4HLCA

Sulfonylpiperidines as novel, antibacterial inhibitors of gram-positive thymidylate kinase (tmk): compound 5
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
202
structure length
195
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Sulfonylpiperidines as novel, antibacterial inhibitors of Gram-positive thymidylate kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 84
structure length 195
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hlcA00
4BEBA 4L15A 4PC2A 3KKPA 1OKKA 5GJBA 1WBDA 1IY1A 1G3MA 4AC9A 1KY2A 1XCPA 2ZSAA 4GDFA 1L8QA 2V4ZA 1Z0KA 1OYWA 1ZC3A 2ZRJA 5KPJA 2CEAA 2P6NA 1G20E 2FEOA 2TMKA 4HAVA 2PCLA 4BFTA 4LBWA 4CRWB 4MYUA 4AI6A 3SC3A 2RH5A 1P73A 1ZINA 4DLSA 2FSFA 3L8YA 3L0OA 3WRXC 3BORA 4Q7KA 1UKEA 2OT3B 5FOVA 4OK5A 2W2VA 1X6VA 1VYUA 2C9OA 4TYNA 4NCJA 1ETUA 4NCHA 2IXEA 4KVAA 3U4QB 2AXPA 2IW3A 1E4YA 3LA6A 4HLCA 1JBKA 5KNBA 3THWA 1VYTA 5LBIA 1MABB 1EWQA 1QHXA 3K9GA 1SKYB 2VF7A 3SZRA 2GCPA 3SI7A 2QU8A 2J87A 2CLSA 2DWOA 4N0EA 5DH9A 1FX0B 2HF8A 1YZTA 3GLIE 5JEEA 2F43B 5DE3A 4E07A 1CRPA 3VQTA 5DISB 4PANA 3Q5EA 2OFWA 3AVWA 4FWIB 1MRNA 2WKQA 2V9PA 2OHFA 1KMHA 3WNBA 2IK8A 1OB2A 1P9WA 2C78A 2I1VB 4Q02A 3TBKA 1TNDA 4JSTA 4ZIRA 4RZ2A 3QNUA 5L8VA 4M8NE 4AKGA 1ONBA 4R98A 1L2TA 5JJLA 3SBEA 3W8RA 4G3XA 4PC3A 3T15A 3R8FA 4Q01A 3THYA 4JLOA 1R4AA 4L9WA 4KJZA 4JLDA 1MR3F 2CJWA 2ZJBA 3EIEA 2ZVQX 1TU3A 1E2PA 2EFEB 2QTHA 1QHIA 2FSIA 4P4SA 3W8NA 1EFUA 5E4FA 3CKLA 2QSYA 2IX3A 3B7GA 1H8HD 4JLVA 4QHSA 1TQ2A 1M1YE 3KFXA 5KHOC 4RD3A 5JEDA 3QXXA 2OXRA 4LDJA 1FTSA 4TMTA 5FFMA 2VL7A 1EXMA 1GP2A 4XVQA 5FUXA 2WWHA 1R7RA 4KLNA 1M34E 1N0VC 4DT1A 1B23P 1HE8B 2G1JA 2O8BB 4KHZA 2CCGA 2NTYC 3WHKA 2X2EA 3IQXA 3MFYA 2BJVA 4NU0A 3TQCA 5BXQC 2P2LA 1GL6A 2W58A 3H84A 2ZRIA 4WVFA 4W9MC 3M6AA 1UDWA 2WSSD 4Q1CA 3EPJA 2PH1A 2C03A 3ADBA 4BFSA 4TMKA 3KQNA 3I4LA 3WY9A 3OEED 1LF5A 2CNWA 4PX9A 1NN0A 2B8WA 1CJMA 2J3EA 4GNKA 4EPWA 1E79D 3T1VA 2GCNA 3QXSA 4FCTA 3KXLA 4XWAA 3U3JA 3EPKA 1J7KA 1XDBA 4NONA 2P6RA 1JECA 1ZC4A 5FTKA 2HXYA 4QRHA 4BLPA 4UNNA 1D2MA 3KUDA 4ZDJA 2IYYA 5AR1A 3K0SA 2FMXA 3U7EB 5FL3A 3ZD6A 3CRMA 2WJIA 4JZKA 1JNYA 2QZ4A 2ZAOA 2ASEA 3DPUA 1W49A 3G82C 4M1WA 1HYQA 2REXB 1JPNA 2Z4SA 3DKPA 1JXOA 1FPMA 2BBTA 1MO6A 1Z06A 1EGAA 2JLSA 2ZUBA 4BGDA 3D3QA 1CU1A 2ANCA 5TB5A 3RC3A 2FGJA 5DNYB 3BOSA 1DE0A 3GP8A 1NMZA 4URXR 2VO1A 4AD8A 4LC1A 3CPEA 721PA 4XSHA 2VSOA 1SVOA 2CL0X 2YOFA 4H9GA 1P3JA 5J4LA 1IM2A 3BK7A 3A1TA 1CF4A 2QY9A 1X3SA 3HPRA 4DCSA 4OJKA 5H1YA 3PXGA 3ZS9A 4EJSC 1DBSA 2WWFA 1Z28A 4LWZA 1CR0A 1DPFA 3CNOA 5A5GA 4B3GA 4KBGA 3OEHD 5KSPA 1CLUA 1SVSA 3ND8A 1C1YA 2XB2A 3UXMA 2YV5A 1VG8A 5HCIA 1RJ9A 2G83A 3EZ2A 4FW9A 5IDVA 2RKOA 3W9YA 3T35A 2BBSA 3KJGA 2FPKA 4ZDKA 5KSYA 3UWOA 1OF1A 1RIFA 4B44A 1J8MF 4CVNA 1G1MA 5TMPA 1T3LA 4I1VA 4QL3A 5J4VA 3B1YA 4MITA 2P3SA 2RHDA 1T6NA 4ZDIA 1NJGA 3RYTC 1NBMD 1AKYA 2WOOA 1N6OA 4M4SA 3T1TA 2ZITA 2XXAA 2C5LA 5FR1A 2OFOA 3KJHA 3NTUA 3CX6A 1P62B 2D2FA 2CK3A 4BZQA 1DAMA 1SHKA 2XZLA 2YVUA 1KZGB 1E3MA 2FFAA 3L2OB 2GJAA 4MGYR 1AS2A 4DVGA 1NBME 1ZVQA 3EWSA 2BWJA 1E1RD 1R5BA 2F6RA 2R6DA 4PAQA 4UNQA 2QNRA 3O47A 1Z22A 4B6EA 4ERNA 4DLRA 1J8YF 2OESA 1ZRHA 3FHOA 3HR7A 4DEXA 5BYKA 1R6BX 5TV2A 1UFQA 5SZJA 1GNQA 3KXKA 1NVXQ 4QJ5A 1Q22A 1Q1ZA 4TT3D 4UQOA 3W6PA 2Q3HA 2W0MA 1QG2A 4KSBA 2PZEA 3IIKA 3QKSA 4D4KA 2IEZA 1A5TA 1SGWA 1UKYA 4ACAA 4HI0E 5FPTA 4L8GA 5EUMA 4DUGA 1AK2A 2IEYA 3REGA 1J90A 4V0ME 5BWMA 1RW4A 2C98A 1T3SA 2VP2A 4OQLA 1XZQA 1VHTA 2IS2A 1QDEA 4P31A 2VA8A 4D80A 1R8SA 2Q9AA 3DMDA 2ZS9A 1AS3A 1SVLA 2D7CA 2OLKA 1NVVR 3T1OA 3UWKA 2BHRA 2P5SA 4IW3B 2EFCB 3L0SA 3DDCA 3NVAA 3P26A 4M1TA 2QI9C 2FNAA 2Z43A 2YOGA 1PVOA 2ONKA 5FOSA 1H8EA 3RS3A 1G8PA 4FD2A 4JL6A 5TDHA 4LJ9A 2GZHA 4I99A 1GWNA 1E2IA 2RCNA 4TTQA 2WBLC 2K5UA 2DWQA 2WWIA 2LKDA 3CM0A 3MG9A 5EXSA 3BB3A 3LW8A 4QBGB 3EPLA 1FW6A 2O8FA 1WF3A 1JAIA 4AURA 2LKCA 1UAAA 4US0R 1KI3A 1P2VA 3RS0A 3CF0A 3P4YA 1P2SA 4P4UA 2QAGB 1E6CA 1HQYE 3AP3A 3LLMA 2ZROA 4NZYA 5H70A 4UXHA 2EYUA 4GRAA 1XMVA 5FBRB 2VP5A 3LDAA 1G8FA 3FHCB 8OHMA 4TSFD 3W3AA 2GZDA 1GKIA 1G64A 4BLQA 1NSTA 4FWTA 2SHKA 1G3RA 2LWIA 5EZ6B 4TMVA 1XXHB 1WA5A 5FH9A 2QPTA 5H8WA 1W0JA 2RGEA 1GILA 3C5HA 4C0AC 3JZMA 4KLZA 1R0ZA 1EK0A 1R5NA 4G5OA 2GXAA 1G8GA 3A1UA 3BJIC 3FFAA 4V0LA 3RDPA 1G7TA 3H2YA 1XRJA 3EAQA 1W0KA 2PBRA 3KJIA 5L3SB 4PSKA 3CO5A 4LC0A 4N3NA 4OHZA 4GOXA 1K6MA 3LW7A 4JKYA 4KAXA 4QOSA 2O5VA 3RS5A 1M6NA 4BPBA 1F2TB 2FPMA 4EKDA 1K8RA 1N6RA 4RJLA 1S8FA 1KO4A 2XB4A 4DZZA 2WAYA 4LUCA 3BXZA 2JJ2A 4KCGA 4PHFA 3CLVA 3HWSA 3Q7PA 4YMTA 1QRAA 2F9MA 2B7CA 2FE4A 5J40A 2UZIR 4ABYA 2C2HA 5ANRB 5F9FA 5KO2A 1MH1A 2GHIA 3UMSA 4G5RA 1J99A 2QUZA 2JDIA 5FBWB 1KDRA 3MCAA 1S2MA 3KTAB 1W5SA 2F1JA 5L3QA 2AK2A 4MDEA 2YHSA 2V8OA 3M1IA 2OG2A 4MUBA 3VAAA 2C77A 4C7OB 4TQ9A 2ZJ8A 1XX6A 3AP1A 4TZ0A 4ZI3A 3QEOA 2ZI9A 1TQDA 2XTMA 3VR3A 4BLRA 4PAOA 1R5OA 2P5TB 2VSXA 1YQTA 3AGPA 2I4IA 3TR5A 1KDTA 4A0FA 3TE6A 2HLDA 3OIUA 4GFDA 1E98A 4NMMA 5KU1A 3FOZA 4O25A 4CDGA 3BERA 2QEQA 4FMCF 5DI3B 1E2NA 2ORWA 4C0SA 3W6NA 1KAGA 1W4BA 5P21A 1D9ZA 1ZM7A 4TYQA 