1S2OA

X-ray structure of the sucrose-phosphatase (spp) from synechocystis sp. pcc6803 at 1.40 a resolution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
244
Chain Sequence
b'MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYHLDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRNAQPELLHWYDQWGDSRHYRAQSSHAGAILEAIAHFDFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sucrose-phosphatase
publication title The structure of a cyanobacterial sucrose-phosphatase reveals the sugar tongs that release free sucrose in the cell.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase
total genus 93
structure length 244
sequence length 244
ec nomenclature ec 3.1.3.24: Sucrose-phosphate phosphatase.
pdb deposition date 2004-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05116 S6PP Sucrose-6F-phosphate phosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1s2oA01
3.90.1070.10 Alpha Beta Alpha-Beta Complex Hypothetical Protein Ta0175; Chain: A, domain 2 Hypothetical Protein Ta0175; Chain: A, domain 2 1s2oA02
3R4CA 3WGUA 3EF1A 5AKGA 1YJ5A 2ODAA 2IOFA 3ZX4A 3DNPA 4OFZA 3PGLA 1NNLA 4Y2QA 3AR8A 5IS2A 3I76A 2OA0A 2HI0A 1YMQA 2QLTA 1U02A 3UMCA 2AMYA 3OCUA 1WR8A 3AR3A 3D6JA 4DWOA 3ZVNA 4I9GA 4DW8A 2AGVA 2C4NA 5AI5A 1EK2A 4J2TA 4JDPA 5AKYA 3L8GA 2ZOSA 3IRUA 4CNQA 2NO5A 4QQFA 1RQNA 3AR4A 2R8XA 2B8JA 1N8NA 1L7MA 1Z4MA 5AVZA 3SF0A 2CN1A 3IJ5A 4KNVA 3ONNA 2FPSA 4NAVA 5IT0A 3NUQA 3P96A 3U26A 5A3SA 3ZVLA 5JJBA 5ALJA 1ZJJA 2I33A 4BEWA 3ZX5A 3CZ4A 3I6BA 3WK8A 1L7OA 4YCNA 5ALYA 3QU7A 3L1UA 4Y2SA 1T5SA 4UU1A 2I54A 1ZD4A 5AVQA 1TA0A 3QUTA 2R8ZA 4H1WA 2JAOA 3SHQA 4FE3A 5ALIA 5AW4A 1VJ5A 5AW6A 3QU9A 3QLEA 3QYPA 1AQ6A 4HGNA 4Y2YA 5AW3A 3FGOA 1FEZA 3TLMA 3W5AA 2HDOA 4OCZA 3OCWA 5AVUA 4EEKA 3ESQA 3QXGA 5AKEA 4FFDA 3SLRA 2C9MA 3OTQA 4UAVA 2HEGA 5AI6A 1N9KA 3AR9A 3MPOA 5AM4A 2WF5A 4HGQA 4BNDA 5AW7A 3R9KA 2QYHA 3VAYA 4UMVA 2YN4A 2G07A 2O2XA 3UMBA 3EPRA 5ALOA 2I34A 4HGOA 2WF8A 1RPZA 1XPJA 4GXTA 1Z88A 2GHTA 3QGMA 5AW5A 4EZEA 3GYGA 4C4TA 3ZWDA 4UMEA 5FP0A 4FYPA 5AKZA 2AUTA 3ED5A 1XP5A 1ZRNA 4EELA 2P27A 4EX7A 3OCYA 3N1UA 5ALMA 3IB6A 4O8CA 2VKQA 3N8GA 5AM5A 4UMFA 3ZTYA 2ZBEA 2ZBGA 4L57A 4UASA 3S6JA 4NV0A 4HYTA 4C4RA 2B1QA 5AI8A 5AIBA 1JUDA 3QU5A 5ALKA 4F71A 4UATA 3L8HA 4Y3UA 3E84A 1YS9A 2YMMA 2OBBA 5AM1A 5AVVA 5AVTA 2IYEA 3NALA 2HOQA 2W11A 5ALNA 3E8MA 5AK6A 3L8EA 4RESA 3B8EA 2YMPA 3L1VA 5AI0A 3A1CA 1NF2A 2GMWA 2YFYA 3ET5A 4AS3A 2RB5A 3KC2A 1Z4LA 3BWVA 3MN1A 3QNMA 3FPBA 3M1YA 4ZEXA 5AVYA 1RLTA 2YMLA 3ZW7A 3AR5A 1O03A 2ZG6A 1KYTA 3AR7A 3WKEA 2HSZA 3E58A 4CF4A 1J8DA 1QQ7A 1Z4JA 1VJRA 5AKKA 5AK4A 2I6XA 3WK6A 2B8EA 1QQ5A 3NRJA 3W5BA 2JARA 3ZWKA 1SWWA 4RETA 3EF0A 4YIHA 4Y2VA 5AKLA 1RLMA 1Z4PX 5AW9A 2C8KA 2MU1A 3QUBA 3QU4A 3FVVA 1K1EA 4C4SA 3SMVA 4AP9A 3QUQA 1ZD3A 2HX1A 5AW2A 4BX2A 4J03A 5AM2A 2G06A 2X4DA 1RQLA 3FPSA 2YJ3A 4L6CA 2RARA 5ALEA 1RDFA 3CNHA 4IG4A 4UAUA 3QUCA 1RMYA 5ALVA 1Z4QA 1TJ5A 4G63A 2C88A 1RKQA 3N28A 5AVSA 3U7HB 2FUEA 4XQ0A 3KOOA 2WM8A 3L0BA 2RBKA 3KD3A 4UMDA 4BKMA 3MMZA 2PR7A 3ZTWA 4BBJA 4OHFA 5AKIA 1IWOA 4BYGA 2B0CA 4CF5A 5AW1A 3WKCA 1O08A 4GIBA 1ZS9A 3KZXA 2G1AA 1S2OA 3A3YA 1TE2A 5ALSA 3U13A 2JGAA 1VFPA 2MSNA 3I1YA 2YJ4A 4E88A 4CE6A 4EX6A 1L6RA 3WGVA 4XPZA 3UMGA 1LVHA 2HCFA 2WF9A 1RKVA 2PKEA 4BEVA 3FZQA 1CR6A 2D2VA 5ALRA 5ALUA 1Z4IA 1Q91A 4MUMA 5AI4A 1YNSA 2JAUA 5A3QA 3W5DA 3A1EA 3BA6A 4IFTA 1SU4A 3U7EB 2G0AA 1Z4NA 2HHLA 2YBDA 4Y2RA 1TJ3A 2FPUA 4QJBA 4KNWA 2YMQA 2P11A 4XOUA 5ALZA 3WK9A 2P9JA 1L7NA 2EATA 5ALWA 2NO4A 3ZVMA 4Y2JA 3NAMA 4UARA 3OCXA 4ZEVA 4NWIA 4HGPA 4Y2UA 3E81A 4B6JA 1RRCA 4AS2A 3NASA 3WKBA 4JB3A 2JAWA 2FDRA 3F9RA 4HAIA 1T9ZA 5AI9A 5IT4A 4YCMA 2FPWA 2WF7A 4BNDB 2CFRA 2DQSA 1U7OA 4UU0A 1RKUA 2YJ5A 3OCVA 3DAOA 1WZCA 4Y2PA 1XVIA 2P69A 1QH9A 2B82A 3I28A 2Q5EA 4KX3A 1RC8A 5AIAA 3M9LA 3B9RA 4Y2TA 4G9BA 4YH1A 1ZOLA 3QX7A 2G09A 1U7PA 2W4MA 3NIWA 4PNHA 3U7GA 2AH5A 2W43A 2OM6A 3L5KA 1WVIA 1CQZA 4OD0A 4KYTA 4DCCA 4EENA 5AK5A 3RF6A 1Z5UA 1Z4OA 2R8EA 4UM7A 1J97A 2B30A 3L8FA 2IA5A 5AKJA 1QQ6A 3QU2A 3ZUPA 4BX0A 1L7PA 1TJ4A 5AK3A 1Z5GA 3WKAA 1WPGA 2YJ6A 3L7YA 1SWVA 2ZBDA 2GFHA 3L0CA 3N07A 3UM9A 2WHEA 4MWOA 3W5CA 2Q4TA 1ZRMA 3HLTA 2HO4A 3SKYA 3WK4A 2O9JA 3U19A 4I9FA 2Q4RA 5ALFA 5ALDA 1YV9A 1YDFA 4F72A 2EARA 1PW5A 4XE5A 3R09A 3J7TA 3SD7A 3ET4A 4NABA 1U2SA 2WFAA 2CFTA 3RFUA 1RMQA 2G08A 3PGVA 2HF7A 3L0YA 3OPXA 2FI1A 5ALGA 5ALPA 2WF6A 1L8LA 5AVWA 4BX3A 2IOFK 5AM3A 3K1ZA 5ALHA 5T41A 2C8LA 3ESRA 5AVRA 3U7FB 2ZBFA 1RMTA 1EK1A 2YY6A 1ZD5A 3DV9A 4DFDA 5AKXA 3AR2A 3HYCA 1X42A 3PDWA 5AICA 5AM0A 3B9BA 3SKXA 5AESA 3N5KA 1Z4KA 3KBBA 2G80A 4CF3A 3WKDA 1U2TA 2I7DA 1L8OA 2EAUA 1ZD2P 2FPRA 4KN8A 4UM5A 2BDEA 2FUCA 2FEAA 2IOHA 3A1DA 3ZU6A 2GO7A 4KX5A 2ZXEA 3ZI4A 3PCTA 4YCLA 1RLOA 1Q92A 2GHQA 2RAVA 2BY4A 3WK5A 5AW8A 2B1RA 1T5TA 2FPXA 1NRWA 3AR6A 4Y2XA 5ALXA 4UW9A 2CFSA 1LTQA 4L6AA 4YGYA 1QYIA 1Y8AA 1S8OA 2I55A 2R8YA 3KDPA 5E0OA 3NANA 1MH9A 3WK7A 4ZEWA 3MC1A 1F5SA 2OYCA 2BDUA 4YIKA 3OCZA 4HGRA 3EWIA 5ALTA 2PQ0A 5ALLA 5A3RA 2HF2A 2NYVA 5ALQA 5AVXA 3DDHA 3FM9A 5AHXA 5AKHA 4NFLA 5AW0A
chains in the Genus database with same CATH superfamily
