4PHGA

Crystal structure of ypt7 covalently modified with gtp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
176
structure length
176
Chain Sequence
b'KNILKVIILGDSGVGKTSLMHRYVNDKYSCQYIATIGADFLTKEVTVDGDKVATMQVWDTAGLERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein YPT7
molecule tags Endocytosis,exocytosis
source organism Saccharomyces cerevisiae
publication title Locking GTPases covalently in their functional states.
pubmed doi rcsb
total genus 52
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phgA00
1ZIPA 1YZKA 1WA5A 3L43A 2JLVA 4A6PA 3THOA 4DC9A 2CEAA 4AC9A 4CEIB 1RYFA 4FMCF 3CR7A 2DCUA 2ZR9A 1G20E 1OKKA 3P26A 1PZNA 2O52A 1JALA 1T0HB 3I3SR 1MO4A 1SGWA 2W0MA 4HLUC 4WZ6A 3H0KA 4F4CA 1G19A 5LB2A 3EW9A 3CZQA 5JI2E 1YKSA 3OIUA 3RC8A 1II8B 4NDZA 1Z0IA 2WWHA 1YRBA 1E1QD 4XWOA 4MKGA 5FUYA 4OK5A 2ZM5A 1P73A 2CMKA 2RGNA 3HP1A 4US1R 1DAGA 2IT1A 2RH5A 1VECA 3VX3A 721PA 3KB2A 2WTUA 1FL9A 3FMIA 2ZRMA 3BIFA 3T1QA 2J7PA 3QOFA 1WRBA 5GJWC 3QIAA 4LC0A 2O0HA 1NLZA 4IDPA 4PQRA 3RAPR 3X1DA 3KZ1E 2H92A 1NBMD 4ZKDA 3RS0A 1KJWA 1QHHA 4MQBA 4PO1A 4B76A 4MRRA 3SFVA 3VR3A 3SYKA 421PA 4LOAA 2VHTA 3S1AB 2QUZA 3TKLA 4B2PA 3X1XA 1OB2A 3A36A 4MYCA 5IDVA 2GBLC 2HLDD 4TT3A 4W5HA 4P33A 4HAYA 1US8B 2BC9A 2WWIA 1AGPA 2IC5A 2QRZA 2QP3A 4Q4HA 2FE4A 5IK2D 2D2FA 1G3QA 4WAUA 2PT5A 2WICA 1ZW6A 5CYOA 4YONB 3A1VA 4BASA 2IYUA 1GKUB 4KXFB 1OSNA 2JJ1A 3KL4A 4LJAA 1R5BA 2J46A 2IEZA 1OF1A 3ICQB 1GRRA 3QKRA 2D4HA 3CM0A 4DLTA 5FOVA 4TMWA 4NTZA 3GD7A 4EFNA 4Q7MB 4B2IA 4AWXA 1KSFX 1VHLA 2VHCA 2Z83A 1CTQA 1P6XA 4BRWA 2WWYA 5FUXA 4O25A 4QGGA 1FQJA 3M4YA 3K09A 4YC7A 5A0FA 4CT4B 4JBXA 1VG8A 1X86B 2IYWA 4L9WA 4HATA 4TL7A 1OHHD 1Z28A 4IXMA 3A1UA 2BKEA 1I2MA 2O8BB 1ZM3A 4HUQB 1U8ZA 1DBSA 1M2OB 3I1FA 3MAAC 2CHGA 1P2UA 2MSCB 2H5EA 1QDEA 2WWFA 4JVLA 1NIJA 2BEJA 3AM1A 1E3MA 2WJIA 3B9PA 1G5RA 1I4LD 3JVUA 1DEKA 3QG5A 4Q4AA 3NH6A 4TLDA 3B5JA 4GOJA 3CIOA 3WP1B 1W2GA 1J90A 4EJSC 1ESNA 3FPAA 3BD9A 1CRQA 3M0EA 4HLDA 3AGPA 1H8ED 3O47A 1CR2A 1GSIA 1OV4A 3CPEA 1OFTA 4H9GA 4BLOA 2BBWA 5KNDA 5J5CA 4RCYA 3R9WA 1Y63A 1Z6YA 3OF5A 5SZIA 2WM9B 4AG6A 1Z2AA 4RZXA 2QSYA 4Q1FA 1YZQA 2QT0A 3HWSA 3X1ZA 5FFMA 3REGA 2BCJQ 4QC2A 3QVVA 4A2PA 4A4DA 1UKZA 5KSYA 1HURA 2ZJAA 2O8CA 1MKYA 2W2VA 2YNMA 3GFPA 4LV6A 2D74A 3C7KA 3DPUA 4MGIR 5DI9A 2ZXUA 1JJVA 2EQBA 1P2VA 1VMAA 3ETLA 1FP6A 2PCLA 5E7IA 5EQTA 3PXGA 4TSFD 4B48A 4CIDA 4C7OA 1JQLB 3QJYA 1SVWA 4TTPA 1B23P 2QQ0A 3ZVRA 3TAHA 3PV0A 2EFDB 3AKDA 1AZTA 3IIKA 3TQFA 4KVAA 4D4MA 1DAMA 2VYFA 1N0UA 1GRQA 2RGGA 2IF2A 3W90A 2V7QA 2WOJA 4U5XA 4AKGA 1W5TA 3EWSA 2A3RA 3I32A 1FUUA 1CP2A 5FBWB 1GM5A 2QBYB 2ZU0C 2EFGA 1Q12A 2GAAA 3KUDA 3QENA 2B21A 4QJ5A 2XTZA 5KDDA 2G1KA 2P65A 3HYRA 1W46A 2EYUA 4GBMA 3A4NA 4BECA 4C30A 2VL7A 3THYB 3LWNA 1DAKA 1CKEA 1F5NA 4A36A 5JMTA 4NMMA 4PSVA 1IXRC 4EDHA 3SR0A 2P5SA 1VG1A 4RJLA 5TVKA 1IN8A 2GTPA 1MO3A 3CNNA 4KFUA 3NEYA 3KKOA 4FMDF 2KSQA 2WJHA 2CLDX 4P4UA 4LCBA 3C4JA 4TQ9A 1MH1A 2IWHA 4DBLC 2ZQ5A 2I3BA 3H2YA 4HAXA 1CR4A 1CLUA 2XOKD 2AXPA 3HJNA 1XEXB 2YHSA 4IOLA 1N3BA 4JLVA 3AP2A 2ZSDA 2CK3A 3GLFB 2QT1A 4KFRA 2YWGA 5AUOB 3A4MA 2GEUA 1UBEA 1LV7A 4IOJA 2QM7A 4BZQA 2BKUA 5DE3A 2IW3A 3NBXX 1XXHB 5C18A 1FZQA 3AKEA 4WZBE 3LW7A 4MRPA 1W0JD 4LRWA 4DCTA 2D7DA 1Z63A 3EZ6A 1JI0A 2VLIA 2ZYUX 1FW6A 3SOPA 3KXIA 2QQEA 1ZVQA 4URZR 1X8LA 2BM1A 2IYSA 2GZDA 1IY0A 3BXZA 2XZOA 2CHVA 2GZHA 1IN5A 4RZUA 4RZ2A 1P2TA 1HEIA 1KI7A 3GJ7A 3SE0A 3T34A 3ZLJA 4ITRC 1BKDR 3LLUA 4QRHA 5CK5A 2EWVA 1KDTA 4ZDIA 1F2UB 4U02A 5K8LA 3MRSA 1ZNXA 2VIIA 4NONA 1E9EA 3THXB 2AWNA 3QF4A 3GJ8A 4D4LA 1UEIA 1ZNWA 4AYTA 4US2R 1Q1ZA 4XSHA 1GWNA 1NG9A 3ZS9A 1WE2A 4UKDA 2QORA 1S1CA 5JSZA 2XJ9A 3U7FB 1RRCA 4MDFA 2HDNB 3PIRA 4EKDA 1ONBA 2XEXA 4Q1BA 4BLPA 1SKYE 1YR8A 2AD1A 3QXXA 1IJEA 2H1LA 3K0EA 2IWRA 3MWJA 2XB2A 1J70A 2I1QA 1NVVQ 2V55B 1W1WA 3G5UA 4KVGA 2NO9A 3W5JA 1E9CA 2ZRBA 5EXPA 3VHLB 4KCGA 2FMXA 1KI9A 4LJ4A 1NVWQ 1KO7A 3IPXA 4AI6A 1PLLA 2PX3A 4HLCA 1WQ1R 1Z0DA 2J1LA 2ZSFA 2I4IA 3L0SA 4NCNA 1OYWA 2IEYA 2ZRIA 1Z0JA 3NWJA 1IXSB 1E9SA 2XXAB 4D81A 4A9AA 2GEVA 4RD6A 1Q44A 1SXJA 