1S2OA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 at 1.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sucrose-phosphatase
publication title The structure of a cyanobacterial sucrose-phosphatase reveals the sugar tongs that release free sucrose in the cell.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
total genus 93
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2004-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1s2oA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1s2oA02
2BDUA 4HGNA 3ZX4A 1ZJJA 5ALPA 1L7MA 2ZG6A 1WZCA 3P96A 4CNQA 2OM6A 1Z5GA 3RF6A 2YMPA 3M1YA 4Y2QA 5ALXA 5AVXA 3IJ5A 3DDHA 4AP9A 3KC2A 1VJ5A 4CE6A 2FPUA 2PR7A 5ALDA 2G0AA 3QGMA 5AW6A 3U7EB 1RKVA 2G08A 4UMFA 3CNHA 1FEZA 3A1CA 4XQ0A 4C4SA 4FFDA 1RMQA 1ZRMA 4Y2VA 4E88A 1N8NA 2B30A 3L8EA 3EF1A 4ZEWA 3QNMA 4H1WA 2I33A 5AKJA 5ALLA 4ZEVA 1RKUA 3FVVA 5AI6A 2AH5A 2O9JA 2HX1A 5FP0A 4XOUA 2NO4A 4L57A 3U13A 5ALTA 5AVTA 2HOQA 4UM7A 1J97A 1NNLA 1PW5A 5AI8A 2HO4A 1T5SA 3DV9A 4BYGA 2WF9A 1U2TA 5A3QA 3U7GA 1L7NA 4UAUA 3NUQA 3IB6A 3KBBA 1TJ3A 1AQ6A 2MU1A 3EWIA 1Z4QA 3L1VA 3QX7A 5AI9A 4GIBA 5ALEA 5AW1A 4UW9A 3FM9A 5AVSA 2W11A 1ZOLA 1EK1A 2B1RA 1ZD4A 4GXTA 3RFUA 5AW2A 1Z5UA 3NALA 2NO5A 4NABA 1YDFA 4CF5A 4FE3A 3QLEA 3WKCA 4HGOA 3AR8A 4NFLA 3NASA 4CF3A 5JJBA 5ALYA 2WF5A 3AR3A 3UMGA 5ALQA 5AKGA 2RARA 4HGRA 5AESA 2CFRA 3S6JA 2AMYA 3QXGA 5AHXA 1L6RA 5AI4A 3ZUPA 1SWVA 3CZ4A 2YJ4A 1Z4IA 3FPBA 5AK3A 2R8EA 4UMDA 3WK6A 5IT4A 4UARA 2QLTA 5AVQA 3I76A 4UMEA 4UATA 4AS2A 4B6JA 4BKMA 4FYPA 3U26A 1Q91A 3WKEA 2IOHA 5AKLA 1VFPA 3EF0A 1XP5A 2O2XA 3NAMA 3SKYA 2DQSA 1L8OA 5ALVA 1U7OA 3FPSA 3I1YA 1T5TA 2I6XA 3BWVA 4HGPA 2D2VA 2G80A 5ALRA 1TJ5A 4UM5A 4KNVA 1X42A 2JAUA 2ZBGA 2I7DA 2P9JA 4L6AA 5ALFA 2C88A 1SU4A 5AW3A 3AR5A 4YIKA 3E81A 1Z4LA 5AVRA 5ALJA 5AW7A 2YMMA 4PNHA 4HYTA 3ZX5A 3I6BA 4I9FA 3KOOA 3WKBA 1TJ4A 1L8LA 5AW5A 3L8FA 2IOFA 4MUMA 5A3RA 1YNSA 2YJ6A 2FDRA 3WKDA 3PGLA 4BBJA 1Q92A 1XPJA 2WF6A 3ED5A 3L7YA 3N07A 1RKQA 1WPGA 4UASA 1QQ7A 4IG4A 4ZEXA 2I54A 1RLMA 1ZD5A 3N8GA 3UMCA 4AS3A 3ONNA 3L8GA 3N28A 4Y3UA 3GYGA 4J2TA 3SLRA 2WF8A 3N1UA 4BEWA 4BNDB 2G1AA 5AVZA 3U7FB 5AM1A 4EX7A 4YCMA 3E58A 2FUEA 1ZD3A 1J8DA 2ZBEA 4I9GA 5AKYA 3ESRA 3OCZA 3DAOA 3AR6A 3WK9A 3L0BA 1NRWA 2X4DA 1RC8A 5A3SA 1RRCA 3KDPA 3KZXA 3QU4A 2Q5EA 2OYCA 3A1EA 5AI0A 3W5BA 5AICA 2GMWA 1U02A 4KNWA 3ZTWA 1RDFA 2ZBFA 2GHQA 1YS9A 2JARA 3KD3A 3OCXA 3UM9A 1N9KA 3HLTA 2HF2A 2AUTA 5AVVA 3EPRA 3ZI4A 5AW0A 5E0OA 3ZU6A 2W43A 4BEVA 4EELA 3W5CA 4RESA 4C4TA 4Y2UA 3NANA 2BDEA 3ET5A 1RMYA 5AM0A 1NF2A 1YV9A 2YJ5A 3L8HA 2GO7A 1YMQA 3W5DA 3WK5A 3U19A 3MPOA 3SHQA 5AKXA 3L5KA 5AKEA 2IA5A 4OCZA 4KN8A 1RLOA 4DWOA 2WHEA 5ALOA 2FI1A 4BX2A 4YCLA 2OA0A 5ALIA 1U7PA 2JGAA 2HHLA 5ALSA 2R8ZA 3QYPA 3B9BA 3NIWA 5AKZA 2I34A 2YMQA 3SKXA 5AM3A 4G63A 2FPWA 2FEAA 2FPRA 5ALUA 2HF7A 1F5SA 2OBBA 5AI5A 2IOFK 2PKEA 1LTQA 1RMTA 2JAOA 2YMLA 2G09A 2JAWA 2B1QA 2HCFA 2PQ0A 1IWOA 3SD7A 4Y2TA 2B8EA 2EATA 2W4MA 4UU0A 2Q4TA 4XPZA 1Z4OA 2YBDA 4QJBA 3VAYA 3OCWA 2CFTA 5ALHA 1S2OA 2CFSA 4F71A 3FGOA 3ZWKA 5AIBA 2YY6A 1YJ5A 3QUTA 3E8MA 3E84A 3L1UA 4JDPA 5ALMA 4RETA 2WF7A 3ZTYA 2HEGA 4YH1A 2YJ3A 4YIHA 3J7TA 2MSNA 5AIAA 5AKIA 4KYTA 1Z4JA 1RPZA 3OCYA 2I55A 4OHFA 4JB3A 2BY4A 3U7HB 1XVIA 3SMVA 4NAVA 2G07A 2ZXEA 1RQNA 3WK8A 2GFHA 3ESQA 3DNPA 3M9LA 1RLTA 3OTQA 3K1ZA 2B0CA 1TE2A 5ALNA 3D6JA 3A1DA 4OD0A 4Y2JA 1ZRNA 1EK2A 1QQ6A 4QQFA 4NV0A 4C4RA 3QU5A 1ZS9A 4Y2SA 4J03A 3ZWDA 2ZOSA 3QU7A 4KX5A 1Z4NA 3WGUA 1CQZA 4EZEA 4G9BA 2B82A 2P27A 3OPXA 2NYVA 5AKKA 1QH9A 4HAIA 4UU1A 2FPSA 3W5AA 2VKQA 3NRJA 1QQ5A 3PDWA 3R9KA 1S8OA 5AW9A 2CN1A 3AR4A 3R4CA 3MN1A 4CF4A 5T41A 1Z88A 4UMVA 4UAVA 4BX3A 2C8LA 3A3YA 3QUBA 1Z4MA 3QUCA 2IYEA 4EENA 3HYCA 3OCVA 3TLMA 3OCUA 3B9RA 5AM5A 1WVIA 1ZD2P 1CR6A 5AW4A 2HSZA 4DCCA 2AGVA 4NWIA 1L7OA 5ALGA 4Y2XA 3AR2A 4HGQA 3PGVA 2HDOA 4EX6A 1Y8AA 3MC1A 2R8YA 3F9RA 4Y2RA 1LVHA 2WFAA 3L0YA 2G06A 3ZW7A 3BA6A 3ZVMA 3QUQA 3PCTA 3AR7A 2RBKA 4KX3A 4MWOA 1L7PA 4O8CA 5AM4A 2C4NA 3ET4A 3MMZA 1O08A 4Y2YA 3WK4A 5AW8A 1Z4KA 1T9ZA 2QYHA 4OFZA 2B8JA 2C8KA 2EARA 2FUCA 3QU9A 4EEKA 1QYIA 2ODAA 2WM8A 3B8EA 5AK4A 5ALWA 5AVYA 4YCNA 2RB5A 2YN4A 5ALKA 4F72A 4YGYA 2ZBDA 2HI0A 5AK5A 2C9MA 1O03A 1TA0A 3N5KA 2R8XA 2FPXA 3WKAA 3R09A 5AM2A 2P11A 3L0CA 1RQLA 2YFYA 1WR8A 2EAUA 2P69A 3IRUA 3ZVNA 3UMBA 4L6CA 3WGVA 3WK7A 5IT0A 4BNDA 3AR9A 1K1EA 1KYTA 4BX0A 4XE5A 4Y2PA 1Z4PX 3QU2A 4DW8A 3FZQA 5AK6A 5IS2A 1VJRA 3I28A 5ALZA 5AVUA 5AVWA 4IFTA 1JUDA 3SF0A 2RAVA 2GHTA 2Q4RA 1U2SA 1MH9A 1SWWA 5AKHA 3ZVLA 4DFDA
chains in the Genus database with same CATH superfamily
