1S2OA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 at 1.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords sucrose-phosphatase
publication title The structure of a cyanobacterial sucrose-phosphatase reveals the sugar tongs that release free sucrose in the cell.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 93
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2004-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1s2oA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1s2oA02
3FM9A 5AM5A 5ALMA 2PKEA 5AW6A 2C4NA 4HGOA 1T5TA 3WKEA 2B8JA 5AM2A 4KNWA 1Z4QA 4XPZA 3PGVA 2RAVA 5ALQA 1ZJJA 1YNSA 3A1EA 3WKCA 1XP5A 1T9ZA 4IFTA 2B1QA 1O03A 5AI6A 2G80A 2NO5A 2YJ3A 3QU4A 3E84A 3SHQA 4BBJA 2WHEA 1XPJA 4Y2QA 3RFUA 3CZ4A 2ZG6A 3AR7A 5AKLA 1RQNA 3M1YA 5AW4A 3FPBA 3QNMA 5AK4A 3EPRA 3R09A 5AI9A 3W5AA 5AKIA 3R4CA 2ZBDA 2OBBA 4XOUA 5ALHA 3QUQA 4UW9A 1WPGA 2ZXEA 3I1YA 5AW7A 4YH1A 4ZEVA 5IT4A 3BWVA 5JJBA 3OCXA 5IS2A 2AGVA 4HGNA 3L8GA 3ZX5A 3CNHA 5AI5A 3QU9A 3S6JA 1ZD2P 3L0BA 4YCNA 4YGYA 1VJRA 5AVZA 2RB5A 4Y3UA 3KDPA 1EK1A 1TJ5A 1SWVA 4KX5A 4NWIA 3WK9A 4AS3A 1F5SA 2B30A 2GHQA 3DDHA 3U13A 1RKQA 4Y2XA 5ALXA 4DFDA 4AS2A 2R8EA 4IG4A 3ESQA 1RRCA 3RF6A 3E58A 4GIBA 1XVIA 2HX1A 5AK6A 2YBDA 1EK2A 4YIHA 2WF9A 4OFZA 4BEWA 4OHFA 4DW8A 3I76A 2JGAA 5AW5A 5AM4A 1ZD5A 4Y2UA 3ZVNA 3E81A 5ALNA 2YJ6A 1JUDA 5T41A 2D2VA 2FUCA 1NNLA 2WM8A 4UARA 3A1DA 2C88A 2Q4TA 4I9GA 2W11A 3ZWDA 2GHTA 2HF7A 3U7FB 3ZU6A 1ZRNA 2WFAA 4EEKA 3U7HB 5ALZA 3MMZA 3KOOA 1VJ5A 3AR2A 4FE3A 4FFDA 3ZI4A 1K1EA 3PCTA 5AVUA 2FPUA 3U19A 4Y2SA 2QYHA 5AVSA 3W5CA 2G0AA 4OD0A 4UAVA 5AHXA 3SMVA 4EX7A 3ET4A 1L7PA 3WK5A 2GO7A 4UMFA 4Y2YA 5ALPA 4BEVA 3QUBA 1Z88A 2C8KA 2B0CA 1SU4A 3N5KA 2FUEA 1U02A 1KYTA 3F9RA 3QUCA 1NF2A 1RKUA 1RMYA 1U2SA 1Z4NA 3WKBA 5AK3A 1N8NA 2WF8A 4NABA 4BKMA 4CF3A 2AMYA 1Z4KA 1L8OA 3A1CA 1RMQA 1RKVA 2EAUA 3L7YA 3SF0A 3I6BA 2YMPA 1J8DA 3ZVMA 2ZBGA 3WKDA 1WR8A 2HF2A 2X4DA 2HCFA 4F72A 2EATA 3U26A 2OYCA 2R8XA 3ONNA 4UMEA 1ZD4A 5ALIA 2HHLA 1Z5UA 1SWWA 2ZBEA 2YMLA 4E88A 3VAYA 4EENA 2YMQA 2YFYA 4UAUA 5AM0A 3WGUA 5AW8A 4JDPA 5AVYA 2G06A 2Q5EA 5ALFA 1Z4MA 4UU0A 3L1VA 1TA0A 3MC1A 3OCVA 1QH9A 3WK7A 3NANA 2B8EA 4KX3A 4C4SA 4F71A 4Y2VA 2AH5A 1QQ5A 1RLTA 1L7MA 3PGLA 5ALDA 3ED5A 2C8LA 1LTQA 4QJBA 3K1ZA 2FPRA 3OPXA 3DV9A 2I54A 2CFSA 1U2TA 3QU2A 3QYPA 2FEAA 3NUQA 4QQFA 1ZS9A 2O2XA 1L7NA 3FZQA 3B8EA 3QX7A 1Z4LA 1TJ4A 5AVVA 1PW5A 3MN1A 4RETA 3WKAA 4BYGA 1L7OA 1CR6A 2ZOSA 3NIWA 4BX2A 4FYPA 5AW3A 1QQ7A 2HO4A 4KN8A 3D6JA 1L8LA 4DWOA 2Q4RA 4Y2PA 3L5KA 4Y2TA 3J7TA 5AKXA 2G07A 2PR7A 2OA0A 2G09A 3UMBA 3WK4A 2NO4A 1Z4IA 3SLRA 4CF4A 3ESRA 3MPOA 2HDOA 3QU7A 5AW9A 4XQ0A 5ALVA 1TE2A 3GYGA 3QUTA 5AIBA 2W43A 3DNPA 1J97A 1QQ6A 2JARA 3KD3A 4I9FA 2R8ZA 2WF5A 1AQ6A 1YDFA 4O8CA 4L57A 2CN1A 2C9MA 3I28A 2HSZA 5AVWA 4J2TA 3ZWKA 3AR5A 5AW2A 3SKYA 2I33A 2JAUA 4UMDA 2AUTA 5AICA 5IT0A 3OCZA 3OCYA 4CNQA 4KYTA 2R8YA 3BA6A 1Y8AA 1QYIA 5ALJA 5AKGA 1Q91A 4B6JA 4MUMA 1LVHA 3U7EB 5AKZA 5A3RA 3UMCA 1L6RA 2P9JA 3B9RA 3QLEA 3M9LA 5AKJA 4BX0A 4HGQA 4EZEA 5A3QA 1U7PA 1RPZA 1YMQA 2FPWA 3QU5A 2HEGA 4BNDA 2P69A 5ALLA 4UM7A 1U7OA 2FDRA 3U7GA 4CF5A 2FI1A 3L0CA 4UATA 3HLTA 1S8OA 3N1UA 1YJ5A 5AW1A 2GMWA 1RMTA 4MWOA 3N28A 3UM9A 2CFRA 4ZEWA 3R9KA 3IRUA 1CQZA 5AK5A 5E0OA 2I55A 2ODAA 3AR3A 1RC8A 3WGVA 1RLMA 5AKKA 2RBKA 2IYEA 4PNHA 1N9KA 4BX3A 1VFPA 4HYTA 3KZXA 4DCCA 2I34A 1T5SA 4UM5A 5AKEA 3UMGA 2BDUA 3L0YA 5AI0A 2JAWA 3W5BA 4EX6A 4G9BA 3ZTYA 4RESA 4NAVA 1MH9A 4H1WA 3A3YA 1Z5GA 5ALUA 1YV9A 1Z4OA 2EARA 5AVXA 5AVRA 2G08A 5AESA 1WZCA 2P27A 1IWOA 4L6AA 5ALWA 4YCLA 1ZRMA 2GFHA 4XE5A 3L8EA 3NAMA 4GXTA 3L8FA 3NALA 2IOFK 2NYVA 1RQLA 2ZBFA 2WF6A 4G63A 4HGRA 2I7DA 3AR8A 3ZUPA 1ZD3A 2B82A 2O9JA 3FVVA 3EWIA 3KBBA 2WF7A 2I6XA 3OTQA 5AVTA 5ALRA 1FEZA 1RLOA 3IB6A 3SKXA 5ALSA 3WK8A 2W4MA 5AI4A 3AR9A 3EF0A 5FP0A 1Z4PX 1YS9A 3QXGA 3NRJA 5AKHA 5AW0A 4C4TA 4OCZA 3TLMA 3OCUA 4J03A 3L8HA 1X42A 3HYCA 5ALTA 2G1AA 3ZX4A 4YCMA 3FGOA 2FPXA 5AVQA 3ZW7A 2YY6A 4HAIA 4UU1A 5AKYA 2CFTA 5ALGA 2VKQA 3OCWA 5AIAA 1O08A 4L6CA 2IOHA 4UASA 2FPSA 3DAOA 5A3SA 4Y2JA 3ET5A 5AI8A 2JAOA 1Q92A 2IA5A 1RDFA 4HGPA 5ALYA 2P11A 2IOFA 3IJ5A 3QGMA 4KNVA 3PDWA 2B1RA 1Z4JA 3W5DA 3B9BA 3FPSA 4AP9A 2MU1A 2MSNA 3NASA 3KC2A 3AR6A 3EF1A 2YN4A 3N8GA 1WVIA 3AR4A 4NV0A 3P96A 1ZOLA 2YJ4A 4Y2RA 2RARA 4YIKA 5AM3A 3ZVLA 2HI0A 2PQ0A 4EELA 5ALEA 3WK6A 5ALKA 1NRWA 2YJ5A 2YMMA 3N07A 5ALOA 2BY4A 2HOQA 4C4RA 4CE6A 4ZEXA 4UMVA 3ZTWA 2OM6A 5AM1A 3L1UA 2QLTA 4BNDB 4NFLA 3SD7A 1S2OA 4JB3A 1TJ3A 2BDEA 2DQSA 3E8MA
chains in the Genus database with same CATH superfamily
