5IUNC

Crystal structure of the desk-desr complex in the phosphatase state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
131
Chain Sequence
b'SMISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase DesK
publication title Regulation of signaling directionality revealed by 3D snapshots of a kinase:regulator complex in action.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase/gene regulation
total genus 44
structure length 131
sequence length 131
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iunC00
1C4WA 4G86A 1VRVA 2ID7A 4NCAA 5JNVA 2HSGA 2FMHA 2MYTA 2LUOA 4P98A 4L85A 5EWLB 2FN9A 2QVGA 5HKOA 4KVFA 2FQYA 2I6FA 4LE2A 3QLVC 1A04A 3H6GA 3JPWA 1A0OA 4MS1B 4W5NA 2MYNA 1CYEA 4KK4A 5JS2A 1TVMA 3LUCA 5BRAA 5KI6A 2PUGA 1DC7A 5EWJB 4W5TA 4WZZA 1JLKA 1I3CA 2IPAB 3IP7A 3C6QA 3GL9A 1DRKA 1KGSA 1KMIY 4MR7B 5FBHA 4ZJPA 4TLLB 4RK4A 4RY8A 5CHYA 3C3MA 1NXWA 3CZCA 2PUFA 3QEKA 3HS3A 1Z25A 1YK0A 2M98A 4NICA 2GWRA 1B00A 3VNBA 3L49A 3OLXA 3GWGA 2O20A 3HSYA 1F4VA 4PEVA 1FFWA 3HCWA 3LKVA 5HSGA 3JVDA 3G85A 1YK1A 4OLBA 3QEMA 2JVJA 1QO0D 2WJWA 3GT7A 4LRQA 4N03A 4CBVA 1RNLA 2PAFA 4D74A 4DADA 4DQDA 5IUJC 5T7BA 2JK1A 2X7XA 4TMYA 1QPZA 1E6LA 1RXEA 2B4AA 3CNBA 3HM9A 5TE9A 1PEAA 3EQ2A 5ABPA 3IPCA 2WRZA 2PL9A 1YS6A 3OLVA 1DC8A 2OENG 5JNUA 1Z18A 3KCNA 3OLWA 1NXOA 5B3JA 3VNAA 3CTPA 4WT7A 5TQ0B 2FEKA 2L18A 4RK0A 3SAJA 3I09A 3T95A 1JDPA 4EVQA 2H0AA 3I45A 3HVRA 3F6CA 4EYQA 3JPYA 2Q5CA 3NHZA 4RU1A 3RVNA 1U2QA 2IPLA 4PICA 2FMIA 4EVRA 3LKBA 1PEYA 4YR7A 2JVIA 2WJAA 3A0RB 3H1FA 3LUAA 3M6MD 3OMXA 1QP4A 2ZWMA 1C0EA 3O2QB 4MR9A 1EWVA 3DBIA 2R25B 2V0NA 3O2JA 4YRZA 3MMNA 3KLNA 5DTEA 2E4XA 4Z99A 2FLKA 3FMVA 1L5ZA 3N75A 5KC8A 4Z4FA 1LK0A 5TQJA 3TMYA 4O5AA 4RY0A 5IEBA 1D1QA 1BDHA 4XAQA 4EGSA 2YHBA 3Q7SA 5CNIA 4UHJA 4YV7A 2JCGA 3JTEA 2NT3A 3Q41A 4QICA 2NUBA 4GPAA 4JAVC 4L4UA 4QYMA 2QXYA 4N0PA 4RS3A 1DCFA 2WMYA 2N9UA 3F6PA 2J48A 2F8TA 4RK6A 6CHYA 1QP7A 2LIVA 1M2EA 1PHRA 4JB2A 4MS3A 3MA0A 2MYUA 3N53A 1S8NA 4G0YA 1MAVA 1Z15A 1VKRA 2XDYA 1RXIA 4KZKA 1ZN2A 2PMCA 1ZY2A 4IMIB 2QR3A 3QEMB 3OO0A 1DBPA 1ZGZA 3FDFA 3IPAA 2JRLA 3GRCA 3LFTA 4JB0A 3HO1A 3NNDA 4KRFA 1JF8A 4TN5A 1JWLA 5KQLA 4RZSA 2FTKE 2B1JA 1YS7A 3F7NA 1Z16A 1JBEA 1DZ3A 2PUBA 3HK2A 3MQ4A 4EYKA 4KFCA 4Q6BA 3T38A 4W5OA 2GX6A 2QW1A 1SD5A 3H6HA 3RVOA 4XFKA 4Q6WA 1BVHA 2PUAA 4YGXB 3H1GA 4HNRA 1A2OA 1ABEA 1Z13A 4RKRA 1H9CA 4HNQA 3K9CA 3O2SB 4EYOA 5KQMA 1TJYA 5TPZD 3RVPA 4N41A 3EJWA 3H5OA 3Q7RA 2VYCA 3RVLA 1BDJA 2MSKA 3LMKA 4O1IA 4H3HB 3Q15C 3OQMA 2VUIB 1VLZA 1TMYA 4YS6A 1RPJA 1NTRA 1HEYA 4O1HA 3I5AA 4B09A 1CEYA 1FSPA 3QX9A 3RH0A 3EODA 4MR9B 3RVSA 4ML3A 3GA5A 4H60A 2CWDA 4MPTA 1JHZA 4WXEA 4MR8A 1PUXA 3QELA 3I42A 2FW0A 1NXSA 1EFAA 1W9HA 3MM4A 1SRRA 5GOTA 8ABPA 1QQAA 2VUHB 1YVUA 2MSLA 4Z4IA 2LP4Y 3LUDA 4OG2A 5FWXA 3CKMA 3QK7A 2HPHA 1YIOA 1AB6A 2RJOA 5F64A 2R4QA 1ZHHA 3H5TA 5TQ2A 4ETIA 5BQ3A 4MQFA 3G1WA 3GBPA 4IILA 3C3KA 5JNTA 3QLUA 4WUTA 1JDNA 1UDRA 1XWWA 3O21A 2GBPA 4EY3A 4MGEA 1JYEA 4HYEA 4MS3B 3UKJA 4OATA 1PNTA 3MF4A 4G0ZA 3N8IA 4RV5A 5CNJA 5DGCA 2YHAA 1T34A 3OLYA 3S99A 3E61A 4ZMRA 2A9OA 2IKSA 1EWKA 5PNTA 1ZAYA 3P9YA 2L17A 1RZRD 4P1ZA 1XHFA 3RVQA 3SY8A 4OBBA 1MB3A 2GKGA 2PLNA 1P6UA 1NY5A 4EVSA 1LJLA 3T8YA 3TD9A 3QX8A 1Z2EA 1OXBB 1DBQA 3NNSA 5KWSA 1PNRA 3LUGA 5GQSA 3RQIA 1DJMA 1U0SY 4XXHA 5JNSA 3KTOA 5DLEA 2PL1A 2AYZA 2P9HA 4Q7EA 4WWHA 3BRSA 3T6KA 1K66A 2HQOA 3NBMA 4Z4HA 1GLGA 1MVOA 4LZLA 1J56A 1P6QA 4PYRA 3N0WA 4E7OA 3EULA 4RSMA 1GUDA 1EWTA 2LBPA 3ROTA 4NV3A 3CLKA 3HDVA 3RVRA 5DCLA 1QMPA 4F06A 4G0MA 5FWYA 1R8JA 4KQCA 1L5YA 1TM2A 3EQZA 5TPWA 1ZITA 2NT4A 2AYXA 2RGYA 2E4VA 4NQRA 4OTZA 3FFWA 5TPZA 3TB6A 1DCMA 3TX6A 2LPMA 1YMVA 1YMUA 1FQWA 3OM1A 1MB0A 4G97A 3EAFA 4LE1A 1QKKA 1U04A 3CU5A 3IP5A 4MR8B 4RXMA 2DRIA 2WY2D 2MSWA 3RVJA 4DN6A 5I4CA 3H1EA 3H75A 3QELB 1P8AA 3W9SA 4S05A 2QSJA 4KV7A 4LDAA 3BBLA 4MQEA 2RJNA 2FKAA 4IGAA 2PUCA 4KNYA 3TO5A 3OQNA 2WB4A 4S04A 1SXHA 2L19A 3BILA 4FB4A 5FWXB 3LUJA 2A9PA 4OLAA 3KSMA 1ABFA 5TQ2B 1ZGGA 3OLZA 4MQFB 6ABPA 4JOQA 3H5IA 1JFVA 1MIHA 3GYBA 3O1IC 3Q9SA 4IMJB 4N76A 5DKFA 3CFYA 4ZMSA 1JX6A 5D2CA 3CZ5A 1BA2A 2IDMA 2VK2A 4RXTA 2L2QA 2H3HA 5FBKA 5KQPA 1DBWA 1JH9A 4KPYA 1QO0A 4EYGA 1AB5A 1JFSA 4RDCA 4YCSA 3DGFC 1GCGA 2E4ZA 4W5RA 3JY6A 4GNRA 4XLTA 5IUKC 1D2AA 1VPWA 4F3TA 1EAYA 1CHNA 4QYWA 3IDOA 2IYNA 3FFXA 1GUBA 1BAPA 4ETMA 1M2FA 3H5LA 3KLOA 1JYFA 4XASA 1ZVVA 3ROFA 4PZ0A 3SQNA 2FVYA 4LE0A 4E7PA 4RK7A 1BDIA 4W5QA 4F12A 1FFSA 1LBIA 1ZDMA 5JS1A 2NZUG 2FSPA 3N0XA 4MAAA 4YLEA 1RZRA 2PUEA 2BGGA 1D4ZA 1NXXA 1D1PA 3CHYA 3HUTA 5BR1A 3UK0A 1OXKB 1NXTA 1E6KA 3R0JA 2HQBA 1U2PA 3HV2A 2PKXA 4G0PA 3DGEC 2HQRA 1EHCA 4KK3A 5CNMA 3C97A 1NXPA 4Z0NA 3RVMA 4Z4CA 3LTEA 3QLVA 1ZH2A 2KYRA 3KKEA 5FWYB 5IX8A 3IP6A 4F11A 3QLUC 2HJ9A 3GV0A 5TPWB 7ABPA 5IULC 2JB9A 5CNKA 1ISRA 1LBHA 1SXGA 1FFGA 3N0RA 4HNSA 2FQWA 3HZHA 1Z26A 3H5VA 4MRMA 5IUNC 4LX8A 2JBAA 3HJFA 2TMYA 5EWMA 5B3JC 5IEJA 3BRQA 4WXMA 2A9RA 4MS4B 2CHFA 4YWHA 4MS4A 4D6XA 5HM6A 4KREA 4MLCA 4LDZA 3A3KA 3B2NA 2IPNA 3JS5A 3D8UA 1JL3A 4YO7A 2QU7A 3KG2A 4MQEB 3LUHA 