5IUNC

Crystal structure of the desk-desr complex in the phosphatase state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
131
structure length
131
Chain Sequence
SMISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/gene regulation
molecule keywords Sensor histidine kinase DesK
publication title Regulation of signaling directionality revealed by 3D snapshots of a kinase:regulator complex in action.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 44
structure length 131
sequence length 131
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iunC00
3O74A 3OQMA 5TPWB 2GBPA 4PYRA 5JS2A 2E4XA 3LMKA 4JA2A 1S8NA 1J56A 4MS4A 4EVQA 3D8UA 3HDVA 4N0PA 3RVPA 2FMHA 4IF4A 5KQMA 4E7PA 3LUJA 2JRLA 4YO7A 3HCWA 4UHKA 1ZN2A 1ZVVA 5BQ3A 1M5UA 4KK3A 1XHEA 1ZY2A 3ILHA 1FQWA 1EWTA 1RPJA 4EUKA 4OTZA 1Z13A 2A9RA 1L5YA 4L85A 3KYIB 4UHJA 5JNUA 4Q7EA 2OENG 2PL1A 6ABPA 1DCKA 4IGAA 4JASB 4XLTA 4EVSA 4HNQA 4TN5A 1JX6A 4G0QA 5CNKA 4YS6A 1U0SY 3OM0A 1ZDMA 5I4CA 5FBKA 1DBWA 4QYMA 5KI6A 4MS1A 3T38A 2IDMA 3CTPA 3QLVC 2JVKA 4H60A 1GLGA 4KVFA 1APBA 1DZ3A 3A10A 1CYEA 4H3HB 1YTUA 1JWLA 2RJOA 4E7OA 3O75A 4RXTA 3KLOA 4RK1A 1DP4A 4S05A 2E4ZA 1KRXA 2FMIA 2HQOA 1JF8A 2MYUA 4Z4CA 4GPAA 1NXTA 1BA2A 4P98A 4N47A 2PUEA 3GT7A 2J48A 3I42A 3QELB 3CFYA 5GQSA 4MR7A 4S04A 1P2FA 3NNDA 4KV7A 4ZMSA 3N8IA 4D74A 1M5TA 4EVRA 1CHNA 2CHEA 2JVIA 4KQ9A 1UDRA 4YCSA 4G0YA 3N75A 4MR8B 2PUCA 1FFWA 2M1ZA 1LJUA 1IIBA 2JBAA 3N6VA 3LFTA 4O1IA 4ZMRA 2WJAA 3A0RB 1T34A 2I6FA 3H6GA 1K66A 3E3MA 3OLZA 1I3CA 2DRIA 4F12A 3H6HA 1ZH2A 4W5TA 3IPAA 4D6YA 3H5TA 1BAPA 5KWSA 2KYRA 4RDCA 3QLTA 2FEWB 1RNLA 2L2QA 3Q9SA 2PL9A 4N76A 2JB9A 5EWLB 1DCMA 3EAFA 4RKRA 2FMKA 5BRJA 3Q7RA 2RDMA 5F64A 1P6QA 2H3HA 3ILYA 4F3TA 3KJXA 1AB6A 1TM2A 3OM1A 4MR9B 3KS9A 1BVHA 5E3JA 3IP9A 4G0XA 5JNRA 5HSGA 4NCAA 1GCGA 3I5AA 3TB6A 2QW1A 4RK5A 1Z18A 4EYOA 3EODA 4MQFB 4P1ZA 5EWMB 1KGSA 1LK0A 1JDNA 4NV3A 1P6UA 5EWJA 1DCFA 1SXIA 2B4AA 1MB3A 3MF4A 4RY9A 4CBVA 4KNYA 2LPMA 5FWXA 4RV5A 1BDHA 2O20A 4RS3A 1VRVA 4Z4GA 3QX9A 1LBHA 1C4WA 2ZWMA 3NNNA 4ZJPA 4RSMA 4MS3A 2PE5A 4OG2A 2FQXA 1CEYA 3QX8A 2W42A 3HK2A 3C6QA 3SY8A 1NXPA 1K68A 3RVMA 2E4UA 3CG4A 3N0XA 4Z4FA 1DG9A 3FMVA 5GOTA 2NT3A 4TMYA 1GUBA 1QP0A 2PLNA 4XFKA 4LDAA 1RXEA 3M6MD 3EQZA 4WT7A 3P9YA 4OBBA 3VNBA 2XDYA 3ROTA 4NICA 2E4WA 5DLEA 1PUXA 3Q15C 2HQBA 6CHYA 2WMYA 4MRMB 4KREA 3HM9A 1YS6A 2PAFA 3CU5A 3DLHA 3ROFA 3I09A 2FQYA 3RVLA 3LUDA 4RY0A 1USKA 1D1QA 3H5VA 2L19A 1QQAA 1FFSA 3KTOA 3BRSA 5IEBA 3QEMB 3HXMA 1QKKA 1TJYA 5TQ2B 2MYTA 2A9QA 3GBVA 2FVYA 4OLAA 3N0RA 2M98A 3RH0A 2QU7A 4XAQA 5IEJA 2FKAA 1A0OA 3JVDA 3QEKA 1QO0A 1Z2EA 5IULC 4W5RA 2JCGA 1ABFA 3KYJB 5B3JC 2MYNA 1ZESA 2R4QA 2QR3A 3RVNA 4ZPJA 4XARA 1MIHA 2RJNA 2V0NA 1ZH4A 1SD5A 3EQ2A 2L17A 3OQNA 1ZGZA 5CHYA 4NCBA 1Z2DA 1M2FA 1SXHA 1L5ZA 3DZDA 1GCAA 3GV0A 4MS4B 2WRZA 5TQ0A 1YS7A 2FTKE 3DGEC 4Z0NA 2VUIB 1ZAYA 3HDGA 3T6KA 3F6PA 4HNRA 2R48A 4ETMA 1F4VA 2VK2A 1QP7A 3KSMA 4YGXB 5KQPA 4QICA 3CS3A 3NHMA 2GWRA 1BDJA 3S99A 4LX8A 2CHFA 3CZ5A 3KCNA 4YP9A 2FW0A 4LRQA 3HSYA 3O1HB 2FQWA 4WXMA 1QMPA 4FE7A 4WUTA 3JS5A 5B3JA 5PNTA 4IMIB 2PUGA 1VPWA 1DJMA 3QELA 4RU1A 4QYWA 5TPZA 3E61A 1EAYA 1XHFA 3KLNA 3K9CA 3OLVA 4Z4IA 2LP4Y 1TMYA 1YIOA 2N9UA 1P8AA 4MYRA 2PUAA 5IBQA 4EGSA 1Z26A 3IDOA 3MA0A 3EGCA 1B00A 2GX6A 2VUHB 1XWWA 2HQRA 3I45A 4Z9AA 2MSLA 3O21A 2NZVG 3JY6A 4RWEA 4KPYA 1FSPA 4N41A 3FFXA 2CWDA 1QP4A 5JS1A 1D2AA 1QO0D 2TMYA 3H5IA 4WWHA 1Z17A 3SQNA 4G0MA 1PNRA 2PKXA 3VNAA 3IP5A 1JFSA 3TX6A 4MR7B 5CNMA 2FSPA 3OLXA 3O2QB 2IPMA 2YHAA 4RK4A 2PUDA 2F8SA 1QQBA 3C3WA 1W25A 3H5WA 3OMWA 2B1JA 5EWLA 5IC5A 5BRAA 1E6LA 1NXVA 2JBAB 1ZGGA 4OATA 1H9CA 3G1WA 3MMNA 3H75A 2WWVD 1TVMA 3F73A 3H1FA 4YR7A 1NTRA 4RXMA 7ABPA 5IUNC 2AYZA 4M88A 4MR9A 2R25B 2QV0A 3C3KA 2NZUG 3UK0A 4L4UA 2PMCA 3QK7A 2GI4A 1OXKB 2L18A 2FN9A 3FGZA 2P4UA 3OQOA 3EJWA 2H0AA 2FEKA 3Q7SA 4MPTA 1PEAA 1NXXA 3MYYA 1MVOA 3N53A 4N03A 5TPZD 4ETNA 1D1PA 2QZJA 3OLYA 1Z12A 3GA5A 2PUFA 5DCLA 2JK1A 1EWKA 4LDZA 1USIA 3O2JA 1D5WA 2BGGA 1D4ZA 5FWYA 3QLUC 3HEBA 4G86A 5EWJB 1JYFA 5D2CA 4DADA 1MB0A 4MQEA 3TMYA 1PEYA 3LKVA 3LUKA 4WXEA 3DBIA 3FFWA 4H3KB 1E6MA 5FWXB 1PHRA 2ID9A 5ED4A 3M9XA 1QNLA 4RY8A 1DRKA 3Q7TA 2PUBA 3EDCA 4RK0A 2NUBA 4MS3B 4F06A 1EWVA 1DC7A 3C97A 2FLWA 3FDFA 3CNBA 5TPWA 2AYXA 3L49A 4HNSA 1YMUA 4KK4A 4EYQA 1NXOA 3DGFC 5JNVA 4F11A 1JHZA 1NATA 1A2OA 3HUUA 4KFCA 2MYPA 4G0PA 4MLCA 1DRJA 1MAVA 1ZITA 2RGYA 3D02A 2MSWA 2LIVA 1ABEA 4NQRA 2IPLA 3F7NA 5KC8A 4EYKA 5JNTA 1DC8A 3SM9A 1TLFA 2YHBA 4G97A 3TO5A 2WB4A 3HS3A 3NNSA 1SRRA 1Z25A 3QLUA 2A9OA 4O1HA 4Z4HA 3O1IC 2FMFA 5HQJA 9ABPA 3SG0A 4JOQA 1JFVA 3IP7A 3CG0A 3CZCA 3LOPA 4FE4A 4Z99A 1W9HA 4JB2A 3LUCA 3OO0A 3TD9A 4PICA 2FLKA 3LKBA 5IUKC 2E4VA 3GWGA 1PNTA 3HV2A 1C0EA 4WZZA 3BREA 5ABPA 2IPAB 1E6KA 3KKEA 2FEPA 3RVQA 1VKRA 1QPZA 3UKJA 3DLBA 3H5LA 2QXYA 4MLDA 4EYGA 2ZAYA 4JB0A 3CKMA 4OLBA 2FXIA 3O2SB 4B09A 3T8YA 3LUHA 4W5NA 1JFTA 5CNIA 1JH9A 1Y1LA 4YV7A 1EHCA 5TQ0B 1ISSA 4DN6A 5TQJA 1NY5A 4PZ0A 3BBLA 3OLWA 4D6XA 3OMXA 4LE2A 2LUOA 3O1JC 3EULA 2F8TA 4Z9BA 1DBQA 2CD7A 4ZYLA 