5IUNC

Crystal structure of the desk-desr complex in the phosphatase state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
131
Chain Sequence
SMISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of signaling directionality revealed by 3D snapshots of a kinase:regulator complex in action.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase/gene regulation
molecule keywords Sensor histidine kinase DesK
total genus 44
structure length 131
sequence length 131
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iunC00
3Q7TA 5DGCA 3RVJA 4Z4CA 4S04A 5CNJA 2ZAYA 1ABEA 1ZDMA 2FN8A 2VK2A 1JLKA 4XAQA 3HCWA 4N47A 2Q5CA 3CLKA 4TLMB 2IKSA 4LRQA 1KRWA 5KQPA 1BVHA 2HQBA 4ETMA 5FWXB 5JNTA 2NUBA 4LE1A 1CYEA 2FEKA 4Q7EA 4IRXA 3GL9A 1JFSA 2LUOA 1ZN2A 4EVQA 4WXEA 4LX8A 1CEYA 1A2OA 2JCGA 3D02A 4EVSA 1ISRA 1SXGA 4L4UA 3MIZA 1P6UA 4Z4EA 1JBEA 3OO0A 4MLDA 1ZH4A 6CHYA 4N41A 5FWYB 4D74A 4RXUA 1EWTA 1YMVA 2MYUA 2WB4A 1KMIY 2JVKA 1NXXA 2A9OA 3QLTA 4JASB 4MGEA 1LBIA 4UHKA 4PZ0A 5JNUA 3UK0A 4ZMRA 4YV7A 4HNSA 4CBVA 4ZPJA 4O5AA 2I6FA 4O1HA 4LE0A 2OQRA 4Z4GA 4EYQA 4UHJA 3Q9SA 1QNLA 2PMCA 5CNKA 1C4WA 2FVYA 4D6YA 3DGFC 2FLWA 4RXMA 1VPWA 3KKEA 7ABPA 5JNSA 3H6GA 5KWSA 3IP9A 1A0OA 5HM6A 4RK1A 3R0JA 5CNIA 4G0QA 8ABPA 3H5IA 3TX6A 3HDGA 1BDJA 1QP7A 2O20A 4IF4A 1ISSA 3RVSA 3KJXA 1D2AA 3UUGA 1QQAA 2FMHA 2P9HA 4M88A 1U2PA 1D1QA 3RVRA 2PUGA 2PUFA 3P9YA 3MA0A 4XASA 1ZESA 4KZKA 4EYOA 2WRZA 4MS1B 3JPYA 5B3JC 4H3KB 2CHFA 3FGZA 3DZDA 2M98A 4NICA 5HQJA 9ABPA 1Z16A 3FFWA 4OATA 1DZ3A 3N0XA 3QEKA 1NXWA 5TPWB 3H1EA 2FEWB 1Z13A 1EWKA 3LUAA 5BQ3A 3N6VA 4MS3B 3G1WA 4P1ZA 3BREA 1OXKB 1RPJA 2JB9A 2L18A 1MB0A 3NHMA 4N0QA 4QYWA 5JS2A 2GWRA 3F6PA 2MSKA 1QO0D 4YLEA 4Z4FA 5JS1A 2PUAA 4XFKA 1MIHA 1RXEA 3MMNA 3KHTA 1FFWA 1EHCA 2YHBA 1E2BA 5IUJC 3C6QA 4WWHA 1DCKA 4E7OA 2IYNA 1GCAA 2JK1A 4KNYA 1TM2A 2HQOA 4NCAA 3ROTA 3VNBA 3N8IA 3EQ2A 4L85A 3KYJB 4DQDA 1QP4A 2GBPA 2GI4A 1L5ZA 3KLOA 1Z25A 3KCNA 3H6HA 4RK7A 1JWLA 1GUDA 3OQNA 3QLUA 1PHRA 2LPMA 4YWHA 3HS3A 4F3TA 2IOYA 3O1IC 4LDZA 4O1IA 4Z9AA 1B00A 1Z2DA 3HV2A 1YVUA 1DBWA 4RXTA 5KC8A 1DRJA 4EVRA 1DCMA 4RK0A 4Z4IA 3RVOA 2JVJA 5KC9A 1JL3A 1NXOA 1IIBA 1NATA 3Q7RA 5HSGA 2PL1A 5JNRA 1VKRA 3OLWA 1APBA 3HUTA 5E3JA 4LE2A 3ROFA 1D5WA 2L19A 2LIVA 2XDYA 2AYXA 3HVRA 4G0MA 3OLXA 1BA2A 5FBKA 5TQ0B 3CHYA 3DLHA 5TPZD 1CHNA 4ZYLA 1ZGGA 4ML3A 2JBAB 3HUUA 4IGAA 3KSMA 2WY2D 3GBPA 3RVKA 4YS6A 3BILA 5IEJA 3O2QB 4TLLB 3S99A 4G0XA 1AB6A 1K66A 1BDHA 4MYRA 3CTPA 4QPJC 1VRVA 4NV3A 1SXHA 3FFTA 3DBIA 1QKKA 1Z26A 5D2CA 1C0EA 1DBQA 3CZCA 3EJWA 1NXVA 2FMKA 3M9WA 4PYRA 2DRIA 1ZAYA 4G0YA 5JNVA 4D6XA 2R25B 5IEBA 5TQ0A 1DP4A 2R47A 1LJLA 3N0WA 4Q6WA 4MR7B 5I4CA 5IULC 6ABPA 3EDCA 2F8TA 1URPA 4WT7A 1R8JA 1UDRA 1TLFA 2FKAA 3OM1A 4RWEA 1JH9A 1NXPA 1HEYA 2RJOA 3A10A 1JHZA 1FFSA 1A04A 3GBVA 3C3MA 3RVNA 4KQCA 2W42A 1KRXA 2B4AA 4G97A 1AB5A 4YP9A 5FBHA 1W25A 2A9PA 4EGSA 3O2JA 4KK4A 1XWWA 3H75A 4N76A 3A0RB 2A9QA 4KVFA 3LMKA 4F8JA 1DCFA 4OTZA 4XXHA 1NXTA 1Z18A 3QELB 2AYZA 1USGA 5CNMA 3HZHA 4YR7A 1P8AA 3K4HA 3M9XA 5FWYA 3HM9A 1Z2EA 3FMVA 2GKGA 1QO0A 2NT4A 5BRJA 3A0UA 2PE5A 1ZY2A 3OMWA 1U04A 1FQWA 2E4WA 2PL9A 1SRRA 3KTOA 1LJUA 5IUKC 3HXMA 4FE4A 1DC7A 4GNRA 5KQLA 4YCSA 4FB4A 1DG9A 4RY8A 2FN9A 2VUIB 2PUBA 1J56A 4GPAA 4KV7A 1QP0A 3BRSA 3LUGA 2ZWMA 5T7BA 5TPWA 4QYMA 2FTKE 3URMA 3LUDA 4TMYA 3SG0A 3B2NA 3GV0A 4MPTA 4OLAA 3GRCA 4IMIB 1H9CA 1MAVA 4LZLA 2ID9A 3HSYA 3L6UA 4N0PA 4OG2A 3NHZA 5EWMB 4G86A 4KPYA 2E4UA 4KQ9A 4MQFA 3JVIA 3JPWA 4ZMSA 3BRQA 1DC8A 4YGXB 3RQIA 2MSWA 3SAJA 3DGEC 2HPHA 3QX8A 4MAAA 1QQBA 5DTEA 4XLTA 5TPZA 1U2QA 1JYEA 4JAVC 4Z9BA 4OBBA 2A9RA 3QLVA 3TD9A 3OLVA 3ILYA 3SM9A 1NY5A 3H5OA 4EUKA 4ZJPA 4WZZA 3NNDA 2QU7A 3EODA 3C3WA 4MLCA 1OXBB 4PEVA 3JVDA 3BBLA 5ABPA 3CU5A 2FQXA 4G0OA 5KI6A 3OO1A 1L5YA 1WETA 3T95A 2L17A 5EWJB 5JNWA 3E3MA 3W9SA 1VLZA 1YK0A 1JYFA 3T38A 3H5TA 1RZRA 3CG4A 3MM4A 3LTEA 1JDPA 3QK7A 1JFVA 1Z17A 4MS4A 4EY3A 5KQMA 3F73A 3TB6A 3A3KA 2PUCA 3G85A 4W5TA 4MR9B 1TJYA 1ZH2A 4WUTA 2H3HA 2P4UA 3MF4A 4RK6A 1D4ZA 4F12A 2WJAA 5FWXA 4RS3A 5T3YA 1JDNA 2FQYA 3EAFA 3HK2A 2FMIA 2JRLA 3CKMA 3I09A 4MS1A 4MRMA 2HSGA 4JB0A 1P6QA 1TMYA 1SD5A 2ID7A 4RK4A 4YRZA 3E61A 3EQZA 3FDFA 4B09A 1BAPA 2QW1A 3EULA 1USKA 3KS9A 2KYRA 1BDIA 4MR9A 4Z99A 2TMYA 3IPCA 5HKOA 3RVPA 3JY6A 3N75A 3IPAA 3O2SB 5EWMA 4DADA 5DLEA 3KLNA 3H5VA 4RK5A 5BRAA 3CNBA 2X7XA 5DCLA 2YHAA 3NNNA 5TQJA 3RVQA 2N9UA 4KK3A 3RVLA 1YMUA 3MQ4A 4RKRA 5TQ2B 2CD7A 3CZ5A 4KREA 4HNQA 1RNLA 1M2FA 1NXSA 3JS5A 3IDOA 4S05A 4JOQA 5TE9A 1DRKA 3QLVC 2RDMA 2VUHB 1ZGZA 1LK0A 1YK1A 4H3HB 2WWVD 1PNTA 3L49A 1Z15A 1EWVA 4W5OA 2NZUG 1MB3A 3O21A 4RSMA 3T6KA 5ED4A 1MVOA 3C97A 3F7NA 3RH0A 1U8TA 2MYTA 5EWLB 4RDCA 1U0SY 1ZITA 3UKJA 4G0PA 2HQRA 3SY8A 3TO5A 1KGSA 4DN6A 3K9CA 1D1PA 2M1ZA 5TQ2A 1E6LA 3O74A 4MS4B 4H60A 3I5AA 1I3CA 4W5NA 2JVIA 1SXIA 4FE7A 2PAFA 4HNRA 5IBQA 3I42A 3O1HB 1GCGA 3IP5A 4MQEB 3HDVA 3I45A 1W9HA 3QELA 1Y1LA 2FEPA 5PNTA 4W5RA 1XHEA 3Q15C 3OM0A 4ETIA 3LUCA 2GX6A 2MYNA 4LDAA 4MS3A 5C5EA 5EWLA 3VNAA 3QX9A 2E4XA 3Q41A 3OQMA 2PLNA 2BGGA 2MYPA 