4HLCA

Sulfonylpiperidines as novel, antibacterial inhibitors of gram-positive thymidylate kinase (tmk): compound 5
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
202
structure length
195
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Sulfonylpiperidines as novel, antibacterial inhibitors of Gram-positive thymidylate kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 195
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hlcA00
2YC2C 3L8YA 4DEYA 3P32A 1ZNZA 2FOLA 1BYIA 4Q1FA 1ZCAA 2VSFA 3L43A 2AX4A 4Q19A 2F43B 5FR1A 2WPDD 1JBKA 1DTSA 2P5SA 2QN6A 3U4QB 2FG5A 4NP6A 1E2PA 5EXTA 4W7SA 4G5GA 4HAVA 1W48A 3QPWA 4O0MA 5HTKA 2F3TA 2RKOA 5FR2A 1NVVR 2FEOA 4MUBA 1JR3E 4TWZA 1E9SA 4DEXA 3AVTA 5E7MA 4TMXA 4EJSC 5C1BA 1AKEA 2O0KA 4MKIA 1KO4A 1AM4D 2AHOA 3AVXA 1Z0FA 1MO6A 4QKQA 3GLFE 2B21A 3QUSA 3R7WA 3ZZTA 2DBYA 3I5YA 1N25A 2AD1A 2GK6A 1T8UA 4BEBA 2B6HA 2HXYA 3VQTA 1KDTA 2WMOB 2YZ2A 4PZYA 1XTJA 2O8FB 1XJCA 5FI0B 2R6FA 1YVDA 2EFDB 3TKLA 2ZR7A 3MRSA 4ZDIA 1YRBA 2OBLA 5FBLB 5L3SA 4W9MC 4KFTA 4QBHA 1N6PA 4HI0E 3A1VA 5DYIA 3E70C 1KSGA 3EARA 1XTSA 3K0EA 4EFLA 3AH8A 2JIZD 3WYAA 2BMFA 4MYHA 4GSYA 4JLJA 2UZ3A 3SYLA 1XB2A 2KBFA 2RMKA 3A37A 5IT5A 3SBEA 4NONA 3MFYA 5JSZB 1VYVA 1G8YA 4MYCA 1FQKA 1RJ9A 2HF9A 2QE7D 1KY3A 5DIFA 1AIPA 2G1JA 3K1JA 3TE6A 4DLXA 4WZ6A 4DDTA 1US8B 3W34A 2EQBA 4B3CA 5FTKA 5JRJA 2PZEA 2VBCA 4GL2A 2ZM5A 1UKZA 5J4VA 1VCOA 2JIZA 4DVGA 3CF0A 1N5IA 1XD2A 3FHCB 4FW9A 3VR1A 1IXRC 1EFCA 1OPXA 2ZVQX 4V02A 3BFKA 2QT0A 2ZRPA 5FTJA 4DSTA 4P4UA 4BRWA 3T5GA 1RRPA 2NPFA 1DAFA 1HV8A 1GKYA 2OZEA 4IOJA 3RSLA 1ESNA 3MWKA 3B5JA 1NN5A 2V6IA 1G8FA 1Q21A 2YV5A 4HZUB 3DM5A 5FBRB 1D2MA 3AM1A 3I92A 1E79A 1ZIPA 1NIJA 4IDQA 4ESVA 3VKHA 1ZNXA 3CX6A 2OESA 4QGGA 1U2RA 2F6RA 4OYHA 3RLFA 2A5FA 3ZLJA 2OXCA 1D2EA 3RANA 4JL5A 4BUJA 3U44A 4TZ6A 2RGCA 3OIVA 5B30A 2R6GA 2ZU6A 3B1YA 1KI3A 1Z47A 4KLNA 4A82A 4I1SA 1YZGA 4LJ8A 4RD6A 2UZIR 1LW7A 5EP4A 4M1MA 2KSQA 2RGNC 1I4LD 4A36A 2QMUA 3A58B 3Q7PA 4MGKR 2VH5R 3IGFA 4LYAA 2ECKA 1OV4A 2W0SA 1CJUC 2QGNA 4JZKA 2BC9A 4ARZB 4BLRA 1HA3A 4QBGB 2IS1A 2JATA 3G5UA 1KK0A 4CEJB 1XZQA 5KU1A 3ECCA 3MWJA 1GVNB 4PPGA 2ZRHA 3A1TA 3T35A 2OLKA 3DOFA 5JWRA 1KY2A 2O0HA 4KYIB 2GXUA 2R6AA 4ZKEA 4M9QA 2QRZA 3OIYA 5J47A 2VIIA 2ZROA 1FNMA 1VHTA 1E1QD 1A7JA 1WQ1R 3PITA 2YWHA 2WM9B 4DLTA 3NBZC 4O3MA 4WZAE 4CT5A 4AURA 1X86B 3SU8A 3RHFA 4JSYA 1YZNA 3B1ZA 2GJ8A 2QEQA 3OEHD 3BIFA 3LRPA 2NZ8A 3QI2A 4IRUB 1JPJA 4EPTA 4PAMA 3X2SA 1NVVQ 3THXA 2Z6VA 4MH0R 2JGNA 2ERXA 4URYR 2O8EA 5FUYA 1GM5A 1CIPA 5FBQB 1W47A 4IDHA 3PG5A 4H1UA 1MABA 3NC0C 1RIFA 1Y63A 1N0VC 2WWWA 5BXQC 3FHTA 4PC1A 1E1QA 1DADA 4QOSA 1TU3A 4LJ5A 4AD8A 3PIRA 5B57C 1OE0A 1AN0A 3C5HA 1VMAA 1TQ2A 2BIFA 2NTYC 2OFWA 1JNYA 2WIAA 2REOA 1T6NA 1JEDA 4XSGA 5JFGA 4IKEA 4EPRA 1KMHA 3KKMA 1PLKA 4Y0AA 4B44A 5LPNA 2PX3A 3LLMA 4P4TA 2ZE7A 3WP0A 4DDVA 2GEDA 3IO3A 1KDOA 2WJJA 3LQRA 3I5XA 1P73A 1FUUA 1K6MA 3CNLA 5FTNA 1WRBA 2A7QA 4I1OA 3T06B 4BFXA 3LWNA 2ERYA 2VRWA 4TLCA 2A5JA 3AUXA 3CRMA 4MRSA 4AIIA 1M1YE 2ZRKA 4LBWA 3AGQA 4B3FX 2ZRJA 2OBNA 3R8CA 4NCJA 3M0EA 4A8JA 4URXR 3ADKA 5KNCA 2F55A 4CZ2A 2BMJA 4LWZA 1ZU4A 4TYQA 4IDPA 4ITRC 3KXIA 4FN5A 1UBGA 1YQTA 4LGMA 1IN7A 3QNUA 3NH9A 1RVDA 1P61B 1Z6XA 2I1VB 4G01B 4R7ZA 3X1YA 4PHFA 4MKHA 1P6XA 4WIAA 1CJTC 1OXXK 3ZYCA 3MG9A 1C1YA 1J70A 1BO6A 1M6NA 4OK6A 4E5UA 1UPTA 3MCAA 4A2PA 2B8TA 3AEZA 4MUAA 4L8GA 4FIDA 3FB4A 1V43A 2ZYUX 1VYUA 4XIGS 2Q9AA 3THWB 4DCTA 4GOJA 2FPLA 1KI1A 2PMDA 3QEOA 3A6PC 1L7VC 1DAHA 2VP0A 1QRAA 3SJBA 2IYZA 2GBLA 4UKDA 3O8BA 4TMVA 2OSBA 4M53A 4X8MA 4HB2A 4YMTA 4ZIRB 5KSYA 3BOSA 3K0FA 2GXSA 2ZRAA 3ASYA 1TPZA 2XTNA 5E7JA 1OT3A 3VHLB 1SGWA 1KTVA 2HF8A 3QIAA 4D82A 5FPYA 2ORWA 2VLIA 3KDSE 3PV0A 2NGRA 1YKSA 3HPRA 4V0MA 3BJIC 2R8RA 3OE7A 2XXAB 4BFSA 3UPUA 3K0AB 4EQ6B 1E2HA 2CVFA 2WJIA 4LC1A 3TW4A 3K70B 4O25A 5GADl 1DOAA 1RRFA 2BV3A 4UXIA 2IS2A 4D25A 1G17A 1UBFA 4PQFA 1DAEA 3KTAB 4FCTA 1NLYA 1Q1EA 4DCUA 2RGGA 1TQDA 4JL8A 4TSFD 3QG1A 5JEDA 5KPJA 2EYQA 1IAQA 4TQUS 5BWMA 4ZDJA 4R71A 1QHIA 4V0KA 1ZU5A 2G3YA 2CL6X 4DDWA 4DKXA 1MRSA 2ZIAA 5HZHA 2V8OA 5FTMA 4D80A 3OIUA 3Q7QA 4UXJA 2DWQA 4DIEA 4X8LA 4JBWA 4KO8A 1QHHB 3B78A 3CM0A 3CRQA 4PR0A 4MRRA 3B9QA 3X1XA 4YXWD 3LDAA 2VP4A 2WVJA 5DSZA 3NH6A 4B2PA 4TL9A 2H17A 3TNFA 5FL7D 621PA 1XD8A 4LBZA 5GJBA 2GXAA 1LNZA 4PO8A 4QFMA 3P26A 1G3QA 1VCNA 1XEWX 1Z6AA 2BHRA 4XOIA 5H1YA 1Z6YA 4PC7A 1NIPA 4BQSA 1W7AA 3RWMB 2H92A 1E0AA 1OIVA 2D7CA 1ANKA 2BMDA 3NIBA 4YXWA 4Q7KA 3Q5EA 1KI9A 4TT3D 721PA 5CK5A 2VSOA 2L0XA 221PA 4ESHA 1DO0A 1H8HD 4C2TA 3VNVA 3AQ4A 5KDOA 2CE2X 1OYYA 1W5TA 5EP3A 1DG3A 4PSKA 2ZSAA 4XVQA 2ZETA 1ZCBA 4NYJQ 3NEJA 2ZRBA 4MGIR 3KJIA 4JLOA 4DBLC 4U7DA 4PFSA 3PEYA 2Z4RA 2XNSA 1ZRHA 5FBVB 3JZMA 3ZVRA 1TL7C 4BFZA 2JLVA 1CBUA 5GJCA 4M4SA 5D3MA 4F7WA 1AZTA 1GL7A 3P1JA 4Q1AA 2WMNB 3U5ZB 4BPBA 1TEXA 5CDFA 4CW7A 4JJZA 4PQRA 5UKDA 3NVAA 2JASA 2CE7A 2QM7A 2JJ2A 4TQAA 5B58C 2ZS7A 1AA9A 2CLSA 4D4JA 4DUGA 1L4YA 3KXKA 2X19A 4TN1A 3VR6A 3NWJA 5GJWC 4C0AC 2GVDC 1W4AA 1IOZA 3ONWA 4NYMR 2OEPA 1BH2A 1TEVA 2B8WA 3C41J 