1S2OA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 at 1.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a cyanobacterial sucrose-phosphatase reveals the sugar tongs that release free sucrose in the cell.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
molecule keywords sucrose-phosphatase
total genus 93
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2004-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1s2oA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1s2oA02
1RPZA 5ALXA 3AR9A 3ED5A 5AI9A 2I54A 3ZWDA 4UMFA 3ZVNA 1QQ6A 2HCFA 2OM6A 2G09A 2HSZA 3UMGA 3ET5A 4H1WA 4YIKA 2ZBFA 4FE3A 4OCZA 2R8ZA 2ODAA 3NASA 2BDUA 2Q5EA 1EK1A 2AMYA 4Y2VA 4BYGA 3OCYA 4BNDA 3QYPA 3FPSA 3QU7A 3CZ4A 4UU0A 2CFTA 2C4NA 5AI0A 5JJBA 5AW8A 5AESA 3HYCA 3FGOA 3BA6A 4HGPA 3P96A 4B6JA 2JGAA 4EX7A 3WK4A 5AVRA 1RC8A 2EAUA 2DQSA 3A1EA 1RMTA 1WPGA 5AKLA 1Q92A 3AR3A 4UARA 5AVZA 3ESQA 3IB6A 1ZD2P 3SKXA 2O9JA 4EX6A 1XPJA 4FYPA 3M9LA 4BX0A 2AH5A 4BEWA 2GO7A 5AW6A 4F71A 3QU4A 2YY6A 4ZEWA 3SF0A 1Q91A 2B0CA 5AI8A 4CE6A 3QUCA 3I76A 4KX3A 5ALMA 5FP0A 2B8EA 4L57A 1YMQA 4Y2SA 4QQFA 3WKDA 1L6RA 5AW9A 2G0AA 5AIAA 5AW0A 3NALA 1Z4MA 3L8EA 4YH1A 1N9KA 1ZRNA 1RQLA 3IRUA 4OHFA 1RLMA 2YJ3A 3WK6A 3WK8A 5AIBA 5AW4A 4UMVA 3EF1A 4UAVA 5AM3A 3KBBA 5ALQA 1EK2A 1NNLA 3R4CA 2RARA 3PGVA 2B1QA 1RLTA 3QNMA 5IT4A 5IS2A 3L0CA 1RMYA 4GIBA 2C88A 4KX5A 5AVXA 3F9RA 2Q4RA 3HLTA 1WVIA 2PKEA 4AP9A 2R8YA 3L8HA 1O08A 2PQ0A 2RAVA 3SKYA 5ALVA 2ZBDA 4DWOA 2HF2A 2PR7A 4O8CA 3WKEA 1J8DA 1VJRA 3NANA 1AQ6A 3A3YA 3WGVA 4Y2QA 1T9ZA 1XP5A 1RKQA 5A3SA 3NAMA 5AM5A 2YJ4A 2MSNA 1L7NA 4IG4A 2HF7A 5AVQA 1S8OA 1KYTA 2B82A 1LVHA 2MU1A 3I1YA 4KN8A 3SHQA 1T5TA 2WF7A 3KOOA 1Z4IA 2WF5A 5AM2A 5AKKA 5AICA 4UMEA 5AW7A 4L6AA 5E0OA 3WKBA 3U7GA 1VFPA 1YNSA 2OA0A 3R9KA 2FUCA 3OCVA 3SLRA 5AW1A 4YCNA 4CNQA 4EEKA 4UASA 3E81A 3N1UA 2IOFA 2P11A 5ALZA 5AK3A 3EF0A 3J7TA 4Y2JA 2W43A 4HYTA 3QU5A 3WGUA 1ZD5A 3U19A 2ZXEA 2YN4A 4XPZA 5ALWA 2FI1A 4PNHA 4Y2TA 1Z4PX 2NO4A 1Z4JA 4E88A 1FEZA 2FUEA 3U7HB 1YJ5A 2AGVA 1U7OA 3QUQA 1Z4LA 1QYIA 3DDHA 3B9RA 1SU4A 4OD0A 3WK5A 2C9MA 1Z5GA 3I28A 2YMLA 4UW9A 5AKXA 3FPBA 4RESA 1Z4NA 3IJ5A 2OYCA 1QH9A 2C8KA 4BKMA 5AKZA 4XQ0A 2HOQA 1YDFA 4XOUA 4F72A 5AW3A 1YV9A 3L7YA 3NRJA 3U7EB 2YFYA 5ALLA 2BDEA 2HHLA 2NO5A 1Z4OA 2Q4TA 3FM9A 3ZX4A 2X4DA 1RKVA 2HI0A 2I34A 5AVUA 2FDRA 2VKQA 4UM7A 2ZBGA 5ALJA 3W5BA 2O2XA 3QU9A 5ALOA 1L7MA 3W5AA 5A3QA 3RFUA 3W5DA 1O03A 4HGOA 3ZVMA 1RMQA 3DAOA 3CNHA 3FVVA 4JDPA 1TJ3A 5AVSA 2AUTA 1WR8A 4FFDA 5ALNA 3NUQA 5T41A 2I55A 2JAUA 2ZOSA 2I6XA 5AVVA 5AK5A 3DV9A 5ALRA 3QLEA 4DFDA 3ZTYA 3N07A 4Y2RA 4KYTA 2JAOA 3BWVA 5AK6A 1RLOA 5AI5A 4C4TA 5AVTA 1RKUA 4DW8A 3OCXA 1TJ5A 3EPRA 3K1ZA 4BX3A 1IWOA 1Z88A 3AR8A 3L5KA 1J97A 4NWIA 2YJ6A 2FPWA 3GYGA 3R09A 1K1EA 3B9BA 4IFTA 3OTQA 3UM9A 2W4MA 2B30A 2R8EA 1XVIA 2P27A 1VJ5A 2GHQA 4YCLA 4HGQA 3I6BA 5AKEA 2G08A 4CF5A 1L8OA 2CFSA 2QYHA 3AR4A 3AR6A 4NV0A 3ZI4A 4L6CA 3QGMA 2WF9A 4I9GA 3E84A 3AR5A 5AHXA 5AKHA 4UM5A 3ZX5A 1TJ4A 1QQ5A 1ZS9A 5AVYA 3N28A 5ALUA 2D2VA 4J03A 2RB5A 2P69A 4QJBA 3ZW7A 2ZG6A 5ALHA 5AI4A 5AKJA 2GFHA 3E58A 3W5CA 1NF2A 4AS2A 2GHTA 2CN1A 4J2TA 2YMMA 1WZCA 1ZD3A 3PGLA 2B1RA 1LTQA 3KC2A 4MWOA 3UMBA 3L0YA 3QUBA 5AW5A 2GMWA 3QX7A 3OPXA 4BEVA 5ALTA 4KNVA 1ZD4A 3MMZA 5ALKA 3WK7A 3AR7A 4YCMA 3RF6A 3KZXA 1S2OA 1YS9A 5A3RA 1CR6A 2WF6A 2WM8A 3ONNA 4GXTA 2BY4A 2G07A 5ALDA 5AI6A 1Y8AA 4EENA 4JB3A 1U7PA 3B8EA 3OCZA 1TE2A 3OCWA 3U7FB 2ZBEA 2QLTA 2IYEA 3EWIA 3L0BA 1RQNA 2W11A 4HGNA 4Y2XA 2YBDA 4RETA 2IOHA 1SWVA 3WKCA 2FPUA 2JARA 3QXGA 2FEAA 1RRCA 1ZOLA 3SD7A 3KD3A 3A1DA 3U13A 1NRWA 2FPSA 2G06A 3QU2A 1Z4KA 3FZQA 3M1YA 4OFZA 2YMQA 5AVWA 2JAWA 4G63A 1N8NA 4YIHA 4NABA 3QUTA 2HO4A 4Y2PA 3ZTWA 3S6JA 1MH9A 2I7DA 3VAYA 2B8JA 2HDOA 3ZWKA 4BNDB 3WK9A 3E8MA 3DNPA 5ALPA 1U2SA 2EARA 2YJ5A 1PW5A 4UATA 2P9JA 4UAUA 2IA5A 3MPOA 3N5KA 3MN1A 1L8LA 2FPXA 3L8FA 2C8LA 4UMDA 4NFLA 4G9BA 5AM0A 5ALIA 4EELA 5ALEA 3KDPA 4CF3A 5ALFA 4HAIA 3OCUA 3WKAA 5ALGA 4MUMA 1Z4QA 1RDFA 3TLMA 4Y3UA 5ALSA 1L7PA 2R8XA 3PCTA 2G80A 1ZRMA 2NYVA 3L1VA 4UU1A 1L7OA 1TA0A 3ET4A 2IOFK 2HX1A 4YGYA 5AKGA 3ZVLA 4BBJA 2EATA 4Y2YA 2RBKA 3SMVA 1JUDA 3MC1A 3L8GA 5AM4A 5AW2A 1F5SA 3L1UA 2YMPA 4ZEVA 2WHEA 3AR2A 4CF4A 5ALYA 2G1AA 2HEGA 5IT0A 3A1CA 3ESRA 1U02A 1T5SA 5AM1A 4BX2A 1Z5UA 4C4RA 3ZUPA 4AS3A 4DCCA 2FPRA 4KNWA 2I33A 5AK4A 4XE5A 2WFAA 5AKYA 3NIWA 4Y2UA 4C4SA 1CQZA 3U26A 2OBBA 1QQ7A 3ZU6A 4NAVA 3PDWA 2CFRA 4EZEA 3N8GA 1U2TA 1X42A 3D6JA 1ZJJA 4I9FA 3UMCA 1SWWA 4HGRA 5AKIA 4ZEXA 2WF8A
chains in the Genus database with same CATH superfamily
