1S2OA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 at 1.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
244
Chain Sequence
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sucrose-phosphatase
publication title The structure of a cyanobacterial sucrose-phosphatase reveals the sugar tongs that release free sucrose in the cell.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
total genus 93
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2004-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1s2oA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1s2oA02
3ZVMA 5AI6A 2YMLA 2R8YA 4Y2TA 2CN1A 3ZVNA 3CZ4A 2YMPA 3WK6A 1T5SA 2WF5A 3E58A 1WVIA 5ALIA 1Q92A 2FUCA 3OCYA 3L8GA 5AESA 3U19A 2ZBFA 3I76A 4NFLA 2O9JA 2YMMA 3U7HB 4DCCA 2P9JA 4Y2RA 1RKVA 3PGVA 3AR3A 2I54A 2C8LA 5AW2A 4RETA 5ALSA 3UMGA 5AW5A 4EENA 2CFRA 1U2TA 3ZX5A 5AVXA 3WKDA 3W5CA 2GFHA 4UMDA 4NAVA 2PQ0A 2FPUA 5AHXA 2C8KA 4YH1A 3AR2A 4HGOA 4KNVA 5AKGA 4L57A 2GO7A 4NWIA 5ALOA 2JAWA 4HGNA 1PW5A 2MU1A 2HO4A 3ED5A 1WZCA 3QYPA 5T41A 2I7DA 2GMWA 3NALA 4ZEXA 5AK5A 5IT4A 5AVRA 2MSNA 4DFDA 3FPSA 1FEZA 5AKYA 1Q91A 4BBJA 3ZI4A 3U13A 3ZWDA 4XPZA 3EF1A 2ZBEA 3PDWA 5AIBA 3AR4A 4JDPA 4UU1A 5AVZA 3U7GA 1U7OA 4Y2JA 2HDOA 1QQ5A 4EX7A 4EEKA 4F71A 3PGLA 5AI9A 4YIKA 1QQ6A 4C4RA 5AM5A 1U2SA 2YJ4A 5AVWA 3MPOA 4E88A 3BWVA 1VJ5A 4HAIA 4HGRA 2HF7A 3B9RA 1TJ3A 4KNWA 3MN1A 1SWWA 3HYCA 4I9FA 2YFYA 1L6RA 3L0CA 4OFZA 5AKHA 1T9ZA 2WF6A 3QGMA 5AVSA 1CR6A 4BKMA 2JGAA 3N5KA 2IOFK 2JAUA 2W4MA 3DDHA 2JAOA 1K1EA 4FFDA 4UMEA 3WK9A 1L7MA 3QU9A 5ALTA 4CF3A 1YV9A 3EF0A 4OD0A 1Y8AA 3OTQA 5AM1A 3QUBA 2B1QA 4RESA 2EAUA 2IOHA 5AW0A 2Q5EA 2R8XA 4CE6A 2IOFA 1JUDA 1EK1A 3P96A 2AMYA 3AR6A 5ALUA 1SWVA 4DWOA 3WK5A 3A3YA 1ZRMA 3QU5A 4IG4A 2BDUA 2GHQA 2R8EA 1RMYA 4XOUA 1Z88A 2G0AA 2AH5A 2I34A 4GXTA 4BEWA 1ZS9A 2NYVA 4MUMA 4OHFA 4YIHA 1RLMA 1U02A 2PKEA 1XPJA 4G63A 3QU7A 1RC8A 5AKEA 2FUEA 5AVUA 2JARA 5AKKA 3N28A 4BX2A 2OM6A 3UM9A 2HCFA 3F9RA 3AR9A 5AVYA 2I6XA 3L8EA 2P69A 2QLTA 3QUQA 4UAVA 3A1DA 5JJBA 3FZQA 2HOQA 3L1VA 1RPZA 3WKBA 2OA0A 2B1RA 4EX6A 5ALJA 5ALKA 5ALNA 5ALQA 2C88A 1Z4NA 1L7OA 2WF7A 3D6JA 3QU4A 4BEVA 4YCMA 1L8OA 4HGQA 3U7EB 5A3RA 5AVVA 2EARA 1WR8A 5AKZA 5IS2A 1T5TA 3MC1A 4Y2PA 3NAMA 2G09A 2FI1A 2EATA 4C4TA 4UM7A 3FM9A 2AGVA 5ALFA 2ZG6A 3IB6A 4J2TA 3FVVA 3E84A 5AW3A 5IT0A 3KZXA 2HF2A 3ONNA 4UMVA 4UW9A 4FYPA 2PR7A 4UARA 3I1YA 4JB3A 3CNHA 1WPGA 3OCVA 3N8GA 5AM4A 4Y2UA 5AM2A 1RLOA 1N9KA 1TA0A 3OCZA 1YDFA 3ZTYA 2FDRA 2YBDA 5AW9A 1Z4LA 4GIBA 1J8DA 1RQLA 1ZRNA 3GYGA 1RDFA 3KOOA 2NO4A 3NASA 3B8EA 4DW8A 5AW7A 4I9GA 4NABA 3EPRA 1LTQA 3R4CA 4PNHA 1Z4PX 2IA5A 4ZEVA 4CF4A 3KBBA 5AIAA 3QUCA 5ALWA 1YJ5A 4BX0A 1QH9A 2G07A 1VJRA 3EWIA 3W5DA 4C4SA 3SKXA 1TJ5A 2FPSA 2YY6A 1MH9A 3ZU6A 4UAUA 1ZD4A 2R8ZA 3ESRA 1O08A 2G1AA 2OBBA 1Z5GA 2B8JA 2YMQA 3RF6A 2I55A 1Z5UA 4B6JA 5AK6A 3WK7A 3ZVLA 3ZX4A 4AS2A 4XQ0A 2YJ6A 3VAYA 3IRUA 2WF8A 3B9BA 5ALVA 3NUQA 5AKIA 4MWOA 5A3SA 3E8MA 2P27A 1Z4OA 3K1ZA 1Z4KA 4J03A 4YCLA 1QYIA 4L6CA 2HSZA 3QNMA 4CF5A 3SLRA 1RRCA 1EK2A 3L0BA 4KN8A 4HYTA 3DNPA 1TE2A 3KDPA 3TLMA 1XVIA 3WGVA 3QU2A 3E81A 3ESQA 5ALZA 3DV9A 3ET5A 4Y3UA 1Z4QA 5AI4A 3PCTA 2O2XA 3L8HA 3J7TA 1O03A 2ODAA 2BDEA 2HI0A 3MMZA 1RQNA 5AI5A 2I33A 1RKUA 4AS3A 1ZD2P 3IJ5A 5AW1A 2B8EA 1X42A 3SMVA 3DAOA 3SD7A 3N07A 2B82A 3QUTA 5FP0A 3RFUA 2DQSA 2Q4TA 3W5AA 2RBKA 1Z4IA 3OCUA 3ET4A 3QLEA 4QQFA 3U7FB 1NRWA 2QYHA 3WKAA 2RB5A 5ALPA 2GHTA 3QXGA 4BNDB 2D2VA 5ALLA 3M1YA 5ALMA 5AVQA 3NRJA 2B30A 3WK8A 3SF0A 2RAVA 4ZEWA 3FPBA 5AK4A 2HEGA 3HLTA 5AVTA 4BX3A 3ZUPA 2B0CA 2NO5A 5AW8A 2ZBDA 2FPWA 2X4DA 4AP9A 5A3QA 2VKQA 2FPRA 2WM8A 3AR7A 1RMTA 2W43A 3AR8A 2G80A 4Y2QA 1ZJJA 4BNDA 4G9BA 4UATA 3SHQA 2YJ5A 1LVHA 5ALDA 4QJBA 1U7PA 2HX1A 1RLTA 5ALXA 2FPXA 3WGUA 1N8NA 1S8OA 4YGYA 1YS9A 3S6JA 4KX5A 4XE5A 2ZOSA 3KC2A 1AQ6A 4L6AA 2C9MA 3L5KA 3SKYA 3L7YA 4BYGA 4KYTA 3WKEA 3ZTWA 1ZOLA 3L8FA 2WFAA 3AR5A 2Q4RA 2WF9A 1KYTA 4KX3A 5AK3A 2WHEA 5ALRA 3U26A 3FGOA 1ZD3A 5AW6A 3ZW7A 1XP5A 1SU4A 1CQZA 1Z4MA 5AI0A 2RARA 2W11A 2YN4A 2ZBGA 4UM5A 1RKQA 3ZWKA 3QX7A 2ZXEA 1ZD5A 1QQ7A 3KD3A 1F5SA 5ALHA 4EELA 2HHLA 5AM0A 2CFSA 3OCXA 1Z4JA 3WK4A 4H1WA 3R09A 2YJ3A 1VFPA 2IYEA 4FE3A 4O8CA 3NANA 4OCZA 2BY4A 4UU0A 1L8LA 1L7PA 3UMCA 1L7NA 2P11A 1YMQA 3L1UA 2G08A 1TJ4A 3R9KA 2FEAA 3NIWA 4Y2YA 2G06A 3N1UA 5AKXA 1IWOA 5AICA 1YNSA 1J97A 4HGPA 3UMBA 4F72A 5ALEA 1RMQA 5AM3A 4IFTA 1S2OA 3WKCA 4CNQA 4Y2VA 5AKJA 5ALGA 5AI8A 3W5BA 4Y2XA 3A1EA 3OCWA 4UMFA 5ALYA 2OYCA 2C4NA 5E0OA 1NF2A 3BA6A 5AW4A 3OPXA 4Y2SA 5AKLA 2AUTA 3I28A 3L0YA 4EZEA 1NNLA 3M9LA 3I6BA 4NV0A 4UASA 4YCNA 3A1CA 2CFTA
chains in the Genus database with same CATH superfamily