3Q7TA 3F73A 4G0QA 4N47A 4RXUA 3HUUA 2GI4A 4XARA 3O75A 5JNRA 3MYYA 2MYPA 1DG9A 3JVIA 4Z9BA 2IOYA 3DLHA 3FGZA 3SNKA 4KQ9A 9ABPA 2FQXA 3D02A 1TLFA 2OQRA 3KHTA 3GBVA 5IBQA 2W42A 4EUKA 3KS9A 4ZYLA 1YTUA 3N6VA 1U8TA 1M5UA 2E4YA 3NNNA 1W25A 4PE5B 4KMRA 5C5CA 1NXVA 3ILHA 3OMWA 3FFTA 4H3KB 1ISSA 1JFTA 2FEPA 1F51E 1IIBA 5IC5A 2A9QA 4D6YA 1DP4A 3DLBA 2ID9A 4ZPJA 1USIA 1Y1LA 3ILYA 2R48A 5EWLA 4Z9AA 4MLDA 3C3WA 2PJUA 2QV0A 2QZJA 1P2FA 3UUGA 1XHEA 5JNWA 4MS1A 3KYJB 2E4UA 3BREA 4G0OA 1NATA 3O1HB 4QPJC 4UHKA 2E4WA 3CG4A 4Y9TA 1QQBA 2F8SA 1E2BA 2PUDA 2FN8A 5EWJA 1DRJA 4TLMB 4N0QA 2CHEA 3K4HA 3LOPA 3HDGA 4RK1A 4YP9A 4FE4A 3M9WA 4MR7A 5KQGA 3DZDA 1D5WA 2FMKA 2JVKA 2PE5A 4IF4A 2WWVD 1DCKA 3A10A 4G0XA 1LJUA 1Z17A 3SM9A 3OM0A 3E3MA 1QNLA 1K68A 3H5WA 4RK5A 1KRXA 2ZAYA 2FMFA 4MYRA 1ZESA 3O74A 3HEBA 4RY9A 3A0UA 1E6MA 2IPMA 2FEWB 5ED4A 2FLWA 1APBA 1Z2DA 2FXIA 1QP0A 5C5EA 3CG0A 3IP9A 3URMA 2QVCA 1M5TA 5T3YA 2NZVG 3EGCA 1WETA 1USKA 2RDMA 4MRMB 1SXIA 2JBAB 5EWMB 4NCBA 2CD7A 5HQJA 1USGA 2P4UA 3OQOA 3EDCA 3HXMA 3O1JC 3SG0A 1ZH4A 3LUKA 3NHMA 3L6UA 3MIZA 2R47A 3QLTA 4RWEA 1URPA 3KYIB 5TQ0A 5KC9A 4JA2A 4JASB 4M88A 4F8JA 1Z12A 4ETNA 1KRWA 5E3JA 4IRXA 3CS3A 5BRJA 3M9XA 4FE7A 1GCAA 4RKQA 4Z4GA 4Z4EA 3OO1A 3CRNA 3KJXA 3RVKA 4JP1A 3LUFA 2M1ZA
chains in the Genus database with same CATH superfamily
3ZJUA 4D5EA 3RYHA 4EF5A 5L7YA 1KDOA 2MSDB 3B52X 3D0QA 1YCHA 3AY7A 2CUZA 5DHSA 5B2FA 1J22A 2H1IA 3Q8XB 3UAYA 3V4SA 1A9RA 1UJ2A 1BX1A 3QFHA 5HQ3B 5E7MA 2QRJA 4ENWA 4RKFA 5F3WB 3KLPX 4IDEA 4JA0A 4G41A 4UMDA 2BM9A 4RA6B 3QG1A 1CIVA 4ARBA 4EO9A 4V03A 4K46A 1BWPA 1JHDA 3KR0A 4ZO8A 3Q4GA 1HDZA 2NXEA 3C3JA 2QX8A 2C7OA 4IDPA 2XRZA 4BMCA 3FFBA 2PKQO 1ORTA 1EXVA 3JALB 1PI3A 3GXOA 4QQ8A 3QMWA 5CFZA 5KTNA 3H5AA 4K6CA 3STVA 3WNQA 2BEVA 2FK8A 1NKTA 2Y71A 2GEVA 3V32A 1NXWA 4P83A 3OZAA 1M10A 2A86A 5HK8A 3USZA 4EWLA 5I51A 3HS3A 3NW9A 4BL5A 2FZEA 4WX2B 3DV9A 3CRQA 4MDHA 1TKCA 4M8NE 4IXWA 2GWRA 4PM4A 1N57A 4E32A 1YA8A 1J8YF 1HE8B 2AOVA 3L6OO 1LLFA 3HSYA 4H0FA 4LZNA 4ENPA 6Q21A 3JVDA 1F38A 3QXJA 1D6NA 2IDKA 4JQCA 4N03A 2DKFA 2HSEA 3IP8A 2JGNA 4XDYA 1MO3A 1JVBA 5CXSA 4BZWA 1S5PA 1J39A 4NYIQ 1JKIA 5G40A 2F3RA 2GCPA 4L5AA 5HF6A 1TQHA 1XAHA 3W6PA 4EKDA 5DVZA 3VOBA 3KSAC 2F43A 2DB3A 2GT1A 3NH6A 4YCAA 2J45A 1DV2A 1LDGA 2W43A 1W46A 3I2GA 4IEEA 4N8DA 3HM9A 5BR7A 1YCGA 1H8HD 2WRZA 3QVWA 5L51A 5A7GA 5TS2A 1IBCA 1TM4E 4I5DA 3ZE6A 5DNVA 5DHFA 3ZHTA 2EWMA 2FFQA 5A06A 2CXOA 2REQA 1VL8A 1GUYA 1QH8A 2EAUA 2EBFX 2PIAA 3H3JA 3N3BC 1MZVA 1I5RA 3HBMA 1BE8A 2OZPA 1LBSA 3DDCA 3B78A 1E92A 4QDJA 5DLQC 2POCA 4DKXA 1I8TA 2HIGA 2DECA 1Y9ZA 3B6JA 1LRKA 4IIUA 4JLUA 4KH0A 5SYNA 4JI3B 5I6DA 1G9TA 4AZ0B 2Y1CA 5F4ZA 1NN1A 3QTBA 3SBDA 4RU1A 1O8CA 4KP7A 4I3GA 4F60A 5I4BA 3GLFA 4JGBA 5DHQA 1U7OA 1JEDA 5ECWA 2AN1A 3VVBA 3LU1A 1TF7A 5AW7A 4G63A 2DSNA 5SY9A 2J1LA 1PV2A 1K9VF 3PQ8A 2GHIA 1LWOA 3KK0A 4J49A 1VE1A 2BKEA 2P3OA 3I8SA 2A5JA 5EEGA 4J0HA 2I80A 1L4GA 2XUZA 3DBIA 4FBGA 4GPD1 3DC2A 5PGMA 4HD8A 1QF6A 2WU4A 2HK6A 3KLNA 2WYHA 3A11A 1JS1X 4ZVPA 1GYRA 4I5GA 1N6KA 4PSVA 5IT5A 4S2EA 3AU9A 2XF2A 2H51A 4B3GA 2F1JA 2OQVA 2V58A 3G2QA 1VJDA 4KJXA 4DMRA 3CX4A 3VHQA 3L46A 1Z5WA 4UHJA 3KZXA 2BW0A 2FPLA 4C06A 1P0CA 2HEGA 2OBLA 3BIXA 5BV2P 1LPOA 2DEUA 4I46A 3CO5A 3SP1A 4QICA 2NUBA 4K87A 4YRAA 4OJNA 2PRIA 3E2PA 1R10A 2HF9A 1GKYA 3EXIB 3JZAA 2PBFA 3MWFA 3QU4A 1ORDA 3FBWA 4A7PA 1RPNA 3IIKA 2QPAA 5D7BA 2WB2A 2KPOA 4U0KA 3TLEA 2MYUA 2A0YA 8OHMA 1E77A 2I3DA 1QLWA 4PC7A 1P18A 1VKRA 3DM5A 2C54A 1E2UA 3SIWA 3SJ7A 3QVLA 2I6QA 1FVFA 1B73A 4GLLA 3INGA 2IEGA 4FX2A 1UP7A 3GOHA 3OCCA 621PA 4EITA 4QU8A 4COOA 1CV2A 4JI0B 2Y8EA 1UJ6A 1YA4A 3Q1LA 3UENA 1YONA 4X1KA 5JH7B 2BDEA 1RWVA 3NIWA 5EJAA 3U0VA 5CBPB 2WJPA 4DJFC 1OBCA 5LU8A 2WJ4A 1E4YA 3EISA 3ZVNA 1TAGA 2O0KA 3GD7A 2FCAA 4LFBB 1F6WA 3ONWA 4PC3A 4TS4A 5IAGA 1T3SA 4XTCS 4Z1MA 1XZMA 1Q6YA 1W9MA 1Z73A 4NBVA 5JWHA 1O6FA 2DYKA 1CDDA 2PUTA 3COPA 2GN9A 3LP6A 1N7JA 2XQVA 1PJRA 2LRHA 3MW8A 4IEFB 4XFKA 2OILA 2R86A 1ZVQA 3VUFA 4JBXA 1JLLA 4XRGA 4JQZA 1A2OA 1RKBA 3STXA 4BB5A 2A3RA 1I7SB 4TSFD 1JQDA 1C30A 4XTRA 1UEJA 3FWHA 3UAXA 1T3GA 3RFUA 2QM7A 1I33A 1BMDA 5E6UB 2JAUA 1EP3B 4PLGA 4MKRA 4DBZA 4GOOD 1U9JA 2OCXA 2NVBA 1UJMA 3IUBA 2WI8A 1RWPA 2OVFA 4WKBA 1UQRA 1X7YB 4PIMA 2B5VA 3PNOA 5F9MA 2PLRA 3H9QA 3DT9A 4BCCA 2HA6A 4ZALA 4YXWD 1MEOA 1SU4A 4WW0A 2QIPA 5EJIA 3OQHA 4CMKA 4BEJA 3B38A 1KZ7B 2DHEA 2CE2X 2OL4A 2Q8NA 3EA4A 4OPMA 4TT3A 5JCJD 3C1TA 3D8TA 4RPIA 4GU5A 1ULTA 3BRCA 4YCMA 2CLIB 4WKPA 1RWNA 1HDRA 4TXLA 5AXDA 1L5WA 4D4IA 2P75A 4UCWA 4BATA 4Z51A 2FUG1 2OD2A 4UZEA 4IHKA 2VUHB 3UMFA 1JG6A 4Z4IA 4X41A 1XEWY 4A91A 3WYNA 1UBKS 4GZMA 1A8SA 1H2FA 3C7AA 4MQFA 4EL0A 1R5BA 1GA4A 4DIEA 3BRWD 1Y9JA 2D59A 2EKPA 1B3RA 1U8AA 3UAGA 1A8QA 5I5EA 4YY3B 4FT2A 5EPUA 2N75A 4AT1A 2CHGA 2EF0A 2XBLA 4NL4H 3CINA 5F76A 4E5MA 3WBFA 2AJCA 3SF8B 3GDWA 1I2DA 3D7NA 3SICE 1L4MA 2F1IA 3E61A 3LFUA 2BMFA 2WOOA 1ECPA 1SG0A 4DR7B 3HNRA 3Q7EA 2QAGB 2YMPA 3ZLUA 5BWLA 4XX0B 1V5GA 2D3WA 3DO8A 3FHJA 4P4SA 1W1UA 1ZINA 3N76A 1I4TD 3PKIA 4HQRA 1UIRA 1PS9A 4XDGA 