1GUDA 5DKFA 4MS1B 1Z16A 5FBHA 5JNSA 1NXSA 3R0JA 8ABPA 2VYCA 3LUFA 4MR8A 1YK1A 3N0WA 1DBPA 3H5OA 1LBIA 1ZHHA 4IILA 3JVIA 1E2BA 5BR1A 1R8JA 1RXIA 3M9WA 4YWHA 5HM6A 4G0OA 1YMVA 2IKSA 3BILA 2HJ9A 5DTEA 5KQGA 4XXHA 1RZRA 2WJWA 4KZKA 3RVSA 3C3MA 3L6UA 4O5AA 5T7BA 3HZHA 1AB5A 4YRZA 1VLZA 3MQ4A 4Q6BA 5C5CA 1ISRA 5JNWA 3B2NA 1JYEA 1A04A 3H1GA 2MSKA 4YLEA 1YK0A 3RVJA 4KRFA 2LBPA 3QLVA 4GNRA 3RVOA 5KQLA 4DQDA 5T3YA 4LZLA 3LUAA 2A9PA 1USGA 5IUJC 2WY2D 4KMRA 4RZSA 1M2EA 4XASA 4MQFA 3NBMA 5IX8A 5EWMA 3CLKA 4IMJB 3JPYA 4TLMB 1YVUA 5TE9A 1U2QA 1F51E 3F6CA 3Q41A 2ID7A 3KHTA 3UUGA 3CHYA 3GYBA 1HEYA 1U2PA 1Z15A 2HSGA 3G85A 4RK6A 5HKOA 2JVJA 3JTEA 4KQCA 2IPNA 4W5QA 4Z4EA 1JLKA 4N0QA 5C5EA 1JDPA 3W9SA 3GRCA 4MGEA 4W5OA 3MM4A 1SXGA 4Y9TA 3HJFA 4QPJC 2HPHA 4RKQA 3RQIA 2E4YA 2IYNA 1JL3A 2PJUA 3LTEA 3OO1A 3A0UA 1KRWA 4PE5B 4EY3A 3RVRA 1BDIA 3NHZA 3IP6A 3RVKA 2R47A 3GBPA 1LJLA 4LE0A 3JPWA 4G0ZA 1U04A 3T95A 1JBEA 3BRQA 3H1EA 1FFGA 2OQRA 1RZRD 3IPCA 4MRMA 3CRNA 4Q6WA 1KMIY 1NXWA 3LUGA 5KC9A 3SNKA 1WETA 4FB4A 3HO1A 2FN8A 3K4HA 3MIZA 3FFTA 4LE1A 2QVCA 1EFAA 4RK7A 1URPA 3GL9A 4ETIA 3QEMA 4HYEA 5CNJA 3HVRA 3KG2A 4RXUA 5FWYB 3URMA 5TQ2A 4IRXA 5DGCA 3SAJA 4MQEB 4JP1A 2Q5CA 4MAAA 2X7XA 2QSJA 4TLLB 3A3KA 2NT4A 4ML3A 1U8TA 1OXBB 2P9HA 4F8JA 4PEVA 3HUTA 2GKGA 2IOYA 2QVGA 4JAVC
chains in the Genus database with same CATH superfamily
5JFTA 3ZWQA 4DYVA 3GZTB 4CN8A 4YV0A 4JQCA 5MN6A 4RO0A 2AXPA 4QQKA 4LJYA 2CF6A 1W36D 3CPSA 1CG6A 4X90A 5KQMA 4PR0A 4JI1B 1HYGA 2SKEA 2D2EA 4G4GA 3V1NA 3GRRA 4UPEA 3KK0A 3PEUA 5D86A 3WJ2A 4AX4A 1KP2A 3E7WA 4R05A 1RE1A 2HU2A 3C14C 1G9SA 3MGAA 2Q5IA 1EFUA 4H1HA 4LJLA 2YZGA 4D4LA 1P7PA 4AS3A 1I7SB 3P4YA 4XPZA 1FYFA 2B78A 2RI1A 4QBFA 3UB3A 2NX2A 1YCFA 1R4MB 2DP4E 3WGTA 5KIAA 2VZEA 4QAJA 3RU9A 1PLJA 3H9JA 4ZVTA 2AIRA 2XD9A 3OIUA 2FB9A 1NR1A 1VXRA 3DB1A 2VAWA 1DX4A 3C85A 1T1EA 4RV4A 1M1YB 2D7JA 2PWPA 3T5BA 1QIHA 3G2MA 4H3VA 5TEWA 3UPTA 2F1OA 3VO9A 4IIGA 3R1IA 3UENA 2HWUA 2Q6IA 1COWD 4G5QA 4A0SA 3OECA 4MEAA 4C0AC 1XV5A 3KLOA 1MPTA 2E4ZA 1W2WB 3BAFA 1L8OA 4PG6A 2O8FA 2ZYGA 3CX6A 4KQGA 3AUFA 2YWCA 3BQ9A 4LDQA 1S5PA 4P3PA 3ISJA 4KL8S 4XCXA 3UWPA 4OV6B 3BHNA 5AM2A 1KOJA 5IJXA 4YRGA 1U8EA 4GU5A 4EJMA 3RRXA 3ROMA 4CG2A 1YS4A 1UZAA 3KD3A 2X22A 5LYYA 2YWJA 4H1WA 1NURA 2X7HA 1CUWA 1U0TA 3BJRA 1TAHA 2NVUA 1Y6ZA 2Y99A 3AESB 3B1WA 1FK8A 3GRKA 1K6IA 1P2UA 1PWEA 2VH5R 1JDBB 3STTA 3MGGA 2VRBA 2JBAA 4EF6A 1C14A 3L1UA 2VYVA 4MCAA 2C78A 2CYBA 2I6FA 3VR6A 4BQFA 4TLCA 3KJHA 2QD1A 5FV4A 2BR3A 3L6OO 3SD7A 2FUG1 1UDAA 3BMQB 1BAPA 3SP1A 2JI7A 4CMEA 2HSDA 4V3CA 1MTOA 3TI7A 3M4ZA 3WGZA 1Z3IX 2JFPA 3Q9SA 2AVDA 2J41A 2IUSA 4OGGA 3HCPA 1B8VA 3M4XA 1R18A 2PKCA 4W9NC 1GNVA 3R8CA 2RDMA 4CHGA 3IT2A 2YMPA 4KZPA 3ICOA 1CE8B 3H2SA 1P2SA 3UWOA 2XNCA 1VXOA 2BCEA 2OKCA 2PVCA 2VBGA 4L5BA 4XUDA 4MEBA 3N5CA 4N40A 4YI3A 4F3TA 2FXVA 3LPLA 4KSYA 1M74A 1RAHA 1KDPA 4G0XA 2ZIGA 4G65A 4LC9A 1YKFA 2FSVC 3KIPA 4R31A 4IS2A 3UMGA 1SY7A 3DOEA 3OQ1A 1QH8B 3ONFA 4AJIA 3AHDA 2ODAA 4Y1FA 3F7OA 4LXTA 4CDMA 4DW8A 1M2JA 3HXTA 1KFCB 2ZPTX 2OZEA 4MVWA 1IM5A 1WTCA 2AOTB 3T9BA 1JH8A 3EN0A 2Z6UA 2E7ZA 3GJRA 3AIOA 2PX3A 3S2IA 3GLIB 1DAFA 2PKWA 4KQ6A 3HYCA 4ZQIA 4PNEA 1K4KA 2FZVA 4QECA 4EJSB 3TXYA 1MIOB 3SLRA 1NONA 1RRKA 1Y7HA 3I39X 4UPDA 4XGKA 5I7WA 3GH1A 2AN5A 4TS4A 4M7OA 3A27A 1KDYA 1XIVA 1V7PC 1GUBA 1X2BA 3LF1A 2I4IA 5JWHA 2H1IA 1Y3FE 4BXOB 5EQDA 2O3QA 1CJTC 3EQZA 4GGPA 1N2JA 1YAJA 1CB0A 4NPAA 4QEKA 4BTEA 3C87A 4PX3A 3AUXA 1FP1D 3NDPA 4GLBA 3DPSA 5COQA 2Y27A 4ZCIA 4KREA 1SCIA 1TEZA 4HG2A 2R00A 3FI9A 4JUFA 3P20A 4N7MA 4C14A 3THYB 2YQZA 5IBCA 4JBNA 1R0RE 3NATA 2J3MA 2L19A 3WWZA 2EL7A 5DASA 2O8DB 5CD1A 1G9XA 3V1MA 3I6YA 2WHQA 3DG9A 4RZ3A 4EB0A 1XTIA 4OLAA 3RUAA 1QCCA 2OFXA 1ENPA 1SCAA 3BMOB 2IQ5A 4YT8A 1T3LA 4F93B 3OHPA 1XC7A 4B2YA 1P19A 4ZDJA 1ECCA 3BTOA 4DWVA 3AIIA 4LY9A 4TM8A 3PHCA 1N6KA 5IULC 1SCNE 2MYNA 4IEEA 4YPOA 1FDTA 5CA0B 2F1KA 3GPDG 3WGYA 1YOVB 2YMMA 4Z53A 1YC2A 3NKVA 4ZIRB 5EIHA 1H3FA 3H5RA 3KAQA 1Z2DA 5J5CA 1GTJ1 2IODA 3V7WA 1QUEA 4J1TA 3FSGA 4UMFA 4B17A 4B8ZA 4CU2A 3MTQA 2WIBA 2I71A 1R64A 2J5XA 4HAYA 4HNRA 4ODIA 1QP7A 2VF8A 1IBSA 1NW5A 2WFLA 4BV8A 5JQWA 1NQTA 1C3JA 1QG6A 1Z4PX 2BV3A 3FOZA 2GWRA 2XBUA 2WWGA 4H08A 4X66B 5FPSA 5B3KA 1M5RA 1IZ7A 1BFKA 3M81A 1KVRA 3HYLA 3T7EA 1OJLA 4EYEA 3L7NA 4KXMA 5AUPB 3VKVA 4M9XA 1IPHA 4MW5A 4XYGA 3EFOA 5BUZA 4V24A 2PUGA 2IY8A 1XMSA 2G36A 4L5CA 1EM6A 4UW9A 2HQSA 3KLNA 4EJ2A 4P3XA 2EOAA 4INPA 4CTKA 3K3PA 5LP6B 4DA7A 2N9UA 3NTOA 4O2LA 2RK3A 1POWA 2ZUFA 4HO1X 3KM0A 3Q3VA 4HS9A 2ECOA 3IILA 4KQXA 4I1PA 2VPWA 1N6LA 2VPIA 1SRQA 2PJDA 3CLSD 5IAGA 4PFQA 5D01A 2RHGB 3DM5A 4OB7A 4FFLA 1G0OA 2GN6A 3OE7D 5I7SA 4UUPA 2VAVA 3COYA 2ZRDA 5DYNA 3PDIB 4E5YA 4MVJI 5E1OA 5THKA 1A9XA 1F60A 1W44A 1OREA 2BEWA 1NUQA 3VNAA 2AN4A 2PU5A 2VL7A 3FUXA 4D9HA 4EKYA 2JGLA 2OSBA 4HFRA 4F56A 2I55A 1TMKA 4F72A 1QHEA 4D4IA 5CX1A 1Y9ZA 3JQBC 2PGIA 3A37A 4G1EB 3WMFA 2JARA 3KU1A 1OH7A 2WSYB 1Y8RB 4BO9A 5KYWA 3OMWA 5BRAA 1DVRA 5LZ8A 1KYIA 3SWWA 1GAXA 2OFPA 2FZCA 4IDAA 5K3SA 3ZZUA 3A3PA 3KVVA 1UM8A 1IEWA 1RAAA 