3AJ9A 4QFCA 1DFIA 3WQHA 4DCJA 3EPPA 2XF8A 3I30X 2ZG6A 5DYIA 4JJFA 1WZCA 4AD8A 4EVRA 1IBLB 4Q9IA 3ZG6A 3BB4A 4BBSB 4LW8A 1EWVA 4Y2QA 1DX6A 5DEIA 4EUNA 4IF6A 4JZYA 3T5GA 4MQMA 1U9YA 2JL1A 4I4TF 4IHQA 4UDOA 4ZT6A 4AECA 3HXMA 2HHAA 1PD0A 5B58C 1GRRA 1B4DA 1BDIA 2UV8A 2C77A 2OBYA 2B21A 4UKDA 1Y89A 3V1NA 4F04A 4PSAA 2DFDA 1ZH6A 3NTLA 5CDTA 2BFEB 4RMHA 2PO5A 4KIJA 1JLLB 4AO6A 2JPDA 4C4SA 2EJCA 4KIFA 1GR1A 2KBEA 2HC9A 3TMAA 2B8TA 1UBEA 4QYIB 1JDSA 3E70C 3MWDA 5DWVA 1XALA 2BSAA 4KFUA 1SQ5A 4R2MA 3UAVA 3HGQA 1CRWG 4NS1A 1I2DA 5SY6A 3L8EA 3H86A 4BBZA 3LX8A 1O0SA 4O1MA 1Y4UA 2B0JA 3LY8A 4QPJC 2I2WA 4AY4A 3K70D 4INOA 1MAVA 4LJ6A 1SVOA 1H65A 2WSMA 3HMKA 3EVZA 1A8UA 2AH5A 1SHJA 2OK8A 5DHUA 1GZHB 2C2BA 5KSPA 3T8YA 4CDRA 1RRFA 1LLFA 2O8NA 3VYTB 4L4SA 1BX3A 1TA4A 1HZZC 2E55A 2PH7A 1PFWA 2XQIA 4PW0A 5KNCA 3JD1A 3DCIA 4JXKA 1W96A 3AEYA 1IJEA 4PWYA 3LYHA 2QG4A 3H9BA 2IXAA 1TT5B 1UQRA 3V9PA 2XKAA 4AJ4A 5E1DA 2C82A 2OOSA 3E9MA 5DO9A 2VDWA 4YREA 1SD5A 2NO1A 3QPUA 4OHUA 5GMOA 4DMRA 1Q0PA 1H66A 1UP4A 1RSZA 1VE5A 2H3EA 5EKXA 3GRYA 4HRAA 2YYAA 1YA4A 4ZCLA 2D3WA 3TAXA 5L4LA 4JU8A 4AT1A 3OE1A 3B7PA 5AQEA 2WY2D 3VAAA 3THOA 1TJPB 3PWSA 5LZ2A 2CK3D 3W2FA 4QTYA 2GKSA 1OA1A 2MU1A 1UQTA 4PAWA 4HQKA 2ZRHA 1TC1A 2PAAA 3L6CA 2B7BA 4NE2A 3OKPA 4QHTA 4E2ZA 4CLRA 1J5EB 2CWDA 1WB6A 2H1WA 2J41A 1EMDA 4PLHA 3SEFA 3ZK7A 5BW8A 2PWPA 3VYUB 4O3MA 1NGSA 1ZD8A 2DR3A 5C81A 1NTOA 4HNTA 3NDIA 3RUDA 1XU9A 3KTAA 5KEIA 1M6VA 1MJNA 2DP4E 1KS2A 1LK0A 2FHSA 4XCVA 3L93A 4A1FA 1XTZA 3CF4G 2A5JA 4C9BA 1THMA 4IIJB 2VYND 4II3A 1W46A 4M83A 4C30A 4F46A 3MT7A 1CUWA 1NHWA 2VK8A 4LHEA 4YP9A 3TIVA 3BWCA 3NJ8A 2IP4A 1GKUB 1FYVA 4FS3A 4J0DA 4TV8F 1I6MA 4WOKA 4C0LA 2IHUA 2X77A 2YHUA 1ISGA 5LDDC 4Z0HO 4JB0A 5CXUA 3BERA 3A6ZA 1YS7A 3RNLA 3TSCA 4NE9A 1MQAA 3CUKA 3RT9A 3CNNA 2MSDB 2P9TA 1U8YA 4NBNA 3V97A 2VXOA 4ENWA 4ZRNA 1A8QA 2YJ4A 4YMSA 5EUBA 3R0QA 4PG5A 1K6MA 1T5LA 2R8EA 5DJ5A 2AX4A 2DVMA 3LECA 4RTNA 3QEAZ 3ZHOA 2W71A 1CDZA 1FVFA 1BEZA 5BURA 3BCRA 3HU5A 2K2WA 1DRJA 1E2LA 3BE6A 3G2NA 3N05A 3DE1X 5J1TB 4DZRA 4ME6A 5AUQA 1EX6A 1TZJA 2DAPA 2LDBA 1CVLA 3TX2A 1EFAA 4OLAA 4R1NA 5AHOA 1NN1A 5B7PA 2A35A 5TSDA 2DGDA 4BDTA 5EC8A 1BVRA 1JIKA 2OFPA 4OKSA 4M6WA 3GWGA 4P3YA 4WCFA 4X1IB 2I3AA 3N9IA 4M7RA 3RBXA 4BX8A 4D3SA 2LBPA 2GPYA 4HZIA 3EGCA 3O8RA 2MIIA 2EKBA 1YULA 1HQYE 3ZKAA 2VJQA 4S1NA 4N8SA 4XWAA 3ITNA 1L1RA 2G80A 2HK6A 1ND5A 2GHIA 4BO3A 4E5PA 1JEDA 4IZHA 4BJ5A 4DIDA 3HJTA 2GF2A 1KJNA 2RGCA 5FL3A 5AW0A 3G5UA 5DCUA 1U8ZA 1SU4A 2A5DA 1Y7PA 4BZWA 3OTOB 4I5GA 4EMBA 1N2BA 3PPIA 4NG5A 1AF4A 1U0NA 2FYTA 3DMYA 5G0UA 1KO7A 3A4MA 4DF3A 1P0IA 5JS7A 1SBQA 4FMCB 4NYJR 3S1LA 3FTPA 2R1TA 4J0HA 3PQCA 2FCAA 4D41A 3I1FA 1P1HA 4I66A 1N6HA 1JDNA 1G0NA 4B34A 1A27A 4CF6A 4EVIA 4AWAA 4OBBA 1NX9A 2NVWA 3GZ4A 4I2NA 4W9NC 3KSBC 2KW5A 3RSCA 3JATA 1FFWA 1XK7A 2JFBA 3EZNA 1O96A 3C7KA 4O2LA 4KFCA 1HSOA 1M8PA 1UDBA 2Z1MA 4K28A 1JI3A 4R01A 4CM9A 4DLTA 4S04A 1BE8A 5DGXA 1EZZA 2D59A 1QZ3A 1SVKA 2Z08A 2R6FA 4ZO4A 1K5PA 3EGXB 4JOCA 1EFLA 4KC0A 2ZJOA 3SFTA 1CSEE 2H16A 4NYIQ 1CEXA 1DELA 2D2IA 3LUBA 3TRKA 3Q9SA 1WWKA 4I4LA 4F6RB 4ZICA 1H3EA 1K8QA 1SGWA 4YJ2F 2E2WA 4ENRA 1DUIA 5ULLA 1JJIA 4E12A 4URFA 4QXPA 1M8FA 2JA5B 3TEFA 1P2BA 1C1XA 3IEIA 1ML4A 3BMOA 3PNMA 1KYXA 1TW3A 2EOAA 4U9UA 1JU3A 5LQMA 1XMOB 4MTCA 5DI3B 2O5RA 5DW0A 3BAZA 3OLYA 4GVLA 1F0NA 1D2RA 3SLRA 2FG7C 3JRWA 2D54A 2VF2A 3GLUA 1QX4A 5WRFA 3E22A 3NVDA 3EZ6A 4BFLA 4GOMD 2Q5JA 4QEZA 1GTRA 1CNMA 4XJXA 3C3DA 4ARZA 1FLAA 5B1EA 3I5XA 3T1YB 2ZS7A 4ICIA 1U1EA 2FFHA 4GYKA 2ZBEA 5IABA 3UYKA 4Y6SA 2XUPA 4DCSA 1WSWA 2IU0A 3HSSA 2FZVA 2PMFA 3DV0B 4PG6A 1T9CA 4P81A 3W2TA 4IUDS 1Z5VA 1RLUA 4AJPA 5A9SA 1RRCA 2PUGA 3WWOA 2UKDA 4C0KA 2AKYA 4GLBA 2XQVA 4FKZA 3KFLA 4JYPA 2OYCA 3FYUA 3H04A 1FTQA 1X3SA 1U02A 3SHVA 4OH1A 4Y9UA 3F2VA 1RAAA 3CM0A 4L22A 4PE5B 3HY4A 4Y7DA 5DSZA 4K8OA 2C1XA 4Z99A 4CKCB 2QLJA 4L0MA 2GD2A 4XGRA 1Y7HA 1Q1QA 1P1RA 4C2BA 1DMSA 2AUTA 2DC1A 2KMLA 4IDGA 1E89A 4D4KA 2Z8XA 3CPJB 2F6RA 2ZAGA 3E3MA 2VP9A 5KPJA 3DHYA 4ZCSA 4LNHA 2IP2A 4LSZA 1YZYA 3NHFA 4TKUA 3WLJA 5BWMA 3FVRA 3KQWA 3R6GA 1DEHA 1X80A 1WU7A 3N3BC 3RSQA 5JY6A 1JH8A 2EFEB 4L95C 4RVDA 4RPIA 1XB2A 4MQFA 5AVJA 1TVMA 4OBWA 3K53A 1OC4A 1EQAA 3DCNA 5AM0A 2C03A 5FUWA 4DUPA 2P9FA 4K8RB 5BPFA 5HUQA 4ZRDA 4F85A 1M0WA 3LT5A 1A97A 3KYJB 3ZQ6A 4OXYA 1JLLA 3QOXA 5J2TF 2H52A 2HMTA 4WOBA 1YB1A 3MRXA 2BMVA 2G9RA 3KL4A 1IN8A 2PZKA 5AKEA 4BNXA 4YYZA 1WDMA 3EAGA 5AQ1A 2FU5C 2GN8A 4PC2A 3VPXA 1YJXA 4MINA 2IBSA 4HAOA 2NVUA 1KMCA 1DBRA 3PP8A 1DWOA 3KEQA 3PTLA 4IGKA 2OORA 1YMVA 3JD4A 3G5LA 1DADA 1B6RA 2YVKA 1K9SA 5ALSA 1O5IA 2YC2C 5IXJA 1ULBA 4UE6A 1AN9A 4R4JA 1LLUA 4IXDA 3WWCA 2LNDA 5JO9A 3T9CA 4EARA 4PR0A 4E6EA 2I34A 1KPIA 3VJMA 5DGTA 1B7GO 4XJTA 5JWOA 5EGNA 3QXXA 2D1FA 4PPYA 5K8VA 4DCTA 4AIIA 1QGUB 1JLRA 1ZIYA 1I4OA 2B1QA 4JV5B 3GTKB 4PYRA 3T5TA 5IKMA 1PNOA 1WCXA 2B8EA 3B53X 3F1LA 4M9SA 2BCJQ 2JKVA 4IJVA 3IMFA 3R5SA 1Z4OA 3HB4X 4RORA 2RONA 5IFLA 5HKAA 1FFAA 3QPBA 3RVMA 1WUTA 2P5YA 2P68A 2WP0A 3DLTA 5CVDA 1VCNA 1RIFA 5C8YF 4DILA 3T9BA 3RTGA 4CLHA 2QIOA 1GGFA 2VHUA 2CZQA 3H2BA 2EG5A 2ZBQA 4P83A 1S8FA 3NZEA 3C5EA 1YZGA 4M7OA 3B3JA 2G4VA 3DFIA 3SLGA 3K9GA 1M6WA 2H65A 2AI1A 3NKLA 3SBDA 1XAHA 4KYTA 2F90A 3LKDA 4OLHA 3VV2A 4MQBA 4P4UA 1P62B 2Z95A 3OQMA 1E62A 2K5UA 1MW9X 4PLVA 5EJGA 4JB3A 4FYIA 4AROA 4AZSA 5TC4A 1O0BA 1VMEA 1U11A 1T0HB 3NP7A 2OZLB 4DIFA 5ED0A 1KDRA 3JVUA 2VT3A 2Y99A 3AEQA 3OI7A 1XZAA 3O9MA 4C4OA 1XDDA 2WILA 3BJMA 4G4SO 5CLIA 5EAIA 3OE7A 4ZCQA 4IIJA 4JVOA 3WXBA 2NU9A 