5IUNC

Crystal structure of the desk-desr complex in the phosphatase state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
131
Chain Sequence
SMISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase DesK
publication title Regulation of signaling directionality revealed by 3D snapshots of a kinase:regulator complex in action.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase/gene regulation
total genus 44
structure length 131
sequence length 131
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iunC00
4LE0A 6CHYA 4OBBA 4IMJB 4Q6WA 1NXPA 4N0QA 1CEYA 5B3JA 2PKXA 4F12A 3LMKA 3SAJA 2VUIB 4NQRA 3I09A 1DG9A 3O1HB 5JS1A 1J56A 5JNWA 3OLYA 3GL9A 1DCMA 5DTEA 3GYBA 2MSLA 2MYNA 4N76A 1QP4A 1DBQA 1P2FA 4YS6A 1R8JA 3SG0A 1XWWA 1VKRA 1NXWA 2E4WA 2FQWA 4KPYA 4KK3A 3NHMA 5TQ0A 5D2CA 2A9RA 2MYUA 1D4ZA 2IYNA 3GWGA 2FQYA 3KG2A 4MQFB 3OQNA 1OXBB 1LBIA 3F7NA 4RK0A 3FGZA 1NXOA 4EGSA 1GUBA 1JFSA 4MR8B 3EJWA 1QQBA 1PNTA 3K4HA 3FDFA 1QKKA 3N8IA 4YLEA 5DLEA 3BILA 2PAFA 4RWEA 1ISSA 5DKFA 1URPA 2LUOA 3H1FA 3KYJB 4TN5A 1DBPA 1I3CA 3N53A 1FSPA 3MF4A 4YGXB 1ZGGA 4RK6A 3RVRA 1JH9A 5E3JA 3VNBA 3O21A 2RDMA 2WY2D 4LDAA 4EYQA 5EWJB 3TD9A 1A2OA 4F8JA 1BDJA 2E4UA 3JS5A 1TLFA 1NXSA 3LUJA 4YCSA 4NCAA 3H5VA 3EODA 4PE5B 3LUCA 3RVSA 1QMPA 3T8YA 1JFTA 4RY0A 1PHRA 1YMUA 1DRJA 3KKEA 4G0OA 4JAVC 1SRRA 1RNLA 1P8AA 2JB9A 1U2QA 2FEWB 3O2SB 4G0YA 4MYRA 4MRMB 4KNYA 3P9YA 2M1ZA 3NNNA 4YO7A 4Z99A 4XFKA 4HNRA 1AB5A 3QK7A 5HKOA 4XARA 2HQBA 1QPZA 1TM2A 4MQFA 4UHKA 2CD7A 3QX8A 2BGGA 1VPWA 2R48A 2FEKA 3CU5A 4XAQA 3EQZA 2MYTA 4MR8A 4E7OA 1MAVA 4UHJA 1RZRA 1APBA 3T6KA 4XASA 1BDHA 3UK0A 4NCBA 1XHFA 4MR7B 4XLTA 4W5RA 3IPAA 5KQPA 2OQRA 2R25B 3GBVA 2FMHA 5TPWB 1SXHA 5IC5A 5BR1A 1Z16A 3BREA 3JVDA 4QYMA 4RSMA 2FMKA 3M9WA 1FFWA 4G0PA 2TMYA 1JF8A 5PNTA 4ETIA 2FVYA 3N0RA 2PJUA 2NT3A 3C6QA 5EWJA 2JBAB 4FE4A 4JOQA 3ROFA 1BAPA 4N47A 1T34A 4YV7A 3OM1A 3LUDA 4Z0NA 3RVLA 4YWHA 1DZ3A 3A0RB 4D6YA 2IKSA 2PL1A 2QV0A 3MMNA 2N9UA 4S04A 4W5QA 3FFWA 3E61A 1W9HA 2WMYA 2QVCA 1TMYA 1D1PA 3KHTA 4QICA 1DJMA 3CTPA 2L19A 5TQJA 4MQEA 5BQ3A 4MS1B 4PICA 1YS6A 3MYYA 3FFTA 4G0ZA 1DCFA 2WWVD 3RVOA 1USGA 3G85A 3HCWA 4KVFA 2FXIA 5FWYB 3S99A 5KQGA 3OQMA 1U8TA 2GX6A 2GI4A 5HQJA 3URMA 4EVRA 3HM9A 3E3MA 2QU7A 4WT7A 2JCGA 1XHEA 1U2PA 2VUHB 3H1GA 1Z12A 3HVRA 3N6VA 5FBKA 4DN6A 3GV0A 3HDVA 4WWHA 3LTEA 5FBHA 4PEVA 1YMVA 5I4CA 1QP0A 4WXMA 1DC7A 5B3JC 1ZDMA 3Q7RA 3QLTA 2QR3A 4W5NA 5IUNC 3QEMB 1GCGA 4B09A 3LUAA 7ABPA 4LRQA 2WRZA 3OO0A 4YRZA 4S05A 2E4XA 3HUTA 4HNSA 1LK0A 2FKAA 1U0SY 1C0EA 2PUEA 2ZAYA 3RVKA 2FMFA 3B2NA 3SY8A 3HEBA 3IP7A 2J48A 2RJNA 4YR7A 4ZMSA 3OO1A 4HNQA 3HUUA 3GA5A 1ZAYA 1F51E 2R47A 4EYOA 5EWLB 4F11A 3IP6A 3Q9SA 4MGEA 5EWMA 5TE9A 1W25A 2YHBA 5FWXB 1Z25A 3L49A 3RVJA 3TB6A 4O1IA 2F8SA 1FFSA 3C3KA 4JP1A 4KK4A 2GKGA 2FEPA 4H60A 5ED4A 5TQ2B 3HDGA 4ZPJA 2NT4A 2LPMA 3CFYA 4TLMB 4Z9BA 3RVPA 4O1HA 4MLDA 4RZSA 1BA2A 1SXIA 4MS1A 1Z2DA 3SNKA 2AYXA 1JLKA 4G0XA 4KZKA 4RY9A 5FWYA 4MS3A 4F06A 1M5UA 3NHZA 1JX6A 4JB2A 3A0UA 4IILA 2RGYA 4P98A 4RDCA 5KQMA 1M5TA 1ZN2A 1RPJA 3DGEC 3A10A 1Z18A 2PL9A 3MIZA 5TPZD 4MAAA 5JNRA 4NV3A 3O75A 3DLBA 3CZCA 3O1JC 4MS4B 4ETMA 3OLXA 1USKA 2PUDA 2JK1A 1L5ZA 1JDPA 2IPMA 3H6GA 1PEYA 2PE5A 1FQWA 2CWDA 1P6UA 2GBPA 2IOYA 2FMIA 1ABEA 2A9PA 2FN8A 4TLLB 4Z9AA 2IDMA 1C4WA 3HSYA 3QEKA 3N75A 3Q7SA 1ZITA 1KRWA 1RXEA 9ABPA 1M2EA 2VYCA 3F6PA 3H75A 2I6FA 4KQ9A 3DBIA 4Q7EA 1JWLA 1E6MA 2JVIA 1Y1LA 2P9HA 3EAFA 3EGCA 5C5CA 3QLUA 3HJFA 1Z15A 3LOPA 1CHNA 5CNKA 5DCLA 4N41A 3OMWA 2MSKA 5EWLA 1L5YA 2GWRA 4G0MA 3IP5A 3CHYA 1B00A 3O1IC 2B1JA 5FWXA 4KRFA 1YVUA 3T38A 3Q41A 3ILYA 1EAYA 3SQNA 4RK5A 1U04A 1S8NA 4E7PA 4Z4FA 4ZJPA 3OMXA 1ZGZA 2ID9A 2A9OA 3IPCA 5BRJA 3SM9A 2HPHA 3CG0A 3ROTA 1NY5A 2MSWA 4WUTA 1YK1A 4JA2A 4PZ0A 4Z4GA 1OXKB 3CLKA 2FTKE 2IPAB 3H5LA 4GNRA 1DCKA 5JNSA 4DQDA 1M2FA 3NNDA 4IF4A 5JNUA 1SD5A 3MM4A 5KQLA 5IBQA 4KREA 2ZWMA 1Z17A 1Z26A 3H5OA 2H0AA 1EWKA 4Z4HA 2P4UA 3LUFA 4MS4A 2YHAA 4PYRA 1ZVVA 1A04A 3BRSA 1QQAA 5JNTA 1NXXA 1MIHA 1D2AA 1SXGA 3KSMA 1E2BA 2QVGA 1E6LA 1QO0D 1TJYA 3I45A 5BRAA 4Z4IA 4MLCA 4RY8A 5CNIA 3ILHA 1ZY2A 4ZYLA 3GRCA 4N0PA 5IEBA 1QNLA 1ZESA 5CHYA 5KC8A 5HM6A 1GUDA 2LBPA 2NZUG 3OLWA 2RJOA 3H5IA 3O74A 2JVJA 4MRMA 2WJAA 3RVMA 3JTEA 4RKRA 1JHZA 3QLVA 1BDIA 3QX9A 3KLNA 2F8TA 3C3WA 3K9CA 3NNSA 1WETA 3F6CA 2E4VA 4Q6BA 2L2QA 3M6MD 2WJWA 3HV2A 3H1EA 3H5TA 3CRNA 1KGSA 3JY6A 4MPTA 4CBVA 2HSGA 3KCNA 1AB6A 3N0XA 1PNRA 1HEYA 2PUCA 4EUKA 4Z4CA 4L4UA 4KV7A 3IDOA 4W5OA 4M88A 3IP9A 4L85A 4MR7A 1DC8A 1NTRA 1TVMA 2DRIA 2PMCA 4ML3A 1YTUA 1LBHA 4IRXA 3I42A 5TPWA 3EQ2A 5HSGA 4MR9B 1KRXA 4D6XA 4KMRA 2LP4Y 3BBLA 1JYEA 5T3YA 4EYGA 5KWSA 2QZJA 1BVHA 1YIOA 1P6QA 2IPLA 1VRVA 4JB0A 3QELB 4NICA 2JBAA 3CG4A 2LIVA 4ZMRA 3A3KA 3EULA 3GT7A 2A9QA 3FMVA 1DBWA 1NXVA 5GOTA 1D1QA 3LUHA 4HYEA 1PEAA 2L17A 2CHEA 5GQSA 1JYFA 1ISRA 1K66A 2JRLA 4RK7A 3N0WA 1CYEA 4RXUA 1JDNA 1ZHHA 3DLHA 1MB3A 1Z2EA 4LE2A 4ETNA 3HK2A 3F73A 3RH0A 4RS3A 5DGCA 8ABPA 1KMIY 5IUJC 1JL3A 3RQIA 1UDRA 4Z4EA 4EVSA 3VNAA 5IX8A 1Z13A 4DADA 1GCAA 1IIBA 4OTZA 