5G0WA 3ZV6A 4CKEA 4WCFC 3NWBA 3PJEA 2B9EA 3JQFC 3TQRA 2RHWA 1CR2A 1YBFA 4WL0A 4DV3B 3IT2A 1TD9A 4R68A 2G04A 2ILVA 3VR5D 4Y7CA 3ZZMA 4X6XA 4H1UA 3UJ6A 3VC2A 5IMBA 2WJWA 1CS4C 4BO1A 4RPLA 3L7IA 4PHFA 3ND5A 1BU8A 4RSRA 4P4GA 3DCNA 5I7WA 2JLUA 3OE4A 1Y89A 3L7NA 4YAWA 4OGLA 4EY3A 2PMZB 2JRCA 3TCNA 2VJQA 4JLAA 4HZGA 5CMLA 2QI9C 5C80A 1UWKA 4I5GA 2FCRA 2GZAA 1BYIA 4PGAA 1MW9X 5K0ZA 3IVMA 2W8ZA 2JH8A 4AO7A 4LSZA 3E70C 3P96A 4ZEOA 3V1YA 1PFVA 1R8YA 1QF7A 1ZIYA 4BL5A 2JZNA 1C8LA 4WAUA 3EMKA 1JKIA 4JQOA 2YYZA 2Z43A 2FMXA 1G59A 1M2WA 2CZQA 3BF7A 1U0GA 1A82A 1Y8CA 4HZUA 5E4TA 1NYQA 2BGNA 3JVIA 1UKEA 3LP5A 4GYKA 5F9FA 4BASA 4L3OA 3RC7A 1ZCFA 2WKPA 1IEWA 5FTMA 1OILA 4ZT5A 3GLRA 1ACLA 2EKLA 3CLTD 4QDXA 2GZ1A 4IFIA 1KZYC 3G5MA 3GOQA 3FLEA 3H7IA 4WOPA 1TYAE 2CNWA 1SXIA 4CXMA 3CCBA 5LD2B 3M2PA 3C4VA 3QUCA 1BX1A 4QGGA 3S40A 3JZIA 4KX3A 1Z83A 2WTAA 2G1JA 4BNTA 1HK7A 1RQ7A 3HL4A 2ZSFA 2NUPB 4ZICA 3AUAA 1QP0A 5IVDA 2YY7A 3R44A 1PJ2A 5JSKA 4B74A 5EHXA 4JJGA 4IOKA 3ESZA 4QIHA 1VA5A 5LQMA 2ZUCA 1PGPA 3WAKA 1QHXA 4W8OA 1WOYA 3RSFA 2R5FA 3FGNA 3FVRA 1RQLA 3G9QA 1R8QA 1M2GA 1US8B 4JUFA 3FYTA 3CZ9A 4HF7A 4PBSA 3F7OA 4DF3A 3VPSA 4YA6A 4UU8A 1FJHA 4TRJA 3A31A 5YASA 2ZLBA 3HO8A 3GJSA 2AG8A 2JCGA 5DHAA 3V1NA 1RRMA 4KSYA 4Y67A 3IDOA 1GG8A 4RTOA 3F78A 2P0YA 4UEOA 2NZJA 4F06A 5LQJA 3WRXC 1XCOA 1T0JB 4FJ0A 2UYGA 1G5QA 1UL1X 3HUFA 2K7ZA 3L8HA 3M34A 4B4VA 3OQNA 2ID4A 1G7SA 4PU0A 4KIJA 4JR1A 4BQSA 5I4CA 3TSZA 5C7IO 2PJUA 4UZSA 4MGHA 3QW2A 1DAIA 2F9FA 2OHHA 1U63A 1TUBB 2JFXA 4L72A 4AKHA 3KCQA 2WYHA 1HQCA 1FTSA 2DPGA 1UXGA 1DRKA 5FEMA 4Q4AB 2WJJA 3TL2A 5DM1A 5KNLA 3OQOA 1ULBA 1L1QA 4KGXA 1FSSA 2Z0MA 3N0RA 2C4KA 4PYJA 1VKZA 3KXIA 4OA8A 5HZGA 1YRYE 3CJTA 1GR1A 4FXOA 4UHEA 3T3OA 2XHZA 5IW8A 1IY1A 1B8UA 2C94A 3MQFA 3N6RA 1FP4A 1GZ7A 2Z04A 1MPTA 3KVRA 2AQHA 3K4HA 1I24A 1ZINA 4YDRA 1RWOA 5H7XA 1AXEA 2ECFA 3FTNA 4R41A 5JVDF 3EHDA 2QD1A 3LHKA 2DHDA 5IVKA 4NBKA 3P52A 3KS9A 5EJFA 5K2MA 5AKKA 3S8YA 2WY2D 4DA8A 4MDEA 3HP4A 4GSLA 3TLEA 3QLUC 1U1DA 2HJWA 1YNSA 2R1VB 2P9BA 3F47A 2NSYA 4ABYA 1UMBA 1N33B 1JALA 1P1KA 2D62A 3DV2A 3IEKA 5E7JA 3N1UA 5DTRA 2P75A 1WUKS 4MX8A 1K0FA 4RNCA 2F3SA 3SE7A 3SLGA 1DAHA 4H1HA 4RQAA 1P4SA 2JATA 3HL0A 4FCCA 2R00A 1W93A 1G5RA 2I67A 2VEDA 4G1UC 5BMVF 2X41A 1HYEA 1EWYA 3NBZC 3ZBPA 1SC3A 4LEIA 2O3SA 2P4SA 2ZXEA 1A9XB 4IJUA 1XVVA 4AP6A 2IBTA 1DPFA 2CSUA 1FFWA 2OB2A 1EQUA 4LNAA 3LCVB 4KQWA 4HXEB 3GR6A 2I22A 3CM0A 2NV2B 1U9IA 1YR8A 1NPDA 2PTHA 4J43A 4NYMR 2TMKA 3FNFA 4RJLA 3TE7A 3R9WA 4O02B 5JS2A 1H8EA 1Q83A 3DDHA 4IDPA 2X76A 4JJ8A 2GNAA 4B8ZA 1CQJA 3O03A 1BMFA 2EW1A 2ID8A 4PR0A 1NTOA 3JU3A 2QMUA 3H9JA 3IAXA 4Q6BA 4B2YA 3ZDDA 2LIPA 4UFOA 1WJGA 5KJEA 1Z39A 4I4TF 4XQ0A 2EGGA 4BP9A 2I4RA 4MWZA 4R16A 4BC0A 3VR3A 1PL0A 1NSYA 1SUAA 2I1WA 4JI2B 2WKWA 5AW3A 1W8IA 3K5PA 1X7DA 7ADHA 1C8VB 3CIFA 3U7EB 3FUUA 2R92B 1NR7A 4OXXA 4MDHA 1EP1B 2X15A 4G5SA 4CPDA 5HNKA 4DA6A 1OA0A 1K7YA 2HI0A 2RGCA 3EUEA 4URHA 4WEQA 3I1JA 1P81A 2QX9A 2QN3A 5B55A 2C29D 2Z5GA 4YXFA 3H9UA 1G17A 1ZMBA 3DMNA 3GRRA 3FY4A 3LECA 3M9WA 3LXXA 5BWOA 2F7SA 4M0FA 3M4XA 1OW3B 4R2XA 2WHQA 2ZAIA 2AE1A 3O8OB 4HN9A 1N3IA 1R5BA 3HDYA 4RIEA 1TWGB 2YKGA 5J2UA 4BNNA 2C8VA 5JH7B 4TRMA 4F8YA 2QPLA 2FH5B 4JKYA 2X13A 3BDAA 4QFDA 2QW8A 1YVRA 3EFOB 1ISIA 3QPCA 5JNRA 3R8FA 2I4NA 2NO1A 2I6XA 4RIIA 5EHIA 4WV3A 3W04A 2PUAA 1AVTA 4MI6A 2RC6A 3EB9A 3FNIA 3HXPA 1NW7A 1WHTB 1GL6A 1YZUA 2P8JA 3OBBA 4P82A 3UH0A 3ETGA 2IDKA 1KWGA 3FOZA 2E2HB 1H4VB 2GJAA 1G8YA 3DHEA 5K6AA 4ACBA 5CHEA 4QOSA 3AP1A 5GADl 3FMIA 2ZUTA 1FSZA 1HYGA 1RRVA 2EIXA 4OHCA 2CGEA 4M38A 1THTA 4BNXA 4F5ZA 1E7SA 1NG1A 3SX0A 1W0JA 1AKRA 1RJWA 1UJNA 3DE0X 3Q6IA 1LH0A 1YR2A 2JGKA 3WS7A 2XE8A 3OCXA 2GVDC 4H0FA 5BUCA 4HRYA 4WCDA 1YJBA 2UVPA 3BMOB 1YFLA 1T2UA 3LFTA 4O2AF 1ATIA 1TZMA 4LXUA 4FYMA 4Y7NB 1W6UA 3TOXA 3ZJ5A 3EPKA 1NA5A 3GYGA 4B3RB 4OLAA 3AY3A 2ZATA 4WOCA 3HO1A 4F56A 5A7HA 1Y6QA 2FZ5A 2J3JA 3TOSA 5BN3B 3PC8A 3NWJA 1LPMA 4D0SA 5KHLB 1M0SA 4DB2A 4IZ6A 1AY0A 3AHHA 1JR4A 2QTTA 3HG7A 1XTPA 4LYHA 1ZL0A 1KP3A 2GNPA 5GZ1A 2JJ8A 1TFUA 3KR2A 1MO6A 2W6OA 4EJ2A 3ZD9A 3R3WA 1RAIA 3JYQA 1R6XA 3U31A 4NFHA 4FLEA 4G1CA 1E3WB 1U7XA 2YXNA 3H87A 2XYQA 5AKHA 1HG1A 1QFXA 4TS4A 3AETA 3D8RA 5EJ5A 3IIIA 4LKRA 4G4GA 4ALMA 3JVUA 1P0FA 2FW9A 1S2GA 2QN2A 3E9ZA 2G5GX 2GN6A 3QITA 4JP3A 5C34B 3R76A 2O8EA 4ZOCA 4ZT4A 3MJTA 1H05A 4O63O 1WCWA 2J9GA 5FI5A 1F9EA 3BK1A 4AMYA 2C97A 4JQZA 3RUHA 4CM3A 4DUGD 2TRSB 4PHGA 1VG9B 1T0IA 5AKJA 4MQ5A 3AI2A 1TT7A 3PNVA 1SN7A 1N6NA 4D82A 5CTAA 1ABFA 1S01A 1VI5A 3OLCX 1Q6YA 4RVUA 4FOTA 1OWNA 3DVSX 1CUWA 3S7TA 2O50A 2R6HA 3VFDA 2I3DA 1BH2A 4WIAA 4KMOA 3ZNPA 1TVCA 5FBWB 2VKTA 2P5YA 4IQ8A 1KIAA 2V03A 4UHCA 2XNHA 2V3WA 3I6QA 3HK2A 4OGGA 1NMEA 1C3LA 2GESA 2AMVA 1SUPA 3PIDA 5TRTA 1TUEA 4Z9FA 3ROKA 2QQEA 3P45A 3CH7A 2WF6A 1FRQA 2D1FA 1EWKA 2YHSA 3C3DA 3QXCA 4BO4A 4C0KA 1U3UA 2XGJA 1JXMA 2C2ZA 2OB1A 3BN3A 2VA9A 4JBIA 4NMMA 5F1KA 3ZPXA 2YASA 4OLBA 1Y8AA 4B40A 3VHXB 5CDFA 5HKBA 2JBWA 2O7RA 1JR6A 1I1OA 1SIOA 4ESVA 1ISFA 4CFSA 1XVUA 1WG8A 2A33A 3IDFA 1JEQA 3TLCA 4WESB 1RQNA 4F9TA 1U80A 1WRBA 3FWZA 3QJYA 1Q0LA 1PJLA 4Y2XA 5F73A 4RETA 4XRGA 9GPBA 2UKDA 4Y0NA 3OM9A 4NMHA 3K72B 4I55F 2VL7A 2OGUA 4ZEVA 4E2XA 4MMXB 2P3OA 5K8JB 4BIMA 1SU8A 1TQDA 2YC2C 3MINB 4PC3A 2VHYA 1BJRE 1N1MA 5IJ0B 1UFQA 4C0HA 3W8FA 1CDOA 2OT3B 3IYLW 2MCFA 4JLOA 4D2IA 3TDMA 2OAEA 5IN5A 4DXAA 4CVNA 2KWIA 2WSMA 1GTG1 5HG0A 1AX9A 4DR6B 4J6FA 1PRYA 4ZCMA 5A9RA 2Z56A 1IN8A 4S1OA 1F9AA 1E69A 1V2HE 1ZMTA 1TMOA 4ZZ2A 1ZN2A 4JJAA 1XU4A 4ZHQF 5GOZA 1UBRS 5AVWA 