3IP9A 3CUWA 1SUSA 3N2GB 3REFA 4D9IA 3QW4B 5LKRA 3VH2A 5LMNB 3ZPXA 1I7QB 1DIRA 1EFCA 2O0HA 1ACLA 5JD3A 4RIEA 1SXQA 4HRVA 3B3AA 2GRAA 4PQYA 5IYZF 4M9ZA 1VSTA 1D4OA 2B0JA 1MJHA 4BX8A 1ETUA 5KTOA 5HKKA 1TTTA 3L8GA 4GFDA 1W85A 1KWGA 1G2IA 2C04A 4HZIA 2ZJAA 3BD6A 2YMMA 1ZC3A 3WQQA 3K70C 1XJCA 2BFCB 3HYSA 3GMDA 4F8EA 1SG9A 1UZMA 3MJVA 2QE6A 1C7EA 2BEWB 3AR3A 3PGVA 2WYOA 2FEKA 4G4SP 5FTMA 4BNHA 2GA8A 1UDCA 2R44A 3MWKA 1KI3A 4JIGA 2HM7A 4IJVA 3S2YA 2I66A 5K6AC 4FM9A 2BC9A 1QFSA 1PZFA 1ZUIA 3PJFA 1JN0A 2QPLA 2QS9A 5U1PA 2B99A 1O2DA 2QOEA 4YYZA 3N2LA 4LFAB 4WY8A 4AYBB 4V38A 3WNBA 2OD9A 5TQ0A 3MNFA 2D1SA 4GRDA 5BR8B 4D9KA 1EIWA 1JIKA 2P2YA 4YH1A 2DY1A 3A7DA 2H65A 3GV0A 4CV3A 2WM9B 5ADUS 3KL4A 1S7CA 3A2NA 4X3OA 4NWIA 1C80A 2GKSA 2ZDGA 3WISA 2MU1A 2BEWA 4CIWA 5AT1A 1PBTA 2ZE7A 4GLLA 4G0WA 1EBFA 2FMXA 4D3YA 2RGDA 3HNPA 1H0SA 5CDGA 5IPFA 1V7PC 2QZ4A 3BIFA 4MCHA 3LFHA 4A6EA 2UVPB 1UBLS 3B2QA 2HMVA 2CLKB 3T3OA 2RGGA 1J24A 3HV0A 1MA0A 2XIJA 3FPSA 3I37X 4KHPB 1IEQA 4N0DA 1JDTA 4BCDA 4DA8A 3ZI4A 5K01A 4ZTZB 2F3RA 1XK6A 3DLIA 4DNOA 1ZLYA 1F1BA 2V9CA 4AO8A 2V7BA 1TPZA 3EUWA 3IEPA 4RDCA 1YIOA 4E2ZA 3I5XA 2Z6AA 2HYIC 4ZZ0A 3STHA 1JB1A 2VH5R 5FWAA 2Z3ZA 4P3NA 4INPA 5DGTA 4TZTA 4G26A 5A7FA 4A3EB 1ZXLA 2C5LA 4IDEA 2GRUA 4HADA 1H66A 3VFDA 4CV0A 4RCVA 4XWOA 2VYCA 1A7KA 5DMXA 1F4LA 1KC1A 1JAIA 3FW1A 2UVPA 3Q9UA 3V4ZA 1M74A 4REMA 3BXFA 5IAAA 1XPRA 1QQ6A 1UBNA 3K0KA 2VZ9A 2XUGA 1GTRA 3FNGA 1WZIA 1I6KA 2Y1EA 4IICA 4OA5A 1GRNA 2E82A 2FRXA 2P9EA 2GTIA 4MYDA 4K6KA 3S2EA 1OGIA 1KVUA 3DMDA 1GTJ1 2O7RA 2W5UA 2ZSBA 3LUPA 1ZQ1A 5AHRA 4GM1A 2CZCA 3UWMA 2CYCA 5EHQA 4OJTA 1SBCA 1X1SA 2EERA 3C8HA 3R44A 4KVGA 4LJKA 5B57C 4NE2A 1SD2A 5BSKA 4UREA 1O58A 4CM9A 4GP6A 1UZAA 1EX6A 2NU7A 3CY6A 3Q3EA 4H18A 3K16A 1DRKA 4YRPA 3EB9A 2V7TA 4HPWA 5IKPA 1QR2A 1K1EA 3TFOA 5G2OA 1TQ2A 3UHJA 1XAHA 3SBXA 2YW2A 4EPXA 3OZRA 1FFDA 1ULSA 3KTDA 3NX4A 4IGAA 5C32A 1IRIA 2QTFA 4TLAA 1H65A 1LW7A 3H3FA 4MAFA 4P35A 3BXHA 1UJBA 5F64A 4ZO4A 5LB2A 3E9MA 3SKVA 3G0HA 2XCRB 4ZREA 4AKHA 3W1WA 3O9VA 5AM1A 4TKLA 2G17A 4YV1A 4KXUA 3B6MA 1JT2A 3FPEA 4RH0A 5FPTA 4CTOA 5FO1A 2G40A 3HACA 3MINB 5TDHA 3WA6A 4DJEC 3AFIA 3ZZMA 1ND5A 2XRZA 4Z2AA 3DLHA 3M9XA 4I55B 1IY1A 1PZXA 2AK2A 2F9FA 4WXRA 2V98A 5CVJA 2AN5A 2DQYA 3R9XB 1SQ6A 2EKLA 1U3UA 3FETA 2W6NA 2JA2A 2UYGA 4WUVA 1Q0PA 4Z4IA 2G1PA 2FF7A 2XZPA 3CG0A 3ROEA 2E7ZA 3MLAA 3H3JA 1VKHA 3W0LB 2XKKA 4XUDA 1JPUA 1OBCA 5IF9A 4G1UC 4DWJA 4D3XA 4UOQA 4ASUA 5ESRA 4ND7A 1O6ZA 1WD5A 3E3LA 4XTRA 1U0TA 5CVCA 4TTTS 4UTNA 2YYZA 1NSFA 4L15A 4LSZA 4MX8A 1J20A 2O2SA 1YT5A 4MUMA 3EJWA 4Y9RA 3W5JA 1QRUA 1N5IA 2I2WA 2IIVA 2UAGA 1VCHA 4JOSA 5A62A 4I55A 1ZESA 4JWKA 4ITVA 2E2HB 5A7GA 3QVSA 1E2BA 4ZDKA 3VPBA 2GK4A 2Z5FA 3F6CA 1WMEA 1M8GA 2IYLD 5BXYA 3C5EA 1JJIA 3ZXIA 1W4AA 2HKIA 1JXQA 5JYEA 7ADHA 3M1AA 2PUDA 3KZMA 3O38A 1F2VA 4LZJA 3UUFA 3H3XA 4ZOLF 2CJXA 1SUWA 4H7PA 3CVWA 4B6EA 5K4AA 1HT2E 1AXRA 1M2NA 4HRXA 3L7IA 1AG9A 3OETA 1ZOOA 1MO2A 3TVYA 5EXDA 2B7BA 1TVMA 4JT9A 3EPPA 3W2HA 3S17B 4XZ3A 1H22A 2GN9A 1JHAA 1QZTA 2QAGB 4H4CA 4X71A 1DT5A 3WWOA 3FJYA 2YX1A 1GDHA 3LQFA 1Q20A 3L1VA 5TMEA 1U2RA 4NP6A 4D97A 2X5JO 2TMGA 5L7YA 3GTJB 5ALJA 1J0XO 1Z33A 4QKQA 3WGYA 3I52A 4QUAA 1FFEA 2Q45A 2RHOA 2E1RA 2O7QA 2WF7A 1N8SA 5EYPB 2J30A 4BEVA 4YCMA 3GCXA 1SXJB 4OQNA 5JW6A 4YJ3A 3U4HA 2RIPA 1TWFB 2JK0A 2X9QA 5AUPB 1FFCA 1FLVA 3AHFA 3OCCA 1S8FA 4ZDJA 4EYKA 4H17A 1AIPA 1GL7A 2IXDA 2QAGA 3ML1A 2QT1A 5A05A 2OQVA 4JT8A 4IFBA 1E7QA 1QGYA 2HA0A 2JLXA 3OJFA 4L5JA 4PAOA 2HF2A 5IK2D 2Z9DA 4EW1A 1SC1A 3BB3A 1IN1A 1EB8A 1B16A 1XTSA 4TZ0A 1UOOA 2O0LA 2O57A 1Q0HA 2FAXA 1UFVA 3GDGA 5AXDA 1Q6YA 2ABWA 5ECWA 2YVAA 5EYPA 1YE3A 3I83A 1MAHA 3KXPA 1KJ8A 4MIEA 4HLQB 2FWPA 3KOUA 4BNFA 3RSCA 3AXSA 3TIIA 1TCBA 5LQDA 3Q5DA 3I9OA 1BVUA 2F43A 4QGFA 4IGFA 4O25A 5HE8A 4CMBA 4FHEA 3L93A 1PWZA 4QNMA 1QWSA 2ZUCA 2JD2A 1TEZA 1IHXA 3NHKA 2Y0PA 3ZS8A 3AIOA 1GCGA 1PBNA 1UM9B 3GCWA 1ZMTA 3KLMX 3M4ZA 3UJ8A 5B7GA 5IDQA 2HUPA 2K2WA 4HB0A 1YDEA 1RWWA 4R84A 4I66A 2SNIE 1GGFA 3DG9A 3P2JA 4DKJA 1GZ4A 1CUBA 4FOPA 4IJMA 3GTOB 1N0WA 4TKVB 5CK5A 2V5VA 4EGSA 1S89A 5I9MA 3ITEA 4J75A 1DV2A 1KSGA 2GXUA 1ZH4A 1OXTA 2FVXA 1V37A 1GAQA 1V9LA 2QG4A 3UOWA 2JG3A 4DDWA 3WSTA 2I2CA 3DW1X 1D1PA 4II7A 5JO9A 4IJQA 2C59A 5ICSA 1ABEA 4LX8A 1R4NB 3VVCA 1N8TA 1XZHA 3GUZA 4PPNA 4V24A 4UOZA 2JIBA 8GPBA 2HK6A 1OD6A 4JI5B 4QUIA 1Z75A 3ZHCA 4AD8A 1UM9A 5C4XB 9LDTA 1KC3A 3SX0A 3RIMA 3BS4A 2H3EA 1ND6A 2PMDA 3DOJA 4IXTA 4AJ4A 2JI7A 3ESRA 3NT2A 3R3ZA 4K26A 3WMWA 2OBBA 5B2EA 5LXTA 2VYND 4TKVA 5K6AA 4FMCB 5EQJB 5AVJA 1CB7A 1NTRA 1KMHA 1C29B 3BKXA 1P61B 2DCMA 2WWFA 4AS2A 2WAQB 3Q8KA 1DIOB 3CC8A 4YGXB 3HJCA 3UWDA 1VIYA 1MG5A 2BZ1A 3ONFA 1E0SA 3BICA 1S8AA 1R4NA 3K1AB 1LEHA 1RHUA 4JYPA 4KO4S 4QQRA 4CMHA 4QLAA 1Y42X 2NUPB 3IQGX 4M9RA 3AHIA 4FMBB 2BHTA 4MWOA 3K1JA 2BTEA 4C22A 4KR2A 2CYBA 3NIDB 4OV6B 5JE8A 4XH9B 2PBLA 4PCAA 1TLLA 3D59A 1QOQB 5EQFA 3PFNA 1U9JA 3AUAA 1R6DA 1Z4KA 1Z28A 3I01A 3K8OE 4CGYA 3ZWPA 1UPXA 1LDGA 5CDUA 7AT1A 3Q7EA 1LLDA 4FEYA 1QYIA 1KMMA 2IZ0A 1YL5A 1HDXA 2QR5A 3P9YA 4NX2A 4S1OA 5GPBA 3UV6A 4HYEA 4JI8B 1Y9EA 2C3MA 4K81B 1MHTA 2N1MA 4CHGA 1HUQA 1TE2A 2QQFA 3K1AA 1E2NA 3AETB 4NAHA 2LE0A 4DIEA 1DRUA 4N6OA 2NUPA 3OLXA 5M3FB 3T7SA 1QRAA 1XVIA 4BWGA 3AHEA 3IPLA 4L5BA 4Y3UA 2QPOA 3RM3A 3MHTA 4URHA 2NV0A 1X3LA 3HWX1 3OZGA 4AJPA 4GEGA 4R1UA 4V0QA 4YP6A 2WZCA 4P33A 1ZN2A 5CB8A 3AHCA 4RSHA 2Y9MB 5EP1A 3JSAA 2GBLC 1TAGA 4HH4A 5FUYA 4CU5A 3FA2A 3CN9A 5GZ6A 