3GQBA 4DHEA 1TEVA 1TEXA 2QA5A 3PR1A 5KDOA 1FMLA 2YWFA 4NL4H 1IY2A 4D25A 1HTWA 2O8DB 3KQKA 4TTQA 1UM8A 1W2HA 4URVR 5TDHA 4HDOB 3SS8A 1NLYA 2QTVB 2IXEA 4DWJA 4MUAA 3A8TA 4DT1B 2JLWA 4NE2A 3OESA 1E2HA 4OBEA 1SVLA 4M9ZA 4ILEA 2ONKA 4V02A 4ZDJA 1E2GA 2PJZA 4ABYA 2D3WA 1UJ2A 2BOVA 4M1OA 2KB0A 5C2JB 2WKPA 2V1XA 3BJIC 1XNJA 4DCVA 2C98A 1FUKA 2HJVA 3SHFA 4R98A 2ERXA 4A0GA 4AKIA 4OK3A 3NKVA 2CNWD 4B6FA 3KTAA 2HT1A 1GAJA 4LUCA 3EIEA 5TB5A 1LS1A 1IXZA 1G41A 3BWDD 2ZAMA 2Q9AA 2A5GA 3GFOA 1FOEB 4CVNA 4HYYA 1G6HA 5FPYA 4TMZA 1RKBA 4XOIA 3UXMA 2BBOA 4Y0VA 4KYUA 2QPOA 3P27A 3CR8A 2JLUA 1KOFA 4P4TA 4DB2A 4Q1DA 5DIFA 3B8HA 3RVBA 3ND9A 2IHBA 4TL6A 1GUAA 2GZAA 1E2MA 2WOOA 3BB3A 3LVQE 2BMDA 4XH9B 5SZKB 1KHTA 2J41A 4M1KA 2R6FA 4D6PA 2CL0X 3GJ5A 4QHYA 4Z1MA 3T1TA 3VAAA 2W0SA 2ORIA 2YV5A 4WXPA 5E3HA 3CRMA 3FFBA 3IUYA 4HB3A 1GIAA 4B32A 1LB1B 3LLMA 3K0CA 4M1SA 1ZRHA 1OPXA 5JJKA 1E32A 1SVIA 3CF2A 1VG0B 3GFTA 2ORWA 3WRXC 2FOLA 4MA4A 1VYUA 2ZUBA 1XU4A 1OXVA 2F1RA 2ZUCA 4PXAA 3W6NA 3B2EA 1X3SA 3W5IA 3MLEA 3U3MA 4CZ2A 2C96A 1GL9B 4ESHA 3C16C 1JXMA 1Z29A 3TQCA 2FPMA 1EWRA 4BFSA 1XD2A 3P1JA 1XEWX 3K9GA 1N6IA 1NP6A 5JCZA 1P4SA 4JLDA 3C5CA 5HKKA 3FMFA 1NKTA 4XIGS 2OCYC 3L0IB 3AVPA 4TQUS 3UG6A 1DAHA 3B13B 3HU2A 5P21A 1N6KA 3UMFA 1E2KA 1DE0A 4IDNA 1LNZA 1HYQA 4G01B 2G77B 1LW7A 2QAJA 2ZRCA 4OHYA 4K46A 5BWMA 3U6BA 2ZR0A 3KKPA 1XEXA 3JVVA 4TMXA 2AK2A 4UJ3A 4WA7A 1KO5A 4Q18A 1E2FA 3L2OB 4G5SA 3RHFA 3WMEA 4O2LA 3UG7A 3TR0A 1AS0A 1Q1QA 2PEZA 2ZTSA 3DOEA 2NZ8A 2G88A 2QNRA 3LA6A 4PHTA 4R7ZA 4FWIB 1A5TA 5KTYA 2WV9A 4E03A 5L3SA 1FX0A 1NN1A 3FYHA 2J7PD 3AF2A 5FH9A 2G0TA 2CVHA 3O8RA 4XJXA 4V0KA 3BERA 5D3QA 2FWRA 1OH5A 2FG5A 2X19A 5D3MA 5FBRB 5LDDC 4BLRA 5BYKA 2WVJA 1ZUIA 4M53A 5B64A 5CLQA 3GEIA 1U0LA 2RHDA 3OFND 2X8AA 2PCJA 4FCTA 2B7CA 1WBDA 2GXQA 2EWWA 2WSSD 3E1SA 1UBCA 4L4UA 4EPYA 4I1OA 5G53C 5FI1B 3ADKA 1SHKA 3FDIA 1CJVC 2OEPA 4NBSA 4Q1AA 3ZZTA 4TL8A 4CT5A 2VP9A 1VTKA 821PA 1O87A 4CW7A 2ZS9A 3UATA 1L4YA 4D80A 4R2IA 3K0FA 5JLJA 3F8TA 2QEQA 1WCV1 4Q21A 2PZFA 1G8FA 1DAIA 2WJYA 4QNMA 2AX4A 5DSZA 4KAXA 1X1SA 2JATA 5FTNA 4C7OB 4JZKA 2NOAA 4GP6A 4LBZA 4Z8YA 1UADA 4H1VA 2GVDC 4HDQB 1W44A 4TMKA 3T1OA 3O8CA 2WWGA 3B1YA 4NP6A 2AFIE 4TLEA 3TUZC 1OHHA 4A0HA 2OAP1 1RJ9A 4FW9A 2ZRKA 2ZJ2A 2RGAA 4FIDA 3P32A 1G3UA 2YC2C 4XD7D 1XB2A 1KI2A 2C2HA 4IRUB 4LK2A 3WMFA 3ZJYA 4DIEA 3KUCA 5A4JA 1GZSA 3E70C 2GA8A 4PSAA 2P67A 4R9UC 2BIFA 3MFYA 2GXSA 2C04A 2F43A 2IXFA 4Q02A 4TWZA 1E2DA 2JIZD 4NHOA 1Z0FA 3X1YA 1XTQA 3EWAA 2FDCA 1VKJA 3CPJB 4WZAE 5FBVB 5B30A 4B3XA 3IHWA 1I4TD 1G7TA 1XF9A 1ZJ6A 3GLHE 4PC1A 3BFKA 4HUQA 2PMDA 1XMSA 3IO3A 2GBLA 2XNSA 2GEDA 2RAPA 3GLIA 1OFIA 3B7GA 2GF0A 3PUVA 3SDZA 1DG3A 3KKNA 4BRUA 4DLWA 2C9OA 4DT1A 2V1UA 4F91B 4M1TA 1SKYB 2GHIA 2ZUDA 4GMXA 1GL7A 1RE0A 1VDZA 5EUMA 2JDIA 3W3ZB 1H65A 1DS6A 4GPTA 1X8KA 3CZPA 1GNQA 2ATXA 4FMDB 3RNLA 4V0LA 4D0GA 1Z0AA 1P9RA 1CIPA 4LC1A 4MKHA 4QJ3A 1E4YA 1NBME 1SVMA 3RYTC 3QY0A 3UWKA 3H4MA 4AKEA 4CF7A 1WF3A 4IVPA 2ZI9A 4IFEA 3J81k 3O8DA 3B78A 1YZLA 2UZIR 1ZC4A 4L15A 5CIQA 1RW4A 1TU4A 1HUQA 1IN4A 5JECA 3H1TA 4PR0A 3TAUA 1AA9A 1T8TA 1E1RD 4MGYR 1XPRA 4IDHA 4DLSA 5F9FA 2BVNA 1NLFA 2FF7A 1T3HA 3Q85A 4I4LA 4YXWA 5CIWA 3CUEF 5FOXA 4DSTA 4W9MC 3U60B 4Q9HA 4PHFA 3AVWA 4W5JA 4Q7JB 1ZCBA 1UDWA 2IUSA 3NBZC 4US0R 3KJEA 5J47A 3L8ZA 3SYLA 3VQTA 5EP4A 1ZM7A 3WBKA 2ZANA 2GJAA 2DHRA 3VMFA 2AWOA 1B0UA 5EE9A 4C4PA 2KE5A 2J0UA 2IYTA 2EYQA 1LF0A 3H86A 2OILA 4JYBA 4PPNA 1E79D 1BYIA 5LB4A 1A82A 5AJXA 4JLBA 1KDPA 3FOZA 2MSDB 1N5LA 2N1BA 4BQSA 4WW0A 4I99A 2JLZA 2CL6X 2CK3D 4KO8A 4OHWA 3K70D 1NIPA 1FPMA 3GLGA 1CJTC 3UANA 4Q01A 1RC8A 3HYTA 2D62A 2UZ3A 3K9LA 3MWKA 5GVRA 4PAQA 5FOTA 1M7GA 4BFXA 1BIFA 1SKQA 1KMHB 1ANKA 3B1VA 2WJVA 1AK2A 2R8RA 4S35A 1W0JA 4GT1A 5G41A 4YMVA 2IYLD 2J3EA 4BFWA 1KDRA 1G8YA 3AV0B 1NBMA 3LDAA 3CRRA 3CW2A 1R0XA 5KPJA 4IHQA 3EZFA 4OHXA 2OXRA 2ASEA 5EXXA 3THYA 4PPFA 5GADl 2ZVPX 4EFLA 4PO8A 4V03A 3MUFA 3C15C 3PEYA 3CLVA 2XSZA 2Z6VA 2JLSA 2ZJOA 2QAGC 4UXHA 5F3WB 1AQYA 2XJ4A 3G82C 2HLDA 1Z3IX 2VSOA 2ZI6A 4IFBA 4TT3D 1RFLA 4S2EA 3GLFA 4IEIA 