4RZSA 2HJ9A 2QR3A 1DJMA 2IPLA 3NNSA 5KQGA 3N0RA 3F6CA 1S8NA 3H5LA 3IP7A 1LBHA 3LKBA 4Q6BA 4Z0NA 1P2FA 4WXMA 4XARA 2E4ZA 2FXIA 3IP6A 4RKQA 1M5UA 2RJNA 3LUKA 2PUEA 3LFTA 3HEBA 5GOTA 5B3JA 2RGYA 3C3KA 4YO7A 3DLBA 2IDMA 1DBPA 3TMYA 2R4QA 4RV5A 5F64A 5IUNC 4RU1A 1JF8A 2IPMA 3O1JC 3N53A 3QEMB 2PJUA 1ZHHA 5DKFA 4JP1A 3JTEA 1E6MA 1F4VA 3Q7SA 4PE5B 1EAYA 4F06A 1RZRD 1EFAA 4JA2A 1YTUA 5C5CA 1QMPA 4HYEA 1T34A 2E4YA 3KG2A 3HJFA 1PEYA 3CRNA 4N03A 2NT3A 4IMJB 2FMFA 2LBPA 4QICA 2NZVG 2PKXA 5IX8A 5BR1A 3CS3A 4IILA 2IPNA 1Z12A 1RXIA 3CFYA 3LUJA 3LUFA 4TN5A 3RVMA 4E7PA 4KFCA 1YIOA 3T8YA 1PEAA 1YS7A 3CG0A 2FW0A 2CWDA 2H0AA 1TVMA 2VYCA 2QZJA 3H1FA 3GYBA 1ZVVA 3LOPA 2WJWA 3LUHA 2FQWA 4W5QA 3EGCA 3OLYA 4EYKA 1M2EA 1USIA 3SNKA 1JFTA 4F11A 4OLBA 2WMYA 5GQSA 2CHEA 5EWJA 1PUXA 3D8UA 4MR7A 2E4VA 3OMXA 2PUDA 1QPZA 2QXYA 3H1GA 4MR8A 3MYYA 3QLUC 4RY0A 4Z4HA 1FFGA 4KMRA 3SQNA 3FFXA 1XHFA 3KYIB 2J48A 4JB2A 1PNRA 1K68A 3M6MD 3OQOA 4NQRA 4MRMB 3H5WA 2FSPA 5IC5A 3NBMA 2R48A 3GA5A 4P98A 3ILHA 4G0ZA 3GWGA 2B1JA 3OLZA 1ABFA 1GUBA 4RY9A 1F51E 2L2QA 4EYGA 4ETNA 2QVCA 1FSPA 1NTRA 4MR8B 1M5TA 2QVGA 4MQEA 1YS6A 2JBAA 4PICA 3GT7A 4Y9TA 1E6KA 3QEMA 5CHYA 2QSJA 2IPAB 2V0NA 4MQFB 3O75A 2MSLA 2F8SA 2QV0A 2LP4Y 1JX6A 3HO1A 1GLGA 4KRFA 2OENG 3LKVA 4NCBA 2FLKA
chains in the Genus database with same CATH superfamily
1GZ5A 3MWDB 4S04A 4ZTZB 1X39A 4P36A 3H6KA 2HZBA 3OCCA 2ZRBA 1E1YA 1W30A 3VZSA 1F20A 2H0RA 1CT9A 4O4IA 3HHEA 1QE3A 1X80B 2C88A 2A4KA 1XTJA 2V6JA 5ES3A 2E48A 3HWX1 3PL5A 2QBYA 5JNTA 3CE9A 4JYPA 5EJ4A 3QVJA 3ZQKA 5K0ZA 3OQVA 3SX4A 1B2RA 2YWRA 3UGJA 1ND5A 2OV1A 1XJCA 4R1PA 1O6BA 4H1TA 4WXEA 2WQ7A 2R8OA 4TKUB 2ZRQA 3ESRA 5EJAA 3AEYA 3FHCB 3OM8A 4BMXA 3KYDA 1YJAA 2GJ8A 3ZE1B 1Z63A 4Q15A 4CFSA 4CXMA 1PR9A 3GZTB 3OCVA 4L4UA 1N25A 1IZ9A 4J1TC 4MUEA 4WKGA 4ZFNA 2QTBA 4RJLA 3F49S 4REMA 4LJ5A 3OO0A 1AKEA 2Y05A 5BOSB 4IGFA 3IXMA 1ODIA 3K92A 1ZNXA 4XDYA 4OHBA 3WWZA 1OTXA 2QTCA 2RIPA 4NONA 1U0OC 3W2FA 1VKHA 1ZM9A 4TWIA 2H65A 1SVMA 1XSEA 2Q0QA 4MIEA 3NM4A 2ON6A 3ZV3A 4G5YA 4RZQA 3Q87B 1X1BA 3INYA 3L7KA 4YV7A 1H94A 5JFOA 4DG9A 1XLTA 4TM8A 3EOAI 3LL7A 4LMBA 2ZR0A 3E7XA 4KVZA 3RS9A 4B3BA 4BQNA 4JLOA 1YT5A 5F7OA 2ZROA 5CVTA 2FRDC 3A36A 4Z4GA 1RRGA 2I6QA 3EUFA 2AW3A 2AFVA 2WWTA 4H18A 4GZMA 2EX0A 4KLAA 4BVBA 1TA0A 1FQJA 1U2GA 1Y1QA 3PFKA 2X9NA 2JGDB 5CD9A 1Q19A 2ZDGA 2FY8A 3E81A 2F3RA 5HKKA 4BBZA 3CF2A 3ABQB 1P4HA 2YYYA 2FCAA 1OD6A 4MKRA 1GZUA 4AECA 5HOQA 5JY1A 3D6AA 5KJ1A 3BK2A 2GUGA 4K6KA 3ICEA 1U0LA 3JQGB 4IYRA 1Y7HA 3E9NA 4P3PA 4W9NA 5DLDA 5BO5A 4B0PA 4BVEA 3ZLTA 1QP7A 4H77A 2OAGA 2IPOA 3GLHA 3M7IA 1EVJA 1AN0A 3BMNB 3OFNA 4NPAA 4TMXA 4X1KA 3M6AA 4CL8A 5K0TA 3AF6A 2WF5A 1CS0A 5F7XA 2FWNA 4LRUA 1EK6A 3PA8A 1T5DX 5LDGA 4RHEA 3ZU5A 5FAKA 2QTZA 5K0LA 4KN6A 1ZH0A 1T0IA 2FRVA 2JD1A 2CV0A 4BNMA 5HQJA 4YCDA 2OBNA 3JR7A 3RSFA 3PL1A 4Q1AA 1H1LA 1SULA 2VSFA 3L1VA 3EPPA 5CB0A 2WM2A 3VPDA 3BREA 4O4HA 2YVUA 4Q4CA 1UOOA 1L5SA 1XGKA 1ZRSA 2JIPA 4FVTA 3OEYA 2NNLD 2A1TS 4Q03A 1PR3A 4UHBA 1GCOA 2H92A 2VO1A 2XA1A 3ETHA 1BRMA 4QPZA 5ESRA 3RE1A 2FUCA 3D6HA 1V5EA 2SKCA 2X8AA 3IUPA 4HN4B 4Y3UA 3UAVA 2OECA 3X43A 2YHBA 2CXOA 3MIIA 1S2MA 1SC4A 4GW3A 4GL4A 2WFAA 4P84A 2A1UB 1FDRA 2QPOA 4TTJA 1VIDA 2EG9A 1OHHD 3KL4A 3HEAA 3EA5A 2GEDA 3G2IA 1OBVA 1LLQA 1F0KA 1NN5A 1ZJ5A 2X15A 3KYJB 4O5OA 2J0SA 1BOOA 3VUEA 4ZXPA 2BELA 5BN1A 2CVPA 1V4VA 2IIVA 1XL1A 4D56A 5KYKA 4WGGA 1SKUA 2C99A 3CZAA 3OQNA 1D9ZA 2P1RA 1KJJA 2WWFA 1VSVA 3TW8B 4O2AF 1EVKA 2VDJA 4PZLA 4Q3CA 4D8YA 4QEDA 2C5FA 3VR5A 2WWRA 4H1UA 1KYQA 5LNK6 4A23A 5ESDA 1YVUA 1JT9A 1DRJA 1MXHA 1VE6A 4MV1A 5K3CA 3T0IA 5T5QA 4BNTA 4R54A 5JSZB 3V4VB 4DBLE 2OEPA 3QVVA 5IW8A 3AETA 3DHVA 2HRQA 2W00A 2WYIA 2J5XA 4KMMA 3HA5A 4RPHA 5T67A 2GCIA 5D87A 4LZJA 1P5FA 2AFIA 5FADA 1R74A 2VTVA 5AK6A 4DIUA 1IN6A 1NVKA 5E4JA 1PWZA 4CG0A 4DJEC 1XYGA 3RG8A 2VVTA 3RSOA 4RW0A 3SZGA 2J07A 2C2KA 1YRLA 2GZ3A 4RD3A 4CIXA 3K70C 3KYDB 2NO4A 3D0RA 5D01A 3A6EA 3FYUC 3WLKX 1RT9A 2E37A 2ZPUA 5KEIA 3HUUA 3X1KA 5B2ZA 4JNCA 3J80A 1V35A 2QPAA 1E3DA 3FKQA 2ATVA 4OB6A 3SS9X 3W8EA 4XYLA 1JAYA 2PKWA 1ZCBA 1JILA 3SHOA 1POWA 3GRRA 4LZOA 2Q6LA 2AFHB 2X6QA 5K99A 4WEQA 5CT9A 1H1DA 5EY5B 1DBQA 4W9MC 1GWNA 2Z2JA 1D6JA 2Z2XA 4CIYA 5B4TA 3B38A 4P4SA 3M9WA 4QUEA 1NQWA 4B7AA 4QOFA 4CMAA 1ZL2A 4D6XA 1N2IA 3ASZA 1XR3A 4LMPA 1G3RA 2UVDA 3T3MB 3HR8A 5ENDA 3IELA 3LGAA 4QIHA 1F0PA 1UINA 2B4TO 3FDIA 4HMPA 1SUSA 4ER7A 5JSQA 3EIHA 2DUMA 3AYXB 3C39A 3W2EA 2GKOA 5LC1A 3BTUA 2BHTA 1HL7A 2P4SA 2IA5A 1J2YA 1RLMA 1A04A 1A77A 3O5AA 1LI4A 2WIDA 1DFIA 1DS6A 1WRBA 2PTGA 3C14C 2E2WA 2XD4A 3H2KA 4RL4A 2XMSA 5IK2A 4B81A 1ZNYA 2PZKA 3H4MA 2RK3A 2GLXA 2NZXA 2ASEA 3NHWA 5K03A 1TEVA 5AJXA 4BECA 2IZOA 4P5PA 4KWCA 3UMRA 4Q9LA 3EXG1 3LT1A 4C0JA 3H1BA 1FJHA 4MH0R 1EFKA 2ZSDA 4GBGA 4BDTA 2FX3A 2R97A 2XUZA 4OQQA 3MUOA 4WNIA 1I7SB 2IODA 1ULHA 1BH2A 1GQFA 3CNQS 4I8IA 4JJFA 5IABA 5EHXA 1PZMA 2ZB8A 4H17A 2J9FB 4KXUA 5GP1A 2IYOA 2FSVA 2W2XA 2BM8A 5EMJA 1YZGA 1YZ3A 4IIUA 3V8PA 5E2IA 3GUVA 4RZXA 5LSAA 5AVOA 1L8LA 3RFUA 4FC7A 1IHPA 2R4TA 4HTFB 4OH7A 4GWLA 1HKUA 1SBIA 