1DAGA 2W0SA 2DR3A 1E0AA 2XZOA 4IRUB 4LV6A 3U3OA 2XEXA 1K5GA 3ADDA 4BFYA 1WMSA 5DN6A 1COWD 2KSQA 3CR8A 1A2BA 1E1QD 1N0WA 2BEJA 3TVDA 1OPXA 3EWAA 1XTIA 1SVMA 1XD9A 2F9LA 3GJ7A 1BKDR 1XEXB 3GJ0A 1ZUIA 4DJTA 3GLFA 2ODNA 1KZ7B 3MLEA 4PZZA 1S1CA 3TW8B 4EJSA 4X8OA 1KO5A 4HUQA 3IUYA 1UBCA 4D26A 5D3MA 3W6OA 2DY1A 1N2CE 2JA1A 3A1SA 2XOKD 4A8JC 4EPTA 2L0XA 4Q18A 3GEIA 5C4MA 3EZ6A 5HTKA 3WNDA 1XD2B 1OFHA 4D6PA 4YLGA 4AKIA 2H18A 3GLIB 2EQBA 6Q21A 1ZYUA 1KDPA 2H5EA 2YWHA 3KJEA 4UNSA 1NKSA 5DGXA 3ZH9B 3I5YA 1JJVA 2WM9B 4RKFA 2JCSA 2ZRDA 5BN4A 3CX8A 4L4UA 3OE7A 5C2JB 4HB4A 3EZFA 2VTKA 1KKLA 5FUWA 3BH6A 4CGZA 4LY6A 3U4QA 1U90A 2LCFA 3P4XA 1CKEA 2F3RA 2Q3MA 3VNUA 1FP6A 4KV9A 3ZGXA 1BO6A 1G7RA 1MABA 3PUVA 2PZFA 2OBNA 3NXSA 1XMJA 5EXXA 2QMOA 4JBXA 2QMEA 1FX0A 421PA 1ZM2A 2D62A 2F43A 1CR1A 4G0NA 2KBFA 5IHPA 4ASUD 4I81A 1LS6A 2MSEB 2IHBA 3NBYC 1JI0A 1KO1A 1VG1A 3Q72A 4A0HA 2OXCA 1N0UA 3U7FB 4D0NA 2CE2X 1U99A 1LW7A 4JL5A 3UATA 4MRRA 1Z0AA 1OXSC 2F1IA 2ATXA 1GOTA 2QT0A 1OIVA 2DBYA 2QAGC 3V4FA 1P61B 2I3BA 2IL1A 3PCRB 4IVRA 4DWJA 2CHQA 3QXCA 5FPHA 3L8ZA 1GKUB 1OH7A 4E03A 3BFXA 3KB1A 4JYCA 3OAAA 4BFZA 2R8RA 1G5RA 3T34A 2V55B 1GAJA 1ESNA 5G41A 1N5KA 1Q1BA 3SQWA 2DCUA 3DMNA 4O3MA 4LHZA 4Q1AA 1T8UA 4DLVA 5EXPA 1N3BA 3CRRA 3SBDA 3U3MA 3GJ4A 4EIWA 1QHNA 3AVTA 3SQXA 4PO8A 2XITA 3L43A 5DO9A 1V43A 4LYHA 1PUIA 4U00A 4OYHA 1IAQA 3TH5A 2OBLA 1E4VA 1GRRA 1CBUA 3MSXA 3D8BA 4JT4A 2KJQA 1OV4A 4US1R 1IN7A 1Q57A 3U2QA 3IQWA 2QMHA 3WP1B 2B8TA 3NBXX 4GMDA 2O8BA 4URWR 1CR4A 2YKGA 2J9RA 3HYTA 3SHWA 2OZEA 2REOA 3X1XA 2WWWA 2NPIA 4NYJQ 2WKRA 3WXMA 4HB2A 2IYQA 1KKMA 2P67A 5G3ZA 1XPUA 4OHWA 4IOKA 1S4QA 1R2QA 3LAWA 2WMNB 3QE0A 3EASA 3VHLB 2CBZA 3D7MA 1IN4A 3LX5A 3TQFA 3BC1A 2ODEA 4Z8YA 4K8OA 4URYR 4PC7A 1TQ4A 2J59A 3GLHE 4DSTA 1QHSA 1W7AA 2ZAMA 3FKQA 2VP4A 2WOJA 3C16C 3QF7A 1VMAA 3FGNA 4MYHA 3KQHA 3PEUA 1BYUA 1KMQA 4HDCA 4AKEA 2MMCA 3IO5A 4TYPA 4KFTA 1KSFX 2BMJA 3VKWA 2W6IA 4JS0A 1OH8A 2X8AA 2ZRPA 3A58B 1JR6A 4F4JA 4P33A 1Z6YA 3FMPB 5E7JA 3TKLA 4CZ2A 5UKDA 2FDCA 1W4RA 1HH4A 2G1KA 1N25A 2G88A 3AVOA 1Z6XA 2AWOA 2D74A 4KITB 5JMTA 3QXHA 2EU8A 1IY2A 4DDTA 5F3WB 4D25A 1CTQA 1ESMA 2ZI4A 3IDQA 2UKDA 4D4JA 4F4CA 4CEIA 1W47A 2IWHA 1M74A 1Z6AA 1ZD9A 3OZXA 4ZKDA 1FTNA 3K9NA 1KJWA 1Q1QA 1TPZA 1M8PA 4B3XA 3W5IA 3T61A 1UBFA 3OIVA 3AVYA 4OQNA 2QQ0A 2RGBA 1OHHD 3SDZA 2QP9X 2JASA 3VU9A 2P6UA 4WBSA 1OH5A 4URVR 2IS4A 4M1YA 3AKDA 3IHLA 2AD1A 3ZZUA 4NKRA 3U60B 1QHHB 4ON9A 2FA9A 2JIZA 4Q4LA 3KDSE 1S9DA 1IXRC 3BE4A 1MO5A 4CEHB 3TJZA 1AKEA 1SVKA 2QA5A 2QE7D 3OHMA 1YE8A 3C15C 1WRBA 4IJMA 4GT1A 1IXZA 4TLAA 3H1TA 3HU1A 2ZJYA 3AF1A 4QFMA 1R8QA 4I1UA 4DIDA 5G40A 1GL7A 3ZVNA 3QSYA 2JLXA 5DIFA 4US2R 1FMLA 2PX0A 4OQFA 1E9EA 1N5LA 2AFHE 4TMZA 2F3TA 1HUQA 1LVGA 4ESHA 2R6CA 3LFUA 2GK6A 2H7VA 1UKVY 3AB3A 4A8JA 1DAHA 2ZRMA 1T5LA 1YU9A 4IDOA 1F2UB 2CMKA 4IXNA 3GJXC 1W36D 1F60A 5FPKA 3K09A 1N6LA 1QF9A 2PT5A 4HSEA 4BZXA 1G8YA 3OFND 2Q3FA 1SHZA 3Q7QA 4DDWA 2KI5A 2MSDB 2ZQ5A 1KO8A 4DB4A 2A7QA 2NZ8A 3PUYA 4OJQA 3ASYA 1XMIA 1KI2A 2GAOA 3HU2A 1XTQA 3ONWA 3TSZA 4NYMQ 4QM6A 3RS7A 2XAUA 1TUEA 1PLJA 3SS8A 2QG6A 2H1LA 2FFQA 2WWYA 1M7BA 4HYYA 4M1SA 2ZR7A 4Q66C 2J41A 2NMVA 2BKUA 1D6JA 1I2DA 2ORIA 4B3DA 621PA 3K8YA 1ZM4A 4UXIA 2OCPA 4M9ZA 2EFHB 3PG5A 3B9PA 1XEWX 4A6XA 3ZZ0A 1ZM9A 2XSZA 5JS7A 4KBFA 4A82A 2GNOA 2YYZA 2GWHA 3SHFA 1BIFA 3O8BA 3DOFA 3VFDA 3GFTA 1DAKA 3THOA 3B6EA 3A4LA 5EP2A 1JAHA 5CYOA 3QENA 1Q3HA 3T1QA 3IEUA 4JLAA 2A3RA 2WIAA 3VR5A 2FG5A 3U44B 4D0GA 4BRUA 3R9WA 1TF2A 2IYSA 4IDQA 5GJWC 2QAGA 1PV4A 2WKPA 5EP3A 3PENA 1SZPA 3TAHA 1JALA 1NIJA 1OJLA 3A8TA 2J0UB 4PR0A 3TAUA 2ODBA 4YMVA 2O0KA 2FZ4A 2ZRBA 3DL0A 4MRNA 4OL0A 4AG6A 1XTJA 4MKIA 4YDHB 4KYIB 1UADA 3C41J 2ZJ5A 2REBA 1EWRA 4CT5A 2IYZA 3NWJA 5KSZA 1BMFA 4PC6A 4HB3A 2JJ8A 4JVSB 1KYIA 3UIEA 1CS4C 1XF9A 1DG1G 2ERXA 4B47A 2XNDA 3QG5A 1NN5A 4PTLA 1J70A 1PUJA 4QGGA 1NP6A 1KK1A 1Z08A 3CWQA 4V0KA 1U81A 1T4GA 4TQUS 1VYVA 4JVLA 3RANA 1E2EA 4ARZA 1US8B 1M2OB 3C8UA 1F2TA 2B92A 3B5JA 4Q47A 2OM2A 4LYJA 5EUQB 3FKSA 1OXXK 4A9AA 1EFRD 5C18A 3CF2A 1E99A 3D6TB 2DPXA 1QBKC 2C8VA 4JBYA 3KQLA 3SYLA 2GEVA 2W00A 4TQAA 4DDVA 4PSAA 2C95A 1I4DD 5BQ5A 4D82A 1G16A 3R8CA 2ATVA 2BC9A 2GA8A 4M9SA 1Z5ZA 2PEZA 4U5XA 1SXJD 3QG1A 2W6JA 1DELA 4GOJA 3KTAA 2AK3A 1HEIA 2B7BA 5EE3A 4NDZA 1M7HA 4B3CA 3OIYA 4R2HA 2JLQA 4C7OA 1G9XA 2F1RA 4M0LA 4NYIQ 4BFVA 2GXQA 3R9IA 3RRMA 2C9CA 5J47A 4HLUA 4RFSA 2QBYB 2Z83A 4RKEA 1YHNA 4O2RA 2R65A 4UJ3A 3HJNA 3R20A 4Q5IA 1WDTA 2OEPA 3DO6A 4BLTA 4DEYA 1F48A 2ODWA 4V03A 4B2PA 1SXJE 1A2KC 3ICEA 3BH7A 1N6PA 3IKJA 3QVVA 1JQJC 1YJ5A 5DI3A 1MO3A 2NO0A 1XPOA 3TLXA 5HKKA 1BOFA 3S1AB 5FUYA 4TYWA 2FFBA 2QM8A 3QJYA 4A2PA 4GZMA 2XJ4A 3C14C 4OHYA 1FZQA 1RRGA 2J46A 2BV3A 2V7QD 3K0AB 5HZHA 1Q20A 3REFA 3AUYA 3EXAA 1DAFA 1VCOA 4C0LA 2HCBA 2Z0MA 1U0HC 5TARA 5J4KA 2GJSA 1VCIA 4NHOA 4TLDA 2RGNC 1XEXA 1TU4A 2CLCX 1OFTA 5JWOA 4A0GA 4XD7D 1RVDA 4A36A 4AIIA 5TVKA 4LYAA 2ANBA 1EX7A 3LQQA 3NC0C 3SJCA 2Z6VA 5JJKA 3QF4A 4C30A 3FHTA 1KNXA 3WYAA 4Q7LA 3KX2A 3SJBA 1XD2A 3ZQJA 1ZM3A 4YMSA 3L82B 1P60A 