4HLCA

Sulfonylpiperidines as novel, antibacterial inhibitors of gram-positive thymidylate kinase (tmk): compound 5
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
202
structure length
195
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Sulfonylpiperidines as novel, antibacterial inhibitors of Gram-positive thymidylate kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 195
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hlcA00
2RGAA 2ZYTX 3RRMA 1CKEA 1YZNA 2QE7D 1W7AA 2ORIA 4PPGA 5FH9A 3IIMA 3PEYA 4URWR 3P4XA 1UKEA 4BE7B 2R44A 4HAXA 3ADCA 4LYAA 1ZD8A 3SHWA 2DB3A 3HR8A 5JWHA 1KY2A 2FWRA 1PLKA 1G5RA 1XTJA 2QG6A 3GD7A 3R9XA 2WTUA 3RWOA 2A5FA 3AF4A 4P4SB 5IK2D 3WHKA 4ASUA 1SVSA 1ZUIA 2B7CA 2VRWA 3QF4A 2YNMA 5K8UA 4LBZA 3C15C 4AI6A 1P62B 4ZCMA 1X8JA 2R6DA 3B1WA 1JPNA 2GCNA 1T0HB 1N25A 2RHMA 4JL5A 2ZROA 1N6NA 3L43A 1SVLA 5AUNB 2NOAA 3TSOA 4GRAA 4OK6A 5AJZA 4KLZA 4AWXA 4CRWB 1XXHA 3HU2A 1LS1A 1PJRA 3KX2A 4IRUB 2IYSA 4C30A 2P3SA 1COWA 4YMWA 2F1IA 4GT1A 5KHOC 1OIWA 2ZSFA 2GETA 3C4JA 4IVPA 4PQFA 1KOFA 2D2EA 4Z54A 3REGA 1US8A 1FFHA 3N2EA 3GJXC 2GJSA 3WMGA 1T91A 2BM0A 2ZXUA 2HXSA 3LW7A 4XD7D 1S9HA 2FSFA 2GKSA 4FI3C 5F9FA 4ARZB 1PLLA 1XTKA 2J0UB 5HE8A 1MO4A 3A1SA 5D3MA 4P4SA 4B75A 1NVVQ 4US1R 2IC5A 3CWQA 3DVLA 3EC2A 4P31A 1KNQA 1H65A 1GAJA 1KK0A 1Y63A 3QKRB 3CBQA 2JLXA 2AHOA 4JLPA 3GEHA 1QBKC 1SXJA 4DUGD 1TQ6A 2Q3HA 3H4MA 1QHHB 4EFLA 1NJGA 2REBA 2VYFA 4WAUA 5LB2A 3AH8A 3P4YA 3VR6A 2F9LA 4KODA 4HAZA 4AKIA 1S3GA 4NP6A 4HUQB 3KKOA 4OHXA 2CCKA 3NTUA 2G88A 4CDGA 2R6CA 3BB1A 2ZE7A 3K70B 2GAOA 1R0ZA 2X77A 2BIFA 3B8HA 4Q19A 2EFEB 4QRHA 5EE0A 3W3AA 2DFNA 2EU8A 4FWIB 3EPLA 1Z6TA 2ZRCA 1DOAA 3AKDA 3OEED 2QGNA 2BBTA 4Q7KA 4GPTA 1ZM2A 3ZVNA 2OLJA 1BIFA 2QP3A 2MSEB 2G83A 3SFZA 4ARZA 2J0UA 4B6FA 3VR2A 4A15A 2IYUA 1JNYA 1E1RA 4JBXA 2O8EB 1XP8A 5DLQC 1F5NA 3DM5A 1YZUA 1JECA 2KBFA 3U3JA 3QKRA 4PXAA 4H9GA 3QVUA 2BMEA 4QGFA 4Q00A 3F3YA 1HE1C 2C99A 4LV5B 3VU9A 1W36D 5FBVB 2CNWA 5KDOA 2ONJA 4EDHA 1A1VA 4UXHA 1ZC3A 2VSOA 2O8BB 2V4ZA 3K0CC 4MRNA 1XBTA 2QNRA 4G3XA 4PC3A 2ZYUX 4POAA 3UXMA 4Q1CA 3TMKA 4Q4JB 2CE7A 3K0AB 4Z1MA 3VFDA 1XWIA 4RJLA 4P32A 3QXXA 2QN6A 2W6JD 2ZE5A 3V00A 1G6OA 5HR5A 3CKLA 1UKZA 3AVWA 3RS7A 1IONA 4HB3A 1EESA 4JLDA 2OV2A 3PVSA 4D2IA 1UDWA 3WMEA 3AKEA 2DCUA 2UVQA 4GP6A 4UQOA 4PFSA 1G8PA 1Z0KA 2BM1A 1FTNA 3U2QA 3OFNA 4QGAA 1MO6A 2O8EA 5H8WA 1LY1A 5B64A 4NCNA 4KHZA 3SYKA 4LV6A 1VCNA 5EXTA 1P9RA 4V0NA 4I1SA 4DCVA 3SN6A 2FGKA 1JQLB 2XTMA 3KUDA 1YU9A 2O8BA 4Z8XA 2FV8A 1MO5A 2IYLD 2XSZA 1ZD1A 2ZJBA 5E3HA 2XXAA 3UK6A 4LOAA 1M34E 1CR2A 3CM0A 4Q4JA 4EJSC 2IS2A 3RS2A 2VO1A 1HV8A 3A1UA 4CIDA 1EFTA 1NLZA 4GFDA 4NYMQ 5FPTA 3LBNA 4HAVA 4KITB 4TWZA 1XCPA 3DMNA 3I62A 5TVKA 3TSZA 2AXNA 3RYTC 4CEHA 3IIKA 3SOPA 4URVR 1DAGA 3FHOA 1OXXK 2A5YB 1SKQA 3H2YA 3OEHD 4W9MC 1KMQA 4BECA 3KQLA 1I2DA 2VSFA 3EIQA 2QROA 1MO3A 3FHTA 3FOZA 1R2QA 2BMDA 1OSNA 1P5ZB 1ZM9A 5KSOA 1NN1A 2BMJA 2F1HA 1ZVQA 1X8KA 3FWYA 1L7VC 4NYJQ 2XZOA 2D7DA 2NO6A 5HCNA 4H1VA 2GAAA 1I4TD 1P2SA 2WAYA 3NXSA 4LV8B 5JMTA 4GOKA 3RC3A 1I2MA 5F9HA 3MMPA 2L0XA 4BLSA 1FX0B 2GEVA 5BYKA 1QZXA 3PUWA 3BFKA 4BPBA 2XB4A 1N2CE 3CX8A 2PMKA 2O0KA 4WZBE 5SZHB 1XCMA 3EZ7A 1E0SA 1NG1A 3Q5DA 4FXPA 2VHTA 3CRQA 5AUPB 4FCTA 1D5CA 3TAHA 1N5JA 1QVRA 2ZTSA 1AGRA 3T1QA 1R0YA 3THYA 2YOHA 1LF5A 1AS2A 2BC9A 4K81B 3R7WB 1KSJA 3CRVA 1AM4D 4F93B 4C7OA 1GITA 3BB3A 5L3QB 2Z6VA 2ZANA 3OF5A 1F3OA 4B48A 1RJ9A 3DHWC 2ZSDA 4UJ5A 4MKGA 3IO3A 3AVQA 1E2FA 3WP1B 2Q6TA 1G17A 1VG8A 1ZIPA 3MCAA 4URYR 4AK9A 1LTQA 1OJLA 4LHZA 5FL7A 2A5JA 5CDFA 1KJYA 3UWKA 4B3DA 2R62A 4JZKA 4KAXA 4DSTA 4C2UA 5FUYA 4M22A 1KIMA 1KI3A 1HA3A 1XU4A 1Q44A 4II7A 2ZJYA 1Q1QA 4ZIRB 5DHAA 2C9CA 3RWMB 5GJWC 1Q3TA 2OFXA 5FUXA 4PC2A 4TTPA 2J87A 4OQNA 3AP2A 2D06A 2ORWA 2Q3FA 3RS0A 2W2XA 4OHWA 3GLIA 5G3ZA 3CR8A 5M04A 2WPDD 2HT1A 4KU4A 1ZMXA 2A5GA 1DG1G 1LFDB 1J7KA 2I1QA 1PUIA 4MH0R 1W0JD 4JLMA 4B3XA 1MABB 4LC0A 3MRSA 4GMXA 3GLFA 1D2MA 2JJ2D 2IF2A 2YWFA 4C0SA 1E98A 1IY2A 1G291 1LVGA 2ONKA 2V7QA 4KBFA 4B44A 4TMKA 3U4QB 2IYWA 5G41A 4L16A 1QRAA 3RRNA 1OFHA 1OYYA 1Z6XA 4DCNA 1TUIA 3JZMA 4YDHB 3U7GA 2G1KA 3TRFA 1UBCA 1ESMA 2PEYA 2QUZA 3OE7A 1E0JA 3C41J 4MA4A 4D26A 3QY0A 3TR5A 1XXHE 4ZIRA 2CVHA 3KL4A 4OKSA 1LS6A 5FOWA 3LFUA 4TYPA 5JBQA 1R4AA 3G0HA 4AYXA 1Z0FA 1U0JA 3LBHA 4G5QA 3LXRA 2AK2A 1YRAA 1E9BA 3GJ5A 3F5FA 3REFA 3TW8B 2QA5A 2EQBA 2G0TA 4BLTA 2ZRNA 4A9AA 4DJTA 2EWVA 3TW4A 4OHZA 2QI9C 4FD2A 4O3MA 3HPQA 3A1TA 3IHLA 4GSYA 2AWOA 1IOZA 2IEZA 2VA8A 4CW7A 4F7WA 1G6HA 1PUJA 4F4CA 4NU0A 3U44B 4HZUA 2E87A 1LV7A 4RD4A 4Q01A 3THWA 2DFLA 2F55A 4RCYA 5H1YA 2ZYVX 3U4QA 1R5OA 2NZJA 2VHJA 1KDRA 4KFSA 1R8SA 1ZC4A 2BJWA 4WA7A 2ZRDA 3EASA 3ZVRA 2DFKB 4LZZA 1EFHA 2HEIA 4OI4A 1GRNA 1UJ2A 2GCOB 5C4GB 3UATA 1SXJC 4DDVA 2BEJA 2FG5A 1SKYE 1OXSC 2NTYC 2OBLA 3W5JA 2CLSA 4TMTA 4U5XA 721PA 2JJ1A 2QTHA 4OQXA 1GM5A 2N42A 3IQXA 4DDTA 5B30A 1W4CA 4X8MA 4C4PA 3R9IA 3VQTA 3S1AA 5DN6A 1OYWA 3O8CA 3GEIA 3LQQA 1JXMA 1GZSA 4TSFA 5J4KA 1X1RA 1Z2CA 1HURA 3A4LA 4B76A 3IPYA 3ZD7A 2H92A 2ZRGA 4IFEA 2ANCA 