4HLCA

Sulfonylpiperidines as novel, antibacterial inhibitors of gram-positive thymidylate kinase (tmk): compound 5
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
202
structure length
195
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Sulfonylpiperidines as novel, antibacterial inhibitors of Gram-positive thymidylate kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 195
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hlcA00
4QM7A 1QVAA 4CEJA 1XEFA 4OHXA 3GFOA 2O52A 1HTWA 2OO7A 4R7ZA 4Q9IA 3VR1A 2VP9A 2FJUA 1KDRA 3MJHA 3A4MA 3D8BA 3TVTA 3ADBA 2J41A 1XXHB 4PHTA 4C7OB 3SHFA 4HDQB 2QE7A 4TL8A 2OBLA 4AY2A 5BYJA 2A2ZA 4B76A 2IL1A 1IN8A 1M8PA 1VYTA 1NG9A 2AD1A 1R0YA 2NOAA 3NEJA 5FI1B 3ND8A 1MO4A 1T91A 2QAGB 4FD2A 4JVNA 1QHHA 4DIDA 3K0AB 2CVFA 4RD2A 3REFA 2OM2A 1CJMA 3C8UA 4D0GA 4C2TA 1I4TD 2RCNA 2IYXA 4RVCA 4FIDA 1SVWA 2WIAA 2IYUA 4M1KA 4NTZA 4C4PA 2ZRDA 4D4KA 4Q4HA 2GETA 4QBGB 1C4OA 3NDBB 1RRFA 2XITA 2WBLC 2J5XA 2R8RA 2O8FB 1E9FA 4N3NA 4A8JB 3HP1A 3OIUA 5G53C 1OHHD 3FKQA 4NCHA 4PAMA 1XEXA 1JB1A 4DLUA 4ZCLA 5KNBA 1BMFA 2BCJQ 2Q3MA 2OZEA 4II7A 1Z0KA 1YZUA 3N2IA 3NWJA 4HB0A 4DCSA 3TE6A 2GTPA 4TZ6A 2IYZA 2R62A 2GAOA 1AS3A 3EARA 3GJ7A 3C41J 4KFTA 1ETUA 5D3MA 4E07A 3ICEA 1NSFA 1VIYA 2I3BA 2WAYA 3BBPA 3D31A 1U90A 1AA9A 2OV2A 4I1SA 4Q00A 1QHIA 3WNDA 4F4CA 4Q1FA 2RKOA 3ZH9B 4X8OA 1OKKD 1T4GA 4QM6A 3I4LA 4TMWA 2QG6A 2GRJA 2OG2A 4R2IA 1SXJE 1U8ZA 2J87A 2KJQA 3KXLA 2BHRA 3AKEA 1N5LA 2D2FA 5GJBA 3CRQA 3RDPA 4AYXA 1MKYA 1F60A 1EFTA 4ZCIA 3H1TA 5CM8B 2B7CA 1AN0A 1US8B 3OFNA 1T3HA 2GCOB 2HXSA 2IK8A 3BWDD 3KJIA 3LBNA 3TIFA 4EQ6A 2ZJ5A 1NRJB 2V9PA 2C78A 1SVMA 2GJ9A 3THYB 2JA1A 1GRNA 1IN5A 1WDTA 3OEED 2A9KA 5FBQB 1ZUIA 4U02A 1UBFA 1NVVR 4Z8XA 3P32A 4KBGA 3LD9A 3LO5A 4RCYA 2FE4A 2FFAA 1HE1C 3BH0A 2EVWX 4CZ2A 2P6RA 2R6CA 2QMOA 2ZR0A 3CRMA 4JMPA 1P3JA 3K9NA 4PZZA 1LF0A 2BMFA 1A5TA 1XEWY 4LJAA 3B8HA 1D8TA 3QPWA 2ZE5A 2OAP1 3U3KA 5KSPA 2BM1A 4ILEA 5FTLA 4Q7KA 5C4MA 2O8DB 1KI6B 2EFCB 2QE7D 4O0MA 3ZZTA 2QPTA 1DO2A 2GWHA 1LNZA 4OL0A 1IXZA 2F43B 2BMDA 3BERA 2R6GA 2BBTA 2Q9BA 5DI3B 2ZR7A 1E2IA 1N0UA 2NO9A 2RGBA 1FX0A 1I4DD 1L7VC 1CLUA 1AQUA 2IHYA 4OKSA 1JR3A 1EFUA 1JPNA 4B33A 3T1TA 2RB4A 5FPSA 5SZJA 3W5IA 2AK2A 3L0IB 4UQOA 3QENA 4NMMA 4B3CA 3ZQJA 4HLCA 5B30A 1KHTA 3QKUA 1IXSB 1RIFA 1RYFA 5JS8A 3WMEA 4FCTA 4JLJA 2JATA 2RGXA 5D3QA 2ZIAA 3K8YA 5KYKA 5ELXA 1M6NA 5EE3A 5ANRB 1IONA 2WWXA 1BMFD 5FBLB 4LBYA 5DSZA 4CEHA 1BS1A 1U0HC 1OJLA 1W44A 3Q72A 4A36A 3RWMB 5JJIA 4JLKA 1A2KC 1G4UR 2BJVA 4US1R 4HB2A 2IS4A 1GZSA 5HCIA 5EXTA 1KY3A 1FP6A 1YR6A 3TJZA 1MH1A 3REGA 3VFDA 2WJHA 3Q7PA 4V03A 3J81k 1XDBA 1OYYA 3OZXA 2WV9A 4I1VA 4E5UA 4AKIA 1KSJA 2EQBA 1WE2A 1Q1ZA 3EPHA 3EASA 2DFTA 1SKQA 2HF8A 3EC1A 3EXAA 3VR3A 2RH5A 3EPLA 2VP0A 1GKYA 4MRPA 2VO1A 2BMEA 5L3QB 2C8VA 4KFSA 1UEJA 2QP3A 2CMKA 4IHQA 2I1QA 1AZTA 3IGFA 2C9YA 4FN5A 3WRXC 3OFND 4NONA 1XB2A 1ZM4A 3JZMA 4A1FA 1GITA 1OXXK 1WXQA 2PT5A 3LH5A 3NTUA 3GLGB 3B7GA 3ZGXA 1TNDA 4ACAA 3GLFB 3GFPA 1U9IA 5JBQA 2ANBA 5AWFC 1XNJA 4POAA 2VP5A 2HT1A 5BN3A 2GAAA 1GSIA 2QN6A 4DIEA 4U5XA 4D81A 4A4DA 1XPUA 3MWLA 3B6EA 2FFQA 3UIEA 4ZI3A 3I32A 2Q6TA 1MR3F 4JT4A 5CITA 2D2EA 3TSWA 4AK9A 4I4LA 3CR7A 4TLDA 2DHRA 1P61B 1YZNA 3E5HA 4HLQB 5J47A 2FFHA 5GJWC 4TZ0A 1W5SA 3WP1B 4RKEA 4Q1AA 3NHAA 2OCAA 4NYMR 2OFWA 1N0WA 2ZS9A 3TUJC 3UXMA 2JLYA 3UPUA 2ZJOA 4PQFA 3K0AA 1P6XA 1KI8A 3ZDQA 3I5YA 2WSSA 1HYQA 3G5UA 1U9IC 2R44A 4ZDWA 1JR3D 1G7SA 4TT3A 5CYPA 2AWOA 5KPDA 1TF7A 2EWWA 4CT4B 1X1RA 1S1CA 2EYUA 1MOZA 1FMLA 1KZGB 1KSHA 2PBRA 5JFGA 1YJ5A 2ASEA 4TMTA 2ZS8A 5J40A 3SEAA 1J8MF 3U44A 1FUKA 3FHCB 1JEEA 1IN6A 4Q1BA 1B23P 1G64A 1F3OA 3U3OA 3NH6A 4GP7A 4B48A 2ORIA 2ODWA 4Q1EA 2D4HA 4Q9KA 4PSVA 4AG6A 3T15A 3KL4A 4RY2A 1F2UB 3W9YA 2J0SA 1CR0A 4AWXA 1HY3A 1K5GA 1GIAA 1NKTA 1N6RA 1Q0UA 2EFGA 3LXRA 5FUYA 1RZ3A 1DAGA 2FMXA 4M1WA 3SDZA 1GL9B 3NH9A 1KI9A 4R9UC 4WZBE 1XTIA 4LZZA 2F1RA 5DH9A 2B21A 1CR4A 3RS4A 3B5JA 3UG7A 5DISB 3T1VA 3FPAA 3L43A 1IBRA 1NVUQ 2YC2C 2F1JA 4BEBA 1JI0A 2P2LA 3LXXA 4AC9A 3QF4A 2QPOA 3SN6A 4BZXA 5DN6A 3TW8B 4A8JC 4NU0A 3VHLB 2GCOA 4TTPA 3EIQA 4S35A 3GEIA 1E4YA 1KJYA 3W8NA 4N0EA 5AUNB 2WIBA 4URVR 3PUXA 1LVGA 2BV3A 4QOSA 4Q4LA 3RS3A 1YR9A 2IXEA 1TPZA 3UG6A 3OHMA 5AJZA 2BIFA 1G1MA 2QENA 4DJTA 3SQWA 1TU3A 1Z5ZA 1RRGA 3IIKA 5JI3E 5K8UA 5KSYA 2DCUA 1L8QA 3PV0A 1UKEA 2QMEA 2ZROA 4LJ7A 3CKLA 3B82A 3QXJA 4UNPA 4FWTA 3Q8XB 1ZM3A 1KAGA 1ELOA 3DEFA 4BRWA 2I1VB 4LBVA 1NY6A 4E22A 2A3RA 3M4YA 1ZC3A 2ZUBA 3NXSA 1KI6A 1Z22A 4IFEA 1OB5A 2ANCA 3VQTA 4LK2A 2O0JA 3RNLA 3RC3A 2ZYWX 1NP6A 1Z08A 3U7HB 3OAAA 2BJWA 3EA5A 3GFTA 2WSSD 3FGNA 3HWSA 2N42A 1GOTA 1CJUC 3P20A 4TT3D 3VR2A 3VKGA 1GM5A 5KTYA 2D06A 3DOEA 1CTQA 4CYMA 421PA 5AUPB 2IEYA 4B71A 4QBIA 1XBTA 4A6PA 3WNBA 1V43A 1J90A 1G7CA 4Q9JA 3AVWA 4L15A 4NCKA 4O3MA 2OEPA 4LCBA 4OQFA 3QNUA 4TYWA 1UKZA 4JJZA 1AKYA 2ODNA 1XD8A 2XNSA 3TH5A 4WBSA 2JCSA 1NMYA 4URZR 1TQ2A 5JI2E 3OE7A 1G8PA 1GUAA 1KI1A 2GESA 2G9NA 2MMGA 2QBYB 2OHFA 1NJFA 3RRMA 1KJZA 4PANA 2VP4A 1M7HA 2WMOB 4C30A 2DBYA 2P0EA 3CNNA 2GCNA 