3R5FA 3L7CA 2J30A 5IFKA 2I6SA 2NTEA 1UKCA 5TIIA 2HMSA 1HPLA 2JLZA 1VRWA 1VJ5A 2ADOA 2PWZA 2VUIB 2QRQA 3A58B 2BT4A 1RBMA 1T5OA 3CN9A 3H1PA 2OCKA 3B51X 3Q3HA 4Z8YA 5FL7A 4YV1A 3ZJTA 3TLCA 2ZWMA 1DG3A 4UARA 3CLSC 2A30A 1K75A 1Y34E 2CB0A 3RVNA 2VTBA 4KAFA 1LLDA 5CT8A 1TZ2A 3RFXA 3LCRA 3ZQUA 4ZZ2A 2CE2X 4OLAA 3MGGA 3EMKA 3O82A 5H82A 3VVLA 3VYVA 3H9UA 1H9CA 3H8WA 2W2TA 4U2EA 2ID9A 1ZM7A 4ZQIA 1EXDA 5A5VA 1J5EB 3NAMA 4Q7LA 3BM5A 5K05A 2YCBA 3CIOA 3HBNA 1G3QA 3NHZA 5KJEA 1HNWB 3F3MA 5BOSA 4A6XA 4HAXA 2OO5C 3VV2A 4UQLA 4HNVA 5LLTA 1YR3A 2E4UA 1J0CA 2QVYX 2VWGA 3PYXA 4G1UC 5FOSA 4DHWA 1S1MA 3HA7A 3OY2A 1DWPA 3CR8A 4BU1A 2WJZB 1Y80A 3IVGA 4YGXB 1BEZA 2MSWA 1HF3A 2J45A 2J4FA 4J9VA 3SJAA 3KB2A 4EZBA 1JJ7A 1W1IA 3IJRA 4S1VA 1O94D 2ZIXB 3VHXA 4DLBA 3ZXYA 3DTVB 3QLVA 1FX0B 1I0IA 1Y48E 2CWWA 2PRZA 3WZ2A 2QZ9A 121PA 2PRSA 4QTTB 4S0ZA 1A7JA 4BOYA 2WV9A 4CEJA 4X84A 2R86A 3H5OA 2B92A 2XBUA 1Z29A 2XXAB 4D0SA 3I2HA 3OZ7A 2HH9A 4P82A 4EW1A 1XDWA 1LDGA 2BEJA 2WWIA 2WBLC 3M2PA 4HDNB 3WFIA 3BUSA 5JADA 5KNBA 2CXRA 5ALNA 1PGNA 1ZZEA 1ZPDA 1PS9A 1HWYA 2BFWA 4D41A 1XNRB 2O8FB 1WETA 1XRSB 3GF4A 4WJKB 1ZIXA 1ML4A 1MO3A 1QRAA 1RZRA 1NOJA 4EY7A 2X5JO 5CB6A 5AJYA 1FYDA 3F73A 2Q3DA 1ZVMA 2VRNA 2YJGA 3TB6A 3UJ7A 1U2ZA 5B7QA 4FUTA 4IDDA 3IA7A 2E87A 1YWGO 4NK5A 3BTSA 1Z6QA 1BS2A 2PXAA 2QHXA 5EMMA 5JVDB 1B41A 4CT0A 2H3HA 1A72A 1LV8A 1MB4A 2AW5A 2FHSA 3M8KA 4KQMA 4B3HA 3BK7A 3PUZA 4F12A 4IVQA 1EP2B 2JDID 2JHPA 4F97A 1TO1E 2ODPA 5D3QA 4WKBA 3F3KA 5KJ6A 4QVKA 5EKSA 4ER6A 4JEIA 2QN6A 2WABA 2YHSA 4X24A 1Z4PX 2JIBA 4MS1A 2HSGA 1CG6A 3RRFA 3GRVA 1SD5A 3LVRE 3C16C 1HT3A 2W2KA 3D7KA 4N7JA 4QU9A 1KRHA 3BZBA 2VP9A 2NVBA 1OFUA 3E1KA 3Q6IA 5I9BA 2OXIA 1UC5B 1USKA 3PQEA 4CMCA 1I2BA 4OOEA 2TMYA 2VJPA 1VKOA 4LQCA 2J3HA 4O4JA 5E4YA 5LA6B 2JAHA 3DOEA 2Y0BA 1JSRA 2Z04A 3IERA 3KLNA 4BNGA 2QRJA 3OF3A 1PT5A 2YN2A 1BSVA 4CR6A 5I9IA 3NNNA 1D0IA 4BNHA 3MGBA 1THMA 2J1LA 2AF3C 4A91A 2BGKA 2OC9A 4LNHA 5BMOA 3USCS 3IP8A 1L1EA 4M37A 2VP6A 3ZCSA 1XDUA 1NXSA 1RYEA 5AQEA 2V6MA 3HYTA 4JOQA 3U62A 2H5IA 3L8HA 1ULUA 3L3BA 2XW6A 4DB4A 2OMEA 2WILA 3IMKA 5B64A 2EERA 1W581 4P7KA 4CM9D 3WWOA 4WFJA 4U9HS 1W0JA 3ESCA 1OFVA 2C9ZA 3FSJX 3DZBA 2VP4A 4TOIA 3TVTA 1SHZA 1FLAA 3WY9A 3O8CA 1VHDA 2OGWA 3ICPA 4G0PA 1TQDA 2ZITA 1DARA 4MUIA 4DLKA 4FNMA 5FUQA 3DE4X 3DFFA 2W2LD 2OGUA 2YXNA 3FUCA 3PX7A 2XCIA 3LDGA 1FTWA 3BE6A 4I2VA 4BRSA 1SMKA 3O4GA 5A6SA 2WM9B 5F21A 5DNUA 4ZOCA 4MIKA 3K96A 2WYOA 4NAUA 1R0WA 4OQNA 1HT0A 1FQOA 2HJGA 5ALDA 3HJAA 3ZV4A 1IBMB 3QU5A 4EUSA 2J9ZB 1NVAA 1UPUA 3C6BA 4PX2A 4AF7A 1RWPA 4UZEA 4MB0A 4KBYA 2J87A 1SQ5A 4RZSA 5AHKA 1K8RA 2W4QA 1CX9B 3I64A 3LKBA 3EZFA 2V3VA 3SGLA 1QZXA 2WKWA 4FHGA 4CQMA 4D42A 2W6NA 3RTGA 4PF1A 1J8QA 1MH1A 2XGMA 2ZJ0A 2IXEA 3OE5A 1IH8A 2Z58A 2VDQB 1A97A 1DG1G 3IBCA 2DBZA 3O9VA 2VRCD 5BQXA 1J90A 3C6MA 1CUIA 1LI5A 1E4YA 2D1FA 1FMJA 5IVDA 4EL0A 1L9XA 1SVUA 5LUBA 5BN3B 1Y9ZA 1NVUQ 1EZZA 2X4LA 2QE7D 4PE5B 2WPNA 5LZ8A 4BO7A 2JIDA 4AF8A 2XBLA 4B5LA 4A0RA 1JDJA 4TS4A 2R85A 3MJFA 3RW9A 3DZIA 1XNQB 3HJFA 2JW5A 2NT3A 1Y1TA 1M8JA 3GX1A 5C4IA 2CNWD 2BKVA 4TYMA 2O6LA 3TVDA 2OXCA 4ZEVA 2QX6A 2GJ4A 3NWBA 4OXNA 4G0UA 5IDXA 5A02A 1PJLA 2VSYA 2BE9A 3C87A 1GFIA 3LD9A 2D5BA 4BGDA 2ZYHA 4FINA 4C43A 3CZ9A 5DK4A 3SLKA 1YQDA 1C0KA 2GNOA 3RAFC 3H1FA 1NONA 1X2BA 3ESDA 3GARA 4DJFC 3TW4A 4BHTA 2Q6TA 2OWEA 3H2IA 3BERA 4B84A 2MR6A 1FOEB 4YJ2A 3LT5A 3KRTA 2APJA 4PQEA 1VCOA 5GQSA 3DL2A 3JATA 1M8FA 1NJSA 3KKZA 4MR7A 3OJEA 1BU8A 2Y8EA 1NJ2A 3LCVB 4UNPA 4FBMA 2IPXA 5IVIA 3QYJA 5KNDA 4WBNA 1P6XA 1I4WA 4N5MA 4F3KA 2R1TA 1KI3A 3KHUA 5CX1B 5F51A 2GVZC 2PZBA 1XD8A 4MRMB 4DMCA 1P1IA 4E09A 4EPRA 821PA 2VHQA 3RC7A 1VE7A 1K27A 1E7WA 2VAWA 4A8JA 2DHEA 3NX4A 3FRJA 1ABFA 3PIIA 1WCIB 1MIOA 3E7PA 4YAGA 2A9JA 2QVCA 2YYAA 2VHVA 5H1YA 1BMDA 4FGUA 2R7AA 5JOQA 3SFTA 1I10A 1W93A 1R4ZA 3S2GA 3UWOA 3ZLUA 3AHGA 4X0EA 3LM8A 2AD1A 4J0HA 1A4XA 2WJ4A 2O7SA 1VKZA 1Z34A 2F8SA 2J08A 3O75A 4M9CA 1WXQA 2NACA 2O4UX 2QV0A 5JYBA 1GLGA 4GGMX 1UWKA 2J9GA 3UOWA 4DG5A 4UNSA 3IE2A 5CJ2A 5EZSA 3GVIA 4EB6A 1N6IA 4GKJB 4NWIA 1X7ZA 4JYMA 3K6JA 4A26A 1HDYA 2G9QA 1UFVA 1ZDMA 4XAQA 4DW8A 3L18A 3LZCA 1Z6AA 2PXHA 3SEAA 3L0CA 4RD1A 5AM3A 1RI2A 1E5DA 3A27A 2HPZA 3GA7A 2WM3A 3IE0A 3QHPA 1NW9B 1WTCA 1KQNA 2D5AA 4KV9A 1T8TA 1EXVA 2XWBF 1M72A 3WHPA 3B1FA 3A4LA 4J75A 4X41A 4TLBA 5E9AA 1PQWA 3GZJA 4MIOA 1SJ9A 2HAEA 1TF2A 4KMSA 3H3JA 1NG1A 3SMVA 3TAHA 1JFSA 1TUBB 2FG6C 3C7KA 1X7GA 2FSGA 2VHCA 4EGFA 3K0FB 4MUBA 3HU5A 3QF7A 3EFHA 4FFRA 2I7CA 1A2OA 1KVSA 1N5OX 2AUMA 2IU6A 2TSYB 1DAKA 1X1RA 2B61A 5CH5A 1SU8A 3V3TA 3PUHA 4DJDC 1CTQA 1EB8A 1SXGA 3D4BA 4HPWA 2CUKA 3QOXA 3QXGA 4LTNA 4OHCA 1R0CA 4Z4EA 1AUPA 1RWWA 3M0EA 4EJ6A 3ZGLA 2WZDA 3EZLA 2BDTA 1CQXA 2PBFA 2PPLA 3MCTA 4MVJA 3LX8A 2GCGA 4AXBA 1Z5GA 4TL6A 1Y6JA 4JLMA 5E3IA 4M1WA 1YGPA 5I5GA 3KQKA 5E7JA 3EIUA 1TJ4A 3IPLA 4QLBA 4ZMRA 4ZOBA 3TJMA 2D7CA 5L8VA 2KBEA 4RV9A 5JYCA 3QFFA 4JSYA 2RG7A 3GEIA 2I6FA 5IDVA 4E2YA 2UVPA 2RAPA 1SBQA 2GM4A 2BH2A 3G13A 2VPTA 1XCOA 4TT3A 4BL5A 1X1DA 2Y2UA 1U98A 2QYOA 5FO0A 1RPNA 3V33A 3KBBA 