1N0WA 1XVUA 2EJCA 4XQEA 1LLUA 2NSDA 4C78A 2H1CA 2AX3A 2NU7B 3A1VA 5EJIA 2D0PB 5DI3B 5DM70 1QGZA 4HAXA 4NCAA 5KWIA 4HGOA 1BRTA 1P5RA 3GUVA 1EWTA 1SXGA 1X7XB 3KLOA 2AFHB 2QJOA 3DLCA 4B40A 4IS3A 1FTNA 4JP8A 2GZAA 3FFXA 5K8JB 2P4SA 3N0RA 2IZZA 3AP1A 4R1MA 3NOOA 3IBCA 1GPUA 3B2EA 4TT3A 2IEAA 4MYUA 3RS4A 1KI7A 2XYPA 1F8XA 2HA6A 2WINI 1NYRA 3O5AA 3LUFA 3EIFA 2XMQA 5K6AA 5LXTB 3IE1A 3D3WB 1EVEA 2X8LA 3SMQA 5A6SB 4MPPA 2XMGA 1RCTE 1LUAA 3C85A 4HTFB 3RSGA 5BUQA 2L18A 4WRRA 1BMFD 1FXSA 1I5EA 2OV8A 3AUYA 3IAAA 3K6SA 1E59A 2H52A 3ECSA 4I7EA 3WJ1A 3EFOA 1DO2A 1S4MA 3SXPA 1IQRA 4LDJA 4RD4A 1AUXA 5AW4A 2IHNA 5BMVA 2JHGA 2ZQYA 2Y2VA 4JB8A 2HHCA 5JQGB 1R1DA 3SNKA 3NHUA 4L4XA 5IC4A 2FK7A 1O5OA 2WTNA 4G1UC 1NBWB 2XQJA 1C30A 1N6HA 3DZKA 2VL7A 4CG0A 2IEYA 5NULA 1ZH6A 3BMOA 3OZXA 1HMYA 1VMEA 3PQEA 2PGDA 2BUAA 5GV7A 4EHDA 1ZIDA 4N7JA 2IEIA 4E1BA 3PHJA 2G88A 3FGZA 2NU8B 3BJRA 5T8KC 3B3AA 3QNWA 3ETJA 2JGRA 2A9KA 3B70A 1Q57A 4ZOEA 2ZVQX 4UREA 3PO2B 1NA5A 1HE5A 3RPEA 4XIYA 5LLDA 3ESBA 4G4SP 2WSIA 5LZ2A 3IRVA 2P9ZA 3UC5A 2QM3A 2NT4A 2CCGA 3IR7A 4X7RA 3QENA 4GWLA 1NVAA 1W2WB 2QQEA 1SVLA 3DZFA 1XTKA 3M5DA 3R0QA 4J0IA 4RSMA 4DPKA 3ULKA 4LBZA 2ZU0C 2BJWA 3H86A 4I4CA 2BMEA 2VQ3A 5SY4A 4DR4B 3DUFB 5PGMA 1GKIA 1GAEO 3I4LA 3RQIA 3SIRA 2BN4A 2V7BA 2OO7A 1SWVA 5AQ1A 5BUSA 2PKWA 1NUSA 3U60B 4NWIA 1ZO8A 1IU9A 1N5IA 4HLNA 3TMYA 5DNDA 3SF8A 1DT3A 3AVVA 4IHJB 3HABA 5DX1A 1AA6A 1IQPA 4E6EA 3PXCX 4EO7A 1SBIA 4LC1A 4NMWA 3HKCA 2XY4A 5ICGA 1E5DA 1E20A 1PK8A 1T9KA 4Q05A 1H0RA 1M8JA 4ZARA 1NW8A 1E89A 4FDLA 3B7WA 5A2QA 4EKDA 4D4IA 3MINA 3D2CA 1TAGA 4ZAVA 5DN9A 3HKDB 1J25A 1K7XB 1UDBA 4LVUA 1YR8A 3EBPA 3JAWB 4DDTA 2MWMA 2AZMA 2ZS9A 3MAAC 5LNK1 1P2DA 2FR8C 1VKZA 2ZJ5A 1WDWB 4XR9A 2F9FA 1ZCBA 2XDAA 4R1LA 5TT1A 2WD9A 4F11A 5JZOA 1P2UA 2AJCA 1CY2A 4GEGA 2WWIA 4QWWA 3VPDA 1PJAA 3SX4A 3FROA 4MUNA 5J2TB 2V7GA 2ZBUA 3VR5D 4H16A 4Z54A 2FRDA 1HLGA 1MNQA 5D1HA 4WK6A 4DY6A 2FUCA 1C7JA 1E7MA 1U3UA 1V4BA 2WM8A 4YJ3B 1XP8A 5CG2A 2IXDA 1BCSB 1Z2DA 4BFLA 2HCRA 4P08A 2V7TA 3BBPA 1XZBA 4GL4A 1P75A 1PEKE 4M60A 5K51A 2VOEA 5IW8A 4Q6BA 1DIAA 1JYSA 1X94A 1RQXA 1ZOOA 3DBRB 1HFWA 1MN6A 3E1KA 3FFBA 1E63A 3ICWA 1T36B 3R3VA 4LNHA 2PL1A 4N0QA 1VJ5A 1OQAA 3P2MA 1U65A 1FTYA 4KQEA 4B48A 4ZGBA 1N5RA 1ZSYA 3H11B 3A6FA 3M6AA 3M4ZA 3OKAA 4MW0A 1VBFA 2VJCA 4QPZA 1PKXA 2GPBA 2VF5X 3ZE6A 5KX5A 3UENA 1WBDA 2OXFA 5AHXA 3CUWA 4MMYB 1L5HB 5FLXA 2VJAA 3ENNA 4PINA 2RHJA 3V8PA 5FI1B 4Q24A 1PSDA 2CW5A 2GASA 5C8DA 1X80A 2MCFA 1DXQA 3ZZTA 1YDMA 1RBQA 1CUSA 1CUUA 1ZN2A 3HE3A 1AUQA 1RU3A 2B2XA 4IIBA 3RTGA 3T7CA 4FCWA 1FX0B 3GRKA 4WDQA 1E3SA 3VR1A 3AEKB 1Z6GA 2J5BA 2NVUA 2C92A 3BRWA 3NHWA 4Y1RA 5T3UA 4AJHA 4PNZA 4P31A 1RYZA 2CLIB 3B6KA 3FBGA 2HBQA 4KNYA 1CLEA 4KIFA 5IJ9B 4Z4HA 1R8JA 3DE6X 1J8DA 1NW5A 2H5JA 5E3IA 1MGPA 4NP6A 2C31A 2VR1A 4QT0A 3BD8A 4CEIA 4ZCMA 4GH5A 2CL6X 5DIFA 3BDAA 2X4DA 4WZAB 2I6GA 3DMFA 3NBAA 4ZVOA 1H9CA 1WUYA 1GL9B 2FWPA 3BCHA 2BMJA 3C70A 3HWWA 3SM9A 4W82A 5EIBC 1TIBA 3GDFA 4EVRA 2P9EA 3N2LA 1H6DA 2A1TS 4DY4A 2ANCA 1TADA 4YQZA 5B1SA 2FDCA 2UZIR 3LOPA 4G9EA 3BXXA 4JODA 4LQ4A 3KHTA 4YCJA 4JNCA 4DMGA 1KNXA 3FCXA 2O8FA 1Q16A 3ONDA 4LSMA 4FC6A 3AHCA 5FOWA 4UTZA 4KPUA 4FBMA 1A72A 4HUQA 4XSHA 1Q15A 1UANA 2HM7A 4QVGA 4UBLA 3ZY2A 2GDZA 1EDOA 2YFHA 1P77A 2ZS8A 3EBLA 1DWUA 2AI2A 2J9XB 5KYTA 1DCKA 1PZXA 4QYIA 1G18A 3JATA 4JY7A 4C4SA 4NH0A 5ARCA 4C0SA 5KNDD 1QU2A 2PLFA 2A5JA 3B6JA 3LGSA 4Y2VA 5CA0F 4GL2A 2Z6VA 4L08A 2I4NA 4FFRA 4O1IA 3ROQA 2BGWA 3TLZA 2YBEA 5JD4A 4JWKA 3IR5A 3ZHUA 3TECE 2J5XA 1T34A 3K1ZA 2OHIA 3QWAA 4XIGS 5LN1A 3WOVA 1TTTA 1SVWA 1XTQA 2CJYA 2LDXA 3BCRA 4DMMA 1OF1A 4JLVA 3AU9A 5F51A 1T3GA 5K0SA 1W87A 4QQFA 4K03A 4AX8A 4N6OA 4Y67A 3FNGA 3OI7A 3WGQA 4IV5A 4M8IA 4R98A 4X8OA 1Z4LA 4XYMA 2AFIA 2R7KA 4E14A 4H08A 3GG9A 3MCZA 2Q5CA 3L43A 2ERYA 2GNOA 3MZ0A 5T57A 2UUAB 3EIOA 3FUTA 1E4OA 1YKSA 4ND4A 1ENZA 1KQ3A 2JA8B 2GAFA 1NTRA 1V35A 2FP4A 5G3YA 4F6RB 1XLTA 3IILA 4LXXA 3BXEA 3KHKA 1V37A 4F4JA 2ZCJA 4C3VA 2V3CC 1WZIA 4XSVA 1C4KA 4RTJA 1FTGA 3DOOA 2GDJA 2NXEA 3JZAA 3QU7A 4YQEA 5JG7A 3RBAA 1W85B 4O4IB 4Q82A 1Q12A 4JVMA 4ZP1A 5IJAA 1EFDN 2O23A 2A86A 2IIPA 3MQ2A 2V7PA 2JARA 4YEDA 4DCUA 3BF7A 4I9FA 5FH9A 7ABPA 4WZZA 4G5SA 1YDFA 2GBGA 2P91A 3K7EA 1AOXA 1UK8A 3RVRA 3AVYA 2VHVA 3JD4A 4XI9A 1BIFA 1HEIA 3IOYA 2WD7B 5DCLA 3WJ7A 2JG3A 2CZCA 3KQSA 4FR0A 1KF0A 3AXSA 3HJBA 1QYDA 5LP6C 5T4BA 4BO1A 4J2TA 1XMJA 3P94A 4DWJA 3LUAA 3UJHA 2HQOA 4QX6A 3RG8A 4A3SA 1UM8A 3UPDA 3RBVA 4FI3F 4L78A 4AFNA 1WMAA 5BOSA 3GTQB 3KYCB 4DVJA 3JWGA 3UWKA 1B6SA 5A4MS 4R69A 2R8YA 1XCMA 2XZTA 5HFJA 1VYHA 2ASEA 2YJTD 2CWWA 3AIIA 3GDHA 4DYDA 1ZVKA 5K0CA 2X3UA 1Z83A 4PN3A 2PKQP 2Q9AA 2G9VA 1R16A 3FCAA 3IVRA 3K5IA 3UXEA 2QZZA 4PF1A 1R27A 1OH5A 1U8CB 3P2OA 1LVGA 2CXXA 4MUMA 3FCYA 4B6JA 3HOZB 3K9CA 3U7EB 1KMQA 1JKJA 1Q17A 4QATA 4YJHA 3NHJA 5AXCA 4GI7A 1T8PA 2RAPA 2XAAA 3N75A 1H9BA 2Z2XA 3YASA 4B7AA 1FJHA 4EZEA 3R6WA 2Z3WA 1WO8A 4O2RA 1SPXA 4OB8A 4V02A 4X7BA 3KR2A 5G3ZA 2FPWA 5H0IA 5DTJA 4RGVA 2R25B 5HIJA 1PE0A 5IABA 1VZ3A 1ID8A 2RJNA 1JN0A 1V8OA 2O7QA 5DW0A 4P80A 4DBLE 2I3BA 4BXOA 3C2QA 2H4FA 3LWDA 4ILEA 3ML1A 4DRYA 4P84A 2IU3A 3M5WA 4HH3C 2JEYA 1T8UA 5FOVA 2Z04A 3HV2A 1YK0A 2ISQA 2GMWA 2WWGA 3D7KA 3H75A 1JT9A 1M8GA 2O1SA 1LXCA 4RVGA 3VOTA 2MDTA 2QX4A 1ID1A 2QYSA 5JPCA 1T2VA 2E6KA 2XDQB 3IRUA 4ECEA 2OBLA 1FFBA 1JBQA 1H1LA 4AYXA 1PWEA 3KUCA 3N0XA 3IDAA 2IHVA 2BLLA 3G8YA 3QKRB 4P35A 2VJQA 2FZKA 5IS2A 2FLWA 3SQDA 5JWOA 2GCNA 3GH1A 1CVLA 3T1QA 1O87A 1QHIA 1M1ZA 5F52A 4JLPA 1E0JA 4FCCA 4P0TA 