA 4CCYB 1IUPA 3GZJA 3H2JA 3CXUA 4G4IA 5HKBA 5ALKA 1ZD5A 1MTZA 2J3DA 1CVLA 1MAAA 1H23A 2DFPA 2PU5A 2HL6A 1EI9A 3SK0A 5LZ2A 3G0DA 1SOMA 1GPNA 4JEIA 2WIDA 5LZ7A 3IA2A 3QPDA 4H18A 4GLBA 4DNFA 2I78A 1G42A 2HA4A 4FHZA 1ZICA 2V96A 1H22A 4Q34A 4HS9A 3C87A 1QZ3A 4J0GA 3BE8A 3W04A 5ALXA 3IB3A 2WU4A 1XQXA 3AFIA 3D2AA 5DWDA 2WFMA 1ACLA 4BAGA 3M81A 5AKHA 3IURA 2XUKA 5EHXA 5CRIA 1LPMA 4U2BA 1QJ4A 3WJ2A 2RIPA 1BE0A 5SYMA 5AM4A 4UBLA 3BXPA 2DHCA 5AM1A 3K6KA 1R9MA 5CBKA 3F9CA 1UK8A 2WUEA 5JD6A 4CFSA 4CG2A 4BDSA 4TGLA 4DM7A 1XLVA 4LXHA 3EQ9A 4EHBA 2X76A 1ODSA 4Y2JA 4F5ZA 2PSHA 4AQDA 2ZYHA 1VOTA 1QOZA 1UXOA 4OSEA 3D2CA 5AM0A 2Z5GA 2CZQA 1J07A 2JBWA 3DL7A 3VXKA 2C0PA 4NS4A 4EB0A 1AMNA 1BCSA 3AZQA 2AJ8A 1CV2A 4UBKA 5AKKA 3O9MA 4CCWA 1EVEA 4I19A 3NGMA 4QWMA 4GHWA 2WHPA 3A6ZA 4TVKA 3RM3A 5HK9A 1N5RA 3FOBA 3S2ZA 1LPSA 2C0QA 2YH2A 2XUPA 2CKMA 2WJ3A 4E11A 5FRDA 4BC1A 1XZKA 3HLKA 4U2GA 4PNZA 4X6YA 5LP1A 4FKBA 1LPAB 5JD5A 3Q8WA 4HVTA 4QLAA 5ALDA 4AO8A 1WB6A 5DJ5A 2CBGA 2ECFA 4CIBA 5DNVA 5CT6A 3WK6A 1Q83A 4J03A 4X71A 2WJ6A 3GUUA 4WJLA 2XQKA 4OD0A 2LIPA 3A2LA 2QKYA 1FSSA 2XDWA 2HHAA 2QXTA 1FFDA 2WILA 3WK8A 2XQJA 3M83A 1HQDA 1BROA 2JGMA 3DL4A 3WKCA 2ORYA 2B61A 2VT7A 4LXIA 4QDUA 4JYPA 3I6MA 1CRLA 4DNQA 1VZ3A 2RHWA 4Y2VA 1VXOA 4MEAA 3QMVA 2OGTA 2XUGA 3W9BA 3M82A 4KE8A 2GBFA 2GZSA 5DTIA 1TRHA 5D3KA 1YA8A 4AO6A 2OCIA 4EA6A 1R9NA 4BZZA 4C4XA 1GPKA 2GZRA 2WIKA 3H1AA 4DMKA 1IZ8A 2ZSIA 2V98A 1HL7A 5EGNA 3RKSA 4MEBA 2QVBA 4UHHA 1JT2A 2JGEA 4KACA 2BFNA 3D7RA 1XKLA 4L72A 3C5VA 4KE9A 2FJ0A 1WB4A 4M0MA 1O6FA 2G5PA 3WWDA
chains in the Genus database with same CATH superfamily
1EGMB 2CUTA 5FYDA 3HVJA 2C9ZA 5CD1A 5AHKA 3MF4A 2BBTA 2MTBA 1QC5B 5TX7A 3ILVA 2GPBA 5CXUA 1YVUA 1NN0A 2H0QA 3R7SA 4JP5A 1AK2A 4U1RA 4IHJF 4Z1MA 2REBA 4MS1B 3RWOA 4BJ1A 2UUBB 2XB2A 3JWIA 1JHYA 1KC1A 3ABIA 3GEEA 3L7LA 4NAVA 1P4GA 1WA5A 2PKQO 5KPDA 1YZKA 3IESA 3SBXA 1FP1D 1QYVA 2IXDA 3SZRA 3OECA 2VP4A 4H0FA 3P4YA 4WXPA 4EKGA 5EJEA 3DBLB 5LZ4A 1TM5E 1BTOA 1L7EA 4XFDA 5ALQA 2AG6A 1XMPA 3ACBA 3IP3A 2ZROA 3Q1LA 1GM5A 1L6IA 4K6FA 1R4MB 1LLDA 3I6BA 2VJDA 2I91A 3DE4X 2J9XB 2ZLBA 1T9BA 2DHQA 3LUGA 1QX4A 3NIBA 2DY1A 4N8SA 4PICA 4ZMSA 3THWB 1NA5A 2ZUEA 1LW6E 3T9CA 1CKEA 1SBCA 3SU8A 3TQRA 4D98A 3GC6A 1W35A 5JLAA 3DZ8A 3OZIA 5ALFA 4DY6A 2ONZA 1KOFA 4OAQA 4BLVA 3S28A 2NQ2C 3KQOA 2FVYA 3FDIA 3UJBA 4OFWA 1PG0A 1P91A 1DEKA 1P31A 3PF8A 4L9RA 1OBHA 5AI5A 5A3VA 1ZM9A 3DOEA 4PAWA 3NTQA 3OPYI 4G5XA 4NMHA 4NOLA 2HRQA 5BN5B 1A9SA 5H4GA 3QUAA 1RPAA 3HXOA 4BRSA 3VZQA 3CEJA 3H99A 1ZJWA 1NE2A 1EM6A 3AONB 2O1SA 2CNKA 3GLUA 1DV2A 3WYBA 1AXGA 1O97C 4MLCA 1J8DA 1Q1QA 3Q3HA 3VH3A 1LWOA 1NRXA 3C14C 3UXYA 1R88A 2GN8A 3UANA 5ABPA 2H4WA 4QZVA 2PBLA 4AF7A 4TN1A 1DKMA 4D5EA 2PUDA 1R6UA 5H80A 2FW6A 3RT9A 5BMOA 3ETJA 2AUNA 3IJ5A 1K3FA 3B78A 1W2GA 3GRCA 2PTGA 3K0CA 1BS2A 1H8HA 1X1SA 2G9UA 3IPAA 3LDAA 2EFYA 2QNBA 1TOAA 2IYRA 2P9QA 3JRNA 3OCWA 1E2QA 4OJTA 1DARA 4W6ZA 1TA4A 1UBRS 3VZSA 5CURA 2O8EA 2XDAA 2G3YA 2X8JB 2RI1A 3N2KB 2EATA 3R3UA 4FYPA 3DDHA 1ATZA 1QIDA 1PW7A 1A96A 3C16C 2LCQA 6REQA 2FSHA 2XQFA 4AAYA 1UQRA 4FWBA 4KPGA 1DAOA 3NFYA 4QUEA 2HZ7A 1DVRA 2EW1A 1C9NA 3JALA 5A4FS 4LRQA 4ZYZA 2F3RA 1R5OA 2DWQA 3FE2A 2MHCA 2QW8A 4GPBA 2A9VA 4B33A 4HBGA 4ODIA 4RABA 1FW6A 4Y8VA 2KBFA 4CM7A 2YL2A 2B7LA 3KJIA 4GE3A 3RARA 4D3ZA 2WIAA 3A1DA 5LMCA 1M6YA 1VE6A 2W5UA 5EZQA 5JSKA 2ZRNA 4FDLA 1OYWA 1YIAA 3D6FA 3KSBC 4NR0A 1KDRA 1P5HA 4YCBA 2BTQB 1F3OA 1UKEA 2O0LA 4IGAA 4P81A 1JR6A 2I4RA 1TU0A 3IBYA 2XF8A 1IATA 4IIJA 4LXTA 3PTAA 3BGWA 3I2FA 3SZLA 3O8QA 1NTOA 4HFNA 1Q1NA 4EQZA 3ZDEA 2BFDA 3UBTA 3MMXA 1PT8A 4M1TA 4ZOEA 3WQSB 3IEMA 2VRNA 2NZXA 3Q8XB 1J5EB 4HLNA 1DJPA 4AMUA 4HWOA 4JC5A 2HTFA 3SM9A 5JCZA 1XU7A 2C7VA 2VJMA 4C76A 1NF9A 3WMRA 1A9TA 3U56A 4POAA 4WZAE 4NCHA 1RQLA 4YFYA 4BJ3A 1UFOA 2IPNA 4MI1A 2J6IA 2O3UA 4RHFA 5EGSA 3ROTA 2DERA 1BS9A 1Q3TA 4EL5A 1RCUA 3LCRA 