3TBKA 2JLWA 4BZPA 4DDWA 1JXMA 1W46A 3GJ8A 3VTKA 3NIBA 1FL9A 1RJ9B 5L3SB 1CEEA 2YOFA 2Z5FA 5DI9A 5DN6D 4IOMA 1QHXA 3ZS8A 1Z6AA 5KDOA 1W36D 3BD9A 5JSZB 2PH1A 3QIAA 4B32A 1LB1B 2NPFA 1DARA 2DYKA 2NTYC 4M1YA 2AKYA 2IYRA 4IDPA 4KVGA 3DVLA 4MRSA 1DELA 2D74A 2LKDA 2GA8A 2Z83A 4LBZA 2NZJA 2DR3A 3U4QB 3RSLA 2QORA 3OF5A 5BWMA 4JS0A 2ZU0C 3BIFA 4NCIA 1VHLA 5F3WB 1KKLA 4DWJA 1KZ7B 1ZU4A 2G0NA 2V54A 3U7EB 1Z47A 3B1WA 1FNNA 3GJXC 1ZYUA 1EWRA 1UBGA 4JVSB 3X1WA 1E32A 2GEDA 3BFXA 2WHXA 1VG8A 5GJCA 1TAGA 2BDTA 4XWAA 2WKQA 5DE3A 3O47A 1L2TA 4JZKA 2GF0A 1P9RA 2HF9A 4OJKA 5C4GB 3X1DA 2XB4A 3L0OA 4B3XA 3V4RA 4M9XA 4C2UA 3OAAD 3FYHA 3KX2A 4BWYA 1II9A 1KK3A 1ZCAA 1K8RA 2ZE6A 2ZRJA 1T0HB 1BOFA 1SQ5A 1NN0A 3AKYA 1XRJA 4Q4JB 3RYTC 1R5BA 5FOWA 4L9SA 4DLVA 2AR7A 2PEYA 3NBYC 1XX6A 1OW3B 2JJ1A 1VG0B 4BLPA 4D26A 3K09A 1YKSA 1E2DA 5E95A 3A1WA 4URUR 1F2TA 1UJ2A 4TMKA 1Q22A 5J4YA 3DPUA 1WBBA 5TARA 2J59A 4AYWA 2IYQA 1WP9A 1Z0FA 1G20E 2OESA 5FL7A 5AUOB 5JMTA 1ZW6A 3GEHA 1U0LA 3O8RA 2QRNA 5EE9A 3TGPA 1JJ7A 2ZPTX 1G5PA 1T3SA 4MDEA 2HCJB 1KDOA 3K0FB 3TRFA 4YC7A 3OE7D 4IW3B 3WYFA 1W5TA 4MRNA 4FMBB 1G6OA 4ZIRB 1NJGA 4P4SA 5AJXA 5GVSA 3CF0A 1G17A 4G01B 1N6HA 5CK5A 5G41A 4OQLA 5JRZA 3BAFA 1EESA 1KOFA 4AKGA 1Q20A 4M9QA 4JBYA 1SKYE 3MMPA 3WHLA 3K09C 2QP9X 3RS0A 2FOLA 1JR3E 4UJ5A 4EJSB 1TX4B 3A1VA 1ZM2A 3AF2A 4TQAA 5F2EA 2ATVA 4EPTA 1ZJ6A 3QF7A 4G5OA 5HE9A 4B44A 1I2MA 4ZCMA 3M0EA 3HPQA 2CNWA 3WMGA 1HA3A 1MO6A 4LHWA 4UNRA 1X3SA 3DZDA 3LLUA 3KFXA 3HPRA 4F91B 4I1UA 3SJCA 4QNMA 4Q47A 1NN1A 3EZ9A 4FINA 2F7SA 2CL0X 4OBEA 4OI1A 1VCMA 1EG7A 2RGEA 1TL7C 3AVVA 1E9DA 4MGKR 4C0KA 3UMSA 2RMKA 4Q02A 1T3LA 2O8BB 1DEKA 2IXFA 3DO6A 4B3GA 1P2SA 4P0TA 3PR1A 5FPHA 2JASA 4KITB 2LKCA 1OIXA 2XEXA 2GKSA 2OFXA 1S3GA 2H57A 3SBDA 1VIAA 1NG1A 1KGDA 2O5VA 4O25A 5FPTA 4M1SA 4NCJA 4XWOA 1MRNA 2CJWA 4MQBA 1E9SA 3H84A 4Q1DA 2RGNC 1WB9A 1S3SA 1PVOA 3CWQA 4PHFA 3AVPA 4ESHA 4RZUA 2W00A 2ZI5A 4KBFA 2VSOA 1R2QA 2D7CA 1E9EA 3T61A 1GWNA 4BFXA 1MRSA 2ZEJA 3FWYA 2IHBA 4MKHA 1AM4D 2HXYA 4D2IA 2QRZA 2X19A 1NKSA 3IO3A 4HSEA 2J45A 4P31A 4B3BA 3ADCA 3W3AA 1OSNA 1MV5A 1Z06A 4JLOA 3B9PA 3VNVA 2OAQ1 5BYKA 4H1UA 3LWNA 3BH6A 3CH4B 1P75A 4QJ5A 2CHQA 3ASYA 2CCGA 1XTKA 5FL7D 1G8FA 1ZU5A 1KO7A 1JPJA 1VECA 1CJVC 1KAOA 4U00A 4DCUA 5A4JA 3KXKA 4DVGA 3CF2A 1ZM7A 1JEDA 3A58B 2ZQ5A 3PXGA 2NMVA 1YZLA 3F8TA 3FMFA 4YLGA 3VX4A 4C0LA 1NLYA 4XSGA 1E0KA 2JJ8A 4RZ3A 2QQEA 4FMDF 5H1YA 2ECKA 2YJTD 1ESMA 3CNOA 3KTAA 1T5IA 1D5CA 2G1JA 4IDQA 4PO8A 3ZVLA 3V00A 4TLEA 3MWJA 4PZYA 3FTQA 4G5RA 5JSZA 3PEVA 5DO9A 4XJXA 5AJVB 1G7TA 3RANA 2IYWA 2KI5A 1PLJA 4M1TA 5GADl 1FNMA 1II8B 5FBRB 3A6PC 4JJKA 4FCVA 2CNWD 3PEUA 2ZRLA 5JWRA 2RGDA 1UDWA 3U4QA 4R98A 4UKDA 1KTVA 3NBXX 4PSKA 4BFZA 2R65A 2YWHA 1YR8A 1XMIA 4Q9HA 4Z1MA 3W6PA 3MLEA 3ADDA 2KB0A 1AK2A 4BECA 3TNFA 3BXZA 1JECA 1QDEA 4GPTA 2ERXA 2VBCA 3AM1A 5KPJA 4JLAA 4EPVA 1NF3A 3TUZC 5DYGA 1CIPA 1G16A 5JJKA 2UZIR 3QG5A 1N6KA 1MO5A 4Z51A 1U8AA 3ASZA 5C18A 3CUEF 2FGKA 2SHKA 3BORA 3K0SA 1TQ4A 3AVXA 1L4YA 2Q9CA 1PV4A 4IDOA 4C0BA 1G5RA 3DDCA 3GLHA 3SNHA 3L2OB 1R0WA 1E0AA 1BKDR 1W4RA 2R6DA 1XD2A 1CR1A 2XB2A 4LJYA 4HYYA 3DMNA 3CR8A 1PLKA 1E3MA 4P4TA 4W5WA 1HH4A 4JKIA 4B2IA 3B9QA 2ODEA 4A2WA 4B75A 1KDPA 1XTJA 2V1XA 3FB4A 3VU9B 2GEUA 1OFIA 1W49A 3QEOA 2OLJA 1QVRA 2J46A 2OBMA 4YMUA 2VH5R 3AVUA 3AUXA 2MSDB 4KSBA 3B60A 4OHYA 5CLLA 4HLDA 1XMVA 4CEIB 3IEVA 1JBKA 4QG7A 2O8CB 3IDQA 1RRPA 1GAJA 1HT2E 2JLRA 1ZMXA 1U0JA 2BEJA 2QMUA 3K0FA 4JVLA 4MGIR 5TV2A 5CDFA 2FEOA 2W0MA 4WVFA 4BFWA 2ZJBA 1GP2A 3LLMA 4NYMQ 1GDDA 5B2ZA 4QKQA 1OXUA 2C2HA 4WZ6A 1Z29A 2J9RA 4RD4A 2GEVA 4GFDA 4TSFA 5FOUA 1N3BA 4M1OA 2YVUA 2A30A 2C9OA 4M1MA 3ZVNA 4WIAA 1DOAA 4EPYA 1N6IA 1EFCA 1SVOA 3T5GA 3EIEA 3IO5A 4GBMA 3IIJA 4K81B 4LX0A 3VKHA 2ZAMA 3FHOA 2O8EB 1W2GA 4NKRA 4TMZA 4PPQA 4QL3A 2H18A 1P9NA 5JS7A 1NNEA 3FOZA 3FE2A 2AFHE 1XJ0A 4IJMA 1W47A 1S9DA 1NY5A 1XF9A 1D2NA 4L16A 2PLRA 3FFBA 1GG2A 1UEIA 3QBTA 3GLIB 4OHVA 2V55B 1T8UA 3AEZA 3ECCA 1ZP6A 4PAQA 2ZYVX 1Z6TA 3CBQA 4Z1MD 1E9AA 2AL7A 1U2RA 4CGZA 1FOEB 4GL2A 721PA 1Q1BA 1EFRA 4US0R 5JZVA 4A2PA 4IXMA 2FSFA 1GTVA 4TYYA 1HQYE 1N25A 1KO5A 2CEAA 3GQBA 2XNDA 3K53A 2FSHA 4ARZA 1VCNA 2ZI3A 3QPUA 2R6FA 4HUQB 5EXSA 2Z0MA 3MGCA 3R8FA 4C0SA 5K8LA 2BCGY 3AF0A 1LY1A 1XCGB 3NC1C 3AV0B 1FTSA 2ZRAA 3QBVA 2IF2A 4IEEA 5KO2A 1SXJB 2J0UA 4BGDA 5HZKA 4HEJA 2IT1A 2GXSA 4YDSA 2ATXA 2Z4RA 4QFMA 1RPZA 3SYNA 4CW7A 4ZDIA 3KDSE 2P5SA 2N46A 4O2LA 2GJ8A 3UATA 2UKDA 1F48A 2H5EA 2QA5A 3G82C 5BXQC 2AK3A 4PQRA 5J4LA 5LPNA 5CIQA 1GILA 4MA4A 3S1AB 2GVDC 2ZRBA 5SZKB 1D6JA 3B1ZA 5FUXA 2PZEA 4MITA 1E2QA 3D6TB 3QXSA 1SULA 4FMCF 4HAZA 2ZJ2A 2VQSA 3IILA 2DFLA 4MUAA 4RD0A 1DAHA 2B92A 4BLSA 2VSFA 1KMHA 2RGGA 3KB2A 2JLXA 1U99A 1TQDA 2IEZA 4TSFD 4F4JA 1YZKA 3N2EA 3HDTA 3DM5A 1E2HA 3LFUA 3IIMA 5SZIA 2BM0A 4YMTA 1LV7A 4LPSA 2H16A 3GJ3A 1R5NA 4KXFB 3RS7A 5DIFA 4F92B 3TVDA 2C98A 1X6VA 2GILA 2ZREA 4DT1A 3CNLA 3IEUA 2EYQA 4JSYA 4M2LA 3BH7A 1FFHA 4IOJA 4RJLA 1P9WA 4GOXA 3WBKA 4G5QA 1ZM9A 2V7QA 3U61B 5EUQB 3MFYA 4ZI2A 3LA6A 3HJNA 4XWKA 2ZJYA 1DG1G 