4P0TA 1G7CA 5FTJA 5C4GB 1KI4A 1S3SA 1G6HA 5TY0A 1G19A 1NJFA 3TGPA 1U98A 3U6BA 1NN3A 2XZPA 2AL7A 1Z0IA 2WHXA 2DFLA 2OFXA 1P2UA 2IA5A 1XEWY 4LJ5A 2JLYA 4BECA 3PEWA 5K8LA 2R44A 1Z3IX 2C96A 4DHEA 2JJ1D 4XH9B 1GITA 2IYXA 2AX4A 3FE2A 3IGFA 5DYGA 3EA5A 5FBVB 4NPHA 4DLYA 3WBKA 1YVDA 3AVXA 3BB1A 2FJUA 3IBGA 1YRAA 1MRSA 2AD5A 1T5IA 1KSGA 3WYFA 5SZHB 1W46A 3ETLA 3EPHA 1OSNA 4S35A 4QHTA 3O8CA 1D8TA 1GTVA 2VP0A 5J4YA 1TEVA 3BFVA 1PLKA 2N42A 5B57C 1ZJ6A 2H57A 2QPAA 4V0OA 2VBCA 1N6NA 4R2IA 4S2EA 5HE8A 2A5JA 2Q9BA 5BN3A 2AWNA 2NIPA 1GDDA 2Y8EA 3IIMA 3OESA 3RRZA 4ZO4A 2ZI7A 3H0KA 3NEYA 4YXWD 4Q1DA 5J4HA 1H8HA 1TL7C 2CVFA 1KO7A 1TX4B 3EC2A 1FNMA 1KI6A 4LBVA 3R7WB 3BS4A 5FTMA 3VMFA 1FNNA 3X1YA 3KKQA 4YDSA 3CIOA 4JT2A 4PSVA 3LD9A 3AVQA 2O52A 4Z1MD 3O8RA 4JVNA 5CB8A 2AKYA 2G6BA 4KU4A 2CDNA 1Q21A 1Z2CA 1XFAA 4WZBE 4LI0A 3LY5A 3TNFA 1FQKA 2Q0HA 3GLHB 2IS6A 2ZYWX 2VP9A 4Q1FA 4W5JA 2GK7A 4KODA 5JSZA 4ITRC 3GPLA 5JCZA 3CRQA 1QVAA 3RSLA 4OBEA 2WSSA 2VHTA 3VR2A 4UJ5A 4C3ZA 2FPLA 4EPXA 3OEEA 2XTNA 2GESA 1P6XA 2VLIA 2FU5C 5CB6A 2C04A 2WMOB 1NLZA 5GJCA 1DG3A 4Q4JB 2A78A 1KY3A 2VEDA 2X77A 4B2IA 1E79A 1XJCA 3B1XA 1XP8A 1HE1C 3QQ5A 5JZVA 2FX3A 3ZIAD 1XTSA 3SEAA 2RB4A 3HPQA 3HU3A 3D31A 5AJYA 5FI0B 2H16A 1MKYA 2E9SA 4LV5B 4E09A 4C2TA 3QKTA 3JZAA 2ZE7A 4RZXA 4KFUA 4Q9IA 4B76A 2IYVA 4M1OA 2BMEA 1Y63A 2QSZA 4M9QA 2GDJA 4RD6A 2MSCB 5D3QA 2GXUA 3B1WA 3IHWA 4RFVA 4LHXA 3B1ZA 4DC9A 3EA0A 4BFUA 3LBHA 1L4UA 3PEVA 4BASA 4EAQA 3GEEA 1DO2A 3KKNA 1Z83A 1JR3A 2WV9A 1P7CA 1AIPA 3KXIA 4G5GA 3MUFA 1OH6A 1VECA 1KSJA 3DM9B 4G1UC 2FF7A 3QXJA 4I1OA 3ADCA 3C5CA 1KK2A 3LVQE 3MJHA 5CM9C 2J7PD 3LVRE 3NHAA 3OEHA 1X8JA 5FTLA 3I92A 4LBYA 4Q4AB 3GLGE 1QHGA 1E9AA 4W5HA 3MWJA 2ECKA 1W2HA 1QG4A 1HV8A 2ZRFA 1E9CA 4LOAA 1XJQA 2Q9CA 2QL6A 1P9NA 2BVNA 3HP1A 2OILA 4A2QA 4CEJB 3EZ7A 1UPTA 4QBFA 3Q5DA 3RSOA 5FL7D 1ZIPA 4R7ZA 5FPSA 5IK2D 3B8HA 1C4OA 3FMOB 1FQJA 1E2MA 2ZRCA 2N1BA 1NBMA 1QHHA 2DHRA 3NKVA 1CXZA 4QBIA 2FSGA 1KIMA 2GVDC 3CZPA 3FFBA 4DKXA 4JMPA 2R62A 4A0RA 2HV8A 1R0WA 1E32A 2QTVB 2V54A 3DHWC 1TF7A 1NRJB 1G5PA 2C9YA 3LWNA 1X8LA 2HJGA 4NP6A 1C9KA 2J7KA 2EYQA 4PAMA 3RWOA 1E1RA 4MRSA 3T5DA 1XNJA 2GEUA 5A0FA 2ZSDA 3I1FA 3RVBA 2RGNA 4G5QA 1W36B 2WSMA 3ND9A 1NMXA 2ZI6A 3QBTA 5CDFA 4Y0VA 2VHCA 4TN1A 4V0MA 3NBFA 2GJKA 3QPUA 4DLWA 1IJFA 1AZSC 1E2DA 4BLOA 2NPFA 4ZPXA 4Q9LA 4TT3A 3IO3A 3CH5A 1KHTA 4OQMA 3K09C 1XU4A 4P32A 3ZJYA 4DRZA 1UM8A 2KWIA 3GCGA 3JVUA 1F2UA 2NG1A 3CRVA 3B78A 2H92A 3FTQA 5C1BA 2R9VA 3X1ZA 3LBIA 1DS6A 3I62A 1TUIA 4M2LA 3CNNA 4M1MA 4LJ4A 4QGHA 2QRZA 2A5DA 5LDDC 4CF7A 3EIHA 3F8TA 4C0BA 2ZE6A 2AFIE 3SR0A 1O87A 4IOLA 4JLBA 1GFIA 3L0PA 3WMEA 5B58C 2O8DB 1Z0FA 4AYXA 4XTRA 1TMKA 4UKDA 5DI9A 4YONB 2WJJA 3QVUA 1X86B 3AKYA 2BBWA 4C0KA 2HJVA 1CJKC 5LD2B 4DCVA 2RGAA 2EWVA 2VSFA 2XXAB 2A5GA 2XJ9A 1E96A 4NH0A 1E2FA 2OAQ1 4FCWA 3DM5A 1NNEA 4BE7B 4MQBA 1S1MA 1YR8A 3KL4A 3AH8A 3QUSA 4NYIR 4GZLA 4HAXA 3AKCA 2QRNA 4C0QC 3ZVLA 3DEFA 3C7KA 4RCYA 4KYUA 1N6IA 4JLJA 1TADA 4TSFA 2BMFA 2PLRA 3KZ1E 4NE2A 4EPYA 1CR2A 2V1UA 1Q44A 2OCYC 1AJEA 1U8YA 1D2NA 2D3WA 2DYKA 4QC2A 2B6HA 4DSUA 4EFNA 4XVUA 3U44A 2OCAA 1OKKD 4B2LA 2VP6A 1KJYA 5GADl 5FBLB 1G21E 1XPRA 2J0UA 5JCPA 4FCVA 4DIEA 3BIFA 3RHFA 4GMXA 3VKGA 3AM1A 2GVZC 3AV0B 4TLEA 3G0HA 4IVQA 1DEKA 2HDNB 1XTKA 2A9KA 4L16A 2VQSA 4AYWA 4HUTA 3FPAA 1LB1B 3Q85A 4XJXA 1AS0A 4XOIA 2JLVA 3MJRA 2V3CC 2Q21A 3FB4A 2A5YB 5EE1A 3NDPA 4EPVA 1R0YA 1Z0JA 1US8A 4F92B 3ASZA 4HEJA 1P75A 4OI4A 2ZJOA 4RSGA 1S9HA 1SXJB 3BFKA 3FMFA 1G3QA 2N46A 4IDPA 4KFRA 4LSGA 4LCBA 4F7WA 3A37A 2WTUA 2EFGA 3GD7A 4TL6A 2VH5R 4R9UC 1LS1A 1RPZA 4B43A 2JLRA 3HYRA 1UKZA 1ZCAA 5JHHB 1P9RA 2ZPTX 5BN5A 5IRCD 3U7HB 3UMFA 2IS1A 1NI3A 1OB5A 2O8CB 4EPRA 4A4DA 2WPDA 5JHGB 2KE5A 4B73A 1KJZA 1VPLA 3KQUA 1N5IA 2ZEJA 2ZREA 4PZYA 4HLUC 4FN5A 4KVGA 3K70D 5EZ5A 1HTWA 4YMWA 4AG5A 4L9SA 2IYTA 5DSZA 5KDLA 1W5TA 3HDTA 4RY2A 2IBMA 5GVSA 1W1WA 3E70C 4B6FA 3LXXA 3HR8A 5CIWA 2V1XA 2ZRKA 1COWA 3AF0A 4J0QA 4MYCA 1TQ6A 3ZQ6A 1E1QA 1EX6A 1A1VA 4E5UA 4RD1A 2O0HA 2QGNA 5ELXA 1HY3A 1JXMA 5AUNB 5B64A 1R0XA 3VX3A 4OK6A 3IEVA 1OFIA 4C0HA 5JECA 3I5XA 4PQRA 3THXB 3MWKA 2ZRLA 4JLMA 5K8IA 4WAUA 1GUAA 1VCMA 2GXSA 3K0AA 4M21A 5B30A 2DFNA 2GF0A 2D06A 2XOKA 3TMKA 3AGQA 1YZLA 2ORVA 4IDHA 4GP6A 1U2RA 5CLQA 1L4YA 2VF8A 3P27A 4QBHA 3PUWA 5KDDA 2ZIAA 4HDOB 4TZ6A 1DO0A 1FUKA 2QGZA 1UBEA 3V00A 1NVVQ 3WMFA 3QKRB 4UNRA 2G9NA 1CIPA 1ZU5A 2HYDA 4TL7A 5L3QB 1PZNA 1G41A 4LPSA 1NLFA 5B2ZA 1U0JA 2WAXA 4MGKR 3UMRA 3PV0A 5CLLA 4QM7A 1NY5A 1EESA 3WYGA 1R10A 4JLKA 3A4NA 4V02A 5JJIA 2CNWD 1H65A 1NF3A 2W6JD 1G17A 2JAQA 3M0EA 4HLDA 4FINA 1IHUA 2AR7A 4GL2A 3X2SA 3WBJA 2ZTSA 1E94E 3ZZTA 2I1QA 5SZKB 2FV8A 2G0NA 3MWLA 3ZLJA 1XCMA 5DYIA 4L5BA 2QMUA 1NN1A 2JATA 3I32A 1Z6TA 2BOVA 2D4HA 2XGJA 4O0MA 3RS4A 3PQCA 1E0KA 3GEHA 4ASUA 4LBZA 4HAYA 4D81A 1YZUA 3EC1A 3TVTA 3UKDA 3FWYA 1DAIA 2F7SA 2ZXUA 1UDXA 2PMDA 3CZQA 4JJZA 4DDUA 4IEEA 4LPKA 4A15A 2IF0A 1F5NA 1G291 4IEIA 3WMGA 4B48A 1Z2AA 2ZETA 3TUZC 1UEIA 1NVUQ 4LZZA 4XSGA 1I4TD 4OQXA 3SFZA 5E3HA 4DBLC 2QTFA 4N0DA 1QZXA 5CIQA 