2X7XA 3Q7TA 3UUGA 5ABPA 4OLAA 4O5AA 4WZZA 3CKMA 3GBPA 2HJ9A 3C97A 3DGFC 2O20A 4LX8A 4RK4A 3D02A 3JVIA 4H3KB 2M98A 3H6HA 4KQCA 2B4AA 3QEMA 2HQOA 1EWTA 5TPZA 1ABFA 3RVNA 2E4YA 2QXYA 4RKQA 4OATA 5IULC 2FLKA 1A0OA 4FB4A 3HXMA 4D74A 3RVQA 5KC9A 3CNBA 1FFGA 1NATA 4MR9A 2QW1A 3MQ4A 2FQXA 2FW0A 4FE7A 3LKBA 5KI6A 1PUXA 3L6UA 3JPYA 2PUGA 3I5AA 2CHFA 3QELA 4QYWA 1ZH2A 3KYIB 2PUFA 5IUKC 2Q5CA 5F64A 3FFXA 1NXTA 3OLVA 1DRKA 3QLUC 4YP9A 1F4VA 3O2QB 5IEJA 3KS9A 4N03A 1E6KA 2MYPA 5TQ2A 2QSJA 4MQEB 3R0JA 2H3HA 4RXTA 4RV5A 1YS7A 2VK2A 3DZDA 4RU1A 3HO1A 4F3TA 3LUKA 3LKVA 4G0QA 4RK1A 3W9SA 3LFTA 1RZRD 1JFVA 4RXMA 3NBMA 4LDZA 3HZHA 2XDYA 1H9CA 3LUGA 5CNMA 3O2JA 3D8UA 3MA0A 3G1WA 1USIA 4IMIB 4LE1A 1GLGA 1JBEA 4GPAA 2OENG 4JASB 1MVOA 2FSPA 3JPWA 4XXHA 3CZ5A 2FN9A 5CNJA 3HS3A 1DP4A 3CS3A 1LJUA 3KLOA 4LZLA 4H3HB 3BRQA 1RXIA 5T7BA 2HQRA 3OM0A 3OLZA 2PUBA 2ID7A 4EYKA 2WB4A 3TX6A 2IPNA 1K68A 1D5WA 2KYRA 3H5WA 4OG2A 4G97A 4EVQA 2NZVG 3TMYA 1QO0A 2PLNA 5TQ0B 4TMYA 2FLWA 1VLZA 1EHCA 5C5EA 4EY3A 2W42A 4G86A 2E4ZA 3M9XA 5EWMB 3Q15C 4IGAA 4P1ZA 2NUBA 1LJLA 3C3MA 4KFCA 2PUAA 4Y9TA 4WXEA 3QLVC 4QPJC 3EDCA 5JS2A 3KTOA 5JNVA 2AYZA 1ZH4A 1QP7A 1EFAA 1MB0A 1EWVA 3KJXA 2V0NA 4OLBA 2L18A 3OQOA 2JVKA 3T95A 6ABPA 3TO5A 1YK0A 4MS3B 3UKJA 2R4QA 4W5TA
chains in the Genus database with same CATH superfamily
2O1WA 4ZVMA 3N59A 4RANA 5JCZA 3Q12A 1S2LA 4WINA 1W34A 5B3JA 3DQZA 2IH4A 3LMKA 1Z0ZA 2JBWA 2P90A 4NR0A 3TYXA 3MJVA 3O1HB 3D6AA 1NVGA 4CMCA 1TT5B 4GQBA 4NCIA 4DLAA 2C3YA 3W6UA 3GL9A 1L8XA 5KOHB 2PKWA 1P4HA 1S2OA 4PLWA 2NP6A 4FLEA 3B85A 3L8YA 1HURA 2QUJA 4IFEA 1QFSA 1EPUA 2IKQA 1T9GS 5LQUA 1XDBA 4URYR 3P9PA 1DXOA 1W4ZA 1AKUA 1II0A 4PBRA 3IAM1 4FI3F 5EVJA 2JATA 3R2JA 2QRLA 5IDWA 1U7PA 4PN7A 3B52X 1W581 3B78A 1SXPA 1U3UA 4JQCA 4KK3A 1T2EA 3KAJA 3G8AA 2EEZA 4CQNA 1MV5A 2QTVB 3BH7A 3IESA 3SMQA 3RSHA 2CVOA 1C7JA 1IAQA 5K8TA 2QORA 2AOWA 2FPIB 2DWUA 4NY1A 2GN6A 2BEKA 4I55B 4OREX 3OOHA 3HCAA 1R00A 4KAAA 3VMFA 1SUEA 4JS0A 1E5QA 4CKCA 2A0YA 4ZZ3A 4NV1A 3I1FA 1O77A 2CZQA 1YVEI 2AQKA 1KR2A 2F9MA 2EBHX 5FI0B 2YIJA 3GIWA 3IUYA 5K05A 1WRBA 1G0NA 3MC1A 2P30A 3OJFA 4HQ0A 3FF1A 4R31A 3MUEA 4LKRA 3TSWA 4JEIA 2QYSA 3UYKA 3NHFA 1Q3TA 4II3A 4ZDWA 1NONA 4FE3A 4GGPA 1YZGA 4UU1A 5KU7A 3I9V1 1YUMA 5E95A 5C1IA 5SYMA 1MKYA 1PFQA 3N58A 1QOQB 2E4UA 4B3GA 4X9XA 3IVMA 1FX1A 3LLCA 4ND5A 4RULA 4LFAB 2I33A 3MWEA 1GPKA 1XTKA 3FNRA 4PAGA 1I4WA 2BTOA 4BQFA 2HW8A 4OY3A 1KNQA 2HRZA 1G2PA 3ETCA 3L4EA 3R0ZA 5JALA 4FWBA 4Z0TA 3M2PA 5ALKA 1JFTA 4US0R 4IXMA 2XWPA 3BMXA 3IBSA 4JAVC 3VKUA 1G8PA 5HPYB 4MB6A 2WAXA 3CO0S 5LQNA 3U6KA 3BIWA 6GPBA 2HF9A 2NACA 3O83A 2OZKA 3NBFA 1XFDA 4LPKA 2RIPA 4RIIA 4EB3A 4UASA 4DV6B 5I8ZA 4YUAA 2P78A 3M49A 1BU8A 5E4YA 1VIDA 2DCUA 2HXYA 4QQRA 3IEIA 3KTDA 5I9IA 2B2NA 4YMWA 2FPIA 1J0EA 2PSHA 3TOSA 1PDOA 5KJEA 1D1TA 3GNLA 2C2YA 2NO9A 3QBJA 1E5XA 5I8WA 1NVKA 3AVPA 3E9ZA 3EQZA 4B7CA 1KNXA 1V5EA 4AKIA 3UAOA 1R5NA 1CQIB 3DOCA 1NASA 2WKWA 4M55A 4PSUA 4ZOQI 1G8AA 3H3FA 3MUNA 2MSEB 1BX3A 2RH8A 2ZU0C 3C8DA 4PZYA 4X1IA 3RYIB 2JLXA 4GX1A 5IM5A 1CBUA 2V5VA 3TJMA 3VISA 1S6YA 3DL0A 4GG1A 3V1YA 1Z16A 1NE2A 4KV9A 4QYMA 5FUXA 4AYXA 1QCYA 1A9ZA 1ND5A 4CEJA 2PJUA 3AZOA 1L4YA 5AO9A 3M4ZA 4FJ1A 4FYIA 1BGVA 1HE5A 3I4LA 3GJ4A 1ZICA 3H11A 3GJ3A 1JQAA 1WY5A 2UZ0A 2W7TA 4FJ2A 5U1PA 4A4DA 1C7QA 2BBWA 3R6GA 1E3JA 1ZU5A 3TAXA 1KJZA 3VV3A 1R16A 1AT1A 2RIRA 4EGFA 3RHFA 4UBNA 1J6UA 3E5RA 2L19A 1MIOB 3FPAA 3CLSC 4MQEA 3KHKA 4MS1B 1FDRA 2P4HX 5AXAA 1FS4A 4NNOA 5L7WA 1NDQA 3ZZNA 2IBMA 4ZI3A 1UCFA 4DILA 3M82A 1GDTA 1E69A 3RS2A 5JIBA 4ZREA 4WKGA 1E2LA 3A70A 4PNHA 3LF2A 2L0XA 4JUIA 5IS2A 3TQSA 1V39A 1PHPA 3A1DA 5ARBA 1CJKC 3BMCB 4A6XA 5J23A 1NNSA 3MELA 4A0HA 4YMLA 3KQUA 1C1YA 1WMBA 2GF0A 2QPLA 4AN4A 3KUUA 3B3QA 3B6JA 2GBLC 4KQWA 4DWVA 2YV1A 1DMSA 1ZDMA 2F1KA 2OC4A 2KWIA 1CQIA 3VU3A 1D1SA 4MQ6A 1R0KA 1E1KA 2E4XA 3ZZUA 4GDMA 5IVDA 1P4RA 2HOQA 1WMEA 3DR5A 4CJXA 4XJTA 2QX4A 2FR8A 5TQVA 4UTRA 5KHAA 3EXIA 1IOWA 1J5PA 3GDOA 1LPPA 5FPSA 5LYJB 3FB4A 4LC1A 1EK2A 4DPLA 3ORYA 3HDHA 4AD8A 2J9ZB 1C8VB 2XNJA 3HUUA 3UB4A 4PZ9A 3Q7QA 1PD1A 1XMSA 2R47A 3N8KA 1R8QA 3P5SA 4LZPA 1HL7A 1HT3A 3IP6A 3Q9SA 3EH2A 1EDEA 2PN1A 4G1VA 4MGEA 4NE2A 1VP9A 2I2WA 2AVDA 4TL9A 3T5TA 2J0VA 5TJ9A 4HVLA 5KIAA 3SYNA 3WLOA 4IW3B 1NBEA 4MVYA 4DV5B 4IJMA 4KSYA 4JP1A 4DW8A 4K03A 3FXAA 2MCFA 1SVKA 5ED4A 3LIIA 5DRTA 3U80A 2J6CA 1N92A 1PX2A 1ULUA 2B35A 5FT9A 4HV4A 3FOAA 3LI2A 3GLGE 4Q1FA 1MIOA 3GPCA 4MS1A 1PFYA 3ZHRA 2AYXA 3SCZA 1GKIA 2GPBA 1CUWA 4YJ3B 5LQSA 3RIXA 2DTDA 2EP7A 1IE3A 4JB2A 4QLAA 4Z1OA 3EIUA 4KO4S 2C7GA 4PYJA 1W1UA 3IP1A 4TKZA 3S4YA 4KHPB 3LHSA 1TYEB 3QOWA 2X9NA 2WAMA 3ESAA 2J85A 1DKQA 3X43A 1JZSA 1XA0A 4GI2A 1NP6A 4ZZ1A 2VHZA 1AQJA 3GJSA 3MWGA 4NG5A 1TU4A 4ZOAA 1WB9A 3VGPA 3QVKA 3UT0A 4DLYA 1Y37A 3EMVA 3M0EA 4HEA1 4QLOA 2PZLA 4RVHA 4U2EA 1NI4A 3DOIA 3R76A 3H1PA 1D8AA 2WUDA 4OXYA 4C0LA 4I08A 1M6HA 1JHXA 3QEKA 3TNJA 5JANA 3F7OA 1UXOA 4L4RA 3IUEA 3N76A 3LWBA 1G21B 2PX0A 2XKAA 3INTA 4OQYA 4JI6B 1WCWA 5LYJA 1CR4A 3HDJA 1JIJA 3H8SA 1UP6A 3OZSA 4OB7A 3ROPA 3QLUA 1YZUA 