4RD1A 5KOYA 2XXAB 4I99A 3QXXA 4W5HA 2FSGA 4Q7MB 4EUNA 621PA 5LD2B 2O0HA 5FR1A 521PA 4GDFA 1OIVA 1XXHA 4C7OA 1QRAA 4ERNA 5JHHB 4JLVA 1RW4A 2GZAA 1G8YA 2JAQA 1DG3A 1EFRD 1FMJA 3FKSA 5FOXA 4Q19A 4OHZA 4PPGA 2F3TA 3L0SA 3VR5A 2W2XA 2QAGA 2HT6A 2JGNA 4XVRA 2NIPA 4DLYA 4UNQA 5FBWB 3ZD6A 4Y0AA 2JLSA 2IYYA 4AKEA 4U7DA 2XNDD 1J70A 2ODBA 2ZRPA 1XCMA 3KJEA 4HLUC 2QGZA 3L8ZA 5E4FA 2QEQA 5K8IA 821PA 5F9HA 1Z0JA 3VAAA 5FBVB 4Z8YA 2O8FA 3ZIAA 4NH0A 4A8JA 3TSOA 3CH5A 4IVRA 1ODFA 1JQJC 2TMKA 4XVQA 1O3YA 5JEEA 4D25A 3WRYC 5JCZA 4NCNA 2REXB 1MO3A 1RFLA 1ZC4A 2WJVA 4LDJA 4LBWA 3VU9A 4W7SA 4B47A 4PC1A 4TMVA 3KKOA 4W5JA 1YR7A 1UDXA 3TR5A 2QAGC 3VKWA 4XSHA 1OB2A 4CEIA 2G88A 1XJQA 3O8BA 1ZIOA 4MDFA 4TQ9A 3KUDA 1K6MA 3AGPA 3RLFA 3EZ7A 3OEHA 2WJGA 4QNRA 3TAUA 4LPKA 1Z07A 4KU4A 2V4ZA 4A2QA 2FN4A 1AZSC 3SBEA 2YOGA 1XPRA 2G77B 2WAXA 1E2GA 2AXPA 3BS4A 4LJ5A 1CKEA 2REOA 1US8A 2J1LA 1ZNZA 4CVNA 1DTSA 4KVAA 2QNRA 4PZLA 1PJRA 3E1SA 1XCPA 2XOKA 3THYA 3AH8A 3QKTA 2JLUA 4B74A 4RFVA 2NO0A 5K8TA 3TUIC 2OE2A 3ADKA 4JKYA 2Q0HA 3SS8A 4DLRA 2NG1A 3THWB 4JYCA 4RFSB 2FZ4A 3AUYA 4EFMA 2V7QD 1YU9A 3GLIA 3TR0A 3P26A 1IAQA 1XTRA 3JVVA 3R20A 4PPFA 2QROA 4LOAA 5IK2A 4IFBA 1XU4A 3FMIA 3A4NA 2YYZA 4BZQA 3IQWA 2IYSA 2XX3A 2IWHA 2O8DA 2PX3A 2NO1A 1FQKA 1A82A 1E69A 1KK0A 1P4SA 4KHZA 5FUWA 5TY0A 1YRAA 5L8VA 2F43A 2J3EA 3HYTA 4LV6A 3FKSD 5CLQA 1OYWA 3VNUA 5DYIA 2DWOA 5DI3A 4XTCS 5FR2A 3U6BA 1UFQA 1CRQA 2QMHA 3WMFA 4C0JA 5C2JB 5M04A 3B1VA 2GZDA 1FQJA 4KJZA 1UKYA 5HR5A 2A5YB 4V0OA 4MYUA 4AG5A 4QGAA 1E1QA 4UNSA 4EPXA 1X1SA 4OYHA 3PJRA 3SJBA 1XTQA 2GF9A 2X8AA 3I92A 2WWHA 4CRWB 3CO5A 2CCKA 3ZIAD 5HKKA 4KI0A 4Y0VA 4HATA 4LC0A 1LF5A 1QHYA 3MD0A 1OIWA 4G1UC 1SHKA 4B6EA 5JEDA 4ACBA 2QTFA 2ERYA 3LVRE 1WBDA 1HUQA 5B64A 1BYUA 2WZQA 3T1OA 3LY5A 2QSZA 2OCBA 3WP0A 4PHGA 1WRBA 2ZI9A 1G3IA 3U60B 5AK0A 4Z54A 5H70A 1T9HA 2IUSA 4TL6A 2CLCX 3QKRB 3S1AA 2BKUA 1HEIA 4WOPA 1TU4A 3N70A 2PJRA 3DOFA 1G8HA 1UKVY 4IOLA 5FOVA 4P4UA 5EP4A 3SU8A 1A4RA 4NYJQ 2IF0A 1T5LA 4DCTA 4NYIQ 2DB3A 1KJWA 2PJZA 1ZAKA 3OEHD 4HAWA 4AYTA 1YE8A 3LX5A 3PIRA 4Q48A 2DWPA 2ZYUX 4A0RA 2H7VA 1K5DA 5JECA 1SXJC 2W58A 5CJPA 4PO9A 3I73A 1AS0A 5L3QA 2YC4C 3GLHE 4FMDB 2CDNA 5TMPA 2IS2A 3A4LA 3OIVA 2H92A 5FOSA 4CT5A 3CRRA 4FCWA 3K1JA 1J99A 1QG4A 2XOKD 2NO6A 2ZR9A 2ZSDA 3GLGA 2JLZA 3GCGA 3GLFA 5JJLA 3AKCA 2ZI6A 2QZ4A 3VX3A 1E2KA 1E2EA 3LQQA 2Q9AA 3AF3A 2JEOA 2F9LA 1R0XA 3R9IA 4NPHA 1Q3HA 3L82B 3HR8A 4IKEA 2DFNA 2ZI4A 2JJ2A 2MMCA 1PUJA 1NSTA 5J4VA 2C95A 5IK2D 5KDDA 3H4MA 1NBMA 3U5ZB 5C46F 2B6HA 1UBCA 1OH8A 3NDPA 4GP6A 2GJSA 1P2UA 3PUYA 1NI3A 5B57C 5CDFE 4CEJB 1ZIPA 2VL7A 3MJRA 5JCPA 1MT0A 2FWRA 3FVQA 5EZ5A 4Q7JB 2CL7X 3EC2A 2J0VA 1G41A 4LRWA 4C9BA 3I8XA 4K8OA 4WW0A 3WXMA 1VYVA 5DNYB 2WTUA 2WWGA 1JXOA 4BFTA 2RGCA 4OK6A 2BKEA 1G9XA 3EX7C 1CP2A 1TUEA 1E1QD 2IYTA 3DMDA 3I72A 5H68A 4DSUA 2FSIA 1J2JA 3DL0A 4OQMA 1DS6A 4L4UA 2WOJA 3SZRA 4IOKA 1G4AE 4V0LA 4AURA 4DEYA 1QHHB 4IDHA 5KSZA 1G3RA 5HKKD 2Q21A 4G3XA 2EFEB 1H65A 3UK6A 5LBIA 3V9PA 5LD2C 2VEDA 1ZVQA 3KFVA 3FDIA 4Q4HB 1RYHA 4BPBA 2E87A 2VF7A 4M9ZA 3Q3JB 1S2MA 1F2UA 3P27A 4I1OA 3CPJB 2CE2X 3UKDA 5AR1A 4QJ4A 2YKGA 4A0GA 2VF8A 4M9SA 3UWOA 1ZNWA 4HZIA 2VLIA 2WWYA 1OFUX 1XEXB 3FFAA 5CYOA 3RABA 1T8TA 1ZD1A 2IA5A 4H1VA 3R7WB 1X8JA 2VSXA 4JT2A 1R8QA 3RC8A 4YMVA 3SYLA 3ONWA 2W6IA 4KFUA 4F93B 3KUCA 2A5DA 4DHEA 5D3MB 2EFHB 4LJ6A 1AGRA 1N6PA 2WICA 1UADA 2ORVA 1VDZA 1X8KA 3GEEA 5LDDC 1SVKA 2V8OA 5TVKA 4W9MC 4GI7A 4OHWA 2GXUA 4FWIB 2QTHA 4HUTA 2WSMA 5GVRA 1GL6A 4KO8A 5KU1A 2F9MA 1ZUHA 2OT3B 4ITRC 4DEXA 2GBLA 1KO1A 2RGNA 4TTRA 3A36A 1W4AA 1IY1A 2G1KA 4Q01A 4DBLC 1TUIA 4AIIA 1FPMA 3D3QA 1ZNXA 5IF9A 3THWA 3AVYA 3PG5A 4EQ6B 2KWIA 4L8GA 1DAMA 1VTKA 4EPWA 1RVDA 4LHXA 3SR0A 2ZE7A 1Z2AA 3IBYA 4XD7A 1E1RA 2JJ2D 2VA8A 3A8TA 3BFKA 3O8DA 2IC5A 3E2IA 3UMRA 4NYJR 2HJVA 1NBMD 1DVRA 4NYIR 2GXQA 2OCYC 1NVXQ 3A1TA 1GKIA 1ZD9A 3JVUA 2WKPA 1LFDB 2IX3A 5E7JA 1HURA 3A1SA 2GBLC 4PPNA 3BFVA 4WA7A 1RRCA 4TN1A 1GNQA 4F38A 4LV8B 4QBFA 3E70C 4J0QA 4DUGA 1T0JB 2W83A 1W0KA 4B34A 1SKYB 2QTVB 5FOTA 1G8GA 1FX0B 4A0HA 1M2OB 1TMKA 3AF1A 3B1YA 2PLFA 3TW4A 4LYHA 3VR4A 4D4MA 5J4KA 3CRVA 1ZBDA 1M74A 4RD6A 3KKMA 4X8HA 2WJIA 3H0KA 4EFNA 2CK3A 3IHLA 1YZQA 4Q4AB 2QL6A 4G5GA 5KHOC 2NZ8A 4CDGA 1TTTA 2VTKA 3X1ZA 4JSTA 1HT1E 2FPLA 2GVZC 2YWEA 1H8HA 3QEJA 1KSGA 3PQCA 1C1YA 3RRNA 1XMJA 1XZQA 1XXHE 2OSBA 2AWNA 3EAQA 2QSYA 3OIWA 3T34A 4Q66C 3U7GA 3MCAA 2QBYA 1G7RA 1FZQA 3CWZA 3U2QA 3CPHA 1G3MA 2R6AA 3Q9LA 3C15C 4CEHB 2PZFA 3K0CA 2HLDA 3LAWA 3RWOA 4D4LA 3GJ5A 1U81A 3LW8A 3FHTA 5FI0B 2W6ID 4FMCB 1ONBA 2ZSEA 1RJ9A 5L3SA 4ZPXA 3EPJA 4DLSA 4RKFA 4HAVA 1WF3A 3TK1A 2AKAB 1LS1A 4A9AA 4QGGA 1YZGA 2G83A 3W6NA 3B78A 4LHYA 5BN4A 4KV9A 1G3QA 3LW7A 1Z6YA 3U3JA 4JL6A 3W3ZB 5E3HA 4BUJA 1AQYA 4V02A 1DE0A 1W0JA 1CJKC 1O87A 2IXGA 5CM9C 1E2MA 2DPXA 4XTRA 4TLCA 4BFYA 2Q3FA 5GJVC 1C9KA 3CX8A 2Z6VA 3LVQE 3KB1A 2A78A 1JAHA 1BYIA 2PL3A 2XJ4A 3M6AA 4MKGA 1GVNB 5KUTA 1IHUA 1X86B 2UZ3A 2ZE8A 3AVOA 4PC6A 1KO8A 2JLQA 3WYGA 4PAOA 4DSOA 2UVQA 3W8RA 2XGJA 3K0CC 1N6NA 4XD7D 4QGHA 2J0QA 