3GXBA 4FIDA 2NPIA 2IZ0A 1OB5A 5CT4A 3WGUA 4CEJB 2X2EA 5BT9A 4UULA 4BLRA 5B6JA 2AJCA 2Y67A 4PAMA 3KQKA 4OQMA 5FEUA 4Y9DA 3A6HA 5KYUB 4PFSA 4INAA 5IS2A 3G0OA 1AY0A 4KE8A 1U2ZA 3NYQA 1DWQA 4KR9A 3CRVA 3ZDEA 1NNUA 2HI0A 3VSBA 3DF9A 1YMQA 4RTSA 3N58A 2DETA 1E1QD 3UH1A 2G5CA 1HWYA 3MMSA 4D6XA 1Q22A 3OCUA 1KH2A 4MH0R 5I9SA 4YI5A 3TZKA 2J6HA 1J9EA 2JIMA 3HFRA 4TTSA 4BLSA 3L1HA 3QWBA 4G36A 3CNNA 1IZYA 4OQLA 4E0BA 4C1NA 1E4EA 2H51A 2AGVA 2CYBA 4OAOA 1XA4A 4QFBA 5AMXA 5UKDA 1ST2A 3DVAA 1EE9A 4NLLA 1OZ0A 4CMEC 5LSAA 4QGAA 3FRHA 1RM3A 3RC2A 3L7LA 4OFBA 4DLAA 3NZEA 2I1LA 4DQXA 5A2GA 1GGMA 3O26A 3FJYA 3VRHA 2OEPA 3T3OA 2XOKA 1FXUA 2Q1TA 5IT5A 1KK3A 4BTEA 3RHZA 4Z4EA 1NW3A 1XTKA 2NO5A 4DMUB 5JCPA 1Z5VA 3EVEA 2VPXA 3IIMA 5IABA 5KTMA 3J81A 2FQXA 3ND8A 3KQWA 2OHIA 5LP6C 3PXGA 4EHBA 4RQTA 5AXCA 5K0NA 1Z0ZA 3REQB 4EL0A 1CUGA 4DKJA 3T4XA 2WUFA 4DIFA 4BVBA 3I72A 1AUVA 3QITA 4IVNA 3ONNA 2FU5C 1LRJA 2VJAA 2FLKA 3UICA 5KSZA 3KSBC 1OH6A 1CB7A 5EPUA 2UV8A 4JYAB 5DTMA 5D7NA 4BU0A 3PGXA 2KJQA 2NVTB 1MABA 3IURA 3Q41A 4Q19A 3AHIA 4D2IA 3ZJTA 2YL2A 3U1VA 4C6RA 2PWPA 2X8WA 2XUAA 2AQIA 3OHPA 1Z7GA 2QTLA 4IF4A 3TKAA 3GGOA 3ZU3A 1F2TA 4I4TA 1UK6A 4J6FA 2EKQA 3OETA 3L0OA 1MPXA 4WDRA 4WNYA 3UIEA 3R5XA 1O6FA 1EIZA 3UMRA 1K08A 1H2RS 4PVDA 1UMDB 2FG6C 2SNIE 4GEGA 5AVQA 3PV0A 4ME6A 3QKRB 4FS3A 1CZOA 1H1LA 2JH8A 1I4LD 3F4KA 1X7WA 4G0MA 1LZLA 3M4ZA 3AWDA 3W04A 4A2CA 4EJMA 4A03A 1IN1A 5I7UA 4MI3A 2DBRA 1FVOA 1QO0D 1QHHB 2K7FA 3DMTC 3FI9A 5FOSA 1U1GA 1MXFA 5F9FA 1VA5A 2NPOA 2R1VA 1FSFA 3PUIA 2B5VA 3Q15C 3AX6A 4YJFB 2O05A 3O73A 2VF5X 4Y0VA 5DX8A 3F6EX 4R9SA 1PKEA 3N8NA 1EGVB 1XCOA 3OZTA 1CUVA 4GI3A 1TF2A 2XH8A 1WLSA 3HXKA 3T3NA 5E1MA 4G1VA 1E58A 2JGLA 1QMGA 1KYQA 1L5FA 1TUEA 1Y4AE 3ETCA 3N05A 3QBDA 5COBA 3C41J 1M66A 1DO0A 2PZKA 3MK31 3U4GA 4IZHA 1T5OA 5IAEA 4Q4JA 4P80A 1DAIA 1JN0A 1G5TA 1BE8A 1NMQA 1OREA 3KR1A 4BY1B 5IYZA 1UZUA 2QRUA 4MR7B 3VUEA 3CCBA 3LC7O 2I34A 5KHOC 2VP4A 1RPZA 3OLXA 1TFRA 4I1VA 4ZIRA 3FF1A 3UATA 3DV0B 3EVZA 3UH0A 4OGFA 4D5EA 5AW5A 2DBVO 4BAGA 3IA2A 5ICMA 3JAMA 3H0GB 2E4ZA 3KQYA 2VRWA 1F3LA 5DHPA 4IV5A 2FJUA 3NTRA 1KPIA 3TQIA 3ZGZA 3OJCA 2PMZB 4LBZA 3I01A 1ZRNA 3MCWA 1U7DA 4L4YA 1GAEO 1AF7A 3KVRA 3WIVA 2I6FA 4HXYA 4W5HA 2XUQA 1Z8DA 3IQZA 3RZDB 2VKQA 5AM5A 1NOKA 2REBA 3IV7A 4PS0A 3SF8A 2PYZA 1Y7LA 1ENOA 1KGSA 1UANA 3FTPA 4TMTA 1J2EA 4TWJA 2BSQA 2PPLA 1UPXA 1PZXA 3EDYA 1ZM9A 4GZLA 2B36A 5E1OA 1NNI1 4FE7A 1GTL1 4HNQA 4X7BA 1W6RA 4ONEA 4BO7A 4PINA 4CHTA 4URXR 4I5EA 2PGIA 3FYSA 1SURA 4MYCA 2A1IA 4EL5A 1WCV1 2OBBA 5FX2A 5ER9A 3WV4A 1N0UA 3G6WA 3D0OA 4PZUA 5AVTA 1EPUA 1YUBA 4ARIA 3L8YA 2EX0A 3FAZA 2IYEA 2XIJA 3HDYA 1IOVA 4JR1A 4G4JA 2C3YA 3D8UA 1FRFS 5B58C 4N3CA 4JLOA 2O2IA 3KQMA 2Y77A 4IDAA 1BS1A 2NIPA 2Z2IA 4HUQB 2YMPA 2R47A 2XVMA 4KRYA 4JI3B 3VM6A 2VUMB 4REMA 2XMZA 3CB2A 3CPHA 3KC2A 4JUCA 4W9NA 3AI7A 2FPGA 2JLQA 3B6MA 4J16C 4I8DA 4QSMA 1SBTA 3WLJA 5AJZA 2JLXA 3L4KA 4KR6A 5EE0A 5EKSA 3AB8A 4CL8A 3UV7A 2R7KA 4Z0HO 1FDVA 8GPBA 2VBFA 4HDSA 4AW9A 1ND5A 1BTOA 3F90A 4GKBA 2GPTA 2W2KA 4EHHA 4YR9A 1DMRA 3E35A 2JFOA 4B6EA 2VRCA 2QW1A 3CY6A 2WHRA 2WIBA 3B6IA 2BGTA 4W4TA 1OD6A 3IE1A 4DJAA 4ISCA 1JJBA 1P33A 1T2FA 3K7EA 1K3FA 2QR2A 4D4IA 4ZOBA 3GMIA 1GPWB 1IHUA 3W5BA 1IPEA 2AMFA 2JARA 5HKLA 4CFYA 5JARA 1P18A 3DFFA 2X0NA 4D4GA 3IHLA 1Q57A 2WHQA 1TZKA 2LRHA 3LHDA 1J8VA 3NV9A 3WBJA 1STOA 3D1VA 1KJYA 2CZGA 3KJNA 5COQA 5AT1A 1KPHA 4P8RA 2GLXA 4DA6A 1Z0KA 4JEIA 2Z2KA 3GFVA 1VL1A 2CL7X 1YRBA 2WM2A 2AN5A 1ZGAA 1J2TA 2WNIA 5AJVB 2BEVB 1EWRA 3OLYA 5B57C 2B1GA 2Q21A 4H1TA 1G8JA 5LB4A 4LYJA 2FMXA 4Q00A 2IUEA 3U17A 2ZJ4A 3MPUA 1L1RA 4AZWA 5AM2A 4C2UA 3JZDA 5CT6A 1CZUA 2QP4A 2RARA 3CCFA 3DULA 4JZKA 2G9UA 3PDUA 3Q9SA 1QFZA 2GPBA 4PG4A 4EPTA 1UKCA 5CEEA 5HOEA 1N0WA 3EXHC 3NBXX 4CTMA 1RMYA 4WBXC 3V1YA 3PO3B 4JVLA 1Z4QA 3EPPA 3TNJA 4ARZB 4ALLA 4C1BA 2JFPA 5ESXA 1OXXK 5FL7A 3C4VA 2NVOA 3ZDFA 4C4OA 2TS1A 1J90A 4TLBA 3V46A 3RC1A 1IM5A 1Z47A 3B6KA 4JP5A 1UK8A 3DAPA 3HB9A 1QO9A 5D1NA 5BQXA 3L0BA 3MW8A 2VDWB 3M1IA 1MU0A 3TTTA 3WL6A 3ZDAA 2J08A 1SH7A 2R8RA 4HH3C 4PIMA 2YXNA 1VE7A 2DLDA 2IH2A 5CGZA 2FFHA 3E5HA 2X19A 1B2LA 1XI2A 4NENB 1IWOA 4G8CA 2OO5C 3SOZA 1FUEA 3H9JA 3D8SA 4FFVA 2OBYA 2E9SA 1TEHA 1K06A 4Y6RA 1M6VA 3T9CA 1RYYA 4RTMA 4A9AA 1N7HA 1GLGA 3SSMA 4GP6A 1IHOA 5ALSA 5JSYA 5B3JA 4GGMX 4GR9A 4PSKA 4HK4A 2V8OA 1MORA 1FMJA 3IOBA 4GPEA 5LQRA 2QX9A 3P5SA 1B15A 3C5HA 5L51A 2B83A 3GN1A 4YRRA 3O84A 2VBGA 3U49A 1KDVA 3TEMA 2XNDD 4XJVA 5LVAA 3FOCA 2R4QA 3NHWA 1PJSA 1PP4A 1XD8A 3K0FA 3LRXA 2C95A 1HURA 4N5DA 5B1YA 3HOWB 1LI5A 3T1YB 2V6MA 3F2IA 1P5RA 2NTEA 4HGYA 3IR6A 3NIBA 3ZBUA 2B1IA 4CLDA 4NZZA 1F6WA 1Y89A 4I1OA 4LKOA 1V6AA 1U11A 2PGLA 1EGMB 4TSKA 4XYLA 4DV1B 3NWOA 1K5DA 3S1AA 4L50A 5FOQA 1SZDA 2P91A 1E0SA 1GFIA 2SCUA 3WYGA 1APBA 3CT6A 3KZVA 1EJ0A 1QIJA 3PJRA 4X1YA 2CNNA 1Y34E 1N6HA 1T8PA 2RB4A 4XOUA 2VJQA 1TK3A 2AS0A 3C5EA 3CLUD 3CUUA 4FOTA 4WVLA 5E7QA 4CNBA 2H2DA 1AKVA 1N7IA 2QP3A 3EBLA 4LMRA 3JPWA 4W7HA 2O0MA 4GHWA 2FW8A 4FHGA 4IIEA 1AQLA 3S7TA 1RZRD 4DUYB 3ADDA 3FSJX 1BCRA 3MG9A 2AUMA 3TDNA 2FDRA 1PJ3A 4HAIA 4XWOA 2OHVA 4MYSA 3OIVA 3NKVA 