4HLCA

Sulfonylpiperidines as novel, antibacterial inhibitors of gram-positive thymidylate kinase (tmk): compound 5
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
202
structure length
195
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKLDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfonylpiperidines as novel, antibacterial inhibitors of Gram-positive thymidylate kinase (TMK).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 84
structure length 195
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hlcA00
2JIZA 4A6PA 1BH2A 3K9HA 3TE6A 3OFND 3FHOA 4QKQA 1R7RA 1XMIA 4KLNA 1OIWA 4GP7A 3NC1C 5GJCA 5KOYA 1NMZA 1S2MA 3FE2A 2V6IA 1R4AA 4DEXA 1DADA 1WB9A 3VU9B 2ZI3A 2F1HA 5HZKA 2JJ8A 4JIMA 4A0RA 3FMFA 4H1UA 4WW0A 5G3YA 3QKSB 3LNCA 5JECA 1ETUA 1XMSA 5FOUA 5FUXA 5JI3E 2NZJA 3FKSA 1NF3A 4FW9A 1ZP6A 4XVQA 3HU3A 2RHDA 1VKJA 1Z8FA 4NP6A 4AKGA 3B78A 3ZQ6A 4XD7D 4U02A 3QKRA 5FFMA 1KDPA 4QBFA 4ACAA 1RFLA 1E2FA 4HLDA 4MGIR 3C7KA 1WA5A 4GNKA 2QT1A 3TH5A 2P6NA 2ZJYA 3NDBB 4DLSA 3U3RA 1DAGA 1R2QA 2EW1A 1OKKA 3TUJC 1J2JA 1FP7A 1V5WA 2WJGA 4Z1MD 1CR1A 3GCGA 4QRHA 4BFYA 1YZNA 3BK7A 5BN5A 1OXUA 1IQPA 2KBFA 3P32A 2EU8A 4W5HA 1R5OA 4DSTA 1J8MF 2IXGA 2GCPA 3UATA 4A8JC 1E2EA 5AJVB 3ZGXA 1PZNA 4AY2A 3CWZA 2IXEA 4JLNA 3TGPA 2G0NA 4JLBA 2DFKB 1TEXA 2WPDA 3M6AA 1P62B 2O8CB 1KSFX 1OHHD 5IT5A 1CRQA 1SHZA 1UKEA 1AS0A 1G3MA 3QQ5A 4JSTA 2F1JA 4HB2A 2LCFA 4KCGA 2WKPA 4LJYA 1MO5A 5LD2B 4CGZA 1II0A 2ODEA 2VP4A 1XEWX 1VCOA 2ZVPX 3BXZA 3SE0A 1E4VA 4P3YA 1F6BA 1U9IC 4DIEA 3AB3A 3HDTA 3GP8A 3SBEA 1NI3A 4KO8A 2ZUCA 3T12A 3FMPB 4YONB 3T34A 1E3MA 4V0ME 1OFTA 4LBVA 3B1VA 4BFUA 1QG4A 3B9PA 3H84A 5KSPA 2GWHA 1CBUA 4M1TA 4ILEA 4N3NA 5FBVB 2IXFA 1G5PA 2G77B 2JATA 3HJNA 2O8BB 2FJUA 2FSIA 4MRVA 2QP3A 4H1VA 2QTVB 4FMCF 5D3QA 2GNOA 1ZD1A 2ZRPA 5JWHA 1E0KA 4PO9A 1N0UA 2IC5A 5FOTA 2FV8A 5FOXA 4B48A 4HAWA 5M04A 2J59A 2JLYA 4OKSA 5FR1A 2H17A 3E2IA 4PPFA 1XPOA 4N0EA 1XB2A 2VLIA 4BLQA 1R0XA 2PZEA 3NBZC 1PUJA 5ANRB 3AGPA 4I99A 3BH6A 4PSAA 4E5UA 1AN0A 2ORWA 2Q3FA 1VCNA 4TSFD 2ZJBA 2O8DA 1VCMA 2OE2A 1II9A 4US1R 3GLFB 3OESA 1X3SA 1KZ7B 2PT7A 3I1FA 2IYYA 5C46F 3GLIB 4TZ0A 2CMKA 2DFLA 1N25A 1VDZA 1W0KA 3OAAD 3UXMA 2Z4SA 3I4LA 5EP4A 1JPNA 1A2KC 4M1MA 5J4LA 3KTAB 1U8AA 1G4AE 4JBXA 3GLGB 2RGCA 4LRWA 4NYJR 1N6KA 1M8PA 3NH9A 3GJ4A 4AURA 4RY2A 3AKCA 3A1TA 1NG1A 2XITA 4HZIA 2KBEA 1RRFA 4LPSA 1GVNB 4MKIA 4B35A 4D2IA 4A8JA 4Q1EA 1SKYE 1W44A 4HSEA 3K9GA 2ZI9A 4LZZA 4FMDF 1XJ0A 4DT1A 3GLHE 5JSZB 1ZJ6A 2GKSA 4IEIA 3KJHA 2D62A 3IILA 3ZD7A 2VIIA 2XX3A 1EGAA 4CVNA 4JYCA 3RWOA 4A1FA 2D3WA 1EX7A 4RKFA 4L9SA 3TKLA 2I3BA 3BE4A 4Z8XA 1YHNA 3DM5A 1YZUA 5HE9A 4I81A 4FCVA 4P4SA 1OF1A 2HV8A 5AUOB 5KSZA 3ICEA 1X8LA 1NRJB 4EPRA 4OI4A 4AYWA 1T8TA 2VSOA 2REOA 2RH5A 1CF4A 5KUTA 3AVTA 1M7GA 5TDHA 1KNQA 3HU2A 3I61A 3PUXA 4EPTA 2FGKA 4LJ8A 3EARA 4ZDWA 2QE7D 1KAOA 2AWNA 4RZXA 1ZD8A 2DFNA 721PA 1IXZA 4UNNA 4LSGA 3SNHA 1E9DA 2IWRA 4TQAA 3QF4A 4GRAA 4OJKA 5DE3A 4XVRA 5KO2A 4DRZA 4NH0A 3TSWA 3QI2A 4CT5A 1PLKA 1KK1A 4IW3B 2JDID 2ZR0A 1T6NA 2GVZC 4G5RA 1OV4A 2WBLC 3E1SA 2ONJA 3O8BA 2REXB 2OBMA 2L0XA 5EXSA 2KJQA 2P6RA 2OLKA 3Q9LA 3KUCA 4G5OA 3FDIA 5DHFA 4XWOA 1OFUX 2YV5A 3CR8A 1TF5A 2CL6X 4CDGA 3HR7A 4DSNA 1U98A 2AKAB 5HKKA 1I2DA 1DAEA 4RFVA 2OHFA 4BECA 3BFKA 5J5CA 4EPWA 3BB1A 2FWRA 4X8LA 4G0NA 2FU5C 5KSYA 2RGXA 4MYUA 4EJSB 4BFZA 2GJ9A 1R8QA 1G3QA 2W2TA 5LB2A 1G3IA 2BKUA 2XSZA 2HJVA 1MH1A 1OJLA 1XNJA 5FL7A 2CL0X 2PH1A 1NN3A 3TSOA 1LNZA 4C0LA 1QHSA 3U2QA 4C30A 3LXXA 3RS3A 3U7GA 3KQUA 1G9XA 2OCYC 2QGZA 4MKHA 2VP9A 4WXPA 4IDHA 1P3JA 4ZO4A 3RDPA 4HB4A 4KSBA 5TB5A 1R8SA 4KODA 3THYA 2QP9X 5JZVA 1U9IA 1YZKA 1OXTA 1Z0IA 4MH0R 4PZZA 4UXIA 2FX3A 5EJEA 5LBIA 1W2GA 1DTSA 1Z28A 2ZITA 3VTKA 4AG6A 2QM7A 2WIAA 4DUGA 3KL4A 1OB2A 3GEHA 1FFHA 3AVQA 3IEUA 5JS7A 4AKEA 5KNCA 1F60A 3CF0A 3Q3JB 2J87A 4TZ6A 1Q1EA 2J0UA 1KTVA 4PHTA 4HUQB 5AUQA 5CIWA 2FA9A 2KE5A 2RGNA 3T15A 3VMFA 4QHYA 1X8JA 3WHKA 4MGZR 1KSHA 5DNYB 2Z6VA 2YOGA 1O3YA 3ZZ0A 1NY6A 2F43A 5K8LA 1W4BA 2DR3A 3U3JA 3K70D 5F9FA 1ZM2A 2EVWX 3DKPA 4NCNA 4DEYA 3MJHA 3AM1A 5HE8A 2ZRKA 3WBKA 5KPDA 1UKVY 2QTFA 2MSDB 3CZPA 3K0SA 5J4HA 2J5XA 3MLEA 3VKHA 5TMPA 1T91A 3BIFA 3SYKA 1CLUA 4U5XA 1F5NA 1LW7A 2G0TA 3SU8A 4ITRC 4JL6A 1GITA 1HYQA 3FB4A 1Z0FA 1AS3A 2V55B 3L82B 3TVDA 1II8B 1KO8A 1ZNWA 4FMBB 1U0LA 3EZ7A 1F2UB 2CK3D 1HTWA 3D7MA 4GDFA 4DCSA 3KZ1E 2PEZA 4DLWA 1E9BA 5C2JB 1E1QD 4JLJA 4WZAE 1FUUA 3GJ5A 5JEDA 1XJQA 3TW8B 4KFRA 1G18A 2PEYA 2XNDD 1Z6GA 4RFSA 3DPUA 1TTTA 1UDXA 2B7CA 2IYLD 1HURA 2ODBA 3AF3A 4V0MA 5EP2A 4C0QC 4M9QA 4B3BA 2ZS8A 2BJVA 4Q1DA 3A1WA 4K8OA 4A2QA 3B1ZA 3PUWA 3F5FA 5DHAA 2QN6A 4PAMA 3SC3A 5ELXA 4C2TA 3HPQA 3Q5DA 5JEEA 1UEIA 4JVLA 2GZDA 2C9YA 3ZS9A 5FBRB 4TLBA 2IT1A 3TJZA 4RVCA 5B30A 3MMPA 1ZBDA 4LJ7A 3U60B 2YNMA 4NZYA 1YR8A 2XOKD 1J99A 2CE2X 3CH4B 1TU3A 4TLEA 5DI9A 2ZJAA 3NG1A 4BFWA 5L3QB 3X1YA 3V4RA 1ZIPA 3EWSA 5HTKA 4OK5A 5AUNB 2GCOB 1CEEA 2W58A 3UPUA 1NIJA 4MYHA 3LD9A 2W6IA 3H2YA 3K70B 3U44B 1RZ3A 3MWYW 3Q72A 3FMOB 4JS0A 3R9XA 3SJZA 2ZI7A 2EFDB 4PC6A 3ZIAD 4I1VA 