4PC2A 1JR3A 1SVWA 1XP8A 2V55B 2J3EA 3LVRE 2SHKA 4GP6A 4GDFA 2DWPA 3EG5A 1N6NA 1S96A 2NO0A 3I4LA 3WY9A 4ZO4A 3UANA 1SXJD 3RC3A 1Z0JA 4LHXA 1JXMA 2PH1A 4IFBA 3CIOA 4AY2A 4E09A 5EE9A 1EXMA 2QSYA 2YYZA 1YHNA 2BBTA 1CRQA 2FSHA 2Q0HA 1F2TA 3AVYA 4C3ZA 1DELA 1OSNA 5H70A 3FMIA 3ZQJA 2ZSFA 5CITA 1Z07A 4JYBA 2GXQA 1S4QA 1J8YF 3IHWA 3OHMA 2XEXA 5KDDA 1EX7A 2DB3A 1P75A 4M9XA 2AXNA 2VHCA 4OBEA 4Q5IA 1S9DA 5FOWA 5FOVA 1W0JA 1SKYE 2WAXA 3KUCA 4FMBB 4DLSA 1Z2CA 2ZR0A 1E69A 4H9GA 3CF2A 2V6JA 4HDQB 3DVLA 2IEZA 2XTZA 3VR5A 4MDEA 2V4ZA 2PEYA 3THOA 5SZIA 4QJ5A 4WW0A 2QBYA 3IIMA 3DMNA 5J4LA 5HE8A 3T1TA 2NPIA 1BYUA 2KE5A 4DSNA 1F6BA 4DLZA 4LJ6A 4DXAA 1XJQA 2EWVA 4BEJA 1TX4B 1CR0A 3QKSA 5EE3A 5P21A 4A9AA 3MWLA 5J40A 1IY2A 1L4UA 1P2TA 1E2GA 1BKDR 1MO3A 2FEMA 3DEFA 3DPUA 4PAQA 1CP2A 3CRRA 3U2QA 1FQJA 3C8UA 1ELOA 2QG6A 3LBHA 1OFHA 4KODA 4Q66C 4I1UA 4NCHA 2V9PA 3LX5A 3ZH9B 2JLXA 1U9IA 2IW3A 1GFIA 1X6VA 4PC6A 4LX0A 2DY1A 3GLGA 2HJGA 2P67A 3U6KA 2OM2A 3G82C 3BXZA 1JECA 1GILA 3PVSA 5BYJA 4P32A 1I2MA 2B92A 4IVPA 2C9OA 4Q7JB 4BLTA 2J9RA 4DSOA 3CPHA 1NN0A 2MSEB 4X8HA 1EG7A 3BB1A 2ZXUA 2J46A 2NO7A 4KHZA 3GD7A 3TUZC 2J41A 1OF1A 1WP9A 1N3BA 1P2UA 4E22A 5KNDA 3LLUA 3ND9A 2CMKA 1RKBA 3CLVA 4R2IA 4D81A 4DC9A 2RHDA 3U4QA 1NBMD 5EZ5A 3CZQA 5KO2A 2W6JA 2EFHB 4IEIA 3CRW1 4I1VA 4GI7A 3SHWA 5DGXA 4JVLA 1CTQA 2WJYA 3ZS9A 3VR4A 4D0GA 3VKGA 1Z63A 2GNOA 1SHZA 5LDDC 1W4BA 2H18A 2XOKD 3GJ7A 3IUYA 1E2DA 3N5CA 2J0UB 4GMDA 2J7KA 2VL7A 1YR6A 3KKQA 3W9YA 2Q3MA 1Q44A 4XTCS 1K5DA 1XXHB 3LH5A 5DI3B 1E9CA 4N0EA 2GEUA 3ZD6A 2IS6A 3VHXA 1NBMA 1GDDA 3B13B 5IK2D 5JLJA 4QGFA 1XEWY 3KUDA 4L9SA 3VX4A 4HATA 3GLIB 4V0ME 4JBXA 1NNEA 3AKEA 1U94A 2ZSDA 1F2UA 1HE8B 3KB2A 3EWAA 4JLDA 2CLDX 3HJNA 3CB4A 4QHTA 4DLWA 4NYMQ 1HE1C 2N1BA 2KBEA 1NSTA 4RZ2A 5TVKA 4DLYA 2WZQA 3OAAA 5CIQA 4URWR 1W36B 4PQYA 4C0KA 2QAGB 4JJKA 1ZM9A 4FCWA 4CIDA 4Z1MA 3Q5DA 5JSZA 2TMKA 1XPRA 1E9AA 4P4SA 3K0SA 1VECA 1G6HA 5ELXA 3GCGA 2GJ9A 1NL3A 1N6OA 2XJ4A 3KKNA 4BASA 2QSZA 2VTKA 3F8TA 3BD9A 1KNQA 1MH1A 4MYUA 3TBKA 1UAAA 2RGDA 1U8AA 5EUMA 2GF0A 2WJHA 4LJYA 3R8FA 3J81k 1HQCA 1NF3A 2EW1A 1M34E 4TTRA 2ZI6A 2CK3D 4AKGA 5G41A 3H84A 4US1R 5KOYA 2XAUA 1E99A 4LJ7A 5DN6A 1GWNA 4HZUA 2EVWX 2CXXA 2BEJA 1N0WA 3RYTC 2NO6A 3U6BA 2R6CA 4OHVA 3CPEA 2G0NA 4YDHB 4C0LA 2QTVB 5JEEA 2J59A 4DT1B 4HYYA 4A0RA 3TGPA 1QBKC 4C7OA 2JLRA 1UKVY 2A5YB 1ZW6A 2BBSA 2IUSA 1KKLA 1ZYUA 4S2EA 2MSDB 5FL3A 2QQEA 3WHLA 1KI7A 4R2HA 4ZI3A 1RYFA 1KK1A 4B3GA 3K9HA 5FUVA 1IN8A 2Y8EA 2ZUDA 4P31A 2VHUA 2G6BA 3REGA 1R2QA 4LRWA 3SYKA 1XRJA 2ZVPX 2QMEA 2ZAOA 3TUJC 1VG8A 1IM2A 1XF9A 1AS3A 2IK8A 1XTKA 3L0IB 4LHYA 1E2FA 4NU0A 5AUOB 4ARZA 3GP8A 5JJLA 2F3RA 2OXRA 2V7QD 2E1RA 2IUUA 3UWOA 4MGZR 5HPYB 2WWXA 3BERA 2CL0X 1Z83A 1L2TA 2Q3FA 4PTLA 3BH7A 3WYFA 1V5WA 1G3IA 1W2HA 4BLOA 3EZ2A 1DEKA 3THYB 1G4UR 4BLSA 5CDFE 3SEAA 3L2OB 5JWHA 2BCJQ 1NN3A 5AWFC 1D8TA 1Z08A 5JI2E 4C0SA 3RRYA 4Q03A 4F4JA 4O2RA 4JKYA 3UMFA 1VKJA 4OJQA 2O52A 2AKYA 2GJKA 3BORA 3H0KA 4DRZA 3D7MA 4Q4JB 1RRCA 4EJSA 2O8CB 4BZPA 2YKGA 5HR5A 1E4YA 5KUTA 4CRWB 4K81B 2AK2A 4BFUA 1GG2A 2WPDA 4PHGA 3T1OA 3QG5A 2ZE6A 1IBRA 1JAIA 2ZPTX 5TY0A 4HZIA 1PLJA 3S1AB 1W0KD 1Z8FA 2K5UA 2N42A 5EE1A 3ZVMA 4IHQA 5C18A 1X8KA 4DIDA 1WBBA 4I99A 1RC8A 2O0JA 3QQ5A 1GRNA 2JLYA 3QKRB 2QP9X 2ZQ5A 2YJTD 1XFAA 6Q21A 1AJEA 2PZGA 1A2KC 1R0XA 1P7CA 4W5HA 1DARA 3QPUA 3HU2A 2XGJA 3OEED 2ZR9A 3QF4B 4AKHA 3DZ8A 3IHLA 4ZCMA 3EPJA 1W49A 1XEXA 4UNQA 5E95A 3PUZA 1U0HC 4RFSA 4BWYA 5A0FA 3GQBA 2VP9A 3CW2A 5AK0A 1W4CA 5CJ2A 4YONB 2GK7A 4M0LA 4M8NE 4RFVA 5JMTA 1E3MA 1GNPA 4Z8XA 2Q3HA 3IKJA 3GLHB 1D9XA 4DJTA 4M9SA 1Z3IX 1COWD 3OFND 5AR1A 3CH4B 4HDCA 4E07A 1E2IA 4ACBA 3IEUA 3QSYA 1JJ7A 1G7CA 1C4OA 3I61A 3CNNA 3T1VA 3OEEA 1N5LA 1XMIA 4TTQA 2P6RA 4U02A 3W6PA 2F1RA 3SC3A 3CR8A 3OF5A 4GPTA 2H5EA 2OLJA 2QE7A 4QGHA 2BBWA 1Z6GA 1XNJA 2GZHA 1OXTA 1KO7A 3RS4A 5ANRB 1P5ZB 3WXMA 2GAOA 4ZI2A 3GLGE 1M7BA 1KJZA 1EGAA 3LW8A 3U7FB 2D4HA 2GCOB 2NOAA 4ZDWA 5L3QB 1YZQA 4OI4A 3TVTA 3EIHA 1FZQA 1OH7A 3VKWA 4F38A 2IWRA 4NCKA 2NO9A 1YRAA 1GRQA 4Q4AB 3A4NA 4W5WA 1E2QA 3P27A 2IYXA 2A5DA 3B1XA 3K70D 1Z0IA 1OXUA 3LBIA 3AGPA 3QENA 3QY0A 5LBIA 4FD2A 4BZXA 4EIWA 4CEIB 3GFTA 2RGNA 3LO5A 4ZIRA 2WKQA 4V0LA 3NXSA 4GZMA 2F9LA 2QUZA 1SZPA 3B2EA 4GBMA 3T15A 4TZ0A 5A4JA 1ETUA 1UADA 3B1WA 2OBMA 4HB3A 1RW4A 4OHXA 5DH9A 4QM7A 4Z8YA 3NBYC 3WHKA 2D2EA 2RB4A 3ZIAD 1JQJC 1Z22A 4C2UA 2WTUA 3AVOA 1T3SA 2IYYA 1G4AE 2X2FA 4V0OA 3K70C 2VO1A 4OK5A 2AR7A 2IX3A 1FL9A 1TUIA 3QVUA 3Q8XB 2VPPA 1Q57A 3EW9A 3QJYA 3JZAA 1OH5A 2JDID 2DWOA 4HAYA 1NBME 1XX6A 2ZSBA 1NG9A 3MAAC 2CNWD 1F60A 1S2MA 4LOAA 2REBA 4B2LA 4BFVA 3DKVA 3JVUA 5TDHA 1G16A 4G5OA 4JYCA 3TAHA 4TL7A 5F9HA 1N0UA 1GAJA 1ZUNB 3VMFA 3CWQA 3PEUA 4LV8B 2J7PD 2J87A 4QJ4A 2HCJB 2GWHA 1E2JA 1WBDA 3FMOB 1LB1B 4HSEA 4TYPA 3HDTA 3LNCA 3L8ZA 3ZGXA 4OHZA 3I32A 3RC8A 1G8HA 3C4JA 4PSVA 1KI8A 1Z2AA 3K0CA 3K0CC 2C9YA 2PLFA 3W90A 1B23P 3PENA 1G41A 1PLLA 3A1UA 3L0PA 2OE2A 3OEHA 4M1KA 4KFUA 3O8DA 3UMSA 4D2IA 4TYNA 3RVBA 3AKDA 5BW8A 1H65A 3DL0A 3SR0A 1AKYA 1NVWQ 3B7GA 2QM8A 