5ALDA 5DNEA 4Z2YA 3NVDA 2ACEA 3I5UA 2ZANA 4GXQA 4O3FA 3OE7A 4K9NA 4BU0A 2YYAA 1RM3A 4G1CA 1T0HB 5AVUA 4LF4B 4QTYA 3H2IA 4B4DA 1BIFA 1PR1A 1ZKDA 5E7IA 1WUTA 2YY5A 2I34A 3HWWA 3IUPA 2FPOA 1RLJA 5CTJA 5FNVA 4E7PA 5IK2A 3RFTA 1QBKC 3OMXA 5TVGA 1R74A 3JQ8A 3R8CA 4B5LA 3OTQA 3SM9A 1ECLA 2GKSA 3AHJA 1DBSA 2QYOA 1GPH1 3HUEA 3PNKA 2AMJA 4OQQA 3GT0A 2WIBA 4BCCA 1N2GA 3PFCA 4YJ3A 1NSTA 1OXKB 2NYUA 5K0CA 1RE0A 2EZ8A 2OO3A 2P9TA 3K71B 3B48A 4KREA 1VHJA 3AUJB 2ZIXA 3D3NA 5BSTA 5EY5B 5LA6A 2PGIA 1ES9A 5AVWA 5U9CA 1IBKB 5ALVA 2JGJA 3BRSA 1M2WA 1ZCFA 4RF4A 4ZVLA 4D8TA 3KV3O 2Q3BA 2CGEA 1KRHA 3OFJA 4FEEA 3N07A 4E3WA 2ISSD 3B89A 5CT4A 1ZR2A 2JANA 3QY9A 4O2BF 2P6NA 3BWXA 3I2KA 5IEBA 2FUKA 1EVIA 1PQPA 3FFAA 5F12A 1FB5A 3CWZA 1KJNA 4HMPA 4M86A 1L9KA 4BP3A 1FNDA 3KZOA 3AVXA 1RE1A 3LV8A 4LN1A 4TXHA 4QDUA 3EFBA 2C20A 4PSAA 4NXMB 1G21A 3SEQA 3V42A 2DWQA 5DGDA 3RC9A 2GPAA 3QLVA 1H2RS 1U6KA 1XZHA 3CT4A 4NZPA 4UU7A 4IO0A 2G77B 1VZ3A 2C3MA 1ISFA 1AN0A 2G25A 2JGNA 2MINB 3C3WA 1OX4B 1I3OA 4X1OA 2WNHA 3ZVLA 2E4VA 4AVYA 4FS3A 2YY7A 4US2R 2Q0XA 3D8RA 3H1EA 3KPUA 3U7IA 1FFBA 2GCNA 3O82A 3ZDRA 4MKHA 3WLQA 2AN3A 3WLLA 5JZ9A 3BXEA 1E2FA 5JZMA 1XE3A 5F23A 1GL6A 1CETA 4Q4JB 3UAXA 3OQ6A 1O9BA 1EDDA 1OYVA 3NIBA 4PXSA 3FRHA 1ZISA 5T41A 2RGEA 4F21A 3PUIA 5L95A 4GBMA 2BP7B 2O9JA 2VHJA 4KSBA 5AM0A 5CB6A 3U4QA 3MTQA 3HB4X 3OKFA 2GOYA 3VDNB 4B87A 5B7NA 1SUAA 5CDHA 1EUQA 1WF6A 4RTKA 4IUBS 1JA0A 1P1BA 2C7PA 3H9JA 2EFGA 1NVDA 5FBZA 1G42A 2EDCA 3PNMA 1KEKA 2HTEA 2JLUA 5H9VA 3FVQA 2HIGA 4ZDIA 5C4IA 2WG1A 3U9TA 4ZMRA 1XCMA 4M1ZA 4OP2A 4WK6A 3MB5A 4MDYA 4RVNA 5CRIA 1OGYA 1FMFA 4MIKA 4HDRB 2QRVB 3HSSA 3LQYA 1E2NA 4B35A 1SAYA 4KBGA 1D1QA 2CV0A 2QQEA 2L17A 4RD2A 1QRRA 3LZCA 3AR4A 4BQPA 2QUZA 1U7HA 1TECE 2ACWA 3NKFA 4FYVA 3JWEA 4MB2A 3F90A 1R6UA 1S2IA 5AK5A 1J97A 3B3JA 4XM0A 5BOVA 3JZFA 3TLCA 5I01A 1YVRA 4R3UC 1E2QA 4QDXA 5L3QB 4IIBA 2IITA 4KLAA 4BEVA 4RS3A 2IK8A 1TMKA 1E1RD 2OC9A 2H48A 2YRWA 3CLRC 4FEYA 2VAMA 4Y6PA 3UJ6A 1TZMA 1Z29A 2OHJA 4ND8B 1X70A 2YWHA 1OX4A 2H52A 3AUTA 3MAJA 3U1TA 2OGTA 3ENWA 1CUFA 2CZGA 3HI4A 2HHLA 4GM0A 4RY2A 3I37X 5KTRA 1P29A 5JR3A 2R4TA 2ZAMA 1ZONA 3AF0A 2YJ3A 5B3AA 3VPGA 3UC5A 4S1VA 2B2XA 3GR6A 5FOUA 2R97A 1U7DA 2I6UA 4KQCA 5FBRB 4Q4JA 2A9JA 1WB6A 5IAJA 1ABFA 5DX8A 4YXWA 3AFIA 5DW3A 2EWMA 3RR2A 1Q1BA 2AD5A 2EHDA 3T7JA 2NO4A 1KK2A 1KO7A 3WDKA 3LTNC 2VFAA 2WUEA 1OT3A 2HEGA 4WESB 1KVSA 3A9UA 1JI0A 3N2GB 4YRFA 5HBRA 4DCVA 4G2NA 4XD7A 2IEAA 3D6UA 3ELDA 4TSRA 1FZTA 5D1NA 1KY5A 4J0KA 2XMQA 4QHYA 4E70A 1F5NA 4WCFC 3Q8XB 1KZ9A 2DPMA 4GX0A 1X8JA 5HMLA 4B44A 5JSHA 1AF7A 1O57A 3G82C 4IJUA 2QTMA 3IGFA 3K4PA 2BSAA 1WWKA 4G5FA 1ISJA 1J2UA 3I8OA 2M9MA 1WB5A 2XYVA 4EPVA 1UFQA 4A15A 1TA0A 4PS1A 2VCYA 2ECQA 3G49A 5L3QA 2RI0A 3SXJA 3KEMA 1H2BA 3C4VA 4UQOA 2HFJA 3GFSA 4NLLA 2YFQA 4FNOA 3VBCA 3NO4A 5EIHA 4MTLA 1SKYB 3A31A 3DBRB 3QWFA 4EM6A 2I78A 3T7TA 4O4JF 2QTTA 4HGQA 4K6KA 4AMVA 4YRBA 3JPWA 2QX7A 4FEAA 3WSVA 1I7SB 1GSIA 1PV1A 3RREA 1TD9A 4LZLA 1ZEMA 2HQRA 5DBEX 2V5AA 4HPXB 2ZYHA 2VVTA 3CPSA 4NECA 4UM8B 2AOVA 2UUPA 1CJSA 2IIPA 3G6WA 2IY9A 3E7DA 1D04A 3U3KA 2VPWA 3KD3A 4WESA 3H4IA 3K8QA 3N2GA 3CWQA 3HBLA 4P9NA 4TN1A 4EY3A 2I22A 3VM6A 2EZ4A 1B76A 4CN8A 1GV0A 4HZGA 4N6GA 4PIPA 5B2FA 5KDDA 2ZXUA 3VZDA 3PNLA 2Q3FA 1K4YA 2C5FA 4G41A 2XQIA 4RPLA 2JGIA 3A2KA 1HG0A 1CVIA 2GXSA 2A1IA 3BJZA 2B99A 3MCWA 4NH4A 4FKMA 4HGPA 4UUNA 3IFSA 3NTOA 2QTRA 1JHVA 4X8HA 2OQVA 3ZKAA 3QWHA 5BMVF 4V0ME 1Z6GA 2V0NA 1USUA 3LECA 3CZ4A 3UHAA 4C5BA 6ABPA 4RD1A 4Z0PA 5HW0A 4IQ8A 1G64A 3QBVA 1I6KA 4RFVA 5SZJA 2OV1A 2LW7A 4CHGA 2VDKB 2WIGA 3L8EA 5KJ6A 1GPBA 3L6OO 5EEHA 4C4SA 5KNBD 3OY2A 1EGAA 1K2VN 1OI7A 3I2JA 3KETA 1CEYA 3F0TA 5JFTA 4FC7A 2K6GA 2A7QA 1EVJA 1OX5A 3DBRA 5JAMA 3FPBA 5JYBA 1ONSA 4CKZA 4G4IA 4UM5A 2JKVA 1KS2A 1YJAA 1HK7A 3TZ6A 5AHXA 2COKA 2GDJA 4KR3A 1L8LA 1I36A 2BW0A 2H54A 4EO7A 1XZJA 5ENVA 4QDKA 1X14A 5HCNA 2XE4A 3CB2A 3W6ZA 4H17A 4GIBA 3RRXA 1XL0A 1ENPA 1VE6A 3FRIA 5C34B 1E92A 4G85A 3LM8A 4IV0A 3T4XA 1LQ2A 3BERA 1ZM2A 2QLBA 2XGMA 1M33A 2KMLA 2PXAA 3TSOA 1HE1C 1XPJA 4WFQA 5D87A 4GRIA 1X74A 3AHGA 3HJGA 3MD0A 3OFSA 2RI1A 4A0SA 4AWXA 2BUBA 4RK0A 1A5TA 1YC5A 5L7TA 2PX4A 1MORA 1BHO1 2JLRA 2V4UA 3I04M 4PRZA 5CBPB 3KZCA 2CHGA 2D1FA 2DPYA 4QBFA 1DGQA 1GQFA 3W1EA 1NQTA 5KTOA 4KIJA 1QFXA 4KXNA 2QMHA 4HLUA 2GSWA 5CFRA 1IHPA 1ISSA 1JSCA 4L72A 2GGSA 2REQB 3QI7A 2ZFUA 3I39X 4KFUA 2WFMA 3EB9A 4I19A 5DWQA 1U0LA 3GLFB 1ETUA 1ML3A 2JG3A 1OB5A 4J3FA 1P39A 3K8ZA 3LD9A 2FW9A 4YCAA 5C1OA 2IH2A 5AJZA 4MI1A 1FIUA 5IJZA 2X0JA 4GBGA 4F1JA 3U39A 1YHYA 4D98A 1M2KA 1GN9A 1V25A 2G17A 2JJ1A 3BHNA 4Y98A 2DERA 3ZDAA 4Q48A 4KUHA 1E0JA 4KMMA 1GTZA 2HHJA 3UWKA 3V7NA 1VCIA 5DOZA 1USVA 3MXOA 4TMZA 4AQDA 1BNCA 2WQZA 4P35A 4CR7A 2NTYC 3GUYA 1R5JA 5F9FA 1VL2A 4O2AB 1S4QA 4S12A 5KSOA 5LIRA 3ZWXA 5KSWB 3ECCA 2VTVA 3ESCA 1U28C 3TLGA 4XDYA 3G8DA 3PR2B 2ZATA 4UUOA 3B9BA 4MRMB 4RMNA 1QH0A 2DT8A 3OCVA 3PJEA 4XJVA 5K3BA 2CMHA 3DE6X 1AB5A 1ZU4A 4MW5A 4UVIA 2J1LA 2LRHA 2NMVA 5A6SB 4PYMA 3OCXA 3RJMA 2GXAA 2JIZD 1QPZA 1C1XB 2F2TA 1RRFA 3IT1A 5IC4A 3VNUA 