4KFSA 3GJ3A 2QP4A 3I61A 1JB1A 1N6KA 1MV5A 1KOFA 3NH6A 1OXUA 1Z07A 2CLDX 2ZSEA 1GZSA 1ZU4A 2VPPA 1RE0A 4DSNA 5KUTA 3U61B 4I1SA 1ANKA 1IQPA 1G8HA 2F1HA 3A1WA 3QY0A 5AJVB 4PPNA 2GILA 3TK1A 2CHVA 1FL9A 3R7WA 3H86A 1S96A 2FH5B 4PO1A 1DADA 2J1LA 3QOFA 2GCOB 3K0CC 3FYHA 3I72A 2ZYUX 5G3YA 3EIQA 4WZ6A 4OI0A 1II8B 4BFWA 1S3GA 1RYHA 2ZSBA 3K0EA 2O8EB 2ZU0C 1VCNA 4PO9A 5F2EA 1YZNA 2GTPA 1UBGA 3GLHA 4MH0R 2FOLA 1U8AA 2WICA 4LJ8A 2BCJQ 1W44A 2CK3D 1VG0B 3KUCA 1IBRA 1AQYA 4WXRA 2IT1A 1FUUA 1NG1A 3QBVA 5EJEA 1GRQA 3T5GA 2BDTA 4MGIR 3BBPA 3MGCA 1BYIA 2GRJA 1SXJC 3RRYA 3I3SR 4BZPA 4NCIA 4RD2A 5EQTA 1E2HA 2ZI5A 2GBLC 2IF2A 3VX4A 2QP3A 2NQ2C 3WNCA 2VRWA 2VHUA 3VR1A 2YWGA 1VKJA 4P3YA 1XXHA 4AWXA 1DAEA 1RZ3A 4ZV4A 4MDFA 4X8HA 4B35A 4DCNA 4Q4JA 4KSCA 4X8MA 3A6PC 1XEFA 2FEMA 5EE5B 1KTVA 4P4TA 3E1SA 4HATA 4PPGA 3UPUA 3NEJA 3CPHA 1HA3A 2IYLD 4N1AA 5DHAA 3PJRA 4LJYA 5BW8A 4EQ6B 1W48A 4DUGD 1P2TA 3CF6R 3N5CA 2OV2A 4QNMA 3AF2A 4I4LA 4UXJA 5L3SA 3GLGB 3LV8A 5CM8B 2WJVA 1ODFA 1YKSA 2HYIC 3GQBA 1GSIA 4WZAE 4QHYA 3Q3JB 4XWOA 4WA7A 1F3OA 1MO4A 1FMJA 4FI3C 2R2AA 3A4MA 3K53A 1ZNYA 1KGDA 2GJ8A 3RAPR 3W90A 2G77B 2J45A 3NIBA 4OHXA 2WWGA 3F5FA 2D7DA 4OKSA 2JLWA 4MRPA 5KTYA 1LFDB 3TUJC 1H8ED 4CW7A 1CRQA 4ACBA 5G53C 2P65A 2P0EA 1OFUX 1T0JB 3DKVA 5E7IA 1CJUC 1OHHA 2NO7A 1HT2E 1IONA 3CWZA 4FMBB 4PHGA 4Q4AA 2IYUA 3P20A 5L3VA 2YOHA 3IBYA 3TSWA 2AKAB 4B3FX 2EW1A 4JYBA 1TF5A 4BQSA 3RC8A 2IYWA 4PQYA 4Q7MB 2CXXA 3BB4A 1TTTA 1RRPA 1O3YA 1E0SA 4R71A 3K1JA 4CEJA 1XB2A 1XWIA 3SYNA 2FSHA 2E87A 1GKYA 4CT4B 1ZMXA 3G5UA 3RRNA 2QE7A 3GFPA 4JSYA 3W5JA 5JLJA 1T3HA 2MMGA 2ERYA 4DLXA 1W0JD 3CR7A 4ZCIA 2PJZA 3ICQB 3OF5A 3W34A 2J0VA 1JEEA 2NOAA 5SZIA 1OXTA 1GM5A 3AF3A 4Q9JA 2OSBA 1VHLA 3X1WA 1NG9A 4RZUA 3SJAA 1W0KD 3GJ8A 3K0FB 4IKEA 3AVPA 2RHMA 4LK2A 3NC1C 3KB2A 3H4MA 1DVRA 2IC5A 4IDNA 5FR2A 4LV8B 3LX8A 2GEDA 4Q1BA 3CNLA 4DB2A 3ADKA 2WWXA 2ZR9A 3VTKA 2RGDA 1PJRA 2BMDA 1LNZA 2JJ2D 3OFNA 4HZUB 1AM4D 2OBMA 5K8UA 3I8XA 3LLUA 1EG7A 1IXSB 3P32A 4QXAA 5LB2A 1JR3D 1OLOA 4A1FA 4WXPA 4F38A 1OIXA 4B74A 5KYKA 1G6OA 4CEIB 2AHOA 2HEIA 4FXPA 3L0IB 2CL7X 4M1KA 2JDID 5JI3E 2KBEA 3CUEF 3GLIA 1W4CA 3ZVMA 5E7MA 1E9BA 3CRW1 4B34A 1E9RA 1OE0A 1IY0A 2WVJA 3WP0A 4Z51A 3AVUA 3N70A 3VU9B 1EFHA 2DWPA 2CCKA 1P72A 1XD8A 3MAAC 2ZS8A 3B2EA 4II7A 5KNDA 1XCGB 1ZP6A 1JR3E 3M4YA 3AKEA 5EP4A 1Q1EA 1Q0UA 1DOAA 4K81B 2XX3A 4NYJR 4B32A 4DCUA 3U5ZB 2IXFA 4WW0A 4H1UA 3UG7A 2HLDD 4A6PA 1UJ2A 2O8DA 5FOTA 4AYTA 2ZR0A 3SE0A 5HPYB 2W83A 1MOZA 5CK4A 1SULA 4TLCA 5JRZA 3E5HA 4EFMA 1Z63A 4CYMA 3LQRA 3IPYA 4MKHA 5AJZA 3PEYA 2BEKA 3PVSA 4B33A 1U0LA 1ZIOA 121PA 2NZJA 1P5ZB 4FMDF 3VKHA 1CP2A 2PZGA 1K5DA 3LBNA 4V0NA 1OT3A 2HT1A 5DN6D 5HZKA 3BD9A 3SFVA 4O2LA 3TW4A 4Q4HB 4AY2A 1VIYA 1G7SA 5DHFA 1NIPA 2GF9A 4A8JB 2X19A 4FIDA 1E2LA 1YR6A 1ZD1A 4Q03A 4IVPA 5FTNA 4RCZA 2ZUDA 3WHLA 5BYJA 2GZAA 4HAUA 5CJ2A 1KK0A 3AUXA 4W5WA 3NHBA 5J5CA 2YC4C 4DCTA 1JPJA 3FDIA 3AVVA 1E9FA 1G18A 3O8DA 1I2MA 2ZSFA 4TL8A 3TRFA 3ZYCA 4Z54A 3F3YA 3GLFE 2YWFA 1Z29A 4MUAA 5EE0A 5HE9A 4MKFA 4C9BA 2D2EA 1KI9A 1ZUNB 4GI7A 2WZQA 1IOZA 3KQKA 4AK9A 1KI8A 5CDFE 2CE7A 3THWB 1G3UA 3K0CA 1WXQA 2ZRNA 2ZJ2A 3B60A 2ONJA 1Z47A 1VTKA 3AP2A 2QAJA 3OE7D 5JFGA 5AJWA 2YNMA 2PJRA 1KI7A 1KK3A 2PL3A 2QN6A 5EXTA 2HF9A 4JBWA 1EFRA 1KI1A 4DLTA 2FN4A 4F91B 1JQLB 1KDOA 4BEJA 3MWYW 4M9XA 1A82A 2GETA 1NVWQ 4Q19A 2JLUA 4NCKA 1N5JA 4MGZR 2ZANA 5KNCA 4A92A 4DLUA 5CJPA 1KMHB 4POAA 3U7GA 2HCJB 4LJAA 1XTRA 2QPOA 1SXJA 1WBBA 2H8KA 2ZRHA 4NCNA 1YZKA 2QENA 1CEEA 2QQEA 2GBLA 2R6GA 4A2WA 4Q9KA 4ZIRB 1OIWA 2GJ9A 3LNCA 1ZNZA 2FFHA 1JEDA 4XVRA 2CL6X 1A4RA 4HAZA 4LGMA 3K70B 3THYB 1GIAA 4LJ7A 4LHWA 4TTRA 1DTSA 1GVNB 1QVRA 1SKYE 2O8CA 4URZR 2CJWB 1NMYA 1QHYA 2YINC 1E0JA 3VR6A 1GNRA 4BLSA 1WB9A 1RFLA 4B75A 4EUNA 2BJWA 2RMKA 5JS8A 2ZM5A 4QGFA 5JBQA 4P4SB 1LY1A 3UANA 2A30A 3LRPA 4ZKEA 1HURA 2CHGA 2YC2C 2YWEA 1KAOA 2FWRA 4QKQA 2EVWX 5CITA 1XJ0A 4JKIA 2VHQA 1VIAA 1U8ZA 2PEYA 4PXAA 2ZRGA 5E95A 3OAAD 4HAWA 1S0UA 2V7QA 5LB4A 4Q9HA 2NO1A 1DARA 4ILEA 4OK3A 2FZLA 1Z8FA 1ZNXA 4Y0AA 4NYMR 1P4SA 4ARZB 4DT1B 3TR0A 4KXFB 4QG7A 2OUKA 4WOPA 4G01B 3CH4B 3THXA 4MKGA 4XD7A 3GJ6A 3K9HA 1FP7A 2QM7A 4PQFA 3B9QA 2IUSA 4Q00A 5FOXA 1U9IC 1YR9A 2GKSA 4HZIA 1IN6A 1E9SA 5F98A 3B85A 4QGAA 3UK6A 4U02A 1YRBA 3A1VA 4C0JA 3GMTA 4BWYA 2VIIA 1LF0A 4RZ3A 1KSHA 1WP9A 1CJTC 3VNVA 3V9PA 1ZW6A 3F0TA 3QKRA 4B71A 2Z4RA 2OCBA 4BUJA 4UNPA 3QEJA 1RC8A 2J5XA 4GPTA 5AK0A 1VG9B 5AUPB 1A7JA 1E2KA 4MYTA 1GRNA 5CYPA 5LPNA 2E1RA 2PMKA 3FMIA 4PFSA 1AA9A 4RFSB 1X1RA 3EX7C 3EW9A 2OLJA 4CEHA 2JJ1A 1MT0A 3DOEA 3EARA 4F4IA 2WPDD 3U6KA 3J81k 4TYYA 1ZBDA 2EWWA 1II9A 5AJXA 3WRYC 1T91A 3T12A 4KO8A 1GNPA 3PR1A 2HUPA 3AEZA 1SVWA 3ECCA 3RLFA 4MRVA 4MA4A 3BRWD 5H68A 1OYYA 5KSOA 521PA 2XNSA 5FUVA 3CBQA 4K46A 2DB3A 4XTCS 4G5SA 5CK5A 2JLZA 4XWKA 4DLZA 4EFLA 2W6ID 3KKOA 4Q7JB 4DSOA 1ZUHA 5AWFC 1W2GA 3RNLA 2GAAA 2RGXA 4TTPA 1LV7A 4OI1A 4FMDB 1U94A 5JWHA 3NDBB 1FFHA 2IHYA 3SOPA 1SQ5A 1E69A 2BIFA 2W2XA 5M04A 2IUTA 3A36A 4JLPA 4RD0A 3X1DA 1Z6GA 1B0UA 2IYRA 3QF4B 4PZLA 1RJ9B 3JVVA 4YXWA 