1Y63A 1E1RD 1NN5A 3HU2A 4NE2A 2MSEB 3Q5DA 1DAIA 2OBNA 2VP2A 4HI0E 3BJIC 2FU5C 4TL9A 2QM7A 3PUZA 3BOSA 4MYTA 4NBSA 2OUKA 4LGMA 1CJTC 2F55A 2D3WA 4IRUB 2FNAA 3SJZA 3AB3A 5FFMA 4JL5A 5FH9A 1KIMA 2XSZA 3RSOA 1OXTA 5BN5A 3TSZA 1NLZA 4ZO4A 5EQTA 2JLVA 3ETLA 4URYR 5HCNA 4FXPA 4Q4JA 5LB2A 4DUGD 2GCPA 3EG5A 1W0KD 1OXVA 1VG9B 2GJAA 4FI3C 3QG1A 4Q03A 4KSCA 1RE0A 3ZZ0A 3ICQB 1AS2A 2FV8A 3MRSA 4GMXA 3C5HA 4TYQA 3ZS9A 1KI7A 3AP3A 2AD5A 4EFLA 4M21A 1Q1EA 1GKUB 1IY2A 3NKVA 2CK3D 5EUMA 1JALA 3AP2A 4RD3A 4DDTA 3GLIE 2QQ0A 3TQCA 3LDAA 3U3RA 4EAQA 2W6JA 4OI0A 2P6UA 3GD7A 4PTLA 1VKJA 5J4HA 3KQKA 3U44B 3AGQA 4JLNA 1H8HD 2F3RA 4TTQA 4B3DA 4AI6A 4ZIRA 4AD8A 2GDJA 4Q1CA 2ZSBA 4XOIA 4UNNA 4PXAA 3R7WA 2X2EA 1E98A 4D0NA 1IM2A 4DSTA 4MUBA 4XIGS 1RKBA 3I1FA 4OQXA 4LHVA 2VHCA 4UXIA 4X8MA 2HLDD 2WOOA 3U3MA 1OLOA 2W2TA 1SHZA 3P4YA 1EFHA 2AXNA 1WA5A 5BW8A 4EJSA 1S1MA 2PX0A 2ZAOA 4DZZA 1D9ZA 2H8KA 2WWFA 2ZUCA 2QPAA 1V5WA 3EA0A 2IUUA 4GRAA 4OI2A 1Y3AA 2CXXA 3GPLA 2X77A 3NC0C 4MGYR 2H1LA 2ZYTX 1W0JD 2GNOA 1COWA 2P6NA 3QF4B 4BASA 5JRJA 3C7KA 4C0HA 4Q7LA 4JBWA 1W36B 3EIHA 3BRWD 3ZQ6A 5SZHB 2PEZA 4A0FA 4BLTA 1S8FA 4ZDJA 1IQPA 1X8LA 4URWR 4QHSA 4OQNA 3KZ1E 4DLZA 2OILA 2NO7A 1AGPA 2BVNA 2ONJA 4PO1A 1KO4A 2CHGA 4F4IA 1IXRC 2RHDA 2O8BA 3QKSB 4ON9A 3UMFA 4YQFA 4D82A 5EJEA 3X2SA 2Z43A 3H86A 3QUSA 4A82A 3QSYA 4MYCA 5JWOA 2X1VA 5CK4A 3VMFA 1CR2A 4Q9LA 4EJSC 5EP2A 3KQNA 1EX7A 3B2EA 3K9LA 2YHSA 2DY1A 1GNPA 1B0UA 2HJGA 2KBEA 2XTZA 3TAHA 2QAJA 3SFVA 4LJ4A 3BB1A 5KSOA 1HQCA 3VHXA 4H9GA 3GP8A 1LW7A 3DZ8A 1E94E 1HE8B 2WWIA 2XSZD 1R5OA 2ZS7A 2XTMA 1TADA 2WM9B 3EW9A 4V0MA 3K70B 4MGZR 4MRVA 2WMNB 3MG9A 4QBHA 2FDCA 3IQXA 3THXB 3B1XA 1QHNA 2BMJA 3GJ0A 5E7MA 3OIYA 3GLGE 3GLFE 2HUPA 1DAKA 1D2EA 2CE7A 3CB4A 3ZJYA 5F9FA 1G21E 1DADA 2L0XA 1VHTA 4HZUB 1JR6A 4YONB 1DPFA 4TYPA 1CULC 4Q4AA 1SVLA 1DBSA 4PR0A 5B58C 1KYIA 1Q21A 3NG1A 4G0NA 4KAXA 2W6JD 1AIPA 5A5GA 2KSQA 1Z63A 4HDOB 1KK2A 4JLPA 4BQSA 1NBME 1VYUA 2ZRNA 3L0PA 3T35A 2GK6A 1I2DA 3Q7QA 2DFKB 1I4LD 2CLDX 1DAFA 3FMOB 3LBHA 4A15A 2GXAA 1MABB 2Z4SA 1OFTA 1E2LA 4EKDA 4ASUA 3SJAA 1CU1A 3KXIA 2C5LA 4PHHA 1OE0A 4XH9B 2OLKA 5FTJA 5EE0A 2J7PA 3GJ4A 2HEIA 3QPVA 2J7KA 1II8A 3CIOA 3IKJA 3PENA 4HLUA 2AN9A 3HR7A 4TLAA 5TB5A 5IT5A 4CIDA 5DHFA 2P3SA 2IS1A 1COWD 1CF4A 3KJHA 4FW9A 3KQLA 2YZ2A 5H8WA 3IBGA 3ZVRA 2LCFA 4QRHA 3CLVA 4KYIB 3RAPR 2YWGA 2ZI7A 3DM9B 2Q3HA 3AKDA 2REBA 4LWZA 1P2VA 4GNKA 2B8TA 4LHZA 3QY0A 3VR6A 1XMSA 3EZ6A 5F98A 4M22A 2XZPA 1GNRA 1Q12A 2FX3A 2G3YA 5FUVA 4X8LA 4KODA 1XFAA 3V4FA 3SFZA 2WJJA 3EPKA 5AJYA 4DC9A 1Z0DA 2F6RA 4M4SA 1E9RA 5AUQA 5CB8A 1IOZA 2FZLA 3LX8A 2ZRHA 2V6IA 3AF4A 4LYFA 3NBZC 1F5NA 2C99A 4QHTA 3CF6R 3TQFA 1M34E 4DLTA 2LWIA 5EE5B 4L9WA 4P32A 4D4JA 2V3CC 1NVWQ 1E9BA 1LTQA 2ZUDA 3RRYA 4L5BA 2YV5A 1YHNA 2W0SA 2QGNA 4BEJA 1TEXA 1Q57A 4A92A 1TQ6A 4PQYA 4BLRA 4EDHA 4F7WA 3R9XA 1KNXA 3KQHA 3OESA 2EU8A 5FPYA 4ZKEA 1TF2A 2C9CA 5C1BA 2AHOA 1S9HA 2WJYA 1SVSA 4LYAA 4C3ZA 1NN3A 1KK1A 4E09A 2QU8A 1Q44A 1CBUA 3A1UA 3RVBA 1OF1A 2O8CA 1P62B 2NPIA 3C16C 2FPMA 4QXAA 3I8SA 1N0VC 1VPLA 4YXWA 3SE0A 2ZRMA 1F2TB 2RHMA 3TKLA 3AQ4A 2ZTSA 4R71A 2CCJA 4UXJA 5HPYB 2FF7A 3AP1A 3F5FA 2E1RA 3SI7A 1JJVA 2FG5A 4R2HA 2A5JA 1BO6A 5EP1A 2OXRA 3HU1A 2O0KA 3CW2A 3R9WA 2IW3A 5DGXA 5A0FA 1R4AA 2P65A 1Z6GA 4OK3A 2P5TB 3PITA 4RCZA 5G3YA 1A2BA 4S2EA 4KLNA 4HB4A 4LSGA 3AVTA 4P4SB 2IWRA 2VHQA 2D7DA 4JBXA 4NHOA 2O8EA 4ASUD 1L4UA 4WZAE 4D80A 1EX6A 4MKFA 2HV8A 3CX6A 4WXRA 4RZ2A 1U94A 2ZANA 4LY6A 1S0UA 2J7PD 2QUZA 4KLZA 3QVUA 2C04A 1Z2CA 2FGJA 1E4VA 3B13B 4ZKDA 1QF9A 1E6CA 1ZRHA 4Q5IA 1G291 3BK7A 4BLQA 1R7RA 1GRRA 2C03A 3WYAA 1D9XA 3I62A 5EZ6B 3CM0A 3NVAA 1ZCBA 4NL4H 3QKSA 5EP3A 3PEYA 1Z6XA 1KNQA 2GJKA 1ESNA 1E2FA 5KDLA 2CHVA 1SGWA 1E0SA 1R10A 3IPYA 3PUWA 1J7KA 4TYNA 3O8CA 2HYIC 2D62A 2JIZA 3N5CA 4XVUA 3CPEA 3GJ6A 1G3UA 4DKXA 5G3ZA 1VMAA 1W4BA 3IPXA 4YMWA 1R6BX 1NLFA 2C77A 4LI0A 4IEIA 4Q21A 1KY2A 3LQRA 4B2LA 1F6BA 5L3RA 4HUQA 3RS2A 4PFSA 4JIMA 2HDNB 1Z3IX 4DDUA 3DHWC 4EPRA 4JLDA 1G6HA 2AX4A 3A37A 4IDNA 1W36C 1QHGA 4M0LA 3KKQA 5HZHA 5JHGB 1U98A 4IVQA 2EFDB 4NDZA 1P7CA 1SXJA 2ZITA 3T06B 3THXA 4ZV4A 5EE1A 4A6XA 3P4XA 1Z0IA 2XTNA 4NZYA 5FTMA 2CJWB 1E79A 2R9VA 3GMTA 3SC3A 1E96A 3G0HA 3CONA 3MWYW 1E2JA 1UF9A 2QP4A 4N0DA 3UWKA 2CLSA 4HZUA 1W2HA 1BIFA 1NIJA 2FFBA 3SOPA 4DCVA 3WHKA 4DLXA 2CL6X 2OCPA 4DSNA 1XPOA 5JLJA 4NP6A 1KDTA 4YXWD 2HYDA 3I3SR 3T1QA 4YDHB 4LJ8A 4IVPA 4ABYA 1QHSA 1DO0A 1ANKA 1NMXA 2K5UA 1GL7A 1P72A 2XAUA 3K70C 1LS6A 4GMDA 2IS6A 4G5SA 1P73A 2FH5B 1Z8FA 2OFOA 3BB4A 2F1HA 3H2YA 3W34A 4M8NE 3MSXA 1MABA 4JVMA 2GZHA 1EXMA 2PMDA 4P3YA 4ESVA 2V6JA 5CB6A 4IXNA 2VP6A 3WNCA 1R8SA 3HYRA 3QXCA 2E9SA 4O2RA 4TQUS 2QI9C 2NGRA 1VCIA 4BLOA 1J8YF 221PA 2C96A 3ZD7A 3EWAA 3QI2A 2JDIA 2ZJZA 4KYUA 5IHPA 3KTAB 2YINC 3CRW1 4LC1A 1YZTA 4PC3A 1Q3TA 4GOJA 2BBOA 1XEWX 1JAIA 3ZVMA 4TLBA 2ZSAA 1VG1A 1IJEA 2KBFA 3EWSA 2R2AA 2ZU6A 3EZ2A 3KJGA 4YMSA 2XXAA 1QG2A 5HE8A 1N5JA 2AFIE 1WCV1 2ZRIA 2P67A 2ZRGA 1M7BA 2WKRA 3HU3A 3PVSA 1CXZA 3DKVA 1EWQA 2G0TA 3Q85A 1ZINA 4LV5B 2QM8A 2WPDA 3CZQA 