2HF9A 2HUNA 5AW9A 1N2CE 5KTOA 4QYIB 1FPQA 2VSNA 2HO4A 2O2GA 3BGIA 3JD4A 1HYHA 3MTGA 4Q3LA 4ZT3A 5BN5B 4AP5A 1OB5A 2Y77A 1TT7A 1Y3BE 3GHYA 5TMBA 3UK0A 1VBFA 4X84A 4AO7A 4EKDA 1WV1A 3JXEA 4BLPA 4OI4A 5IT5A 2A5LA 2FX5A 1JXQA 3ISVA 1FP4A 3PGXA 1VSUA 4WVLA 5REQA 2O7RA 3WGVA 3PLAE 2Z6QA 3SICE 2JAOA 1U0RA 1T4DA 1CVRA 4YIHA 4PANA 4CEJA 4PSCA 4RGYA 1L7AA 4S3MA 3GLHA 1I10A 3AUTA 2O2CA 2Y0CA 3LQRA 3HFSA 2JIDA 3SKXA 1HEUA 3TBFA 5BMOA 2WVAA 2H4YA 2D1QA 2WM3A 4GBJA 3WQQA 1ZW6A 5I7FA 3HXOA 2XGMA 3KUDA 5H68A 1GCIA 3IEUA 1GPLA 3PC4A 4FR0A 5AKJA 4AVYA 3PJEA 2PD6A 3OX4A 4ITRC 1USIA 1ONBA 2AFHA 1K75A 1ZSVA 3O2JA 3DD5A 4M0LA 4NAVA 1EX1A 2QYHA 1VFPA 5T4FA 3WGGA 3LQ4A 3ANXA 3WRVA 3L77A 3HEBA 4G86A 5LU9A 3ZCSA 3HGQA 2DWUA 4WIAA 5KNCH 1CPYA 4MYUA 3DBIA 2B3DA 3AWIA 7MDHA 2PBRA 5BWNA 1IUPA 2WYOA 4RY8A 4C6RA 5NLLA 5CA1A 5KSYA 4XLLA 1CRWG 3KZXA 2G72A 4MWOA 3RTBA 5J5VA 4R3NA 2EYQA 3IODA 3PPIA 4HBZA 5JDIA 1P3Y1 2VQSA 4UAJA 3CRRA 1L6IA 3GLSA 2JLRA 2HLDD 2ODBA 2QTRA 3U9LA 2EQAA 1EJ6A 4G8JA 1NT2A 4ARAA 1HM5A 2C8VA 5IH7A 2GHTA 5ICMA 1YRHA 1JQBA 1PNOA 1U9IA 4XGNA 1C0KA 3K0HA 3GROA 3ZQJA 4BV9A 4M8KA 1ABEA 2FCRA 2G6BA 1VYUA 4G97A 5FI5A 3GJ0A 2HCTA 1EBFA 5CLLA 4OGWA 2V54A 1P1FA 2GCGA 1RWMA 3LXRA 4QA9A 2X6QA 1SC9A 1VKJA 5FKJA 1XPRA 2HSEA 3RJ9A 1DI0A 3FMPB 5M2QA 3GN1A 3IVGA 4QUHA 5CG1A 1CR6A 3K6SA 2C0QA 3TFOA 1F2UA 5I9IA 3I1JA 4G5GA 3D4LA 1B8PA 4NG4A 4NH0A 2FLKA 2BIFA 1TQDA 1MH1A 1O96B 2O8NA 2VUTA 3I04M 2F7SA 2Y1FA 3QF7A 4BNMA 3MRSA 2CK3D 5B1EA 5JHHB 3ECCA 1YBVA 4JOSA 1W4AA 2FNAA 2JH9A 1L6RA 4UU8A 3UKJA 2ID8A 3RWOA 2ZTUA 4A73A 1R9MA 3DYVA 4LHWA 4E31A 2PQMA 3ZD6A 3ZDBA 2J1LA 2WINI 1GPJA 4W1RA 4A82A 2XMRA 3DC2A 4HPJB 1XNJA 2YWBA 1TECE 2HX1A 3OLCX 3VDMA 5TQ0B 4XM0A 4CUZA 5I45A 2ZIWB 1NY5A 3I6ZA 2P4QA 3TW8A 2GKSA 5A5FA 1U0GA 2Z6VA 3DBLA 3PL5A 3ROGA 2L0XA 3A2KA 2YW9A 5BVHA 4NBVA 5IT4A 2RGAA 1NW6A 2J59A 1EVIA 4J6FA 1C1DB 4C7OA 3MBIA 1GSAA 3FPEA 2HHLA 3VSDA 3FTFA 1XFAA 4HLUC 4CFYA 1XDSA 3L84A 4G5YA 3EVGA 1LX7A 2V3CC 2P69A 4HN2A 1KYXA 5AVUA 5GQSA 2NZ2A 3NTUA 4GZLA 4PN7A 4FBLA 3UBMA 3U5ZB 4BFXA 2ONKA 1K4YA 3AKZA 1HKUA 2C7VA 2GEDA 4EUEA 2AMJA 4FSXA 4OXXA 3AVYA 3OX2A 5JCOC 1SQFA 2A92A 4TPKA 4RFSB 3S2GA 1MO6A 3PSAA 1PK7A 3EUWA 3N6RA 4TVSA 1DC5A 1PKEA 3BAZA 3DTNA 3PQFA 4DEYA 5KNLA 1ZUNA 1D4FA 3C7KA 3DXZA 4IWXA 4ZWNA 4MTLA 1F8XA 3UO8B 4AMVA 4Q9KA 3D3WA 1CV2A 3I6QA 2QR2A 5LLDA 2JKZA 4IR7A 1KJIA 1U3VA 1I32A 4K9KA 4MCHA 2D3TA 4BKUA 3LTNC 1UWVA 1VJDA 1OROA 5JZMA 2QT0A 2TSYB 1SU4A 4RGQA 3AR4A 2Z4RA 4JXKA 2P68A 3LUAA 3VO2A 1USGA 2WY2D 4AJHA 3OT1A 3RYHA 4I8DA 2BHLA 4S1OA 3I0ZA 4XASA 5JAPA 1Z0FA 2CNKA 1YACA 5CFOA 4DR4B 1K7XB 4WESB 4U2BA 3KLBA 4NWIA 1V8ZA 3KTFA 1U2QA 3LKZA 5GJCA 5HIIA 3TVDA 3DOHA 2V6GA 8LDHA 3KT0A 1TA9A 4TTAA 5FJIA 2ZIEA 1X1AA 1Z15A 3G02A 4RDHA 1ZZEA 1JNXX 3ZCUA 1J39A 3FSEA 3PKJA 1WABA 2ZBDA 2R65A 1WVGA 5IXYA 1VKOA 2E18A 1N33B 3H0CA 1L7DA 4UZSA 2OQIA 3V4VB 2JCVA 3K9FC 1BFDA 2IH5A 4BKMA 3K9GA 1GZHB 4OHZA 1BA3A 2WHXA 4EKIA 2EHJA 4IBOA 2IUEA 4MLPA 2VRCA 3L82B 2IYRA 3QH4A 4WCFC 4HWTA 1MUUA 1KVTA 2AQ8A 3DOOA 1NG1A 2WZCA 1PF7E 4RE5A 4OH1A 4TZ0A 3ZHYA 1YQ9A 1OLOA 1Z5VA 4OHBA 2PNJA 3KRTA 3GJ5A 1GILA 1MA3A 2ZZNA 2XYGA 4J7UA 3T34A 5F7OA 1BH6A 2HEIA 5DFAA 3ORFA 4ESVA 1NXWA 2QG6A 3HB9A 3KBOA 3WYNA 1RMQA 1UDXA 3QBEA 1O57A 3L7JA 1LLUA 1N2BA 3RC1A 1ZCBA 4F4IA 4ETIA 1T2VA 2Q2WA 3FZQA 2QL7A 1EFKA 4UEQA 3TLZA 1NQAO 1KAHA 4MWZA 2WKPA 2X1HA 3CB4A 2X42A 4MQEB 3QVGA 4GP6A 3MHPA 4QPNA 3C98A 3GPCA 2TYSB 3CWZA 5DLDA 3SHWA 1D03A 3GZNB 2PT6A 4F86A 3HLKA 3DMNA 2Y1XA 4ML3A 2GYWA 3R2JA 1ZGCA 2N1MA 4LXIA 1E7MA 1XTSA 5AUOB 1SQ6A 2IEGA 4J7CA 1E5LA 3WP1B 1DPFA 4GHWA 3AP2A 3NXKA 1HDYA 5DP2A 4AJOA 2C9OA 2YJ3A 5JBNA 5CCBA 3O8NA 1CQIB 1QPGA 3UJ6A 2WE7A 5H83A 1KNXA 2LCIA 3EF1A 3GJ8A 3RV3A 4WBNB 2R8ZA 3S2ZA 3A25A 3H2BA 1W7AA 1UM9A 3RVPA 4WLOA 1L5QA 1JQ5A 1IM8A 3D8SA 3GQVA 4WY2A 3PUWA 4ZEOA 4AK9A 4B3FX 1GDDA 1G3UA 2H7CA 2WV7A 3OT5A 2OZLA 1C3XA 4H15A 4F8EA 4LI3X 1FX0A 4MEJA 1XHEA 4AJ2A 1KYZA 2Q3DA 3HUFA 4GPD1 1EWTA 3SZMA 3ABIA 2FRDA 2C8KA 2VSFA 1X14A 3QHPA 3I72A 3ILVA 3ZK8A 3L92A 4DLVA 1NBWB 3AJ8A 4X00A 2BSAA 2ADFA 4CF7A 2DBQA 1L4HA 1WW8A 3OC0A 4JXJA 4XLTA 3ESZA 2L82A 3FCAA 3FYUA 4D0SA 3ZWWA 4KOAA 3ZHVA 3UNXA 2JLYA 5F78A 3PPVA 1P75A 1T8RA 3RI3A 2AN9A 1SCDA 1XVVA 4FOTA 2FPMA 4LV6A 2B5OA 2BTQB 2RGEA 2YWEA 1VFNA 4QM7A 1LPAB 1LTHR 2X5JO 1XZAA 4BQSA 3CTPA 1HQKA 3PC8C 4PNZA 3A10A 1NAIA 2RGNC 3UT6A 4Y6PA 1Y5LA 4A26A 1T3SA 1ZD9A 3MTEA 5A0TA 4B7UA 3N9IA 1B0UA 2I78A 5DOZA 3U1TA 4QGGA 1JB1A 3SKYA 1Q7EA 2FZ5A 4R0MA 2WKRA 4DRXA 1C2TA 2BFWA 2HF7A 3QV2A 4UULA 1YZNA 3W0LB 3WIBA 4KVAA 2ZULA 1IDN1 4XW2A 1VB3A 1EGVB 1VCOA 2C1ZA 5COAA 4ZMSA 1NUHA 4K6MA 1J21A 3AILA 1M5TA 4FT4A 4OSOA 2X9VA 3C41J 4NBTA 4EVRA 2YVUA 3NWBA 2I4LA 1SIOA 2HR1A 4DPMA 4G0YA 2PUCA 5EPUA 2XVXA 3F90A 4FFWA 3SZ3A 5DXJA 2WKWA 4KQIA 2ILTA 4MV0A 4Y18A 4D43A 1ZSYA 1F0YA 2DFPA 1K98A 1U9ZA 2GDZA 2Q21A 4XWKA 1N0IA 3RRJA 3U4QB 3ZX4A 3KHKA 2BYTA 2IYLD 1ODIA 1XEWY 2Q3FA 2PMEA 1WL8A 3JWPA 2DY0A 3KXDA 4I3FA 2XOEA 4YAFA 3SS9X 3RTGA 1RNLA 3AHCA 4BNGA 5JCJD 4ZZ2A 1EFVB 1JBQA 1QG4A 