3ZY5A 1YFZA 1GARA 1PR3A 1B6RA 3PE6A 4PONA 4HUTA 5MN5A 4OPMA 4NCHA 4KK4A 1N6KA 3T5MA 3A1NA 5FR1A 1JEJA 2E4UA 5GJCA 1GYQA 3PXGA 4P4NA 3EJ6A 3PHLA 1P9RA 3A3YA 4FEGA 4RPIA 2JBAA 4C0JA 4B8ZA 4TZKA 3KTAA 4MS4A 3SKVA 3VR0A 4WXPA 3NHBA 1NUTA 1U2DA 2R97A 3GJTA 2TRSB 4TTAA 4A3GB 2EFGA 3AY0A 1PQPA 1PSZA 5L3RA 4OYLA 3EFHA 2DJ5A 5EQFA 3ES9A 2BFMA 1Z5PA 2C2KA 1ULSA 3EE6A 4BFYA 1NYQA 2XKBA 4GM1A 3D1JA 2R5WA 1HNNA 3PL5A 2D0IA 4CODB 3U3MA 4RSGA 1FS4A 2IF2A 2X58A 3TKLA 1G8AA 1GPDG 3OVMA 2X0EA 1AKRA 4U2CA 2OTCA 1AN0A 4YAGA 1PP4A 1SA0B 2YWGA 2PH3A 3MLBA 5K4AA 2NVBA 5DLYA 3VHRA 4LRXA 4X6LA 1U31A 2GK3A 1G2IA 3PX3A 5EZ5A 3V48A 4YJ2B 3RIGA 2RIPA 3ZHXA 1Z17A 5HKKA 1MAUA 2B9VA 5G0VA 2P7HA 4E5DA 1CEXA 3QELA 1USGA 4CDNA 3ZZUA 1QH8A 1B8UA 1ILEA 4CPDA 2GBCA 3PXXA 1M5UA 4BC0A 4LJRA 3LDGA 4LN1A 3WFJA 1YVUA 2NPIA 4FOPA 4GFDA 3UA3A 5J47A 5A4DA 2PQMA 3TX2A 4C4TA 4W9MC 4PZLA 4BLPA 4J03A 2QVLA 5KDDA 4JI0B 1ORRA 1OCEA 1I3NA 3OQNA 3B2NA 1I3KA 2DPGA 3PITA 1CNEA 4P34A 4S04A 3OPVA 1E2KA 2DQ4A 2ZDGA 3CRW1 5BN5A 4P6VF 5ECWA 4EG5A 1LPOA 2CFTA 3GA7A 1F38A 3EGWA 1EI9A 1QU3A 4QXOA 1Y9EA 2VF8A 4CG3A 5HYVA 1NJ5A 1DBSA 4ARVA 1E1QD 1E3EA 1MQSA 1Y5IA 4Z4FA 2VF2A 1LWNA 3SZRA 4D41A 4DADA 1M34B 4K46A 4MW4A 5A3SA 5A3JA 1JA9A 1GR0A 2P2DA 4C3OB 3OOHA 4TMWA 2F1RA 3LKDA 5AI8A 2YWEA 1G8PA 2DFNA 4NICA 3KZOA 3WLTA 4A8JC 5ARBA 4J3FA 4TUYF 3NBQA 4OGKA 1EK6A 5K3BA 4TLMB 3ZLTA 4BJ6A 4FE7A 5ITZA 1JEYA 2PKRA 2P11A 3BJZA 5CXSA 4OQDA 2J4DA 2QRQA 4ND6A 2HSWA 4GKKB 4MV0A 3LD9A 1W96A 5FWDA 2JIQA 3GFFA 3VR5A 1GZHB 4RQAA 1E7YA 2GTPA 2WMYA 4O0LA 4YRLA 3OUTA 4O2BF 2Y1FA 1GNTA 3MJHA 4M0CA 3JYNA 3JQBC 2QDXA 2AA3A 3GN1A 4N3CA 4XUGB 1TQ2A 2XQFA 1AZSC 2BT4A 2J0QA 4JI6B 2RB4A 3ECAA 3G68A 2B2CA 2DKNA 2GD2A 3OWHA 3THRA 4GVLA 4L51A 4G1BA 4I5GA 3P97A 4Q7LA 1ORVA 3ANYB 2WHYA 4MLCA 2YMMA 4C4RA 4F3KA 3IB3A 1DDIA 1D9ZA 1MX5A 2XSZD 3TGWA 3ZY3A 3W2IA 3CEPB 4PHCA 4IV0A 1FQJA 2MSWA 3BWDD 4LF9B 3K1TA 621PA 3L7NA 4LRYA 4AU1A 4O5OA 2FN9A 3SJCA 3C7CB 4JU8A 4TKUA 3V34A 3WBBA 1K4MA 3GB9A 4WHMA 1JXAA 4UPDA 1L1FA 4AF7A 2F1OA 3IP5A 1GCIA 4PLCA 3R5FA 5I9MA 5CA1B 2NQ8A 4L8VA 2WUGA 3A1UA 4IS2A 4TXNA 3SSOA 4WY2A 4X1KA 3DC2A 2P1ZA 3LDAA 1XEAA 4DM4A 1Z4QA 4L73A 4QUBA 1W35A 4MRMB 3HKEA 4OUDA 1QZZA 4K6FA 2WTMA 1DCFA 4UHDA 4EAAA 2BFAA 3HR8A 4G84A 1G4HA 1WB4A 2CBGA 2DT5A 3BAZA 3CZCA 2ORIA 5LQSA 5JTTA 3E9EA 2BKEA 5CXUA 2GT1A 1K89A 1Q0LA 2WE8A 5I4CA 4AKIA 1E92A 2JFBA 1E8MA 1JR6A 3MXTA 2QMHA 4PQYA 5FBQB 3CF4A 3I64A 2F59A 2FJPA 1VL0A 4KXWA 4RAOA 4MWCA 3A2NA 4NZYA 4N3AA 2CV1A 1MG0A 3C0KA 5F77A 4YUWA 1VXRA 2QE6A 4PIVA 5B1YA 1VSVA 3UB4A 3AQ4A 3LPDA 2FR0A 1LV7A 1OV4A 4RK1A 1SOVA 1SB8A 2PZJA 4TYNA 4RMNA 1FFEA 3FPLA 5EJGA 3NTLA 5AKIA 5K05A 2JJ8A 1BCRA 3JQ8B 3MUOA 3WWPA 1RJ9A 2BR5A 5G0WA 2P4HX 3CRNA 4AMBA 5L3QB 1W4RA 3A9SA 1WPGA 6YASA 5CT8A 3I1YA 4NDNE 4WFKA 3IKTA 4DRXA 1MHPA 2B99A 4MUFA 2KQUA 3Q3GE 3N2IA 9ATCA 3ZZ1A 3FWKA 2LZ0A 3FJYA 2MMGA 3IQDB 1N9GB 4HGNA 4E4YA 3EBOA 3UV7A 2EJTA 5GVRA 2YZGA 1COWD 5JSYA 2ZWMA 5SZIA 3UJNA 4EF6A 2BMVA 1HA3A 2EBHX 2ZYDA 3QU9A 1P1JA 1ZD2P 2ZJYA 3AEUA 3G0DA 2OLJA 3IXLA 3LBFA 1AN9A 2WJJA 3IPCA 4XX0A 2BBWA 1VRCA 1YZKA 2BE9A 2OKGA 4QC2A 4HX5A 3V1LA 1IM2A 2PT7A 1U2EA 4QNRA 1TJ5A 1J21A 3IIKA 1OUMA 2BEVA 3KWJA 4JITA 4AP6A 1I0IA 4B47A 4ZC8A 1QRUA 3TIIA 5J40A 3GZTB 1H0SA 1VE5A 2D62A 3AUAA 4RX1A 2Q50A 4W9NA 4Y2XA 4M1SA 3VPBA 4QODA 4ZHQF 1L4NA 4H6PA 1HNWB 4FB4A 5D85A 1JL3A 4IG4A 4LYDA 5I9BA 1RRCA 1CZLA 1ZUWA 3DP7A 1Z8FA 3T99A 1Q95A 3THYB 1XVIA 3R3JA 2HX1A 3OJWA 2A5LA 1G42A 2OC4A 4BMSA 4JAVC 1VMAA 2WF9A 1DWPA 1TWHB 4ACAA 4QTZA 3ADDA 3TTSA 3H3XA 4DWVA 2Q0SA 2WK1A 1OREA 2MSEB 3ROTA 2XCUA 4V0MA 2A1TR 3BMNB 2O0JA 3HPQA 5F35A 4DV1B 2Y67A 3ZZ0A 1V9LA 4N03A 2Q4BA 3R9XA 4AG6A 1BS1A 2K5UA 2OAGA 3KOZA 3T5CA 1YF3A 1YE3A 4PHFA 4W8OA 1II8B 2GYVA 1XWIA 2FPIA 3GLHB 3RHTA 3ZEAA 5KYKA 3ESCA 4C2BA 4OAQA 2PL5A 5JE8A 1SU8A 2K7ZA 2IPOA 2QJFA 3DH0A 1LKZA 3IKMB 4I4TA 4GC5A 2A67A 2HJHA 1EUDB 4BO8A 1XMVA 4UBNA 3VR2A 4BNVA 4YAIA 3FDFA 2YXEA 3WICA 3M70A 4DRZA 3BTSA 4R3UC 2WQZA 1T26A 4HY3A 2FEXA 1D4OA 1G5QA 2I7CA 3AB3A 3CYFA 4XWYA 4IV8A 4R7TA 1BD3A 2Q8QA 3ZOZA 5ECGC 3TIGA 3T1OA 3W5IA 1BXRB 1TIKA 3LPNA 3GVHA 4W7HA 2PG3A 3IPAA 1P9LA 1SUFA 4KSBA 4AUKA 3ND5A 4NOKA 5K8VA 2Z5LA 3PIDA 4Y98A 1CIPA 3M6WA 4OXNA 2DSTA 3DEIA 4I1YA 3VR4H 4R6XA 2PUAA 3TQHA 1U9IA 4XGKA 4A6XA 2HMWA 3A3KA 4OMUA 1DKQA 2PKXA 1YCGA 3MBKA 3QYAA 4JJZA 4DT1A 1V48A 4JLAA 5CU7A 2VXBA 4P22A 3A1CA 4NG4A 4ZAGA 4IEFB 1HZZC 1NNUA 3CX3A 2Z83A 3N0VA 1U8AA 3QK7A 4MVJG 3H2ZA 1O58A 1H22A 4RVOA 5AJVB 4DV5B 4R2WA 2MR6A 3DWGA 3E5RA 4H3VA 4QFBA 2XA9A 4OOFA 4L0MA 4MCIA 2AKYA 2FG7C 4R6WA 4BFSA 5DLQC 4ZHQA 4N8DA 5DBEX 3A6ZA 1DG3A 1C8KA 3ONNA 2C58A 4V0NA 4Q16A 3ZU4A 1BU5A 4C7OB 3BPSA 4M0MA 3LA6A 1DCMA 2JLXA 4RZ3A 1MBZA 3U0BA 3TJMA 4D5EA 2PHZA 5C8XA 1YBFA 3FYUC 4K81B 1NIJA 5EZYA 1T91A 1XT6A 3PRHA 1VQ1A 1W8DA 2JRCA 3BWMA 2O4UX 2RGAA 3QPUA 4J7CA 1JQBA 2VSFA 4X63A 4CMEA 5JCOC 3OJCA 4MMXB 2GM9A 2O19A 3DZHA 3BSWA 1P1RA 3UHFA 2VHYA 4BECA 1JHQA 1XU7A 3SYMA 1M8FA 2PU7A 1PVDA 4LYEA 3RD5A 3FYUB 5CDFE 2BELA 2FW1A 2AH5A 2ZR0A 