1E3EA 4J2HA 5C3MA 7ABPA 2ZULA 4IV5A 1L3BA 4E88A 4U6SA 5KWSA 2B69A 3B13B 4H15A 1Z2OX 3V7FA 2I4NA 1TA9A 3HEMA 4CKEA 3MLBA 4PSKA 1Q1ZA 1XKXA 4D44A 4ER5A 4DC1A 4EUFA 5C18A 3HKEB 3HDGA 3HJNA 2V5VA 1Q7BA 1JG1A 1Z0DA 3O4IA 4OUDB 2BJHA 3ILVA 2DERA 5U4XA 4RIIA 5EUQB 4ZI7B 5K0GA 3BJMA 1DE0A 2BMJA 4US1R 2X2FA 4R81A 3V8VA 1LPBB 3JPYA 3Q2KA 2BJVA 2J5QA 1N75A 5EI5A 3B1WA 1W73A 3ZY3A 4PGHA 4I8XA 1C81A 4NICA 5LP6A 1UC8A 5KYXB 1QKIA 3DBHA 3NJRA 2XKKA 4FT2A 1EFTA 7MHTA 1KYTA 1OXXK 1NN0A 4QWWA 3PNQA 5D5QA 4ZO9A 4HGOA 4C0AC 2PX2A 4MVJH 2HMVA 3UPUA 1AKUA 1XZFA 1Z0IA 1K86A 3IBYA 1P3Y1 1X87A 3F90A 1MF7A 2CJXA 1JH8A 1V26A 3GLFE 2FUEA 1FTSA 1RLUA 3KAQA 4MUGA 5FFMA 1WUJS 4AKHA 4JEUA 3CMCO 1M1NB 4ZHQB 2UZ0A 1NPTO 5HUQA 1P2GA 1DCKA 2JLCA 2YCLA 3AU9A 3H9BA 4I2NA 3O0DA 3SK0A 3U5TA 4NCIA 3EQ9A 2X86A 1YDFA 3DD1A 1OIXA 2I1QA 4JGGA 5EYPB 1QOZA 2B37A 4F5EA 2QTGA 2ODTX 3TRJA 4FTWA 1MG5A 3KB8A 3S8YA 3N2KB 4MQLA 3LWNA 3PXEA 4H6WA 3KU4A 2J41A 1RAAA 2IP1A 2VLIA 3K5IA 1O96A 2DC1A 2XTAA 5C51B 1IHDA 2GN6A 3EGWA 1HDXA 1G1AA 3K9WA 2CMGA 2O0JA 2RGNA 2RARA 3W1VA 1DCMA 1WXXA 3ZW7A 3TKLA 4BC0A 1K8QA 3JYPA 2UYCA 2D2IA 2NSDA 3STWA 4DE5A 4KJZA 3FPAA 2AN5A 3QKUA 5KKCA 3FPHA 4G0NA 4KLZA 5FLEX 2HT1A 1PWXA 1J9EA 2D4HA 1H0RA 1PZNA 1T6ZA 5JNRA 3L7LA 4G8DA 3WTBA 5I7OA 3N5CA 4C01A 1TF5A 3RAJA 3REQB 1T1JA 1E8MA 4OMDA 1F9AA 1FRZA 3PWSA 1O94C 2P2GA 1QE5A 4Y6OA 5FBKA 4GKVA 4V2IA 2GBLC 5FFFA 4XYBA 4L78A 5FORA 1DRUA 4PSAA 1OROA 5ERGB 3I2YX 2R3SA 2C3OA 3DLPX 3EGVA 1OYOA 5G0VA 4YS6A 4WFKA 4W8GA 1RCUA 3JVEA 1FTGA 5TY0A 4QNNA 5JECA 1HT1E 3U3RA 5JPDA 3MJ4A 4CKWB 3R9KA 5E7QA 3IX7A 5JMOA 3VO8A 2IOQA 3T7TA 2W83A 4KN8A 3NB0A 1Z5VA 3DMHA 4S1PA 4LQDA 4MP6A 4MW4A 3ZG6A 2CC2A 3GLQA 1V47A 3LT2A 3A9SA 4S1NA 3VV3A 1TVEA 4TTRA 1WXEA 3KDAA 2UZ1B 3K0CC 1N6RA 2DRIA 1YQWA 1YQTA 3ELUA 4X9XA 1B2LA 4XIJA 5CLQA 1V1RA 4QA9A 1JLSA 4YAEA 2VDOB 3TR6A 3KSAC 2R47A 1MJHA 1TVKB 2PT9A 3SYNA 3EGOA 1Z37A 3GLKA 2ZQZA 5DIFA 5J9FA 5HM8A 2DHDA 2WHQA 1L6IA 3J7TA 3MJTA 4X6YA 4BTVA 3BEDA 1OGIA 2H9IA 3KAJA 3VJLA 3DEHA 3A10A 1C29B 2RD2A 2YYSA 3V1KA 1T1SA 1IQRA 1RYFA 4F5ZA 4HEA6 2WJGA 2DM6A 4CL2A 1RAIA 3T5BA 2Z1MA 3DJYA 4ED9A 3DA8A 2AJTA 4GC9A 2YINC 4B6SA 3ACBA 1YE8A 4MJLA 2F67A 1OTYA 2EU8A 2A9QA 1YDWA 2R1UA 3OIVA 1GG5A 3GFSA 3IOCA 4NS4A 2IXFA 4NMMA 5JJBA 4HGZA 2G72A 2H2HA 3KOYA 3KUUA 5DBOA 5IBRA 1AF7A 1D2RA 2E6UX 4J0CA 3GEHA 2OZVA 3ITEA 4RV4A 4KL8S 4C6HA 1RC8A 1J25A 1JIIA 3ITDA 4A3SA 3M9XA 4XGNA 1RYHA 3IAFA 3N2YA 3NDJA 3G0GA 4RFSB 1L5MA 3RHFA 4E94A 3MS4A 2C29D 4Q82A 2PGOA 3A0UA 4WNAA 3OMWA 1W36B 1RS0A 2Y0PA 1DAIA 4OHKA 5EOVA 2AI1A 1E9VA 1LJUA 1Q44A 1BOFA 1OU4A 2DSTA 1LRJA 4M54A 5IUKC 4YTEA 4C4YA 5JC8A 3VKGA 1RRFA 4QTZA 1DBSA 1H4TA 3LY7A 1DC7A 3OF2A 5KWJA 5IYZB 2EFYA 1PYOA 2HCRA 1HNXB 2JRCA 4TTIA 3OOSA 4CDNA 1QQ7A 2UZ3A 1ZGJA 3NIWA 3QJ5A 1VA5A 2ZIUB 3D7RA 4OYHA 4QFCA 3DQQA 3W5VA 2GN9A 4M38A 1GLVA 2OV8A 1O96B 4PM4A 4MCJA 3OF5A 1BW9A 3K1AA 1OWNA 4YJHA 3NXKA 4WZBA 1KWGA 3GRCA 1WUIS 1SIUA 4HXYA 2M6RA 2YUTA 5H16A 4B8ZA 4N3BA 3WDSA 1JA9A 2X8LA 3H2GA 4NATA 4COKA 4CLEA 4Z9FA 5HS4A 2I4LA 4M1YA 1C7RA 4NOLA 3L4JA 4AF6A 1CUXA 3HY3A 4WN9A 2Q9UA 1SC3A 3T4PA 1T1GA 2BFMA 1S1CA 1IBLB 2UUBB 16PKA 4LC9A 1KAHA 1OH6A 3UCEA 3L5KA 3C5CA 5IKMA 4D9FA 1E7RA 1U8EA 4PWYA 3O3NB 4RVCA 1ZO8A 2NMVA 2X4GA 1SBYA 3ZIUA 1C9MA 1QAMA 4X7BA 4ZQEA 4R3WA 3BGWA 1ZD3A 5T6BA 3CO5A 4EG8A 1XPRA 4W9NC 3D6MA 3A1EA 1K7YA 3FCYA 4JAVC 2QUAA 3ZHCA 2OFOA 5G2OA 3BCUA 3GPIA 1XMXA 3PFGA 3TTXA 1J33A 3TECE 4L6AA 4Q9JA 5KTNA 3L79A 3JWPA 3DBLB 4CMKA 1MJGA 4B6JA 4Q9HA 1XEWY 5J47A 2KQUA 5KHAA 1G3MA 3D2LA 3K2EA 4GT1A 2FN3A 2OYCA 3VNRA 3D3WB 2HLDD 3PFWO 1NUUA 2I54A 5AUOB 5FTWA 3BZWA 2BAGA 3CU5A 4KE6A 4JX9A 4C21A 1TM5E 4G89A 4LJRA 1CZUA 1LFAA 3MT7A 4LJAA 5DW0A 2ZT7A 3HWWA 2VG8A 2AMLA 1U7OA 2X0FA 5I4BA 3PGVA 4BV8A 4EM6A 2RGWA 3CG4A 3BXPA 3VQTA 3FWYA 3KKMA 4PC6A 5FRDA 2PUCA 5FT9A 3K35A 2FPPA 2I2WA 3KT3A 1E2FA 2PM8A 2YVAA 3F74A 3ZGXA 1T5SA 3FAZA 1JG7A 4WUTA 2FMTA 4N3NA 4MYHA 3MF4A 4QQ8A 3WQHA 1EYZA 4MUFA 1V16A 2ASVA 4W1SA 3WWYA 4BGUA 3BD7A 4F7DA 4A15A 1SOWA 2DF8A 1ISIA 1F0YA 4KAAA 1ORIA 4C9BA 3VR6H 4IOMA 3SC2B 2C4VA 1YJ5A 3DZGA 2QTTA 2ID7A 3BWBA 3ZZMA 3EQZA 3W9YA 1A9XB 4Q1VA 1GCIA 3PDHA 3E70C 5IJ0B 1OAAA 4M53A 5HKOA 4Z51A 5IHPA 3O2SB 4I1IA 1SBNE 1WVGA 2W6ID 1D4FA 2VNJA 2WAAA 3OE7A 4DADA 3H5VA 2EKDA 5ALVA 1LDBA 3GJ6A 4AQYB 4BFSA 1OGYA 2GRJA 3NBAA 5I4KA 1QVZA 4NRDA 2EJBA 3MQ4A 3DH0A 5AI5A 1JHPA 1FP7A 3WZLA 2GD1O 3VX3A 2QLTA 4K6GA 3E22A 3G0BA 4C5CA 4P0PB 3LIPA 1L5VA 1QF6A 1K0UA 4MW9A 1RHJA 1J70A 4QG3A 1L7PA 3RVKA 4JVMA 5JASA 3NHRA 1H2RS 3L1UA 3D1JA 5AESA 2RH8A 3PC6A 4ZARA 4HJRA 2K7FA 5F12A 4OI1A 3R6GA 2ZE7A 3EYAA 1CUAA 1JV2B 2PLAA 1O95A 5YASA 2Y1GA 1LI7A 4E31A 4UCFA 1BIFA 3VKFA 4B4OA 2J0QA 1OASA 1L7BA 4LOAA 1T2NA 3TZEA 5TQ2A 3LW8A 3SDZA 1YRAA 2E89A 1G21A 4IDFA 1Y6RA 2C2GA 5BW8A 2GDJA 3WGYA 1IZ0A 2VS1A 2D0DA 3IA2A 4GS5A 2WD9A 5IBQA 1JKXA 1G8GA 1IIRA 3RVBA 3ZXXA 2P9EA 2FEPA 1U9IA 2WTXA 1FS6A 3D7NA 3N07A 5DYNA 3DTYA 4IBOA 4HTAA 4PLZA 4TTQA 5KVCA 4ZQGA 3O26A 2BP7A 3INTA 4FBGA 3VNAA 5FUXA 5CBPB 1XQWA 1USWA 1SXJA 