3HR4A 4IKOA 2Y1OA 4LHZA 2JGIA 3AEYA 4K2HA 4KP7A 5AESA 4G8DA 1VHJA 1ZK0A 4IH1A 2HY7A 1ZQ1A 3WWPA 3IE2A 4P2GA 3GGPA 1L5HB 2ZTVA 4AP6A 2QJTA 2H3HA 2OCKA 5AVKA 5FHQA 5JD3A 2NUAB 3GHHA 4Q3CA 1N1DA 1UWKA 1X0XA 1T5LA 2XVAA 4HH0A 4TN1A 5TMEA 4NCAA 4YAJA 2EDAA 3M6LA 2HZ7A 5DNDA 4ZU6X 2ROQA 3SFVA 5LZ7A 2RG1A 3T61A 4U2EA 3QEOA 3JARB 4IJQA 2GBFA 3H86A 1F1BA 4MIOA 3TKAA 3WXBA 2AQIA 4HMQA 4WEOA 5D7BA 4G23A 4MI9A 2P65A 1CR2A 1SXIA 2UVPB 3DCIA 7REQB 1R2QA 1JJBA 3EDRA 1V47A 1R4NB 1NRJB 1TC1A 5LNK6 2BP7A 4C9BA 2PQ6A 2QAGB 4GG1A 2O20A 4KR9A 4LFCB 4BMXA 4B3JA 4FJ1A 1O8CA 3BFJA 2HLHA 3PEVA 3P9SA 3SXJA 3CEHA 3KEQA 4P92A 1MJGM 1SEVA 4C76A 4RZXA 1PK9A 5BPHA 1QHGA 4INOA 1NYRA 3AF0A 4DC9A 5I7RA 2ZM6B 5TJHA 3WGUA 4LJAA 2CJFA 2Q62A 2BFCB 3AVVA 3CGGA 3PDJA 4RYLA 2NQTA 3ZU4A 2H07A 4BE9A 3THRA 5DW3A 2YJZA 3BXOA 2H3EA 1JLMA 2RGCA 5J63A 3K9WA 1N2CB 2R97A 3L1VA 2EIHA 3H5AA 3LZCA 4XPIB 5CEJA 3NHSA 4XQGA 4CMJA 3FYHA 4KAFA 5K3DA 1NG9A 2HK8A 4A6XA 3CZMA 2QGNA 3L6DA 3HHEA 4BNIA 2ET6A 1XPUA 2XGSA 3H5VA 3MD0A 1OZ0A 1NNSA 3DMTC 2N42A 4MKFA 4PC7A 5IEBA 1ZK1A 2C4HA 2LDBA 3OZDA 3KE8A 4B3SB 2VK8A 3W2EA 1KC1A 3IH5A 1T1JA 1GTL1 1OH6A 2RHDA 3AKEA 5TXGA 2HD4A 4EQ6A 2I67A 1G8HA 1Q3TA 3HKBA 2VN8A 3GEEA 3LLSA 3GF4A 1JKIA 4Z54A 3IVMA 4A0RA 4F0JA 1ZMBA 4JB3A 4WKBA 5IYZB 4W5RA 4CGZA 3A04A 5JAQA 3BE5A 3T7KA 4PZPA 2RJNA 4YHHB 3W6PA 4NYJR 5CDTA 2O3JA 1E2MA 3M4JA 3L7BA 2GRAA 4TLAA 4B4VA 2GN9A 2V6IA 4YCBA 2CV0A 1X15A 1GCAA 2XTNA 4HLQB 2BLLA 1UQTA 5AJXA 3UCEA 1H5NA 1YS7A 4IDQA 4MHOA 5DB4A 4ZGBA 4BN5A 1FQOA 4DILA 1FQKA 4FIDA 5FWDA 1BDMA 1X2EA 4OK6A 3K70B 3U4GA 3ADPA 3AUKA 1IEXA 4QWMA 4YT5A 3DNMA 1JQDA 2H7XA 3AZPA 3ID6C 1QR6A 4JFAA 2R6FA 4FFVA 2E5LB 1EMDA 1FLAA 2ADOA 4IDCA 1EU1A 2DQ4A 4MW0A 3TZQA 4DWJA 1DBSA 2YCBA 3AO0B 1GGEA 1NE7A 2X6RA 3EXEB 4KFRA 3JQGB 3C4QA 4F3CA 1N77A 2FQWA 1M66A 2FEOA 1XD8A 2WILA 2H48A 4ZREA 3TTXA 4LJRA 1A76A 2VDRB 1VL0A 4DOMA 2IEIA 3G8AA 2WUEA 2IOFA 4F5DA 1E0KA 1T4CB 1ULZA 5B3AA 1KJYA 4K6GA 1KO7A 1YZQA 3Q9NA 5E2BA 1WSBA 2LP4Y 2XUHA 3I32A 3VJLA 4ARVA 4TUYB 5C4MA 2BEVA 4QFDA 2ZANA 4YCNA 4G0UA 3FZYA 4UHFA 5MFZA 1NVXQ 4F2PA 3DJFA 1IONA 1XB2A 1XWFA 4QBGB 4EPRA 3EZ9A 3RAFC 2JJ2A 2JGDA 3NYRA 1Z62A 3ZXUB 3ZLUA 5LR6A 3RO7A 1O94A 4B87A 2TECE 3P4XA 4I5EA 1LUAA 3TUJC 4S2EA 4WJZA 4C6TB 4LOLA 2EX0A 1O5IA 4N49A 2QKYA 3NOVA 4Q1DA 5L7WA 4XM1A 3NXSA 5AVJA 1EXWA 1VJGA 4V39A 3GGJA 1O6ZA 1YRBA 3JSXA 4UVDA 2IIBA 1EHIA 1ZBDA 4QYTA 1W581 2B1IA 4F6LA 3R40A 2DF8A 4IOMA 3E2IA 1H93A 3LVRE 1E7YA 4MRVA 5KB3A 4J3JA 2C42A 1VLMA 1PFYA 4DZRA 3B5IA 2BFBB 1VIDA 1Y9AA 3A31A 4DBLC 4ZN6A 5EJ7A 1LNQA 2IRWA 2QW8A 1E1RA 2ZIXA 5KNBH 4YJFB 3OJEA 4UEJA 3V4SA 4BP8A 1TGVA 2WU1A 3D8HA 3EH2A 1RKBA 2ONZA 3E18A 1DKNA 1AC5A 4RPHA 1OYOA 3ZQKA 4KR6A 2ILVA 2QV0A 4LX0A 2CWWA 1XF1A 3VHLB 4ROTA 2QX4A 1C80A 1IUOA 4BNDA 3AVOA 2P2NA 3JZFA 2K4MA 1LZLA 1EE2A 4MVJH 4Q4DA 1IUKA 1Q1NA 3OWHA 3Q7SA 2C5FA 1BW9B 4MITA 1PIWA 1KO5A 1B14A 1MVOA 1V39A 1W76A 3GFSA 4PY2A 4RF3A 5TPZD 3W06A 4BEVA 4Z7NB 3OLYA 1CZHA 1L7XA 3CC8A 1EJBA 4JLBA 4N39A 4BNWA 3EG9B 2ZAGA 2EIXA 3QPCA 4XQCA 4BLSA 1TTTA 2BPOA 4TTQA 5A6SB 4YUXA 1I01A 4Q1CA 4XSHA 3U4MA 1JYSA 4JR0A 1QZZA 5AXBA 1IHUA 3QLUC 3SHTA 4DB4A 2JIOA 2ZQYA 1SZDA 2R2AA 2X41A 5D2CA 5ALFA 5EZYF 2E5WA 4HN4B 2QMEA 2ZUVA 4GDMA 1IZ9A 1O97D 3D6MA 4LVUA 2G0AA 2LTAA 2B9EA 4AJ9A 3SF8A 3O9MA 5DOVA 4FSHA 3EJ6A 3ZBQA 4ZHQF 1A8PA 1ZUHA 3TH5A 3IHTA 5F12A 5JG7A 2OZPA 1CS4C 2HU8A 3DE3X 4YC7A 3UT0A 2E82A 4DTIA 1FFCA 1Y98A 1PX0A 2HJGA 3WJAA 1O9HA 1QB7A 3PJDA 3JATB 3QHQA 4GRIA 5JD4A 3EEYA 2BMEA 2V7XA 4H4DA 4DSTA 3HUUA 4KFCA 3B8HA 2ARKA 2H0RA 3N3AC 4R0NA 2FSHA 4JEIA 4NQRA 5TARA 1NM5C 2GILA 1DC8A 5C3UA 3ZNQA 3QPUA 3DQPA 3O6VA 3JAWB 5CCXA 1TKBA 4JC4A 3RSOA 3G7SA 4C0SA 4RTQA 4JBIA 2PK3A 2HBZA 4EWLA 1MOPA 1SG6A 1J4AA 1DZIA 1WR8A 3EGIA 3FI0A 4TWRA 4TLDA 5ALYA 2EJCA 1ZN8A 2P40A 4KO1S 3SG0A 5KWJA 4I55A 1E1MA 5MN5A 4XX1A 4KEAA 3LOPA 1ZOSA 2FK8A 3RUFA 4FCTA 1R4MA 4K1XA 4M89A 1RP1A 3KELA 1YJAA 1DJOA 1S4QA 1YUNA 4PFJA 5EIBD 4MH0R 3TOXA 3E2MA 4HAIA 5C5DA 1ELOA 1U2DA 4EHDA 2QRHA 3BB4A 1YS9A 3IUMA 2BRUA 1H0HA 3R3XA 3SIXA 1M1YA 4YAIA 5A7HA 5IZCC 4QOIA 4KOEC 4AKGA 4EDHA 1FRFS 2WK1A 1QPZA 4NATA 3VKHA 2HADA 1GQOA 4NZZA 2R6HA 2YZKA 4XIJA 1PR4A 3U9SA 4AT1A 2B2XA 1SBZA 2GYYA 1SR8A 5FL7A 4EKGA 4QTZA 3PQ3A 2QD4A 3Q8WA 4LGVA 3FETA 4MW7A 2D4AA 3IHKA 2VHZA 3OQIB 2KM1A 4UQLA 4GI3A 4C43A 2Q50A 3DHEA 3AI3A 3AL2A 2X9LA 4OLJA 1LSOA 2OD2A 1WHTB 1UFVA 2OAGA 4QUBA 1CQZA 4GMXA 1CD5A 4EHHA 1PCXA 4M53A 3U7RA 3WNCA 3ZXYA 1N3YA 3E05A 5JS6A 4NOLA 4E2YA 1P61B 1QIDA 1RRMA 3WBFA 3HQ4O 3L06A 4HS4A 3VYWA 4ABTA 2W6MA 3AESA 2NVOA 1HQYE 1IATA 3R3UA 3N0WA 1XCLA 4KXXA 3BDAA 1M3SA 2ZUDA 4A8HA 2QE6A 1GNPA 1YZTA 2H2WA 2J3LA 1E2BA 4RVOA 4JCCA 4RJLA 1ZQ9A 4KIJA 4YV2A 2CLDX 3IKVA 5HM6A 3M2TA 5DLQC 1GV1A 2VHVA 3ZDZB 1KGDA 4GR5A 2A58A 3TLGB 3WKCA 1U0BB 3T5TA 1RHUA 1N4DA 2EFJA 1FDRA 3BMQA 3L0ZA 3PNVA 4IXMA 4DDHA 4ZDKA 3F46A 3KFLA 4W1QA 4J07A 3RVSA 2BMVA 4RH1A 4M2LA 5GIPE 2ZPAA 2CFCA 3IQGX 5I7VA 2CXNA 4CZ2A 3EIOA 1Z75A 4NFYA 4ZFNA 1E89A 1Y9EA 5JAHA 2VUUA 3WLFA 4KKVA 2PCLA 2OAQ1 4YCMA 4KWTA 