1GR0A 1V48A 2WVHA 3VR4H 5IUNC 3ZJYA 3OM1A 1H05A 2WWHA 1BMFD 3BXXA 4M0PA 4NEHB 2F43A 3RFVA 3SIPA 4WOCA 5E1BA 2FFRA 5AXDA 3C6XA 1M73E 4BLPA 2AR0A 4BO2A 2ONKA 3I4CA 3OQJA 1GGJA 2DF8A 4LE1A 4PRLA 4QYMA 2WVGA 3JQAD 4P4NA 1DQYA 2JJ1A 4KLNA 5FOWA 5LDGA 5KSPA 2QV0A 1GT6A 4LZWA 2AI3A 4IPTA 5TPWA 3TD9A 1PZFA 3H1GA 1WVMA 3TI9A 1DQPA 2YHAA 3ZCVA 4AUNA 2VOEA 3DZFA 3H18A 3P9RA 4V02A 3UW1A 3VPGA 5BOSA 1VSQA 1KY5A 1YBFA 4NMWA 4FNAA 1TZJA 3TIXB 4A2QA 1P29A 1QAQA 3AEYA 2NO4A 2YCBA 3U7EB 4YT4A 2D0OB 2FJUA 5IYZF 2XOXA 1KBQA 2C42A 3KKKA 5A5FA 3FR8A 2AEJA 2IS4A 2V6FA 3AG5A 3AEKA 2CL6X 3PQFA 1EB8A 3GLHE 4GSYA 2CJFA 2FPIB 4QNRA 5DNEA 5K0NA 4EF5A 2AI2A 2RSLA 3LXMA 1IHUA 2GPTA 4HYEA 5IWCA 2Q5IA 3FYSA 4FSXA 4BWVA 2J9FB 2V03A 5FOXA 5AUNB 3CBQA 3PRJA 3QNUA 2RAUA 2IFTA 4XWGA 5FNVF 5LKRA 5JC8A 4HH1A 2GFHA 3QM1A 3MMSA 4MQBA 3QU4A 2X19A 1ZITA 2R8XA 2GCOA 2CNWD 2A5JA 3FVRA 4YALA 3K1ZA 3TDMA 2BR3A 1KK3A 1N0UA 1U5AA 3VH4A 1G8JA 4GZLA 4PC2A 3VA7A 3OF2A 2FSPA 1E7QA 3VDNB 4KYIB 4NQZA 1IVSA 1HWYA 1EZ1A 1L5MA 1ND6A 5EWLA 5BR8B 1Y7HA 4S1OA 1NJGA 4KO8A 5DX8A 4DB4A 2I67A 3MK31 3RUPA 3TI7A 4BVAA 5LYJA 4CMGA 3IAEA 3PYLA 1QUEA 3FNHA 4C4TA 4ID9A 1UPXA 1L7PA 1OA1A 2F1OA 3CGWA 3GJSA 3QKTA 4R1PA 2JIOA 4QGAA 4V24A 2FPSA 3TCXB 3I2HA 8ADHA 1YONA 1VP9A 3R1IA 4Y2UA 4DUYB 5GJWC 2BMWA 4MB6A 3UWMA 4PY2A 2A57A 4MWSA 5H68A 3QUTA 1KSGA 2Y0PA 4QGSA 2JFFA 3G3EA 4JK3A 2GYYA 5IHPA 3OPMA 4UU1A 4MW4A 7AT1A 1BRTA 4NCNA 5CDYA 2KQUA 4NJOA 4GRAA 5JOQA 1BO6A 2JFGA 4C7XA 2WLTA 3KFVA 1S8NA 2YXEA 5E4JA 4MR8A 4M7RA 2PTHA 2BFDB 4ASUA 1JZSA 3WQBA 3D7NA 3DYIA 3K9WA 3DV2A 4NC9A 1B3RA 2CHQA 5AIAA 4I81A 4N40A 4A7PA 3ZCXA 5JO0A 3ZKWB 3LCUA 1ONBA 2R7MA 2VJBA 3PRHA 1XTZA 4M6WA 4ZDJA 2XCOA 3DKVA 4KAFA 3I5MA 2JBAB 3BG5A 2W4IA 2R6DA 4ZEXA 5JJIA 3R44A 2B30A 3QVUA 4EKIA 4ARUA 3GJRA 2DFDA 3BMQB 1P45A 1T6YA 3P2EA 4LVCA 5C7OO 4MPDA 5YASA 3E0QA 1C1YA 4CKEB 4RXTA 1GLGA 3VZBA 3EIFA 1XTTA 4XIYA 1AU9A 4JI3B 3ER9A 2VYQA 4EGJA 1BGWA 2O0HA 1CJSA 1FX0A 1CT9A 3FYUA 1KNXA 1NBHA 1YDGA 2BKXA 1UIMA 4D0LB 4DSZA 3VVBA 1C0IA 5CAEA 1K7FB 1OGJA 2UYOA 3FTPA 2Q5JA 5BSMA 4BVJA 4EAQA 4H16A 1XDSA 1UPFA 3KDAA 1DXHA 5JHGB 2J7PD 3E9YA 3OLVA 4MV1A 1QUFA 2QMHA 3U16A 5IPFA 1UOOA 2VUIB 1NVKA 5KMGB 1O94A 2ZAOA 1H1LB 4C2BA 4PRKA 1QG6A 1RT9A 2FW1A 5KDLA 1NVGA 1W85B 1XRNA 3HL4A 5E7JA 2PR7A 1R15A 2QYTA 1T5BA 2CVFA 2PYDA 1ULTA 3ESRA 3H5LA 5IAGA 3LU1A 3WB2A 4ZC1A 1JXOA 2DBYA 1BE6A 2ROQA 4XGIA 3UK2A 5IYZA 1A76A 4TZKA 3VVMA 2YUTA 2NV6A 2H65A 4GYKA 4L76A 4XLLA 3KR9A 2VTBB 2XADA 4HTFA 4CHTA 2FE1A 2Y1XA 1USIA 3NNNA 2Z2IA 5FLEX 3K96A 4JT4A 3OF5A 3P0FA 5AW7A 3WYCA 2H2FA 1TYAE 3BDVA 5KOYA 3FF1A 4W4TA 3DH0A 3R5TA 5ITVA 3BWDD 3GW8A 4OB6A 1SC9A 2NAPA 1GD1O 3E2PA 4ZPJA 1NBME 1GPDG 1SIWA 4ZK2A 1BE8A 3M4JA 2QD5A 1G8KA 3HABA 1Y6ZA 2FUG1 2L82A 3UTCA 1ILEA 1AZLA 3AY6A 3NHLA 4R7GA 5F2EA 3BSSA 3VU8A 1KSJA 4WZBA 3RUHA 1SAYA 4GPAA 2XMPA 2MR5A 3GP3A 2AG1A 2AYYA 1DAKA 1NMSA 4ZEOA 1IG0A 3O75A 4HAUA 3GH1A 4FFVA 1JFRA 4OHVA 1E3IA 1GDDA 1M1YB 1W73A 2ZUUA 3EIEA 3P9SA 5K0GA 3LP5A 3HUTA 4KQKA 1XDWA 3A9SA 4MR9A 1GG8A 1TXGA 1BMFA 5BW8A 2XKKA 2E4ZA 3GRKA 1U0GA 1GUDA 3TOCA 3ZHCA 2CE7A 3GZNB 3AEZA 4MQLA 3W2GA 4NG4A 3KQPA 5AWFC 2GK6A 3ZTTA 3PNOA 4U6SA 3R74A 4QU0A 4RHTA 5KQMA 5FBQB 1Q0ZA 2MMCA 4YUYA 5K9ZA 1T4MA 4QEKA 2HRBA 1KJJA 3KWFA 4K0RA 2EJUA 3KUKA 3S3TA 2XCIA 1T5IA 1QPBA 2IGBA 4HDQB 3KYDA 4BNGA 2XJ4A 4ON9A 4B7UA 1E2LA 2X7JA 4J7CA 2GRAA 4Q3KA 3ZXXA 3LKVA 1VMAA 2AG5A 4B79A 1E3WB 5KU7A 5DHUA 4X6XA 1C9DB 2E7ZA 3TXYA 1DADA 4O1HA 3V1KA 1TQ4A 1UPTA 2RCYA 2GN2A 2Z2XA 4JYCA 4QSMA 4J16C 5CT5A 2DSTA 3FRIA 4XPIB 4RGBA 2JLUA 5IKEA 2F8TA 1ZN8A 2AOWA 2MYTA 4ZCPA 3BQ9A 4KWHA 1U2QA 2HRCA 4IHAA 3QYAA 3LGAA 4V0RA 2ZBVA 4XCQA 5JDIC 1YOVB 3EXEB 3KS9A 4FDAA 1W34A 1Z82A 2FZCA 4GOKA 4WADA 4DPLA 2QTBA 2VCEA 1PK8A 1D09A 2O8DB 1BX3A 2WM9B 3CLTD 5CVEA 2FW7A 4ZAGA 5EJ8A 1TCUA 4YRGA 4EHHA 4W5QA 1ZONA 1ESZA 2V7BA 3HJRA 