1RZ3A 4L16A 3BFXA 4ZDKA 2R62A 1ZUIA 1JEEA 2H1LA 1KSFX 5LD2C 1CJKC 1LVGA 3GFOA 1ESMA 2ORVA 2IUTA 3QKUA 3CX8A 4P33A 4D6PA 4EDHA 3P4XA 2W0MA 3U3MA 2GESA 2YVUA 4Q18A 1P60A 4MKGA 3TQFA 1Q1QA 5L3SB 3EWSA 2VYFA 1CR2A 3Q9LA 4JKIA 4ZV4A 4HAWA 4RD2A 5KHOC 4UJ5A 1I4TD 3U7GA 1EWQA 4JVNA 4ZCIA 2AKAB 1TQ6A 2C99A 2DR3A 4BZQA 4IOKA 2ODBA 1GIAA 2RGEA 1T5LA 4NYJR 3KX2A 1A4RA 5C2JB 2FSFA 1E2NA 2BEKA 1EFTA 2C96A 1Q3TA 1CJVC 3FHOA 1RJ9B 3NTUA 4JLNA 2JEOA 4NPHA 2HDNB 1U98A 4UNRA 1VDZA 3EPLA 1XDBA 2HT6A 1LY1A 4NCIA 4PZZA 1TTTA 1WMSA 4IOLA 4OQNA 2WSMA 1FMJA 2VF7A 3GFPA 4Q48A 2F9MA 1XTRA 5C46F 1XD2B 3FFBA 1RYHA 2QNRA 1SVSA 4B76A 5CYOA 4OKSA 2FV8A 1M2OB 2G0TA 3IPXA 2ZRDA 4ILEA 3RDPA 4AI6A 3BGWA 1FX0B 4L15A 1E9EA 2DFKB 1G1MA 1S8FA 2AN9A 3ZJYA 3U3RA 2NO1A 1DE0A 1Z5ZA 3VR2A 5CIWA 3KFVA 2W83A 1QHYA 1UDXA 5BQ5A 3TAUA 4OJKA 1MKYA 5FUWA 2P6NA 1D2NA 2QY9A 2QAJA 3IO5A 3RS3A 2IYWA 2G83A 1TQ4A 3ICQB 5FPHA 4A6XA 1E2EA 4UNPA 2GF9A 3QPVA 1RE0A 5EE0A 1WB9A 1G3RA 1VHLA 1N5JA 2VHTA 3SI7A 1WF3A 3I73A 4Q21A 4Q47A 3WMFA 5JRZA 1NN1A 4KV9A 4UQOA 4HB0A 4US0R 3QKTA 4MGYR 4Q02A 2WJGA 5JHHB 1KDRA 4D4LA 2BBOA 4PO9A 2OO7A 3M6AA 1QHSA 2PCLA 2ZYWX 4LPSA 3WRYC 2GZAA 4FMCB 5HE9A 3C15C 2IXGA 3OIWA 1E98A 4A15A 1J99A 1SULA 3IIKA 2CVHA 2E87A 2ZUCA 1NSFA 4J0QA 3L0SA 1VG9B 4LBVA 4U00A 5DLQC 2BOVA 2AD5A 3UK6A 4LCBA 4L5BA 1R10A 2R44A 3V4RA 8OHMA 2JCSA 2GVZC 3F3YA 4FXPA 4TYWA 3VTKA 2HJVA 3MSXA 1DAMA 3GJ5A 3W8RA 4FMDB 2XB4A 2CDNA 2REXB 1G9XA 3C16C 2WSSD 4PXAA 3UIEA 1G20E 1P9NA 4TSFA 1HYQA 5G40A 4LJ9A 2FSIA 4H1VA 1IN4A 4KYUA 4LHVA 2XZPA 3UWKA 5E3HA 4I4LA 2J1LA 3AF0A 4KITB 1PJRA 4B73A 2CBZA 4XD7D 5KPDA 3W5IA 5SZKB 1KMQA 2C03A 3DO6A 1EFRD 3VX3A 3THXB 1G7RA 2O8EB 2FMXA 1LF5A 3PR1A 4L4UA 3UKDA 4IXMA 2A30A 5FOTA 1YZTA 1N6IA 5KNBA 4KJZA 1J8MF 1MABB 1EFHA 2WSSA 1G5TA 2RAPA 2O8BA 2BMEA 2Z43A 1SKYB 2FDCA 4RZUA 1G21E 3B1VA 1A82A 1KI6A 2P6UA 2XNDD 2J0VA 1OKKD 5JZVA 1TNDA 5FL7A 2QTHA 1EFRA 4F92B 2R6DA 4CF7A 3PJRA 3NKVA 1KMHB 4QJ3A 1ZNWA 4ASUD 3R9XA 4GMXA 2FE4A 2C2HA 4AK9A 4EFMA 5JBQA 1GL9B 5CK4A 4MQBA 1JQLB 5CLLA 3QF7A 2RGAA 4XJXA 4LPKA 4LHZA 1U0JA 5J4HA 5IRCD 3EZFA 4TT3A 3IEVA 1OKKA 3VU9A 3SQXA 1II8B 3A1WA 1W36D 1H8HA 2PX0A 1E0KA 5CB8A 4A8JB 3AVVA 1E2MA 3GMTA 3ZZUA 1WDTA 1YR8A 4FI3C 4XVRA 1HEIA 4IDOA 2QZ4A 2HXSA 2ZJ5A 3FKQA 4DDUA 1RPZA 1HT1E 1Z6TA 2OHFA 4Z51A 5JJIA 1R8SA 4WZBE 4WA7A 1Q22A 3AUYA 3TSOA 2ODWA 5G3YA 3FE2A 1X3SA 5TXGA 1YZUA 2H57A 4F91B 5J5CA 3LV8A 5BN5A 2WOOA 1KZGB 1ZP6A 3FPAA 3GJ3A 4UNNA 1KYIA 3P20A 4YDSA 4K46A 1IY1A 1BMFD 2EWWA 3KQUA 3ZD7A 2JLSA 3BFVA 1NG1A 4JL6A 4V03A 5CLQA 3W5JA 4LYFA 3SDZA 2DFLA 1KI2A 1YU9A 1LS6A 2YWEA 3RSOA 3EZ6A 1YZLA 1VG1A 1T91A 3T34A 1I2DA 4EPXA 2EFGA 4CEHB 4C9BA 4TLDA 3R20A 4MRVA 1SXJA 1SXJC 3CR7A 3K0FB 2ZE8A 4B33A 1IXSB 1EESA 3ADBA 3I1FA 3GJ8A 1R5OA 1OFUX 3FTQA 1PVOA 3C5CA 4B35A 3RNLA 3I62A 1ZM3A 2CJWA 4NH0A 2FGKA 3BE4A 1OH8A 4DT1A 3GEEA 3LAWA 4II7A 1K5GA 2GJSA 3HU3A 1AGRA 4B3BA 5IF9A 2NIPA 1BOFA 5D3QA 4B3XA 4AKIA 1OHHD 1ZD9A 3TVDA 2QP3A 1DAIA 5FPKA 1Q1ZA 1W4RA 2G1KA 1BS1A 4PPFA 2IF2A 1KKMA 2V1UA 2W00A 2MMGA 4YQFA 1GNQA 1NI3A 4IOMA 1CR4A 3SHFA 3L0OA 5F3WB 4LZZA 3EA0A 4RCYA 2AFIE 5KDLA 2RHMA 1J2JA 1FTSA 4WXPA 3FKSD 3DMDA 2WAYA 1WXQA 4NTZA 4DZZA 1VIYA 2YOFA 4URVR 4EUNA 1G3MA 2VP2A 4NMMA 2HLDD 1NP6A 3V9PA 4S35A 1XTIA 4Q4HB 1HT2E 1QHGA 4LBYA 1NRJB 4JSTA 3SFVA 1QHNA 4EKDA 1M7GA 1GKIA 3FGNA 2F43A 2WIBA 3EZ7A 4GRAA 2FPKA 1ZM2A 2HEIA 2P65A 3LW7A 1PZNA 4Q1BA 1NMYA 4A0FA 1P62B 5BYKA 1TF2A 4R9UC 4MYTA 5TB5A 1X8LA 3CWZA 2FPMA 1P2VA 1S9HA 1ZM7A 2P3SA 2FF7A 1CS4C 4A4DA 2CHGA 1N2CE 2KI5A 3KXLA 1VCIA 3TQCA 4PSAA 1UEJA 1QVAA 5DI9A 4MRPA 2FN4A 3U3OA 3RRNA 1Y3AA 3EPKA 2ZJAA 1KSJA 3A8TA 3DHWC 3HWSA 4JMPA 3TK1A 1S3SA 4O2LA 4GFDA 2GILA 4Q1DA 5G3ZA 1QZXA 1OFTA 1F3OA 2O8FA 3S1AA 3U7EB 2C98A 1KI4A 1VIAA 2EU8A 2QQ0A 3LXXA 3KJHA 3IBYA 4RZ3A 1VCMA 3OESA 1SKQA 2HCBA 2QGZA 1ZNYA 2Z4SA 3BWDD 2XOKA 5E7IA 4B75A 2V54A 1KZ7B 1GKUB 4MA4A 3RS0A 1IJFA 1W2GA 1PUJA 2V3CC 1Q0UA 4FWIB 4CGZA 1AS2A 4LSGA 1TF5A 3FWYA 2D7DA 3O47A 4HUQB 5AJVB 4RVCA 5IK2A 1OW3B 1E9BA 4GOKA 4B2IA 4HAXA 4LJAA 5KTYA 3GLHA 2VQSA 1P2SA 3NBXX 5AUPB 1US8A 2BWJA 2HV8A 5FUXA 2ONKA 1UM8A 2QP4A 1O87A 4M1OA 4KLZA 4G5QA 4GP7A 4MRNA 2ONJA 2O8DB 3TSZA 5JWOA 4BFYA 2X8AA 1GSIA 4CYMA 2RGBA 1KK2A 3REFA 2ODNA 4KVGA 821PA 1KAGA 2ZJ8A 3GEIA 4URUR 3DOEA 4JVMA 5JCPA 3GLFB 2ZRIA 3NDBB 2BKUA 3U61B 3UATA 4HDOB 4DLUA 1JJVA 2ZANA 4LYJA 1SQ5A 2PT7A 4RD3A 2QA5A 1E9RA 2VEDA 1HH4A 3NC1C 1K8RA 4XWKA 5J4KA 2UKDA 4MKFA 1OFIA 1S3GA 2P0EA 2PT5A 4ZPXA 4XWOA 2IC5A 5CB6A 2C78A 1DAKA 2ORIA 2ZRFA 2RCNA 4DLVA 5FH9A 4PX9A 4TLEA 2WHXA 1N5KA 3QXJA 5G53C 3U3KA 3LVQE 3BB4A 1GNRA 4EPVA 2W2VA 2CK3A 2VSXA 4MITA 2Z83A 3X1DA 4MDFA 5HZKA 4Q00A 3RRMA 1TADA 2F7SA 2CLCX 4N1AA 2XZLA 2FSGA 2OUKA 1N6RA 2WKRA 4LY6A 2CHQA 4B74A 2IWHA 4CEIA 1N6KA 3F0TA 2QBYB 4C30A 3FFAA 3ZVLA 2FNAA 3H86A 1Z0AA 1UF9A 5DISB 4QHSA 3KQKA 3QKSB 3GEHA 5IDVA 4CEJA 1AS0A 3O8CA 4PAOA 4BGDA 1DG1G 2WWGA 4Q01A 1XJ0A 5DE3A 1RRGA 1Q3HA 4U5XA 3U60B 1II9A 1TF7A 1ZM4A 1R6BX 3QBVA 3DZDA 5SZHB 1F48A 3SJAA 3SE0A 3QVVA 