1W36D 3O8BA 2FGJA 2RMKA 5IK2A 2L0XA 3LRPA 4BUJA 3W9YA 5C46F 1KO8A 3VHXA 2C9CA 4IJMA 1YE8A 2DR3A 2ZYTX 3D6TB 4Q7LA 4KBFA 2NO0A 5HE8A 3RS3A 2OG2A 5CJ2A 3JZAA 2VPPA 4JL8A 3QBVA 4UNRA 1KZGB 4QGHA 1MO6A 4JLJA 5FL7D 3SU8A 1IHUA 1R4AA 4LWZA 1DO2A 3UWOA 2GILA 4HAUA 4PQYA 2H8KA 3WP0A 1P75A 2P6RA 2FSFA 4YMSA 3DDCA 1TPZA 4ZI2A 1JB1A 4WIAA 2P3SA 1KNXA 5KSZA 1GNRA 2C03A 3A37A 1KDOA 2K5UA 4TN1A 2ZYWX 1IY1A 2ODNA 3U5ZB 2WKQA 1G21E 5TY0A 1Z6TA 2PJRA 2CCJA 5J40A 1NVUQ 3BH6A 5CYPA 1CU1A 3TH5A 3WMGA 3BS4A 4URUR 4LGMA 221PA 5EZ5A 4O3MA 1JEEA 3K0SA 5GJBA 2VBCA 4BGDA 1F3OA 4PPQA 1CJMA 2CDNA 5M04A 4G1UC 1Z06A 3D3QA 1TMKA 1Y3AA 2REXB 5DH9A 2HV8A 2E1RA 2Q9BA 2LKDA 1ODFA 2QMUA 1KAGA 2FPKA 2XTNA 3AQ4A 3U61B 3BH7A 2QMHA 3EA5A 5HTKA 3VKWA 2P2LA 1HQYE 2FFHA 4Q9LA 1Z8FA 4BZXA 2NGRA 1QRAA 3Q8XB 2IYRA 4IVRA 3GJ3A 1NSTA 4C0KA 2W6JA 1S3SA 4LPKA 4HAZA 5JWHA 1TL7C 1QG2A 2PZGA 3RRMA 2CBZA 3QKSA 2GKSA 2VP0A 4X8OA 2GJ9A 2O8FA 1WP9A 2ZRGA 3B1XA 3GLHB 3K0FB 1E96A 1S2MA 4A8JB 4Y0AA 3TGPA 1KY2A 5BXQC 3QKSB 2O0JA 2PLFA 3Q5DA 1Q3TA 1Q22A 1XEFA 1QHXA 2MSEB 4U00A 3KXLA 1TQDA 1E0AA 1ZD9A 2F6RA 2YINC 1D8TA 2NQ2C 4MRNA 4A92A 3WRYC 1YQTA 1XTKA 2Q3HA 5AUQA 5CDFA 2OFXA 5J4VA 3KJGA 4UXJA 4LBVA 3AP1A 1KAOA 1M6NA 1XWIA 3CH5A 1UEJA 3BORA 4GFDA 4PX9A 4BEJA 2GETA 1PUIA 1KI8A 4MYHA 4Q7KA 5F2EA 2O8EB 2DFLA 4LJ5A 5HPYB 5BN3A 2VP5A 2ZREA 3RLFA 2KBFA 3ZZUA 4LHVA 4A0RA 4QGAA 4ZCLA 2RHMA 1SXJC 1P60A 2W2TA 4LHWA 3NTUA 2EW1A 5EZ6B 3VFDA 3FHCB 3H84A 4NKRA 1UBFA 2HYDA 1GRNA 4DB4A 4DCNA 1AS2A 2JGNA 3AF4A 1MT0A 3UMRA 2FFBA 4N0EA 1NJFA 4ZPXA 1NMYA 3R8FA 2VRWA 1G3IA 2JAQA 3IKJA 4BFTA 2OZEA 2ZRNA 3AF0A 1YVDA 4D26A 3LY5A 5HKKD 3CWZA 1E6CA 2A5JA 1Z6GA 4MYTA 3C41J 4W7SA 2B6HA 1BOFA 1KY3A 3IPYA 3MG9A 4PC2A 4ASUD 2IS2A 5EXTA 5JRZA 4PFSA 4P0TA 1OW3B 2FJUA 1PJRA 2P0EA 5L8VA 1GOTA 1J8YF 4LHXA 3ONWA 3ZGXA 3P20A 3W3AA 5IHPA 4RFSB 1C1YA 2PH1A 3IILA 2AD5A 2FA9A 4JJZA 1BMFA 2CLSA 4IOMA 1EFHA 1XPOA 3UKDA 1WB9A 3I4LA 1SXJE 4YMUA 4M9XA 1G4AE 4W5WA 1C4OA 1NN5A 2DBYA 4C2TA 1YZTA 3I72A 3HPRA 4X8LA 1ZMXA 4J0QA 2JEOA 5EXSA 4B44A 1S1MA 2IF0A 1Z22A 4QBIA 4N0DA 1RIFA 2WJGA 2R44A 4LBYA 2QPTA 1XEWY 3DMDA 3PITA 4MKIA 4B47A 1D9XA 2QI9C 3VR2A 1VYVA 2FZLA 2WSSA 2QAGA 1C9KA 1RVDA 4FWTA 2O5VA 3THWB 3P4XA 5KSPA 1WBBA 1S0UA 1N6PA 4ACBA 4JSTA 621PA 5JEDA 3TJZA 1CJKC 2ZJ5A 1E4VA 4BE7B 5GVSA 2BM0A 2R6AA 3AH8A 2YOFA 3AKYA 4FI3C 4HB0A 2JJ2A 1U90A 5JS7A 3LQRA 1OYYA 1D2NA 1FMJA 3QXJA 1ZUHA 4EQ6A 5L3RA 4PC6A 3BK7A 1OLOA 2ZE5A 5BN5A 3KDSE 3T1VA 1VIAA 1EWQA 3IHLA 5K8TA 4O2RA 1VG9B 3QF7A 5B58C 2QM8A 3T5GA 2DY1A 2G1JA 4G5QA 3RANA 3RS4A 2F55A 4HZUB 4TTRA 2PL3A 3BE4A 2BHRA 3DOFA 5TXGA 3OIYA 4YMWA 4ZDKA 4ZV4A 1COWD 4MYUA 1R2QA 4XD7A 1M74A 5L3VA 2QROA 2YWEA 5JFGA 4TLBA 3GPLA 4JT2A 1G6OA 3HU3A 1XMJA 2FSIA 5AJZA 2EFEB 2A7QA 4F93B 1A2BA 2PEYA 3BB4A 5JRJA 2ANBA 4ZIRB 1KJYA 4PC3A 2JIZA 2R62A 3LO5A 3SBDA 1X1RA 5FPSA 5K8UA 4Q4JA 2NO1A 2V6IA 3RWMB 5IF9A 2ZETA 5DNYB 1JR6A 5K8IA 4AIIA 3KQNA 4ACAA 4LHZA 3PEWA 2WIBA 3TVDA 1RJ9B 1DARA 3AF1A 4UNPA 3ZD6A 1UKYA 5KYKA 2E87A 2C78A 4C0AC 3LX8A 3AGQA 2SHKA 2VHQA 1TX4B 4Q4LA 2OT3B 2F43B 5FBQB 4YQFA 1N5KA 1W4RA 2A5YB 2BJWA 5DHAA 1P9WA 1W36C 3L0PA 2JDID 4R2HA 5HZHA 1W36B 3WBJA 4TZ0A 4PO9A 4QBHA 1GTVA 2HYIC 5FPKA 3FWYA 1Z0KA 1JR3E 2QPAA 4H1UA 1BYUA 2A5DA 4QL3A 3K9HA 2IUTA 4B2LA 3U4QA 1MR3F 2P6NA 3VKGA 3U2QA 1MRNA 1A4RA 4NYJR 4C0BA 3EPJA 4A2WA 4Q9IA 2X1VA 2O0KA 3NIBA 2HT6A 2QG6A 3RSOA 4DDUA 1JBKA 4E09A 4XWAA 4D0NA 1BS1A 3SJCA 4FINA 1DELA 2KI5A 4M21A 3TW8B 2DFKB 4BFUA 4Z54A 1XP8A 2J5XA 1CR1A 3L8YA 4AY2A 4JBYA 5F9HA 1ZM4A 3QSYA 3Q72A 4EUNA 2CCKA 2JLRA 2QL6A 1VHTA 4M8NE 3T61A 1DAFA 1OXXK 3WYAA 1ZCAA 1LVGA 1L4UA 2OBLA 4I1UA 5KU1A 2REOA 1G17A 3TSWA 1G8PA 1E2EA 1KZ7B 4HUTA 4QHTA 4A2QA 4M1MA 3OEED 3EARA 4EPWA 5H1YA 2ZAOA 4LX0A 3SFZA 4NYIQ 3PCRB 1E94E 3OAAD 1UPTA 3TNFA 4GRAA 3FVQA 2ZS8A 4BWYA 1IBRA 4RD2A 1N25A 1JECA 1W5SA 4IW3B 1N6NA 1EX6A 1J8MF 3A1TA 4ERNA 2ZRLA 3KQLA 2FX3A 3MWLA 1KMQA 3W34A 4B75A 4JLPA 5TMPA 3LFUA 2RGDA 2J0SA 5DYIA 1AM4D 4BFVA 3FGNA 1M34E 3U7HB 2ZS7A 3OFNA 4B6EA 4Q4JB 2ZR7A 3SZRA 3ADBA 2BMFA 4OJQA 