3MWKA 4KFRA 3QXHA 1E2PA 2JIZD 2X2FA 2Y8EA 4OJQA 4PX9A 1IN7A 2DWQA 5TDHA 3LRPA 4D6PA 4B2PA 2PT7A 4OI4A 5IRCD 4GSYA 1Q1QA 2ZXUA 1QBKC 1P5ZB 2ZVPX 3EZFA 3P1JA 4HAXA 1U8YA 4GZMA 3U7FB 1KI3A 3I5XA 1G5TA 1QZXA 3LBIA 1OH7A 2GK7A 4QHYA 4C0QC 3K70D 2F1IA 5FPKA 1SVIA 2ZRKA 1SXJD 2ZM5A 4PC7A 2IYVA 4URXR 3PEWA 1RC8A 1OH5A 2IBMA 2PCJA 3RS5A 1YQTA 4TMXA 1KSFX 2XZOA 3GLHB 3BE4A 1E79D 4JLMA 2NQ2C 1EGAA 2BBSA 3KKPA 2H17A 3IUYA 2YNMA 1XD2B 3RRZA 4D0LB 1A7JA 3ZYCA 3Q5EA 1NIPA 2BBWA 5DHAA 5KNCA 5BQ5A 4B3FX 1XJCA 4GZLA 3W90A 4WXPA 2G6BA 1BH2A 2EWVA 5TXGA 3T12A 1UBEA 2ZRCA 1JQLB 1GFIA 3MUFA 4PSAA 1E0JA 2VIIA 2IYLD 3C4JA 3F0TA 2YWFA 1CRPA 121PA 4N1AA 1H8EA 1GRQA 2CBZA 2YOHA 1JNYA 1FTNA 3R8CA 4JYBA 2VRWA 4ZDKA 2VHUA 4B35A 1OXSC 3K9GA 2CVHA 4TL7A 1E99A 2ORWA 2VYFA 4DB2A 4HAUA 3NBFA 1PZNA 1YRBA 4TWZA 2EW1A 5G40A 4BFSA 1KI4A 4HDCA 1N2CE 1E9CA 2A5GA 4QGFA 1TF5A 1II0A 2BWJA 3C5CA 2RGAA 4V0ME 5CIWA 1Z83A 2B8WA 3QE0A 4BE7B 2VPPA 3F3YA 4RZXA 1FP7A 2FEMA 2ZRFA 1CS4C 4LUCA 4JLBA 3LNCA 2QY9A 5JWHA 2JDID 2QT1A 2FPKA 1W1WA 1KMQA 4RFSA 5HTKA 3TMKA 3PCRB 4BRUA 4DRZA 4DLWA 1SZPA 5DLQC 3FMPB 3TLXA 3D7MA 4GT1A 2I4IA 3K9HA 1FW6A 1NL3A 4PC2A 1XD9A 3B85A 1W48A 3QJYA 3W5JA 1OT3A 2KE5A 1D2MA 3SHWA 1P60A 3DKPA 1UAAA 5CJ2A 1N5KA 3PUVA 5FL3A 4BFVA 3CX7A 3QQ5A 3QOFA 2WPDD 5FTNA 4MKIA 1WQ1R 4AKHA 2PCLA 1N5IA 2VHJA 4HB3A 1Z0AA 2ZJAA 4Q18A 4BFUA 3K0EA 4UXHA 2VHTA 4MYHA 4E03A 1A1VA 1OFHA 2XJ9A 2B7BA 2HCBA 2ZVQX 2ZJ8A 3BB3A 1AJEA 1ZNYA 3JZAA 2QT0A 5KNDA 1PLLA 1XWIA 4M53A 5EXPA 4DB4A 2XZLA 4C0AC 1UPTA 1AKEA 4V0KA 4QC2A 2IUTA 4ARZB 3L8YA 3LV8A 1T6NA 1UM8A 2WWWA 5IDVA 4DDVA 2A7QA 3SYKA 4QJ3A 1KKMA 3C14C 4MH0R 3UANA 3WY9A 1Z28A 4RSGA 3W6OA 3WBJA 6Q21A 2PMKA 1IJFA 1OHHA 3ND9A 2BEKA 3ZZUA 2J0UB 3QKRA 1R0ZA 1KI2A 5J5CA 2WVJA 3NEYA 4HAYA 2ONKA 1NVVQ 1W7AA 2JJ1D 5AJWA 4EIWA 4I81A 3M1IA 1M7GA 3I61A 2ZSFA 4P33A 1IN4A 5FTKA 4DXAA 4MRRA 1OPXA 4JL8A 2FA9A 1DAEA 3MAAC 5L3VA 4KCGA 4OK5A 1H8ED 1VCOA 1OH6A 2GHIA 3AVQA 5LB4A 4CF7A 3ZLJA 4GOKA 4LYJA 3THOA 1IY0A 3BGWA 1PUIA 4K46A 2V1UA 3NHBA 4US2R 1OKKA 1XP8A 1E2NA 1S4QA 4B73A 1HV8A 1XTSA 4V0NA 1YVDA 2N1BA 1NMZA 2RAPA 1XZPA 3T5DA 1ZUNB 4B6FA 1KMHB 3KQUA 1S96A 4B43A 1P2TA 3IHWA 2ZETA 3QVVA 4UJ3A 2PZGA 1N6LA 2W2VA 3X1XA 5UKDA 8OHMA 1OV4A 1ZD8A 1WMSA 2OXCA 3CZPA 3SQXA 5EXXA 5E7IA 3OEEA 4DCNA 1G19A 1EK0A 5P21A 3BC1A 3X1YA 4WAUA 1M1YE 1W4CA 2MSCB 1TEVA 4DT1B 1G18A 1FUUA 3U6KA 3PFIA 3KKNA 1N6OA 2BC9A 3RHFA 2BOVA 4LJ9A 2A5FA
chains in the Genus database with same CATH superfamily
1K6XA 2A1IA 3SDSA 2Q29A 1XEFA 4RL4A 4DQVA 3LT4A 2J48A 4MW6A 4RO0A 2OO7A 3P0HA 3IPCA 3H11A 4NS1A 2F48A 4R40A 5CT9A 1MU0A 3U17A 3L4JA 5BSKA 1WCXA 3TVTA 3VRHA 2J41A 4PHTA 1VYHA 1WDLA 1L6IA 4KKXB 3K05A 4C7OB 4RNCA 4B76A 4OMDA 4YT8A 2CXPA 3BK2A 1ORTA 5K1ZA 4X1KB 2XCUA 3M34A 3MWEA 3GGJA 3DLCA 3ND8A 5ALZA 1MO4A 2QAGB 5THQA 1QLJA 5ICEA 1KQNA 3ZE8A 1QHHA 1Y5LA 1TYBE 2CVFA 3IAAA 3OT1B 2BF4A 4LEIA 4DIDA 4B0OA 1CJMA 2Q2WA 2GYWA 4UZSA 3W8FA 5CDGA 1EFKA 1LPBB 2EG9A 4C2TA 1WUKS 3ZWWA 4RVCA 4D4KA 4E6EA 1H85A 2WIAA 4J2OA 4C4PA 4EP1A 2ZRDA 5T7BA 2YW9A 4MUNA 4M98A 5EIEA 5JZOA 3S40A 3ESZA 3TLBA 4QBGB 4YAFA 1J6UA 2X41A 5CFLA 2WBLC 1J23A 3HJBA 2J07A 1RHJA 2R8RA 3B1FA 3KS9A 5CBPA 2O8FB 4BUCA 3KEFA 2VT6A 2VZLA 3OIUA 5G53C 3WI7A 1WV1A 3OPQA 2HSGA 3FKQA 4PTYA 5AJTA 3M1LA 4J29A 2HI0A 3I53A 1R3DA 4RV9A 3DR5A 1XRSB 1NTOA 4CMKA 3BXHA 1BMFA 5CX1B 4CM7A 1X9GA 3B1JA 3H75A 3C3XA 3IJ5A 4EB6A 5DNUA 1COZA 3H1PA 2R62A 4IYJA 3N86A 1ATIA 3C41J 4WKBA 1T4MA 3ICEA 2M32A 1NURA 4I5DA 4JENA 5ALPA 5DU2A 4OIMA 3BBPA 3HWWA 3QW4B 4ENRA 3H1GA 1MC4A 4F4CA 2VTVA 3GDFA 3TZQA 4LF9B 2RKOA 3KSUA 2GDZA 1OKKD 1T4GA 1LK5A 1J5XA 4J03A 3ZGLA 2HA5A 3ELDA 4PCVA 5LP6C 1PE0A 2XYVA 2CV2A 2BCEA 1CZOA 4TXMA 3O9ZA 1XU7A 1U8ZA 2J87A 2P6PA 2CXSA 4FK8A 2YUTA 2O8VA 3AKEA 2WUVA 4WY5A 4D74A 1A0OA 2D2FA 4ZMRA 1EFTA 3MNFA 2M1XA 1DZ3A 4XX1A 4CETA 2LCIA 3H1TA 1US8B 2E4UA 2ACKA 1EVZA 3BWDD 3LBNA 1Y1TA 3PWKA 1LPOA 4G4SP 3DHVA 1JMVA 4R1TA 5A3VA 4YS6A 2GJ9A 1DGQA 2JA1A 3K1AA 1IN5A 1WDTA 4I6JA 2AF3C 5FBQB 4BO8A 3W9UA 3F6EX 5INTA 5D1NA 2DQYA 5CDYA 3K6RA 4HOYA 4Z8XA 2VK1A 4UUOA 4BP1A 3EQZA 3U7IA 5C3MA 2AOXA 3DO5A 1U3UA 2UVPA 2OQ2A 3HHPA 5JAOA 3R1IA 2P6RA 4QOJA 2O07A 2A9JA 3C8ZA 3DTYA 3GWZA 1KZ6A 5FO1A 4HVAA 2QMOA 3TTWA 3WJAA 3JD2A 1BVYF 1Z4OA 1M2VB 3BTUA 4AXXA 4CFZA 4ZCTA 1P3JA 5IBCA 1QP7A 1A5TA 2WY2D 4B7ZA 1A1SA 1IU9A 3B8HA 3OJFA 2OAP1 2QUAA 2YN2A 1AUPA 3PGXA 4WPGA 3MJSA 4J8PA 1DCKA 4Q7KA 3U0VA 3PNBA 3WIOA 1FFWA 1ZQ9A 4HH3C 1H6AA 3H8SA 4OQ4A 4XDZA 1L4BA 5D51S 4CKYA 4OL0A 4OHPA 1OBOA 3JYOA 1IHXA 4FLEA 3GDOA 2BBTA 5IVKA 3H5OA 4B8YA 5ITZA 5DI3B 2ZR7A 1ABEA 1E2IA 2RGBA 3EVFA 1CUXA 1FX0A 1MG0A 2X13A 3VSCA 4E88A 1C1DA 2VATA 1CLUA 3MQ4A 2PUDA 3TN7A 1E6UA 1JG2A 1QH1B 5DM60 1JPNA 1PYOA 3T1TA 3AHGA 3CLKA 4HH1A 1FTYA 4F97A 3BILA 5L95A 3HADA 4DA9A 3R6GA 4FFBA 4NMMA 4Y7DA 4UHEA 2D2XA 3AHDA 2OO3A 3DC7A 2GN0A 4TRMA 3JQ6A 3ZQJA 1VJCA 4G36A 1TCAA 2IEIA 5COAA 4IV5A 1GGNA 1KHTA 4I4TB 4IINA 1HG0A 2XCQA 3M4ZA 1RIFA 4BNTA 1R6UA 3WMEA 1DJLA 4FCTA 3DFZA 5D3QA 1HZZC 1FDRA 5D5PA 5KNBD 