3TW8B 2PBRA 4AYXA 2OAQ1 1XXHE 2GDJA 5FOSA 1XZPA 3GLGB 4LV6A 1W46A 2JA1A 3EC1A 4D4MA 3KJGA 1GP2A 4QRHA 2YOHA 4TMWA 4JLVA 5BN4A 1X1RA 2V7QA 4M21A 4Q7MB 4XVUA 1P9WA 3QEJA 2CEAA 2F1HA 1JALA 3MMPA 2CCGA 3QE0A 3KZ1E 2IA5A 2FX3A 4LC0A 2R2AA 4Q1EA 4OQLA 3ZZ0A 3D31A 2OFXA 5EXPA 3HR8A 2YINC 4KBGA 4QNMA 4Q9JA 2FZLA 3TSWA 5B2ZA 5KYKA 1CF4A 4DCNA 2G88A 2QMHA 3Q85A 1XMJA 3MJRA 4LDJA 4GNKA 2QROA 4XSHA 3K9LA 2XJ9A 521PA 2GKSA 1JPNA 4UJ3A 2H7VA 4Q9LA 1IXZA 5SZJA 3CONA 2BM1A 4TMKA 4JLPA 4QNRA 2AK3A 5GVRA 1NJGA 3AVQA 3TIFA 3UXMA 2GTPA 2IYRA 2C8VA 5K8TA 1SXJE 5EXSA 2WWHA 3CZPA 1CXZA 2W6ID 3AF3A 1IQPA 1UJ2A 3EASA 4ERNA 3K09A 1W0KA 3K09C 2RGXA 5K8UA 2GAAA 5JJKA 3WMEA 1F2UB 4TMTA 5J4YA 1ZJ6A 3ICEA 1D9ZA 2O5VA 1MR3F 1EK0A 3HU1A 4UXHA 1XTQA 2ZI9A 3VR3A 1Q12A 3EC2A 4M9ZA 4A2QA 2W6IA 1AQUA 2JLQA 3KQLA 4A0GA 1E32A 3DM9B 1HTWA 1JR6A 3QOFA 1XCPA 4P4SB 4A1FA 4DHEA 3C14C 3ZVNA 1LTQA 2NZJA 4I81A 4JLAA 2GCNA 3EX7C 4HAUA 4F4CA 2OFOA 3OFNA 1COWA 1E79D 1D6JA 2C9CA 2LCFA 5LB2A 3PEWA 2ZS9A 2IXEA 3QXXA 3TRFA 3UG6A 1E2LA 3FYHA 3M4YA 1S1CA 2FFBA 5C4GB 2QRNA 1P9RA 1NVXQ 3W6NA 4M1WA 2KB0A 1TU4A 3THWA 3I72A 1T8TA 2ZEJA 2ZJ2A 1FX0A 1XD9A 4QBIA 2QORA 4IEEA 1UFQA 3K8YA 5C4MA 2AFHE 2ZJBA 5F2EA 1IJEA 2D06A 1KSHA 1XEFA 2LKDA 1MV5A 1E9FA 4F93B 2BVNA 2LKCA 4C7OB 2JLUA 2FH5B 1HQYE 3BBPA 4Q9IA 1YR7A 3SJCA 1GUAA 2A9KA 3B60A 2NQ2C 3F5FA 4PANA 2YHSA 2GEVA 4OI1A 4YMSA 2XXAA 1XMSA 2NG1A 2ASEA 2CCJA 3K0AA 1OYWA 4N0DA 4EQ6A 2W2XA 2JLZA 3MUFA 1OH6A 4IXNA 1OLOA 4HLCA 5AUNB 2CL7X 2WJVA 3AVUA 1KHTA 3RS2A 3ADDA 2WV9A 4OL0A 3KTAA 1G6OA 1U8YA 2CCKA 3MLEA 2ZU0C 3SOPA 2XZOA 3G0HA 1R0YA 2KWIA 1ZC4A 1E0JA 1U0LA 3B82A 1KIMA 4AYTA 2EYUA 5JS8A 4X8OA 3KFXA 3R9IA 4KU4A 4YC7A 1G291 1A1VA 4OQMA 4EPYA 3N2EA 4NKRA 1X8JA 3ZIAA 3KB1A 1M74A 4NBSA 4RD4A 5H8WA 5IHPA 1Q1BA 2DHRA 4RD0A 5F9FA 2NMVA 1VTKA 5JHGB 5GJVC 1FNNA 2VP6A 5EJEA 5FPTA 2MMCA 5FTLA 2IHYA 2JDIA 1T0JB 1T3LA 3SBDA 3BB3A 5AJZA 5KSZA 2CNWA 1QHHA 2ZTSA 5FBWB 1G5RA 1XPUA 1SVKA 1S1MA 2BDTA 3K53A 4JT2A 1T5IA 4R98A 3GLHE 1EWRA 1KAOA 1OJLA 2IT1A 3LD9A 5EE5B 3VAAA 4LI0A 3LFUA 1W5SA 3KKPA 4BLPA 4EFNA 2A78A 1R0ZA 4OK3A 4HLUA 4HLUC 1CLUA 2J7PA 3LA6A 5CYPA 4EJSB 2I1QA 4Q4LA 4OHYA 4WXRA 3R7WB 3CPJB 3IPYA 2GJAA 3CO5A 2WWIA 4JIMA 4LJ4A 1FMLA 2ANBA 3IIJA 3EIQA 4NHOA 3MD0A 4C0QC 1AQYA 2QPOA 4UNSA 4D0LB 2Q21A 2IYTA 3TR5A 2C5LA 4JLMA 4WVFA 1E4VA 4FCVA 4Q7LA 2AWNA 5EQTA 1OXVA 5EXXA 1JB1A 2ZI5A 4BLQA 1ZAKA 4YMVA 1CKEA 5CM8B 3GJ6A 1SVIA 4AWXA 1NJFA 2DCUA 4RKEA 1EFUA 3AKCA 1XEXB 4RFSB 1EX6A 1E9DA 1FUKA 1P72A 1YE8A 4XH9B 5BN3A 1MT0A 3IDQA 4B71A 3KKOA 2Q9CA 3FOZA 2GCPA 4LUCA 3KQNA 1IY0A 1II8A 3PQCA 2FFHA 4GT1A 4C0JA 3K9NA 1LF0A 2QT1A 1UKYA 2B7BA 4A8JC 1U90A 1AZSC 2RH5A 3AKYA 4GZLA 4XTRA 1G3UA 3ZS8A 1G8PA 2ZJOA 1QG2A 4LYHA 4LK2A 1Z29A 2QMOA 4DB2A 1KGDA 2WICA 2J45A 2R65A 3T1QA 3QXCA 1VG0B 3E2IA 1DO2A 3PCRB 4BFWA 3GJ4A 4YLGA 3Q72A 4B43A 1M8PA 1ZINA 4WOPA 3WNDA 3WBKA 2PEZA 4G1UC 4URZR 1DBSA 4OHWA 4HLDA 1SVLA 1XCGB 3A36A 3FMFA 1YR9A 3HP1A 1G7SA 1KJWA 5TARA 5JS7A 2DFNA 2HUPA 1LFDB 3WNCA 2ZJZA 3U44B 5FI1B 4IJMA 3E1SA 3ND8A 4IDNA 3OE7D 5FOUA 3LXRA 4DCVA 4FINA 4PO1A 2WWYA 1QHXA 1Z28A 4NE2A 2ANCA 2EFCB 4CT4B 2PL3A 2GBLC 1XWIA 1G64A 4CEHA 4PZLA 1G8GA 2QENA 2EFEB 3IQWA 1G19A 2BJVA 3HYRA 1VYTA 4LHWA 2AXPA 1GOTA 1NKTA 3AVWA 2ZRGA 1AGPA 1HY3A 4P3YA 1LV7A 3EXAA 3D8BA 1PV4A 1J90A 1KDPA 1ZC3A 4EAQA 2PJRA 3PEVA 1P4SA 3BK7A 2PCJA 3B6EA 5DNYB 1FP7A 1A5TA 4Q9KA 3U7HB 4JBYA 4RCZA 2OCYC 2P5TB 1SVMA 1UKEA 3TMKA 2OG2A 2V1XA 3AF2A 2F1IA 1U8ZA 3NEYA 1IHUA 1T9HA 3W3AA 2IHBA 4Z54A 5FFMA 4JLBA 3ASZA 3D6TB 3HR7A 3WNBA 1CU1A 2P2LA 3EA5A 3C7KA 4QGAA 2D2FA 2A5GA 1RFLA 2VHJA 1MO5A 4L9WA 2B7CA 1E2KA 1JAHA 2WWFA 4AG5A 1DS6A 1CEEA 1R7RA 1NLFA 2N46A 2FGJA 4B6FA 4NCNA 3UMRA 1CULC 3MGCA 2YOGA 2FZ4A 2HYIC 421PA 4BFTA 3SFZA 2A3RA 4QC2A 2IYSA 1A2BA 1U99A 4NYIR 4Q4HA 4W5JA 4V0NA 3CF6R 2MSCB 2Z0MA 1M7HA 1WE2A 4KI0A 1DPFA 4XD7A 3WBJA 4C0HA 1FP6A 1FPMA 2OCPA 2Q6TA 5K8IA 2D62A 4QL3A 5TV2A 2ZSEA 3AF1A 3P4YA 4OQXA 5AJYA 4ON9A 5DHAA 4YMWA 1HUQA 3TH5A 5L3RA 3R9WA 2ZRCA 5LD2B 4C0BA 4RKFA 3B9PA 1OB2A 4TYYA 2IXFA 4F4IA 4Q1CA 2XNDA 2DFTA 4KSCA 4TQ9A 1GL6A 2J0UA 2BCGY 2WKPA 3PUXA 4B48A 1ONBA 3AP1A 1GTVA 3H2YA 4NL4H 4A0HA 4M1YA 3MWYW 1R0WA 2ZITA 4HB4A 5DI3A 1XXHA 4LV5B 4OQFA 1XPOA 4TTPA 2JJ2D 2HT1A 4ASUA 2G9NA 3AP3A 5FPSA 1W1WA 3B8HA 2H16A 2OT3B 2ZRLA 4DUGD 3H1TA 3GLIA 1GZSA 2X2EA 3SNHA 3SZRA 1Z06A 5TMPA 1ZBDA 2JLWA 2D3WA 2ATVA 5M04A 4TL6A 1JR3D 1XBTA 3LQQA 2WOJA 4PPNA 1SVOA 4IW3B 2X1VA 3CBQA 4KBFA 3GJ0A 5CJPA 2XX3A 3SN6A 1II0A 5JI3E 1W36C 3BAFA 4IVRA 2QAGA 2QAGC 3FMPB 3EPHA 1KJYA 4WBSA 2ZI4A 2IL1A 4HUQA 3EZ9A 3BC1A 3TR0A 1GRRA 1J7KA 3RAPR 4AKEA 4G0NA 5KSOA 3DKPA 1MOZA 1B0UA 3LX8A 2IF0A 2ZRMA 5L8VA 1P3JA 2O8DA 1OIXA 2HYDA 1QG4A 1OXSC 1T0HB 3N70A 1CRPA 2UVQA 3GLFA 1UBEA 1ZVQA 4G5SA 3X1WA 4RZXA 4ACAA 2ATXA 1W0JD 2BJWA 2ODEA 1BMFA 4KFSA 3M1IA 1JI0A 3KL4A 3MJHA 2F1JA 3PUWA 2YC4C 4JS0A 1L8QA 2QU8A 1O3YA 3CX7A 2QPAA 3SJZA 3RWOA 1YJ5A 3CKLA 2C77A 4D4KA 3LY5A 2ZUBA 1DAGA 3NDPA 3TUIC 3ADCA 3PUYA 2J0SA 1E96A 3V4FA 3AVPA 1IONA 3X1ZA 