1XFAA 3LWNA 3RLFA 1FW6A 3EIHA 2PZGA 1ZM4A 4Q9HA 1S3SA 2ASEA 3T1QA 4YMTA 2VL7A 2XNDA 5JSZA 2IYTA 2WJJA 3QVUA 1NJFA 5IHPA 2Z4RA 3WYAA 1N6LA 3UWOA 3KJGA 1H8HD 4IFEA 3RS0A 2C96A 2D4HA 1JXMA 1W47A 4B3GA 1A7JA 4C0AC 3ZLJA 3T61A 1E2IA 4R9UC 1JEEA 2CXXA 3RRZA 4DBLC 2LKDA 1JR3D 1FMJA 2AXNA 1C1YA 4TLDA 4DCUA 3KTAA 1XTIA 5DISB 1XRJA 5DN6A 1Z0KA 1YJ5A 4B3FX 1Q21A 1KJYA 3CRMA 3IIMA 3ZVMA 2O8CA 3FOZA 3LV8A 4EKDA 4IDQA 3I62A 2OILA 4L15A 2NMVA 3A1SA 1NVVQ 5FBLB 1OH8A 4RJLA 1RVDA 4LV8B 1GNPA 4BLOA 1AGPA 4E09A 3SEAA 4HLUA 4P0TA 4HYYA 5FUVA 1TPZA 3IEVA 3W5IA 4PZLA 1NP6A 1BO6A 1GL9B 1KKLA 5L3RA 1JALA 1P5ZB 4JL8A 2CLSA 2ZRFA 2CJWA 2XB4A 3ZDQA 3AUYA 1HE8B 3Q7QA 3CO5A 1HQCA 2YZ2A 2YWGA 4G1UC 4AK9A 4X8HA 2Y8EA 1CULC 3SFZA 1VYUA 4RCZA 2CE7A 3AUXA 3K9NA 4HZUB 3PEVA 3M0EA 3ADBA 1CJMA 2OXRA 1QHXA 5LDDC 2DY1A 2UVQA 1QVRA 2OUKA 1IONA 4LHVA 1NVVR 2IF0A 3U4QA 1A1VA 1VYVA 3QEJA 1ZNZA 3BH7A 1DAMA 1N5KA 1NIPA 4PZYA 2CEAA 1JR3E 2WIBA 2XJ9A 2H5EA 4TN1A 4R71A 1GRRA 1P9RA 3QNUA 4Q4AB 5BQ5A 1RJ9B 1H8HA 1Z3IX 1D5CA 3QEOA 1MR3F 3U7EB 4Q47A 1ZINA 1S9DA 4Q7LA 2WKQA 5SZIA 1DO0A 5EUQB 1IN8A 2ZRGA 4Q00A 3X1WA 5E3HA 4E22A 4URZR 1LF5A 1Q1BA 1Z22A 5DN6D 3R8CA 2RGNC 4QJ3A 2FDCA 1E32A 1N5LA 2FN4A 4Z51A 5JFGA 2NO7A 2VF8A 2NO6A 5FOWA 4IDNA 2W00A 5CIQA 3UG6A 1Z08A 3RANA 1NN1A 4B2LA 1U8YA 1XD9A 1JPJA 3CPJB 2BIFA 1BMFA 1XZPA 3PXGA 2VP2A 2FPKA 3CX6A 4PO8A 5FUYA 4AYXA 5GVSA 4Q66C 2IS1A 1A2BA 2ZE6A 1NVUQ 3M4YA 4POAA 1QHNA 1KNXA 2BC9A 2QQEA 3PEYA 5E7MA 2VQSA 1SVLA 1DS6A 2VRWA 2YJTD 5CB6A 1XMJA 3IIJA 3FHCB 2JLRA 3REFA 3WYFA 1UBGA 4HAUA 1EFUA 2V7QD 4RD3A 2A7QA 1M34E 1Q57A 4KXFB 2CL7X 2GEVA 5CYPA 3VR3A 2QZ4A 1S8FA 1XWIA 2H18A 4JL5A 5L8VA 1KIMA 2JAQA 2HYIC 1OHHA 4IEEA 4KU4A 1OH7A 4EFNA 1E9CA 1ZM7A 2WWHA 2OAP1 4ZKDA 1EX6A 4C0KA 2EYQA 2XTZA 3TLXA 4KI0A 2BEJA 121PA 1B0UA 5EZ5A 1PJRA 1EXMA 2HXYA 5BXQC 2D2EA 3TNFA 1YR7A 4Z1MA 3J81k 3ZVRA 1RPZA 2JJ1A 1QHGA 1KO1A 4HAXA 2FF7A 4UKDA 2CVFA 5CLLA 1VIYA 3LY5A 3CRVA 3LVQE 5FI1B 3KKPA 4GT1A 4M21A 1T0JB 2TMKA 3GLIE 6Q21A 3UKDA 2WPDD 1Q20A 1JAIA 4GSYA 5FTJA 1DOAA 4TL9A 2HCBA 4OHZA 4NYJQ 4TWZA 2Q0HA 3KX2A 5KPJA 3TAHA 3R8FA 1DG3A 1Z29A 2PZFA 1YZTA 2GJSA 4FD2A 4MA4A 2EFGA 1OW3B 2D2FA 1TNDA 2ZJ5A 2GCNA 2ODNA 5HCIA 4F4CA 1W1WA 4RFSB 3HYRA 1W46A 1TMKA 1I2MA 5GJWC 2ZRIA 5JMTA 1G1MA 1AZTA 3T35A 3S1AA 1J8YF 5AJXA 3C4JA 4LBWA 2FH5B 1LS1A 3QXSA 1DVRA 1Z83A 4JT4A 3K70C 3B1XA 3L0IB 4GBMA 1KZGB 5UKDA 4Q48A 5DH9A 2JJ2D 3EC2A 3QXXA 4B75A 1UDWA 2OCPA 4AC9A 1U2RA 4QM7A 4PHHA 3C15C 2IUUA 3NBFA 4F4IA 3G82C 1XTSA 2GZAA 3HP1A 3I92A 5D3MB 3TR0A 1E9SA 4W5JA 2QMHA 1KK2A 3LBNA 1X86B 3UANA 4TTPA 5KTYA 2A78A 1SVIA 1Z0JA 4LCBA 3QKSA 3B2EA 2QORA 4HAVA 4I4LA 3C16C 2FFQA 5CM9C 1QZXA 2FFHA 3QG1A 5L3SA 1NL3A 4PSVA 4TLCA 3GFTA 4FWTA 2GVDC 4CEHA 2NO1A 2ZVQX 5TV2A 1ZW6A 2BHRA 2ZRHA 1S96A 1T4GA 4D4KA 4ACBA 2Q6TA 4D81A 3KDSE 4UJ3A 3CX8A 3NEYA 3IPXA 2CNWD 1XDBA 2XTNA 3C5HA 4JVMA 1VPLA 1HV8A 1OE0A 3X2SA 1ESNA 4CEHB 2JCSA 3Q7PA 4LY6A 3PITA 1HE1C 2CLDX 3P4YA 3DOEA 3QXJA 5EQTA 4YQFA 8OHMA 4BEJA 1GWNA 3VNUA 3P20A 2N46A 1G7TA 2OCBA 4O3MA 1OPXA 4CYMA 3OE7A 1P61B 1IY0A 2F7SA 4HDQB 2OFOA 4QNRA 1E79A 5AR1A 1XTRA 3VX4A 4LYHA 4BFSA 2WAXA 3GLHB 4KVAA 4DLVA 5CDFA 1UADA 2GXQA 3ASZA 4HZUA 1COWA 3GLFA 3FHTA 2ZRAA 5J4VA 1Z07A 4Q7KA 5FPHA 5CYOA 3VR4A 2GXAA 2KWIA 4GI7A 4URXR 4GMXA 2ZIAA 2EWVA 5JCPA 2YWEA 1TL7C 2ZSFA 4EJSA 2E9SA 3ND9A 1D9ZA 3OIUA 3LBHA 4RD0A 5C1BA 2Z5FA 1G19A 2WOJA 1MOZA 4TQ9A 4Y0VA 3NKVA 3A6PC 1SVOA 1QHHA 2GJAA 1IAQA 4KYIB 2JLUA 2GK6A 4TYQA 1DARA 2KI5A 4EIWA 4LHWA 1PLLA 2O0JA 2A5FA 2C5LA 2G6BA 4A92A 3C41J 2JLWA 2HDNB 4TMVA 1E2HA 1HEIA 1OFIA 3WNBA 3ZVLA 2QAGB 2IA5A 2QY9A 4URWR 1KMHA 3DZ8A 2PBRA 5JHHB 5G53C 4LHXA 3AV0B 4NHOA 3IBGA 3AVOA 2A30A 3QPUA 4UXHA 3TR5A 2IYWA 2D7DA 2AFHE 1W7AA 4Q19A 1VMAA 3NEJA 5G41A 3WNCA 4RSGA 3D6TB 5KDLA 4XVUA 4PHGA 2QROA 5CDFE 4B47A 3IGFA 3CKLA 5FL3A 4FCWA 1H8EA 1G8FA 5JS8A 1EG7A 4UNPA 4P4UA 2EFCB 5GADl 3ADDA 1KI6B 2OG2A 4L8GA 4HDOB 3K0EA 2J0UB 4QOSA 1KOFA 1U0HC 2QTHA 1LY1A 4OJQA 4D0LB 3K0FB 2AWOA 3KJIA 1E0AA 2Q9BA 3IHLA 4UJ5A 1NBMA 4WZBE 2YC4C 1IJEA 1BIFA 3L0PA 3IKJA 3K53A 2F6RA 4MRPA 1IN6A 4LDJA 3GJ8A 1GL7A 4BEBA 2VEDA 2XAUA 2WOOA 5H1YA 4Q9IA 3T5DA 2WTUA 4TL7A 1KI7A 2PMDA 2GHIA 1F2UA 4R2IA 4DSUA 3TSZA 1N6IA 1OYYA 4D26A 3B8HA 5HPYB 2GF9A 1GRQA 1NY5A 3THWA 2G1KA 2GJKA 2Z0MA 1R0WA 1XPRA 4WBSA 4NCIA 1KI6A 2R65A 3GJ0A 3LQQA 2X19A 4LV5B 4ZI3A 3QSYA 4F7WA 3MWKA 2ZRCA 1E79D 3WYGA 1GIAA 3EW9A 3MD0A 4A15A 2V8OA 2QMOA 1UPTA 2IWHA 4HI0E 1WQ1R 5SZJA 4NMMA 3B6EA 2HJGA 3DM9B 3EZ9A 4PC1A 2V3CC 1F48A 1TF2A 4IXNA 3B1WA 3RWMB 3GEEA 1JECA 1F2TB 2FMXA 2XJ4A 3KB1A 5HZHA 4OHYA 2QSZA 3PENA 2WJYA 1W36C 4PPGA 1MKYA 1SKQA 1XXHA 3L8ZA 4JJZA 2FSHA 1JR6A 5H8WA 4W9MC 1W4AA 3DO6A 3D31A 3SBDA 2ZAOA 5TY0A 3TW4A 2C9CA 4WXRA 1QHYA 2CCKA 3CR7A 5AJYA 1TU4A 4PQFA 2ZS7A 2A2ZA 1ZC4A 2V6JA 4M1OA 2QRZA 4CIDA 3VKGA 4R2HA 2G9NA 4BLPA 5E95A 4B71A 2GA8A 1TQ6A 3RAPR 4MUBA 2ZYWX 3AF2A 1MABA 1FQKA 4KHZA 2IX3A 3OEEA 3BB4A 5EXXA 2NGRA 3LLMA 1UKZA 1XX6A 1R0ZA 2OESA 2RKOA 3VHLB 1N6HA 2GETA 1A4RA 4ZCLA 3TMKA 1UJ2A 3B5JA 1XTKA 