3OCJA 3AJ9A 4CETA 4TXJA 2YDXA 4DANA 2W2MA 3SE0A 3GJZA 1M0TA 2ZPUA 2JBWA 2JATA 1G1MA 1CE8A 4PO8A 5ILGA 2OCXA 3ZZ1A 2B8EA 2MSKA 2HC9A 4FW9A 2ZSFA 2WU0A 1ZNQO 4N18A 3IIJA 4MPTA 2CKMA 2A9PA 2J7PD 3I2JA 1BTOA 3QUTA 1ZN7A 4L6CA 2YRWA 1PE0A 5FR1A 1IN8A 3C7DB 3UV6A 1QH8A 1X1TA 4Z0TA 4D4GA 5AI8A 3CNEA 1SHUX 5JUWA 4IJ6A 2AD5A 4IMJB 4PSDA 2H1VA 4H7KA 2GF9A 1SK8A 3F6CA 4NZ9A 1XK6A 4OA5A 4YUYA 1HEYA 2AOTA 5DTQA 4DIDA 2DXIA 3HDYA 3DMGA 1TQ6A 1UZUA 5C1PA 2CSXA 1Z5WA 3KWMA 3GLIA 2WE8A 2H52A 5C1BA 1XZ8A 3C1TA 2NWQA 3KOXA 4JK3A 4RIIA 4BFWA 2VH1A 4HQLA 3A9CA 1MIOA 1E0SA 1AKUA 1SXGA 2Y66A 5AO9A 4BB5A 1VRWA 4BVBA 1JEYA 3RWBA 4IIHA 2YKGA 2YV3A 2PFGA 2PJUA 4JJGA 1YR7A 1T26A 2ZIZA 2ZREA 3FTCA 5H82A 3WYBA 1TEHA 5F1OA 4XYLA 2XEXA 3PZBA 2E87A 1CBUA 1JHPA 4N5DA 1E64A 3GP5A 3KXPA 3NHZA 1NDQA 1ZUWA 4TMFA 3BPSA 1J9EA 1XRSB 1CY1A 1EK6A 1NQWA 4MKXA 4E03A 1Z88A 3WMRA 2LRHA 1YDMA 3KQUA 3BIJA 1SQSA 3BWXA 1Y7PA 3HVHA 4OHOA 4P36A 3NIBA 1E5XA 1DUSA 2ANBA 2LD4A 4U7JA 4EL5A 3U0BA 2O8DA 1HT2E 1E2FA 4RH3A 4EA6A 2Q8QA 4QATA 3SQXA 2IUUA 4B84A 4CIDA 5A62A 5IJ0A 5JZSA 4XWGA 4UBJA 2B34A 3BMOA 2GBGA 1E32A 1BO6A 4DUYB 3FCYA 3WGNA 4MDEA 2FKNA 2WTXA 3WSVA 5C7OO 1YQGA 5BQXA 1UKAA 1NYTA 1T24A 2W0SA 4AZWA 1VJCA 3L4KA 2GKGA 4P5DA 1GTG1 3OPYI 5CA0A 3UHJA 1FFXB 2OA0A 3TDKA 3KPWA 1UXKA 1DTEA 4ZIRA 2VDQB 5KVQA 2DG2A 3VZPA 2C2WA 1T6NA 1RI3A 2HU5A 4MUJA 4RADA 1AT1A 1G1AA 1Z2NX 3N6XA 1BIFA 5DWQA 5LIPA 2VJCA 5GY7A 5F1KA 4ZXFA 3PC3A 4L7QA 5E0OA 16PKA 5FUBA 2G17A 5DYIA 2Q7OE 3UY4A 2HT6A 1AF7A 1HEIA 1J8FA 2OCDA 2PGOA 3T7AA 4OY3A 4UHKA 3RWMB 1HT1E 2KBFA 2WKSA 4TKLA 5C1IA 1M5UA 4BQOA 5F3WB 3PLNA 1H1LB 1CEXA 4MDHA 2HU7A 3R3HA 5AJUA 5BV7A 1UKEA 4LYEA 1Z13A 1X7HA 4UHJA 3PUYA 1RJDA 3QBDA 3HN6A 3T9DA 3W9UA 4KN6A 1RWQA 4H59A 1YZUA 3BERA 4NZPA 1D04A 1ML3A 1NF3A 1VC2A 4MWBA 1ZOIA 2WC1A 1JTEA 3VV2A 1N7IA 4R68A 2BFEB 3KJNA 4ILEA 5KX5F 5MN4A 1IPEA 2B69A 1W0JD 1OA0A 5I4CA 1QK5A 1GOTA 1UKBA 2G4LA 4GMKA 3OOEA 3GEDA 5KI6A 5IDWA 5KKNB 5LP6A 1YRQA 2V55B 5MHTA 1YE5A 1VHDA 1APBA 1DZ3A 4IDDA 4K81B 3TNFA 5C53B 3DA8A 1J7JA 1DQZA 1ETUA 1KSJA 2KX7A 3HYSA 4ARBA 1INLA 2YFYA 3RIMA 3RTDA 1KRXA 1S2IA 2HIGA 4XDZA 2JLUA 3PDIA 5B2ZA 4A0GA 4F46A 3ZK9A 1QYRA 1PFWA 2PUEA 5IDVA 2KE5A 1YUBA 4G56A 3F6RA 3CEPB 1Z4LA 5HJ2A 4WOPA 1FNDA 1ZR4A 1P2FA 1C81A 1U8ZA 2H9AA 3GU3A 2VQ6A 3MWFA 3IR7A 4MJLA 4NOMA 4QXOA 2BH9A 3TN7A 2OCAA 4MV6A 1TUBB 1HUQA 3E9YA 4GWGA 3ZY2A 4DABA 1Y8RA 4J9VA 5CJPA 5ITWA 1VLJA 2C5LA 3IDAA 5CD9A 2F3UA 4M55A 1IIBA 2OV2A 4QOJA 2FHPA 3WMGA 4FYJA 1VDMA 3LFTA 2ZIFA 2CXSA 5HJ7A 2WJAA 1QIMA 1D6JA 3U6KA 3KR2A 5E1BA 1P1JA 2BGNA 2ZEJA 2IGBA 2ZRFA 4QYIA 5J2UF 1ZH2A 2XAAA 1E7QA 4Z3OA 5BSMA 4TYPA 5BN5A 5A4FS 3ZVMA 1RWNA 2KHZA 3NVDA 4UBMA 4YALA 2CW5A 1PZFA 1NVBA 1Q0RA 1K06A 3GRYA 2I4RA 4FONA 2R8RA 4MB2A 3VH4A 5JWOA 2ZTMA 2VPYA 4PGAA 4YQYA 3C8UA 1U0LA 3L1HA 2X0FA 3V2IA 2DU8A 3KTAB 1BCRA 4Y2YA 3A1NA 4IY1A 3VAZA 1F48A 2WIAA 1P9LA 5EAIA 1MD9A 5BRJA 4KIUA 3KC2A 4LJ4A 3IQIX 3ER6A 4ZOLB 1IRXA 5HG0A 3INGA 5ER9A 1U80A 3NBFA 1YUMA 4FWTA 4YAWA 1QGZA 1QPBA 5TLSA 4FD2A 1KKLA 5FADA 2O8CB 4Y0NA 3R75A 4YHBA 3LDAA 2AN1A 3MN1A 5BMVF 3QPBA 4G9BA 3EODA 4DREA 3IO3A 3AG6A 2IC5A 1VIMA 1YB6A 3HCCA 3ANSA 3V8PA 2WD7B 4Z7OB 4CEHB 1MB3A 3ES9A 3K1YA 4G5SA 2AT1A 1PS0A 3MT0A 1PT9A 2K5UA 2WIKA 3OUUA 4LQ4A 4ZVOA 1UH5A 1G64A 1GJRA 5AKLA 5U1PA 3ZCVA 2DLDA 1VRVA 1VQ1A 1NV8A 3D6JA 3JRNA 5TT1A 2YZNA 1OH8A 1AUOA 1HL3A 2YJ5A 1QRTA 4KN5A 1MXHA 4O3FA 3CVXA 3CNQS 3AY3A 5KINB 4ZANA 1OFTA 1ZPDA 3E7FA 3EVAA 4L8VA 4UBNA 1ZJYA 2QRMA 2TMGA 2RK4A 2OV6A 4PAWA 2ZM5A 4LF4B 1YOBA 4C6HA 1RDFA 1RM4A 1QIGA 3ZV7A 2J0UB 2CMHA 4M1ZA 6CHYA 4OHCA 1JEAA 1YS6A 5DSXA 2X40A 5ADHA 3HL0A 1L8LA 4MO9A 5EVJA 5FTJA 1OMOA 4B82A 2PX2A 4LJ7A 3F4LA 3DEJA 3PB3A 1R6TA 3JVVA 4C4SA 2VDNB 5TQ2B 1EFHA 1JFLA 1V7ZA 4KDRA 2IZ0A 5CXQA 3JQFA 2NZXA 4DVJA 4PNHA 2VLIA 3EFBA 3GFBA 3PDHA 2E21A 4EATA 2PL3A 4P33A 3HG7A 4RD4A 2QRGA 1DEAA 2C3OA 3GCGA 1VJ1A 1IOLA 3COZA 4PG5A 4EW3A 3IAM6 2NPIA 3RS7A 2V6FA 4X8OA 3COSA 3GMSA 2C4NA 2FR0A 3OU2A 1KJJA 4HPWA 4M0DA 1L0BA 2J67A 1HT0A 4G1UC 5FOXA 5IKXA 5CHYA 4C7XA 1I2AA 3A4YA 3IV9A 3BHJA 1C9JA 1WKCA 2HXGA 2B25A 2QTNA 2ZYRA 4M1QA 4MS4B 3FNRA 4LDPA 3LP5A 4X6LA 5TQ0A 4A4DA 4M9SA 5JMOA 1Z6AA 3HDGA 1WVMA 1JA9A 3KWLA 2XCSB 4E3ZA 3NBQA 3IELA 5B1HA 4AB1A 4ETMA 4XVQA 4MYCA 1UAYA 3JD2A 3IEMA 5AM4A 4S0XA 4YGXB 1IAQA 5A03A 1C1DA 2HOQA 5FPQA 3EAQA 3ZOZA 2SNIE 3LLCA 3MINB 2E49A 5ALWA 4EQZA 3QUCA 3U44B 3FSRA 1E4EB 2W2VA 2XUOA 3V4OA 2GPWA 3K96A 2ZXEA 2KLBA 4Z6KA 4NXNB 4II7A 4M9QA 2EERA 1S7GA 4C4ZA 4I9HA 1DARA 3HB7A 4C08A 4A2WA 2B8NA 4R2HA 3JS5A 5FBQB 1DT3A 3H97A 4IMIB 5C3MA 3H8SA 4OJNA 3V4ZA 1D2HA 3MUOA 3RS2A 1SHKA 3B3QA 3VAYA 1Q21A 1W4ZA 2WUVA 2OO5C 1SBNE 3Q2OA 4UHHA 4RFSA 1RTKA 5DHPA 4NFHA 2HNKA 4CMIA 2C04A 2QG4A 1Z26A 2Q2VA 4R1NA 4KFSA 2IEAA 2D13A 5DGTA 4WNCA 2OM2A 1KY2A 3GQBB 3BH0A 3LHSA 3Q3EA 1XWWA 3H4MA 2EJTA 5TJ9A 1BX1A 2QTGA 1CT9A 5BSGA 1ADFA 2DGDA 1U99A 4PZZA 3CVWA 2GJ9A 1QO0D 4MV4A 4Q3EA 1F6DA 1SVNA 1KXJA 1P9OA 2ECKA 1GD1O 3CXRA 3FKQA 4F5YA 1ICIA 1I8TA 3KSDO 5JSUA 1TJPB 1JLRA 1IY8A 3JRXA 3BWMA 