1Z6XA 1GKIA 3RVQA 2OL4A 3QJYA 2VP6A 4IAOA 2WW8A 3PHLA 3JYPA 2JPDA 3SNKA 2E6KA 1OA0A 4JJ6A 2IT1A 2VOEA 4DJFC 2DEUA 3DXYA 5KS2A 1UZAA 1EUCB 3BULA 1SUDA 3HKDA 1Q0ZA 2W2NA 4AN1A 2YHIA 3EXFB 2R9VA 1QYRA 3RADC 2ID4A 4J8PA 5DXAA 2HJHA 3QYJA 5J1SB 3OMXA 5IZ4A 4LXXA 4J94A 3BRWD 2C1ZA 1FFAA 4FC7A 2HRQA 2K2QB 3U4MA 1FMTA 5KQPA 2O1EA 3OZGA 5EVJA 5BN1A 4G8DA 4EA6A 1FP1D 3GAFA 2TRSB 4K6FA 4KYTA 3I05A 2ZPAA 3DAFA 5ICSA 1GNQA 4TTTS 4BVLA 3BFJA 4JHLA 3GD7A 1OIVA 1EWKA 1C3XA 1Z5UA 4IOJA 1YS6A 5C4GB 4RD1A 1GCGA 3LVFO 1S3GA 2J5XA 3BBPA 3TM4A 1MC4A 5K6AC 2ZYSA 3K0KA 1KL7A 4EUKA 1FP7A 1XMXA 2B92A 4QTZA 1EXWA 1P77A 3NDBB 1NWHA 4I1IA 3ZHXA 3AF2A 4OA8A 3L7YA 4MA5A 1B0AA 5C3UA 5PGMA 3S8MA 3LJKA 1IAVA 1P73A 4CKEA 5LOVF 5FUWA 2B63B 3I64A 2B99A 2PUFA 4G5HA 4XFJA 4YMHA 5TRTA 5JRJA 4ZYXA 2IU3A 4MI6A 3IUMA 1L7QA 1AUOA 1FTYA 1ZH4A 4UCXA 3X0DA 1WPXA 4ENTA 3DBHB 4KI0A 1MV5A 1M2HA 1ST3A 1X2EA 1JR2A 2WVHA 4KLRA 3IAM1 3EGDA 3LQ1A 2REQA 4C6HA 5CT8A 3Q11A 1JE1A 1W5EA 4PEVA 2ASVA 3E3LA 3SSOA 4YRTA 1O4VA 4MW6A 3RUIA 4RD0A 5FKJA 3FHCB 3ILYA 3E7PA 5FR2A 4Q03A 3V2HA 3NBZC 3NJ4A 4NABA 4UBIA 1RVDA 3GLUA 1KH1A 3H05A 1L4KA 2ADMA 2C2WA 3P9NA 1TVKB 5KPDA 1GCUA 3Q3EA 1CJCA 3T9FA 3THXA 3ED1A 3H42B 2DG2A 2FI1A 1DV2A 3DE0X 2WF6A 2EF0A 1Y82A 2J9RA 2PT9A 3VNRA 1TWAB 1XMQB 2I2XB 3CMMA 1HRDA 4IUDS 1WCIA 4V0SA 3SFVA 1RRKA 1CZNA 3I9OA 4O59O 4Z9BA 4RJLA 3U31A 1SQGA 7YASA 2D1SA 1AF4A 1YVEI 1MIHA 5JCJA 4PSCA 4QGHA 4TWAA 2DJ5A 2TMGA 4KTTE 5K7SA 3ESRA 4H7JA 2GJ8A 1ZFNA 3B3GA 3L6EA 3ZQJA 1G1MA 3T4EA 2BHLA 3X2EA 3IPAA 3DW1X 4LX0A 3OX2A 2ISSD 4P7BA 3SR4A 4JI7B 3UUEA 1DAHA 1GR0A 1OXKB 1Q6YA 4M1OA 4AMVA 4JCCA 5KYYA 1DQSA 5EZ6B 2YDYA 2H07A 3O3OB 3BMOB 4HDRA 5EXSA 3QXJA 3VKUA 3F74A 1U8FO 2FWJA 3A31A 1MAVA 2QD2A 3TQTA 2PJDA 3E61A 2VZ9A 5KYVA 4G6ZA 4B3XA 4UBLA 3IIKA 1R10A 2C3OA 3Q5DA 4JU8A 1YGPA 3A1DA 4JFAA 5F7JA 1V2HE 4XWTA 1WCMB 3WVNA 5HP4A 2JIRA 3L92A 5DRTA 2OFFA 3ZEAA 4TV9B 5BR4A 3H65A 1ZN2A 4QG3A 1XU9A 4YAFA 5ADVA 1LJLA 4NJMB 1E7WA 1ZK2A 1OZHA 1C14A 4C4PA 1X3SA 4K6HA 1NN3A 2ZE6A 2QTCA 1W8IA 2PD6A 3CLTD 4OO3A 2HH9A 3RBXA 2IYAA 1G5QA 1M6WA 2C97A 2FXIA 2VJLA 4NCJA 1QP4A 4ETMA 821PA 1NF8A 1DAMA 2PTGA 4C7OA 1AIPA 5IH3A 3U1BA 2F62A 4LNHA 4OQFA 1X7ZB 4EMBA 4GYWA 2ZWPA 3D8HA 1V8PA 2VN8A 3I0ZA 4O4JA 4JJ8A 1T1EA 3IL2A 2JKVA 3NR2A 2VK2A 3NVAA 1NI5A 1NT4A 3HSSA 1E1MA 3LC2O 4TXHA 1DZ3A 3PR1A 3HVIA 3NKFA 4P4NA 4U7DA 3HBMA 1U9JA 3VSCA 5LDHA 5FF9A 2YJGA 4G25A 1LV7A 1WZIA 1E2QA 3R7LA 1BRTA 3SK0A 2BHNA 4XVRA 5DI3B 1BDBA 4YWHA 3PGLA 1H9AA 4IYRA 1S8AA 2GHRA 2XTMA 4CCSA 4A15A 1X1TA 2YHUA 1FYFA 4G3XA 4ZVKA 5K8IA 1LBTA 4K6KA 2C29D 3GNTA 5CUQA 2YV2A 1IOLA 4JUBA 4M1YA 2BFPA 3V4LA 2F67A 1YIAA 1TK2A 2BFDB 1DIRA 4IS2A 5K4AA 4BPBA 3VNBA 4LSWA 1KZ6A 1M2EA 2O7QA 1KOJA 3HJAA 4WCFB 5CVCA 4EMTA 5HJ5A 2A6PA 2OV2A 3O4HA 3WWDA 4PAGA 1IBCA 1DIBA 4D0NA 1MCZA 4FYXA 3EZXA 2VTEA 4JWTA 3NEJA 4KUHA 4TV8A 3F71A 2H1IA 4ARCA 2WYWA 4RJTA 3Q6NA 5A6SA 4QRIA 1D2GA 4B2PA 4XTRA 4BJHB 3D0QA 1DQNA 1O1YA 4DWVA 1A97A 1E9BA 4OEHA 1ADJA 1RVV1 2CL5A 3N76A 4GPTA 3UT5A 4D9MA 2RG1A 3GJRA 1A04A 2CBGA 1A69A 1YB1A 5LXTF 3T1OA 3NV7A 1FDUA 2NSLA 4BN5A 3HU2A 2ORIA 3BMNB 1Y8ZA 1WDKA 2MYTA 4QELA 5K0LA 3ER9A 3EH2A 4MKRA 3BGVA 3PXAA 4IEFB 4DV0B 1TCBA 4M83A 5G4KB 3K1AB 4QM7A 1OBHA 1USWA 2UVDA 2VL7A 3AQ4A 1L4UA 3CU5A 5B5SA 2ODPA 5IKPA 3OEYA 1Y9EA 3I2JA 1RZVA 1JHVA 2IUFA 4PNZA 3VDRA 1E3LA 2FWRA 4IXWA 3ZK8A 5JNVA 4PX3A 3PUWA 4Y7NB 3O2QB 3TSZA 2ZR8A 3W78A 3P9PA 5L3QA 1ZH2A 1RI4A 3DOEA 3PDJA 2X8JB 1IDN1 3OE4A 4LDQA 4AJIA 3ZJVA 4J2OA 1XTTA 4XIJA 5MGBA 1KJJA 4EQZA 2QY9A 3DEHA 2AYYA 3CX7A 5DYIA 4HT3B 3O8QA 4BECA 2RH9B 4FLFA 4KE7A 1M1UA 2KPOA 2XKBA 5FHRA 2HNKA 1KMQA 3JPYA 3DPSA 4FE3A 1L9KA 2DHDA 5C7YA 1KBQA 2ZIXB 1LNSA 1W5AA 3NT5A 1CJMA 3OUZA 2CXNA 4IGFA 1GQRA 4M9UA 2H9AA 5DYYA 2CFIA 2XZOA 2JCSA 4IIJF 1UP7A 1V0JA 2AI1A 2W8BA 3DR5A 4RS4A 3U60B 1W25A 4OCZA 1XHEA 4ZOLA 4OBBA 4C5CA 2C3UA 3KSDO 1KYXA 3DLCA 2FZKA 4NE2A 4NZNA 2P3QA 1DT3A 4KBYA 2NUAA 2V4ZA 2I91A 1VBNA 3KEGA 3A27A 3B8HA 1J8YF 2VH5R 1SA0B 1ARZA 1KZYC 1OI4A 1T1GA 3FFAA 4KQ1A 4Q01A 4RM3A 4ZTBA 2O8NA 2OD2A 1OASA 1ODSA 2VIIA 1SJ9A 4ND8A 1SKUA 5HQ3B 2IYOA 4AO6A 4YCSA 5CA0F 2EFGA 4CKBB 3UANA 1R8SA 3MRSA 4ERXA 1E6EA 5FJJA 5DTQA 1Y6QA 1BQ4A 2E1PA 3UJ7A 3M5PA 5JBQA 2XZLA 2WYIA 2ON6A 4ZDWA 5ULLA 2I6SA 2PKQP 4Q37A 3X3HA 2BGLA 3ZLVA 1Y0BA 3OOHA 3B70A 3VNSA 1IOZA 2W93A 4OM8A 1T2NA 4V2UA 1NURA 4X91A 3TW4A 1XPJA 5EZYF 1T36A 1EJBA 4URFA 4YI3A 4IFEA 4ER3A 5J47A 3CLKA 2NO0A 5BNTA 2YJNA 3GLFB 3AJAA 1PT7A 4OH7A 1AUXA 1VCOA 4R41A 4DCMA 1BEUB 2A5JA 5EIEA 5IF3A 2CE2X 5JALA 4E4RA 1SELA 3T5CA 1PHPA 3BFXA 5B2FA 1FLVA 2DVMA 3BSYA 2RONA 4TLDA 2B4RO 5ALMA 1S01A 2ZROA 4JUFA 2Y6VA 3KKLA 3A7DA 1J7KA 1XELA 2CZCA 5B37A 3TS1A 3CO5A 1QHEA 4BO5A 2IYXA 3COVA 2JW5A 4C4RA 1LVGA 4ROSA 3TCNA 4Z4HA 3TBHA 5JQWA 3VPDA 1D1PA 1FFCA 3OA2A 4QVKA 2ZJ5A 4BUJA 2EHJA 2C1XA 5TB5A 3L02A 4GM0A 3WHLA 3ZWCA 2D1YA 2IHVA 5MFPA 3E84A 2DQYA 1TVEA 1ADYA 1NG1A 3E48A 4FLEA 4KVGA 1AGRA 3U3XA 3DUWA 2O2DA 5K3EA 3KSMA 4DR4B 4QHSA 4BLOA 2ZLBA 4W1RA 1TEVA 3C2QA 3O5AA 3K71B 2PQ6A 2OXTA 3AF1A 5IP5A 2FR1A 1ZMXA 4Y0NA 1XKTA 4C0HA 2ZULA 3AIOA 4ZICA 1TQHA 