2LWIA 2ZUBA 3THOA 3FMFA 1IAQA 2H5EA 2RGXA 1EFCA 2JLRA 4IDHA 5KPJA 3P27A 3K9LA 1T9HA 1JR3D 3BORA 3SHFA 4MKIA 4EPRA 3U3MA 221PA 4IDNA 3DOEA 4Z8YA 2JLUA 1JALA 3K0FA 4AG6A 2GHIA 4KFRA 4TT3A 3PJRA 3EW9A 3PR1A 3ADDA 3EARA 4C3ZA 5KOYA 1AZTA 2HF9A 2WVJA 1VHLA 1OXTA 3LNCA 4FCVA 3BD9A 2Y8EA 2X2EA 3FE2A 2F9MA 1NBMD 2YWEA 5KNCA 1MRNA 3FKQA 1W4AA 3QQ5A 2ZU0C 3K70C 1TMKA 1KSFX 3SFVA 1K5DA 2GILA 3CLVA 1RRGA 1T5IA 2TMKA 5E7IA 4AURA 2RB4A 2QP9X 2J7KA 4P0TA 2ZITA 4TLBA 4BEBA 4Q1BA 1U9IA 4PPFA 3UMSA 3FMOB 4HI0E 4MQBA 2CVFA 2QORA 2ZJ8A 4YC7A 2ZS7A 3AVTA 3LLUA 4ZI3A 2NO9A 4A6PA 3I73A 3B1YA 5IK2A 2CLCX 1DVRA 2CHQA 2H17A 1VIYA 1ZU5A 3CNOA 4GNKA 1G3MA 2KI5A 2I1VB 3RC8A 2QMEA 5FTNA 2O8CB 3KTAB 1S2MA 1KO1A 3Q72A 4HLQB 2OCYC 1P75A 4NCIA 2ZRHA 5AUQA 1OH7A 3HYTA 3CNNA 2FFAA 3W90A 2PCJA 4M2LA 2FPKA 4ZDKA 3FMPB 1YZQA 2BCJQ 4NH0A 1X3SA 4AYWA 4B43A 4IOJA 3RRZA 4AYTA 3GJ8A 4TN1A 4IW3B 2WOOA 3TBKA 121PA 4RFSB 2WHXA 4EPVA 3V4RA 1NVUQ 1JJVA 3QXCA 1N5KA 2G3YA 4KFUA 3RSOA 1LF0A 1NBME 2QQ0A 4CZ2A 2ZSBA 3QPUA 1FQKA 2QSZA 3ND8A 1ZNXA 3VHLB 4DZZA 4XD7A 3U3RA 5IT5A 1WQ1R 3TUJC 3LWNA 5AK0A 1ZM4A 3EZ6A 4LX0A 4EJSB 3SZRA 4DEYA 2AD5A 4PO9A 2CMKA 1TU4A 4KFTA 4XH9B 3BOSA 4XTRA 4YQFA 1G4AE 1CLUA 4JIMA 3VMFA 5LD2B 3NC0C 1P72A 4PHFA 3QXJA 4Q4AB 3WXMA 5BN3A 2C03A 5KDDA 2O8CA 3KTAA 1VYUA 3CR7A 4HLDA 4ZI2A 5JSZA 4ILEA 1AZSC 1DPFA 1GRRA 1G7CA 1TX4B 2PX3A 2QSYA 4DUGA 1OHHD 2OESA 2O0HA 2OO7A 3O8BA 4XVRA 4QNMA 1CRQA 3EZFA 1DAKA 1CR4A 2ZAOA 1A2KC 1Z06A 2QPAA 3QG1A 1AK2A 4LYFA 2HCJB 2RMKA 4PSAA 4D4MA 2N1BA 1W44A 1XTIA 3HPRA 3KXKA 4YLGA 4RD3A 5SZKB 3EPKA 5IDVA 4EFMA 4RD0A 3IPXA 4OBEA 2EFGA 4FIDA 2P5TB 3OZXA 1EK0A 5L8VA 2I4IA 1M8PA 1Z0DA 2EW1A 3W8RA 1G7RA 4PO1A 3CZPA 4YMTA 1CBUA 3OEEA 3IDQA 1AGPA 3ADKA 3BH6A 2ZRLA 4MYCA 2XX3A 5FOUA 2ZR7A 1TF7A 2H57A 2P65A 3B85A 3BWDD 1M7HA 1H8ED 4MRPA 3ZQJA 2VP9A 4B35A 1IN4A 2H8KA 4LUCA 1TU3A 5EJEA 4LBWA 3CRRA 4DLYA 1E96A 3CPHA 4LHVA 1KAOA 4OI0A 1EFUA 3A6PC 4P4TA 3ND9A 4WIAA 5AR1A 3AKYA 1WRBA 3EG5A 3JZAA 1FTSA 2C96A 3KZ1E 1W47A 1DAIA 1ZUNB 1YE8A 3GLIE 1TF2A 3NBFA 1E4VA 4Y0AA 4QHSA 2GCPA 2QAGB 1DELA 5KSYA 3LV8A 3SJZA 1KGDA 4EQ6A 3TNFA 1W4RA 4U02A 3THXB 4FN5A 3PIRA 2F43A 4JS0A 1J70A 4A6XA 1IY1A 2AFIE 4O25A 5J5CA 5K8LA 5EP3A 3GLFE 2O8DB 1E0AA 3RS3A 1DBSA 5JWOA 3ZLJA 3KXIA 4G5RA 1KDTA 5EE1A 1DADA 3B2EA 2ZR9A 2WZQA 2JJ8A 421PA 1KO4A 4TTRA 2PMDA 4U7DA 2ZJZA 2GZDA 3MG9A 1OLOA 4B74A 1S96A 1X8LA 3A1WA 4FW9A 2WSSD 821PA 3IEUA 1IBRA 1CJKC 4PC7A 1OFTA 4EPWA 2QTFA 3BK7A 1FZQA 2D62A 4DCSA 3OHMA 5L3VA 1PVOA 1M1YE 1W2GA 3CPEA 1SHKA 3LRPA 2JLSA 4G5GA 2F7SA 5G53C 3WNDA 4B73A 3KQUA 3ZYCA 2B21A 2KBEA 5GVRA 1KO7A 1G5TA 2HF8A 2OXRA 2QAGA 3E70C 2E1RA 2ORVA 4OL0A 1E79D 1YR9A 2FJUA 1OE0A 2V8OA 4UXJA 4PHTA 2C9OA 4ZCIA 2QGZA 2B6HA 4UJ3A 1G1MA 4M1WA 2IXGA 4LYHA 5E7MA 4DLUA 4HSEA 2JA1A 3OEHA 4TMXA 3RRYA 2YV5A 5BQ5A 3C14C 4GMDA 3T15A 1CEEA 2P6RA 2C2HA 3AVVA 2B8TA 5KTYA 5FR2A 4M1OA 1RZ3A 1XD9A 1XXHB 2XAUA 3ZVMA 3K9GA 3X2SA 5JCZA 3B5JA 1T5LA 1IM2A 4CT5A 2PX0A 1GNPA 3B1XA 1ONBA 1CIPA 1EGAA 4O2LA 2FFHA 4B34A 4G01B 3A36A 2KJQA 1YZTA 1EFRA 2XNDA 4YXWA 5AJWA 3VR5A 1Q1ZA 4BUJA 1US8B 3DM9B 2A5DA 3I61A 3F0TA 3WYGA 4E09A 2QL6A 4AC9A 2XEXA 1NVWQ 4F4IA 3TUIC 5SZIA 2R9VA 3TVTA 4LWZA 3EPJA 1W4BA 4QG7A 1JPJA 2EFHB 4IFBA 4EIWA 5B2ZA 5D3MB 3UMRA 1EX7A 3KKQA 4B3CA 1IJFA 2IL1A 1IXRC 4R2IA 1HT2E 4PAMA 3MSXA 2ZPTX 3BERA 3NBXX 4RZUA 3WRXC 4RY2A 1SXJB 1E1QA 1XB2A 4OQMA 1HT1E 4BLQA 1P61B 3SQWA 1Q1BA 1P2TA 2OEPA 1GKYA 3QPVA 5JCPA 3AP1A 1L4UA 3LH5A 1MRSA 3EZ9A 4TMZA 4TLCA 4LYJA 3MJHA 3G5UA 1E2NA 5BWMA 1S1CA 1KKMA 2WKQA 1Q1EA 3BAFA 4LJ4A 4PHHA 4JLNA 4V02A 2N46A 1KZGB 2ZS8A 4TYYA 2YINC 5EXSA 2HXYA 3C5CA 1MV5A 3K0SA 3CONA 1U98A 2V6JA 2ZUCA 5L3RA 3W6NA 4DB2A 1A2BA 4P3YA 1AS3A 2V54A 4KVGA 4ACAA 4CGZA 1HYQA 1HH4A 4YONB 3C5HA 3ZDQA 3GJ7A 3HJNA 4V0MA 1ZP6A 4NCHA 5TV2A 3U5ZB 3CNLA 1E3MA 2FDCA 3QSYA 2ZE6A 4NYIR 4TMVA 2OM2A 2OHFA 1KO5A 3GMTA 1YRBA 3T06B 2IW3A 2XTNA 3UG6A 1QHYA 3VU9B 5FR1A 2W6ID 4DVGA 1P9WA 1Q0UA 5CK5A 1Z8FA 1VECA 3AF3A 1U9IC 2BVNA 1SVOA 5EE5B 1PV4A 2WOJA 4GZMA 1GG2A 2PT7A 4AY2A 3NH6A 1ZAKA 5FUVA 2ODNA 1WF3A 1JXOA 2WMOB 2Q0HA 3RVBA 1G8HA 1P9NA 1S0UA 2MSDB 3MWYW 5HKKA 4AG5A 4TLEA 2WJGA 2X1VA 4DLZA 1W5TA 2BBWA 3OIUA 2IXEA 1KK2A 4L15A 2PCLA 2Q9AA 3UMFA 1N5IA 2YOGA 3SDZA 2C77A 2DWOA 2GEDA 2RGBA 4U00A 5EP4A 1CJTC 2ODBA 1VG9B 4Q47A 2GWHA 3SE0A 2AD1A 4IVQA 2OXCA 4BZPA 1VPLA 4D0GA 4HDOB 4WOPA 1CTQA 2XXAB 3AF1A 1ZYUA 2ECKA 2XOKA 2VEDA 1DEKA 4GL2A 3K53A 2C98A 2J45A 1Q57A 1UDXA 1YZLA 2KE5A 3OIWA 3GPLA 1XPOA 4Z51A 1CR0A 1E32A 4A82A 3U6KA 1G16A 4CEHB 1FNMA 1JAIA 4I4LA 4W5JA 5JI3E 1Z28A 4XJXA 1XJ0A 1KI7A 4E22A 3O47A 3SS8A 1T3LA 1E2QA 4DEXA 3FMIA 1M7BA 2F3RA 2ZAMA 4JVNA 5DE3A 5FPYA 4DIEA 2O8FA 2ZI6A 1R0WA 1ZINA 5AJYA 2ZRJA 2J41A 4URUR 2IWHA 3KQKA 1AA9A 1R0XA 4JKIA 3LQRA 3PFIA 1GFIA 2IYTA 4UKDA 2CK3A 6Q21A 2G0NA 2GVDC 4JL6A 1E6CA 2RHDA 1RKBA 5BXQC 4MYUA 1L2TA 3MD0A 1WB9A 3T34A 1H8HD 1KAGA 2GJAA 4IOMA 4W5WA 1FMJA 3ZQ6A 4FINA 2ZI9A 2AR7A 4EPTA 1XMIA 2H18A 5CB8A 1GUAA 1EWQA 4JT4A 2H1LA 3RSLA 5LD2C 1KY3A 4LBVA 