4AKHA 2BM0A 1UEJA 1E9DA 3IILA 3CB4A 5L3RA 4IOJA 1OXVA 2OAP1 3LXRA 3PUXA 2J0SA 3GJ5A 4TLBA 2ZJZA 4JVMA 3QIAA 3PUZA 4NTZA 5GJVC 3R9XA 2QROA 5KPDA 1NL3A 2UVQA 1N6HA 4QNRA 1E2GA 3U3KA 1AQUA 1J2JA 2AN9A 2PCJA 3B1VA 4ZDWA 1ZD8A 2JIZD 4Z1MA 5AUOB 2YZ2A 1EFTA 3BWDD 1TAGA 3N2EA 3NBZC 1IN5A 5FI1B 1G4UR 5IF9A 1Y3AA 2GCOA 2QT1A 2R6FA 4JIMA 4TMXA 2IWRA 4E22A 1X8KA 4IFEA 4Q1EA 4RVCA 2ZRAA 3T06B 2B21A 4GBMA 1II8A 3PIRA 2ZS7A 1M7GA 2O8EA 1SVIA 1RYFA 4D4LA 4OI2A 2JGNA 1T0HB 3ZVRA 3TUIC 1Z0DA 5K8TA 4QJ4A 3SJZA 1CULC 2R6AA 3DZ8A 4Q21A 2V6IA 3VHXA 2PX3A 1NKTA 1ZAKA 2DFTA 2ZU6A 4LHYA 2CVHA 5F9HA 1VDZA 4ZCLA 3I73A 3QKSB 4RD4A 3ZIAA 2EFDB 1YZQA 1KNQA 1ELOA 3N2IA 4W7SA 4B3BA 3K70C 2OE2A 3CX7A 5EE9A 1FOEB 2RGGA 2FGKA 1EFCA 821PA 3U3RA 3UG6A 3W3ZB 4EQ6A 1KI6B 2O0JA 1E2QA 4LYFA 3SU8A 3B13B 3GLGA 3MRSA 1T8TA 4JL8A 2BBOA 1NSFA 2X2FA 2RGCA 4JLNA 3SN6A 4HLQB 3AQ4A 4WIAA 5AUQA 2A5FA 4KI0A 5TXGA 1IJEA 3RABA 5C46F 3CONA 3BAFA 3AF4A 2V6JA 4Q48A 2ZE5A 1HT1E 3TSOA 1RKBA 2J7PA 4LRWA 1LTQA 2VHJA 2XSZD 4URUR 2O8FB 2HT6A 1G3IA 2AXNA 5HCNA 4Z8XA 4DXAA 2F55A 1XZPA 3V4RA 2HXSA 1PLLA 2RAPA 5A4JA 5JSZB 4F93B 4ESVA 2WJYA 2G3YA 1WQ1R 1YZGA 221PA 4PPFA 4M53A 1E2JA 1UF9A 2WJHA 4C4PA 5JWRA 3BH0A 3QPVA 2ZVPX 3MD0A 1SKQA 3I8SA 4NBSA 4PC1A 5FL7A 3SYKA 4BFXA 3KFVA 5IK2A 2ZYVX 3CPJB 3QKUA 2C99A 4NL4H 2QBYA 1I4LD 1JJ7A 1NLYA 1L7VC 5FOWA 5KOYA 3K9LA 4IOMA 2UZ3A 1ZCBA 1HQCA 2ZUCA 2QORA 3EG5A 2VYFA 4YQFA 3QPWA 3ZD7A 1RRFA 3IIJA 3Q8XB 3S1AA 3B82A 1F6BA 5FOUA 4ZI2A 1WE2A 3BGWA 2NO9A 3ZS8A 1BMFD 2Z5FA 3PITA 4TMWA 2J0QA 3RWMB 2ZJAA 4M22A 2XNDD 3LO5A 4LHVA 3K0FA 4YC7A 2OO7A 4FMCB 1U9IA 3MMPA 1XXHE 4GSYA 4TL9A 1W36C 3C4JA 1W4AA 2Q6TA 3IPXA 4D0LB 2KB0A 3CW2A 4OHVA 3FKSD 1X1SA 4QJ3A 1BH2A 2CCJA 4HZUA 3QI2A 1YR7A 3KKMA 4GP7A 3TIFA 2NO6A 3SNHA 3EZ9A 2W2TA 5FPYA 3FVQA 4YMUA 1D5CA 2XTZA 4HB0A 1D2EA 2A2ZA 4GOKA 3Q9LA 2X1VA 2H17A 4D4MA 4C2UA 4BRWA 3PFIA 2BCGY 4HDQB 5KDOA 3DZDA 5DLQC 4U7DA 2YJTD 1WCV1 1ZNWA 5GVRA 4IXMA 1IN8A 4IFBA 5EP1A 1T9HA 3DVLA 5HR5A 1D9XA 2IXGA 4TWZA 2G0TA 4ZCMA 4LX0A 1AGPA 4D2IA 1AZTA 3GFOA 4H1VA 5IT5A 4CIDA 1G4AE 2BKEA 1RRCA 4PPQA 3RS2A 4X8LA 1II0A 1TEXA 1XMSA 1OW3B 4EDHA 3E2IA 1G5TA 3OIWA 3NG1A 4PHHA 1AGRA 1V5WA 3LH5A 4JJKA 5HKKD 5LD2C 2DFKB 3VR4A 2ZYTX 5JI2E 2BM1A 1GL9B 2JEOA 1XBTA 5JRJA 3P1JA 3GLFB 1CJVC 1Q12A 2ZI3A 2ZE8A 2PT7A 4PHTA 3ZDQA 4EJSB 4HUQB 3NH9A 1BS1A 1GG2A 2NGRA 1NY6A 2WIBA 2WJGA 1AN0A 4IHQA 4LJ6A 5D3MB 4XIGS 5FBQB 1Q3TA 2IUUA 2PLFA 4Q4HA
chains in the Genus database with same CATH superfamily
3OQ1A 4BEBA 1AURA 3EH2A 3KKPA 5TGDA 5GJBA 1BJRE 2FLVA 3BHMA 4FFDA 4C6TA 3TG2A 3T1HB 1SD2A 2ZSAA 5A3SA 3T54A 5B36A 4GDFA 1DG9A 4REMA 2ZRJA 4GWLA 5KPJA 3HO8A 2P6NA 1U5BA 2TMKA 2WF7A 2IOFA 5C8DA 4DLLA 4LBWA 1RRKA 4LWPA 4AI6A 3GCWA 5A5VA 3RVMA 1P73A 3GUVA 1ZINA 4W4TA 4WUVA 5FO0A 8MHTA 1EHYA 2FSFA 2VJLA 2V4UA 2QIOA 3DOCA 3RADC 2FY8A 2ZZMA 2NV0A 2C2BA 1P2FA 2ZUUA 3HY4A 3P2IA 4G0XA 1QO7A 4JLUA 1XSEA 4DRYA 1BNCA 2IHZA 4ATNA 3T7JA 4IZHA 5BW5A 4ZYYA 1IZZA 1YZYA 1ZUNA 3U4QB 4RVNA 6ABPA 1Z4MA 3UY4A 2ZYGA 2F3SA 4GXTA 2CJYA 3T5MA 3W77A 4ZI7B 1JBKA 1XZIA 1Z9BA 2Y66A 3PDUA 3ANTA 4HNRA 4CM4B 3PGJA 4ZU3A 1MFPA 1SKYB 2VF7A 2XWSA 3G9QA 3UWSA 1GZ6A 3M7IA 2A33A 2J87A 1BE0A 1LBIA 1KY4A 5DBHX 2IP4A 1SUWA 1ZRNA 5L4LA 1FX0B 1YONA 1JBQA 2P3LA 4NG4A 2IEAA 4GXNA 5DISB 2G08A 1PQPA 3HNPA 2JFWA 2OFWA 4FYWA 2NT3A 4QULA 2GEJA 1MRNA 3OPYA 2WKQA 4M7PA 2X0EA 4A10A 4EELA 1UINA 2OHFA 4ND8B 4ZYUA 2ET6A 1Y3FE 4UUMA 2JFVA 4XGIA 4DV7B 3JWHA 3QOXA 1KOJA 3NEAA 2N9UA 3TX6A 2C78A 2I1VB 1FNBA 5KYXA 4LDPA 1U0EA 3H87A 1YJBA 2ISQA 2O57A 3N59A 4N7RA 4D74A 4ZIRA 3P9YA 3QNUA 5TNXA 4AKGA 1ONBA 2JGJA 1L2TA 2ODTX 2R751 4NCAA 1UMCB 2QRJA 3EDCA 3ICWA 2IOFK 4JBGA 4PC3A 3WZLA 4KXYA 3DFMA 4HDNA 2Q99A 2JGDA 4JLOA 4M8SA 2G04A 3QYAA 4Q01A 5DP1A 4IINA 5EGNA 1VHQA 1V45E 1MR3F 1HWYA 2A8YA 2ZJBA 3EIWA 3FNHA 4O2BB 1QYCA 2A9VA 5FIUA 3AEKA 2IVZA 4R54A 3LKBA 4BEWA 4CV0A 1QHIA 4IMIB 1SRRA 4KGVA 4NATA 3ZCPA 2B9VA 3MAJA 4M0KA 3PRKE 3W8NA 4BMCA 1R9GA 5BN1A 1P8JA 1FUYB 3O8QA 3OE1A 3PC7A 4CMEA 1ZW1A 2IX3A 4G2TA 1AGNA 1TQ2A 1U3TA 1REQB 1M1YE 2EF1A 1MU0A 1QYDA 1CRZA 1YL7A 1ISJA 4HWTA 3S2ZA 2AI3A 1SCNE 5FFMA 3B5IA 2J85A 3WBBA 1GP2A 1OYVA 3LT1A 1RHMA 2JVIA 3MYYA 1Z2OX 3ZJTA 2FHPA 4JIGA 3WSWA 1M2KA 4KI7A 4NBWA 3PVCA 3U9LA 1QGZA 1PGNA 4XVHA 4ZAYA 3EZNA 1YVRA 1U1FA 3KQWA 1Z4KA 3OQPA 3SJUA 2V7PA 1JDBC 3TXXA 5JSUA 2DLDA 4X1OA 4C6SA 3BZWA 1NW7A 2X2EA 3MFYA 3PXBA 2IOHA 4NU0A 2NU7B 4IO1A 2P2LA 2P8SA 1U8XX 4PZPA 2PKCA 5F4BA 2AUTA 3RS8A 4IGKA 4RV4A 3H84A 4P08A 1XR3A 1EFLA 2DAPA 1IIBA 1ZESA 2HCTA 4Q1CA 3DC7A 3FTEA 4D41A 3VMMA 2NUAA 4UZSA 3VR2D 2GYUA 4HRAA 3MB8A 1N2XA 1V5IA 3W04A 2ZIWB 2CUNA 4DQUA 2E4UA 5A6SA 2CNWA 1X7XA 2YH2A 3PXXA 4G0MA 4DWOA 5I47A 1O03A 2OC4A 3LQ4A 3V3TA 4YRNA 1T4MA 3PIIA 4QTUB 2OV8A 1PEKE 4TVKA 1QJ4A 3OU7A 3U31A 2LCQA 2ZWOA 3GPDG 2Q2WA 4XWAA 3KXLA 1J7KA 1XDBA 4UHDA 1XLVA 4DQDA 2QTVA 4BLPA 3GB9A 2Q2VA 4P82A 1KC3A 3TWOA 4PCLA 2B4KA 3C6KA 3E53A 3V32A 1GA4A 2EBUA 3HUEA 3HBLA 1RRVA 1I10A 2H1IA 2WJIA 3ENZA 3MBKA 4MR7A 4UEQA 4Z5XA 5IUJC 3HFGA 