3CH7A 2OPBA 2J6BA 2XQIA 3MELA 3UK7A 1YC2A 1E1LA 3W8FA 3WRXC 4EAQA 3B5IA 4JP2A 4KLNA 2XCTB 4KO3S 1KFCB 2ID7A 2X1HA 3WP0A 3HYSA 4CBVA 3KL4A 4J0CA 3S2YA 4IIDA 1ADBA 2WFZA 3C16C 1N2CB 3C3PA 3KQVA 3KB2A 2IBMA 4WCFB 4RFSA 3RYIB 4B3XA 2H92A 2QQFA 2XOKD 2H4ZA 3L7DA 4HFRA 5COAA 4RACA 2A9PA 5EHNA 1E5VA 4L5BA 3FZQA 3D2BA 4KO2S 2HJVA 4HQOA 3RANA 1W47A 2OE2A 1TKAA 3D4BA 4JOBA 4MIOA 5B58T 3RKRA 4B3CA 1KEEA 3TWOA 2Y4OA 3H1AA 3JQAD 5KNBA 4X66B 2Z4RA 3SEAA 4X3OA 1XB2A 4MQEB 2JCSA 1RW4A 4EW2A 2O1XA 1EGMB 1NLZA 1XJWA 4GMXA 2BGMA 1QFYA 3ROKA 2R8OA 1O8BA 3T9BA 5DGHA 3ZCQA 1FNDA 4BGEA 5K4GA 3E23A 2QRVB 4BY7B 2XYQA 1KETA 1RXCA 5A4AA 1WSDA 3CPJB 3EX7C 4ZI2A 1JR3D 2ZAGA 4IIUA 4NYJQ 4PZZA 5EEGA 1DOHA 4C01A 2ILTA 3N58A 5AJWA 1LI7A 1U9ZA 1MU0A 1WMDA 1XE3A 3WK4A 5ESDA 4XD7A 7ADHA 5LZ4A 3ZBTA 1T3TA 1OYVA 2NO4A 2QAGC 2V8BA 1RAIA 3PGMA 1B23P 2JK0A 5EJ8A 1FNSA 2ECFA 5B4VA 4AYTA 1P7VA 1ZMBA 1T0IA 4B6OA 3BXOA 3QYJA 2Y68A 1JTEA 3HY4A 4GR5A 5A9TA 1SC3A 4TLLB 5CMLA 4ZICA 4K1XA 5A4FS 1MHTA 4CEHA 3GWGA 1CFZA 3L05A 4NFSA 1ST3A 2ZTMA 4KGVA 4YDSA 3GRZA 1G4UR 3LH5A 2NXNA 4YJFB 5FV7A 3QUAA 5HK8A 3U31A 4E2WA 3KQNA 4FOSA 4IUYA 3SYTA 3E9CA 5KJ1A 1GL6A 2Q28A 4X8HA 1E1QA 1PLKA 2EW2A 1PGPA 5H3LA 4CGZA 4NAUA 3HI6A 1UDCA 4Q01A 3OPYB 4M0KA 5EKUA 5BQ5A 3HJFA 3SKYA 2JAUA 3RVKA 2G4LA 3VJLA 2QRHA 2AUTA 4BLQA 2Y77A 1TZMA 1Z8HA 2GZMA 2PS1A 4CM7A 1KE1A 1TKRA 1D8TA 1DMRA 4DJTA 1VIVA 1PQWA 1K7CA 3VO9A 4BBZA 4JBXA 5KYYB 4G0QA 1C3LA 3GTGB 4IDDA 4D6YA 1XMIA 1MJNA 1JEQB 2B20A 2Q8NA 3KOUA 4OJTA 2AEMA 2RC6A 2FMIA 3HCPA 4BZQA 4YY3B 2BFCA 3L4KA 2P9YA 4L3OA 2V3VA 4PZCA 2M32A 4GAEA 3IUJA 1IONA 5IP5A 4OO3A 4DCMA 3VJMA 4YMTA 1DEOA 1LTHR 3W3AA 4B2PA 2RCNA 5HQ3B 5B5SA 1F7UA 1NDUA 3B9RA 1WDMA 2DWQA 4C7KA 3FNFA 3OWXA 3SR0A 4P4SA 4AM8A 5C1DA 1U8TA 2VI5A 3CLRC 1GNRA 2JHPA 1ADGA 2W8BA 3KV1A 3DAHA 3NJ8A 3FTQA 2HNAA 3BB4A 1K8QA 1PYOA 3UK1A 3U9TA 2XSZA 1W5FA 3WMGA 4CF5A 1YIAA 3OFKA 2QQ5A 1UC8A 1NVFA 2DVMA 1LLQA 2EOAA 4OBWA 4PYLA 3V2IA 4F45A 1CF2O 4ZMRA 1R5OA 2Z2IA 3E3MA 1DX9A 4KXYA 4TQUS 3L2OB 5HKAA 1NQ5A 1I1HA 3IVAA 5GOZA 3WDLA 4J49A 3EQ7A 4K5QA 2TMKA 2XMDA 3GT4A 4J07A 4LIPD 3R75A 1UL1X 4MGIR 3R9KA 3W8EA 4DHEA 1HLPA 2UXDB 4K2HA 2JEOA 1WXFA 3HQ4O 3M6MD 4NMMA 1QAOA 1YL7A 4GOOD 3GXBA 3H16A 1K7EB 1TMGE 3AC0A 2AB0A 2W6JD 4J1TA 3D4OA 2RD2A 5HKOA 4WXYB 5E4JA 4JLJA 2ZIZA 3IESA 5SYAA 4CM8A 1R18A 3S16B 2FKAA 3GL9A 5CCXA 4NONA 3NKLA 5H5JA 3UCFA 3UT0A 2HRBA 1ZQ9A 2QT9A 1MAWA 5L6LB 4UM5A 3U3RA 4EYEA 5KVCA 1B14A 2HXGA 3QE4A 5GPBA 4DIBA 1A5ZA 4FDUA 2BONA 3ZJVA 2NU6B 4LJSA 4YI5A 4DZZA 3T3EA 2VYVD 1NVVQ 1DB3A 1WD7A 2R8RA 4IXTA 1WHSA 3OJOA 2O52A 3A2LA 2BHNA 1GRNA 1T0PA 1Y7PA 4MVJH 3VPFA 1NDQA 1JT2A 5AESA 2D6FA 1UMBB 1ZHOA 1B26A 1I1QB 2NNWB 4AQDA 4KUGA 1AJEA 3G0CA 1YRWA 10MHA 1V16A 4TRMA 3AB8A 2AOXA 4M7WA 3BL5A 4CN8A 3W0LB 4K6CA 3L8FA 1XJCA 3DO6A 1V1MB 5EJ7A 2IOFK 4MYHA 3C14C 4RF3A 4YX9A 4RADA 2R6GA 2RHTA 3FPKA 4FT4A 3H65A 3SQXA 1TDJA 4NARA 3ZY4A 3M3PA 2ZBQA 3P9KA 4LKRA 1LI5A 3AI7A 1S1CA 2O2CA 2Q0XA 5B37A 4ZO8A 5TQVA 2NZXA 2EQAA 4BRWA 4LK3A 5CH3A 1NXWA 3ELUA 5IPFA 3EGDB 3LF1A 3NWBA 2ZRLA 4MQMA 3TAUA 4UDOA 3TLJA 1L7RA 2A3NA 2VLBA 3KJIA 3ONFA 3SF8B 2GJ8A 1IJBA 4C43A 2JVKA 2AMJA 2JH3A 3V4ZA 1I01A 4CIVA 4KDEA 2V45A 2FWAA 2BKXA 2VJMB 3QXGA 5AT1A 5TC4A 4ZIRA 1NMXA 3D5EA 2BR4A 5AKHA 3K70C 1BQEA 5CM8B 4QQNA 1ZISA 2Q2NA 3HEBA 3HYCA 4LDQA 1RWXA 1RC1A 3GELA 1Z0JA 4GWKA 2FOIA 2F4NA 4AJJA 4LJ7A 3OFSA 2YY6A 3QYFA 4UU1A 2IS4A 1W6RA 1JIXA 1FFXA 1ZICA 1M2EA 1QBKC 4R54A 2WJVA 3FXAA 2BCGY 2VHJA 4K6GA 4JBNA 5B30A 3OT1A 1XQVA 2OXCA 3LIPA 2D4HA 3DOJA 3Q8XB 4R51A 4F1WA 3RUEA 1EUQA 1FB5A 3MD9A 1QUFA 3T3IA 3WV4A 5KOJB 4KQ6A 3HMQA 1K3TA 1IM8A 5JSQA 2D7JA 2ZYHA 2OZLB 2R751 1BXGB 2X7JA 1N3BA 4FD3A 4NFYA 4D79A 2NT3A 4XJVA 4MNTA 4ER3A 1Z25A 4URVR 1OB5A 3F9IA 2DKOA 2NUAA 3MAJA 2B94A 5E9JA 2NPFA 2VZ9A 4OQFA 4XWWA 4WN3A 2B1RA 4HN9A 5EE9A 5HM8A 4WN9B 1VKNA 1IATA 3O6VA 3ZIAD 1CULC 2WTXA 3V55A 3WADA 3URMA 3AEZA 2CVHA 3AKEA 3O74A 4M0DA 4B3MB 1WXEA 2J3KA 2XHZA 2QE7D 1ZJ6A 2YV5A 1Q6YA 3L6BA 3N8GA 2PZKA 1P6UA 2V74B 4N0EA 1EFVB 5E7JA 1H23A 4QU9A 1OI4A 1VLHA 1JDTA 2XQGA 4LQCA 1ZOLA 3HJCA 5JO9A 2WZQA 4L4RA 3VYSB 4WECA 3D1VA 5BNTA 2PKCA 3ZWOA 3P9CA 1NBMA 3GEHA 4RPHA 3TZKA 5I4BA 3CR7A 3LUKA 4HI0E 5CCBA 1PFKA 1G3MA 2NO9A 4DS3A 1BMQA 1GPMA 3A4VA 2TYSB 3ND7A 5KB3A 2WVJA 1L4EA 3DF7A 2RHMA 3PHCA 3KNZA 4KAAA 4ZQIA 3AW8A 5EE3A 4A03A 5E1BA 2B92A 1QGDA 2GS9A 4BNDB 1WCYA 2H29A 4NFLA 1LY1A 4H2DA 5KSPA 4KEAA 3SFVA 5BR8B 3CHYA 5TF0A 1UPBA 3C6ZA 3JQGA 1R0XA 3R7AA 3HADA 4U9IS 4EL5A 5CB4A 3CR3C 1L8QA 5AM5A 3CZPA 3GYBA 3VSCA 1BZYA 2PKEA 4D8YA 4D8TA 3CG0A 2IYFA 3RU7A 4EGCB 4E5NA 4MR9B 2Y0CA 4YRMA 5BV0A 5IYZA 1T3LA 4U8GA 4MV5A 3MGCA 1GCUA 3LP5A 5DU2A 2JBWA 3B1JA 3KETA 3PTAA 3VJKA 3E70C 3Q3EA 4TSKA 3RTBA 3OQOA 1TFUA 3O1IC 1SFOB 5EERA 4LMAA 4PAGA 2QN3A 3WKCA 3WTCA 1PK9A 3CJRA 3WYAA 4O4LA 4BBSB 1OLXA 1C4WA 1L0BA 2WP0A 1JU4A 1T1RA 1XTBA 3L8YA 3LUPA 4FFNA 2QENA 4OLFA 3ZD8A 3LM8A 1XPJA 2XMRA 2BUCA 4EF4A 1AZLA 2P68A 3EUWA 1B41A 1U1EA 3M81A 3ZI7A 4RMIA 3N2EA 3N59A 4HDNB 3ZK9A 5IXSA 2WQ6A 4C7MA 