4DDVA 1ESMA 1DG1G 4OHZA 2BEKA 3T12A 1W0KA 4PAMA 1G7RA 3TR5A 2XSZD 2RGCA 3C14C 3Q3JB 4HSEA 4D82A 1OIWA 3EC1A 5FOUA 5JS8A 1ZINA 2P5TB 3V00A 1OIXA 3AVXA 3UMSA 4RVCA 3EA0A 2X2FA 1IONA 4LYJA 2F7SA 4AYXA 3NDPA 4OHVA 5E4FA 5CM8B 2PMKA 2CXXA 4JLOA 3ASYA 3EZ2A 5DYGA 3UIEA 2YWHA 1CBUA 1E99A 2R2AA 4LHYA 3OE7A 5L3QB 5LD2B 5FL7A 1QVRA 2DYKA 3CF0A 3DM5A 4HI0E 3ZQJA 3TLXA 4KYIB 3AVUA 3OZXA 5KSOA 3VNVA 1R8SA 3SJBA 2QE7A 2ZJYA 3QVUA 4EPTA 4BLQA 2J45A 5CITA 2Q3MA 5HE9A 3A1SA 2OCAA 3NC0C 3PG5A 4PHGA 2V9PA 4UQOA 5J4LA 1XTIA 3DVLA 2IS1A 1H8HD 2OBMA 4B3FX 4Q4AB 3BGWA 5HCNA 4N3NA 1IN7A 4DCUA 3I92A 1AKEA 1XRJA 4PC7A 4L9SA 1WDTA 3A1WA 4OK6A 2IYVA 4QBFA 4XVQA 4DLZA 3FHOA 1J7KA 1NVXQ 1UKVY 2ZIAA 4MRVA 4RZ3A 5CM9C 3THXA 1YR7A 3K9NA 4NCJA 4RCZA 1TNDA 5J4KA 2ZRHA 4FCVA 4PAOA 1HY3A 4DSOA 4B74A 1IQPA 4QFMA 1MABA 1N0VC 4JIMA 1Z6AA 2BCGY 4MUBA 3U7GA 1QHGA 4KITB 4F38A 3NC1C 3LQQA 1Z07A 3QXSA 4LV8B 4JVSB 5JBQA 5JWOA 3BAFA 1CXZA 3SC3A 1T0JB 3ND8A 3AVTA 1QF9A 1P72A 5FBLB 5G3YA 2KWIA 1PLJA 1AJEA 2W6JD 2VF7A 4KI0A 5JZVA 1QHHB 1ZNZA 5AWFC 1IN6A 4ZCMA 2Q9CA 2F3TA 1T5LA 1SXJB 2VQSA 1LF5A 3KFVA 3LW8A 3FMPB 3TUJC 4BFZA 5EE0A 3NDBB 3I73A 4EFMA 1DOAA 4GP7A 4HAVA 4RFSA 3RRYA 1QHNA 3CRW1 1XDBA 4NYMQ 2HUPA 3WNCA 4IDQA 2YC4C 4NU0A 3K70B 1T4GA 1T6NA 1EG7A 3QKUA 1LS6A 3CKLA 2O8BA 2ZITA 1M1YE 4OL0A 5DI3B 2DPXA 1D6JA 4GL2A 2HCJB 1II0A 2GDJA 3AF3A 4NYJQ 4M22A 2RGXA 2MMCA 4JS0A 1KTVA 2DFTA 1Q57A 4LSGA 3KJHA 3LX5A 4URYR 1XCPA 2A9KA 2HF9A 2IYYA 2QP9X 2ZRPA 4DLXA 4RD3A 2DWQA 1SQ5A 4A8JC 1G7CA 2IK8A 3PQCA 4YXWD 2GCPA 1GKIA 2AFHE 2OHFA 1EFUA 4B33A 1F2UA 1GVNB 2BJVA 4QNRA 3RS5A 1Z47A 2ONJA 3U44A 1NN0A 1PV4A 2ZI7A 3QPVA 3P4YA 1GL6A 1UAAA 1AKYA 2VHUA 5J4YA 1KMHA 4LI0A 4E07A 4RD4A 5L3SB 3GP8A 1YRAA 1G1MA 4OI2A 1E79A 3T06B 1N2CE 2OSBA 1AQUA 3B1ZA 5F98A 1DPFA 5FTMA 4XSGA 1ZM9A 2D2EA 2ORVA 2FH5B 2YOGA 4KJZA 1RYHA 1EFRD 3WNDA 1JQJC 3FMOB 1RRFA 2WZQA 4QM7A 2QGNA 4DDTA 1Z5ZA 4CGZA 4B71A 2Z4RA 4PANA 2VP6A 5G3ZA 1XZPA 1JR3D 5DN6A 1E2PA 4II7A 2FPLA 1JEDA 1FQKA 4TMTA 1XTSA 4OKSA 5JJLA 4M9QA 2WAYA 4LJYA 4OQFA 3ZZ0A 3GLGE 1BMFD 1JNYA 1XTJA 4JBWA 2QTHA 1NSFA 5CB8A 4B3GA 1EGAA 2F1JA 1X8JA 1VYTA 2XZLA 3ZIAA 3TRFA 4G0NA 1ZD8A 2IYZA 4B43A 2IXGA 1ZNYA 2FV8A 3I8SA 3OIWA 3RRZA 1N5JA 3DKVA 4N1AA 4YDHB 2DB3A 1A7JA 2GJKA 3R9IA 4JVMA 1MV5A 2R6DA 3F5FA 3NG1A 2IHYA 1U0JA 3MGCA 4AG5A 2Y8EA 3TVTA 1KO4A 1T3SA 3U7EB 1G5TA 5DISB 3PEVA 4Q66C 2YJTD 4PTLA 4PQFA 5H70A 4MRSA 3SNHA 4E22A 2XGJA 1XTRA 3G0HA 1KSHA 1T91A 3OEHA 3EIHA 3T15A 4HDCA 4AYWA 1GDDA 1G291 2NTYC 3NXSA 2JJ2D 2O8FB 2OO7A 1AN0A 1XJ0A 2N42A 2FEOA 1OFUX 4WBSA 2ERYA 1TF2A 2ZU6A 4A15A 1F60A 1K8RA 2FSGA 2YZ2A 2OE2A 5SZHB 4L16A 4RD1A 1G3RA 1N6RA 3I8XA 1T8UA 2GCOA 3DKPA 3CX8A 1G3MA 3A4LA 1SHZA 2GCNA 2QBYA 4GDFA 2AXNA 1XXHE 2I1VB 1KKMA 4B3DA 2DFNA 1P2SA 4YDSA 1MO5A 4F7WA 1KGDA 3VR5A 4X8MA 5CJPA 1ZYUA 1E9BA 2R6GA 1COWA 2GK6A 4KU4A 4EJSA 1T5IA 2ZJ8A 4QG7A 5CLLA 1U8AA 5DGXA 2ZRDA 1HA3A 3GLHA 1OH8A 3ADDA 2OV2A 2Q0HA 1EX7A 1LTQA 3MJRA 3WYGA 1QVAA 2WJJA 3N70A 4OJKA 4V0MA 5AJVB 1NG1A 4HLQB 1W49A 2V3CC 4HAWA 2B8TA 3M1IA 2W2XA 4TL9A 4LZZA 2LKCA 3LBNA 4RFVA 4K81B 2FGKA 2Q3FA 3E5HA 3SN6A 1S4QA 2OM2A 4DLRA 1OXUA 5HR5A 5D3MB 5E7MA 2IA5A 1D9ZA 4LYFA 4DKXA 4QHSA 5JJIA 1XD8A 2QU8A 3DL0A 2RKOA 5FI0B 2XNDD 3RC3A 3N5CA 1G18A 4PZLA 5C4MA 1U94A 2W58A 1GITA 2FEMA 3AB3A 3BBPA 5B2ZA 2ZRFA 1E9FA 2A2ZA 4B3CA 3A6PC 2GJ8A 2NIPA 3PUWA 1EK0A 1ZUNB 2F1HA 4ZDWA 4EJSB 3NHBA 2VF8A 4JLAA 3CBQA 2ODBA 4B35A 3WXMA 2C99A 3DHWC 5HCIA 3LXXA 1PLKA 5JHHB 1PVOA 2YKGA 3LD9A 5FTJA 2BBTA 4LYAA 3ZH9B 2ZI5A 1NVVR 2PX0A 3AP3A 4JL6A 4KLZA 4C3ZA 4CDGA 4UXIA 3TIFA 1N0WA 3SQWA 2J0UB 3A58B 5FR1A 2VTKA 1NMZA 4NZYA 4KBGA 5FUVA 2YVUA 1TQ2A 1US8A 4XTCS 4FN5A 1XBTA 3DO6A 3THWA 2WSMA 1YJ5A 2V6JA 3GJ6A 1OJLA 4LDJA 4LJ9A 4BLTA 2IS6A 3RRNA 4DEYA 1R5NA 2OAQ1 4ZI3A 1GILA 5KPDA 2R65A 2XZPA 1G5PA 1R8QA 1LY1A 2BV3A 1KKLA 4TYYA 1VIYA 4OYHA 1U99A 4DCSA 4DUGD 2DWPA 3WHKA 3GLFE 2CL7X 2FSHA 2JCSA 2GNOA 3EXAA 3ZD7A 5JHGB 1ZBDA 1QHYA 2F9LA 3ZDQA 4EPXA 3KX2A 1JPNA 3DM9B 5CK4A 1KI6B 4OQMA 2WIAA 5DHFA 3GLGB 3KQHA 4ZO4A 4ASUA 4Q9JA 