1WDWB 1GCUA 4BRSA 3S1AA 3I3OA 3HY6A 1ZA2A 3GRZA 2CE2X 3I6IA 1PDVA 2FP4B 1O5OA 3M6LA 4MP6A 4F5WA 2ZI7A 4Z4GA 2CXTA 5FLKA 1UK8A 4JCOA 1X14A 1CJUC 1YMVA 3UQZA 5H5JA 3FVWA 3V6MA 5KX5F 4DLRA 4D8UA 1C3OB 4TSFD 4IGIA 4Y9DA 1OBOA 3RSQA 1D1QA 5LMUB 3KXPA 2VWGA 4Y0AA 1BMDA 4E31A 4C3HB 2J09A 2AZXA 2OORA 4CIWA 5FHRA 3N5KA 2FNAA 3R3YA 1K8QA 3DPUA 3Q88A 3R6LA 1OZGA 4IMIB 5C46F 1NI5A 4G6ZA 1E3LA 1E3IA 2ONYA 4NU0A 3RHFA 4WLUA 4I6GA 3CEPB 4YJHA 1BKDR 3ZDZB 3O26A 3PGKA 4Y1RB 3JV7A 3RQSA 4MKRA 5DU2A 5BSFA 5E7QA 2OV3A 1TZ2A 2AA3A 3AM3A 3K9BA 1IBKB 1SKYE 1BD3A 3BH6A 4PYMA 3RNLA 5IFKA 2H8GA 1ZK2A 1JECA 3INGA 4DA0A 4C0XA 1EBBA 4KLCA 3SYTA 1J22A 2G80A 2PKCA 4ZU6X 3VSBA 5JH7A 4B3GA 1S8AA 3L1VA 4V1CI 5LQAA 4YJ2B 4ZGBA 3ET4A 2JI9A 3I05A 4G2TA 4RKFA 3V2GA 1L9XA 3GA7A 4DR4B 3N8NA 3SK0A 4D42A 5UKDA 3KJNA 1OBHA 1RTKA 2J5BA 3N86A 5EHNA 1UR5A 1R0LA 3R5KA 3H05A 3EZ9A 3G2MA 3LQKA 4IOLA 1NY5A 1F8UA 4PPGA 2A0WA 2H65A 4UHJA 4K05A 1I13A 3QY9A 3IJRA 4DCOA 4E5KA 1NUSA 1A4UA 4YJ3A 4AS3A 1MB0A 3BBPA 3L18A 4PYOA 2OHGA 1D9ZA 3KTAA 3PYMA 4HGYA 2EBHX 5ICFA 1OA1A 3S99A 2HA4A 2XTZA 3O4GA 4FSXA 4MYHA 3LX4A 5DULA 4L73A 5CAEB 3ROQA 3U7JA 1T43A 4EY8A 2UV8A 1AGNA 5CB6A 3OZAA 1IQPA 5HK9A 5BV1A 4BU1A 3I04A 3MD0A 3H11B 4G5OA 1YZTA 1UDRA 4ZO6A 2IS2A 4PNPA 4YBZA 2C54A 3FE2A 4BDSA 1V1RA 2HTEA 2I2XB 3KYCA 3JQBC 1VBMA 3A9TA 4US0R 1DIOB 3SFZA 3KOUA 3ZW9A 1HOTA 2J6IA 4PYLA 1F4LA 1E1CB 2O14A 1ESCA 1XTKA 2C95A 1JPJA 2GS9A 3H1FA 1L5GB 3F1KA 3JARB 1BS1A 4YHHB 1LDBA 2DCMA 4MW1A 4L15A 2BGIA 3PSAA 2PA0A 3DOFA 3N58A 2JVJA 2Q3DA 1NQOA 3OPNA 2QM0A 1YL7A 5JLJA 1C3VA 1IEXA 1FRNA 2ZYIA 4XGIA 2REOA 4FE3A 2M98A 3ZY5A 4BEJA 5JADA 4P92A 1NVAA 3A4IA 3K16A 5AFSA 4QICA 1E1RD 2IEZA 4BNDA 1ORTA 3GUVA 1J0CA 3QU7A 1NJFA 2Q3BA 4CV0A 2B2CA 3GLGA 3WICA 5H70A 4JI0B 3EXHC 3GCDA 4RPJA 2WQ7A 4ZAWA 1YF3A 3C85A 3HYCA 1IIBA 1KAQA 3BA6A 4X3CA 3MFYA 1CB7A 1A97A 2I76A 2WU1A 3WMWA 4G8DA 1F8YA 3B6EA 3O73A 4RVHA 1JI3A 1OHHD 1WW3A 1ONPA 3AF3A 1MJHA 2UVQA 4FM9A 4N54A 2O8BA 3FG9A 1RVDA 3C3XA 3GXBA 3N2EA 4FNMA 3PDHA 5HMMA 1UMBB 3IGFA 3NJRA 3VPXA 4BFWA 1AA6A 1Z73A 4I6EA 3TDNA 1DDIA 1EH5A 2ANBA 3I2YX 1IBMB 2JA7B 2GLUA 2EQBA 4P0TA 4HLNA 3RRYA 2AKAB 3SDSA 1MJGM 1SVWA 2BH9A 1O57A 4YRZA 3EXHB 3PI7A 5E9QA 3ORRA 4F71A 4KLAA 1XHFA 1EX9A 2Z5FA 4ND1A 4HH4A 4O33A 2ACVA 4UHDA 2ZAYA 1C30B 2ZP1A 3PFHA 5E0KB 2C4HA 4CODB 3T5PA 1HOXA 2P41A 3EARA 4MGZR 3WMXA 3RV4A 3OZIA 1KH3A 3CR3C 3ISVA 2HMAA 1JDVA 4ARZA 1E9AA 3CE6A 3RTAA 3DA8A 4TMXA 5T3YA 1JSRA 5HZKA 5DHRA 5FP0A 4OX9Y 4O8ZA 4F3YA 3DOOA 3C7TA 3SXJA 2P79A 1Z6TA 1OKKA 4BFCA 4L75A 2FMUA 2GM4A 1B14A 2G25A 5J2TA 4G8CA 2BFEB 3MWKA 4XUDA 3VC3A 3PC2A 2O1SA 2J59A 3V9PA 3NALA 1YDGA 3MLBA 2PO7A 1UPXA 2B8NA 2CKDA 2XITA 5DHPA 3OTOB 5D6OA 1QE0A 4RZ3A 1RLMA 1SBHA 3WHIA 1IUPA 1O9BA 1D6JA 3O94A 2EU8A 4J91A 2D0DA 1SK9A 3COWA 1EK2A 3UEOA 1TKRA 5T8KA 2I7VA 2XNKA 2PU7A 2ZPAA 3GGSA 1DAKA 3GZ4A 3VXKA 4C08A 1IZYA 1Y5RA 4RE6A 3VKHA 1RMYA 3LKBA 2YDXA 4TMKA 1X9IA 5CVVA 3ZHVA 3QV1A 1CZUA 1XEFA 3T7KA 2PGDA 5CJPA 2OV8A 2JANA 2RGNA 2YJNA 2Q4OA 1FRVA 3IPCA 2PKRA 4TLBA 3W2FA 3TFOA 1VRCA 4E21A 2FKAA 2I80A 2NSJA 2XWPA 3DVAA 3WWYA 4XVQA 3VNBA 4AN0A 1PV4A 1I33A 1C3OA 1H5NA 1JSZA 3O7WA 2QMOA 1KS9A 3GYBA 3MUOA 2Q99A 2HBYA 3H99A 3GTGB 3ICOA 3WGVA 2P6UA 3HDHA 1DUSA 1FMLA 3BSWA 4QEDA 4Y2QA 4HV4A 4PBTA 1QYVA 4XWYA 5C1OA 2OAP1 1JR3E 1B0UA 1Z34A 5DFAA 5E6RB 4RACA 3K0CA 2X1VA 1QO0D 4KFRA 3ZXUB 1FFXA 3P2IA 2V7BA 1EP2B 1THZA 1LWNA 1AN0A 4KBYA 1YMUA 1GUZA 3A27A 4YMVA 1R6TA 1JPVA 3DUFB 3QE2A 2HGSA 1QVZA 3YASA 1E59A 1JVSA 3BJRA 3EA4A 3MTDA 4I0WB 4LYGA 4DCTA 1EWTA 3T0FA 1DKQA 1T1SA 2QQFA 2OCGA 1R0YA 4MTCA 3LVBA 3NHAA 1R4MA 1AQYA 2N1BA 1XQ1A 2VQ3A 2MINB 3DYIA 4TQGA 1FXSA 3O2JA 1B8PA 4HXGA 4FDVA 3KNZA 5C2JB 1YB5A 3II6X 3DR5A 2GEVA 1W48A 4L6AA 4N01A 3Q2OA 4OSEA 2WE7A 3D31A 2YW2A 4A3DB 2AS0A 1BW9A 3OCVA 1U3TA 1ANKA 2W6CX 3F73A 3IVXA 3BC1A 2RCYA 3E2MA 4OYHA 1BVHA 3D8TA 2KJQA 2JCXA 2FPOA 2ZJZA 4BLWA 1NXXA 2VTKA 2YJZA 3ONEA 4R81A 5JS7A 1KYQA 4ZTZB 3HSSA 1OIXA 3WISA 1TUBA 3K0BA 5ERYA 4CQLB 3NHRA 3RTDA 1O6GA 1QSGA 4CDGA 5JS8A 1R9NA 4F4FA 4U0JA 5B2EA 3W4KA 2Q2NA 1HXHA 3BX1A 4GOND 5E8JA 3MCZA 1WMBA 4HNAB 4DJEC 5KWVA 1G60A 3M83A 4K9OA 1O9HA 1Y1KE 2FX2A 4NSNA 4Y2TA 3RU2A 4G9EA 4XM2A 2X0EA 4HZUB 1E2DA 2HFKA 1NXSA 1JAYA 2E3JA 1W85B 4JYBA 3I0MA 5CGZA 3WRYC 2I2AA 4CM4B 3QUQA 3D6VA 1XEXA 1EG7A 3D3QA 5CBPA 2ZE6A 2H4XA 4GWLA 1Y37A 3T3HA 3B9RA 1JQAA 5JXHA 3UMJA 1SU4A 3WAJA 1KQOA 3NVDA 5TGTA 1Z38A 3FYSA 4GKAA 3JQAB 3DHVA 1LTHR 1D2AA 3HCWA 4HFRA 4QLAA 5H0IA 4F9FA 3UXMA 2R4TA 5BY2A 2A2ZA 3T1VA 1SKBA 1Z47A 4ZYVA 1CUIA 5JSUA 1AZTA 4UTZA 5DXAA 5G1PA 4HDNB 4D5GA 2WTEA 2B4KA 4J16A 2VP4A 5KNDA 3JS5A 1YDFA 1XU9A 3EXIA 4YJ3F 2OQIA 3WMEA 4MNTA 5B3LA 3HJFA 3ONDA 4CYMA 4CEIA 1SEPA 4MVYA 3FKSD 4XX1A 3T4UA 2GBLA 5KWIA 1AB6A 3QJGA 3ZH9B 3RS3A 2ZQZA 1LPNA 2GJKA 2GSDA 2R2GA 1V7PC 3C4JA 3Q0TA 2I1QA 4N5IX 3GTMB 4GI3A 5TNXA 1I4TD 5JPCA 5L8VA 4Q9AA 2P2LA 3T9DA 4GI2A 1U1GA 2ZJ7A 3EZ6A 4D02A 4KN5A 3KYDA 1FK8A 2E4UA 4OV6B 2F1RA 3L6BA 4WBXC 3K6SB 1IZ9A 4O59O 4ERNA 4RAOA 4QYWA 4MYTA 3LOUA 