3FPEA 2FPSA 5FAXA 1P6UA 1YCFA 4ENSA 3GEDA 3HLTA 4IZOA 1Q0HA 4U8GA 1KEEA 1NUSA 1K6MA 3NTOA 1T9KA 3QJGA 4LKRA 3WDKA 4TYPA 3PX2A 5DLEA 3VYTB 2CZQA 4AZVA 1JIKA 1XP8A 2HA5A 2BEWB 1HL7A 2HQOA 3T6KA 5LP6B 5CX1A 3L8HA 2O3QA 3HN2A 2ZIWB 2QVYX 1YI8A 4BYMA 1G8HA 3C3BA 5AHXA 2QTAA 1M5RA 1GQ2A 1SEPA 5IT0A 1YI1A 1V5IA 4OLJA 3IAFA 4C2UA 5KKNB 1TE2A 2LBPA 4N5HX 3ZLVA 4E4YA 4J1TA 4H0CA 3DP9A 4H1HA 3O4IA 4OQYA 3H4MA 5KSYA 5CH8A 1ZA1A 1PL7A 2GERA 3BN3A 2FSFA 4N5NA 1QIGA 3WGUA 3EQZA 1IPHA 2Z6UA 4WLNA 3DBRA 4ZOLF 2GAAA 3IFSA 1OVGA 3JD1A 5A5EA 3U7QB 5F5XA 1IEWA 1YR1A 5HUJA 5JSHA 2BMWA 3UXMA 4YP0A 2F3TA 2VBIA 2ZROA 2UVPA 4HAZA 1UC4B 3KB1A 4NEQA 4RD4A 5C8YB 1PSWA 2WT4A 2Z1DA 1E66A 3QELB 3WLTA 3BD9A 1JEAA 2QQEA 5DGTA 1JHXA 1TDJA 2JH3A 4IGAA 4PYQA 5G4LA 3MG9A 5J2UA 3O95A 3HTXA 3WA6A 2FUEA 2HK8A 3OQNA 3S2GA 1WUJS 3HA7A 5CM9C 2PEZA 4FGSA 1K97A 4IDGA 1AO3A 2M9MA 4NBKA 3TEMA 3QVGB 2I76A 6ABPA 2NZ8A 2A94A 3GYBA 3MCZA 1XTTA 4N6GA 1KJ8A 4WLUA 3WICA 4Z6KA 4E2FA 4X5OA 1RRFA 2PNJA 4O29A 3ERCA 2PYZA 3WL5A 4FOLA 3FKSA 2CLCX 1GRRA 3CLRD 1EBFA 4L9RA 4M0LA 5HMLA 3RK0A 3VGJA 3VSCA 5JTUA 3VKGA 4LVCA 3KJGA 3HN7A 5C32A 3KQWA 4HGYA 3T3PB 3UJ9A 2RBKA 5DISB 4BPRA 4EL5A 2X9QA 2V45A 1JJ7A 4QARA 3WSVA 5A0TA 1E0AA 4C04A 1AQJA 1EVKA 2EBUA 2UVDA 3ROXA 1BMFD 3TFOA 1NY6A 2FWPA 1L5SA 1ZIYA 2I4IA 3IUEA 3OQJA 3CEMA 1V7ZA 4PG4A 3CRZA 4RD1A 3T7KA 4DR3B 2I2WA 3UHAA 4N0DA 3TE7A 2OM6A 4M0EA 3OPYI 4PZ9A 1K08A 1MEEA 1S2IA 4CTMA 4ZV4A 1WDWB 4LYEA 1JG3A 2NZUG 3HH8A 1AE1A 2ZUTA 4AP6A 1JXAA 3G7NA 3IQWA 4ZT3A 3EA0A 2B2XA 1ESDA 3GYGA 1OXKB 3DKIA 2VI5A 3IYLW 3BIWA 1FU4A 5B6PA 5DM4A 4X8LA 3PUKA 4EA6A 1Y82A 5AJVB 3M5PA 1FP7A 2HQRA 3OETA 4X8HA 2EERA 3OPQA 1GPBA 2HCBA 3NM5A 3PGJA 5HW0A 1K7FB 2HV9A 2DQ4A 1VB5A 2YHIB 4QPZA 4IDNA 3UT0A 1CRPA 5LDDC 5DM2A 5HZGA 4AWBA 1OWLA 4D1YA 3VR5H 2HJ9A 5BNIA 1U6KA 4JMPA 5IULC 1D7AA 4I6JA 1V39A 1P1KA 1SXGA 2CBGA 1M2VA 1PFQA 2CSUA 4H7PA 4R2KA 4NK5A 1Q20A 3ZXIA 2MHCA 4E03A 1O4VA 2R6FA 4LX8A 1FX0B 3DEYX 1XRJA 1EK2A 4HXYA 4L02A 2VHUA 3SEFA 1KYQA 1RM5A 5G0SA 2ZSDA 1GNRA 3A3NA 4QBFA 1GL9B 1K3TA 2VYND 2Z9DA 4NRDA 4TUYA 1GU0A 1NIJA 3FZYA 2TMKA 4HEHA 2WJZB 2Q4TA 4J0JA 1T4CA 5FPHA 3SZRA 5CBKA 1YRWA 2W2KB 1T5HX 2QKYA 4HZGA 3GFGA 3O75A 3ESCA 4XARA 3TVDA 3U62A 1S0UA 1BDMA 1M6EX 3UGKA 2ZRAA 4IKEA 1GWNA 1GZ4A 2C5LA 1RJWA 2QVLA 3RIYA 1OA1A 3A3OA 3ISJA 1WDLA 2P2LA 4CI0B 4HRAA 2ZSEA 5KSWB 3GBVA 5CA0F 4KAAA 5HCIA 4KBYA 4EUEA 5LWHA 1Y0BA 4H6WA 2BHRA 3FCEA 3X1WA 2CVHA 3GVXA 3QEBZ 1FW6A 3FRJA 3BBPA 2ZVQX 4KMMA 4QUGA 4C4XA 2EX0A 4DQKA 2NMVA 1UT8A 4H3KB 1OA0A 2WUDA 4HWPA 1KR5A 4NONA 5AM4A 3W4JA 5KWVA 3V7WA 2G8LA 3KL4A 1USIA 2JL1A 4JT9A 2YIJA 4CCWA 1YUNA 3DMDA 1TTTA 2GEJA 3GA7A 1W0JD 3IOCA 3CR7A 3K09A 5EMHA 2VF8A 2YINC 2BMVA 4HDOB 3UCXA 5EJ2A 2WICA 2JJQA 3KYJB 5FB3A 1X1TA 3I3OA 3FN4A 2O19A 2BONA 3FVVA 4DCTA 1CERA 1P77A 2CV0A 1XD2A 2QQ0A 2XA2A 2ZLBA 1ZXBA 1OLOA 1T24A 2AEJA 1O58A 1W29A 2ZB7A 4OGFA 4PZYA 1FS6A 1ADCA 2QNBA 3DLCA 3GFQA 2PU7A 2XODA 3GUUA 1B6GA 2DH6A 3JQPA 5ALIA 2CF6A 2CZCA 3LHIA 1O4WA 1Y4DE 3M0EA 2YHUA 2EG5A 5E2BA 2JJ2A 1UXGA 3CUVA 2CJXA 1QNLA 2XA9A 3E3MA 1QF7A 2CNWD 2R2AA 1EFVB 4MYRA 2O2IA 4QE3A 3IKLA 4HZUA 1CLEA 4M1OA 1QAMA 1G6OA 1W48A 2WYVA 4ZHQB 4BN0A 2JIBA 2PN1A 1AHPA 1DADA 2ZBFA 1R00A 2PWAA 3L0SA 5KWEA 4UFNA 1ZOSA 1N3LA 1CD5A 1UBHS 4EW2A 3HP1A 3H83A 4DLBA 3HR7A 5HF8A 5BN3A 2K4MA 4KVZA 4LOAA 1I0LA 2VJKA 3JVVA 1PTJA 3A1NA 3QVUA 5DP1A 1M5TA 3E7FA 2ZIUB 2ZTSA 2JBAB 1U8FO 3NEPX 3PP8A 2JH9A 4C2BA 3ADBA 2PWPA 2ZI4A 4KN5A 4AF6A 1OYVA 4WN9A 1MO2A 1TT5B 2IEDA 1RYHA 1SXJE 2ZT7A 1U8CB 5E8RA 3RWOA 4CG2A 1P9RA 1CUJA 5FUYA 3OUTA 4R69A 3WWZA 1SQ6A 3K70D 1HYQA 4DJTA 4ER5A 4XJXA 4B3FX 4DBLC 4CXMA 2IXTA 2FV8A 1AMOA 5TEVA 4OJQA 1GEEA 2IK8A 2X9LA 3K9WA 3L9WA 5CX4A 3WJ1A 4F4DA 4BJHB 4NOLA 2FRDC 2PZMA 2WJHA 2QR2A 3EVGA 4NLLA 4YACA 3M49A 2DAPA 2WM9B 3ZWNA 3C24A 2UXCB 4TT8A 4LDNA 2C3UA 2PV0A 5K03A 2NTNA 2X0RA 3OOSA 4KBGA 4ZIRA 5CCDA 2AH5A 2G9VA 2XCSB 4CF3A 4L85A 1G3RA 3F7TA 2VWPA 3L0CA 2QVGA 2R3SA 2B8WA 2D3TA 3VXKA 5JYEA 1PR1A 4C0SA 3VNRA 2XTMA 3IEIA 5JCOA 3QYPA 1T1IA 1PKXA 2O59A 1T2CA 3IMGA 3PNQA 4J0GA 2ZDGA 2PZ8A 3EF3A 5AHRA 5KI6A 3V9AA 3FOWA 4Y67A 1Z22A 4P8RA 4DDHA 2DUMA 3PXUA 4BO1A 1EXMA 5IN4A 1B23P 1TB4A 2X2EA 4EJFA 1KGSA 1N8KA 4DS3A 4QFBA 2AW5A 3SDZA 3NALA 1R15A 13PKA 2EX1A 2GK4A 2IHZA 2O8NA 4HS4A 4RFVA 2QORA 4KAJA 3RTAA 1F8YA 2CF5A 3AHIA 2G7ZA 3SHTA 3TUJC 3IMCA 3QEAZ 5HKAA 3LBFA 3OIGA 1T36B 8ATCA 4E88A 5TVKA 4G6ZA 3ZV6A 4WXYB 4EKYA 5DHUA 3P2YA 2YZKA 1NMXA 2XUKA 3H19A 4NNOA 4NEGA 4TM8A 2RE8A 5HTOA 3T7RA 1S9HA 3WISA 1XL0A 3K5WA 2VNKA 3U49A 4HH3C 4MHTA 3ORYA 1NBMD 4QAJA 4RFSA 1ZD4A 5IANA 2F48A 4RJKA 3W2HA 2ZI7A 2PY6A 2ZDQA 3F3KA 5DI9A 1A7JA 3LQRA 5ALNA 1A1VA 2V97A 3GRKA 5AI6A 3FMGA 1XI2A 3NT4A 4EW1A 4N49A 2G4CA 2FSHA 3GLHA 3OTQA 3CKKA 3EZNA 1DAKA 3PYMA 1ORVA 3PR2B 3AETB 4DWVA 1XFAA 2L18A 1DKLA 5E9JA 1XU9A 2QP4A 2C5AA 2FW7A 2PPLA 4RK0A 1RHKA 1KHTA 5GM1A 1KZ4A 1V5EA 1KC1A 2Y1LA 5GONA 2B8TA 3BZBA 3EBOA 1OR8A 4YO8A 3BIJA 1X9HA 3K1ZA 5JE8A 4AECA 2BZSA 3RS3A 1NW3A 4YRFA 1C8VB 1PLLA 3M81A 4BX2A 4CM5A 4F04A 