1ULZA 1Z07A 1F48A 3ITKA 4BUZA 2X42A 3CF0A 4YN3A 5C51B 1M83A 3O83A 1PV4A 2Q3EA 2JCXA 4JLWA 1FUYB 1UEXC 2WSSA 4G67A 2O14A 4D3YA 2VDLB 4KACA 2GFQA 4KQWA 3BB3A 1OFUX 2GZHA 1UPAA 3HLYA 4TKLA 1I1OA 1JXMA 2X9NA 5MFZA 2YRWA 3F46A 2PMFA 3MWKA 4L4SA 2SHKA 1Z28A 4DR7B 4JP1A 4DOMA 2FLKA 2IZOA 3BMQB 4Y6LA 1Z63A 2BKAA 1R4MA 1DKPA 3AIKA 2PMBA 1WV0A 2HXSA 5AR1A 3GJRA 1GGFA 1M1UA 3E2PA 3R23A 1K0FA 2Z2ZA 4IJUA 3RWMB 1Y6JA 1AQNA 1EJ6A 1Z2PX 2J0UA 3G5MA 5IKEA 1S3IA 3RTAA 2SKEA 4RXUA 1U28A 3O73A 3H5IA 5AI5A 3UTDA 1T2EA 3VO8A 3MLAA 1WXXA 4X54A 2DG2A 4D45A 1TYZA 2H4JA 2A0YA 4YCNA 5GM1A 1RYYA 1IY1A 1ND5A 3ED1A 3PCRB 3RUHA 4BS9A 1AS2A 5JYEA 1LF0A 4IKEA 5EP1A 3USZA 1O94C 2P5UA 3EG9B 3NYWA 4KH0A 3ZKWB 1WBBA 1BHQ1 3HA2A 3K0BA 4D4KA 1ETHA 1G60A 3FF4A 1OYOA 3MIZA 4ZXPA 4EP1A 3D8SA 1G19A 4KE8A 2XX3A 4Q39A 3URKA 5JMTA 3CPEA 3OT5A 1QE0A 4E08A 3NV9A 2FPGB 4BCBA 1V3VA 2NO1A 5K6RA 3AF6A 5L3VA 4ZU6X 1U0EA 2GTIA 4WUTA 3EQ6A 5HPYB 3GLIE 4DQVA 1VJ1A 2F48A 1RYBA 2DR2A 1P4AA 1TW3A 2YBDA 4PM4A 1SG9A 3C15C 4ZTUB 5DF1A 4V1CA 3MTQA 4ZREA 1Z08A 1EFPB 1IN1A 1UP4A 3A1FA 3FUCA 3I05A 1PRYA 3AF1A 3K1AB 2WKRA 4Y9UA 3W9YA 2WSYB 1FTWA 4YRNA 2XA1A 4KDFA 3EIQA 4DLTA 1ISRA 5IJWA 2B61A 2FN8A 1LW6E 2IUEA 2R6CA 2ZAYA 2ZB7A 1RD4A 3AI1A 5E38A 2RSLA 3OD5A 2R47A 1Y8ZA 3TI9A 1N0UA 1O95C 1W5BA 1RQGA 4URWR 4D0NA 2P90A 2QVXX 2ZDQA 4Y6GB 2A33A 1J1UA 1OBVA 4YMSA 1NSTA 5JAOA 3AIMA 4X65B 2PU5A 1X2BA 3KYDA 3LY5A 4WK0B 5JSUA 1NMQA 2VJDA 4E3ZA 4JEIA 3OFJA 4HAYA 2Y6VA 2YASA 3K9NA 1IRXA 1YJBA 3U0VA 3QE9Y 1AMNA 3U7HB 1ICEA 3NU1A 1RI3A 2G04A 3G9UA 1Z5NA 4L5JA 5HBGA 3ZI4A 4F6CA 1N33B 5AXAA 5A71A 4DQ0A 2IYSA 2NUTB 1F0KA 3I53A 3OTWA 4RFLA 3ZD6A 3SFTA 4K9DA 3U17A 4TYWA 4FQ7A 3MCAA 1OXXK 1TTPB 2EJVA 2HK8A 2VRWA 2YYAA 3PDCA 4G2TA 1PQ4A 3LT5A 5CNIA 2G0AA 3K70D 2BFBB 3LPMA 3RI3A 5FF9A 5IT5A 3R8CA 3TM4A 4G0VA 2FMUA 4V3BA 4H17A 1VJDA 4TTSA 3TQCA 1CC1S 3AZOA 1LC0A 1JDZA 1XA4A 4H15A 3SEZA 2FE1A 1OX4A 5BW6B 1CDOA 4KRXA 1X8XA 4L8YA 2B0CA 4TZTA 1SU4A 2WU8A 2OCGA 2VXCA 1I4TD 1KYTA 3LPLA 4Q1CA 5CAEB 4KE9A 4FN5A 2Y1LA 4DMRA 1CHDA 3LAWA 3EGIA 4AZ3B 3U61B 1ECPA 2XD9A 5J4VA 4BKMA 5L7WA 3IELA 2V7UA 3L4EA 2ZT8A 1CVRA 3D7RA 4MP3A 3BL6A 4F4HA 2YNMD 5BMVF 3RAEC 4ARIA 1RKVA 1JDSA 3P19A 5M3BA 3ISTA 3M49A 1T8SA 3ZBPA 4A15A 3S8EA 4FOLA 3RFFA 2ATVA 4BJ1A 2F8LA 3WLHA 2CK3D 4KLZA 4ZVNA 1NQAO 3S7ZA 1KJIA 1M6VA 1YNOA 5KSWB 5JNVA 2VC2B 4BY1B 3UFXB 3N2GA 4EY7A 2VFAA 2Y9MB 3ACCA 4CLHA 1Z5UA 5IDWA 3S2UA 2VZ0A 4CMBA 1BN7A 5F1PA 5H7XA 3M3YB 3HA7A 3VM6A 1F3LA 1P6XA 4HB2A 4KVAA 4B3IA 1C4OA 1KPIA 1MOQA 1TJNA 1UQTA 1I2DA 1P17A 2CNKA 3Q12A 4FSXA 2OMKA 4IIJB 4M1TA 3BHMA 1UT6A 4LOIA 3PQCA 4UDYX 3TQTA 1RWNA 3DVSX 2HLDA 2PL9A 1TA0A 2H5EA 3AYZB 3MC1A 3OCVA 4RQTA 1QH9A 5DH9A 5BWCA 3S68A 2M1XA 5TEVA 4HQ0A 1SXJA 2GCOB 2GBLC 1N25A 1I51A 4YUZA 2A1UB 2VYVA 4C4AA 2PQ6A 2HL6A 2DPXA 1O9HA 2ZQZA 3G8AA 1QQ5A 2PTGA 2X8WA 5AYVA 1H2ZA 1SC9A 3P71T 5F21A 3IA2A 3IX7A 2VG8A 1FUKA 4KAFA 3AY7A 1XWFA 1E4EA 2DPHA 4XGRA 1U2TA 3PC2A 2D5BA 5LQDA 1WA5A 2NUBA 4M9CA 4HZIA 1FNNA 1OIVA 2WIBA 1FFGA 4KXNA 4RVUA 2YHAA 3HLKA 3VZDA 5L4LA 1TO6A 1DEHA 4TKZA 4UJ3A 5GIPE 1JH9A 5EWJA 3TVTA 3OM9A 4UD2A 5IN5A 3G89A 4DV2B 3NMUF 1N78A 2J30A 1P1IA 1PNVA 1YULA 2PXHA 3ELDA 2DAPA 1IMOA 4YROA 3N0WA 1Q11A 2VXYA 2OECA 2ZITA 3GO4A 1E1RA 4L3VA 1N3YA 2EFEB 4LFAB 4B6FA 2P3QA 2FZEA 1I13A 1NMZA 1OBOA 2BF7A 3BXZA 1MFPA 3EWSA 4WBXC 4Y2PA 4A27A 4E5SA 3UGKA 3OE7D 2G67A 4BP9A 1BGVA 1XK6A 1RNLA 4GOJA 5K0EA 2YVUA 1CZNA 1WKVA 1BEZA 1G20A 1BYUA 2AHRA 4WBNA 1EUCB 2GCIA 1FFYA 4MAAA 4NZPA 4DUZB 2D7DA 1XL1A 2FUNB 4RIHA 4BNJA 2HDOA 3C1UA 2I80A 2ZRPA 1TXGA 4X1YA 2UKDA 3LBIA 5ESXA 4COKA 2O8EA 4R2LA 4XQ0A 4CM4A 4OXQA 3O8OB 3GYGA 5TMEA 3DNPA 4HPWA 1J97A 2CUKA 2X1MA 2PE5A 3T34A 4UEWA 2VTEA 1Y1TA 3TD9A 4EA7A 2H1HA 4ID9A 4RGBA 4AULA 2HFKA 4ZYTA 2E4XA 3OIUA 4H60A 6Q21A 1SRQA 2C78A 4R01A 1FDOA 2VDVE 1YDEA 3I28A 4HWOA 4UVEA 5I8WA 2QD1A 5JNWA 3ZCXA 4WPGA 1LF5A 2JGJA 3IE2A 4HNRA 4RY2A 5FADA 3LQYA 3VISA 2YWRA 3ZTTA 5KX5F 3FCCA 1JBKA 4OP3A 4E33A 5HP4A 1JDBB 2IPLA 4UMDA 3BZUA 3A04A 1NU8A 1XAHA 1ZXXA 2X2FA 3K30A 4XVUA 1JR4A 5IKXA 1GU0A 3OCZA 4BYMA 3RC2A 1NXXA 5MN6A 1NQTA 5T4FA 4KZPA 3NT4A 1SY7A 5GAJA 4P3YA 3F7TA 2Q45A 1T4CB 1ND6A 2JPDA 1MC8A 3FPJA 3FVQA 4DCTA 1DC6A 3E3OA 3IQEA 1KMMA 3ZIAA 4D0SA 2EFHB 4YAEA 3VV3A 1L7AA 1GDHA 2OFWA 2F43B 3LUJA 4M6WB 3ROZA 3V97A 2YKGA 1XZQA 5IM4A 4HFMA 1L6RA 2OC9A 5JD3A 3UMCA 2O07A 3FYSA 4JYMA 5REQB 1PEDA 3DCYA 4MR7A 2FN4A 4IH9A 5CXXA 3MFYA 1Z68A 1MD9A 1N36B 2DWUA 1XDWA 4DQXA 5HMLA 3PU6A 4F8EA 4DSUA 2ODNA 3L7OA 4FFPA 2YN2A 3L8MA 2H2DA 3LCUA 4P3PA 2IHYA 1B6GA 3KSUA 3FWNA 4I4NA 1H8HA 4AYBB 2EZ8A 2DT8A 2FW6A 2JGMA 2YJNA 5JAUA 3FTNA 2HWXA 2ZVPX 3H3FA 4Z86A 3U7IA 2ZE8A 1T8TA 3TLYA 3KSAC 1PV2A 4OLHA 2R1VA 2VJLA 3B48A 2GN2A 1J70A 5TT0A 1DRWA 1B15A 2WIGA 4BMPB 1QMPA 2GKGA 3IQFA 1EFKA 3ILHA 4WT7A 3SCZA 4BFZA 1N1GA 1ISPA 4D3FA 2IDJA 3CQZB 1CS0B 1G16A 2E18A 2ECQA 3PFIA 1ZN9A 5HIIA 1YQDA 2V96A 4H18A 1ZR4A 4RW0A 3NB0A 4EJSA 2I6UA 1WTCA 3TLXA 3AERA 3WXMA 1T9CA 3U44B 4Q48A 1JS1X 2FQWA 2XT9A 5FYQA 2JRLA 1X13A 4R1UA 5K0NA 