3CNOA 2OV2A 5DYGA 2OAP1 3CUEF 4AG6A 3RRZA 2VF8A 2J0QA 1CR1A 1KOFA 2VHQA 2BM0A 4E03A 1FFHA 2E9SA 3ZQ6A 3IBGA 2FFAA 3I8XA 3GPLA 3SS8A 1KO1A 2ZYVX 4POAA 4B32A 4EPWA 1MO4A 4KAXA 1Q20A 4QXAA 3TLXA 2LWIA 1DVRA 4DB4A 4M1SA 3T61A 4OI2A 5CM9C 1E6CA 1OHHA 4NZYA 1N6HA 5AJWA 5EUQB 4US2R 3EIEA 4NYIQ 3JVVA 2PMKA 2Q9BA 2CHVA 3THYA 4P0TA 2WBLC 5EP1A 1YZKA 2IYVA 1PUIA 1R8QA 1U9IC 1QVRA 1E1RD 3FKSA 4RY2A 3RABA 2ZYTX 3RS5A 1GITA 3SQWA 2KJQA 2X77A 1TAGA 1ZMXA 2Z5FA 3W8NA 2W6JD 4OI0A 3LBNA 4K8OA 1WCV1 4ABYA 3KQHA 3FVQA 5LB4A 2O8BB 4NDZA 2HLDA 2I4IA 1SHKA 4KXFB 2QI9C 4Q4JA 1KI6B 2IYUA 3QXHA 1NVUQ 2O8CA 4BECA 4GOXA 2PZFA 4QM6A 3NG1A 5HCNA 5H68A 4D0NA 1ZIOA 5B64A 2C04A 1G7TA 1E1RA 1T4GA 4C4PA 2ZRNA 1E94E 1Z0DA 1AK2A 1UBCA 1UEIA 2YWFA 4Q9HA 1Z0KA 5FOXA 3BH0A 2QL6A 1D5CA 1NY6A 5AUQA 1R4AA 2ZREA 5DHFA 1NMZA 1FW6A 1FOEB 3NHBA 1ZD8A 3V00A 3QKRA 4M1TA 2OCAA 1C9KA 5AJXA 4ZCLA 4PHHA 1S0UA 3AV0B 3HYTA 1HURA 1NMXA 5D3MB 3A4LA 4AYWA 3VU9B 4B3DA 3OAAD 4CDGA 4D26A 2FU5C 3QF4A 4HEJA 1R5NA 4HUTA 3A4MA 1U81A 5EZ6B 3VNUA 2XTMA 4Z1MD 2JAQA 1OIWA 3TJZA 121PA 4HAZA 2AL7A 4XWAA 4DCSA 2ZI3A 2GRJA 2IEYA 4IFEA 3GJXC 4A2WA 2DYKA 3AF4A 5K8LA 4N3NA 3BRWD 2IS4A 2VA8A 2XITA 2AWOA 3L82B 1TMKA 1XU4A 1QF9A 4PHTA 4TLBA 2XB2A 1F5NA 2FWRA 2GETA 2QPTA 3PFIA 3AB3A 5JCZA 2OILA 2QTFA 3NBFA 2GZDA 4RD1A 5E4FA 2ZS8A 2OCBA 1G5PA 3OZXA 1NKSA 2R9VA 2BKEA 3SYNA 3I8SA 2DPXA 3N2IA 3WYGA 5DN6D 1F2TB 2JJ8A 1KNXA 3QXSA 1X1SA 3RS7A 1FTNA 3IILA 2JJ1D 2FA9A 2GHIA 4IVQA 2ZJYA 3W6OA 2GA8A 4CVNA 5F98A 1I4DD 1KO8A 4TLAA 1XCMA 2VP5A 2XSZD 1ZD1A 4TMZA 3A1SA 4FMCF 3VFDA 5HKKD 4BE7B 1UDWA 2GCOA 3CRVA 2W2TA 4G3XA 5L3QA 1ZUHA 1SXJB 5HCIA 2FFQA 3AP2A 4QG7A 3BH6A 3U3JA 3ETLA 5JECA 2J5XA 1CJMA 1T3HA 3B85A 1KO5A 4Q4AA 4Y0VA 1H8ED 1N6LA 4B34A 3DDCA 4FMDF 4WAUA 2I3BA 3BS4A 2PJZA 1IN5A 1MRNA 4DWJA 3WMGA 2JJ1A 4JLKA 3UG7A 2G77B 5DO9A 1E0SA 4B6EA 1IN6A 4HLQB 1JXOA 3CH5A 5L3VA 2CJWB 2XSZA 3D3QA 4KSBA 5EP2A 4M2LA 5HKKA 3FDIA 2A2ZA 3I3SR 3WRXC 3PXGA 1WA5A 2ZAMA 3O8RA 4JT4A 1R5BA 4A6PA 5A5GA 3EAQA 2IBMA 3E5HA 4PPQA 4TL8A 2PLRA 3IQXA 3PUVA 1VPLA 1BIFA 3NHAA 4DSUA 4G5RA 1H8EA 4KCGA 3ZDQA 3W3ZB 3QBTA 2IYLD 2W58A 4RJLA 5KSPA 4A92A 4ZKDA 4DLRA 1NY5A 1QDEA 4FWTA 2FJUA 1LS1A 3KJEA 2IYQA 4KFRA 2ZI7A 4JVSB 4RSGA 5GVSA 2ZE5A 2H8KA 3K9GA 3T12A 1NLZA 3WP1B 3T5DA 1TUEA 4QHYA 3GLIE 1OB5A 1G18A 4KVAA 4M22A 4QBFA 4YMUA 4PC3A 3H4MA 4BRUA 1XMVA 1KK3A 4B47A 3Q3JB 2YNMA 1W44A 2C95A 4AC9A 3HPQA 1ODFA 2YWGA 2D74A
chains in the Genus database with same CATH superfamily
5LBUA 2PS0A 3ZG6A 4WKNA 3P32A 1N9GA 1BYIA 1D07A 1ORVA 1ZCAA 4OGWA 4RDCA 3ZXYA 2VSFA 1YH3A 1RQPA 3HB4X 2AX4A 1EAYA 2HJSA 3L43A 4PIVA 4Y2GA 2F43B 4URHA 1B41A 5FR1A 1YDMA 4N41A 3I6IA 1HEYA 5D6NA 4NZNA 5E3JA 1ECFA 1NP3A 2Q5FA 4RF2A 1E2PA 5EXTA 4ND1A 4WADA 3CH6A 4W7SA 5H16A 4BMDA 1U7TA 2BEWA 1OX4A 4HN2A 4Z53A 2X6TA 2A0WA 3GRRA 3CKMA 1NVVR 1ACMA 1C50A 1LDBA 2G04A 1YOVB 3KVOA 4UC0A 5ALGA 3HJBA 4Z99A 1BHO1 4HFMA 4LSWA 4LNHA 4DEXA 5E7MA 4U3JB 2O0KA 3MWDA 5AOVA 2AHOA 2AMVA 4KMOA 4BV9A 2GFQA 1MO6A 5BQFA 1E3IA 1GZVA 2GNPA 2GK6A 2Q46A 2Z1MA 3G5AA 2HXYA 3KJXA 3L0DA 1VMIA 2DKNA 4Q3EA 4UFOA 5TSDA 3EGEA 2YZ2A 1JFVA 1FQOA 1SQFA 2FPIB 2O8FB 4RETA 3O8QB 4Y9UA 1OZGA 4J3JA 1RWQA 2VSYA 3TKLA 1K08A 2L18A 2CY0A 4BKQA 4F6RA 4KG7A 5L3SA 4KFTA 4P82A 3SHOA 1O9GA 1C8BA 2Q4TA 3A1VA 3E70C 1ZGZA 1KSGA 2WB2A 1ZA2A 1A9QA 2BEVB 3K0EA 4FEGA 3PP8A 1CUYA 4L0MA 3AH8A 3VPXA 1IBMB 3QPCA 4HD8A 2BMFA 4Y2XA 1ZZGA 2M9MA 4RNCA 5FEMA 1CZNA 5C1IA 1FLAA 1T5OA 1R88A 1L7DA 1U9YA 2KBFA 3A37A 4AWAA 4CMIB 3SBEA 5IT5A 3LL4A 1VYVA 2Q2OA 1G8YA 4IUCS 4M86A 1Q7GA 3DVRX 4MYCA 1IATA 2UYYA 1U31A 1VA4A 5BSEA 1KY3A 3O7WA 3W4KA 2DHQA 1Z75A 2V97A 3UFXB 4C4SA 5DGCA 1GFWA 4WZ6A 4QGBA 3CT6A 2P2ZA 4EMTA 2EQBA 5FLKA 5BPFA 1MUUA 1JFFB 1VCOA 2JIZA 4P7JA 5AVOA 5BT8A 3CF0A 1YUMA 2F4NA 2SKDA 2WYUA 3B6JA 2VPQA 3CUTA 3G1WA 1OPXA 2ZVQX 5FTJA 4M9UA 2ZRPA 4DSTA 2NPFA 4HEA6 4AF7A 1DAFA 3G6KA 3Q10A 1EFAA 4IOJA 4F9EA 1JHQA 1R5JA 1ESNA 3MWKA 4TQGA 3RSLA 4EO4A 1IUPA 5CAEA 5FQOA 4BVHA 4RVUA 5AMXA 3SWWA 3DM5A 5FBRB 1UQRA 1U7OA 2PS9A 1Y4SA 3FUTA 4LQDA 4RHYA 1TUBB 1E79A 1D6MA 1NIJA 1YIAA 1ZIPA 4MUEA 4QBKA 1EB8A 2FUG1 3T9CA 5LC1A 1RJEA 4CM1A 2ZUSA 3WE7A 4EL0A 1BFUA 1QC5B 2F3PA 2ZJFA 4HWOA 1JDBB 3DTTA 4FFOA 3RLFA 4BO2A 5LU8A 2ATEA 1D2EA 3RANA 2PN1A 3I2KA 1HRDA 4JL5A 3UH0A 1XA4A 3WX0A 2RGCA 4A6DA 4XR9A 3B1YA 1V9SA 4YYZA 4A82A 5IF3A 1GCOA 4EENA 4ZGGA 1MJFA 4ZAWA 5LU9A 3DYBA 1J6UA 4P38A 5AICA 1OAOA 1J0DA 1OAOC 4QQ8A 3ZNPA 3KBOA 2HHCA 1I8TA 1P9OA 3ZC3A 1W76A 3GL9A 2KSQA 3VYRB 2RGNC 2L2QA 3LC7O 1FFEA 3KIPA 5HM8A 3DUFB 3A58B 4QWWA 5CB4A 5K0EA 3IGFA 2OLEA 2ECKA 1ACJA 1CQJA 4K6MA 3ZK8A 1EJBA 3GZTB 2TYSB 1F4LA 1XDUA 2IP2A 3EIUA 3KPVA 1VDMA 5AW9A 2PXXA 2CVZA 2IS1A 1PR6A 1E1YA 4REQB 5NLLA 5GZ1A 1M6YA 3G5UA 1Q95A 1XZQA 3AWDA 2QJTA 4G41A 3I9KA 1WNFA 2X0IA 4PPGA 4B9AA 5AM3A 2CLOB 2ZRHA 5FLYA 4ZT4A 1K9VF 2G1AA 3E58A 5KTMA 3RAEC 4IIJF 3AL3A 1KY2A 2R6AA 2RI6A 4ZKEA 4X54A 3IAFA 3DNFA 5J47A 2PRZA 3RUHA 2QSUA 4MLDA 1VHTA 1KYQA 1WQ1R 3ZCVA 5JYCA 4WOJA 5DKFA 1N9KA 1JHYA 1U7DA 3BVPA 4ZPJA 