2PWPA 1LLUA 3KR0A 1QS0A 1CP2A 4Q4HA 5FLYA 4DTIA 1JHXA 1TQ2A 4M7WA 5LDDC 2PLFA 1N77A 3OM0A 3OU6A 2WWFA 1RBQA 2H57A 2YZMA 1XD8A 5CDGA 1NDUA 3ELUA 1G42A 3LT5A 3RU3A 1Y34E 1T9GR 5AJXA 1OAOA 4R8VA 2JIBA 3MD9A 4KH1A 4IJWA 4N5LA 3CLHA 4V2UA 4NULA 2IS4A 1UBHS 4NEQA 3JALA 5TB5A 2NADA 1Z8NA 2XH8A 1NVUQ 2OCBA 4HTFA 4QPDA 5I51A 1N2JA 1JXOA 2Z57A 3ABSB 3MJSA 4E51A 2CLIB 5DGTA 3PK0A 3AM4A 2PJZA 1D8AA 1EDDA 2YHBA 3M82A 3M49A 3STYA 4ESOA 5BWNA 5AVTA 1TA9A 1KI3A 2WIDA 1NW9B 4CT4B 3CW9A 1S9DA 1N7IA 1TIBA 4MQEB 1W94A 3NGMA 4XDHA 4ZIRA 2PZJA 4IYJA 4LSMA 4DGSA 4QZVA 5HS4A 4Q9DA 1G8FA 4IFTA 2HV8A 4B32A 5ADWA 3HYNA 2QUKA 5B1DA 5C1PA 1DX6A 1XF9A 1VJ5A 4KACA 4L76A 1QR6A 1QUFA 2RI0A 3IQHX 2PT6A 3QHQA 1E77A 4PLWA 4PO3X 5HQ3A 1LK5A 1NW5A 4HEQA 3ZDYB 1ZH6A 4TTJA 2VZ8A 3ELDA 3MJFA 2BMJA 4ZI2A 2HZ7A 3MTAA 4PTLA 4RHFA 1PFUA 4KUGA 5DF1A 4HUQA 4LGMA 2EBWA 4N8SA 5JAHA 4I4CA 4X1IB 1H2RS 1X80A 3C3EA 1B41A 1IZ0A 1SG9A 2WJPA 3VR2A 5BYKA 2P5TB 3CEMA 3ZX5A 2GX6A 2WR8A 2NX2A 3QEMA 4QUGA 3OFVA 5FWYA 3MGAA 4DSAA 1B26A 4KO3S 3PTZA 4FC6A 5AVYA 5FPSA 3TTYA 2OCKA 3DBIA 4MWEA 1QFZA 1YOBA 3B3JA 4J03A 4CU5A 4UPDA 1RXYA 2ZRCA 1AN9A 4BVJA 2Z9CA 4QXPA 4X95A 4YUZA 4KXNA 3NEJA 2X5KO 4KXYA 1KRHA 1RVV1 5L4SA 4JLVA 1BE8A 1CVIA 1I2BA 3W5CA 1A4XA 1J0AA 1QVAA 1UM8A 3GWZA 1XJ5A 4WEOA 1AGYA 1QPBA 3M6MD 2AEMA 2QR5A 1ABEA 2HIGA 4IH1A 4WZZA 3S2IA 2OEPA 3V7UA 5JBIA 2RHHA 3RJMA 4CLXA 4W9MC 3FPJA 4MWOA 4XYGA 3LS2A 5C8YF 2CHVA 2IP1A 2EFHB 3K2IA 3HYSA 1SPXA 2QJRA 5E2AA 4B2IA 3JWJA 3BOSA 3C45A 2F9LA 4QULA 1SUIA 1X3LA 1Z5WA 4H7DA 2XAUA 3EJWA 3PU6A 2ZAGA 2O52A 1GT6A 2P35A 3PWKA 1BVYF 1S4QA 3R23A 3HCEA 4MW4A 5IH3A 3KZXA 2Q9UA 3TW4A 1M76A 1B8NA 2BFMA 2WHPB 1RHRA 2QLFA 1VBKA 3GBPA 1C41A 1QK3A 1V26A 3S4YA 3ONNA 2WT4A 1CJSA 3ZG6A 4ZYLA 1QG6A 2D4HA 3VYWA 4AJ1A 2Q7XA 3DUWA 2Q2WA 3W7BA 3WNBA 1KY5A 3ZV5A 5B7PA 1U0SY 4KXFB 4MRNA 5DIZA 1EMDA 1YL5A 2PZKA 1CB0A 2YYAA 1FPQA 2B83A 1TO6A 2O1EA 3BMQB 3CF4G 4R7ZA 4TLEA 1XKQA 3HLKA 3STTA 4Q4CA 4HFMA 3T3NA 1EHCA 1KMHA 3GLHB 3LK7A 3LZ6A 4GMKA 2XB2A 2ZKLA 4N82A 4ZOQI 3AF0A 4O25A 1C9KA 2BJHA 2FRVA 4E70A 2AN1A 4MYRA 5AXBA 3PT9A 3ZDRA 3FBGA 1P91A 2UXBB 3CE9A 4P93A 2SECE 3O4IA 3OX2A 5M5XB 2JLRA 1L5YA 1MGPA 3LVRE 2H2GA 3TD6A 2XE4A 3H1AA 1D6NA 2MJLA 3PKJA 3FOWA 4F9EA 1YIDA 3A1UA 4DRXB 3QTLA 1QG2A 5B64A 1L4BA 4E0BA 1C1YA 3EIXA 3KL4A 4ZVVA 1E6LA 2BFDB 4KKXB 3SIWA 1E63A 4EO9A 4DG9A 2BMAA 3GP8A 1P62B 3UT6A 4YQZA 2XMBA 4IDGA 4MJLA 4EPVA 4YRAA 3HXKA 3S2EA 3GN1A 2XQJA 2PD6A 3AY7A 1XCLA 3AC0A 2RSLA 1EFLA 4JBXA 4NCXA 1PN3A 3OTHA 4IJ5A 5BORA 3K7EA 4INAA 1MH9A 2XVAA 2LR0A 2O8CB 2Q0XA 3U81A 2GYUA 4ROTA 3WYFA 1HDRA 4ENVA 4KREA 1OX4A 4XSGA 2AG5A 4BFZA 2NVUA 3GXOA 2ZI4A 1UWVA 2C5BA 2A0KA 2F9MA 1PW5A 3CHYA 3MJHA 4L5BA 4NFSA 5H9VA 1PEAA 2DSTA 4KR6A 3H0GB 1U8TA 5EAIA 5D2CA 1GKIA 4PWYA 4X61A 5M34A 2ZBUA 4WUVA 3ZLTA 1P0PA 4GX1A 4PS0A 1Y5MA 4TWAA 3VPGA 4E22A 1KMHB 3GLHA 3W2TA 4EF6A 5KDDA 3K32A 4B6SA 4OQYA 2OLKA 4EELA 1HT1E 5FEUA 3U3OA 2Z6AA 2ENUA 3UFXB 2CLMB 1S2IA 2F3UA 1Z6ZA 4BO8A 1Q50A 2Y77A 4WLEA 1QCYA 1A69A 3HBLA 3LHSA 4N7JA 2GPAA 2XCIA 1EE1A 4UTNA 4RTKA 1GYRA 1I3CA 2J7PD 2G70A 2ODTX 5J5CA 2R8XA 3A1SA 1BO6A 4MI3A 1L5QA 3R7DA 1DOHA 2JLVA 1DRUA 3BT7A 5TQ0B 1VGVA 1X6VA 2EWVA 2NYVA 2C96A 3EZ7A 1Q1BA 3FJOA 5TVGA 3WZLA 2HK9A 4UU1A 5EIFA 3MRSA 4HVAA 4O5AA 4CW7A 5KOIA 5LZ7A 5TMEA 3ZWCA 4LJKA 4G0UA 4P54A 1P5FA 4FCWA 2DEUA 3SLKA 2WD9A 1HLFA 3NH9A 2Q9AA 3OA0A 1R6AA 4FR2A 3SSMA 2A58A 1XV5A 3WJAA 3LCMA 1OWPA 1H23A 4QUAA 3KQUA 1K5HA 1MEEA 1AIPA 1C1XB 2NPIA 5IT0A 2SKDA 4YDHB 3BUSA 1NYRA 1WP4A 1F1BA 3FGPA 3KUXA 1W8DA 3CQ9A 4K46A 4NENA 2W6ID 4L8LA 2OG2A 3BMOA 3U1TA 4KHPB 1KBZA 4L7VA 3R2JA 2R5NA 4KH0A 3TBHA 3IP8A 4AWXA 4KBFA 5K20A 2JAPA 3E2IA 5BQPA 5C5DA 5DWVA 3UW1A 2R79A 3COYA 2IY8A 4POAA 1R0XA 1DP4A 3I2FA 2IYPA 4I4LA 5FDFA 1N6RA 1AKUA 2GGSA 3GFSA 4AROA 3R5SA 1ZGAA 1I10A 4P5EA 1M6HA 2R93B 3G1TA 1G3IA 5K0FA 4GMGA 4TZKA 1U2TA 1MP0A 3BXEA 3UUWA 1T6ZA 2VTBA 3O92A 1U4NA 3EVTA 3QKIA 2PSJA 2BMFA 1MOPA 3ZGZA 1D2GA 5FBLB 4BJ5A 1VJTA 2G28A 2Y6UA 2QAIA 2F43A 2XB8A 3ED5A 3BA1A 1MBZA 1TVEA 2N9UA 2Y2UA 6CHYA 5K3BA 4M2LA 1QX4A 4ZDWA 1L7QA 5KSYA 2VA8A 3I04M 1VHJA 2VJNA 2CFIA 4OHPA 5EZ5A 2G09A 3ET5A 2RGUA 1UMDA 2O2ZA 3ZY4A 4D79A 1R4NB 3U3DA 5F7JA 1X38A 3U4AA 3KV1A 2WAMA 4KPUB 1UMCB 5A5EA 2W6JA 4JGIA 1STOA 5GV8A 1Y3FE 4CIAA 3O38A 2X1MA 4D9CA 3PEWA 4ADSG 3BWCA 2HBQA 4JHLA 4Q47A 1GL7A 2OORC 5G40A 4DQ0A 3U1VA 5CPBA 2PE5A 1WPXA 5HXAA 2ZSJA 3HCFA 2YRXA 1AHIA 1L5VA 3EAQA 4XJSA 5D3QA 5F3WB 2HMTA 1I9CA 2AXQA 3FGOA 3OWXA 3QA3E 4NHEA 3N2KB 4UBJA 2BCGY 5SZHB 5LUAA 3PPXA 3N2YA 2DC1A 5K05A 2VTVA 4K40A 4EF5A 3ADDA 5HYVA 4JEHA 4ZAZA 2D0PB 1U1IA 1N2OA 1N5OX 4YVFA 5DTQA 3VI4B 1MXHA 5EZQA 3HXTA 3T5GA 1P7YA 2OCLA 1KAOA 1VKRA 1XFAA 1XZHA 1ZGZA 2SCUA 4XLLA 3PLNA 4R1QA 5AVZA 2OUIA 3PENA 2OO5A 3I09A 2NT3A 5KQMA 3UV7A 2QTWB 4BFTA 4NNOA 3IILA 1W9MA 2C3UA 2ZTVA 1ZO8A 2GPJA 1I1QB 2VYQA 4O4JB 1YB7A 2ZVPX 3JYLA 3AOGA 2YY6A 3NC4A 3SQMA 2UZ1A 5KYGA 3LQYA 4LOIA 4YREA 2WWYA 2B0CA 1ECCA 1G8JA 1W5SA 1YRQA 1UZLA 2Z3WA 3GD7A 5E9AA 1BS9A 1QAMA 4CRWB 1JR3D 4M1YA 