2CZGA 2HJ9A 1RYNA 3DV0A 5IJXA 4X66B 1HEIA 1CP2A 1V5GA 5CYGA 2HSJA 1BN7A 4XQCA 2D7JA 3IP7A 4KYVA 1P2FA 2GPAA 2NTNA 1GQ2A 3P9XA 2CF6A 3ETNA 4HRXA 4QXOA 5KS2A 4RUKA 1M2VB 2JGIA 2BHSA 2WDZA 2GVDC 3OJ0A 4PNEA 3LFTA 2WTMA 3LXXA 1KU0A 3QI7A 2O2EA 1LPSA 1UDCA 3BWCA 5E0KB 1RHQA 1NBEA 4UXJA 3ILXA 5K45A 3JW8A 2XUQA 3ICOA 3UTCA 1NVEA 3K15A 1ZIYA 1H3EA 3N53A 2CBXA 1PJSA 2QVZX 3RTBA 3DF9A 4JP1A 1EXNA 4HZUA 2ZBDA 1T0PA 1DJNA 1RQGA 2JARA 3QW2A 2X5OA 4YNBA 1EAYA 5JDCA 3ECCA 3RI3A 4ALMA 1KO1A 5JANA 1NQTA 3EA4A 2ZSHA 1PD0A 4U6NA 4R2JA 4F8YA 2ZUTA 3NOXA 4KCGA 1HFJA 3BD9A 3LG2A 1N2SA 3HB7A 1KJNA 2P6PA 4B44A 4DCMA 1X9HA 4ZT5A 2FZEA 3GEDA 4RAQA 1S5PA 4B4DA 1RJGA 4QYSA 2WZQA 3TG2A 4B3RB 4C7OB 1QWOA 1KGDA 3PUIA 4OBXA 3LY9A 1L5RA 4IHJF 3VNVA 3PSAA 1V6CA 3KC2A 5CDSA 2ZIVB 1ZVVA 3LUHA 3P0RA 3LDAA 3QENA 3X1WA 2GCEA 3UOAB 2AE1A 2G0AA 1B8VA 1MD9A 4YPVA 5ICEA 3K0CA 5JWHA 5A6SB 3AHHA 1UQUA 2PCJA 5CGQB 4IEFB 2HO5A 4K9NA 3ONEA 1QU2A 4TSFA 5AJWA 3V1MA 1QGUB 4KXMA 2IX3A 1L7DA 1XROA 2ESRA 2GZRA 4KPUA 2HU7A 3M6FA 2JFVA 3A9VA 3PE4A 4KQFA 1JEEA 2XOEA 3D8RA 4ENVA 4WHMA 2J48A 5A7GA 4D9NA 3T52A 5BN5A 1GPAA 4BE9A 3QEBZ 1PNRA 3UHFA 1GZHB 1YHNA 2JD0A 3GH1A 2PGNA 4LYHA 3TMAA 2NSHA 1OI7A 2QJTA 4D9CA 3HB4X 3F9CA 1ECPA 3IMEA 4JYCA 3ZZUA 4YVFA 3UMYA 1XJ0A 3RADC 1NV8A 3R77A 4EJMA 3OZUA 3GLVA 1V4BA 3IDSA 2VZ9A 3OP1A 2PRYA 2EF1A 1WUTA 1W5TA 2ODAA 4S35A 4WAUA 2IQIA 1ZQ1A 3FA2A 2P2YA 4Y9TA 2KLBA 3QEMA 3WS7A 3PRHA 1IOLA 2VHWA 3L41A 1VHLA 2XIQA 2IPAB 4YBRA 3V9PA 2IH5A 2DFDA 2W11A 2V7QD 1SQ6A 4RFVA 1ZLYA 4J4BA 3TNJA 2F43A 4G8JA 5LA6A 5COQA 2WQZA 3M1AA 4MXDA 2HTEA 1ZUD1 5LB4A 1QE0A 5MHTA 1A9QA 1RRVA 3OIFA 2JLSA 3AIOA 3M5DA 3JYHA 5LZ2A 3E9DA 3P0JA 1JLKA 5FBVB 1QJCA 1VG8A 4YJHB 3UJCA 3GEBA 4CKXA 1DU4A 2QG6A 3RSHA 2HQBA 4F3NA 3P2JA 5IZCA 3O8NA 4LBZA 4HC4A 4NPCA 3D2AA 3L0IB 2PN1A 1QH1A 4UUNA 5AT1A 4BVGA 1PWYE 3B20A 3PNLA 4DJJA 4DLXA 1ISGA 2XSZA 5LYJA 1GG8A 3BSFA 1J09A 2HA5A 1FMFA 2W90A 3KSUA 1MEOA 2PQ6A 1VXOA 4ZYZA 2JCGA 2UYHA 3IR5A 1KOJA 3HFRA 1GTG1 3F6BX 1Y6FA 1W52X 1CZOA 2BM0A 3TXAA 1E2NA 1HTTA 1UXOA 2XCQA 3ECAA 3FHLA 4KR3A 2R8RA 1GPLA 4B46A 1KY5A 2UDPA 1NYQA 4C0KA 4E1AA 1E2HA 3GEMA 3V2UA 2VUSA 4J0EA 2FB9A 3WA7A 4OGLA 1CHDA 1RPTA 1JE1A 2R8ZA 4EMTA 4URVR 4ZAGA 2AGVA 2CDBA 2PSJA 4PZ0A 5EVJA 2F55A 3W78A 3SVLA 3KB6A 3PIDA 3QPWA 1CV2A 3KM0A 3RAEC 1HDOA 1ZFNA 3EEFA 4TXMA 3RKUA 3PXAA 3RJZA 4O1HA 1AZLA 4YPFA 2V3WA 1QHIA 3H2JA 2EG5A 1RLJA 2NUPA 3I5XA 4E03A 1Z33A 3ZK8A 1GQYA 1CZLA 1RBZA 1B74A 3OPMA 4PNPA 4O63O 3R0ZA 4M3NA 3DHNA 3MGAA 2ZXFA 1M7GA 2XUFA 3PNBA 4U0JA 4AN0A 3W5DA 1BHQ1 3D4OA 1NDQA 1RWOA 4U7FA 5M29A 4CLXA 2Y67A 4ECAA 3PLNA 3PF8A 3FBWA 3LNCA 1OFGA 2HBRA 4Y2PA 4CKBB 3JQEA 1E7YA 1VG0B 1ZKDA 1KXJA 3EH2A 3FZNA 4WFIA 2X0DA 3ZN2A 1ZOIA 3HC7A 1W5EA 2EFJA 2P9HA 3I4LA 3ND6A 1PT7A 3PPWA 4IICA 3WLFA 2B4RO 1TADA 3CUKA 4DCJA 2ZJFA 1F2TB 3COSA 3SKYA 1Z68A 5FBRB 3JQQA 2FFAA 4WN3A 4I6JA 3OZDA 5GJCA 4YA6A 3KR2A 2IITA 4QNRA 5CURA 3FGZA 2R5NA 5FULA 4BO8A 4V3CA 2G6TA 3RU7A 3ZXSA 3PCTA 1JMVA 2OCGA 3DWFA 1DZ3A 4EKGA 9ABPA 1E98A 3E23A 1TIPA 2P9GA 4DWVA 1Z13A 1XC7A 2DT8A 2Y1EA 3CZQA 4J0JA 4R98A 2Z83A 2C2MA 3G59A 4M7PA 2GAFA 4N0QA 4QDOA 1W36C 4ND5A 5KYTA 3WL8A 4Q4AB 5EKDA 3GI1A 1M0WA 3V4FA 4D4KA 4XFKA 2YW2A 1FP4B 3EIQA 2PKQO 3PPXA 4FILA 4F56A 5AW8A 4Y9SA 3N5KA 3RRMA 1KPIA 2BMDA 4U7PB 3FPCA 3TH5A 1WKCA 2IYNA 4YQEA 5AK5A 5E1BA 3DMYA 3N8IA 2C58A 4K1XA 1GNRA 5EZ5A 3NHYA 4QOJA 1ENOA 1OR8A 2E3JA 2DMRA 2QGNA 5GTDA 1KO7A 4AXXA 2G9ZA 2EJWA 1HETA 1UBOS 2JDIA 2P4HX 1GZDA 2IFTA 3IQEA 4BMVA 5KU1A 1OPRA 3N2LA 3ZXIA 3BRWA 3HKBB 4I1PA 4YWHA 4GZ3A 1L3IA 3IUJA 3T1NA 5CLGA 4M7RA 4Z9AA 2DAPA 2PMBA 4RXTA 4XGIA 4BAZA 1XQYA 3AW9A 1T29A 2VA8A 2FPPB 3F5SA 3H1TA 4YRSA 2OBLA 1G7RA 1JL3A 1NXOA 1NQXA 3AKEA 1J24A 4MQ6A 3U3MA 4OIMA 3QMWA 3ZCQA 1SO8A 2IZ1A 2DU8A 5JD4A 1RP1A 3IO5A 3LA6A 3UFBA 3V1TC 4CU2A 1P1BA 4QARA 4IDBA 4KEAA 5EEHA 2VDNB 4AO6A 2PUJA 5LMCA 5AOCA 1NW6A 4JXZA 3M6WA 1AXEA 4KDFA 3RYIB 1JALA 1XG5A 4L3VA 2BUAA 3AFGA 5KDOA 1TAGA 1QANA 2XMGA 1TT5A 1GYQA 3K16A 2PLWA 3FPFA 3A04A 2WY2D 1RXWA 2UXBB 3TZQA 1S2LA 4W9RA 1XJ5A 4TLLB 4NNJA 4Z6KA 1K66A 3KT6A 1ZINA 3EUWA 4IJWA 1VRVA 3G2MA 3KUXA 5ITZA 5T64A 3NTRA 5GM2A 1MC4A 4G4SP 1OI4A 3DBOB 4MYTA 2WD8A 3IVCA 4HDMA 1KBZA 1V39A 2GSWA 2XY4A 3ESBA 5KYYA 3ANXA 3N2ZB 2IUUA 4B6QA 3LTNC 3RYIA 2BDUA 1Z8DA 3H11A 1HE3A 3LRTA 1C3OB 3FDJA 1CDEA 3UMBA 1JWBB 1LJLA 1HUQA 1TI7A 2A5FA 2EWVA 2HO4A 1NZJA 2O2ZA 3GEGA 3KVYA 4M89A 4KTTE 1OJLA 3ZZNA 5BPFA 2DWPA 4IH1A 4UEQA 5AWFC 1FSZA 1Q0HA 4BYMA 3ORHA 5DPMA 3KZNA 1FS4A 3K6RA 5EZQA 3WADA 2Y6UA 1T8SA 1UEJA 1UT5A 2OKGA 3AUFA 4L73A 5IRCD 4G97A 4ATNA 4C07A 2MT9A 1L4MA 3W77A 1I2MA 1M2HA 4R4JA 4OY3A 3HJUA 3FTDA 4KO1S 2RGDA 1NVXQ 2SCUB 2OV3A 4KK4A 4FFWA 2J85A 2PKQP 3A0RB 2IK8A 2J67A 2XF2A 3CKLA 4IXDA 1NULA 3WFJA 4N76A 4DR6B 4NEHB 3FOCA 4DM3A 5A1TA 3W5AA 2HF9A 4DR5B 1O0BA 3KQYA 3R7SA 3MWKA 3VSDA 2ATIA 3SSNA 4INPA 3E9QA 3SXJA 2XODA 3NS7A 2DBQA 1H0SA 2FUNB 1QYDA 3FW1A 3TSWA 5H3CA 3S8MA 4DWWA 4EB3A 1TW3A 3ER9A 1P9OA 2PE5A 1TM4E 2H3EA 1JR6A 3D0KA 1R6AA 2XRZA 4FYIA 1PP4A 4ZXFA 4US2R 