5H3HA 2AK2A 1TECE 3UAZA 3U39A 1CUHA 1JLHA 2IYLD 1DINA 3F6PA 4RFVA 4PLGA 1UDCA 5A4MS 1ZK3A 4YJKA 1RXUA 1CR6A 1NQAO 2DECA 2NZJA 2QUHA 3QY9A 5IC5A 3HYSA 4MVJF 1I7NA 1YB6A 4TS1A 5I9SA 3SBEA 5J58A 4YMVA 3PXAA 4P08A 3F4BA 1KAQA 3ILSA 3OESA 1ZJ4A 2PD3A 4ITVA 3QXCA 4RD2A 4ZC8A 3RWBA 3L0BA 3DHNA 3R5SA 4EI9A 4XA8A 1YE8A 2GJ8A 3AI3A 5BSVA 1CRPA 4IQFA 5EC8A 1CS0A 1SXJE 3H2YA 4KYTA 3OZUA 3PZRA 5DDIP 4YJ2A 2Y93A 1JAIA 2QYHA 3KYDB 1VSBA 1VJDA 1E1QD 1FB5A 2PUWA 2Q0XA 1IY1A 1KO1A 1SM4A 2YS6A 5IAAA 3PHHA 3MC1A 2XX3A 2CLMB 3K15A 4KTTE 2JLVA 4ZV9A 4DWWA 2CV1A 4KFSA 1TLFA 4L6CA 4B3BA 4OK3A 1CR4A 2HJ9A 3UHOA 2WA2A 2HPVA 4L2IA 2ZJ3A 3CVOA 5TEWA 1U7XA 1NV8A 3CM0A 2IXEA 3NKLA 2BKAA 1GCIA 4NG5A 3GEBA 1XPOA 4DMUB 3MXTA 1BKYA 4BJ5A 3PHLA 1O7JA 3TDNA 4ZVKA 1WHSA 4I50A 3ZDRA 4QOGA 1IZZA 1VG8A 2OQ2A 3W4JA 1Z2AA 3HB1A 1B1CA 1FMJA 3A2NA 3NKVA 5ALWA 2XXJA 3H5AA 1D4AA 4MKGA 2H1RA 4NZZA 3NHYA 1MB9A 2CLIB 3REGA 2H1CA 1OZ0A 3FROA 3SC3A 2ORVA 2NSYA 3T5MA 1YDEA 1BNCA 3KQVA 2GVDC 4DMCA 5I48A 1P81A 1SQ0A 2WF6A 5DEOA 2LVBA 3E05A 5JJKA 1Y7IA 4BBZA 3Q87B 2VAWA 4R2HA 4DEVA 3EXG2 3KOUA 1OWPA 1D7OA 4HGPA 2B37A 2X23A 4M0CA 3DCJA 4E12A 3F5FA 4K46A 5BMVA 3IMEA 4JOSA 1RPJA 2VP3A 4B43A 3AJEA 4L8FA 1JUDA 2G36A 3BB4A 3UHAA 1E32A 5DGDA 1U8CB 4DDKA 2QRVB 3E1GA 2CXOA 2PPVA 2GD1O 1U2DA 2RGXA 4H60A 2HMAA 1Z0KA 2HQBA 4K40A 4JLPA 4MO9A 1X80A 1BCRA 2ZTVA 2A9JA 4ZJZA 1CQJB 4DV4B 1VL2A 3MTBA 3NAMA 4DBLE 2R5WA 3V1UA 2H59A 2HXGA 3GFTA 1QVZA 3H0KA 3A04A 1Z16A 2FOXA 3DNMA 1IRXA 1QO9A 2PZMA 2GEDA 3GV0A 3PLRA 4XW2A 3VPSA 4BNNA 1AHNA 5JCXA 3L49A 1PFKA 3QPWA 3ZHOA 3ND8A 3QMWA 1HYGA 5CEFA 4HK4A 1SCKA 3HMQA 4IXMA 3V9AA 3ESAA 3W9SA 5C3UA 1A7UA 5KBYA 3L6CA 5FPPA 2CLLB 4BFSA 4DLWA 2AFRA 3PCXA 1YTLA 3D7SA 1J7JA 3FBGA 3SBOA 4O4HF 3E22B 1UXJA 3QYJA 3SD7A 5B58T 1EAMA 2B2XA 2J3IA 4WLOA 3W4KA 3WGIA 2QORA 2RHMA 4WECA 2FPGA 4BZQA 3O73A 4CM6A 1RZVA 1ST3A 4DL9A 3JQAB 3BCRA 3CLUD 4UZEA 5K6TA 3OE7A 4N3CA 3OJEA 1TUBB 1ODLA 4BX2A 4XDHA 2OAEA 3P7MA 1I1NA 2ZIGA 4IX9A 4KXMA 4LQDA 4PQRA 2H8KA 3DWEX 4Q12A 3TZHA 4RJJA 4WXYB 1ZR4A 4IJ6A 2NU6B 3H0CA 4X45A 2H52A 4J8PA 1L5WA 4OH1A 1QOQB 3NP9A 4RJLA 1T3SA 3KSRA 2MSEB 4MPJA 4RJKA 5FL3A 4UAVA 2X7XA 2WKRA 4HTAA 2D0PB 4IXDA 4LOKA 4RQUA 1KHHA 4EPXA 1YBVA 2F1JA 3M70A 4PZYA 5KZMB 1FTYA 1I6MA 4GKBA 4AXBA 1QM5A 2GLUA 3R3JA 4MZDA 4N0QA 4TLAA 4HQ6A 5A06A 1PL6A 5E7QA 2ACWA 1QYRA 1AS2A 1K3UB 1CSEE 3CEPB 4UM5A 2GHIA 2OY0A 2D06A 5IT4A 1OZGA 1XXHE 2EP7A 1H8EA 4KDFA 4W9NA 1OH5A 5HTOA 2QDXA 4GPTA 1QSGA 3OKAA 1JZTA 3O7MA 1P62B 3FPGA 2JFOA 4YR9A 1L4BA 1UODA 3EXFB 4YMUA 1VKRA 2JZOA 4GP7A 3FD8A 2XYGA 3D64A 3GY0A 4QXAA 3K9CA 4XJVA 5HKAA 5GAJA 3LBAA 5IT9A 4AKGA 2PZLA 2CBZA 2DT8A 3HUFA 4Z0NA 1MOSA 3NLLA 5H59A 1QRUA 4HC4A 1P74A 2Q6OA 3WIBA 2B6HA 1XJCA 4HG2A 1ISHA 1KYVA 2CN1A 4K2HA 4MV8A 3QVMA 4R8KA 4ZVLA 5BSUA 3L04A 4Z3OA 5AXAA 2HA7A 4GYWA 4QHTA 5IVHA 2IEIA 2UKDA 5CTAA 1O94C 2BV3A 4Y6GB 4ND6A 5J5VA 1KAMA 2EDCA 1CZKA 1MV5A 2FPOA 3ES9A 3SEAA 1LBSA 2ZRDA 4MJLA 3L0IB 2DHEA 3H1TA 2ZUDA 4KMMA 3FDJA 3H5IA 4BPRA 5BORA 3R8CA 2VTVA 5C8YB 1CY2A 1WF6A 4OMCA 3ZU6A 1UM9A 3MA0A 2IH4A 1D1PA 3IUNA 5AI6A 2WG0A 3DHWC 3RV3A 2HYIC 1EDEA 3FKSD 4K9SA 1R8XA 4MINA 3A4NA 1XDDA 2GHTA 5AQ1A 1NDHA 1HF3A 2PD4A 1Z7EA 2PKRA 3N8IA 4W8HA 4YIKA 4EJSC 3Q3VA 3FTQA 3H05A 4HWRA 5EQDA 3WR5A 3X2FA 5AVTA 1OBCA 2WUFA 3EHEA 3FZQA 4DRYA 1EBFA 3DZBA 4XWWA 2GHRA 5IJ9B 4UKDA 4UBJA 1X2EA 5FI0B 1DJOA 2IY7A 2YFQA 4DIFA 4YBRA 2ZT5A 4KQWA 2BI4A 1IOZA 1SCBA 2QN6A 2AB0A 1IJKA 3F7MA 3P9QA 1W4BA 4KBGA 1PZMA 4KN9S 3A9CA 4ZVQA 1KEUA 3TLJA 3U1TA 3VOAA 3CRZA 1QRTA 1CE8A 1U0SY 4LVNA 1RWPA 3FMOB 2QTNA 2BFEA 1VGRA 1I2DA 2GARA 4WFQA 3UYKA 3WDSA 3X2SA 1WKVA 4MQEA 3CTPA 2MINA 3ANTA 1VJCA 2GF2A 3Q9UA 4TMWA 1E5TA 4GXQA 5DTRA 5IM5A 2CV0A 4MWCA 2C4HA 3C3CA 1F17A 1PQYA 4CBVA 1PL8A 2JIZA 2BSQA 2Y05A 1ZAKA 5AJWA 2ZTSA 1XZDA 1L8XA 3UM9A 2OXEA 2NXEA 1XT6A 3GHYA 3LO5A 4QGBA 1JSCA 