1ZZEA 3OPMA 5K51A 4YBRA 1SBQA 3CIFA 1RKBA 2HTFA 3HDTA 3BL8A 4G81A 5JS7A 4JQCA 3WFJA 1KTIA 3T1HB 2XMDA 1CQIA 2MMCA 3AEKA 2Q6TA 1E5LA 4YASA 2MR5A 5A04A 4N12A 4I5DA 1DKPA 4ZYYA 1BWPA 4UBNA 4EITA 3RSSA 4C04A 4E14A 3LM8A 4O2AF 1EGHA 1TLFA 1US8A 2FE1A 5JRZA 1CDEA 4EHIA 2VSNA 2J3MA 1U8UA 3G2QA 3OKAA 3WKEA 2BI7A 1Q16A 2N75A 5KX5A 1IXSB 1P5JA 4YRNA 3E58A 1YDMA 1CDZA 3K8QA 4L02A 4WRRA 2P65A 3AHJA 3V32A 4DIBA 5C4IA 1AGXA 4EI8A 4OX9B 1PE0A 3QPVA 2XMGA 1YI0A 2ZB7A 4KXLA 4C76A 2QF7A 3K0CC 4CCAA 4KE9A 1FOEB 3QOYA 1MAAA 2RSLA 3G59A 4NZOA 3O8NA 3DVRX 1GRQA 4LY0A 1W2GA 2Q9BA 1U8AA 1J42A 1LJ8A 4YMVA 1G0NA 4OQYA 2CUZA 4P7JA 3V4RA 4F4DA 2JVKA 1Y1RA 3EARA 1A7UA 1NUQA 3F6YA 3FGPA 1FPQA 3HB7A 2I4TA 1VYUA 3GDWA 1A2OA 3OQHA 1N4DA 4GLJA 3QKSA 1YVRA 4YAKA 3BC1A 4V0OA 4LYHA 2EL9A 2YOHA 3QUQA 4MINA 1FPMA 2ZRCA 4KLCA 2Q3FA 3CW8X 4BX2A 3VOSA 3OJLA 1IN5A 2GPNA 2Q4EA 3EOBI 3IJPA 4DLYA 1WXDA 4LQ4A 2OO7A 1XEXA 4BRWA 4IG4A 2QX8A 3MMXA 4KDEA 3QUCA 1IUPA 1XNHA 4K9DA 3BHNA 3ZY4A 2VHXA 5A9SA 3OM1A 1TAUA 3JVEA 1YB5A 2ODTX 1DBRA 1JJFA 3NHLA 4BN4A 4E2ZA 1WWKA 4LV5B 1J1IA 3DYVA 4OUDA 3MTAA 3I42A 8MHTA 3KWMA 1QB7A 2AOUA 1ZSVA 2IY7A 2RKBA 3LUGA 4JJFA 1W73A 1KK1A 2MCFA 1TJNA 4MMYB 4Q4AA 3RFVA 3GUVA 3L6UA 4LC9A 5IULC 2YVKA 1GPBA 2UYYA 1D2MA 4NULA 3B5JA 2BFCB 2FCAA 2WQZA 3GVIA 1BA3A 3VR5A 2FN8A 3JQ9A 3VI4B 4EF6A 1E5TA 3T9AA 3A3PA 1PBNA 1NUHA 3F9CA 4ZVNA 4TKMA 3TH5A 3VAZA 2B7CA 4EWLA 3GFRA 3Q8MA 1MO3A 2JLVA 1E1RD 3O92A 4OLAA 2OLJA 4GBJA 4OREX 1FS4A 2YIMA 2JGJA 3HY4A 3KXKA 2CFCA 2XMRA 2CW5A 1AVTA 3CVJA 3PQCA 4K87A 4CM8A 4CV1A 5L3VA 1E2NA 1EAYA 2VWPA 1ZS9A 2O52A 4CUJA 1KI9A 2EIHA 4XD7D 2FEWB 3S2IA 2UUPA 5J63A 3SIRA 4YV2A 5A3JA 1QU2A 4KWIA 4YMSA 3C3JA 4CMIB 2INGX 5J5VA 2YNMC 3Q5EA 1JZSA 2XE6A 4EX6A 1E9CA 3K9HA 1KK2A 1M76A 2G9RA 3HB5X 5EVCA 5IC5A 4F60A 3VBEA 4Q7MB 3BSWA 2QUIA 3P9SA 3GZNA 1I2AA 1QIFA 2ZQZA 4MS4A 4DMFA 3W77A 1S5PA 3AESB 3URKA 3F6RA 3FZQA 2D2VA 4EA7A 3P0HA 3KYIB 2RH5A 2WYHA 3BGIA 4BNFA 3ILXA 3OX1A 3RF7A 4A0RA 2XGMA 4D44A 1LJUA 1BU8A 3P45A 2JCVA 4EJ2A 4D4MA 4HVCA 4MMZB 3JU3A 3SEAA 3FCAA 1QRSA 4YJHA 1A76A 1DXYA 1P9WA 1WMEA 2P9GA 1AGYA 2UKDA 3RFTA 2F17A 2O2ZA 3T1VA 4ZI7A 1G16A 3OFKA 3SG0A 1L2TA 4FYWA 4AZ3B 5BWMA 2DHEA 1DTWA 2NZ8A 4YQFA 3UGTA 3QVUA 2NO4A 3DDUA 3EMDA 4JP8A 1PR1A 4UARA 5CB4F 5A5EA 1A5TA 1GFZA 5FWXB 2CLMB 3QKIA 3PFGA 3RVKA 4RZUA 5HFNA 3WKBA 2PCJA 1LDEA 3K2QA 1YRHA 1X13A 5EIOA 3X44A 3VJKA 1S4MA 4OIMA 4NYJR 5AI9A 4A3KB 1QOQB 2FPWA 3O4JA 1TQ2A 4MP6A 1X3LA 3BGOS 2P4UA 2PUVA 4RS3A 2H17A 1G3MA 4AMBA 3DAOA 3O91A 4QOJA 4RWEA 3UXEA 4DM7A 4XA8A 3PYMA 3HA3A 3FWHA 3LS2A 3AVXA 4HDKB 2R7LA 4RTPA 5KVVA 2GZ3A 3R8CA 1A4UA 2ORWA 3H11A 4JIGA 2FPLA 3DW3X 5AIAA 3WLIA 4B45A 1WV1A 3HU5A 4Z6KA 1NX6A 4IV8A 4HX9A 4I55A 4BCCA 5EKXA 1NBMA 3C48A 1ZPDA 1J8QA 1NVBA 1QZXA 2V98A 1S0UA 2F1JA 5AK0A 5BW5A 3A9CA 2Z30A 3CBQA 4L6IA 4P3KA 1EX6A 4RA9A 2G82A 3C0KA 3FHJA 2FMTA 2XOKD 4B4KA 5HFAA 3LTNC 2I6TA 4EG0A 2CVFA 4KQEA 4CR7A 5FUBA 4OSPA 1W2HA 4BLUA 1G8AA 5KU1A 3JQ8B 1TZCA 2R8EA 3N0TA 3M3PA 3PFBA 4KAFA 5CVDA 5L8VA 1LD3A 1E0KA 2CUKA 4G0UA 1YQUA 2BSXA 2J9XB 2W2VA 4PTYA 3QYFA 1TKCA 1L7PA 3NTQA 4BMPB 1QIHA 4YN3A 5DK6A 1SWVA 4ZGGA 1DIHA 2YOFA 3L7OA 4K9LA 1JA1A 1K98A 2ZBDA 1SVWA 1NR1A 3BHMA 4FC6A 1DQPA 4KVZA 4UM9D 5JJIA 4EG1A 1XQYA 3R8XA 2WSIA 1NKTA 2JFFA 5DP1A 4CKWB 3GUUA 2HO4A 4G41A 4BIMA 3JQ6A 1SO8A 4AJLA 3B51X 4CDGA 2VG8A 3HH8A 4MVJE 4HAWA 4XH9B 2IY9A 2VYVA 4HAXA 4D45A 4IMJB 2E4XA 4I50F 2XPCA 2ZI5A 4NDNE 4DA9A 1KRXA 2OGZA 3MCUA 2B4YA 3ANLA 3N8KA 4O4HF 3A3KA 4EZIA 1A0OA 1XMSA 2BJWA 2Q3JA 2QI9C 4IIGA 3TSCA 2PFKA 3L0YA 2HF9A 4R1QA 5ALGA 1TMOA 4AZ0A 4GKJB 1SG0A 3NDRA 5HZHA 3ADPA 1W85B 3CF0A 3T1QA 1Y81A 3H99A 1WPQA 3IUEA 3B9QA 1IMJA 3M5WA 4ND4A 1HSZA 1RHQA 1RMTA 1UPBA 5EJ6A 1R6AA 2PEZA 4LFBB 1JDBC 2QYOA 2WLSA 4XIIA 1GPUA 2XRFA 4BDSA 2EFYA 1V7CA 4WH0A 3L84A 4GQAA 3WLLA 3UTCA 1DX9A 3HFJA 5EIFA 2EVWX 2ZSHA 5FPYA 2QG6A 4Y6OA 3PPIA 2D3TA 6YASA 4TLEA 5HHTA 2VBIA 3DD5A 3FKIB 1EA5A 3G0IA 3SZLA 2CMHA 2JBWA 3HKZB 4U2BA 3JQGA 2QR5A 3RUFA 1N8TA 2VXCA 3JCZA 5K1ZA 3ZWPA 2XADA 3VC7A 4COKA 2QVCA 1GM5A 2VT6A 1PNQA 2X8AA 3GT4A 2JIPA 1E79A 4RADA 3KPWA 1ES9A 4HWSA 2IIVA 2VDPB 4HQ0A 4HYYA 5CJ2A 5ENVA 1TT5B 4DDWA 1MW8X 2X42A 5TPZA 3ZGLA 1SPXA 2DB3A 1RD4A 4R6XA 3B82A 2FF7A 3NKLA 3WK5A 4B34A 1VG0B 1NRWA 4LNUA 4B6FA 1XE3A 3A8TA 2ZB2A 1I4WA 1TGYA 2FFBA 1CCWA 3OPNA 4PXSA 4RTNA 1YBHA 3DLIA 1A2BA 1VMAA 3G88A 3ODPA 3KT3A 3I73A 5EPEA 3RLIA 4D8YA 2HBZA 3Q7QA 1QLWA 2J7KA 5H8WA 3HRKA 4QOIA 3ICOA 4EB3A 2HDNB 4ON9A 5KC8A 1UODA 4TYYA 1IJKA 4YHBA 5AVXA 2BGJA 3MJSA 4Z0NA 4YALA 1ISFA 3K2EA 4N6GA 1GV1A 4NQZA 2X6RA 5JFGA 1FJGB 1QKIA 2IHZA 3DFUA 5ETJA 1A88A 4QYIA 3ZWQA 4ABYA 3K16A 4NFLA 1MENA 2D1TA 1YRYE 1J22A 3GVXA 3HFSA 1NVKA 3R5FA 4MXDA 4R8VA 3WWZA 4C0LA 1W1WA 1SRQA 2JRLA 4HFMA 1C8BA 5D5HA 2EFHB 5B6PA 2DWPA 3A6LA 5J5CA 1MOPA 2DY0A 3FD8A 3W3AH 1X0XA 1J06A 4ZVVA 2A59A 1PV4A 4FK8A 1PEAA 4DNXA 1U2QA 1RPNA 1U02A 1Y6ZA 2O8EA 1Z12A 4D97A 2P3LA 1WF6A 3NYIA 4F86A 2J0EA 1TLTA 3ZVNA 4QHTA 4YJ3A 3L9XA 1E8MA 1TUBB 1I6WA 1Q1GA 2GEDA 3JSAA 2VP2A 3KUCA 4OHWA 2VRCD 4YDSA 3SYLA 4IKEA 2XV1A 4ZCTA 1L0BA 2EEZA 3PEVA 1QVAA 