2J7PA 3C7KA 4Q9KA 5FPHA 5FTMA 2EYUA 2MSCB 4QBHA 5EQTA 1ZNWA 1G3IA 3K9HA 4BASA 1G20E 4LJ6A 2GDJA 1W36C 3THYB 4R7ZA 1PLJA 5C4MA 1X86B 5AWFC 2RKOA 4C7OB 3EWSA 4M8NE 1MT0A 1N6PA 1N3BA 3RS5A 1NBMA 2GJ8A 2WICA 1SQ5A 3SEAA 5IF9A 1KI6A 4D25A 2GJKA 1RJ9B 3CWZA 1K6MA 1C1YA 3AB3A 3AEZA 3LW8A 2BWJA 2YVUA 5P21A 4JSYA 4NCKA 1B23P 3NBZC 3NKVA 4UNNA 4XWKA 1NIJA 3PUVA 4JVLA 2D7CA 5TXGA 2VIIA 1FUKA 4EFNA 1CRPA 1SVIA 1C4OA 3SYNA 1UADA 2GXSA 1VG1A 4HLUA 2WWFA 4HYYA 1GDDA 5L3SA 4WXRA 2VP6A 4QKQA 2GXAA 1OB2A 2ZRFA 1BMFA 2ZI3A 4PAOA 3ZIAA 5DNYB 2WKPA 2V1UA 2X8AA 5EE9A 5KNBA 3GLIB 4V03A 4X8OA 4QJ4A 1G8YA 2C5LA 1SGWA 1E69A 4FMCB 4TMWA 4A0FA 1XZQA 2ZR0A 4LC1A 4OHYA 1KI1A 4OHVA 1HUQA 3OESA 2OAQ1 3ZVLA 1E2KA 3UKDA 3GLFB 5KUTA 5EP2A 1J8YF 2QAGC 3DDCA 1NI3A 2CL7X 1RIFA 4RKEA 4HATA 3CRW1 4X8HA 1N6IA 3NHBA 3EAQA 3ETLA 4ESVA 2PJZA 1JEEA 4QBFA 2FE4A 1XEXA 3M6AA 4ASUD 2ANBA 2IYYA 3RHFA 1CULC 1T0JB 1XPRA 2QBYB 2GXQA 4NCJA 1UEJA 3V4FA 1OIVA 1SVMA 3KJGA 3KQHA 1A4RA 4M1MA 3D3QA 1F2TB 1DARA 1G3UA 1V43A 2V55B 4PTLA 3UG7A 3CUEF 2AK3A 2F3TA 2B8WA 1VCOA 3W34A 3PCRB 4NYIQ 5GJVC 3I1FA 4Q4HA 4QL3A 3Q9LA 2IHBA 4N3NA 4ZKEA 3KKPA 1OHHA 3AVUA 3ADBA 2W00A 1Z0IA 5FPSA 2CL0X 2ZVQX 1GKIA 4IXNA 4WBSA 3EA5A 2QM8A 2QRNA 1FMLA 3AP3A 3GJ3A 3EPHA 4HZUB 4HDCA 3THWB 2PH1A 2W2VA 2ZQ5A 4RZ3A 1W1WA 3WMFA 1MH1A 3CPJB 1E9AA 4JKYA 1GNQA 1HQCA 5FUWA 3HDTA 2DFTA 1MR3F 4D80A 4R2HA 1IN5A 4LCBA 3X1WA 2JLYA 2QBYA 1SXJD 1E2MA 5B58C 4NE2A 4JLJA 5JS8A 1JJ7A 3U6BA 3K09A 1WBBA 4B6EA 4EAQA 1U81A 4QJ3A 4B33A 3PEWA 3IUYA 1F2TA 2OBNA 1E9DA 3VTKA 1U8ZA 2CL6X 1NN0A 2IEYA 3SJBA 2C95A 3R8FA 2FA9A 2H7VA 1NLFA 3QE0A 4MYTA 3U60B 2AWNA 3S1AB 4DDUA 4MDEA 3D7MA 4ZV4A 3OAAA 4Q1EA 2PLFA 3CX6A 4A0GA 3TJZA 2ZSAA 1KK3A 1CR1A 1QG4A 1ZM3A 3KFXA 1BKDR 4V0ME 5TDHA 4HB0A 3I3SR 4DCUA 3DZ8A 4TQ9A 3U3KA 2VP0A 3ICEA 1E1RD 4DLTA 3NH9A 2ZRBA 3PEUA 4BRWA 3IEVA 2CBZA 5DH9A 4DRZA 1RE0A 1W0KA 1R5BA 5KO2A 5F98A 4ON9A 1CXZA 3CW2A 4I81A 5FBRB 1N5LA 4CT4B 1YHNA 5JWRA 3K0FB 3LBIA 4JMPA 3TQFA 4D4JA 1NF3A 2CNWD 2PZGA 621PA 2NPIA 5HE9A 2GESA 2J3EA 2WJIA 5J4VA 1ELOA 1ZCAA 1U0LA 2SHKA 2QT1A 3ZJYA 2IS4A 1Z3IX 3FHCB 3B1ZA 2WSSA 4RD1A 4L5BA 5DYGA 3RABA 2IUTA 3FFBA 4Z1MD 3K70D 2YWGA 5JEEA 2WWWA 4YDSA 2DPXA 1TQDA 2QU8A 1UF9A 2E9SA 4D82A 4TYNA 3L0IB 2DYKA 2BKUA 1OW3B 3AUXA 1OPXA 2HT6A 1RRPA 1VMAA 2R6FA 1ETUA 1JBKA 3AVOA 5LDDC 1KSHA 1S9DA 2JIZD 2ASEA 2CDNA 4PZLA 1YKSA 4JJKA 1TQ2A 1A7JA 3D31A 2JEOA 1EX6A 3I8XA 4PO8A 5JEDA 1U2RA 2J1LA 1YR8A 1U94A 1S3SA 1AS0A 2FSIA 3AKCA 1QHNA 1GL7A 2A78A 2HLDA 3Q8XB 3QVVA 1F6BA 4KLNA 1Q20A 1A5TA 1YR6A 5LB4A 3W9YA 4KXFB 5CYPA 1D9ZA 2IUSA 5GVSA 1NKSA 2XJ4A 1II8A 1UEIA 2YOFA 1GL9B 1N6KA 2AKYA 3QNUA 4G5OA 4QM6A 4ZDWA 4HUTA 5JI2E 1U8YA 4UNPA 3ZGXA 1E2JA 5AJXA 2QTVB 2QPOA 2QMHA 3BH0A 3BJIC 4IDPA 5DO9A 2NO0A 1G3RA 3A4MA 3GLHE 1KKLA 3HU1A 3DL0A 5DSZA 4DIDA 3BBPA 1CP2A 1M2OB 3FYHA 2VHCA 3B60A 4DT1A 4ABYA 4NZYA 1M7GA 1R8QA 2QE7A 1E2DA 1VCIA 3R20A 4HB4A 1S4QA 4A2QA 1NP6A 2QMUA 3EX7C 1J8MF 2J9RA 4D81A 1SVWA 3CF0A 3K0EA 1OB5A 2W0MA 4JVMA 1N6OA 3FB4A 4MRVA 3B1VA 3VAAA 2IF0A 4N0DA 2F1JA 1R10A 3QXSA 1KI8A 1TNDA 5FI1B 3FKSD 4ZCLA 2P5SA 2W2TA 1G5PA 5CJPA 5JSZB 1JR3E 3CRMA 2XJ9A 2RGGA 3QG5A 4UXIA 1EXMA 4US2R 1P60A 4JLKA 2OFWA 2PBRA 4JVSB 2WIAA 4WZ6A 4DC9A 5AJVB 4OI2A 3IIJA 4BLOA 4MKFA 2RAPA 4LHYA 2G6BA 3I4LA 1YR7A 3Q3JB 1G9XA 3U3OA 4I99A 1UAAA 2V3CC 2DHRA 3IHWA 2G77B 4QOSA 4US0R 3PG5A 1Z6AA 2Q9BA 1G7TA 3NVAA 3VKWA 1XTQA 3I32A 2OAP1 4FMDB 5BYJA 4C0LA 4W5HA 4I1OA 1WDTA 1IHUA 1T4GA 3K9NA 3TGPA 2Z5FA 2C78A 1NMYA 1VHTA 1ZJ6A 4MUAA 3GFTA 3LVQE 4QHTA 5F2EA 2RGNA 5JHGB 2K5UA 2V1XA 5E95A 4IXMA 4JSTA 4OQLA 4M9SA 1M74A 3AM1A 3X1ZA 1AKEA 5FL7D 3TVDA 1W36B 2CCJA 4I1UA 1AQYA 2QAJA 1N6LA 2VPPA 3AGQA 4C0KA 5FTLA 2IX3A 4DBLC 4AKGA 3P32A 1NVXQ 4HLUC 2EFDB 2EYQA 2OE2A 4MYHA 2ATVA 1D6JA 2J0VA 1XRJA 2JAQA 1YZKA 2Z43A 3NIBA 2PZFA 2OILA 5HCIA 2IYVA 4EQ6B 2XGJA 1ZNZA 3L0SA 2UKDA 4BWYA 2EFCB 2F43B 3AF2A 2YKGA 2J0SA 3NDBB 1OFIA 2HYDA 2YZ2A 5DHFA 1ZBDA 4D0NA 5K8IA 3TUZC 2DY1A 2WJJA 2FSGA 3B78A 3VX4A 4C2TA 1ZW6A 3SBDA 1X6VA 2ZM5A 2WM9B 3P20A 4KSCA 2NZ8A 2Q3MA 1NKTA 2FU5C 1GP2A 1E9CA 3N5CA 3ONWA 2GZAA 4XOIA 2PJRA 4D0LB 2IYQA 2FPMA 1AIPA 1K5GA 1TL7C 2V7QD 1YVDA 4NL4H 5A0FA 3AVXA 2ERYA 1BOFA 4GDFA 1E2PA 3QKSB 5ANRB 1I4LD 2XZPA 5JJIA 5LBIA 2QQEA 3PV0A 4YMVA 3FPAA 4A8JA 3ZD6A 3QEJA 1KYIA 2MMGA 4KVAA 3J81k 2ZI4A 1E9RA 3RS4A 2KWIA 3E2IA 3L8YA 2NPFA 4L9SA 1GNRA 2ZYWX 2O52A 1NIPA 4TYQA 1FL9A 5CIWA 3ZZUA 4R71A 2W6JA 1GIAA 1SULA 4Q7MB 1QF9A 1TF5A 4LJ7A 4RVCA 2G9NA 5FL3A 2QM7A 3QJYA 4PC1A 2R6AA 4BQSA 5B57C 1E2GA 4PZYA 3W5IA 2ZRPA 3E1SA 1KHTA 2CJWA 4OK5A 4LSGA 4B47A 4GOXA 1QHSA 2P67A 3U7FB 4C0HA 1E4YA 3IO5A 4S2EA 2DBYA 5CK4A 2AKAB 3PUXA 2HJGA 3ZZTA 1W5SA 1WBDA 4NBSA 1XJQA 3DEFA 1Z2AA 2WWHA 3QKSA 1I4DD 3KJHA 1Y3AA 1GILA 5FOXA 2WIBA 4M0LA 5F3WB 4EPYA 3VNVA 1GKUB 2AFHE 2YC4C 2PL3A 1XTSA 5KNDA 4Q4LA 2F1RA 2CE2X 2P0EA 2QRZA 1SZPA 5ELXA 4CF7A 5JFGA 3K09C 3KQNA 2FFBA 1KI9A 2B7BA 2GXUA 2WKRA 3E5HA 2QP4A 5KDLA 3LY5A 5DI9A 4YMUA 1GL6A 3PUYA 1T8UA 4M9ZA 4MGKR 5J4LA 2X2FA 5DN6D 4EKDA 