1S2OA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 at 1.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a cyanobacterial sucrose-phosphatase reveals the sugar tongs that release free sucrose in the cell.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
molecule keywords sucrose-phosphatase
total genus 93
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2004-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1s2oA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1s2oA02
2GMWA 2ZBFA 2IOFA 1Z4PX 4KNWA 5AKLA 1EK2A 4PNHA 1Z4MA 2CFTA 3GYGA 4Y2UA 4BYGA 1WR8A 3M1YA 3ZU6A 3WGVA 2C8KA 1RQLA 1L7OA 1YMQA 1VJ5A 5AM0A 3WK7A 5AVQA 2R8EA 1LVHA 4RESA 3QU9A 3UMCA 5AVXA 4H1WA 1VJRA 2P11A 2JAUA 4G63A 3B8EA 5AM3A 5A3RA 1Z4IA 3W5CA 1RLMA 1RRCA 1Z4QA 1NNLA 2QYHA 1WVIA 3OCVA 4ZEXA 2G1AA 1LTQA 1ZD2P 3I1YA 2JAOA 4DWOA 2W43A 4HGOA 4GXTA 3WKCA 3HYCA 2P27A 4HAIA 4I9FA 4C4RA 3AR6A 5AKEA 2ZG6A 1L7NA 3BA6A 3L0CA 1CQZA 2YJ4A 5AW3A 2C8LA 1S2OA 5AW4A 3DAOA 3U7FB 3QXGA 2G0AA 2YMQA 1L7PA 1ZJJA 2C88A 2PR7A 3IJ5A 1RKVA 3SKYA 3W5BA 4YGYA 4QQFA 5ALZA 2FUEA 4MWOA 1ZS9A 2FPSA 2WF9A 3R4CA 2NYVA 3L1UA 2BY4A 3NALA 3ZVMA 2FPUA 3ZTYA 2RAVA 3U13A 4RETA 2JGAA 1JUDA 4Y2QA 1X42A 3PDWA 5AI4A 5AIAA 2FPRA 1J97A 4UATA 1T5SA 5E0OA 5AHXA 3L8FA 3SMVA 5AVRA 4EENA 3OTQA 1Z4KA 4DW8A 3FZQA 2RB5A 1Q92A 4G9BA 4NWIA 2IOFK 3L8GA 3QGMA 3ZWDA 4YIHA 4Y2RA 1J8DA 1RDFA 2G07A 4UMFA 3U7EB 4FYPA 2W4MA 2B0CA 2FI1A 5ALYA 3E81A 1ZD3A 1QQ7A 1O08A 3L7YA 3WK5A 4NFLA 2YBDA 4BNDA 2WF7A 2HEGA 3WK8A 2C4NA 4EX7A 2HO4A 2HF7A 2YJ3A 1FEZA 4Y3UA 3DNPA 4IFTA 3N8GA 5AKYA 2HX1A 3QUTA 3W5AA 2I54A 2NO4A 1IWOA 3PGVA 2CFSA 4UMVA 2R8ZA 3SKXA 4NV0A 5AK6A 3WK9A 1YNSA 2HI0A 4C4SA 3TLMA 2HCFA 2GHTA 4KX3A 1ZD4A 2YJ5A 3CZ4A 2FPWA 1ZOLA 1Z5GA 3QLEA 3ZI4A 1O03A 2I7DA 3KOOA 1RC8A 2R8XA 3L1VA 3HLTA 4L57A 5IT0A 3N28A 2R8YA 2G09A 4F71A 3ED5A 3P96A 2IA5A 3QYPA 3QUQA 3L8EA 2FUCA 4UU0A 1SWVA 3UM9A 5AW2A 5AVZA 2YY6A 1U2TA 2BDEA 5ALTA 2EAUA 3I76A 5AW1A 3L8HA 5AW0A 1YDFA 4AS2A 1L7MA 4HGPA 4XOUA 4CE6A 1S8OA 3ZW7A 4BX3A 5A3SA 3QUCA 4I9GA 3MN1A 5ALEA 4AS3A 2Q4RA 2ZOSA 5ALWA 2AGVA 1RLTA 3KD3A 1SU4A 2YFYA 2GO7A 5AW5A 4EEKA 2EARA 3J7TA 1Z5UA 3OCYA 4J03A 3UMBA 2B1RA 4UAVA 1QQ6A 2O2XA 5ALOA 2ZBEA 2FDRA 3QUBA 2ZBGA 3FPSA 4HGNA 5AKJA 4AP9A 1YJ5A 2WF6A 3QU4A 1Z4OA 4J2TA 2MU1A 3ZWKA 5AI5A 3FGOA 2OM6A 2RARA 5ALJA 3I6BA 3B9RA 1RLOA 4BNDB 5IS2A 3CNHA 4DFDA 3ZVNA 1QYIA 4YCNA 1ZRNA 4OCZA 5AVWA 4KX5A 2HSZA 4FFDA 4KNVA 3W5DA 5AK3A 3OCXA 4HYTA 3WKAA 5AKHA 3SF0A 3DDHA 1YS9A 3DV9A 4BEVA 4UMEA 3EF0A 3OCWA 3PGLA 3KC2A 3AR2A 2MSNA 3NASA 1YV9A 5AIBA 5AM4A 1VFPA 3NUQA 1XPJA 4JDPA 3ET4A 5ALMA 4UM7A 2ODAA 5ALHA 3OPXA 3U19A 5ALIA 3NANA 5AKXA 5AVTA 3E84A 4UASA 2B8EA 5AI9A 3AR3A 2IYEA 2PKEA 4MUMA 3ZTWA 3N1UA 5ALDA 1TE2A 3QU5A 3VAYA 4C4TA 4CF4A 1NF2A 3FVVA 3MC1A 2ZBDA 4O8CA 5AW8A 4HGQA 3M9LA 5ALVA 4HGRA 4XQ0A 3BWVA 3FM9A 3AR7A 4UARA 4KN8A 1T9ZA 2W11A 3SHQA 4YCLA 3ZUPA 3QX7A 5ALFA 2ZXEA 4Y2TA 5AK4A 3SLRA 3AR5A 5AM2A 2WFAA 2AMYA 3AR8A 2Q5EA 1L8OA 2GHQA 3N5KA 1TJ5A 2IOHA 2JAWA 3R9KA 5AM5A 1Z4LA 2VKQA 3WK4A 3IRUA 3QNMA 5ALXA 3IB6A 4OHFA 3ZX5A 4EELA 1QQ5A 1TJ3A 5AKIA 3UMGA 2FEAA 5ALNA 4UW9A 2P69A 1N8NA 1Z4NA 3N07A 4L6CA 1RPZA 3ET5A 1KYTA 4L6AA 4E88A 3L0YA 5AW9A 3RFUA 3A1EA 4CNQA 4OD0A 5AW6A 4Y2PA 1Y8AA 3FPBA 2FPXA 2CFRA 1SWWA 3KBBA 2AUTA 3EPRA 4KYTA 3KZXA 1F5SA 3EF1A 1RKQA 2PQ0A 4ZEWA 2I55A 5AW7A 1TJ4A 1ZD5A 5AI0A 1U2SA 3ZVLA 5AESA 2WF5A 5AVVA 3I28A 4QJBA 1RMYA 2YN4A 3AR4A 3OCZA 3NIWA 3R09A 4ZEVA 1QH9A 1RKUA 2B30A 2RBKA 5AICA 1K1EA 3U7HB 3ESRA 2YMPA 3B9BA 4Y2JA 5ALLA 4XE5A 2Q4TA 2B1QA 3QU7A 2CN1A 5FP0A 3ESQA 5AKGA 3L5KA 1XP5A 2B82A 4UAUA 4NAVA 3NRJA 2DQSA 3S6JA 2G80A 2EATA 2OA0A 1Z88A 4JB3A 2G08A 1AQ6A 4Y2YA 1WZCA 3D6JA 2WHEA 3RF6A 4F72A 1XVIA 4EZEA 2AH5A 4BX2A 1U7OA 4BX0A 1L6RA 4Y2XA 4EX6A 1Q91A 3ONNA 3MMZA 3EWIA 3ZX4A 3PCTA 1WPGA 3OCUA 1NRWA 3WGUA 3MPOA 5ALSA 4BEWA 1RQNA 5AI8A 2HF2A 1EK1A 2HDOA 1T5TA 3WK6A 5A3QA 5AKZA 3WKEA 1MH9A 4UMDA 1RMTA 2YJ6A 2YMMA 2X4DA 2D2VA 4YCMA 4DCCA 3E8MA 2P9JA 1N9KA 5IT4A 4CF3A 2NO5A 4NABA 3A3YA 5ALGA 1U7PA 3U7GA 4UU1A 5AVSA 5ALPA 1CR6A 4GIBA 4XPZA 4FE3A 2QLTA 4IG4A 5T41A 5ALRA 3A1DA 2YMLA 3AR9A 2HHLA 3F9RA 2I6XA 4YH1A 3NAMA 5ALUA 5ALQA 3WKDA 4UM5A 2G06A 5JJBA 3L0BA 3E58A 2OBBA 2OYCA 4CF5A 4B6JA 1ZRMA 1L8LA 5AI6A 2WM8A 5ALKA 3SD7A 5AVYA 1Z4JA 2I33A 5AM1A 2O9JA 2JARA 1U02A 1TA0A 2C9MA 3KDPA 5AVUA 2BDUA 2GFHA 4OFZA 4Y2VA 5AK5A 1RMQA 4BKMA 2B8JA 4Y2SA 3A1CA 3K1ZA 1PW5A 4BBJA 3QU2A 2WF8A 2HOQA 5AKKA 2I34A 4YIKA 3U26A 3WKBA
chains in the Genus database with same CATH superfamily