1DO0A 1OLXB 1VXRA 2LNDA 2RHGB 2HHHB 4WGFA 2NP7A 2P3LA 3ILYA 3QELB 3FRHA 4R2JA 1HFJA 1LU9A 1NVVR 3JPWA 3N70A 4OGFA 3LXUX 5B12A 1VLJA 4E7PA 2R1ZA 3ESYA 2PPLA 4Y2SA 1LLCA 4X5OA 5IAEA 1Z8DA 3NHMA 1DC7A 1ZLXA 9LDTA 4ZRDA 4IPTA 2DY0A 3D64A 2V0CA 3OX1A 4FBGA 1I7SB 3RW9A 1JEOA 1Z4MA 2R1TB 1ULUA 3UKJA 1N9KA 3HOYB 4G8BA 2DH5A 2IYZA 1HDIA 5KS2A 2JGFA 3IAFA 3RUCA 3EF1A 1Z28A 3D8BA 5EGSA 3ZEAA 4YMTA 3THXB 2W2PA 4HDNA 1V5FA 4KQIA 3S17B 3CUSA 5ALQA 3NG1A 3HUUA 4I4TA 4WKCA 1NZJA 2X9QA 3EG9B 2K7FA 1QH1B 2WK1A 1Z8FA 2XNJA 1JNYA 1WHSA 5B7NA 2DQKA 3H9QA 3QEJA 2JF0A 2QIOA 2V97A 5IS2A 3LCJA 3K6RA 2A5YB 4RD6A 1SC4A 4BATA 3F9RA 4OI0A 1SIUA 3OUZA 1WVIA 1P8AA 2CNWD 2XRYA 1TD1A 1YRWA 1WDMA 1I5RA 2GJ4A 2XE7A 2XMRA 3GEDA 5K51A 2NU9A 4NS4A 3EC2A 2ZBDA 3H97A 3IPRA 2CUNA 2ERYA 3PX2A 4GR9A 1QNLA 1CUUA 1XUOA 1YDHA 2RKOA 1FS5A 2H06A 4X41A 3TGWA 3AK4A 5C7OO 1EAMA 3E9CA 5LBIA 3WGLA 4DZRA 4B9AA 2GEUA 2CNDA 3E1GA 4URXR 1QGED 2C2HA 2NTEA 2ZBPA 4Z3DA 5CDFE 4ATNA 4DDTA 5J2UF 1E5VA 2RHLA 1RKQA 5AVKA 2IHUA 5THQA 4UNRA 4BPRA 4GX5A 4MGKR 3DKRA 3ZLJA 1NE7A 1TLTA 1Y4AE 2GASA 4X45A 3RADC 1BKSB 1KAEA 1NP6A 1S0UA 1GYQA 4R98A 1L8AA 3OCJA 3FNEA 1RZUA 5J5AA 1UEXC 2Z4SA 1T5IA 1XQXA 3MTJA 5FB3A 1RYZA 2W70A 3A2NA 3MWDA 1H3NA 2WZDA 3LFHA 4D3ZA 1O94A 4XQEA 5BN1A 3U62A 2MT9A 1DC8A 4MI9A 1PWXA 1ZH4A 2GK7A 3IEUA 3L6RA 3PZRA 4LDQA 4RK6A 1M6VB 2B6HA 4ON9A 5KJ1A 4RMIA 5JSQA 3B5EA 1M34A 2W6PA 3LKVA 1W6RA 4MCIA 3ZGLA 4ZDIA 4QAJA 4OMCA 3UT0A 3PNMA 1RM5A 3PXDA 4RMJA 4EEKA 3TSWA 1P5RA 3DXZA 4ENQA 3B36A 4DBZA 5KTNA 1EU1A 4TVBA 4ZO4A 5DHSA 4X90A 2P62A 4BQPA 4N6GA 2OD7A 4V0MA 2PJRA 1BEZA 1GCGA 1BJTA 1MOZA 5JJLA 2QS9A 4MS1A 4OQZA 3P2MA 5C8ZA 2FQQA 2OR3A 4PYKA 5K0JA 2ORWA 1ZM7A 3LHFA 4CI0B 2AEEA 5JD3A 3R5TA 1SXJC 3JQGA 5EUQB 4C7MA 2WQ6A 3JATB 3CXRA 4BNIA 5B5SA 4JEUA 4BV2A 1F4PA 2AOTA 4KQKA 2HZBA 5KAMA 1JBQA 4TMWA 4ZA2A 1D6SA 1YJ5A 3GIWA 3CB4A 3QKRB 4YRNA 3VZSA 3G59A 4JVNA 3MUNA 3Q8WA 3LPDA 4JUIA 4PAOA 5INTA 4TWRA 2C9MA 4LC1A 4FZ5A 4DTCA 4X93A 1MB3A 2G17A 3CONA 5BSVA 1BWPA 5B37A 1U81A 4MRAA 1S3GA 1TAQA 2BAGA 3A9SA 5E8RA 4ZYZA 1FDTA 4QO8A 4MV0A 1GDTA 4P4SB 5JFGA 1E0SA 3EMBA 4Y7DA 3VH3A 3HCAA 3O8QB 1EFCA 4LUCA 4DGQA 1OYOA 1S6YA 2LDBA 1Q84A 2DFLA 1RAHA 4OB7A 5JNSA 3F5FA 1ODFA 1OPRA 2WWIA 3WDSA 2I87A 4WECA 5K8CA 1VA4A 1TZKA 4FOPA 3ZDFA 4UUBA 1X1EA 2CXHA 2XB9A 1G6HA 4LIPD 3DH0A 1RQ2A 3GRKA 2B63B 2DPXA 3AESB 3ANNA 2C92A 4UM7A 4CETA 2DPYA 5ALJA 4D9KA 5FPKA 1N2CB 1Z0KA 4EJSA 3SVTA 3W5AA 2CNLA 4ND5A 1JZTA 1RRFA 3S70A 4D9GA 1QH8A 3UMMA 4JDPA 1IVSA 5BWMA 1FNBA 2E89A 2E82A 4QREA 4YO7A 3L7LA 4AJHA 3DLIA 1EXDA 4ZAVA 5L6LB 4E46A 3V2UA 3RO7A 3EGIA 3KEQA 1DBIA 4CMJA 4PSVA 3ANLA 3EMDA 2AG0A 1H5QA 2PS9A 3NUQA 1FFBA 5KYXA 3SQLA 4TVSA 5GVRA 4JGGA 4L85A 4XM1A 1PZFA 3L0OA 3HV2A 4TLDA 5ED4A 3EXAA 1XE3A 5BSGA 4V24A 5LNK1 3NIBA 1NUUA 1W47A 3HOXB 4EB3A 5EYPB 1JZQA 2BFEA 2GN0A 5CH8A 4DLNA 4BMNA 5MN6A 1JA9A 2IS1A 3K2EA 1E3QA 2QTGA 3BWYA 3PLAE 3EBLA 3E9YA 4PM4A 4DMGA 1XWWA 1G8HA 2ZI9A 5A4MS 2HPHA 1KEPA 4BX8A 4RABA 3VPAA 5BOSB 4G1MB 3OO0A 4WK6A 1DDOA 3PNLA 3K2QA 5A4IS 5LN1A 2FMTA 3EPRA 3NAGA 3UT5A 1IWOA 2VTDA 4H17A 3JYPA 3CMMA 4GOKA 4D9HA 3ZGNA 4NWIA 4JBLA 1MX9A 4C29A 1E4EA 5LQNA 1BE1A 1WA5A 2GZDA 1LI5A 1R0SA 3I52A 2B3TA 1XVIA 2XA9A 1ZIDA 5I8WA 1HZJA 2VC2B 5F1OA 5IANA 1MC4A 4KHZA 5GJCA 3EVNA 3M6IA 4JJ7A 1PGJA 4MKXA 4WE3A 4E7OA 2EW8A 1KKUA 1DKLA 2G08A 4KN9S 2JIMA 2O8CA 3F96A 1D4ZA 2O23A 2YNMD 2WPNA 2XMGA 4L6CA 5K0TA 5DN6D 5KYWB 4OH1A 3HV0A 1EWQA 5GM2A 3OSUA 4NU6A 5HJEA 5AHXA 2QA5A 4GS5A 3CLSC 5F78A 4MS4A 1GPNA 1MVNA 1JHMA 3KSZO 4P7JA 3NHSA 3C8DA 4K0RA 5GQSA 3UJCA 1T6NA 1CIPA 1RJ9A 3BD9A 3E3AA 1U0BB 3AHGA 3LPCA 3IT3A 4WJLA 7REQA 3MWGA 4MOWA 1E79D 4L9WA 4DR5B 1A2BA 4WX2B 1T9KA 4GQAA 5EWMB 2N1MA 2ZTLA 1OZAA 5BSTA 4TM7A 2NZ2A 1Z2DA 2VEOA 1YOVB 4DLTA 3ZDBA 1JG6A 2BP7A 2AFHA 1IM5A 1FS4A 1AV7A 1MRNA 1WB5A 2ZG6A 4FMCF 4MR7A 2IDMA 4UUNA 2HMSA 2EFGA 5FD8A 1KDZA 3ZI7A 5CLFA 2X8BA 1T4CB 1MEJA 1JDBC 4REOA 2FW8A 1N3YA 3WLFA 4WLFA 2DF8A 2Y1XA 4DRYA 1KPGA 1CIJA 1A2KC 1XT6A 4M1SA 3T9EA 1M10A 2OK7A 5HF8A 5ADVA 1PK8A 1IPHA 4OHOA 2H7CA 4C6RA 5BPFA 5KX5B 4P84A 4ETIA 3ORFA 2E6UX 3QHPA 3DPIA 4YB8A 3H7AA 5ALTA 5M29A 1ZD4A 1ESDA 1BDMA 5ALKA 1I6HB 3O1IC 4EPRA 1FMCA 2M1ZA 3FZYA 3H2HA 4LHEA 4V0SA 3BL5A 1KHHA 2YCBA 4M6WA 2QG4A 2BY4A 1WO8A 5L3ZA 4BN4A 4TYPA 1F0YA 1UWCA 1QHNA 4PW0A 5A4JA 1OMOA 1IUNA 1PJBA 1HPLA 4IDOA 3RUIA 3QF4A 4XUGB 1U7PA 1ZXLA 3KU4A 3VU3A 3ZY6A 3IQFA 1JB1A 4OL9A 2DUJA 4P2BA 3L4BA 1A1SA 2RC5A 4H15A 3H8VA 2BWJA 4MP3A 4BZPA 4O0MA 2V1UA 1NVKA 2IYEA 5CHYA 1XRRA 4FT2A 2DPMA 3A9RA 1GPYA 2CLKB 2IQIA 4PPQA 3GFGA 3ROZA 2YBDA 4H0NA 3DEYX 1E2BA 1VXOA 1R6DA 5AVOA 1AKVA 1DO8A 1PEKE 1DHTA 2W6JD 3TLGA 2XRFA 3V33A 3O8NA 4ZJPA 5FOWA 4ZDKA 3RYCA 1YRBA 4H3SA 8ADHA 4JLUA 3TR5A 3BHIA 2OZPA 3SVLA 4A03A 3KJHA 3CX7A 1X3SA 5IRCD 3ETEA 1D07A 3MZ0A 3OTWA 4G5FA 3RDPA 5DM60 3O8DA 1JE0A 1NRWA 2OD9A 3E9DA 4UQOA 3WJ1A 1T36B 1QU3A 3WFZA 2D59A 1IXSB 2DPHA 4US1R 3DP7A 5KX5A 4D0LB 2JLSA 1I0ZA 1KDRA 1W4LA 3FZQA 3M1YA 3I9KA 3TUIC 3ZV4A 4F21A 1NBME 3T5TA 4OIFA 1LZLA 2REXB 4GMXA 