1TU4A 1PUJA 1G98A 2BFAA 4JJKA 3HJGA 1Q3HA 1FUIA 4FB5A 3E8SA 1OWLA 2FLVA 4UBKA 1EDOA 1C14A 2ONYA 2Y71A 2GGSA 2XNKA 2DHRA 1VM6A 1HLPA 1LXCA 3PENA 4FW8A 2YXPX 1QV6A 4FMBB 4DNOA 4KQHA 4TQUS 1ZICA 1SUAA 5DI3B 1PJRA 2OUKA 1HEUA 3AEUA 1O54A 3I61A 1GPUA 2GFIA 1YCGA 3BTOA 2PGIA 4JITA 1T2EA 1G7SA 3SG0A 2AK2A 4MPTA 2QV7A 1U8FO 2JJ2A 5M34A 1FUYB 3VTFA 2UXDB 3QVGA 2POQX 1Y7LA 4IHJB 4RTJA 1D2GA 1MRNA 3KSZO 3HB0A 1GEEA 1VHTA 4R1NA 5AJZA 4M9ZA 1OWOA 4RQUA 5ALGA 5FBWB 5BURA 3E35A 3VISA 3GLIA 3IVRA 2CVOA 1PR2A 5B3LA 1OXUA 3FN4A 1S4MA 2NP6A 8LDHA 4BQFA 3NI2A 3EFBA 5DTMA 2E49A 2CD9A 3G1UA 4EGQA 1RSZA 1H69A 1HLGA 2EDCA 2Q21A 3H17A 1O57A 1PL7A 4HLQB 4QJ4A 1P1RA 3LOUA 5CLHA 2WA2A 3EQ8A 4BC1A 3D3JA 2HPHA 1AKYA 3HY6A 4WXHA 3JQ9A 3W3ZB 1JVNA 3DOHA 1Z7BA 1H4QA 1EK0A 2H1WA 5CBKA 1Y3HA 2A9RA 2VTKA 5EN4A 3KPUA 1AMNA 2HK6A 4IDPA 2G07A 4L8WB 2D2VA 4HNAA 1D0SA 4F2HA 4PVDA 2J3LA 1C1HA 4AICA 3EZXA 3HPQA 4YJ3B 3AI2A 1UBHS 1U80A 1E9DA 1W87A 4TXHA 3Q98A 4RYDA 5AXBA 4I5EA 1E3LA 5C8XA 1BMFD 1N5KA 2GEBA 5L3QB 4AJ4A 4X00A 3H9JA 4FDMA 5A4IS 3UWSA 2XI4A 1XTUA 2WD7A 4WADA 1LWOA 1MR3F 1N2JA 1OIWA 2Q0XA 2XVXA 4ND2A 2EQBA 1JYFA 3T38A 4TZ0A 3NAGA 5KTTA 1U0HC 2HNBA 3LWBA 1J8YF 3MM4A 3PSHA 2LCQA 1QCZA 1UDWA 3EGXB 3FCEA 4MS4A 5IN5A 4FEEA 4PHCA 3S68A 4C29A 2O23A 3OQJA 1WXHA 4I0WB 3AONB 2FV8A 2FFBA 4FFOA 2XUAA 3H2SA 4TYQA 1FCJA 2Z5FA 4K9MA 2D0PB 2Q62A 1O4WA 1ODJA 4FIZA 4QXQA 3TNYA 4EELA 5I4IA 2Z30A 3STUA 4ZQHA 3UMJA 1QHFA 3HJCA 3CF0A 3O1LA 4PIMA 1NBWB 4RS3A 2QBYB 2P5UA 2PU5A 4JCOA 3I2KA 4A7PA 3HMKA 3ICWA 1KH2A 2F64A 1M10A 1W6UA 2RI1A 2QLBA 1DEOA 3BIOA 3N2GB 4JQZA 4DMRA 4QU8A 1EX7A 2HBQA 2Z4TA 3SD7A 4YUYA 2OCDA 2HUNA 4LF9B 1DPFA 2NXWA 2PH1A 1LLFA 1AKRA 1O3YA 3K2BA 2OAP1 1DEHA 4IZHA 1J5XA 5TB5A 1P7VA 2NUTA 1LCIA 2CJWA 3QHAA 3RC1A 5I3ZA 4P08A 5LNK1 3TOCA 4TS3A 1Q92A 5MN6A 1KI7A 2CLKB 4WESA 2PCLA 2ADMA 5H59A 2CLHB 3G79A 3LVQE 3VOAA 1AK2A 4BYGA 4Y1FA 3I9NA 5GAJA 1BQEA 2NTYC 1TW2A 3TMKA 4RKRA 4D46A 4TWJA 4PYMA 2J7PD 2M6LA 1TU0A 5KNCH 1M2FA 3IH5A 1WMBA 3PQ8A 3G1TA 4M8NE 2BKEA 3BJZA 3QLVC 2VUHB 2YRWA 4BZXA 1LK0A 5K3FA 5JYDA 1OPXA 2AT1A 1AK9A 1BXGA 1YQQA 3B6MA 4TVKA 4W99A 3TFQA 4QTYA 4XCXA 4AM8A 1O5TA 3QXJA 2BRUA 1CY4A 5FBQB 1UBSB 1U8TA 4UCQA 2BZGA 2EJCA 4OHXA 2QN3A 1QS0B 3WGNA 5C1DA 4NJMB 3EMBA 4XQGA 3WK5A 5LUAA 4US0R 3ZI4A 5KSWB 2QN9A 2W6CX 3VR3A 2XNHA 2XUDA 3DCNA 1GT6A 3NYQA 4J7XA 4QXRA 4YLYA 2B4KA 2FR1A 3AYZB 5EXXA 2FWRA 3FWNA 2VYNA 4KLCA 2QVLA 4D5EA 2CCGA 5F5NA 4J7CA 1NT4A 1Q0QA 1AG9A 2UXCB 1KFEB 4FX5A 1YB2A 2WT8A 3MOSA 5LZ7A 2PJRA 4NF2A 3OM0A 1MQSA 3LUCA 4BEBA 1ZRMA 4ETWA 4DPLA 2IH4A 4E3ZA 2ACEA 3D31A 2VZ0A 1C7ZA 3E2MA 1XVUA 3I9MA 1NF3A 4X85A 3AI3A 4X8MA 1NUTA 2IQ5A 5AK0A 4MRRA 1A50B 4C08A 4A0QA 3ES9A 3INRA 2I65A 3KQUA 4G01B 2BVNA 3R0IA 2PBLA 3QMPA 1WMDA 5F23A 3PNPA 1RJFA 1Z2PX 1XOIA 3DT6A 3OG9A 5EMHA 3LUKA 3WO1A 3VJKA 4B85A 4YRKA 3P4UA 3T1HB 4TYNA 4ZEOA 4KXVA 4YB8A 2BFPA 5BSMA 1JQBA 2D1SA 5GZ1A 2PWAA 3EAQA 3GG9A 4PYIA 4UNRA 5CDHA 4XOUA 3T1VA 3SE0A 4K8RB 3NKFA 3OC0A 1UR5A 4MV4A 4Y2RA 1UT8A 2OCPA 2PH7A 2Z8YA 3KJFA 1HFKA 3KU1A 4JWKA 4BO4A 1P7ZA 4JUAA 5MF6A 3WJ1A 2JLXA 4HY3A 4DDKA 3PHIA 3AUTA 1V1MB 3E9YA 3CLHA 2PKEA 4AO7A 5C5CA 2D7DA 1VG1A 1C3JA 4UMVA 1N33B 3FGNA 3RUDA 3D0OA 1G8YA 1QFMA 1RM5A 4RD0A 1P0CA 5G1PA 4LWQA 1UKBA 4GRIA 4MLZA 4Q01A 2JPDA 1W4BA 2QLNA 3C8DA 4EFMA 4MUYA 3A2MA 5AI6A 1IN4A 2PBZA 2PGXA 4IX1A 1TB4A 1YIOA 3TSAA 1PEAA 1EK2A 3PR3A 1A69A 1C8KA 4LJLA 2O2HA 5ADUS 2QD5A 3ORFA 1W4LA 1GNQA 2F1JA 4JI4B 1S2IA 4GE0A 1NW5A 1N1DA 4ZMBA 3VBEA 4DSOA 3U39A 1M2EA 1P17A 1A9OA 1SKYB 5FEMA 2NVUB 4PAWA 3SNKA 3NDPA 3JATB 1WBBA 1Z0AA 4E2ZA 2Q29A 4IVRA 4EF6A 5CCDA 1K2VN 4OA5A 1FSFA 4FN4A 3NAZA 5LQCA 4KXQA 4Y2UA 5IXYA 4HDNA 2F1RA 1ECFA 1STOA 1KSGA 2IXGA 3VYWA 5EL0A 1CIJA 2CYBA 3ESQA 3PVZA 4JB2A 2CY0A 3AY7A 1Z73A 1W59A 7GPBA 1QGZA 3M6MD 4A0FA 2CNKA 1SR8A 4O8ZA 2PUEA 4N12A 4G67A 3O38A 3ZKWA 3ZS9A 2WM8A 5DGXA 5LDDC 1Y1RA 1W2HA 4IUDS 1GOTA 1SCUB 2GJSA 1T36A 1J8VA 3L6BA 2EHDA 3R8FA 3FLMA 2GBIA 4P4NA 4ASUD 3F9IA 2FK8A 2QZPA 5ANRB 1XZ8A 3GLIE 3BE4A 2QRGA 4MQEA 3R7AA 4PICA 3QWIA 4C2BA 2C9YA 4V1CB 2ST1A 4LXYA 1A9YA 4E46A 3E2PA 2YYZA 1UUFA 4PONA 4W1RA 4G1BA 5E1OA 3HE3A 3NH6A 3UAYA 2IIBA 3UAOA 5U9CA 2FQ1A 4HVCA 1WDTA 3BWYA 1M2OB 2FA9A 4K46A 3TTVA 1A9XA 1A96A 2NVOA 1Y3BE 3EG9A 4I5DA 4QAJA 2Q5CA 1V1JA 4TLMB 3RFVA 2IKSA 1HK7A 1VSBA 4MYCA 1GPDG 3GOQA 4UVDA 4ARIA 1F0NA 4IS3A 4B43A 1X7XB 1XMSA 1QYCA 2GJ9A 2HJVA 4RL6A 5ISMA 1UDXA 1E9AA 1YB5A 4PCVA 3I01M 4QGSA 3D6NB 4JI1B 1GTL1 1OLOA 1VECA 2A1TR 3AR5A 4F2PA 1G8FA 1XLTC 3BHNA 2PFGA 3VVMA 5A9SA 4ZN6A 2C54A 1PD1A 4IXNA 4CDGA 3OMLA 2A5GA 2ZRMA 4L22A 4YN3A 2X77A 1S0UA 2Q5LA 5AI4A 1P6UA 1G2QA 2CLCX 3IAXA 4GLJA 4O2BB 4ND6A 4PWZA 1RJ9A 4QRDA 5AVQA 3ZQ4A 4U2KA 4ZKEA 1QS0A 4PFJA 4V1CI 4K1LA 3P52A 2JJ8A 4UBMA 5CA0B 1E1QA 3K9HA 2UVQA 4ND8B 3HYLA 5F1KA 3WHLA 1EX1A 1VPEA 5CFQA 4L8GA 4D81A 5LMUB 3MCVA 1AXGA 5HKLA 4EYSA 4V2UA 3CUTA 3FNBA 5F33A 1G8MA 4CLOA 3SYLA 3NVAA 4RTPA 3HY4A 2WP0A 5EJFA 1PVVA 4UEWA 1ILEA 1V9CA 1EFRD 1R0YA 5ILOA 4DV7B 2I29A 3ZWAA 3TGPA 2YJNA 3QKSB 4D9KA 3GPDG 