4BP3A 4F3TA 1I5OA 4BB6A 4ZJZA 1I01A 2B2NA 4YVFA 4JR0A 2I8LA 2IU0A 5LWHA 3L7BA 2QU8A 2J45A 2ODBA 3TQOA 4LBYA 1A4IA 4Y6QA 1D1SA 1QFXA 1WY7A 2LIPA 2OEPA 4PFSA 4PICA 2OL4A 3AX6A 5B3AA 3VAZA 3VZDA 4AF8A 1JDJA 3FLEA 2PL3A 1GPYA 3KLOA 3TINA 2NYUA 2ZANA 3UG7A 3ZVKA 3PLRA 5KKAA 3CYFA 5E4FA 2D5BA 1FLVA 5JTUA 1R10A 5GVRA 1F17A 1GPKA 1K08A 3D0OA 1QTNA 1V8ZA 5J47A 1ZGHA 4H1WA 1WV1A 1PR5A 2HSWA 4M6WA 1TL7C 5HMLA 4O4LB 3LOUA 3FDFA 3STTA 1YKSA 1CJBA 1GQ2A 1RIFA 3BORA 3CX3A 4JJFA 4Q1VA 3LXMA 4RMHA 1E3QA 1FQWA 1K8QA 3N2GA 1RRCA 1JMYA 1JVBA 1U7WA 2BP7B 3TVDA 4BV2A 4CMGA 1YVEI 1VL8A 3GUHA 4RVSA 1FW6A 3BL8A 3WIVA 5C7YA 5EYPB 5LP6F 3I1YA 3R3HA 4X7PA 5AHOA 4P38A 3CE9A 2QIOA 4BVKA 4DWOA 2J3DA 5I8ZA 1G5TA 1ZICA 2PIAA 4JP1A 5JZ9A 3CWQA 5BV0A 3QYAA 3AVVA 3MAAC 2Y4OA 2F3RA 1L6IA 4PS0A 4K9QA 4W5TA 2G4LA 1I3KA 5E9AA 4P3NA 2PXHA 3SYNA 4KR6A 1RM3A 2XITA 5FR1A 1UJ5A 1S2OA 1WLYA 3CFYA 5COQA 2Y77A 3QBJA 1ZC4A 2BELA 3CPHA 3LDFA 1ZINA 3A4YA 3K92A 3E53A 2PXXA 1XU9A 3N7UA 4TV8A 4NOLA 3EEIA 3HLKA 4P81A 4Q00A 1XEAA 3GLUA 5AMXA 3W04A 1TCUA 2PSFA 5FJIA 1E6KA 1A7AA 2RHDA 3PE6A 2PX8A 4GBMA 3NHFA 3RSGA 3SAJA 1SBCA 3EMDA 3P5BA 2A78A 4PR3A 3FDXA 2WTXA 1VC2A 3OTIA 2G8NA 4RQTA 4GE3A 4YO8A 5AJWA 3R5TA 3ZZ0A 4KITB 1U6KA 2BZ1A 2J3EA 4BFLA 3BDVA 1CF9A 5CHYA 3HYRA 2VAPA 3WNZA 4D5GA 1KJ8A 2HU2A 3WOHA 4LZNA 3CF2A 2F8SA 4F21A 3EVNA 4MVJM 1G20B 3RTGA 1W5EA 5CNMA 3F6PA 3C3XA 4I14A 4IYRA 4TTTS 3V6LA 3WYNA 3DDOA 1JYFA 2PZBA 3QIVA 4ZTBA 3T15A 2BDTA 1SXJB 1ND5A 4PGGA 3RO7A 3KJXA 5AIAA 1WZUA 4E13A 4X9XA 1FF9A 4U2DA 3PNYA 3L8FA 5LR6A 4EUFA 2PUEA 1PX0A 4NR0A 3EEYA 3OPNA 4H59A 3EVTA 1LBQA 1O8CA 4IH1A 4DGQA 4EM6A 3KL2A 4RXMA 2PY6A 2PRKA 4B3BA 4C4OA 4ER0A 3ESDA 4ABYA 2N46A 3HJHA 3LP8A 3QGMA 3A36A 3O0DA 1GGVA 2Q41A 4MLCA 5J2TB 4A36A 2V7VA 3AEXA 5IDQA 1NDQA 2DC1A 2WAAA 1QYDA 3FZGA 3SIWA 3THYB 4IIVA 1PIWA 4RKRA 4N0DA 4TGLA 3TSOA 3A4NA 4G1FA 1P2TA 1PG0A 4IBOA 4YUWA 4ZI7F 5BSRA 3WGZA 3F8SA 3THXA 1YI0A 3RJ9A 4EWLA 5F9MA 4MINA 5KWEA 2DR2A 1IEXA 2PO7A 1XJWA 3B82A 4RA9B 3W3AD 4KGXA 4ME6A 2AZ4A 1P7CA 3TSZA 3AETB 1ULUA 5DW0A 5FI5A 1PFWA 3E8XA 4Q4CA 1ZY2A 1UMBA 4XUEA 2VHTA 4L15A 1SD2A 2EQBA 3ENVA 1WW3A 4LRYA 4JEMA 3NVAA 4OLJA 3B3QA 4OU5A 1NBOA 1OZHA 3UFXB 1DGQA 5FPYA 1E1DA 1RWBA 1G3MA 3KG2A 1E4OA 4J7AA 4OAQA 5DYIA 2IZZA 4KLCA 5FKJA 2PJZA 3HU3A 3AVWA 2ZBVA 3PI6A 5A4FS 1XJ5A 4OB6A 1YA8A 2VDJA 2FFAA 4UNQA 4ILKA 2ZPUA 2XUKA 3GJQA 3CNNA 4D8XA 2WJVA 1XZHA 4HRXA 4ZO7A 4BDTA 1I0LA 2V9PA 3ZDXB 2FVYA 4WN3A 2HI0A 4B79A 4BWGA 4V1CA 2D2EA 2FJPA 4TV9F 1P5JA 1XEXA 2YWGA 1ZAKA 3FWNA 2NU6B 4P3OA 4RM2A 5C1DA 5EP1A 2YYYA 1RRPA 4TSFA 2XNSA 3NLLA 2JBHA 4J91A 4FFOA 4QUIA 3VYSB 1GDTA 4JI4B 1DZIA 1WOMA 3NV9A 1GGJA 4MA4A 3AI7A 3FDJA 4MVYA 4C4XA 5C52B 4NARA 1O03A 5FL7A 3GARA 1FUKA 2NLOA 3DDCA 3WB2A 4DV6B 4KRGA 2BMWA 3LXXA 1PV4A 3A9WA 4NPHA 4QUBA 2BFOA 3OE7A 2QTRA 2F8LA 4QPDA 2DFTA 3ZDCA 1R50A 2AQHA 5GQSA 2AV6A 3CM0A 1UOOA 3PXUA 621PA 3D7NA 1FYVA 5M04A 3NDRA 3LRPA 3TCNA 5CX4A 4W5NA 1JU4A 4GVPA 2OM2A 3C6XA 4CCSA 1TD1A 3PDJA 3R2JA 1H05A 1PZHA 5EKDA 2G40A 3G0BA 2D74A 5BWBA 3P1JA 4N76A 3FMIA 5FEMA 2I87A 3SSAA 5ALTA 1TIPA 5BWLA 4BGEA 4KL8S 5K0SA 3HO1A 4PC6A 3GDHA 2HU5A 3U3KA 5AW0A 3VPHA 4O25A 3KQKA 1XMXA 1L5MA 2C97A 3URMA 4AQ7A 1SUFA 1RYDA 1KWGA 3CONA 2QKYA 4LFAB 3R7BA 4I9GA 5CPBA 1CDEA 2W93A 1FTWA 3WA6A 4C43A 3A2KA 1FDVA 3GLKA 2SICE 3BWBA 3NWPA 2HNKA 5ALWA 3R7AA 1ZK0A 5JCJD 3C97A 2GRJA 2YFYA 3ORFA 2ZT6A 5DE3A 2G9QA 3OCYA 1ZMTA 3P0HA 1Q7EA 4RW0A 2EL7A 3V6MA 3M2TA 1BWSA 5ALOA 2C00A 5MN5A 4LNAA 1Y98A 3DPUA 4JVLA 5K4AA 1L7AA 3G8YA 3TI7A 1S89A 1DG1G 3BGSA 1Q77A 4GGPA 4OX9B 4UPVA 1N1GA 2OHOA 1UIRA 4LY0A 3ZWKA 3BSWA 1E4VA 1C9YA 4DSUA 1S2DA 3HJTA 3W8EA 1MGOA 3RS0A 2H2IA 3DV2A 4ZHQB 4KI0A 3F78A 4ZU1X 1TF5A 1DIHA 2YZKA 2Y1XA 3F8TA 1X9HA 3VPBA 1QYXA 1HEUA 2H0RA 1CUXA 3BVPA 1SVWA 3IR7A 3UMVA 5IKOA 3AKCA 1ZVMA 2BTEA 4EGAA 1KI9A 2Z09A 1EVYA 2E5WA 3BFVA 5AKHA 1S96A 2WR8A 3M7IA 1Z0FA 2IV2X 3LFTA 4ATNA 5FOQA 1U0OC 2ZYHA 3PHCA 4KO8A 3M6LA 4QECA 1HV8A 4HX5A 2KB0A 5DDIP 2BV3A 2OVFA 3NUQA 1SBZA 2HPHA 3FPCA 1QRDA 3KUDA 4W6ZA 5CT5A 3VOSA 3I9KA 1PSZA 1BXGA 2Y8EA 2WG1A 5ALIA 3GEPA 1U3TA 1TLTA 5CA0B 4JROA 3ADBA 3MQ4A 1F1BA 2PLAA 4O0LA 5G1OA 4K46A 5GOTA 4E2WA 5KYYB 1XD8A 4Q1BA 4LYGA 4FR2A 1VOTA 1Z8NA 4C29A 1V2HE 4UZFA 3IBSA 5EJAA 5L4LA 2QTVB 3VKFA 3I9OA 2FUG1 4B4WA 4IDDA 2IYTA 4LJ7A 3ITKA 4YXWD 1QDUA 2PPVA 4HNAB 4J2OA 5DIFA 5JMPA 1XHLA 3NBXX 3HSSA 4G4JA 3VYUB 2R6ZA 4F97A 1Y6FA 4EPVA 4XPIA 3MC1A 3B20A 5CB6A 2H2GA 4HB0A 3KHKA 4UDOA 3GWZA 4OOFA 3A6JA 4DCUA 5AW8A 1YZHA 1SCBA 3PWSA 4LF9B 1B0PA 2ATXA 2E9SA 2OWEA 1MF7A 2RHTA 3KZVA 4W7SA 4W1QA 4GEKA 2A14A 2VA9A 4GPD1 5DM0A 3OWHA 5FUVA 4AFNA 5FAXA 4Y18A 1FBNA 1JDBB 2IPLA 2AJCA 4GGOA 4AKEA 1U11A 2FWAA 4JGGA 1JR2A 1EDEA 5F64A 2PUDA 1LBSA 1SC9A 4KXVA 5EWMB 3ZLVA 4BU1A 4OHUA 1PZXA 1G8HA 5SY4A 4A03A 4AJJA 3DAHA 4MW2A 2ZM5A 3UJNA 1V3VA 3IBTA 5JVDA 1Z7WA 5FYQA 1KF0A 1E6CA 3FUUA 3OZAA 1X94A 4KJZA 4QRHA 4WNAA 3SSMA 4TKUA 2AVNA 3AJAA 3ZQUA 1A2KC 4G4SP 4RPGA 5DGXA 4ZT5A 1AM4D 1WCWA 1G8SA 1NBAA 2BGJA 3P52A 5T6BA 1M1NA 3DEFA 1E6WA 2YWXA 4LWPA 4FGWA 2JANA 2R6CA 4LJYA 2JC3A 3PT5A 3PF8A 1HDRA 4XWYA 1MJFA 1UPXA 1DLIA 5SYAA 3UTCA 4BNIA 4K5QA 2XKBA 4U7HA 1G0OA 2C5FA 1EIZA 1XLUA 5IKMA 1GQRA 3LGSA 2R48A 3B3FA 1W85B 1OWLA 2FF5A 1BOFA 4NPCA 5JEEA 2P2YA 2BHSA 2WWXA 1BS2A 1N6LA 2FY8A 3L0YA 3QBVA 2IYQA 1QHHB 2O2GA 4KSCA 1MA3A 3PPYA 5EUBA 3ZUGA 5FUXA 4EPWA 3H1BA 5TLSA 2ZSBA 1JG6A 3G7SA 1I5RA 3T1HB 2XCQA 1BE8A 1HTTA 4RVNA 4YRBA 2IUEA 2BWJA 3ZBPA 1TWGB 2E55A 1RWWA 1U8ZA 1TMYA 3RV4A 2B69A 