1L5SA 2CEKA 2CVOA 2CEAA 2E4AA 1K7EB 1BWRA 3A1WA 3R0XA 4HTFB 1CKEA 2QTHA 1YRLA 4C04A 1IY9A 2JLYA 2V7EA 2EKQA 3UJ3X 5JNTA 2DVMA 2XIQA 2DWCA 5I4IA 1V5WA 1MENA 4Q93A 1Z08A 3MIZA 5JRJA 4M55A 4JI1B 2BEUB 2FWNA 1KI4A 1IPFA 4LQLA 4AIRA 4DPLA 4FGLA 5E1OA 1R4ZA 1KVSA 1SHZA 2CCJA 2HWWA 2IC5A 2X9NA 3HKCB 3WGHA 3ZDXB 4D4JA 5LR6A 1U28C 1JBKA 4QOGA 3GX1A 4E5VA 1PVOA 2WUDA 1NVMB 2IZ0A 3F7TA 2VH5R 3NVAA 4KUEA 2WNIA 4IJQA 4RZQA 5DGXA 1BN7A 1KDOA 3O9ZA 5LP6A 3C4QA 2R85A 5BUZA 5HQ3B 4K8OA 5KQPA 3BIXA 3ESBA 5COBA 2QE7A 3I32A 4AZ0A 4DMFA 1BDBA 5BMVA 3S14B 4DCJA 5BT9A 2WBLC 4BB6A 4UM9B 3QWFA 3K6SA 1DOZA 3ASUA 2X2FA 2WHXA 4MUMA 4ZI3A 4MV3A 3Q1LA 2BF4A 1G4HA 3GH3A 4OJNA 4XLZA 3AEKB 4IIBA 4CLDA 4DMKA 1KQFA 3UK2A 3DKVA 2WKRA 3HA5A 3P9SA 1ZRMA 3E53A 3U3XA 2OFPA 3E5MA 3ZR4B 3J81A 1U0HC 4Q18A 4YUYA 3EPLA 4A16A 3P7MA 1L5NA 2IV3A 1BDIA 4C05A 4X97A 4UPVA 4UFNA 3D3KA 4HFNA 2JBAB 3W9SA 5AW2A 2R11A 3KBOA 4BMCA 5BSWA 3M3DA 1OX4B 3D7SA 3N7AA 4HS4A 4WBSA 2A9FA 2DTDA 2FR8C 3N3AC 4HDRB 5D7BA 1CC1S 3MRXA 4NARA 3ESRA 1SQ6A 4GRDA 1NC3A 2RKWA 1NONA 4I1VA 1ECGA 4XRRA 1XKTA 13PKA 4CWAA 1PQPA 4D9FA 1J90A 1MAUA 2I33A 2VDJA 3L8MA 4G1EB 4NYJQ 8MHTA 1S5PA 3AUTA 1DC4A 4NZNA 3BF8A 2VXCA 2PX4A 4O2AB 2VHVA 3T12A 5ARBA 4ZKEA 2WU0A 3O0TA 5FBZA 3DZKA 1CUEA 5A2QA 4RQTA 5FWYB 4KV7A 1F2VA 5CCXA 3WA6A 3IUEA 3S2FA 1ZPDA 4ZOEA 3AW9A 5JLAA 2G0TA 2AI1A 3BD6A 4ZODA 3QI7A 3S1SA 3L9WA 2E2IB 4CLRA 2J3IA 2QSJA 1VHWA 5HF5A 4URFA 4LQ4A 3V8MA 4GVPA 2XKKA 1JFTA 3PQCA 2XUFA 1FX1A 2XB4A 3B7GA 1MRSA 5B2ZA 3ZDAA 1RP7A 1TT5A 3CCFA 4MUIA 4R83A 4YV0A 4Q1EA 4ZAFA 1T8RA 2PPVA 4MS4B 4C4ZA 3EIFA 1EVYA 5BYBA 2QJWA 1QQ6A 1EUYA 1YDEA 1XMOB 3PC7A 3M5CA 1UKYA 2AJ8A 2V3CC 1SZDA 1VI6A 1L3IA 1YQQA 4JA0A 1EXNA 1BMTA 2FEKA 3R6GA 3RRFA 5H9WA 4IRMA 5CFNA 2R8ZA 3DPSA 4BVLA 4IMRA 4QL3A 4G0OA 1A8SA 1SBCA 3B1YA 2JFPA 1RWQA 1EM8A 3ITKA 3L8CA 1UH5A 3EG5A 3NIFB 1M2KA 1C7ZA 2AFHB 2EGUA 2XCUA 4OF4A 1FFSA 5ER9A 2GERA 3B60A 4RA9B 1SVNA 2JCSA 2PY6A 1JKFA 1I6KA 2NW6A 2VHEA 1XR3A 4ITRC 4RMNA 3GGOA 3UHAA 5BVHA 2VDLB 1LZKA 2PX8A 3S1AB 1UJMA 4GM1A 3WTCA 3K0HA 1AKTA 3OZSA 3CRRA 1DWOA 4RFVA 3WK4A 3WB9A 2QGZA 1TGVA 2Z83A 2J41A 2FFRA 2DQSA 3NJ8A 4AZVA 3RBXA 1YBMA 1PDWA 1XJCA 4GC5A 3CV3A 5DNEA 1ZQ9A 1P74A 4MQUA 4LI3X 4DPKA 1CZRA 4X1KA 3KQMA 5LMCA 4W99A 4EX6A 2PFSA 4FTWA 2IOYA 1XPJA 4TKUB 3AINA 1WXHA 2VHJA 3KV3O 4PX9A 5FKJA 2AFHE 2PG3A 1ULHA 3LLMA 2HHJA 3B85A 4KE9A 16PKA 3X1KA 2R25B 3WR5A 4A9AA 2ZBQA 5I5EA 2AXEA 2CK3A 5JTTA 1DJMA 3C1UA 1Z0JA 1Q91A 3HKDA 2QYTA 3IJPA 4OUDB 3VPDA 4HDQB 2ST1A 1GAXA 3JQGB 3PO3B 1R8JA 3ORHA 4Z1OA 1SXGA 2QZJA 1UBMS 2Z98A 1GLVA 2WM9B 3KOWA 3QFTA 3I61A 3A05A 5ALMA 1JEAA 4M0EA 3OPYI 2PRIA 3ZS8A 3ZJTA 1OGJA 4HLUA 4U5XA 1WVGA 421PA 4LGCA 1GL3A 2GZRA 1WCYA 3L6UA 2L17A 3UKOA 4Z1MD 4Q4JB 4BAZA 5KWSA 2C84A 4L4SA 2C00A 3OLWA 2PVPA 1NBWB 3PDIA 3IHLA 3MIIA 4N41A 4X71A 5KNCH 4DWVA 2D06A 3GJ7A 3ED1A 4FINA 2IY7A 1E32A 3ZU4A 4Q7JB 1K5GA 4KDEA 3RB8A 3SU8A 1L4GA 1R64A 5CT6A 1T6BY 2OKCA 3EWAA 4RZ2A 2IZ5A 4DCGA 1ZKDA 2ODEA 3W34A 5C44B 4B9EA 3N2GA 3L0CA 1ZJZA 3C6BA 1RZ3A 2QSYA 1JIQA 3DC7A 1DEHA 3P9ZA 2NPOA 2XOEA 4GIBA 4HPWA 4KX5A 3LCRA 3DBOB 4ILKA 3VTZA 1HKUA 3KKQA 4YDQA 1ZMXA 1EHIA 1XL1A 4F1WA 2Y67A 1FZTA 3WLRA 3L6CA 5CJ2A 4DNOA 4MIEA 4QPJC 1DQPA 1H8HA 4LS3A 4CMIB 3RSOA 4RK5A 3KT6A 4EYEA 4IZIA 2QM3A 1G21E 3DMRA 3TL6A 4NXMB 3WRYA 1M72A 4C4YA 4JOBA 5CR9A 1SJ9A 4J1NA 4PYIA 4LW8A 1RZRA 1Q0UA 2QAGC 1WPQA 4JIGA 3ZNNA 5IK2D 1HLGA 1PS0A 2HHCA 3C6YA 3TLJA 4BWFB 1YKSA 4QYXA 4QBGB 4JXXA 2OVFA 3MGGA 4AUMA 4MUKA 4CDMA 1LV8A 2V7VA 1C0LA 2KLHA 3HHEA 3K9NA 4IV0A 4M1ZA 4F3RA 4IGAA 4I5EA 4MW7A 1WDLA 1SUFA 4K9RA 4PLFA 1N3LA 4RVFA 5JSZB 2MYUA 1UXKA 1E6WA 4Y6PA 3ICPA 2R66A 2FLWA 5LXTF 3WGZA 1WCV1 3OEHA 5ERGB 5E0OA 2QAGA 1R4NA 1Z5ZA 1VP3A 1JEEA 1K4YA 2CL5A 2COUA 4KZKA 1MUUA 3L02A 4RKEA 5DNDA 1P7ZA 1Z0ZA 2WABA 1P9WA 1RPJA 4PY2A 3WIUA 3E81A 3VVCA 3EZ2A 4YRSA 3RQIA 3E9QA 2XGSA 2LV8A 2R2AA 2IOFA 2P3QA 3DFZA 4UULA 4EITA 2B8TA 3D4PA 3D8HA 3GJ6A 4ZZ0A 4HO1X 1ITZA 2WD8A 2P4HX 1AHPA 1VMAA 3JZMA 2W2QA 1P72A 1M6EX 1O0SA 1U9JA 4EG3A 2BSAA 5BW6B 1JDZA 1RIFA 5EFZA 2CWWA 1RSZA 1V16B 2IYLD 1SMKA 3D6NB 3SAJA 3WGUA 3CFYA 4ZV4A 5KYKA 3ZW8A 2NTYC 2FI1A 4J1TA 3MELA 3GFFA 3N3BC 4K9MA 4N7BA 3DOHA 5FTJA 4ND2A 3UAWA 1TLLA 1AQNA 4IDNA 1T35A 4ZQGA 1KK0A 5EJAA 3D7LA 5AD1A 3GUCA 2QD5A 5PGMA 4PZEA 1XZ8A 3PXAA 1SZJG 5ILOA 2REQA 1ZIXA 4YJGB 2XXAB 3ZH2A 3WAGA 4P3YA 4PGMA 2HJVA 4YJFA 1GXSA 3RSHA 4HAZA 3TH5A 3Q2KA 4F46A 1DEKA 3T7RA 2QP3A 3VR3D 2QRGA 4RO0A 5F2KA 4FNGA 1LQ2A 2CW5A 1T2VA 5T4EA 4MWSA 4CG0A 3KSUA 3L7YA 4KPUA 4QYTA 1VG1A 1YB4A 1MJ5A 3CR7A 4RELA 4CN8A 1K97A 3PXEA 4JLJA 2CXPA 1KMNA 5THKA 4PLPA 3ZGXA 2X4DA 3D81A 3A26A 1MG5A 2Q1XA 5K2OA 1ZUNA 2C4WA 5AVUA 2HLPA 1L2TA 1ZM3A 2E6KA 2O0HA 3C6QA 3KJGA 2JW5A 1P0MA 4U7JA 4O1IA 4J7CA 2ZJFA 2YWJA 3EY4A 3AG6A 3JQ9A 2ZBGA 3R3VA 5CK4A 5EWLA 3VR2D 4DJTA 5MHTA 1UIRA 1JIKA 5ALOA 1KP2A 2CL7X 1G8KA 3RFUA 3IT0A 4HGOA 4ARUA 5LLTA 1RMQA 5DM70 1LC3A 2VJOA 3H84A 5B4TA 4RS4A 3K1AA 4MYSA 4N6NA 3PB3A 5D51S 2IZOA 2EWWA 2K2QB 3IAEA 3VDXA 5K3OA 3IO5A 2LRHA 