5JATA 5CCXA 3OTQA 4BQQA 4NBKA 2VSXA 3IQZA 4AKHA 3HJRA 2PMZB 1ISFA 4LMBA 3AJAA 3ZE0B 2XXAB 1HV8A 3IP1A 1XCBA 1NQWA 2WWRA 4C43A 1G8HA 2B92A 4AF6A 4ITRC 4XWYA 1FDUA 1G3IA 1TEVA 4XUGB 4F7WA 2Q3FA 1CERA 4Q82A 1W2GA 3PPVA 5CAEB 421PA 4FE4A 1PUXA 2PT7A 4RWEA 3LQRA 3LUJA 4X84A 4BLQA 2IYUA 1A9OA 2NYRA 3B3GA 3QJYA 4W1PA 3BIFA 4BDSA 3GOHA 2A14A 4UVHA 3NHAA 2PMBA 1FDOA 4YUYA 2NVXB 4Q5IA 1AN0A 2ILTA 3PFFA 2HU8A 3O4GA 4HNAA 1RXWA 3P9NA 1SKYB 3CHYA 5ALFA 1C9NA 4HDKB 2C5LA 4ARSA 1UBUS 1Y6JA 4OG2A 3C7TA 5KC9A 1TWGB 2PGAA 3GIDA 2NZJA 3UANA 2L69A 3WRXC 2PLAA 4IQGA 3ZD8A 1UMBB 2WAXA 3QYJA 2EQBA 1GUFA 2IELA 3D4IA 3ZDCA 1CQJA 3WB1A 1LC0A 4FT2A 5F77A 5KWVA 3LC7O 2WZDA 4EENA 3OCVA 1NVWQ 2OXCA 4YJKA 4FWTA 4TVSA 2WVHA 2A9PA 5FLEX 3QZUA 1PHPA 2BI4A 2HPHA 2GJ9A 2IF0A 2O3SA 2BPOA 5DX0A 4C87A 3TS1A 1VLVA 4DCCA 1P9RA 3K31A 4GGOA 4RK0A 3W9BA 1UBRS 4G86A 4YRNA 4K9OA 1WCIB 2DHRA 3M7IA 2R8YA 1MNQA 1N2GA 3F96A 4IFEA 4LMRA 4UCXA 1IK4A 3V6MA 3VR3A 4EKNB 5IZCC 4RY9A 2W6CX 2GBIA 3ZVMA 4U6QA 2DJ5A 3QUQA 4UBJA 3DFUA 3NEYA 3RSZA 5JU6A 4IKPA 2Q0QA 4YR9A 3COWA 3F97A 4L3OA 4NMHA 4P38A 1DIAA 4JC0A 3NKVA 2AOXA 4A8JC 1SO8A 4AMZA 4E94A 5PNTA 4QTXA 4YO7A 1PW7A 1JR3D 1ZSVA 4QUDA 4D02A 3GDGA 4G1MB 1QR6A 1LRLA 1B1AA 2IQIA 4EEKA 4F60A 2VRNA 3I2YX 4RSRA 4YCNA 1TWAB 3PDUA 4ZKDA 5JMOA 2RI1A 2YXLA 4RV9A 5DKFA 4MGZR 4C3OB 4AQYB 2IH2A 4JASB 1R15A 1AMOA 2QHXA 5HXAA 2JS7A 3QH4A 4B0PA 1KWKA 4EOGA 1FNDA 5C5IA 1UIMA 4Y18A 4MARA 5HTOA 3HI6A 1Q11A 1ZA1A 2FPXA 4DC1A 4HGZA 1JDBC 1WW8A 3AF6A 4FBMA 3LKZA 3GVHA 5LJLA 1Z7WA 1PFVA 3TVTA 2A5YB 1HF3A 3VPCA 1F2TB 1M73E 1I0IA 1ST3A 1WR8A 1B6SA 1SUCA 3HH8A 3IEXA 2OO3A 1T10A 2LPMA 4IJ5A 4FOTA 4YONB 2IYRA 2FGKA 2OV1A 3NHMA 4ESHA 3DE0X 5GZ1A 5DI3A 2VN8A 3ZVNA 2VNJA 2B4RO 1NMSA 2VKTA 4P0TA 1OTHA 4YGXB 3ZCVA 1ORHA 4GT1A 3OBBA 1ZICA 3AR9A 5EHNA 2WSIA 2NNWB 1JV2B 1GUYA 4JYMA 3WA7A 3AKZA 1ZI6A 1L9KA 2AD1A 4D9HA 4RIGA 3KB6A 3EXAA 4JOBA 3VOSA 2GEVA 1E0SA 3C3MA 5CYGA 1A2BA 4BGVA 2DT5A 3AUAA 4Z2AA 1IE3A 1E9VA 3UXMA 4XR9A 3A1TA 2CV1A 4K9KA 3DV0A 1CT9A 3E9NA 4H7EA 5HILA 4C89A 3F3KA 1CJSA 1GL9B 3ZXUB 3DMDA 3CLHA 4HAXA 5FUBA 5A4IS 4JLBA 4KWEA 5BQOA 1GTJ1 3R7FA 3EIOA 4CU2A 4ZODA 4BVAA 1C3JA 1FVXA 4DMCA 3SJCA 5HMLA 1RJDA 1SBZA 2JGNA 1VGVA 4CKCA 2WKRA 4LCBA 4ETMA 1X1SA 2ISSD 1XDZA 3WLRA 2D1SA 1AO0A 3H5NA 5CB6A 1ZWKA 5DM4A 1VZ2A 4ND4A 3T0IA 1Q1NA 2DXIA 4YAOA 3I8OA 3OIDA 1L7XA 4X1YA 1OWLA 1FQJA 1SIWA 1RKVA 3AEUB 4H3SA 1QCYA 2IF2A 4Y9SA 4CHGA 4EA8A 3OA0A 4JY7A 3T9FA 4ETWA 4KTTE 4R0MA 1BXKA 3QPDA 3LCCA 1N6RA 3K71B 1OBFO 1ZEMA 3C5VA 3VU8A 3RWOA 1R12A 1B23P 1N8NA 2ZI6A 3CV3A 3E9EA 4YAWA 4GYWA 3K0KA 2XGOA 2I4NA 4BY7B 2XMCA 1WW2A 2QXYA 4HNSA 4LWZA 5HJEA 1XZEA 3BMQA 2CLSA 3C16C 2FR8A 2I29A 4DNXA 5IP5A 1SQFA 4QRDA 4KEAA 1AURA 1PYOA 1HTTA 4G0PA 3GEEA 1I9CA 2OL4A 1IYZA 1JR3E 2R1VB 1QGZA 5G0TA 3FMPB 5CJPA 4F5ZA 1VXOA 3GAAA 4WZBB 4WZAB 1CULC 2BN4A 2C1ZA 4OQ4A 3TQHA 3UB2A 1EVKA 4L6IA 3TOVA 1EFUA 3K2BA 3AKEA 1NUPA 2R87A 4IJWA 4LI3X 4WSOA 4XIGS 4BLPA 1QYDA 4PFJA 4RJTA 5F35A 1UBMS 4OMFG 1ZGCA 5ADHA 4CFSA 2HGZA 3I4LA 4JBHA 1YVEI 1UWKA 3KRTA 1XWWA 3K2EA 4GX0A 5SYMA 4FDLA 5JAUA 3A4YA 4WLUA 1PJLA 3PNOA 4W9NA 1VB5A 4P36A 1P0PA 4RKRA 2HWKA 5CM9C 1U2PA 4KBFA 3BK2A 3ETHA 2GXUA 4DXAA 1XKQA 3D7SA 1U7DA 5GONB 3C45A 1XWFA 3IAUA 2PGLA 4P7FA 1TTQB 2FY8A 3EWIA 4YUWA 1S96A 5EHQA 4ZJYA 1G0OA 1AUPA 2A0UA 2P9HA 1DG1G 2DUUA 3QX7A 3EQ7A 1IDOA 2HA6A 4FOLA 3WQSB 5FQOA 2VTEA 1WQ4A 2G0TA 2QB5A 2CUKA 4WNCA 1NMXA 2ZRIA 3DZKA 3E18A 3WHLA 2VRCA 2FW9A 1O8CA 2RHWA 3HVIA 1ZNQO 3GDOA 3OFNA 2NXJA 5FEMA 5BUQA 4EO7A 5BVGB 4RHEA 3RVNA 4GMKA 4WY8A 4XIYA 3TWOA 2ZT7A 1NUUA 5IM4A 2HBQA 4YRIA 3K0BA 1ZRHA 2QM8A 3UUEA 1CP2A 3TR6A 1BC5A 3VI4B 4UNSA 3RSFA 4M9ZA 3EC7A 3L8ZA 4BCDA 4F45A 1TADA 2J9XB 4GUDA 2PZFA 4DYVA 5BYKA 4WVFA 3ZBPA 5BN4A 1N1EA 4KQKA 2GO1A 2RHRA 3QXGA 4LJLA 4O2BA 3WBFA 4W5QA 1WNFA 4AXXA 3Q11A 1E8MA 5AVOA 2TSYB 1KMQA 2I7VA 1BHJA 1JILA 1DUSA 3AEZA 4RQUA 3LSYA 4A3MB 1VA4A 3I9FA 3OJLA 1Y7IA 1XLTC 2QA5A 4XB6B 3D7MA 3CSSA 5B3LA 5IT9A 4M9CA 4XVRA 5JJLA 521PA 2FXVA 4E70A 2YBEA 4B4DA 1JVBA 1N7JA 2PGNA 1T15A 4NU8X 1X7WB 2E1PA 4WTOA 2D4HA 3HGTA 3I09A 3VVBA 3DTNA 4Q4CA 2Y1XA 1ZGJA 4ZV4A 2HCBA 1ESMA 3PR3A 5DPMA 1OBCA 3W2IA 1P4HA 4U7GA 3W8DA 4ID9A 3A2MA 4MCIA 3BRSA 2VK4A 3HP7A 4FQ5A 2PO7A 4IIJF 4IMRA 1BO6A 2ONCA 4L2IB 5E7JA 4IVNA 1L4FA 2A67A 3C2QA 4PEVA 1C3EA 3R3ZA 4BZPA 2HDHA 1INLA 4HPXB 4MYUA 5JZMA 2I4LA 4MIOA 4Z4EA 2FN3A 2CFIA 4Q3EA 2O2SA 4U0KA 5C37A 2YVAA 1ZSNA 3U0VA 1J07A 1M0SA 1T5TA 2FNAA 3VYSB 4NV3A 5JISA 4Z54A 4FFPA 4BNVA 8LDHA 3BWYA 4MEJA 3KYCB 4R6WA 5FQNA 3CQZB 4U2DA 1DX9A 4M8IA 1KE2A 3NH6A 4GSLA 3CUYA 1IQUA 5D00A 1N7IA 2VAVA 3IEMA 1K2WA 2OLJA 3KJFA 4LSMA 3ZDXB 3HLKA 4ENVA 4D81A 1QRAA 2X0IA 5IWCA 4C2TA 3AI1A 5FX2A 4EW3A 3C74A 2C2HA 3D4PA 4LZAA 2BJHA 3GEIA 3MWEA 6REQB 2C4VA 2EZUA 3C1UA 2F8TA 3VISA 4BOYA 2E2IB 4IF4A 1Z15A 4A8HA 3LPMA 3ZZUA 4S0ZA 1C4WA 1CIJA 1K92A 1PR2A 2VPIA 3JARB 2I22A 4KN6A 2AN1A 4EHLA 1G6HA 4IMIB 3R8CA 2GZSA 2F1IA 5J5CA 3LHKA 5FBVB 1ZI9A 4E51A 4DCNA 3DMPA 4DMGA 5D3QA 3GLHB 4Q4AA 4ZU1X 3TQOA 1CE8A 2Q5HA 