5EZ5A 3T5DA 1MOZA 3QF7A 4QGHA 4TSFD 2XB2A 2ZU6A 2ERXA 3FGNA 2FGJA 4LDJA 3FFAA 3L0OA 4ITRC 4QC2A 3K8YA 3QPWA 3JVUA 4IOLA 1HY3A 3AVYA 4QBIA 1UPTA 1XMSA 3N70A 3WYAA 2UZIR 4QNRA 4B71A 4D4KA 3R9WA 4WXPA 4E07A 3D8BA 2BOVA 2GK6A 4JBWA 2CEAA 1D9XA 5TARA 4CEIA 1JEDA 1RC8A 2B92A 4TT3D 1NSTA 1Z5ZA 3TKLA 2D2FA 4G5SA 1Q21A 1XFAA 3RANA 3FTQA 4GOJA 4DSNA 1E94E 2WWGA 1RRCA 1HTWA 3NDPA 4LJYA 5E4FA 1YJ5A 1ZNYA 2ODEA 3CH4B 1DAMA 4P4UA 3VKGA 2F6RA 1OXVA 1YQTA 3QUSA 3SBEA 2GRJA 1ZRHA 1W48A 2VLIA 2A30A 3KFVA 4B3FX 2OG2A 4TQAA 2FZLA 4WW0A 5EXXA 5BN5A 1XD2B 2NGRA 2ATXA 5KYKA 1WMSA 3U7HB 1F2UA 3SNHA 1T3HA 4ERNA 4P33A 4XWOA 1KJWA 1AQUA 4HAUA 2OBMA 1DO0A 1P7CA 1P4SA 3DMDA 4XSGA 3BS4A 3LX5A 3RAPR 2QT0A 2A3RA 3QI2A 2GF9A 5CM8B 5EUQB 1SKYB 1ZU4A 2A2ZA 4Q02A 3W8NA 5GADl 5EZ6B 3CH5A 1LB1B 3UPUA 2VSXA 3UWOA 5DI3A 1K8RA 5KPDA 3BC1A 3KXLA 2CLDX 1OFUX 2DWPA 3NEYA 4RKFA 2OFOA 1B0UA 1Z29A 3EA0A 4Q18A 5FTKA 3I8SA 3DZDA 4XVQA 2CHGA 4LBYA 1Z83A 3WYFA 2NQ2C 2VBCA 1II9A 3T1OA 3KJEA 2VP4A 3SJCA 3WP0A 4B32A 2FSHA 1HEIA 1S1MA 5FBWB 1E99A 4TZ0A 2WPDA 3R8CA 3TAUA 4OJKA 1G41A 4QHYA 4TZ6A 3H84A 3PEVA 4LHWA 1W0JA 1XD2A 3GLGE 2Z4RA 4OQFA 3GCGA 4Q1FA 5J40A 2JJ2A 3VR3A 1X1SA 2GBLA 1BS1A 5TY0A 4B2PA 2A9KA 1PZNA 4M1SA 1IQPA 4HAYA 5JJKA 4RFVA 3QXHA 3SC3A 1QVAA 1W49A 4WVFA 1VG0B 3QOFA 3VHXA 2Z0MA 1NY5A 2ZEJA 1XZPA 4RCZA 1OH5A 3ASYA 1WE2A 3MUFA 2FH5B 4PR0A 1FQJA 3GLHB 5H70A 1F48A 3EIHA 4MGZR 1DE0A 3VNUA 3BH7A 2W83A 3FVQA 4HDQB 2O8FB 2GK7A 2RGEA 3DO6A 4NMMA 1NN3A 2JLQA 4AIIA 4BZXA 3T1TA 3SU8A 1VCMA 4PSKA 2GF0A 2BCGY 2XTZA 3LVRE 3MFYA 2YWHA 1IXZA 1JR6A 2GNOA 3A1VA 1DAEA 3TE6A 2VP5A 3CO5A 1R6BX 1UBGA 1BYUA 2ZJ5A 3I72A 3F8TA 4NKRA 1P2VA 4IJMA 3GEEA 1G21E 1QHXA 3EC1A 4RZXA 1IJEA 3EWAA 1DAHA 4CVNA 4X8LA 2J59A 2AL7A 1FOEB 4YMSA 3P1JA 1M6NA 4QM7A 3CIOA 4N0EA 1E2EA 2FMXA 1T8TA 3Q85A 2VQSA 1FPMA 3MGCA 1XEWY 2IBMA 2RGNC 4IEEA 5JHHB 1QHHA 5LPNA 3GLHA 4LJAA 4IVRA 2D3WA 1UM8A 4KJZA 2VF8A 2WV9A 4RZ2A 3T5GA 3LDAA 2JCSA 4HUQA 3AQ4A 2IXFA 3B82A 1LW7A 3GP8A 4BEJA 5G40A 3BGWA 3UIEA 3ZZ0A 4L8GA 1GTVA 3TH5A 4IOKA 1KI6B 4LJ5A 5FI0B 4BFUA 4IEIA 5CLLA 2LKDA 1GOTA 4MRSA 5CIQA 4M4SA 2NIPA 5JLJA 4HZIA 3T12A 4Q66C 2VP2A 1G19A 2PEZA 5C18A 2JIZA 2XITA 2IUUA 1BO6A 3PUZA 4A0RA 1P3JA 1JR3A 3GQBA 4N1AA 5L3SB 2R6GA 3CF6R 3I5XA 1KJZA 8OHMA 3QBTA 5SZJA 4TLAA 5A4JA 5EXPA 2OCPA 2Q9CA 2BHRA 1T3SA 3CB4A 2IYZA 2YC2C 2ZJOA 1KI4A 3T61A 1Z6YA 3LD9A 3IQWA 4LRWA 1C9KA 1DAFA 2ZI7A 4TLDA 2QEQA 2JDID 1E2LA 1HE8B 1JQJC 1ODFA 5CLQA 1VYVA 2ZIAA 4A8JC 5TMPA 5A5GA 1WCV1 3L82B 3ZS8A 4S35A 4ZDIA 3K0AA 5FOVA 2PT5A 4ZDJA 3M0EA 2G1JA 1O3YA 2FF7A 4B3BA 1KDPA 2OZEA 5FBQB 5JZVA 2VHQA 2QENA 2C9YA 2R65A 1XEXB 3ZH9B 1XF9A 2OLKA 3QIAA 4B2IA 2WBLC 2WJHA 2FZ4A 5EUMA 4NHOA 1A82A 1FP6A 2ZE8A 3VKHA 4Q21A 3WY9A 4DWJA 3W6PA 4BFVA 4BFSA 1OKKD 3LX8A 3KUCA 4GZLA 1TQ4A 4K46A 1CF4A 4GP7A 1IN6A 1J99A 1L4YA 3WRYC 1TPZA 4RSGA 1XNJA 1F60A 2GZHA 4A92A 3IBGA 3X1XA 2BBOA 3FKSA 4A2WA 3B6EA 4I1VA 4Q4HB 4OJQA 5DISB 4HEJA 5JRZA 1Z07A 4BRUA 1UFQA 1EFRD 2XNDD 4YXWD 1P6XA 1U8AA 2BMFA 1G8FA 4C0BA 5FFMA 1CU1A 2HJVA 1R7RA 4WZAE 4JLBA 3A37A 4M1TA 3RNLA 2A7QA 4FMBB 1E9EA 2ZRKA 3BB4A 1RFLA 4PPQA 1QDEA 1XPUA 4BFXA 4GI7A 1TUEA 2P6UA 3MLEA 5JRJA 4QGGA 4JLVA 1KZ7B 4A4DA 1KNXA 1G18A 4CYMA 2J0QA 1E1QD 2HUPA 4MUBA 3Q7QA 4TL9A 4DB4A 4XIGS 1KO8A 3QKUA 1E0KA 1D2NA 1KI2A 3CZQA 5HPYB 2AX4A 3T35A 3QENA 4PAQA 2QPTA 3QKTA 2RH5A 4L9WA 2JGNA 4EUNA 2HV8A 4F4JA 4F91B 2D74A 3EIEA 1COWD 5FOSA 4R98A 4XSHA 5K8TA 4QJ5A 4D6PA 1FX0A 3HR7A 3LXXA 4RD2A 4QBGB 1FW6A 1JI0A 1TEXA 5G3YA 2WWYA 2O5VA 1FNNA 2AN9A 5E7JA 4DDWA 2J5XA 4M1YA 2YHSA 4Q5IA 1KK1A 1T6NA 4DLWA 4FWTA 4MDFA 1N0UA 4KYUA 4NPHA 4Q1DA 3VX3A 4BFYA 5J4YA 1Q3HA 1OH6A 4TL7A 3WNBA 2NO7A 2ZUDA 3G82C 3R7WA 3DPUA 4G0NA 4JT2A 1DG3A 2OT3B 5L3QA 1KTVA 4MKHA 1Z63A 4TQUS 4JJZA 1H8EA 1SHZA 4LI0A 4BLRA 1P73A 1GSIA 4MRRA 5IRCD 1E9FA 1NRJB 1XDBA 1D8TA 4JYBA 1XCGB 4ZO4A 1XD8A 4M1KA 1U90A 2QY9A 3GJ4A 3SQXA 2UZ3A 1Q12A 2YYZA 3A4NA 3KJIA 4AKEA 4UNRA 2VHUA 2BEKA 1QHGA 3BIFA 3NBYC 2VTKA 2BV3A 3KDSE 2Q21A 5HKKD 5IHPA 1KDOA 2WAXA 5C2JB 2D4HA 4JYCA 1UBFA 4O0MA 4DSOA 1TTTA 3D6TB 4DLSA 2CHVA 4MGYR 4FMCF 2OSBA 3UANA 4W7SA 4A1FA 5DIFA 3L2OB 2VH5R 2FX3A 1VDZA 3H1TA 1IY0A 4EPXA 3ECCA 2JLZA 1NLYA 3TR0A 1NY6A 1ANKA 4BZQA 2ZSEA 4KO8A 4LY6A 1II8B 5H68A 1MABA 2OCAA 4PC6A 4D4LA 4ZKDA 2CXXA 4G1UC 3PENA 3I92A 4OYHA 4NONA 1OV4A 2CCGA 1BH2A 2XOKD 1QHIA 1SXJE 1AKYA 4Q9HA 1G4UR 4DLXA 5GJBA 3DKVA 2GBLC 2JASA 3GJ6A 2BDTA 3M1IA 3HWSA 3MAAC 4URZR 1BYIA 3A58B 2NMVA 4LGMA 4DCTA 2Z4SA 2P2LA 4C0AC 4F38A 3U61B 4DT1B 3BXZA 3AF0A 5KSPA 1Z6GA 1QG2A 1ZM7A 3NEJA 1WA5A 2GJ9A 2LKCA 4IKEA 4BLPA 3BE4A 1E79A 1ESNA 3OFND 4AKHA 4XTCS 4LPSA 3B9QA 1YZGA 1Z0JA 3AVPA 1J2JA 4Y0VA 3HU3A 3LA6A 4BFTA 1XEFA 3GLGB 1ZCBA 2FPLA 5C1BA 1II0A 4LPKA 5DYIA 5FOTA 5CB6A 3W3ZB 2FNAA 2CK3D 3ICQB 1E9SA 2GEUA 2PZEA 1RYFA 1Z47A 4KI0A 3U44A 4Q9IA 3GFPA 2QZ4A 2XSZD 5D3QA 2NO1A 5C46F 1VTKA 4XWAA 3PITA 4LJ9A 1N0VC 4PQRA 3OIVA 5AUOB 1GWNA 3NC1C 2BBSA 4B2LA 2JATA 2P6NA 4DLVA 3ASZA 3LAWA 2RGCA 2YJTD 3IILA 3QBVA 5DGXA 1VYTA 3NWJA 1KSGA 