4HMOA 4X85A 1CE8B 3ZZ1A 5IRCD 2O8CB 3V5NA 5EKDA 3RUCA 1CU1A 2X9NA 1ORRA 2NIPA 5LB2A 4DQLA 4M0UA 4A10A 2HA7A 3H1FA 2QY6A 2G4LA 3FGNA 3RE1A 3L0IB 2WSSA 2WU3A 5JI2E 2HF8A 1RMYA 4YONB 3UC5A 3THYA 1RM4A 6YASA 2VPPA 4HDKA 2XE8A 3C85A 2FR0A 3FMVA 3R4CA 4L5CA 2ZJ5A 4NEHB 1EQ2A 1P7WA 3U26A 1LK0A 5LN1A 2NU6A 1E4OA 3GNTA 1XLTC 4RMHA 3CLTD 3GXBA 3IV7A 3E8SA 1REQB 4B6RA 4M21A 4PYMA 1ADBA 1EG2A 4FC6A 2ZUCA 1IVYA 3Q41A 4M8KA 3KKMA 4MINA 4R8MA 4JI8B 3WRYA 1GCIA 2R4UA 1RJGA 2D1FA 4P0TA 4YAJA 1AQUA 2Q1WA 2R5FA 3FYDA 2W6QA 1ZM3A 3LVBA 1CUDA 2GS9A 4XOIA 5FUWA 5K4AA 1VOTA 2GDZA 2NUPA 1I1HA 1U8YA 3A06A 1E8NA 4RK6A 4RPJA 4C4OA 3GHYA 1N36B 4JLBA 5L3VA 1WY5A 1OC2A 5DK4A 4EI7A 1CULC 3BCSA 3COVA 4R81A 4KWTA 2YVAA 2Z6VA 4RYDA 2ZYVX 1EVLA 2YICA 4Q15A 4FCVA 1QBGA 3B7PA 4OHMA 3U31A 3HY3A 4IMIB 1OH5A 2QR3A 2CNLA 4WVLA 3TLXA 2B4YA 4Y9DA 4YXFA 1XELA 1X38A 2GN8A 2ZZKA 3JD0A 2AKYA 3LZCA 3LX4A 4Q3BA 4Q4LA 5HXAA 2O2HA 1CJTC 1TEHA 5JVDF 4Q7QA 2VRCA 2P6OA 4RHYA 1J5XA 1UKEA 2RK4A 1HDXA 3IERA 3DHYA 2E3JA 2NYRA 3G9UA 2PL3A 1GSAA 1UMBA 1V35A 2XNSA 3HA5A 1FP6A 2G07A 1FTGA 1F6DA 1L7NA 4EYKA 1EXNA 2VDWA 2GX6A 3GLIE 2JJ1A 3AUAA 2BJVA 3ZCSA 1O57A 1YSCA 4KPUB 3ZY3A 1W35A 1GN8A 5GY7A 2VG8A 1EMDA 2HGZA 3PEFA 3O2SB 3ITNA 3QKTA 4F9TA 4JT4A 2C5GA 1IYZA 4NBNA 5B1DA 4DDMA 1IJKA 4B31A 1H5QA 3RU7A 2ANCA 1KZ1A 3B85A 2EL9A 4O1IA 4I4TA 1X14A 1MFZA 1XHLA 3CM0A 2WWXA 3OQPA 4MICA 1D5CA 2FFJA 5FUBA 3RFVA 2YJNA 3AVWA 1LFAA 2WAYA 3ICWA 1M2KA 1Z4PX 2BBWA 4MR7A 4Y0NA 1UKZA 2QRVA 5C31A 3FVWA 3OEHD 2XWSA 2Z5LA 1F8GA 3DBHA 3H5RA 1CFJA 1B8VA 4AY6A 1K3UB 1AXEA 2NVUA 4OUDB 3OEED 2X22A 3L4KA 3CXRA 3P0IA 5FKJA 1PZHA 2VQDA 2GPWA 4W6QA 2FETA 1ZRHA 4JHLA 4XYBA 4QGSA 2WP0A 3EQ8A 3MM4A 4J07A 1FFYA 3DE1X 3Q7PA 1RAGA 4E5PA 3PDHA 3WAGA 3H84A 1AUPA 2DHCA 2PS9A 5EXTA 4TKZA 1JDVA 4B8YA 4D5GA 1YIOA 1L9KA 2OK8A 1UWKA 5F64A 1XD9A 1L5HA 3L4JA 2OP0A 5EAIA 5BQ3A 3L7CA 1Q7RA 1KK3A 1J42A 1RSZA 1XAGA 3EY4A 4EY5A 3WLIA 2GETA 2LKDA 2NZ2A 2ZULA 3EF1A 3G1WA 4RQTA 2OYRA 4AD8A 1ISHA 2YY5A 5HS4A 3LY7A 4JXZA 1UBTS 4C4ZA 4IGKA 1NUUA 1L8XA 1AU9A 3G8AA 3BMXA 2Q49A 3CUSA 3CEAA 4MUHA 5LDGA 5I3CA 3WHKA 5JAUA 4NHOA 3OLYA 1KDVA 1BFDA 3Q5GA 3ZDFA 4UTRA 1R4ZA 2R8EA 4J1SA 4MVJH 5BSFA 2WWYA 2J59A 3CLRC 1NFQA 1GV1A 3ESRA 3QUSA 1CUGA 3NBXX 3UJAA 3SY8A 2NU8A 1CQIA 4K6HA 4XI9A 3R41A 5T4FA 3QE9Y 4QEZA 3DS8A 4UREA 5CIWA 4IHJF 4MEJA 2B8NA 4B73A 1T25A 1LJLA 4PHHA 2EP7A 3QX8A 3ESZA 2UUCB 1AX9A 4URZR 2Q3LA 1MJNA 1WBJB 3F4BA 3LBYA 2PMKA 4DQVA 4YN3A 4H6VA 4X7BA 4TKUA 2IYTA 2PL1A 4NY1A 4MA0A 1FTSA 5E1BA 5BQ5A 1PJZA 3L6CA 1P3Y1 1PIWA 1TQ8A 4D8YA 4D97A 4RMJA 3VNUA 3GCXA 3MXOA 1RBZA 1WKVA 1G5TA 3OKFA 3R2JA 4P92A 4CIDA 4DGSA 1I3MA 4MB2A 4DPMA 1KVUA 1E4VA 2GSDA 2P9GA 4JNCA 1F8XA 1RWBA 3BTVA 1HOXA 1W2WB 5LBIA 4FLEA 3Q8MA 4UHEA 1X1DA 2I8LA 2VPXA 3SFTA 4B1FA 4C20A 1NVVR 2DKOA 1ZMBA 4EY6A 3KZNA 3RABA 1V48A 1MG5A 4DGQA 10MHA 1XUOA 2LPMA 5MGBA 1Y63A 1TKAA 1YDHA 4UBNA 1QKKA 2PTGA 4JJEA 5FRDA 1QPBA 5DW3A 2FDCA 2FSGA 3A1DA 4MJ3A 4A8JA 1JDSA 3FKQA 3V1TC 3QV1A 3MGKA 1OIXA 1WDMA 3BBLA 2CL6X 4FCWA 5KVQA 5C37A 3STUA 2I2AA 3D4NA 5KVSA 4OQZA 1PJLA 4WKCA 5H9WA 4OX9Y 2VNJA 5LNK1 1WB9A 1OX6A 4U0JA 1OIVA 5DN6A 4I4LA 3IXQA 4E6EA 1JHVA 5AK3A 1TIPA 4GOKA 1NONA 4Y6PA 3WQHA 5I45A 3GFRA 4JR0A 3WZ2A 3ETHA 3I9NA 2BL4A 1YZGA 3FZEA 1O94D 1ZBDA 2ATCA 3AILA 3EPKA 1J1IA 3R7DA 1JX6A 2WJYA 1LVHA 2FFRA 3AR6A 4KOAA 2H2HA 3LQKA 3BE8A 2CYBA 4W1QA 1I7QB 2ZAOA 2P4QA 1MHPA 2ZAGA 3KOWA 3LVQE 3PD1A 3BORA 2EWWA 5D51S 1H3FA 4IDOA 1RBMA 1WMAA 4MVJA 3DOEA 4HWRA 2MOKA 2I2DA 2ZI5A 5DYNA 2OSBA 1O97D 4XDZA 3SIXA 3IA2A 2C4HA 1VG8A 4MQMA 1AT1A 1QQ5A 1KP2A 1WHTB 3D6NB 1WVIA 4GR9A 1SKAA 3NWEA 5LLTA 1DBVO 2ETVA 3RHZA 2AIRA 1EIWA 2J9FA 1HT0A 2BE7A 2HQSA 3CUEF 4W1SA 5JJIA 4MEBA 1V71A 5FNVA 1XRNA 3AI2A 4EDFA 1EVYA 4TMXA 3UKOA 1ABBA 3L41A 3ILSA 4FFPA 5KQRA 1MIOA 4YB8A 2YFKA 4R7TA 1IQPA 2FSPA 2W6NA 1WOYA 2OHJA 1EDEA 1E1MA 3DE5X 3JD4A 4Y8VA 2O0JA 1R6TA 2E82A 1IEQA 4B7UA 3HCAA 4QO7A 1CUVA 1R0RE 4BUCA 3QFFA 3GZNA 3MT7A 3I2YX 1D2RA 4BVKA 1AZTA 1US8A 3QPUA 5J9FA 4YMTA 5CXUA 1DQZA 1B4DA 1AUXA 4L08A 4P81A 3MHTA 1DAGA 3DGEC 3QGMA 2HSJA 1ODKA 1TW2A 3E5NA 4O5OA 3RVMA 4YMLA 2QRHA 2GAOA 3V8NA 1EFUA 1AXRA 2EKDA 2JJ8A 1ZH2A 3QLVA 1QGYA 5AJZA 1HE2A 4QOFA 4RDXA 2MCFA 5DNWA 4BMYA 2EX4A 4PCLA 2JH8A 4NARA 5DZSA 3TPFA 4N18A 5J47A 3NEYA 1VE5A 3ONNA 3VR6D 2AQIA 3NMUF 3R6DA 3RJTA 4WSOA 3DZJA 1CSEE 1SHZA 1ZK2A 2TMYA 1I0IA 3HXTA 3QEOA 4P6VF 4TX1A 4UM5A 1DDGA 4Z5XA 5JUWA 2B3DA 2FG7C 4TRRA 1MXHA 2C57A 3VTAA 5EUBA 4CYMA 3VVMA 1CBUA 2OO5A 3ZJ4A 1EGMB 2J3MA 1U65A 3BJEA 4NFLA 2Q5IA 5GZ6A 1VIVA 2GFIA 2PX5A 2CXRA 3L8CA 2NO1A 1GQQA 2C1ZA 3M1LA 1H4TA 1X1BA 4LF8B 5JNRA 4G5OA 4QPNA 2UYCA 4EG5A 1L4KA 4UU8A 2O8EA 5FPQA 2W22A 3LQ1A 3PRHA 1X77A 1P2BA 3IXLA 1L7QA 4KQ9A 1JPNA 1RPAA 2W2XA 4P38A 2XPCA 3AW9A 2IHJA 4Q3NA 5FF9A 3ONVA 3IR7A 4GYJA 5LIRA 4PE5B 1U8TA 1M5UA 2HSDA 1J5PA 3CX6A 4YJ2F 1IK4A 2VRNA 3EDOA 1FDSA 3R6WA 2AJTA 4Q5IA 5G53C 2BGJA 2I2BA 1OIWA 1R16A 4FMCF 2HF7A 1U3WA 4WTOA 1KJJA 2PQ6A 3RRBA 1XMOB 1AS0A 1QHFA 2CY0A 2OXCA 3L43A 3P8ZA 3VZCA 4JFAA 1BG6A 