4GBGA 3NGXA 2POCA 3KVRA 4PQFA 1NG9A 5CVUA 3GT0A 1NNSA 2CDBA 2ORWA 1IQRA 3HACA 4TT8A 4YRLA 3C3WA 3T3GA 3TXXA 3UK6A 5B4UA 5J4LA 2ID9A 1M1NB 3IB6A 5AVYA 1XZPA 2FG5A 5JRZA 1E4EA 4KSBA 1N6HA 1ICEA 1KY3A 1L6RA 4UUNA 1NM5C 2I4NA 1YE5A 4IVNA 4MLZA 2W83A 2VK2A 2NO0A 3K2BA 4Q82A 4X8LA 2ZITA 5E6SA 3S1LA 3W3AD 5IDQA 3DFKA 3ZLTA 2OZPA 2V4UA 1U3TA 3Q11A 1JJBA 4XCVA 2HIHA 3NKFA 3AUKA 4DLXA 4Q93A 1XZAA 3J81k 1C8VB 4GF5A 3RJTA 4EENA 5BWMA 1WSDA 2PZKA 5CX1B 3RFCA 1FVFA 2PKQP 3DAYA 1VSTA 3DZIA 4BE7B 3PWTA 1U9JA 2OZLA 2OSBA 2XW6A 4NS1A 5FTJA 3N2NA 1MAHA 3HCEA 3GB9A 1G5HA 3CG4A 4Q00A 3V2GA 4YHHB 3EX7C 1RQNA 2YR0A 1PJLA 3U7QA 3HZOA 1ID1A 3GJTA 2XUAA 3RYIA 2WT9A 1OPRA 3I9V1 3L8DA 4LOIA 2AOUA 2C1EA 4ZT2A 2CEAA 2OESA 2ZJ4A 4M0KA 4KPUB 4O4LB 1ZG3A 4YFVA 4RSMA 5BURA 4QNMA 3GVCA 1RZ3A 3A1TA 4N7JA 4U0JA 1V4BA 4KAXA 3ZK7A 3MWEB 5TNXA 2BHNA 3ZNQA 2VXBA 5F9HA 1UL1X 2QMEA 2HSGA 3CLSC 4RGYA 1KDPA 2M32A 4JVOA 2W58A 1IPFA 3JALB 3T12A 4DOMA 4KFUA 4B3CA 3BILA 8MHTA 3WLNA 5D86A 5DMHA 1YNSA 2GUWA 3S27A 4DZTA 5FBRB 3LQ1A 2YC4C 9LDBA 4QVGA 3CE6A 4M4SA 3TTSA 2GZHA 4DYHA 2I9PA 1JJVA 2VH5R 4F3RA 4GR9A 4QGFA 3KXLA 4ZTUB 2GT1A 2QU7A 3PFBA 1YQQA 3D6UA 4ZZIA 1IJBA 3G9ZA 3I8OA 3KQNA 1FSZA 1E9AA 4ZDWA 4JDUA 2V5UA 4BVFA 1Z38A 4ZYTA 1A72A 5EHIA 4C89A 4CW7A 4ZT4A 3OSUA 3K0EA 2QM8A 1P1RA 2A33A 3E3MA 4HDMB 5L45A 4KQIA 2BHSA 4C6TB 1NUAA 1C7ZA 1WQ3A 1TUBA 1QX3A 3WLMA 5TVKA 5AOCA 4M49A 3UJCA 5LZ5A 3KVYA 2ZUBA 3G88A 1BN7A 2A78A 4IDCA 1J8FA 3IAFA 3I6ZA 1BN6A 2A94A 1DDGA 1JR4A 3UB3A 3JASB 5K3AA 4HUJA 3OFKA 4YJ3B 3ZHBA 2Q3HA 1UR5A 2B8NA 1FP6A 2BE7A 3ZY6A 2XQVA 4BO4A 1PR9A 1Z6AA 4Q4JA 2YJNA 4ZI5A 3GZTB 1E9SA 2I3BA 3P9ZA 5EESA 4B81A 1QTQA 1TQHA 2CLKB 1H9CA 1X1TA 1J2EA 3OY7A 5L4LA 2F1IA 1HE3A 4DT1B 1PKEA 3UHJA 3D6NB 3CYFA 5EPOA 5DP1A 3EC1A 3REOA 4CMIA 1E9CA 4A0HA 2H4HA 3SIXA 1OYVA 1F1BA 3AHHA 4M8KA 4DNXA 3ZK8A 1YQ9A 4G2TA 3RFXA 4CF6A 1Y7LA 3F67A 5KTMA 1V95A 1M8PA 1O08A 1SA0A 3PCRB 1SU8A 2J9YB 4LOHA 5FPYA 4ZYUA 3NETA 1DO2A 4RTMA 4V0MA 4HMPA 5K6AC 1KRWA 2HJWA 3SZGA 1YB7A 5JCPA 3CPEA 2J5QA 5C4IA 4N6OA 4LJRA 2PZGA 3DM9B 2FSSA 3RVBA 1YQDA 1O57A 1AY0A 5TRTA 1VLQA 4L73A 1P60A 1MO3A 4G89A 4II3A 3RHZA 4BFUA 3RYHA 3G2JA 1ZWKA 4KH0A 3W78A 8AT1A 3EPKA 3DT9A 3R8XA 4Z9BA 2IXBA 4WKOA 1QLJA 3ZGVA 3AB8A 1SOUA 2DTEA 3HKDA 5FFMA 3PNMA 1E8DA 4OXRA 5GVRA 3C6ZA 1A4RA 4TKUA 3H1EA 3ESQA 3L8CA 2VHYA 2WD7B 3PEWA 3EGDB 3GDFA 4F93B 1E3TA 4XLZA 5BSHA 5ECGC 3G7SA 3AVYA 4XB6B 5CG2A 3E9ZA 3GDHA 1OOEA 1TI7A 5CT8A 2X0NA 3CVXA 2QMZA 1L4FA 3R9WA 1P1IA 1B42A 1Z8HA 1PI3A 3NYIA 2OG2A 1WETA 1MJNA 1XZBA 2BVNA 5CUQA 4BV2A 2IHJA 3JXEA 3CVYA 1QH1A 3LC0A 5LLSA 4ZRDA 2VDUE 1EE1A 3NVKI 5TGZA 2O8FA 4PFKA 3GAMA 4LZLA 1QAOA 3JV7A 3V7UA 4C6RA 3O90A 3IEUA 4R1OA 4RU1A 1RM4A 2GCOB 2I1WA 1NSTA 1UDWA 3G8YA 4CUJA 5LLTA 4LFAB 1CRZA 3QLJA 3VV3A 4F5WA 5DBFA 3TQQA 5K0BA 1H4VB 3IE1A 1JDZA 4QYIB 3PHIA 3TKAA 2NU9A 3IAXA 5IBCA 5CYPA 3SQDA 3HEBA 4GI3A 4Q9AA 1RRMA 3LKZA 1NOIA 3UN1A 5GJBA 2XLBA 4ESOA 4OXQA 2WU3A 2ZTHA 2WT4A 1FFXB 4HUQB 5A3SA 1WHTA 5TQVA 3WLSA 4B44A 4D0GA 4PRYA 1SXIA 3OA2A 1NHWA 4R7ZA 1Z2EA 4D9HA 1JS1X 5IANA 2BEVA 5FBKA 1E94E 4JR0A 3EGIA 1ML3A 2PMKA 4DQKA 4P0PB 1AB5A 4YCJA 1PZHA 4BQPA 1SVMA 2BFMA 4N8DA 4MVJM 4WVLA 5D3QA 5JNTA 3D8RA 2E4AA 1EQ2A 1I2ZA 3CR8A 3LWZA 3OPNA 4PGMA 4PSCA 3Q15C 1KH3A 4CDGA 5KHOC 4JJ7A 3AIOA 3OA0A 4WLUA 1IBMB 1OY1A 1OAOC 3B9QA 4FZVA 4TUYF 6PFKA 1CERA 1E2BA 2XNJA 2HLNA 3KG2A 2VSOA 4UUMA 1Q0QA 3DEFA 1N5OX 4LZAA 1K86A 2HWUA 2RG7A 2VEDA 3A3YA 4FB5A 3GUHA 3ZCPA 3EEYA 3HA3A 5ALJA 3GWGA 4DLRA 5C5EA 1Y5RA 5JVDB 1SUIA 1NFRA 3NB0A 1Q1GA 2OCLA 4FVTA 1SRRA 2O7QA 2W6CX 5TVGA 1BC5A 4KIFA 5CDTA 3SQWA 3T5CA 1G17A 3H9GA 1KI9A 2QDKA 2WWYA 1XAIA 1ZS9A 2IZOA 4C43A 3BUSA 2PKYX 5FOTA 4JVLA 1A5ZA 3WK5A 4ND5A 5BWNA 3SF0A 1WUYA 2VC2B 2J46A 4PZCA 3RVQA 3SP1A 1ZD3A 2LGJA 4DJ5X 4KXYA 1QKIA 3VDQA 4KLRA 1T6NA 2BLLA 3N2ZB 3DLBA 2FEMA 2JLBA 3DPIA 3S2SA 