1DPFA 1E1MA 2FDRA 2YJ6A 3NR2A 2HMVA 2FLWA 4FWBA 4MKHA 4KXFB 3PQ3A 4B17A 4YMLA 3K0FB 3KDSE 4EPWA 1YT5A 2I3DA 2VQSA 1NATA 4EY4A 1V3TA 3T3HA 2MYUA 1IZ8A 1AC5A 2VUTA 1GPJA 1DUVG 2BUCA 2VDQB 3EG9B 3I6YA 4LOHA 4NAUA 4RW0A 3WNDA 4EFLA 4C2MB 1YRHA 2DQKA 4I2VA 3MAJA 3T52A 3GFRA 1ELOA 4LRUA 2C3MA 2WSSD 3D54D 4PO1A 2M6KA 2BGUA 2DM6A 2Z58A 5GOTA 3NHWA 3L8GA 1RD4A 4FMCF 1O89A 1DTWB 3E23A 3W0LB 1A3CA 3M49A 5IBCA 2WFLB 1DCTA 1QZUA 2Q41A 3GYGA 3R6LA 4FZVA 3NTXA 4ZO8A 1ZHHA 2PSEA 4H4DA 2E87A 1JLSA 4MVJG 4QVKA 3PC3A 1NP7A 4HZUA 4BB6A 5FFMA 1ZYUA 4JEUA 2QQ5A 1DSSG 1I32A 1MRNA 1PWHA 1UAAA 2WLSA 1UPCA 3D2BA 3EBOA 2XNDD 3K1AB 1ZD3A 4BBPA 3NHSA 5KTYA 2H3HA 2VJMB 3FOWA 4QNNA 3IIMA 3VNRA 2JJ2A 4RTKA 1PKEA 1QGOA 2QT1A 2UUCB 4BEJA 2GPBA 1IU9A 4MYRA 4YRZA 5DNWA 1TRKA 1B0ZA 1X1EA 5EJ7A 3J7AC 2Q21A 4I4NA 3EXHC 3QNUA 2BI7A 5FTMA 2XYQA 3OFVA 1U4SA 3KZXA 1E3WA 4IDDA 4PU0A 5J63A 3TQFA 2JG3A 3EIQA 3DZIA 3LT2A 4M60A 4MW7A 1QK3A 2GMWA 1YL5A 1G17A 1I4DD 3EY9A 5CVVA 2P1DA 2GHQA 2BVNA 1P72A 1SZDA 3KD3A 1N9KA 1FFHA 3BIWA 2F4NA 4P7BA 5KCZA 2BEUB 3QE3A 1E2PA 2ZYTX 3A6KA 3C4VA 3AY0A 3DKIA 3DOUA 3TOCA 4ZYYA 1GY8A 1NX6A 4K6MA 1CZLA 1HBJA 1Y98A 3DUFA 3PC6A 3LXRA 4H59A 3S15B 1HE5A 2RGBA 4PAGA 4GXRA 3LP6A 4BS9A 4G67A 4DEYA 2FF5A 4GGMX 1G55A 3OEWA 3LBIA 4GDMA 4LYYA 4TTRA 1VPDA 1Y0BA 4J6FA 5F5NA 4EA9A 3VJLA 3FYDA 5A2GA 1I3KA 1QZZA 2PFSA 2B3TA 3MTJA 3FNBA 4EQ6B 1CP3A 3IKMB 3O1JC 3R9XB 2QQEA 3AEUA 4OAQA 4RLQA 3RTDA 3VSDA 3FTFA 4V0RA 2ZFUA 3W5DA 2HRDA 3AX6A 1Z63A 1PFYA 3L4SO 2MOKA 1QTRA 1JHUA 2ZPTX 1GZVA 5ER6A 3NFRA 3WRXA 3OJCA 2E85A 3IOBA 3TNLA 4CETA 3TOZA 1GM5A 3KQOA 4OHWA 1IB6A 5TQ0B 3I01M 2OA0A 2W42A 1WUKS 4JLAA 3U17A 4RJLA 1I2MA 1NLMA 1AKNA 1YL7A 3IV7A 3LOPA 4N8EA 3AOEA 3LBAA 5EP4A 3TVDA 3ICEA 1QO0A 2FPGA 2P0AA 2R8ZA 5CHYA 1II8B 1RI5A 4B3FX 1E1KA 1MIOA 3Q3JB 5A6SB 3B5JA 1XZLA 1M34A 4F2GA 4H1VA 2OHXA 1S0UA 1U2EA 2GPAA 2P4EA 3FW1A 3QKTA 4FUQA 5BWOA 1HNWB 2E4AA 5B7GA 3CUWA 2IU3A 2R1VA 3L6UA 3PFKA 3KVRA 1L7EA 1N2ZA 4ZCTA 5SYAA 1II0A 4WZBA 4GSYA 3O84A 1M34E 1UPBA 2G8NA 2PL9A 3U40A 3EA5A 2XUGA 8ADHA 2ZCJA 5IZCA 1V9CA 3TIIA 3U4QA 1IQ0A 1ZNXA 2IY8A 2ZIVB 1T1EA 4TTQA 3RBZA 3VU1A 1LZKA 1JAZA 2E2HB 3CLTC 3IVXA 2HZ7A 4MVWA 1M5RA 3HKBB 3IR6A 1OI2A 4A8JA 1GLVA 3W5VA 2VFAA 1UQUA 5AUOB 4YT2A 3B1ZA 4JT4A 4ND8B 3HVHA 1NZFA 4MW2A 3IUBA 4DGQA 1YQDA 2CLHB 2I2XB 1UBLS 3ZU2A 2J08A 2W8ZA 5JTTA 4CJXA 5F7XA 3HKCA 3K1JA 1PT9A 5HQJA 1JMYA 2RH8A 5T6BA 1DC3A 1Z4JA 1IEWA 1NMYA 1WV0A 1YSCA 3RB8A 3OCYA 3UV7A 5F2NA 2FW8A 3NBYC 1A4RA 1MN6A 2AR0A 3DZGA 1O94D 5GGYA 3JRNA 4UAGA 1N7HA 3M6IA 4MJ3A 4NAVA 3ZZMA 1RWBA 3RREA 3UG7A 1U2ZA 4BB9A 1ORRA 5J5AA 3E3OA 1S2GA 2V54A 3D6MA 4U1RA 4G65A 2RFLA 1XV5A 3ZR4B 3P26A 2B0CA 4UVGA 4YMVA 3IHKA 5I4BA 4RSHA 2BLNA 4FVTA 1WMFA 5KSOA 3DEKA 1O95D 3EXHB 4A6XA 2VJOA 3JZMA 1EK2A 4XIIA 5B30A 2CVFA 3TCKA 2AMJA 1W5SA 2IZ0A 4GE3A 3QU5A 2IZOA 4KTVE 3HOYB 3DAGA 1BQEA 1YKSA 2W22A 1KFEB 2RGUA 4A15A 2E4YA 3OLCX 5C8XA 4B2PA 4Y6PA 1N5KA 4L5BA 1R6DA 1J2YA 2JAXA 4JL6A 4MW9A 4XZ3A 3UENA 3O1IC 3NAQA 4BB0A 3I2KA 4YRSA 2H2WA 2OEPA 3NRJA 2LD4A 2VJCA 4RAQA 3NC0C 1MC1A 2QR5A 3PPWA 1H6CA 3GL9A 4BO8A 1B43A 4OEHA 2GKOA 1WZUA 4HDQB 4L2IA 4CHTA 4GI7A 2GDZA 2ZIEA 4WERA 1YQWA 1ZK2A 3L0OA 4CN9A 5CXQA 2Q1TA 3FKIB 1G5RA 3QUCA 3UB4A 1C2TA 1OXSC 5HW0A 2YDYA 2UUAB 3QXJA 3IXQA 4K9NA 2X0RA 1S8AA 1ZC4A 1F8FA 3W7AA 3PC7A 1Z2OX 1NQVA 1VKRA 2HXGA 2Y1GA 3F6CA 4MJLA 3UKOA 3A1UA 5C5CA 1BVHA 4M22A 3SDSA 1O54A 3NXSA 1G7TA 3U4MA 1DBSA 5CFQA 4O8ZA 4DJEC 3ENNA 2PUAA 2IUSA 1SXQA 3O9ZA 2I3BA 4RDIA 4S3MA 1Y3AA 3H9GA 1CJKC 1E6UA 1QFMA 1UMDB 3OZCA 1DARA 2ZIUB 4N01A 2HJSA 4N5LA 3R5KA 4FJ1A 4C04A 1GUAA 2AHOA 3MJCA 4R9RA 4WIAA 5I9NA 4NIMA 1RBYA 5JQGB 1AF7A 2RGNC 4P4SA 4MWOA 3CNEA 1RHKA 3CGWA 3VR6A 3OWXA 4A8TA 4UXIA 4O8CA 1KI4A 1GL7A 1VKZA 3OZTA 4AMYA 3THWB 1IFXA 5HJ7A 3DE5X 4HLCA 2CZCA 3FZGA 2BUBA 3WK4A 4M54A 4AJNA 1SVNA 1U8UA 5BV2P 1N6NA 3U3JA 1DKPA 5J4LA 4GKJB 4TLAA 5AK4A 2ZM5A 1XYVA 3KE9A 4FIDA 3VA7A 1T4BA 4MS3B 4M98A 2O19A 4EF6A 3MINA 2ZJ5A 3II6X 3FR7A 3R2JA 4OF4A 1TA0A 2WTBA 3EG9A 3DKPA 4PYKA 1TAGA 2BRUA 2IUUA 3T54A 1CXZA 4BAZA 3OQNA 1PL8A 2BM8A 5B7NA 2P6PA 5FULA 4JBNA 4QQNA 2PVCA 1C3OA 1XGKA 2FPKA 1YQXA 4J9VA 3E61A 5JADA 1E2NA 1UFKA 3D6TB 3UJDA 2R60A 4J4TA 1CEYA 2W2OA 3GGSA 1DTWA 1AKYA 1JAYA 1O58A 1RYZA 4ZJZA 2ZJ6A 3I6IA 1EK6A 5ABPA 5J1SB 2DZDA 1SUSA 1X9IA 3T5DA 1Z8DA 4Q3AA 1DVRA 2R8PA 3OFKA 1CUXA 3UZUA 3ZCRA 1EXMA 4BJ3A 4RD3A 4CLOB 4BX0A 2BGMA 3R75A 3NMUF 2PFKA 3QU2A 2HWYA 4LAFA 5KJ6A 2CHFA 3G6WA 3VR0A 3Q8KA 1JZSA 3K1AA 5BSEA 2PRKA 2VJMA 2XTMA 4B7ZA 1DZIA 3GGGA 2DBYA 3REOA 4KCGA 2VJPA 3V4OA 4DB4A 5ISMA 4XQCA 1QRTA 2YN2A 5HIIA 5JXJA 1TKCA 3FPLA 4CWAA 3BWXA 4QDXA 2QD5A 1CDOA 4LVOA 4DFDA 4HGNA 1OKKA 1XUOA 4XUEA 3CXRA 1BMFA 5KTNA 4L08A 2GAAA 2GBCA 4YAKA 4CCYA 3FHOA 2QENA 4G81A 4PHGA 2DUJA 2IUTA 1LXCA 3UH1A 3V3KA 3TQRA 3K6SB 4BFWA 2X8BA 3IJ5A 3FMVA 4O0MA 4QU9A 4R9UC 1E4OA 2JC3A 3NIFB 1OWPA 3KWJA 1O87A 4Y1RB 5TMDA 5IFKA 2PT5A 1TM4E 3NHZA 4F38A 5BSRA 3X1ZA 4KN5A 1XLTA 2WJGA 4UCQA 1F17A 5ALDA 1SU8A 1K7FB 2G0AA 1VJ1A 2GPNA 3SCZA 1A5TA 