1R3DA 3LNTA 5IUNC 1E2KA 2RFLA 1ZH0A 2PA0A 4M76B 4Z86A 1F51E 1V26A 4XOIA 3OUTA 1GGFA 3H84A 2AR0A 3EBPA 2F8SA 1XRMA 4TXNA 2ZOSA 1AQNA 3N87A 3OJEA 5JJKA 4KW7A 1RRMA 4E5DA 5CXQA 4RL6A 3AKDA 2R8XA 3DTYA 3N0RA 3K6KA 5T4HA 3U3OA 4L85A 4ZALA 3W6OA 4HFJA 4M1QA 3ZPXA 2VF7A 4ARSA 1RTKA 2CN1A 1FFGA 2HA5A 2RHWA 3OJWA 1MJGM 1M9NA 1OZGA 4M1KA 4OPMA 1JECA 1P80A 1Z6GA 5G2OA 3DEZA 3PC8C 1K6JA 1P3Y1 1VXRA 3OEHA 1AC5A 2OBNA 4BNZA 1T2VA 4ZYWA 4QYXA 1D09A 1PLKA 3GPLA 5DBHX 3NEPX 2KLHA 3KQUA 5MF6A 4BCBA 1LQ2A 4B33A 4EKEA 3I6BA 4MP8A 1FNDA 1NIPA 4HB0A 5FOXA 1LXCA 2DPYA 4UHHA 2W0MA 2R68A 3AKCA 3PX3A 4XGNA 5E9WA 2QYTA 5GONF 1DC5A 4FFWA 1V2GA 2AFRA 1BO6A 2HMWA 4UJ5A 4B7AA 5FL7D 4DOMA 1V5WA 2Z6VA 4K9NA 1Y80A 4B87A 3N2EA 4INZA 5EE1A 2QOEA 3A4IA 3QBVA 5AOBA 5E2BA 1FMCA 5DSTA 2A78A 4Z4IA 1J6UA 1W30A 4MZXA 1DBWA 1E62A 4BNIA 3OWXA 4WBSA 2W42A 3L05A 1VJ5A 3SYRA 1QYCA 4OMUA 4ALKA 4EJSC 2IPNA 4FB5A 5LR6A 1N2EA 4AY4A 1EVJA 4UBOA 3LXMA 4PRZA 4W82A 4Y7CA 5LA6B 1CVIA 2VJYA 2WI8A 2HA7A 5IN4A 4KR7A 3L79A 4TS1A 1T3ZA 3LXRA 3SZGA 5BSVA 1YZKA 3WRWA 4I5FA 4MUKA 3O2SB 3ME5A 1YKFA 2I1QA 4GOOD 3UCFA 2HEGA 3H0EA 4S0ZA 1G5HA 1TA9A 2MINA 1QG2A 1V16B 1PYDA 4R9RA 1QOZA 4RJIA 4DILA 1VL8A 3AT1A 3I5MA 4QTXA 5AM4A 3D1JA 1CS0A 2GUGA 1Q19A 2HA6A 3BJEA 4IBOA 4XJSA 1I33A 2LW7A 4LXYA 3PL1A 3URMA 1MEEA 2O14A 2G07A 3OJFA 3NBMA 3H5NA 4PZLA 2Q8QA 1ODKA 3OCJA 4CMBA 1OLSA 1I4OA 1C9MA 3PE4A 1CEXA 5C81A 3RYCB 2P0EA 2PL3A 2WE8A 3LHIA 2I0FA 1MT0A 1WRBA 2IC5A 4FHDA 2C31A 4BLTA 2PT5A 3G5TA 4TWIA 3H2BA 1CT9A 1XFAA 1KOGA 4C4TA 1XZQA 3C6QA 2P4QA 2V7UA 2XVZA 1IC6A 3AFMA 2RGBA 3FPGA 2X8BA 3MTEA 5YASA 5EWMA 2V7QA 4UVIA 4DG5A 3KKQA 1GILA 2QTVA 3JARB 1Y4UA 4KMRA 3VJLA 4KQHA 2FMUA 2WM9B 3PNVA 3UG6A 5DNCA 4N7RA 4PPQA 2GF2A 2IHYA 3QX9A 4PHTA 4OQZA 3T7SA 2H4WA 4MR9B 1DDOA 4NZYA 2AVNA 4BVGA 3A2LA 4N48A 1P2SA 3RIYA 3TZBA 1QWOA 1ZIOA 2BTQA 1MG5A 2I78A 4X00A 1QQBA 4FMDB 1CHNA 2LIPA 2ZSIA 3NO4A 1M67A 4BZQA 1ZMTA 5J2UF 3G17A 3GVHA 3JWJA 3AOEA 3THSA 3VVLA 1RE1A 1RBYA 2CNLA 1WEHA 1DAOA 3LT1A 2BZ0A 4RIIA 5FTMA 3RKUA 3D7RA 5AK6A 4X6XA 3RHSA 3ND5A 1BFDA 1T9GR 2Q3EA 5FTWA 4D98A 1SUSA 4IWYA 4W5WA 2FPPA 1WDWB 2YFYA 1GTVA 3HPQA 2E87A 1T5IA 2WJAA 3ITKA 4N1AA 5KVSA 2BHTA 2HFJA 4GMKA 2VYFA 4Q6WA 1MJHA 4QL3A 4WXRA 3G2HA 1KQNA 1YJBA 3LQRA 1NVVQ 4QUGA 1D7OA 3LX6A 4AM8A 4AULA 2WIFA 1QGAA 2ZRJA 3LPCA 2O2YA 1R4MB 3DKIA 3LKBA 1L3IA 3NH9A 3LCMA 3LWZA 1H2HA 4TXJA 2GX6A 3HP7A 4I2VA 1GTMA 4I99A 4MIOA 4RH3A 5KCZA 3K9FC 5EUBA 1VJRA 4R2HA 3PGA1 5A6VA 1JEYA 1QQ5A 2WG1A 5FPSA 3T9EA 3HKCA 1EM6A 1VMDA 4K1LA 3DOCA 4Q1FA 2ZJ2A 4KAJA 4Z9AA 2D13A 2P62A 3BK7A 4DTCA 1YE3A 6PFKA 4FSHA 5E7JA 2P0AA 1OR8A 4BC1A 4MVXA 5F7OA 2W6NA 3SJZA 3FDZA 1R0BA 4OU4A 4UPVA 3I6MA 3G9UA 1JPJA 3IBSA 3LYHA 3UB4A 3C85A 5JMTA 2X14A 2X0DA 3T3IA 4ZQBA 1DX4A 5DF1A 1NMXA 3IUYA 3T06B 4AUMA 8AT1A 2PY6A 4ABTA 3RSLA 3BMCB 1JTVA 3GL9A 5DBEX 4LMPA 1ODIA 2D7JA 4WI1A 5ADWA 1VE5A 2CHVA 2XXBA 1UDRA 4OU5A 1PJRA 1Z63A 4EG7A 4P7GA 1KAMA 4F1JA 2PGNA 1MAUA 3P7MA 1OH7A 1N3IA 1UT8A 3T9BA 4JZYA 2G72A 1KNQA 3H1FA 5BNZA 1WMAA 1PYOA 4D9FA 2EJUA 3P8ZA 1BDIA 4JI0B 1NAHA 2QDKA 4GOND 1YJAA 2AE2A 5FFMA 5K8TA 4CI0B 1SQSA 3RU9A 3PEFA 4RPHA 3ZZTA 5EZSA 1SMKA 4IL5A 1CUZA 5JAQA 3KKKA 2J0SA 3AY0A 3E1GA 5HDQA 1HEYA 3V8VA 4KFTA 5JCJD 3RTDA 2H9IA 2JHCA 1JHXA 1HTBA 3ANMA 1H0KA 1TQDA 2CXRA 2FPIB 4BBJA 5LN1A 5AKIA 5DTJA 3KXLA 4CF5A 5FWAA 1Y8CA 1TQ4A 3AILA 4OTZA 4C3ZA 2I3AA 4CV2A 4AJ9A 1J1UA 1B8UA 2EF1A 3LOPA 1O08A 4MLDA 4JX9A 3SIWA 3TLJA 3BTVA 3OT5A 1GUAA 1C3LA 3GNLA 3LYUA 1IXZA 5ER6A 3GTMB 2MSNA 4RO0A 4UEOA 3OX4A 2B9EA 3E9EA 4BB6A 1E1LA 2DYKA 4G5GA 3ROEA 4LDPA 1VG9B 2BHSA 1TEXA 3HE3A 5H81A 3IR7A 4GWLA 2EXXA 4HB2A 3HBNA 4RVDA 5DEIA 2C92A 4FSDA 3IEVA 4YROA 1G5PA 1IB0A 3SQXA 4N03A 1LS1A 2P5UA 3R44A 4CTKA 2PYDA 2RHHA 1GXSB 3HZRA 4IHKA 4EGAA 1BGVA 3OQIA 1U6JA 1RXCA 1T8SA 1QORA 1HXHA 1X7YB 5DI9A 1KAOA 3ZDXB 3U7RA 1CUAA 4JJ7A 2BFFA 3GPBA 4BVEA 3C97A 4CFSA 3KQOA 5DXJA 4BL5A 4DY6A 1LW6E 1SU4A 3GJSA 5C3MA 2YY5A 3HBAA 1ZC4A 1XCGB 1ZRSA 2QQGA 4MVJG 4WD3A 3RVBA 4ALMA 1CJVC 3PEUA 4EG4A 4D9KA 1IXRC 3MWYW 4I7EA 5KOJB 4HXGA 1W581 2PAFA 3OX3A 3LHSA 4M6WA 1CJKC 1PSDA 1U8ZA 1SIUA 5C8YA 1UM9A 2WBLC 2Q6VA 2HQRA 3TIGA 1HE1C 1RI3A 4KUGA 4ROTA 2VYQA 2HZBA 1YACA 2X1LA 1NVMB 4M54A 3OIWA 2HQBA 4P82A 3S7ZA 4A27A 2ZZNA 3T8YA 2GYWA 2I4IA 3CWCA 4IH4A 3I92A 5L53A 5IM4F 2CMGA 4LCJA 1LTKA 2VRBA 4J0JA 2YS6A 3ITEA 3MT9A 4B6JA 4EGFA 5KZMB 4AS2A 3NASA 2FW6A 1E7SA 1WTAA 2DUWA 3JQRA 4LJKA 1RAGA 4MKHA 3S29A 1J0DA 1KMMA 3SVZA 3NUGA 4I9NA 4O29A 2M9MA 4P6VF 1K8YB 3BCUA 1ZMBA 4FLMA 1WZCA 2JA6B 2YXDA 1F17A 4OYHA 3GW8A 1JQBA 2I7XA 2PJUA 4CIXA 2Z1DA 3IPXA 4F4JA 1GIAA 3IDFA 4R9UC 3LO5A 2GEVA 4FJ0A 1FTNA 1Q7RA 2BEWB 3F5FA 2A58A 2Q1YA 1GCIA 3M1AA 1ZK4A 2ZJOA 2RCYA 4KBGA 4M8KA 4YCDA 3GNQA 4ZCQA 3C5VA 4LC1A 3FRJA 5JXGA 1MRSA 3CVUA 4DT1A 1U2EA 5DP2A 2QNIA 3I2FA 1HE3A 5H3LA 3SX4A 1LSUA 1UFKA 2DHQA 2P1DA 3BXEA 4EW1A 2HIAA 4UUAA 3MTIA 1RWWA 3C8ZA 5JAIA 1L5OA 3I62A 5EG5A 5D5PA 1FS6A 1QYWA 2PMFA 5E3IA 4HLUC 3WL5A 1ML3A 5K3SA 3HXLA 3J81k 1DWPA 2GDJA 4AQ7A 5A0TA 1NVXQ 2QN9A 4IQFA 1WDLA 1G4UR 3JYNA 2XUDA 4LE2A 5DE3A 2F43B 1NVUQ 1GU1A 