5DK6A 3DLHA 5HBRA 3CUSA 1WXWA 1EK1A 2EFGA 1NXQA 2ZAIA 2PGXA 4GXTA 1DI0A 3OTOB 2XVZA 3DWGA 3V1LA 5EI5A 5BXYA 2WJIA 4JR1A 3VJLA 4Q4LA 3O8LA 2WF9A 4NHEA 4KR7A 1FTSA 4KIWA 1RYDA 3GZNA 4XGQA 5E9AA 2OCKA 5L7WA 1X1DA 2XWJI 5DULA 4L6IA 3EWAA 4F4FA 1CR1A 3KYJB 1ZNQO 1MDFA 1OREA 2VO1A 3DB1A 1R0SA 3FSRA 3G9QA 3CX4A 2QVYX 1ZIXA 1CUFA 4LI3X 5HX7A 4L6AA 3AR5A 1AQLA 1U7ZA 1BFDA 3N8KA 3DV9A 1NYRA 1QYWA 2E37A 4LX0A 3JX9A 1AZSC 3DEZA 4MQFA 5LA6F 2WTUA 1I3KA 2V7PA 2OGWA 4NFSA 2I6UA 5E1MA 1HEUA 1F2VA 4R1UA 3OIVA 4I9GA 1HYBA 3MWGA 2Q4OA 1L5LA 1XZFA 2V0GA 5J4VA 1R8SA 2HMVA 1XEXB 1C9JA 2QTLA 3KKQA 1BHO1 4L07A 2VI5A 4M88A 1NYTA 5G4LA 4MUFA 1FFYA 1EWTA 1JF8A 2IF2A 3EUFA 4ZT5A 1GXSA 1TIPA 1JLSA 2ACKA 1B93A 4TZTA 5M5BA 3RSGA 1Q20A 2GVZC 2H63A 1EXWA 4LGCA 3ND5A 2QUKA 4KE7A 2R7NA 2EOAA 3RSQA 4MEJA 1YU6A 4WNAB 1U6KA 5M2QA 3PQDA 4QU5A 3EFOA 3I9MA 1LDEA 4NOKA 2P2SA 1I6WA 3P4UA 2BIFA 5KS2A 3UJAA 2X8JA 4LE2A 5DYWA 3BA6A 3JQ8B 4HJRA 1F38A 4Q24A 3MB5A 3DVAB 5J2TF 3KT0A 2QNIA 4XARA 1OLUA 3MSXA 1C3OA 1LW7A 3DYVA 2FN8A 2O1EA 2P78A 3LNCA 4FW8A 5EIBC 1GKLA 4QPCA 1ODFA 4KRXA 2FMFA 4RUKA 5EUBA 3UAGA 2UZ1B 1G41A 4O4IF 5CDHA 1UK6A 2VA8A 3AP1A 1OPXA 1OC4A 1ZGHA 4AJIA 3LXRA 1O58A 1MENA 3ZY2A 4N41A 3H8JA 4PF1A 4DKJA 1P4AA 3WSVA 3X1YA 1G3RA 1VIMA 3VC3A 1GPYA 3K32A 1TT5B 3R40A 1MEJA 4KQCA 4MRMB 5IDVA 3QPUA 1ZSNA 3ZYCA 5KHAA 2G1JA 1KDZA 1ZD2P 3HA2A 4UHDA 5ALSA 5JAPA 2Y92A 1HYEA 5IJ9A 3MBIA 1K6JA 3PGJA 1JSXA 3GI1A 4IDBA 4OAPA 3NWJA 1VSUA 1P75A 4UREA 2I34A 5DT9A 3TRDA 4TQUS 3I42A 3KXIA 4MWZA 3I83A 2R84A 3GLKA 1PFGA 3OUUA 4R31A 4UMEA 3NR2A 3A9WA 2C5SA 3G8BA 3SMQA 4A0RA 1NUSA 5JRJA 1W4LA 2HA0A 1UBNA 4G56A 3A1WA 4NH4A 2C84A 1J20A 3N7UA 4IDEA 4TMVA 5A4DA 1LBTA 4C7VA 2DJ5A 1KQGA 2R1UA 2PUGA 3ZV5A 1ICIA 1Y8RB 2NSHA 2VNAA 3NBQA 1T9CA 4FONA 4G07A 4XD2A 1T0PA 5P8WA 5KQRA 5KTKA 1CIVA 1BDBA 2Q6IA 4L27A 4ZJPA 4HLQB 1PD1A 2PLRA 2A0KA 3E9DA 3AG6A 2X4GA 3SR4A 1E2FA 2X8AA 3R9IA 1PLKA 2P4QA 4AK9A 2NQ8A 1PNTA 3IHLA 2QX4A 3IEVA 1UBUS 2WSSD 4KVFA 2H1IA 3QJYA 4PHCA 3WZMA 1JQ3A 2V5VA 2XOEA 4RD3A 3MS2A 2L17A 3V4PB 5AHXA 1G3QA 4WEOA 4I1PA 3KC2A 1NNI1 5H81A 2SNIE 1N5IA 4CEJA 3RD5A 3QFHA 4JXXA 2HI0A 1I4TD 1H5NA 3COPA 2SKEA 2K2QB 3BJMA 2XA2A 5CHYA 5BWBA 3II6X 2O2ZA 7YASA 3E61A 1M2JA 3N5KA 4KR6A 3HSSA 2GNPA 1ZESA 3E7FA 4YY3B 4WZBB 3VOBA 3A3NA 4ZZ3A 1M2OB 1CF9A 4FHGA 4C08A 1A9QA 1MU0A 3PNSA 4DAEA 2M6RA 4L4ZA 3U7RA 3RVSA 3JQBA 4Q9JA 3AR2A 3GFGA 2BT4A 1XMIA 4NNOA 4QPPA 4C7MA 2XMDA 4W5OA 4XWYA 2FDRA 1KAOA 1FZTA 4YYZA 5E9QA 4Y7CA 2ZZKA 5KTSA 4LF4B 5DHFA 2VF2A 3JWEA 4Q7EA 2ZTUA 4D79A 2OO5A 1BEEA 3PD7A 3WFZA 3U9SA 1S89A 3JS5A 3O3NB 5DYIA 2JI8A 4BO0A 4YDSA 4WE3A 1DNPA 2RAFA 4AURA 1HXHA 1OROA 4M0LA 2VNKA 1X3SA 2RG1A 5ADVA 3OO0A 4NP6A 4ANFA 4BO8A 2Q6TA 4HATA 3DBHA 3L40A 4HXEB 2A9QA 4DQ0A 1X42A 2VTEA 2C4WA 3INNA 1Z0JA 2GMWA 2EZUA 3KB6A 3QMMA 2WEKA 4M7WA 4OMUA 4B71A 5B6JA 4D9MA 4M1EA 2HADA 4PNHA 2YCLA 3JASA 3IVGA 3OLYA 4FQ8A 2WICA 1ITZA 5IFLA 1V5GA 3U3JA 3C3AA 2P9TA 4ZGWA 2IYQA 1FXUA 3NT4A 5KTRA 1GSAA 1YR3A 4FFRA 1GITA 1M2VA 1JDVA 4JB3A 4X1KB 4D56A 1NIPA 1RJEA 2OHFA 3C98A 1R50A 2K5UA 4Q1VA 1QJCA 3INRA 4IIDA 3OOEA 5D5HA 5H9VA 1JHDA 3BMCB 2IDMA 3BK2A 2WVJA 3BD7A 1EX7A 1DG9A 4I66A 4WKPA 5HMMA 5JDCC 1DTWA 1USKA 5ELLA 1AGPA 1DUSA 4IY1A 2GBCA 3DZJA 3F90A 2QRVA 1MUUA 2OXIA 1QIKA 4YX9A 4DMFA 3FWKA 1RHUA 3K72B 5DIZA 1FBTA 1J90A 2WOOA 4NSNA 4X3PA 5A4AA 2C82A 4EF6A 5LWQA 4DA6A 5ITZB 1OLXB 2FE4A 3N0XA 1CY0A 2EERA 1HYQA 4NABA 4U8HA 3AL0C 2OXCA 2W93A 3M4YA 1OFUX 1WPGA 4NULA 3BWMA 4AKSA 5L6MB 4BMCA 4QREA 2TYSB 3V33A 4JVMA 3TR5A 2WIBA 2RBEA 3ZUGA 4O3MA 5KYWB 3HGMA 3WTBA 3MGCA 4OCZA 2H9AA 3BT7A 4OB8A 5DGHA 3BHIA 5LZ9A 1XMVA 4M36A 1EG7A 3HKEA 4B2PA 3DC2A 1RBZA 3VZCA 5KDOA 2ZRGA 2RJ3A 4MR7A 2GCGA 3NC1C 2B5OA 4H77A 4L3VA 2EEZA 4P86A 4UXHA 2H2GA 4MKRA 2XB4A 1N9KA 4HCJA 3PC4A 1G5QA 4U6QA 2WKSA 3RROA 3F9RA 3UV6A 3MVEA 4B4KA 4UOEA 3AFGA 1TYDE 