4O4HB 3CPEA 3I9NA 1CNEA 3B6MA 4Y67A 5L3VA 1AO3A 5CBPA 4C0BA 4PLYA 2CXSA 4KIWA 5BY2A 1VGRA 2C7RA 2BFMA 1PZFA 4WZBB 2WUFA 2X5OA 2I55A 4JIGA 5JSZB 2OXTA 5KQPA 1NMXA 4WACA 2OFWA 3HCOA 3TGWA 4K9QA 3UXHA 3AV0B 3QUAA 4BMVA 4X6YA 4KJXA 4L0CA 4E33A 2QD4A 1JKXA 3D8BA 2CL5A 4CM9A 2HM7A 1PT5A 2C2BA 3WLNA 5HNKA 1DQNA 4HDKB 4YMIA 1FYEA 3EEOA 1KH1A 2YXPX 1IN8A 1ZGAA 4V0LA 2X14A 3KWLA 5GIOE 4OM7A 3DQPA 3CN7A 2W83A 2FB9A 4LMRA 3DDOA 2ON6A 1CFZA 1OA0A 2EGHA 3E61A 3NETA 1C8LA 2HLHA 5JCXA 5KOIA 4YV0A 1RKVA 4HMOA 5C1BA 4ZT6A 2WTAA 3F73A 2A7XA 4A8HA 4MIEA 2O0LA 4HLQB 4PR0A 4GICA 2WWVD 4RO0A 2B21A 3HCBA 1SELA 3CXRA 4ZXPA 5KWIA 2CKDA 2XRYA 2GX6A 4H31A 1NGSA 3BKWA 1UEIA 5HQJA 4F5WA 3HM9A 2HHHB 3TL2A 4M1OA 3W4JA 1K88A 1GXSB 5ALIA 4OQFA 5A6SA 2VSXA 4IDEA 2Y1CA 2OHFA 4NU6A 1MTOA 4AJLA 5BV8A 3TJRA 4B2IA 1U8CB 2C57A 1MX9A 2GUWA 3GJZA 4Y2XA 5LQCA 3L18A 4WPGA 4Q4LA 4OXIA 1QP0A 1ZZGA 2ZUUA 4UXHA 2JZOA 3OUUA 1EJ0A 1NN1A 1H6AA 2DOKA 2I1VB 2QZSA 2OBXA 3ZS8A 1SEPA 4MHOA 5KB3A 4R83A 3TMKA 5FO0A 2Y0PA 3GZTB 4WZBA 1FW6A 4QSMA 5CYFA 3HUTA 3UZUA 4B6JA 1GY8A 3DCIA 4RVCA 1Q1QA 5FLEX 1V41E 1HH4A 3L6RA 1Q19A 3L07A 3SY8A 1KO5A 2CLKB 4IFIA 3WA7A 1PT9A 4PSCA 2WILA 1SXJE 4HX5A 3OIYA 1JDVA 4I1RA 3MCTA 1E9SA 5DEIA 3OO1A 1XL1A 4PTZA 4Y6OA 4B85A 1OXVA 4ABTA 1ZAYA 2DFDA 4A8TA 2GEFA 4PLCA 3WP1B 3G8YA 4KO8A 1K6MA 3VTKA 4PTLA 2V65A 4P3YA 1T4DA 4NSNA 4L6AA 4Q12A 4MP3A 3ZDBA 1ECJA 4TUYF 2RAFA 4D80A 1TJ4A 1KVUA 2VHEA 4PU0A 3TCKA 2WYWA 3HDGA 4JROA 4OJNA 2W2VA 1KDZA 4U7GA 2WOJA 1I1HA 1H4SA 1WNTA 3WRXC 4MLDA 1V3VA 3NIFB 1QV6A 1UMDB 3EFOB 3KCQA 1QE0A 2C9OA 2HNBA 4DWWA 1TCVA 4ZCRA 1KYTA 2OOKA 1NBMA 2PU7A 1Q3HA 2QG9A 2QS9A 3DP7A 3DVSX 3NHAA 4RZHA 4X84A 5G0WA 3UEOA 4F04A 4GX5A 3NHZA 5IMSA 5IXJA 3N1UA 4GS5A 1OBFO 3GFFA 4JI8B 3OUZA 4YRDA 1M5TA 1N5IA 2J5BA 4IWXA 4MW6A 1SHTX 1P1IA 1VE5A 3IPRA 3LGXA 2Z4TA 3I9LA 2KQUA 4GW3A 3UHPA 1QGAA 3H5RA 1I9GA 1QDLB 2ZIZA 3SNHA 3CF0A 1XCPA 2A9PA 3W3AA 4IVQA 2YH2A 3DV0B 2JGDB 2DPGA 1UDWA 2XDWA 3BXOA 3M6XA 3T34A 1NX9A 4JGIA 4XTCS 4BLTA 5FORA 5LLDA 2NYAA 4ZJZA 1N2EA 3WZMA 2H0QA 3AI3A 3IKTA 1T1EA 4BYGA 3BCUA 3JAWA 3GXOA 2OCBA 1WXEA 4C5CA 1GNVA 2PKEA 1ZIXA 3T3EA 1EFUA 4B81A 3WQBA 2BC9A 2OHXA 2P9HA 2CXTA 1JWLA 1ST2A 3HLTA 1PJCA 3LWNA 1Z15A 2B92A 4YIKA 2EJBA 3VFDA 4ZYTA 2Z8YA 2GCGA 1SQ6A 1XA4A 1SUFA 2G88A 2ZIWB 4G0MA 1K4MA 2CJFA 1SIWA 3CHYA 3DEYX 5CLGA 1IXYA 1Q6YA 3DO6A 2D2IA 3HRHA 2VZ9A 1M73E 2B1JA 4PHCA 4KRFA 3AJEA 1RQ2A 4H7JA 4RIFA 4YQZA 1RP7A 3QV2A 4XX0B 5K3DA 3VO1A 5KMGB 5HIJA 5H4GA 4V3BA 4PYIA 1GPUA 4JUAA 5CA1A 4IV5A 3EZ9A 1UMDA 3DZHA 3EFOA 4NBSA 3IPCA 5CVDA 3SDZA 4EHJA 4ZVSA 4MVJF 2P5SA 3HFRA 4RIHA 2VTBA 1ZCZA 5FL3A 4EQ6B 1R10A 4HXFB 1G9TA 4CG3A 1YK1A 3GVPA 5CXXA 1ZL0A 2Y92A 5I3ZA 3K1AA 4FUTA 2RGXA 4K6OA 4E32A 1QANA 4H7KA 1USWA 4IF4A 1QVWA 3MM4A 1XEFA 2JLVA 3SLRA 3TG8A 4D3DA 1IFXA 1RLUA 4ZPXA 3OG9A 2G76A 3PKZA 3CF2A 4IHAA 1MO5A 3HA7A 3LHIA 1R9MA 1TTTA 3K70C 1EQAA 3NEYA 4EL0A 3G7SA 1JZTA 5M5BA 3I45A 4BLPA 4DDWA 5AIBA 5KCMA 3DV0A 5FV4A 2JGDA 1U2GC 1Y3IA 3H19A 1IL0A 1WZUA 2JIOA 4B32A 3WB2A 2H4WA 2I91A 4JXZA 3IALA 1T4GA 2HGZA 2MIIA 3IJEB 2GF9A 1RYDA 1JR3A 2FUNB 1F0NA 1NN0A 2FY8A 2ISCA 2FSFA 5ICSA 1QR2A 1Z8HA 1JVBA 2LKDA 1QIFA 2CXRA 3KUCA 1NZJA 1JHZA 2Q3EA 1FDVA 1B3BA 3TE6A 1Y0BA 4HNTA 2JFUA 2BKUA 3A25A 2I4NA 1T2UA 3UMGA 3WJ7A 4JZYA 1E9BA 3TEFA 1WETA 1CZKA 2H9AA 1MVLA 3L1VA 5KNDD 1C4OA 3PUXA 3GRRA 4UDYX 3KM0A 4KVGA 5DHAA 1OXUA 3T1NA 3IUQA 4ZC1A 2ODAA 2I8CA 1XALA 1JTEA 2J67A 2R2GA 3B51X 2VTEA 5KMGA 4XX0A 1OROA 2PUCA 4YXFA 2PWPA 3R5KA 5HOQA 5JTTA 2R1UA 1GG5A 3RJZA 3FDZA 4UTZA 4DDKA 3UAVA 1I0LA 1Q7GA 3QKRA 3R7WB 4I66A 3HXOA 3QUSA 3MCVA 5BSEA 5TEVA 2ZIEA 3EY4A 4XDZA 2EFJA 5EQJB 5JXGA 4WXRA 3VQTA 2YVAA 5GINE 3I2FA 1MC8A 4R3NA 1E6CA 2XLBA 1OXXK 5F4BA 1ZRMA 3GJ5A 3EIXA 5H59A 5T8KC 4BZQA 4BX9A 2BR3A 2KW5A 4IS3A 1LX6A 2PRYA 3I4FA 1N2HA 5LMUB 2QL9A 3CMCO 3FSGA 2PGXA 2LDBA 2Z2XA 3OC0A 2UUCB 2XKJE 1RAHA 1P4AA 1Z34A 5F33A 1FE8A 1EE2A 4HDOB 2B34A 4DS3A 4P33A 4D99A 2ZRIA 3EG9B 1C3OB 1SY7A 3HO8A 4QYSA 3RFCA 4LMPA 1WBJB 1WEHA 2HIMA 2JRLA 4HZIA 4L8YA 2XKKA 5CJ2A 2VZEA 1VJTA 3B1VA 3TLEA 1MNQA 5IDYA 5EKUA 3Q88A 2ASVA 3IVCA 1UBFA 3L0PA 4LE2A 4BMDA 1U2SA 4BQQA 4OL0A 3EDYA 4UW9A 1LW7A 1KMIY 1YGYA 3FB1A 3ORQA 1PVOA 3GLRA 4LAFA 1L7RA 3N9IA 4TSKA 4Z4EA 3FMPB 4E0BA 3UC9A 4U6SA 2HRRA 1TCBA 2JS7A 2C95A 1BS9A 1D09A 2YNMD 3ZCVA 1YFJA 1GA4A 3VI3B 5ICEA 1FJXA 2O20A 2XR1A 3FIUA 4BFCA 4RHEA 1D5CA 2Q62A 2QX6A 2B8JA 2RBKA 4IO1A 4O2LA 4ZU6X 3TJZA 1KTIA 2EX1A 5F77A 1ZQ1A 3ICCA 1KZ4A 3HY4A 2JL1A 3LY8A 4F4HA 1S02A 1E2UA 3G8CA 4CIAA 4HNUA 2I1LA 1HEUA 3K0EA 4FFWA 4I2VA 4LQCA 1NQOA 4P5EA 4XFDA 2E1PA 3W3AD 2QRMA 4TT3D 3AI7A 4IXNA 2GCPA 5JH7F 3SVLA 2A14A 1AA6A 3DC7A 2IU3A 4A91A 4B4WA 1EK5A 5KNCA 1POXA 4LTMA 1IHUA 2JZCA 2DCMA 3EVZA 3IKJA 4NS4A 5KPJA 1XNJA 4QYWA 4MVCA 3NVKI 1QIJA 4HR7A 5C7YA 4U7WA 1H2EA 3RBZA 4L5BA 5IXYA 1OVMA 3A1EA 4X1KB 2HK6A 5FPKA 3OZXA 4N0EA 1KDYA 2H3HA 1AUOA 1C3OA 2JAXA 3EG9A 4LQLA 3V1MA 2H65A 4RU1A 2RHJA 4EA6A 4KTTE 3TZKA 4PYLA 4YEDA 4CWAA 1AJEA 1GO2A 3IMCA 1Z56C 2C8KA 4HNVA 4ROSA 2HT1A 3Q3IA 