3RRNA 4DC9A 3ZH9B 5J4KA 1X1RA 2P6UA 4JZKA 4GL2A 1DAHA 2ZAMA 1QG2A 4US0R 2DCUA 3BH0A 1NN0A 2JGNA 4QGFA 4Q7JB 1TQ4A 1OFHA 1ZC3A 2OFWA 3H86A 4GZMA 1ZCBA 2XNSA 5EP3A 1VHLA 2J1LA 4Q21A 4TTQA 4ZV4A 3DVLA 3S1AB 2IHBA 3H4MA 2VHUA 1DO2A 4QNMA 2ZRLA 2J3EA 3HYTA 4NBSA 2BJWA 4AG5A 1Z5ZA 2JLSA 1P7CA 4DXAA 1ZNYA 1QBKC 2RGAA 3AVVA 2V1XA 2NIPA 2WWXA 4MGKR 1S1MA 2PT5A 3MWJA 1KI8A 4WZ6A 3LX5A 4Q5IA 2IS6A 2GDJA 2QBYA 4LYFA 1RRPA 3F3YA 5FTNA 2J9RA 4AD8A 4QBGB 1US8A 1XD2B 4KVGA 4DDUA 1SHKA 2GAOA 3O8RA 4Q1FA 4AI6A 2EYUA 2W6JA 3JZMA 4MKGA 1JB1A 1FTNA 2C95A 4KFUA 3QY0A 2O5VA 1DPFA 1IY1A 4D4LA 3NIBA 1H65A 4P33A 1XP8A 2PLRA 1CJVC 1YRBA 3T1VA 3TK1A 3W6PA 1AZSC 2QBYB 4Q1CA 5CLQA 5LD2C 4U00A 3VX3A 1ZAKA 3SJBA 2IK8A 3B82A 3RABA 2ZTSA 4W5WA 3OF5A 1M7HA 4TYPA 3SYNA 2O8EA 1CRPA 4URUR 3L2OB 1GP2A 2RHMA 4RCYA 2R6CA 2BMDA 2FPLA 4G5QA 4NL4H 2ZR7A 4EAQA 2XXAA 3NHBA 4LPKA 1T9HA 3OIWA 2BKEA 5CB8A 2QMEA 2C78A 4QHTA 1ZU4A 3OEHD 3MGCA 3B9QA 1EESA 2QU8A 2ZU0C 2Z43A 2ZR9A 3H1TA 3VU9A 3VAAA 1A5TA 1WE2A 3VQTA 2FEMA 4FIDA 2CCJA 4PAOA 1GAJA 3QPVA 4K81B 4XTCS 2QT0A 3U44A 4CW7A 4M8NE 2J45A 4Q4HA 3WBJA 2BBOA 5CJ2A 4L9WA 1V43A 5P21A 3WMEA 4B3DA 4HB3A 1W48A 1Q44A 2X2FA 2FNAA 5GJBA 4I1OA 3OEED 1ZCAA 3PEWA 4ASUA 1G3UA 2VTKA 4V0OA 1KI9A 4BFTA 2XZPA 1XF9A 3SQWA 1QDEA 2IUTA 4M1WA 3ETLA 4G01B 4TT3A 1PLJA 2MSEB 3Q5EA 3BC1A 4TYNA 1R10A 3CNNA 2QAJA 3BFXA 4RD6A 3NWJA 4V03A 1WRBA 1YR6A 4C0SA 3QENA 4KAXA 3C14C 4KBGA 1W49A 1UF9A 2QEQA 2JA1A 5DYIA 4YMVA 4JLOA 3QXHA 2HLDA 4HEJA 2ATXA 2P2LA 5FTMA 4N0DA 1NSFA 3LQRA 4Q4HB 4YMSA 2JLZA 1XEFA 5GVRA 4DUGD 4Q1BA 2XZLA 1DAKA 3R7WA 1N6RA 1PUIA 4YDSA 1QHHB 3GEIA 4GOKA 4F93B 4OQFA 2IS2A 1ZUHA 4U7DA 4O0MA 4CZ2A 2A5JA 4LYJA 2EFHB 1OLOA 2VA8A 4IVPA 1U99A 4P4SB 3L8YA 1KKMA 4Q18A 1ELOA 3FKQA 4R7ZA 5DIFA 1FL9A 2BVNA 3IIKA 2X8AA 3W5JA 1ZUIA 2A9KA 4MRNA 1L2TA 2F3TA 3PFIA 4KFTA 1VG1A 3K09A 1U90A 1MRSA 1UFQA 2O0HA 3VR6A 5D3MA 3UMSA 4ZPXA 4KLZA 3CF2A 3N5CA 5EP1A 3WRXC 3LXRA 2YHSA 5JJIA 4B33A 3A4MA 4DT1B 2A3RA 1NNEA 2WWWA 4BWYA 3K9LA 4PC2A 3DL0A 2ZRMA 4PSKA 2CDNA 2AKYA 1IN5A 5LB4A 1O87A 4LJ4A 1TQDA 1FP6A 1K8RA 4TT3D 4URYR 2GXUA 4WA7A 2GEDA 3TRFA 4EPVA 1Q0UA 2ZRDA 3ASYA 4PX9A 1KMQA 1WDTA 2H57A 2DB3A 5BWMA 4MUAA 4A0HA 1R5BA 4NYMQ 4JLPA 5AK0A 4JSYA 3VR2A 1FMLA 3THXB 1G8PA 1ESMA 2Z83A 1FX0B 1E2GA 1RJ9A 5FI0B 1HA3A 3LBIA 2UKDA 1LS6A 421PA 4ZDJA 2DPXA 1LFDB 3BOSA 2OO7A 4WIAA 3V9PA 2GF0A 1Q3TA 4ZCIA 1E2KA 2IL1A 4Q4JB 4KV9A 1XXHE 2QNRA 2B8WA 3KQKA 4IHQA 3UWKA 4LBYA 2ANCA 1KK0A 5J40A 4D80A 1ONBA 2OT3B 3VHXA 1VG0B 2H1LA 4MKFA 2V7QA 3AEZA 3CNLA 4DB4A 1ZU5A 5JRZA 5C4GB 1IM2A 3MFYA 2V1UA 1SULA 4HB0A 4DVGA 3W3AA 4TLAA 4ZKEA 3EPHA 2WKRA 2A5GA 4S2EA 5EE1A 4EQ6A 1QHIA 2P0EA 3ZD6A 2AD5A 4MYCA 1XEXA 2PJZA 4DIDA 1CP2A 1T3SA 4PR0A 3RC8A 3A4LA 1P2UA 3PUZA 2X77A 4Q03A 4B76A 1G6HA 2WZQA 2ZJ8A 1SKYB 2QMUA 2JJ1D 2WMNB 1Z2CA 1NLYA 4CEJA 2R6FA 2C99A 4HATA 4Q01A 3VFDA 2B8TA 1ZYUA 1E0JA 3IO3A 3I5YA 1Z47A 4HLCA 1CJUC 2ZRJA 3AP1A 3O8CA 1ANKA 2YVUA 1E9EA 2V54A 1NKTA 4B43A 3EZ2A 1GOTA 4Q4LA 1IHUA 2OM2A 1HH4A 3I8SA 2F1RA 1DAFA 4LJ5A 3LVRE 5L3SB 2NTYC 1FX0A 2DHRA 4Q7MB 2BMJA 3BBPA 2GESA 1KY3A 1JJVA 4M22A 1BKDR 3AVYA 4IVQA 1CJTC 1GSIA 3PIRA 4A36A 5E4FA 2ZJZA 2VHQA 4DCTA 2J0VA 4CEJB 2G83A 1SZPA 4OI2A 2Q3MA 2C77A 3QUSA 3K8YA 1WXQA 3AGQA 4JKIA 3CM0A 3SDZA 2CHGA 5DO9A 4Z54A 2QPAA 4BPBA 2PCLA 4QGHA 1WP9A 1CU1A 1Q3HA 2J7PD 4E03A 2VHCA 2VO1A 4ZDKA 4DDTA 2VP5A 1D2EA 3W8NA 1YQTA 3M1IA 5JBQA 2HT1A 4W7SA 3B85A 1G21E 1JQJC 4PQYA 1XPUA 1Z2AA 2OEPA 2WVJA 3CWQA 5EZ6B 4BE7B 4QHSA 4PQRA 4YXWD 4PC3A 3MG9A 3U7FB 1W0JA 2FGJA 1OXXK 2V4ZA 3QKRB 2BWJA 1GZSA 3NBYC 4PFSA 2YOHA 3KKQA 4IXMA 4LI0A 4I1UA 4D0GA 2EQBA 1JNYA 3SZRA 4D82A 4EFMA 4ZDIA 1Q12A 3BAFA 2ZYVX 4M53A 1QVAA 4D6PA 4NE2A 2O0KA 5A0FA 2ZJ2A 3WMFA 4C0HA 3AVPA 3PV0A 4OHXA 3ZVNA 3AVUA 3AVXA 4OL0A 2W83A 1U81A 4RD4A 3LW7A 5C4MA 1JI0A 1KK3A 2ZU6A 5G3ZA 1E9RA 1S4QA 3WP0A 4DDWA 1YU9A 1E98A 3PEUA 1LV7A 1Z6XA 3VR1A 1US8B 1WF3A 1GNQA 2ZYUX 3P26A 1MO4A 1QF9A 4UNQA 4FMCB 1TUIA 3VKWA 5G40A 3U3OA 4BASA 4WAUA 3DEFA 3PR1A 5CK5A 4C9BA 1NN5A 1ZM3A 2OZEA 2Q3HA 3BD9A 1G8HA 4LX0A 4OHWA 1EK0A 2PLFA 2MMCA 4ARZB 1EFHA 3JZAA 4ESVA 1GILA 3NDPA 4YDHB 3OE7D 1AKYA 5IF9A 2MSCB 3GD7A 4AYTA 3SI7A 5H70A 2F3RA 4G5SA 1OIVA 1S9HA 1COWD 1N0VC 1XCPA 4EUNA 4II7A 1G4UR 3CRQA 2GXSA 4RKEA 2QUZA 4B32A 5FPYA 1W36D 3ICQB 3K09C 4Q02A 1OB5A 4YC7A 3FPAA 3AKEA 5TXGA 1AA9A 3SYLA 2RB4A 4EJSC 3LLUA 5K8UA 1NVWQ 1W0JD 2FG5A 4HAZA 4Q4JA 5DYGA 5JCZA 2JIZD 4JJKA 4DDVA 4GFDA 4YLGA 2FOLA 2QL6A 3UMFA 5KNDA 1E2NA 1MO3A 3ADKA 3FYHA 2RAPA 5EE9A 2DWQA 4AWXA 2HEIA 3X1DA 4KITB 4LJAA 2CVHA 4TTRA 2UZIR 4DLXA 5IDVA 2XZOA 4M9XA 3VR5A 2B92A 3CPHA 1HY3A 2B21A 2Q9CA 3LO5A 3AP3A 2ECKA 2CHQA 2VH5R 3B1YA 4M1KA 3A4NA 3PG5A 5B58C 4BLSA 3KFXA 2NO0A 3IHWA 1HT1E 2ZI6A 3N2IA 3ZQJA 3Q85A 1E2MA 3OIVA 2LKCA 4B3CA 4XJXA 4IDPA 4HAYA 3A58B 3AKDA 1A82A 5HR5A 3FWYA 3IQWA 1ZUNB 1D8TA 3RS2A 2QPOA 4ERNA 1D2MA 5FPSA 1DG1G 2J46A 4PHFA 5F98A 1Q1QA 1U8ZA 1W4RA 4X8OA 4C0JA 4CRWB 2O8BA 2WSMA 4Q1AA 3N70A 4DSOA 2WSSA 2DWOA 3GLGE 2ZSEA 2YINC 3EWAA 3ZZUA 1EFRD 5BYJA 