5CITA 2WJYA 2GCOA 2J7PD 3DOFA 5HZHA 5TB5A 4E5UA 4KV9A 4K8OA 2FOLA 1NL3A 1GVNB 2XNSA 4Q03A 5JECA 3H86A 2WMNB 1KMHB 3X1YA 1O87A 1VKJA 3L8ZA 3NHAA 3SR0A 5CJ2A 3LO5A 3JVVA 2PLRA 1OF1A 4M21A 3GLGA 2BKEA 4UNQA 5JJLA 1U99A 2HYIC 3A8TA 2DWQA 2GTPA 1AN0A 3L0PA 1AJEA 1DO2A 2IS6A 4F92B 2FEOA 3PXGA 3SI7A 4DSUA 3IKJA 3AV0B 4NDZA 4V0KA 2KSQA 2IS1A 2KB0A 2RCNA 5KSZA 4ACBA 3KB2A 1BMFD 3Q5EA 1G3QA 4TL8A 3ZIAD 5EP1A 4GBMA 3O8DA 2H16A 1CJVC 3Q7PA 5HZKA 3EXAA 3EZ2A 3OIYA 3C16C 1CJUC 1Z22A 1DS6A 5J47A 3NG1A 4BFWA 4M9XA 1KMHA 1RPZA 5HTKA 3AUYA 4CEJB 4AD8A 2ZRIA 3WHLA 3B13B 4PX9A 2QMOA 3KKNA 2JLWA 5CYOA 4ZPXA 4PANA 4ESHA 1NMZA 1W2HA 4TTQA 1ZIOA 4IHQA 3PQCA 2Z83A 2GA8A 3MWKA 3V9PA 4HAWA 3VR4A 5GJCA 4MITA 2W58A 1WXQA 4Q9LA 3K0CA 4Q7LA 4A8JB 2W6IA 4C0JA 4R9UC 2GVZC 4NTZA 3B9PA 1SVKA 1Z08A 2VL7A 4Q48A 2ZETA 2EVWX 2AXPA 4E03A 4PSVA 3HP1A 2LCFA 2ZI5A 3CX7A 4FCWA 1NVVR 3AGPA 3QEOA 3MJRA 5UKDA 4LJ8A 1IN8A 3B7GA 3IGFA 2FEMA 1DTSA 2HDNB 2OUKA 3DKPA 4JLAA 4CEJA 2ZRAA 1EWRA 1JAHA 1XEWX 4KCGA 1XX6A 2CJWB 4QFMA 3KB1A 4Q7JB 1NMXA 4BFZA 3TIFA 2JLVA 4JL8A 1U0HC 2X19A 2WWXA 4IDOA 2ZREA 2R8RA 1N6RA 2O0JA 3MWJA 4RFSA 3RLFA 1NJFA 2ZRMA 3MWLA 1RW4A 1V5WA 1MKYA 4M9QA 1CJMA 3M4YA 3SJAA 3BRWD 2NG1A 3OE7D 2I3BA 2W0SA 2ZJ2A 3RDPA 2ODWA 4EJSA 2IK8A 1TEVA 5FTJA 4TYWA 2ZS9A 1N0WA 3T1VA 1G7SA 1TADA 1EG7A 1ZD9A 4KBGA 3X1DA 4L4UA 5CDFE 1HQYE 2R2AA 4LHXA 3SYLA 3H0KA 1RVDA 3FDIA 3K1JA 2RGDA 4UNSA 3VR1A 4Q4AA 1E2HA 2MMCA 3TK1A 1RYHA 3BFVA 3OAAD 1J90A 2ZJAA 4B3GA 1OXUA 4IDQA 4JBYA 2C04A 1OIXA 1RRFA 4V0OA 5BN4A 4BGDA 1NG9A 3WNCA 2REXB 3O8RA 4DXAA 2BJVA 4A36A 1LNZA 2OCBA 5FBLB 1NSFA 3LLMA 2DR3A 1VIAA 3IBYA 1CS4C 3TQCA 1W0KD 2REOA 1JB1A 1GRQA 4J0QA 2FN4A 5J4HA 4FMDF 1IXSB 5BW8A 1R5NA 1L8QA 4CEIB 2V6IA 3TSWA 4MGIR 2IYXA 1NN5A 2WJVA 3CF2A 4M53A 3N2IA 1IN7A 1H8HA 2VF7A 1ZUHA 3ZS9A 5EE3A 4URXR 4XVUA 4A0HA 3I5YA 3WBJA 2JJ1D 4OI1A 4A2PA 4RD6A 3C8UA 1G8GA 1S8FA 1XTRA 2IHYA 2HCBA 4PPNA 5KU1A 3HYRA 2C8VA 4KSBA 4HLCA 4OK3A 1XMVA 2EWWA 2JDIA 521PA 2IA5A 5JS7A 1WP9A 1D2EA 1UBEA 4LK2A 4HB2A 1Q22A 4QXAA 4H1UA 2IT1A 4V0LA 5CM9C 1F2UB 1N6HA 4PZZA 4Q1AA 1FUUA 2IWRA 3WBKA 3THXA 2ZVPX 1OH8A 2HLDD 3BFXA 3P26A 3KKMA 4NYMR 2V9PA 1G64A 2O8DA 1XJCA 1NNEA 4DKXA 1XMJA 2FFQA 4DLRA 1OT3A 1UKVY 3QF4B 4Q9JA 1TAGA 4JLOA 1W46A 4TL6A 4PHGA 5DI3B 4C0QC 1OKKA 3GFOA 4O2RA 5FPKA 4KYIB 2WSMA 1FP7A 3W6OA 3TLXA 2WWIA 4NYJR 3GJ0A 1Z0AA 2XZLA 1E2IA 1UKYA 3U7EB 2J46A 4DHEA 2IYRA 4C9BA 4PQYA 1P2UA
chains in the Genus database with same CATH superfamily
2RGAA 2W6NA 4B5LA 1S4MA 1CKEA 3OTIA 4MW7A 4F97A 2QE7D 4I55F 4YAUA 2WLSA 3EF1A 2G4LA 3PEYA 4U8HA 4CF4A 1UKEA 2R44A 4HAXA 4I6JA 2PSFA 5EYPB 1J00A 1ZH6A 3B52X 2JHPA 1GPYA 4DQKA 2QG4A 3GFVA 2CJYA 3MINA 1FBNA 1BD3A 2BGKA 5BRNA 1Y9AA 3M8KA 2QG6A 2AG5A 4FOLA 4CMIA 4F4HA 3R9XA 2LIVA 4UBMA 3LPAA 4N5IX 3WHKA 3ST7A 1CDOA 2WWTA 3U17A 2B7CA 1EFVB 2VRWA 2WD9A 2YNMA 5A5FA 5REQB 3A3KA 1ZOOA 3C15C 3BZUA 4EGQA 1M1XB 3F7NA 3QX7A 4HFNA 1XL0A 4L74A 4OFBA 5GP1A 1CZLA 1X8JA 2R6DA 4ZCMA 4GPIB 3I5MA 3U16A 2C8JA 4JL5A 4KPUB 2CKMA 4U7WA 1SVLA 5ARCA 1Z3CA 5BSWA 3G6KA 2I91A 1E9VA 2ODTX 4AZWA 5AVZA 1V8ZA 2NOAA 1OWLA 3FH0A 4M89A 2PH7A 1H0RA 5HJEA 4KLZA 4AW9A 1XXHA 5EWMB 4C4RA 1VA5A 2FUCA 4Y6RA 2TS1A 5DNCA 4NQRA 1R37A 3FZQA 2P3SA 4Q24A 4ZQHA 1JHVA 3RVPA 3TD6A 3DLHA 1CUXA 5LLTA 1E3MA 1XQWA 2IYFA 3MOIA 4GT1A 4L07A 3HC7A 4OHKA 2Y05A 3FMVA 2GETA 1D0VA 2PO7A 2GYUA 4RGBA 1LBSA 4Z54A 1US8A 1CHNA 5EYPA 4AJ2A 3DAOA 5HWSA 1T91A 1CC1S 3ENVA 2PX6A 3WKCA 2HXSA 1T2FA 4H6WA 1S9HA 2BI7A 4NFSA 3OM9A 4XD7D 2GKSA 4FI3C 1R27A 4KWCA 4DMHA 1RQXA 5ALUA 3UMYA 1F7VA 2DPYA 1T5OA 3GGCA 2OV6A 1MO4A 1VDMA 2X0RA 3VNRA 3HUFA 3A1SA 5D3MA 4B7ZA 2IZ6A 3KAKA 4B75A 2PUGA 4DDMA 5E1OA 1IN1A 3QEMB 1K3UB 1YUBA 1GKLA 1H65A 2PZKA 3C3AA 3DEHA 3IULA 4EJMA 4I50A 1O5OA 3QKRB 3CBQA 1DC3A 4JLPA 1QBKC 1SXJA 2Q3HA 3ZOZA 1SC9A 3CMMA 3H4MA 4EFLA 5ALNA 2VYFA 4KPUA 3AH8A 3P4YA 4EO4A 2F9LA 2Q27A 3GZ4A 8AT1A 4FFBB 4R4JA 1ZGJA 4HAZA 1S3GA 5CTAA 1PL6A 3KKOA 1MW8X 5FORA 2UDPA 3CLTC 3V80A 1I0ZA 2G88A 3M3DA 5EWMA 4CKWB 4CDGA 5K45A 1T1RA 5GV7A 2V97A 3TI7A 3BB1A 2O20A 5F12A 4MS1B 4BGVA 3FPKA 2EGGA 5HIAA 4HVAA 2EFEB 2XBMA 4QRHA 3DB1A 5I5GA 5IJ0B 5EE0A 1D4OA 4RMJA 3SIWA 4FWIB 1VXOA 3OOEA 5CA0B 3MCUA 1DOAA 2JGEA 4MINA 3ROQA 1E7YA 1JW9B 1K7EB 5C1PA 7AT1A 2PJUA 3N8DA 4FFSA 3SFZA 3OZWA 4WUVA 5EPUA 1E1RA 5K01A 3B7WA 4ZEMA 2NPOA 5M3BA 4D98A 1T1IA 1JZSA 1YL6A 3QEMA 5ALEA 2O8EB 5DLQC 4ZT4A 3DDZX 1KDVA 1UJBA 1GZ4A 5F64A 4NXMB 2OC9A 2C5HA 2O3SA 3QKRA 4H9GA 4FTWA 2V7XA 4LQLA 4MV1A 5G0VA 3ES9A 1D1QA 2RK6A 4NJMA 3F3YA 1CQIA 2AXEA 1G55A 4G2TA 2WNHA 3OJWA 3VU9A 4CMJA 4WTOA 5FBVB 1W36D 5DM0A 4G36A 1CY0A 5F2KA 4MHOA 4X5OA 1I0IA 1WP4A 5FOQA 2G40A 1L4HA 2G08A 5AMXA 4ER0A 2Q8PA 4ZGGA 1SU7A 5HM8A 2ZYUX 3RR2A 1ESEA 2H1IA 2AF4C 1DKQA 1FDUA 1WMDA 4Q1CA 4ZI7A 5D5PA 2P9GA 1FFDA 4Z1MA 4YRQA 2GMWA 1AUVA 2H4XA 3QXXA 4P32A 3W8DA 3DAPA 2I8AA 3FYUB 5IJ0A 1PWYE 1KQ3A 4NBLA 4O59O 4W8OA 1YC5A 2LGJA 4N41A 1CFJA 2FG6C 2BFOA 2CNBA 1I6WA 1Z4LA 2FZEA 5CA0A 3IOBA 3HGTA 4RL4A 4OSPA 1YRQA 3CTPA 4FHFA 4Y2PA 