1I0LA 3JCZA 2ON6A 3A9TA 3CUVA 3QYAA 3AF1A 5E1BA 1COZA 1JJFA 2HTEA 4XQ0A 4Z53A 3QV1A 1G98A 1D8AA 2AC2A 1J0CA 2OGTA 3BICA 3FNGA 4WADA 3U37A 1G7RA 2Z3ZA 2Q9CA 3VPSA 4XPIA 4X8HA 4ZV9A 2A9KA 5D1HA 3CNLA 3LFTA 1N3IA 5D3MB 4K6KA 4H1WA 1HE3A 1V35A 1C7JA 4HQLA 3CNBA 3DYVA 3SX0A 5CD9A 1GAJA 3E05A 5JNSA 1SKAA 2ACWA 3FG9A 3OZEA 3VX3A 1KYWA 3IAM6 1QZXA 1WO8A 2JH3A 3BGIA 3DEHA 2NU7B 2Y1KA 2H11A 3E2PA 4NBVA 1BRMA 1UDCA 4XWKA 1BZYA 3X1YA 2VQFB 1PS8A 2X76A 1U0GA 4LWOA 1S3SA 2DFNA 3RF7A 4ZT3A 2YXDA 2KWIA 2XWSA 1JA0A 4A3FB 3HXTA 1AS0A 4J8PA 1GZ6A 1OGYA 3JW8A 2H57A 3RQSA 1ZHOA 2JLVA 4HTAA 4MQUA 1FUEA 2A8YA 4I0WB 1M8KA 1C2YA 1VRVA 2EV9A 4P86A 3QYFA 2VDKB 5I9MA 5A6SA 2GLUA 3CXUA 2BFDA 3OF2A 3DOIA 1PQUA 2A5FA 1QVWA 3NLLA 1MJGM 1U2TA 1WABA 2ATEA 1UM9A 2K2QB 3NW9A 1BDHA 3F0TA 1JN0A 1OFUX 4BO1A 2ZYUX 5GJWC 3ZUGA 1B16A 2NZXA 1CUYA 4B1FA 3W9YA 2RGAA 4RACA 4ND3A 1MB2A 4G5SA 3ENZA 5FHRA 4IUBS 1MGPA 1ADYA 4Q7EA 2FSIA 2XCSB 3RKUA 4KPYA 3P9QA 1AQIA 1Z35A 4H0FA 3PHJA 5FPQA 4PTYA 4UQPA 3HKBA 1I3CA 2C2GA 2I5PO 5G53C 3JYNA 1GTG1 2IV7A 2FAXA 4M49A 1MU0A 2AZMA 2YVUA 4GG1A 4B3BA 3OVMA 4DHWA 1Q21A 2OXFA 5LSAA 2O2YA 5F2OA 1APBA 3W3AD 1KAMA 1N2SA 4FE3A 4HN2A 4FOSA 3IUNA 1Q84A 1QYXA 1UPAA 3A4TA 4EKIA 1AU9A 2Z6VA 2DWCA 1MFPA 3R3JA 2PKRA 1YF3A 1A9QA 1H5NA 3AGQA 3IOEA 3PB3A 4Q3NA 5ALYA 2GEBA 3RJMA 4EG4A 2OV6A 4F9GA 2ZRFA 4RDXA 3U4CA 2H7YA 1SBTA 5EKTA 4B83A 2QE6A 3L05A 1E1RD 3H6HA 1T13A 3ZCUA 3PBKA 4JCCA 2BIFA 1NU6A 5GONF 5TGDA 1XRMA 3CLTD 3H5IA 3B12A 3WADA 3KNZA 4RLHA 2VPWA 4WACA 4CDGA 2R6DA 1JU9A 4IVRA 4UMDA 1IVYA 3EXHA 1II9A 5B3JC 1E6KA 2PNFA 4ETIA 4HFRA 2B3DA 2VYVA 4OJTA 4XX0B 3RRFA 3U3ZA 3AKCA 3KKPA 2RHCA 3D8RA 2PZEA 4IDQA 1ZUHA 1O9HA 3PV0A 1VIAA 4Q01A 3AVPA 2WPNA 1C4OA 1OYWA 1V71A 2G4CA 2O2XA 1Z2DA 2V3VA 1QFYA 3AB8A 3DF7A 3PUZA 4UD2A 2OV2A 4WJKB 3SFVA 3STWA 5LVAA 4BZQA 1SIUA 1WEHA 1NHGA 2AQ8A 1W4AA 2II6A 3COJA 1OLUA 4B6OA 2A1TS 1SC3A 2GD1O 2OXRA 3C8HA 3IP6A 4B2YA 1OR8A 2J31A 3GUYA 3RAJA 5KWJA 1E1CB 2QORA 4QJIA 4QJ5A 2HADA 4LSGA 2R6GA 4RK7A 4NDZA 3IT0A 1NP3A 4RVCA 2WK1A 5TB5A 3HBFA 3DEAA 5HQTA 3OWHA 1MG0A 1QHNA 2ZU0C 2FW0A 3EY4A 4OIMA 2H1RA 3WGJA 3G5AA 3Q1LA 1DKNA 1PFKA 1PR0A 1UPFA 2QD3A 4YDHB 1RPNA 1Z4LA 2QDXA 1WKCA 4GD3Q 3FTEA 4R71A 3CLUC 4K46A 4NNOA 5LZ8A 1L8AA 3B1FA 5KC8A 2H4HA 2Z83A 1DT5A 3SAJA 4XVUA 4OGGA 5DE3A 2GEDA 2H8KA 2JFZA 2IUYA 4OP3A 3OUUA 5BYJA 2XNKA 2RC5A 2QVZX 3B52X 3ZYCA 1YB6A 5DHRA 4A82A 3OQIB 2P7HA 1R0SA 5G1OA 3K70B 5BXQC 1J1IA 1XRNA 3IJEB 2AMVA 1TEHA 5H1YA 1V41E 3N8HA 3FNQA 2FMFA 4J91A 4X63A 4C05A 5H4GA 4HDNB 4DNQA 4O5AA 1EGHA 4TMXA 3BRQA 4ZEOA 1OTXA 1WCV1 2J3JA 1DKOA 3DBRB 3GZNA 4RVNA 4MNTA 4UHFA 3MCWA 3R7SA 3W05A 5BWNA 2EFJA 3EBLA 4KK4A 4MR8B 1C7FA 3ASZA 4NCIA 1BNCA 4G2TA 1DHTA 3PNVA 3WL3A 4GPZA 4WA7A 4DV5B 3ZWAA 1G2QA 2IIBA 3HUEA 3UGJA 1OXMA 3K0CC 2OYSA 1AG9A 3IGFA 2RD2A 2IXBA 2DHDA 2QMYA 1AXEA 4N7JA 1YDHA 5JLJA 3KZOA 3Q3GE 4BY9E 2YOFA 4XDZA 3RRXA 2IQ5A 3NVAA 4J6EA 2BHTA 2FWBA 3BREA 4H16A 4G9EA 4AI6A 1TVKA 4NZYA 4CLOA 1Z6XA 5HCIA 3KKOA 1JKJB 4LRWA 4QUKA 3RABA 4Z51A 1KNXA 1N9GA 1KORA 3IE2A 3HOVB 1H6DA 5IJAA 4H31A 1QCDA 5H7XA 2XCLA 5JAIA 3VKHA 4DXHA 1YKGA 5JVDB 3F49S 1J2TA 1QF7A 5EJ6A 2JJYA 1U94A 4OL9A 2WRZA 2HIAA 2MYPA 3O83A 1IIRA 3BQNB 2HF2A 1I30A 1X7ZB 4G0MA 4HTFB 4EDHA 4HV4A 2R84A 5C7YA 4GQAA 2HDNB 3H1BA 3G1UA 1BCSB 3KDAA 3K5HA 3GJZA 1FXWA 3LK7A 3K6SA 2Q99A 3QBVA 4C0HA 4GQBA 1S4MA 2H2AA 3AI3A 1N1GA 2PS9A 3DR3A 4X60A 2AW3A 4YJHB 3AVYA 5JI2E 1WSDA 1UZLA 4OPMA 5IK2A 2V6GA 3L06A 5JWHA 3E8SA 4PYIA 2B7CA 1QQTA 2AYXA 1U1CA 1CR4A 1YRAA 2UUOA 1N78A 1C14A 3VR5A 5FRDA 4KXXA 2R44A 1RQXA 2GM9A 3BFPA 1AZSC 1PT5A 1AQUA 5BW4A 3LFUA 3OT1A 1T8TA 2HHCA 1JPNA 4JIMA 1B1CA 2YR0A 3CU5A 1BHQ1 4O5OA 5B3KA 5TGTA 1H22A 1XQXA 3EDOA 2CLEB 3MCZA 3NTRA 3GN1A 2J3EA 3HA3A 3KZNA 1UDXA 4IDEA 3FFTA 1XA4A 3KKQA 3QE4A 4PANA 3R76A 4H0CA 1WZIA 3ME5A 2X3UA 1EUDB 1FXSA 1ZNZA 1XQWA 2W6ZA 5DB4A 2QJWA 2GOYA 1OTYA 3I4FA 3QEMB 3RVKA 1W0JD 1CQXA 1LPSA 1X7YB 5J4KA 1VOTA 3MRSA 1FVHA 2NU7A 2XD9A 4O4LA 3ESCA 2IE8A 4KYUA 4N39A 3SSOA 5JSQA 2OHGA 1E1NA 3S2HB 3ZBQA 1JKFA 5K2OA 4QXAA 2EJWA 2ZWVA 1DAPA 5DMXA 4GAEA 4LZPA 4RABA 4YT8A 2GF0A 3NU1A 5HIJA 3BXPA 1UBHS 4QDOA 1JW9B 2YW9A 4D43A 4I1IA 3SD7A 1HOXA 2PJUA 4L8FA 1CIPA 4B43A 3UTCA 1WF3A 1GPNA 4HX9A 4ETNA 2IH5A 5BSHA 4AN1A 1PS0A 4FDVA 5EHXA 1BQ3A 1ORIA 1T9HA 2RGNA 5ALHA 4FN5A 4E7OA 1S2OA 5KNLA 2WOJA 3ZPXA 5GINE 1KYYA 2Q7DA 3C8DA 3SF8A 3NWBA 4LY6A 2F64A 2Q3BA 1Y9JA 3I4CA 1Y8QA 3OTIA 4U8HA 4BMZA 2AFVA 5C52B 1U0FA 3PEWA 2XUIA 2HEGA 4HH1A 3ROKA 3ZTYA 1ZKMA 1IZ9A 2MR6A 4PTLA 3HXKA 4WBNA 1UF9A 5G40A 4YQEA 4L27A 3EIHA 1UBKS 2JZCA 3OPYB 3R3WA 4N5IX 3NC1C 5EIBC 5AR1A 5L3VA 3MF4A 3T1TA 1KDYA 3KUUA 1V8BA 1B74A 2XH8A 4TMFA 3DFFA 4EI9A 3CVYA 3H3VC 1G21B 2VP4A 3E1SA 1C0IA 1KI8A 2BISA 4QBGB 5CVTA 3M9LA 4W8GA 5IUNC 3AJRA 4IAOA 4Y2GA 16PKA 1QHFA 3FA2A 3RTAA 3AJEA 3F47A 1O8BA 4BLVA 2FMHA 1Z73A 1H4VB 3C3JA 3EISA 1ZCBA 3OFSA 4MGIR 1Y5LA 4L15A 3RRYA 3NATA 1Q0RA 2BWJA 1VCMA 3PVCA 1FTSA 4UTZA 1X74A 1JXAA 1GPDG 1V43A 1NASA 2HO5A 1FW8A 4TS3A 3HVRA 5A2QA 3L77A 3MLEA 3AERB 