4IX1A 2OFFA 4RA9B 3TQCA 4F1KA 2NTEA 1BWPA 1WV1A 3NR2A 4LDZA 1RRVA 3QU5A 2BM9A 3IUSA 2NGRA 5CNMA 1QHXA 2NO1A 2A67A 1SD1A 5IHXA 2H2AA 1BFUA 5AVJA 3A32A 3T52A 4MO2A 5JFGA 2AUTA 5ITZA 2R00C 4Y2TA 4ZZ2A 1VSQA 3UGKA 4CMIA 4DM7A 4GC5A 4NZNA 5HXAA 3LPMA 1AKTA 1EJ2A 3QOYA 4LHXA 3ZY5A 2ZJ5A 4AW9A 3OPNA 3CF4A 1MABB 3JD0A 1PR0A 2PUBA 1HTBA 2RFLA 5BWLA 1KI8A 4FZVA 3BMOB 4R2WA 2Q46A 4ZU1X 4AN1A 3H5WA 4JODA 5EJ5A 1VMDA 1KMNA 1T9BA 1XN4A 1OTXA 3O3CA 2J3DA 3MGKA 3MW8A 4X94A 2EW2A 3MAGA 3T9FA 3ZEAA 1YL7A 2EFYA 3OTOB 3R6DA 2Y1XA 2OLEA 2ZQ5A 4JXJA 5KYXB 1BCSB 3FGNA 3FCOA 4K86A 1HEIA 2HLPA 2NUBA 2VBFA 2Z5LA 2QRNA 5AKHA 1RYNA 2OZLB 1BA3A 4LJKA 5GONF 1XNQB 2J5QA 2FX3A 3PPYA 3P52A 4BGUA 4IWNA 4JCCA 2VQDA 1G8GA 2ATVA 3R3JA 4LNAA 1XVLA 3EVFA 1U4SA 3ECSA 3EZLA 1ZK4A 1P2SA 1YZHA 2VAPA 3WLIA 2AT1A 2HC9A 3JQGB 3D43A 5I4CA 1STOA 4MV8A 5HUHA 2J3EA 3IQEA 1XTRA 4Y6SA 1MJ5A 1KVTA 2EIHA 1SOAA 5EJFA 1P7CA 5J2UB 1A9YA 4E46A 1B6SA 1DIHA 1RBMA 4UFOA 3EUAA 3GLUA 5JSYA 1Z73A 3R7LA 2R44A 4RABA 4B3RB 2IV3A 1LLFA 3NDPA 3EARA 5C8VA 2CJYA 3D4BA 1DG9A 3VPHA 2NU6B 1E9AA 5U4QA 2A30A 3RRZA 1BH2A 1K86A 5EFOA 3DEHA 5G0VA 4C4ZA 3RG8A 1UBEA 5DW0A 1GDDA 2RHHA 3OX1A 4JZKA 4K1XA 2MT9A 1YDWA 2GEBA 1JXAA 4TXLA 2ZIAA 1P2FA 2QMZA 1R8JA 4LQ4A 1YOBA 4LXXA 2HK9A 3BXZA 3ZXUB 4AKGA 4UE3S 1NXWA 1WXFA 2A1TS 4G09A 4WL0A 2FQWA 4WCFB 3GEEA 3RAGA 3WAJA 3BMOA 2ZUSA 1ILWA 4YYZA 2V3WA 3GGOA 1I1NA 1XF1A 3FPCA 1XCGB 1OXSC 2BJVA 3AUYA 4JVLA 2J3LA 4YP6A 2YJGA 3QX7A 5KYXA 1BCSA 3FCYA 1U0BB 4JJEA 4I0WB 4YFVA 3F7NA 5DLYA 1NNUA 1THMA 1UBHS 2CDAA 1IXRC 3EPPA 3VR5H 4LJRA 4R8KA 1J1ZA 4ZO4A 1KAHA 1L8AA 1DKRA 4XVRA 3CNHA 1SK8A 3SQDA 2R62A 1EX1A 3WK8A 3F3MA 5JT1A 2OCAA 4N3AA 1BE6A 1IRXA 4P4SB 3TW4A 2IODA 2XYPA 4B3MB 1JXOA 4N0MA 1RCTE 4BCBA 3NH6A 3N8HA 4U63A 1T3ZA 4Z3DA 4I3FA 1K5PA 4XRGA 1KQGA 1J07A 3BSWA 2Z08A 2E5WA 2OYSA 5AI6A 1UMBA 3V8VA 5J2UA 2YIDA 1Q92A 4LDAA 4NU0A 2BGNA 4ENPA 5L6MB 4N5IX 4MAFA 1D7OA 1MOQA 2G4CA 2OESA 2I1WA 4MKRA 4PZCA 5TGTA 3CW8X 4QRHA 4CV3A 2NU6A 4D8UA 1J0CA 1I5EA 2FWMX 1XZMA 2QLJA 3F78A 1JAXA 4LY9A 1JPVA 2RHWA 1VPEA 5KNCD 1EE1A 2P4QA 1DIGA 1DRJA 1YMUA 2H1FA 3FE2A 4JLVA 3SYMA 1N3BA 1Z5VA 2H4JA 1OYOA 2W00A 3K73O 5DB4A 4JYCA 4KQJA 4NESA 3KR2A 3IDZA 5AJVB 4RM2A 4XGRA 2IUSA 3E58A 4G81A 5C7IO 3RTAA 4BKOA 1NF8A 2G5PA 2VJKA 1RC0A 3IELA 2Z0MA 3G5LA 4HRYA 4KACA 4NOKA 5AM4A 4EJ2A 1IMOA 2ZRKA 3USES 5JJCA 4LF6B 3NWPA 2W6JA 5FWNA 1TM2A 1Y3FE 3D7NA 4EY6A 4QUEA 4WLOA 1U2RA 3KB8A 4EG4A 1N7JA 1Y6FA 4U2BA 2CV2A 1E0DA 3IUJA 1UBTS 4REQB 1UPAA 1XZ8A 2A92A 2JAHA 4D8YA 1QYIA 2EZTA 4DCMA 1FTQA 4WA7A 4CG1A 2F4NA 4LISA 2XCSB 1D2NA 4NE7A 4R2KA 3RKUA 3DMHA 4EF6A 1I3KA 1XHFA 2O2YA 2PMBA 4YDSA 2VF7A 3IUBA 1FSZA 1I6MA 2OXRA 1PSDA 4ZGBA 1NJFA 3O4VA 4GYYA 2ONCA 2O8CB 2R11A 3RJ5A 4BFLA 1DKMA 2H06A 4HS9A 3CEMA 4MUIA 2VRCD 3K0SA 4NYIQ 2PD6A 2C96A 4BNXA 2X1VA 1FP7A 1B0UA 1QAMA 2DJIA 2H4FA 1T5OA 2O52A 3JAKB 3KKQA 2VCHA 3UHFA 3NCHA 4Z0NA 2VNAA 1L3BA 3EVBA 3MJFA 1GQYA 2PMFA 5HGXA 3CVJA 1CS0B 2C5GA 5DRYA 2GN8A 5CUQA 4IIVA 1VGVA 1OV4A 3U7QA 4HN9A 1D1PA 1OJ7A 1PGJA 2XTNA 3E27A 4DIDA 1M8JA 1DFHA 3H0EA 1MJNA 3RUAA 1HSOA 2BFCB 1FUUA 2GM4A 1M6EX 3LVBA 1EUYA 1DV2A 1VE1A 2CW5A 3BN3A 4MUMA 4DABA 1ZNYA 3CBGA 3FTPA 1KI9A 1ODFA 2RCYA 4RTQA 1ZD3A 3STUA 2QU7A 4LCJA 3ZWBA 5IWAB 4KWTA 2ZM6B 5LBTA 2LCFA 1BDMA 2OBYA 3TTSA 2R6JA 4OK3A 1MW8X 3CUTA 2PCLA 1G6Q1 1XN1A 2QE6A 4O29A 3DDUA 3DFZA 3KXLA 5JMPA 1XQWA 5FAKA 3N7TA 5FBHA 2QVBA 1VCNA 3T99A 3WICA 2A94A 3A58B 4REQA 4ALJA 5LMNB 3HU5A 4R16A 1Z5PA 3PDUA 1DC7A 3OSUA 3PG5A 3QLTA 3A6ZA 5HYVA 1PJRA 2WC1A 1OW3B 2J6HA 4TMFA 2O19A 4LYAA 4TYQA 1WPQA 4M6WB 4E08A 1O0SA 1FA9A 3AC0A 3HDYA 4HD8A 1C0EA 2JDID 2VYVA 2ZAYA 3IH5A 2FMFA 4ND1A 4OD0A 3TSCA 5DM70 3JR7A 2AXEA 3DZFA 4NZZA 2AN5A 1Z0JA 2RKWA 3HVUA 1U94A 4FYJA 5H80A 3A9VA 2O8CA 3SIPA 1DQZA 4FTWA 2W4IA 5SV2A 4JA0A 3M2TA 1YRWA 3GJ7A 1FP4B 3BG5A 1BMFA 1S8FA 2FK7A 3L3BA 1J4AA 1U1GA 2R6R1 1AXRA 3ITEA 2JCSA 4EYOA 3JAKA 3KV1A 4WDRA 4WJLA 1PZGA 4UBIA 5EZQA 1XDUA 4E31A 4HH3C 5EQTA 1CS0A 5DBHX 3VZCA 3DJFA 2XJ4A 4JB8A 3KDSE 3R5TA 3PRKE 4ENTA 2VF2A 2F4VB 4AQ7A 3VZSA 4LOKA 4Z9BA 1DAOA 5G4LA 3WMGA 3ZQ6A 4M46A 4IBOA 1JBKA 4HGRA 2ZI9A 3PIIA 4Q16A 4EY5A 1SXIA 4F93B 2BFCA 3JRNA 3V33A 2EL7A 4LY6A 4LJAA 4DR4B 4C2UA 3MWKA 1TUBB 4HLDA 3FAZA 2FLVA 3JZMA 2Q1XA 1YCFA 3JW8A 4FCTA 5JQGF 3IAM6 2ORVA 4W7HA 1BHQ1 3KVYA 1E5TA 1JW9B 4ZRMA 1MQ9A 1RPJA 2QRUA 3AEYA 3QXCA 4MTCA 4I4TB 1H1LB 4XIYA 1C7IA 5JNRA 3QKWA 1GGEA 5F2EA 3CZCA 4UNIA 4YHBA 2IHKA 2P0EA 2F7SA 4PG4A 1XTZA 1ZLXA 5BT8A 3MUFA 3STTA 2WJYA 3C1UA 3QSGA 2E0IA 4YP7A 1YKFA 2V55B 2VJOA 3A14A 1QQTA 3ER9A 1ZM4A 4ER6A 4LOLA 3PGA1 4M6WA 3INYA 1B7GO 3OAAD 5LZ9A 4FGLA 3VSEA 3OIFA 5CDFE 4ZI7F 4PR3A 4MRAA 1G6OA 1WCV1 3O9ZA 4MJ3A 4X0EA 3MWYW 3RGGA 3NGLA 2I6FA 5MN6A 1Y81A 1F3OA 2NU7B 4M9ZA 5DDIP 1VKHA 2Q3HA 3PXUA 4FHZA 3FVRA 4D79A 3DCJA 3PXXA 4GHWA 3C7KA 1FP4A 2PZJA 4HFRA 3DAFA 3P9XA 5C5CA 1F48A 2LDXA 3PC7A 3D64A 4DJAA 3W5DA 1D07A 4G4JA 5BR4A 2MSKA 3TW8B 3OJXA 3A4NA 1QPBA 1TYAE 1WXQA 4POAA 1K7YA 3I9V6 3FR7A 2BGTA 4TT8A 3FHCB 1QAQA 4J0QA 7MHTA 2J5KA 