4LUCA 2J0QA 1E1RD 3KKOA 4NCHA 4BLTA 1KAGA 4Q4AA 4V02A 4XD7A 2ZJOA 4A9AA 4P4TA 4B3XA 3I8XA 1YKSA 4MITA 4JT2A 2C03A 1HT2E 4V0KA 3RS7A 1BYUA 2DBYA 1G17A 1LF0A 2IYXA 5J47A 3O47A 5F3WB 3THOA 4BFXA 1MV5A 4E07A 1E96A 2FFBA 2PMKA 3P27A 4FINA 2J0SA 4EQ6B 4ZIRA 1XZQA 1MO6A 1R0YA 2LWIA 4JLKA 1JXOA 2ZI5A 1SXJA 3WHLA 4C4PA 3RS5A 2R44A 1DEKA 1N5JA 3C8UA 2NQ2C 1TQ2A 4M0LA 2P65A 4MYTA 5FH9A 3KQLA 1UKYA 3CH5A 1E2JA 2ZETA 3TIFA 5KYKA 2WWYA 1SQ5A 2RCNA 4DLUA 3TUIC 1WCV1 3WXMA 2BBWA 2C9OA 2VBCA 3DMNA 3CF6R 1YZQA 5EUMA 4LV6A 3ND8A 2J7KA 3GLGA 5EE3A 1PV4A 3PCRB 1P60A 1ZNXA 2G88A 4YMWA 1Z0DA 4B2IA 5FBQB 5B2ZA 3SN6A 3L0OA 1E99A 2IEZA 3QIAA 2QGNA 2C8VA 4NCKA 5IK2D 1J70A 2FZLA 1E69A 2WICA 4OK6A 4DKXA 3CX7A 2GTPA 5AWFC 2VF7A 3NHAA 3TBKA 5LPNA 2AXPA 3QJYA 4OQXA 1Z06A 3KKNA 3W9YA 2B7BA 4MDEA 1E9FA 4YMUA 3RS4A 5FR2A 4TMZA 1L7VC 5TVKA 2I1VB 2ZUBA 2CNWA 3BRWD 2X2EA 3K0CA 1ZVQA 5DI3B 2IBMA 3QE0A 3PJRA 1IN4A 1IXSB 2I1QA 1RRCA 3G0HA 5DGXA 1SXJE 1KI2A 4OI0A 1E6CA 3MCAA 4FI3C 1MRNA 4GOJA 1WBDA 3P1JA 2NZ8A 1DELA 4JLMA 2W6JD 3WNDA 2VSXA 3OZXA 1KI3A 1P9NA 2ZRNA 4DZZA 5KNBA 2AD1A 3EA0A 3RVBA 4NPHA 3V4FA 4A82A 2BBSA 3K0CC 1CR2A 4IOKA 3CONA 4O2RA 2JEOA 5DI3A 3EC1A 1AGRA 3GFOA 4NCJA 2WSSD 4FWIB 4I1SA 1J7KA 5SZKB 3U5ZB 4V0NA 1KJZA 2QENA 3OHMA 221PA 2ZE5A 1K5GA 1OYWA 4PTLA 2AL7A 2FZ4A 4P31A 3WMGA 1W36B 4XIGS 3EXAA 1FNNA 1NMYA 1XMVA 3TVTA 3MRSA 4TMKA 4XWAA 1P73A 1YVDA 4HLQB 2GRJA 3AQ4A 2ERXA 3AF4A 4F4JA 4NKRA 2YKGA 1P9WA 5HCNA 2F9LA 2Q9AA 3BJIC 3CPEA 4LC0A 1GM5A 5FUWA 4NYIR 1AIPA 1W4CA 2OXCA 4URVR 5BN4A 4NDZA 3I5XA 2DYKA 1IN7A 1X6VA 4KJZA 1R5NA 2O8DB 3X1ZA 2GZHA 3QPWA 1NBME 1X8KA 1UBCA 1Q22A 2G3YA 3MWLA 1ZMXA 4O2LA 3SQXA 4PXAA 2NG1A 3NXSA 3U61B 5AJZA 1KDOA 1G7RA 4KSCA 1CTQA 1AQUA 3KUDA 1G64A 5KHOC 1T0HB 4JYBA 1Z6TA 1YZGA 2QSYA 1SXJC 4QG7A 1AJEA 1CIPA 4QFMA 4C0BA 1S3GA 1KO5A 3GJ6A 5JWOA 2WWGA 1II8A 1R6BX 2NO9A 4OBEA 2O8EB 4NYMR 2C2HA 3FKSD 4XH9B 4B34A 3DOFA 3WRYC 1K5DA 3FMIA 2WWIA 3PUVA 1D9XA 1XEWY 1XU4A 1E9AA 5C18A 1KI1A 3BORA 4LYAA 2IYVA 1RYFA 1TAGA 3BB3A 4ON9A 4O25A 3U7HB 3CNOA 4D25A 3EZFA 5TARA 4DCNA 4QXAA 4BZQA 1IY2A 2YOFA 3BFVA 1OKKD 3QG5A 2B6HA 1DE0A 1G41A 1XD2A 3RC3A 1EFTA 1P72A 3R9WA 1VG8A 2GJ8A 1ZD9A 2F1IA 2OBNA 4M2LA 2NOAA 3O8DA 4XOIA 1ZM9A 4H9GA 5HKKD 1UM8A 2VHTA 3I73A 2GBLC 1VECA 3AF0A 4FMDB 2H7VA 2ZUDA 4IDOA 4HLUC 5FOSA 3ZZTA 3IBYA 2AR7A 3CIOA 3U6KA 2IF2A 5KSOA 1I4LD 2D74A 2HYDA 2P5SA 3PUYA 5CK4A 5FL7D 2O8FB 5JJLA 3V00A 2ZYTX 2ZANA 3D3QA 2ODWA 2WAYA 4GPTA 3UIEA 4P32A 3QF4B 2NPIA 1N0WA 2R6GA 2ZS9A 1Y3AA 3GLIA 3UMRA 1VCIA 2AN9A 3L0SA 4B2PA 2KB0A 4IOMA 2ZQ5A 1X1SA 2PCJA 3UK6A 2BMEA 4RZ3A 4BZPA 5KDDA 3EPJA 2FFAA 2J41A 3IQXA 3MUFA 4JLAA 4DWJA 2ZEJA 2PX0A 4RZ2A 4L5BA 4OQMA 1FQJA 4OQLA 3FGNA 3T06B 3KXIA 1CKEA 1FUKA 1U94A 2ZSBA 4BLRA 4D4JA 3W34A 2AFIE 3H0KA 1EFCA 1GNRA 1GKUB 2ZE7A 4A0GA 1C4OA 2A5DA 5KU1A 1GDDA 3HPRA 1VHTA 1FZQA 2E87A 4QC2A 4TL6A 2RGGA 3LFUA 4BQSA 2UZ3A 3K0AA 1G291 1BYIA 2NPFA 2DFTA 2ORIA 2A5YB 4M9SA 4DLZA 1OIXA 4TSFA 3F8TA 1NMXA 5F2EA 1C9KA 2H8KA 2IHYA 2WJHA 2RGBA 5EE0A 2CJWB 2FPMA 5E7JA 1T5IA 3GJ3A 2QI9C 4QJ4A 3U6BA 3QBVA 1E0SA 1NLFA 4WVFA 3SJAA 4CF7A 1F2TA 1G5TA 3MJRA 1GTVA 1SVKA 1YZLA 2ZI4A 3EIEA 4AKHA 1DBSA 1LTQA 2SHKA 2WHXA 1G6OA 5FPTA 2OLJA 5FTLA 4A2WA 2Q21A 2R62A 4UQOA 1OXSC 3SHWA 2IYRA 1G8YA 4UNSA 4HUQA 1TF7A 2HCJB 2PJRA 2YC2C 3LX8A 4RZUA 5K8TA 3KB2A 4PPNA 4M1SA 4G3XA 4J0QA 3TQFA 1Z6YA 1W2HA 2RMKA 5BW8A 3FTQA 4IKEA 4JVNA 3EX7C 1YR9A 2IYZA 2VPPA 2REBA 4LGMA 3GQBA 1G3RA 2I4IA 4OK3A 1W0KD 1SGWA 3OAAA 1HQYE 2PL3A 4GMDA 2CK3A 4MQBA 3A37A 1FTSA 1RIFA 3RYTC 3JVUA 4GP6A 4LJ9A 3UG7A 1Q1ZA 5FTKA 1JQLB 4LWZA 3EAQA 2RGEA 1AS2A 1GKYA 2R2AA 4PC7A 4D0NA 1P75A 2AK2A 1N6OA 3IDQA 4V0LA 3N2EA 1M7BA 2KSQA 1UAAA 1G16A 1E4YA 4DLRA 3OEHA 3ZJYA 5JWRA 1M2OB 4B44A 1UBEA 3IUYA 1H8ED 3P4XA 4EFLA 3EPLA 3AVWA 3GLFE 3WY9A 4TYWA 1M74A 3SS8A 1VIAA 1JAHA 2VYFA 3JVVA 1CR0A 1CS4C 1NLZA 1YE8A 5E7IA 4ASUD 2W6ID 2H92A 3KJEA 5GJVC 1VTKA 1S1CA 3R7WB 2BOVA 2QPTA 3THXA 4BRUA 5B64A 1E2LA 3E70C 2BCJQ 4A6XA 4G5GA 2VP0A 2JDIA 2C04A 4R98A 2CCGA 1KO4A 4TYYA 1CXZA 4IVRA 4D4MA 3R20A 1G7SA 2EFEB 4JMPA 1RYHA 4A8JB 3BERA 2HLDD 2MMGA 4FN5A 3KFVA 3T1OA 4M1YA 4QBIA 4M9ZA 3RRYA 2IEYA 1N3BA 1BOFA 4PAQA 621PA 1OH5A 1KSJA 2QE7A 1L4UA 4QGAA 4LC1A 2YWHA 3U4QB 4TQUS 1KHTA 2QRNA 2ZSDA 1L4YA 2CHVA 3GPLA 2OV2A 4EPXA 4N1AA 2WJIA 1KMHB 3CBQA 4KFSA 3Q8XB 2BDTA 4QBHA 3LW8A 1KDRA 4LHZA 1KJWA 2P3SA 2ZREA 3I32A 3ONWA 4BZXA 4ZIRB 1YRAA 2BBTA 2H16A 5EXPA 4K46A 4L16A 2J7PA 4A4DA 4HUTA 3DMDA 1OSNA 4RD1A 3GLHA 2OBLA 2QG6A 821PA 2R8RA 1P4SA 3CRW1 3ZS8A 4Q9KA 3LAWA 3AP2A 2JASA 5KDOA 1AM4D 1JJ7A 3A36A 2K5UA 4ABYA 2HF8A 4IOJA 2XXAB 1Z6AA 3KQHA 1SVSA 2IS4A 3RNLA 1CJKC 1AKEA 1N5IA 5L3VA 3K0FA 1NVXQ 2IYUA 1G8GA 2ZRBA 4AKIA 3REGA 4CT4B 521PA 1JR3A 4Q9JA 4DLYA 2PX3A 3GJXC 1S0UA 1T8UA 5JI2E 1P2VA 3GMTA 1I4TD 2XSZD 2JJ2A 1GL6A 4EDHA 2HUPA 3X1XA 4XSHA 5BYKA 1G5RA 2OAQ1 4JVSB 1RKBA 3BWDD 2QM8A 3FFBA 3LRPA 4LOAA 3RSLA 4F38A 1N6PA 2GAAA 5A5GA 1NSTA 3T5GA 4F92B 1P2SA 2WMOB 1D6JA 4TMTA 1EWQA 2ATVA 2ORVA 1ZRHA 5JLJA 1TEVA 1P6XA 1SXJB 5FOVA 