3HVIA 3JZIA 1X7HA 1RQNA 3HXTA 3GLIE 4Q3KA 4PV7A 3QH4A 2ZU6A 3EEIA 4TRJA 3GDHA 1VHJA 1ZD2P 2KW5A 3U48A 3ZWWA 3CO5A 3TWOA 3N8KA 3AETA 1C9KA 5HHTA 2P0EA 2QB5A 4HWGA 4XVRA 2QN2A 1W44A 1O5OA 1GR1A 4FQ5A 2XNKA 1G8HA 1MOPA 3FNRA 4XARA 4UUPA 5KQRA 1LW6E 3BXPA 4IIVA 4J07A 5E8RA 4WTOA 1KXZA 3O8NA 3USES 3UB3A 4IWNA 1EFRD 5E2BA 3NHRA 4CLOB 4BEBA 4AUKA 1I0IA 1HOXA 2IBTA 1C4WA 2CJYA 4GMFA 4NBLA 5AXCA 1FJGB 5K8IA 3KVOA 4D4MA 1NOKA 2BEKA 1PLKA 3DTTA 3U7FB 4IDDA 5KSZA 1K6JA 3D3WB 4HUTA 3LWBA 2ZR8A 2TMKA 2EIXA 2FG6C 4S1TA 4DCNA 3IAFA 2CV1A 1L7EA 1TM2A 5DNYB 1WUKS 3WNVA 3HCDA 1IY2A 1NPTO 3NRJA 2QIPA 2X7HA 3L06A 1F8FA 1ISIA 1ZD1A 2PX4A 3QHQA 4I7EA 3VDNB 1MN6A 1QANA 2BR5A 3C85A 1E63A 4CT5A 4FI3C 5CT6A 3A6ZA 3K5PA 1JG3A 3F0TA 3F96A 4CLOA 1P9OA 4WBXC 4UHCA 3C8UA 4WW0A 4EG7A 2QU7A 5BUZA 5A5GA 3M3PA 3VC1A 3A06A 1CNMA 4NAUA 1QTQA 1SPBS 2RGUA 2IZ1A 3TI9A 3UJ9A 2A4KA 1JAHA 3DHEA 3DBRB 3F67A 2OAQ1 2JI6A 2QW0X 4NCJA 5KI6A 5HRCA 5AFSA 4B6RA 4QVIA 4IXDA 2WJPA 2GS9A 3RFCA 4C3IB 4E2XA 1B8UA 4CLHA 2VDOB 2EP8A 5SYMA 3NRBA 2XSZD 4HSEA 1K8QA 1ST2A 4AO7A 1R9MA 5BNWA 2XJ4A 1JWAB 4A7PA 5T6BA 1TI7A 3WI7A 5H82A 3GG2A 4IV8A 2FUG1 4IPTA 1SB8A 4LHYA 2Y1FA 1YRWA 5K3SA 4AKSA 4AROA 1XXHA 4BPRA 1J8QA 3W77A 2FDCA 4L07A 3NGXA 1U6JA 2AS0A 3ETLA 4G07A 4IQ4A 5KKCA 3HFJA 3RNLA 4BFYA 4JI6B 1SQ5A 4N48A 3U1TA 2GOYA 2JRCA 2CHUA 5H1YA 3C5WP 1JDVA 2WTNA 1GPDG 4R71A 4E32A 1XWWA 2TS1A 3ONEA 4Q3CA 1G63A 1GL6A 3L0SA 3IPXA 4AUMA 1AQNA 1W34A 3KLOA 1W7AA 4D26A 3RADC 1B0UA 3G8DA 3ZWVA 1ZD3A 4CCYB 3CLHA 2H5JA 2P6NA 3KVRA 2IKSA 2XUZA 4Y6QA 4BMVA 5EPUA 5J5CA 1S01A 4UAGA 4C30A 1CQZA 4L2IB 2EQBA 3JR7A 5JEEA 2C9ZA 1T2CA 1OF1A 3OVMA 4UNIA 2FF5A 4WNCA 4CKYA 1TF2A 4DM7A 2WKPA 2XTZA 3KD3A 3GGCA 3BGSA 3RJ9A 3UGTA 3A6KA 2AUNA 3VDMA 4QBHA 4X6XA 3VMMA 3WFZA 1KY4A 2YOFA 4F96A 4ZICA 1DVRA 5HK8A 1MC1A 1ZGAA 1Z4JA 4I0WB 4RTRA 4PRZA 2VG8A 2JFWA 1I36A 1WETA 1D04A 1M6HA 2QMZA 3P2OA 1UJ4A 4B0PA 2IPOA 1TTPB 3WO0A 2PLNA 1GQ2A 2IY9A 2OOSA 3QELB 4ON9A 4MPTA 4B3HA 4B6FA 4F2DA 3T7DA 2CCJA 1M6NA 1GPYA 4PLZA 1X7WB 1VJ1A 1TM7E 4FXPA 4ONEA 2J0SA 1E9DA 2X5OA 2ZI7A 4EG0A 1N0VC 1K86A 1HC7A 9ATCA 3RVPA 1JSCA 3UEOA 2WUWE 2HU7A 1T4DA 4F5ZA 1YNSA 4BO6A 2I4OA 1R37A 3WZLA 2PX3A 3QELA 3VOSA 4BFCA 1L3CA 4R3UC 2C2GA 5A06A 1E3JA 2C96A 3HB5X 1J2YA 3JZAA 4CKBB 4RM2A 4P82A 3QLJA 4UMFA 3IURA 3WOHA 1X7WA 1I2BA 3DEZA 3O82A 5LYYA 1ZGGA 2O7NA 2PV7A 2Y3IA 4LC9A 5JBQA 1AH2A 6ADHA 3FFTA 1JIXA 1Q50A 1LS6A 2RGCA 3BA6A 5TV2A 1KO7A 4M0EA 4N0MA 5IK2A 2PSHA 3U49A 1D7OA 3L0YA 4Q05A 3H6HA 1VCOA 4FZJA 4U2FA 3V9AA 4EZEA 4X44A 1A76A 3UWKA 1KDYA 1PVOA 5TARA 1RQGA 4QIWB 1N0UA 4BFTA 1CZLA 1XZCA 1RC0A 4MICA 4TUYA 1XE3A 2I2FA 2V6IA 1DL5A 3DMPA 4CKBA 3CUSA 4NH4A 3VMFA 3DAFA 4B73A 1QYCA 2WF5A 3KJGA 3E58A 2WTAA 3HYRA 3C3AA 3TG8A 5A4KA 1D6SA 2G7MC 3ODGA 1ILEA 2FUCA 2G04A 1SN7A 2PRKA 1USVA 1Z34A 2C31A 4ZK2A 1IB0A 3K6SB 1XEAA 3SSOA 3LS2A 1DIGA 4B87A 3CLUC 4S1PA 1RKVA 4E5UA 3K31A 1BA2A 1T4GA 2Q27A 1C9NA 3BIOA 2GPNA 1U6IA 1RWVA 2VRCD 2VUUA 2WU1A 2XADA 10MHA 1TZMA 3IV9A 1PWXA 1DUVG 3RBZA 2ZRIA 1Z07A 4PC3A 821PA 1N9GA 5JVDF 2FPUA 2JLCA 3F5QA 3ZYCA 1D6JA 1ECBA 5TB5A 5BSTA 4NQRA 1T8PA 3ZK9A 4QO7A 2R6GA 1THTA 2IYTA 5B2FA 2XEDA 1V25A 4HLDA 5C1IA 2OCKA 3UAGA 1II0A 4MRAA 3WYNA 3W6ZA 4D4LA 1UIRA 1VHWA 4LWPA 3AW8A 1PYDA 2Z4TA 2QT0A 3D02A 3ZWCA 5GWXA 5T41A 4AJ9A 2ZUFA 3UGQA 1R9TB 2VYNA 4MYCA 5HZGA 2F9MA 2NXJA 3CWQA 1GTG1 5B3JC 1JWLA 3PWZA 3PF8A 1NIJA 1ZVQA 2J3JA 3L7NA 4B43A 3HM2A 4QWWA 1Z12A 2PEYA 3ZNPA 3HDGA 3U4CA 2ZAYA 2P2DA 3HY3A 1M1YE 2HCRA 4LSWA 4CI9A 1Z6TA 3HO8A 4DQ0A 2VDNB 4AMVA 5C8YF 4YDQA 5JZ9A 4B9AA 3BCHA 3CEAA 3A6LA 3GF4A 3M49A 3K8QA 3SFVA 1RRKA 1Z7WA 4MLDA 4RACA 5CXXA 1VCNA 5JWOA 3NHUA 1E9AA 1AKQA 4UJ5A 4EEKA 2FX3A 3U4GA 1PGPA 2W6CX 4ZYTA 4YREA 2GBLA 4NDAA 4YQFA 3HR4A 2YXNA 4YRRA 1W35A 1LD3A 1P74A 1SKAA 2JCBA 4M36A 3L7AA 2YIDA 5FX2A 4C2MB 5ER6A 1SH7A 2JANA 3NTQA 1F0PA 1ZU5A 3H9UA 2ZM6B 4O3FA 1HF3A 4PZ0A 5I6DA 2QF7A 4CM5A 3VUFA 3BGIA 4R41A 2FUNB 3NDJA 4MMZB 4MRSA 5C7YA 3WZ2A 3F2VA 1MEJA 3MS4A 1R4AA 2GWRA 2JZCA 2X86A 3KOWA 1V39A 3PUXA 4FNGA 1EUYA 2C4KA 1HZZA 1YRAA 2WUFA 5AKHA 3RAJA 2IKQA 4WL0A 3L0CA 1I1NA 1Y3FE 1ZYUA 3DAYA 4EECA 1R1DA 1WSWA 4R0NA 1C81A 4RS3A 4OHKA 1RIIA 2LVBA 1LPOA 3R75A 1VB3A 2O1SA 1WXHA 3D1JA 3T7AA 4OA8A 3RU2A 2FFQA 3LCMA 3WK9A 1BYUA 1PR9A 1K98A 1MJFA 3KAKA 1UXOA 3IERA 2NTJA 1G9XA 4GLFA 4BVKA 2NUTB 1L4LA 3INRA 4N5MA 4G0ZA 1VKJA 4ARAA 1XRJA 5JS6A 4EZIA 1YK1A 3QFCA 5EKDA 5KQSA 2QP3A 4RSMA 2KMLA 1EFRA 3C3DA 1M2OB 2F8LA 4S1WA 2QNBA 2YHUA 5LLSA 2Q5EA 3PNPA 4FOLA 4AAYA 3FDIA 3A1NA 3WBKA 4AKIA 1KSFX 5HBGA 3SMQA 4EG3A 4P53A 2PKQP 1KZ9A 5LFAA 1MQ8B 4D42A 1X6VA 4I1UA 5BRJA 5ITZA 4PANA 5ANRB 4I4TF 4JMPA 1J9ZA 3QWIA 3RREA 3TTTA 3N8NA 5CFQA 4IP0A 4KXNA 1RABA 1T1IA 1MIOB 4R3NA 4K9OA 5FLKA 4QRHA 3S44A 4C14A 4XTCS 1HNWB 3ESBA 1NV9A 1O96B 2FZWA 1SPXA 1XDBA 2UUOA 2XE6A 3EODA 1P31A 4H0NA 4LYGA 3TE7A 5KYTA 4NPCA 3H9CA 1S2IA 1PFKA 2OLKA 3AF1A 2Q49A 3Q5EA 3SYTA 1L5WA 1Z8HA 3OD1A 4KTVE 1QKIA 2Y05A 3PD1A 1PZGA 3KWFA 3PJGA 5J5AA 3ZDYB 1SOUA 3OQMA 1XPJA 1SCDA 3ZDXB 5CPFA 5KOHB 3ZDDA 3S2HB 