5FX2A 2G76A 3E9QA 2ECPA 1Y34E 4DQUA 4EHKA 4JXZA 4R8KA 3NNNA 1NXOA 2JL1A 4MUIA 3KOUA 1CWUA 3HJUA 4E2FA 5ADHA 4O4HB 5KSZA 4HNGA 3B53X 1ZJ4A 2PT5A 2BFEA 4D9EA 3T1YB 3HCEA 2QQFA 1TJ4A 5BSHA 3AIMA 3B2QA 2WHRA 1K6JA 2ZPAA 3L02A 1RCUA 4D1YA 5JCJA 3JD2A 1SCUA 1IM8A 3ZJTA 3RLFA 1JH8A 2AI1A 1RMYA 5A5FA 3O21A 5MHTA 1PWYE 4J1TA 3R09A 2WZBA 1SCUB 3N87A 4BVJA 1F20A 1TA4A 4M1ZA 2GSWA 2FSVC 4DUPA 1M2HA 2BM9A 1BN7A 4O2AA 4PLZA 2CLIB 3QXSA 3L7LA 5EAIA 2PSJA 4H3SA 3WV5A 2QMZA 1U2GA 3PO3B 4MS3A 2Q4TA 1U31A 3PC4A 5JZSA 4NFSA 3NHUA 3S4YA 1E77A 2V7BA 2E21A 4DBLE 3QOXA 1WMSA 2BBTA 4RE5A 3RWBA 3TLEA 5HF8A 3BKWA 1YS6A 3DJFA 1NI4B 4FJ1A 4ND2A 3V8BA 3VXKA 2B4AA 2YICA 3DHVA 5E1MA 2YYZA 2OR3A 3AVQA 1T6ZA 4ZOLF 2Q3FA 3GJ5A 3NUZA 5JMOA 2Y0PA 4BLWA 4KI7A 4D8YA 2P35A 3JQ7B 1JF8A 2F43A 2OGSA 3S2ZA 3U6BA 5TMDA 3TQHA 2P2ZA 1VDZA 4R3NA 2IZ7A 1BROA 4KWEA 3I9FA 4JBIA 3CZAA 5DW3A 1BYIA 1NRXA 1UKAA 2WMYA 2JKZA 2QG4A 2FSVA 3E7PA 3K0AB 1HRDA 1LPSA 2YJNA 1UP4A 2VSFA 1FJHA 4G5GA 3G2PA 1DP4A 1T3HA 4HR7A 1H4SA 1GQFA 1FS6A 3JV7A 1OW3B 3ACCA 5JS1A 1H2FA 1FDWA 2FF7A 3KTDA 1B8OA 4PQFA 3VV3A 4EDFA 5A4DA 5KKNB 3GEMA 4AF6A 1RQNA 2GRUA 1YBAA 2HF2A 1MHPA 4YRZA 2VBCA 2G5GX 2OBMA 4MJ3A 3UPTA 2Z5FA 5AKZA 1MVOA 1NVVQ 4HB2A 3FKSA 4UD6A 2JJ1A 1JX6A 3DL2A 3F3KA 1R5BA 1YR2A 3UUFA 4W6QA 1I7SB 2FJ0A 4Z4IA 1IPHA 4RS4A 3TECE 4HHEA 3HCWA 3CY6A 4CEHA 1I7PA 4ZT6A 3MJSA 3WLPA 1KYZA 1N7HA 2E4ZA 2X40A 1PYGA 2A7XA 1OE0A 3K1AA 1M10A 3DJYA 1TI7A 2BISA 2FKNA 3I64A 3IELA 4MUEA 4FE3A 5IWCA 2C59A 3SFVA 4YMWA 1RRGA 3AT1A 1CEYA 1CNEA 4HZGA 3C3CA 4JU9A 3V4RA 1NVBA 2JHAA 3F7OA 3OO0A 3ZD7A 1N78A 4J0CA 3PXAA 3ZU5A 1L5OA 1KHHA 1TU4A 1CUVA 4ARBA 1DWQA 2O3TA 2LKCA 1H85A 1M5UA 2OD7A 3OY2A 4JBLA 4CI0B 5ALQA 3WKDA 5L7TA 1X9GA 1JPVA 4GR4A 4WXYB 1L5NA 3SDBA 4OKSA 2FOXA 3AM4A 1YQDA 4NXNB 2QD4A 3BS4A 2O2DA 5L3QB 3ODGA 3U3MA 2W58A 4OIMA 5CFZA 1S4MA 1ZRMA 1J8QA 4MLPA 1VLVA 4X6XA 5KTMA 2ZJOA 1QE3A 1TO1E 3B2EA 4FZ3A 4LW8A 5JSKA 5K45A 1JKXA 3CVOA 3ELBA 3GW8A 4FOLA 4MRMB 3HB7A 4WLOA 4JQCA 4XWGA 3RT7A 2Q8QA 3VHRA 4KXWA 1STOA 3DMTC 1ZQ9A 2Y1DA 4KVGA 3WJAA 1QFMA 3RAFC 2OLJA 3AP3A 3EB9A 5K3BA 3ZNNA 1OF1A 2KSQA 2M32A 2QVGA 3MRVA 2RJ3A 2YVUA 3FTCA 3CN7A 4BWYA 1QPZA 1NFQA 2WF8A 3SJZA 1V26A 1P0MA 3ASUA 4OXRA 4TXMA 2OMKA 2ZTSA 1G8GA 2OTCA 2QZJA 4GICA 1KRXA 4MKHA 5IJZA 1MV8A 2Q1TA 2Q5LA 1E79D 3IOYA 3WGTA 4CM6A 4G5QA 2A92A 2XUJA 3AW8A 4FS8A 2YL2A 4Z4GA 3EYWA 2VPYA 2E37A 2D0DA 1N7IA 5FADA 1D8AA 3RYTC 1NXPA 1QK5A 3IT1A 4IEEA 1C41A 3DE0X 1L9KA 3GL9A 5EIWA 3I4CA 4DQXA 4ZQIA 4HKTA 3TLGA 3UC9A 2H2FA 4OI4A 1DO2A 2QAIA 1L7OA 2ZTMA 1Z56C 2BR4A 3OZVA 2GFQA 2HRZA 4GD3Q 3R3VA 2EFEB 1DCMA 5C4JB 1P81A 1SR8A 4GBED 3TO5A 1FYDA 3DFKA 2GHRA 3KAPA 3GLIE 4L28A 1Y7TA 3FSRA 4WXMA 5ITSA 3LV8A 1P39A 3IEKA 3GG9A 4C0XA 1RBYA 4QJ3A 4JP3A 3VKUA 3V1KA 3DXYA 4CMIB 4QM7A 4GL4A 4TLAA 4O2BF 3O8RA 4YRLA 3M3DA 1WDWB 4FFVA 3MD9A 1CHNA 3W5CA 2VWHA 2FW8A 4YDRA 1R9JA 3OIGA 3UJ3X 2IEYA 4DBZA 4DQDA 2DWPA 1C9DB 3UJDA 4D8UA 4KLRA 1U7HA 2HH9A 4MHOA 2CL5A 1XMPA 5AJZA 3TW8B 3LXRA 3ESZA 3CVYA 2O0JA 4F46A 2UXDB 1C3JA 2VXBA 3ICOA 5KJCA 1RP7A 4HAIA 5F5XA 3AEYA 3OPMA 2H11A 2QT1A 3PGKA 1WW2A 2XYGA 4WH0A 3WJ1A 2ERXA 4LRTB 5BSVA 3M33A 2OD9A 3X1ZA 2FZKA 2J0EA 2D1TA 4AUKA 1KDOA 4D9MA 2ZROA 4EY3A 1G19A 4Q4AB 5K3OA 1ZM9A 2LE0A 1PUIA 3KO8A 2Q5CA 1NW7A 5HS6A 3VJRA 1R37A 1QH8A 4OK3A 5FNVF 1XA4A 1R5JA 1SCJA 3VYVA 4NU0A 4EQ6A 1DKLA 4LZZA 4C2TA 2GLTA 4XWAA 2VZ9A 3AUKA 4G8BA 3RSSA 2Y0SB 4OB8A 3S2SA 2NYRA 3ZK8A 1OI4A 1XVUA 2IYAA 2XUAA 1HLDA 3N75A 5LMZA 1E3EA 1KS9A 1P0PA 1L5SA 3NX4A 4QNMA 1R4ZA 3MUOA 1HLPA 2HU8A 2NMVA 1TDJA 4M36A 3NB0A 4K9OA 4KMRA 1OBCA 2JFFA 2ZTVA 1ZS9A 5HBRA 4C7XA 1D04A 4EMUA 4FYWA 3UJ7A 1U8XX 2RHOA 2WTMA 1PL7A 3AUUA 1K88A 1U3WA 1ZYUA 3B6ZA 3TQQA 2AXNA 4K05A 4J0DA 5JSYA 4O4IF 1W0JA 2QRQA 1V9SA 3DZKA 5DHTA 1K5PA 1NBIA 1WKVA 1MRNA 1RJGA 2JGAA 4I50A 3VU0A 1QPBA 3FSJX 4WXPA 4MDHA 1E3IA 5K09A 4LBVA 5BVHA 1SQ0A 3TQIA 1XCPA 2YWCA 1GFWA 1VG0B 3OQVA 5D3QA 3MB8A 5KZMB 3IDSA 2AFIA 4IILA 2JLQA 2J9FB 2QM7A 1GFZA 4UHKA 1UWLA 4UFNA 1Q92A 3VO2A 2HLPA 1EWRA 1WP4A 1GUYA 2QLMA 3PICA 3GRRA 1MCZA 4NOKA 2AZTA 4Q9JA 2V4UA 4HQLA 2FI1A 4QYWA 5D6NA 1WF6A 3LLMA 3AOEA 3TQTA 2YW9A 4U0JA 4QICA 3S8EA 4KXLA 1Z5OA 3VTKA 5IH7A 3HOUB 4BY9E 2OHFA 3VPGA 2ISQA 3LGAA 3L7YA 2HJRA 2WUVA 3GI1A 3DE4X 3TCXB 3WK5A 4S1TA 3WGNA 3T34A 4HN2A 1KK1A 4JLBA 2JFQA 2CV1A 1KFCB 1T15A 1X7ZB 1N4AA 1BWPA 3WQHA 1U9IA 3OFKA 1NLZA 2PANA 4HC4A 3HKZB 4AY6A 2I78A 2N0SA 2RC5A 1T8RA 1UKCA 1KNXA 2FWNA 4GSLA 2XTJA 1EFHA 4URUR 4PCVA 3ESYA 5HK8A 4IDCA 4IUBS 3VYRB 1S7CA 4CLOA 3OKAA 1VCMA 5AKYA 2A9OA 3HO8A 4Z1MD 5KQGA 3PGVA 4MTLA 1SHUX 2OQVA 1JHQA 4ZYLA 4WK2B 2IUTA 3HN2A 3CVWA 5K8CA 1GCOA 1LK0A 4BGVA 5DHPA 4IXDA 3DEAA 5LMUB 2WTBA 2V96A 3D1JA 3GWGA 2V58A 1FQJA 1WD7A 4NK4A 3E5NA 2QLJA 2FSFA 2G28A 4FXOA 1NP7A 1YS2X 1A5BB 1KYXA 5F3RA 1GKUB 1LZLA 3JQFA 1Z5PA 2CLCX 4EYKA 2PUTA 4QJIA 5CYFA 4FIDA 3WTCA 2PIDA 3KRTA 1ORHA 3FKQA 5GAJA 3EHDA 1TM1E 4US1R 1ZR4A 2EERA 2ZYDA 3M5DA 4QUAA 2RK3A 3ZWWA 5HJEA 3L1JA 4NBTA 3QVWA 2OXRA 2GEUA 5PNTA 3WIEA 4D4KA 3T12A 4F71A 