3DHWC 5AJWA 3KXKA 3KKMA 2QAGA 1XCMA 4C3ZA 3CW2A 4KBFA 2FE4A 3LH5A 3W6OA 2CLCX 2F9MA 2BM1A 4B73A 1OT3A 4HDCA 3AKYA 1NJGA 3I3SR 2GK7A 2P5TB 1N6NA 3NH6A 1T3HA 3RSOA 1ZIOA 3QKUA 3RHFA 2YYZA 2X1VA 4MRRA 1JBKA 3EPKA 3THYB 3QXCA 3B60A 5JRJA 1UEJA 2BV3A 1SVWA 1W5SA 2WM9B 2EWWA 2GILA 4DB2A 1E1QA 2F55A 2D7CA 1GRNA 2ZROA 3CUEF 3IPYA 3U3KA 1G7CA 3PQCA 3TQCA 3ECCA 2QQ0A 3SHFA 1E2QA 1VG9B 2IYSA 3WP1B 2D06A 5DSZA 2GCOA 3EA5A 4TL8A 3B13B 2OCAA 3FFAA 4MGYR 4UNRA 1PVOA 4M4SA 1DAIA 4EPYA 4FXPA 3BGWA 4IFBA 1OH6A 1HUQA 3TAUA 3C5CA 2QA5A 4PO1A 4QJ5A 4Z8YA 4XWKA 1XBTA 2QP4A 2O8FA 1E1RA 1KYIA 4ARZA 1CR4A 1XD8A 2YWFA 1IJFA 1IOZA 2ZPTX 1OXVA 3L43A 1XTQA 5A4JA 2ONKA 2V9PA 2BEKA 4JBWA 2JLXA 1XCGB 2XOKA 4TMWA 1TUEA 1VYTA 2R6AA 3AF1A 2AX4A 2VHJA 2IUSA 5B57C 1GUAA 1BMFD 1BS1A 3DKVA 1G20E 3SOPA 3TUZC 5AUPB 3W3ZB 4JLDA 2ZSAA 3LA6A 1AK2A 1EWRA 1J90A 3MAAC 4C7OA 4S35A 4FCTA 5CJPA 2HF9A 4OI1A 3SFVA 1KDTA 3NTUA 2XEXA 5J4YA 3EIQA 1XEXB 2W0MA 2W0SA 5BN3A 3RRMA 1Z63A 3GJ7A 2CBZA 3F0TA 4MRSA 2AK3A 2C98A 2BM0A 3B7GA 4LK2A 4TMXA 4CEIA 1EFRA 1I4DD 1QRAA 4C2UA 1FOEB 4QGGA 5IRCD 4MDFA 1D2NA 1B23P 1FPMA 3QVVA 4DLTA 1RE0A 3K0AB 5FPKA 4A0FA 4IRUB 3THWB 2JLVA 4ESHA 3SJCA 2XGJA 4YXWA 3CZQA 2HXSA 1E2DA 3IO5A 4OHVA 2AHOA 1W5TA 1XJCA 2FSFA 3PVSA 4NTZA 4B6FA 1LB1B 1T5LA 3EASA 3OFNA 2QAGC 4NONA 1LVGA 4WOPA 2RGDA 5CITA 1KY2A 3W6NA 3AH8A 2F43B 2FSGA 4LBZA 5FBWB 4L4UA 1L8QA 1Y63A 1NBMD 1SXJD 3HR8A 2BMFA 5H68A 1AQYA 3SR0A 3ZIAA 2ZE8A 1KI4A 4JLVA 2WWFA 1XXHB 1MT0A 1SVMA 3EZ6A 2IYQA 4JBYA 3CRRA 1IBRA 4GZLA 4DCVA 2WJVA 5L3QA 4XTRA 4LJ6A 4IOLA 3W90A 3ZYCA 4B6EA 1GKIA 2HT6A 4QM6A 4ZCMA 3MSXA 2GBLA 1JEDA 3GFPA 4PPQA 3R9IA 2G1JA 4JKYA 3A1VA 4KYUA 3QBTA 1FNMA 3BS4A 4QL3A 1GG2A 5IK2A 2JLQA 2GEUA 3D8BA 5CM8B 1P2TA 5JHGB 2VP6A 2XTMA 1F3OA 1E2PA 2O52A 4BGDA 2N1BA 3NVAA 1RW4A 2XB2A 4BFVA 1IXRC 3LDAA 3NC0C 4US2R 2ZM5A 4GOXA 1M6NA 2N42A 1ODFA 3W8RA 1M1YE 1GFIA 4XSGA 4A2PA 3DZDA 2ERYA 4DHEA 5DLQC 3HWSA 3E5HA 2WV9A 3FVQA 1WMSA 3G5UA 4IJMA 1XTJA 2R6DA 3EG5A 3QOFA 5EXTA 4RD2A 2W2VA 4LHYA 4UXJA 1KSGA 4ZI2A 3QKTA 4Y0AA 3KQNA 4BRWA 3DDCA 4C7OB 2VSFA 4NU0A 4BUJA 3QF7A 4OQNA 2BCGY 3I72A 5JJKA 4X8MA 1WBBA 2OFXA 1KO7A 2P67A 4OYHA 3HU1A 1U0JA 1RC8A 3OIYA 3K1JA 5SZHB 3NBXX 3CLVA 2FEOA 3U3MA 2OSBA 4CEIB 2DWPA 3VNVA 1T3LA 1MABB 1N2CE 2E1RA 4AIIA 4B74A 5K8IA 3ADCA 2W2XA 1K6MA 2IW3A 4PANA 3A8TA 1NKSA 2ANBA 4F91B 1NG9A 1TADA 1UBFA 2R9VA 5EE5B 1Z0AA 5F9HA 4DJTA 2ZXUA 1RRGA 4NYIQ 4Q9LA 3A1UA 3T1TA 3CB4A 1TX4B 1E94E 3KXLA 1KGDA
chains in the Genus database with same CATH superfamily
4NBWA 3P0FA 5A05A 4E3WA 4IH9A 2H6EA 5BSKA 4YACA 5A03A 3DZKA 1OLSA 4QA9A 3KTOA 4UHBA 1R7RA 2P68A 1AKQA 1OIWA 2NVUA 1FFDA 3IP1A 3NC1C 3QY9A 4GP7A 2GTIA 4NJMB 4DR6B 3FE2A 1JHMA 4K7JA 1FMTA 2X5XA 5K0JA 1JQKA 2BGJA 2BHLA 3PUKA 5JSQA 2CLLB 2WUGA 1V2GA 2ODAA 3VU9B 4F3CA 1EUQA 1V16A 2F1HA 4JIMA 5LCXA 1LSSA 2MYTA 3QKSB 1BQ3A 1ODJA 1PTJC 1Y34E 5JECA 5LQJA 4L2IB 5FUXA 1H2YA 5C5IA 5JI3E 3ZLTA 4HNTA 1Y7IA 3E1KA 1FFAA 5CX1B 1Z5WA 5LQSA 4M0PA 1NVEA 3SBXA 3A1EA 1U8EA 2AR9A 3QPDA 1Z8FA 2R4TA 1AZWA 3PC3A 4HVTA 4NP6A 1KQFA 5B1IA 2R4UA 1K7FB 3FCCA 4UTOA 2JGDA 3ELWA 1MN6A 3NT5A 3QKRA 4LK3A 5IZ4A 4YREA 3G85A 4Q03A 2VWHA 4OAPA 3OLVA 4QBFA 5JO9A 3IQGX 1E2FA 2ZJ3A 4ACAA 1PZEA 1X1CA 4PLPA 2QYSA 5DULA 5C5DA 1QM5A 1K98A 2EP7A 2P6NA 3NDBB 3KCQA 1SA0B 4DLSA 1DAGA 1KAEA 1NRWA 1U4OA 3GAMA 1L7NA 4R84A 2WJGA 2AJBA 4GL4A 1CR1A 2NN3C 3OJ0A 1Z7EA 3OTQA 3BK7A 5A9RA 4I9FA 2DERA 3FTEA 1YXMA 1ZHOA 1FRNA 1RXWA 2DCMA 4ECEA 3P32A 2PUGA 3NKLA 4DSTA 1SCKA 1J8MF 1Z7YA 2IXGA 2PWPA 1E18A 2ZJ1A 1E2EA 3D4NA 5BSHA 5JNLA 5KTOA 4JI0B 1NBWB 1U8FO 2PKQO 2NWQA 2QM3A 2RJNA 2WF5A 2XYRA 4O1IA 4F72A 4F12A 3R40A 3FLEA 3MGKA 1TEXA 2WPDA 3M6AA 2N3ZA 1HDZA 1P62B 1W5AA 1WB6A 1KSFX 2DM6A 3HCAA 4S0XA 4ALJA 3D6MA 3N2KB 5IT5A 1UKEA 1AS0A 1T8YA 1AOXA 3QQ5A 4DXHA 1RQXA 2Q1YA 2J48A 4KCGA 1QWSA 1TKCA 4LS3A 3GJTA 4C5BA 3SE0A 4WKNA 1BJRE 3K8OE 2HC9A 4ARCA 4CKEA 1JVBA 2R8OA 2QD2A 3EGDB 4UU1A 4P6VF 1U9IC 4P7KA 3MOGA 1H69A 1R50A 2HBYA 4KWEA 3AB3A 3EZNA 4PGAA 1MAUA 3GP8A 3SBEA 2CKDA 2ZUCA 3AK4A 3T12A 5MGNA 1ODIA 3NYQA 1K97A 4JHLA 4LBVA 3B1VA 3F5QA 1VKHA 3OVMA 1L7XA 3H84A 2ZGVA 3PHGA 1MTZA 3Q9NA 1NU8A 5FBVB 3RK0A 3H99A 4ZRDA 2EKPA 3LOQA 4FYJA 1G5PA 2G77B 2JATA 4QTYA 3QIVA 4MRVA 4Q3LA 5F4BA 3TNLA 1LZLA 2J67A 4BAGA 3VKFA 4EW2A 2IHUA 2A58A 4TSRA 1N0UA 1CRWG 1Z26A 2FV8A 2GUWA 2JHGA 3E2MA 4S1NA 1RWNA 3GQBB 1UJMA 4YRDA 4PPFA 2NU7A 3GNSA 1BEEA 2DXIA 5BSTA 4X85A 3MMNA 2FZKA 3B6ZA 1H9BA 2VOEA 4I99A 1N3YA 2ORWA 2VDRB 4J75A 1P0FA 2E82A 1VCMA 2DTDA 3OM1A 1II9A 3IOMA 3OT5A 2FPUA 4US1R 5ESWA 5HFAA 3OESA 4WK0B 3I1FA 1YB2A 1TT7A 1MEEA 2QVGA 3P9SA 4H1TA 4XR9A 4ZAZA 2JJQA 2ATCA 5EP4A 1JPNA 1V8ZA 2IQ5A 1BCSA 4KQIA 3UAXA 3L7DA 1G4AE 1YJBA 2WZBA 2RGCA 5B1YA 4HNVA 3HJFA 1YL6A 3KYCB 2AZDA 3R7SA 1KORA 3U19A 4UHKA 4MUJA 2X8WA 1NG1A 4MS1B 1YI0A 2DE0X 5T41A 5BMVF 1CF2O 4Q1EA 4DMMA 1CUHA 3FNHA 4DUPA 2PUVA 1W44A 2XNKA 1SBIA 1H4TA 2AQIA 2VH2A 3H3XA 4DT1A 2VAMA 2F90A 5DK6A 3EZXA 3GLHE 3THRA 4BV3A 5ITZB 2X0RA 1YUBA 1ZSVA 1D2GA 5CNKA 2IIPA 1VKNA 3IB3A 