1CRPA 4TQAA 4P3YA 1SZPA 1RRPA 1XMVA 1OKKD 3F0TA 4A1FA 5GJVC 1II9A 3FTQA 1G64A 1Z08A 4QXAA 2IUUA 2AKYA 3ZVNA 5GJCA 2ZI3A 2B8WA 3UPUA 2H57A 5FPHA 2WBLC 3OEEA 1E1QA 1FX0B 4QGFA 2BBSA 2VH5R 2WWWA 3SI7A 3VR6A 1P62B 1II8A 4MKFA 3RS2A 4ZCIA 1V43A 3U3OA 1E0KA 1E98A 1YU9A 4TYPA 4DEXA 5AUPB 2HEIA 1U81A 4URXR 3VNUA 2JLQA 2IS4A 4Q19A 2XX3A 4E5UA 3UK6A 1ZIOA 2R6CA 4AURA 2HJGA 4PPGA 4CEIA 2NMVA 4TZ6A 3IEUA 4R71A 3PJRA 4JSYA 3VU9A 1E69A 3V4FA 3B9QA 1D2EA 3FKSA 3QE0A 5ANRB 4F4IA 4MGKR 1KSGA 1QBKC 1W47A 2ATVA 5TV2A 5LD2C 1W0KD 4AKHA 2ZSEA 4A6XA 2CCGA 1G9XA 4M4SA 4A0FA 4QJ4A 3K70C 3W8NA 1KSJA 1RRGA 4JMPA 3ZS8A 2ECKA 3DZ8A 1S96A 3CX7A 3GCGA 2C77A 3DEFA 3AUXA 4KFSA 4AK9A 3QQ5A 1QHSA 5FOWA 3D7MA 1MABB 3WNBA 4OQNA 2KBEA 3OIVA 3CONA 2GCOB 4G3XA 4IVQA 3WY9A 1A1VA 1NY5A 2QSZA 3CNLA 1GKYA 1YR6A 4OQXA 2OBNA 2QE7D 1NNEA 4GZLA 4RY2A 1QG4A 4EPVA 4LJ8A 1UFQA 3U3KA 1CS4C 4HZUA 4DVGA 2GF9A 3QEJA 1OH6A 3GEEA 3X2SA 3BFXA 3KJIA 2OLKA 1H8HA 3DMNA 1A2KC 4UJ5A 3QEOA 1N6OA 3QBTA 3VR1A 2AR7A 2VEDA 3GJ0A 4IXNA 4PZZA 1F6BA 3I61A 1VPLA 4TLCA 1VCNA 5B57C 1E2NA 1Q1EA 1YHNA 2F1IA 2X2EA 3PUXA 5AK0A 2B7BA 4CEHA 2AL7A 2FN4A 1T9HA 2FU5C 4FCWA 3QPUA 4FMBB 4TMVA 1OB5A 3VKHA 1EXMA 4KSBA 4DDWA 3IIMA 1ZAKA 3GLIB 2OUKA 1E2JA 1FTSA 1H8EA 2B92A 4FXPA 1XZQA 3PVSA 4WXRA 3BB1A 1FP7A 1HQCA 1KI3A 2VP2A 2WPDA 3ZQ6A 4C9BA 1RZ3A 2GESA 1NF3A 2W6IA 2HXSA 1TQ4A 3K0AA 4UNNA 2H16A 3VR4A 5JI3E 3PUZA 3AVQA 4I81A 3V4RA 1L7VC 2A78A 1JAHA 3BOSA 3SJZA 1N5IA 1Z6XA 2QN6A 5CDFE 3CH4B 4LJ6A 3RABA 4RD0A 3IQXA 3ZYCA 4YLGA 3ZVMA 1E0SA 2IYQA 4QKQA 2RGNC 1IOZA 3EIQA 1KI4A 3B1WA 1EFTA 4LYHA 5IT5A 3CNOA 3K8YA 4B34A 4L5BA 4D4KA 5EE1A 2NPFA 1DTSA 2ZRAA 2CLCX 1K6MA 3T35A 1OFHA 3TK1A 1TUEA 3LNCA 3NH9A 1CULC 2Z5FA 3PFIA 4Q48A 4LY6A 1XPUA 1EFCA 3SBEA 3W8RA 1Q0UA 2JLYA 2AN9A 4F4JA 3I5YA 2NO6A 4XVRA 3HU1A 1S9HA 2KJQA 4V0OA 2ZEJA 5L3QA 4C0LA 3ICEA 1JPJA 5CB6A 1J99A 3IDQA 1E2QA 4GOXA 2XXAA 2ZPTX 5AJYA 2OLJA 2V7QD 2YYZA 2OCPA 4NCHA 4C0QC 2RB4A 2J0QA 3DZDA 3GMTA 3B85A 4FD2A 3Q9LA 3X1WA 5H8WA 3L0OA 4BLSA 1XFAA 2J9RA 3K0CC 4C0JA 2PZEA 3RDPA 2ANCA 3LBHA 1U9IC 1ZU4A 1GP2A 1U0HC 1YZUA 2ODEA 4DLUA 4KFTA 4M1WA 1OH7A 1HE8B 2F9MA 5SZJA 4EAQA 5EUQB 2A30A 5AR1A 5AJWA 4WOPA 4CRWB 4CEJB 4TYWA 3BFVA 1HV8A 1K5DA 3FKQA 4JKYA 3EPKA 3I5XA 5FOSA 1XJCA 4OI4A 3PEUA 4Q47A 3HR7A 3KFXA 2JJ8A 4GOKA 3C8UA 1KK2A 1N6LA 3R8CA 1WXQA 2J0VA 3IQWA 3NHAA 4NYMR 2Z43A 2XOKA 3MWYW 3C5HA 5FL3A 1Q1BA 3BC1A 1E9DA 1N6HA 3KB1A 3KKMA 3MMPA 4D2IA 2BMEA 3PENA 3B60A 4RKEA 2V54A 1P3JA 3OAAA 4I1SA 4HEJA 4TYNA 3CRVA 1AS3A 1R0YA 2D06A 4HB4A 4UNSA 3U4QB 2MMGA 3AUYA 1E9RA 4B73A 1CEEA 2YOHA 4DJTA 4B3BA 4URWR 2EVWX 4OI1A 4D4JA 4PZYA 4EIWA 1R0ZA 2ZE8A 1SVOA 1VCMA 3FB4A 4QBGB 1XCMA 1XMIA 1F2TA 3CB4A 4IDOA 4JLKA 1NRJB 4IEEA 1FNNA 2C95A 5FTLA 3Q7QA 4GZMA 1FTNA 5DLQC 4G5OA 3EZ7A 4DXAA 1F2TB 4BPBA 3SEAA 1OXSC 2ODWA 3QXCA 3ZIAD 5DO9A 2ZI4A 1DADA 5JWRA 3LH5A 2H18A 4G5RA 2JJ1D 2H17A 1XD2B 2VP4A 2WHXA 1K5GA 2TMKA 1G8GA 2QP4A 2VSXA 3LV8A 2OFOA 3NVAA 3OE7D 2ZVQX 4M1YA 3BH0A 2O8EA 3U44B 4GMDA 2DWOA 4M0LA 3CX6A 1R0WA 3K0AB 2ZSBA 3QKTA 1E9AA 3NEJA 3JZMA 1P7CA 1Z2CA 3EC2A 1AGRA 5ELXA 2XAUA 2RCNA 3TW4A 4A82A 4L8GA 1E2LA 2QY9A 1JXOA 1R10A 5EP1A 1KNQA 4I1VA 3OEHD 2G83A 1G4UR 3N2EA 1KI1A 4TYQA 3B6EA 3NBFA 3D8BA 3CWQA 1FNMA 1R5OA 3VX4A 2LCFA 4C2UA 5DI3A 2GXAA 1Z83A 2F3RA 2JA1A 1KK0A 3AEZA 1NMXA 2REBA 1SXJD 1TUIA 5AUNB 2OCBA 2UKDA 1W4AA 4GSYA 4LJ7A 4ZIRA 2W00A 4O0MA 1ZU5A 3TUIC 4DRZA 3IGFA 5JEEA 2GVZC 4NCKA 4P4SB 2FFAA 4IKEA 2GK7A 1SULA 2WMOB 4Q5IA 1HH4A 4PHHA 1M7BA 2AHOA 3QNUA 3KTAB 1F48A 4LPSA 3MCAA 4P4SA 4Z51A 1R7RA 2H7VA 2CE7A 4XTRA 4Q1EA 2NPIA 3HR8A 2PLRA 4M2LA 3EX7C 4ON9A 1TQ6A 3NBYC 4Q1CA 4V0NA 2G0NA 2PBRA 1OIVA 3LBIA 3IO5A 4TSFA 2GWHA 4BEBA 4NPHA 4CYMA 4EQ6B 3R9XA 2O8DA 1UF9A 3F3YA 2Z4SA 1KK1A 2JLXA 4ESVA 1KJZA 1UKEA 2QGZA 1KO1A 2GXUA 4PSKA 3QKRB 4MDEA 4XVUA 2HXYA 2VHJA 3VU9B 1NN3A 1U8YA 2V4ZA 2C9YA 4LBWA 5IRCD 4AD8A 1W4CA 5BW8A 5EJEA 3SHWA 5E7JA 5KUTA 2ZYVX 1BH2A 4MH0R 3CO5A 3K1JA 1SVSA 4JLMA 3QF4B 4RSGA 1M8PA 1G7SA 2PT7A 2WWXA 2QMEA 4K8OA 2GAOA 3TMKA 5EP2A 3E2IA 3IBYA 1P9NA 