2XVXA 5JH7B 4FYYA 4LYFA 1P3DA 4ZXFA 3U49A 4F4HA 4LY9A 3LO5A 5FLYA 3QVUA 4QOGA 3DOHA 1IVSA 4AULA 1T36B 2JDID 2YY6A 3LA8A 3HWSA 4J16A 3EXHB 4BFXA 1HTWA 4L27A 1QLWA 4ZZ0A 1N6NA 1NQ5A 4CTNA 2PEZA 2CW5A 3PKZA 3R76A 3V55A 3OFJA 4MGYR 2UU9B 2K7ZA 2OB1A 1LI7A 1QNLA 1BVYF 3MN1A 3GO4A 3X43A 3H9GA 5CMLA 3T6KA 4RQBA 2XGSA 4IQ0A 4MVXA 4I3HA 2AFIB 4RO0A 3T5CA 4B6GA 1ONBA 3S1RB 4O33A 4HTAA 2Z30A 3NC4A 1AO3A 1FFAA 1N4DA 1CZLA 5HZMA 3PI7A 2YYSA 4Z3DA 4ZC1A 1SUIA 2PZLA 3TFQA 5H16A 1GPDG 3WMWA 1MOSA 2ZT5A 4LX8A 3HVKA 3R3YA 4UAVA 2P6MA 4MR7A 1NG9A 2YC4C 1NXQA 1HE3A 1GOTA 4RSHA 2F9LA 2FDRA 3VTAA 4EB6A 1F8GA 4OFXA 2QQGA 4XGIA 4DL9A 1ZSNA 3QKIA 4B84A 1N92A 1XV5A 2LR0A 4PSDA 5GZ1A 3P0RA 1XDUA 5BSEA 3AF1A 4ZFNA 2W6JA 4IKOA 1A8SA 1QK3A 4YB8A 1Z17A 1CULC 3G2LA 4RZXA 2OGUA 3VR6D 4LZOA 4Q9KA 4XFJA 4Q9NA 1QGAA 3IDQA 1M34E 3TMAA 1VJGA 1FRQA 3BULA 4H08A 4OCZA 5GV7A 2LBPA 3ROXA 3ZE6A 3ABOB 2ZYAA 4DV1B 2PMFA 1DAHA 4YJHB 3UICA 3C1AA 2W6CX 4OJTA 4MS4B 4O59O 2J3QA 1PVVA 1TLLA 1IUOA 4IRXA 1TB4A 2FRXA 3MLBA 2WE7A 3EF0A 4P98A 3AR2A 3TD6A 4D43A 5JZMA 3K20A 2MSLA 3LUJA 3UWDA 4OLHA 1GDDA 1CUDA 2ZCVA 2AOXA 4DGSA 3N8HA 3H99A 3DEZA 4DABA 1JVSA 1NN5A 1QRAA 1T5DX 3WDMA 3E7XA 4YMTA 2FSHA 4BBRB 2G1JA 3H5RA 4EJFA 1IQPA 2CHVA 1HYHA 2X5OA 2Z4TA 3R7LA 4D0LB 4XYLA 1SXJC 3LBFA 1UBGA 3KZKA 2UAGA 1ENZA 5IZCC 3C6BA 5EP4A 1SG6A 1NT4A 1ST3A 3DONA 4EHLA 1J21A 3I4NB 3AUYA 2CB9A 2H4FA 3G5TA 4N5NA 5TT0A 5LQSA 4ZYVA 1PFQA 2HY7A 3NDJA 3QV2A 1I3LA 1AS0A 4TTSA 4BZWA 4QBTA 2DERA 2W9XA 1RE1A 3FMOB 4ZARA 2F4VB 2I9PA 4JHXA 5EHQA 3W7VA 4I2NA 1GY8A 4O4JA 2K5UA 3M9LA 3X1MA 4DLVA 5ALVA 1IPEA 4WW0A 1NOJA 5CT8A 2I4MA 5ILQA 3UT5B 2GILA 3OEHD 2AN5A 1C9NA 4GWLA 4Z0HO 3TNYA 1G63A 1MAVA 2PS0A 4IJVA 5DGIA 5I7HA 4L16A 3QEAZ 1CLUA 2WMOB 1XMQB 3H3JA 1N33B 2F3SA 3AZOA 4IVPA 1W5AA 1WUYA 2ZREA 1DOZA 2VDLB 3AUSA 2WFAA 1KJYA 4EA6A 5D5QA 1GFIA 4XDZA 5EXXA 2XGGA 4Q1FA 4H0CA 3RVNA 2JLCA 1O6GA 1YAHA 3BXFA 1ZA2A 3FCAA 1OTYA 4AJLA 3BD6A 1XKXA 1Z4LA 5FEUA 1RADA 1JG2A 3K6SA 3IDFA 1NYTA 3WLOA 4NBKA 3A70A 2IZ5A 5F33A 1QRUA 1CR4A 1T5BA 1M8JA 2IS4A 3ZX5A 2WIJA 4YJGB 1E8NA 1F51E 2A4KA 2IXTA 4DDVA 2XW6A 4LKRA 2H9AA 3NEYA 2BEUB 2BMEA 1D5WA 3SFTA 1VYHA 4KDRA 1N8NA 2YUTA 1GL7A 2DFDA 3TZLA 1D2AA 4YY3B 3D8HA 1SVIA 3N07A 3HU1A 3SNHA 2PYDA 3E22B 3TPZA 1C3OA 3TQSA 1TYZA 1SIWA 2QD1A 1Q0UA 3INTA 1D4FA 5SZJA 4YYEA 2DH5A 3OMWA 2OXIA 4YCJA 4HAWA 1A2BA 3PRJA 4X1YB 5G4LA 4CCWA 1SCAA 2QORA 3UK6A 4BUZA 1T0BA 2QL5A 2X3UA 4PGFA 4R9RA 3TZCA 1AGRA 1XWFA 3RVSA 1RAIA 2OKGA 1G55A 3LBYA 4DDMA 1PJBA 3OESA 5IN5A 4QHYA 5TS2A 3CZPA 2O5RA 2GJ9A 3VZSA 5DM4A 3EF1A 2PQ0A 4WZAB 5LXTA 3MGCA 4DADA 2I55A 1JVNA 3H6HA 4PS1A 3S68A 5D1NA 4J1NA 5SICE 5CJ2A 5MFZA 1FBTA 1RWMA 3R40A 1QZXA 1E59A 1KI7A 2WF5A 4FWBA 1ZMBA 3LUAA 2GZRA 3KTFA 4YAFA 1FUIA 3K0KA 2YN4A 4MW9A 1QH1B 4QSHA 5TGDA 3ICPA 3CLUD 3PC7A 2GZ1A 4GZMA 4Q7MB 3SOZA 3VVLA 2E2JB 2QHXA 4PYRA 3KUXA 1XWWA 3PRHA 3MWDB 3F6BX 1XQ1A 2W6IA 5JDCC 3U7QA 4J0HA 2RAPA 2AR9A 1QBKC 2VCHA 3W5UA 4PCUA 1QU3A 2VP0A 4NMLA 4OFBA 3C7AA 3ETGA 3ZGXA 1MOQA 1LNQA 3I92A 2ZS9A 4MA0A 3OPVA 3WYFA 2JCYA 3PFBA 3BK1A 4DLKA 5K8IA 2WVHA 3KTAA 4MA5A 5B3JC 6GPBA 3ZLBA 2AK3A 4JUDX 1KXZA 3LWZA 2QNIA 1NXWA 3UY4A 4DCTA 1ZUNA 4LF8B 4KUEA 5U4XA 4BE7B 3BF7A 2HK9A 1E9RA 1D6MA 1LDEA 3KK0A 4N5HX 3R0QA 5KREA 3AOGA 1IAQA 5FUWA 4BX0A 1L4LA 4ZJPA 1H9AA 2EXXA 4QTXA 4UM9B 2VQEB 2A9JA 1RYZA 1V5EA 4X85A 2N9UA 3IUPA 4KLZA 4TUYB 2YXBA 3CX8A 1QE5A 2R7MA 2XEDA 4P7KA 3ZX4A 2FNAA 3OCUA 2HV8A 4LXUA 5JI3E 2BUBA 1N3YA 3ICVA 1CDOA 1N9GB 3AINA 4KH0A 3N0VA 5DX8A 1XU4A 4LXIA 4AZVA 2B34A 3AZPA 4OHRA 4OU4A 1G2QA 3T3IA 2PUJA 4UNNA 3RHSA 3QVXA 4U2KA 3B6MA 1LV7A 3OZXA 2R0QC 4A3IB 1Z63A 4C3ZA 2YQ5A 2VG8A 2A9QA 3C16C 4GM0A 4Q3EA 5IYZF 1K5HA 1C9MA 2G71A 3H4MA 3Q4GA 3EDOA 4LHWA 3GEEA 3QIAA 4IX9A 3AY6A 1A4UA 3FF1A 3VO1A 4BV8A 3E1SA 3L05A 3GEHA 4GPBA 4JJ6A 2WE8A 4CG3A 3ND7A 2QSYA 2A0XA 4NMWA 5KUTA 1P74A 3K35A 3PWKA 3U56A 5AJHA 4PQGA 4X1OA 4EF5A 1A71A 2FZWA 5T41A 3OJXA 5K4GA 3IUJA 5B7PA 5BNIA 2PZEA 4XDYA 2FH5B 4GG1A 3C4QA 3YASA 3MAJA 4PTLA 3DP9A 3AB3A 3QNUA 1JB1A 1YGPA 4MW6A 1CS4C 5DV9A 3VR6H 1GZUA 4DIKA 2B83A 4JH0A 1TYEB 1PSWA 1IJKA 1DPGA 1FSZA 4EL5A 3W8FA 5JJBA 5AO9A 1YB1A 5DK4A 2ZQZA 5IVHA 4UHFA 2Y1FA 3DAYA 1I3OA 3VNSA 3VC1A 1VPDA 3BC1A 4AO7A 2ECOA 2QL9A 3ADKA 1C8LA 1JJ7A 2GBPA 3ECCA 3KEGA 1RWQA 2L82A 2COEA 1JTFA 4RSRA 4AXBA 1XLWA 2EJTA 3AF5A 1GZ3A 3F67A 3GJ6A 3NRCA 4IDAA 4LMAA 1EIWA 1QTRA 3F7NA 2WJAA 4FDTA 4Y2GA 5ECYA 3P4YA 1J56A 3KR1A 1N5RA 3I8XA 5B1HA 4YUAA 4TT8A 4MQ4A 2X0RA 4EZBA 4DHWA 3VPDA 1QV7A 1W59A 3DTYA 4F3NA 3NBZC 4WT7A 2CL7X 4L0QA 3IHKA 4IIJB 1P6QA 1T35A 2OYSA 3UF0A 1ZDMA 3L18A 3ETCA 2GMWA 3EJ6A 3ICCA 5E6RA 4ARCA 1IVNA 3M49A 2PLFA 3GVPA 4XVUA 2VK2A 4MVJD 3NS7A 3M34A 1HFJA 1JWAB 1N0IA 1YVRA 3VVBA 3STVA 1Z75A 1VJ1A 3OIYA 3SYKA 2FN9A 5H4HA 4M9SA 5E2IA 3H04A 4JBGA 1ZMOA 3SC2B 1VRVA 4MIOA 1C4XA 2WJGA 3K94A 3WK7A 4D56A 2IDKA 1M1ZA 2LIVA 2FEPA 4TX1A 5KYWB 1HA3A 4Q1DA 5B3LA 4FCWA 3SDZA 5LQRA 1PF7E 2QM8A 5DN6A 1XVTA 3L4SO 4A8HA 4AZTA 4UTRA 3NJRA 3QU9A 1C7RA 1U0LA 3F6YA 2XB8A 3GDWA 4H1UA 