3IILA 1MDFA 2XX3A 2YFQA 4IFIA 1LDMA 1SM4A 1MU0A 1VLMA 2IHVA 1J9EA 3RWOA 4RKFA 1V8BA 3C0KA 4YYZA 4BXOB 1BFKA 1VHQA 1VIDA 3AHCA 4Z8XA 1O9BA 1XMPA 4IZ6A 4WLNA 3ZEIA 2V7VA 1T25A 1CYDA 1DT3A 3G88A 4FCVA 4DM7A 5LZ7A 4FQ7A 2HV8A 1S2OA 3ICEA 4GPZA 1KJJA 5CLIA 4MEJA 1FLNA 5EJGA 5BT8A 3HU2A 1OAOC 4L50A 3PGA1 3PGLA 4QDXA 1E2UA 4A3SA 1IU9A 4EPTA 3ONEA 3EARA 1QS0B 2P2SA 4ZZIA 4U1RA 4ZDWA 3CVUA 3L84A 5DHSA 4Y2QA 4KQMA 5JD6A 2DKFA 1VBFA 3QX8A 4KW7A 2VR1A 1LVUA 2Z9DA 3KUKA 4JFAA 4MV1A 2QMQA 5HRUA 1KEWA 2IWRA 4TQAA 1Y48E 3K9QO 3FIJA 1DC5A 5B3LA 4PS1A 5BN5A 1ML4A 3EOZA 3IT3A 4UBLA 4BX2A 2J9FB 3RIGA 4ZOLA 5EOVA 1QVVA 1FEZA 4LXYA 1KK1A 4IW3B 1WEKA 5L7TA 2YTZA 4F6CA 1QGUB 3D0RA 2ZBFA 2BW0A 3HGTA 1U2TA 3MGBA 2ZTLA 4LGVA 4O3FA 4F96A 3L7CA 4NHEA 2ONJA 1RHQA 3O8BA 3G1UA 3H5IA 4B83A 1OI7A 4K5QA 3I2JA 2P3OA 4OB6A 2OBMA 3SKVA 3W2HA 3I28A 5EXSA 2KJQA 4UTNA 2P6RA 3RT9A 3PPIA 4PFJA 3UT5B 4M46A 2YV5A 5DMHA 4TTJA 1OOEA 3IBTA 1TF5A 2CL6X 3O8LA 5EHZA 3U4DA 4AMUA 3BJEA 1ZRNA 3FWZA 1DAEA 1QHEA 4BECA 4MV3A 4TXNA 5J5CA 4O2BB 3BB1A 4EPWA 5AW7A 4Q3AA 4XDZA 4R71A 4EJSB 1P18A 3FB1A 4P08A 4IIDA 1G3QA 1PNOA 1G3IA 1T1IA 2XSZA 2HJVA 2QG4A 4BXOA 1NVAA 2CL0X 4H16A 2RJ3A 2A1UB 5HKAA 4GBGA 1NN3A 4TKVA 2CWWA 1LNZA 4G36A 1IAVA 2I8AA 3U2QA 4M37A 1V7QA 4JBNA 4EARA 2ZB2A 5CPBA 4MVJH 3KQUA 2OCYC 4MKHA 2JB9A 1K2VN 4H7JA 1P1IA 4YRCA 4WXPA 2QY6A 1ZOPA 3EGEA 1L4FA 3MCZA 3RDPA 1X94A 1AO3A 4KSBA 5CLGA 4Q3NA 1IMJA 3SQMA 1A71A 1O4VA 1R8SA 2DG2A 3LXMA 3N9IA 2Z56A 2HSDA 1HDOA 1OC2A 4DG5A 1TA4A 4LSZA 5LP6B 2C9MA 5EJEA 2FX3A 3UJNA 4HXEB 1DTSA 5L53A 2ZITA 2B2CA 2BSXA 4IQFA 3RRFA 1EFKA 2B4KA 1VJCA 1ZO8A 3Q7EA 5F1YA 5JS7A 4AKEA 2VPZA 3PEFA 3CF0A 4K26A 5J2TA 1NBHA 3HBNA 1G42A 2J0UA 1KTVA 2JGEA 4ZJUA 3DF7A 1IUNA 2RONA 2FA9A 4OP3A 3AEYA 3T15A 2O19A 1QQ5A 4ZVRA 1HYEA 3PQFA 4ZVOA 4QHYA 1J2YA 2D6FA 1K7CA 4J2TA 3DLAA 4LZNA 4W63A 3ZZ0A 3EOAI 3R24A 1A27A 4YJGA 5D00A 3PIIA 5LVAA 1GZ4A 5DLEA 2G76A 2HGZA 3K70D 4QUGA 4M1ZA 3DKPA 4IGKA 3MJHA 1ZI9A 5HE8A 1P77A 1U1DA 5A5DA 2ZB4A 5KBYA 3EVCA 1UKVY 3Q6MA 5AI9A 3CZPA 2P6PA 2PMCA 2R6HA 4OQYA 4UZEA 5J4HA 3VKHA 5TMPA 1NQUA 3KVRA 4OM8A 4LSMA 4U6NA 3SYKA 5FWXA 5C80A 4J1NA 5CMLA 3SU8A 2HWUA 4MVJI 2Q1SA 4DE5A 2YJGA 1ZJWA 1JLMA 1HYQA 4QU8A 3TTVA 3VHXB 2H1CA 3HCDA 4HXGA 1XL1A 1A9RA 3TVDA 4QX6A 1KO8A 3U7JA 1F2UB 3H5OA 1HTWA 3LPAA 4X1YB 4XAQA 3RKRA 5FV4A 1LK0A 1V2HE 5JYBA 4NPAA 4LXXA 3KZ1E 3B3JA 5KYYA 1AKNA 4LZWA 5C2JB 2JPDA 3OH8A 4B7CA 1T4DA 1UZLA 2I7CA 4N5LA 2RBEA 2QRMA 3GRKA 1KOGA 4MS4A 1M83A 4KXNA 5ILOA 2ZZMA 3DV9A 2XNDD 3QI7A 4MI9A 4ZYZA 1Z6GA 1Z2EA 2V7BA 4Q6WA 8GPBA 1UDXA 3PCXA 3KAQA 4N40A 2WT8A 3EMDA 3FWKA 4PFQA 4V0MA 4WD3A 4M9QA 1FMCA 4JITA 2QIPA 4HKTA 4KAFA 1OXKB 2NZYA 3B1ZA 1L4LA 3BL5A 1E89A 3NW9A 5HUQA 5TPWB 1ZJYA 1PT5A 1XIVA 3BBLA 3FYSA 4X94A 3ENZA 5DHAA 1YAJA 2X1HA 3BIJA 3SC3A 5ELXA 5JASA 3IP9A 5JEEA 1UEIA 4C4RA 2QTBA 4R2WA 1F0KA 4ZQHA 4BNWA 2AG8A 5KQPA 4Y2RA 1N8NA 3HCEA 3BK2A 5B30A 5I6DA 2B69A 1ZBDA 3TJMA 4UBIA 3U60B 3TLBA 4GXTA 5FQOA 2BH9A 2OXTA 4QTUB 3ORQA 4CM1A 1Y1LA 4EKGA 1UUFA 5LBUA 5DI9A 2X86A 2CB9A 3VH1A 4PLFA 3X1YA 2JIOA 3V6LA 1WD5A 3QMMA 1W2WB 1BWSA 2ZUWA 4R1PA 1XF1A 2Z8YA 1KDZA 4PLZA 1NIJA 1J56A 1DBRA 3ETGA 1C9MA 3LD9A 1KEKA 1OFUA 2W6IA 3RYCA 1DV1A 1K88A 1JQ3A 1RZ3A 2RK3A 2VJQA 3BICA 3B3GA 4IO1A 4U2KA 5I01A 3EFBA 4Z2YA 4XXHA 4ZCSA 2HX1A 1TJYA 1XRPA 3MWGA 5DT9A 5IASA 2VSYA 5FFFA 2EFDB 3UT6A 2PFKA 2H2WA 3VU1A 4PC6A 1ORRA 2RAFA 2IX9A 5E6RB 5KYXA 2QLLA 1XFAA 5REQA 3PJGA 4OOFA 3H1GA 3JATA 1Z4KA 4PNPA 4UASA 2W6NA 1FW6A 3EIHA 2VUSA 4AKSA 3VPSA 1BA3A 5LXTB 4N48A 2HIAA 1KY5A 5D5PA 1GAQA 2PZGA 3R6TA 6YASA 4CIYA 3LCCA 3HBLA 3QUAA 1NBOA 4I7EA 4RLHA 1YB7A 1IM5A 3T3IA 4QEZA 1HYHA 3NUGA 1IEWA 1S3SA 1JSXA 1TMOA 3RAFC 2VL7A 2XNDA 4WLFA 1X19A 3S1LA 6REQB 1T4CA 1AD2A 2GNAA 1XP5A 3JY6A 5JSZA 1U2GA 3IPLA 2XUKA 2QM0A 4UTZA 4ZVLA 4BP8A 5IHPA 3DPIA 1L5FA 3NCTA 3UWOA 4TZTA 4IFEA 2C96A 2IITA 1UOPA 4CMCA 2XMBA 1W47A 1LTHR 1PL6A 1O0BA 3H0EA 3DKRA 3IEIA 3FNQA 3T61A 4R9UC 1YI8A 3RRZA 1ISRA 5K0BA 5KJCA 5L95A 1FMJA 2AXNA 4TLDA 4WOJA 2XE6A 3WLRA 3TTYA 1VKZA 5KWVA 1XTIA 5DISB 1PZFA 2RHBA 4HDAA 4RIHA 1X70A 2C07A 1R9NA 2XYHA 2OYSA 3FUUA 1T0IA 3HVKA 3FOZA 1GRVA 3OU7A 1QB8A 3H6HA 3LV8A 4IDQA 1FJGB 2H1OA 5IC4A 3U0VA 1X2BA 1K27A 2XOEA 3I5UA 4QOFA 4LV8B 4RJLA 4BX9A 1GNPA 4BLOA 2XGSA 1E4EA 3PQ2A 4E09A 2GHTA 4E33A 5FUVA 2QDKA 1TPZA 3IEVA 4HWSA 1BXRA 1NP6A 5H9WA 3KHTA 3QLVC 4DSAA 5EPEA 3B5IA 4DREA 2H59A 1Z73A 2XUIA 4HN4B 4HQFA 4IUDS 2ZRFA 1KMNA 4JL8A 4Z3KA 4GWGA 3DZHA 3WE7A 1J21A 3AUYA 4LMBA 3VC3A 5CHYA 4Z49A 2JFPA 1YDWA 2KHZA 4X8HA 2OV6A 1TAHA 2Y8EA 4QUDA 3FPJA 3G7SA 3SFZA 5DLYA 2RARA 4IMRA 4BJ1A 1WXHA 3DPSA 1NVGA 1O95C 3ST7A 4RTJA 1C9DB 1XVVA 5DEIA 1SHTX 4M9UA 2ZCUA 1MG5A 4YDRA 4DW8A 1D2AA 3ND5A 2BTQB 4Q3DA 3E03A 2FR8A 1U4SA 3H2GA 5C7OO 4EB0A 4AMVA 3U9SA 1XDWA 1A1VA 1IK6A 4I4NA 4L3VA 3NEAA 5ADUS 1ZNZA 1FS4A 4W5OA 3BH7A 1DAMA 1GZ6A 1NIPA 3BTOA 4PZYA 3O92A 2XJ9A 3VUFA 4OLAA 1MC1A 4YV0A 3T7AA 3VR4H 2R60A 1E6EA 3BHNA 3QA9A 4EJ0A 1WUYA 3OOSA 5BOSA 1ZINA 1E3SA 1S9DA 4Q7LA 1AUOA 2WKQA 3DOJA 3A6DA 4CLXA 