1SVKA 3VTKA 2XITA 3TE6A 1YR9A 3EZ9A 3KXKA 4X8HA 3TSZA 1HE1C 5JSZB 2GJSA 5BQ5A 2NG1A 2EFHB 3WHLA 121PA 2N46A 3ASZA 2EFCB 2W83A 3K09C 2ZE6A 3AVYA 3EASA 4KHZA 2C8VA 4QOSA 3K53A 2EU8A 2FNAA 3KKQA 4DUGA 1KI6A 1EESA 4MGZR 4Q4HB 1PUJA 1W4BA 4GI7A 1S3GA 3AVVA 2GRJA 1JJ7A 1ZD1A 3GJ4A 3Q7PA 1G8HA 1EFRA 1OE0A 2AK3A 4YMTA 3L82B 3N2IA 1CF4A 2XB4A 2E9SA 2ZE7A 2RGBA 1T3LA 4BFYA 3MSXA 3QUSA 1S8FA 1S9DA 5UKDA 4HB2A 1HT1E 2QENA 1TADA 2IL1A 3GLIE 1TF5A 1JR3A 5DN6D 1TF7A 2AKAB 2D7CA 1XCGB 1KYIA 5KO2A 3U3JA 4OQLA 2R9VA 3I62A 2JASA 1GFIA 4JLNA 1TAGA 1U2RA 2ZROA 3QXHA 1JAIA 3ECCA 1XXHA 1ZP6A 5FR2A 1ZC3A 2VA8A 1NY6A 1R6BX 2J87A 2ZJBA 3FFAA 4D0LB 2FFQA 4JKIA 4UNQA 1XD9A 1U98A 2UVQA 1P61B 2X77A 3GJXC 3R7WB 3LAWA 1VCOA 2CE2X 1Q3HA 5E95A 1QZXA 1WMSA 4ZKEA 3W6OA 1D5CA 3LVRE 1VCIA 5J4HA 1Q20A 4HZIA 5A5GA 4CEHB 2IBMA 1UDXA 1NKSA 4CEJA 3QI2A 3ADCA 1DVRA 1W48A 1V5WA 5C1BA 5KNBA 3FKSD 5G40A 1L8QA 2BMJA 3TBKA 6Q21A 4U7DA 2CJWB 2ZRJA 1YZNA 4JYCA 4JL5A 1CJUC 3SJAA 4DLYA 1GG2A 4V0ME 3MJHA 1U9IA 4M9SA 3U6KA 2O8CB 3HDTA 1Q21A 3EPHA 1UBGA 4JJKA 3EAQA 1X6VA 1XX6A 5TARA 1DAEA 1ELOA 4MITA 4Q03A 3CPHA 1BO6A 3EPLA 5KDLA 4XWKA 5FTKA 3CRQA 5JCPA 5KNCA 3V9PA 1MOZA 3M6AA 4LV5B 1IM2A 2Q21A 5FPTA 3ZVLA 3U3RA 3QPWA 4NH0A 4IOKA 1AIPA 1G16A 4FMCB 2BWJA 4F92B 2LWIA 5KHOC 1CR0A 2IYXA 2HF8A 1NI3A 2ZJZA 2Z0MA 4DSNA 1AZSC 2OESA 4WVFA 4JVNA 5KOYA 4ARZA 1RPZA 3LXRA 2OXCA 2A5FA 2CVFA 3OHMA 4HLUA 1E2IA 1GNPA 5EP3A 4Q00A 3RSLA 3SYNA 1NJGA 3HPQA 3IIJA 4DIDA 3FHTA 2QTFA 1TU3A 3QG1A 3REFA 1ZM2A 4C0SA 2J59A 2C5LA 1ETUA 2QAGB 4Z8XA 2P6UA 4ARZB 2CNWA 2FZ4A 3GEHA 4EPRA 2VO1A 1P5ZB 1FFHA 1QHIA 5LBIA 4BZPA 2NZJA 1XJQA 1NL3A 2WPDD 4C0HA 5LPNA 4DZZA 4QM6A 1IJFA 4A8JA 3IEVA 2W6ID 2XTMA 4DLVA 4DSUA 1YZGA 1I4DD 2G3YA 3MD0A 2QRNA 2Q6TA 2XNDA 5EE3A 2CHQA 2G9NA 1LFDB 2OFWA 5H68A 5EE5B 2VSFA 2ZSAA 4KODA 2WAXA 2J7KA 3AKCA 2BDTA 4NCIA 1TTTA 1DO0A 3PUYA 4P31A 4Q9KA 3W6PA 4KLNA 5C4GB 8OHMA 5FUWA 3R20A 4P32A 2G6BA 3IBGA 4Z1MD 1I2DA 2HCBA 4G5GA 3S1AA 2V8OA 2CJWA 2IX3A 2WKRA 2QMOA 5BN4A 3RS7A 3FE2A 3D31A 3EG5A 3T5DA 3Q5EA 4OI0A 2NO7A 3KQUA 4JT4A 1W7AA 3SQXA 2WMNB 3AVOA 1J2JA 4GNKA 4RKFA 521PA 1E0JA 3TSOA 2RGEA 3CF6R 5BYJA 1M7HA 4POAA 1IAQA 4KSCA 1OXTA 5HZKA 3R7WA 1KIMA 1E1RA 4NYIR 1OT3A 4TLAA 3B82A 1KK3A 1L2TA 1D2MA 2QZ4A 3WYFA 1HT2E 4KV9A 3RWOA 3BRWD 1MRSA 1O3YA
chains in the Genus database with same CATH superfamily
2JLVA 3WGTA 5AW6A 2JL1A 2AVNA 4RS3A 2CEAA 1O9BA 1Z26A 1EVJA 4CEIB 1B8NA 4FMCF 5TE9A 4G1FA 2WG1A 1W4ZA 3F9RA 3USCS 4K9QA 1RKUA 3P26A 4BWVA 4P2BA 1CCWA 4K0RA 4HLUC 4NMLA 4F4CA 1L7MA 1WETA 3DULA 5CX1A 5LZ8A 1QUFA 5JI2E 4YRAA 5A3QA 3OIUA 5K20A 1EQ2A 3BQNB 4GDMA 3P2JA 3UOGA 3DAGA 3PYMA 3A6ZA 3HO1A 2JHPA 4NAHA 1YE5A 1KVSA 5FUYA 4OK5A 3AF5A 2ZM5A 5IH7A 1NW3A 4UM9B 1V0JA 1SXHA 2TECE 3TWOA 2RGNA 5BSHA 2BUAA 1V7CA 4BFCA 1CUWA 3UENA 4WK6A 1QR2A 4KQ9A 2WF7A 1FL9A 2W6OA 2J7PA 1WRBA 5L7TA 3UW1A 3P9XA 5C3MA 3E7FA 4Y2QA 1YR3A 2Q6IA 1PHPA 3AR9A 4TKVB 1ZS9A 4EA6A 1UMCB 5A3VA 4DIFA 1IDN1 1SVNA 3KZ1E 2WFLB 4IY1A 4ZKDA 3IAHA 2PANA 1VMEA 4MQBA 3I9V6 4B76A 4MRRA 4ARAA 1BRTA 2Q1UA 3DJFA 1SURA 3I2IA 5CX1B 4CDMA 5BN3B 1J7JA 1FW8A 2IOHA 2OQ2A 4NNOA 3ZWXA 1W73A 3QFRA 1HE4A 1Z2OX 4X7PA 4B4VA 3OPYA 4IYJA 3KWLA 4B2PA 2N1MA 4A6EA 1OB2A 3A36A 3NCTA 2D1TA 4RESA 2NVBA 3COVA 1KZYC 1NONA 2OMKA 4KQKA 2BC9A 4HAIA 4O2AA 2PUCA 5F1PA 5C37A 1BQ3A 4FGWA 2PL5A 2WICA 1ZW6A 2B5VA 3GLRA 4BASA 4KXFB 4UMFA 1OSNA 2AMVA 2C5AA 2PV0A 4LY0A 1R5BA 3FROA 5AD1A 4NJMB 3B6JA 2DU8A 2QPLA 3EXHC 1AY0A 3QKRA 1RMTA 1UXKA 3R5XA 3B9RA 4IGAA 4KPUB 4Y9SA 4TMWA 3FNBA 1G55A 3H2ZA 4L08A 5IUKC 4XGIA 1E7YA 1AG9A 2HO5A 2Z2YA 4JJ4A 4X45A 1U3FA 4P7KA 1Z6QA 1KSFX 2Z83A 4MIEA 3JWHA 4YCLA 1FQJA 2AUMA 4CT4B 5A0FA 4Z86A 3CLKA 3ORSA 3RCBA 3U1BA 3HKDA 4P98A 5JNVA 4KI7A 2A57A 4L9WA 5ESWA 1Z28A 3A1UA 3OSUA 3U5TA 2O8BB 1PL7A 5KVVA 4HUQB 1HQKA 3WLIA 5KJEA 3U4DA 3I1FA 5FLXA 2CXOA 1P2UA 2IKSA 5I48A 1PL6A 1BC5A 2MJLA 3OZVA 2ROQA 1ZIYA 1Y42X 5FNVB 1AN9A 1NJ2A 3HN2A 2IHTA 5C51B 2DTXA 1AZWA 1FS4A 1KEUA 3B9PA 1EK5A 1M2VA 1CQXA 2XMZA 5FO0A 5JO9A 3K8OE 3QG5A 1NAIA 2FWIA 3CRNA 3WWDA 