3QW2A 4NPAA 2R96A 3T9FA 4E7OA 4AJ4A 1KC1A 2V7QD 4X93A 3DB1A 2FGJA 2JI8A 3K2BA 4D02A 1Y7TA 3I52A 4LF8B 2EZUA 1E62A 2NZYA 2ZIGA 5CK4A 3EOAI 3TPFA 3AVTA 3JWJA 1F17A 4RESA 2Y1KA 4TZ6A 4NAVA 4D4LA 3DULA 3IP9A 3E0XA 1B73A 1JV2B 3INYA 2VRNA 4HT3B 4TTRA 3S7TA 1ADFA 1CDDA 1QV7A 1YV9A 2YWBA 3Q6IA 4TT8A 3MYRA 2UU9B 2XJ4A 4YFYA 2WAXA 4AMVA 3WYBA 2AW3A 4ATNA 3HU3A 5TS2A 4IPTA 2AFRA 3ZIUA 3PO3B 2GFHA 2VZEA 1JAIA 3NS7A 5LVAA 1JHUA 5LJIA 1HL7A 2CB9A 3OE4A 4EB6A 2PUGA 1ZD1A 1G8MA 3Q11A 4MVXA 3STYA 3OEWA 3IMEA 4OXXA 4OQPA 3KQHA 2IW3A 4CEJA 1T0UA 3THWA 3HACA 4FGLA 4M76B 4V0SA 4EBFA 2HPZA 1E9AA 3IPRA 1FJXA 1OI7A 1QGUB 5ENZA 4RO0A 1JHDA 1YMVA 1WU8A 3O9MA 5M3FB 1L5ZA 3D8RA 1VG1A 4ER7A 4EG1A 4AECA 4S2UA 1FRVA 1PK7A 4TXJA 3ZHOA 2O2YA 3KZCA 1LV8A 2WHPA 1OZGA 5E4YA 4UNNA 2E89A 3ICQB 1FMCA 2RFLA 1CB7A 4KXUA 4RXTA 3THOA 1MORA 1I2AA 3DR3A 3L8HA 4MEBA 2C7QA 1VBNA 3ILSA 4RA9B 4W7IA 3T1TA 1OH6A 1TPZA 2BFOA 2R2GA 3GD7A 3FGOA 3Q87B 1JKFA 4M1ZA 4M9ZA 3L8ZA 2Q2WA 1P73A 5KMGB 5JMPA 1XUOA 3ZW7A 1MO6A 2F7SA 5EXTA 1TRHA 5AKYA 1UC5B 3MAGA 4F2DA 4LGMA 1C3JA 2REQA 3KZKA 4F5ZA 3DAOA 4W4TA 2ODTX 1UXIA 4EARA 4IXMA 5GONB 2X3FA 3JYHA 1XRLA 2C5FA 4MPDA 2ADFA 1TT5B 2BR3A 2PD6A 1H2FA 2IA5A 2ZJ8A 1RDFA 3GT0A 5CURA 3TJZA 3SS8A 1A9PA 1NJSA 1E3WB 2EFDB 1KZ6A 3S0JA 4FWIB 4X1OA 3WR5A 3L1IA 1ETUA 1OXMA 2QRJA 3QGMA 5TARA 5PNTA 3H2BA 5EP4A 5FLEX 3R5KA 4Q3EA 4YYZA 4KFCA 2VTKA 4MW9A 4UFOA 3R5XA 4EF5A 2WILA 2CNDA 3PZBA 1ZP6A 4ERXA 2PBZA 2XLCA 1INLA 1EB9A 3JQ9A 5EJFA 3W9BA 2IEDA 1R0WA 5JRJA 1CRLA 2V0GA 1NV9A 2FCAA 4TWJA 3AF5A 5JRZA 3J81A 4AY4A 4NYJR 1NF8A 1NWHA 1ORIA 1U11A 1V8BA 2P5TB 3G5TA 3LHFA 4OG2A 2P9GA 3FFAA 1HV8A 3B9QA 5EP2A 2OCAA 1ZZEA 3DTVD 1J49A 2PQ0A 2H2GA 3CTMA 1JFFB 3KLPX 3LBNA 4J3JA 4M8LA 3T94A 1N6LA 1QFXA 3DEKA 4HR7A 3TE7A 1IVSA 1R2QA 1M3SA 1DTSA 3N07A 1SULA 3KSRA 4Y0VA 1LK0A 5TEWA 3UMRA 1GU7A 1XCLA 5B4TA 5DI3A 1YB1A 1NL3A 2KHZA 3CIOA 3FHLA 1TF7A 4U63A 4Z2YA 3PPWA 4X1IB 1S2OA 1X7XA 4URUR 1C7RA 2AFHA 4EMTA 3A28A 4R41A 3WYCA 3O91A 3A9TA 1RVV1 1W9MA 3DW1X 3OCCA 5E2BA 3RUDA 3RYHA 4DG8A 4XDYA 1RPNA 2PR2A 5CRIA 4BFXA 1QJ4A 1QGED 4FB5A 2ODPA 4LY6A 5AM2A 3PHHA 1G5IA 4GO1A 4QYSA 4Z9FA 1Q0RA 4LFCB 1GN8A 2KMLA 5DHTA 4BE7B 1X1RA 2O7SA 3DGFC 1V9SA 3T8YA 4A3KB 3NKFA 4UVGA 3TFQA 3AP3A 4I9HA 1MEOA 4QPJC 5A4JA 3QITA 1C5KA 1A69A 3F6YA 1DL5A 3HB1A 3ZBQA 2I78A 2J3LA 3X0DA 4XIIA 2CGEA 2FHPA 1EZ4A 4L75A 1M76A 1MJHA 1HFEL 2WHEA 4JWTA 1E3DA 5LQMA 2XGJA 1WCMB 3QTBA 1PL7A 4N6NA 4P1ZA 4BDSA 3K5HA 2JJ1D 3EXFB 4WXHA 3RFUA 3MRSA 3OIVA 1Y6GA 4A5SA 5A03A 2ZG6A 4QTTB 2NM0A 5F1OA 1E7WA 3TLGB 4BFWA 4BUCA 2WB2A 1RQNA 1GTSA 2J08A 3VHXB 4AO6A 1SBHA 4PPGA 3MJVA 1KEKA 3NM6B 4CL0A 1XAIA 1G8YA 2GBPA 4GPTA 4WVFA 5DK4A 3M3HA 3S70A 2XD4A 4FGSA 1PNRA 2FGKA 5BUZA 4G5XA 5D01A 3DPSA 1LW7A 1NJ2A 1TD9A 1E6UA 2HEIA 2VN8A 2ECKA 3AINA 3FCUB 4KRYA 4OP1A 4PX3A 2CDCA 4E6PA 3WFIA 1E2MA 1R0KA 2WA1A 3E35A 1Z06A 1K5DA 3W4KA 3O4HA 3SC6A 5AVJA 1BRMA 2XUFA 4I4LA 4N7MA 4LXIA 2QOEA 5KVQA 2IUUA 2IEBA 5JJBA 4KQHA 1K5GA 2EHDA 3DXYA 5T8KA 5EAIA 1XMSA 1J5EB 1RWWA 4DIOA 1W4BA 3PT5A 3WB9A 2WHRA 4G5YA 1V96A 3DZJA 2QW0X 2XLBA 2XEXA 1KE2A 5HQJA 2VJOA 3FN4A 3MGAA 3WZ2A 2XNSA 5I48A 4IHJA 2D8MA 1J23A 1GUBA 1XK7A 5FNVF 1QKIA 1K9SA 3B12A 3OMXA 4O59O 1JIJA 2JKYA 3ZE1B 4KX5A 4KMRA 2BP7B 3U1TA 4QFDA 5C9ZA 4X62B 4G5GA 4Y9RA 5TQ0B 3M4NA 3UJBA 3WL8A 3U13A 2YV1A 2XXAB 3QJ5A 2HADA 1UZUA 5TGTA 1V5FA 1NVVR 1T8YA 2ZIWB 4ENPA 4DMUB 3GLFA 3NR2A 3E05A 3OE7A 3SLGA 3VMMA 1G9TA 4FYVA 5LMZA 2ZZNA 3TSAA 2HK6A 1RXIA 4LRSB 4JJGA 4REQB 1G41A 4LYYA 3WI7A 4F46A 3ZWCA 3AFGA 2XUZA 4JA2A 1XQYA 5B1IA 1PWZA 1MOPA 1XZJA 4AF6A 3DZGA 1K8XB 4GR4A 2F1HA 3H05A 3OLQA 5JVDB 1Z6AA 2OQ2A 5J2TA 3PEUA 4DM7A 3EVCA 5IT9A 1EE1A 4TV8B 3D8TA 1QIIA 4QHSA 4Q66C 4E30A 4YJ3A 4XWOA 3FNEA 4YB8A 1RXWA 1BCSA 2IE8A 5JXIA 2FR8A 2XWSA 1C0PA 1ACMA 3QX8A 5LKRA 2DJIA 2GETA 4GI2A 2YJ6A 4FC7A 3D8NA 3VBEA 4GPD1 4GDFA 1R4NA 1T36A 3CN9A 1EP9A 2GXQA 4D9EA 4M1QA 3RC1A 2DQKA 2VK4A 3LRPA 4PLTA 5D8DA 5J2UB 3M1LA 5DT2A 3PK0A 2W11A 3GPLA 3PUXA 2I4RA 3U7FB 3ND6A 5FB3A 4EWLA 2DUNA 1RQ2A 3PCXA 1P2GA 3ICEA 4EEKA 4YUAA 1M33A 5ALZA 3FZNA 3VKHA 3RVSA 3PQ4A 3AEQA 4LHEA 4MKIA 4RK4A 1PFVA 4RL4A 3PQ5A 4HATA 4Y2SA 1E6CA 1Q1AA 1L5VA 2QMZA 4Q3KA 1EHYA 1G291 2DWPA 3DTVB 4JLBA 4B0PA 2LW7A 5JAIA 4X94A 4V39A 3P0IA 3VA7A 3AHIA 2PVCA 4QNNA 4DMKA 4AJPA 5JXWA 1AMUA 5L3SA 4UXHA 3DL0A 2RGUA 3WK5A 4UMFA 2J0VA 5MN4A 3UMSA 3CZ5A 4IAOA 4ER5A 4P36A 2PGIA 4MVWA 4U7WA 1HDEA 5BVGA 3EMVA 3UBMA 5IK2D 4H0NA 4ILKA 3V1TC 1KSGA 1B2LA 4E22A 3PTLA 1K83B 3IUQA 2SICE 4AVYA 4CKWA 2OV1A 3AONB 4D9BA 3U7QB 1PHRA 2JNWA 3L9WA 2D3TA 1E1CA 3I1JA 3KSBC 1ZNYA 4WZAA 4MCHA 3IALA 2YVAA 5KHLB 1SUSA 2WMNB 5HF8A 4C0WA 2ZUTA 5IMSA 3ZVMA 1WLSA 4E5YA 4Q3OA 3HOUB 1HNZB 3JZFA 3IEPA 2D1SA 5WRFA 4DLPA 3JD1A 1CP2A 4CLRA 2FTKE 3RYFB 1MT0A 4HADA 3SJAA 4BGUA 2EATA 4I1VA 2JLYA 1I7PA 5DYIA 5LQRA 1O6BA 1Z15A 3GFOA 3L7MA 5AOAA 3F3MA 5JLJA 5HTOA 3MUNA 2VDUE 1Y33E 3I3SR 1DU4A 3D2AA 3DZDA 1P3DA 1UZLA 2GN0A 4XOIA 1IDN1 1E0SA 2A9QA 4UD6A 5B1DA 4E13A 2YMLA 5HK9A 1U8UA 3BIOA 3R74A 4F4UA 2YYZA 3M2TA 