1WCV1 1TO1E 5JTTA 4D96A 2IA5A 3C3WA 1NMZA 2HA2A 4K9PA 2O07A 4B4VA 2HR1A 3ZK7A 4FNGA 1JHRA 5LNK6 2ISCA 4JBIA 4N82A 4RZXA 4G0VA 1RIIA 2W6IA 4ZOLB 2ZYUX 2XMPA 3ML1A 4KE6A 4BLVA 2IYZA 1QYCA 1D8AA 2IGTA 3E9ZA 5C4IA 1OW3B 1SCJA 3IQEA 1S89A 1YJ8A 1EX6A 2V9ZA 3I76A 3KJZA 3C2QA 3RROA 4ABTA 4YC7A 2RHCA 3FTDA 4PPNA 4MKIA 1JDZA 4Q4AA 2LCQA 4MQ6A 1K68A 3RIXA 4BNDB 2YV4A 1CUBA 2IIBA 4MKXA 3UC9A 1PWZA 3O74A 1LGYA 4CQMA 5A6VA 4OBXA 3MTAA 4LNAA 5AVWA 4OEHA 4R16A 1J0XO 4MYSA 3MMXA 1IJEA 4NYMR 2I7DA 4ZVRA 1MDFA 3BSYA 1E1RD 3PFGA 2ZDHA 3CG0A 2UYHA 2P2YA 4R9RA 4OVKA 4D43A 1BZYA 3LHKA 2JIZA 2QVCA 4JYCA 2CE7A 1A77A 4OP2A 1BJRE 3KVYA 4UUAA 1USKA 2V74B 1TUBA 1HZZA 2FPUA 1JT9A 2QMHA 4WEQA 3GH3A 3EXG1 3M1IA 2QZSA 4ZOQI 4OBEA 4YRIA 2P8SA 3I2FA 3P1JA 4L73A 2WSMA 4JYZA 3G17A 2GN2A 3NCTA 3HXMA 3N2LA 4DSAA 5J4HA 4GM1A 5DX0A 2AHRA 4AKSA 1D6JA 2H5EA 3HE3A 3OHSX 4O2AA 2VHCA 2XLBA 4DMHA 1E5XA 1RI1A 4RDHA 1IUNA 2NO6A 2G5PA 3U1TA 3N2YA 4GNKA 1NRJB 4Y6RA 1K9SA 3CEHA 4UNIA 4PNHA 2QL9A 2ZJ1A 3AUXA 1SUFA 2A0FA 2AD5A 4NZZA 1F60A 4GMFA 1XTUA 2HLDD 3WWDA 2OFXA 1H1DA 1VC2A 2B37A 2B1GA 2VKQA 4E5YA 1FW8A 2RIPA 1WP4A 1VJ1A 2Y93A 3ZDXB 4UUOA 1Y1RA 3AB8A 2GQ0A 5JNLA 2ODAA 1WV0A 4EFNA 2QGNA 3RW9A 1NVBA 3QBDA 4AZSA 5DYTA 5CM8B 3FE2A 5EWLB 2V1UA 5HZMA 1PNOA 3N2KB 5CG1A 4KVFA 1OLSB 5KYUB 4QX6A 4ZOAA 2XTAA 2O2GA 3K70C 4G1MB 1K88A 2FAXA 1Y4SA 3IT1A 1F1JA 1VI6A 1CY4A 3HJRA 4FGKA 5JS2A 4BFYA 2CXUA 2VDPB 4L57A 3AR8A 3BHNA 3BKWA 4G0NA 2BBOA 5E4FA 1QE0A 2X19A 3C7TA 5LYJF 2ZRMA 1AF4A 3H4VA 4W5TA 4NHEA 1DKUA 1I3CA 1SVWA 4RFLA 4LAFA 1FDUA 4RM2A 3KQVA 1UMDA 2AE2A 3CLTC 1HEIA 2Q2WA 4OXQA 2E5FA 2JFFA 4TLLB 2RK3A 4N7RA 3LT5A 3WG9A 3CZCA 1UCFA 1NC3A 4R54A 5SZHB 2QG4A 3C4QA 3HXKA 2BHTA 2VHXA 4R5MA 2ODBA 4UVDA 5EZYA 4BC1A 1Y8QB 3VU0A 3BC1A 3AVVA 4YRDA 4ERXA 4ZI7F 1W1WA 2HPZA 1QS0B 2IP1A 3ETEA 4Y9SA 5CDTA 3ZDEA 1U6IA 1AS2A 5CIQA 4CBVA 4DUZB 3L7KA 3FETA 4J43A 4AMYA 4URWR 5FDFA 5T7BA 2ZJ6A 4KLNA 1KK2A 2CLMB 2FPPB 3QTTA 2OCLA 5CA0B 5EJ7A 1IH8A 3QF4A 2H8GA 1NULA 3OPYA 3W3AD 2EQAA 2IYLD 1RXEA 2AFIA 2JFHA 4UBIA 5D3ZA 4ZCSA 1Q2UA 5TE9A 1WB4A 4WLOA 5K01A 1V11B 3KJHA 1X1CA 2XCIA 4LGMA 3DF9A 3HZZA 1SNYA 4BZXA 4D57A 1H94A 3PX7A 3C4VA 4M1TA 4UASA 1NF3A 2YQ5A 3N8KA 4YQZA 5GPBA 3O9VA 4G8BA 2FDRA 3RODA 4U7GA 1H9AA 5CGZA 4DEVA 5JMOA 1L8AA 4KQHA 3GUZA 3OH8A 1DIRA 1Z6YA 1UUFA 2C7QA 3Q2OA 2HIMA 3UUEA 2ERXA 1HF3A 2EZ4A 2VN8A 3I09A 2YDXA 1T5IA 2XWQA 5AOAA 4QASA 3PD0A 1PS8A 2VZ0A 1M74A 3MRSA 2NQ2C 3FUWA 3TLCA 1YOBA 3ZWWA 2DLNA 1J7JA 3OE1A 4WJKB 2AMVA 4XVHA 4LNUB 2J07A 4GXRA 1LH0A 1EINA 2QJOA 4K0KB 2QN1A 4IXNA 2O8BB 4RY2A 1PF7E 2OZLA 4GWGA 4GEGA 4L0QA 1F4LA 4N8SA 4R1MA 1OTHA 5CW2A 2W37A 5JZSA 3CRW1 3WKCA 4BIIA 4EB6A 3MAJA 3L0BA 3RGWS 4CI9A 5EESA 4IYRA 5CFRA 2Y92A 5KYKA 3L02A 2IV7A 1L3IA 4GDMA 1LNSA 3UMJA 3ZYCA 1EIZA 2IXGA 2RKOA 4FWBA 1LKZA 4RMNA 7REQB 1NN5A 4LMAA 2DETA 1UZNA 1CUWA 1U3DA 2RAUA 4GMGA 1XRPA 4HH0A 1XCJA 4MWDA 2ERYA 3L06A 3P71T 2JFQA 3PPYA 4Y18A 3MCTA 5FOWA 1BQ4A 1ZJ5A 5DHAA 4G07A 3T3IA 1P5JA 4RM3A 4D3XA 4JJAA 5B2EA 2H1HA 4QYMA 2EF1A 1XTRA 4KXFB 4YMHA 1HNXB 1B8NA 1UMCB 4MKHA 3A6ZA 1G6HA 3LOQA 2E89A 3G1UA 3NIGB 1KI3A 1NUHA 1BWRA 2EFJA 3WKAA 5DNUA 4D9IA 2AYYA 2J6CA 2J9ZB 2G5CA 3DVSX 2AN3A 2RHDA 1RHRA 3P2EA 2OXTA 3RRXA 3SR4A 3ZJ5A 1KQGA 5FL3A 4IUCS 1TEVA 3E9RA 3GGOA 4TZ0A 3PX3A 1CNFA 2GTPA 4JJ6A 1ZCBA 3UUWA 2ECOA 3WNCA 1U0FA 2BKXA 2VA9A 3EGXB 5EXXA 3ZE7A 1VHWA 4A0SA 3EG9A 3SZUA 3EQ6A 3LWBA 5J1TB 3M5DA 2XUFA 1PKEA 4ND8B 4UVHA 1P0MA 1W4CA 2HA4A 3G2KA 3TRIA 2PA0A 4R83A 4RPLA 2BUBA 2IXAA 4AJPA 2HWUA 1C7EA 4RIEA 1TNDA 1EE9A 3TBHA 5L40A 2JAHA 4RGYA 5AKKA 1YJAA 3I04M 1Z16A 3OWOA 1DZ3A 1FLVA 1NJ5A 1DQSA 3PUIA 3D2BA 3HK2A 1N8SA 5ULLA 1IQ0A 1DEAA 3BX1A 3O0TA 3WYBA 1KZ9A 4WFJA 5CVVA 1JP7A 5BRNA 1R5NA 2IXEA 3OX3A 4G89A 2H92A 3JYNA 4QBGB 2IELA 4N12A 4WKOA 1QOPB 1VGQA 4QRDA 3TLMA 4UAVA 4V0ME 4UW9A 2HMAA 2J5XA 3K9CA 1HTWA 4TTRA 3TQHA 4WFIA 2XDQB 1RRPA 3RVPA 1VJ5A 3EZXA 1UJBA 5HX7A 4OYRA 3RFXA 1Q0QA 4RTJA 4DR6B 2HWWA 2WZQA 5ALYA 4BNLA 3VR1A 5CB4A 5IFLA 1KMMA 4FU0A 3V42A 1HYHA 5KJCA 1FMFA 1HUQA 3GUHA 1KJIA 4LV8B 1OZHA 4P5DA 1NI4B 1RMTA 4B4DA 3PRYA 3AEQB 3F3YA 3NTQA 2HNBA 4ML3A 4WE3A 4MW7A 5F7JA 5CITA 4J0KA 2ICAA 4EBFA 5JFTA 2W70A 3MWEB 3BF8A 2BFEA 1KVQA 2GZHA 2ZIXB 3WGQA 2FW0A 2WV9A 1R5OA 5LQUA 3JAMA 4CDGA 1MH1A 2QTBA 3WQBA 3LVFO 1OXMA 4FGWA 1PGQA 5BQPA 3FDZA 2CJWA 3D0OA 1Z7EA 2CB0A 3UWPA 4BWFB 1FFBA 2I29A 2EEPA 2OOKA 4JKYA 2OC9A 4OJKA 5BN4A 3D3NA 1HMPA 2WUEA 1ZM2A 3BFPA 3B7WA 3H3FA 4MV7A 2NSDA 4OY3A 3WLJA 1MAAA 3CEJA 1CTQA 1LLDA 1WXFA 1RWQA 1XKLA 3R5HA 4WUTA 4TV9F 5CT8A 3TTSA 4CFYA 1SUWA 2B61A 2GBPA 2O2EA 3DKRA 4ZCPA 4Q7MB 4AM8A 1G5PA 2E9SA 2G88A 4ZPXA 1LI7A 1O94C 1T1GA 3X1ZA 2G1JA 2JZOA 3ONFA 4HFRA 4CKBB 1CS0A 2OGTA 3OTIA 1MQAA 3L0OA 2YZMA 5PNTA 4AICA 4B6QA 3JZIA 2GBIA 4YTEA 5I9SA 4JI6B 4FK8A 5IC6A 1GR0A 2LIPA 2NU9B 2BMAA 1P9NA 4YYEA 3OTHA 4JVNA 4OBBA 3KHSA 2H2WA 2ZBPA 1KY2A 3MC1A 4X63A 1IZ9A 3FNBA 4FILA 3PR3A 1PQUA 1O97C 3EGEA 2FP4B 2LE0A 5KYXA 3T15A 5HKKA 5L9AA 4JOSA 1PCXA 2B3TA 5EA2A 2VQEB 2V7QD 3LQQA 4TMTA 1UK8A 4NULA 2TS1A 