3IUBA 2IJGX 1O97D 2GGSA 5K0SA 2QTZA 2VFAA 2B4AA 3FZNA 1JXOA 4KR0A 1H4SA 2BBTA 4JOSA 1Z06A 4LEIA 1RVV1 1A8HA 2JLSA 3S27A 4BGDA 3B7PA 3DE2X 1QIGA 4B6RA 1NVAA 5B7QA 1YDGA 2Q8NA 3BOSA 3JTMA 4OJTA 1DE0A 4QXRA 2WD7A 3I2FA 3RVSA 4LF6B 2VO1A 3V1UA 3FAZA 3WLHA 2VCEA 2OM6A 4GSKA 1NXVA 1W8IA 3EQ2A 3E8MA 4TZTA 5HJEA 1SVOA 3M9LA 3BXXA 5BPHA 2HIAA 5B3LA 4GGPA 2QY9A 5AM5A 1X3SA 3HPRA 3RREA 4DCSA 3FMVA 1PZHA 4LKOA 3PXGA 3ZS9A 5K03A 2WWFA 3KRTA 4WHMA 1CR0A 1Y5IA 3CGGA 4WACA 4EK9A 3OJ0A 4KBGA 4B3GA 3OEHD 4MI3A 1UANA 1JKFA 2J9GA 3C6MA 3C70A 2PD3A 2YZGA 5KSPA 1FFXA 2V03A 4LE2A 5CB4B 4YAEA 2HO4A 1FSZA 5TT0A 4RAQA 1IBMB 3OKCA 3JAWB 4I1IA 1DJMA 1XLWA 3OM0A 3PGA1 4GC5A 4ZGBA 3KJGA 3KUXA 4B83A 2E85A 2VDNB 1OF1A 3RV4A 3KJZA 4K6OA 4E14A 2AF4C 4EUEA 1AQNA 1J1ZA 5J4VA 4Q05A 3LWZA 3UT0A 3JWEA 2P3SA 1XCOA 3INNA 3TW0A 1NJGA 3CC8A 3IXQA 1NU6A 4KLCA 1NBMD 4BWGA 4CDMA 4ZDIA 2CV0A 1I5OA 4W9NC 2MSWA 1LBQA 1DB3A 3DR5A 3I2YX 1CHDA 1ML4A 4JJ6A 2C5LA 5BSFA 4KO1S 2OFOA 3R0QA 2Q5CA 1Z5NA 1P62B 3CX6A 3FCYA 1RM3A 2CK3A 3AWIA 4CLOB 3GH1A 4IMRA 2GM4A 1DAMA 2JFXA 4YRQA 1RJGA 2QN9A 3KJNA 4KH1A 2Q5IA 5HS6A 3VVLA 1M6VB 2QRVB 2QTRA 4Y2HA 4DVGA 3TNDA 1ZVQA 1BHO1 2QN1A 2BWJA 1E1RD 3NUGA 4ZOLB 1Y9DA 1Z18A 3FPGA 4NU8X 1QTNA 5BYKA 1BRTA 2CVOA 2VJDA 1A27A 3ABQB 3HR7A 4BV2A 1W35A 1UFQA 1SOWA 4OYYA 3DBVO 4U63A 5EJGA 3QYFA 3KXKA 2VTBA 1HDRA 2P4HX 2FMTA 3R7DA 1CE8A 2EP5A 1Q22A 4ETWA 4UBNA 5JNUA 2OZVA 4LGVA 3FR7A 3LOUA 2W0MA 2JHFA 4QQRA 1QG2A 2GCGA 3GDOA 2BGNA 3K1YA 2O2EA 4D4KA 1HBJA 2RGUA 4J16A 4OM8A 2PUEA 4HX5A 4NMXB 3LUPA 3LCUA 5EUMA 6CHYA 1AK2A 2IEYA 1U7ZA 1H9BA 1L5MA 1ZGBA 2Q4RA 4IH4A 5AD1A 4HF7A 1K2WA 4FFMA 2W42A 1LEHA 1X1EA 5GIOE 2EBHX 3SVTA 2VP2A 2CLIB 3WHIA 4EA8A 4JCOA 1XZQA 1EM8B 1V9CA 1VHTA 5DTEA 4P31A 2I8AA 1EP3B 2Q9AA 4JOBA 4X62B 3ELUA 4KMOA 2JJQA 1AS3A 4WE3A 5G0SA 3AEYA 3RVPA 2P5SA 1FSGA 3TE7A 3NVAA 3Q9SA 1YQ9A 4M1TA 5HW0A 1T6ZA 2YY6A 3DEAA 4MDYA 1STOA 4GWKA 1HYGA 5HMLA 5FOSA 3BJRA 1I2AA 3AJAA 1RWMA 4R1PA 4CCWA 1G8PA 2H4WA 3BF8A 3FSJX 4NJEA 5IWCA 2GZHA 1EK6A 2IQIA 5G1PA 2K5UA 2DWQA 3F7OA 2RJNA 2YQ5A 1XC7A 3FI0A 3HKBB 4BS9A 7ADHA 4DV6B 2GWRA 2BFBA 1SK8A 4EI2A 4LOKA 3ZG6A 1YBAA 2P91A 3HE3A 3EPLA 4AURA 1UAAA 3C7DB 4US0R 5BT8A 3EBOA 1BGVA 4K9QA 1F7VA 3JXEA 2YFKA 3CF0A 1CUZA 1G8SA 4FUQA 3A7EA 5CXXA 3AP3A 3LLMA 5H70A 5I9SA 3K35A 3MTGA 3T9BA 3FD8A 4K9LA 4MPRA 2X6TA 5TQVA 1ONOA 5FBRB 3ZVKA 3IKLA 3N6VA 2F3UA 4QLAA 1UXOA 4V2IA 1I4EB 4CF3A 1T0IA 1J22A 1EA7A 2XB8A 4X3CA 1NSTA 5EIBC 4Z99A 3W8EA 1IM5A 1U0RA 3FZEA 3MCTA 4IPTA 1CNFA 4K9PA 1XXHB 3GLRA 4DJFC 4I9HA 5FH9A 5H8WA 3NALA 3C5HA 1IVNA 3CTMA 3D4BA 4Q3DA 2QU7A 3O21A 4C0AC 1R0ZA 4EG0A 3RO7A 1EK0A 3HJAA 4KQ6A 1G8GA 4L8LA 2J6IA 2GXAA 5LWQA 1CS0B 1PHPA 3RDPA 4W5OA 2BM8A 1G7TA 5J9FA 4UDNA 1SFRA 2RI0A 1BE1A 3KJIA 4TVBA 5EWLB 3FA2A 3UKJA 3ONEA 4PLHA 5L3SB 2QJRA 2SECE 4QQKA 1XA4A 4LC0A 4N3NA 1JIIA 5BOSA 1QFXA 1DX9A 1LJUA 2PS9A 2XE7A 2JI8A 4L95C 4QOSA 2ZT6A 4NSNA 3U56A 3INGA 2FPMA 1M1NB 3IP3A 4X7RA 2I6UA 1VP9A 5E4YA 1FLDA 1TK3A 2JGFA 1XZBA 5F5XA 5AI9A 3K1TA 2HK8A 2X1LA 3R6GA 2VJKA 4YMTA 4WFKA 1LK7A 3JWJA 5CLFA 4YGXB 2UZIR 2AG0A 3USZA 2JRCA 3H3FA 7MDHA 1U8TA 3ROXA 3T7RA 5JW6A 1S2OA 1XRMA 2BL4A 1SOUA 2GHIA 5AK4A 5JS1A 5F9FA 2CKMA 5AVSA 2QUZA 3GA5A 3I01M 4B4VA 1KDRA 3VNAA 2ZB7A 4W82A 1PYGA 2VQ6A 4YRBA 3C5WP 3PNYA 2AK2A 4IEFB 4UM9B 5IUNC 1IZ9A 3M1IA 2YUTA 2OG2A 3LL7A 3D8TA 3DT8A 4YRCA 2I2DA 1E3JA 3K6SB 4C7KA 1BX0A 1WTCA 4KOAA 4ZI3A 1XQWA 1VA5A 2ZI9A 2NUTA 2YYAA 3HYLA 3P9PA 1QSGA 1W94A 2RE8A 2E3JA 4RW0A 1R5OA 3WGKA 4B4KA 1ISHA 2ASVA 3NHLA 5AKJA 2XTJA 3RJZA 3ZYZA 4I7EA 2ZG6A 1SC6A 2X1MA 4FYPA 1NQTA 2AEJA 3IJEB 2HLDA 5A71A 4A0FA 5JUWA 3FOZA 3THRA 1P1IA 4O25A 2ZT8A 3BERA 3BFJA 5DI3B 3NTVA 2VPQA 1DCMA 4WXHA 3IS3A 1PD1A 2D3TA 4Q9DA 1X74A 4K87A 1YSCA 4OHBA 3G0GA 4TYQA 1Y1QA 4NOKA 3WB2A 3VSDA 2YV4A 4FBLA 2O6HA 5F1PA 3V4SA 1E0AA 3IQGX 3ZGOA 5EJ2A 3EXG2 4KPEC 1JSRA 2IGBA 2PKQP 1K5GA 3OCWA 5DN6A 1COWD 2PYDA 2FUKA 2YIMA 4OUKX 4XM1A 3UMBA 2WPNA 2AV6A 3CR8A 4FFBB 1N0WA 2BEJA 3ABSB 1OPXA 3EWAA 4RCVA 3M8KA 5ELLA 3VGPA 4RK6A 1XD9A 3PLNA 3T94A 1H1LA 1BKDR 3QU4A 4ENWA 1XCBA 2HMVA 1YF3A 2H85A 5CFOA 5ESRA 1S1CA 1MD9A 2OPHA 3TW8B 3E7XA 4YCSA 1KO5A 1Q7EA 5PNTA 3S2SA 3PI7A 1KDYA 3ZUGA 3NHJA 2DY1A 1N2CE 3MAGA 5JVDA 1O96B 4A8JC 2NZ2A 2IHKA 3MOIA 4KPUB 2L0XA 2NO4A 5LZ7A 3TI7A 1OOEA 3L79A 5I7EA 3EZ6A 1YB6A 4D6PA 3GWGA 4YIHA 4AKIA 5DNVA 1HNNA 3PUKA 4JUFA 2FRVA 3IPCA 1VE9A 3CA8A 2DE0X 4EY7A 1SXQA 2VYCA 2QD2A 1HZJA 2YWHA 3IAHA 4PVDA 1NKSA 3ZH9B 2OQRA 3D7NA 1W59A 5DBFA 4DUYB 4KHPB 1Y6RA 3NTLA 1F3LA 2JCSA 5JXGA 1DI0A 1QGUB 3CX8A 4X00A 1TZBA 2VTKA 5FI5A 3IUPA 1X2EA 4CLDA 4OHFA 5EKUA 3RAFC 1Y1SA 3CF4A 1E60A 2I87A 1JX6A 3P9IA 3FYTA 3OBBA 2HM7A 3GLQA 4GIBA 1XDDA 3L7DA 3O4HA 3VNUA 2A4MA 2PX4A 2CNNA 4MWSA 4JI7B 4ZAVA 4WBNF 5DNCA 4WASA 1M8FA 5IJZA 2HPZA 5JCOC 2FSVA 5GTDA 4JBXA 2QMEA 5JY1A 3AETA 3FYUA 2QD1A 3Q5GA 4K88A 1KU0A 3SZUA 2WUFA 4TYMA 3ONNA 4A23A 2YRFA 4ITVA 5I7UA 4F9FA 1CR1A 4G0NA 1CK4A 1MGPA 3HFSA 2AH5A 1Q6ZA 3VV3A 2KBFA 2WZCA 4HEA6 5F7OA 5IHPA 1SH7A 2XRZA 3UNXA 4GOND 