3EXHC 4FGUA 2YFYA 3SEFA 1HOXA 2QW8A 4KGXA 4RE6A 3UB2A 3WGUA 2IYZA 4C4YA 1WW2A 3RT9A 4IO1A 1JU9A 1NYLA 4OMDA 3U5ZB 1JDJA 4BU0A 1CJBA 1XTIA 3EHEA 4PCUA 1NVMB 1TJYA 1YBVA 4JIGA 3DLIA 3V2HA 1GTL1 1D6NA 2O06A 1C8VB 2R79A 3I12A 4QAJA 5CUQA 4RGYA 4C6RA 4Z7OB 3QVLA 2H57A 1HBJA 2EW1A 2Q2OA 3KEMA 1I4DD 2TS1A 5HNKA 5LYJF 3VZQA 3CA8A 4EK9A 2PXXA 2Z8ZA 4YR7A 4FNAA 4WXEA 1RP1A 3KIPA 3LT1A 1MO2A 3IXMA 3I32A 4NI5A 1GNPA 3VR3D 4US0R 1O97C 2ONYA 2GK7A 3OQIB 1JJIA 4YREA 3EVBA 2G7MC 4NJEA 2Y1CA 4GOXA 1NASA 4TWIA 3L6UA 1OTHA 2PBFA 3WYNA 4GOKA 1L8XA 1PR2A 4KYVA 1LSOA 3HB7A 4EJ2A 3LUDA 1GZSA 4MUBA 4B76A 4QGGA 4DDVA 3FW1A 1JE1A 2LP4Y 1ACLA 2OGUA 3V4VB 4CIYA 5HRUA 4FCVA 4BGDA 1XTJA 4BFVA 5KVVA 2VVTA 1VG8A 5LWHA 1L7OA 1T29A 4BVFA 2FJ0A 5C37A 2EG5A 2VAVA 3Q3IA 2X5KO 3PYMA 1WEHA 3GARA 4HAZA 3JQQA 1OXKB 1SBYA 3CF2A 2FA9A 3H2KA 2OD2A 3OZCA 4LMRA 5TQ2A 2CNOA 3DLPX 3TL2A 3X1XA 2DYKA 4W9RA 3S29A 1C2YA 1VIMA 4Q18A 4HVAA 2OT3B 4WZBE 5EUCA 5ADUS 1Y34E 4ER0A 2RG7A 3ZVKA 2VT2A 1OU4A 2Q3CA 3CNOA 3JQDA 1QH0A 1YBAA 3JALB 4ID3A 1ZMXA 3I5MA 4OM7A 1ZC3A 3DVQX 1G66A 5DOVA 1HX7A 1POWA 1W93A 2ZTUA 4UZFA 4FFBB 3ELYA 3P0RA 3ESRA 4OXKA 3R20A 2GB4A 3UF0A 2IU6A 5KKCA 2X0JA 3KT8A 3LS2A 1I94B 2IH5A 1R6DA 2IYRA 3C5HA 4I4TF 4K3UA 3WISA 5TMPA 4LPSA 1V1RB 3HWSA 1BDHA 4NC9A 3MRXA 4O0MA 1QQ6A 1LRLA 2QM8A 5ESRA 2PANA 3KJHA 2V55B 1GTRA 2PUHA 2E4AA 2OWEA 5B6IA 2A5GA 1BX0A 4BO3A 2V6FA 2VBIA 2QYTA 3U7JA 2PV7A 2ZUWA 3CRQA 1PZHA 5AHOA 3RFTA 2CJWB 3NC0C 4YV1A 2DGDA 1FXUA 2QQ0A 4KVZA 1NC1A 2I3AA 2W98A 4KI0A 2ZIUB 1NHGA 3L82B 5EGNA 1IY8A 2O8BB 5CVUA 1MJ5A 2I33A 3H04A 4B2YA 4CMAA 5LP6A 5AICA 3CY6A 4GBMA 4C4ZA 3NDPA 3OCYA 3TW8B 4PHGA 3D7NA 4O2AB 3U4QB 2WZBA 1NN3A 2FW9A 4O4HF 1DT5A 1OY1A 1K5PA 1OROA 3JVUA 4JD5A 1KK2A 3M33A 4MEAA 4N7BA 4U39A 3SOPA 5BN1A 4PPNA 1G8KA 2XNDD 4X91A 2VYND 4IIXA 2NSYA 1N5KA 2R4TA 3T1VA 5CX1A 3IV6A 4AZVA 3CEJA 4DA8A 1ZL2A 3PJDA 2CMFA 4IHQA 4GKVA 5AKZA 3WL7A 1YB2A 2LD4A 2FXIA 3EUAA 3HJTA 1LNQA 3BJMA 3N2YA 2B4TO 3JSXA 4AJIA 2AR9A 2H17A 3OUUA 3IVGA 3QXHA 3E7DA 3MILA 2VNSA 4J43A 1FYXA 2WWVD 4TMTA 1IN6A 1U7PA 3D0KA 1RLJA 2BTQB 3JQPA 1APBA 3ANXA 2M2IA 3RRYA 4TV9B 3LHKA 2W6ID 4HZUB 2EWWA 1RIFA 3AK4A 1K6MA 1TL7C 3NJ4A 1TLLA 1FXWA 1IAQA 1JSXA 1QH1A 4YP0A 5DNWA 3UJ3X 2WM9B 3U7GA 1HTTA 1RSZA 2M1ZA 1JQAA 4HMPA 4FE4A 4R40A 3AXTA 3ZS8A 4D4JA 4TLBA 3VUFA 4NDZA 2IY8A 2NXWA 5EZYF 5EJEA 2A14A 3WZMA 3ZHZA 1JEDA 1SUAA 1TTHA 2LPMA 3N1UA 4FXOA 4NBRA 3SR4A 5CR9A 3VYWA 4ENRA 4MWOA 5KS2A 4UQPA 5CTJA 5D7NA 3OY7A 3OEHA 3UM9A 4WY5A 1BJTA 3H0GB 1NJFA 4M88A 1J9GA 5E0OA 1OR8A 4S1VA 1U4SA 4ZALA 4AZSA 4N49A 1O1YA 2Q3JA 1OASA 4DF3A 2W71A 4JT2A 1P1HA 3MT0A 4MYDA 4RZXA 4RTLA 3EDQA 1JLLA 4LJKA 5FWYA 4ZN6A 5DYTA 3SDSA 1O0CA 4KW7A 3C24A 1P44A 2BEKA 3C39A 5DLEA 3S27A 3TO5A 5MFPA 1GUAA 4AMUA 4F4DA 2L2QA 1Q0ZA 1FQWA 1FVHA 3B85A 3ORFA 1NQVA 4WL0A 3LSTA 2PNFA 3TR6A 4G9BA 9GPBA 5HEKA 1FX1A 1BKYA 3SYRA 1D6SA 4CLEA 2OESA 1QPZA 1YRLA 4FUTA 1HRKA 1P33A 3JTEA 2ODQA 4KBFA 3TZLA 4TL7A 2VHUA 1JZSA 3H83A 2P27A 1XALA 3O4RA 1EVQA 4QSMA 4RSHA 5CFMA 1FW6A 4OX9B 2YZ7A 5TNXA 2ECPA 4HZGA 2R8PA 5C0OE 4MUXA 3IOBA 3KEOA 3NTOA 4MLZA 4GMDA 3NTQA 4HH4A 3IAEA 3PHIA 4ZAYA 2BZ1A 2D2EA 3SZMA 4CM3A 1L6IA 1MZPA 2VHQA 2YRXA 5C5DA 3CZMA 2AOVA 1R6XA 3AR8A 1G5TA 1ITZA 3PR2B 1RM5A 4FZRA 4IEEA 4RJKA 4JT8A 5K0LA 5K8LA 2VTBA 4JQSA 4RABA 1DE0A 3KAJA 4WKPA 4D9JA 3ZJTA 2WKPA 1R0YA 5FOXA 5D5PA 3UTCA 4G0ZA 4PO1A 4YXWA 3TFWA 9MHTA 1JDUA 3DT8A 2B37A 2QL6A 2RI6A 3A05A 3LDFA 4TXHA 4YT2A 4IGIA 3GJ0A 4ZI7A 3IB6A 3DL7A 4QUKA 5FPPA 4EZBA 1ZKDA 2CC2A 3ER6A 3KPWA 4BQEA 3SHFA 2KB0A 1ESEA 3BH6A 1HNXB 4NU6A 1UMCB 5IJZA 1YS9A 3BREA 1H3FA 2X2EA 5AUNB 3CSSA 3HCCA 1WABA 2Q2VA 4HH0A 2W70A 1ZW6A 4QQKA 1P39A 1R4ZA 4FD2A 1CUYA 2JW5A 3ILXA 4NSNA 5E2IA 2RHHA 5FLKA 3WL4A 5K2MA 5FBHA 4E46A 3TNFA 1QCYA 1ESNA 2BGUA 1YD7A 1ZN8A 7YASA 2O20A 4MW5A 1OH8A 1BVRA 5HTKA 4JLDA 3H7IA 2YOGA 3JQ6A 4I1SA 4ME6A 4HBZA 3PG5A 1L1EA 3K0HA 4NJMB 4DC0A 2AG1A 1RQPA 2OV4A 3TD6A 5JSZA 4IP0A 1IHXA 2IKSA 3BKXA 3EEFA 3GEMA 1FBTA 1K08A 1OLOA 5G4KB 4CV1A 3KKEA 4UCFA 2OK8A 2JI7A 3PFCA 1PD0A 2JS7A 1ZAKA 4ROTA 5LB2A 4E09A 2ID8A 4OGGA 1EWYA 3UJDA 1QC5B 2JFHA 4M83A 1D04A 3DF9A 4X5OA 3WGGA 5EMHA 2YZ2A 2QRKA 4A8JA 5F9HA 1ZL0A 1ZCJA 3TIXB 4BB0A 1Z4JA 4IJQA 1QIDA 2HU8A 1LDGA 2BL4A 4LE1A 5FT9A 4URYR 5CDFA 3U2QA 3KB6A 1C1YA 2Q1TA 4OHMA 2FZLA 4QE3A 4AWXA 1B42A 5I4KA 3NHRA 1K8ZB 1W52X 2ZI3A 1DJPA 2A9RA 2C2YA 2IE0A 1W4LA 1NFRA 4TS4A 1BSVA 1WXQA 3JQBA 3Q3CA 4R8RA 4KMMA 3E3AA 3QKWA 3V32A 1TVKA 1ULTA 2FYTA 1VLJA 1X7YA 5AM3A 4G3XA 1C1HA 4F5DA 1H3EA 3EGVA 1XAJA 4MWBA 4UHBA 2GEBA 3WHLA 4NDAA 3LV8A 5KYNA 4RCZA 1XELA 3K8ZA 4DMCA 1QHGA 4WV3A 5CA1A 3HOWB 4IL5A 3KK0A 4WOKA 3SVZA 4B3GA 4EHBA 1HDOA 4YO8A 4DV7B 5E1DA 2B25A 4I08A 5FA5A 3KEQA 3S8MA 1ZK2A 4TMFA 4TTTS 4IMPA 4BZXA 1U5CA 2JHAA 2AKEA 2YR0A 4RS3A 1T5TA 3GRRA 2O1WA 3GJ5A 3LOUA 4DSOA 4RZQA 4E1VA 3VPXA 4Z3OA 6PFKA 2QPLA 1UMDA 2D1YA 3VU9B 5TJ9A 5FBVB 1RIIA 4EHKA 2ZPUA 3AGPA 3NYRA 3LBHA 3HVIA 3MJSA 2CXTA 1PLLA 2XWJI 5A0FA 3U5TA 3TXYA 3FTCA 4NU0A 1TQHA 4QG7A 2HJGA 2JASA 1NHWA 3EQ9A 