5THXA 1M6NA 1OZHA 1ZAYA 1U2EA 2ZUWA 5FBLB 2HPVA 3OUUA 3HRHA 3UKJA 1KH2A 5DSZA 1Z75A 4JFRA 4YBRA 5FCDA 1OJLA 3A70A 4KXYA 4A36A 3RWMB 1E1CB 2F9FA 4JLKA 4BEVA 2BJVA 4US1R 2QMYA 4DRYA 4EARA 3GG2A 1G2PA 1KFCB 4GHWA 4R1MA 5EERA 4MR9A 3U81A 1F8FA 2GB4A 3DDZX 2VDOB 1SURA 4RY8A 1UIMA 4TWBA 4YRLA 3CVUA 3MA0A 2OV8A 4OP2A 3MWDB 2WJHA 3Q7PA 1E3JA 4N0PA 3M6WA 1RQNA 4HGPA 1T13A 5EWJB 4DMHA 4F3TA 3D2LA 2YJ3A 1CUFA 1Y5NA 1JHRA 4NXMB 3GRAA 3G3EA 5J3JA 2KX7A 3EC1A 3EPLA 2QXUA 5K8JB 4PU0A 3IUBA 4MRPA 3H5AA 5L3QB 3HSKA 4IHQA 1QV6A 1NP3A 1SG0A 3EGCA 3E2MA 4NONA 4EG8A 5HILA 5BMOA 4MQ5A 4YIHA 4WCFA 2JFZA 4ZJYA 4ZVKA 4INZA 2G76A 5ICMA 2HU5A 4N5DA 4DBLE 3NPAA 5EYPB 1TNDA 3IFSA 4EVRA 4ACAA 3GLFB 3PKIA 4OB8A 3GFPA 3PL1A 3FYUB 2ANBA 2TSYB 5AWFC 5JBQA 4PWZA 4POAA 2PGIA 1EUZA 1F51E 5EJAA 3WWDA 4AW9A 4LY3A 3VO8A 2FK8A 4CNQA 3OY2A 1ZOIA 4GVXA 4ZI5A 5ITWA 4YUZA 1TEZA 2DT8A 4OUDA 1JR2A 3B6EA 4KWHA 4R0NA 3BZUA 3UIEA 3V4SA 2QN9A 4ZI3A 1VFPA 4WFIA 2AC4A 3QLVC 1RJGA 4BC0A 5CITA 3TSWA 1XTBA 2NVWA 1WG8A 2WNIA 3ZV7A 1U2ZA 4KIUA 1IJKA 1NHWA 4MVJP 1P61B 3RTBA 1SU4A 4HLQB 4O1IA 4HQ6A 2RC5A 3IQZA 4FDAA 5LQUA 1DOZA 2UYHA 2VF2A 3AR4A 3O3NB 4JSRA 4KIWA 5AK3A 2MU1A 5YASA 3CSSA 1TCUA 2WIDA 4LJSA 1N0WA 1KPHA 2ZS9A 4JX9A 4MTLA 2G5CA 3UXMA 2JLYA 2ZJOA 4WQMA 2GARA 2FLWA 2PRYA 1P6XA 2B4QA 1L5SA 2BL4A 1KI8A 2P5YA 3ZDQA 2WSSA 3ZTTA 1GZDA 1U9IC 2R44A 1SVNA 1EP3B 1JZSA 1VOTA 2VK4A 2YDYA 4TT3A 2AG6A 1VZ3A 1Y1SA 7MDHA 3LBYA 2ZAYA 4RHTA 2EWWA 5K51A 4CT4B 1W35A 2ZBEA 4C22A 1VE1A 1T8YA 1MOZA 3LSTA 1BW9B 1KZGB 1KSHA 4RJKA 1Q83A 2C20A 2PBRA 4ZARA 3ZLBA 1SBHA 4BNMA 5JFGA 2W2MA 1NVMB 3E82A 1N0IA 3KDPA 2Q49A 4UZFA 1J8MF 2BDUA 5K3FB 1Y7PA 3PC3A 1B23P 4KK4A 5IAJA 1G64A 1T8PA 4GX1A 4HDRA 1F3OA 4L8LA 3FCSB 3R5HA 1ZA2A 2B5OA 2I33A 4ZJZA 2ICAA 4CODB 2YXNA 4B48A 3VYVA 4Q1EA 2D4HA 1P9LA 5EIAA 4AG6A 1HK7A 3KXDA 3RHZA 2B4TO 2W6OA 4F86A 2X8BA 1O0BA 5DTIA 2J0SA 1CR0A 4R6XA 4PVDA 1HY3A 3D1LA 3EVAA 5B3KA 3COPA 5C7IO 1N6RA 3ZCRA 4DCUA 5FUYA 2AS0A 4DAEA 1GL9B 3HJGA 1KI9A 2OXIA 3QMVA 2FWNA 1Z6ZA 3IYLW 1RYNA 1KEEA 3ICVA 1UDAA 2FRXA 4AN1A 4EM6A 2PD3A 3F6YA 2IU6A 3B5JA 3IQIX 3R5SA 4ILKA 4NOLA 3LRXA 4QTXA 4J3NA 3AFNA 5DISB 3T1VA 3L43A 1HGXA 2QGFA 3HP7A 5KVSA 1IBRA 4Q7QA 1ZCJA 1S2GA 4X5OA 1RMQA 3HJUA 2X42A 1USWA 1CYDA 5CCDA 4LECA 4BZXA 4A8JC 4UPEA 1F1JA 4NU0A 4D02A 3W5DA 1UFVA 2O5EA 1UJ4A 3PXBA 1T9CA 2PG3A 4FB4A 1Y4AE 1PEKE 1PUXA 2GCOA 2GN1A 3TRJA 1GPH1 3EIQA 3IRVA 3T5MA 3T7JA 3GEIA 4BZZA 4CLXA 3ETGA 3QLUC 1E4YA 2M6LA 3SF8A 2J3QA 1LJLA 1SQSA 3QQPA 1GN8A 4H7JA 2B2CA 2IY7A 4L8VA 4ZAGA 3W8NA 4DS3A 3CGGA 4URVR 3AETB 1T36B 1A9TA 2H1SA 5EIBD 2G5PA 4QOSA 2PE5A 1P18A 1I7SB 4Z4IA 3M3DA 2IXEA 4YRCA 1TPZA 2FR0A 2WNHA 3OHMA 4DSAA 3OQMA 4YQZA 2X58A 4CM9A 1YAJA 4LNUA 4QLAA 3NORA 4DJTA 1BVHA 4WX2B 2AXEA 2DULA 3OOEA 1VMKA 2QKYA 5KX5A 1A9ZA 4Y2UA 2QMEA 3IMKA 1NUQA 1QYDA 3CKLA 3CLUD 2EKBA 2WD8A 3SX0A 3W4IA 3V2GA 3FCCA 1CLEA 4OCZA 4YDRA 2WZDA 3Q8XB 1V1RA 4E5VA 1KAGA 4FWTA 4ZCRA 1K98A 3KLOA 3EXHC 3KLMX 4JCOA 2ECQA 4ZYLA 3QU2A 4O4IB 3NXSA 2NX2A 1KI6A 2OZLA 4AJIA 5C7LO 4IFEA 2ANCA 3RSCA 4DPMA 3KALA 3RC3A 3BGIA 1NV8A 1WCIA 4JJIA 2ZYWX 1KWKA 2P2ZA 1X74A 2IRWA 3NI2A 3T5CA 1K5HA 5KYNA 4JAVC 3U7HB 2Q3JA 3EA5A 2A0FA 3IT1A 1SOAA 3H3FA 4P08A 1YTUA 2FXVA 1FP4B 2N42A 2UUCB 4KVFA 4DDKA 1T9BA 3DDOA 3KQQA 1Q74A 4YEDA 3DOJA 4WZAB 3RGGA 3ZU5A 5G1NA 3IAS6 4FGWA 1QNLA 5KTYA 2D06A 3F4KA 3DOEA 1CTQA 5I6DA 2CGEA 2RHGB 5BUSA 3NKFA 5KYVA 4BIIA 1XDGA 2IEYA 1L7NA 2QDXA 4CR7A 4UDYX 4QBIA 5LBUA 1AGXA 2HGSA 1IY9A 2C7QA 4L15A 3AVWA 1IK6A 4KO4S 3RYCA 5EJ5A 4UPVA 1O6CA 1R74A 2QAIA 3R7AA 3JYPA 5C8XA 2JCSA 5ERGB 1NMYA 4HVTA 3IR6A 4C0WA 4EG3A 1A5ZA 3A4IA 1X8XA 3GBSA 3TIXB 5LR6A 2IIQA 4P2BA 1I0LA 1EM6A 3PFWO 4IVNA 5E6RB 5BSFA 4ZU3A 4S1NA 1YQDA 4NCBA 2KYRA 1M7HA 1F20A 3EJWA 2DBYA 4U2GA 4K88A 4RGQA 4C30A 3TBKA 5EQFA 1HLPA 3H0CA 4DDWA 4DA6A 3EDCA 1G5QA 1W46A 3NTOA 3VTKA 4BX8A 4P36A 1OJ7A 3IUEA 2W6QA 3NYWA 4PV7A 2YOFA 3D6UA 2P3LA 1P74A 1IBCA 5DN6D 4IOMA 1QHXA 1Z6AA 1ZMBA 2Y0PA 4J43A 3BD9A 3ACBA 2FPPA 2OYSA 4J6EA 3VPAA 1KARA 1QBGA 1YBFA 1BMTA 1ZICA 2IZ1A 5HF8A 2NPFA 4AJ1A 1N92A 5LLSA 1X1AA 4B46A 3GUUA 4IDPA 4KVGA 2I65A 3GI1A 1VJDA 3RW9A 4MHSA 2Z83A 3EYAA 3D8UA 4JEIA 1V3TA 4LBZA 2GGSA 3WWPA 2M98A 2G0AA 4A73A 3BIFA 2VH2A 4EO4A 1VHLA 4WNYA 3S2YA 4GGMX 1IJBA 5F3WB 1KKLA 3RBVA 5IANA 5ABPA 3U7EB 1Q0PA 1BROA 1RU3A 4HWKA 4UTXA 5AW3A 1FNNA 5LZ4A 1SD2A 3OP4A 2J32A 3E9CA 2JBWA 2W48A 3X1WA 5U4XA 1JV2B 5L4SA 1VG8A 2VK8A 2YXBA 3H16A 3UC5A 1H2EA 4TS1A 3PYMA 1MVNA 2WKQA 3IOCA 2R4UA 5JE8A 5K05A 4I8XA 1JYSA 1H2ZA 1ZI8A 5AT1A 1V4BA 4JZKA 2HPAA 4Y98A 1PZMA 2GF0A 1HDXA 4M0FA 2AX3A 4OJKA 3ZXUB 4BAUA 3TLGA 3O4IA 3QX8A 1BC5A 2XB4A 3G9XA 1N8SA 1GPMA 2WQ7A 2V03A 2BH9A 3UGJA 4GYYA 4FOOA 3FYHA 3ORFA 3O1HB 2IP4A 1K8RA 2ZE6A 2HREA 2EV9A 3AF5A 3L9XA 1T0HB 1BOFA 1SQ5A 3K2QA 3Q1KA 3IP5A 4QPNA 4D8YA 1JFSA 4KDEA 3VC1A 4Q4JB 1D6MA 1POWA 3CZCA 5FOWA 3RYTC 2VXCA 1JR4A 3NBYC 4TQGA 3S99A 3VR2D 2JJ1A 1K7SN 1OW3B 2WJ4A 3G85A 4D9MA 5HXAA 4D26A 1O8CA 4X6XA 4HNAA 2PV7A 3SJUA 3AXTA 4IJKA 1KJ9A 1RIIA 1WXFA 