3WMEA 1RZVA 2Y6UA 1XP5A 3AKEA 5FBKA 2UVQA 5LP6C 1W6RA 2GSWA 4GP6A 4PFSA 4X54A 4DILA 1MO6A 3MJVA 1PS8A 2O8EA 5EMMA 1LY1A 1TIBA 2V0CA 3DDHA 4ETMA 2D0IA 4LV6A 4RZHA 4CUKA 5EXTA 2F48A 4V0NA 5KJ6A 4DCVA 1MBZA 2QJWA 4O4JA 3SN6A 1U5BB 4FFRA 4I1YA 2O7QA 5IVPA 5BMVB 1OXBB 4C0WA 1A5SB 5BV8A 3H0CA 3PHLA 1I51A 1EB9A 1YU9A 1O6FA 4N5DA 2FV8A 3F6BX 3LLVA 4CIBA 1UODA 2IUEA 2B37A 3QEKA 3VNBA 1ZD1A 5KNDD 1RI1A 2GPTA 3SLRA 3P0JA 3U4HA 1M34E 3IELA 1CR2A 3ZWBA 1TFRA 5A3RA 4EEXA 1VSVA 3A9VA 4HKTA 5JTUA 4CCSA 2EX0A 1HV8A 3A1UA 5CVDA 1NLZA 2VYND 1S2OA 1SCBA 2G5PA 4KITB 3EY4A 1XCPA 2H4ZA 3M3HA 4M55A 3LE8A 3RYTC 4CEHA 3SOPA 3IEIA 1ZR4A 4K6CA 1D1SA 1OXXK 4EP1A 3PF9A 1H1LA 3EVZA 1MNAA 2W98A 4YJ3B 1IEQA 4W9MC 1H0HA 1KMQA 2D2XA 5T64A 4BECA 3WQBA 4YAGA 2QROA 3KSMA 2FTKE 1IPHA 2PIAA 1ZM9A 2P62A 5KVVA 1GT6A 5AKJA 1A96A 2F1HA 2JGLA 1ORHA 1ZVQA 4UTNA 1IZ9A 3JPWA 4NYJQ 1M2VB 1YIAA 3GFGA 5TMBA 1VJ0A 4JB3A 5CAEA 2XZOA 2QN1A 2QRPA 1BCSB 3VSDA 4RUKA 1SELA 2EIHA 3O95A 4YGYA 2QTRA 5BMVA 1F20A 5JPIA 4RULA 2GAAA 3DLAA 3NXSA 4FDLA 2WAYA 3KWJA 4LV8B 4PBTA 4BKQA 3P9XA 2DQYA 4MW4A 1I2MA 2AOWA 2V74B 3MMPA 4QJIA 4GLBA 3RC3A 1YJCA 3AHIA 5F9HA 2P69A 3QNWA 1FX0B 2WJWA 1BN6A 3ZI7A 2D13A 1LSSA 3DUFA 3H3XA 1TZBA 3D2LA 1MIOA 3UCEA 4KPYA 4UU0A 2G07A 2JKZA 1A4IA 3ZNQA 3PGJA 3ZHUA 2GAFA 3PQ6A 1XR3A 1DTEA 4L57A 4FCTA 4FHEA 4AZ3B 1N2HA 2ZTSA 3ANLA 1AMOA 5K4HA 1XKQA 5CLGA 1AS2A 2VHWA 2WINI 1AM4D 3CRVA 2LCIA 1DBVO 1ENZA 1JYEA 1WULS 3NCHA 5HK9A 1WBBA 2HHHB 3ZWQA 2Z6VA 1S01A 2ZANA 1M2VA 1N8TA 3KJFA 3Q3CA 4LJSA 3HTXA 1H2WA 1QV7A 2VZ9A 4PINA 1BCSA 3E22B 5H0IA 4B48A 3MELA 5CEFA 2OQIA 1Q14A 1H6BA 3EXG2 4RC9A 2XVZA 4UJ5A 1E2FA 1EVJA 4KRYA 4RWEA 4CLOB 5I4IA 2Q6TA 4IO0A 1G17A 3PE3A 4AK9A 3C39A 3LSYA 4K3VA 1OJLA 3LK7A 3PIDA 1JKXA 1KJYA 1OU4A 3VYVA 4DSTA 1Z4KA 3EBOA 4C2UA 4M22A 1OXMA 1KIMA 3KOXA 1T2CA 4EJFA 1RLIA 5HYVA 1LI5A 2DQSA 3L84A 3O82A 1DAOA 2XMSA 5DHAA 2C9CA 2OQRA 2ZUUA 4U2EA 4X6LA 4MGHA 5DLYA 3MB5A 3UJDA 3GH1A 1E5QA 4OXRA 2EZ9A 3B48A 3EZGA 3LPDA 4LMPA 3S5UA 4TTPA 1ZKMA 3AP2A 3RS0A 2JGMA 2VNSA 1IPEA 2OOKA 1GUZA 4Y2VA 1FDOA 1NPDA 3E58A 5G3ZA 5EIWA 5EHZA 1PHPA 4BMPB 4ZHQB 1Z25A 3IQDB 1L5QA 1DG1G 1LFDB 2DBQA 2I1QA 2QTGA 1PUIA 2XRYA 3QLEA 1W0JD 4LRYA 5BSHA 3JD4A 3DDOA 1MABB 3D5TA 2GR9A 3BK1A 4MYRA 2I3GA 2JJ2D 2JFWA 1V8DA 3D2CA 3F6SA 4BDTA 1GRCA 1E98A 1SCUB 1JDPA 1TCBA 3NUZA 4DMUB 3GJTA 3C2QA 1BRMA 4L16A 3FTPA 4YMLA 5T6MA 1K2VN 1HT3A 2HK7A 3JZMA 3QFFA 3U7GA 1F14A 1ZXLA 2C7VA 1UBCA 2I03A 2QUZA 3TRFA 3GROA 3TNLA 4HDKA 3H16A 1OILA 3TG2A 4ER3A 4FDMA 2GCIA 5BSTA 4M37A 1LS6A 2EL7A 5AHKA 2JC3A 3ZEAA 5JBQA 4NFLA 1U3FA 4HLNA 1U0JA 2GPNA 4B40A 3LXRA 1IWOA 1MA0A 4RS4A 2P35A 2WIFA 3GEDA 2AK2A 2J5QA 1E9BA 2XNHA 1EMDA 1W85B 3I34X 5FLYA 5EIBD 4Y9RA 1O03A 4HK4A 3ZK8A 1ZL0A 4ZHQA 4K6FA 4YJGB 4KR2A 1DC5A 1K1EA 1UPFA 2ZRNA 4A9AA 4DJTA 1W93A 1NF2A 5CX1B 1EE1A 5EIXA 4FD2A 3X44A 3HPQA 5ALFA 3IHLA 3K4QA 2EX1A 4GSYA 2UAGA 2HJWA 1P5HA 4J3JA 4CW7A 4F7WA 4ALIA 4LOJA 4NU0A 3Q0TA 2EKDA 4HZUA 2E87A 3FWNA 3ZXIA 1GG9A 1NU6A 2NYRA 1AOXA 1KC3A 5DBIA 3DS8A 2F55A 1PHRA 1SCUA 5H1YA 3RVMA 1AKQA 1IEWA 3FIJA 2WW8A 4MWBA 3E9QA 4M6WA 3PL5A 3L4EA 3DBHB 3AERB 5HOQA 1YFJA 4P98A 3EASA 3PBKA 3KO8A 2BGNA 4OI4A 5LKRA 4G5HA 4QXPA 4BKOA 4N5MA 2C3YA 3DBRB 4U7GA 3RBAA 4CFSA 2XGSA 3UATA 3S81A 5ESRA 1SKYE 1OXSC 1VC2A 3U7RA 3PJGA 1SCNE 4CR6A 1GAXA 721PA 4EEKA 1JVNA 3W6ZA 1RXCA 3FNEA 5EJ6A 1GM5A 3HDHA 3TIIA 3IQIX 5K8VA 5LOVF 3OMXA 4EYOA 3DMPA 3RRXA 4DR6B 5BSGA 1C4XA 4PR3A 1YWGO 2RC5A 4S1TA 5JZSA 1SK8A 1XLTC 2GJ4A 2XCIA 1F4VA 3GEIA 2QV7A 3H17A 2OAEA 4TSFA 1X1RA 2HXGA 1GA4A 1L7AA 4U9IS 3HLYA 3E18A 3VI3B 5TX7A 3ED5A 4B76A 3RIGA 4EY5A 3ZD7A 3K8OE 4V0QA 4IFEA 4K9DA 2P1RA 2XMCA 2FDXA 2HMAA 1TVCA 1EFCA 2JLRA 3RVLA 4CL3A 3FDJA 3RODA 3K9FC 3EDQA 3PI6A 2YV4A 2NVWA 2LV8A 1S6YA 3GUYA 3VGPA 3AERA 3H5WA 3U3MA 4DPKA 3R0XA 1KY5A 221PA 3OCVA 4ENSA 4Z8YA 5BNZA 3IX7A 2JLUA 1R9JA 2B4TO 2XKAA 4AG6A 3DAYA 2QQ5A 3L1JA 1AMUA 1ZCZA 2QYSA 3EW9A 4PQGA 3R5SA 5EQJB 4DNPA 2MHCA 3ADDA 1T9AA 3EARA 3FNFA 4GX0A 4I5FA 5KOYA 2EKPA 4UM7A 2F8SA 2ZXEA 1OXTA 2C4MA 1E0DA 4LMRA 1PP4A 5JIBA 1UBJS 1KEVA 1TZ2A 2O2IA 2X2EA 1ARZA 3NVKI 1NBMD 5BV1A 2YWEA 5KNCA 2SBTA 1W4AA 2YFQA 4CCYB 5CEJA 2BFPA 3R3JA 1PX2A 1TMKA 2PL5A 4RE5A 2R7AA 3B51X 3O4IA 3SFVA 2V96A 5SYNA 1LPAB 2AXQA 3MTQA 2TMKA 2POCA 1FW8A 1DBIA 2ZT8A 1NOJA 5E7IA 4ZAXA 2C7OA 1PQUA 1T9GS 1YBVA 4CI9A 4K6MA 4BO8A 1TCAA 1MJHA 2IRWA 3AI2A 1U9IA 4I3HA 1TOAA 3R5HA 4MQBA 1BKYA 1NM5A 3OA2A 1RM5A 2A8YA 3RK4A 1RJGA 2QVCA 3JQ8A 3LLUA 2QF7A 3U31A 2C2GA 2HF7A 1GGKA 2B78A 2NO9A 3B1YA 2XVAA 4NONA 1YS6A 4MQ6A 2YIDA 1VIYA 3CJQA 2R47A 3ED1A 1ML3A 2I1VB 3EGWA 2PGLA 3QVJA 2QMEA 5DMHA 5FTNA 1P77A 4K26A 4FCCA 3KTAB 4N40A 1JTFA 3D81A 4NJOA 1XK7A 2HY7A 3BGIA 3FWKA 4U2KA 6NULA 3BMQB 4TYMA 1WSAA 2HU7A 1UK6A 4ZEVA 1OH7A 3B3FA 1HC7A 3HYTA 4CV2A 3NU1A 2Q1UA 3CNNA 4ROSA 3W90A 4K0KB 3NIGB 4RHXA 4EG6A 2WT4A 3ZQUA 2WSLA 1ZMTA 2WM3A 4Y6SA 2BCJQ 4U6SA 3WL3A 4AYWA 2ZYHA 4CCYA 3RRZA 4C08A 5CEEA 3GJ8A 4IR7A 5EJAA 5KTSA 4O4HF 4ID9A 1J97A 121PA 3RC1A 2WHXA 2PE5A 1JJVA 3QXCA 