1TT5B 4B7AA 1BNCA 3ZQ4A 2X5JO 1X86B 5BN4B 3WMXA 1QNFA 4JSYA 4KO1S 1E61A 3LVBA 3VPCA 5KTTA 3H7IA 3GRKA 2YHIA 3OZVA 5EMMA 4JT9A 1XDSA 4KQ1A 3LRPA 3TJRA 3DTYA 1AMOA 3K92A 4FUQA 1NVVQ 3THXA 2Z6VA 4MH0R 1AB5A 3L6DA 3QA9A 1W47A 2D3TA 1AKMA 5ALPA 2CFSA 3KHUA 5BXQC 1GYQA 3IEPA 4Y6PA 2OGTA 5E9WA 5EWJB 4ENPA 3HCNA 4P36A 3BXFA 1KP9A 3UHFA 4DREA 3PIRA 2Q99A 3BQMB 2I2WA 1H6CA 3RIMA 1NOIA 3H19A 1VLLA 2REOA 1BA2A 1T6NA 1M33A 3G3EA 4RHTA 2CDAA 4Y6GB 1SM4A 5KOHB 1FBNA 4HT3B 4DLKA 3IDSA 3ROFA 4TTIA 1U80A 5FA5A 2FQXA 3PC6A 3WJ2A 2QXYA 3F96A 1ZIDA 2Q29A 1KYXA 2H59A 2WVHA 4HL6A 3UK2A 1KH2A 2ZE7A 3C7CB 4FJ1A 3WRWA 1SXPA 3IQEA 5FX2A 3VJRA 5T5QA 1TYCA 1V2HE 5F7XA 3LQRA 3I5XA 3KHSA 5DP2A 3FNRA 1K6MA 2A7QA 2YWXA 5J63A 1JQ3A 1TA9A 3LWNA 4UU8A 1GJRA 2C4TA 3U09A 2D0PB 2DVMA 2A5JA 4FONA 1QDUA 4JNKA 1NE7A 3ICVA 1VGVA 4D98A 3MWEA 3N5KA 4DGSA 2I6SA 4LBWA 4B3FX 2FEPA 4QVKA 3SXPA 3P0EA 5BR7A 4NCJA 4JC8A 4URXR 2F55A 4OAOA 2H9YA 4A23A 2WF5A 1XCOA 4LWZA 1AHPA 2NAPA 4F8YA 2BGJA 1W6RA 4EB0A 3KXIA 4DRYA 3VDNB 3OTWA 1GV1A 1YQTA 3OX1A 2WPNA 4RLQA 2R87A 3KOMA 3NGLA 4YJFA 2I62A 5F2KA 2LPMA 3DOJA 1BD3A 3NH9A 3A3KA 3B3GA 2JD1A 5EEHA 4WNAB 4HEHA 4G01B 4R7ZA 2VTBA 3X1YA 4PHFA 3MCUA 4E7OA 3OPXA 4L2IB 5K3EA 2F64A 4R2JA 3ZHYA 5IULC 1CJTC 3ZJTA 4JGGA 3WWOA 4BNNA 1OXXK 1AHNA 2JCGA 1EIZA 3TXAA 1EHCA 2X5KO 1ZOSA 2P4SA 2WFAA 3MCAA 4A2PA 3VZCA 4MUAA 1B0AA 4HUJA 3SEZA 4B40A 3FB4A 1V43A 3OM9A 1A69A 2Q5OA 4L95C 4EECA 4WCVA 2GEKA 2FPRA 4BKPA 4MWCA 5T7BA 4P8RA 1K75A 5D2CA 3QEOA 5DM0A 4HNUA 3K72B 1DAHA 5AI6A 3SJBA 3IMGA 1PAUA 4R83A 1B14A 2FQQA 4TMVA 4ZVOA 3NYQA 3H5OA 4ISBA 1T8PA 3OT1A 2CF6A 1Z35A 3IA2A 1HWYA 4Q82A 3EVTA 4MO2A 3TW8A 3ZU5A 2GXSA 2NYRA 1NOJA 1KJ8A 4MPRA 2XTNA 1K66A 1IYZA 3N75A 1P77A 3UV3A 2MINA 3VHLB 2UZ1A 1PR2A 1KTVA 2AVDA 1NC3A 2HF8A 3NT5A 1ENOA 4F8EA 3PV0A 1QIEA 4UPEA 3D2AA 2KX7A 1P4RA 2DERA 1QCCA 4OB8A 3DE6X 3T3IA 4GLOA 2XXAB 4CLXA 1E2HA 5GP1A 1QONA 2ETVA 1YMUA 5IKEA 3LCRA 2NVOA 4K0KB 1RAHA 5A5VA 4X66B 1DOAA 2BV3A 3ICOA 4HDRA 4N3BA 3MYRA 3REQB 5GADl 4BKRA 4GPD1 1M3SA 1SY7A 5REQB 1UBFA 3C6YA 3KE8A 3KTAB 2X7XA 3UGKA 1IVSA 1EWTA 2IZ1A 2QI9F 2YYSA 3AG5A 3C6QA 2RGGA 3GFFA 3ONDA 2HGSA 4HEA1 3FN4A 4JL8A 3MOSA 2IHNA 3LF1A 3ABQB 3QG1A 2FUCA 4FLMA 1L1RA 3ESYA 4HS4A 1EE2A 4RL4A 2F17A 1GO2A 1VKOA 3N86A 4TQUS 3TW0A 1Z74A 3U49A 4CGYA 4OY3A 5DYYA 5DHUA 5BSMA 1AUXA 4MW1A 4C4OA 3WNDA 4X6LA 4V0KA 4B09A 1T0PA 2VDOB 2G3YA 3LWZA 3NNDA 2V7PA 1CYDA 2B61A 2JBAA 4NDAA 4BB9A 1VBKA 4CKCA 2ZIAA 2XHZA 4YQEA 1O9BA 2V8OA 2XW6A 4DKXA 1IBKB 4EYSA 3STTA 2RK4A 2FR0A 3IPAA 3PHHA 5CLGA 2A4MA 5L7YA 1HNXB 5K0FA 4KO8A 3D2BA 3H5IA 5LQDA 1DMSA 2R1TA 5EXEA 5JJ5A 1BDIA 2Q0SA 4FGUA 4PR0A 3SZ3A 1MB0A 5A1TA 4YXWD 3X1XA 3AERA 2WVJA 3AUKA 3GZNB 3NH6A 1VHQA 4FBMA 2ECOA 5HF5A 2IKSA 2FPOA 1E3LA 3HSSA 4DJJA 621PA 1T35A 2V9CA 2IOHA 3W2IA 2GXAA 2DFVA 1CQIB 4U2GA 3H2IA 3P26A 1X7YB 2C83A 1G3QA 4GH5A 2WA2A 1XZ8A 4IJWA 3LCCA 5AESA 4ESEA 3DGFC 3Q4GA 1U7ZA 1Z2EA 3QJ5A 4MWOA 4PC7A 9MHTA 5A5FA 3ILHA 3EIXA 2BZSA 2JFGA 1TYEB 4MLCA 3WL5A 1B8PA 1Y6JA 2OGSA 3JCZA 3QE3A 3DMTC 4LDPA 2C4MA 3DHVA 4WFIA 2BMDA 3NIBA 5DTIA 4QLBA 1QZUA 4LA4A 5MFPA 3TTXA 4TT3D 5DW0A 5FDFA 1JKFA 1Z8NA 2QQFA 2YICA 1J1ZA 3MS2A 5AHWA 4BTVA 1LXCA 3M9LA 4ESHA 4JV5B 4ZI7B 3B3QA 1OYYA 1QS0A 3M5PA 1DG3A 3RIXA 1GG8A 3D3NA 4PSKA 1I13A 1UH5A 1ZR4A 4EUEA 2BFFB 1SB8A 2PJDA 1A97A 1P1HA 2X15A 4H0CA 4JB0A 3WK5A 4F9GA 4E30A 3NEJA 3DDSA 4MGIR 3O4FA 3EOZA 4AJHA 4PPYA 1KAMA 2Z4RA 1DLJA 1ZRHA 3GGSA 3JZMA 3T8YA 4EI9A 4XWGA 2JIBA 4C06A 2JLVA 4BFCA 4F7WA 3RUDA 4GOOD 1GL7A 3P1JA 3X2EA 3VKFA 1I2BA 3PICA 4I0WB 4MWEA 4LF8B 1U7XA 5B3KA 4DJDC 2VJDA 3IH5A 4FBGA 5B58C 2HC9A 5C7OO 1M5UA 4FR0A 4HGQA 2HWYA 4D4JA 5LYJF 5LP6B 1I3MA 1SQGA 1H1DA 1DQNA 4TN1A 4JFRA 3VR6A 2AXQA 4M9CA 3HXOA 1POWA 1R4MB 2GVDC 1W4AA 1Z4IA 2VYCA 3SAJA 5HM6A 4KR7A 4Z4GA 5ALZA 5LXTF 1JQEA 3COWA 4M0EA 4CQMB 4NYMR 2EP5A 4UTNA 1L5QA 1SVWA 1XP8A 2V55B 3IOYA 3PR2B 5CW1A 1E8DA 2MYNA 3Q6NA 4GDFA 2DWPA 4I46A 3LT2A 3HKCA 5GAJA 4NECA 5J1SB 2P2CA 4GGOA 4CMEA 4CMEC 5GMOA 3RC3A 1A8UA 5DTJA 3QVJA 1YA8A 4JB8A 1KWKA 1TD9A 3FUUA 1T9GR 5DDIP 5EE9A 1EXMA 3JYHA 1Y8AA 2E85A 3LXMA 5ALJA 2YYZA 3RNOA 1YHNA 2BZ1A 1CRQA 2JNWA 4AQYB 3LECA 1F2TA 2PT6A 3AVYA 1BD4A 1G6Q1 4C3ZA 2BUAA 1A5AB 3SEFA 3WQQA 3L8DA 2G82A 3ZQJA 4DGQA 5CITA 4NFLA 1NVTA 1QH8B 3S5JA 2DB3A 1L7OA 1YI1A 4DR3B 5EZYF 4YRPA 3KK0A 4ALIA 3RADC 4BMVA 1ZI6A 1IPHA 1YHYA 3FNIA 4O5AA 1M6HA 1SKYE 3I6QA 1KBOA 1A8SA 2EXXA 2WAXA 3AQIA 1M75A 3KJFA 3OX4A 4IJ6A 5CA0A 5I7WA 1T9DA 3HJRA 2Q4RA 2Y1CA 2QD3A 4JP8A 1SOAA 5FKJA 4B4KA 3DVLA 2IEZA 3IE2A 3PKZA 4RLSA 3UMMA 3LWBA 3LKZA 2YHBA 3ZGZA 1RWOA 3IIMA 3PWSA 1RJDA 2J9ZB 4HF7A 3T1TA 1YQDA 3U13A 4CCWA 3GROA 4ER0A 5AHKA 1XL0A 3VUFA 1F6BA 5KKCA 4DLZA 1DBVO 3E3MA 1XJQA 1TX4B 3KP1A 3QFSA 4PLWA 5EE3A 3NRJA 3T9BA 5GZ3A 5AM1A 1S8OA 2J48A 2WUDA 5J40A 4E21A 1X19A 4DQDA 1L4UA 3HCFA 4JNCA 1BKDR 3COZA 1QGZA 1WUKS 1MO3A 2WI8A 4NENA 3EZNA 4WOKA 1V1RB 3DE4X 1FQJA 3QOYA 4AZ0A 3C8UA 2XGOA 3QV2A 1S2LA 4Q66C 5EJAA 2V9PA 2QNIA 2IW3A 2DH6A 2AZ4A 3JPYA 4DKJA 2DY1A 2G07A 