3O8QB 1C1DB 4CIBA 2Y3IA 4G0OA 2GWRA 2EKLA 1GKKA 1KO4A 2PRJA 2J3DA 3IP3A 2I03A 4CGYA 4LWZA 2AR0A 4DLNA 3GD5A 4Q3DA 1BDIA 3TRKA 2R48A 3ZIDA 4KIUA 4WE3A 3WG9A 2HCBA 1RI5A 3V7NA 2MYPA 3U49A 2BI4A 3B1YA 1TAUA 2YIMA 1M73E 3LI2A 3EXG2 4XJTA 5IBPA 2J45A 3UHPA 3NH9A 1VHJA 1F2TB 1KBOA 3D3NA 4V0OA 2BDTA 3GFPA 5FQNA 5TB5A 3JQ8A 2IHTA 2D74A 4MW2A 2OFFA 2IS2A 4A3BB 1Q74A 2H59A 5M5YB 1IEVA 1OILA 1SK9A 3H2SA 3ORRA 2JGIA 4IYRA 1DWQA 4D26A 1P2FA 2W2LD 3L6DA 4CR8A 4UUBA 3ICOA 3W5AA 3WMFA 1DQZA 2QUAA 2V03A 5HZGA 1IJKA 2FRVA 3CJQA 2ZBDA 2E1PA 3U9LA 5C46F 8OHMA 3Q9UA 1I24A 2ZB8A 3Q9SA 5AW7A 2J6IA 4RXMA 4S1TA 5KPJA 1ZEJA 3BZWA 1ZR2A 2O2GA 4QDTA 2CUZA 3VR3A 5B7GA 2R93B 1DV1A 1YE8A 2I6FA 3LUHA 3Q7IA 4MWTA 1OA1A 4YJGA 5KYWB 2CJFA 1W4CA 2ZTLA 3GEBA 4GF5A 1E58A 1DBVO 3O0TA 4MTCA 1DIHA 4QVIA 5HRAA 3S6JA 3A4LA 2FOXA 3QI7A 4TXLA 3V4OA 1R0LA 1E6LA 1TZ2A 4BNFA 3KPJA 4XJXA 1QS0A 2ZI5A 1CERA 4IY1A 3IPXA 3HVJA 1RLUA 3IUEA 1RRFA 4MDHA 3ONVA 4PVCA 4EHLA 2IOQA 4J4BA 1MF7A 4C0HA 2I2DA 1S7CA 2B36A 2K2WA 3F71A 3N0TA 4CQMD 2A9JA 4D1YA 1RKQA 4YT5A 3R3SA 1GAXA 4AQYB 1Q1BA 4WFQA 5FQOA 4AS2A 2J3JA 3LVQE 2YIVX 2FKNA 1SVSA 3FNHA 4TKMA 5EPOA 5EL0A 5IDXA 1GYPA 4JN6B 2E49A 4LJ5A 4B7UA 4XASA 2JHCA 2PY6A 3V8NA 4A3EB 1NYTA 5JU6A 3IEVA 1L5NA 5I7HA 3SJZA 3RRZA 4YCCA 1S0UA 2EFCB 2Z0MA 4NS4A 4HQRA 4O2LA 4OHOA 4YRDA 4Q1EA 4K87A 2AWOA 1FP7A 4ZYXA 3X3HA 2GJAA 1QRTA 3ROPA 5A1JA 4Z1OA 1U8FO 2QPAA 2Y0DA 1PQYA 2GM3A 5ER6A 3KHSA 2ZKLA 4JB0A 1EVLA 3WYGA 1GV0A 1IRIA 1M2HA 3PUJA 2GAIA 3EFEA 1I7LA 3W5SA 5IEJA 3ZVNA 1E5TA 2POCA 3MTEA 1ECGA 5A9SB 2O3QA 2O8DA 1EUDA 3CF4G 2B34A 3CBQA 4JSRA 3U48A 2KPOA 4TWRA 1ABEA 3RVNA 2ZJZA 1OXUA 4NOMA 4CIDA 1BQ4A 4D3DA 3QG1A 3EWAA 2TMDA 2I1VB 4Z8XA 1HZJA 1X7ZA 2Q6KA 2G0NA 2VZLA 4KIJA 4XVRA 4PGHA 1ADJA 1IY0A 1UCFA 1M2WA 2GWHA 5L40A 4OHUA 3NAGA 3AR2A 5HM6A 2JD2A 4ND3A 3PF9A 4IEIA 4KI7A 3ZHYA 3PDJA 3OPMA 5LWQA 3MNFA 4DREA 5GWXA 2J67A 3S2EA 1JJFA 2V98A 2WE7A 2OGZA 3B9PA 1B0AA 1V1JA 3N8IA 1T6ZA 5TVKA 2J3MA 5K3FA 3SMVA 4OSOA 1XEXB 1NLUA 1NG1A 4YO7A 4RZSA 3DHNA 2PUWA 3DLBA 1OMOA 1KH3A 2VAWA 3G8DA 2JGDB 3N5KA 3CVVA 3L1KA 3VPAA 2QY9A 1W36C 3E7FA 4CTOA 1HTWA 4G65A 2RHDA 3VDNB 1IM5A 1HT1E 1NF2A 3G0BA 4MEJA 1FA9A 4GWGA 1E94E 2PGOA 3RUAA 3KCNA 1A4UA 2WUDA 3N2NA 3VAZA 4UE6A 3PD0A 2BEUA 4HWTA 1G8GA 5CD9A 4DR3B 2Z30A 3FI0A 5GGYA 3ZDCA 2WD8A 3RS8A 1CCWA 4QYWA 2YMPA 2H0RA 3NONA 5C1BA 4CETA 2WYOA 1W36B 1WR8A 2G1PA 4NL4H 1P2BA 4C7OA 1C1XA 2ZBVA 3DPIA 1NAHA 4ND8B 1I36A 3FHOA 1HZZA 1PT9A 3LP6A 1QKKA 3GNLA 3AFOA 3QNUA 4Y7CA 3RK4A 4I9NA 1RCUA 1OGYA 4ZAXA 2IY7A 4AX4A 4NG5A 1FP1D 3PKJA 4I3GA 1PR9A 2P62A 1LQTA 2JI9A 3IYLW 2HPVA 4FSHA 5GIOE 1NT2A 1HG0A 1UPUA 4MITA 4J3NA 4E15A 2ZSJA 1GQFA 4X3PA 3GP3A 3CTPA 2H4XA 2V58A 2Z43A 3QMVA 4JDPA 4YK7A 5LZ8A 4F6LA 4F8JA 3F3KA 4A6PA 1XKLA 4M1KA 1Q50A 3G82C 3FYUA 5C4MA 5CNMA 3SP1A 2RE8A 2FN7A 3WGHA 1SZCA 2VEOA 2JLSA 4ISBA 5JWHA 2F3TA 5ADVA 4QPNA 5FCDA 1F4PA 2RC5A 3GPIA 4YAOA 2HA3A 3BJEA 4N8SA 1Q3HA 5JCOA 4ALLA 1NZJA 1W2HA 1F8FA 2C9DA 2IXAA 4IDQA 1G5HA 2EBWA 4DLYA 3G88A 1RYMA 4WCFA 3RYIA 5E6RB 2JI4A 1RBZA 3PGLA 1EVYA 3WYEA 4EPTA 2J9ZB 1P5JA 2EWVA 1I10A 1ULAA 3HB5X 4QJBA 1DZ3A 1XTZA 3AOGA 2JJQA 4G8DA 3WRXA 5I5GA 3QU2A 2CYBA 2ZT7A 4B17A 1BQ3A 1PYGA 3QYPA 3VVLA 3QFCA 4QIWB 2PCJA 1YVEI 3GEDA 1ZCZA 1L9KA 3BS4A 3R4VA 5HKKD 4X7MA 5GJWC 3COYA 4WKCA 1G8JA 1M0SA 3LW8A 4B6GA 1TM7E 1V5GA 4OYRA 5SY9A 3CH6A 3VTFA 3O1HB 1IUPA 3RAGA 5EIEA 1ODLA 4FYPA 1JJVA 4Y18A 4BATA 1O94D 4BQFA 4FZ5A 4KXMA 3RKSA 3FRIA 5CA0B 1DP4A 4W5NA 2ETVA 5J1SB 4YCAA 4FJ1A 5KYUA 1O5TA 1UZAA 3DE3X 5ULLA 1OW3B 3EMKA 4GLJA 4MV9A 3C7KA 1YJ8A 1CRWG 2G5TA 2K6GA 4RYLA 2VH5R 3NV7A 1UAGA 4KIWA 4NZ9A 2CF5A 3C48A 1GM5A 3F78A 3CM0A 4BVLA 1I2BA 4YJFA 3S55A 2QAGA 4LJYA 1Y81A 2D3WA 3EODA 3G0IA 1E3JA 3EGOA 4LKOA 2H1FA 4FX5A 3S2ZA 1W30A 2B3DA 1ADCA 2JIDA 4PV7A 2X23A 5DW3A 3UH1A 1E2EA 3SSAA 1J2YA 3ZDAA 3A3OA 2ZXUA 4A3IB 1HEUA 2W0SA 3EPJA 1O95D 1D2CA 1SCQA 1VHWA 4L4UA 1ENOA 3NJRA 4B83A 1DQNA 1GSOA 4XR4A 2H9AA 5KWSA 1O96A 3O1JC 1AG9A 3C6QA 5KYYA 5K3AA 1WCIB 1XLVA 4GZ6A 4YMUA 1JEQA 5IT0A 3S1LA 1SVKA 3G49A 3O4VA 3RWBA 5HS4A 1QP8A 4A26A 4IJ5A 2QZ4A 1OHHA 1Y1VB 2KI5A 1A9XB 1V25A 1Z37A 3EZXA 1TFRA 4FJ0A 4U2BA 3Q4GA 3OZIA 1L7EA 3WHPA 5BT8A 1RXUA 1CR0A 1IY2A 1URPA 5HQ3A 1D3AA 5LSAA 1CQIB 3TNLA 2C99A 3JD2A 4RS4A 4KMSA 4KWIA 4NBWA 3HCRA 2FWBA 3W1VA 5JS2A 1Y42X 4D74A 3DE7X 1I0LA 1HYHA 5CM2Z 2ZIXB 1R5NA 1UBMS 4HDKA 4NATA 3N8HA 1SH7A 4GP7A 1X1BA 4J7UA 4O1HA 1Y4UA 2ZRJA 1P5HA 4A91A 3FPAA 3WLNA 2REOA 2PX6A 3VYVA 5BUCA 1YMQA 2H2WA 5G1NA 5H4GA 3HYNA 4X00A 2JB9A 5HJ5A 3B36A 2IUYA 2O0HA 1GN9A 3LOQA 4LEIA 3BIXA 2Q29A 3MTJA 2IXFA 3R5SA 3PEVA 1ZRHA 4FDAA 1U1GA 3OU6A 1J2UA 3TINA 1Z6YA 2X13A 2AFIE 4BWVA 4B81A 3P0HA 4DIKA 1QIHA 4Z1MA 1EXNA 4GQBA 1AURA 1BA2A 1IH8A 1S8OA 5H16A 4M0FA 4F60A 4OB7A 3W7AA 3EZ6A 4NH4A 1I1NA 2IZ0A 3H9QA 1X7HA 2XMSA 4EH1A 2QT1A 2WJ3A 4KJZA 2ORED 4XCVA 4AKEA 4M1MA 2QTGA 1IK6A 1J0BA 2D2IA 3QF7A 4E70A 2G5CA 3HP1A 2QU8A 2OCBA 2J0SA 1RLMA 3H0EA 5AP9A 4JLOA 2C42A 4MTLA 2JATA 3L6EA 5D86A 4ZCRA 2I34A 1KHHA 2W0MA 2CY0A 5EZ6B