2F48A 5LSAA 3V8RA 5AKXA 2Q5OA 1E0AA 2ZRGA 1YB6A 4FKZA 3UV3A 2AF3C 1V45E 1U7WA 2PV0A 2P9GA 3HFSA 2NU9A 1QIFA 2OZPA 1MX3A 1CE8B 1K7SN 2DQKA 4X61A 5HRAA 4UEQA 1OX6A 4UTRA 2PGXA 4YP6A 1WPGA 4ABTA 3G2KA 1WKCA 1N5LA 2FQWA 3LHFA 4Z51A 1NURA 5ICFA 4DKJA 2XB6A 4CQMA 3DWIA 3EEFA 3H5AA 3RC9A 1DRUA 4WADA 4K86A 1TIPA 2Y27A 5CIQA 3UG6A 5J23A 1QLWA 3GEDA 4Q93A 3B20A 2R8EA 3C4VA 5L6MB 3E7WA 4ZI7A 3CPJB 3I2IA 3SHVA 2BUBA 2P9FA 1HKHA 4G89A 4BC0A 5FWAA 2INGX 1I30A 4NEHB 4AJNA 4CCSA 5A1JA 2P8SA 5BV8A 1DFGA 4JYMA 3WICA 4CM9A 4IKPA 2F8LA 1A2BA 2G9QA 3PWKA 1Y6GA 3CN9A 1KNXA 3G2JA 1GPDG 4FYYA 2OAGA 4G2NA 5H3LA 5JROA 1YOVA 3QTTA 1DS6A 1YIDA 2YJTD 1XMJA 1HDGO 3FHCB 3REFA 3L18A 4IH4A 4P0PB 4BU1A 1ODTC 3LSTA 5KOJA 3OHSX 1ZESA 2AMYA 2PUWA 4IICA 2A7QA 2PZAA 1USKA 2BLNA 2IP2A 3VNRA 3V7YA 4GKKB 1PZGA 5FLEX 4W1QA 3ED5A 1GTRA 1NVMB 1OHHA 4H0FA 4OIFA 5H59A 3ABOB 4I6EA 1C3OA 2GS9A 2Z2XA 3EXIB 3TN7A 1PGQA 3C8ZA 1E9CA 1VJ5A 2ZWOA 2OAP1 3TLXA 1AMOA 4N54A 4KI0A 4CM7A 2BEJA 3LUAA 1B0UA 5KYWA 1GXSA 1LDEA 1RBZA 1WP4A 2F67A 2JBHA 2F8MA 1JDTA 5AOCA 1SC4A 3OT4A 1WOYA 2Z58A 4Z1MA 5FA8A 3TNFA 3VNBA 4JGGA 4YCMA 4IUCS 3ZE0B 3OBBA 2I33A 2C94A 1KO1A 4HAXA 1EWVA 3H5LA 3U81A 4BVBA 5CLLA 1VIYA 3CMMA 3LY5A 3ZJUA 1NYLA 4JXJA 5FI1B 3PFBA 5TS2A 4FDTA 4GT1A 5AW2A 4MUMA 3M9LA 4JLUA 4YUXA 2TMKA 2VFAA 2BCEA 2PRSA 4GC9A 1W9HA 4TUYB 5BV1A 4NJEB 1DNPA 4XEUA 6Q21A 3ZI7A 1GAXA 1Q20A 2ZJ6A 4WCVA 1Q11A 2CF6A 4XDGA 5K8CA 3BRSA 4OHZA 2WJ4A 4FHGA 3WK9A 1EFLA 2RDMA 4YRIA 3M6LA 3B3FA 5PNTA 4MW9A 1SOUA 2X4GA 4OGLA 1RE1A 1I7LA 2IYFA 4MYDA 1DG3A 1Z29A 5T67A 4RTOA 2JGMA 1YZTA 2GJSA 4P0QB 3VJRA 2I2XB 2E6KA 3LYUA 1NXXA 1TNDA 1FYVA 4DC0A 2ZJ5A 2GCNA 3C6ZA 2OC9A 3IX7A 1UBOS 1TW2A 1TMKA 1I2MA 4V0QA 1AX9A 3WLEA 2ZRIA 1W8IA 1OXBB 3T35A 3UHFA 1L7PA 3WFJA 4H6WA 2FH5B 3T9DA 1X7WB 3VSDA 2VTEA 3O1HB 4R8KA 4W82A 2VAWA 1KZGB 3CVJA 4O2AF 3TNDA 4GI1A 5TT1A 3QXXA 3H11A 3CX4A 3KL2A 5DVZA 3H5TA 4B75A 2OCPA 1JDSA 1ICEA 4AC9A 4BFLA 5I8WA 1CW2B 3C6MA 2IUUA 1QV7A 1RRVA 4BJHB 4PRKA 3E27A 4KEAA 4WFQA 8ADHA 1K68A 3SM9A 3JARA 1BDBA 1VLQA 1X86B 2RI1A 1TYDE 3AB7A 5DYTA 1RJGA 5T6MA 1LDYA 2O8VA 1VBKA 3QKSA 3WYEA 1JTEA 2B4AA 4HAVA 4I4LA 3L7BA 4LE1A 5LUBA 1G59A 1AXGA 3K2BA 3LHSA 1UZAA 4PSVA 1PJAA 2ETXA 2IKQA 4Z3DA 2H7CA 4F71A 4F3TA 4A6DA 3TE7A 4FWTA 1EB9A 2HM7A 2WTNA 3P8ZA 2PR7A 4C0WA 1L5QA 4EMTA 4HNRA 5JNWA 3SICE 2ZVQX 5CLJA 3JWIA 2FPXA 1Y1QA 3MEQA 1S96A 3MRVA 4D81A 3C6KA 3KDSE 1N0HA 2AOTA 2YV1A 3IR7A 4KXXA 1Y4DE 1SUEA 2RHCA 4JP5A 4AF6A 5K0CA 1SRQA 2KM1A 3B1JA 3CX3A 5A5FA 1JWLA 3OE4A 2UZ1B 3LPCA 2NSHA 1VPLA 3K0KA 4GW3A 2DHDA 4ZOCA 3K31A 4J03A 3Q7PA 1UJ6A 4F3NA 1LGYA 1ONNA 2CLDX 3KXPA 3I04M 1GWNA 1B1AA 4I5IA 1W34A 1NVTA 4Q4DA 1VL0A 2Q5IA 2G5CA 3LT0A 2IZOA 1P61B 2F7SA 3ZKAA 1TMYA 3VX4A 1HE3A 1ZNQO 3I42A 3WKCA 2WAXA 4JX9A 4NULA 4W6ZA 2PX8A 3WGQA 3PLAE 2JH8A 3SYTA 3ROTA 2XI4A 4HH0A 5CDFA 4WDQA 3TCXB 4DNFA 1KRWA 1COWA 3STWA 1QG6A 3EXHB 2YMLA 4GNRA 4NECA 3AWDA 1Z07A 3HEBA 5TMDA 1SD1A 2EBHX 2H00A 3MPUA 3ILSA 4DCGA 1JSCA 2FUG6 2HL6A 2UYOA 4GMXA 2Y9MB 4KH0A 3U56A 5FJIA 1ZQ1A 4EJSA 1ILWA 4HGNA 2I4TA 1G60A 4BBPA 2HDHA 1KMIY 1ZD5A 3OIUA 4KX3A 5BN3B 3C1OA 2DR2A 1NNSA 3RT1A 1E3TA 1HORA 4J49A 1U65A 4YCJA 4B4WA 1DRKA 1F06A 4XYEA 3PR2B 1QHHA 2GJAA 1COZA 1MLDA 5I9LA 4LRYA 4K9OA 3EG9A 3ICWA 2GK6A 3KSZO 2VDWB 4HNUA 2QD4A 3JALB 1DTEA 1E66A 1PLLA 2GFHA 3GGSA 2A5FA 1USWA 2Z2ZA 4L4RA 4NENA 1JDBC 1WIWA 4RIEA 3C41J 4ARUA 5BQ3A 5AVTA 1N57A 1U6KA 5F1OA 1RT9A 4KRFA 2GJ4A 2QY9A 4URWR 3KB6A 1KMHA 1BEZA 5KYTA 5K4AA 4BMOB 4EI9A 4ZN6A 3DE5X 1JIVA 5DEOA 3U16A 3A6GA 3IKVA 4EMSA 2OL4A 3C8DA 1DPGA 2IYWA 3MGAA 2V03A 4MEBA 2C2WA 3IDFA 2YV3A 1ONOA 3NBMA 4RLSA 4Q19A 1O2DA 3GYBA 3NEJA 3O6VA 3NOQA 4RZIA 2QE6A 1LA2A 3A7DA 3NHLA 1CUBA 1R6TA 1V5GA 2IPXA 4MZDA 4MWEA 5KDLA 3EY4A 3WDMA 3ZWCA 4E5VA 1SD2A 1N2XA 3ILYA 3ETEA 3IGFA 4L8FA 2MINA 4BL5A 5FL3A 4L9AA 1IOLA 2VPQA 4U9HS 4LNAA 1TZJA 4FHCA 2I6TA 3G5TA 3QU7A 2YXLA 4UNPA 5KSWB 3ADDA 4FXOA 3KLMX 3OPXA 3QVSA 4G2TA 3DZBA 4HDOB 1NE2A 1XZLA 2J0UB 4FYMA 4OLFA 4QOSA 1EA7A 1KVQA 4M60A 3VOAA 1O77A 3D7NA 5INTA 2XXJA 3CA8A 5BSUA 4WZBE 3MJCA 5SYNA 1Y7HA 3USZA 3DYIA 3UW3A 5KKNB 3KETA 3K53A 3WQQA 4CXMA 5I9NA 3OQIB 5IF3A 2EP5A 5JIBA 1JBEA 2VEDA 1V5IA 4OYYA 5CCBA 3JQ9A 3IDAA 4TL7A 1U7HA 3BE6A 2GHIA 3D4BA 4FMPA 1N7JA 4J9UE 1YOBA 4L4YA 3TSZA 3HCBA 3JW8A 1L5ZA 3N2ZB 2IGTA 5F2KA 2JIBA 3WG9A 3THWA 2G04A 2ROQA 2QVYX 1RR6A 2GJKA 1PS9A 4CR8A 1XZ8A 1DWUA 4WBSA 2WNSA 4O08A 4LV5B 3QSYA 3QH4A 1RZVA 3EK2A 3IJEB 3ORSA 2ZRCA 1E79D 3MD0A 1GARA 4R31A 4B4OA 1VLVA 2IWHA 5AQ1A 4S0ZA 3AZQA 4WACA 1XCOA 2M6KA 1LDBA 2Y1KA 2YICA 3DM9B 4PC1A 3TZQA 1C7RA 4DA0A 2J4FA 1EVJA 2V5UA 4IXNA 3QEMB 4K6KA 4AROA 1LC0A 3D3NA 4MWZA 3RWMB 4QG3A 4B7UA 4LXGA 3UJ6A 2NXJA 4DLPA 3AIMA 4OHYA 5FB3A 1HFEL 3D6FA 3PENA 4ZAVA 1W76A 2OB1A 4EA6A 5I7SA 4WHMA 3ZHTA 1EXVA 3O3NB 5JR3A 2Q2OA 3IUMA 1R18A 5H8WA 1W4AA 1WMDA 2JLBA 3KAJA 2YMPA 3D31A 4JFRA 3DE6X 2C9CA 1LH0A 2A2ZA 3FDXA 5AOAA 2XDWA 5C51B 4Q7EA 4AJHA 2VZ9A 3VKGA 1IL0A 5F7XA 3UAYA 4R2HA 3MOSA 2G9NA 1DHRA 2OP1A 1QFJA 3KYBA 4K6GA 4OQZA 3SK0A 2FP4A 