4M37A 1OC4A 1QO0D 1S4QA 4ZYYA 4IMJB 2ASEA 4G63A 1I1NA 1WHSA 3KKQA 3OM9A 1NG1A 4ZANA 3BMOA 3GAZA 3RVDA 2BIFA 1LU9A 1NNLA 2QL7A 3NBQA 4GW3A 4TS4A 4G0WA 4PGMA 1CQJB 4X8OA 4C3OB 5C7LO 5DBHX 2DLDA 3E9EA 3T38A 5M5XB 3H5TA 1NF3A 1E1RD 1X7DA 2GBLC 3F6EX 3KT3A 4HGOA 4QTUB 1RYFA 1ZVKA 5CA0A 4IS2A 4K6OA 2C58A 1N34B 4W8GA 4OL0A 3MOGA 1GUBA 2FQYA 2Z08A 4KDCA 3H5IA 3E4CA 3FI0A 4KOAA 4Q9AA 3ZH9B 3VZCA 3V4SA 5I4BA 4S05A 1GRNA 3AXTA 2YJ4A 3OLVA 2NVOA 1DFIA 3PA6A 5KU7A 2ES4A 2EJCA 1YKGA 4I9UA 5C9ZA 1P4HA 4XSGA 3PUIA 4IDGA 1N2CE 2G0AA 1ZAYA 3EZFA 1YQWA 4R68A 2HMTA 4N03A 2IZ0A 3W77A 2E4UA 3LS2A 3F96A 3OZTA 2H3EA 1GCAA 3CVUA 2F1OA 3CNQS 3DLPX 3LXUX 1CE8B 2QS9A 1ZHHA 4ITRC 2YDYA 2OMEA 4YGYA 5K2MA 4ENRA 3AXSA 4I6EA 4TKZA 3ZY6A 4YMGA 4R1LA 3N6XA 2G8LA 2A9PA 2P90A 1UEIA 4RS3A 4ZHQA 4ISBA 5LNK1 1OT3A 5M2QA 2E49A 2X9QA 4LECA 1ZJYA 4D6YA 2XRZA 3DF9A 5INTA 1Q16A 5A6SA 2WF9A 3FBGA 3H2JA 4CEJB 2C5SA 2GXSA 3ZHYA 3ZWBA 5TQVA 2BGGA 2X42A 1NHGA 1NNEA 3EISA 3W2HA 2W71A 3HSYA 1XMIA 2KBEA 3ZTYA 2I2BA 3U13A 2NYAA 5LCXA 4DLSA 2X4GA 2OFOA 5KTYA 1DUSA 3KPJA 1TRHA 1U5BA 3DKRA 3GCDA 4TMKA 4LV8B 1J97A 5IM4F 5HFNA 1FP4A 1R5OA 3L8CA 1S9DA 3QHPA 4V3BA 4ZALA 3WMGA 3BB4A 8ATCA 5HGXA 1KDPA 2W6ZA 5KSOA 1EVJA 3RADC 3OEYA 5JFOA 4MS3B 4IXTA 3N70A 1Z4KA 3H0KA 3G5UA 3OCJA 2A9FA 3PFNA 1T5HX 3PDIA 4IM7A 2P67A 5ELLA 3S1LA 4HWOA 2X8JA 4MP3A 4IGKA 5C80A 3OEWA 1IXRC 1QGDA 1MG5A 4A8PA 3FGPA 1ZI8A 2HM7A 4JQSA 2QR2A 3EZ2A 3OHPA 5E3JA 2O5EA 2CE2X 4MDEA 3I34X 4ZZ1A 4MITA 3VR2A 1SVMA 2D7JA 4MR8A 3RYCA 4J1QA 4RJJA 1N1DA 2WWGA 1GARA 3Q9NA 1O08A 2O3UA 2RGBA 3GBVA 4ESVA 2VDPB 1XU7A 1XZBA 1PEKE 4MPJA 5DNEA 4ETIA 3Q0EA 2O2SA 3OE4A 5SZKB 3AIOA 5DF1A 1QS0A 4A6XA 4KUHA 4C9BA 5K3CA 4MJLA 4YACA 1T0PA 1EMDA 3KQUA 3L8DA 4DZTA 2Y0BA 4K9PA 4N8SA 1JPNA 3OO1A 4BRZA 1DJOA 1KRHA 2DECA 3TJRA 5HP4A 4HDOB 1KOLA 4QL3A 1AHNA 2RGDA 4YMHA 4OYHA 2QM0A 1KI1A 4C20A 4PCLA 1QZTA 5KIAA 4HYYA 4C4SA 5CVVA 2ZJ6A 4BNWA 5C3EB 4GX0A 2WD9A 4ZOQI 4B7AA 2OAQ1 1DDGA 4C2AA 2FHPA 1KETA 2JIBA 4G5FA 3RKRA 4EMBA 1PHPA 1BDMA 2WM2A 5JHHB 3LTEA 2XTNA 4BO7A 4OP2A 1T6NA 2WHXA 5FRDA 3GGOA 4P08A 5E6SA 1TWCB 1PO7A 3COVA 1PLLA 3PBKA 3J80A 1IB6A 3PFFA 2MSDB 2XCOA 5K7SA 3EVBA 1E9FA 3OQBA 1TWAB 1OYYA 4TKUB 4PX9A 1A98A 2QLFA 1DELA 4F92B 1DO0A 5GGXA 3HR7A 1TZMA 2W2KB 5IFLA 1H1LB 3JRXA 2ZVQX 1QDLB 1A5TA 1PHRA 2H17A 3QWFA 5TE9A 4KRXA 3P96A 4M9QA 4FMPA 4PLPA 5EWMA 3HS3A 3VH4A 4DAOA 4K9NA 4NL4H 1AG9A 1NKVA 4ARIA 1TT7A 3RPEA 2P2SA 1PTJA 2BHNA 3OJOA 3EG5A 2BHRA 1U0HC 3HFJA 2WJ3A 2VP4A 1E3TA 3O38A 3S2UA 2NN3C 1IN1A 3FXAA 2PH7A 2D59A 2UZ1A 3QKUA 3U4QB 4ALMA 3LGXA 4AS2A 5HQ3B 1YBFA 2HRDA 1F8FA 3X1JA 4AW9A 2BGWA 2FR8C 3OLXA 3LI2A 4HLCA 2GPWA 1V8PA 4C6SA 1VE3A 5KSPA 2VBIA 1AXEA 1O89A 2IS1A 1CF2O 2EZ9A 1P77A 2RGWA 1R9TB 1P29A 1I6MA 1J09A 1D2EA 2NO9A 4PM4A 1DC6A 3UO8B 5CB4A 4FGUA 5AUQA 3SX2A 1Z5UA 4TTQA 4CM1A 3N2IA 1I3MA 4K6HA 3O7WA 3JQGA 4BCCA 4AXXA 5D5HA 3QSGA 3SWWA 1ECCA 1JR4A 1IHUA 1V3UA 1WQ3A 3H75A 2QRPA 4X1YA 4J3NA 1SQSA 3PX2A 2I3BA 3UGTA 1IHYA 4TVKA 4KXFB 3MS4A 3ZLUA 2VS1A 3AHDA 1Z74A 3ZDYB 1C3OB 1IN8A 1C3XA 2CEAA 2FV8A 2HPVA 2VWGA 4NZPA 3KJFA 2HRBA 1KEUA 4NMXB 4W8HA 3HVHA 1OX6A 1KZ4A 2CLKB 2B7CA 2ZVPX 3CUSA 3WZLA 4BXOA 4FFRA 1PNQA 1N2OA 2QAGC 3E5MA 1T2DA 4EI8A 5DCLA 4W5RA 2C54A 2JIOA 4FOSA 4GZ5A 4NBWA 4K0KB 3L01A 2QAJA 4KN5A 4PZ0A 2D6FA 5C31A 2GXAA 3FB4A 5JE8A 4C0KA 8MHTA 3DKKA 4TV8B 4YJDA 3GHHA 4F8EA 3GGSA 1NRIA 3DG9A 3IJPA 4RWZA 3EZ6A 1XJ0A 3ZWVA 4RTOA 2VHVA 4YRIA 1E99A 2ZRLA 2CLFB 4CCYB 1DG9A 2XADA 4LHYA 4H3VA 3ET4A 4ZOEA 3PDHA 3BWMA 1ZEMA 3N2EA 1W96A 3LIPA 3NBKA 4PAMA 4GU5A 5KYUB 3IP1A 1N7GA 3PX3A 2WNHA 1XD9A 1C2TA 1IZ9A 2QL6A 3FCXA 3I23A 5AVTA 3KQQA 2GCOB 4NG5A 3D3WB 4O1MA 1T8YA 4G2TA 2C4MA 2LW7A 3L0IB 3W1VA 4CFSA 3MCAA 4JB0A 3CJQA 4RUKA 2HYIC 2JLAA 3EQ7A 3HU5A 5H7XA 2BP7A 4G5YA 1OH8A 5B1YA 2HLDD 2O0KA 1B4DA 5U4QA 4BO1A 1QFZA 1U28C 2HNAA 4ER6A 2V1UA 1QPGA 3AHCA 3GPLA 3ZGLA 5B1EA 5KTRA 1WPQA 4LE0A 5HE8A 2FMUA 2YZ7A 3A4MA 1CZOA 2J0VA 3O8DA 2RGXA 3GMIA 2G5CA 4L7QA 3IKJA 4ZO4A 1K3TA 1GN9A 1UBSB 2XOKA 1M7GA 1FU8A 3O93A 3T61A 3WYEA 1OMOA 1P5ZB 1N7JA 4UARA 3HOXB 1WCIA 2I1LA 4C1NA 3B52X 4IJMA 4E2ZA 3QE9Y 4G0QA 5I9TA 1UBHS 4UQOA 2LWIA 2ZXEA 2ZKLA 1A04A 3DEHA 5JY1A 3KKLA 3SC3A 4A9AA 5IJ9B 3WB0A 5IAGA 1O0SA 4EJ2A 3WWOA 4X1KA 2GHQA 3NIGB 3G68A 4MV9A 5CG1A 1USKA 4Z3OA 2VJLA 1LSUA 2RHJA 2JAWA 3CTMA 4EB0A 1LVUA 4BZXA 3HVUA 3GLGB 1NQVA 2GCIA 3BL5A 1XRPA 1D9ZA 3FBWA 1GNPA 1SOVA 2WB2A 1J2YA 1KDYA 2BGNA 4PRKA 1ENYA 4NAUA 1W36B 4F6LA 5B4UA 1CKEA 1TJ3A 3AQIA 3O2JA 3U9LA 2RE8A 4BNFA 4ZT3A 2J67A 1FTGA 1MEJA 1UT8A 2IYSA 1TIBA 4RLSA 3WMFA 3ZKWA 1NLMA 3DXFA 4D9HA 4W5HA 3HCBA 1KMCA 3M6IA 1XEXB 3RQSA 4BMOB 1Z4NA 3TLCA 5BXYA 4YDHB 1YE8A 2ADMA 3AEQA 1Z45A 1TEVA 3R0XA 1Z7BA 4Y0AA 3D8RA 3UPDA 5A62A 2OAEA 1GXSA 3BSSA 3IEUA 4C0HA 2DG2A 4B4VA 1XD2A 2UZIR 2QJTA 4KR0A 4OQEA 5ADUS 3I8SA 1T9BA 1L3CA 3A28A 4MR7B 1U8AA 4PV7A 4RVFA 5FLXA 1G38A 1JDBC 5D8DA 4ER5A 5CXQA 3JXEA 1XUOA 2PJUA 5E7MA 5KJ6A 1U3GA 4NULA 1YDEA 3EPRA 1TECE 2Q8PA 4BAZA 3EULA 3F7TA 3WRVA 2G04A 1NL3A 4MWZA 1WZEA 1KI6A 5BNTA 