1VXRA 5A5FA 1L4FA 4YQYA 1ESNA 4ZVLA 2OV6A 1QJCA 3PFCA 1GLGA 3IUPA 3HR8A 1D2EA 3F4KA 3V1UA 5I4IA 2D00A 3A4YA 3BMQA 3OF5A 3IBFA 3SKYA 1ZAKA 3GDGA 2FW9A 5A4FS 1N6NA 3PTAA 4R05A 4WNAB 4ZCLA 3WWOA 1F5NA 1YNSA 4Q9KA 4ZFNA 4RPCA 3OKAA 3EEQA 1JBQA 4Y2JA 4YLYA 5FWYA 4RH0A 2AN9A 2X3FA 3PT9A 1T15A 2ZB4A 5K3DA 1P29A 3ABZA 1Q3HA 4WNYA 5H9VA 2JKZA 3PC8C 4OYLA 1W4AA 3ENKA 3R77A 1F8FA 1P31A 4RL6A 5A7HA 2ZUWA 2EVWX 3ETCA 3GLUA 4GHWA 4EK9A 1DCMA 4CKCA 1J23A 3S5JA 4OFWA 1FQWA 4FBMA 4LE1A 4RSGA 2WKSA 1KI6B 2BIFA 3TOVA 4MK4A 4U39A 4ZVVA 1QQTA 4R9SA 4Y1RA 1ELOA 1FZQA 4B83A 2QSJA 4HZIA 4HVTA 4ZDJA 5EQDA 2RHJA 1Q11A 4Y2QA 1JKMA 1JNXX 4EPRA 2PUCA 5M34A 1K6IA 1QHIA 1SXJA 4H7HA 1AK9A 4EA9A 1CR2A 1DMRA 3G5TA 4ZVTA 4S04A 4MX8A 3ZE9A 4FB4A 4L8LA 5L7WA 3LUJA 3FDXA 3WMWA 3FPBA 1PWEA 1KEUA 2DBQA 3D6JA 4I2VA 5TQ2B 1GPJA 3HB4X 1NMSA 3NHLA 4UEOA 4DA8A 2PD3A 3E1SA 1IE3A 1C0PA 3ZG6A 4G5SA 3ZCTA 3DE3X 2WTEA 1VKOA 2XZTA 4RPKA 4ABYA 4IOLA 4ZMSA 3EYAA 1PJCA 1RAIA 2JRCA 2PWBA 4IR7A 3DA8A 3VPCA 5FBKA 3RC2A 2IDMA 2L2QA 2H3HA 4CDMA 5ITSA 4N6OA 4AXXA 2HWYA 2ABWA 2P2NA 3C45A 1U7XA 4HGPA 3T0FA 3UEOA 1JH9A 2P6RA 3T4XA 4YHHB 1KA9H 4HS9A 3DGFC 1RVDA 1FTNA 2BGNA 3UAZA 4E31A 2E4ZA 3BZUA 5FA5A 2ZBUA 2QDKA 1VPWA 1NR7A 1YRQA 5BN5B 1EAYA 3DF7A 2IZ1A 4BECA 5A0FA 2GPYA 4CLHA 2A59A 1KBQA 1N33B 1QC5A 3ASYA 2YJZA 3JVEA 4PYNA 1QHXA 3R7WB 1AOXA 4WPGA 4D9KA 1L7PA 4IJWA 4ER7A 4EG0A 3TSZA 1K63A 1N7GA 4BFUA 2MWMA 1VE3A 4RVGA 1NHGA 5E38A 4MMZB 2RGBA 1W4BA 1ZL2A 4W6ZA 1QO7A 3V34A 2BGGA 1VBMA 5AIAA 5FL7A 4MDEA 3WMRA 1E2QA 1EJBA 3LS2A 2QMEA 1Q15A 1YOVB 5LXTF 3I0NA 2AOWA 2VTEA 4WCFC 5DT2A 2ZJBA 4C1NA 2LKCA 3TQFA 1NXPA 2WE7A 3G68A 4ITVA 3DMFA 4X54A 1GKLA 2DGDA 2IT1A 3FTQA 4L6IA 4C08A 2FWMX 2HRBA 1Q16A 3HWSA 4JEMA 3WB0A 4B34A 4DRYA 1SC1A 3K6SB 1XT6A 2PRZA 1KO8A 1FP4B 1BJTA 1YNOA 1TU0A 3MIIA 4HLNA 4EHLA 5TPWB 4R8RA 4DE5A 3DQQA 3WIDA 1ISRA 2BFCB 4V3BA 3PC7A 4G09A 2BGRA 3AHGA 3HYTA 3NH9A 3X1YA 1G5RA 3DAOA 3WO1A 1LPNA 3CRRA 4HX5A 3K9HA 1JQEA 3QXHA 1RPZA 4DLXA 2D2EA 2BF7A 4W1RA 4YBZA 3R7NA 4B9EA 2OK7A 4YO7A 5K0BA 3TG8A 4AYTA 3KQQA 1X86B 1YQWA 2XNHA 4X6XA 2XA1A 4IGFA 1PFWA 2RHHA 5WRFA 3IPXA 4MPDA 1H3NA 1JU9A 1VIDA 3EQ7A 3RJMA 2D1YA 2P3LA 4U2DA 4MW4A 2O8FA 4DQ0A 5IBCA 1P7VA 3L1HA 4IHJB 4Z9BA 4NJMB 4PSUA 4HMPA 3D02A 1CJCA 1XTZA 5G0UA 5JAQA 4NG4A 3TW8B 1KH1A 3BH6A 1KAGA 3N6VA 4UBLA 1HFEL 3REQB 3IV6A 2WAOA 5FT9A 2G9NA 2I2XB 5EUMA 1H2EA 4KI7A 1V9LA 1IIBA 4O3FA 1TZJA 1X74A 1ZEJA 3QKSA 4LRTB 3TFWA 2I4LA 2LV8A 1UOEA 2HMYB 3MQ2A 3RAJA 3UK2A 3ILYA 2H6EA 2XLCA 3A6EA 4Z9AA 5GVSA 2BCEA 1N2CB 1PT6A 4URFA 1O0BA 2RH8A 5KMGB 2OV8A 1XHEA 2R87A 2WIAA 4MS1A 3ROKA 1C3LA 4EDHA 4YUWA 2ZM5A 4G0OA 4QQRA 2EZUA 3RIMA 4XSVA 3U3RA 4YIHA 3FCUB 2GFQA 4BIMA 1HK7A 4TKVB 2CHEA 4X1IA 5DW0A 5DNAA 3V7YA 3AEUA 3GMIA 2GPBA 3FOEC 1QHSA 3DZDA 3R5KA 4L6AA 4Z54A 3CZMA 3VH2A 2XCTB 4FZVA 3TIVA 1GT6A 1YR2A 5I9NA 2R65A 3S29A 3TE6A 3TRJA 4HQ0A 3RC3A 4BTVA 3K2EA 3BVPA 3KKKA 1Z9BA 4FWIB 4RK5A 2XCOA 3OOYA 4F6CA 2HN9A 1PNQA 3E2MA 3U48A 3NBZC 4F71A 1PX0A 2QWXA 2XW6A 3S55A 5P21A 4DFDA 4YUYA 2C1EA 1GQFA 4UNPA 1FPQA 3BMCB 3QKIA 1CQZA 4O8CA 2FXIA 5K3AA 1IM2A 1Y7IA 3BQMB 4LZOA 4D0SA 4U9HS 4Q82A 2HLNA 2VJPA 4RUKA 4LJYA 2HI0A 5CAEA 3MTGA 1P4RA 3B6KA 4Q1DA 3IIEA 4LDJA 4NCBA 1TCVA 2X0JA 1FYVA 2Z5FA 2ACVA 3ZTTA 3N2IA 2FR8C 3RRFA 4AROA 4KTTE 3E27A 5T57A 3H7IA 5DWDA 4I55A 1W52X 5CTJA 4Z2AA 2V6FA 4E5KA 3WRWA 4V39A 3ZUGA 2XOKD 1SBTA 4JJ4A 1URPA 5EE9A 1NSFA 2JK0A 5LPNA 2QLNA 4F86A 4CG3A 3ZU2A 1DX4A 4P3YA 2FZ5A 1OU0A 3GLIA 1E8DA 4QODA 5ED0A 3NDIA 4OD0A 1P33A 3K4PA 2PJDA 3T1QA 5DYWA 5EMJA 2FI1A 4N3BA 4BO3A 1VJ0A 4GBGA 4QTZA 5IVDA 2FPMA 2J3DA 1DIOB 2GN0A 1M6YA 1H85A 2XKKA 3DMNA 1Z88A 4UNNA 3CE9A 3K30A 1WUIS 3WLSA 4ZZ3A 2C7VA 2D1TA 2FSVA 2NZWA 1DXYA 2XITA 3OZXA 4K40A 4PZEA 5I9TA 1Z82A 5TRTA 1VRVA 3VSAA 4F72A 2I6TA 2QRNA 4AKGA 1ENYA 1RQ7A 1S4QA 5FYQA 1UEIA 1NNI1 2YIVX 4LRWA 5BXYA 4GKAA 4IEIA 5J5AA 3ZK9A 3QE3A 2C4WA 1Q0PA 2FQYA 1P7ZA 1Q5PA 1VCOA 2AB0A 1A04A 2BTQA 3L05A 3OY7A 3P2IA 2BRUA 3V8BA 3MXTA 5D3KA 2J9RA 4JLMA 4QM7A 1O0CA 5LIPA 1U2TA 2PZGA 4UFPA 4FGZA 1S2MA 3H9UA 4JSYA 2BHLA 2QTVB 4B40A 4Z0HO 3EXHA 1R74A 3SYTA 1JA0A 4A0RA 4H7FA 5K3EA 4H6XA 3IP7A 3U17A 1IJBA 4G0UA 1YD7A 3GL9A 1RE1A 2H5IA 4PFJA 2W2LA 4G5RA 2WJIA 3FYUA 3AVXA 4XSGA 5AHKA 3AVOA 2ZGVA 5FUQA 4DLYA 4I19A 2Q45A 2CYCA 4GZ6A 3WA7A 4Y6QA 3CSDA 5KYYB 2H2DA 3CX3A 3DAHA 3GG2A 4F3KA 2ZJOA 1B26A 1M1NA 3RANA 1MABA 2ETXA 3W7BA 3ZHRA 5AUOB 1I3OA 1QO0D 3QXCA 3A6GA 5J4YA 4PAWA 3RWBA 3H11B 4CR7A 2PFGA 4F8EA 3VHLB 2WF8A 2I1VB 1Y7TA 4HTFB 3O91A 4YJGA 4AJOA 1YWGO 3D5TA 1SCIA 1M6NA 3F8SA 4YJ2B 1DRUA 3UWKA 3H65A 1QRUA 3AKCA 3FB4A 3B7GA 3EEIA 3WIOA 5A7FA 5IABA 4FMCB 1G8GA 2WHXA 4H9GA 2WMOB 4LGCA 5FORA 4BE4A 1MO5A 3AZPA 1CNMA 1D04A 2FEKA 4HEJA 4IJUA 1VSQA 3PGKA 2XKJE 2G1PA 2M32A 1SD1A 3ZDQA 1EDOA 2FZKA 4B3BA 1YHYA 4PQEA 4V0RA 3SQMA 5J23A 4HNAB 1V5WA 3AJEA 3RSOA 3THOA 3TLGB 3EOAI 3V4PB 3ZLBA 3ZHYA 2XWBF 1CJSA 1L7OA 4GPBA 4B7ZA 1NYRA 4INZA 4OGKA 1K0UA 4EVRA 1SOMA 1Y6JA 3UV7A 2CNBA 2VF2A 1Z45A 2JVIA 4YCCA 4ZK6A 1II8B 1NW9B 2F59A 3ESXA 3HJTA 