2PKWA 2W2LA 2P67A 1H42A 1T10A 2OM2A 5BYJA 1GILA 2IYOA 2Y0CA 4B8ZA 3HCEA 4JA0A 4MWDA 1H9CA 4IVPA 1F4PA 4WKPA 3AFNA 4BLTA 5B1EA 1R0LA 4DSOA 4DV1B 1HMPA 2Q8NA 2MSEB 1FMCA 2CXPA 2ONYA 2W2QA 3DULA 3HKEB 4FSDA 1AKNA 1VRCA 3BB1A 3M5WA 4NEHB 4X8HA 4YUWA 2A9JA 2ZXUA 3PLAE 3UJAA 4IRMA 4KHZA 1C0EA 4R2KA 1TRKA 2UYQA 1H9BA 1NYRA 2QW1A 4L08A 1WP9A 3WYNA 1SWWA 5KNDA 5H4HA 4MHOA 1RQLA 5CFZA 3AF6A 2XZDA 4W6QA 3ND9A 1A9XA 3CLVA 4LX8A 2Y9MB 2RHDA 3A27A 4KE9A 4C2AA 1NBMD 3VC2A 5J1TB 4PYQA 3VOAA 3VNBA 4N65A 4CV3A 3BX1A 2W6JA 3TTYA 1R6TA 2ZJ4A 3SGLA 3GJYA 3ZXSA 5JAHA 3WHPA 3SHWA 2NU6A 4JVLA 3OLQA 4CTOA 4RTLA 1LLQA 4D0GA 3BXEA 3ET4A 2GNOA 1T6YA 3IP6A 3PGXA 4RF4A 4G63A 1CY7A 1FVOA 3QWHA 4BO4A 2ES4A 4V39A 4DRXA 3QPAA 4BV3A 4GMDA 4OUKX 4W8GA 1YR6A 1WG8A 2CUNA 3QLUA 2CFTA 4XTCS 5DI3B 1XXHB 4HXYA 3LH5A 3ZD6A 1XF1A 2GEUA 2E82A 4OXRA 4JP3A 8ATCA 5JLJA 1RLUA 3L4JA 4L9SA 2J6BA 4I9FA 3GLIB 5JXWA 4V0ME 1Y7LA 4JBXA 1Q1NA 4REMA 1NNEA 2QPLA 4AXBA 4OG2A 8MHTA 1PI3A 1KEPA 3L8HA 4D9KA 4YJ2F 2ZBQA 3T9AA 1JU3A 3LY8A 3FX2A 1B7GO 2JFZA 4NYMQ 2N1BA 4RZ2A 2HOQA 3AIIA 4KBYA 4YMIA 3WK7A 5KYWB 2YY6A 2VYND 1QE0A 4URWR 4UOEA 3FBWA 3T5CA 2JCXA 4JJKA 4PGAA 4HJRA 4GQAA 2TMKA 5JQGA 3FZNA 2YQZA 5FP0A 1F8GA 4P4SA 2X1HA 2VF2A 1G6HA 4JJFA 2GJ9A 4NJMB 4HCJA 5AK6A 3I34X 2ERCA 1YA4A 4DR7B 2PR2A 2VTKA 3F8TA 4FXOA 1KNQA 1MH1A 5L95A 2P9CA 2CHFA 1U8AA 4FM9A 4HDMA 3IVGA 3R8FA 1NC1A 3UJ8A 3J81k 1HQCA 3WL4A 4FFLA 4TTRA 1IK4A 2W6PA 4GVLA 3EW7A 4Y2QA 2X7HA 3DH0A 4MLZA 4X60A 5JPCA 4HPJB 3EXHA 3EXHC 3M8KA 4HN9A 4NBWA 1FJGB 2OBXA 5KOYA 1YFJA 2G9ZA 2H31A 4S3MA 2XMPA 2I3ZA 1E99A 1JXQA 2BKVA 2QLJA 3FJOA 4LJ7A 3DZBA 2JGLA 1ZA1A 5DN6A 1WULS 2OHVA 2Y9PB 1O0CA 2X4GA 2VUHB 1Y7TA 4HZUA 3RQIA 3R40A 1PVDA 1VFPA 3PEEA 1PNOA 1SUWA 4D43A 4ZYTA 1W5AA 4L3OA 2NO6A 2QNBA 2VHEA 1M1YA 3RYTC 4BGVA 5HQTA 4C0LA 2RHCA 4JEMA 1ZW6A 1GA6A 1FMTA 4V3BA 5FL3A 4NBKA 1FYEA 2OV3A 4YRRA 5FYDA 1KI7A 3T5AA 4ZI3A 4PYMA 1PWEA 4B3GA 1ENZA 2JHGA 4P9NA 5FUVA 4R8KA 1Q0RA 4DG5A 5CA1F 1UQUA 3ECSA 2VHUA 1RQ2A 2VQ3A 4DV6B 2J5RA 3A9UA 1R2QA 2W2PA 3SYKA 1BWPA 1UMDB 1YRWA 2QMEA 2P1DA 5HEKA 1IM2A 1Y3IA 2GBGA 1N0HA 1J5PA 4LHYA 1V35A 5JS6A 2ZP1A 1Z2NX 4Y2YA 5CMLA 5AUOB 3OIDA 1CUSA 5I8ZA 2OXRA 3OPNA 1O95D 1L0BA 4KNVA 4QO8A 4OHCA 2V7QD 3PXBA 2Z6QA 3UWOA 2O07A 2OR3A 3RSZA 4O02B 5AOAA 4QLOA 5BNFA 4PTLA 3FG9A 4ED9A 5ESXA 2A3NA 1WPQA 3WSWA 2HPHA 3K31A 3EZ2A 1DEKA 2AFHB 3BGSA 1L9XA 4BE9A 3EWNA 1JU4A 3M83A 4BLSA 1XA0A 4DA9A 5CDFE 4OB6A 2WYVA 5BW6B 1U1GA 1ABEA 1SRRA 3OC6A 4JJ6A 2GN1A 3H1BA 1T1JA 2BCJQ 1WMBA 3KZXA 5AWFC 5JWHA 3TZEA 1E6EA 1Z08A 4UDNA 4CUKA 1PL0A 1YRYE 3DNPA 1ZSNA 10MHA 1WTCA 2DQSA 2EGUA 4LVUA 4YY3B 3PA8A 2SICE 1QORA 3FD8A 4I1YA 4JKYA 4IYRA 1VKJA 4OJQA 3BORA 3H0KA 1LLCA 3OQJA 5EIBD 4EI8A 2JGEA 3QY9A 4HX5A 1A76A 5BVGB 1KGSA 5TMDA 4CCAA 2XE4A 5JDIA 5JDIC 2VJNA 3F78A 4X65B 2A0XA 4K81B 1MJGA 5KKNB 3JYOA 3OICA 4WV3A 1K7YA 1NQOA 4BFUA 3UC5A 1FIUA 1CYEA 1GG2A 4PHGA 1DINA 1TC1A 4X1KB 2AJDA 3K05A 1JAIA 1ISGA 5T6MA 2K5UA 1W5BA 1THMA 2FSPA 3DBHB 3RS9A 1V11A 4UEJA 4EHJA 1YJXA 1ZITA 3DCIA 3NR2A 1ZY2A 4QSMA 5AO9A 4DIDA 1JG4A 2FRVA 2O0JA 5EKDA 3SYTA 2NLOA 2JLYA 5FJIA 1Q7TA 2FZWA 1A04A 2P75A 1U5CA 1Y8QB 2Y66A 3CINA 1Q74A 2PSJA 3CLSC 5K2OA 4G0WA 3CB2A 1A2KC 1N2EA 2GSDA 3NHLA 3WDLA 3VR3D 1S7CA 1T5DX 5BV2P 5KX5F 4PF1A 1EQUA 3IHLA 5FWYA 2DWUA 2FOXA 3VVLA 4XVHA 3WOVA 4BWYA 2CUTA 1E1NA 1ZH8A 3GQBA 5ALXA 2IUFA 5AK0A 3U7RA 4M0LA 1E3MA 3H8VA 1BHQ1 4Z8XA 5JS2A 1VJGA 2Q3HA 2XMBA 3SIWA 1L5OA 1GPKA 2JIMA 4ZARA 5KNBH 2ARKA 1OI7A 1QKKA 1COWD 3IR5A 3OFND 3CH4B 5AR1A 4Z7JA 1GNTA 2D1TA 1V8FA 4DCMA 2WJ3A 1MDBA 3IEUA 3QSYA 1C4OA 4KW7A 3OEEA 3ZE1B 3WLQA 1N5LA 2HDWA 2VNJA 4OFXA 1Q1AA 4RDHA 2Q1SA 3CISA 4BCDA 3W6PA 3NX4A 4DIUA 3PA6A 1DJOA 2PD6A 3CR8A 3FDXA 3DAOA 1XLTA 1XLTC 2DT5A 4GPTA 1AT1A 2OLJA 2QE7A 3GBPA 4R5MA 4FDMA 4AMGA 4Q3AA 1CEXA 1G21A 4XSVA 1PFVA 3UWSA 2HW8A 1C3VA 2BBWA 4HK4A 3M82A 3CZAA 4IV5A 2G28A 3KPUA 1P5ZB 1CNFA 1YZFA 3LY7A 4DABA 3GLGE 4MVJA 3LK6A 1M7BA 2PFKA 1KJZA 4R0VA 2PKCA 1K5HA 3P2MA 4JQCA 1U2DC 2NOAA 1A2OA 1JQAA 3UTDA 5L3QB 4BFLA 1XZKA 2CFIA 3O2NA 1S2GA 4PLGA 3LC0A 2GT1A 4JBHA 5HX7A 1GRQA 4Q4AB 2IV7A 4W8OA 3AHIA 1W85B 1P5FA 2IYXA 3FOCA 3IOBA 4PQGA 1Z0IA 3AETB 1OXUA 3HVRA 3EVZA 4MIOA 5JYBA 1YTUA 1JMVA 3PQFA 4OGFA 4R0MA 3GFTA 1N5MA 3G2IA 3B3AA 2XGSA 4ZIRA 2DKOA 4QULA 1FRFS 3NXSA 3OE5A 1PJLA 4HNQA 1VJ0A 1JZQA 2AI2A 3B2EA 3Q6MA 4DIKA 5A4JA 5JT1A 2VT2A 3NHRA 2AZXA 2GCIA 2TMDA 2YH2A 1ULAA 1RW4A 2CLKB 2IP1A 3K2BA 3IYLW 3P9KA 1PG0A 1ZD2P 3NBYC 3RO7A 3RYFB 2ETXA 3EUFA 3W1WA 3WHKA 4FKZA 2C9DA 3H05A 1Z22A 5BQPA 1TM2A 4BNDB 4C2UA 4LJLA 3WDMA 3VMMA 3WLHA 5JH7B 3BJEA 5FUBA 2X2FA 4BVEA 3E8MA 1QKJA 4V0OA 1QYDA 3EEBA 1BWRA 4ZYWA 4UHFA 1MJ5A 2AR7A 1FL9A 5E6UA 3DMPA 4BV2A 2VPPA 2KM1A 3H9GA 1SUSA 4J4BA 2L19A 1OH5A 4H08A 1DCKA 5DB4A 1L7QA 4EB6B 4YR9A 2E5LB 1E92A 4MA0A 3MAAC 4DG8A 3D0OA 4N82A 5DMXA 5ECYA 2C92A 4LOAA 5EJ2A 4BFVA 3JVUA 3IEKA 4WNCA 1G16A 3F6CA 1DPGA 4G5OA 5FIUA 5KHAA 5TDHA 3T4PA 3TAHA 2VZ0A 2WAMA 1U04A 3VMFA 2Z2JA 4EJ2A 1IUKA 2X5XA 1H94A 4D3SA 3LCJA 2J87A 2BGIA 