1Z6PA 1VLQA 1F2TA 4HPJB 1U11A 1X7YB 4RY9A 5HIAA 1Q22A 5T6BA 4W8GA 3IMEA 5JD6A 5JZ9A 5L40A 2F59A 1CC1S 4AYWA 1IUKA 1UMBA 4EHIA 4GXRA 5JMTA 1ZW6A 2GI4A 2WP0A 1U0LA 3GEHA 3O8RA 3VU1A 5BQFA 1IEQA 2FEPA 4UBOA 1N0HA 4RHCA 1B2LA 4QXMA 5AVVA 2GPWA 1RAHA 4H6XA 1I3LA 2B8JA 1U5CA 1FXWF 1LWNA 3OE7D 4FMBB 3EF1A 1XTPA 2D1QA 3DLTA 3PA6A 4PGHA 2G4CA 5DOVA 3UWMA 1XFDA 4B3JA 1I3MA 2QTZA 4OQLA 4CF4A 2R4QA 2AQ8A 3SZOA 4BKRA 5LNK6 4INAA 3IP6A 4M9QA 1ZO8A 3HVUA 4B31A 3NOXA 2UXCB 3T1NA 3ZD8A 5K5EA 1L5QA 2WAAA 5AW0A 2FOLA 3HCFA 1BXGB 5F2EA 3F8WA 4TQAA 4CMBA 3TTTA 2BLNA 4EPTA 4ZAWA 1FTWA 3LJKA 1I2MA 4G1BA 3M0EA 1VRVA 5GIOE 4HUJA 2RBEA 1Y1RA 1SKAA 3PI6A 5KOIA 2XUPA 2HBRA 1HOTA 3N7UA 1HA3A 4LHWA 1X3SA 3OEWA 5E8JA 1ORIA 4K3UA 3AF6A 3BL5A 2ZM6B 5IYZF 4XASA 3U4AA 3TX6A 5GQSA 3SXUA 4FINA 5KTTA 4OI1A 1F6WA 4JWTA 1EG7A 3AVVA 1TGVA 2JCYA 2ST1A 1ZWKA 4NXNB 1X7DA 4E15A 2X0EA 3DO6A 3PQFA 3NRJA 4B3GA 2QNIA 5I8ZA 5EC8A 3LCRA 1V16A 2GYYA 2LKCA 2XEXA 1J25A 4IG4A 4PLCA 2YY7A 4FZVA 3TNJA 4YRIA 1GAWA 4NCJA 1MRNA 3FLBA 2IPAB 5HQJA 1MEJA 2CJWA 4Q0MA 3T95A 2QPLA 2BUBA 3H84A 1SY7A 4YJ2A 2RGNC 4I5EA 1PVOA 2YMMA 4FFSA 2CDBA 3OFJA 1OZ0A 5T4HA 4QOHA 4RZUA 5GM1A 4FFWA 1N2CB 1GFSA 2D8AA 1YDWA 3KDAA 4W1PA 1NYTA 4BV3A 1ZVVA 1VGRA 2UZ4A 3T61A 3R0QA 1NF8A 2CWWA 3ET5A 4MKHA 3T0GA 2BM9A 3K8OE 3BX1A 4RVGA 3WL8A 1W9HA 3IAS1 3G2PA 3WGUA 4W4TA 2J45A 3RUFA 2W4QA 4P31A 5DTQA 3UWPA 4B3BA 3W3AA 3UJ9A 1OSNA 4BQIA 4HT3B 3H5RA 1YTLA 1X1CA 1MFPA 1GAXA 3RVMA 3B9PA 4H60A 3EFEA 1A4XA 1KPGA 2GQ0A 3BL8A 3MT8A 4B7UA 4RM2A 2IV2X 5HS4A 4X1YB 3CVOA 4LXQA 5FL7D 1G8FA 1IWOA 3R3VA 4YRZA 1BVRA 4P98A 4UNIA 4A8TA 5K0NA 1I4EB 3PD0A 4DVGA 1JHZA 3JZIA 4TZTA 4IY1A 4XUCA 3DP9A 1EEHA 5TS2A 1R12A 2RSLA 4QDZA 2WPNA 3C6MA 3FMFA 3VBCA 4C0LA 4XSGA 1XMOB 1E0KA 1IHPA 5CT6A 2VTEA 4RZ3A 2OO5C 4N6GA 4QATA 3QMMA 4MR8A 3OZRA 1PR6A 1EHYA 1ZH6A 3D4PA 5A6SA 4EGAA 1XCLA 2G1JA 4PO8A 3LKDA 1ID8A 4J3JA 1XLTC 5KNLA 1QOPB 2DLCX 1ZK3A 4AJ9A 4MX8A 1CQXA 4TLEA 3MWJA 4XRRA 5ALLA 2UXDB 1FLVA 4G5RA 2C9BA 3CLRC 3PEVA 5K3DA 4XDYA 3WG9A 2PO5A 4I1IA 3KAKA 2BH2A 4UEKA 3RANA 1GTZA 3NZEA 2DQ4A 2KI5A 2FMFA 3NV9A 4YJ3A 3H2SA 4EMSA 1D2RA 3L4BC 1FNMA 1II8B 1T4CA 4H3SA 3KT0A 4U9HS 1F12A 5FBRB 4AJPA 4LRYA 2CNWD 2WJZB 5C35A 1Z7GA 2ZRLA 3P9XA 4G0OA 2BZ0A 5HIJA 5A04A 4BMXA 1T6YA 3HKDB 1KTVA 1QU3A 4YLEA 4IICA 2GWRA 3D3NA 3WKEA 4D9JA 1SC4A 3NYRA 3KHKA 3A11A 1V96A 4Q9HA 3K7EA 2KB0A 1AHPA 1W94A 4BMYA 3R9WA 1N2JA 2WB4A 3ND7A 2HF7A 4WCFB 2VBCA 2OXFA 3FRIA 2VR1A 1NF3A 2FWBA 2PYZA 3T9CA 5I9LA 5JD4A 5AVOA 3QG5A 1N6KA 2AJTA 5CA0A 2FFRA 4JOQA 4JU9A 4N01A 1R9JA 5FUBA 2SHKA 4MB2A 1I1QB 1N7HA 3V1TC 1ZPDA 3DMTC 3AVXA 4LFAB 3MT9A 1VLMA 2NU7A 5AI5A 3QWBA 1LPPA 3X2FA 3GLHA 1QXSA 4U5QA 7REQA 1D7OA 4FFPA 4Y9DA 1FJHA 4HL6A 4GWKA 3UFXB 1UBTS 5LP6A 2IDZA 2NVUA 4HQOA 4D3XA 1F0NA 2WFMA 4LAFA 4BN4A 1ONPA 3E84A 2YY6A 4HBZA 2IXDA 2GJ4A 3IALA 4ZEOA 4E6PA 4KE8A 2XQIA 2XZTA 2HIAA 4W5WA 1JEYA 2ZBUA 2VSYA 2ODEA 4L4XA 4RK1A 3TXXA 3BE5A 3GT0A 3ZHTA 1NQOA 1VMEA 3WVNA 3VU9B 2GEUA 1OFIA 2XCLA 2OLJA 1N2GA 1P45A 2EZ9A 5EJ6A 3CCFA 2D0IA 4MUGA 3AUXA 3AVUA 4JI4B 4P4NA 4B83A 3HXQA 1NMQA 2FZVA 2NPOA 1NR7A 1K3UB 3P97A 4D41A 2EG5A 3B6ZA 1KFBB 3O31A 2JIQA 1RRPA 2YN0A 4XX0A 4EH1A 3CZ9A 5A6VA 2JLRA 1P2FA 2J3DA 2BEJA 3K0FA 2PZLA 2MT9A 3QH4A 3OTQA 4NPAA 5E38A 4G1CA 3BGSA 2W0MA 3Q8KA 4BFWA 3OQPA 5AI8A 1GP2A 4CHGA 5CVEA 2RBKA 3MCUA 5FEMA 3JZFA 1XZAA 1D2GA 1Z29A 2Q5CA 2H2AA 3QHPA 4GFDA 4O02B 4TSFA 4XFJA 5F4ZA 5KYWA 1RHQA 5LNK1 1GTRA 2C9OA 3N8DA 3GHYA 4WIAA 5K99A 3E0XA 2FKNA 3CLTD 1DOAA 4PYOA 2VHWA 3D7LA 4WWHA 5A05A 3T5GA 4YAWA 1PR0A 4GBMA 3ZWKA 3JXEA 2ZAMA 2FSSA 2O2EA 2ZJ6A 3WLRA 1EIWA 4NKRA 3BCUA 4CKBB 4QL3A 5KINB 2XNHA 3GEMA 4XCQA 1P9NA 2W2KB 3JQPA 4R9NA 4ZANA 5BQOA 4XVCA 5GGYA 1AKTA 2YHBA 1LQUA 4HMPA 2A3NA 2H06A 1DXYA 1Q7RA 3OQ6A 4P22A 3S2SA 1ZMTA 4W6QA 1PT8A 4YYEA 4E31A 1U65A 1XJ0A 5HF9A 5EHIA 1TKBA 4L16A 2PLRA 1UEIA 2XA2A 1KKUA 2V0CA 3OP1A 3QBTA 4FJ1A 4N54A 4OHVA 4BPRA 5KQMA 3ECCA 4MKXA 1QIIA 4AX4A 1M6WA 1XN4A 2GM9A 2IZ7A 4GQIA 3I2HA 3CBQA 2XVXA 4EGFA 1E9AA 1D1PA 4WXEA 3U0BA 1HZZA 2XB6A 4Q3NA 3JQQA 3OM8A 5DZSA 2D8MA 1Z2DA 1G2IA 1XK7A 3PRHA 3KJQA 1Q1BA 4FYJA 5BR8B 3FSGA 3GIWA 3IVMA 5T64A 1UKCA 3ES9A 1QX3A 1YFJA 2X4IA 2FSFA 1GPUA 1J0BA 3WL3A 4TYYA 1HQYE 1N25A 4G0XA 2NAFA 3KELA 3GQBA 2XNDA 4TRNA 2B3TA 2X9LA 1MP0A 5IXJA 5TIIA 1A4UA 1GQFA 2OA0A 1XMPA 3KIPA 1R0RE 3A4TA 4HUQB 9ABPA 2A8YA 3WSVA 4YCSA 4C0SA 4BTLA 4RIHA 5L4LA 4KVZA 1DFHA 3AF0A 2JLWA 1IG0A 3UHAA 1WVGA 5AH0A 3RYIA 5A4MS 3ENWA 4PSCA 1ACLA 2IF2A 2G06A 1ESDA 3RQIA 1UBRS 4KMSA 4RPCA 1A96A 4EYGA 4HEJA 2PNJA 5KYUB 2PAAA 3VHRA 4WBNF 4JUFA 4X3OA 4F5ZA 2CXOA 3FFXA 2UU9B 3GBPA 4K9OA 2X0FA 2E37A 4ESOA 2B4YA 5B7NA 4G41A 3GG9A 4GEKA 9MHTA 1JJAA 5BXQC 4BNZA 1J0DA 1ZI6A 2ZIZA 5J4LA 2G8NA 5CIQA 1N2BA 4C14A 3C6YA 3JQAB 5HUQA 3FOWA 3S1AB 4W5RA 2OZPA 3EFOA 5AOCA 1V1MB 1GN9A 1T0UA 1EGMB 5ER6A 4DDMA 3WR5A 2XIJA 2DBRA 5HZMA 1NW6A 3KZOA 3TSAA 3G7UA 1E2QA 3OJXA 5KVCA 2B2XA 3PVZA 4DMRA 4K6FA 1C0EA 3QA9A 2OC4A 3KB8A 4E1VA 4MUAA 4FHGA 4RD0A 1BQ4A 5IDQA 1ZK1A 4BLSA 1KMHA 