4ZT3A 1A5TA 1TUEA 3A6EA 1ISMA 2NZXA 3CSUA 4F6CA 1NQUA 3OZAA 2FV8A 4NXMB 2FUEA 2H4XA 2VAMA 2X4GA 2ZLBA 4TSKA 4N54A 3MBIA 4G89A 5AKKA 3VR6H 1B8NA 2QTTA 2XSZA 4HNQA 2IZOA 1N4DA 5AHWA 5U4QA 3KSAC 3UM9A 1NLUA 2V03A 5FADA 1PR3A 5TT0A 4PTZA 1QV6A 4Y0VA 4NG5A 4YCBA 5B3AA 1E6CA 5EXEA 2QLNA 1USIA 4X63A 1Z36A 4Q9JA 4C1BA 3DULA 4P80A 5B1HA 2IUEA 5KOHA 1HT1E 4Y6LA 4J4TA 2GPWA 4M7PA 3BZUA 4XIIA 1XN4A 1KDPA 3V6LA 1EH5A 1TMKA 5JRDS 2OESA 1VMKA 4KKVA 4W7HA 4RTKA 4FQ8A 1KQOA 2C1EA 3K2IA 2OD2A 1E3MA 4OOEA 3HABA 5IMSA 1T9CA 2B4KA 5C1PA 4LCJA 1YA4A 2Q8PA 4BFWA 3UTCA 3Q5GA 4H15A 1JG4A 3DMHA 4XJSA 3V2HA 3GPCA 3PO2B 5KDDA 2QQEA 1WVGA 4V3CA 1YMUA 3BFKA 2OY0A 1A2BA 2VPIA 1HL7A 2VSNA 4TLLB 4L6IA 3HHEA 4R1NA 3VOBA 1IM8A 3ZV3A 4KQGA 2AGVA 4US0R 4HNAA 1XRNA 1ZVJA 2G5TA 1OE0A 4FHFA 2C7PA 1WVMA 3CNEA 4QGHA 4YO7A 4UTXA 1O9BA 4WFIA 5DCYA 3RWMB 2F4NA 2WSIA 1LFAA 4BLWA 1G6HA 1ZEMA 3HPRA 1PNOA 2HQ1A 4MGIR 5DLPA 5NULA 4U39A 2P77A 2C5AA 1A4UA 4UEWA 3N3BC 4OFXA 2Y4NA 1TMOA 4JB3A 4FVTA 1MOSA 4U00A 4F7DA 4F8JA 4QARA 3ZV6A 3WGHA 1UOPA 3CX6A 1E1KA 3PE4A 1OFTA 1FW6A 3Q6NA 1RYFA 3IVCA 3EASA 1P62B 4GNKA 4BVHA 1IWPB 3RC8A 5EJ8A 4EB3A 3R20A 3O1HB 2PYIA 2Z8ZA 5F2KA 4LYHA 4PEVA 4ENVA 3RC7A 1GNRA 3S1LA 4URFA 3ZQUA 4LXXA 1GPNA 3C1OA 1II9A 3EBOA 4V2UA 4FOTA 3L4SO 3H4IA 5DGIA 1BQ4A 3JRXA 1P77A 1V8OA 1CF2O 2OV3A 3D7SA 1YRLA 3MCWA 4GVLA 1SHLA 3LY7A 1QG6A 1U4NA 3DD5A 3L7DA 4GMGA 1LTQA 2VDPB 3NEJA 4GPAA 4K87A 4UHFA 3KOZA 4YBZA 5BN5B 2OCXA 5JD4A 4KXYA 5CD1A 4LAFA 4PSVA 1YAJA 4W5HA 4JI3B 4DN6A 3ITNA 4GZ3A 4ZEVA 2NVUB 4ER7A 3DCJA 1LDMA 1N2IA 2FRDC 2I4MA 3SKXA 4AJIA 2ZTLA 2H51A 4KO8A 3HB9A 3ZQ6A 4C7VA 5J2TB 5C4MA 2ZBPA 4KPUB 3FYHA 3M3HA 2YY6A 3KSUA 4HH3C 5L6LB 3I2JA 3HYLA 1ZD4A 1PJ8A 1TM3E 2DFTA 4H6WA 1LPBB 1TQ8A 1F2UB 3GVCA 2XECA 4FHGA 4GZMA 3HCNA 2NZWA 2AC4A 2G1UA 3G2LA 2Y0SB 4DT1B 1BW9B 1VKRA 4DG8A 3FCYA 1NBMD 3EC1A 2C99A 1H3NA 1IU9A 1JIUA 2H0QA 4NS1A 4D80A 2ZWVA 3G0OA 3GOQA 4NZ9A 2NO9A 3GEGA 1FTQA 4LVOA 3S1NB 4MHOA 3E6AA 1WP4A 3JQ8B 1ORVA 3MRSA 5E8JA 3KKOA 3OQ6A 2PKRA 4M8IA 5HWSA 5EZSA 5EJ4A 2Z4SA 2HXSA 1DDOA 1J22A 3I39X 4ZVUA 2AZTA 1XELA 3P9QA 4G41A 2HQBA 3UICA 1JZQA 2YV4A 2BFEA 4XFKA 1F2UA 4BMCA 5JFTA 4UCQA 1DI0A 3GJ3A 4D02A 5BWOA 1PTJC 4DT1A 2VRCA 1BW9A 1HK7A 3RVNA 1TJPB 4KN8A 1KYXA 1FRFS 2PZLA 2Z5LA 5I4IA 4UZFA 4A0RA 1E3WB 1XNRB 3A6FA 3KDPA 3UK0A 3BH6A 1XTKA 3LCUA 2EQ5A 2WPDD 3AXTA 2VPZA 3DE4X 4B2IA 2CEKA 4FFVA 1WMBA 4UJ3A 3UMSA 3JQ8A 1K2VN 3EVFA 2VUIB 3HKCB 2WQZA 1YR6A 1F7UA 1QM5A 1Z56C 3TQFA 3MZ0A 3H87A 4RC9A 3NEYA 1Y81A 4EI2A 5C5EA 4G9GA 2G6TA 1R9NA 2GN2A 4CKZA 3QKSB 4C29A 3LXMA 2Q2WA 3ROXA 3MMZA 2DQKA 4U1RA 4WLEA 5EQTA 4LE0A 3MWFA 2GHRA 1RKUA 1ZJZA 2RHTA 1Z25A 3D6MA 3SX4A 4RTMA 3SDSA 1A0OA 1E3WA 3VNVA 3ZGNA 1SUDA 3MCZA 2DULA 1YZGA 4MQUA 3E9CA 1N5OX 4W1RA 2FSUA 3FKSD 3HBNA 4C0QC 2BM1A 4A4DA 4ES6A 2B5OA 8ADHA 2RBKA 1WDMA 3N0TA 3OIYA 3BTSA 4ND8A 4L27A 1RJ9B 5FJJA 3QKSA 3QPVA 3SBOA 2P3SA 2GPSA 3MTIA 3QXSA 4UTOA 4HNRA 5K8UA 2GNAA 4V1CI 1ZKDA 1AGPA 4EQ6A 2YJGA 1XU9A 4FSDA 1UPAA 2ZRAA 3GH3A 1QNFA 2ZYIA 4LJ8A 4DQDA 3NATA 3J7AC 1E4YA 1KKLA 2PRIA 3DPIA 4RZ2A 2ZYWX 2H11A 5FJIA 4OATA 1XUOA 3D6FA 4RKFA 5CA0B 4U5QA 3MK31 1WG8A 2IVZA 3SF0A 4F46A 2O3TA 4KIUA 2V3CC 5CYFA 3IT3A 4I9UA 1K3FA 1U8ZA 2CB9A 1IULA 1P8JA 1NPYA 2Z83A 3FOWA 3M2PA 3ER8A 3LUAA 4R4JA 1AZTA 3C15C 1HFJA 2XNCA 2I4RA 2Y77A 2GR9A 1SRRA 2Q07A 1AO3A 2ODTX 4TV8F 5HZKA 3GHHA 1D2GA 3NORA 1U8CB 4PNEA 3M6AA 2RG1A 3GJ4A 3P9RA 2IY8A 4JUIA 4TTSA 4HS9A 4DQVA 2RJOA 5L40A 3NTRA 1B8OA 3CJQA 2JEYA 2JHCA 5CW2A 4KZPA 4PG4A 3GJ5A 3TLAA 3ZI0A 4RHCA 1J7KA 3ICWA 1U8UA 1YRBA 2CNBA 2EHJA 2P40A 2ZROA 5DYYA 4ZI7A 4JC5A 3S2FA 3F5MA 4G85A 4Y6OA 2QM8A 4R2KA 1UPTA 3EXAA 4QOGA 1JYEA 4YLEA 1R00A 3DL2A 4BWYA 2EJVA 2WJJA 1XWFA 4U9IS 5HW0A 3AEUB 4MRVA 2C77A 2XB9A 2P79A 3NHFA 1DKMA 2X9LA 4JFAA 2FMUA 5D01A 1LX6A 4U6SA 3V1YA 1BMDA 4DHEA 1PE0A 2ONYA 5JXGA 2DPYA 2VDMB 2D1QA 1U04A 2WF9A 3MCAA 1R0ZA 4GLOA 4HUJA 1EE1A 3LAWA 4NPAA 5AK3A 4QU9A 5JI3E 2QRLA 1U8EA 2ZIVB 4Q16A 3W2IA 3ZCVA 4C3JB 2N46A 4MI1A 4RBNA 1UZNA 3TTSA 3IQFA 1YAHA 2XNDD 5DRYA 4D41A 4JUCA 3P7MA 1MBZA 3R7WB 1GQSA 1EVZA 3BMQA 3KJNA 4QZVA 3DVAB 3NBXX 1FFSA 5ALHA 3AEUA 2HTFA 1TLFA 2DSNA 2GPAA 4AMUA 1YUMA 1ZIXA 4P7GA 3TD6A 1Z6GA 3GTGB 3ZJUA 3KNZA 4YRZA 2FHPA 5IN4A 1SCUA 3WGIA 1PLLA 1CUJA 4J4HA 4Z0TA 4CLDA 1UMKA 5IULC 4V0ME 4DANA 2O2ZA 3GZNB 4FE3A 4K1LA 1FS5A 1S6YA 2QP9X 5FUWA 2ATVA 2VP2A 3PENA 2XCIA 1KMIY 5A71A 5L7WA 5ERXA 2BY4A 3CVUA 3NVKI 2K2QB 5DXJA 1L7NA 2NAPA 1YMQA 4PCVA 5AUQA 4CDMA 3VA7A 1L5OA 5DTIA 3EUFA 3DVAA 4PHGA 3ZQKA 3K2QA 3WO1A 4QQKA 3DB2A 5HXAA 1I2MA 4M8NE 3DLTA 1M7BA 3L07A 4UQOA 3DPSA 2NUAB 2CDBA 3JAWB 3TAUA 3G0CA 4DC1A 1EXDA 1XXLA 2OXCA 2QM0A 2TRSB 3TQOA 13PKA 3RRBA 1A9ZA 3WB2A 2QRVB 4IFTA 4BMDA 2OG2A 2BH2A 1Q77A 3NXKA 3O4GA 4UNPA 4BNNA 1EVIA 2Z0MA 3O73A 1L5ZA 4KQFA 5ENZA 3CEHA 3QYJA 4PG7A 1V48A 4ZC8A 2WJVA 3IXMA 2V5UA 1CFZA 3CM0A 2PUBA 1RNLA 2WLTA 1KAMA 3DKKA 3KX2A 4EUHA 2GK6A 3DHNA 2PWAA 3I4FA 4ND5A 3HFSA 4ESHA 1JJAA 3ABQB 3M81A 1R0RE 2NUAA 3JAWA 4MVJG 2QRGA 3PEYA 1U1DA 3AUKA 3W6NA 2CFTA 4JITA 2LXNA 