3GIWA 2DFPA 2VI5A 3VDXA 4D9EA 3QX9A 3FMOB 5HZGA 3K6RA 4N8DA 4A8PA 3HDTA 2YIVX 3LNCA 3WLNA 1P33A 3C45A 4NAUA 2NZ2A 3C6ZA 3LBFA 1MEEA 1HORA 1EMDA 2AG0A 3MZ0A 2D1QA 1PK9A 2FFJA 4G0OA 4D42A 2OMEA 1QUFA 5F7OA 2OG1A 1UZMA 1MX9A 1UCFA 3LS2A 1WKBA 4S2UA 2Q3JA 5EJMA 1UJ4A 4G89A 1B23P 3S8MA 1G41A 3A1UA 3OEHA 3L0PA 1C7IA 1VLZA 4V1CI 3UMSA 1EINA 1FTQA 4WOCA 1JTFA 4TYNA 1IXYA 3MWDB 3SR0A 1E5VA 3NIGB 2E18A 5H0IA 4I9HA 4Q6BA 5C80A 1EXDA 1CUWA 4L16A 1CUZA 3RUFA 3HCRA 4AZ3A 3KB8A 2UU9B 2P40A 5I48A 5EIAA 2H48A 5ALMA 2OPHA 4HH3C 3O91A 1V7QA 5A3SA 3GFOA 3NM6B 1TC2A 2A9RA 2IUTA 2J4FA 2ORVA 4DWWA 4EDHA 3P71T 3P4XA 3GCXA 4IL5A 4KLRA 4UCQA 4OAPA 4AN4A 4QG3A 2JPDA 4Q18A 3UV6A 5L3SB 3JSXA 2VYFA 1CR2A 3Q9LA 4JKIA 4TRMA 4R31A 4XYGA 3ZVKA 1SUEA 4KIJA 5H9VA 3L92A 1Y9AA 3N0RA 5G1PA 3F1KA 1JA1A 1B74A 2L69A 2ODBA 3CY6A 3I2JA 4FGLA 4MVYA 4NYJR 4PZAA 5T64A 3KX2A 5T4BA 1HDRA 4B46A 4F21A 4BO8A 2Z57A 1XQXA 2BEKA 1BEZA 1TAQA 1Q3TA 2ZJ3A 1CJVC 1OFGA 4L5CA 5LMUB 1XJ5A 1Z7GA 3I5MA 2PYIA 3ZCTA 1D09A 2JEOA 4ITVA 3WV5A 1WJGA 4DMKA 2B9EA 2ZTHA 2C4VA 2PUFA 1VDZA 3EPLA 5EHGA 2JFVA 1LY1A 2X0NA 1QGAA 3ZTWA 1N2OA 4IOLA 1SCNE 4YIHA 4Q48A 2VF7A 2HSGA 2CFOA 2XEDA 3D6FA 1YAJA 2Q28A 5JXJA 5C46F 1FDIA 3FFBA 2N47A 3IP5A 1Y1TA 1K88A 1SVSA 1WU7A 5ISMA 3BD7A 1Z3CA 1FXUA 1LQUA 1MTOA 2D2IA 2FV8A 1M2OB 3KLNA 4OKSA 2ZRDA 3EXG2 4CG1A 4O3FA 5KYUA 3LUDA 4GE3A 1NAIA 1N33B 2BW0A 4L15A 1E3WA 1E9EA 1D2RA 2DFKB 3J7TA 3ZGLA 4Z86A 1CX9B 5CAEB 2AYZA 1NW7A 5A5EA 2YBEA 1E4OA 4IO0A 5DGTA 3VR2A 3U7QA 4KQCA 2VDLB 5K3SA 1Y1QA 2PXCA 3EVCA 3ZY2A 2OV8A 4DLNA 4HVCA 5COAA 5TLSA 1UDXA 2E5FA 1BKYA 4GQBA 4J03A 5BQ5A 5A62A 2HU7A 2P6NA 1BRMA 2JLAA 3A05A 4YGYA 1T6ZA 3IO5A 3WGNA 4TV8A 3L40A 4RTOA 1RWXA 4C4XA 3ICQB 2FW9A 5A3VA 1HC7A 3GRPA 4UNPA 4CIBA 1TKAA 5JATA 3A1DA 4FNMA 1B93A 1VHLA 3ENWA 2VHTA 3I73A 4DQLA 4Q21A 4AN0A 4Q47A 1VL0A 3WMFA 4QYWA 4KV9A 4XGRA 2JL1A 2I54A 1ACLA 2H9AA 3W3AD 3AR7A 4CKXA 3D7SA 5CB4B 3L7CA 2BBOA 5K09A 5IVIA 1QHSA 1COZA 1CQJB 5EESA 1PJCA 2D0IA 4ZU3A 3WRYC 1KC3A 2QRVA 1C0LA 3HU5A 2ID8A 3ES9A 5DT9A 2GZAA 3OJEA 3RC7A 2C0PA 1B42A 2QU7A 3DXFA 3C15C 4OLBA 3ID6C 2ZKLA 3OY2A 4ZEMA 4PG4A 3ODGA 2CVHA 1HZZC 1EX1A 2WV7A 3L0SA 4IQFA 4ZAGA 5CR9A 5KQSA 1ML4A 1T8RA 2X0KA 5TT0A 5LMCA 2NZXA 3JVEA 8OHMA 2GVZC 4FXPA 5IXYA 3VTKA 2XGJA 1KVQA 1K98A 1UWKA 2XB4A 4MNTA 2WSSD 3O2QB 4PXAA 2VQDA 2YY7A 2PZLA 3HCWA 3RTBA 3TN7A 1EK6A 4OM8A 3KZVA 4TSFA 5KJ1A 1SU8A 1F51E 3EQ2A 2XQJA 1PGNA 4MI3A 3RSQA 3AFIA 4R01A 2XZPA 3O95A 4DADA 4I4LA 2MR5A 4F9FA 3SCZA 2A1UB 3MGAA 2YHIB 4FN4A 2IHVA 4J9UE 4MWGA 5SZKB 4YLYA 2C03A 1EFRD 3THXB 2QS9A 4OEHA 5BOSA 4DMUB 1WPXA 1NF2A 4D8UA 1EVQA 2PMCA 3L04A 2FMXA 2VRCD 3R7NA 4RY8A 3DBVO 1DFHA 4IXMA 3RASA 1DCMA 1GZ7A 4OHUA 5FOTA 1YS1X 2R1UA 4EL5A 1YZTA 4IIUA 1FU7A 1IAVA 3ELBA 4WEOA 2QDKA 1EFHA 1HYEA 1HTTA 1MA0A 5L53A 4IMJB 4B9EA 4LNUA 4JYPA 3KPJA 2F48A 3P45A 1YXMA 3ZWWA 2GSWA 2EW8A 1JE1A 2C7GA 3G2MA 2QR2A 1A82A 3B1VA 4GL4A 4WUVA 3TRDA 2P6UA 4RVSA 2J0VA 1OTHA 3ZLTA 4F1KA 5I7AA 3WLMA 3NRCA 2P8SA 2BFOA 1BAPA 2P2GA 2ECQA 5CP8A 1EU1A 4BAZA 3NKVA 4CF7A 3KJNA 1ZNWA 3ZI4A 2FE4A 4U7HA 1PDWA 2C2HA 4AK9A 2IDJA 3Q1LA 4EFMA 2XDWA 2J3DA 3OF3A 2HREA 3D64A 4FHZA 4QTUB 5CK4A 3K20A 3VSDA 5A06A 4XJXA 5DHRA 2AMLA 3RREA 4GX5A 1P9LA 2Y0DA 3HBLA 2UDPA 4GQIA 4DIFA 4EGFA 2FZ5A 2Y05A 1XK6A 4XCXA 1MH9A 1OKKA 3UW1A 3ZIUA 3MWEB 1DC5A 5LZ9A 1BFKA 1W36D 1USKA 1H8HA 2O7NA 1HO3A 5K0TA 1T6XA 1TLTA 4E88A 3EQ6A 1LDMA 4GWGA 1OI3A 5F52A 5C9ZA 1YVUA 4ZALA 1DX6A 4ABTA 1JJBA 1QVWA 1XYGA 4HNAA 2WLTA 4FI3C 3PNBA 1WU8A 3P52A 3EAFA 2PXHA 3KCNA 4MMXB 5SYAA 1U9CA 2ZJ5A 2I3DA 3FKQA 4CLOB 1HT1E 4Z3DA 1I4WA 2NNWB 3EXIA 3Q0EA 3G85A 4N6GA 4MVWA 4Z51A 2A9OA 2VLBA 3ESBA 2OK7A 4WA7A 4E5KA 1Q22A 5FAXA 4MCIA 5CFMA 3KYCA 4KI7A 3UZUA 5DEIA 2VTBB 5J5CA 3RU3A 3WNQA 1PJAA 4NK5A 1Z5UA 5ULLA 5A7HA 1DTWA 2JIQA 3FPAA 1JDSA 1KYIA 3IQIX 1UM9A 1BMFD 1A96A 2BR4A 2EWWA 4YAEA 2XQFA 5JVDF 3KQUA 3H0EA 1NG1A 3CTMA 4V03A 3U1TA 1ZN2A 3HYLA 4XB1A 1A0OA 3NTXA 5ES3A 1OTXA 3KSRA 5CFRA 4LYFA 1NUSA 3SDZA 2FG7C 3ORSA 3T0IA 2J9YB 1LS6A 4ZT2A 1DRJA 3RSOA 1YZLA 2WG0A 1B26A 1DBQA 1VG1A 2J33A 1WB4A 1T91A 2YXBA 5LDHA 3ZCQA 1VIDA 4A7PA 4CEHB 1MOSA 2VWQA 4C9BA 3CN9A 1UANA 3OSUA 3OT1B 5C37A 2HD4A 5JDCA 5JDCC 1WCIA 1NYQA 1SXJC 1SXJA 2R6JA 1YKFA 3NTOA 4JLUA 4L3WA 5IAAA 5C81A 4YBZA 1PO7A 4BJ6A 3GNQA 1W6UA 2P90A 5LCXA 3MUEA 2MINB 1YJBA 3LOQA 4HC4A 3CEJA 1P0IA 3GNTA 1T9ZA 3FTQA 3LVFO 3R3UA 5EUBA 1LLUA 2P41A 3AIKA 4WWHA 1PVOA 5LQCA 2CL5A 2HF2A 3IP9A 4JJIA 1MXFA 2ZIGA 3OOJA 4LMBA 3ETGA 4GECA 2ZPAA 4XRGA 1CNEA 3VRHA 1UDBA 3CSSA 4MUIA 3BHMA 2V7VA 4DT1A 4HDRB 3GEEA 1N77A 1JXAA 4XDZA 5B4VA 3I5AA 2NZUG 2C2KA 3WR5A 4FZRA 1VP9A 1DC3A 2NIPA 3SX2A 4FFDA 3FUXA 5D3QA 3ZWVA 1PS8A 3CUWA 1OHHD 4AKIA 1IH8A 3TVDA 2QP3A 5TQJA 1Q1ZA 1W4RA 4L72A 4O0LA 3F6SA 3TB6A 1LI5A 2PVPA 2Z2KA 3MWGA 3CEAA 4JC4A 4OHFA 2FB9A 1QCYA 4IMRA 5FJJA 3RK1A 2WJ6A 1QB7A 3IPRA 4R41A 5IASA 1FTSA 2WT4A 3CNHA 1U2SA 4Z5XA 2JBAB 2VYQA 1WXQA 1ADYA 4CKCB 4DNXA 3HEMA 4QFDA 3L18A 1F7UA 4KEAA 3TD2A 2YOFA 4IXTA 4OH7A 4EUNA 1CIVA 2WTXA 3GF4A 1EGQA<