3NH6A 3WLNA 4TLDA 5B5SA 3CIOA 3TTSA 1J90A 1QH0A 1DEXA 3DCYA 3EBOA 3NPMA 4B4WA 4B3MB 2PWPA 1ESNA 1ML4A 2BFEB 3AJ9A 3M0EA 5CGQB 4HLDA 2BTEA 1BJKA 4ZD6A 5I7VA 1ZESA 2VYVA 1CR2A 3O47A 2YMQA 5TT1A 1N2EA 4JBNA 1WCIA 2BBWA 4II3A 5J5CA 4RCYA 4BL5A 5FQNA 4IZHA 3EZLA 4JEHA 4BXOB 4RXTA 3K6KA 1Y63A 1Z6YA 5EJ6A 3TYXA 1O6FA 1IWPB 3JASA 4AG6A 1JJAA 1QIMA 3IEIA 1BWPA 3IDSA 4IIEA 4KL8S 2HA3A 1Z2AA 4G36A 5E9JA 2C42A 2OORA 3FY4A 1YZQA 5L4SA 1VJGA 2KS6A 3PD1A 3X1ZA 4BNLA 4DJAA 2C3OA 5FFMA 3REGA 1U0SY 1I51A 4ER0A 1V5GA 4IWYA 4MS4A 5E7QA 5FFFA 2WVHA 2C1ZA 2JW5A 2QZ9A 1UKZA 1YUBA 3AXTA 2J33A 2BSAA 2ZJAA 1MZVA 2O8CA 5MN5A 3F5DA 1FP2A 1JU3A 3AHJA 5DI9A 1JJVA 1JIQA 1A5ZA 1VMAA 1FP6A 2PCLA 4EHAA 3OTHA 4L1KA 3JQFA 4TSFD 4B48A 5AVWA 5M5BA 1OAKA 1ORDA 1P4JA 1Z2NX 3CLRD 3D0KA 1SVWA 1E1CA 3AMVA 4O63O 4MW2A 2QQ0A 1B23P 1ISRA 1IL0A 3GEDA 4KNWA 4PRKA 4K9KA 2IPOA 4DOMA 1M66A 2JARA 5HZGA 3EDMA 3UWPA 5A3JA 1ZQ9A 2VTDA 4FYKA 3IQDB 2HSJA 3JQRA 3MRVA 4CMEA 3I32A 4LGYA 5FBWB 3D8SA 3P0HA 4P7JA 1CERA 1PQUA 2GAAA 1Q12A 2EFGA 2M1ZA 1O58A 2QUJA 3LKDA 4MGHA 4Y7DA 4BOYA 1VPWA 3TIGA 3E7XA 2G1KA 4GM0A 2P65A 3FSEA 3S2UA 3TLMA 4YMHA 1Q0ZA 3QMWA 2AOXA 5HCUA 4GZ5A 4BECA 4C30A 2VL7A 3O2QB 4IJUA 1O96A 4Y6QA 2AGVA 1F1BA 1DAKA 1K66A 1BVHA 1CKEA 3DDZX 3AXSA 1NVDA 1H93A 2C3YA 1IXRC 1AO0A 1N1EA 3SR0A 1Y34E 2VQ6A 1D5WA 1OLXA 2G4VA 2O7VA 3T9BA 1C9MA 3I2HA 3L4BC 1FRQA 3UICA 2PUBA 2GTPA 5K0NA 4AMYA 2OQIA 4WH0A 1TCVA 3NEYA 2CSUA 3LM8A 2XRZA 1BW9B 1N9GB 2DPLA 1ZCJA 3IBCA 3L7BA 3PHGA 4LCBA 4N54A 1CB0A 1U9JA 2DPGA 3MGGA 3TL3A 3V32A 3ESCA 3H5OA 1YDWA 3MZ0A 2IRWA 5ICFA 2NZ2A 4QRIA 3FSJX 2W2KA 4BNJA 2G09A 1XEXB 2OWDA 4Z4IA 4JLVA 1N3BA 3R8XA 2ZSDA 2CK3A 3VSCA 1FFSA 4EG4A 3AOEA 3LDHA 4N5IX 4KFRA 4KR9A 3K4QA 3F2IA 1VA5A 3IXMA 4IOJA 3Q3VA 3CCCA 3TGLA 1GSHA 1H0RA 3W5VA 4GIBA 3JQ6A 4XE5A 2NUTB 2OPHA 1XXHB 3MWDA 5BSGA 3VC7A 4BWFB 4BWGA 3DOCA 3SF8A 3FCEA 3EXIA 1GG9A 3DXFA 4MRPA 5IKPA 1E6KA 3FF1A 1XCJA 1YE3A 2F17A 3FWZA 1NDUA 4IX9A 2D7DA 1MUUA 3BICA 3PNVA 1SBQA 1XQWA 4HS4A 4MLPA 1EFPA 4D5EA 4DS3A 4DGSA 1FW6A 2YHUA 3VOSA 1SBHA 3AG6A 3ILSA 2ON6A 3P97A 1ZVQA 3TRDA 2PUEA 4Y67A 3SKVA 4LXIA 1X8LA 2GZDA 2W4QA 1IY0A 4EGCB 2XZOA 1D2AA 3HUTA 1RWBA 1T43A 3AHEA 3CLSC 3IURA 3OSZA 4RZ2A 3GJ7A 3T34A 4F6CA 1WULS 2NSJA 4ZRDA 4QO8A 3N2NA 1GZ3A 3R5JA 5FAXA 4ZDIA 1F2UB 4U02A 5INTA 5K8LA 4EKYA 5JG7A 4EM6A 2WTEA 1E9EA 1YJBA 2XQGA 3THXB 2AWNA 4NF2A 2XE7A 3D1LA 1ZNWA 1K9SA 3WISA 4A8PA 4US2R 4XSHA 4Y2HA 4UUBA 1SBIA 1GWNA 4RVSA 1A69A 1UJNA 3ZS9A 1QS0B 2YY7A 5FV7A 4MDFA 4G4GA 3IMCA 4HEA1 4UUMA 3S3TA 3P94A 4EKDA 5FTWA 4GX1A 1FIUA 2XEXA 3P9YA 1RSZA 5F7JA 5E1MA 2CUNA 3WAKA 2P11A 1PR5A 5F52A 4YR9A 1QGOA 1J70A 4ZT4A 2BYTA 1LQTA 4KXQA 1JN0A 3DWGA 4KAFA 4B9EA 3HYNA 3G5UA 4DQUA 2QRVA 2VNHA 1I5EA 3H0CA 5JXJA 4NCAA 1D3AA 4R3NA 2FSSA 1E9CA 2RBKA 2GO1A 3NANA 1SMKA 3IPXA 3KSMA 3P2IA 2Q7DA 4CG2A 5I47A 1NBOA 2XWQA 3PHHA 3KJXA 4RF5A 5D6OA 2O5EA 2I55A 1OXKB 2J1LA 5ALTA 2BFBB 2D00A 1TLFA 1XVVA 2DTDA 1OAOC 3HB4X 3NWJA 1E9SA 1SCAA 1UFKA 4RD6A 3FOBA 4IZ6A 1IWOA 1GUBA 4DHEA 1TEXA 2I71A 3SNKA 1FMLA 4D25A 1IY2A 2Q28A 3MCUA 4XM1A 4AQDA 2HOQA 4EHDA 3IAXA 2VJPA 3ESZA 3M9WA 4JITA 4IIJF 1M2OA 2HQRA 2P9EA 1Z6ZA 2H5LA 4PS0A 5B37A 5KBYA 1Y8ZA 2VC2B 1PHRA 2V98A 1VBKA 4JROA 3RTGA 3DXXA 4YJ3A 4EO7A 1VHJA 3GRZA 1ZKDA 4RSRA 4TVOA 4KAJA 2O2JA 4XCXA 3ZU3A 5CH8A 4DY4A 4ILEA 4AXBA 1KEEB 2FWMX 2BTOA 3IPCA 3LC0A 1E2GA 4V02A 4HDAA 1P77A 3K8ZA 3JAWB 4KRYA 2BOVA 1NLMA 4M1OA 2KB0A 3IAAA 4UZEA 5C2JB 3GGJA 1C50A 2WKPA 4YJDA 2VF4X 3WK4A 4JX8A 2HJVA 4R98A 3CZ9A 1V6SA 4YN3A 4EI9A 3H97A 2R68A 4NNPA 4B6FA 1PD0A 3A1DA 3NWOA 3OTOB 2HT1A 4KN6A 4DC0A 1FDSA 1LS1A 3NR2A 1WIWA 5TB5A 4DJEC 5BVHB 2HGSA 3E53A 4MI6A 4UQLA 2Q9AA 1UBMS 4Z3OA 5IJAA 2DGDA 3WFZA 2H52A 5FPYA 4EY6A 1GT91 2K2QB 1ZQ1A 4Y0VA 1J20A 4HEA6 4YPVA 2RHRA 3P27A 1KOFA 4P4TA 4UUQA 1XLTC 4L5AA 3B8HA 4ARBA 4J7AA 1O94D 3ZGLA 4JMLA 5FA6A 3SXUB 4EA7A 3K16A 1VHWA 5CT9A 1GUAA 2GZAA 1E2MA 3MTEA 1SZJG 2BMDA 2I7CA 4PFKA 3N1UA 2PKYX 3AIIA 3PT9A 3VUEA 4DM4A 4KR3A 1B6RA 2R6FA 1UOPA 2FN8A 1D1QA 4R8RA 3GJ5A 2EJTA 1R3DA 5C5CA 1GFWA 