1A5BB 2FSPA 5CB4B 2VHJA 4IG4A 4JLOA 2P7IA 4KN8A 1JV2B 3RHZA 2Q28A 2X3YA 1KAMA 1DAKA 3GJ7A 4FEGA 2GF0A 4UMVA 1OBCA 3T7DA 2OC9A 3H5WA 1AOXA 2PX5A 4WESA 2A7QA 2MIIA 3N87A 1E6LA 4P7GA 1RU3A 2NV2B 3JWIA 2WFZA 1QCZA 2BGWA 4WNIA 3NT4A 2W11A 4R2XA 4TWIA 3PUVA 1QGUB 4I4IA 2CYAA 1I6MA 5DSTA 4QHTA 3KKPA 4RXMA 4ZGGA 4GX2A 1GVHA 4GOMD 4IQFA 3OETA 3IBGA 4ROSA 1KQNA 4BMSA 2VIIA 3K2QA 3LVQE 5TIIA 1JKJB 1THMA 4FOSA 2B0JA 1E60A 3FYTA 4AS1A 1X1BA 5FA5A 1QC5A 3G2PA 3T9AA 3USCS 5E7MA 3UCFA 2R6JA 1X94A 1XU7A 5JLJA 4H9GA 3IBTA 2PS0A 3GXOA 3EXHC 2J5RA 1TU3A 2C29D 3VZSA 3ND5A 4C5AA 2AOWA 5BR8B 5G53C 5SYNA 1UMDA 1KIMA 4LDZA 4P81A 3GELA 2ZCJA 1UPAA 1OPXA 1R9NA 3ZIAD 3VKGA 1A7JA 1ZOOA 3BCUA 2ZYWX 3R5FA 1WP9A 4MQEA 1FYDA 4L8FA 1OY1A 3E8XA 4PAMA 5TV2A 5HE9A 3GZNA 3OFNA 3LXMA 4NE7A 4YRJA 3EGWA 1KZ9A 3LQ1A 1QVRA 5F5LA 3EGVA 4BO7A 4PBRA 3KB2A 3DLAA 2WFMA 2WWYA 3Q87B 4EJ6A 3ZVNA 4MS3B 4B6FA 5B37A 5F9FA 4LHSA 4RDXA 2AG0A 4YO8A 5CDSA 3HNRA 3WLEA 3FDFA 1GYQA 3L49A 1F4LA 1CQIA 1EGAA 1E58A 1T6BY 1A2OA 2IYFA 2WF7A 5G1OA 4WBNA 2MYPA 5EJ4A 2A8YA 1DRJA 2V74B 1SXJC 3BORA 4NCIA 3GIWA 3P9IA 1BE1A 4BQQA 2B4TO 4L0QA 3PUXA 4YMIA 4FDLA 3S1AB 1UJNA 3AR9A 4NYJQ 1OQAA 3ASYA 4PHGA 4OH7A 4YK7A 3TO5A 5AFSA 4RZ2A 2X0RA 1SUWA 5KX5B 5BSEA 3AI2A 4HRVA 4UBOA 5KTSA 1B74A 2J3DA 5AQEA 5F73A 3VDRA 2XJ9A 3ZVLA 5HXAA 2BGIA 2PD3A 4X8MA 4FE4A 5A7GA 2P91A 4IMPA 1M54A 5ESRA 5KDLA 1HG0A 5CDFE 3DC7A 1V8PA 3E9EA 3TD9A 4PAGA 3WLQA 3QMVA 1G4HA 1JEOA 2HRDA 5SZKB 3ZQUA 4AZVA 2NO7A 4CLHA 2ASVA 2OV3A 3H8JA 1WHSB 3HKEA 3H0KA 5ARDA 2I2AA 2WU3A 3CN9A 5C4GB 1MZPA 2YJ4A 1VHLA 4D5EA 1JG6A 3AOGA 3DTVD 4UE2A 4WK0B 1C41A 3ONVA 2BTQA 2QY9A 4P5PA 3RVQA 1TW3A 5BP7A 5JSQA 3WADA 1M67A 3TIXB 3DLBA 1FFHA 4HB4A 2YDYA 2COKA 3KEOA 5IF3A 2FXIA 3B52X 3DFIA 4V02A 4BU1A 4C3VA 3DWEX 1LLDA 2YJ6A 4KI0A 4Q21A 2X77A 3G0GA 2BBSA 3Q3HA 4YV7A 2KBEA 3H4VA 4F92B 1TJ4A 3N7UA 4ZYVA 2RFLA 3BBLA 5CCDA 3FWHA 3UW3A 3FWPA 1RKUA 3BXZA 2AG8A 2CD7A 3EC2A 4E5DA 2PR2A 3NU1A 3VNUA 3IAUA 5LA6F 4IGFA 1A2QA 2Q1TA 4TOIA 4B7XA 2IA5A 1NN5A 1XVUA 2NXNA 3E3OA 1V4NA 3AHJA 1UBTS 2REQA 2I22A 2VYCA 5LQJA 2P2DA 4UHDA 4F91B 3SSOA 4ZOAA 1RWBA 4CGYA 1W59A 3WX0A 2FWRA 1NSFA 5AW0A 2ZWVA 3DLIA 4MVJM 4JVNA 4W8GA 1TF2A 3U4QA 3RYFA 4JL5A 3WNVA 5AW2A 1H8EA 4DCVA 2QNRA 1LPMA 2BKAA 1RI2A 3KKQA 3I83A 4N5HX 4FHCA 4RPIA 1AHIA 1N25A 1V41E 1ZNWA 5TSDA 5G0SA 2BZSA 1KK1A 3LSYA 3BMNA 5B6IA 1ADBA 3D81A 3HCNA 1OAAA 3ESCA 2QGZA 3LU1A 4RMHA 4DMRA 5T7BA 1HFEL 1EFVA 1LNSA 4GXQA 5FTNA 4DY4A 2HRCA 4JYPA 1EIWA 1WXHA 3EDYA 1R37A 1C7JA 4FLFA 4NENB 3IOEA 3LBHA 4QRIA 3FPGA 4IQ8A 5DHRA 4ZYTA 1Q19A 1L5HA 1JYEA 1S01A 4L4RA 2XQVA 2NUAA 5FBWB 1UMBB 1NUPA 4NBRA 1J5EB 2IV3A 4EHNA 4JBHA 3VZRA 4P80A 5ETJA 5JVDF 2BGLA 3ICVA 3QNUA 5HM8A 3K6JA 2J3HA 3W2GA 3IAEA 2WM8A 2OGSA 3JARA 4QTUB 2IF2A 2CL5A 4POAA 5GZ3A 1ONNA 2OG2A 2VRWA 2UVPA 1RAGA 7REQA 1SOUA 4Y9DA 3RAPR 1R4NA 1EUDB 1V1RB 3CX4A 3OVMA 3SJAA 2QAGA 1U3WA 1RLJA 1U7DA 2EKQA 4ZO8A 4D8UA 2AOXA 3HXLA 4V38A 1Z82A 2ZUSA 2QTBA 4FU0A 1PJSA 3OIYA 3X1MA 1JTVA 3DTYA 4FGKA 4PM4A 2BFCA 4L9RA 3B1FA 3HCOA 5GAJA 2YNMD 3ICWA 4ARUA 2FN7A 3IQHX 1OWPA 3F9CA 4C3UA 1I24A 4D3SA 1LI7A 5LBTA 4EY3A 3EH1A 5BSWA 4HLCA 4RUKA 1UODA 4I7EA 1DWQA 1KOFA 1XLTA 1N2CA 1EJ2A 2E6UX 2XMSA 1QKIA 2I9PA 1P0IA 2Y1CA 1FRNA 1VPDA 1X1EA 2RHMA 1CZKA 1PAUA 4G0ZA 3CXUA 4TV8F 1FW8A 3II6X 3M4YA 4TWAA 1QIFA 1NC1A 1Z6PA 4WV3A 3DDOA 4UVGA 5LQSA 3USES 3UUWA 2HV8A 4ZEVA 4YLGA 2J4FA 1XRNA 4PYMA 4LGYA 1DHRA 4M1MA 5FPKA 4L73A 3UQYS 1UDCA 2PG3A 4AFNA 2FQ1A 4ENPA 1D1SA 1R0BA 1NUTA 3HUEA 4L3OA 5FNZA 1Q0LA 1GYPA 1JR3E 1RJEA 4R2JA 4EL0A 3TAUA 2GEKA 4IUYA 5IYZA 1FP6A 1GU0A 1RBZA 4GOXA 4BMDA 5K09A 1L3BA 3BD7A 1F06A 3O74A 1WBBA 2PEYA 4MW9A 1OLXB 1WXXA 4MHTA 4JWTA 3TG2A 4JOCA 4D8VA 2VHXA 5JECA 1LDMA 5DHTA 5GM2A 2BTOA 4L5YA 1ZA1A 2P2ZA 5DLYA 2PIAA 1B0AA 4RPLA 2PUWA 4E7PA 1GZDA 1YE8A 2D2VA 1ZA2A 3DH0A 2PJZA 4COKA 2ZCVA 4HXYA 2HMAA 4ALJA 1ZVVA 3ZUPA 3U56A 1ST2A 4URXR 1PJBA 5B1IA 4WN3A 2K6GA 2IITA 3DONA 4E2XA 2QUKA 2WIFA 2OAEA 2IYXA 3QX3A 3EBLA 2H1RA 4OTZA 3VU1A 2A9RA 1KPIA 3WE7A 3IQFA 4B7CA 1OT5A 3EXEA 3PWTA 1CZLA 2W2LA 1SQ5A 5FIUA 3R9IA 4JYAB 5JSFA 3B3AA 4IKEA 1K3TA 3KOWA 4QDOA 4C4PA 1EK5A 4BC0A 4OU4A 3HTXA 3OQVA 4OBEA 3U0VA 2ZRKA 4Q9IA 2H1HA 3HGTA 4FZ3A 3CO5A 4RFLA 5CLFA 1UDBA 5KTRA 4I81A 4Y2JA 3HJTA 4FYHA 5A0FA 1OTXA 1OXTA 5K6AA 4BYGA 1L5LA 2I2DA 3WLIA 4OL0A 3P9NA 2XHZA 1W5BA 1CYEA 4HK4A 4A6DA 3LYAA 2XVZA 4GX0A 1J22A 3ANYB 4DQXA 2SCUB 5E4JA 5E6UB 4CIXA 1NVWQ 4OGLA 2IXEA 3HBLA 2HDWA 5C2JB 4AZ0B 4C6TA 3Q6MA 2XODA 3CFYA 1CJBA 3EIUA 3KXIA 3MNFA 3F9RA 1N0HA 3WIVA 3PWSA 5AJVB 4P83A 1GQFA 2NO0A 1IJFA 4FI3C 3VJKA 4EABA 3K2BA 4C0BA 4BGEA 5JI2E 5FA8A 1E9FA 4BP1A 4NJMA 1B8UA 5CH3A 4LKOA 1FFWA 1XKLA 4YP5A 5HKLA 4I6EA 3N6VA 2ZITA 2BFBA 3NWOA 4JUIA 2I3DA 2DPYA 4GO1A 1AMOA 4MULA 1UUFA 4YJFA 4ND8A 4ZARA 3R4CA 5F7ZA 1E18A 4ND4A 3K6RA 4E1AA 4ZK6A 2F8MA 1JHVA 1OR8A 1UZLA 3QMPA 4BECA 3DE7X 3OEED 2Z30A 1S4MA 4OPMA 4DIEA 1GRCA 4HAXA 4JI3B 4AMZA 2JB9A 5GONF 5HQ3B 2YIJA 4BVKA 4XB1A 3LWDA 2IPXA 3M70A 2AMYA 3FNFA 3OQHA 2EX1A 4NOKA 4TMXA 4G24A 3FUTA 3H9QA 