4CTJA 2A30A 2DBQA 2QRVA 1TJNA 2OCLA 3OOEA 4ODIA 3ACBA 2R8YA 2WQ6A 5EQDA 1H23A 3NJ8A 4LFCB 1H8HD 2IU0A 5TQ2B 2IW1A 1P9NA 3JW8A 3ZBTA 1KMCA 2O5EA 4F9TA 5L9AA 1O9HA 1I10A 5ILOA 5H81A 3F3SA 2DHRA 1UBHS 4W1SA 7ABPA 1ADFA 4J7CA 5I7AA 4ZK6A 1N5LA 4DCGA 1HX7A 1DAKA 1NZFA 2EFDB 3IA7A 1EXWA 1PD1A 2WDZA 4HH0A 4L22A 4O2BB 3ZR4B 4DJTA 4LF7B 1YZYA 1DEHA 2C8LA 1G42A 1Y7HA 2QPTA 2J6HA 1OI2A 2FZGA 2PWPA 1K9SA 2OGZA 1LDEA 1BKSB 1HE3A 4J94A 1CJMA 1E89A 5MN6A 3W90A 3QKUA 1Y1RA 1W2WB 2JA7B 2Z08A 4L9SA 3WA7A 1NBHA 3F3YA 1NAIA 4RADA 4YRLA 3DOCA 4MIOA 2FP3A 3I2HA 5FRDA 3AR2A 4HMOA 3R41A 3UUWA 4DJDC 1VKNA 3ESXA 2ZTHA 4L57A 3UXMA 2ZJ4A 4N9QA 1R27A 4XGIA 2JAWA 5LMUB 4Y9UA 4MITA 5JAPA 1FBNA 3F4LA 3AVWA 3KKMA 3A0UA 3CUTA 5BSFA 4DLXA 5ICMA 1NG9A 1DCFA 3R5HA 3B53X 1FBTA 4FCWA 3ZCRA 4LDRA 5CNJA 1PTJA 3NUZA 3QWAA 2VTEA 2XA1A 5CA1F 1NBMA 4BBJA 1A4XA 1IDOA 1NLYA 1B43A 1XA0A 1JKMA 2LCIA 3PXEA 5FUXA 1XGKA 2A0XA 3DAPA 4RD4A 3DEIA 4GU5A 4RHEA 3E82A 2IPXA 3CIOA 1NUAA 3AR4A 3FHOA 2JA6B 1A95A 5DT2A 4L9AA 2FDXA 2PUWA 1XDUA 3NVMB 5ENDA 3LV8A 1NE7A 1GTVA 4D4IA 5FNZA 1Z7YA 4PRLA 1OB2A 1DBWA 2W0MA 3T52A 3OHMA 3ND9A 5K4GA 2JVIA 4JU9A 4LDQA 2YY7A 1YASA 5JZSA 5M2QA 2NVXB 5J23A 1PRYA 3M6IA 3OZTA 3QA3E 4QEKA 4HUQB 5JAZA 2Z4RA 2I80A 1ML4A 1P39A 1B7GO 1HPLA 2J09A 5MF6A 3R0IA 3R0VA 4R1MA 4HAIA 4CEHB 1XK7A 2WPDA 4Q24A 3WQBA 3OJLA 4BDSA 2BFBA 1HH4A 1TGYA 1IMOA 3ENKA 4Z8YA 5C1BA 3L1KA 3AINA 3SIPA 3THWA 5JI2E 2Z6VA 1CWUA 3MN1A 4XB1A 4OF4A 2QUKA 4KKXB 5DNAA 4EHBA 2WF6A 5IFKA 2PRJA 2H1LA 3FF1A 4OXXA 2PLWA 2AFHB 2QTAA 1ZNYA 2G1JA 1R6AA 1TOAA 2EX1A 3DQQA 1Y0BA 4MKIA 5CDFE 1PNRA 4JIMA 3RS7A 5I9TA 5JJCA 2OCYC 2ORWA 5ALTA 1JKJA 2Z1NA 1JR2A 5HA5A 3U7QB 5H9VA 4Z54A 4C7OA 4CEHA 3ND7A 1FLAA 3MTGA 1N6KA 4W82A 3TKAA 5JAMA 4S05A 2B1QA 3FKSA 1L7XA 2IIBA 2BGMA 1CJCA 2EC5A 5AW0A 3OM8A 3OT4A 5JATA 3I01M 1ZG3A 3HJAA 3T1HB 4UE3S 2IOFA 3G5LA 3QV1A 1O0BA 2CE7A 3PQ7A 2IYXA 4UD6A 1YUNA 2R79A 3C5HA 3JD1A 1R8YA 1SVMA 1VLLA 4RHTA 4A9AA 5PNTA 4BB5A 4EPVA 1PNQA 4QFBA 4MYUA 2C8VA 3ADCA 5EJ7A 2C5FA 3IKVA 2AH5A 4LRYA 2UUCB 2BLNA 2XMPA 3B7PA 1UPBA 3MTEA 5F23A 5HRAA 4YMHA 8AT1A 4XJVA 4ZD6A 1G4HA 1PQWA 2QNRA 3ITKA 1GAWA 1H6DA 1RLMA 2GF0A 3D7MA 4HZUA 4IOJA 5D7NA 4HV4A 1XI2A 1C8KA 5J4LA 2GZ3A 2YNMD 1T6ZA 3CRW1 3DUFB 4J0EA 5LA6A 3CZCA 2Y67A 3H04A 4D2IA 4DYDA 1E79D 1E5XA 3PPWA 1M0TA 4OHRA 2WEKA 4X61A 2AOVA 2AXQA 1Z0FA 4PXSA 4TMTA 4X1KB 3O7MA 3TN7A 1SG6A 3MMXA 5DKFA 3DOHA 2ADMA 3K1YA 4KZKA 1G1MA 3D3JA 3I5YA 2HJSA 3NOOA 4O4HB 3ORSA 5M3BA 2VP9A 5B6IA 2O8DB 2HCFA 4A3GB 4CM4A 2DAPA 2XODA 3V6MA 4I1OA 2I6XA 2P69A 2BVNA 4ZEMA 3HUFA 3LYLA 4IZIA 2Q8QA 1Z6XA 1WLYA 3ZHOA 1AMNA 2YNMC 3FLMA 3A4MA 1OGJA 3A1WA 1QFYA 3WYEA 2QD5A 3DUFA 2ZRDA 1HSZA 1EFPB 3G2NA 4BE7B 2V55B 5ALQA 3PXDA 3V32A 3GJ0A 4X1KA 3W78A 3EGDB 2N9UA 2J33A 4CRWB 4EL5A 3SR0A 1DWOA 1CRPA 3DGEC 1YKFA 4C2TA 3IP8A 3SQNA 4O4HA 4IS3A 4RMJA 4GYKA 4R51A 3RYHA 6CHYA 1ZNWA 2O8DA 2UKDA 3QLUC 3FUVA 1KQGA 1NUTA 2WA2A 2XNDA 2FI1A 4HQRA 3IEVA 3A31A 4I1YA 1CIJA 1T3LA 4ENQA 5F7XA 1ADCA 4U7WA 1LXCA 4GX5A 4CKEA 2C3OA 3KYIB 2RHMA 2VDWB 2FJ0A 3WNZA 1ZDMA 5B3KA 2W70A 2G36A 3LMKA 3M5WA 3WZMA 4ZYZA 3P32A 1J21A 4DR2B 1EFPA 1KH2A 4WEQA 3T41A 1F38A 1JR3E 4JBWA 4M0PA 3EGDA 3KQMA 2ZU0C 1UODA 3NPAA 1O97C 4AMBA 2KWIA 1XMJA 2OBYA 1DTWB 5IHPA 1E9VA 4FJ1A 5AM4A 3ZE7A 4F9EA 3B5IA 3NVAA 2HA7A 3RYCB 2GEKA 3I5MA 5EPEA 1JTFA 3TW0A 3HCEA 2D0IA 3ZNNA 4C0AC 4C7KA 1TWCB 1J8VA 3R3YA 5IX8A 4Z5XA 4OKSA 5F5LA 5KQMA 1OXBB 3ANMA 3HP1A 1TVKB 4FWBA 2L2QA 1W4RA 1U2QA 2A9QA 4XM0A 2NO4A 4YJHA 4QGAA 5CAEA 5CDYA 2NSDA 1LNZA 3UOAB 1D4FA 3N6VA 1QLJA 1CDDA 4IKEA 5DGCA 3ZW9A 1U2GC 4GPTA 2O7SA 2O50A 4A91A 1S02A 3KQLA 3O1IC 3EFHA 1VYTA 1DTWA 1ENYA 1CUWA 3A9RA 4IYJA 4OU5A 4ZZ1A 4DY6A 2AE1A 2B9EA 4AL4A 2JGNA 1NQ5A 3RYCA 3HDVA 5A5DA 5A0VA 1H1DA 1AS3A 3KBBA 1CP3A 2GM9A 1ZK0A 3FHJA 1H2HA 3RBVA 3WWEA 4BX0A 4JT2A 1XO1A 2FSIA 4DSZA 1VL2A 2R8PA 4FC6A 1TVKA 1RXSA 2FVYA 4MS4A 3UKOA 3IVMA 3S1SA 2I8LA 1NC1A 3H17A 4RYLA 1RI5A 2J5KA 5DM0A 3T3HA 1X86B 5KTPA 2O2EA 2OMKA 1ZEJA 2R8ZA 3KP1A 2ZI3A 1Z5GA 4OMFG 4CKXA 2CUTA 3SJCA 3UXHA 1OSNA 4BP1A 4B6JA 4E31A 3FKIB 4CM8B 1K6XA 5CPBA 1NUSA 1H8HA 5AK6A 3C3KA 4CEJB 2DHEA 3H8JA 3M1IA 5CGZA 5BQ5A 4TL9A 1IY8A 1NRIA 2RBEA 3PSHA 4B8WA 3F98A 2J9GA 3VPSA 3GGSA 1ZUD1 2F3TA 2QG6A 1O77A 3K8YA 4G24A 3BG5A 1GUFA 4NMHA 3LZDA 3PFBA 4BASA 3GLSA 3PTZA 2EFJA 3CINA 2VHUA 3DOIA 3GRPA 1JG6A 2IUTA 4F2WA 2A6PA 1YJBA 2E4VA 1ORRA 1A8HA 1QS0B 1SU6A 1ZW6A 3GEHA 2GYUA 1KI8A 2JIZD 3W9YA 3A4YA 4AZSA 1C1XB 1G8SA 1GZHB 2ZPAA 4Z9XA 1NVFA 2WD7B 4K6CA 2QVBA 5FYQA 5DOZA 4EHHA 2ZB2A 3ENQA 1ISRA 5C35A 2ZYRA 3BH7A 3C3EA 1KTIA 3IQIX 4Q6BA 4BMYA 2WSBA 2Z04A 4K9SA 1H4TA 4IX9A 1KJYA 4LOIA 3HZZA 2Q0QA 2ZI5A 3IIEA 1DLIA 4IJKA 5ALZA 5LB4A 3DV9A 3ET5A 1GPBA 1NJ5A 1S9HA 4J49A 4AJEA 1C50A 4US1R 2GUWA 3CTPA 3JYQA 1ONSA 1H05A 1QLWA 2WWVD 5LWHA 1TB4A 2R751 4BWFB 2ZS8A 3LBIA 1ESCA 1ZOSA 3PEFA 4JXJA 1J8YF 3AB7A 1QO0D 3AQIA 3OHSX 2EIHA 2FCRA 2WD7A 2YY5A 3FBWA 4ZZ2A 4UQLA 2P6PA 2OV2A 4FKBA 1GZ5A 3V8PA 2N75A 4FT2A 4JJ6A 1E2IA 3DV2A 4ARIA 1SG0A 3I4LA 3NXSA 1SKYE 4OEHA 