2FLVA 2BLLA 4KPGA 4MEAA 2RGGA 5BT8A 5K0TA 3DMHA 3NHLA 4NIMA 3KRTA 1M6HA 5TQ2A 2DG2A 4L1KA 2CEKA 5JVDB 2JFNA 4HRAA 4EKIA 3Q7TA 2HRDA 4FFOA 4YJHA 3RSGA 4FMPA 4KH1A 1L7PA 2CKMA 2H16A 1L5GB 3RAGA 1I94B 4KXFB 2PIAA 2Y1XA 2QN1A 3MWGA 3RS7A 4BJHB 3TVDA 2C98A 4FTWA 4KXVA 2H4XA 2ZREA 4X20A 3L7CA 4UOZA 1LLUA 2QN2A 3AINA 3IEUA 3L7LA 5IJ9B 4GM4A 2Q8PA 4IOJA 5D5QA 3A3OA 3MGBA 3UOWA 3WBKA 3U61B 3JAMA 2VJCA 2G04A 1MOPA 4ZI2A 1PR1A 2DTDA 2OK8A 1SWWA 2ZJYA 1N9GA 3L8GA 4JUAA 4RF4A 4TKVB 1DTWB 4EF4A 2G9RA 4DMUB 3HXPA 1PNQA 1J2TA 4CM8B 1P1KA 1L9KA 2D3TA 2HBQA 4O0LA 1OIVA 1T25A 2JANA 4OBBA 1ADGA 1D09A 2AYZA 1QRAA 3EY9A 4XI9A 3WRYA 2BFCB 1U3VA 2I6TA 2ONYA 3GV0A 3ML1A 4DGQA 4P35A 1Z7WA 2GZAA 1G8YA 3K0BA 3EZYA 1EFRD 1FMJA 3FKSA 3WK5A 1ODKA 1ZS9A 4BWVA 5ICGA 4RPIA 4V2IA 2QG9A 2O06A 2HT6A 3LPAA 4S0ZA 2NIPA 3BEDA 4OYLA 4HG2A 1ENYA 4ITVA 3C3MA 4Y0AA 4L6IA 2FPXA 2I4RA 1OI4A 4OQPA 5MFZA 2ODBA 2ZRPA 1XCMA 3AXSA 3KJEA 5EKXA 1KOLA 2IU0A 2ZUVA 3PTLA 5E4FA 3I6BA 2B1QA 3NPMA 4KXNA 3UN1A 1Z0JA 4KHPB 3EGDA 4RQBA 4YRAA 5FBVB 2UVDA 2VDVE 3IDAA 4GPEA 1UXOA 1SQ6A 3QA3E 4A8JA 3TSOA 1HNWB 1J0AA 5ALHA 2AA3A 1HDZA 1ODFA 4IIJA 4UOQA 3SXPA 1PR2A 1T6BY 2O8NA 5EIWA 5D6OA 1O3YA 4W1QA 5JEEA 4NATA 3R41A 3VZPA 3TTUA 1P1BA 3UAZA 3DDNA 3WAKA 3QLUA 4HQ0A 4YRRA 4NCNA 2REXB 1X2EA 1Z5GA 1ZC4A 2WJVA 3RIEA 4B47A 2ECPA 3TDNA 2B99A 1M2GA 4TMVA 3RU7A 1TJNA 4W5JA 1HNXB 2ZUTA 4CMAA 3TR5A 3VKWA 4K26A 1DIOB 3V1MA 3B51X 4MDFA 3I37X 4KR6A 3ONFA 3D6HA 1YC2A 4R9SA 1SHUX 5EZQA 2BUAA 3RLFA 1IVSA 2I2XB 1LDNA 5H81A 4CFSA 4DV4B 4QNRA 2UZ0A 3FNIA 4WDRA 1XNRB 4LPKA 3R24A 4LRXA 4ZT7A 2V4ZA 3LQKA 3ZI7A 3K32A 2XT9A 3SBEA 1FYDA 2YOGA 3UYLA 1PVDA 3EVCA 3BJMA 2WVGA 3MRXA 2P79A 2QZ9A 1UM9B 2ZK7A 4NBRA 3UYKA 3AKZA 4EKGA 1SXGA 4GRDA 3EXHA 2HRRA 4YV1A 3EDQA 2XOXA 2R86A 1VZ2A 3AB8A 3ENVA 4LJ5A 1CKEA 3EXIA 2REOA 3GLQA 4S1WA 4UM5A 5HM6A 5ES3A 1DTSA 1H9AA 1HQDA 2BSAA 2O50A 3T0IA 1XCPA 5JOQA 1M5TA 3THYA 3AH8A 3FPJA 4UAGA 1FFCA 4RFVA 4N8SA 3EVBA 3TL2A 4RKRA 5K8TA 2V5UA 2I03A 1PN3A 3G2OA 4P0PB 1BMDA 1U7TA 3LUPA 5IKPA 2ZYSA 4CCWA 4N0MA 3L1VA 1JHQA 3FTCA 1Q0RA 1B6TA 1T3TA 5JSFA 1CDDA 1SUDA 1PJQA 3L49A 4HEA6 1GQYA 4JYCA 1CZUA 3AI7A 1VE9A 1NM5C 2FZ4A 4WK2B 4ZCQA 2V7QD 1YU9A 2QMQA 3CWCA 1ORVA 5JISA 3GLIA 3P26A 2YMLA 4E5DA 2I62A 2PANA 3PWZA 2QROA 5IBQA 5K0EA 4XWWA 3CO0S 3PDHA 4IFBA 3RK0A 3W5HA 4U0KA 2PMBA 2VDWA 1OGIA 2DWCA 4B6RA 3ZV5A 5FULA 5LBTA 4BZQA 3M7IA 5I01A 4R2WA 2RAFA 1DG9A 2ZW9A 1YIOA 3B9RA 2YQ4A 3MRVA 4N3BA 1A82A 2O8DA 4WN9A 3ZD9A 3ZZMA 1RI5A 5L8VA 2F43A 3H17A 2OM6A 5DHPA 2AUNA 3VNUA 3H42B 4RMHA 5DYIA 2I1WA 4HAIA 4LE2A 3I4FA 1UFQA 5IJXA 5SYMA 1XRRA 2EP7A 2WKSA 4H7IA 5AMXA 1PJ4A 2GZDA 1FQJA 3S3TA 2P4UA 1FDWA 5HR5A 4HC4A 1P7VA 3ITKA 4WZBB 2I5PO 1Z4MA 3UJ3X 2NYUA 3O7MA 1E1QA 3WIVA 5JZBA 4X54A 4CLRA 2CMFA 4O29A 2DUUA 1VI2A 5K4AA 4RTRA 4G9BA 3ZWXA 1GXSA 1YJCA 2YWRA 4NQZA 2WWHA 1EFLA 3O8NA 3TQIA 1NBOA 3MT7A 3ZIAD 4BVEA 2C7OA 4TRRA 4LC0A 4WKOA 1LF5A 1KJ8A 3VZQA 1QHYA 3AV3A 1ODIA 1QE0A 2G7ZA 4DV1B 1XC7A 4AROA 1RAFA 1E5DA 1OZFA 4NZMA 5AK4A 1BE6A 1HYBA 3DPSA 4LRTB 3T1OA 1B26A 4QIHA 1MFZA 2I3AA 4I4TF 3N53A 3WP0A 2DERA 3ON5A 1QRSA 2ZI9A 2AI3A 3ESDA 3AW9A 4Z54A 1P3Y1 2IUSA 4ZGGA 2CLCX 3QKRB 1K08A 1GR1A 1HEIA 3H5WA 3WLIA 5C80A 3N70A 4RKQA 1B2RA 9LDBA 4L8FA 3CA8A 1OYVA 3RKSA 4IIHA 1QYWA 1Y7HA 3SU8A 1A4RA 1CQPA 2IF0A 2PUJA 2ADMA 4NYJQ 4N41A 3EEQA 2DB3A 4J0KA 3RYHA 4AYTA 4BJ3A 1SB9A 5DF1A 2G70A 3TEMA 4F11A 2B7LA 2CLOB 2XGGA 2QTRA 1UC4B 2QLJA 3B7WA 2VYND 5AW9A 1SCIA 3L7DA 3V7UA 3ESXA 1YR3A 4BLUA 1L3BA 4QPJC 3NHPA 2IS2A 3A05A 3OIVA 5A5FA 2V0GA 2C00A 1LDEA 2YWJA 3ZYZA 3CRRA 1K2VN 1RQXA 1R6TA 1XZBA 3E8SA 3PHLA 3H65A 5H16A 5JLAA 1NU6A 1RABA 2O1WA 3GLGA 3LCMA 1C14A 2UUAB 1UBUS 3WRVA 1CIVA 2EW8A 4F6RA 2E82A 4PY2A 4DA8A 2AG5A 2IUYA 2BONA 2QZ4A 4YCLA 2XYQA 1DLJA 3OEYA 1E2EA 3RQSA 2B83A 5K6AC 1SWVA 2RFLA 1LJ8A 1K7CA 2JEOA 2VHVA 3R9IA 3P9ZA 4MPPA 2P8SA 3L82B 3G8BA 2WQZA 1XT6A 4UAUA 1MD9A 2JJ2A 2IW1A 4XB2A 5PGMA 2E5WA 3VYTB 4KQEA 3FHJA 2NTNA 3Q11A 4CNBA 1PUJA 4C4OA 4TPKA 4P7FA 2C95A 1G1AA 1MXFA 1DT5A 4FBMA 3WISA 2QOEA 3M89A 1O89A 4OXRA 2X4LA 4Y6QA 5BV2P 2JCBA 3HO1A 3KJFA 1VKZA 1Z73A 5CGQB 3BXPA 4EJ0A 3A2NA 1X9IA 3ABSB 5B57C 3CVVA 3AG6A 4LXTA 3BULA 1ZIPA 4HDSA 3JTEA 5EZ5A 3H11B 1PHRA 1TGYA 3A32A 2QTWB 4HO1X 2PT9A 4D6XA 1ZVMA 3I8XA 4ZGBA 1GZ3A 4ZOEA 3WXMA 1VYVA 3NJ8A 3KPYA 4CR8A 2UUPA 3GJYA 2WTUA 1GNTA 4RK5A 1JXOA 3H9BA 3DVAA 2CMDA 2WJ3A 4GR9A 2GZMA 2BKEA 1G9XA 4OK6A 1E1MA 4QPPA 3AJRA 3DL0A 3M1AA 4UVGA 4OQMA 1RXIA 5A9SA 3L46A 1HORA 5M29A 4U7HA 2VRCA 1G4AE 4D79A 5A6SB 1QHHB 4XJSA 2LXNA 3TTSA 5IVIA 5KSZA 1SUIA 1U8CB 4P3NA 4G3XA 1ULSA 2EFEB 2E89A 3UK6A 2VEOA 3EFBA 5LD2C 3U48A 3FDIA 1YCGA 3NP9A 1RNLA 2G9QA 2VF7A 2PV0A 3M3PA 1F2UA 1L7DA 1TM7E 1PTJC 2CZGA 1D4FA 1PFVA 3UKDA 3T7IA 5BSHA 5I7AA 1V39A 2VF8A 2JFOA 2ECFA 1NFFA 2WD9A 4PX5A 1ZNWA 1T2DA 4TN5A 3MLAA 3JQAD 3T94A 1JG3A 3LFHA 3DF7A 1YB4A 2AFRA 1PZFA 4RC9A 3FFAA 1BGWA 2CYAA 1ZD1A 2IA5A 2O4UX 2ZLBA 4EGQA 4JT2A 2AVNA 3JW8A 1R8QA 4NJMA 1X3LA 3RC8A 3SYLA 3GZTB 1UJMA 4DSZA 2HA3A 1HLDA 4YN3A 1IVYA<