5LLSA 1A77A 2BW0A 4HLQB 2VNJA 2JGDA 4P86A 4A93B 3TR0A 4HZIA 3X2FA 1QP7A 2X5JO 3VU9B 4ENUA 1P1RA 1KEEB 1U0TA 2ID7A 1PR6A 3OP4A 3AQIA 2VDOB 3U56A 4ZHSA 1XZMA 2IIPA 3IP9A 2HAEA 2X7HA 3JQPA 4NBWA 1H0KA 2RAPA 4L22A 1AKQA 4EMSA 4ER0A 3KEGA 2Y1LA 4B3JA 3LCCA 1XZBA 1QYWA 1T26A 3BREA 4LHSA 4M1EA 4YAEA 2HA7A 3SZ3A 4D8VA 2ZI6A 4H7FA 2DTXA 2NZYA 3AI1A 3PFFA 4LCEA 5AK6A 3M6WA 5G4KA 4BAGA 3UBMA 4DS3A 2BEWB 2HNAA 1A04A 1ELOA 3F1LA 4PRLA 4WMLA 2SNIE 3MUEA 4UE2A 2DLNA 4C4TA 1Z75A 1UJ6A 1G55A 1IY0A 3CSDA 3BAZA 4EY6A 3V4RA 4LC9A 4QLBA 2BYTA 4RSGA 3H4MA 1XA0A 4HAYA 1FXWF 4EB0A 4PYNA 2QPAA 1MMFB 2AC7A 2H2AA 2ZSUA 3IKJA 3LPNA 2OAGA 4FCTA 3THOA 2P9ZA 3ZIUA 4PN3A 2QJTA 2OSVA 2WUGA 5TDHA 3UM9A 1KJJA 4QUHA 2B5OA 2GRAA 4LK3A 4R2KA 3BXZA 2ZREA 1O5TA 2WLTA 1KR5A 3Q3IA 4F3CA 5CB4A 1PK7A 1X1QA 1JAIA 3HNRA 4QPNA 1UJCA 4GUDA 3N0WA 4RY9A 1L8OA 3E82A 2ECOA 1W5TA 1Q7RA 2X9LA 3AR6A 4ODIA 8ATCA 2FAXA 1Z18A 5FYQA 4AJPA 3L0PA 3FMPB 5LC1A 1FMTA 1Q6ZA 2J9ZB 4P5PA 2WB4A 4FGKA 5EJGA 5ESXA 5G1NA 5EHZA 1DJNA 2GK4A 2VHXA 5G0VA 3CNLA 4RD3A 2D3TA 2JGIA 5G3YA 4QGBA 2J07A 2VP9A 2ADOA 2WWWA 3Q8KA 3OQHA 1OXTA 4TV8F 1CTQA 3WLTA 2O48X 1E2QA 3CH6A 2XCQA 3JQAD 3CZCA 3KUDA 4I1OA 4LZPA 3H04A 5CITA 5HR5A 2ZDHA 3KUUA 3WWCA 4G9GA 1EIWA 4MWGA 1OBVA 4TN1A 2KMLA 2K4MA 1YULA 5CVJA 1DXHA 2XCSB 2M2IA 2B92A 4XCXA 1M5RA 3A4VA 5JZSA 1I4LD 2PUWA 3K0EA 5JWHA 1ZEMA 3AEQB 1T3TA 1FBTA 1VCOA 1M34E 1SD5A 1GPJA 2B4TO 2NZXA 4RHXA 4V0LA 5LYYA 2FXVA 1WZCA 4REMA 3BMNB 4M1TA 4ZC8A 5IM4F 3KQLA 3EW7A 1TO2E 1HT2E 5DPMA 3O0DA 2P5SA 3KHTA 2G76A 1MQAA 2EG5A 2FFBA 4IWYA 4ND8B 2ADMA 1V2GA 4YMUA 2PXCA 5A4FS 1R66A 5HUQA 5LZ2A 3SBXA 1ZKMA 4YCMA 1XTZA 2GUWA 2V74B 3KB6A 2H1SA 4MKFA 4ZT3A 5G2OA 3RTEA 3C5VA 3FMVA 5A3RA 1PAUA 5J2UB 4B43A 4C0AC 3IKVA 5JIBA 3FZGA 1EI9A 1VSQA 3DQZA 1QIKA 3JASA 1QQAA 2XZTA 3R0VA 2EW2A 3PGMA 4RIFA 4NZYA 3VZRA 2A1IA 1L3CA 1A76A 3OCWA 4X64B 2C2MA 1LQUA 4UNQA 2PN1A 1EGVB 1KY3A 1H1TA 1H8ED 1MV5A 4FI3F 1N2GA 4X60A 4EG8A 1GITA 5K3EA 3OOJA 2EZ8A 4A1OA 2RB4A 2QLMA 4Z0PA 4ZD6A 8LDHA 4PG8A 2CY0A 1GNPA 1OV4A 3GGDA 3AF2A 4ERXA 3QSGA 3FYUB 3QBEA 1BSVA 4D4HA 3EGDA 3QXGA 3H42B 2FEAA 2QP9X 1MN6A 2GEJA 4YP1A 4TWJA 4EHBA 3RE1A 2V7WA 1YA6A 3T7IA 5CT9A 4Q03A 5ABPA 1ZM4A 2HK6A 2NUAA 3UFBA 1G20A 3VAZA 4C7VA 4MO2A 1JJIA 1Q19A 1Z6PA 3E8XA 4N1AA 4QRIA 1HG0A 5HJ2A 3ZEIA 4BMVA 4ALNA 2YBEA 3PUJA 1X9HA 3QOFA 3AIOA 1ZLYA 1KO4A 4PZZA 1P1CA 2HO4A 3OFNA 3PG5A 1N2XA 2UUAB 1GR0A 2PX3A 1NBEA 2QPOA 3PYLA 3GW8A 5EEHA 4OATA 4ZO7A 1LA2A 1PR9A 4MQEA 5HIKA 2G88A 2Z1DA 2OILA 1AK2A 2CZCA 3UPDA 4BNDB 1Z5OA 1TCAA 2QRNA 1K7FB 3QBJA 4WZBB 1VE7A 1W59A 1IB0A 1RXEA 2C58A 2HDNB 2ZJOA 1VJCA 4B0PA 2BGJA 2QT0A 4JZKA 3R7LA 3UWPA 1HTBA 1ODKA 1P2GA 5GV7A 3TG8A 1FOEB 2E4YA 3K1JA 4B7CA 1XTIA 3NH6A 4N6OA 3EFEA 2IYXA 1V9CA 2C99A 2Q1WA 5JISA 3QXHA 5GP1A 2X6RA 4CL3A 2H1VA 1BU5A 2FUG1 3D4LA 1ESZA 3OICA 4FEGA 4X1KB 1BQ3A 5JQWA 3RTBA 1FJXA 3VM6A 1UODA 5HX7A 3PNKA 5D00A 5C4GB 4IQ0A 2ORED 1EJBA 5MGNA 3DW1X 2O19A 1OCEA 4QGFA 2D1RA 3WL4A 1BG6A 2PX0A 4RW0A 4GZLA 1WUIS 2CLSA 4KQ1A 3B6IA 4LSGA 3ND9A 1EIZA 1PNQA 1J00A 1RBZA 3IP1A 3KL2A 3IQWA 3DZHA 3NI2A 4JBYA 4I81A 4MVCA 2ZYWX 4WXHA 1E3DA 1PE0A 1J2YA 1IEQA 1TIKA 1YGPA 2QSZA 1IHOA 2R00C 3FUTA 4HNGA 4B44A 5JR3A 1YE3A 1BE6A 1ZXXA 4PGFA 5COAA 2W8BA 4S2EA 2VP5A 3M70A 3KWMA 2Q1TA 2GB4A 4CF4A 3DE5X 4KQFA 2G1AA 3WWEA 2H07A 4NTZA 4TMZA 1USWA 2AD5A 3IR5A 3FETA 1XRNA 1PR5A 2UYQA 5LOVF 4IQGA 4PO9A 2PAAA 5HUHA 3COZA 1N0VC 1CYEA 4C87A 4XE5A 4WH0A 4DEXA 1SR8A 5FUXA 4QOFA 4JMPA 3UGQA 5IMSA 2J87A 1CUFA 4IICA 2DSNA 2J67A 3CG0A 5IYZB 2QTLA 1J1UA 4QXQA 2OBBA 4O6VA 3T5DA 4WY2A 5A06A 4BGEA 3FFBA 2SHKA 5IJ0A 5AO9A 3OCCA 4OQNA 5HJ7A 3O8OA 3Q9UA 1XZAA 1OVGA 3Q5GA 4IV5A 1XZIA 2HIHA 1DCMA 2QROA 3BMQA 3LQFA 1FE8A 4ARAA 3OZFA 1ID8A 1CIVA 2FN4A 4EIWA 2PX6A 1Z36A 2YVQA 1RQGA 4ZO9A 3A0UA 2RIPA 3OQBA 3A4TA 3EEIA 3OI7A 4FEEA 2XVYA 4BE7B 4W1QA 1EUZA 2V5AA 3NNDA 3GT4A 4OBBA 1OOEA 1PQ4A 3D7MA 1G8AA 4F2PA 2ZSIA 1QGUA 3VPFA 3V7FA 2V8BA 3WE7A 3H5VA 5DBHX 4ZYUA 1ZITA 1ARZA 4A0RA 1PTJC 2PEYA 3TKAA 4C0SA 4DV7B 4OHUA 5TARA 3HTXA 1EX6A 3CN9A 4QJIA 3BERA 3LF2A 2OXCA 4RYLA 5HDBB 1EB8A 5DW3A 2QBYA 5C37A 1NL3A 5JJBA 5DEIA 1GG9A 3DE1X 1U1EA 2AL7A 1Y4ZA 3OMXA 2R6AA 5JU6A 3IP3A 1Q1AA 2AR7A 4K87A 4D9NA 1IFXA 4Y98A 1ZVJA 1T2DA 2YV3A 4KYIB 2VXOA 1PD1A 4ZVUA 2IYSA 3EPPA 4BRZA 1BOFA 1UPUA 1WULS 3GLGE 2XD4A 2AKEA 3A1EA 5FHQA 2O8DB 3DEKA 4UBOA 1MEOA 5L51A 4HD8A 3WB2A 4FI3C 1ZVQA 1QQTA 1ZZGA 4OQ4A 1SUBA 5CT5A 5FR2A 3SHTA 5KMGA 2ZI5A 4FD2A 4HDKA 1N1GA 2GEKA 1N2CE 3OG9A 3V2HA 3ZWVA 3FYHA 3GJYA 3SMQA 4JI6B 5D1HA 1D2HA 2AH5A 3HZHA 4J0JA 1CRLA 2Z95A 3PX3A 2ZVJA 3GARA 5BSHA 3UTDA 3GLVA 3GGCA 4INJA 2FWMX 3K05A 1SUEA 4GP7A 3K4QA 4QA9A 2H5IA 3T7SA 2GZMA 2WJVA 3FUVA 4YCCA 1G2OA 1BKYA 2I2DA 5A1TA 4XXHA 4I1SA 3JQ7A 1PSDA 2ZTMA 2I29A 4D92A 2IUTA 4U9HS 4IX1A 2FWBA 3W5JA 1HDOA 4IVRA 4FGSA 2XCOA 4RK4A 1DRWA 5HTOA 3TEFA 4C4OA 2BGRA 4NBUA 1UMKA 1TTHA 5C4IA 3EZXA 1VG0B 3K8YA 3ZIDA 4ZEMA 3TZEA 5HRAA 3G5UA 4G0NA 1SAYA 3CUTA 4I5DA 5K8LA 2Z6QA 2QJFA 3ETJA 2JHCA 4BTVA 5CD1A 4MCHA 2FSVC 3I9NA 5FTNA 