3NHSA 2DULA 2OZKA 3CH4B 1ESNA 2VPTA 3BX1A 4GM1A 3FYUC 5BSRA 1F2UA 4JUBA 5FOQA 5M04A 3FPHA 4Y3UA 2PD6A 4ZQGA 4S2UA 1A7AA 1Z8NA 1P80A 3PFGA 4F2HA 4P0QB 1R0LA 1IQPA 2AN5A 3ST7A 2QRNA 4JB8A 2FJPA 4PBTA 2WWFA 1IEXA 1B23P 1HT1E 2ZAMA 3TZ6A 1U0BB 2QZSA 1NASA 1EVKA 5A02A 3KEGA 4EFKA 2P9EA 4XPZA 3DBHB 3VAYA 4AO7A 3L84A 2V7VA 2YHSA 5FPHA 4YAJA 2C31A 2R60A 4QG7A 4PYRA 2Z04A 5FNZA 1KJQA 4DILA 1KI7A 3TWOA 1NXOA 4KL8S 1DUVG 4AJNA 621PA 1C0PA 4NYJR 3RADC 2J9RA 3NASA 2AXQA 3DWIA 2PS3A 3G6WA 4G81A 1GVHA 3DCNA 2ZJ6A 2O0KA 1FS6A 1RYHA 1K6MA 2ZYDA 5EE5B 1G1AA 2EKQA 4Q4CA 2WHEA 2FXVA 1P3JA 1TADA 2ZKIA 3FPBA 2HMYB 4A8HA 1XTRA 1YOVA 4YK7A 4XQCA 4ZVVA 3O0TA 1QFYA 4J0FA 1P77A 4NARA 3TL3A 3U4HA 3W2FA 3QWIA 3QE3A 2BBSA 2IU0A 3L18A 3SCZA 4MVJA 3MJCA 5D1HA 5DI9A 1NVWQ 3RRZA 4HDCA 3RNOA 1V4NA 1KTIA 2FUNB 1NG1A 5AXBA 4DXHA 2CHGA 3FLEA 4REMA 3I9FA 3PX7A 4XFKA 3B5IA 3N7AA 5LP6C 1ADCA 1DX9A 1N5LA 2PX0A 3K05A 1ZOLA 2XNDA 3M4ZA 1XDGA 2QN9A 4UMDA 5H0IA 5HYVA 1X1QA 3DOIA 1NP6A 2Q27A 3FYCA 4RPGA 2AMLA 2NO6A 2ZSUA 2Z57A 4U7TB 2CDCA 3UT6A 4IQ8A 3INGA 3L07A 3EXG1 1FRVA 2ZBDA 4P3OA 4QBGB 4UVEA 2HNBA 4ENUA 1KSFX 4LCBA 4CEIB 1T9GS 1TVMA 1OIXA 1F0NA 2A9FA 2HIGA 3RC7A 3VZRA 1OLOA 5T4HA 4BMNA 3ZD7A 4GVPA 1JIKA 1CFJA 3CXRA 8LDHA 3AHCA 3FW1A 3LHSA 1POWA 5B3LA 2BZSA 3Q40A 4HADA 4F2DA 1J6UA 1WEHA 2BR5A 1ZC3A 5I3ZA 1VRWA 3S0JA 3V4RA 5SYNA 4HB2A 5DNUA 3I6YA 2QY9A 1F8GA 4N54A 1A27A 2VHTA 5DTQA 2FR8A 1TTTA 3A05A 3QE0A 3IOBA 1JVSA 4ZYLA 4CG0A 4CMEA 5DLDA 1HTTA 1PLLA 1VCMA 3PFIA 2XBMA 1S8FA 5CA1F 1FTQA 4F4JA 4B9AA 3WDLA 3OCYA 2HBZA 2LV8A 3L0DA 2P90A 2GUGA 1DBWA 1V3VA 3UV3A 3LHDA 3TMYA 5HEKA 4AWXA 3A9TA 3PEFA 3LT1A 4HAYA 3DULA 4KJZA 1O0BA 5HZKA 3IVRA 4QXQA 4D9IA 1OE0A 2C94A 4CF3A 3HBAA 3VKUA 1T2VA 4DR7B 2DPLA 2HJRA 4UNRA 1UEXC 3SZOA 3FCYA 1CUXA 4IIUA 2ZVJA 3A32A 4D8YA 5DSXA 3EYAA 3MYRA 4JB0A 4TL7A 1Y6JA 3QOFA 5I01A 3WMXA 2G77B 2YVQA 3ZV3A 5BSFA 2X2FA 2DWOA 1UPBA 3PUIA 1RXSA 3DC7A 4L02A 2W6QA 4R2XA 2WLSA 4EW6A 3DE7X 3GVIA 1E63A 2FHSA 4ZI3A 2ZAYA 4L5YA 1NI5A 4EX7A 9GPBA 4NPAA 1C2YA 1QANA 3KKMA 4KP7A 5KNDA 1LNZA 1QKJA 4J7UA 4RA9A 1G64A 3M3HA 4DDTA 1M2VB 3K20A 4RAQA 4X1KA 4BDTA 1UWVA 3NUZA 1X86B 4Q7LA 2IOQA 4V2UA 1BQ3A 1XU4A 2GZDA 4U3JA 1CEXA 1LX7A 4JLUA 4KKXB 3SX4A 2ZZNA 4EP1A 3OLXA 2D7JA 2REXB 2FP4A 4POOA 2BFAA 1HDIA 3QU2A 4MGZR 1SK8A 2QX7A 1EQAA 3GG2A 4TV8B 5CNMA 4OHZA 5DO9A 2YWEA 4MROA 1W7AA 4TKMA 3PC3A 1VGVA 3ZQ4A 2PX4A 2EQ5A 1IPHA 1RM5A 2QT0A 3CZCA 2ZTMA 3GA7A 4MQMA 5FA8A 2YQ4A 5JASA 3BE6A 4IVPA 3ZGXA 2HRRA 4W1RA 3ZI7A 5M7EA 4IIVA 4D26A 4LCEA 2WJWA 2JFBA 1OWLA 5DRTA 4F9GA 5JO9A 1Z6GA 3GVXA 5BVHA 1RI4A 1CQXA 3OURA 3RTCA 3D2BA 1Q7GA 1MC4A 4QU9A 3JQBC 1BU8A 3MT7A 4DSTA 2F6RA 3YASA 4BNYA 4QDTA 3EJWA 4UXJA 4W5HA 3FDZA 5FLYA 5L3ZA 3HWSA 3K0SA 4KHPB 3CZ5A 5F3RA 1LTHR 1NNUA 5JQGB 4LISA 2RHTA 3HKBA 4EVIA 5HZHA 4LTDA 2FHPA 3N3BC 4F6LA 2WIJA 5LZ8A 3FXAA 1M2WA 3EMBA 3GLSA 4YXWA 3GLIE 4C4PA 3PC8C 2HF8A 3BH6A 2O8CB 4LSZA 4HGZA 1CZNA 2BD0A 4C0SA 3DAOA 1MQ9A 2YZ2A 4FD2A 2WUWE 1ZLXA 1YFJA 2R6R1 4B8YA 4P5PA 6CHYA 1DTSA 1E2PA 1M0TA 2ACEA 5LQAA 2FK8A 2QXUA 3F0TA 4I8DA 4URUR 4PHHA 4YPVA 1URPA 4IINA 1X7XA 3LHKA 4JC0A 4M8SA 1F2TA 4LDJA 4B31A 5JAZA 5KU1A 4CGYA 1IDOA 1FYWA 4PX2A 4JWKA 4L1KA 4KNVA 3GAZA 3L8EA 3B6JA 3UH0A 121PA 3M6WA 1G20E 1AB6A 5HBGA 4DJDC 3SLRA 3S7TA 2RH4A 3VJKA 3TBFA 3I9NA 1KI3A 3I3SR 2DFLA 2GNOA 1FFEA 1FYFA 3DTVA 1R0ZA 2WSLA 4J6FA 2YRXA 5IP5A 1ZCAA 4CUKA 2OD9A 1F9EA 2VPXA 4NJEB 3MNFA 4WVFA 2V8OA 3WV4A 2XNKA 4IHKA 1JR3A 1YR7A 3LQRA 5JDCA 4PG4A 2AA3A 3TW8B 3BD6A 3HBLA 3P9YA 3P8ZA 3DDNA 3LBNA 4LYFA 1IWBB 5CBPA 2I87A 4XX0A 1BXKA 1V1JA 1NRIA 2V58A 3KPUA 4MO2A 4D0SA 1US8A 1JN0A 1U11A 1FP2A 5EMKA 1AKUA 3SJAA 4HAOA 2I22A 1Z2NX 3CKKA 3UVEA 3RR2A 2C2HA 4IH9A 2X1HA 3R7WA 5KUTA 1G5FA 3JARA 5EHZA 4WKGA 1VXRA 4EHKA 2A14A 5EAIA 3GGCA 3RGGA 4AUEA 3RVPA 3FI9A 2I8AA 1W2HA 3LQYA 4L7QA 3MRXA 4ZPXA 1SIOA 2XA9A 