4RMNA 1LS6A 2MSEB 1M1YB 3G0IA 2I5PO 1NW6A 3N7UA 5C7IO 1UPXA 4ENRA 4OSOA 2X0FA 5JQWA 1QF6A 1CUXA 1N0UA 3U7FB 4ROSA 3DOUA 3WZMA 1G9TA 1UXJA 3EBLA 3C3PA 3OU2A 1E62A 1YK0A 3IMEA 2G9ZA 3SKVA 2XGOA 3D2AA 4JL5A 4L5AA 2QT0A 2X9NA 1SU4A 2DBYA 5HXAA 1P61B 5G0WA 5LNK1 3HDGA 4XA8A 3TPFA 1Q91A 4UHHA 3QXCA 5CNMA 3VPAA 3L8ZA 1GKUB 3IVAA 2BHNA 3LBAA 3D6UA 4GR4A 1U6KA 1VLLA 5J5AA 4BVHA 3UOGA 4E03A 4ENSA 1A5ZA 3ZD9A 3OAAA 5ALDA 2R8RA 1G5RA 4L0QA 2V55B 3ZLTA 1TM3E 4U0JA 4BXOA 1ESNA 4CMEC 1Q1BA 4O3MA 3DMNA 1T1JA 2VYQA 5DHRA 4ZEVA 3UM9A 2C2OA 5AW5A 1DC7A 1N3BA 4B1FA 4XGQA 2W11A 4DWVA 1L4HA 3SBDA 1QRRA 16PKA 1I80A 4EJ6A 4EIWA 4LN1A 3ESRA 3DO8A 4K6CA 4M54A 1R12A 2X8JB 1UZAA 2K2WA 4UU1A 4FM9A 2EBWA 2Y27A 3QVSA 4P5DA 4Y1RB 3Q6IA 4FC7A 4LYHA 4U00A 2XUDA 3SOZA 4BN0A 1KP9A 4AMUA 3MSXA 5G4KB 2AJDA 1C30B 4JT4A 1Z5WA 1DJLA 5KTKA 3L4KA 3GA7A 3VISA 2JI4A 5HIMA 6GPBA 1B2LA 5IXSA 1Q57A 3FCCA 3HJTA 3FMGA 3WP1B 1J2RA 2B8TA 3GUCA 4FWBA 4RLHA 4M0UA 4TKMA 4GMDA 5IYZF 2FB9A 1JFSA 1CR4A 2XTAA 2J9RA 2PRKA 3G0CA 2OZEA 2REOA 1Z39A 3PPYA 2DKOA 1L7BA 2W48A 2WWWA 4WLFA 3R5JA 4B84A 4RTMA 2IYQA 2IVFA 3QHAA 4TXLA 5D01A 3P97A 2B5OA 1AKNA 5FEUA 1KKMA 2P67A 3LUHA 1CERA 1L7AA 5G3ZA 5J2UA 4FOOA 4CE6A 3GNLA 1K7CA 2VATA 2B8EA 4P36A 5D2CA 1RKUA 4FEEA 2XYHA 3AX6A 3OFJA 3QE0A 2NTNA 5D84A 3TIVA 2CBZA 3VHLB 3TQFA 3LX5A 4A3SA 2ODEA 4FQ8A 5LC1A 1TK2A 1ZNQO 2NX2A 3KSBC 3GLHE 1XCJA 3ETJA 3MMNA 4A2QA 1W7AA 3FKQA 2VP4A 3WLEA 3O75A 4D9JA 2QZJA 1RFGE 4UAJA 1VMAA 5BORA 3KQHA 2E49A 1G8KA 1H66A 4H7EA 4I1YA 3IV7A 2CNBA 2OO3A 4HDCA 4QUEA 1NR1A 4AKEA 1G8JA 5IJXA 3GRYA 1RU3A 5ESXA 5ALVA 4KFTA 1KSFX 4TPKA 2ZVJA 3T7CA 3O4IA 4JS0A 1VGQA 2X8AA 3MUNA 1G60A 3N2ZB 3GARA 3KPWA 4BJ6A 5AM1A 4LXHA 2H11A 3AVOA 5GONA 4E13A 2I9PA 2FK7A 4KITB 3QXHA 5JMTA 2GX6A 3TD2A 4I8XA 3SMQA 3PNSA 1DQYA 1CTQA 4MMYB 1GGHA 1SY7A 3PS9A 4F4CA 4LZPA 1X1DA 1W47A 4RHCA 5LYJA 1LWNA 1T2VA 1LLCA 2PH5A 3K9NA 3IQHX 3PNBA 1IE3A 1Q1QA 2FZEA 1M8PA 1SZJG 4M8KA 3W5IA 4IIBA 1J39A 4B3XA 3T61A 4DFDA 4DV3B 5CR9A 5HGXA 4WT7A 3ULKA 3HHEA 4OYRA 1J2UA 1RCFA 2VYVA 4EKEA 3UK2A 1ECFA 1OHHD 2O2XA 4ZREA 3NVDA 1HRKA 1QH8B 4LNUA 5B3KA 2I8CA 2P6PA 2BHTA 4UVGA 3OCYA 4URFA 4ZVLA 3TKYA 3ZZ1A 1N5DA 3FUVA 4M1YA 3TQOA 3R8FA 2G72A 1Y34E 4TTJA 5IDYA 4EI7A 3ZZUA 1A1SA 1NMSA 4N7MA 1QHHB 1IAVA 4PYKA 2WP8J 4TS4A 3V46A 1TMYA 3DB2A 3WFIA 1JFVA 5TPZA 4FC6A 1RYEA 1XRQA 3KDSE 4L02A 1TOAA 3HCWA 1WB4A 3VBCA 4RANA 1MO5A 4CEHB 4FHGA 1N34B 1KEZA 3F2VA 3V1TC 3S2EA 4RHEA 3HCAA 3LY8A 4XYMA 3CIFA 4NOLA 2VTDA 1WRBA 4XUEA 4OX9Y 4C14A 4HNAA 3H1TA 4Y2QA 3AF1A 3HJHA 1R8QA 2OBBA 1JLSA 1QWOA 3OQVA 1U7WA 3G68A 5HQ3B 4ZV9A 2B30A 2IYOA 4M0FA 2PX0A 1AQJA 1L9XA 1W85B 2AFHE 2IU4A 2RCYA 1DEAA 5D3ZA 2JH9A 4ZXPA 4BJHB 1NASA 1I6WA 1LVGA 4EZEA 3GXOA 4N3BA 3FUTA 5HIAA 2CLEB 4MQEA 2AE2A 4NQZA 2ACVA 3DDZX 1SCDA 1YU9A 3DCJA 3PNKA 1UOEA 2PV0A 3DOOA 5EMHA 2QKYA 4WDQA 2R86A 4YJ2B 3U7RA 1BMTA 4BNMA 4CR8A 3K09A 1CRWG 2ZBQA 1SVNA 3JASA 2EIHA 1P3DA 2PT5A 3ITKA 4FU0A 4QDXA 4B0OA 2NSYA 1M6WA 3L7IA 1U0FA 3OFND 3Q7QA 3O3MB 1IEXA 4IWXA 3C6YA 4URHA 3RGGA 3I9OA 2KI5A 3BMOA 3IKMB 3IMKA 2ZB4A 3QVXA 5H5JA 1KO8A 2QLFA 2CMDA 3NVMB 4QM6A 1AGYA 1PBTA 2EZ4A 2P9YA 3RS7A 4LF7B 3C3CA 2A67A 1DKNA 3ZWXA 1HTBA 1NI4A 1M7BA 5EN4A 2HK9A 5CFRA 3TLEA 2NMVA 2PH7A 2BKUA 3EEIA 3PP8A 5B58T 5JR3A 4QFBA 2OYSA 1I2DA 3VC3A 3LGAA 4WNIA 4BTVA 3K8YA 4NE9A 5IP5A 2EQ5A 3CCBA 3VC1A 2ZT5A 2OGUA 3V4PB 1J0EA 4BO5A 4ND1A 5KTOA 1L3IA 4M9ZA 2EFHB 3PG5A 1FBNA 3QUCA 3IIIA 4CKEB 1R4MA 3ZZ0A 1ZM9A 3D1LA 3PE4A 5E6SA 4QPDA 3UO8B 1XVUA 1OTXA 5JS7A 2GNOA 4O1MA 4B17A 2QD4A 1GY8A 3KV3O 4D5EA 1JSLA 5JZMA 3RK0A 1X87A 1W88B 2VNHA 1DAKA 3GFTA 4P4LA 4BKRA 2JAPA 1HDGO 1JAHA 2A0FA 4Z1OA 2Q3CA 2W5UA 2EL9A 3HA7A 2NZWA 4L2IB 2GA9A 1U3VA 2Q2OA 3COSA 2WIAA 1PFQA 1LU9A 3MELA 2I34A 3CUTA 4J0KA 3YASA 1HYBA 4JX8A 5CLHA 4P35A 4BRUA 4L76A 1OROA 2Y9PB 1YOVA 2VJOA 1EUCB 1AHPA 4YMGA 4FDMA 4C29A 2QAGA 1NF9A 3PENA 4RKRA 1SZPA 1U3WA 3ETCA 4Q34A 1UPAA 1QYXA 1YNOA 2J0UB 1R18A 4MYRA 3ND6A 3TAUA 2ZWAA 3RYIB 4MV3A 1JIVA 3HDJA 4II2A 2VJPA 3STYA 4YV2A 4EECA 3DL0A 2PE5A 1F5SA 1XTJA 4MKIA 3FCXA 2LD4A 4KYIB 1C9MA 1Z35A 2REBA 1EWRA 3FNGA 1XMPA 1IOLA 1PS8A 2QMZA 2Z5VA 4OUDB 5KSZA 1YAHA 5L6LB 1HDCA 2J9YB 1CS4C 1M1UA 1YL5A 4MQ6A 2EZUA 1Y9JA 3FPJA 3HGQA 3NWEA 3O8OB 1ONSA 4KPYA 2CXUA 1PUJA 3IAEA 1RYZA 1TT7A 2I2CA 4V0KA 2XE6A 3CXRA 1U81A 1T4GA 3HJGA 3PF8A 2R2GA 4ARZA 3BWVA 1IMOA 4KDEA 1QRUA 1BW9A 1BD3A 1BU8A 3OT1A 4H7HA 5H81A 2ZYSA 3TLYA 3B5JA 2H4JA 2HQBA 2OM2A 3GW8A 1JDJA 1GV1A 3PCTA 4LYJA 1T3TA 3FKSA 5EWJB 4YN3A 1OXXK 4A9AA 4FBGA 5C18A 3D6TB 2ZBRA 2B6NA 2C8VA 1ORWA 3DSRA 3DZFA 1GXSB 4DDVA 4PSAA 4J8PA 3NRJA 3D3WA 1G16A 3B1FA 1LZLA 4JFRA 3I9JA 2IZZA 5EXDA 5KNCD 4RIEA 2OGTA 1TFRA 4BLUA 4CUZA 3KTAA 2DBRA 2C4MA 1Z4PX 5LP6B 2OENG 3W5DA 1HEIA 5GIPE 2O4UX 2RHHA 1M7HA 4NDZA 2YV3A 2VPZA 3OIYA 4RTRA 5ED0A 3AY7A 4C7OA 2PGJA 3P7MA 3NOQA 2D6FA 1PP4A 1RI5A 1I1QB 4NYIQ 2OHIA 4FKMA 3RRMA 2E18A 3D1JA 2Z83A 3OF3A 3NP9A 1N1EA 2ZCVA 4O2RA 2R65A 5EC8A 3NM4A 3HN2A 4XOUA 3UJ8A 1SXHA 2FQ1A 3MJSA 3L49A 2YJ5A 2QLLA 4V03A 3T5AA 