2J31A 1B0ZA 3GT7A 3LBNA 2Z08A 4PZ9A 4CG1A 4G4IA 1C3OA 2GZAA 3QHPA 4DC1A 1VG8A 3AU8A 3LLUA 2QLNA 2XUIA 3ZY5A 5FEMA 4Y67A 1KJZA 1DTEA 1WXHA 3MWJA 3TSWA 3FB1A 4WBNA 1ISPA 3NEAA 1P91A 4NATA 4QUHA 4A3GB 4E5YA 1EFCA 4JITA 3GUHA 3ROMA 1PWXA 4JK3A 6NULA 2NWQA 1ORRA 1T8TA 5EIXA 4N76A 1OPRA 3NBAA 3SJAA 3S0JA 3GVPA 1JHYA 2JFWA 4I4TF 3RVPA 2QD5A 3EGCA 4WY5A 4ZCRA 4MJ3A 1WU7A 2FQWA 2HV9A 2NSJA 1N0VC 2ENWA 5HKAA 2Z8YM 4MQ6A 5BNFA 1DRKA 2Q5LA 3K94A 5HQTA 3DQQA 2G08A 2I3ZA 3C6MA 1FFSA 5TY0A 3TL2A 2P9TA 3SQLA 4IDDA 3LCCA 2PKYX 4IJ6A 4ND3A 1F0YA 1HDIA 1Z2AA 3CNOA 3ETDA 4N7BA 5DHFA 3C6ZA 5TMEA 2O57A 1DRJA 3B5IA 3VISA 4ZGWA 1UEJA 2WJZB 3DZ8A 3QVXA 2B9VA 2V0CA 5B4TA 2H0AA 1MGOA 2GVDC 5I4BA 1KZHA 5JQGA 2FWBA 3KZNA 2QUAA 3GC6A 1KI6A 5FBZA 3R76A 1RWMA 1GTZA 3F3MA 1DHTA 4I2NA 2QMYA 3RGWS 1TC1A 2NU8B 3PDWA 4ZYZA 1X42A 3PPYA 2R4TA 2O4CA 3C3PA 1GARA 1AKTA 1ZA1A 1JEQA 4O2LA 4C3UA 2NN3C 2NTJA 4P5EA 4O4LF 4P4SB 2D6FA 4CF3A 3DZCA 3K31A 4IJVA 4MGYR 4R1UA 1NG9A 1UPCA 3KCQA 1U8TA 3P32A 3AKYA 3H2GA 4G9EA 4RWZA 5K6TA 3S27A 3JAWB 1N6NA 3E1KA 4U2FA 1BN6A 1NLYA 5IYZF 1EK6A 1GN8A 3LLVA 4B8YA 2NYAA 5F78A 3GLHE 1BMDA 2DUMA 4XW2A 3TOZA 3R3ZA 1I3CA 4AQDA 1CD5A 1FTGA 3B20A 3OT1B 4U1RA 3PA8A 5FRDA 2BISA 3VSAA 3FLAA 3PNMA 4F56A 4O2BA 4RHFA 1XNRB 4PYJA 5CYPA 3KDPA 5E0OA 3CNQS 1QIEA 5DHAA 1DEOA 1U8EA 3WK7A 3UTDA 3OU6A 1GKLA 2J0UB 1HNZB 2I1WA 4IRUB 2ZXUA 4I4IA 3VFDA 2XR1A 3WA6A 5F1YA 1QE0A 4ZD6A 1CR2A 1XZAA 1B76A 4U3JB 1JSLA 4J1TC 1QRRA 4YJDA 2PFSA 4EB6B 5KWVA 4N7MA 1V35A 3R7NA 1EJ6A 2PS9A 1Q84A 3CSDA 1YZGA 3SX2A 3SJBA 5HMLA 3EQ8A 1YL6A 4L28A 4M0PA 4R0MA 4NS4A 1CF2O 2M6KA 4LUCA 3I4FA 1EP9A 1V5IA 2AK2A 5CDHA 4CKCA 2BGRA 3U3DA 1ABFA 4LRTB 2BGKA 2AX4A 3EUWA 4J2HA 4HLNA 5MN6A 4OFZA 3R20A 1X6VA 2COEA 2H2GA 3HUFA 1U4NA 1JG6A 2FVXA 3PQ3A 3I76A 4O5OA 4ASUA 3T95A 4GOKA 3G0GA 4DBLE 3JZFA 1TB4A 1KKLA 3C6XA 3I5XA 1O57A 3FLEA 3TTUA 1CUEA 1WR8A 3PL5A 1YDWA 1SOMA 2H1CA 3LRPA 3C1UA 5HIMA 3U3KA 3GA5A 3GNSA 4LTDA 1ZCAA 3JWGA 1U0EA 4WN3A 1VXOA 4Q39A 3SS9X 3GRUA 2PD3A 4KQFA 1AO3A 1M34A 1P1IA 2H4ZA 1JEJA 1EFRA 1NJFA 2AT1A 2WP8J 3EIXA 1YOBA 2Y71A 3FCSB 4F4UA 1C7IA 5JCZA 3HOZB 4J2TA 1SR8A 1RXYA 2I8LA 3F46A 1X7XB 3DNMA 4TUYA 1T13A 4B48A 4ZRDA 3BFVA 2POCA 4E2XA 3IP8A 3ROKA 2BR4A 1XRNA 4TYNA 4PLWA 2QXTA 2OB1A 5G3YA 7AT1A 1PZFA 4UTNA 3E53A 4MQFB 3N2NA 2WYVA 1Q7CA 1QGUA 4ZO7A 3GR6A 3C74A 3EIOA 1QG6A 1TCVA 2I80A 1Z4MA 1J0EA 2G28A 5K0EA 3BB3A 1HORA 2CDCA 1DKMA 2V9ZA 2VSXA 4IZOA 1BN7A 4M89A 3TE7A 1VKOA 4D0SA 1R8JA 5C51B 2GJ4A 4MGZR 4WDQA 3SFZA 1FFWA 1F8GA 1XCJA 3WMGA 1QUEA 1N2SA 4O5AA 2B0JA 5FADA 5EKTA 3TEFA 4AD8A 1RI2A 2H6EA 3ZDZB 1BS2A 3ZCRA 5HVNA 1CPYA 4NMXB 1YS2X 3QTLA 3FHTA 3F7OA 4MHTA 4UBJA 3MLBA 3ROGA 3WK8A 2NTNA 2GHIA 1IRXA 1ONOA 3I6QA 2WG0A 1CF9A 4TTIA 1C9EA 1IH8A 1G8FA 2ZJ7A 3H9GA 5ILGA 2PN1A 1ZD4A 4HDNB 4O25A 5IDYA 2CDRA 1Z3CA 2F55A 1ZGHA 4UQOA 4AUEA 1XSEA 2NP6A 1C1XB 1NVAA 4RV4A 3VR5D 1NJ1A 1COZA 1NXOA 3L4BC 2I1VB 2JBAA 1GL6A 3GZTB 3N2KA 3OZVA 3QU9A 3I1JA 1R66A 4BKOA 5SZKB 3TLMA 1OAOC 2HDOA 3OCWA 4J0CA 1LFAA 4C0AC 1IG3A 4QLOA 3RYFB 1CE8B 3C4QA 5C80A 2PSJA 3AL0C 2IZ5A 3KU4A 5DM4A 1B16A 4YP9A 2XNJA 4KYVA 5JAPA 5T67A 4WESB 3VKFA 1FU4A 4IHAA 5IEJA 2EZUA 4IVQA 4H9GA 1Q1ZA 4KXQA 3S5JA 4K28A 2Q0HA 4BNDA 5A5FA 1JFFB 3PPVA 2AR7A 4RLSA 3VAYA 4LDZA 1ENPA 1RIIA 1EFHA 3DOJA 2YW9A 3HCNA 3ST7A 1MD9A 4B2LA 5HS4A 1L5QA 3KKEA 4ILEA 4NAHA 2DUNA 3S1QB 1UK9A 1NW6A 2K87A 3QUAA 3T7RA 1AA9A 2AJBA 2GBFA 4DG8A 2F1OA 2OZLB 2OK8A 4IQGA 4H7DA 1F2UB 1GLNA 1ZXXA 2H54A 3V2UA 2PAAA 5CMLA 3WWOA 1PL0A 1XDUA 2JGMA 4NCIA 1CY6A 4WN9B 1THGA 1N6LA 4FYPA 3UVEA 1I1NA 1K4MA 3OCYA 4A5SA 4U8HA 4YK7A 1MEJA 1VHJA 1LX6A 4IUBS 1PFWA 1UWCA 1I3NA 2VNKA 1PR5A 1ZL2A 4GZ3A 1DEKA 5LJLA 4BQRA 4K40A 1CIJA 4D9GA 5FWNA 4ZZ2A 2GI4A 5K45A 2AG5A 2N3ZA 2B1QA 1Y4SA 5AIBA 3NDPA 1NU6A 3A26A 4WJZA 4I08A 5B30A 2H1HA 1AHPA 3TFOA 1SUFA 2AJLI 1L8XA 3H1TA 1U1IA 1FDIA 1TTPB 2YH2A 4ACAA 3PUVA 2DZDA 5I9LA 1DLJA 1NQ5A 1N0HA 2QMUA 1ZU4A 2I4LA 2ZCJA 1IY8A 4K46A 3GG9A 4UZFA 4ND5A 3NVKI 3LK6A 2DX7A 1J99A 3A11A 2FDXA 3V3TA 1M7BA 2EEPA 2D5CA 4FINA 4XIYA 5AYVA 3VHXA 2YXLA 3HU1A 3N59A 1R6XA 1ZKDA 3L8EA 2D7DA 4LG1A 1ZDMA 4WL0A 3Q7IA 3MTBA 5J4HA 4A91A 2FSGA 5KMGA 5JZSA 4WUVA 1Y8RA 2EJTA 4GI2A 5H4HA 4KI7A 1NBMD 3P0IA 2BE7A 4IICA 1UWKA 3PXXA 4TQUS 1R4ZA 4GPZA 2YYAA 3GFOA 3MOGA 3QA3E 4OXKA 2DBQA 4XVQA 1M10A 5H16A 2CLSA 3G2IA 2OMKA 2ZG6A 4P54A 5G3ZA 3ZIAA 2JEOA 2XMBA 3ZV3A 1O0BA 2RKOA 3MUFA 1WHSB 4DIOA 2HU5A 2ZDGA 3X2SA 2YV3A 3NJ8A 1BMTA 1FW8A 3D81A 2XUZA 3I04A 1XTSA 2YVLA 3P52A 3W2EA 1LC3A 5LLDA 4PRYA 1PR9A 3LE8A 1I3MA 2IDKA 2O3UA 2CNOA 3GGGA 1Z2OX 3GQBB 4PNPA 2H3HA 3Q3VA 2PD4A 2O8BB 1PBTA 4Y8VA 1XXHB 3TB6A 4PNEA 1KERA 4QQNA 1OU0A 3CH6A 3FVWA 1SHZA 4DC0A 1E3TA 1JIUA 5IKEA 2BMJA 3RVSA 1RWKA 4A0FA 5CFZA 9LDBA 1I0ZA 2DPHA 3PDIB 3SVTA 5D86A 2NVYB 4C0BA 2JF0A 3A05A 1S8FA 4YAGA 2I3DA 3HV2A 3M6IA 3KQHA 4PCVA 1PDWA 3MJ4A 1JLMA 3W5JA 3ZCUA 2R85A 3EPLA 1OZAA 3HVRA 5MN4A 4BIIA 4NK5A 2AC7A 4ZJZA 2DFDA 2GJAA 5CNJA 2O8FB 4FW9A 1JKXA 1VSQA 1UBSB 2VYVD 2UZ4A 3IUNA 1H05A 2QSUA 3KOZA 1K5PA 1MB2A 4TL6A 4CU2A 3KUDA 4C07A 1WXWA 1BXRB 4DQDA 2CK3A 3E7XA 2DECA 4LJ4A 