3W2HA 1BW9B 4KLRA 1Z07A 3D3WB 5AW4A 2LVBA 5E4FA 2OXEA 2C3YA 4UAVA 5C3MA 5JS6A 1X0XA 3DJYA 1BWSA 3MS2A 4IMPA 1Q0PA 2R751 2YHUA 4BO2A 4MWCA 4CV1A 5KYUB 2TMYA 3KFVA 7MHTA 2VAMA 4KQHA 2BZGA 4B09A 4CL0A 2FGJA 1L8QA 1JTEA 1LW6E 1A8HA 4MQFB 3LDFA 4R8SA 2FRDC 1MO5A 2C88A 2K5UA 4UBIA 5LP6B 1OREA 2IW1A 2IUSA 3C24A 3OAAD 4BB0A 1YVPA 5KC9A 2FW7A 2CVHA 1EAYA 1MVLA 2Q4RA 3DD1A 1XRLA 4NU5A 4RA6B 5LZ5A 3WIVA 4QXOA 5KOHA 5KHAA 2ORIA 3T5BA 3RVJA 2O2EA 5DM0A 1YAJA 4KK4A 3BG5A 1DCFA 1G291 4EFMA 4P3NA 4HWPA 4AJ4A 4HRAA 4EEXA 3ZDCA 1E9DA 3H5RA 4L4ZA 4Q34A 1E58A 1LVGA 5IABA 5B58C 3SCZA 3GPIA 5DEOA 3F2IA 1DXQA 1EFPB 1J0XO 2Y1FA 2C4UA 1PG0A 2OO7A 4FC7A 2R6CA 2Z1NA 2P2YA 3W9YA 4QPCA 5JI2E 1I2AA 1DC3A 2YJ4A 3V4PB 4BBSB 2JBAA 1NJ5A 1SVIA 1V3VA 2OXIA 5DCLA 2JJ2D 5GJWC 1RYFA 5KIAA 1UBCA 1V4BA 2UVPB 3HVIA 1ZHOA 2GD2A 4MQLA 3FI0A 3S2ZA 5EIAA 4AKGA 2G40A 1OI7A 4M54A 3UOAB 2FR1A 4NRDA 3BRCA 4Q3DA 3IE1A 1EEXB 2Q8NA 4ZYWA 3BRWD 4MUYA 4RGYA 4TGLA 1ZDMA 3AU9A 1ZM9A 1CV2A 4KCGA 4XKJA 1RE1A 2FZLA 4ZQBA 5HP4A 4BPBA 1DL5A 3LOQA 3BTUA 4G4IA 3IKMB 4QDJA 4HNVA 1UFVA 3BCSA 2IE0A 3I4LA 2BBSA 2CVPA 4QRDA 3IOCA 1M8KA 2P9FA 4K5QA 4J07A 3T5AA 2CLOB 2WJAA 1P1IA 1YCFA 4DAOA 2DE0X 1DAMA 3OA2A 3MT9A 3ZDQA 3DOIA 3HADA 3J7TA 5CA0A 2B7LA 1QBKC 3FA2A 1N2SA 1GPH1 2K87A 3DONA 2PIAA 2X2OA 2C1ZA 2AIRA 4QU0A 3FWNA 2OQ2A 3OQJA 4JUCA 4N0MA 5K09A 4PNEA 3ESCA 4MQBA 2X8AA 1E1QD 4PXYA 1ADCA 3LUAA 5JJ5A 1G16A 1HL3A 1QB7A 3TJZA 2B37A 4AKIA 5CNJA 3G2OA 3DT6A 4LZNA 2CJWA 1XQWA 3CNNA 2ZIWB 1WB9A 5JSZA 3C7AA 4HG2A 5KNCD 3WL5A 4PO8A 3IUNA 3S2UA 4XD2A 2C7BA 2GEDA 2Y9MB 4MJ3A 5HBRA 2WNSA 2I6GA 3RH0A 4HH3C 5KHOC 1PFWA 4B3HA 4A6DA 1RIIA 3LBYA 3Q1KA 2H7VA 3DM9B 1GZ5A 1A95A 3SR4A 1VL8A 2VZ0A 1W0KD 5JEDA 5TV2A 1ND5A 1T1GA 2O6HA 3GFOA 1HZZA 5M3FB 3MBIA 2IX3A 3LSTA 4Q0MA 5EJ7A 1SCDA 1ZSNA 4BP3A 5CG1A 4OMDA 3OEWA 2NO5A 3EXG1 1L1FA 1CT9A 1UAAA 3IJEB 3QKTA 3ABZA 4HTAA 4ZTUB 5JJIA 2AC4A 4I1IA 4Q39A 1N5IA 3BH0A 3HDJA 4RA9A 4MO9A 1QMPA 1TWCB 1FVXA 2X22A 4MQ4A 3WXBA 3ICQB 4BNVA 3DE6X 3H19A 3W5BA 4RTPA 1TK9A 4TOIA 4AIIA 1E2JA 4CKYA 2CDNA 3FOCA 3OESA 4Q21A 3WGYA 2C9BA 2L18A 1I3KA 1HDGO 3NW9A 4A8TA 3CNHA 1O87A 3ECCA 4MV5A 3UC5A 4A4DA 2ZU0C 5HM8A 5GGXA 3LDAA 5AJZA 3FPHA 2PAFA 2XNDD 2YUTA 4CMCA 4OBXA 2V3VA 3F7NA 5F7XA 4RV4A 1U4OA 4C1NA 3JY6A 4JXZA 5T41A 4YAGA 4DV2B 2H92A 1X86B 1KGSA 2HU5A 4FN4A 2JKVA 4DT1A 3BSYA 1EBUA 1MIOA 1TKAA 4C22A 1PJTA 1QWOA 3WSTA 4EGAA 4L50A 1FVFA 3GZNB 5ALRA 5JC1A 1SKUA 4B4KA 4NE2A 4XEUA 1SBQA 3UAZA 1I2MA 1R4MB 3QVUA 3HJBA 2PWZA 1AKNA 1LX6A 1NLZA 1RBYA 1VL5A 2VPTA 3HM2A 4IOMA 3D0KA 4LK2A 4QC2A 3IUYA 4JN6B 1DUIA 5K0GA 3CPJB 3TNJA 1QKJA 2A9VA 1B0PA 5EOVA 5FI1B 1SOAA 5K7SA 2JFOA 1WXQA 2QLBA 3RC9A 1VZ2A 2LDXA 3IALA 4MUHA 3D0RA 1DFIA 5EJIA 4EHAA 1TJ5A 3RBVA 4MR8A 1UUFA 2IH4A 5CEFA 1NATA 5JXWA 1SCBA 4IRUB 4Q4JA 2LCQA 1JU3A 4YRDA 3MMNA 3NVKI 3FWKA 1QZ3A 2BGUA 3R75A 3TNFA 3EQ8A 4B79A 1SBYA 4MH0R 1N34B 2LBPA 3A2MA 5FIUA 1BTOA 3QUAA 3FTDA 2UAGA 3V9AA 4EI7A 3KTDA 1XXHE 6PFKA 2J4DA 3DG9A 3IEXA 3OQ1A 3AVPA 3CTPA 3JQCA 1PQYA 1E1LA 1NVGA 4E5UA 1MAWA 2CVQA 1USUA 3FCXA 2INGX 5BWCA 5I7HA 4WZBA 3A1TA 1QC5B 2FE1A 5EUCA 2XQFA 3WLKX 1IN1A 1NJGA 1I0IA 1TJ4A 4PLVA 5I7EA 1T2NA 2P3SA 1GO2A 3RVPA 1M2VB 3MILA 1UFKA 5D5HA 5JCJD 2OHIA 3AX6A 2OLEA 4PFKA 3AHFA 2D1QA 4I4IA 4MHTA 2IZ6A 2C83A 4PIMA 4DRZA 1TQHA 4HVLA 4L0CA 3FPCA 2JBHA 4PZPA 2Y1OA 4XZ3A 5KPDA 3RSSA 3VV2A 3KZVA 1PD0A 1XXHB 1NF3A 3AMVA 3UUGA 3QX3A 1XMSA 3HJGA 1WKCA 2H85A 4M8LA 3M4JA 2UZ1B 3IVGA 2D4AA 1ZX1A 1GZSA 2FP4A 3QMPA 1JDSA 1C4KA 1PZHA 1SULA 1TGYA 2NG1A 3L6DA 3LF1A 2PXXA 3W3AA 5BYJA 4Z8YA 3RFFA 1ZJ6A 1LTQA 5DYIA 5FAKA 1SKYB 2ZYHA 1B2RA 3ROTA 1R88A 3CLUD 6GPBA 1PG5A 1M2JA 1A7UA 1ZEJA 4EI9A 4EO7A 3M6UA 4BX9A 1Y3IA 1ZH0A 4NPCA 3NDPA 4LZJA 4O4HF 3TRJA 4RSMA 3OZRA 2QDKA 3K53A 2CXUA 1FX0A 3PHBE 3C3JA 3DCYA 4ID9A 4OL0A 1FU7A 2G67A 3AR7A 5JNWA 3GC6A 4JYMA 3RF6A 4UM9D 1KDTA 1HURA 3LY8A 2OP0A 2OCIA 3HCOA 1FB5A 3HPRA 1OLSB 2BMWA 4NJOA 4OOEA 5AOVA 4D6XA 2PMFA 4OQEA 3LKDA 3PXUA 1JDNA 2A0YA 1LLDA 5ALDA 5JVDB 4JOCA 3T7TA 4UCXA 3ZHOA 3NBFA 2Y99A 3HU3A 4QOHA 5LJIA 3KKMA 3I34X 3PJFA 4Z4CA 4JB8A 4HADA 4MI1A 4Y6RA 3Q8MA 4WVFA 1H93A 1D0IA 1M2VA 5K1ZA 3W06A 2H2WA 2AI3A 5B6JA 1TJPB 1BAPA 4B3MB 5CH3A 3N05A 3UQYS 1P1FA 3BDVA 2H48A 2XGMA 1VYHA 5SYMA 3JWHA 1F8XA 1JLLA 1GN9A 2W11A 3COSA 4IEEA 3ROEA 2YV1A 1N8SA 3LC7O 5IF9A 1DX4A 4H3KB 2PUHA 1TTTA 2AW3A 4BUJA 3CPSA 3FGZA 5IJ9B 1ESMA 1T25A 2FPUA 4IHQA 3IEIA 1T6XA 3DWEX 2BISA 1ZOLA 3FHOA 3IDSA 3R3SA 1WD5A 3ADOA 2FKNA 3L49A 3O8QA 4E2FA 4ZK2A 5HZHA 3EX7C 2W2MA 5E1MA 1Y63A 2XMZA 4NJMA 4E5SA 1CUXA 1YA4A 5GY7A 4P2GA 4EFKA 4NYMQ 3RIXA 4C4PA 4N48A 1M1UA 1VMIA 1YRHA 3ORSA 4S1TA 5BQ3A 1Z4KA 4QJ3A 1C1XA 1AUXA 2DBZA 2REQB 1GTSA 2VJLA 3KTAB 4Q82A 4CBVA 3REGA 3ZDEA 1KMQA 5I5GA 3TBKA 1QUEA 3CA8A 1JHRA 3VNUA 1VJ0A 1E98A 4TXHA 2CJPA 3LSYA 3TLZA 2G4VA 3BFPA 3U3KA 4EHKA 3DZBA 3MK31 4PQEA 2VQDA 4RFLA 2VT7A 1FUYB 5JRDS 4W1PA 3GTOB 1Z9BA 1J1ZA 1Q20A 2BEVB 4P7BA 3VR0A 4MMYB 2PRJA 2D5CA 5D01A 1Y1WB 1WQ4A 4D0GA 3AONB 4CM8B 4NBLA 2VUMB 3WK9A 1U7HA 3EGOA 3GZJA 5KSOA