2XA1A 5HK8A 3PLNA 1EAYA 2EQAA 3HYCA 4DGQA 5ISMA 3DWIA 2XNHA 4BYMA 1Q0UA 4K9PA 4NYMQ 2XMCA 2ZJ2A 4M8IA 1D6NA 1E3EA 2UYGA 3V4SA 2JFQA 1H3FA 2I8LA 3WQHA 5IT9A 2AE2A 1W29A 4QTXA 3F6SA 2GZSA 4HUTA 5J47A 2F8LA 2H1VA 1LI4A 2HYDA 2ZJOA 2PWZA 2I3AA 3F8SA 1FDIA 4MO9A 1TUBA 1QH9A 2J45A 4RH0A 2BUCA 4FW9A 1Z83A 2NVUB 4GNRA 1A72A 2X5JO 2KLHA 2ZTMA 3STVA 5C53B 1DC4A 3AY7A 3C45A 5JRDS 4WRRA 2AZTA 4I4TA 1H1LA 2AXQA 4LRXA 5ICMA 1NVMB 1L7DA 1G291 2OK8A 3G8BA 4MPJA 3GG9A 5CP8A 1S2GA 3HU1A 5DKFA 3GG2A 2Q5QA 1Y3AA 2YWEA 4IXWA 4S0ZA 2QVGA 4OQZA 3CZMA 4UNQA 3AUFA 3GFGA 5FYDA 2IX9A 3GH1A 1LC0A 1NOIA 5E4JA 4RWZA 5BSWA 3QRWA 3IV9A 4M9XA 1Y9DA 4N0PA 3BRWA 1S96A 2CLMB 1Y3HA 3W7AA 4CM4A 4OX9B 5LCXA 4E4YA 2ZITA 1EQUA 4IS2A 2NU7A 3DXFA 1LSUA 1SKBA 2GAJA 3L40A 3OZUA 1KJIA 4N1AA 4R1UA 4U8HA 5EPUA 2YTZA 2PIDA 2UYQA 5AJTA 4B0OA 5DCYA 3TW8A 4J4HA 1GGVA 1T8SA 2AJTA 4N9QA 1X80A 1FQKA 2DUJA 2Z1NA 4MI9A 5AI8A 3SHFA 3MBOA 5CX1A 5LPNA 5TS3A 2ZIVB 1LJ8A 3KCNA 4OYYA 5K9ZA 3TXAA 3ACBA 1V11B 1JNXX 1HXHA 4H77A 5FWDA 1A76A 2XHZA 1FLAA 1PTJC 5I9MA 3DL2A 4MR7A 1NW3A 1X15A 3ND5A 3KZNA 2QPOA 4DXDA 2AJ8A 1RCFA 2ZI3A 1LBHA 1K8RA 4HFNA 2QRGA 4J1TA 3C48A 4GVLA 1EA5A 5FA5A 3WBKA 2V6FA 1KRXA 2NVUA 3PNSA 2Z3VA 2LP4Y 2NSYA 2Z2KA 1TUGA 1Z4PX 1JHQA 4ZCMA 3TXYA 1RXSA 2ZRLA 3V4FA 4DKXA 1F8YA 4HUQA 2KLBA 1L5HB 2IYEA 3SEAA 4BKRA 5JS8A 3T41A 1CUCA 4ZO7A 1MZVA 2O6HA 3A4IA 3AFGA 5G4KB 5L9AA 4H9GA 5KKNB 3NM4A 1YTLA 2GJ4A 4EECA 3P26A 4RJTA 3OQBA 4ZV7A 1YQUA 5TNXA 3LUHA 1A50B 3GFQA 5DSTA 1JTVA 4OOEA 3CH5A 4L3WA 2AEFA 5F5LA 5JTUA 1PW7A 1X77A 1ZHHA 1SBYA 3BHIA 3G2JA 1KORA 1UC8A 2CVFA 1WZCA 4X3OA 2HWUA 3IBFA 1G1AA 1MCZA 4BN0A 3U3MA 3K15A 1QNFA 1NFRA 1TA9A 2QM7A 4GZLA 2A0KA 3CLVA 4HJXA 2G9NA 3VNAA 3WRXA 5IX8A 5LOVA 3GZNA 4QYIA 1Y8AA 4N7MA 4KP7A 1GUZA 4KJZA 5K7SA 5T64A 4RK4A 3F5MA 3GAAA 5DHRA 2FUEA 2OGUA 3Q98A 4M37A 4FMDB 1JEJA 1KDRA 2Y6VA 4XTRA 2RC5A 3O8LA 3RVNA 5ILGA 1KFEB 4KWEA 1OA1A 1P0MA 2FLKA 3NEAA 5A3RA 2J0QA 1YIDA 1HE2A 3QVLA 2O48X 1NC3A 5DYNA 1P0FA 2G71A 3IEXA 2ZUDA 4GOND 4HYQA 5TRTA 1EIWA 3O47A 4RHXA 5BNIA 1JFFB 4Y6GB 4ZAGA 1IM2A 3TSAA 4BJ6A 1L5HA 3ZCTA 4LWOA 4DIEA 1XCLA 5P21A 5JAHA 2XMRA 3I73A 5E2BA 5G4KA 1J70A 2AKYA 3QJGA 3GOHA 3FFXA 1JU9A 1DAIA 2IIQA 2YS7A 3KS9A 5TQ2A 1XP8A 2YJTD 1RYMA 3D7MA 2IZ6A 2JJMA 2VRNA 3GVHA 4FINA 4ZOLB 3R7NA 4MLPA 1G6HA 1LQTA 2H1CA 2I7DA 2OTCA 2V96A 2VK2A 2XCQA 3DZDA 4QTZA 1FFCA 3DO5A 3W2GA 4LZOA 4F3TA 2Y0BA 5DTRA 1PJ2A 2O8BB 1RAIA 3R6WA 1SU7A 4RW0A 2PZAA 1RJ9A 2O0HA 3SEZA 5J58A 3I64A 4WLVA 3SSNA 1WAMA 3ORRA 2QMQA 3ZLUA 1PZHA 3HZHA 2ETVA 3NBUA 4JXXA 2OOSA 4TS3A 4J6FA 4UVEA 2QN7A 3G2KA 2BHRA 3MA0A 1USIA 1CXZA 3FNBA 4GDFA 2FSPA 3ADKA 4J16C 3R7SA 3BK7A 3A3OA 4B1FA 2FN9A 2Q8QA 1XK7A 4B3JA 1T1IA 1XMVA 2ZLBA 1U0NA 2PNJA 1B16A 2XQKA 4XOIA 3VH3A 1IY9A 1WHSB 3TX6A 1ZZEA 2HGSA 1J2YA 2IHYA 1UBCA 4RJIA 3I2IA 3PGXA 3E23A 2PMEA 4F3KA 1U3VA 4QJ5A 1I7DA 4PPFA 1DQSA 2WG0A 3C5CA 3ZDXB 4AURA 2R8OA 5C8YB 5I7VA 2GCEA 1EHCA 3KSZO 1ZA2A 1A8QA 3BTUA 1JFFA 4ETWA 1U2GA 4JBIA 3Q6IA 1CUHA 1H4QA 3KPYA 5T57A 1TYCA 4B7ZA 3P7MA 1H5QA 5IABA 2WHPB 2R8BA 4HQFA 2TRSB 3ZI7A 2VI5A 4HEQA 3AILA 5JS2A 1GTG1 1VG8A 3THOA 2ZSDA 4S24A 5GJCA 1EFAA 3EXEB 3EFHA 1Y5IA 1KJJA 3LRTA 1DKPA 4CQMB 1UMKA 1CJBA 2OV2A 3G2MA 4TWZA 4D43A 1YI1A 3AR8A 3OKPA 3ZU6A 3T95A 1G8JA 2QNIA 4BVHA 5KTPA 1AGNA 1TMOA 4HB3A 3UKJA 1GN8A 2DJ5A 1M34B 1TDJA 3WLAA 3KE9A 3SZGA 6CHYA 5IN4A 3VTFA 3ICQB 2O8BA 1HFKA 2GTPA 4PYNA 4ABYA 4U5QA 4YK7A 4DUGA 4EYEA 3E5NA 2QTBA 2HLDD 2O05A 1F6BA 4FHGA 4XSHA 4KWCA 2WTUA 4FWTA 3K70B 2XKBA 2Q3JA 1T0PA 1BEEA 1VG9B 1TM4E 1L7AA 2H85A 3PPWA 1ZK3A 4DSAA 2JI4A 2NO7A 3UFXB 3GLVA 3AEQA 2UZAA 2QIOA 1IY1A 4C14A 1M8PA 3Q9LA 1U2ZA 2QPAA 2Y1DA 5BRNA 3UJ8A 3OZCA 2AOTA 4N9WA 1E96A 1UAGA 1YQTA 1PZMA 4DJFC 4DY6A 1KDOA 4FKBA 4BJ5A 4FYXA 1GYPA 1M6NA 3KU4A 3MWLA 1IM8A 1NQAO 2HSEA 4JLMA 2EG5A 4DSZA 1IQPA 1Z7YA 4DR6B 1D3AA 3BX1A 5C8YA 1O97D 2ZSHA 3BULA 2ZKLA 1RQLA 3ZDQA 2IHJA 2XSZA 2A5LA 2QR5A 4L6IA 1JDTA 2GT1A 5CPBA 1ATIA 2D06A 2JF0A 3I04A 5FBWB 1ORIA 1Y9ZA 3RNOA 4HDQB 1HNWB 2WHPA 1CDZA 4MR8B 1WXHA 4HRAA 4IZIA 2VYNA 2HA2A 2D2FA 2YV2A 4ZOEA 5AKGA 4EY8A 2VEDA 4XE5A 4DG8A 2ZJ1A 3EXEA 5AW7A 1U3FA 2CNOA 3KB6A 5INTA 1G5HA 2NUTB 1UKBA 2NTNA 2OAGA 4MV7A 8AT1A 2PVPA 2M6LA 2R1VB 1J8VA 1QIMA 1M34A 1N4AA 4YGXB 3S2YA 1C3JA 1OYYA 1ST3A 3QITA 4ZXFA 3RVRA 3WADA 5LUBA 5FEUA 3DC2A 2YWFA 4FC6A 3DZJA 3LF1A 1L5RA 3TD9A 4OB8A 4K26A 3RF6A 3RLIA 3F97A 1NF2A 1OX6A 2IUUA 4HWRA 5LNK6 1XELA 4R7TA 3ZE2B 3GUCA 4DJDC 2ZVJA 4FXPA 3VR5D 3EOAI 4FDAA 3UFXA 4MW4A 4PO3X 4UBJA 3ZI4A 2CFIA 5IVPA 3EZNA 2X9VA 2ERXA 4CKWB 1XMIA 3I28A 1D7AA 3V2IA 2Z2ZA 3AP2A 3CIFA 4EUHA 4EW2A 5AD1A 3O2SB 3SSAA 4CV1A 1M8KA 1C5KA 5DTQA 3TLMA 3X1DA 2DWOA 3ZW9A 4HDCA 2OAEA 3B1ZA 3QFRA 4PHTA 3CY6A 2ZSEA 4C6SA 3ZBUA 3JQPA 2CF6A 5B1SA 1L4FA 4K6MA 4HAYA 4QTUB 1S3SA 5F3RA 4LHYA 1O5IA 1ZMTA 1QFMA 3D6NB 1EFTA 4NENB 4Z4QA 5I7WA 1E60A 1O6BA 1W93A 2PD3A 2JAOA 4KL8S 5JWHA 2XWQA 4YYEA 1ZVQA 3MGCA 3OZDA 4TTPA 1YB4A 4MR8A 3U7HB 2P8SA 4E7OA 1X2EA 5JBNA 1KJQA 3IVAA 3OY7A 4XUGB 1FNMA 3F4BA 3HUDA 3G0HA 3ETDA 2UXDB 