3WGOA 4H3VA 3RFUA 4U7JA 2H54A 4BIIA 4UDNA 1JQKA 2DKOA 4P0TA 3V7NA 5EZQA 4DMKA 4Z4HA 4W5QA 2GK3A 4EHLA 1U0JA 2I8CA 1OLSB 2PMBA 3TSOA 3ESYA 4RL4A 3INYA 5JAHA 5D3MB 1ULTA 1QX3A 1HV8A 1FDTA 3LNTA 3MT9A 2VYVD 3IQXA 1BNCA 3MMNA 1U2DC 2CLFB 4Q01A 5DBOA 1UM8A 1XVTA 2GHTA 4BNDB 1AX9A 2G8NA 3QVGB 3QVXA 3S2GA 1P18A 2B9VA 4CQJA 3ZIUA 3KJQA 4YMVA 2X5XA 1JLRA 1XQXA 1VI2A 4Q7KA 1QZ3A 5IBRA 4AZVA 4DV7B 1LNQA 4A0GA 2TECE 5FIUA 3UWPA 5JTTA 4PLPA 4JXXA 4YS6A 2B0CA 2E87A 3ZHVA 1NATA 2I7CA 4IMRA 2VBFA 3WGNA 1XWIA 1R50A 4DTIA 2X4DA 4F0JA 3V1NA 4X6LA 3BHIA 2R0QC 1JR4A 2P9QA 3WMRA 3R5JA 1NNSA 1QIJA 3NKVA 2R5NA 4C3ZA 3GPLA 1X0XA 3KTOA 4BNDA 1V16B 2ZRFA 3AFGA 3UIEA 2OECA 5ALDA 2BKUA 5F2EA 5KTSA 1VL6A 2V6FA 1XEXB 3BEOA 2HX1A 3TK1A 3VU1A 4AO6A 5JDCA 2IYSA 3EZGA 5KS2A 3I6QA 1AQJA 3IVXA 3DFZA 1SO8A 2YW9A 3REQB 1ZBQA 1N8NA 2EBWA 1DNPA 1DXYA 4M1KA 3B1VA 4ETMA 4P93A 3DZJA 3P20A 4FGJA 1GYPA 2PGNA 3PG5A 2XTAA 4U7FA 1NFRA 3P4UA 3ZBPA 1AK1A 2VF7A 4EA6A 1HEUA 2B63B 3CWCA 3LOPA 4XSVA 4ER5A 1PK7A 3N0WA 5FHQA 2WWYA 3LHFA 1JLHA 1F2DA 1WUYA 1YBVA 1V16A 3AKCA 1VA5A 3CPJB 1SCAA 3DMRA 4GX2A 4MS3B 1MR3F 2OV6A 4DNPA 5MGNA 1C8VB 1V0JA 1XEXA 4HAVA 1GYRA 3K9BA 3U44B 2AE2A 3UJCA 1DTSA 3TSWA 5KMGA 3A4NA 3OQJA 3REQA 3W7VA 2EYQA 2IWHA 2CXSA 2FWNA 2FSVC 3NTOA 3L40A 4KEAA 4KMSA 4AJKA 3LT4A 1KFEB 3K5HA 2ZQZA 1YR3A 4UM5A 1SXJE 1Q0LA 2EFEB 2ZIXB 3EH1A 3GNLA 3VAAA 4B4OA 4ANFA 2YNMA 3KELA 3DWGA 1Z5OA 1N6NA 1XN1A 2W6ID 4WOCA 4ZEOA 4P36A 3LCCA 4U63A 1E79A 4CMEC 4Q7EA 3STUA 4FONA 521PA 2FG7C 3OPYA 4QD3A 3BREA 1VFPA 3B1JA 4JSTA 3B85A 4ZOLB 4UPDA 5JQGF 2FWAA 2BLLA 1VJ0A 5BQOA 3ND8A 1TD9A 3T12A 3OKPA 4YASA 3UHOA 1RYZA 1PG5A 3WADA 4DAEA 1P7CA 5M04A 4BRZA 3QLUA 1J9GA 1WY5A 5AUNB 1JG2A 1LLFA 1NY5A 1R3UA 2ERCA 2GN1A 3MGAA 1T26A 2VP4A 3B2EA 3BK7A 4G25A 4DPKA 1DAFA 4IUDS 2RHJA 4A3MB 1K6IA 1A9YA 1CKEA 3FGPA 3I9V6 1RKXA 5HNKA 1D2AA 2I6UA 1MPXA 3MS2A 4AKGA 3V1UA 4EHFA 3AFHA 3SS8A 2HJRA 4F72A 3KUKA 1O4WA 2G4LA 4ZOLA 5FT9A 4JCCA 2Q5QA 4Q1BA 3U3ZA 3WKCA 4F3CA 5IH3A 2HDWA 4F5WA 3T1OA 2NYRA 2PKXA 1QIGA 4OYYA 5G02A 2Z56A 1WSBA 5DX0A 4RSGA 2RAFA 5HVNA 1DEAA 4BMZA 1EK0A 2R4UA 1GPAA 1DMRA 1M1NA 1OASA 1V1MB 3QX9A 2VPYA 4MRRA 3WSVA 2D00A 1CRLA 3FFBA 3TB6A 2C0QA 2C2OA 1SK9A 1ZM4A 1A8UA 4YALA 2IXBA 4JS0A 4ZT6A 3LHIA 1ORDA 1ICEA 3OO0A 1NIPA 5K0CA 3QUAA 2H1CA 2UYHA 1E0JA 5G41A 2QORA 5IKMA 4R05A 2PS1A 1O8CA 4LC1A 1O89A 1I24A 2HJWA 1GRQA 1CD5A 2I4NA 2FEOA 3BE4A 2GN4A 4KE7A 5JECA 1A8QA 2FFJA 3L05A 1S3SA 2X13A 1R6VA 4NBKA 1W94A 4RZQA 4M0DA 1TUIA 3DHVA 4TQGA 1ZK3A 1V1MA 1K89A 4GXRA 4S1NA 2HWXA 4OB6A 3QVTA 4FFBB 2AG5A 2ZDHA 3IDOA 5SYNA 5FAKA 3S14B 1P6XA 3UK6A 5LNK1 3RIGA 5LBTA 2QTLA 3LVRE 3MUEA 3A9WA 3ETEA 3STTA 3LT1A 1FQKA 4BGDA 3VDXA 5JJ5A 2ILTA 4N41A 3N2IA 2I54A 4CDRA 4JC8A 1D0IA 2ZRKA 4HG2A 3UA4A 3UMGA 4AI6A 4AP6A 2BE7A 4EF4A 2Q5OA 4PF1A 2BGWA 2HWKA 4B35A 4FGUA 3PPXA 5IU6A 4O33A 3SP1A 4YR9A 1GGNA 1W30A 3LPAA 2P2CA 4P1ZA 5JBNA 1MF7A 3S1AA 1U1EA 1D1SA 1QV7A 3MSXA 4E2FA 2I6SA 1XAIA 3GEBA 4FFBA 2OFWA 3AJRA 4HGOA 5EC8A 3Q72A 3S5UA 4KNVA 5AKGA 3C8ZA 3LC7O 1XCLA 5ILQA 4BIMA 3W79A 3COWA 4YXWD 3DDUA 1K5GA 1WCIB 1LBHA 4OK3A 3ZJ4A 4BVLA 1MEOA 1MQSA 4DJJA 3EYAA 4OK5A 1DKPA 2NU6A 1BZYA 4H3SA 4NBWA 2GHIA 4FMPA 3VH4A 3WL6A 5IT4A 1NBIA 3OJCA 3OZDA 2ZR9A 1C0KA 2R6HA 2AHRA 4DC0A 2Q8NA 2W93A 4F60A 3CRMA 2J3HA 1F7VA 1PCXA 3SN6A 5EESA 4DLSA 3D8HA 1A5ZA 4AQ7A 3Q8XB 4JNKA 4XVCA 2I1LA 2P9ZA 4DDMA 3MAGA 1JX6A 3MWDB 5LBIA 2YWCA 2JGLA 4G5FA 4XGNA 4OB7A 1IBCA 1U7OA 1WCIA 1OC4A 1YR1A 2EP5A 2PL5A 2FW8A 1UJ2A 2GZ2A 2BKVA 1O8BA 3JVVA 1I7SB 4AJ1A 4DIKA 4PSAA 2GO1A 4EHKA 4MAAA 2P9CA 3E5MA 3F9CA 1JU9A 2MYPA 1MB3A 2EWWA 2GPYA 1JZTA 2WSLA 3IXLA 4FEGA 4ECEA 5AVWA 1P19A 3HBMA 3ZU4A 4LF4B 4I50B 3VQTA 1WSAA 3LD9A 4ZI2A 1MRNA 3MWDA 2ZETA 4AY6A 4QDUA 1E1CA 4X60A 4RF2A 3RRMA 3AVYA 5I7HA 2DT8A 4O4IF 4QJ5A 2WJGA 1I7DA 5AVSA 1N33B 5KNBD 1QC5B 3MIZA 3DYIA 4M49A 5AI0A 1P5ZB 3CE9A 2WKWA 5CB4B 4BNZA 1NXXA 1QO0A 2OCPA 1FUIA 1M1XB 1H94A 1Q14A 3K15A 1IJBA 1BD3A 2JKYA 1YR2A 3BD9A 4RHXA 3PNYA 4IJ5A 4QNNA 3V4FA 2MMGA 3HNOA 4ZCRA 2YQ4A 5HGXA 3FE2A 3T0GA 3MUNA 4LY0A 2Y1OA 4FHDA 4YCSA 3ORRA 4I50A 4UUNA 4F45A 1F06A 2O52A 2ICAA 2XNJA 3QIAA 3TNDA 2VNJA 1VLMA 1OH7A 3QKWA 1A5BB 1XZQA 2NYUA 1ECCA 1QC5A 4DMCA 4UNRA 3GLRA 1SWVA 1XZBA 2VYVA 2XUPA 2WJ6A 4HBZA 4R1OA 1NVWQ 2FG5A 4UEOA 3THXB 3E7PA 3FUXA 3QI7A 1JI0A 3TUIC 3ZY2A 4M60A 3WAGA 2F1OA 1RMYA 1LBEA 3KKPA 3RVRA 3VRHA 4CQMD 1PZNA 1M67A 1PFYA 1Y1KE 1JIVA 1QP4A 4P98A 2DUJA 1P4AA 4KAFA 1EM6A 1AGYA 2OBXA 1AKVA 4HAXA 1FNBA 4AF7A 4JCOA 1PX0A 2XA9A 4LPKA 4BEWA 3M6UA 4OMCA 4D96A 4BRWA 2QY6A 3PQ2A 2J08A 3CF0A 1Z38A 2A9VA 3DT9A 3HA5A 4I5IA 4JLAA 2PKEA 3IOBA 3EZ2A 2DTDA 1KVRA 3RS3A 4XIJA 4DRYA 1ZFNA 1T1EA 4C4XA 4KQEA 2QPAA 2YC4C 1G5TA 3EGCA 3K1TA 4QXRA 3THXA 3HUUA 2A0YA 4PLHA 1NA5A 2NZYA 3WRVA 3NH9A 3NRCA 4HXYA 5I4KA 2XRYA 2BYTA 2OZVA 5DGDA 4YV2A 2R8OA 2WINI 5EOVA 3WLEA 4B40A 3O83A 1LLUA 1EFLA 1YFKA 1JTVA 2JIMA 2V6BA 3GBPA 3BB4A 3GD5A 4WLVA 4XSHA 1UOEA 1Y4AE 2IS6A 1FJ2A 1M2FA 1GKUB 2BEUB 1Z45A 3N59A 2QLTA 1VM6A 3EQ8A 1RM5A 4KP7A 1EEXB 4ERXA 3T8YA 2OR3A 