4FZ5A 2G3YA 2VKTA 1LF0A 1NBME 2H29A 2QQ0A 2ZSBA 3QPUA 4DZZA 1T8RA 1D8AA 1C9YA 4EK9A 3GT3A 3KR1A 1O97C 3OKAA 3V2GA 2I80A 2X3FA 2YJ6A 3EZ6A 3FPJA 3KZOA 2IHZA 3ELDA 3RS9A 3HDVA 2AD5A 2ZQYA 1ZGBA 2Y1OA 5CURA 2OSVA 3VJLA 4P3NA 3WLAA 3U6BA 3L0YA 3WLHA 4YQFA 4NU8X 4RY9A 3HK2A 1CLUA 2A92A 2D54A 2O7NA 3H9JA 4L1KA 1P72A 4AMZA 1FU4A 2X3YA 3EH2A 1V9CA 3QXJA 4UEWA 2LD4A 4WE3A 1JHDA 2C03A 4ZVKA 3KTAA 4HLDA 4NU6A 5JSZA 4DUGA 1G7CA 2QSYA 1KAMA 2L82A 3RVQA 1WSBA 2OO7A 4HNHA 3O3MB 3NIWA 3GEBA 3MTBA 4YRKA 3T5CA 4Y1EA 3PDWA 4Q15A 4LEIA 1QG6A 4ZQEA 4BNTA 3O91A 5IJ9B 1OBHA 2Q8QA 1GO2A 3ESRA 1FB5A 3K0HA 1HFKA 4C4ZA 5JXGA 2ZAOA 1TK9A 2H5IA 1RYYA 1W44A 1XTIA 1GGFA 1YI0A 3HPRA 2E85A 3KQMA 4IPTA 1PDOA 5T3YA 1P1BA 4EFMA 3EPKA 2ZBPA 1I30A 4Y6GB 4JI4B 2H4FA 9LDTA 4QWWA 4B4VA 1D6SA 1SHLA 5KQSA 1U02A 1YCHA 2EW1A 4PYQA 4Q3NA 1PR1A 2WAAA 3EPRA 3W6UA 5ILOA 1G7RA 4PO1A 5IDYA 1J2RA 4W7HA 5E2BA 3OEEA 3IDQA 2JVJA 3BH6A 3NMUF 1E8NA 4OHMA 4MYCA 3V7YA 1HI9A 2QRKA 3LYAA 4MWZA 5CDGA 2F4NA 4DZRA 1EYZA 4MS3A 4YA6A 2XX3A 3VJRA 1CV2A 1B1CA 4PSUA 4UEQA 5F1PA 1TF7A 2H57A 3RTGA 4MRPA 1M7HA 3VYWA 3T4PA 1O8CA 3QV2A 4EKNB 1IN4A 2I6UA 5E8JA 1AC5A 2YVKA 3W1EA 1TU3A 3Q12A 4HG2A 1CVLA 4XRGA 3CRRA 2XI4A 4YJHB 1KAOA 1Q92A 4MAAA 2EZ8A 5L7WA 4MVJP 1E3TA 5JMPA 4IF4A 4A16A 3CCFA 3E7PA 1U2PA 4R3NA 4WLVA 3KZ1E 1ZUNB 3GLIE 3NBFA 1E4VA 2H3EA 4K3UA 3OQIA 1M0WA 2A9QA 4ZRMA 2AW5A 2P9YA 4IDCA 3THXB 2DX7A 3DWEX 1LPBB 1LRJA 2QRMA 3GP5A 3PIRA 3RRBA 3ZXXA 4F5DA 4JS0A 1J70A 4GKKB 4L5AA 5TS3A 1KC1A 1TQHA 2J9ZB 3ETHA 3ESXA 3F6CA 3VAYA 1RWPA 3QLUA 1E2UA 5E6RB 4A23A 4CGYA 3TX2A 1QCYA 5JWOA 3K71B 3CBGA 3KXIA 4G5RA 1URPA 1ID8A 2NZWA 2ZDHA 5EE1A 3SYLA 3DGFC 5CVTA 4P4NA 5IT0A 3I5AA 2JJ8A 1KO4A 3VVBA 1AQLA 3INRA 4CMEA 2AOVA 4GPEA 4FW9A 1H6CA 1VHQA 3GLUA 821PA 3IEUA 3RJMA 1HFWA 1IBRA 4E33A 1Z0ZA 1CJKC 2XA9A 2VRCD 4RIIA 1N2CA 3D7KA 4LY9A 4DCSA 4EHBA 3L05A 3LRPA 3IP7A 3R9KA 4BFLA 4JJ6A 1A76A 5KYUA 1UZNA 1QP0A 2YY6A 1EA7A 4IG9A 3ZY4A 1VKZA 4Y6QA 1S3FA 2OXRA 2WQ6A 1BHO1 3CURA 1A8HA 3E70C 1KQNA 4P36A 4F9GA 1NVKA 4OL0A 1QVWA 1TXGA 1P0CA 4BJ5A 3F71A 1N2SA 1YR9A 3BHNA 3W2IA 2V8OA 2C4UA 2QRJA 4D43A 4PHTA 3P9KA 3PNLA 3SF8B 1ZITA 3RYIA 2GBFA 2QLJA 4UJ3A 4BXOB 1QP8A 3UB4A 1G1MA 3TG8A 1VL8A 4MUFA 5I7OA 2ZVDA 4FOSA 4QDXA 1U0TA 2GHTA 2JFXA 4M0PA 4MPPA 3FAKA 3SMQA 1AX9A 3ZDFA 1V26A 4LVUA 2CXRA 3OKFA 4OREX 3C14C 4RGQA 4ZFNA 2BFCB 3GRPA 4GMDA 4CG2A 2XRMA 3GFFA 1T3GA 3O3NB 2VC2B 5KTYA 4U5QA 3IUBA 5DOZA 1AO0A 1DMSA 4O2AF 4BMYA 3WXBA 4GSLA 1K0UA 4CBVA 4FB5A 1WU8A 2XAUA 4RV9A 1MN6A 3K9GA 1O0CA 2X58A 1FDIA 2EF0A 5TQ0A 1O4WA 3V6MA 2DZDA 4DIUA 5LOVB 4WEQA 2IOYA 1T5LA 1GNPA 3B1XA 1CIPA 1H1TA 3GZNA 3TOXA 1QIFA 5IMSA 4B34A 4G01B 2KJQA 2RBKA 3QLVA 4IYRA 2EG5A 5AJWA 5EWLA 3VR5A 2XB8A 3KLOA 4BVBA 2A5DA 3K1TA 4C87A 4E09A 4AC9A 5CX4A 5GZ3A 2HQOA 2X41A 1A9YA 2JKVA 1IYZA 3SF8A 4LWZA 3TUIC 3EPJA 3ZVKA 3FY4A 4QG7A 4EIWA 5LDGA 5CB4F 4NMHA 4CTOA 1KZHA 1IXRC 4G8CA 3G9UA 4PAMA 4BDSA 3KAPA 4JELA 5IN4A 3DLBA 3V2HA 3S8MA 4M0DA 1TKAA 2ZT5A 4H0NA 3V5NA 4CL0A 3WRXC 3KQTA 1HT1E 2X5JO 4J29A 1PQWA 1Q1BA 1LVHA 1X9HA 2OEPA 3NI2A 1NLMA 2Q62A 3QPVA 4HEA1 1L4UA 1WW8A 4LYGA 3ZLVA 3OJFA 2PUAA 2Z5GA 4TMZA 3OFVA 1HZZA 3R7NA 4OU5A 2DG2A 4EOGA 2JZNA 1RTTA 4EABA 4ETWA 3Q9SA 1EJBA 4F86A 1KKMA 1PL0A 1WHSB 4LJ4A 4RF4A 4B81A 4GYJA 4X44A 1HXHA 4GUAA 3EGVA 4YAWA 3IXLA 1QH8A 1XEAA 1EM8A 1KZGB 2JI6A 2XDAA 4J8PA 5EXSA 5AXCA 4RTRA 4S05A 4JT8A 1NYQA 5FUQA 3R7SA 3Q0EA 3UGQA 4B6JA 5A4DA 1RM4A 2R5NA 1MXFA 2V6JA 3AHHA 2WUVA 3GLSA 5KTMA 5M2QA 1U1IA 1AB6A 5AVRA 2Q7XA 1RRKA 1BE6A 1NONA 3S29A 2JD2A 4P84A 1M83A 2XT0A 1DIOB 3F8WA 3AW9A 4V0MA 3IDOA 3T54A 1J25A 1ZP6A 2OP0A 4WK0B 3VSCA 3I9JA 4YFVA 3FM9A 1RAFA 4JODA 2OHFA 1KO5A 2W8BB 2Y9PB 1YRBA 3G2OA 2IW3A 5HMLA 3T06B 3ZDBA 3GY0A 2XMPA 5FR1A 5C0OE 4JOCA 1ZVJA 4RPGA 4WCFA 2YMMA 4IGAA 3UJ7A 3R41A 5HHTA 1Q0UA 3AFIA 4KE9A 2HSJA 2I4MA 2Q4BA 3KOWA 4LISA 1SVOA 2CFOA 1PV4A 2PKYX 3DJYA 4GYKA 3ZD8A 3H9BA 2PDAA 7GPBA 2PT7A 2IHJA 3O3CA 1F4PA 1VSTA 3TKYA 5FUVA 2QPLA 4DOMA 4ZZ0A 3W5AA 3A1DA 4CF5A 1K0FA 4ZU1X 4Z4CA 1CUBA 1JXOA 3IA7A 1OTYA 2WF7A 2WMOB 3OJ0A 3U9TA 1H9AA 4B6SA 4CR8A 1P9NA 4QOIA 2DRIA 3C8ZA 3NFYA 3EXHB 1Z4OA 2PS1A 4AG5A 5HKKA 1FUIA 1N8NA 3AHGA 2X1VA 1HYGA 1X7WB 1ZWKA 4JCOA 3OIUA 3WVNA 4LKRA 2HK8A 3UAZA 3H2SA 2GOYA 2OCLA 2OWEA 5E38A 4AY3A 3SDZA 1YGYA 3WV5A 3A05A 4FNAA 4E1VA 2K7FA 2AD1A 2QZZA 3FZYA 2IUYA 2P79A 4J2OA 1V1RA 4W9NA 3STYA 2QMZA 4I3GA 3UHOA 1VLHA 2P3LA 4G1EB 5CFRA 3U7IA 1BXRB 3G9ZA 3PC8A 1XLUA 4XRRA 1R4NB 1J09A 1DEKA 4GL2A 1SNYA 1UDXA 2VWPA 4RLQA 2V0GA 3U6KA 4R84A 4DV4B 1E6WA 1PJAA 3BF7A 1PK8A 4I4LA 3HCWA 4W5RA 5JI3E 3GEMA 2IE0A 4PCLA 1YBAA 3A1NA 1Y8CA 4K9OA 4HQ0A 1NOKA 2FSPA 4L5CA 2P6OA 4N3BA 2XDWA 3SS8A 1G2QA 1E2QA 3M82A 3FMIA 5EC8A 2X0NA 4DA7A 1Y5MA 4ZU3A 4EHIA 4FYIA 1L1FA 2O8FA 1SD5A 2Y1GA 3KTFA 1B8OA 3KYBA 4OHUA 2ACVA 4Z3DA 5A7HA 2OPHA 1KMIY 4BMVA 2ZJ0A 1B0PA 3KQKA 2IUFA 4N9WA 2FUEA 5FNVB 3VISA 4ZN6A 5JH7F 5AHWA 5EJ7A 4GVPA 4U3JB 6Q21A 2ZXFA 2CK3A 3DL7A 2GVDC 2QVBA 4IIJF 3I76A 4RHYA 1RKBA 5ELMA 2WB2A 4OM8A 5HMMA 4G1MB 3O0DA 