1XFAA 3GV0A 4YRCA 3BM5A 5FL7D 4B44A 4O2BB 2PGAA 4E1VA 5JYCA 1Z29A 3RK4A 5C4XB 2QIPA 4FGKA 5AESA 4P32A 1UBLS 2ESRA 2ONZA 2VHWA 3KDSE 3L6EA 2LGJA 1AKMA 1ESDA 1Y4SA 3RR2A 1Y6QA 2EL9A 2IP2A 3EXEB 3PEVA 2DH6A 4GO1A 4NEQA 1M2VB 2JEYA 2QTLA 1A9TA 4H3KB 3VNQA 2PS1A 5IXYA 4Q3AA 4ZVOA 5J2TA 4MPPA 1VG1A 5EE9A 2G77B 4RULA 3C1OA 3BREA 2CL6X 1XA0A 4TWIA 4BDSA 2I2XB 1K89A 4XUGB 4NYMQ 3E61A 3GHYA 4WAUA 5KQRA 4GKBA 2IYOA 2JVIA 4OXIA 3HUUA 4A26A 5A9SB 4YAIA 1N2EA 1Z6AA 2I66A 3AVTA 2PKYX 1GYRA 1FQKA 4UNIA 5FBZA 1EVLA 4ZI2A 3S1MB 3T3NA 10MHA 4DPKA 1Q3KA 3IPRA 3FCUB 2GM3A 1JEAA 1FDUA 3EFBA 2VPPA 1LDNA 4ZP1A 3EXFA 3U1VA 3ICWA 1BX1A 4E4RA 3G0DA 3GLSA 4F93B 1A9XA 3ROFA 3W9SA 4P82A 1RABA 4TOIA 2QT0A 1POXA 4G85A 1G6HA 1QYRA 2ACKA 2YQZA 1A8QA 2ZAIA 5JSQA 1NW8A 2H7YA 1GA4A 3THWA 2ZJ7A 2QWXA 3GDFA 3OBIA 3NXSA 4OM7A 2XDQB 4F4UA 2IYLD 1L5WA 2C5BA 3JWJA 3M81A 3MMZA 4YDSA 2AEMA 5E2BA 4MW0A 1U2QA 1ZSYA 2ZR8A 5HHTA 3QKSA 3W8RA 2PO5A 1C9KA 3U4HA 5IKEA 2J41A 4CM8B 2QPLA 5FFFA 2HCTA 3WGUA 1KTVA 2J4FA 4QU5A 4OBBA 3WRYA 4FLFA 4GLBA 4IJQA 4M1KA 2Z2XA 3EXHC 3S99A 5A5EA 2PH5A 2ZETA 3NHWA 2LDXA 3LKBA 2R87A 2PBRA 5THXA 1YZQA 3Q3VA 4L51A 2CSXA 4PE5B 1QRSA 1MH9A 1ZUHA 1CUAA 3HYLA 2IHJA 4HQ0A 5KJFA 5DNDA 3PXCX 4IV0A 3E8MA 3SIPA 4NCHA 1I0IA 1FXWF 1HORA 3A7DA 4JLOA 3DZDA 1CYEA 4CF3A 3WE7A 2JI7A 5B57C 2W37A 3OE5A 1YOBA 3V3KA 4R16A 3TUIC 2QRVA 1YQXA 1U7PA 3U7GA 1T0HB 2OCGA 3LRXA 2WM9B 5EVCA 1Z7GA 2G70A 2R6JA 2H18A 3DE7X 2O57A 4DV5B 4BASA 3S29A 3H9QA 5GY7A 2JBWA 1KDZA 2OGZA 4EO7A 4ZYTA 1GG8A 1KDVA 2BTQB 2Y0EA 2II6A 3TL2A 5HJ5A 4PGHA 3KD2A 4ZT7A 4A91A 5KNCA 4UUMA 3Q1LA 1W48A 5LBUA 2PKQO 3ZU2A 1FUUA 4AWBA 3FTFA 4OSOA 2XQVA 1NUTA 3WVNA 1HYBA 2QNBA 3K9WA 1C8VB 3T52A 1CUJA 1AX9A 1R64A 2UUCB 1Y1KE 4X97A 3ADOA 4QBKA 1FFGA 1Q20A 1KSHA 1GGKA 3D6UA 1A5AB 4LHEA 4PPFA 5LP6A 1R4AA 4N82A 3CRQA 5FBKA 3ZBUA 4OM8A 2IGTA 3A6KA 2I33A 2Y4NA 2VDNB 3HC7A 3HMQA 3TXYA 3K4QA 3I0MA 1SC4A 4KTTE 4JOBA 2AHOA 2XNCA 3IAM1 4H4DA 4P2GA 5TF4A 4BC0A 4DN6A 1V3QE 5L9AA 4ZDIA 1KARA 1S5PA 2ECFA 4BKMA 3GD5A 3VM6A 3GH1A 1KA9H 1UBMS 4EKIA 1EFRA 3NOQA 2XNJA 4PU0A 1TM7E 1M8PA 4M99A 3TE7A 4YR7A 3JYQA 4UBJA 4QA9A 3U26A 4AJ2A 3OSZA 4TS9A 4FIZA 1TZ2A 2V55B 3QXHA 3I6MA 1C2YA 3U2QA 1KRWA 3EASA 3HDVA 3NDBB 2JJ1D 2EBHX 3KM0A 3QHAA 4OI2A 1YHYA 3DOOA 2W2QA 5CK5A 4HRVA 1I4EB 3DA8A 3N6VA 3MRXA 4ZTUB 2QMUA 3CZ5A 3D2CA 3TW8A 3JVVA 1R8SA 1R4NB 1OLUB 4LY3A 1NVGA 3MJTA 4XX1A 3V8PA 4F3YA 3PVCA 3DGFC 1CHDA 2PBZA 1XFDA 3IBFA 3ZJVA 1DQPA 1PEYA 3GVIA 1VE7A 2EWMA 2W6ID 3PXBA 1GPNA 2ODEA 2YXDA 4NYJQ 3I0ZA 3N0XA 4EMTA 1E1CB 4KBYA 4LGMA 4OB7A 2XOEA 4RTLA 6ADHA 1T26A 3E03A 2ID7A 4M0DA 3MCTA 1JBKA 2YASA 3G5MA 2ZEJA 4N40A 2ZCUA 4R3WA 4H4EA 3HL0A 2EOAA 1WO8A 2QY6A 1XXLA 5EY5B 5JANA 4GXTA 4DMGA 1HOTA 4M0MA 3QKRB 4XOIA 3U3RA 4DSTA 3LQRA 3Q8WA 4BAUA 3FTDA 1J7KA 5IM5A 4P0QB 1A2OA 2M6KA 4EG4A 4N3GA 5TF0A 4H7KA 4C0LA 3JATB 3GRKA 2PL9A 2CK3A 3EFEA 1X3LA 3KVRA 3P94A 4ARSA 4BJHB 1DWPA 4BKQA 3I3SR 3HFSA 4QO8A 2WZQA 3C6QA 1BEEA 1PGNA 4TL6A 1U81A 3T4XA 1EM8A 2A1UA 3UKDA 1K4YA 2C2GA 3IEIA 5C8XA 2RC6A 3SVZA 1A8IA 1CERA 1UBKS 2G9RA 5JYDA 2NVTB 3FFTA 1GL6A 1NQUA 3PNKA 1H5NA 4G1MB 2GYWA 4LF7B 5FBRB 1HEYA 1MQ9A 4EHAA 1G2OA 1HDCA 3OOHA 1K75A 2LPMA 3ETNA 3D0KA 4FC7A 3U7JA 3B7WA 3HKDA 1YU9A 1ZM7A 3E1KA 3ME5A 2FUEA 5I7SA 1L4EA 2QB5A 3F8WA 5FXMA 3R4CA 4NE9A 1GRCA 4OREX 1E7MA 1TAGA 4E21A 3HMKA 3AESA 3OZBA 5FWAA 2B4RO 5HFAA 3O90A 2RAVA 4MHTA 2W0SA 2XI4A 2OECA 1PD1A 3P0FA 4M8IA 1X80B 4R5MA 4WGFA 5CP8A 3DE3X 2J33A 3EE6A 2GLUA 3H7IA 4JBWA 2B98A 2QX6A 1S1MA 2W6NA 4Y2QA 5EMNA 1PS8A 5FBLB 1DI0A 3KBOA 3NEJA 4KO3S 1IIBA 2XTZA 4EENA 5LJLA 1ONNA 4EYGA 1CRWG 1QP7A 4MI6A 2Z57A 1PVOA 5I01A 3H7AA 5BSTA 4K0RA 4P4GA 2BFBB 3IFSA 1MORA 1ZP6A 2GK4A 2R84A 4GS5A 1QOQB 2V0GA 1Z6TA 3GLVA 3PCRB 3IKVA 2BFAA 2R66A 1E69A 2GM5A 4MQEB 4PPQA 2I2DA 2WMDA 4CKWB 4TWJA 2EDCA 2ILTA 5AVOA 1SM4A 3NT4A 3S16B 2B1GA 2GN0A 3KKOA 4AZ3A 2WV7A 3RODA 4YRTA 3WTBA 2DR3A 1NQXA 1SCQA 2QVZX 1YNOA 4R2WA 1KMMA 4F9GA 3LQYA 1EP2B 1R3DA 1YCHA 4JASB 3FNHA 4NFLA 4YAKA 3CX7A 3E6AA 4FHDA 4F86A 1ZXXA 1B26A 3B38A 2C0PA 1P1JA 3CBGA 4RTRA 1Z0KA 1C1HA 1A5ZA 3PYLA 5THKA 1UP6A 1E1LA 2PMKA 1FVOA 4A3SA 2J3KA 1IN7A 4J0KA 3TAHA 1KTIA 4FOOA 2BEWA 3DNPA 1ATIA 2DGDA 3A2LA 4M21A 1B41A 1SPBS 5J4KA 1Z0AA 2X1MA 1RBZA 1YCFA 2BAGA 1R8QA 1SHTX 4M1WA 4BN0A 4EYOA 5FAKA 3GLFB 1A1VA 2Z4RA 2AOTA 2YINC 1F2DA 4CTKA 2VLIA 3RB8A 4G5SA 3S55A 1NF8A 2FGKA 2GCNA 3V5NA 4XR9A 4WINA 2WYUA 1DAIA 2IPNA 1IXYA 5E9QA 1VIVA 4ND4A 3I37X 4NHOA 3CZ4A 1RXUA 3D2LA 4KFTA 3RSHA 2YFKA 4KACA 4A27A 1FMFA 1DCFA 3OZIA 5FV7A 5ERYA 3ZI4A 1D6SA 2OSBA 5FTLA 4XUDA 2Z9CA 1QBGA 2R7KA 3FTQA 3V8QA 3ENQA 2AHRA 2Y1CA 3U4GA 1OFUA 3OURA 3RFFA 1X1RA 4X3PA 1PKXA 1N1EA 3RYIB 5LQMA 1A5SB 3THOA 1KJZA 1Y9JA 2JLZA 4HDKA 5IJWA 1NBMD 3NJ8A 1FC0A 5TQ0A 3ES9A 3QA3E 2OCAA 3KX2A 5F3WB 4E33A 2G7MC 1ORRA 3GPIA 4JEHA 2HQ1A 3HJRA 2FPIA 2WDPA 2B61A 3EPPA 4Z9FA 1W0CA 5E9WA 4FFMA 1QHIA 3EIQA 4TVOA 3RFVA 4IY1A 4ID3A 3CVXA 3UWSA 3GGDA 3WP0A 2CD9A 1GNSA 2GXUA 2JFXA 1JLMA 1EYZA 2XMQA 2P77A 3C6ZA 4IS3A 4JLJA 1Z73A 