3QM1A 2A33A 2ONYA 4U2CA 1DB3A 2IYAA 1TJ3A 1G21E 3G9ZA 5DEOA 5JS6A 2R1VA 2FMHA 1M72A 1UBRS 2FWNA 1SXHA 2AEJA 2R6CA 4Q4HB 5F5NA 2JA2A 5GM2A 5EESA 1NW5A 3CNLA 4GYWA 4PQYA 3SS9X 3V00A 1ZW6A 3TKAA 2EJVA 2WE8A 1NNEA 2VA8A 3T3PB 2W6ID 3QW2A 1YC2A 3EVEA 5K0TA 5I48A 2NAFA 5FNZA 3L7AA 2UYYA 1JWAB 4RKEA 1MX3A 3O92A 1QZZA 4Q3EA 2WF8A 4OHFA 3KSDO 4KRXA 3A0RB 1G7CA 1NSYA 1WU7A 1PGQA 5AW6A 1GGFA 1P17A 1AKEA 2H2DA 5JS7A 1LF0A 1U7XA 1K7EB 2WM3A 2YN4A 3BGWA 3PSHA 3HUFA 4ZAYA 4B7AA 2AK3A 1II8B 5KJFA 1YFZA 1OIVA 1DMRA 1HLPA 4IJQA 5B6JA 2O3TA 1R9JA 4EZEA 1USGA 5DYWA 5JAOA 1BWQA 3KOWA 4CF5A 1E7YA 4RMHA 1C3LA 3GHHA 3AT1A 3EAGA 1JEDA 2V9ZA 2IXEA 4YBRA 1V7CA 5I7UA 3HVRA 1G9SA 2GCOB 5JC8A 2OSVA 4QJBA 4NENA 5TR9A 2C3OA 2H7VA 2Q41A 2ZWVA 3NXKA 1JDJA 1JDSA 1X1TA 1ZO8A 2GSDA 4MV1A 4WWHA 2MSCB 3QJYA 5G3ZA 3BORA 1P4JA 1N0VC 1KXZA 3KVOA 4E12A 4JKYA 2QDXA 4QUDA 4DRYA 4YCCA 3Q7RA 2IDJA 2ZVDA 3ROMA 2WUVA 4B34A 1A95A 3WWDA 4TZ0A 1CIJA 1T3TA 3B2NA 2N1BA 2IIVA 3EWAA 4MWZA 1V8ZA 4B6EA 5E8RA 3U5ZB 4Q4HA 5HEKA 2JASA 4PLFA 5DNWA 5TMBA 2PJDA 2V59A 1VJ0A 2GK7A 1U9IC 2V7TA 2XUQA 3HGQA 1SKQA 2PXHA 1UBOS 3T5MA 3GEGA 3ZN2A 1A82A 1VM6A 1J0DA 1D4FA 3V2UA 1OSNA 3WYBA 1E1DA 1EWRA 5KVCA 3L4JA 5EJEA 1JB9A 4R5HA 4IX9A 1G4UR 3NPAA 4OMCA 1C4XA 5EA2A 1WXGA 4MP6A 5LQDA 2X15A 1XEXB 3SC2B 2M6SA 1V5FA 1VKZA 4TLEA 1E1QD 1LX7A 1E18A 2HA7A 1VG1A 1XAGA 2QQGA 2VIIA 1WPXA 1T4CB 3NCTA 3IE0A 4I4LA 4TLMB 1DJLA 3SXPA 3T9EA 3L4SO 2QROA 1W5AA 1NUTA 5IPFA 5D6NA 5ALTA 1CFJA 4OI0A 3O90A 4JI2B 3NHWA 2JCXA 5E6SB 4F06A 2PA3A 5FTKA 3FI9A 2O3JA 2R60A 3V2HA 4BEWA 1PEKE 2RB5A 4WLUA 1W36C 5KQMA 3L7DA 1RRMA 2ZJ3A 4MV3A 2D1RA 2GPTA 3ZCUA 3EISA 4J2TA 4EWLA 1Y48E 3A10A 2YIMA 1AHPA 5TPZD 4OSEA 2BCEA 2OT3B 4NV3A 5A5GA 3BZBA 1NNLA 4UM9D 4ITVA 2O57A 5F7JA 1O6FA 4KLCA 3KR1A 2XDAA 3ZNNA 2G8NA 2GBPA 3DT8A 4FMCB 3P0RA 2Q0QA 3GRPA 2Y1KA 5LWHA 1J5EB 4UNSA 3CUWA 2N47A 3SHTA 2Z04A 4X62B 1CP2A 1FVFA 1Q57A 3NASA 5ECGC 3EXG1 3THSA 3F6PA 4BIIA 4KFRA 3OZEA 1YAHA 3GFTA 4CEHB 3D2CA 3OLQA 3QH4A 3PNPA 3L9WA 4I6GA 3BIXA 2ODTX 1H2WA 2VK8A 4BNUA 1RC8A 2UXCB 3EGCA 4KFSA 2J6IA 5A02A 1WD5A 3NEJA 2PGDA 2C2XA 4FBMA 3PNYA 2Y76A 2IS6A 1K3FA 3O1IC 1MF7A 2PZMA 3JCZA 1MO3A 5KQRA 2VRBA 4QOHA 3RB8A 4PO8A 5CVJA 4UC0A 3IV6A 3ZHXA 3ZWMA 4QJIA 1N2BA 1U3GA 4P2BA 4JKOA 3L02A 3KBOA 5AW8A 1DAHA 1T4CA 4QVKA 2WPDA 4LGYA 3QXJA 1CR1A 1Y8RB 2QAIA 2Q8PA 2EW8A 4OPMA 4AF8A 3K09C 3PJFA 3F5QA 3Q6NA 3QWBA 4TWRA 1RYHA 2PH1A 1UPUA 2YW2A 4MVJM 1HTTA 4Z4GA 3WQRA 2IPAB 3SKYA 1BOFA 3SDSA 5FDFA 3D1VA 1M2FA 4AUKA 4N48A 3VZPA 1SD5A 2DPXA 4JR0A 3T5BA 5EG5A 1IWBB 2WWYA 4MCHA 5CDTA 1Z26A 3QTLA 5FXMA 2H0AA 2DMRA 1E2KA 4LZZA 3VUFA 3JX9A 3DF7A 3U7FB 3T7DA 5JNTA 1COWA 1J90A 4HQOA 1U0RA 3FPEA 3UN1A 1JB1A 4RLHA 1ZN9A 5B64A 2LKCA 2Z95A 3ZV5A 2ENUA 1KYVA 5BPHA 4DQUA 4LBYA 4ZYLA 2NP7A 2O3RA 1BMDA 2AZMA 4J75A 4BO7A 1ZESA 1ZVJA 1JQ3A 2Q3LA 3E3LA 4DR7B 3HJBA 3WLSA 4Y2RA 1WTAA 3AVQA 4LWPA 3RQSA 4CEHA 5A2GA 2JFNA 1G0OA 2JH8A 1VGQA 5EHNA 4QECA 5IFLA 1GRQA 4WNYA 4E5NA 4AJHA 2MTBA 2JARA 3FTDA 5TARA 2ZYDA 3B9RA 4KB5A 3FZNA 4X92A 2Z8XA 1IPEA 1W30A 4O08A 3B5JA 3GH3A 1XMQB 3RYCB 5CD1A 1RVDA 1ORVA 2GA8A 3QA9A 4KQ1A 4YQEA 2VP4A 3JY6A 3KZKA 3O4RA 5ALYA 5KHOC 3AM5A 3UWSA 4Q66C 4B45A 2HAEA 2C4NA 2K2WA 4OUKX 3QNUA 4JT8A 1EDBA 2PS1A 1XI2A 4Z4CA 2BM8A 3HXTA 4K8RB 3WNZA 4B3CA 5LM3A 4FX5A 1L1FA 1Y8RA 5TJHA 2FDCA 1ECCA 2RKBA 3MTJA 1NTRA 1NKSA 3KK0A 5HZKA 4K5QA 1J7KA 2ZT7A 4QLBA 4IRXA 3CN9A 3DTVB 2HV8A 1NQWA 3TLKA 2AI2A 2QUHA 2QZJA 3KYCB 2C7VA 3BCHA 5KX5A 4GOKA 1Q77A 4M9CA 1CUDA 3FZGA 1X1AA 5BPFA 1Z4KA 3AOEC 3RK4A 4DARA 2DH6A 1KQ3A 2H9IA 1HZZC 1WTCA 3KXDA 5JXHA 2ZB2A 4ZHQF 5BQXA 2OZPA 2QGZA 2CCKA 3AB7A 4I36A 3ULKA 2ZJYA 4KXWA 4PANA 5A7FA 2HX1A 3N0WA 4DEYA 2K7ZA 3KQTA 6NULA 2ABWA 4O4LA 2YZMA 4B6RA 2YWDA 4C3ZA 1RLTA 3G79A 2WSSD 1UEXC 4A6DA 1K6XA 2HA4A 4G1BA 1KK0A 4PLVA 5IUJC 5JRJA 1DKUA 1QZXA 3WGMA 2TYSB 3EA4A 3RQIA 2R1ZA 4MZDA 1PV2A 2Y6UA 1GCAA 2Z83A 5BNTA 3RYCA 1LI5A 2MSDB 1UF9A 2X3FA 1FRZA 4O4IB 2GJSA 1NJ6A 1IK6A 4WZZA 1HT2E 2P2GA 3X1YA 2HJ9A 3C97A 1JJIA 4CDMA 2H6EA 2CY0A 2JJ8A 4YNBA 1EH5A 3HMKA 5JCJD 3JVIA 4QU8A 1GGHA 1RJFA 4YQYA 3UH1A 4C4PA 4INAA 2B4AA 3OCWA 1EWTA 2C0PA 2A78A 4NMXB 4XEUA 5TGZA 3SKXA 3OVMA 2HHAA 5T3UA 3P2JA 2YOHA 3QMMA 2X58A 4AS3A 1ITZA 4CVNA 1IY2A 2V8OA 1XJQA 2YBEA 2OG2A 1P0PA 1Q3KA 1UJBA 3DTVA 4RPIA 3E2MA 1CDEA 3AXSA 3LRPA 5ALPA 3I9FA 4LMAA 4AXXA 3MXTA 4ZFNA 4ALNA 4Y2JA 1MT0A 5DWDA 5ALOA 3W6OA 3I5AA 3RS7A 3ONFA 1XVIA 2RGUA 2V58A 4WKPA 2Q1WA 4NZMA 3QEAZ 2Q5CA 1B1CA 1DU4A 1HNNA 3A1NA 1Z74A 4ZALA 1O2DA 2ZRPA 5D5QA 3OFVA 2IXGA 3EOBI 3OF2A 2PGAA 4GXNA 1HQDA 1I3NA 1RC1A 2QAGC 3F5FA 1XVAA 2IYZA 3E9QA 3AG5A 3RUCA 1TVCA 4JHXA 4C1NA 3GGJA 4OXNA 1GQRA 1ZBDA 3PZBA 2YYYA 3B7GA 3MRSA 3GOQA 1R0YA 4G0QA 3WWPA 1Z36A 3GARA 3OZRA 3W9SA 4EW1A 3O8DA 4D4GA 1YJ5A 1WULS 3GFOA 2EG9A 3H86A 1QCDA 3MRXA 2Q6LA 3A1FA 4RXMA 5ALFA 2IH5A 2JGFA 4LK3A 2YRFA 2XDYA 1TQHA 4MARA 1R3DA 3DFKA 3E2IA 1W88B 1FFXB 4L74A 5CU7A 4DV2B 4O4IA 3CXUA 3G1WA 1WA5A 2AMFA 4IMIB 4RH3A 3NYIA 4Q3BA 2X2EA 2OXEA 2IXAA 3AFMA 2OBMA 2VC2B 1IXSB 2BD0A 