1FDWA 4CMBA 3CEHA 3GRPA 4TRMA 3UTDA 3OD1A 3U09A 3AERB 2FRVA 4WZAA 5A9RA 3KJXA 2J0QA 1DWPA 3I30X 3Q6MA 3EJ6A 4B4OA 4TZ6A 3JY6A 1P3DA 1Z28A 4C87A 1H4TA 2O14A 2C5EA 2NZUG 3WLFA 3SS8A 4LVUA 2IPMA 3M0EA 4D9FA 4B6FA 2P67A 3FMFA 1PNQA 2OMEA 4BFCA 1QB8A 4N03A 3NEAA 5BY2A 1V11A 2GILA 4TLEA 3H2SA 2VDWA 3UOGA 3GFRA 2PGDA 2QRLA 2GN1A 4CM9D 3BCHA 3UJ7A 1Q0LA 3L6EA 4O8CA 3WL8A 2I3DA 5CFLA 3HRHA 3CB4A 4B6PA 4Q48A 2ZI4A 3KP1A 3BREA 1Z2OX 3P2MA 4GP9A 3BWBA 4JKYA 5CGQB 2M98A 2XNCA 4AMBA 2QN1A 4Y9SA 2RH9B 3WKDA 3CNEA 4ZJYA 1FTWA 1JZQA 2XPCA 3SYNA 3SKYA 1K4MA 1PR3A 1NXPA 1KIMA 5H9WA 1N78A 2K6GA 2RH5A 3CF4G 4MRSA 2VF8A 3GFPA 3D3NA 1XAGA 2ODNA 4Q1EA 4YLEA 5CT9A 4RTQA 5CDGA 2O3SA 2JHGA 4Y2RA 3T9FA 1R8QA 4PLVA 2NO7A 2V9ZA 3LW7A 4DCGA 5HJEA 3B12A 1SCUB 4LY0A 4CM9A 5EVJA 3NWEA 2Q3FA 5EP3A 1BXRB 2FF5A 4Y0VA 3RSHA 4CGZA 5ENVA 1IWPB 3R3VA 1FMTA 2HIAA 1UZMA 4HPJB 4PM4A 3D0RA 3U26A 2AW3A 2R4QA 2WP0A 4H6WA 1RIFA 4QX6A 1A77A 2I29A 1PT7A 5JH7A 4LY3A 2QVZX 4DLUA 5D7BA 2HLPA 5TPZD 2VJMB 5FAKA 3AYXB 2DFTA 2J0VA 3U4QA 2R66A 1H2EA 3JAWA 4P3KA 2VDKB 5K1ZA 2JD0A 1UBTS 2JFXA 3L8YA 2JA1A 3D31A 2JFPA 3DT6A 3M3PA 4PQGA 5DBOA 3WKAA 4BNFA 5T6BA 4DDMA 4YV2A 3QY0A 2IUUA 3KHTA 5ICSA 2COEA 4R2MA 4O0MA 2HJVA 1G291 3H5OA 4BFYA 1K3TA 4HO1X 3TMAA 2VJPA 2KWIA 3DUWA 1FYEA 5J1SB 2R5FA 5JBNA 1H6AA 2HO4A 4ARVA 2PU7A 1XLWA 4BNLA 2ORIA 1R9JA 3FGOA 1IHOA 4MWEA 2AKAB 1S01A 3MN1A 5DW0A 1G18A 5I9MA 3DMDA 2Q9UA 5GM2A 4IV8A 3X44A 4RTLA 1P7VA 1VRVA 1VSVA 2D2XA 2OK7A 2Z4TA 2E6UX 3WE7A 4TRJA 3U0VA 4DSAA 1J2RA 1ZH0A 2GPWA 3FHJA 3CW2A 4N7MA 1MX9A 1Q57A 2Q0SA 4D6XA 4KWEA 2XOKD 2H7VA 3BK1A 2XGSA 1XEWX 4JNKA 3ZKAA 4LPSA 4ZTBA 3OM8A 2WWGA 1BVUA 1YI1A 1GQRA 1YFZA 2DPXA 1G6OA 2P8SA 5BVGA 4A8TA 1ORDA 1P9OA 2OPHA 3TQFA 4AMZA 3BXZA 3GN1A 2YWRA 2GI4A 4IFBA 4EKNB 3CO5A 5HQ3A 1AQUA 3UKOA 2YWCA 1I0LA 2H2AA 3THXB 4CMEC 2WJAA 2ZJ5A 2QUAA 5KNDH 2Q2WA 5D01A 4CTNA 5F3DA 1PS8A 4G25A 1FF9A 4KU4A 1F0YA 3ETCA 1XVIA 4M76B 1JU3A 3IS3A 3UAYA 1VA5A 3EA4A 3PC7A 4KPUA 5AUOB 5DNDA 2XZLA 2ZCVA 5EXEA 3HXLA 2QR2A 3FHLA 2PT7A 4L4UA 4MUIA 3T99A 4DJTA 2ABWA 4Q3CA 1WVIA 5FWAA 2VK8A 2XVMA 1LDMA 1P5FA 3KM0A 4G85A 4Y2PA 3S40A 1MQSA 2IELA 1NLUA 1SO8A 2JBAA 2FYTA 3FYDA 3V7FA 4ETNA 4G8JA 1N1MA 3ETNA 1XD2A 2WIFA 2G8LA 1CX9B 1SQ5A 3B51X 3O2QB 3PNQA 5H3CA 4LF5B 1AK1A 1FJ2A 3D0QA 1MRNA 3T9DA 1CUYA 5J2TA 4YRSA 2PS9A 2FZWA 1UKYA 2EJVA 1G0OA 1VKZA 1K88A 4ZVNA 1N4AA 5LDDC 1X8XA 1GUAA 3L4BA 2UU9B 1GTL1 5EMJA 4N39A 2P41A 3ADDA 3N8NA 5CYOA 5G41A 1LJUA 1Y3HA 3UMFA 5ALZA 1NW3A 4H1UA 2GHQA 1G9SA 1SBHA 1CTQA 1M83A 1SVSA 1UADA 1IFXA 2YV5A 5FKJA 4NCIA 2WD9A 1O1YA 1JB9A 4Y6RA 2P7HA 4BFWA 1R6XA 1HNXB 4LZPA 4R1SA 5TLSA 3V3KA 2Z6VA 3VSAA 4F9FA 5ECWA 5JJLA 1IHXA 2YJ4A 2GBGA 1E62A 4PYLA 1FTGA 5DK4A 2J7PA 3VM6A 4BXOA 4N9WA 1I9GA 2MYPA 4GU5A 5AK5A 3QITA 5JQWA 4W9MC 1LDGA 1PVVA 4PQEA 5F1PA 4DDUA 5IS2A 3IULA 3ROMA 3BFVA 3TSCA 5TR9A 1A69A 2YY6A 5JTUA 4MS1A 3R0VA 1P2UA 5JS2A 3AIMA 1ZI9A 3EZLA 2DWUA 1SXJA 2QE7D 4QFMA 1Z4JA 1FYDA 4DIMA 3L7KA 2QL9A 1DRJA 1BXGB 3U37A 1MRZA 4F4UA 2OHHA 3RCBA 4OF4A 4TTIA 4UDOA 4LTNA 3D02A 1CZLA 3T9AA 1FJGB 1X3LA 3IV6A 2XUDA 3FIJA 1SA0B 1U31A 2GPAA 1Y5MA 1U9CA 1YR1A 1O8BA 3E53A 4C4AA 2IS6A 5EIXA 2PZJA 3R5HA 1OLUB 4NZ9A 4AVYA 1VP3A 1ELOA 3HDHA 1BJTA 1ACMA 3D6MA 3PC8A 2V7XA 3E3OA 2BFPA 3BRSA 3JQAA 3RSZA 1OX4A 5FV4A 4LSGA 1C7IA 1SG0A 1TGVA 3EQ2A 2EFJA 5GIPE 1I0ZA 2YNMA 5FPSA 4CXMA 2LIVA 1C3EA 5LD2B 5JNVA 1DIHA 4FOSA 4G1CA 4BLSA 5AK6A 1C1XB 1ZK4A 2ES4A 4GG1A 4X3OA 2A5FA 1T2DA 3ZHXA 1HR0B 3CV3A 4FTWA 3THRA 2SCUA 4MW1A 2OSVA 3RU7A 4DPKA 1FFAA 2O20A 2ZYWX 3A9RA 3EEFA 3VU9B 3HXMA 1HDEA 1L1EA 2OBBA 3NOOA 4UDNA 1VLZA 1SZDA 3H1PA 1DAHA 1RHRA 1Z26A 1C9KA 2GTPA 2VH1A 1EVIA 4CM4B 2V45A 1X7ZB 1XQ1A 3O83A 1E61A 3BJEA 2C20A 3R75A 3V4VB 2RHCA 4CLRA 5HMLA 3QVWA 4I8XA 4RL4A 5IMSA 3JQRA 1K7CA 1QHIA 4LMPA 1P2TA 3V7WA 1OX4B 1XDBA 1DIRA 5JZSA 2YIMA 1PDVA 3UMGA 5KVVA 4PSUA 