1Z83A 4K26A 1TQ8A 2VSYA 4HR7A 3ZY6A 3BGWA 4O33A 4X3OA 3STWA 4DQVA 5HKOA 1H3EA 2PX3A 1PFYA 3MVEA 1G64A 1KFBB 1O87A 2JFXA 3VR2A 3C14C 2LVBA 2GD6A 4OV6B 1YRWA 3DE6X 3MCAA 4NC9A 4WZ6A 5EFZA 2HMTA 4PO9A 1YBVA 4DXAA 4POAA 2PR7A 4WMLA 4WZAB 5BV7A 5F76A 1JLRA 2H16A 1I80A 3K96A 1I1QB 5JNWA 3R7AA 3IXMA 2ZRFA 2JRCA 1MG0A 3FHLA 4U6NA 1N2CE 3TMYA 4QXPA 4P3YA 3IULA 4WA7A 1RYEA 2OGTA 1FRVA 3KWJA 5CXXA 3ZJYA 4EG8A 2X5XA 3G13A 4L4ZA 3ZJ5A 1NN5A 2EIXA 2AYXA 1S2GA 4A8PA 2NX2A 4LYAA 4Q3DA 5B1SA 4QO8A 1QC5B 2G6BA 4XPZA 3V8BA 4UE3S 1LVHA 3OC0A 1H2FA 1E79D 3K0AB 5D2CA 1T4CB 2ZUSA 2E48A 5TE9A 3FPAA 5KHAA 1RKVA 1OB2A 1RYBA 1C3EA 1ISIA 1RPAA 1YQDA 2PKEA 3ES9A 2HQSA 2HQ1A 5TPZD 4RQAA 3TPCA 3ESCA 3SC2A 3FA2A 3KKMA 5FBQB 3IHTA 5ILOA 4X63A 3IVAA 2ET6A 2I4NA 3VO1A 2VCHA 2R0QC 1V6SA 3KO8A 4Q1AA 4M46A 3RS8A 1XVTA 3CEHA 1L5LA 2H1LA 4B5KA 4ZQGA 3SC4A 2GA9A 1XZLA 1FFXB 1KJIA 2ERCA 3BQ9A 3U7EB 4CIAA 5EEGA 5IHXA 4C2AA 3GLHB 2W7TA 5F64A 4XCXA 1NHWA 1SVUA 4CQLA 2CVQA 3GOHA 2AFIA 2ATCA 3IC5A 2HYIC 1PR0A 5ALWA 5EUCA 3O3NB 5IVPA 4YMLA 1P19A 4KIFA 3C70A 1MV8A 3P2YA 1XROA 4ZOEA 1W6UA 1KNXA 1Z82A 2B35A 3FNEA 3OCXA 4RK6A 1NDHA 5JS8A 4CETA 2JEYA 5E6UB 4V0RA 3GXOA 1KRHA 1XHLA 4HEHA 1MNAA 5EEHA 4Q21A 3FUVA 5T6MA 2E5LB 2P8SA 2FUKA 1T9ZA 3NWJA 2W6JA 3QEOA 4YO8A 3K5PA 3RHFA 2QE7A 5GINE 1QV9A 2C7GA 3D6UA 2V7BA 1U7OA 2W2OA 3CCCA 3JWEA 2NSYA 2B21A 1ZW6A 1HEUA 1BAPA 1G63A 1T3HA 1ZNWA 4G86A 3PLAE 2A57A 1PJLA 3O38A 4OHKA 1MH1A 2XEXA 3DBVO 3G9XA 3O83A 1NI4B 3I5AA 4KVFA 5E38A 3S2SA 2BGWA 1R12A 2NG1A 2QN1A 5JVDA 3LPMA 4A8TA 4CDRA 5CDGA 4CIWA 1V8OA 1GUDA 3OC6A 3OIUA 4Q48A 2C2BA 2DKOA 3T12A 2BCEA 1V47A 3OKPA 2ECPA 4ZRMA 4F5WA 2VTBA 2QM0A 3F47A 2NO7A 3VU9B 2P5YA 2JVJA 5CVVA 3ROQA 3GGJA 4OKSA 3ZQKA 2IYNA 4D9BA 4F92B 1CERA 1FYXA 4PCLA 3ZNQA 4MB2A 5FNZA 4EMSA 3PEEA 2RI1A 4BP8A 2IQIA 4KWEA 4BAZA 1VSVA 5JYBA 4DLWA 4XLTA 2KB0A 1Q74A 3FIUA 3Q40A 4KXWA 5DN6A 4BMYA 2PRSA 4R54A 3HYSA 4FI3F 3DLPX 3I5UA 4MVJA 2HK7A 4LMBA 3BJZA 3GFPA 2UUAB 1GT91 5JDIC 4CG0A 1BDJA 1DAFA 3I32A 2DRIA 3E6AA 5IWCA 2IUTA 3SEZA 1PQWA 2VAMA 2WAXA 3RG8A 4XB6B 2CNWA 4JOCA 3GN2A 4FGUA 1BYIA 1TTTA 2DQKA 3NORA 1BHSA 1B14A 3OEHD 4TMYA 3T1TA 2VQFB 4NBLA 3WMFA 4AF8A 4HPJB 3DB2A 1PQPA 4QPJC 2V4UA 2XW6A 3I4NB 1T9BA 1GAJA 1E64A 1PL7A 3QMWA 4Q9LA 5FWYB 2A0KA 3RBVA 1LBHA 2FEMA 3W90A 1UK7A 1VJCA 1QJCA 5GVSA 2XGJA 1O94A 4I9FA 1C9NA 1KZ7B 4M1TA 4GLBA 4D8WA 1YDFA 4DYHA 4YUWA 4F72A 1XYGA 1C1DA 3NI2A 1GQQA 1KAHA 3FB4A 1TU4A 3LY9A 3GP8A 2FDCA 1K7SN 5DIFA 4D96A 2CLEB 4JI6B 2AL7A 3MLEA 4RENA 1QMPA 1V8FA 3KS9A 1QCYA 5F9MA 3X1YA 4E1AA 1NAIA 4BCDA 4LGMA 3K4QA 1NLFA 5DM0A 4LHVA 4DPKA 1O58A 1U9CA 4A6PA 4ZP1A 4FMCF 2IV3A 3TWOA 1Z07A 1IPHA 4MULA 1UJ4A 2J1LA 4RA6A 4HGZA 1YL5A 4HTFA 2WUDA 4MRMB 4B82A 1GU0A 2I22A 3EIHA 4ZOLF 1TWFB 1NXXA 4JENA 3LBAA 1E6KA 1HA3A 2A94A 2FNAA 3RYHB 3CX6A 1VLZA 3QA9A 1EK1A 2VPZA 4JBWA 1EHYA 2VEDA 5EJ2A 3VZRA 1KI1A 2BMEA 3BF8A 1ZEJA 3DBLA 3Q8LA 4P33A 1J2JA 3W9UA 4V39A 2IQ5A 2HJGA 1FX0A 1I3LA 5KYUA 3WYDA 3I5YA 2A7QA 3KBBA 1SUAA 3PG5A 3W2TA 4JOBA 3DCNA 1QHGA 4XR9A 3V1LA 3KLNA 1SGWA 4AJ4A 5ITSA 2E55A 3FOBA 1L5YA 3CLRC 1ZUIA 1OZFA 3QVJA 2DHCA 4YYEA 2COUA 5C53B 2WVAA 3BWXA 2J7PA 4IGAA 2HR1A 4LRQA 3R0QA 4QGSA 1DQYA 1ESEA 2HSJA 2X9VA 1TWGB 4K3UA 3VGJA 4XGIA 2WYOA 3CN9A 4DADA 3KQNA 5DIZA 1L4YA 1HKHA 2V6BA 5BMVF 4CMAA 1ISRA 2GVZC 3MSXA 3AHGA 1SU7A 2ZTMA 4TZKA 3TKYA 2BY4A 1AQIA 4N5LA 1PUIA 4L9WA 5ALXA 1M7HA 1Q95A 1I2BA 3RVNA 5DWQA 4E2FA 2V7QD 2YVUA 3EJWA 4TMFA 1Z17A 2R6JA 4BJ6A 3KFVA 2WMOB 1WA5A 3UC9A 3KQLA 3VU0A 1E1DA 5I9MA 4UOZA 1FDOA 2V54A 2IE0A 4U02A 3O8OA 4DA0A 3WYCA 2EDCA 4BFCA 5KHLB 1Y3CE 4XUCA 3GUCA 3JR7A 1W0CA 3MD0A 1YFLA 1LPNA 1ZMOA 3O94A 1YA6A 3EEOA 3ZVRA 3V8QA 5HW0A 4PXAA 3M4OB 1U81A 4TVBA 2VQEB 1MO4A 1SZPA 3KR9A 3PEYA 3JATA 3DE1X 4G5YA 1NQVA 1QFSA 1YAHA 2EFCB 3PUZA 4HNHA 5FUMA 2MJLA 3EDCA 4BWVA 1Z15A 3AL2A 4FNMA 1GJRA 4EFMA 1YZVA 4Q12A 2HMYB 4EUEA 4Z49A 1JEEA 2C57A 1TPYA 2P9CA 3ITNA 3P2EA 4B44A 4HNTA 5CA0B 3EF1A 4OGWA 5JRDS 2VO1A 3A9UA 4FFLA 2RJOA 4ETIA 3LUKA 3TBFA 5TLSA 4ZV7A 1JQEA 1OGYA 3PITA 4Y2QA 5D51S 4A26A 5EGSA 5K5EA 1WVMA 3BJIC 3U48A 3V34A 3ACCA 3FETA 1O9BA 1XEWY 2HEIA 2OYRA 3V97A 4ZCIA 3EWSA 4J91A 1KP9A 1D4FA 3P94A 4YT8A 3IE2A 5CCDA 5K05A 4GFDA 4EYSA 3RSCA 2QM7A 3D8RA 3GTGB 4G9GA 4Z53A 1Z5OA 5JAMA 4LHYA 1RM5A 1ULTA 4YMWA 4LVOA 1QV7A 5DLDA 2VRNA 3ECAA 1LKZA 1L5RA 1P5FA 1YQGA 3KJXA 5CVUA 4DW8A 3MWFA 1X9GA 1KOFA 1JVBA 4HDCA 4RXUA 1RXWA 3EB9A 1T34A 4ZZIA 1HDCA 3A4YA 3GP3A 5I3ZA 5JNUA 3OQPA 2JAPA 4PGFA 4JA0A 3TLKA 5EE9A 3TK1A 5F35A 1KE1A 3LUHA 5FUQA 3TJZA 2FEPA 4OH1A 3U5ZB 3QENA 4LZNA 2YINC 5A4AA 1SFRA 3AVTA 3MOIA 2HRRA 4NZPA 3H2IA 5IVHA 1IY1A 4BVHA 1DCTA 4MI9A 1L7MA 4RHYA 2XRYA 4YRDA 2JD0A 4C7JA 4E4YA 4C89A 4PV7A 4G0YA 4U63A 3DLHA 2D5BA 4N9WA 2VBCA 4LYGA 4GX1A 1W88A 5IT0A 4S04A 1BFUA 3B1KA 4C0QC 1VC2A 2XUOA 2WWHA 3I01M 2ZXFA 3CGGA 3JRNA 3KAJA 1ZD1A 2WJ6A 4ZU1X 4DDKA 3U7QB 1EUYA 3S15B 1AB6A 3REFA 3N5CA 1YB7A 3L2OB 3T7IA 1RE0A 3BFPA 4PO8A 4WFJA 4JVNA 2PMDA 5CPBA 4BQEA 3GLTA 2XQVA 4YA6A 3UO8B 2OAGA 3D4LA 2VQ6A 3DFIA 1ADGA 3QHAA 4REQA 1RXSA 2WKQA 2Z4TA 3U6KA 5KYXB 1XN4A 4PYOA 4NICA 3JZAA 