5HRCA 5KSZA 1RVV1 2DFDA 4PRZA 1AS3A 1GAJA 5DGHA 3R7LA 1I9CA 1Z4IA 1AQUA 2VHTA 3MT7A 4RHFA 1PTJC 1Q1ZA 3FMIA 621PA 1NYLA 2A30A 3EG9A 3WSTA 3L0OA 4ZI3A 1PWXA 3PXCX 3CJQA 1RYDA 5HSGA 2IHNA 3WYGA 4CMKA 1HH4A 3PIRA 5A6SA 3TB6A 5J2TB 2RARA 1CUBA 4MSUA 2OB1A 2BH2A 1OV6A 2CEKA 5DXFA 3TFWA 1V1JA 2BGUA 2CL6X 2EZ8A 2PBFA 1LI4A 1BGXT 1L1RA 3IUYA 3QVLA 3SDBA 1Y5NA 1NY6A 1R5OA 1A9YA 5D7NA 1VRCA 4O59O 5CDUA 1WULS 1DIBA 2Z5GA 1PLLA 2I3BA 3LT0A 2HGZA 3L5KA 4J7AA 4DA4A 3NBYC 2EFEB 4G37A 4N48A 5A6VA 1C4WA 3D4OA 3ZD8A 3NYWA 5BWBA 2PE5A 3FW1A 3DTVB 2DJIA 3UMJA 3MILA 4L74A 3QX8A 3VOBA 1T3ZA 2W6NA 1YJ5A 1LH0A 1NXPA 3IUPA 3JATA 3P9XA 1P4GA 3GJQA 4ZRNA 4BFZA 4LF8B 4LDJA 1ZBQA 4QOFA 2GM9A 2QQFA 2ABWA 3MJDA 5HE8A 1PYGA 2PLNA 3KKLA 4XOUA 1NLUA 4PONA 1JEEA 2NTJA 4EX6A 5HK9A 1HE2A 2XF2A 4X6UA 2MSCB 4Y2XA 4ZVSA 2BM8A 2XDYA 4X64B 1BWPA 3T7IA 4C22A 4DLNA 5J4YA 2VP3A 1MJFA 1AY0A 1DADA 3L0SA 4QDZA 5E1MA 5LQCA 1HXHA 2YY7A 3LY9A 5DJ5A 1K2VN 1BWSA 1QH0A 5D1NA 1QKKA 1EUZA 1T3HA 2PS1A 3F6YA 1X8KA 1JJ7A 2ZIVB 5IFKA 3QEBZ 1ODSA 2YFHA 2QPAA 1XQ9A 2PQ0A 3C1OA 3VR5A 1UFQA 4BVFA 3IHWA 1XQWA 3PE3A 1DAMA 3G8YA 3I34X 2OBLA 4ZV9A 1IY1A 1Q50A 1GXSB 1UBOS 3IMGA 3IBFA 2CC2A 4NMLA 5JPIA 5AR1A 1E2GA 3CNNA 3ET4A 4Z8YA 5IU6A 4M3NA 3HCEA 3L8YA 2V0NA 4WCFB 5DTIA 3KVYA 1R12A 3MWDB 4ZYXA 3PT9A 4WY5A 5CIYA 4K9MA 4LGMA 2DLNA 3VYRB 2V1UA 1UJCA 4INAA 2W8BB 1J6UA 2A0UA 4CLOB 3GUHA 1G2IA 2VBFA 2C9CA 1W2GA 3E9CA 1WHTA 3PNBA 2H2AA 4EA8A 3FOEC 5JZBA 3E5MA 2QTVB 2X0NA 3MERA 3OTHA 5KQPA 3AC0A 4G81A 4J1NA 4MGIR 4YJGB 2Q3EA 1W34A 3GFGA 4XB2A 3EDMA 4AZ3B 1HZZC 5IBRA 2IX9A 2JW5A 3ZV3A 3J81k 3G79A 3RFFA 3P4UA 3RU3A 2O3TA 5KYNA 1MX3A 4A2QA 3VUEA 4C0WA 3F1LA 3N8HA 4S1VA 2OYCA 4GEGA 2ZUWA 3RLFA 3ND9A 1E1LA 1FS4A 2BJWA 4Q48A 4XYMA 5I01A 5F9HA 4RD0A 3PNOA 3UXMA 4U63A 4IH9A 3CCBA 3GEHA 3RG2A 5CBPA 4LQCA 3A9WA 1M2NA 2C2GA 3P8ZA 2RONA 3OLVA 4G5OA 4JLVA 3TLGA 2QM3A 3VR4A 1FU8A 4WKCA 3ZZMA 2CXHA 4L27A 2QTHA 4PYKA 2PYDA 3C1UA 1SFRA 5ALEA 3R5JA 5IC6A 4QJIA 1CJCA 1U9YA 1N75A 3NIWA 5BV1A 2XZOA 3DZJA 3GEIA 1ZOLA 4QC2A 1EVJA 4B85A 4J0KA 5J4LA 3EGOA 3GDOA 3ACCA 1A7UA 4ZVLA 3SQNA 1F0KA 3V2UA 1YB1A 3V4LA 3BK2A 4DSAA 1M7BA 1T5SA 1YB5A 2YYSA 5CNMA 1XAHA 3PXDA 2ZRLA 3OLXA 1JIXA 4IUCS 5EP2A 3O3CA 3DQQA 1RLOA 2OBBA 4X7RA 3UAGA 1CUFA 3W5SA 3N58A 3FZEA 1QQBA 1VE6A 2ZBGA 4IDPA 4IZ6A 4HB3A 2W6IA 3HL4A 1ECGA 4FFDA 3TKLA 2XXAA 4BRSA 1FS6A 2Q1UA 2FUG6 1R0CA 1NAHA 4QOHA 4F84A 2FPIB 3Q8LA 4FR2A 4PO1A 4A15A 4DV6B 1DC6A 2XR1A 3EPLA 4V0SA 3AFHA 3O7MA 1DRWA 5D3MB 1EGQA 2D1TA 2IH4A 3D4PA 2Y0BA 3UHOA 3QYFA 1CY0A 3BXXA 2P67A 3ZLVA 4L75A 4F97A 5IUNC 4C0JA 1K5HA 2VXOA 5AM5A 1QQTA 4DZZA 1J0XO 1G18A 4EHJA 1OGIA 2AGVA 3MB8A 1M0EA 1XWIA 3PWKA 1JDVA 2DT8A 2KJQA 4ZI7F 1A8QA 1VLLA 3EJWA 3NX4A 4BVGA 3RC2A 4EGCB 4QPDA 3ZXXA 4L51A 1XZKA 1OVMA 4EGQA 5A2QA 4UCQA 3FCCA 4YA6A 4N7JA 4MB6A 3ETGA 1Z12A 2B5VA 2LE0A 1XP8A 5HVNA 6ADHA 2Q1XA 1PJ2A 1P4JA 2VWGA 4KI7A 3ZUGA 2CDCA 1ZZGA 3E22B 1FNNA 2DQKA 3MGKA 4FOOA 1ND5A 3CVUA 1TM1E 1D5WA 3ZHBA 1D4ZA 1HNXB 2YZ2A 4IIBA 5FR2A 1Z68A 4MQUA 2FG5A 2C5AA 3SPXA 3RK1A 1E3LA 2YMQA 5B30A 4RKFA 1D9ZA 1CUYA 1ANKA 3L8MA 1W96A 1LFAA 5AVRA 2OAP1 3F7TA 3I05A 2GVDC 3FKSD 3M9XA 3NM5A 4MVJE 5I4BA 3UB2A 4EEZA 3B6EA 2XLBA 4P7KA 4C21A 4MUBA 4PLZA 1T5IA 5D3QA 3VOAA 3HNPA 2VI5A 3BD9A 2R1TB 2HPZA 3Q9UA 3RU2A 3GMIA 1F3OA 1FFXA 1G8KA 4PXAA 2EGHA 2WTEA 5BSRA 2V5VA 2D2FA 1E7WA 1B3BA 5E4TA 3WZ2A 2X5NA 3AXSA 2IOFK 4JQOA 4MICA 3U09A 4XZ3A 2QV7A 1JHZA 1KTIA 5CUQA 3GA0A 1TJ5A 3KNZA 2QX9A 4YRNA 3D02A 3IQWA 4UEOA 2LIVA 4BNYA 1Z4MA 4AULA 4C0XA 2P6OA 3PKIA 4K86A 5CT5A 1YQUA 2YHBA 1P72A 1U0EA 2QENA 1A27A 4LNUB 3BXPA 3WDKA 1GN9A 3NNSA 5KVSA 2B30A 1WB5A 2RAVA 3BOSA 1A96A 2H2IA 3I2IA 1H1LA 2FETA 5JRJA 2BMFA 3DE6X 1SUFA 3WLHA 4D7AA 3WB0A 2G9RA 3GG2A 3WHKA 4JOQA 4RJKA 3ZS8A 2P4SA 1YD7A 3K16A 3IP7A 4LXHA 3WYFA 4E46A 5HQTA 1XMJA 1TKAA 3U49A 5BN4B 1QRDA 3L0IB 3LCMA 3KJQA 2ZE7A 3OZCA 2JFWA 4IO1A 2K2WA 4KXYA 1RLUA 3CZAA 2GLXA 3QU4A 1H94A 3HV2A 4DQUA 1GUYA 4B4KA 4WJLA 4JI2B 2BL4A 2VZ0A 3M1YA 5AXCA 2IUTA 3TRFA 5I8PA 2P79A 1Y7TA 5L4LA 4GSKA 1MBZA 1P2GA 3IAHA 3KR1A 4PWYA 4AN0A 2PKRA 1O0CA 5B64A 1OAOA 1NNEA 1E0DA 1S3GA 1RYFA 1PYDA 4E2WA 4B09A 3PNSA 3T8YA 2ECPA 4D9FA 3L07A 2Z2XA 2XDAA 4YRRA 5HIMA 5FPHA 2FP4A 3S28A 4DC1A 3WMEA 4JBGA 5IJZA 1UPFA 1ISSA 2VDWA 3LQFA 3I12A 3NAQA 4IVPA 2YYAA 1M34E 1CUZA 4N0MA 2WABA 5AQ1A 1XR3A 1W5AA 1BMQA 3LQYA 3WIOA 4A7PA 2QZZA 4I50F 5JNSA 2ZJBA 4AWXA 1PS8A 1VJ5A 1TUBA 3DAPA 3G2NA 3O1LA 1NW8A 1FVFA 5CEFA 3CH4B 3GG9A 3NHKA 2VPQA 4YTEA 4L16A 3H5OA 1GWNA 1EINA 1YS1X 4IILA 3SMVA 4B2PA 1WSDA 4F4FA 4RMGA 4CQLB 3HRKA 2ASEA 2BI4A 2GPTA 1PNQA 2CUTA 2EDCA 1RBMA 2C5EA 3FOFC 3I1FA 4G0OA 4MZDA 4DBZA 4DMUB 2EJVA 4IDFA 1L1EA 1T0JB 1WDTA 1AURA 3LS2A 5DTEA 1U94A 1PV2A 4RZQA 4JQZA 4D79A 721PA 1N7HA 3TQCA 3TTVA 1SUIA 1O5TA 3PQEA 2EP5A 2PZLA 3BWYA 3MPUA 3MZ0A 3VU8A 3IIIA 2NXWA 4ETWA 3ZH2A 4LJ9A 4JZKA 1Z8HA 3R6GA 1VJRA 3KTAA 3W9YA 2HMYB 4RHXA 3T5DA 5BN1A 1HX7A 2NXCA 3BYZA 3B9RA 3K09C 4QNRA 3ONEA 4JSTA 2V1XA 3JQPA 3VA7A 3VAAA 1A04A 4ZOLA 3L0DA 1TPZA 4YLEA 3TRJA 3PXEA 