5AK6A 4BO9A 3AKCA 3HEMA 3LCMA 4IIFA 1N1GA 5ERGB 3K8OE 1IUKA 1FNSA 2OCLA 4EPTA 3OM0A 2E85A 3HVKA 1PWYE 3PJDA 2G5TA 4FFSA 4XVCA 4H2DA 4A16A 2R8XA 3WB9A 3AETB 3ZY2A 1P73A 3MT0A 1UINA 1UPBA 4S2EA 4H7FA 4LZWA 4YONB 1FVOA 3B12A 1TJ5A 4RGYA 3ZCPA 5CEJA 5T4BA 4B6SA 3NHYA 2P5YA 3EFEA 4EAAA 3IIEA 4L95C 4XLLA 3A37A 3HA3A 4HYYA 5CCBA 1V16B 3UM9A 4A2WA 1EX7A 3BK2A 4CKEB 1I7PA 4JELA 9ATCA 3ANTA 5JYCA 1LJLA 2Q50A 3TBFA 3C3MA 3T7CA 4N82A 1RI5A 1XAJA 2PUAA 4WXEA 3H16A 4F2HA 4G4SP 3MCZA 2FPLA 4HDMB 3WV4A 1OZHA 1RD4A 5DBGA 3WYEA 3HKBB 1UM9A 3AM4A 4C7MA 2J3QA 4WZBE 4UEWA 2SCUB 2YX1A 4RACA 1BG6A 4PRKA 3S2FA 1W96A 1O94D 4BAGA 1K5HA 3B1FA 3G5TA 1GGMA 1JMVA 5B7GA 4IOLA 3KBBA 4MS3B 2CMKA 1G18A 3LPDA 1XVVA 5LDHA 1JN0A 3MJTA 4QNNA 4CTOA 5FCDA 3FKSA 2ZE8A 2DM6A 1KMQA 3W6PA 4F12A 3FI0A 3K2EA 5JI3E 3I09A 2X2FA 5DN9A 1N4DA 2P11A 5CCDA 2F1RA 5AJWA 2ECKA 5FF9A 1W88A 1FFXA 2MHCA 2NNWB 2VK4A 2WWIA 1P2VA 5EJGA 3LKDA 3NTQA 2H57A 3KZVA 1RWMA 3CH4B 3FTFA 5B4TA 2OORA 1YQXA 2PGOA 5BT9A 1IDN1 4AJNA 3GAZA 3HABA 4JUDX 2P7IA 1TPZA 2FW6A 3PFFA 3Q7IA 4AG6A 3VNSA 3VYWA 1R4ZA 1NBME 2E4AA 3CH6A 4K6FA 4DY4A 3BCRA 5JDIC 1YHZA 5FHQA 1M76A 3SBOA 2WTEA 3UV6A 4DM4A 1J9EA 2HMTA 5FB3A 2Z1DA 4XQ9A 3FWYA 3FYUB 1QVZA 3EIHA 3D9QX 3L0BA 3GLQA 3N2EA 4UJ5A 1ONPA 4F5ZA 1TGYA 1N5OX 1XLUA 2A4MA 3D3QA 4JL5A 3RRNA 3V4PB 2OAQ1 5DF1A 3NEPX 3SEFA 1NXOA 1XMJA 4TVKA 3ADOA 2CV1A 3R9XA 1SU4A 2GPSA 1IHOA 3DLAA 3LC7O 3OEED 4N3GA 1SXJC 4TKVB 4X7MA 5IRCD 3HKBA 5IH7A 3L92A 3P2IA 4MUKA 3VX4A 4MVXA 5BV0A 4Z0HO 5MDHA 5CEFA 4Z53A 4INPA 2ZCVA 3KYJB 5TS2A 1JVSA 1I3CA 1TLTA 1WDKA 1L6RA 3UGJA 1YSCA 1FSPA 1KMCA 1EXWA 1OUMA 5EZYF 1N2SA 4NATA 1GSHA 1JKIA 2J3JA 3RFFA 3TUJC 2X19A 5DNYB 3D4OA 3BQ9A 3MZ0A 1UXJA 2GPWA 1E7MA 2VP9A 3IEUA 2HXSA 4TKLA 3QEOA 4ZT4A 5IJXA 1SVUA 4D4JA 1ZMBA 2QTLA 1N0HA 2ZZNA 1QLWA 3JQAD 1A7KA 3GY0A 4RBNA 4DC0A 3TNYA 4I9HA 2EYQA 1E1YA 2FXVA 1UBMS 3EODA 2ZSAA 1XYVA 1UK6A 1PHRA 4PINA 4CTMA 3GLSA 3M6IA 1TM1E 2QSZA 5AVKA 4HH0A 4YRPA 3ZCSA 5DNUA 5L4LA 3JZIA 1CNMA 3GEBA 4BO6A 4CETA 1KI7A 4HQNA 4M1KA 4IG4A 4IVRA 2H00A 1SC6A 2JLYA 3SVZA 3DDSA 3L0OA 2DHDA 4Z99A 3ED1A 2PUHA 2C1EA 4ZC8A 2CVZA 3U7RA 2ZPTX 3RAPR 3JALB 2WM8A 3TG2A 1EUZA 2J9GA 3FYUA 3ROKA 4UU0A 1R88A 2FPWA 4FQ5A 2XYRA 4X3CA 3EC2A 4FDMA 2CD7A 2BGGA 1K4KA 3CLTC 5ILOA 4LJLA 5SICE 3WKBA 3D8TA 2W4QA 1RFGE 3TZLA 2HSZA 4TKUB 2R66A 4A92A 4OYRA 4RD4A 3R0QA 4RPCA 4TKVA 4YLYA 2YINC 4X63A 3U60B 3LRXA 4PHGA 1RZRA 1O3YA 2BY4A 3DL4A 4ILKA 4WNIA 3V1NA 3B3FA 4HEJA 1APBA 4HQ6A 4EHIA 1CZOA 1Z7WA 4NQZA 3L7LA 3AH8A 1JR3E 3CINA 3ES9A 2BN4A 1YS9A 4L9AA 2C88A 1HO3A 5LDDC 3T1YB 1F0YA 4DPKA 1NQ5A 2EKLA 1ZXXA 4FHDA 2QJWA 1LCIA 3LLVA 4LMBA 3KOOA 1FLVA 3UMCA 3I01A 5JXJA 4DIKA 4UNRA 2GEDA 3PE3A 4KUGA 4MUNA 5DNDA 1KPIA 2PZ8A 1JLSA 3SX0A 2NXJA 2WMYA 3O3MB 4WBSA 1JEQA 1MU0A 1NLYA 1AA9A 1RYFA 4PQGA 5DMXA 4PSKA 5B57C 4LF9B 2D5LA 1K7CA 3CTPA 4LOJA 2ZVPX 1PQWA 4KDEA 4N3CA 1B15A 1OFHA 2YZ2A 4LDPA 4RD3A 3TRHA 5JNLA 2C83A 1Q14A 3LS2A 2VHUA 3F4LA 3LT0A 1FY2A 1U9JA 4NARA 1GAWA 1WVIA 2FEOA 3H8WA 3PNBA 4RUKA 5ICFA 4DMRA 1ATZA 1DG3A 2B6NA 4LY0A 3U6BA 2VH1A 3ECAA 1EBUA 2CJWA 2VPQA 3VSCA 2PSSA 4BAZA 3JALA 3ZLJA 2P6RA 1XHEA 1OJLA 4LRSB 5CX4A 5LOVB 3OHSX 1WDTA 1WX1A 2GPYA 1TO6A 3OTHA 2I4LA 3K0BA 1PK7A 2V9PA 2P69A 4CV0A 3IT2A 3SJBA 1YOVA 2H2GA 4D4IA 4TKUA 2PTHA 4LSWA 4CW7A 1KC1A 2VDLB 3DEZA 2VOJA 3TK1A 5CR9A 4CDNA 3U7JA 2HIHA 3ZV7A 4BP9A 1KPHA 4C3OB 4NFYA 1RXCA 1P8JA 4COOA 3ESRA 3WLKX 1UFOA 2XTAA 5C46F 1J06A 1NY6A 3DPUA 1PL0A 2C9DA 4RA6B 1E2EA 3HNRA 3UTDA 1R4MB 2VJDA 4ERNA 1KIFA 4A6EA 2JKYA 2PX6A 3IDFA 2QD1A 3H9EO 1H8HA 4QPPA 5K6AA 1KEEA 3VH1A 3HC7A 1MC1A 3QPDA 5ALRA 3TM4A 1PFKA 4UHCA 3T9DA 2QMOA 5FWXB 1DQRA 2PX2A 4CFYA 2ZB7A 3D5EA 1UWKA 4BRSA 4D3YA 2M6KA 3BRCA 1RYEA 2IEDA 3DH0A 1MO6A 3TSZA 3V46A 4RZSA 2NQ8A 4C6HA 1IOZA 4EEKA 5AESA 3GDGA 2DPHA 4GLBA 4ACAA 3AXTA 1LK7A 4ZAWA 1LLQA 1NU8A 2OD9A 4J9UE 3Q87B 4G0XA 3R75A 1GADO 1XRSB 4QDZA 4XYMA 1PJAA 2NXNA 1BU5A 2JEYA 2OCYC 3E22B 1JFRA 3B1XA 2I3ZA 3CC8A 4L5CA 1G3QA 1ZN2A 1NUSA 4ILEA 4WGGA 1UPTA 1Z68A 1FTWA 2PL9A 5IJWA 4XGIA 4ESVA 4Q1AA 2PRKA 1T1RA 1YA4A 4MVJI 1AQUA 1QYDA 3ACDA 3L41A 1L4MA 1ZJYA 3H3JA 2P2DA 3IIIA 2JK1A 2H9YA 4MKIA 2VXYA 3H6GA 4BDSA 3ZWOA 2IOYA 2FMIA 3P9KA 4R1SA 2PYDA 4B8YA 2IL1A 4D25A 2YN2A 3R24A 4QGHA 2R7KA 1W8IA 3H5NA 5CDSA 4LXHA 1ZITA 2XEDA 3LT1A 1FYXA 3PVCA 2H31A 4KQMA 4ASUD 1M2EA 5IU6A 2SKEA 5LWQA 5K03A 2OGZA 3HEAA 4MWDA 2JI8A 4XVUA 4QFBA 3PUZA 4LDRA 2JVIA 4DMUB 1R4MA 1LW6E 2QTHA 1AU9A 1U8YA 1XCBA 2GK6A 3VDXA 4ZQEA 2QZ4A 3D2LA 4RKYA 1RAGA 1Q44A 1TZKA 3R8XA 1XKLA 3UTCA 2RI6A 2H7YA 5FWXA 2HZ7A 4ESHA 4XQGA 3Q41A 1DX4A 1AZLA 3HY6A 3ILYA 3LWZA 3PUKA 5K45A 1LWOA 3UMYA 1U04A 3IURA 4YFYA 1S8NA 4J9VA 4BVKA 4YQFA 2DQKA 4BY9E 3TE7A 1J8QA 2O2SA 4A82A 3ZUPA 4R40A 2EFDB 5LXTF 3SF0A 2CVQA 5ALEA 1WCXA 3SI7A 3E3AA 3IR7A 2AX4A 3CLKA 4EENA 1IBCA 3E22A 5AM5A 2BFAA 4N5DA 4DLTA 1TUIA 4YAFA 3WO0A 5KQLA 2EW1A 5EERA 1KJYA 3C3DA 1Y7IA 4QHSA 1ZSNA 4RFSB 3P9CA 3ANYB 3R40A 1TMGE 5H7XA 1ZXBA 3WOVA 1QQAA 1MIHA 2F62A 3NJRA 2X4IA 3PZRA 4P3KA 4DWJA 1J20A 4V1CI 3ZU3A