5AVJA 4AO7A 4AX8A 5JI2E 1B3BA 2D00A 4B4VA 2JAOA 1NVFA 4LDAA 1XPRA 1SK8A 4O1MA 2GXUA 2AX3A 3MNFA 3TMAA 1C41A 5AW4A 1I0LA 4ZFNA 4L95C 2WD7B 2VZ8A 5DJ5A 4E7PA 4GO1A 3HVHA 4DREA 1K6MA 3FGOA 1FW6A 2QUZA 4GR4A 3ADCA 1NFRA 4PYNA 4JQYA 4YRKA 1CUXA 1WUHS 4BNTA 4FDAA 4DGSA 1JA0A 4RVUA 4TWRA 3RFXA 3O7MA 4S35A 2C4HA 1VE9A 3OTQA 3AERB 3DHYA 5C34B 1U3VA 3E0XA 1MO6A 1HMPA 1OBVA 2G9ZA 4RZQA 2NZWA 1NKSA 1Q0LA 1WKBA 2J09A 3QPDA 4MPTA 5SY9A 1H69A 4RC9A 1I32A 4HHEA 4PLTA 2VI5A 1F8UA 4F8JA 3W34A 3SBDA 1ZITA 2WMNB 4ZVQA 1OY1A 1D0SA 5FBWB 1VMKA 4MYDA 1PGNA 4MS3A 4B9AA 4UMVA 1N2CB 3G7SA 4G0PA 1QYXA 3HZOA 2X6TA 3JWPA 2O7RA 1KAEA 3KRTA 3EVNA 3H1AA 4W8OA 4WOKA 3C3WA 2ABWA 2IEBA 3I8XA 1HLDA 1AS3A 2ZT6A 2OILA 1CIPA 3PENA 1TJPB 5DISB 1UXJA 4LF5B 4A0HA 4O08A 3LY7A 1I3OA 4B76A 1LEHA 3GPCA 5FP0A 4HDAA 4P3NA 5GM1A 3ZWDA 3QX3A 1XP5A 3FBWA 4EX7A 3GRPA 3INGA 3WBBA 3VU1A 2IBMA 4JXKA 3PC2A 1FP6A 4UMFA 1EM8A 4DSOA 1CUFA 2ZBEA 1G8KA 5CLJA 1HOXA 3B7WA 4JI8B 4ZI7F 1TM2A 3AHHA 3E1SA 1HT2E 4QQ8A 4UHCA 5LP1A 4ZA2A 5LYJB 1CYEA 2WWFA 5CM2Z 2YCBA 1C7ZA 4BXOA 2E7ZA 3BG5A 3DE7X 3AVUA 1YS9A 1XEFA 5DNDA 5P8WA 1RPTA 1GG2A 1SUEA 3IVXA 1IXKA 3HJHA 1NFFA 5JNLA 2BEVA 3NBUA 3T7DA 4W5QA 2JANA 3KKNA 5DLQC 1YR1A 3V1UA 1K86A 4JOSA 4O4IA 2XBMA 2IP4A 3JXEA 1X80B 5TXGA 4G26A 2L0XA 1XKQA 3C39A 3ZWBA 1F48A 3IP6A 1MMFB 4FEEA 1FDSA 1QIIA 5LU8A 2GARA 1JMYA 4LOIA 5T8KC 2V0NA 4FZVA 5CFPA 5KUTA 5HBGA 1JIKA 3TRFA 1IZ8A 1A82A 3W2GA 1E63A 1EDZA 4AF6A 4ARZA 3QNMA 4YEDA 1PZMA 4OKIA 3WWPA 4UC0A 3DO5A 3IKVA 2LE0A 1JIJA 1S9DA 1SOAA 3MRXA 4B46A 4EQ6B 2HSDA 4I55F 1P1FA 1TX4B 1PZHA 1NW4A 2I4MA 4ZXFA 3UENA 1RHRA 4P1ZA 2VWQA 3CZAA 1S2LA 1B74A 1J0CA 1A2QA 1G42A 2WHXA 3EXG2 1ODCA 4IIXA 4NARA 4WKOA 4LHEA 1ZGJA 2XCRB 2WWYA 2IXDA 3PCXA 4QJ4A 5GJBA 3UMFA 2CJXA 1T6BY 1Z6TA 3OPYI 3ASYA 4NENA 3HA2A 3ILHA 3F2VA 4RF3A 3FPLA 2IPOA 3H2KA 3PS9A 1E89A 2JFHA 4GMGA 3K9WA 4URWR 5JI3E 4JB2A 3V4ZA 1EWQA 2Z2ZA 4ZT3A 2AQKA 3DS8A 3EW7A 4B0PA 1YI1A 1Y33E 2JAQA 4MGIR 3FPHA 4IXTA 5HJEA 2BRUC 4RETA 3G82C 5AVKA 3SLKA 2EZ8A 1BIFA 4DLZA 1W0JA 5J3JA 3Q7TA 1W52X 3WWEA 3IAAA 3I9FA 2G0TA 3RODA 3I61A 4Q4LA 4ZC1A 3HB1A 3AYZB 2QZSA 4MRNA 1MOQA 4Z0TA 4KGZA 4OI2A 2QSZA 4Y1RB 2YQZA 3W9SA 3EGVA 3MB8A 4KN6A 1KFCB 3PPXA 5KQMA 1P39A 4BGDA 3ASVA 2P1ZA 3IQDB 1QH1A 2A5YB 1J25A 1UBMS 4IMRA 2C58A 1P2GA 1V1MB 3KP1A 3JYLA 4G63A 1G7TA 2EJCA 4GX2A 5JZBA 4ANFA 4FEYA 4RANA 4HDMA 5DU2A 1ZJWA 3KQSA 4G5FA 4LPKA 3BGSA 1CQJA 4XQ0A 3TFQA 4FU0A 3AJEA 4QATA 3WL3A 2GEUA 1IVNA 4FM9A 3TR5A 2I67A 1K2VN 4RLHA 4HUJA 4IPTA 1ONBA 2VJCA 3HVUA 3CW9A 4D1YA 3BERA 3L93A 4B35A 4CLHA 3NGLA 1G8GA 3TTWA 1L4EA 2NQ8A 4OHVA 1Y6RA 4ESVA 1VTKA 4OJNA 4S12A 3RTBA 2OXEA 4PS1A 1WSWA 3WLOA 2E2WA 4MV0A 4P7KA 3TM5A 4X85A 4C5BA 1VCMA 5I7RA 4Q24A 3O8DA 3KV3O 3IUJA 5KQLA 2FR8A 1KQOA 1S2OA 4QIHA 1WZEA 2LUOA 1UXOA 4OLJA 3U13A 1CRLA 3CNBA 1NXWA 4OMCA 2HLPA 4KQ2A 1QG4A 3G5MA 3P20A 4XQGA 3EIUA 3CR8A 2YWRA 4HG2A 4U9IS 1B6SA 1LZKA 1Z2CA 4GR5A 1EUCA 5E6RB 2YX1A 3RE1A 2E4VA 1I3QB 4X1KA 5BSKA 4MKXA 1WSBA 3L07A 4H17A 1T5DX 1ZIDA 5E2AA 2AI3A 2EGUA 2WG2A 1JIXA 3BXOA 4FHFA 4G4SP 4MW1A 3T3EA 2WJJA 2R1UA 3EA4A 2P90A 4I50B 4FX2A 2HWUA 1Q50A 3ORSA 3OZXA 4KPGA 3X2FA 2FAXA 3U39A 4Z7QB 4QTTB 4IHJB 4DV6B 3NYWA 1QSGA 1JIQA 2VVTA 1XN1A 4NV1A 5DO9A 4A8JA 5BN3B 5JSZA 2XB2A 5DRYA 3VH2A 1H4TA 4UDNA 3ZLUA 1T1RA 2FEKA 3HN6A 3KQQA 1ZUNB 1EVLA 2BF7A 1XRJA 1HL7A 2ADOA 4IILA 5TMBA 3S2UA 4A10A 4ZYTA 1OLOA 1G5RA 5AH0A 3ZHBA 1EBUA 1AMNA 3OWOA 3B48A 2W6ZA 2WAYA 3G5UA 3BKWA 4QUDA 2P11A 1AE1A 2CHUA 4RDCA 5EE3A 4DXHA 2PJRA 3SE0A 1FJHA 1E98A 1AGPA 2FW1A 2P9JA 2WPDA 5EQFA 4FE4A 2PMKA 5EWJA 3EOZA 2WJYA 3OE1A 3FZEA 4E08A 4OHCA 1SCUB 3UMJA 5DN9A 1IULA 1WTCA 4HRVA 5C8ZA 4ES6A 1AKNA 1TRKA 4R1OA 2FMKA 4TWZA 2GYUA 4RFSA 3HDVA 5DM70 1TFUA 3CH4B 2GN1A 3KZCA 1V71A 3JQBA 3OFJA 4NK4A 4EYKA 3D2AA 1QAQA 2IYRA 3M33A 4FQ8A 5WRFA 5BMOA 2PX5A 2VTDA 1PG0A 4PLGA 4ASUD 2OSBA 3GHYA 5TF4A 1ZMRA 5CITA 1L5KA 3K5HA 3CJRA 5LU9A 2WJPA 2ES4A 2IH5A 3CLUC 5EQDA 1Q3HA 2GNOA 4Y2PA 4F3YA 5F33A 3TPFA 2MYUA 4R1MA 2R48A 4YCBA 4B6SA 2R7AA 3L6DA 4RK0A 1XVIA 2NOAA 3GEIA 1HTTA 4ND7A 1F0NA 2VNJA 1TVKA 2OY0A 2ZQ5A 3L49A 1SVMA 3BQMB 4G07A 1ZOLA 3TE6A 3CH5A 4YJ3F 1EFRD 1DBQA 2BEJA 1DWOA 4FFBB 4FXPA 3DG9A 5FYQA 3TZHA 1A9RA 1TECE 3U5TA 2RKWA 4A5OA 1QHXA 5D1HA 1T9KA 1N77A 5IUJC 5FXMA 3KJHA 3FFTA 4XM1A 2GUWA 4YWJA 4DCUA 2QT1A 5L4SA 2QE6A 3HEAA 1N5MA 4LQLA 3AG6A 4B7ZA 5F3DA 2XDQB 3I2KA 3RANA 3TOCA 1VQ1A 4Y7DA 3ZZ0A 1R4NB 5E95A 2Z4RA 3R7WA 2QX4A 3JWHA 4XIGS 1R6DA 2F1IA 2H4YA 4OHZA 2FFAA 4DMLA 1P4SA 1UJBA 1NASA 4RLQA 3R1IA 2NU7B 2P5TB 3BMOA 1NW8A 3NRCA 3WKAA 5IZCC 3G85A 4UUMA 5D00A 4BNLA 3DEIA 4FZJA 2XEDA 5CEFA 2V6JA 2OAEA 3OMLA 1GYRA 3SX0A 3LXXA 3TW8B 1F2VA 2ZCUA 5TJHA 4QBKA 1NYRA 4NFYA 2VNIA 5DW3A 5LOVA 5A1JA 1Z2NX 4JP3A 1XWWA 3PVSA 4G5RA 3LWDA 2J6BA 4UCWA 3SQWA 1K6EA 4RMHA 3LP8A 3CM0A 3CPEA 3P4XA 2F1KA 1PUJA 4KBFA 1ZOSA 1M6NA 4P4TA 1W1IA 4NCKA 1EHCA 4XWAA 1E5XA 1TCUA 3C7DB 4QGGA 2R87A 3IDQA 3ESZA 2EZ9A 1DP4A 3H9BA 4Q15A 4S05A 4LJYA 4M0MA 5E2IA 3IBGA 4G5XA 1XZCA 3SN6A 2F48A 3AOGA 4Z7NB 4B1FA 5K0CA 2IKSA 3ACDA 3C4JA 4TRMA 4RTQA 3ZXUB 4IRMA 2MIIA 3B3FA 3HR7A