5J2TB 2QBYA 3M6MD 3IO5A 3VZRA 5DNYB 3JYOA 1GGMA 3G82C 2OE2A 2AG8A 2PIDA 4TTPA 1U2RA 2AEMA 3TWOA 2PGDA 2VWQA 4Y98A 1R18A 3N75A 1L5ZA 4DLWA 3PC6A 3D6FA 4R2IA 2YOGA 5KOIA 1R66A 2XIQA 3MRVA 2NOAA 3DEAA 4EGSA 4EZBA 1FFAA 4NU0A 3WWYA 5EYPB 3PEYA 2Z9BA 5EP3A 1R0BA 5J4VA 4QUDA 3ZLJA 1QE5A 1OWPA 3TX2A 3CH5A 4EPTA 3ACBA 1RE0A 3P9SA 3ZJTA 3HL0A 1SCBA 2Y05A 4UBJA 3V7NA 4M9SA 4GVXA 2QXYA 3W5VA 2AJLI 1AG9A 4NPHA 5AXAA 3VI4B 3ROPA 5LD2C 2XZLA 3FOCA 4R1QA 3T61A 2V1XA 1T3TA 4R3NA 4F9EA 4WLEA 4UHHA 4F93B 4PFSA 5I7AA 1XZAA 3G0OA 1Z36A 3LAWA 3W3ZB 1OLUB 3RYFA 3H8JA 2XDYA 2HBQA 4E22A 1RXIA 1DIHA 4TMVA 1KETA 3KPYA 3CW2A 4WCFB 3R7SA 1A7UA 1D8TA 3RAEC 4KQ2A 4PCAA 2QLLA 4DJEC 1ZGZA 1E2JA 3M4YA 3UGQA 2YWEA 2PNFA 3AM3A 1R4NB 4P3OA 4V2UA 1OFTA 3LFTA 3AVYA 2WTAA 4ICIA 4ND3A 4ENTA 4NJEA 1C9JA 2BTOA 5JSKA 3RC1A 3VPGA 3NHSA 4EG3A 5KQLA 1IBKB 4NBWA 4BFCA 3FOAA 4CM1A 4ON9A 1UADA 2H65A 3HR4A 3EFEA 4HT3B 4TVSA 2JGDA 3CA8A 5JBNA 2O2YA 4X6YA 1EI9A 1P0QA 1K4MA 5FTKA 1D4OA 2XEDA 2J0SA 1S02A 1GPDG 1XRMA 2GBCA 2WF7A 3UJCA 1EDBA 1FJGB 1QH9A 2PHZA 3GJ8A 4LOLA 3PDIB 3W05A 1G64A 3PUWA 3V7UA 5M2QA 4A23A 3G2PA 2WWWA 3RVOA 2F55A 4Z1OA 3O3MB 1WSDA 2E18A 3BL6A 2BN4A 1G20E 1JG1A 4UXJA 4QXQA 2ZJ0A 5DXAA 4PWYA 5CVJA 5LQKA 2B7LA 3PA6A 4AQ7A 4N41A 2AQKA 2AT1A 3IEXA 3T3GA 5LYJB 1HORA 1QYRA 1N0UA 1E5QA 1IHOA 2MSKA 2R79A 4RNCA 3L7NA 1KQNA 1VIMA 5LFAA 4M76B 4QNNA 4RNDB 3RTBA 2W93A 3FPSA 1R1DA 1QK3A 4B09A 4ZVOA 1OZAA 2KWIA 2Z3VA 1OH7A 1Y3AA 5EIBD 1K89A 4LQ4A 5BOVA 1YHZA 1AD2A 1DRVA 6REQB 1Z06A 1G5QA 4URVR 1PUXA 1WX1A 2BC9A 1XBTA 1UBFA 1W9HA 3LW7A 3HVKA 3LDGA 1J2TA 2HD4A 1GP2A 5K0GA 2XMCA 3ABSB 3DL0A 4CF7A 1V41E 2JFXA 3LDAA 3ZDDA 4O4JF 4GLBA 5H81A 4Z2YA 4XM1A 4AS1A 4INPA 2ESRA 1II0A 4M55A 4L3VA 1JI0A 5B1SA 1D1TA 4DDKA 1BD4A 2H16A 4W8HA 4XJSA 1XO1A 5KVCA 3TQIA 3VVLA 2B4RO 1HYGA 1JDNA 1SVLA 5AOBA 1JIQA 4JLNA 5EJ5A 1C3EA 3OC0A 3S44A 2C7RA 3U7EB 2GEBA 4QUHA 1Y4AE 1U2EA 4X97A 4B46A 1LY1A 2SECE 4O0MA 1UPUA 2PMDA 3DMPA 1E5VA 2HO4A 2DM6A 2ZRDA 3EIHA 3OY2A 1HT1E 3OE4A 4HKTA 1K8ZB 4BEBA 1QV7A 3NKLA 4LECA 2ZTHA 1Z4JA 5IASA 1T1SA 2DTDA 1YZUA 2YUTA 2LWIA 3LDHA 3OM9A 4P1ZA 4YRPA 1V1MB 2QTNA 1IUPA 3U0BA 2WU0A 3AF3A 3GLIB 4CPDA 1MB3A 5JDCA 1IOWA 5TARA 3ZXXA 5KOHB 4DG9A 3A1FA 4DEXA 3GLGA 2AN5A 4KNVA 4L8VA 1DAHA 3TAUA 4F56A 1MT0A 3F96A 3NNSA 3WC4A 5HRUA 1IPEA 2ZUDA 1EGVB 4GZ5A 2NZJA 5JRJA 1J2YA 2G7MC 3WRXC 5SYAA 4YRGA 1G42A 2YBDA 4YP1A 1G7RA 1MV5A 4G26A 3T0IA 5FULA 2WV7A 4DILA 4AYWA 1MVOA 2F1RA 4MV8A 4WH0A 1JHUA 3HG7A 4TL9A 2XKAA 5EUCA 4ZCMA 3S81A 2K7FA 1A76A 1JEOA 1U11A 1A2QA 1DXOA 1VB3A 2HO5A 5EKUA 1UANA 1EWTA 3AESA 4NBUA 1L0BA 4GFDA 3CLKA 4KE8A 1QMPA 1TZMA 2VDMB 2GZSA 1TK3A 4OU5A 4C7OA 1A7KA 1EK6A 4KLRA 3A27A 3MS7A 5A9TA 3WQQA 2VTVA 4NDNE 3ZZNA 5AVRA 3CIOA 1T8SA 1YU9A 3OT5A 2XUGA 3I4CA 2AYXA 5HIAA 3GDFA 2HXGA 1Y9DA 4UJ3A 1KO7A 2ATIA 3VISA 4AMBA 1RJDA 4ZAFA 4L8FA 3MCUA 1DB3A 3CRVA 5HQJA 5LB4A 4DCMA 3CU5A 5C7IO 3EXFA 1NTOA 3MQFA 5A4IS 4FGLA 1SVOA 3HXLA 3AL3A 1GG8A 5K6RA 4LDAA 3O8LA 4MAFA 4TLEA 4FE3A 4DMFA 4EAQA 3RAFC 3D8HA 3DFZA 3ELDA 1JEEA 4V3CA 3RJZA 2ZYAA 2WZCA 3E5MA 4PX3A 5YASA 3RFFA 4E5SA 1G5FA 5JALA 2C07A 2CFIA 4PNEA 4FOOA 1ZGGA 3IQXA 1YE8A 5AW8A 2P1DA 1CEXA 3EH2A 1JFVA 4KXYA 3U7GA 3A9WA 3TKLA 2PUVA 1SCUB 4DJJA 4H17A 3VR3D 1T4GA 4X7RA 4YI3A 2VK2A 3KETA 1WTCA 4K6KA 2AOTA 2O8DB 1Y9EA 3B13B 4JI2B 1DBWA 1AXGA 1U90A 5B6IA 3AIMA 2VCEA 1AB5A 1JFSA 1ZD1A 1EPUA 5D7NA 4YCSA 2ZE6A 4JLVA 3KHKA 2IXBA 5DT9A 1MO4A 5KTPA 3KSDO 2EARA 2PZLA 4R01A 2XTZA 3PG5A 5FQOA 2XZDA 1VJCA 3AI7A 1NBIA 3NOVA 2HHAA 3ADCA 1TEXA 4MRPA 1SG6A 1YDEA 4ZT4A 1J99A 1H8HA 2J09A 1BAPA 2VJMA 1OB2A 1KVSA 3AZQA 4G1UC 4F5WA 4XASA 4HDSA 3NHUA 4PX9A 3A37A 1H2AS 1PG5A 1G8SA 3ANMA 2ATEA 3IEPA 3R5SA 4ZO4A 5JDIC 3RS0A 3CF2A 4ZGWA 3W0LB 2O0MA 1HE1C 2VHQA 4O02B 4JB3A 2PUEA 3NR2A 5JR3A 2GOYA 1D4ZA 1NXXA 1QG2A 5KCZA 1NQXA 4UDNA 1NLFA 5DXJA 4ZZ0A 3ODGA 2A9FA 1L5LA 3WYGA 4ZYZA 2RGGA 1QZUA 3LLCA 4Q21A 3MJTA 1UT6A 4X91A 3FRIA 2IY7A 2R1VB 3I83A 2Q7DA 3LNCA 5FI1B 4BFXA 2R00C 1EVIA 3TB4A 4F5ZA 4LYHA 1L6IA 3T1VA 4PCVA 1HO3A 1XZIA 5E6RA 4QJ4A 1FDTA 1BCSA 1TVKA 2HPAA 4KMOA 5LQDA 3C1UA 1QOZA 1TK2A 4LUCA 1PQYA 4FI3F 1E58A 3FLBA 3RTDA 1RCUA 2PWYA 3PE6A 5IX8A 4JV5B 4CWAA 2WSLA 3NHPA 4WZBE 3SF0A 4BKQA 5L3SA 1IN7A 1KBOA 2NTEA 2JLAA 1Z37A 2AJ8A 1P2VA 1E0JA 1PFKA 4Y2YA 3BRQA 3QYJA 4WXMA 2Z1NA 4KREA 1FDVA 3RYCA 1EQUA 4MLCA 2WHQA 2RH5A 4YH1A 3AOEA 4MKFA 2Q3MA 4UPEA 1JL3A 2GCEA 4X94A 4A6DA 4PR3A 3RJ5A 3FHOA 2ZWAA 3V8MA 3OZVA 4CLRA 1YH3A 4DLNA 1PJSA 5H7XA 3SNHA 5KX5F 4HLDA 4RXUA 1BKDR 3B8HA 4DV0B 1F0PA 3A31A 2YXPX 3GFVA 1LZKA 2RG1A 5IKEA 3MWKA 1MRNA 3VYVA 2X8LA 2C5EA 2D2XA 5E6SA 1R64A 5FJJA 4LY3A 3VPAA 1SJ9A 2J0UB 1EHYA 1LD3A 1W19A 1GAJA 2PGNA 3AC0A 4LSWA 1ZD9A 5LD2B 3PCRB 2PXHA 3HGMA 1PZMA 1TU4A 2PANA 3HYNA 4BMXA 3FFTA 1GN9A 5FBLB 1VSTA 1J33A 2R8ZA 5KIAA 1EFPB 4A2CA 1X70A 4BASA 1SXQA 1IK6A 4AMGA 3H1AA 3PGVA 5AVZA 2R48A 1I01A 3MPUA 2R8YA 3K5PA 3MCAA 4X90A 4R8SA 3F4LA 1FBTA 3TZLA 2EJUA 1A50B 2R1ZA 5HOEA 5IZ4A 1QIMA 4RVDA 2YY6A 3MLBA 2NV6A 3KV3O 1F1BA 3ECAA 2R1TA 3PHCA 2XVZA 