2XCOA 1ZS9A 5KTPA 1SVIA 1CDDA 4FMPA 2RG1A 4IMPA 4MO9A 4Y67A 4ZDWA 3T5MA 3TI7A 4TTTS 2EJTA 2F4VB 2W83A 3CO5A 4LXYA 3VZSA 3WGUA 4YAUA 1T4GA 1HOTA 5D51S 2IW1A 5JNVA 5LQUA 3P7MA 2BBOA 5JCOC 3NHBA 1Q6ZA 1UPXA 3IOMA 1ZVQA 1BEUB 2Q3MA 3D3EA 3V33A 3LM8A 3VU9B 3E6AA 3PDWA 1UCFA 1G66A 2FE1A 1JIIA 1GN8A 1ZJYA 2W6JA 3X1DA 4BEBA 1SB8A 5DN9A 3V4SA 2O8DB 1XTBA 1G8MA 2GK6A 2R7NA 1BFUA 2GASA 2OK7A 3GW8A 4OQEA 4YAEA 1H23A 4OGFA 3T61A 3UOWA 4DR2B 4CLEA 3BKXA 4UAVA 2Q8QA 5EG5A 2P40A 4REMA 4XM0A 1RYNA 2IYYA 1H1LB 3ICPA 2PJRA 2F43B 3KHSA 3IESA 4LNUB 1EGVB 1BMDA 1OLOA 2V74B 3HE3A 3B9QA 3NYWA 1QGED 4OQNA 4KMOA 4NXMB 1SK8A 2HXSA 3CISA 3MT8A 4TLLB 4UXJA 2LUOA 2QM0A 2PUEA 3P9YA 1CR6A 1DINA 1OZHA 1YH3A 3QPAA 4CQLB 3S44A 4OQZA 1QLHA 1EIWA 1QZTA 4NWIA 4N65A 5FWXA 1L7OA 4LVUA 3ICQB 3O94A 4F5DA 4POOA 3QMMA 3S2GA 4WNYA 2OBNA 2Q5FA 5I47A 1LPMA 3ANNA 1Y8AA 3I5YA 4NBSA 1XCMA 2WTXA 3JWGA 2YCBA 3OLZA 3BFXA 2A78A 5JEEA 1EUZA 4LDAA 3M70A 4JSYA 3UWPA 2QJOA 5FV7A 1K06A 3OFJA 3IUQA 4BJHB 2DBRA 2XVXA 4FOOA 5EZYA 1IM5A 3QW4B 1UEJA 3QF4A 4NE7A 4RK1A 1FZQA 1Z0JA 1ZJZA 2V7QD 5JLAA 5FXMA 1EGMB 5IVKA 2FUCA 1Z0SA 2C8KA 2YYSA 3GA0A 1Z0IA 3FCCA 3NI2A 3O3CA 4INAA 4PGFA 3WO0A 3F7NA 3S68A 4QBIA 5AVYA 5BR4A 3PXXA 5KQPA 3M3YB 1FP6A 2JATA 2YN4A 2JVKA 3WIBA 1CY7A 5EA2A 2DPXA 1VJTA 5DHPA 3TLEA 3IB3A 3DGEC 2FG6C 4JR2A 4OSEA 4RFSB 5LQCA 2M32A 1AKRA 5DCWA 1ESEA 1FSSA 4D25A 3R0ZA 2XTAA 3I1IA 3L6DA 4NY1A 3A1SA 3SG0A 1NV9A 4G24A 1DC7A 1QX3A 1UJ6A 2WTAA 3TLCA 1RTTA 4K40A 3IQXA 4I55B 4OOFA 4RJIA 3O74A 1YHNA 3MSCA 4KZPA 2OGWA 5FCDA 3UA3A 2JK1A 1MC5A 2H0AA 2I4RA 2WPDD 3A2LA 4MR8A 1TWCB 2X1VA 4B45A 5JQGF 1K68A 2PSSA 4L6CA 3WGVA 4YPVA 4MS1B 3TRDA 2G1UA 5IT0A 2PJZA 1ZOIA 4FU0A 5CM2Z 1F6BA 1R1DA 1W4RA 4F91B 5FWNA 3K05A 1CPYA 1C7QA 3WXMA 1YZ3A 3LCVB 1NQTA 5DGHA 3RT7A 5JTUA 1ZZGA 5AVWA 3C98A 3JZAA 1CHDA 1NVFA 1A7KA 2W2MA 4LEIA 3IMKA 1W29A 2YVLA 4C14A 4CCSA 1CUDA 4JN6B 4DSOA 3FRHA 1X92A 2ZTMA 4UBIA 5CT4A 1HDGO 5F73A 4DPMA 1OHHD 5EHZA 3HVJA 3SHWA 5FD8A 3B2NA 4KGVA 1IONA 2EWWA 3ZX4A 3SIRA 2P65A 1VJGA 2HLPA 3COYA 2B4AA 1FYWA 2ZJAA 3FF1A 4MQ5A 4RL4A 5CNJA 4AZTA 4ER7A 2C2MA 2B8NA 2VHEA 1U31A 4Q48A 4QPNA 4U5XA 2P5SA 2JFGA 4UFOA 1OX4B 3N2LA 3RF6A 6LDHA 2YJTD 4UREA 4PX9A 1U9JA 4HDMB 4BGDA 4PLTA 1ZL2A 5KKNB 3G2LA 1CZKA 2MT9A 1DIBA 1X8XA 2FN4A 4N3BA 1W0KD 2YNMD 4HTFA 3JZFA 4CE6A 3PEVA 1SC9A 4EUSA 5D1NA 3VPHA 3LAWA 5B3JA 1PEYA 1GG5A 4HFNA 1XXHA 4ZK6A 2WA2A 3K1YA 3KLBA 1U28C 1JHDA 5DGCA 4OM7A 3A1CA 3X3HA 3AFHA 1YFKA 3GTLB 1BEEA 4ZREA 4V0LA 3L0DA 2FFQA 2PXCA 4LPKA 3GMSA 1FB5A 1RMQA 2YWBA 3D3NA 2WLTA 3UJ3X 4AY6A 3PCXA 5E9AA 3GI1A 3LBNA 1TZKA 4MRMB 4CVNA 4CEJA 3UJ8A 4JBYA 2JRCA 2A7XA 4RF2A 1GPUA 3ZNQA 5JFTA 1BWPA 3KUXA 5ALLA 5LUAA 1M76A 2PANA 3TLXA 1KIMA 1UJ2A 4EH1A 4GECA 2G6BA 1HURA 5EIOA 3KR0A 3HI4A 5TIIA 4G9GA 2AYYA 4YTEA 1UR5A 4BKPA 5F9MA 3CWCA 2GM5A 1LD3A 1CWUA 3KAPA 4M8KA 3D7LA 3UT5B 1VI5A 5HS4A 1DO0A 3QHAA 4XFKA 2Q45A 1YFLA 1OAOC 3PD1A 2ZS8A 3NHKA 4HAWA 2M98A 4OQFA 1EJ2A 2GDJA 2I8LA 3DPSA 1EWRA 1YI1A 1Z8HA 3CEJA 1DV2A 5EINA 3WLAA 3UMYA 2XV1A 1PV1A 3QXHA 4MZDA 4ZGBA 1Y6GA 4MDFA 4HEJA 2HSEA 4NK4A 4R7TA 4OJQA 1CVRA 1R7RA 5AXBA 4UTVA 1QE3A 1XYYA 4B4UA 4XWTA 2WU4A 2LCFA 3NS7A 4YAIA 1V8ZA 2D1YA 4LISA 2AFIE 1TUBA 3M0EA 4FMDB 1Y7LA 5CBPA 1R9MA 2E6KA 4FP9A 2FWJA 1DCMA 1Z4QA 1BW9B 3K30A 2FEOA 3VI3B 1UMKA 5DOVA 3USES 1U3DA 3DVRX 3DLPX 2PU7A 2HFKA 4H3HB 2QAGC 5G3ZA 1E20A 2Y6UA 3EIEA 4FB4A 4GXTA 2QPLA 3QWIA 2J5QA 2WKPA 1UJCA 4OX9Y 4A93B 1WL8A 2W2QA 2BL4A 2CXTA 3RODA 3WMRA 3ANTA 3CYFA 3DOCA 4KIUA 4KODA 3N7TA 1YFJA 1NVBA 2PD4A 2NXCA 5EKUA 3LUCA 1NMQA 3G2QA 1EXWA 5IDYA 5K0NA 1IRIA 2C9DA 2ZDHA 3OPYA 5C5EA 2P6RA 4KUHA 5K1ZA 4TWAA 2WF5A 3U3OA 3EEOA 3D02A 3I9LA 4OK5A 2FQXA 2V59A 3O75A 2NUAA 1P60A 2PBRA 1FTGA 1VIDA 2ECQA 1T5IA 3A0RB 5JMTA 3FSEA 4R3WA 2H0QA 3ZE6A 3MJDA 3C24A 1OWNA 4MVJI 1N5MA 3NXKA 2ZQYA 4A3IB 1XX6A 2WVGA 3UTDA 2LDXA 3DLBA 2R68A 3B82A 3OC0A 4HNVA 2O2JA 4KSYA 1L5YA 2GTPA 5AVQA 4BB5A 4QDTA 3W6ZA 3ENWA 4CR8A 1JWAB 4GKAA 4YXWA 4DJTA 4Z7OB 4RA6B 1PGNA 1QFJA 3H97A 4G1CA 3VKUA 3IPXA 3UGQA 4DVGA 5IF3A 2GBLC 1P1KA 1L4EA 4LTMA 3GFBA 2IYZA 3HPRA 3PXAA 4KKXB 3UCFA 2E5LB 5FLKA 1MKYA 4W1SA 2ZI9A 3OKCA 3NAMA 3DLIA 2FJ0A 5CYPA 2O48X 3K3PA 4V03A 2EJBA 4XQEA 2OCXA 3UGTA 1V7PC 1IZ0A 2PH5A 3WA6A 4BHTA 5JSUA 2ZBUA 4KR7A 3NDBB 3DEZA 2FRVA 3SC2B 4D0SA 1EM8B 2CMKA 2EW2A 4MLDA 4E08A 1NJGA 3GLIB 2B94A 1H1DA 2AEEA 3LZCA 4IIEA 4MQLA 5EYPB 5AJHA 3GP8A 1YUNA 3T7SA 1W0CA 2A0XA 3I2HA 2Q6TA 4D56A 1P80A 3FMIA 2HSWA 3S99A 4OP1A 5AXCA 4G97A 3VV3A 4ZVQA 1TPZA 1T1RA 2C4WA 2C88A 2JFWA 1Z6GA 1H1LA 2CLCX 3NWPA 1A50B 3I2JA 4N3AA 4YIKA 5DCLA 3ZZTA 3FWKA 5DI9A 5BNWA 1O4VA 4YY3B 3J81k 1G64A 1X1BA 3E81A 1T8WA 1NKSA 1RE1A 4RNCA 5EXXA 2ZP1A 4FYJA 1T1SA 1V1RA 1JHXA 2NV0A 3A06A 3DONA 3GVCA 3P9SA 4QUGA 4TN1A 3DWIA 4IDOA 1XQ9A 1CNFA 1TEXA 5D6NA 2VNSA 1GG8A 1WJGA 1IM8A 4NHOA 4UC0A 1HZJA 1UH5A 1ZEJA 3GPIA 5JHGB 1UC5B 3KPVA 1FRFS 2Z30A 1WETA 4ZALA 1BVUA 4AG3A 3H7AA 3F5SA 4EJMA 1EJ0A 2QZSA 5DYWA 3N0XA 4GVPA 3DOHA 4MWBA 4QOIA 5B1IA 2EBFX 5KZMB 4BBJA 5EY5B 4KVGA 3OURA 