4RTQA 1KYWA 3B3GA 2F8SA 2AZDA 1XVLA 4C6HA 1IQPA 1EGHA 2X0DA 3IMEA 1U7HA 2WPNA 3IP6A 1GZ3A 1KY5A 3E9YA 4OHVA 4XRRA 4EG5A 2PTGA 5JYDA 4QBFA 1VXOA 3K05A 1Z4NA 4CMEA 5JS7A 2AOTB 3O8OA 1W46A 3F46A 1N6HA 5A3RA 3UG7A 1NW4A 4DILA 3T7CA 3K92A 3EUAA 3R7SA 5LU8A 3ZGYA 3EPJA 2CSXA 2YVUA 1JDUA 4IDOA 4MUJA 3TLBA 1J33A 1E7WA 1Q12A 2V9PA 3NAMA 2PSFA 2BEUA 2G09A 4YDHB 5FXMA 5EAIA 4Q7JB 1L5YA 3C3XA 4PM4A 5F3WB 1R64A 2GEVA 1J49A 1LJ8A 1WXXA 5FPHA 4R2JA 3D0QA 3PQ8A 5WRFA 4DHWA 2IELA 3COVA 5T4FA 2W6IA 2VXCA 4J3NA 3UB2A 3AF6A 1MRSA 2Z1MA 3TCXB 2XYPA 3ZVKA 4TYQA 2RI1A 4C6SA 2AOTA 1RYNA 2HLHA 1J2JA 1Y8RB 3CBQA 4PC7A 4HC4A 4O5AA 1UUFA 4UTZA 2Q6TA 4B17A 3T5BA 3A4TA 2PANA 4ZCPA 4MQFB 4EM6A 1QHIA 2OCBA 4GQBA 4YEDA 3CH6A 2J0EA 1LDYA 4Y2UA 1M6VB 3QPCA 4YN3A 1OAOC 3OC6A 2E55A 4A6DA 2ZZNA 2ZCVA 2EGHA 1FC0A 3O26A 2Q7XA 2IP4A 4QPDA 3SQOA 2BMEA 3TTVA 4GBJA 4WFKA 2R47A 3SHOA 2XDWA 5JBIA 3PZRA 5AW9A 2V1XA 4HQOA 4XXHA 3D31A 5CB4F 3KOOA 2GEFA 2AN4A 3D4PA 4KFSA 1YB2A 2YJNA 4C2BA 1N92A 4RLSA 1DZ3A 1K6MA 3UC5A 3TBFA 3R8CA 4B4UA 4GP9A 4CWAA 3E1GA 3E7FA 4DSUA 2BAGA 4WDQA 1OXSC 1TYAE 3OWHA 4MQFA 4JB0A 5K0FA 1C1DA 3DDZX 4EP1A 2O2DA 3UCFA 1M6VA 5J1TB 2QD3A 4MW7A 4NI5A 1P2UA 4OSOA 3RT9A 4C0KA 5I9IA 1PD0A 5L4SA 4E5SA 4XPIA 5AIAA 4ZCIA 1PX2A 3QUCA 2YC2C 5JMPA 3AL2A 2LIPA 4YAWA 1P4HA 5SV2A 1YL7A 3B3QA 3QBEA 2OCIA 4ZAWA 3VU9B 4C05A 3G0GA 4QLBA 1AA9A 3BZBA 4QYTA 1MU0A 4WA8A 4W5RA 2YMQA 1KL7A 1HM5A 1QF9A 1VYHA 5HFNA 4EAAA 1H9BA 2RFLA 4KO2S 3DCNA 4UZEA 5EWMB 1GTL1 5FTKA 3KE9A 1BDHA 2Y6UA 3OFJA 4I1PA 1USWA 4M1MA 1JI3A 2UYCA 2R86A 3CH7A 3L49A 3V2GA 3WGLA 4YT4A 1ECLA 3UZUA 2GXQA 3J81A 2H8GA 4QTZA 4ENTA 4GR4A 3O8BA 4DLWA 2C8JA 5L3QB 3P9ZA 1CY4A 1XX6A 3E3NA 1APBA 3I6MA 3L0DA 3FAZA 4BC1A 1TZCA 2DT5A 3VU9A 2P27A 2WV9A 4NU6A 5EVCA 3WJ7A 4ABTA 1IOZA 1E60A 1II8A 1Z2EA 5DBIA 1XZMA 1CF9A 5B4UA 5BURA 1ORIA 4ER0A 3UJPA 1I14A 2X23A 1R18A 3L04A 5EWMA 2HZ7A 4UTPA 4N76A 1T91A 2XQIA 2FPIB 4R16A 2EW2A 4OQMA 1V4VA 3FB4A 5IAOA 3HUDA 3BDVA 3LYHA 1RFLA 1THGA 3G5AA 4R5HA 3UJAA 2BMFA 5L3QA 1LUAA 3QZUA 2B35A 1VDMA 1VG8A 1J2EA 5BOSB 1XQVA 3B12A 4BQRA 3F3MA 1LPPA 2SCUB 2WJYA 4RK0A 1J9EA 4I99A 3HL0A 5FBLB 2WYUA 3FKJA 5KAMA 4X64B 4YXWA 5IJ9A 1CV2A 1PHRA 2RAPA 1TKAA 1YCHA 1HDCA 3LVQE 3R2JA 4INOA 1E9BA 1EFDN 4KQ9A 4LZZA 3S7ZA 3ZWAA 1RZVA 2HCBA 3MTDA 4NFHA 3RFVA 4ND4A 2X58A 4IDCA 2OFFA 1KHTA 1U0BB 3M3DA 2QD4A 3OJWA 2EGUA 2R6ZA 1QFJA 2PYZA 3LUDA 3LXRA 4EH1A 1HKHA 4EHDA 2E6KA 4MKXA 5BN3B 1TIBA 3FUTA 2V7UA 3EBPA 3PT5A 3IJ5A 3I6ZA 5G4LA 3TFWA 5BOSA 2IX9A 1Y5RA 4OYRA 1J4AA 3IQHX 3EF3A 1YCDA 4B6QA 3C7DB 4WY2A 4DABA 4HO1X 4MV4A 4ZVSA 2DQSA 2GXSA 1Z0IA 2LWIA 3G0DA 3CA8A 3GIDA 2LW7A 2RGWA 4MUBA 1UJNA 3U3MA 4CDGA 1D8TA 2X8LA 3NBUA 1EWRA 1P7VA 2PKCA 1YZUA 3FJ1A 1EBBA 3O3CA 1Y8QA 2A5FA 3CNBA 4K9QA 1UIMA 3DBIA 2JBWA 3C4JA 1FY2A 2QVCA 5KSOA 3SF8A 3BTVA 5LJLA 2FZ5A 4R1QA 3L6BA 4KQKA 1DDIA 4KJXA 3W9BA 4F56A 3OIVA 3TXAA 5I7VA 1M10A 2QM7A 2XDYA 1JG1A 3GAZA 2W2QA 4CG0A 2QW8A 4M1YA 3WMFA 4IUCS 4UPEA 3EWSA 1JMVA 1RXEA 4FFMA 3SS9X 4M38A 2FPGB 4Y1EA 3WGQA 5FPKA 5K8JB 3IILA 1AQUA 3RSQA 5JCXA 1GPUA 5KYWB 1XTJA 2E4UA 3A10A 1UFRA 4YDSA 4OBBA 4Z3KA 2BF7A 1L4GA 4OQQA 3EZNA 2DBVO 1DX6A 2I4TA 3QE0A 4FR5A 4NCNA 4D9CA 3R7NA 2EDAA 5FF9A 1PJQA 2VHVA 3GXOA 1CUUA 4B2PA 1BE6A 2RAUA 2ZSHA 5GP1A 4EB8A 2XGOA 1TL7C 3O47A 3UOGA 3CF6R 4XB6B 3W1EA 2VAXA 2DPGA 3N0XA 4XQGA 4TTPA 5HKBA 1I32A 3Q2KA 4QOJA 1CJKC 5CNKA 4A36A 2QTZA 3KPWA 1P4GA 3IQDB 1U28A 1JKIA 2FPGA 1S8OA 2ZREA 1M2JA 3TI7A 4NC9A 4TWZA 2XUAA 1XF9A 1CR2A 5EERA 2A2ZA 3H5AA 2DH5A 4RK1A 5FI3A 3M70A 3MRXA 1FX1A 1U8FO 3T7JA 3HBLA 4KYTA 1Z5PA 2BM9A 4PZDA 3Q2IA 2HGSA 1R4ZA 4IIGA 4ZQBA 5C18A 3ZDCA 2CNKA 3AR5A 4YFYA 4CQMA 1SHJA 3QE4A 4W5OA 2CY0A 1L4MA 4TTQA 4C5CA 4NCAA 1SUIA 2GSWA 4NU8X 3U26A 2V54A 4YMLA 4NHOA 5E1OA 5JH7B 2QMEA 5BMOA 2C2MA 4F4JA 3W8FA 1SU4A 2WMYA 3C70A 2B7LA 1XZNA 2CXRA 2M98A 1JQJC 2Q1TA 3LWZA 4POAA 1E2GA 2JBAB 1A9QA 5DTMA 5GVRA 3TZEA 4N7JA 4PHFA 3R7BA 1GL3A 3D54D 1DO2A 1F5SA 4I4TA 2VK2A 2JFGA 3M2TA 4EELA 1T2NA 4HFMA 1UK8A 1K5DA 1KJWA 1KQ3A 2YRWA 5EI5A 1EGVB 1WA5A 1XDDA 1OLXB 4HB4A 2C2XA 1ST3A 4J0DA 4PIVA 4H1WA 4EABA 1V5WA 3M1LA 4W7IA 2ZRBA 3DC2A 3DM5A 3DFKA 3DR5A 1KR2A 5DW0A 1KO4A 1UMDB 3E7DA 3ZW8A 4PIPA 3IE0A 5JH7A 3D8RA 1VSBA 3BSSA 4G0NA 4K46A 1UKZA 4PLGA 3ILSA 1CEEA 1DEOA 2WHRA 1U5AA 2DPHA 2G08A 2JBAA 3AUYA 1GUBA 3DE2X 5PGMA 4PZZA 5JNTA 4JQOA 1HY3A 3ZH2A 5LDHA 1YFZA 3I34X 3FIJA 2BFDB 3I9V1 4KSYA 5BNIA 4BLSA 1C0LA 2NXWA 1TC1A 1CY8A 4E4RA 1Z13A 1H0KA 4RKWA 3VDQA 4DCMA 5JS8A 2P6RA 1OLXA 5HYVA 1OB5A 1DS6A 2Y0CA 3UKJA 1FFXB 1NVVR 3OPVA 3SE7A 1ZRSA 3NOXA 2ZJ8A 1ZMRA 2MSDB 5FQOA 2B8WA 4JVLA 1BJRE 1N7JA 2JI9A 4ZJPA 2ERYA 1CUVA 1EVQA 1OAOA 3PCRB 5A9SB 3DVRX 5DSZA 1BE0A 2C9YA 1RWQA 4GZLA 2OORC 5HM6A 2OXFA 5JCPA 5CTAA 5T67A 3K7AB 1NYTA 4GI7A 2FQXA 2H2AA 5K9ZA 3IQZA 1MC8A 2ZWPA 1E3IA 6GPBA 1WM1A 1ECFA 4RKYA 4I2VA 4REOA 3RANA 4DIFA 2ETXA 4L1KA 1FFXA 2EWVA 4WXEA 4E22A 3LRTA 4JX9A 3C8MA 1OTYA 2J5XA 3DW3X 2VUSA 3F74A 2NU9B 4MUEA 1FQJA 3CZ4A 4RU1A 1DMSA 1PG2A 1WZNA 4IYRA 1WRBA 4D4HA 2PUCA 2QGFA 5A9SA 4PR3A 