3COYA 1PN3A 3ESBA 3L7AA 4WK6A 3PQ6A 3LHSA 1F2UB 1MLDA 1QE3A 2PMBA 4FBLA 3HDGA 4K9NA 1WEHA 2E87A 3DDZX 2YWCA 4O0LA 4TSFA 4W5HA 5CLQA 1BO6A 4KPGA 3RM3A 1P91A 4LHXA 1XU4A 1G6Q1 4C4PA 2Y0DA 1XZGA 2IDJA 5BYKA 3TDNA 1ZUNA 2HDOA 1XWIA 3V4RA 1N2IA 5KVAA 4ZVUA 1XZNA 4AJ9A 3WP1B 2A5LA 1VMIA 4HR7A 3ZGNA 3BXPA 3GLRA 3ZH2A 2IYVA 2HCTA 1VIAA 1A9ZA 3P9XA 2FOXA 2FEWB 1Z0IA 2ENWA 3O73A 1PZGA 1QIIA 3L84A 1XLTA 3BKXA 5A6SB 1IY2A 5C5EA 2P40A 4QBTA 4U2GA 5JCJA 3A2LA 2AFVA 2Q2QA 5A4JA 3WB1A 3DOUA 1N1DA 4TL7A 4TROA 5JC1A 4FM9A 2R7MA 1YMQA 1SXIA 2J31A 2R6HA 2WPDD 2Y1WA 4DSUA 5BWMA 3DO6A 4FFBB 3OMLA 5EHXA 1PT7A 4JLDA 3Q6IA 1A9YA 2ZM6B 1HSZA 2ONJA 4DNOA 4LJLA 4NV1A 1DJOA 1R9NA 3SG0A 2XUAA 2I91A 3BXXA 1A71A 1SN7A 3ICCA 2HLHA 3LUKA 2AUMA 4RD2A 4C07A 1KNXA 1KZGB 3U13A 4O4IA 2QQ5A 1JR6A 4FW9A 4CNBA 1YUBA 2RC6A 3ZWCA 3GRVA 4M88A 5T6MA 3BRWA 5BSRA 3WYEA 4DC0A 3RFCA 4H15A 1NNUA 2V96A 3PXDA 2YWGA 5A5GA 3HEMA 1QGUB 3ZHZA 4V0MA 4V38A 1EEXB 4WOCA 1G2QA 1OHHD 3T5DA 1GFIA 4QC2A 1Z08A 3EVEA 4GP6A 1GGFA 4Z4GA 2RGEA 2XGSA 3AX6A 3RFTA 4N76A 4B2LA 2WHPA 4BYGA 1TPZA 4D8TA 4G86A 5LXTB 4E09A 2RONA 5JW6A 1Y34E 2LUOA 4HUQB 1FVHA 3A4LA 4L9SA 1BGWA 2WD9A 3HB9A 1AUOA 2I6SA 3I34X 3GVHA 5E4JA 4QA9A 3TNFA 2ZWOA 4CF5A 3ZY4A 3RSCA 4RANA 5JJ5A 3DB2A 3EUEA 3HVIA 4WMLA 3U5ZB 2RHMA 3R3XA 3B2EA 1H6DA 1T9GS 5F23A 1I5OA 1FRVA 2GTIA 3O47A 2O5EA 2HIHA 2F90A 1WXGA 1T2UA 5H4HA 5EMMA 4XFDA 2R96A 2OOSA 2ZB3A 5F12A 2SICE 3ZY6A 1NVXQ 4BNZA 4D4GA 1M75A 5F1YA 4C0BA 5KTOA 3ND7A 1J0CA 1EAMA 1RQPA 1P0FA 3IA7A 4PIPA 3I64A 3RCBA 3BXGA 1CUSA 4HH1A 3ZGXA 1X92A 1D3AA 3PLRA 2GZ1A 1QCCA 3ADKA 3D59A 3HKEA 4HPWA 5IP5A 4INOA 3L49A 4NH4A 3U4CA 3UWSA 5AI8A 3PCTA 2BFAA 3WIVA 1J8MF 4PEVA 3GT0A 3PUXA 3CRMA 3W79A 5I01A 5KTSA 2APJA 4B5LA 2ZBEA 3I6MA 1EP2B 3NC0C 5EI5A 3E35A 3VAZA 2B2CA 3DVQX 5C8XA 2NV2B 1ZJ6A 4Y6LA 4DZTA 3BWVA 1L1RA 5CFLA 3C41J 3Q0EA 3A4VA 4C4SA 5LDHA 2CDBA 2JK1A 5IVPA 2CLKB 1G5IA 3T4UA 1CY7A 2FJ0A 3DOIA 3LL4A 1RRMA 4QPCA 1V3VA 4CM4A 4MV5A 2XD4A 1L3CA 3GJXC 4MWSA 5ILGA 4LQLA 9ATCA 4CHGA 1YS6A 5LZ4A 2D1RA 4HHEA 4PNZA 3C8ZA 3PC4A 1J24A 1V7CA 2JBHA 1DBRA 1JJIA 2IYYA 3D6VA 2RAFA 2RD2A 3FZNA 5F2KA 1WZ2A 1T9DA 4QTXA 3IR6A 1FRFS 2PH3A 2DWQA 4RCYA 2A5DA 1R88A 3RJ9A 2QLTA 4XQ0A 4KRGA 1BXGA 2D62A 4GYYA 2AS0A 4NIMA 4D99A 5FR1A 1DDIA 4DIDA 3U56A 1ZCJA 2E55A 2ZT6A 3RVNA 1XALA 1A5SB 3GJ3A 3OPXA 4WUVA 3RI3A 4WBNF 1JAXA 3MHPA 2P5SA 4CT0A 1XL1A 2FMIA 5FTWA 1CVIA 1T5BA 4F6LA 2GR9A 3SQOA 1C41A 2DFTA 2VDOB 5JPIA 3PENA 3SXUB 3O4VA 1JMVA 4POAA 5DLPA 1X15A 3UJDA 1ZKMA 3Q3HA 3IEUA 5LQSA 1BMFA 1H2BA 1WMBA 3ILXA 1EVQA 3RYIB 4CF6A 4C7VA 3NJ8A 3ORRA 3FCCA 5D87A 1ZP6A 1WCYA 3VSDA 1Q17A 1B2LA 2XDAA 4QUJA 4IQ0A 4GX2A 3DBLA 3H05A 5EIBC 2DPMA 4D92A 1GSOA 3LT2A 2GWHA 5DBEX 3KC2A 2CMKA 5ALJA 5H68A 3IQIX 2EG9A 1CQJB 1WXQA 5G3ZA 2ZWIA 3DR5A 1OWNA 3OSZA 1R3UA 1BW9B 1CJMA 2WU1A 2R62A 5JZOA 2RCYA 3GZJA 1GL7A 3K0AA 5FTMA 3JARB 3L0ZA 2WNIA 1MF7A 2BGTA 3FRHA 4J0EA 2OUKA 3D6MA 1I7LA 2C5FA 4L4YA 1COZA 1XTQA 3K1TA 4G1FA 6CHYA 5ADHA 3JR3A 5CVUA 4ZA2A 3HP7A 4DTIA 5AFSA 3AUYA 3R0VA 4EENA 1LSSA 5HJ5A 2BDUA 3JQ7B 3HDTA 4DDVA 5C52B 1ZN2A 2BFDB 2PV7A 3RK1A 2JLVA 2VZLA 4J2TA 2PXXA 3V4ZA 5B36A 2BEUB 2UZ0A 3TGPA 2R66A 3DE7X 4I8XA 1GAQA 5BMOA 1S1MA 4DJDC 4NV0A 1GRQA 2GK3A 4YP5A 2RHTA 3O9MA 9GPBA 5IF9A 3NIDB 1JAIA 4YJFA 4EJSC 1X19A 2PKEA 1Y3DE 4TN5A 1JWLA 1NQTA 2VYNA 1HLPA 1E9DA 1U1IA 4PXYA 1EA7A 4Y2GA 4XYMA 4ZKDA 4HGOA 3WGIA 3L4EA 4QRHA 3IESA 3JX9A 4N3NA 3ZE2B 1FTWA 1MAWA 2VEDA 3ZCRA 1W96A 4BVAA 1JBEA 5CLJA 4D25A 3FMOB 5IKOA 4TVOA 4NTZA 4QJ3A 3P9IA 3WE7A 4DCJA 1QK5A 5J3JA 1C3JA 3JWPA 5L4SA 1UM9B 2PFSA 1E99A 3GU3A 3K0FB 3HKDA 3N5KA 5HFAA 1OXUA 2OWEA 1JVSA 1LQ2A 1Z13A 1WD5A 2UZIR 5B1YA 2CMDA 5JXWA 3KT8A 4OM7A 4A6EA 1WMSA 4D82A 5LKAA 3EJWA 1JFFB 4UEJA 4YP6A 5DLDA 3Q7RA 3AVUA 1WUHS 2VYCA 4OHOA 2CK3D 3B20A 5ALTA 3LMKA 3DTNA 3SSAA 1HM5A 1JFLA 1Q3TA 2FWIA 4DMKA 4K05A 3WYAA 4IDCA 3NC1C 4EGQA 1AGYA 1KDPA 1V3UA 3D0RA 4Q12A 4MQ4A 4H16A 3IBSA 4YS6A 2ODEA 3GDHA 1JH8A 5IWAB 5KQGA 1EVJA 2P65A 1XZKA 4B0OA 4LHYA 2AKEA 1HBJA 4IJ5A 4B3HA 2JAXA 4PRZA 3G59A 1F0NA 4BU0A 4W8OA 4ACBA 2Z2XA 2VTKA 3EC7A 2QN9A 5DRTA 3PQ7A 3WK6A 4C78A 3T5AA 5H83A 1IDN1 1GGKA 4PBRA 1L6RA 3IT0A 721PA 5LOVF 1EZ4A 1FNDA 3D6HA 3O8OA 2OQIA 4ESVA 1USUA 3QIAA 4QYIA 3PEWA 3QM1A 1E89A 1VP3A 5JJKA 2XB6A 3DYVA 1XA0A 2P9YA 2QD1A 1RLUA 1WUTA 4JR1A 4ENVA 3DXXA 1P19A 2OHFA 5AHOA 3H5TA 1D0SA 2IYQA 1OQAA 3EDRA 2F64A 4LQDA 3VTZA 3GJ6A 2J5BA 5C1PA 1XQ9A 2R6DA 1UC5B 2A0XA 2RFLA 2QPTA 4Q47A 4UVEA 4MCJA 3UJNA 1KE1A 5CA1F 1EA5A 2Q28A 1OWOA 1UC8A 2AOUA 4MPRA 1TUIA 5CT4A 4XYLA 1FU8A 5K2MA 2JFBA 1EE2A 2SNIE 2SCUB 1Y3CE 1UR5A 2PUWA 3DL4A 3HA3A 1EK5A 1E96A 3MFQA 3O4GA 4AL4A 1PYGA 3D5EA 1QYWA 4FI3C 1RZRD 2PWZA 3T34A 3EXG2 2LW7A 3Q98A 3THRA 2ZRIA 4FDTA 5K1ZA 3VJMA 3QOFA 4ZXFA 4B84A 1JXQA 3ZZUA 3AR9A 2AUTA 4PLTA 3EVBA 2HRZA 5DE3A 3GB9A 4N6NA 3AF2A 3AF4A 5EN4A 5AR1A 4CZ2A 1CZOA 4N7MA 2BFBA 1G2IA 5K0TA 3UMMA 1DUVG 3ZTYA 4ZGBA 1ZM9A 4DR4B 2ECKA 2R6ZA 1Y5IA 4Q7LA 2HHJA 3PQ4A 4M1EA 3NBMA 2CMFA 5JWOA 4AMZA 1C7IA 3EMBA 2QT0A 2VLBA 2ZK7A 2O0LA