1E2HA 3C8MA 2E4WA 5CXXA 1O2DA 4G84A 4JI5B 3GVIA 3SC4A 2ZCVA 4LZJA 4MKZA 4WDRA 3PE6A 2V5AA 3TMKA 3G1TA 3LHSA 1ECCA 3VTAA 4FNMA 4X7BA 3RYCB 3GRPA 2BE7A 1W25A 4EGFA 1SK9A 4YECA 5BPHA 2E49A 1VPWA 5JJ5A 4Q9JA 2ST1A 4Z4FA 5JOQA 1G4HA 3RUHA 1E2FA 1AQLA 2ZJFA 3RK1A 2CFCA 1KY3A 1MAAA 4K9LA 3SY8A 4GM0A 1MABA 1C30B 1GQ2A 1YOVB 1FP4B 1JFLA 2MSCB 4DG8A 1B8NA 4MXDA 1H0SA 2Q1YA 4UUOA 3HN6A 5TMEA 5AVZA 3EOBI 1XEAA 4R8VA 5AM1A 2P4UA 3KQNA 1JSXA 1JG6A 1Y37A 1R9JA 3QG1A 4FGLA 2MR5A 4OHMA 5CPFA 4QBKA 1HYHA 4JC4A 4TKVA 3F4LA 3EXG1 1GTVA 3EDMA 1WOMA 4MS1A 2X15A 3ZIDA 1L5GB 3I04M 2V6IA 1ULZA 4YWHA 4FQ8A 4WBXC 3FLAA 3R5FA 4IW3B 3A37A 3AG6A 3INRA 3Q85A 2PT6A 1LTHR 1U5BA 3CRRA 2CLFB 2IEDA 1P33A 3CVXA 3FB4A 4Z0NA 1EFHA 3GT3A 4YALA 3AW9A 2I9PA 3FDJA 3NV7A 4QPZA 5HF5A 1IBSA 1RXEA 2GUWA 1YR8A 3PQFA 2IBTA 1DGQA 2C7VA 2GEJA 2XOEA 4BE9A 2QN8A 4B3GA 1KVTA 1LX6A 1Z75A 3K4PA 2AVDA 5DN6A 5FOWA 1R66A 3WY9A 4ECEA 2AOTB 1K0FA 1Y42X 1YIAA 3B13B 1DFGA 5F21A 5BSKA 4MVJP 2XX3A 4S1VA 5E0OA 4CV3A 4RANA 1QO7A 3CLSD 1KY4A 5E4JA 2F59A 3N2NA 4J16C 3STUA 2FA9A 1T9GR 1F2DA 2ZJZA 4HFJA 4KN9S 4D57A 4M8SA 2HLDA 1FU8A 2H4YA 2R11A 5JI3E 4EKDA 4Y9DA 2OO7A 2YL2A 3U81A 4LFBB 5G2OA 2YJ5A 1JTFA 2WBLC 1TMGE 3U2QA 4KFSA 4P2BA 3ZWYA 3HZHA 5JCOA 2Q3HA 1XZBA 4J7CA 4L8GA 3IUMA 2ZM6B 2J6CA 1TZMA 4IXWA 2GZ1A 5K09A 1RAFA 3OM9A 2DUNA 1ZKDA 3DHNA 3PVZA 4GF5A 4ISBA 4N7BA 5CDUA 2IA5A 4FLMA 4L5AA 3KK0A 2SBTA 4P3KA 5JVDF 1IN4A 2PD3A 2Y0BA 3O21A 4MRMA 1QHXA 3Q5DA 4TGLA 5HGXA 2WU1A 1E63A 4JLNA 4LBWA 1PR3A 2D5LA 2YASA 2BP7B 4GPBA 3TTWA 5CB8A 3FDXA 1CY6A 2BH2A 3U09A 1D2AA 2NWQA 4KPUB 1SHUX 5JMPA 2P1ZA 1FPMA 1K8RA 1L7RA 4LX8A 5HKBA 1W1IA 2D5IA 2M6RA 3NCTA 3YASA 5DGIA 4Y1EA 2NU6B 3CKKA 3CB4A 1V45E 1Y8RB 2D2FA 4JB8A 4D0RA 4NS4A 5MFZA 2HF7A 3D6VA 5T7BA 1Z6TA 4LHSA 1EAMA 2IOFK 3H8JA 4GOND 4IH4A 3UT5A 4AQDA 4BRWA 2B9EA 2QGZA 3N0TA 3OJWA 3I64A 2Q0HA 3INNA 3CWQA 4MKXA 2NUPB 3PGKA 1N8SA 5EZ5A 2GEUA 3ZJ4A 2EATA 5E3HA 5GIPE 3AUFA 2Q1XA 3GFOA 3Q15C 4G07A 5E7MA 3A9UA 1LDMA 4TRMA 2JGDB 5KWEA 2F00A 2CKDA 3GGDA 1W581 2PWZA 4JROA 4K26A 3G5MA 2P9CA 2HMYB 1Z37A 2BEJA 5UKDA 5LBUA 3KHUA 1LFDB 5I4IA 2IS6A 2XMGA 1S7CA 4BFCA 3RTEA 3E8MA 1G9SA 1EXNA 1LWOA 1QYWA 2WQ7A 4L02A 4TUYA 2HSGA 1SHTX 3SYRA 4A5OA 4KNYA 1QGDA 2NM0A 2Z3VA 3DKRA 4Q02A 4GL2A 3VHXB 4C88A 2QEQA 1E79A 2A1IA 1S2NA 1Z5WA 3MCVA 4KQ6A 1NULA 4QG3A 1IDN1 4TTIA 2NXWA 4J0QA 2FV8A 3MXTA 1V3VA 4BC1A 2OQIA 4EI7A 4UBLA 2ATIA 4NBLA 4MVJD 2A33A 4IIFA 3WK8A 1NQOA 3MTEA 4R9SA 4KLZA 5IAGA 2NVYB 2J4CA 2FDXA 3ZWMA 3RFXA 3HM9A 4EPRA 3AY7A 4X97A 3RG2A 4P4TA 4NMLA 1FUUA 4Z3KA 4AKEA 4XGKA 1HRDA 1D4OA 2B6HA 5L3ZA 2E1RA 3T4XA 4C07A 3RW9A 1P4SA 3MTBA 3T7IA 4K88A 2WG0A 3FRJA 4FFBB 1JIJA 2V97A 3NEAA 1IUOA 4J0EA 3S16B 3WNBA 4LY3A 5CYOA 2PSDA 5KQLA 2E9SA 3WSTA 2WJPA 1Z2CA 1BU5A 1JSLA 4F96A 1VB3A 1I4TD 4L5JA 2JLZA 1CKEA 3VQTA 3AKYA 2J0EA 4J7AA 2CNLA 1XZ8A 1N2CA 3H5RA 3OOWA 3NBFA 1GV1A 2HV9A 4Q03A 5DLPA 5BRAA 4HAIA 5I4CA 5ICEA 1ID8A 4L07A 4RA6A 1Q77A 4ZPJA 1O1YA 1Z7EA 2F1KA 2IYFA 3KKEA 4RPCA 4XCQA 4C6TA 2OFXA 4Q18A 4X00A 3TB4A 4YC7A 4Y6LA 3ONEA 1B00A 1L4YA 1N2CE 3L7JA 3N0WA 3P0EA 5GAJA 4AY5A 4CTJA 3OD5A 2V55B 5T41A 3Q10A 3RC2A 3SEQA 4EGJA 1I1NA 3FFWA 4G6ZA 3SQDA 1Z88A 4EHJA 3ZJTA 2HT1A 1E1QD 2EWMA 2ZSKA 3A3YA 3HYTA 1NXXA 2V3WA 1PL6A 1VM6A 1MOZA 1QDUA 3WNVA 1CZRA 3MG9A 2IDMA 2GD6A 2C2KA 3GOQA 4HQ6A 3KKMA 4ZC1A 4ZZIA 4Z7QB 1PJTA 1U28A 2FZWA 4QDJA 4I1PA 2FZ5A 3HEMA 3RVJA 4QA9A 4B3DA 3DR5A 3WLFA 3GPLA 1GCOA 2XUDA 4CG3A 2HM7A 1Y7TA 4LJ4A 4BU1A 4ND2A 2Z0MA 4CGYA 4ZI7B 1RZRA 4YB8A 5IBRA 3SX4A 5M5XB 1JSZA 2WJ6A 1RLIA 4UHDA 3CN9A 4YHBA 1LDNA 3QJ5A 5F52A 3EIUA 3ZWWA 3AM5A 3NVMB 3UY4A 1K3FA 1SG6A 1H5UA 3KB8A 3RDPA 5ED4A 5DV9A 1X14A 1MB3A 2WJYA 4YFYA 5BSFA 3NO4A 4IG9A 2PYZA 3G7SA 3KELA 4OFZA 4GL4A 1XFDA 4HB0A 4XD7D 1L4KA 3TW8B 1KK2A 2Q5OA 5FIUA 2GD0A 1DJNA 4H1HA 4BU0A 1NOIA 4DQKA 2C9MA 4LE0A 3DB1A 3GFTA 2ECOA 3KPWA 4XDGA 2V1UA 1N6KA 5CA1F 4DLUA 4WXYB 1MNAA 1CS0B 4P9NA 4QDKA 4AC9A 1JFTA 2HYIC 1SOWA 4HNGA 4MVJE 3KTFA 3L9XA 2BKXA 2CBXA 1SQSA 3G2KA 3L0CA 1YCDA 5H0IA 3D43A 2VCHA 2XMBA 3SOPA 3LY5A 1YRYE 5EWJA 3RIEA 1MB9A 4LZLA 2DQYA 2AF3C 2F9FA 1C30A 1J6UA 5LWHA 4O29A 2WZCA 1YHZA 6NULA 2LIVA 3EIWA 1QG4A 1T43A 1ZGZA 2ZJ2A 3NORA 4GPIB 2P2CA 1HE4A 2OMKA 3DBHB 3FNHA 1C9KA 3IMCA 2R25B 4FS8A 1RWOA 5FLYA 1IWBB 4BP1A 2QAGA 3DBIA 4C08A 1JG3A 4D26A 2H8GA 1MF7A 1R64A 2QMOA 1TF5A 4ZEMA 2O2EA 1XCJA 3F6YA 2O2HA 4MQ4A 3UJHA 4ZA2A 1YB2A 1NQ5A 3ZXSA 5FPYA 2CXQA 4CL8A 5EJ5A 4U7JA 2XE6A 1PDWA 2WOOA 5JNRA 3VR6H 2WWIA 4TMZA 2B4KA 3HR4A 3GRFA 1EFRA 1V8PA 2NN3C 3NAGA 3LD9A 1TK2A 1XFAA 5ALPA 1L7MA 3Q0TA 4EIWA 4JNCA 1LJ8A 3QBTA 1URPA 1EFKA 4C4XA 5HX7A 1RXCA 1ISPA 4ENPA 3DM9B 2O0KA 1ODTC 2X2PA 4I55F 3ZHCA 1SC6A 5JW6A 1FLVA 4GHWA 2FZEA 5B4TA 5DHSA 5LD2C 2DLDA 5C1BA 3ODPA 2HCRA 2PCJA 1KPHA 2X1MA 2AOTA 5HJ2A 3U1TA 1AIPA 3FPEA 2H92A 3N2YA 1WMEA 5D84A 5U4QA 4FSXA 3WMWA 1XAJA 1QAQA 1IXZA 1RWWA 5J59A 1TKRA 1UT5A 3OTWA 2RK6A 4PZUA 1W8DA 3AQIA 4QOEA 1U0LA 4R8MA 1AUOA 2F3TA 1BAPA 2GBLA 4JUFA 3K09C 2G70A 3ZCSA 3TJZA 5MGNA 1A2QA 3FOCA 3EZ2A 1CQPA 