4BV8A 1MVLA 3LNTA 1JEQA 2V9ZA 3B1JA 3D7NA 1MZVA 3V8PA 5KQRA 3WTBA 5FI5A 1H8HD 3OHSX 1KAGA 4EGSA 1FYDA 2VK8A 1P19A 2D1FA 3JWEA 3I9KA 2HF2A 4EPTA 1ZA2A 3YASA 1XMIA 4OKIA 4RKRA 2BDUA 1NQWA 4LX8A 2Q2QA 1YA8A 4UOEA 1TO6A 1WG8A 4JOBA 1ZJJA 1GFZA 1M6VB 3C7KA 4LF8B 4Q9KA 4E5PA 4NG5A 1M6HA 2B98A 2WTBA 2MSCB 1JIQA 4FZ3A 4GLFA 4I9HA 2CMGA 3LCUA 4BASA 4DC0A 4ZT5A 4RMNA 2JNWA 5JE8A 1W36C 5EY5B 3WIVA 5AVSA 3THYB 3OQJA 4C6HA 3NR2A 2PUEA 3LXUX 5AWFC 3ZCVA 3T7SA 4M8NE 5AIAA 2F4VB 1GZ3A 4BEWA 1JVSA 2GFIA 3RS5A 3RAFC 1SQ5A 1UOPA 2GPWA 3RREA 5FNVA 5J1TB 1KI6A 2A0YA 3GMIA 3GXOA 3KCQA 3SEAA 3T9CA 1SBQA 4NAHA 3UC9A 4DYVA 5B1HA 4YIHA 5JXWA 2V7WA 3AEZA 3C7AA 1UK9A 1VLJA 3PU6A 1KVSA 2BWJA 4UHEA 1XC7A 4JSYA 5AO9A 1Q15A 1U7PA 1LEHA 2AOUB 2QRHA 2Y1FA 3NKVA 3NIFB 3MOSA 4UNNA 3LS2A 3V1YA 1VB5A 1K4KA 2D7CA 3PUVA 4C5CA 4UASA 1SVIA 1FTYA 2CBGA 2SCUB 4PG4A 4RVUA 5ESWA 1WXFA 1RXSA 2BE9A 1F8FA 3KHSA 1PBTA 3QUCA 4HYYA 4I4CA 4IGEA 2M6KA 3V4LA 3HJFA 2R48A 2YQZA 4WXRA 2VP6A 3ZH2A 4QKQA 1J0EA 3DE2X 1QTIA 4J91A 2I4LA 3VJKA 4RTLA 3FI0A 1D04A 4O4IB 2ZIXB 3D6HA 2WKPA 3UHPA 1U4OA 4QPJC 4OATA 5EAIA 1JVBA 5HJ5A 4QT0A 2XLBA 3H5TA 5CVEA 4HNTA 4HFJA 4A0FA 1SGWA 1E69A 3HKBB 4YJKA 2B5VA 1QFYA 1XQVA 3PQ7A 1XZQA 4OHYA 2VCYA 1KI1A 5IM4F 2YWJA 5TNXA 3QHQA 4MV7A 4YCAA 3UB3A 5FWNA 4P38A 1LRKA 2NUAA 4J03A 1E2KA 1K8ZB 2HA0A 4EB6B 5KUTA 4DUYB 5EP2A 1WW3A 3U4AA 4CV0A 1G1AA 1NI3A 1RWXA 8LDHA 1J0AA 2QJRA 1C1DA 3CRW1 5AHRA 4X8HA 1QX4A 2ZVJA 3EAQA 2QVLA 3ETLA 3NHBA 4G9EA 2R6HA 4MMYB 1XZCA 5CT9A 3W2TA 2Q2VA 2FE4A 1Q74A 3M6AA 1CETA 1HL7A 2CXUA 2NYUA 2ANBA 2IYYA 4FN4A 5GONB 5BWLA 5IAOA 4QTUB 1CZHA 4CT0A 3N8KA 4FKZA 3PJDA 3IVCA 3ETEA 4X7BA 4ZVPA 1FXSA 1RQGA 3JQEA 3P8ZA 5TMDA 1VL6A 2GBGA 1FCJA 3V4FA 5CBKA 1MRZA 2O2JA 3D6MA 3HO1A 4LXIA 4TXJA 4WFIA 3D3QA 1HGXA 1LNQA 3JQAA 1DARA 1G3UA 1UXIA 2PRYA 2ZIXA 3CINA 4LQDA 4V0RA 4A27A 5LUAA 1Z6ZA 2AK3A 2O9JA 2B8WA 4XE5A 1VCOA 2DSNA 5FUBA 3ZGLA 2O2HA 3FBTA 1H4VB 4HRYA 1DFHA 3HKBA 3Q9LA 3GCZA 4FUQA 4AAYA 1GEEA 1OHHA 2PNJA 1L3BA 2AUMA 4RPHA 4FKMA 3UK1A 1FYVA 2NV2B 4JA2A 3D0KA 1GKIA 4OXYA 4XZ3A 1ULZA 3SZUA 4EB6A 4B2YA 2DH5A 3AP3A 5EINA 4DM3A 3EPHA 2XWQA 5AHOA 3OJCA 3UMCA 4FWBA 1Z5WA 1V7PC 3NBMA 2C1ZA 2ORYA 2W2VA 2ZQ5A 4GO1A 2EXXA 1EP2B 1X1CA 3Q7EA 3WMFA 3IAXA 1HQCA 3HY4A 4MDHA 4RW0A 3E7XA 4MVJD 1EVIA 1PNOA 4D80A 1JA9A 1UBRS 1E3WA 2FQQA 4LCBA 3D4BA 4F5YA 3Q1KA 1E2MA 5B58C 5JS8A 3LTEA 1JJ7A 4QUEA 4Z2YA 4B6EA 3FCXA 4I6GA 1U81A 3VR6D 4B33A 4AN1A 1ACLA 4PWYA 2E48A 4TXNA 2NM0A 3U40A 4BV3A 2BH2A 2O7RA 2QYOA 1JT2A 1X1AA 5ALHA 3C3YA 4XIFA 3QV1A 1U8ZA 2WMDA 2X5XA 3K3PA 5EUCA 4MUKA 3PE4A 2GM3A 3ZQKA 4GIBA 1G8MA 1L7MA 1CQZA 1K92A 4AROA 4OQZA 2QJOA 3A9CA 4TGLA 3WSVA 2GD0A 1YOVA 4YXFA 3W3AD 1PS0A 1EVLA 2PLFA 1SH7A 4LXUA 1L9XA 3WGYA 4CKZA 1QG4A 1WTAA 4J94A 1CVIA 4NCXA 1GUYA 3KFXA 1SHJA 4BV9A 4MP6A 3FOFC 1WCWA 1GD1O 1O95C 2VPTA 2WR8A 3DZ8A 4MDYA 4S04A 3WL7A 3EISA 1QRDA 3PEUA 2AS0A 2ZRBA 1L7NA 2YV1A 3D3KA 5DH9A 3RFUA 1H2HA 3A7DA 4BRWA 5BP7A 2I8LA 4I81A 4E1AA 5FBRB 1YS2X 4J9UE 5H80A 1G0OA 3G2MA 3L0DA 4RX1A 2J6BA 1DSSG 2FR0A 3K0FB 4GR5A 9LDBA 2PXAA 3IPAA 3WIUA 621PA 4C7VA 5HE9A 2XXJA 3D7SA 1RYNA 3STHA 4DLPA 1Z6QA 3TIGA 1U0LA 2QT1A 3ZTWA 1REQB 3FDFA 3UAGA 1YDEA 3SKYA 2WUWE 4MV6A 3H8WA 4TLMB 2P11A 1CT9A 4R1UA 4DC1A 4KGXA 1RIIA 3JATB 3K70D 2YWGA 3FZNA 2UZ4A 1YRWA 5IUJC 4BKMA 3ILYA 2DPXA 3CGWA 2ID7A 3ELBA 2DYKA 4X1IA 1I2ZA 1TK2A 4M3NA 2XBLA 2CHFA 3AUXA 1OPXA 1ZZGA 2AJCA 4KP7A 1RRPA 3V32A 5FYDA 1BU8A 1JBKA 2Z57A 3AVOA 4NECA 3VC7A 3QVSA 3KWFA 4D8TA 1JX6A 1KSHA 4IXTA 2CDNA 1ZGZA 3GT4A 1YKSA 1NQTA 2NZXA 1TQ2A 4PZLA 4Q12A 1A7JA 1L9KA 2I7XA 3D31A 4G0MA 4CQLB 4ERXA 1JS1X 5EJ5A 1INLA 5I48A 5JEDA 1A9OA 1WTCA 3QOWA 3SIRA 2OZKA 1JIUA 1GR1A 4HBGA 3FVRA 3AKCA 2FSIA 4X63A 1OA1A 1GL7A 2A78A 2EP5A 2HLDA 3Q8XB 3QHPA 3MTDA 2V5VA 5K4AA 1XTZA 1Y9DA 1ACMA 4EY4A 2XUDA 4HQNA 3W9YA 5BSKA 2YZ7A 2J08A 4YS6A 3SZMA 2OORA 4FVTA 4YJFB 3M34A 5GVSA 1NKSA 5EJ2A 3BWXA 3CT6A 3Q88A 3VAZA 1E4EA 4HVLA 3NUQA 3UXYA 4PVDA 1N6KA 1ZOLA 3NHPA 2OBYA 4R8VA 3UN1A 1YRYE 1REQA 2DM6A 5JI2E 2QLMA 2PX8A 3U3XA 3VH2A 4BJ6A 1K66A 1V1MB 2QPOA 2CLMB 2C7PA 3A4MA 1G3RA 3HFRA 3DL0A 4OOFA 3BUSA 1SBZA 2V03A 2E3JA 1VLVA 5ICFA 3B60A 3R0JA 2BKLA 3WWDA 3OOHA 3WZMA 4NIMA 1EGQA 2YWDA 4HN9A 2ADMA 4BWFB 3E5MA 1L8OA 2PMFA 2Z5LA 1K6EA 1LK5A 5DGDA 3CGGA 5D1NA 1SUDA 1GEGA 2PU7A 2QMUA 2C29D 3T3IA 4CQLA 4KVZA 5K6RA 4UNIA 1J8MF 1TYBE 2J9RA 4PU0A 2H7XA 4D81A 4QC2A 1QYXA 1SVWA 2X76A 3K0EA 1GPUA 3EE6A 1GQFA 1U2GA 2YCBA 4HWRA 3Q5GA 1X7GA 1N9GB 2CJPA 2XB9A 3B1VA 2PH3A 4GM0A 1P5RA 3P9RA 5EOVA 3VAAA 1GQQA 3QXSA 1JLLB 1KI8A 3KYCB 5FI1B 2I6GA 3FKSD 5BN3B 1EFPA 1HKHA 5CJPA 4P54A 3IA2A 2YS6A 5GWXA 4ZYLA 2RGGA 4PZ9A 1FTQA 1S3IA 4K9PA 5IASA 2HWUA 3L6OO 4US2R 4RK4A 2OFWA 3FCUB 1AQNA 3MWEB 4IEFB 4MUEA 4BEVA 4E2ZA 2Y93A 3LY9A 3IIJA 1WF6A 5G0SA 4HQLA 3QW2A 4ISBA 1EDDA 2RAPA 2NXNA 4TLLB 4MQLA 2PZLA 1G9XA 1Q0TA 3U3OA 4EG5A 2V3WA 2G77B 3LECA 4IIFA 1Z34A 2UVPA 3T3NA 1ISGA 2YW2A 1G7TA 1UXGA 1DX9A 2OXEA 4TM8A 4U39A 4J75A 4FMDB 2P2ZA 4TM7A 5LQKA 1XJWA 5F33A 3TGPA 1WDTA 3WGQ