4Y1RA 3TB4A 3ZUGA 1Z5OA 1J0AA 1WCV1 2BHNA 1KI1A 2XE6A 2V6BA 1ZIPA 2HRRA 3C48A 4PQFA 3MBIA 5HM6A 3R0JA 3RTDA 1VL0A 1G8HA 1ATZA 1OSNA 1WXGA 4GOXA 3HRHA 4L7VA 3HNRA 4NZYA 4R8MA 5A5GA 1GDTA 2FPKA 3RANA 3TNLA 3O31A 5CD1A 2ZXEA 3KJXA 4KSCA 1RYMA 2FMHA 3EVBA 4M88A 1YOVA 5K0SA 1H5NA 5JD6A 1T1RA 1VMIA 2J33A 2HQ1A 3A2LA 2CXXA 5INTA 4D45A 1BFDA 1AZWA 4YROA 4D9JA 1JVSA 1Z16A 2O5RA 1LZKA 1P72A 3ITNA 4JBGA 4MGHA 3OQ1A 3O8OA 5TXGA 2IS1A 2ZP1A 1X7YA 4U2GA 1GPMA 3KEMA 4P1ZA 1B16A 1HOXA 2W58A 1W9MA 1YBFA 5IYZA 3FYHA 4PN3A 4P4GA 5IKPA 4PIVA 1RXEA 3ZWXA 1P77A 3Q7PA 2ODQA 1DTEA 4AZVA 5LQRA 2YZ2A 3NFRA 3SQDA 4M98A 1V8ZA 1A9SA 1WVMA 2B1RA 2GXSA 4HH4A 2GHQA 3OP4A 5CT4A 1G60A 4DEYA 1TM2A 2H2DA 5BORA 4V1CA 1V6AA 2C04A 5L3RA 3VNBA 4L85A 1U1EA 4DQDA 1UKZA 1ZVKA 1KI4A 3EVEA 3HFGA 1QP4A 5KTKA 5AW7A 1BXRA 3ECSA 1XD9A 5ALIA 1ESEA 3B2QA 3OKFA 5B2EA 3T4UA 3TTTA 5EJEA 5GIOE 2HRCA 3JQBC 1GUDA 2XUPA 1SA0B 1PHRA 2WU8A 1Q3TA 2I0FA 2PV0A 3B3QA 4LNUB 5A4FS 4CIVA 2EKZA 3PPIA 5B6PA 4O2AB 1W35A 1DSSG 2P2ZA 1YFKA 2Q0SA 2EFCB 1Z2DA 2GAIA 3HV2A 5ALTA 1HZJA 5BSRA 2X0JA 3AFIA 4B32A 2C7QA 2JVJA 3UA3A 3KFXA 2A7QA 2A0XA 2J46A 2PL1A 2YWFA 3SIXA 4ROTA 4QGBA 3E3AA 2C2XA 2OB1A 1ZMXA 4D3YA 2R6JA 3RBZA 2P8JA 2GLUA 2XDYA 2IEIA 2PY6A 2V4ZA 4XDHA 4G0MA 4G5OA 4TWRA 1KJQA 1TU3A 3OLCX 2ACKA 2JA2A 4UJ5A 2K6GA 3P45A 4Q93A 4X91A 3X2SA 4NKRA 2VHEA 3QVGB 3H8SA 2V7BA 1C9KA 2AZXA 1NVWQ 4M83A 3LSTA 4GM1A 3KZCA 3WB0A 4CVNA 4DBLC 2Q2OA 4FKZA 1C41A 1KORA 4MQMA 4N9WA 3AF4A 3FYSA 2TECE 4S2UA 1RKQA 5CLJA 1O8CA 3O2QB 2FX2A 1O9GA 1JSCA 2VI5A 3QVUA 2BN4A 4MGYR 3TLGA 2WSLA 4CKWA 1YRHA 4NV3A 4AJ2A 4U4AA 2D2EA 3AVYA 3FFTA 1FFAA 3ENNA 2IP4A 2YRFA 1C0EA 3MGKA 2ISQA 3QG1A 3FB4A 3P2IA 3A9WA 2JIOA 4RVNA 3DHWC 5ELLA 3WYDA 1U2TA 4M9XA 1V8PA 4RZIA 3BMNA 4H0FA 3BIWA 1JLLB 1KAGA 2FR0A 3CRMA 2QTRA 4E5YA 3CR3C 4YXFA 5DYTA 5IEBA 5TQ0A 2L0XA 3IQWA 1NZFA 3EXIB 3S44A 5HS6A 2O8DB 4Z86A 2E21A 4K3VA 3BGVA 2LZ0A 5AJTA 5SYNA 5K7SA 3ZK9A 1GDDA 2P5TB 3OPYA 5JCOA 3WGZA 1UDRA 5L9AA 1GARA 2J9FA 2P3OA 1TCBA 1JHOA 1NXPA 2WPDA 2PO7A 1JH9A 3WQBA 5JH7A 2CXTA 4ABYA 2XGOA 3ZCTA 1QH0A 1A7KA 4DL9A 2GARA 1TPZA 2IX9A 4PPYA 3X1DA 2X5NA 2X9GA 4O4IF 2POCA 4BVFA 2OHJA 1I01A 1O2DA 3FIUA 3PC4A 1QGED 3T35A 1NFRA 1L7XA 1QR2A 3ODPA 1XWWA 1YVDA 4MUMA 2PZLA 1SNYA 1Q17A 1QHEA 3P4YA 3AWIA 5AI8A 4Z0TA 3LVBA 1QKJA 2NZ8A 2B36A 4L8FA 2OA0A 3CF4G 3SSOA 5MN5A 4I9HA 2FZWA 1EHIA 3A9UA 4IJVA 4KACA 2WK1A 1OY1A 4X60A 5IU6A 2NPFA 3A28A 4OJKA 4N41A 3W06A 3FMVA 4JT9A 3EYWA 1G42A 1OKKA 4FM9A 1CNFA 2PUHA 4Q9NA 2WJ6A 3SCZA 4HLUC 3QSGA 2YKGA 1PJQA 1DOHA 1V5IA 2G36A 4OKNA 4XPZA 5IG2A 4JDUA 3V4ZA 3DFMA 1HQKA 7ADHA 4M6WB 5H9VA 5IJ9A 1OLXB 1U11A 2PUBA 2FETA 4EB0A 2C8JA 1C1XA 3DBLA 3OHMA 2DZDA 9ATCA 5JHHB 5JIBA 1R8SA 1GD1O 2CXPA 1F4PA 1U65A 2PRJA 1QGAA 4LXXA 4OI0A 4LZZA 1CZRA 2QWXA 2X9QA 1YU9A 1ZIOA 2XIJA 4M1KA 2VPYA 3L5OA 4TV9A 5ALOA 2DLCX 4ZV4A 4O29A 5LDHA 4MVJF 3ZHRA 4CTMA 1H42A 4CV2A 1JHMA 4R9SA 5HIJA 4PG7A 3I6QA 3FMGA 3FRIA 4BO0A 4FR0A 3L6UA 4QFDA 2CVHA 1C0IA 4YMGA 2MWMA 4IS2A 4ALNA 4F0JA 5AVYA 2O8BA 1Y37A 3KOXA 1FSSA 2FW8A 1DKPA 4Q3AA 1G20B 1NKSA 1PLJA 4D8XA 3ROEA 3V42A 3PQFA 2XEDA 2Q9BA 3RJ5A 5BW4A 4MQFA 1Z82A 4EHFA 1R18A 3F8TA 3OQIA 2YHIB 3I4CA 5LCXA 2B21A 2CBGA 4CM3A 5F2KA 5HX7A 2ZWIA 3SAJA 2YZMA 3TG8A 3QX8A 1QORA 3M81A 1JQAA 5TPZA 4L57A 4Z0HO 3EDYA 3WXMA 5D3MA 3K1AB 1LK5A 3AILA 2K2QB 1H5QA 1HLFA 1NAIA 2B3DA 1UCFA 1W76A 1OYWA 1TYEB 1XZCA 1Y0BA 1YR9A 5JAOA 1BROA 4YRQA 3REGA 4YHHB 2HZ7A 3HCPA 4OH1A 2QMUA 1QZUA 3NNDA 4CG1A 5J2UF 4R1SA 3QQPA 1XALA 1JEYA 1MT3A 1GKIA 2W6JD 1QLWA 3DMDA 3SJZA 4B8WA 2IU4A 3A1VA 1PQYA 2ZJBA 5JSYA 4DUZB 5DNYB 4UCXA 5GJWC 4D3DA 2ROQA 1RJDA 2QD4A 4TWZA 2HR1A 4MVXA 4MV8A 4OKIA 3P97A 3I9JA 1P74A 1JFVA 2QZZA 1GAXA 1XEAA 2YVLA 4GF5A 3C3CA 4H35A 3SSAA 4MR9B 4KVAA 3L8DA 4YJ3A 4C4SA 4FSDA 4NECA 2Q46A 4YCBA 4ZREA 4D8WA 3ZBPA 1B8OA 2IHJA 4PG6A 3QFTA 3DDOA 4BZWA 3AEZA 3GVCA 5IKOA 1FFDA 4KIJA 2FP3A 4Y6PA 5T3YA 4YRNA 3O91A 3B6IA 4X65B 1ISJA 2QUBA 4FDTA 1L7EA 1HDEA 1MX9A 4JT8A 4DCSA 2VP3A 3RSQA 1YB4A 1P4RA 1WEHA 1KFKB 4M0DA 4Y2HA 5HMLA 3EPKA 2Z8ZA 3GJ7A 4GI5A 5HG0A 5I9SA 2F3UA 3Q0EA 4AKTA 1K7CA 3B1ZA 3FVTA 1GFWA 2A1UA 1QHSA 1OW3B 1JTVA 5DM1A 4EBFA 3TYXA 5KYWB 2IJGX 3RR2A 2K87A 1CY7A 2ZIGA 3EHEA 4F3YA 3QTLA 4MYSA 1RBQA 4COOA 2QROA 1E3MA 4LHZA 2H7YA 3T12A 2HF2A 1EM6A 1JSLA 1EUDA 1E99A 1TKRA 1Z0KA 3RVQA 3IHTA 3P9CA 3RUHA 3RVLA 1JAXA 1Q6YA 1I80A 1GTSA 4G63A 4KQIA 4XB1A 5I3CA 1SXJE 2OV6A 4J03A 1TD9A 1GP2A 1XKLA 2QYTA 4IEIA 2PS9A 3OZAA 3U1VA 5JS7A 3M4YA 2EF0A 4AROA 1C4KA 2WVAA 5LYJF 2VHJA 4KIFA 1U3VA 1DT3A 3B7PA 5CB8A 3EFEA 4CTJA 5E1DA 1DDGA 2YWHA 1YBHA 1U0SY 2OILA 2B4QA 2CEKA 2EGUA 2BISA 2IDKA 1Z0JA 3OT4A 4MZXA 1NRXA 2FI1A 2ZATA 5GY7A 3SY8A 5HOEA 1JIXA 3NEAA 2P27A 1GZ6A 4AIRA 3SU8A 2ZYWX 4GM4A 1I9GA 1KHTA 2WKRA 1Y1SA 3EXHA 4MS4B 1XRJA 5AICA 5K8CA 1MDBA 3NV7A 2RSLA 4FE7A 4RETA 1GGNA 2Q9CA 4UBOA 2ACWA 1UEXC 4NCJA 4EA8A 1G5HA 1KZYC 1GPBA 1W9HA 2EYUA 3LX5A 4PZPA 4R7GA 5BQ5A 4IFIA 1T1IA 4DVJA 2R0QC 5C8ZA 4HXGA 1EH5A 1E2QA 4B6GA 2QQEA 1DL5A 1KI6B 3ZDYB 5TEVA 1RAEA 5G0WA 2IHTA 