4TWJA 1A2KC 3ICEA 3BH7A 1YFJA 1N2CB 3QVVA 3HR4A 3MJFA 1ATIA 3RBAA 4LE1A 4EDFA 5I8ZA 1U7PA 4YUYA 2F9FA 1YJQA 3B1JA 5HFNA 2Y67A 4B82A 1AH2A 4K9SA 1BOFA 3GOHA 2GTHA 4RC9A 5EIEA 2DY0A 3FWZA 3ZKWB 1TA0A 2C2XA 4MUIA 3MQFA 4G89A 5DYYA 1FZQA 3SZ3A 1BOOA 4HN2A 2WQZA 4ARSA 2BV3A 4IIYA 1G9SA 2PXXA 1MQSA 2OCIA 5HZHA 1PTJC 1M2WA 2Q4OA 3DV9A 2PPLA 2W70A 3EXAA 3DOJA 3QA9A 1K8XB 1VPVA 4QVKA 2CZGA 2HCBA 4DEVA 2Z0MA 3JQRA 2V65A 2V6BA 1QV7A 5ENDA 4FR2A 4NHOA 3TTWA 3J81A 3TRKA 1DKLA 4F2DA 3OCJA 3UV3A 2CLCX 3R3JA 2NM0A 4HVAA 2RKBA 3FRHA 1UBJS 4A0GA 4XD7D 3VVMA 4XASA 5HF8A 3RC1A 1DIGA 3BEOA 3GZ4A 3PFFA 3SJCA 2R60A 1KRXA 5JJKA 3RVRA 3FHTA 1JU3A 1X94A 5HYVA 5KB3A 1T8SA 1UM9B 4Q9AA 4ODIA 4X6LA 4XZ3A 4YYZA 5EZYA 1E6KA 1E1CB 2PGAA 4K6MA 4HGZA 4XLLA 4I3HA 4I66A 1XDZA 2E0IA 4HQNA 1IEWA 2PUCA 3I42A 4W6QA 1XD2A 5EHQA 5CM2Z 2JFGA 2C42A 4YMSA 3P9SA 3L82B 5F52A 2A0KA 4P0TA 4EG1A 3OF2A 4PYQA 1S3SA 2GN6A 1G6HA 3RUAA 5TY0A 1U98A 1CCWA 1GJRA 2GK4A 4HVLA 2XDAA 2DFLA 3A6KA 3ZWPA 2REQA 3PNQA 4LJ5A 2JLYA 1EBFA 2XH8A 3EHEA 5K8LA 2JFQA 3PEWA 5C5DA 3VR3D 4GDMA 4O8ZA 1UK8A 3AF6A 4PTYA 1I3MA 4XH9B 2QLBA 1TA9A 1OLSB 4RUKA 3A3OA 2HRBA 1NATA 1C7FA 1Y81A 2H29A 3IGFA 5I48A 4BOYA 1MO2A 1XG5A 2QTLA 2VZ0A 3KSDO 2X5KO 1XHEA 3WBKA 3FYUC 2FJUA 3IBGA 1YRAA 5AYVA 1MRSA 2DETA 4BGUA 4JEHA 1AB5A 4OOEA 1MAUA 3QNMA 3P0HA 1ZK1A 2ZK7A 3HRKA 1ZKDA 5SZHB 2QMQA 3DWFA 2QXYA 1KU6A 2ZSUA 3N05A 1JLMA 3AB8A 4K6FA 4Q3LA 1BDBA 1Y8CA 5HFAA 1GTMA 2C92A 3SXPA 4D9BA 1KPIA 2JI7A 1RMQA 1KXJA 3VRHA 1CV2A 2DSTA 2VP0A 3BK1A 4MSUA 1NQOA 3CUUA 3JQEA 4OAQA 3UTCA 1ZJ6A 4BVGA 3BIJA 3DZHA 2EEZA 2VBCA 1N6NA 3F97A 3I4CA 4HPWA 4YJ3B 4YQEA 1HFJA 4NNPA 2AWNA 2BI8A 2XYRA 4LXUA 4RGYA 3DUFA 4NESA 1ZD5A 1G5IA 2NIPA 2VXOA 3FFWA 2HCFA 3ANSA 3IIMA 4AJNA 4ZO4A 3WWDA 1M34A 1SG6A 3HB1A 3NEYA 1BD4A 3O2QB 4Y6OA 3M3DA 5H3CA 4F1KA 4WLUA 1PWEA 3A7DA 3DD1A 2PGNA 3WSVA 5EJ4A 5IJ9A 1TL7C 2P9HA 3OUTA 1FNMA 3GMIA 4MPPA 2QG9A 1A4XA 3U4HA 4KKVA 4ISCA 4AZ0B 4GP9A 1UODA 2VDRB 4MK4A 4MP8A 3ST7A 4QUBA 3PKJA 3Q3CA 4R0MA 3E03A 2GYWA 4GOLD 5IBCA 2R47A 3ZI7A 1AHNA 1HZZA 1TYEB 3EPPA 3LD9A 3NUQA 2O52A 5DULA 5CB8A 2AKYA 2AZMA 1VA4A 4KU4A 3SG0A 1XFAA 3SHQA 3M1AA 4WZBE 4D44A 1DFIA 1FQKA 2HHAA 2TRSB 3GLHB 3P9ZA 4U7TB 3TZHA 1D0SA 1O89A 2NUPB 1K6JA 3L04A 1W87A 4JB0A 5JSZA 4W5JA 4RTQA 3A32A 3SXJA 1Z8HA 4IG4A 1QVAA 3LX6A 3BTUA 2VHTA 3HXPA 1E3LA 2VRCD 5HCUA 4H4EA 3VR2A 3ENWA 1CUIA 3SZLA 1EIZA 2MSKA 4Y2XA 4NH4A 1SOVA 4Y2YA 2YWXA 2XTNA 2GESA 1SZCA 2CHEA 2EL7A 2C4NA 4U7GA 4C2BA 4OXIA 2WMOB 1NLZA 1DG3A 2AOTB 2H3EA 4QD3A 4Q4JB 3Q11A 3VU3A 5A4FS 2VEDA 3PJDA 2RARA 2X77A 1KQPA 3P9KA 5AI5A 5AVXA 2JJMA 4C04A 2ZYAA 5JZVA 1XTSA 3SEAA 4D9CA 2XRYA 2WDZA 5FI0B 1LLDA 1MKYA 4E30A 4YAWA 5HF5A 3BMNA 2G28A 3NB0A 4EO4A 4JJ4A 3PJFA 1PL7A 3JY6A 1RHQA 3QKIA 5KX5B 1JFFB 3JPWA 3OPQA 4CG0A 2EP8A 4B7CA 1OILA 4YK7A 4X3PA 4B3JA 3OHSX 1V6SA 2GXUA 3UT5B 1YMUA 5CBPB 2XNCA 4LHXA 4AJKA 4AWAA 4BFUA 3VPGA 4NHEA 4X1KB 3ZE7A 3WLMA 1QG0A 3WDMA 5DPMA 1DO2A 3GVXA 4R1QA 4QYMA 1YR3A 3GJZA 3RUIA 5AVYA 3KXIA 1AIPA 1CB7A 1BX3A 1R9NA 4G5GA 5B1SA 1U7XA 5IG2A 3MUFA 3OX2A 4ZAXA 4G1UC 3CWCA 2C1XA 4CBVA 3V7WA 1KYVA 4OIFA 1ZVMA 1OX4A 1V1RB 4LYYA 1ORHA 3MJHA 1YS7A 2PU5A 4IXTA 1L5FA 3STWA 2NZYA 3LVRE 5AVVA 3OEHA 1X8JA 3OY7A 1SEPA 2FE1A 2LUOA 2TMDA 4KB5A 4LBYA 4NENB 4CMCA 1V16B 3I6BA 3QZUA 4W5HA 4DR6B 2ECKA 1UDAA 3G9ZA 1K7YA 1OAOC 1W2HA 1G59A 3G89A 1HV8A 2Y77A 4LOAA 1IUNA 1J2YA 3OZVA 1O58A 1T9GS 3FUCA 3MTEA 4XPIB 5KJCA 1A96A 3EF1A 3AG6A 1P9NA 2MU1A 3TLBA 3D8HA 4CEJB 5IKXA 1HQKA 2VLBA 2AFHB 4QBFA 3ZY2A 2WE8A 1X2BA 2B2XA 1ZIPA 2GO7A 3RSOA 4FI3F 1M67A 5CT5A 2ZYIA 5ECGC 1FQJA 2FW9A 1B14A 2N1BA 3G2JA 3JD0A 1L3BA 1RAGA 1NBMA 4HOYA 1GYQA 2JIOA 1XVAA 3GROA 4UCFA 1BE8A 2FSGA 1PSDA 1L1FA 5CCEA 1UL1X 1LPAB 1PR2A 3FFBA 4JMPA 5J2TB 2R62A 4A0RA 2HV8A 4TM8A 3HVJA 4DPKA 5C5EA 2V54A 3DHWC 4G97A 2ZQZA 2EERA 3NT5A 1BCSB 4NC9A 1QO9A 1G5PA 4Z9BA 2WY2D 2P1ZA 4KXUA 3M3HA 4LF4B 2IZ5A 4FHFA 4PAMA 3RWOA 3LNTA 2CUKA 3N2YA 2Q45A 1E1RA 2EBFX 2L2QA 1XNJA 5A0FA 5G2OA 3I1FA 5D8DA 4IDCA 2WSMA 2J3HA 2BDUA 1UPUA 2ZI6A 5B1HA 2JZOA 2M1ZA 4Y0VA 3PE6A 2KQUA 4TN1A 3N0RA 3LYHA 2GJKA 4RDIA 3TFOA 1EE2A 4HEQA 5F3RA 4XQGA 1G55A 3UBMA 4DLWA 4ND5A 4WBNA 3FETA 3HP4A 4J0HA 1FTYA 1PSZA 3CH5A 4EMUA 1XYVA 3K09C 4JR0A 3LUKA 1E63A 2H9YA 3JVUA 1F2UA 3DHNA 2QW1A 2Q4DA 1DPGA 5E9WA 3CRVA 4G84A 3OPNA 3B78A 1KAMA 4ZANA 5B2FA 4CMIB 2NT4A 1IUKA 4UVEA 2GFHA 2MOKA 4MVJD 3X1ZA 3LBIA 2ZTVA 3RI3A 3PNMA 3Q3HA 1TUIA 4IR7A 3WNZA 4ACAA 2JFOA 3L7CA 4L7QA 4M1MA 2J09A 1PDVA 3TOCA 5C8YB 4G4JA 4QGHA 3NWPA 2P2CA 1ZOPA 5LDDC 4JC5A 2AC4A 3EIHA 3F8TA 4C0BA 1VMKA 4QVGA 2AFIE 2YCBA 1CSEE 2C5HA 4Z7NB 1O87A 1NLMA 4JLBA 1GFIA 2PANA 2QXUA 3N8KA 2VAXA 4WDRA 3P71T 1Z0FA 5B58C 2ADOA 2PIAA 4WADA 4JITA 4ND6A 4YONB 3EXHB 4GX5A 5F76A 2O1WA 1P5RA 3JRNA 4ZK2A 4LJRA 2PGIA 5AKKA 4ZO7A 3H1BA 1CJKC 3KT8A 4NWIA 2BFCA 2A58A 5K3FB 1D4AA 2XGMA 5LD2B 2EWVA 4J03A 4NH0A 5BVGA 3BTSA 2B9EA 2OAQ1 4G09A 3IQFA 4JUDX 1P18A 2FR1A 4B7AA 4DJJA 3PICA 3AT1A 3K4PA 4FFLA 3OQNA 1P1JA 3E3OA 4NYIR 3GT3A 1K2VN 3AKCA 4HAXA 5K8VA 1VS