3I1YA 3MD9A 1IDOA 5A9RA 2XH8A 1UBSB 2JLSA 3V42A 2O8CA 2QRPA 1PZNA 1DXOA 3KEFA 1QTRA 3S5UA 4YFVA 2EZ4A 1E3EA 1EP3B 3S27A 4UFNA 2EL9A 2WD7A 3PUHA 1OZGA 4ZZ3A 4HGPA 2UYCA 4CEHA 1OXMA 1U2PA 4US0R 2JGAA 1BMDA 2P9YA 2JVJA 4H3SA 2R60A 3H1AA 5HUQA 1ZNZA 2B0CA 4PNPA 3DD1A 4RSGA 5IAEA 2J08A 1AKNA 4J0EA 5GZ6A 4GM1A 3ABZA 1JDJA 1FVHA 2R7LA 3Q3JB 4P7BA 5H5JA 4GBMA 1Z7GA 5A2GA 3THWB 3P9ZA 5GTDA 3FUVA 1PQPA 3OIVA 4IDEA 2ZU6A 1MEOA 4KSCA 1K7EB 1XQ1A 1ZXLA 1KEPA 1D2RA 1MAHA 1XO1A 2HIMA 2Q5JA 2ZBEA 3BWCA 3OO1A 4RULA 2YH2A 3ZHQA 1QLJA 3FTQA 1LJLA 1QJCA 2MINB 5DHUA 5IM5A 3CUKA 4X7MA 1T0PA 3BRQA 4BNTA 2X58A 2OQRA 2J0UA 2OXFA 2VSOA 2WSSA 3KDSE 4BEBA 1OLSA 2A6PA 1AQNA 1ABBA 4Q6WA 4LC0A 1FP2A 1YRAA 5DP1A 3MJVA 3TLAA 2XNDD 1N7GA 2ZROA 1U8UA 4H31A 4LE1A 5K0TA 5AT1A 3HZZA 4PC3A 3HJNA 2QZ9A 1P6XA 2KMLA 2WJ3A 4OUKX 4M87A 4DMCA 2DY1A 3EISA 5TQ2A 3N8KA 4QU8A 3W3AD 3WK8A 5JSHA 3URKA 1PTKA 1UK6A 4I4NA 5GVSA 2PWZA 4HDQB 4JKYA 1OX4B 1T5HX 1B15A 4L4YA 4IDOA 4AF6A 2ISSD 4YASA 3KT8A 3RT7A 3TTYA 1VHWA 2AD1A 2H2HA 2G80A 3GUCA 2PSSA 3F2IA 2OR3A 1L4KA 3W7AA 1IBLB 1YQEA 5CPFA 1M6WA 4JI8B 2OCLA 2XTJA 4GMHA 4R51A 1U2TA 4XGIA 3IA7A 3RASA 2H4WA 2Q5LA 4ZQFA 5TGTA 3U3JA 4DMFA 2ZVPX 3LMKA 2IIQA 3G2HA 1CULC 4DGQA 2N47A 4MS4A 1M2WA 4MKHA 3OJ0A 2FMHA 2IE8A 1GR0A 4QXRA 5K45A 3T7CA 2C5SA 5FUMA 1JVSA 2JZCA 2OG1A 2V0CA 3AGQA 3KYCB 4TV9B 1PG5A 4IFBA 4B0OA 4EECA 1I7QB 1N5OX 3UZUA 2ZXUA 3ZBPA 3AM3A 1ISIA 1E3DA 1PR2A 2GZ3A 3ILHA 1CC1S 3ZG6A 5BQFA 3U44A 1H42A 2IBTA 3GZJA 3NGLA 2E85A 4G8CA 4G89A 1R1DA 3A6KA 5FLKA 4DQKA 5DISB 2OENG 3WB1A 2WZQA 1OSNA 4KYIB 1DCKA 4S1WA 4D9GA 4JASB 3WK7A 3RHSA 1CZOA 1U7ZA 1G17A 4GX1A 1XAIA 1T5OA 4Z3DA 3V48A 5BYKA 1T10A 2WB2A 4JSYA 1FTYA 2G09A 2J5KA 3QUBA 4U5XA 3VSEA 1JZQA 4RVNA 3WGQA 1KEKA 3HO6A 5AOCA 4Q0MA 3JASB 1XRRA 2VEOA 3GQBA 3G6WA 4YEDA 3ZKWB 3TW6A 1CRQA 2BWJA 4B44A 4F3NA 5FBVB 4K6KA 2FMIA 1SC6A 2XB8A 3VC1A 2Z8ZA 4E0BA 4H6WA 3TEFA 4GYYA 4A23A 3TF5A 2QQ0A 4WERA 5K8TA 3CUVA 3H9BA 3R0ZA 4GYWA 4N47A 4ZYYA 2VR1A 1JPVA 3FNGA 1TCAA 1GP2A 2J48A 1DKPA 2B8WA 3E9RA 2QPOA 4GE3A 4RX1A 1C8LA 1FX1A 1J1IA 2NUPB 3AEQB 2OO3A 2X8BA 3MWGA 5JQGF 5B12A 4ZT6A 5CB4A 2Z8YM 4AW9A 4L72A 4ZICA 1C50A 2XBMA 2ZATA 3N76A 2XUDA 3OM8A 2W2XA 5T5QA 1ZK3A 2QN2A 1Z2CA 3N75A 3PFIA 4MR8B 4O4JB 5BW4A 5EJEA 2DB3A 3QG5A 5EZ5A 3AOEA 3VU9A 1ZGBA 2JI4A 5K6RA 3A0RB 2RCNA 3BTUA 3OLZA 1NR7A 1F0PA 1UC5B 1QGUA 3TTUA 1N36B 4PV7A 2Z56A 3AVWA 2B1GA 2PGLA 3N2ZB 4NOJA 4C3OB 4CHTA 1E69A 2ORIA 1RPNA 4JGBA 2EF1A 5ESWA 4MGYR 1JKJA 2BFFB 2FR8C 7AT1A 3FUWA 3TRDA 1B1CA 1I51A 3MVEA 4DLXA 4TYNA 5KDOA 2ZR7A 1QF9A 2CL7X 2HL6A 2O7QA 2OCPA 2H5LA 1W88B 5THQA 1GYRA 3K2EA 1YDWA 3IALA 1LRJA 4UVHA 4DJFC 5LYJB 1EX7A 1D6SA 4KAJA 1WIWA 3NH9A 1QTNA 2Z4TA 2O8EB 2WWRA 4YQFA 1DJLA 3D7NA 4IZIA 1R9JA 2YR0A 4IIJB 1BVHA 1O58A 4WPGA 5C7IO 3M1LA 3W4JA 1TEXA 3GFOA 1A4XA 1O8BA 2IVFA 4P1ZA 4M0KA 3T1QA 1E2LA 4QJ3A 3F2VA 1I2CA 4H7HA 4URWR 3ZCXA 1JR2A 4Z3KA 3ZPXA 4RY9A 5IW8A 4FKZA 4YP6A 2RHWA 3KPUA 1XCGB 3ND8A 1WTAA 1T1GA 2WSMA 3L7MA 4DRYA 2Q7DA 5JV5A 2HDHA 1LDNA 1E2JA 3SU8A 2V7VA 4HDKB 2VTBB 4J6EA 4C2AA 2GNOA 1LTQA 4URFA 4EG4A 2VHUA 4EBFA 2XITA 4XYEA 1EK0A 2P27A 4MS3A 4PLCA 3WY9A 1ZX1A 3U6BA 1T9KA 3PX3A 4OSEA 1N6RA 5AIAA 1KETA 3S68A 1WMDA 4KQKA 4RD1A 4B71A 4CM8B 1UOQA 3ROPA 1MZVA 1QXSA 4I8IA 2YYZA 4RIHA 2OLKA 3D3QA 4M99A 3RREA 4I4LA 4KDCA 4PLFA 4DLPA 5JXGA 2VAXA 2B37A 1Z8FA 3S1AA 2FSVA 3MBKA 3R3JA 4YFYA 1QHIA 3HI4A 4OHVA 4YDHB 2IY7A 5KX5A 3SZRA 3O94A 5JC1A 3IMFA 4RNCA 1BGWA 2PXAA 3PITA 2WTMA 4V0RA 5DEOA 3I73A 3CUWA 5JYEA 4Y6RA 1FFSA 2NZ8A 4JLNA 4W1PA 5KDDA 1UEXC 1Y6RA 5LZ2A 1GQSA 1OJ7A 3GP8A 3DDUA 2H7VA 4ISBA 4LWPA 4AKTA 1U5CA 1N4AA 1HE8B 4WXHA 2QN1A 2AZ4A 2PSFA 3L40A 3MJSA 4F71A 4RC9A 5KNDA 5FUXA 3H11A 1WHSA 4R5MA 1EP9A 1A3CA 3X1YA 1O0SA 5IEJA 2FKAA 2E2WA 3LPNA 1NBAA 1EX9A 4QSMA 4GZMA 2O8BB 1CFJA 1XMVA 1OFIA 1ZEJA 5AKGA 5KHOC 1AN9A 4ENVA 1K0UA 3IUNA 5KSWB 5KU1A 5K0LA 2CN1A 2BR4A 1GGFA 1ZH4A 1U2RA 1YBHA 1SPXA 1U5BB 4FZJA 3CT6A 4U5QA 3I6IA 4QXQA 3OQNA 2AJCA 1A88A 1M1UA 1SXHA 2ZRAA 4JYBA 3NV9A 5IDYA 2ZKLA 4FN5A 4KVZA 1FA9A 1I5OA 3D8NA 3K0KA 3UQZA 1BROA 2ZI6A 2YC4C 1XKTA 1S9HA 4S1PA 3OIWA 4BX0A 3AR8A 1X77A 2D4HA 1V7CA 2VF5X 2X2OA 4MX8A 4F38A 2R1VB 1OVGA 5J2UA 5LB4A 2WBLC 3N2LA 4HAUA 4AY4A 3BZWA 1JWAB 1UQUA 1NBHA 2IYSA 4IINA 4REMA 3FUUA 4W8OA 1IRIA 4ZYUA 4DB2A 2HNBA 5CX4A 2YASA 4YP9A 4U9IS 3LPMA 1SN7A 3NJ8A 4HN9A 4BNLA 2I99A 3BFKA 1BEUB 4BNNA 4KNVA 1PWYE 1LLQA 4F5WA 5DNCA 1EESA 5FL3A 2J0SA 1MJHA 4DRZA 1V4VA 3KPYA 2L42A 3MWKA 1NMYA 4WUTA 4V0LA 3ZV4A 2IHBA 2JG3A 3N8GA 4DR5B 5DNEA 3KOUA 3O38A 3PCTA 4TYMA 3E61A 3QTTA 2DWOA 4FFMA 5G0WA 1QHXA 4JJIA 1MX1A 5G1NA 4TLEA 4CU5A 5DEIA 4HQKA 4MGKR 3LX8A 3BTSA 4Q00A 1R8QA 1WUYA 1G7CA 2XWJI 3MMZA 3WYEA 4DM4A 5A1JA 4QU5A 3U3XA 3I2GA 3PHIA 3A3YA 4TZTA 5BMVA 3CLTC 3CVVA 2HQRA 5JEDA 1HGXA 2NZVG 4EY4A 2ZJOA 1L8XA 3AY0A 3CUYA 3WNDA 2J33A 4OP1A 4B3GA 4UFOA 4JVSB 2I0FA 1BJKA 2QE7D 3KHUA 2EF0A 5I5EA 1E1CB 3H0EA 3TX6A 1UMBA 2KLHA 3LT1A 4BX2A 4NEQA 3TEMA 4YJ3F 3RTEA 4R7ZA 3H84A 4XYBA 4MJ3A 3FB1A 5EJAA 2R2GA 1ID1A 2YHIA 5D5PA 1VCNA