3GG2A 3UMYA 2PUBA 1DC3A 4WN9A 3DCIA 4IF4A 2QBYA 4XD7D 5DB4A 1HQCA 3PIDA 3IXLA 3MMNA 4GP9A 5IMBA 1XNJA 3AV0B 3I09A 2GD1O 1V47A 1CQIA 4H17A 1RLTA 3HCAA 4WX2B 5CAEB 4B7XA 2W8BB 3TDNA 4KHPB 1Y4ZA 3GMSA 1ZUD1 4OJNA 1KQGA 4Y9UA 3AUXA 4ZV9A 3UB4A 1ILEA 5TX7A 1RPAA 2QP4A 2GZMA 2IQ5A 4G0NA 4OJKA 4XWKA 1OI3A 4JP2A 3DZCA 5FPSA 1YJ5A 5FUMA 5KPJA 1T6XA 3F6SA 3AVUA 5JSHA 2PA0A 4XRRA 2JGJA 1YC5A 3V8MA 2Z8YA 4WDQA 1B6GA 1NVFA 4WCVA 3M83A 3W1EA 5BT8A 1S8FA 1A9OA 2BEVB 3GJRA 3UA4A 5FWYA 1HFKA 1Y5NA 4CGZA 1AQIA 4R31A 3OZRA 1WTAA 4P92A 7GPBA 2XDWA 4KX5A 4B6SA 4WZBB 2W7TA 4AKHA 3VKHA 2B78A 1U7TA 4QEDA 1FDOA 2FEKA 3BFKA 3OCXA 4C07A 3GROA 2BC9A 2O3SA 1I7LA 3CURA 1ZH8A 4KTVE 4OKNA 5FI1B 3E1GA 3QWAA 5DVZA 2PX6A 3O1IC 4DMMA 1RJ9A 2Q9UA 1KYQA 2ZKIA 2NNLD 4XW2A 1QIGA 2RBGA 2O7SA 5CTJA 1LPMA 3T54A 1X7GA 3IAM6 3NASA 3ESBA 1XRNA 1HR0B 3D5QA 1YXMA 4NZYA 3Q3JB 1MABB 1S3IA 2WPNA 2YRFA 1ZIDA 2UVQA 2IIBA 1TADA 3DOJA 3LP5A 3NVMB 1SN7A 3OPXA 5HF5A 1ZOPA 3G13A 5DBIA 4B3SB 2Q3BA 2WP8J 4QULA 4HT3B 1QC5A 3HPRA 4PYKA 2PZGA 1KAGA 4EA8A 5D5PA 4D5EA 1ZK4A 3P26A 1ZBQA 3UV7A 1G8YA 1RYYA 4OBWA 3PNOA 1DBPA 3KQPA 1D7AA 4LCJA 5ALDA 1SG0A 2BR5A 5BR4A 2XKAA 1ORIA 4HWGA 3GUYA 5FA8A 2JA6B 4YDQA 5I47A 4HAUA 1E6LA 2REQA 2X9LA 1EG7A 1X7WB 3D0QA 3ULKA 2XGMA 3SBXA 4CUKA 1E9DA 4U5QA 1XEWY 2Q0SA 2Q3MA 2RG1A 2HBQA 4GI3A 5B58T 3D7MA 2IHKA 3HJGA 2CCKA 3EOBI 3GFQA 1L7DA 1L1FA 4PLCA 3RHFA 1VECA 1MAAA 4UOQA 2JLXA 1AUPA 2BFFB 1VDMA 2XT6A 3ZE1B 2CXNA 4Y2TA 4ND8A 4YROA 3K71B 4ERNA 3ISTA 2R6FA 3AR5A 1JNYA 4LOAA 3RTDA 2J59A 2AMYA 3DULA 1Y3CE 2XNDA 3A11A 4CDGA 1WCMB 4REMA 2DWCA 3V7UA 5ENZA 1V25A 2W2NA 4LV6A 4WUTA 5DULA 2PWAA 5BQFA 4IG9A 3TGLA 4B3MB 4GP7A 1F0KA 3ZE9A 4EYQA 3PT9A 3HY4A 4R3UC 5LB4A 4B47A 3LO8A 4MULA 2DOKA 2IXDA 3K0FA 5IF3A 3W6ZA 1J7JA 3EUWA 2PUHA 3L7KA 4RD4A 4DLLA 1R0CA 1MD9A 2QMYA 3KYDA 4YJ2A 4KQEA 1K5GA 5FPQA 4E4YA 3OQ6A 3I5AA 4C6RA 4MQFB 4JQYA 2NUPB 4JNCA 3ZCPA 2A1TR 3FR7A 1GPJA 4O1IA 4I8DA 2XQJA 3D3EA 3AILA 1SC3A 1GCGA 2YZ2A 4NBRA 3HKCA 3LPLA 3ZHTA 4CKXA 5A02A 3VA7A 1SCIA 2GUGA 3S40A 1HURA 1LB1B 3AL2A 4A73A 1GPLA 1OCEA 4D3YA 4Q82A 2PVCA 3C4JA 2ZYGA 2CDAA 3TBKA 1USWA 5DHFA 1LD3A 3ECSA 4F3KA 1QRRA 3RIHA 1C0IA 2ERYA 3BEDA 4MQLA 3UOAB 2J1LA 4L0MA 4BEJA 4ZEOA 1JW9B 1CZUA 1V6CA 4DVGA 3T9FA 4HUQB 3GNSA 4CKYA 1TZJA 2I99A 2V6IA 2WB1B 1JTVA 1SU7A 3L6RA 1DV2A 1KMHB 3U3JA 1M33A 1RWVA 1W5TA 3CO0S 4L3OA 4Y9TA 1DRJA 1KEZA 3ZVLA 4AT1A 2DBYA 4MV4A 2G0NA 5AVVA 4RD6A 2NPFA 2E48A 2ERCA 3OM1A 3LQ4A 1SXHA 3ND8A 2Q29A 2FRDC 2O1EA 4OQPA 5DK6A 2EZ4A 3IEPA 2X3YA 5D2CA 4KPYA 4YBRA 3U7HB 1PWZA 3L04A 2FEOA 3LH5A 3D3KA 2X14A 1HH4A 1K5DA 4XE5A 3OQNA 1E7YA 3UH1A 4WMLA 1KIMA 4NYIR 4Y1RB 4ZAZA 4C76A 2Q2QA 1KYIA 1OASA 3I53A 3KZNA 1QUEA 3I39X 4RQUA 4URWR 4D8TA 5FP0A 3S7ZA 2AW3A 4PO8A 3EG9A 4IDPA 1CW2B 1OWPA 2QROA 5LB2A 3U4AA 3BWDD 1F2VA 1Q0QA 3M1AA 1E3DA 1GRRA 2ILVA 2X77A 2VWPA 3ANXA 3HYSA 5EJFA 4Z2YA 2G80A 4B7ZA 4DV2B 1QG4A 1QM5A 1N0HA 4GXNA 3IT0A 4UEKA 2D06A 4ZN6A 3SIRA 2B99A 1QWSA 2I7TA 4LHVA 1RKXA 2GYUA 2HLNA 2PMCA 5J2UB 3RBZA 3TDMA 4AG5A 4F72A 4EZEA 2JA5B 4BX2A 5BN5B 4P7GA 2PH1A 3JAKB 3G7NA 5D85A 2DQKA 1NN1A 3I9MA 4DCOA 1QONA 1IONA 5ES3A 3PU6A 2J3LA 1AIPA 1PV1A 3ETEA 1H5UA 4UHBA 4XYGA 5I8PA 2ZRMA 3GP3A 3IP3A 3ZPXA 3AFHA 4CR8A 3CZRA 2I22A 2I3AA 1M1UA 5M3BA 4MLZA 3PFWO 3DFMA 2ZIGA 2QLBA 5DM70 2BUAA 4MJXA 1RFLA 1RXSA 4FMDB 2WQZA 5H4GA 4IMIB 5TMPA 4C08A 1NZFA 3B51X 4PNPA 4JSYA 2XBUA 5JS2A 5GINE 2NQTA 1YZGA 2D7CA 2ZZKA 3G88A 1SCDA 4ZXPA 3KB1A 1Z8DA 1RWPA 2RGRA 2YWEA 3I2HA 3O31A 4GLOA 1Q2UA 3G9XA 1HMPA 1U9YA 2CXRA 2QZ9A 3PZRA 1ZUWA 4TM7A 5CX1B 5ED0A 1ETHA 5BN4B 5CLIA 4DCCA 1IRIA 2ZJ3A 3C98A 4IMRA 4MPDA 1XLVA 5AH0A 1EUDB 1ZI9A 5EHIA 4YAUA 3SP1A 2ZWOA 4CT0A 2ZSDA 3B8HA 3V80A 1DKNA 2ZUTA 1MAWA 1HYEA 2CLHB 4WCFB 3SR0A 3HADA 4YLGA 4OGGA 4DIBA 3N86A 4HATA 2LRHA 3DD5A 4F1KA 4IINA 4TQ9A 1BWQA 4AB1A 4ZWNA 3PNVA 5CYPA 1T4CA 1L4KA 3BMCB 1E5XA 3A3OA 1PBTA 1YH3A 1XN4A 3AR9A 4QYSA 4TYYA 1X9IA 3A6ZA 1K4KA 3TVTA 2VHJA 3TVYA 2FPGA 2A9KA 2G17A 3OZSA 4QJ4A 1P2BA 2G06A 3RRNA 4DA4A 4Q7EA 1M66A 5IYZA 2EVWX 1DARA 2COKA 3ENKA 2PKXA 4EPTA 1JXMA 4TLMB 2D2XA 2OZPA 4WFJA 5JRJA 2XCRB 3MXOA 1OKKA 4TTAA 4HDRB 5I3CA 3OOSA 2FZ4A 2V7EA 1ZNZA 3RVLA 2KJQA 3OFVA 5CT4A 5HGJA 4AIRA 1L5ZA 3DNFA 4AZSA 1ZN2A 2P5UA 2QK4A 5FA6A 2B8JA 4URYR 4DKXA 3BWXA 3A1CA 4EVQA 2O8EB 1VXOA 1JKMA 4RV9A 3SQXA 1NZJA 2A7QA 3G9QA 3OAAD 3SR4A 1PR0A 1J6UA 2JGDA 1T1GA 1AKVA 2WUEA 5GIOE 5G41A 1YB4A 2C9BA 2E85A 5T4FA 3COSA 4M0LA 4L4XA 2X6RA 1SBTA 2YWFA 3RUFA 1H8ED 1GD1O 1PU2A 4D6PA 3FVQA 5FF9A 5FTMA 3MK31 2XBMA 4LAFA 5E95A 1N36B 3HA7A 4K6KA 1M2GA 2E1PA 4XVHA 3OM0A 2ODTX 2ZPTX 3QK7A 4QOEA 2UUOA 4GFDA 2GZDA 3SC6A 1FSSA 1Z4MA 1KZHA 5B7NA 1PL6A 2O19A 1RHMA 3OQMA 1B42A 4DMKA 2I7CA 1CEXA 4E1BA 3AERB 1MJGM 4F9FA 1RQLA 3LYHA 1T3ZA 3WLTA 1OBVA 3DR5A 1NDUA 4NIMA 5JS6A 2GCEA 1ZX1A 2OORA 3NHKA 4AM8A 4DJFC 3PXGA 4CXMA 4HMPA 4ZRDA 3UMCA 1ABEA 3N2GB 1RD4A 2NV2B 1KYWA 1R15A 1VJRA 4HDSA 1ZKDA 4AU1A 4EI9A 4TQGA 2HRRA 4BBPA 4YPOA 5HUHA 3QHQA 3V9AA 4UDYX 2FFBA 2C9ZA 4Z6KA 1DB3A 1V8BA 2IVFA 3C5HA 4UZSA 