4BZZA 5ICCA 4ZAXA 5FI3A 5TMEA 2CMHA 3U4IA 2ZAIA 2A7XA 5E4FA 4RJIA 2WF6A 3RJTA 3L8FA 4LXGA 3C74A 2H4WA 3NNSA 3JAWA 3NC1C 4Q1FA 5IZCC 2AG0A 4F04A 3ZOZA 4OXYA 3H8VA 2GRAA 3I1JA 3SBEA 4C0SA 1TJPB 1MAHA 6LDHA 2R00C 4RKQA 5B3AA 1B1CA 4XQ9A 4Z7NB 4U63A 1NLYA 1QHYA 3ZX5A 3ESZA 1KZ7B 1YV9A 3RS0A 1JJBA 1CR1A 1L4YA 3RTEA 4ZHQA 3SJBA 4A27A 3RHZA 5CH3A 1U3WA 4GKBA 3G5AA 5DHUA 4FZVA 4DR3B 3QEMB 5IAEA 4FCCA 5IDYA 2OXFA 4M1OA 4FPXA 1LBQA 2JKZA 3U4HA 4TYPA 4JA2A 3I1YA 1LW6E 3NEPX 2FPLA 2REOA 4ZAVA 2FHPA 1T34A 3AOGA 3MJRA 2FSIA 2ZRFA 1KETA 2F8LA 3FWKA 3PUKA 4HEJA 2NU8B 3TLZA 3VSBA 5J3JA 5L6LB 2R7KA 4H3VA 4BPBA 1ABBA 4EG1A 4K6MA 1VDZA 2CBZA 4OU5A 1HE8B 4WY2A 5KIAA 5LJIA 1TC1A 4KFCA 2ZI7A 4KAJA 4HQOA 1CFZA 2J3QA 3VKWA 4Q66C 1C3EA 3LPNA 4U0KA 3PPVA 3SZ3A 2QZJA 2BGTA 2VWHA 4E6PA 3DM9B 5B7NA 3B3JA 3R2JA 2F4NA 4QO7A 1T2AA 4X3PA 3V7YA 1W94A 1AXRA 3CCCA 2BEKA 1SZCA 3Q3GE 2WV7A 2H08A 3QBDA 3R0VA 3ZI0A 2PG3A 3A3NA 1G4AE 4GBMA 4GFDA 5M2QA 2XJ9A 2PD6A 5K6TA 4CM4B 1UC9A 3F1KA 1X86B 2RAVA 3G2HA 3Q9LA 1JEJA 1SKBA 4JKYA 2VWQA 1TTQB 4OGWA 4D02A 4AC9A 3H1GA 3GJ4A 2JFNA 3DMTA 3NHFA 1A4UA 3TQOA 1AS3A 1NQUA 1NBMD 1WPRA 3FHOA 4NJEB 4DGQA 3G9ZA 2D3WA 4KMRA 2VDMB 1KPGA 3SQNA 4Z54A 3FFXA 3MFYA 5E9JA 1DEXA 5DNAA 5ES4B 4MHOA 3RJMA 1PT8A 3OQ6A 1YHYA 2FWMX 4LK3A 1NFQA 2NM0A 4HWPA 2O0MA 3S29A 1HZZC 3SZRA 2C5HA 3ILHA 4JLUA 1DT5A 2CLFB 1B15A 3PGXA 4OQYA 4G0ZA 5ENZA 3WRXC 4B7UA 3M1IA 4CODB 5LWQA 1E2JA 4Q3EA 4FHFA 5D3MB 4BNDA 3AHIA 1JSXA 2ERCA 2OFXA 1NTRA 5IVKA 1VJ0A 1SHJA 3OFKA 3H0CA 1M75A 3PJDA 4G1CA 2DSNA 1AX9A 2I9PA 2HFJA 3GT7A 3IKJA 1N2XA 2XQGA 4JUCA 2BFEA 3HLKA 1QQTA 2VBIA 4AKGA 3GUHA 5FIUA 4MQFB 5ER9A 5C8YF 2MSLA 4MUXA 2JNWA 4O2RA 3VPBA 1P4JA 4UAJA 1NI3A 4HYTA 2AFRA 2OENG 4M49A 2XWJI 1N2GA 4OYRA 3U4CA 4BMCA 2JFYA 4AJNA 4N3GA 4CMIB 4NCBA 4OKSA 3ANMA 4YT4A 2VSOA 1WXDA 3GW8A 1DJQA 2BRUC 5EXEA 2V9CA 2Q1WA 1GZ3A 3CBGA 2QLJA 4ND7A 5J4LA 1N6LA 3CLKA 5K8VA 2OSBA 3E05A 4NU0A 4Z3OA 1BCSB 4LRQA 1PZXA 1W5SA 2LWIA 3HCAA 3V8QA 1P0FA 4QPPA 3BULA 3KHSA 1H2YA 3T94A 1XMJA 4ZPXA 3GNSA 4W63A 4FU0A 4LE1A 4PW0A 2IY9A 1ZH6A 2AD5A 1BE1A 2QTWB 3GZNB 4IIYA 3RNOA 3GL9A 1C1XB 4EO9A 5D7BA 4OIFA 5CEJA 4OSEA 1BGXT 3A6DA 2EKBA 1ZOPA 2JHCA 3L7JA 3TOVA 3UGKA 3VU3A 1Y8QA 4G9EA 5JU6A 2WICA 2ZPTX 4D3FA 3ZVRA 3B5EA 4P5DA 1IG3A 5B6JA 2KB0A 3E4DA 4D4GA 5L7TA 3B1XA 1U02A 3LO8A 5COBA 2P2LA 1ISRA 3ZHVA 1Y9EA 2W22A 1EFHA 3A11A 2VTDA 1E2KA 5JXWA 2O8FA 4TTPA 3UQZA 4J29A 1WXFA 2HPVA 1TFRA 2YIDA 3KTDA 5BQFA 1L5GB 5A3VA 2NYUA 3T7SA 4B34A 3KQOA 3K9FC 3AB3A 4BLPA 3MILA 4WXRA 3RRJA 4IIJF 3D6JA 2IXTA 1UBKS 2AR0A 3FH0A 2J5RA 5A9TA 5P21A 3BKWA 1YDMA 4ZEMA 1AMOA 3SVZA 3Q9SA 3TRHA 4RNDB 5CNKA 1C4WA 2ZJ6A 3S2IA 4MCAA 3ZYCA 1XMOB 1V6SA 3PEEA 3WE7A 2HMUA 2VNIA 4PPNA 1L5QA 3OPYB 4IIDA 2GD0A 3HN6A 2WHYA 6NULA 1UWLA 2BUCA 3COVA 3HVIA 1B42A 1WY7A 1PN3A 2Q3LA 4NIMA 2CXUA 1W1UA 4IF4A 4KWTA 5EHIA 4KPEC 3F7MA 3F7TA 1SKQA 1JLLA 4CLDA 1FXWA 1FP4A 3LCCA 4D7AA 2R4UA 2A0YA 3BWDD 1XRNA 1FFXB 2Q8NA 2YVKA 4KZKA 4MWSA 5TX7A 1IN5A 3IQIX 4J0GA 5KPJA 5IJZA 1ZMTA 2JGNA 4CM8A 3PV0A 2ZSIA 1HE5A 2OGTA 2RJ3A 1EUYA 4C76A 3N0XA 9LDBA 4F91B 5H68A 3AR9A 1I1OA 2XKBA 3OESA 4I5FA 1E3TA 5M3BA 2BLLA 5I8ZA 3UWDA 3R3SA 4BO2A 3AM4A 4E5MA 4HX5A 4YAFA 2LCIA 4GI1A 5T4HA 3W6OA 3WYEA 4F4FA 1I3MA 3IFSA 5IF3A 5JS1A 5DNWA 1XMPA 4RH0A 3K05A 3LZDA 4RS4A 2X58A 4Z4FA 1MIHA 1J7JA 1HXHA 1ZISA 2GPBA 2PX0A 3AB7A 3I6BA 3BDVA 3HZZA 4WI1A 1Y3CE 3BXOA 3E9RA 5A3SA 3ABIA 2OOSA 2HSWA 2G0TA 2ZUCA 4EI7A 3KXLA 5FHQA 4XDGA 2B7LA 2Q3EA 2RHLA 4V02A 3QKRB 4QRIA 1HZZA 4G1MB 4M7OA 1SCDA 4XKJA 1RBYA 3ZDEA 5BNIA 2QD3A 3A4NA 3W1WA 1M1YE 1FDIA 1VPVA 2IYYA 3GRAA 4PCUA 1L5ZA 4NFSA 3RODA 1P31A 2V65A 3EFOB 1NP7A 2WTEA 2PS0A 2I6GA 4UE2A 5F98A 5CCXA 3IQHX 2JJ1A 3DMTC 3AINA 2BFDA 1REQB 1Q0SA 5B2FA 2IOYA 3ED1A 2Q45A 2R5WA 1G59A 1TQ8A 3WLEA 2ZM6B 1PGOA 4RY2A 2F3PA 2ZT6A 1JZQA 3BH7A 4E51A 5ITVA 3S7ZA 1A95A 2VSQA 4CETA 4M1TA 3SEZA 1F8UA 2P3QA 3W04A 2VJNA 5DH9A 3DB2A 1YUBA 3WSTA 4X20B 4F1JA 4ZA2A 4YR9A 1CUDA 5AFSA 1PU2A 5JY6A 3CRZA 3TUZC 1FK8A 5BR8B 2R7MA 4TKZA 1NW4A 1M6NA 1KP3A 4QXAA 1AIPA 4E33A 1ZJ4A 3AB8A 1E96A 5C53B 2WINI 2ENWA 1G6HA 4EUHA 5IASA 5JS8A 2CXSA 2JLYA 2PIDA 4JI2B 4FX2A 2OP1A 1XDZA 4M1QA 4PHHA 1HFWA 4Q1BA 4UBIA 1Z08A 2FMXA 1I94B 1ZM2A 4NDAA 2JBHA 4CL3A 3SOZA 4PO3X 3PWTA 3LW7A 3K6SA 2WWWA 1PGPA 5HDQA 3U5ZB 4NBRA 4MYRA 5CDYA 1EFPB 5JJIA 1M34A 4XUEA 1JEDA 4BBAA 3KYCA 4BJHB 1SVWA 1PIWA 5D2CA 1TCCA 3D8NA 5JE8A 4EHHA 1GNSA 3IT1A 2DPXA 1R0SA 4FXPA 3WBJA 4F4JA 3DE6X 2YBDA 2JLUA 3FROA 2FMKA 3C5VA 3MAGA 4N49A 3NIBA 3L1HA 4LX0A 2ZB2A 5JI3E 5K6RA 3W5HA 4ARBA 2FDXA 3OE1A 2H1VA 3FCOA 5HIKA 3CEJA 2ECQA 3A25A 3KOUA 3AJ9A 4CUKA 3ZD8A 1DO2A 4TSRA 5DYGA 3ASUA 4QOGA 1PQUA 3JALA 3NWJA 4NCKA 4C04A 4CMEC 3EA0A 5L3QA 4RH3A 4LNAA 4CDMA 5E95A 3EWAA 3VPGA 2KM1A 5GVSA 3BZUA 3ZU6A 2ONCA 4BB9A 3IAM1 3THYA 4RQTA 4HUTA 1LS1A 1PSZA 5FP0A 3LP6A 4URYR 4AD8A 3D54D 3ED5A 1XEXB 4BAUA 2GBGA 2OSVA 2WF8A 3TW8A 1SWVA 1S3FA 4F8JA 1E4EB 1K8ZB 3AERB 3FJYA 4MGZR 2BKLA 1NXTA 2ECOA 4UEKA 1XLVA 1ZK3A 4TQ9A 1B0ZA 3BD8A 5MFZA 3GMSA 4F60A 2NP7A 1DQZA