1GD1O 2XWQA 4L6AA 3MS7A 1RWOA 2COKA 2ZYWX 3FVTA 3FZGA 3HJGA 4ZOQI 3OM0A 1JDZA 1YS6A 2OR3A 2YHIB 3LC0A 2IX3A 3KTFA 1SUBA 3VPFA 4G1FA 4B8ZA 1UKZA 5ENZA 2JGIA 4D5EA 1HMYA 3PSAA 2Q4EA 4QQ8A 4D02A 2OESA 1RI1A 1ZPDA 3EW7A 3N2YA 2GETA 1XTKA 4RPJA 2PSEA 4N5NA 1EPUA 1VE9A 3B52X 3ZH9B 1L7MA 5HSGA 5IAOA 1M73E 1X1RA 3AEKB 3G9ZA 4X64B 2CLOB 3B70A 4MAAA 2YWXA 4AU1A 5LYJF 1QG2A 4IP0A 4HEA1 2F9FA 1ULTA 2DCUA 3LOUA 4N6OA 3BH0A 4E11A 3IAS1 1UBRS 2C2OA 4EO7A 3GVXA 4L72A 3G9UA 4P7JA 1OFHA 4AM8A 2O1SA 4G0QA 1XHFA 1YRWA 3ON5A 4E2ZA 5DM0A 3ZYZA 3NONA 3GX1A 3EE6A 2WE7A 3DVLA 2AQHA 2WFMA 3RARA 2IHBA 2EFJA 2VHUA 3IOBA 1VLLA 3S1AB 1P39A 4R6XA 2HNKA 4E0BA 3UJCA 4ENQA 2ZRLA 3DFFA 1JH9A 1H4VB 2BJWA 5L4NA 1DDIA 4QLAA 4AUEA 5IW8A 3G8AA 1UPUA 2C29D 1ZNYA 1QBKC 5I3CA 3NAGA 3DAGA 2PL5A 3OD5A 4EHIA 4O5OA 2WWXA 3EWIA 5ITZA 1H2ZA 4NEGA 1H2EA 1S1MA 3DO8A 1H3EA 1VP9A 4B0OA 4C0XA 3LX5A 5CNMA 5I4KA 2GK3A 2BL4A 3Q12A 1XALA 1RRPA 2QBYA 1QGAA 1XA4A 2J9RA 3SY8A 3TTUA 5IJZA 1ZL0A 5JDIA 3O8RA 2QJRA 3SXJA 3TL3A 3DMFA 3N8HA 4QQRA 4DIFA 4AI6A 3FSJX 4OLHA 4UUNA 1FTNA 3TLMA 1U5BB 2C31A 2D5CA 3QY0A 4K6CA 5KNBD 3NHJA 1FMFA 3RSGA 4BMNA 5LU9A 1DPFA 5M7EA 3K6RA 4D4LA 5KVVA 3CVWA 3M6VA 4KYTA 3I0NA 1J4AA 4PCLA 1LBHA 1MJFA 2YH2A 2B61A 1NNI1 2XRYA 3QBJA 3VX3A 5A7GA 1F2DA 4CF4A 1EINA 1IH8A 3SJBA 1MC8A 2IK8A 1C4WA 4FGWA 4G0PA 5LLDA 2JI7A 2DBRA 1PFKA 2ZTSA 4JA0A 3CVYA 3OF5A 3JVDA 2O8EA 2RHMA 3IYLW 1F0YA 2VDVE 3IUEA 4NL4H 3JTEA 4U9IS 4CODB 4LPKA 3EDMA 1H22A 4N5HX 2BKEA 3D4PA 5CUQA 5DCWA 1SCBA 1UJBA 1W5BA 4QHTA 1C4XA 1WU7A 2FLVA 3GCXA 3B9QA 4HGRA 4KZPA 1OY1A 4CUZA 1JJAA 2Z43A 3H1TA 3CLHA 2D13A 3F6CA 2IBSA 3VU9A 2DPYA 3ZR4B 1CEYA 2ZXFA 5FBKA 2IYEA 2JW5A 4EKYA 1U7TA 3K2EA 1ADCA 2Q8NA 3O83A 5EJFA 4XTCS 4JIGA 2QT0A 4UDOA 3R3HA 3QPCA 2IEIA 4WEQA 4M8NE 4CW7A 1TT5A 4BLUA 4Y98A 3JXEA 1J0BA 1C1DB 2FNAA 1UC4B 3JQFA 4R4JA 3NQ41 3ZZ1A 2Y05A 4ENUA 2VTKA 4BFTA 4NNOA 4BB6A 3SQWA 2FY8A 1XF9A 1QO0D 2PKWA 2PX5A 3HJAA 4C20A 2KS6A 1Y8CA 3BC1A 1O97C 3QVMA 4BQQA 2Q6IA 3MXTA 2YRXA 2JCBA 3F67A 4C43A 2O1EA 2I1LA 2QUBA 1NC3A 3QENA 1UWVA 2IYPA 4U9UA 5JMPA 2Q5CA 2XRFA 4UUAA 1TI7A 5FORA 4ANFA 2B5OA 5DK4A 1UP6A 3DMYA 5DYYA 2CLIB 3O7WA 4RHUA 4U8HA 2P2LA 2RGWA 4YMSA 1ISGA 3LE8A 5DNEA 3L6BA 2ICAA 1XEFA 3ZD9A 3UGJA 3QE4A 2I6UA 1Q1NA 2HZBA 3R7WA 3WQBA 3S81A 1IVSA 4FNOA 4PG5A 2DWUA 3WAKA 4RJTA 3P9YA 2PV7A 5CVCA 4IVPA 4D9BA 2OORC 1QV6A 3MERA 4YUYA 4K0KB 4X1IB 3BD6A 1ELOA 2ZPUA 3TLGB 4FM9A 3NETA 1DKRA 2X8AA 3F7TA 4HNAB 3V7UA 3W5JA 5ICSA 1RWMA 2A9KA 1U0RA 1ADJA 1VG1A 1MRSA 1BOOA 4HBZA 1K7EB 4DLKA 2HFKA 4KLZA 2O54A 4NMWA 1W581 2MR5A 3O8NA 5CVEA 4AECA 2H1SA 3G5MA 3PTAA 1X1QA 2YHSA 2XA1A 4YCNA 3TXYA 4BEVA 3PCTA 5F64A 3WLMA 2GVNA 1UFKA 3CZ4A 2WWWA 1Y4AE 4Y30A 3WNQA 4U2FA 4BWYA 1M1UA 2PKCA 2ZIZA 1GSHA 1G8JA 3DL0A 5GM1A 2K7ZA 2XUQA 1LLCA 3STXA 3GELA 2AMVA 2D1SA 4N6NA 3STVA 1IN5A 5LB4A 5C8VA 1KHHA 1TTHA 2FR1A 1H94A 4C7VA 1K8RA 1OVMA 4MRMA 5AOVA 4TTTS 5TJ9A 5FUMA 4BDSA 3TRFA 2W6OA 4DIUA 4NJOA 2R1TB 2DHQA 2YVLA 3IJ5A 2NVUB 4Y9UA 3AO0B 2XYPA 1I3KA 1PGOA 1KMQA 4G0VA 4NIMA 4AULA 2EBFX 4KAAA 5BWMA 1A5SB 5HF8A 3FZNA 3RBXA 5AK0A 2ILVA 1N34B 5JQWA 3THXB 1G8PA 2A9RA 1M1YA 1RHRA 2H5JA 4WE3A 5EA2A 3I04A 1E6UA 4GGMX 5FHQA 1SUCA 3FDZA 4LOKA 1JDPA 4MVJM 4YH1A 2NXNA 3O73A 1XYVA 421PA 3OOEA 2OO7A 2WUVA 3HGMA 3AI2A 2ZWPA 2GF0A 1Y6QA 1ORTA 1HEUA 2XB9A 4BE9A 1U0FA 1KQPA 1TW3A 2Q5FA 4H18A 2PWAA 2HQ1A 2Z98A 4IHQA 3JYNA 1UPBA 2A86A 1UMBB 1BKYA 4LBYA 2C5EA 4C88A 1OT5A 1XZHA 4PLCA 5GZ6A 1V6CA 2OP0A 2WKSA 5J40A 5ADHA 3RK1A 3UF0A 4S1PA 3HNRA 3KK0A 5H80A 1ZU5A 1PBNA 1IIBA 4B9AA 1WWKA 3QWFA 4YAKA 1HG1A 1BW9B 3AM5A 4DVGA 5CJJA 1U28A 4IDAA 4ZKEA 5F21A 1DG9A 1NMQA 2H2HA 1U8TA 2WKRA 4KO1S 4OP2A 5EE1A 2NSYA 4EQ6A 4ZHSA 3UJ3X 2PXXA 3D3WB 3WLIA 4C7BA 5HHTA 2H2GA 1M2WA 2O8NA 2PJZA 1Q83A 5F2NA 2XYGA 3V1KA 1HNWB 1WTAA 4XRRA 4ARBA 5JQGF 3TD2A 1P2UA 3WGGA 5KTNA 4EJ2A 1DLIA 1XU7A 3LHDA 3IAAA 4G4IA 4QARA 1O6FA 1YBFA 1T5OA 4RWEA 1NLYA 3T7CA 3IT1A 3RV4A 4HRVA 1KFKB 2FEAA 2VXCA 5HVNA 2ZBEA 1IY8A 1L5WA 2B8TA 4KQCA 3IO3A 4MPPA 2WR8A 4ZC8A 4Z3OA 3O8CA 2YVUA 5TF0A 2C4UA 4B43A 2XVAA 3HCOA 3FM9A 1LPMA 4O29A 2VA9A 1QUEA 3H2IA 1T1EA 3ORFA 1K89A 2P2DA 4HN2A 3UGKA 3T3HA 1N2BA 1KH1A 3LVRE 5M5BA 2DHRA 2V0CA 3D3KA 3GBSA 1L4HA 4Q7MB 5L7YA 1PR4A 3NBUA 4ZJZA 4RGYA 1L7DA 2E7ZA 2I3GA 4EABA 2FFJA 2GESA 4QFDA 1RPNA 4IIJA 2OV8A 4JYPA 2FEWB 1G4HA 4Z6KA 4DFDA 1EBFA 1CJTC 2Y0BA 2CBXA 3GT7A 4G67A 3PQDA 3EXG1 4DCTA 1BE6A 1C0KA 2J0VA 4NFYA 4C2BA 3Q0IA 5DP1A 1X7ZB 2PWBA 3C3AA 3QUSA 2Q5LA 1NLMA 4LWPA 4JKIA 4M55A 4QJBA 3W5DA 3SDZA 1O9GA 1WUHS 3M5DA 3PD7A 4K40A 1KERA 2LW7A 2PCLA 4Z9BA 3VR5D 1IN1A 4MTCA 4H1HA 5I7OA 2J7PD 4PBSA 2P91A 3RU9A 2VHCA 3S8MA 3VH2A 3FVRA 5K01A 1T36B 3N5KA 5NULA 4LFCB 1D2EA 5DFAA 4RVHA 1UANA 1EDZA 3CZAA 3B85A 1RWBA 2LRHA 1XPUA 2XD9A 2OEPA 1A5ZA 4QUIA 1M2OA 2QHXA 5SICE 3CJQA 3CJRA 3DYBA 5K99A 2A9QA 2CL5A 3HMKA 3IA7A 4PC3A 2WYIA 1GZHB 3PWSA 2X9GA 3CGGA 3NC4A 3PXBA 2V4ZA 1OXXK 2CDCA 3MC1A 1L3CA 1UJNA 1DBWA 2BISA 2P9EA 2YOHA 3QQPA 3EUFA 3CV3A 1NE7A 4RH0A 4DRXB 1JLKA 5BMOA 1RACA 4LI0A 4I1UA 1X87A