3WLRA 2JKVA 3K0HA 4AU1A 1JHXA 1W9HA 5ALIA 1D4AA 4PRYA 4HNHA 2BHLA 3PUHA 1SQFA 3A25A 1LDNA 1UMBB 3DZHA 2V96A 4NARA 1TYEB 2PU5A 3C43A 1B74A 3EARA 4YJ2F 5KDOA 2B36A 4MQEB 3I23A 3KE8A 4KRGA 2GF2A 2O3UA 2IWRA 5HJ7A 2PFKA 3BTOA 5ES3A 4XB2A 1WU8A 4U2DA 4YMUA 3IUNA 5DE3A 1LPMA 3L6OO 4UU8A 1Y6JA 3W5CA 2JH3A 5DH9A 2NU9A 3DMNA 4QYMA 2AWOA 4BO8A 4BNJA 5F33A 2BM0A 4PPQA 1LSUA 5JNSA 4XWWA 3FKQA 2GEDA 4J91A 2H07A 3VBEA 1QFMA 1Z8FA 4RYDA 3OSZA 5BNTA 3V9PA 4P7KA 3PQDA 1E94E 4IQ0A 2NVTB 2VOJA 5DLQC 5FI5A 3FFAA 1E2FA 1UMBA 2FSPA 2R6FA 3Q0IA 4ZA2A 2CCGA 4AJLA 1JPVA 3A4LA 2VPXA 4CIVA 1O94D 3CX3A 1GA4A 4DCSA 5CLLA 5DXAA 3MJSA 3V1MA 5H8WA 4LISA 3WIOA 3L8YA 4EFDA 4I6EA 1QZXA 1D2HA 1UC8A 2ZAMA 3UW1A 4BQFA 4IWYA 3VHLB 4M37A 3K9WA 3DMFA 3OTIA 4LBWA 4A3BB 3A9UA 3W2FA 4XWYA 5H68A 1I4DD 4NE7A 5FA5A 2CNWD 3I1JA 4FN4A 5L45A 2QR3A 4PHTA 3PDWA 2BFWA 2VHWA 1QIIA 5CLHA 1NVMB 4NU5A 1EDDA 4I1RA 3DBHB 3IEKA 2R7MA 3Q1LA 5FH9A 1RRMA 2I1QA 3WQHA 4NBVA 1T6BY 5LQKA 4HQLA 5BW5A 3KQYA 4QJ3A 3FMVA 1TA9A 2D1TA 2HADA 2Q6KA 3DFMA 3RI3A 3PGLA 1QRTA 1OWOA 1HLDA 2C2YA 4CLRB 2AN3A 1P2BA 2RGBA 2AKAB 1RW4A 1BQEA 1GNLA 4YCJA 5IVHA 3S55A 1GQQA 4P83A 5B6PA 2F9LA 5GJWC 5A5VA 2PH5A 1NUUA 1I4TD 3TSZA 1R5BA 1SUEA 5HIAA 1GPLA 3OZEA 4IIUA 1UXKA 4I9FA 1GSAA 3N58A 1I1HA 1M73E 1Z0DA 2CD9A 2F2TA 1DP4A 3ASVA 4TPKA 1CR6A 3PNBA 2VJCA 1MGPA 2QN3A 2ZUBA 1AF4A 3BVPA 3ENVA 4QDOA 3QXCA 5EFZA 1VBNA 5F12A 1IHDA 3C16C 2ZJ0A 1D2EA 5EUBA 1X87A 1O5TA 1WE2A 1MLDA 1DG3A 1N2ZA 2PA3A 3H05A 3I72A 1Y3AA 4JVMA 3ZK8A 2XLBA 1Y8AA 4UCWA 1R0LA 1F2TA 4U7TB 4Z53A 3BFXA 1KRHA 2AMJA 2FZVA 3WL7A 3PKZA 4BMPB 3QWBA 2IOHA 3B70A 4KSBA 2A1UB 1KOFA 1KDZA 4M1QA 3DZKA 5BR4A 4F9FA 5IDWA 4LGCA 2H9AA 3BWYA 4M0UA 2QRNA 2EFGA 1EQUA 3W5VA 2H2DA 2JATA 1HYBA 2A33A 3T3IA 1VI5A 3IOCA 3NT4A 2PJDA 3OTHA 4QM7A 2ZBUA 2I34A 5CFOA 1KI4A 2O8BB 3AOEC 4HTAA 1GCUA 4MTCA 2R87A 5JDIC 4OH7A 1CR1A 4OOFA 4YNBA 5FWDA 5GIPE 4YWJA 4KPYA 4YIHA 4LJLA 3VUEA 2FLWA 1CCWA 1WTCA 2BUCA 4Q1FA 1UKAA 2EFYA 1VJDA 4W8HA 4BO5A 2VZ0A 5KEIA 5B7NA 4LC0A 4AKTA 2IPLA 1BS1A 2JVKA 2ZCUA 4TQAA 1HLGA 1YTUA 5AVUA 3KETA 3ABOB 5I47A 1UCFA 4PQFA 1KH1A 1XR3A 2BBSA 2QSYA 3DYVA 4S2UA 4DSAA 5ULLA 3ELUA 4DR4B 5BW8A 1U81A 1QYWA 1VPVA 2QUZA 4X20B 4R81A 4IXMA 4EY5A 1F9EA 3ILHA 4J90A 4N0QA 4HLCA 3UTDA 1R3DA 2QY9A 3G0BA 1A9RA 3MJTA 4IEIA 4X3CA 1Z68A 3H75A 1RWPA 3B5EA 2XZTA 4OHOA 2PUTA 1XZ8A 2XXAB 1Q84A 1V2HE 3PIRA 4TV8A 1IHUA 4IUBS 4DLZA 1DOHA 1Q2XA 5ALKA 5ALNA 2QMUA 4DARA 3PPVA 4ESEA 5C4IA 4GW3A 4YI5A 4ZALA 5K0NA 4RMHA 3IJEB 3WTCA 3PXBA 4I55F 1WR8A 1JFLA 4EA8A 2ZSFA 3DD1A 3QFHA 2BJHA 3NFRA 2QZSA 3R5SA 4FJ0A 3J80A 3AX6A 4YV7A 1UT5A 4JGGA 4P5PA 2FB9A 1GEGA 2O0JA 4QAJA 4Q4HA 2C3YA 3ZXUB 3C3MA 4X20A 4RHUA 2GZHA 2JLWA 3A7EA 2X6QA 5H0IA 2GJ8A 2PNFA 1A5AB 3H99A 3IB6A 3JVEA 3PL5A 4ZVLA 1TEXA 2AMLA 4I36A 4M6WB 1JR6A 3E4DA 5CG1A 3PEWA 4BB9A 2WAOA 3H8SA 2XXAA 1CY2A 4UBJA 4CFZA 5KJ6A 5G1OA 2PFSA 1QH0A 3AOGA 3HR7A 1D6NA 4LVCA 4DJFC 1XEWX 5F3RA 4B32A 2I7TA 1GGHA 3R3XA 1Y4ZA 4GS5A 3UC9A 3OCVA 4ZCQA 4MLZA 4EY3A 4Q37A 4RY8A 1TK3A 2Y27A 4PVDA 1ZCZA 4ARBA 1V1RB 4P34A 4OI2A 3UA3A 1AKWA 2WYHA 4H7HA 2HU2A 2QRJA 4QBKA 3B20A 2JJ2D 3E9EA 1NKTA 2C97A 1KRXA 4L28A 3GYGA 1E32A 3WRYC 1X3SA 1UXGA 4H59A 3NASA 4KFCA 5DM2A 1YL6A 2LRHA 4MINA 3TQIA 5CBKA 2ON6A 2WHXA 3DXZA 1WXGA 3PRYA 1BCRA 4F21A 3WGZA 5AW7A 5DPMA 2SHKA 2H7CA 4LJ7A 3LLCA 2CJWA 5K8TA 9GPBA 3TLXA 3U40A 5K4HA 1FLDA 2R1VA 3IO3A 4TKUB 3ZDQA 1LJUA 1K75A 4W4TA 3AI1A 3LYAA 5JALA 4MEAA 1YJ8A 1V1RA 1Q1BA 2I3BA 4NYJQ 1NQWA 3VR1A 1IY9A 2CT8A 4UEKA 2DKNA 1EUCB 1NAHA 3GFTA 4BKQA 1K2WA 3RRFA 5C7OO 1TJ5A 2GK7A 4IM7A 3KXIA 5JD5A 1R0SA 1UEXC 1DFHA 3ZU6A 2SKDA 4PGMA 4IV5A 1WCYA 5SY6A 3OU6A 1TO6A 3EG5A 1M2KA 1HOTA 3F7NA 1U4SA 2I55A 1Z5UA 4LQCA 5D87A 1L5QA 1OVGA 1QG0A 1MX9A 2R6CA 4UBOA 3MTAA 3MWYW 1VYVA 2GLXA 4NYIQ 3AM1A 5KPDA 2CL6X 2IT1A 1F0KA 5CYOA 4FMDB 4KG7A 1U0SY 1SY7A 2ID8A 2XQJA 4GMDA 4I8IA 3AQ4A 4DWWA 5ALVA 4LTMA 4OM7A 3IGFA 2CSUA 5FEUA 4A73A 3QXHA 3E1SA 2FXVA 3IB3A 4EYQA 2ZXUA 2R60A 4EPRA 2ERXA 2WD9A 3ZE6A 2VATA 5JLJA 3PNQA 1VBKA 3H84A 1GY8A 3BMNA 3JQFC 2B25A 1RYYA 1DO0A 2KJQA 5D2CA 1ZMXA 3CBGA 2PGAA 5FBKA 3TVTA 3OX2A 4MVJE 2KLBA 1W2GA 2QE7D 1N7HA 2JJMA 3EBLA 3JD0A 1EHCA 1L4YA 1T2AA 4PHCA 1CDEA 2EZ4A 1P75A 5JLAA 2GYYA 3RF7A 1ZICA 1C4OA 4HZGA 1DC7A 3JQDA 5IFLA 2OP1A 2AJ8A 2OFXA 3VO9A 3RBXA 2ODWA 3ZKAA 1CF4A 3PC8A 1K5PA 1EP3B 1F6WA 4TWRA 4E33A 4DZTA 2AXPA 4EJSB 4BECA 1O94A 4C89A 2WNHA 1LX7A 4WOKA 4RV5A 2K87A 1FIUA 3KJEA 3PNOA 4J0IA 1JHDA 1YDMA 2XUQA 3VZQA 3DO8A 2HL6A 5FI0B 4KAXA 3AJ9A 4BKRA 5FBVB 3CZPA 5AW1A 5E6SB 1LPAB 5HDQA 1IVSA 4JYCA 3L9WA 3PVZA 4E7PA 2AFHE 1M8KA 1Q16A 2CNWA 4EW6A 4FMCF 4ZCLA 1CUHA 3OF3A 3PFWO 1PFWA 1D0VA 3PFCA 4R2HA 4EJSA 4KUEA 4BLUA 4NDZA 3OCUA 2C5BA 1G60A 1E2EA 2AD1A 1CUEA 2W42A 4X90A 2MHCA 2OG1A 1U0NA 3FD8A 2E0IA 3LTEA 4RWEA 4DZZA 4H31A 1AK2A 5CA1A 4TWJA 1K63A 3WKAA 2RB5A 2XDQB 1WUJS 1ZITA 2X41A 1I1OA 3CFYA 3EWAA 1NWHA 4XVHA 4RABA 4DV5B 4LWQA 4ZDIA 4ENUA 2BEJA 4OHXA 5GJBA 5TRTA 5CLIA 2PM8A 1KP3A 1JS1X 2VF5X 2XMZA 1UP7A 1TQ4A 1WB4A 2P90A 3HJTA 3R23A 2VDJA 4GD3Q