4PBTA 2CLDX 4EA9A 5AM3A 4IWYA 2JLSA 2GKGA 1N5IA 2B6NA 3L3BA 4LZPA 2V9ZA 5FTNA 3FYUA 4ZI5A 1MGPA 2FR8A 4B7CA 4FB5A 1LTQA 1T1SA 1MNQA 4IL5A 2X5XA 3TYXA 3A7EA 4MRVA 3EVFA 1UFQA 3UUEA 2ZT7A 5T6MA 2F67A 4O8ZA 1SOWA 2V5AA 2QA5A 2YW2A 4E46A 2WJYA 5FHQA 1ML4A 4MWSA 1GSIA 2E3JA 1WBDA 2J87A 1DUVG 1KQFA 1PK8A 1RQRA 1T5LA 4M0FA 2LTAA 4KYUA 4O4JF 2O8FB 1BHO1 4UPEA 3HL4A 3A58B 3IEMA 1JV2B 5THQA 5JRDS 5EPEA 1TFRA 2YMQA 3NBUA 4QGBA 2ZR0A 5E6UB 3UAXA 2OOKA 5C3MA 5HF9A 1VZ3A 4CLEA 5GV8A 4K6FA 5L53A 4B1FA 3W5BA 2FDCA 1W4RA 4KH1A 4LJAA 2RH8A 5K0LA 5ALZA 4FE7A 4CU5A 4Z9XA 3V4ZA 4TTJA 1KAMA 4C5AA 5C8YF 2C96A 1GIAA 2V7UA 2YXNA 1WA5A 1PJZA 2C8VA 4IIDA 5CLGA 4F5YA 5LVAA 5ELMA 1AQLA 2X76A 2OCLA 4RZ2A 5JW6A 1ZN8A 2JLWA 5IT5A 2XUIA 4M0KA 2Y93A 4QIWB 2OZKA 2FUKA 3IAAA 5IHPA 5A0VA 2HSDA 2Y6VA 5ULLA 3U1TA 2ISCA 3RHTA 2CK3D 1WMFA 2AC7A 1RXCA 1LBIA 1LC0A 2DPMA 2O2EA 3HA5A 4MYSA 4RF4A 4ZQBA 4ZCQA 1YVUA 4G0OA 2EZ8A 4YP9A 3B5JA 3RM3A 2E4AA 2NTNA 5EXPA 3OX3A 4I6JA 5G4KA 4AN4A 4BC1A 4OEHA 2IYYA 2A0FA 1L8AA 1YZNA 2JI9A 2WJZB 4AMGA 1T0JB 4JI1B 4ND3A 2AZXA 1IN4A 4UM9D 4IO0A 4QRIA 4YA6A 3GQBB 2AN3A 1H2ZA 2PRIA 3ONVA 3WLSA 1QFYA 2PFKA 3G82C 3BCUA 4YV2A 3GVHA 3L8ZA 3HXMA 3GT7A 2DPXA 2DM6A 4Y67A 3O2QB 3RHZA 1AB6A 2JCBA 2MHCA 3BQMB 2CF5A 3NTOA 2BE7A 1JN0A 1G59A 4LJRA 1N0VC 1RQGA 4URXR 5ARDA 4RVUA 1E6MA 1PAUA 3UHAA 1K3UB 2AMLA 5AOBA 3LBNA 1V41E 1OXUA 5DYNA 1LDYA 4UHEA 4UUNA 3WZ2A 4DE5A 2PFSA 4E5SA 5BUSA 3FYCA 1G5FA 1XVVA 4JKIA 2IE8A 1GKLA 2Q1WA 2TMYA 2VJYA 3PGA1 4QDKA 2P4SA 4X61A 1SZPA 4OUDA 2MMGA 3GGGA 4RK6A 4ZEWA 3NYWA 1U63A 5FTKA 3TN7A 3HNRA 2AOWA 3EX7C 2Z1MA 2QYSA 1QHSA 3CEAA 3KV1A 2GWHA 2IZ1A 2YVAA 4RIEA 1QSGA 4RU1A 3KKZA 4BMVA 3VC7A 1YK1A 4U3JB 4TMZA 4V03A 4LX0A 1DX4A 4OHZA 4BNHA 1YQUA 4V1CI 3TLMA 3WGOA 2QSUA 1A2QA 3DUWA 2Z43A 1TTPB 5JDIC 4B4DA 5K1ZA 4ZICA 1XPUA 3HSKA 3I5YA 1Q14A 4S0XA 4CM9A 5KOJA 1BDIA 2V3CC 1L4UA 1K9SA 1R1DA 1H3NA 2H0QA 2KPOA 3HI6A 5KOIA 1VG8A 3OPYB 5FDFA 4KUGA 3RV3A 1NWHA 4AURA 5CDUA 1G18A 2ZUSA 3FPFA 3HLTA 4F1WA 4N47A 2EJVA 1Z0ZA 4PZCA 5F4ZA 1VPWA 3LX8A 4FS3A 3HR8A 1FP7A 1W4CA 3TUZC 4XEUA 5MGBA 1QCCA 1G291 1C3VA 1W5FA 3WGMA 2DULA 3JQ9C 2WSMA 4NOJA 2IA5A 4MUGA 2GD0A 4S24A 3DQZA 5H3LA 4CEIA 1NVAA 1GZHB 3P4UA 4RVHA 4BU0A 2HT1A 2FUCA 1E96A 4A23A 3KB2A 1HK7A 4KAFA 5DRYA 4TRJA 3DT8A 4FYJA 4M4SA 3WSTA 4AMVA 3CLHA 2IZOA 2ZBUA 5FV4A 4L4SA 1XNQB 3ANNA 3I6ZA 2IEZA 1SVSA 4OGLA 2WNIA 3VI3B 1KEVA 3AFNA 1AHIA 1KU6A 2A33A 3QFCA 4RHYA 1Q0PA 2OHIA 3F46A 4ZK2A 3W2GA 3HKBA 5C0OE 4ARZA 5GTDA 2Q4RA 3GBSA 4TROA 4LXTA 3WWCA 2GX6A 1UBNA 1G7RA 2DTEA 2WUFA 5EZYF 3TLZA 3GJ0A 3WDSA 4CQLB 3ZDDA 5GJCA 2HLHA 1SU4A 1TJYA 2D0OB 2YFHA 4KMSA 3BIXA 1MQ8B 3R9XB 1O9BA 2W2MA 3UUWA 4UUBA 2P9ZA 1VZ2A 2PUWA 2YXPX 1COWD 1JIJA 3A8TA 1KEKA 1B8NA 4B6OA 3MILA 4BLSA 3DL4A 2BBOA 5HIMA 1Z4OA 2JAHA 2J7KA 3FF4A 3H4TA 4OF4A 4E08A 1OZAA 4YP1A 2X5KO 3STUA 1YFKA 1DIRA 4RANA 2LXNA 1VSTA 3ITEA 1CVIA 2ADOA 2M1ZA 2PS3A 3B9RA 3DBLA 1GO2A 1IJFA 4X6UA 3U62A 3UWOA 4NBVA 2Q3HA 4W99A 3EGWA 4XZ3A 5IBRA 5EMHA 3HABA 3N2YA 1PK7A 5LUBA 1BDJA 5AK3A 3GP5A 4WV3A 4XYBA 1WBBA 2XUZA 5DGCA 2ZIAA 3HBJA 1V1RA 3I6IA 4L1KA 4Y6LA 3TLBA 4UVEA 2Q2WA 3AEZA 1LX6A 4EP1A 2P9YA 2OXFA 3DAFA 3DDHA 3GEIA 4V0SA 1JFTA 4J0FA 4K26A 3IHWA 2OFXA 3PKIA 1JS1X 1X1QA 2DHDA 4OQZA 1JXOA 1HMYA 1WKBA 4JJIA 2P75A 4JJZA 4NENB 3OG9A 4ZMSA 1SXPA 1KKMA 1MW9X 4KK3A 4M2LA 3P9PA 3Q10A 2ROQA 4XCXA 1W47A 5HCUA 5GJWC 1QHXA 4D79A 4R9SA 1PR3A 1OU0A 1JKJA 1RWOA 1KAHA 2N3ZA 2WIDA 3OMLA 3M6AA 4M53A 2FLVA 2NO6A 5AI9A 1Z9BA 3THRA 3HEAA 3IULA 1HE1C 1SU8A 5ENVA 2BE9A 3JD1A 1KFJB 1JEEA 1NR1A 2XLCA 1PL8A 2ZJ5A 3IR5A 4M76B 3SF8A 3VAYA 2JH3A 4B3HA 2I71A 1XZPA 4C4TA 2NUAB 1AZLA 3Q40A 3ZCSA 3IVCA 1JAYA 1G1AA 3QX3A 4FXPA 2BLLA 1K97A 3TUJC 4CR6A 3GFBA 3U4DA 4CIBA 3C39A 4GI5A 1VI2A 3LPAA 1NLFA 1XCOA 1V4NA 2OC4A 3RU9A 2I4IA 3INRA 3PV0A 4H7HA 4L72A 3U4IA 1HDYA 2W11A 1A72A 3GA0A 1SVLA 5DXJA 3GFOA 3OPQA 5GM1A 4DBLC 2JA7B 4AROA 2CYCA 3LUBA 2IL1A 1VSVA 3DOIA 2B9EA 4FQ5A 4DV4B 4PFKA 4B85A 3M3YB 1VKZA 2WM3A 3NYQA 4US0R 3OT1B 3X44A 2OK7A 2RHRA 1KXJA 1XYYA 3G3EA 4KQ2A 1L8OA 2IHUA 4MGHA 3GFFA 4NH0A 5ILOA 4MEAA 3ZBTA 3MIIA 1GNRA 1VMIA 1ACLA 1TGVA 3FPAA 2R1TA 4UTOA 3KQVA 3HOVB 1OA0A 1X0XA 2Q5QA 3CINA 5IX8A 1VL1A 1UJ2A 3DMRA 4YP7A 5AUOB 5KNDH 1KJ9A 3ELDA 1I0ZA 1OTXA 3LQFA 5ALNA 1UPAA 2XPCA 4B82A 2LUOA 2BHLA 3EQ9A 2HC9A 3KQSA 3R3ZA 4OQMA 4OXNA 5BN3A 3DBHB 1FFBA 4F91B 2UXBB 3AGQA 2MYTA 2IGBA 4DWWA 2WHPA 4D0NA 3V1NA 1MT0A 4A3FB 4ZYXA 1EHIA 4FEYA 4L6AA 1Z2PX 3WXBA 5KBYA 2Z9DA 3S14B 3TRIA 5SV2A 3A1EA 3QTTA 2CDRA 4NSNA 1TMOA 4LISA 4DSAA 2VTBA 4DB4A 2GBIA 2V1XA 2CFRA 4GOKA 2O52A 3PK0A 4LEIA 2W70A 2AUTA 4X8HA 1M83A 1P3JA 1VQ1A 1HNNA 1JKJB 2QD5A 1EBUA 1R8YA 4HQOA 4XLLA 4FHFA 1L5VA 4F6RB 4UCFA 3WGYA 4YP6A 2CJPA 4RL6A 3MJFA 4BE4A 2I3GA 1TX4B 3GRCA 1JFFB 2O2CA 3B7GA 4KQMA 4P7BA 1N2IA 4UDXX 4RGBA 2DX7A 3FYHA 3ABIA 3CW2A 3QXXA 1HDIA 1JAIA 3UMRA 1GU7A 1SEPA 2IU3A 2O7RA 3ZDRA 1SAYA 3SI7A 2JK1A 3BD9A 2GKOA 1N6PA 3OLCX 1M2KA 4X91A 2H1VA 3R7DA 1MB9A 3SHFA 1GQSA 1M2FA 1ODKA 4PAOA 4U9IS 5AJYA 3S1SA 1NULA 2CF6A