1E4VA 2YZ2A 3BTSA 3HKEB 1QC5A 1KOLA 3E9RA 4AUKA 4MR7B 2COUA 3WIVA 1SXPA 1M1YA 5A5EA 2FFBA 1Y3CE 1ATZA 1P2DA 1XZCA 4PNEA 1MDFA 4ZEVA 4RNDB 1H2RS 3NM4A 1HFEL 1R8QA 1SKBA 2YHIB 5KVSA 3U49A 2R2AA 2PX0A 2WD8A 2V0CA 4IV8A 4CG0A 1L5ZA 4MW6A 5H82A 3TE6A 1D2HA 5ICSA 1PJ3A 4RQTA 2BELA 1EVZA 2BP7A 2EHJA 3AM1A 5K45A 4V0ME 1LVUA 4L57A 4PLFA 4YRMA 2PZAA 3PXEA 4KPUA 3V7UA 2HOQA 4RZ3A 1GZUA 3QBDA 4UM7A 5GQSA 5IAOA 2WB1B 3KV3O 1Z33A 3H6KA 4YCAA 1HDEA 5FOSA 2NU6A 1G3MA 3ZCPA 4ZYLA 3R7DA 3W7BA 1Y8RA 1MH1A 3DV9A 3OTGA 5CNKA 2F3QA 3ZXIA 3KZMA 1ZIOA 2IVFA 2JIZA 3HC7A 2Q4BA 3KUDA 4R1QA 2EQAA 4EY3A 7REQA 3LGAA 1EXVA 2E48A 3EUFA 4TSRA 3H2IA 5IASA 1Q0TA 4JI0B 2FOLA 1KQNA 4M1ZA 3LQQA 4QUBA 4U7WA 4FLFA 1TVCA 2ZB3A 4HATA 3EWAA 2WNIA 5CTAA 1PR5A 1RWPA 1WLYA 2BKLA 3BORA 3KXKA 5F7OA 2JGDA 3L18A 4I5DA 3FWNA 3FETA 4F92B 1SVLA 1ZMOA 1ZSYA 1KSJA 2G7MC 4MROA 4RVHA 3V2UA 4C22A 5H70A 4XYEA 3M1AA 4N0EA 1OOEA 5J58A 1ADCA 2GTIA 4PZ0A 3MJSA 2C94A 4LDPA 3M6UA 4K03A 4OQXA 1CUSA 2NO5A 1M0TA 3NIGB 5BOSA 4B7UA 3FVTA 1L1EA 3K96A 1GVNB 4GM1A 2W2KB 4FC7A 3RSHA 3VHXA 1E7YA 4L4YA 3EWSA 5KAMA 2D7DA 2WABA 3DTYA 3NT5A 4DDVA 3IA2A 4AZVA 1I80A 1HDZA 2UZ1B 1Z16A 3MM4A 4H0NA 1U0TA 5BQ5A 3GXBA 3UHJA 4EI8A 1FP7A 3R7NA 2GVZC 2RARA 1DV1A 1LPOA 1RRVA 2CFRA 1YA8A 3C97A 1V2HE 3EHEA 1VL0A 4P98A 5E4TA 5BSTA 2YWCA 3TNJA 1P0MA 4LTDA 4HS4A 3N70A 3HO8A 4CI9A 2YVQA 2JIMA 2V5VA 2ZR7A 4LKRA 4FMDF 2QYOA 3S5JA 1PZMA 1SKQA 1QH1A 4UTRA 1H93A 1Y34E 5DRTA 3R8FA 4YJGB 3KT3A 1Z4IA 4JUIA 3D6NB 3LUKA 2ECPA 3A3PA 4L1KA 4RVOA 5HKKD 1QBKC 2R6AA 3HY6A 3OEYA 4PY2A 5A71A 3T3IA 1UL1X 3WBJA 4D9IA 5IT4A 1L3CA 1GU1A 3IX7A 4E1BA 3QI7A 2OFWA 1BDJA 5KNBH 2J4FA 4HAYA 5JE8A 3NBKA 3MJTA 1AS3A 3N2IA 4TZ0A 1QOZA 2J5RA 1MXHA 3BX1A 5EP1A 2GLXA 3U26A 3UK0A 1LZLA 3ZU4A 5JJIA 1I1HA 1HORA 4W5JA 3MIIA 2AJLI 1Q0HA 3ZU5A 3GU3A 4WA8A 3UXHA 4NCBA 3DDNA 4HNHA 1E9SA 3EXEA 3JQ6A 3L9WA 4FZRA 5L3RA 5LD2B 2VT6A 4BNIA 5LB2A 1Y1KE 2FGJA 1U7OA 2WD9A 2YHBA 1RPTA 3P2IA 3WYNA 4RGVA 3W8EA 3QLVC 4BBRB 4XA8A 1KJ8A 2GT1A 2VA9A 3BQMB 4MB2A 2I6XA 3REQA 1OLSB 4J7XA 5A04A 3H4IA 3P9ZA 1TJ5A 4J16A 3IBCA 4YK7A 2GZRA 5I7FA 3T5AA 2IBMA 3TAUA 1B2RA 3G02A 4FEAA 2QTRA 3LVBA 4NQRA 2O8BA 1UBTS 4R40A 1HQCA 1U2GC 3K0EA 2CZGA 2PMCA 4PHTA 3QLJA 4CEIA 4ZT7A 1BDMA 3DBVO 1XMIA 2DKNA 2WJHA 5CJ2A 5DNUA 2ZZNA 1KMIY 2PVSA 2PSFA 4B3IA 5NLLA 3EQ9A 4FHEA 1GGEA 3BE8A 1XVAA 4PNHA 4WKBA 3RLFA 5HZGA 4N03A 1Q3KA 4HYTA 5B55A 1KI6A 3KJQA 4HYEA 4IV0A 4QSHA 3WHIA 4CL0A 2HA2A 3K9CA 4AJIA 4J3JA 1S02A 5LZ7A 1UBJS 2P2LA 3L01A 4GQIA 4BFUA 1FCJA 3GLGA 2QLLA 1A1VA 4UNQA 2EQ5A 2WNHA 4R1TA 2I6FA 3QVMA 4AF7A 4G8JA 1JQEA 4IOKA 2WF6A 3R3SA 1SPXA 1ST2A 1W6UA 2N75A 2WUDA 3FI9A 3GEBA 3L6BA 5FBHA 4CLXA 1E6CA 1PJQA 2BHSA 4MCAA 1QK4A 2BGTA 5E9WA 5LA6B 5KYXB 1SELA 2H17A 4AWXA 2LP4Y 3KSZO 2VUMB 1U99A 1YJBA 2OCKA 2I54A 5THQA 2XCRB 5L6LB 2IZ1A 3WDKA 4JX9A 1M5UA 3TW8A 3O47A 1G3UA 1HFWA 2FMKA 1REQA 3MAAC 3M5PA 1GTSA 1PGOA 1UOQA 2XVMA 3OMLA 5FA5A 4R2WA 4JGGA 1Q12A 2FPIA 4F6CA 4YV0A 2W2VA 2BYTA 1Y1SA 3B5IA 3P97A 1ZXXA 5DLEA 3WLKX 5JSZB 2TYSB 2C5HA 3F7TA 3A6FA 3DDCA 4YCMA 1CRLA 2FOXA 1DT3A 3F8TA 4UHKA 3WP1B 1J5PA 1LI5A 2VHXA 2QR2A 1XBTA 3GEHA 2DSNA 2A3RA 5ELMA 3UW1A 4B47A 5DM70 2W37A 2XCQA 3LRTA 2XEXA 3CN7A 1E8DA 1YBMA 3RUFA 3TNYA 3AR6A 2FN9A 4P3PA 2Q9AA 2Z56A 3R77A 5EJEA 2OILA 3KAKA 4W6QA 3A14A 1N3YA 1NNSA 1FA9A 6PFKA 2BCEA 2H9IA 3IERA 5KREA 1P7WA 3FOEC 4F2PA 2GJ4A 5AICA 3RIGA 3RU7A 2ZBFA 1GNVA 4M9XA 4LCEA 4NG4A 2HA7A 4WLVA 1ZGBA 13PKA 5BY2A 1M7BA 5LIPA 1S89A 3CKYA 4NSNA 3B2QA 2PRZA 4RQBA 2HF8A 3S2IA 3NFYA 4WDQA 1O57A 3W3AH 4KDCA 4ALKA 1I7PA 4DZZA 4DMFA 5JPDA 2B2XA 3AM3A 5AO9A 3OG9A 5JAHA 5FPKA 1M33A 4QRHA 5K01A 2F48A 1YCGA 1L1FA 4RADA 1D4FA 2KI5A 3VUEA 2XUKA 3L84A 4N8DA 4CG1A 5HIMA 2R5FA 1NFQA 1IY9A 4R98A 3ZDAA 1FU4A 2FUG6 2BGJA 2C5BA 2HLHA 4Y2UA 2BDEA 3SXUB 4DCVA 4R8KA 3CNOA 3G85A 3PQEA 2OPBA 4G5GA 1IATA 4GO1A 3UF0A 3ZV4A 5JHHB 1KARA 2IXGA 3SMQA 3K8QA 4N3GA 4YUVA 3CY6A 1MC8A 1ONSA 2OGZA 2IS2A 4L4UA 1IUPA 4D9GA 1BX0A 2RI0A 2ZRBA 5GVRA 3W78A 4Q7KA 1YJCA 3FBGA 3P0JA 4B8WA 2Q4EA 3ABOB 3MPOA 1XMXA 5LMNB 1SUDA 3F3SA 1Y6QA 1LK5A 2EW8A 2WT9A 2A30A 3AK4A 1Y3IA 3I72A 4MO2A 1WPXA 4WWHA 4X6YA 1G6Q1 1KP9A 1SCUB 1L7DA 2PX4A 3BG5A 1XK6A 3MK31 3S2UA 3QSYA 3HKEA 5HBRA 3SICE 2DUWA 3WISA 1DBQA 2W2LD 2Y0DA 1QRRA 2PN1A 3BD6A 3L7IA 1DXYA 5E4YA 4DDKA 4EAAA 5JEDA 5M04A 2Y4OA 3I62A 3VR2D 5DXFA 3VOTA 1QP0A 1MJFA 2FUG1 3DKVA 2BTEA 2YHIA 1Y1RA 1H3FA 2R4QA 3BUSA 3F9IA 1PWEA 4G0YA 4N3CA 2OCYC 2H9AA 1NU8A 2QTTA 2NPFA 5FWAA 2HR1A 3BHJA 1F5SA 3O3MB 4ZI2A 3EG5A 1MRZA 2GEFA 1LSOA 1W59A 1CF9A 2G1KA 2PKEA 3GEDA 1RMTA 4OO3A 3VNBA 2V7BA 4RULA 1QLWA 3H2GA 1CETA 2PQ0A 3A1FA 5J4VA 2O2CA 3WB9A 3WL6A 1KF0A 1H2ZA 4BWVA 3MTQA 2Q4TA 2XOKA 4KITB 2WU8A 5IF9A 5F1OA 1ZFNA 2QNRA 3DO5A 5CX4A 4BMPB 3E7WA 1TLLA 1VI6A 4EJ0A 4S05A 3Q8WA 1NC3A 2NTYC 4JKIA 4LOIA 4QWWA 2B37A 4B48A 1HQKA 1SJ9A 4HWOA 2O2IA 3TEMA 1HLFA 4LRSB 1J56A 2JJQA 1FY2A 1F8XA 2RK3A 3E84A 2O0HA 4UJ3A 3WLTA 4EO9A 4Z0TA 5CFOA 1RVV1 2QTVA 1UEIA 4M1EA 1NLUA 3TR0A 2FW6A 3FVQA 1SY7A 3OMWA 3OQBA 1TYZA 1Q14A