2BMVA 2GWHA 4FFSA 4HQLA 1LC3A 1GGKA 3C5CA 3VOTA 2PGJA 3W1VA 2CNLA 2I80A 2VDQB 3MWDB 1U8TA 4MH0R 2I33A 3W0LB 4CJXA 1FA9A 2FMTA 4LJ7A 3DMTC 1RI3A 1N6PA 1OZHA 2I4OA 1V5IA 2WU8A 1ZD5A 3HY3A 3E27A 4RADA 1T26A 1PSDA 2C03A 4ZODA 1W36B 3SOZA 4ZHQA 5KNLA 3MRVA 4JX9A 1CVLA 1IHDA 4LDNA 5KOIA 1Z4MA 3JPWA 4UEKA 4PC3A 1MAAA 4R8LA 2QV7A 5CG1A 3TAUA 2GDZA 1P1JA 5K8LA 1QBKC 1QGYA 3KEQA 3EF0A 4N12A 2CFSA 3RYIB 2IDZA 5TQ0B 3OP1A 1O96B 2P6MA 4XIFA 4FD3A 1EI9A 1ZCBA 2QSJA 1UFRA 1QZXA 1TX4B 3I04M 3G0DA 2ANCA 4HEHA 1WZUA 3BWYA 5BMVB 3SZUA 3VPDA 3E9QA 3VU9A 3IT2A 5B7QA 1OTHA 4FXPA 4M7OA 3A1CA 2UVDA 1J7KA 1MV8A 2XIJA 2PRKA 5EZ5A 4TQAA 2R1VB 4Q34A 4HLUA 1QHXA 1KVTA 5LOVB 3I23A 5DCWA 3SHOA 5C4MA 5ED4A 1P39A 3PL1A 4ND7A 1E1QA 4KOAA 4PSAA 3IEXA 1GVNB 3T7JA 3ZU3A 1D5CA 1SBIA 1GEGA 3B6EA 4NTZA 3R09A 6ADHA 5TS2A 2QLFA 4RS4A 2ZPUA 3DB2A 3OMXA 1T5SA 4A82A 1ZH6A 1WB9A 3WAGA 2AFVA 4KSYA 1Z2DA 4LJ9A 4X5OA 4JHLA 5ALXA 4EO7A 5CJJA 4L08A 3U81A 2C3PA 1PLJA 2QP4A 1N92A 4B3XA 2NNWB 2Z9BA 3D5TA 1RFLA 3MEQA 1NUPA 2E85A 3QXJA 2NYAA 1PEAA 2FFAA 3N2EA 4FS8A 4WRRA 1N1EA 5CM9C 5DP2A 4MVJP 6LDHA 1W44A 2IZ0A 1SD2A 2XOKA 3B82A 4UZSA 3M81A 4YJ2B 5CTJA 3IQWA 1PSWA 5AKHA 1UBHS 1F9AA 1M8FA 3W1EA 1LPMA 1P4HA 4JJAA 2J3JA 5CBPB 5AW5A 3KJFA 1EXVA 1WCV1 4OVKA 1EDOA 1ZWLA 4O4JB 3V4LA 4MVJD 3IDSA 3CZRA 4NI5A 2OP0A 4OEHA 4B34A 3NEYA 7MHTA 1E5XA 4WCFC 2VHUA 1RQ2A 2KJQA 5AM4A 4F91B 1M5RA 4FJ2A 3PXGA 3ZTWA 1JJAA 4BY9E 1C8LA 2AVDA 2PFKA 2IV7A 3URMA 4YQFA 1VE9A 3M33A 2WZQA 3K6KA 5JAMA 4FCWA 2CUZA 1ZVMA 3CKYA 5EUMA 4M38A 3COVA 2X9NA 3HFRA 5HRCA 2VPPA 2OHGA 1ZINA 5TE9A 1ZUHA 5B7NA 3UB4A 1JILA 1CY8A 1I36A 1EUCB 1ORHA 3GQBA 3MBKA 5LP6F 1XLVA 4EHBA 1WZCA 2JGRA 1NR1A 5F77A 1N2EA 2D7CA 5IAJA 1ODSA 4Y2JA 4XVQA 3MTJA 3NTRA 5J5CA 4BOYA 5C5CA 4MIEA 2ET6A 3D3WA 4UXIA 2ZYHA 3W6OA 2O0JA 2PUCA 2WC1A 5LP1A 2BGUA 1VOTA 2DUMA 1XNJA 2M6LA 3GRFA 1UXOA 4C6SA 2ILTA 1BWRA 3KO8A 4D9CA 2V59A 2B2CA 4G37A 5A5EA 2ZTLA 4WV3A 1OI3A 4ECAA 4Z3KA 3HZHA 2YFYA 3JCZA 2DKFA 4GBJA 1KDVA 1CVIA 2FGKA 4Q4DA 4ALNA 3EZ9A 5I4KA 3CZQA 1E5VA 3PUZA 4ZKDA 3PWZA 1E6KA 4ZZ1A 2M6KA 2JCVA 2X40A 3DL7A 2OGUA 5BSEA 4NS4A 2PUBA 4XR9A 3IT1A 1WP9A 4I3GA 3KQLA 3VX3A 3F6YA 1E4OA 3AZQA 2GM4A 1UBEA 2AJ8A 3M3DA 1W47A 3ZX5A 1RABA 4DR1B 4DCTA 3T1OA 1CV2A 1RLIA 1PR0A 2J3HA 1G2OA 2Y1EA 1CIPA 1YUNA 2FV8A 3WMGA 3FUTA 4URZR 3R9XB 3U4MA 3KD3A 3NGMA 4QWMA 4RY9A 3HG7A 1VHQA 4IOJA 1JQKA 4BO5A 5BXQC 1B26A 4D81A 2CDNA 1UBOS 4I55A 3IAAA 1Z63A 3T1NA 2YHIA 5B1IA 3RM3A 1SQGA 5MN5A 2A5DA 4M1QA 3OFVA 1SXJD 1YHZA 1BWQA 4ZT6A 3WNCA 1ECPA 2YH2A 2FZEA 3KLPX 4WZZA 1HV8A 4WK4B 3MJSA 3WVNA 1XTIA 3O8RA 4B4WA 4BC1A 1XTKA 3ODGA 1XZKA 4E2FA 3AKZA 1PJCA 2JKVA 2VP5A 2VVTA 2OBLA 2ZIXA 4EHFA 3GMDA 3RBXA 5LU9A 4TTVA 1J00A 1LPAB 5JXHA 3WDMA 4UASA 4HVTA 5B64A 5ALDA 3ZXSA 2OXFA 2R4UA 2VYND 4P4TA 3D5QA 3P9KA 3AF4A 4FSDA 2D00A 3SY8A 4YGYA 1KRXA 5AVKA 3EFOB 4EUFA 4UTNA 4XWKA 4N7RA 3GGPA 3WLTA 3TCKA 2L2QA 4XB1A 3WK6A 4YAGA 3AM5A 1GRVA 3PWKA 1T3GA 1G5TA 2WJ6A 3BKXA 4KFRA 3BRWD 4ZT7A 3EGCA 5HKLA 4GKAA 5KNCA 2PMBA 3LYUA 1ZD8A 4PVDA 3FZEA 4OD0A 4V3BA 4XIJA 2XVAA 5ENZA 3JAMA 1FVOA 4F9TA 1A8HA 2XECA 4P31A 4Q4AA 3AVVA 3GVPA 1IMOA 2AK3A 1SIBE 1QDUA 2H1LA 2HHAA 5LL6P 3MWYW 1E18A 4PO9A 2Q1UA 1ULSA 2D1QA 1FDVA 3OE4A 2FA9A 3K5HA 4P3NA 3VH1A 4R83A 3ZBTA 3BXFA 4CNQA 3U44B 5BQOA 4QOFA 5MFZA 2QAGA 3NWPA 5CAEB 3R76A 2D5AA 1HETA 4RF3A 5JR3A 3QPBA 3N76A 3CPHA 5I4IA 2JGMA 3C3MA 3JZFA 1WMAA 3DL4A 5IT5A 2I6FA 2CY0A 1FMLA 4FS3A 3EB9A 4D7AA 4G5OA 2X0IA 1SXJC 1CY7A 1CY4A 4JYPA 1Y1KE 1BFKA 1E2DA 1ECLA 4DJJA 1XCJA 1Z2CA 3VQTA 3DMHA 3MCTA 1VZ3A 1WDKA 3JSAA 4MS3B 5IMBA 4DM4A 2WJZB 3ZI4A 4MEAA 3QA9A 1YR8A 3VPBA 5HUHA 3KLMX 2VNHA 3W9BA 4IKOA 4ZEMA 5EMNA 1HNZB 1O9HA 4JSRA 1PWZA 4BN5A 1RVDA 1V96A 3HB5X 2FPKA 2GBFA 3SICE 1LI5A 2XVXA 1TRHA 3K94A 4GR5A 3TZQA 4URWR 2OEPA 1RP7A 4B87A 4KNYA 1I4WA 1PN3A 3PHGA 2OCIA 1JBEA 1DHRA 3IPCA 1R9NA