2WUWE 4FUTA 5EWJA 3VAAA 1NSYA 2YV5A 4WXPA 4EHNA 1K97A 1BHO1 1SBTA 2Z3VA 3CRMA 1GIAA 3FFBA 4HB3A 4YIHA 2A6PA 3HVRA 1LB1B 2DH5A 4FD3A 2FWPA 4AU1A 1SD5A 2G04A 2JKVA 2OENG 1QZTA 5JJKA 1SVIA 3PI6A 5FJIA 2J6IA 4YMLA 3E8XA 4IHJF 4L8WB 2YMMA 4MA4A 5CBPA 2JC3A 4IKPA 4GLLA 1X9HA 4PXAA 5DNDA 4DA8A 2PU7A 4E13A 3W6NA 1D4ZA 3B2EA 4H7EA 3MLEA 3U3MA 2A9RA 1M5TA 4CZ2A 5EINA 4B2YA 1CZHA 1JXMA 2OHIA 4I9UA 3UC5A 1TJ4A 2ZWPA 3II6X 3SQDA 1W5BA 3ESBA 3P1JA 1B0PA 4F6RA 1XEWX 4Z2YA 3WOVA 3HKBA 4TV8B 1YI8A 5ESRA 2Z30A 4S05A 3HBNA 3PA6A 3JQ8A 3GWGA 3U17A 1OFVA 3I58A 1PV1A 4UU8A 3WQHA 4ZALA 3DVQX 2NU6B 4P7FA 2ZIZA 3X2EA 5C8DA 3PKIA 3IRUA 2B4AA 3ZDDA 2WINI 3DAHA 3HU2A 3F49S 4COKA 5K3FA 4IDNA 1ZD2P 1J6UA 1CYDA 1SC6A 1R66A 4R7TA 5BQFA 2Z9BA 1TJ3A 2QAJA 3TTXA 2WYVA 2XWPA 5BWMA 1O96B 3KQWA 2IYAA 2PO7A 3KKPA 3W1EA 1YMUA 3BE6A 4BVHA 3LHIA 4GR4A 2AK2A 2QIOA 5B36A 3PNKA 3PGMA 1L5KA 3RUPA 3WQRA 4Q18A 1DP4A 1ZRSA 4AN1A 2GN2A 3S2SA 3TXYA 6ABPA 3A7DA 1ZI6A 1BVUA 2X0JA 3G0DA 2M6RA 3NO4A 1UK9A 4LDZA 3K2BA 4RQTA 2I7XA 5G1OA 1JSRA 3ZNNA 2G9VA 1OAAA 4FDVA 4F5DA 2NAPA 4ZICA 4L4ZA 1A5TA 2C4HA 5L3SA 3FZGA 4WOBA 4F12A 4EY4A 3AI7A 3KS9A 4M8LA 4RVHA 4D5GA 1RPTA 3OZFA 3A28A 2ZSKA 3JQBC 5K3OA 4V0KA 3LG2A 3KETA 4M87A 4EEZA 2PA3A 2FWRA 5KTKA 2FMHA 3GOHA 1N4DA 4U2KA 3EG9A 5CVJA 5D3MA 2WVJA 5BSKA 1EUQA 2WIDA 4M53A 4NECA 5CLQA 4JEUA 2AI2A 2DAPA 2O6LA 4OBXA 5TQJA 4DLBA 4F5YA 2ISSD 5IAOA 3ZJTA 1V4BA 5AI6A 1J9GA 4JR0A 2PL1A 4FCTA 5HQ3A 5JAZA 1WBDA 4FKZA 3BK2A 3L6UA 4QXOA 5ECDA 1KE1A 2WSSD 2EWWA 3BPSA 3Q0IA 3FRIA 1VLJA 3IUJA 1JTFA 4FYPA 4B5KA 1UBCA 3LKVA 4L4UA 3OPMA 4EPYA 3L4KA 3QELA 3ADKA 4Q3AA 3FYUA 5FI1B 3VJMA 5CA1F 1JT2A 4YRPA 4CT5A 3ZBPA 4TL8A 1QE0A 1VTKA 2B5OA 4RK4A 5C1DA 1XDUA 1MGPA 4P81A 3NT2A 1RYZA 1FB5A 1TU0A 2J3DA 1GZ4A 4XLTA 1EBUA 5KOJA 3K0FA 5JLJA 3N6XA 3O9VA 1HZZA 2EC5A 4GICA 4RO0A 2QXUA 4B7ZA 1P18A 3CX3A 1G8FA 3ER6A 3VJLA 4QNMA 5DX1A 4JI6B 1QONA 1OZAA 1PJ2A 5IG2A 1N2SA 1WO8A 1ZIXA 5REQB 4JI4B 1Y4DE 3UFBA 1QC5B 3HLTA 4E5MA 1OX4B 1RJEA 5JJBA 3Q40A 3T1OA 1V5EA 5FIUA 2EJVA 3T9AA 4BMSA 5DT2A 4DQVA 1ZOOA 2Q6OA 2VZ9A 2J3QA 2ZJ2A 1JSZA 3PUKA 1JNXX 1O95C 2Y1DA 2RGWA 2FVYA 2X9VA 3MMXA 4N7MA 4UQPA 5ADVA 4TRJA 3WL8A 1Y5LA 2J9ZB 1CX9B 4EUFA 1JIIA 1NNI1 7ABPA 1CUVA 3I5AA 4DIEA 5BPHA 3KUCA 2Q2QA 2QRJA 1GZSA 1NF9A 1U3CA 2P67A 2XWBF 4M0KA 4R9UC 3F98A 2BIFA 5LA6F 1AHNA 4PSDA 1E2DA 4M54A 1EB9A 3GG2A 2CXQA 4F04A 5BV2P 1Z0FA 2FDCA 4DANA 4C29A 1VKJA 4OFZA 3UEOA 4H4DA 3CPJB 5FBVB 1BKSB 1DT5A 1I13A 1W29A 2JJMA 3C6BA 4B3XA 1XF9A 3GJYA 4DG5A 2COKA 4PC1A 3ZHOA 3ZY4A 1QIDA 3NVDA 1Q7BA 1BGVA 5CB4F 3DE5X 2GBLA 4CKXA 2XNSA 2RAPA 1C4XA 2O4CA 3SDZA 2GF0A 3P2YA 5FXMA 3R5TA 5C1IA 4DLWA 2OSVA 4RENA 1GO2A 2H2HA 3JX9A 3LY7A 4RMHA 1M34B 3D4PA 1MJGA 3LZCA 1DIOB 3RV4A 1L5RA 1EH5A 5SY4A 2WW8A 4ALIA 3Q15C 2ZUDA 5FAKA 1PTJA 3FI0A 4C78A 1GL7A 4FLMA 3H3XA 1VDZA 3A26A 3H1FA 4UZSA 3O4HA 1T6YA 1X8KA 2WT4A 2ATXA 2BGIA 4FMDB 3D3EA 1Z0AA 3SSOA 1CZOA 1YMVA 2BD0A 2Q3CA 2BFOA 4KEAA 3QY0A 3UWKA 4AKEA 3OPNA 1TO1E 1WF3A 2ZI9A 1VB3A 1CS0B 1PG2A 1G5HA 3B78A 3O8DA 3J81k 3ABIA 2UZIR 1SAYA 4L6AA 1K88A 1QYRA 5DBHX 3QLEA 3JZFA 2YJZA 3RYHB 4BKMA 2BRUA 4Z9YA 4F3KA 1MX5A 4WN9A 1GN9A 5JECA 5BOSA 2B5WA 1QBGA 2Q1WA 3H1TA 1U0TA 4U5QA 5EEGA 4L5CA 2O2XA 3CMMA 1T8TA 5EESA 1E1RD 2QUIA 4MGYR 5F9FA 2R751 2J85A 1NLFA 1XA4A 2F3QA 1T3HA 1EZ1A 3CUEF 4I6JA 1AF7A 1I6LA 3BRWA 3F6BX 2Z5VA 2ZK7A 4RWEA 5DBOA 2FP4B 4W5JA 2IUSA 3DBLA 1JQAA 3QV1A 1AUPA 1G0OA 3COWA 3CW9A 4FP9A 4S3MA 4YAWA 1TJYA 4JJ7A 3D6MA 5EP4A 3VQTA 3DMGA 1QOZA 1K7CA 1XYYA 2ZANA 2XUGA 3WBKA 2UYHA 1VKRA 1YVUA 5JW6A 1VE5A 1FTGA 2NVWA 1IZ9A 3VMFA 2IYTA 2VK8A 1EWYA 3R7DA 1XOIA 2OILA 4PPNA 2XRFA 5D6NA 4Z4QA 2JI9A 1YQGA 3KQQA 1A82A 1JX6A 5K0FA 1WXHA 4H0CA 3FOZA 3A6FA 1N5LA 3KZVA 5BNIA 2V7EA 4BQSA 3HCWA 1QTNA 3MOGA 3WSTA 4CN9A 4X92A 4PLFA 5CA1B 2PMEA 4OHWA 3PR2B 1TO6A 5ED0A 1GPKA 3WI7A 3K70D 3Q8KA 1ZBQA 2VBGA 3OZEA 4Q01A 1QGYA 4BKOA 3HB9A 1RC8A 3K9LA 2E0IA 3WIDA 2WG0A 4PAQA 1AK9A 4U2FA 2P6MA 2Z2XA 1EP3B 1KFCB 5DEIA 1BIFA 5A5EA 1UJMA 4YMVA 2R8RA 4C5CA 1W0JA 1ZN2A 1USVA 4KO3S 2IKQA 1DJPA 3JD0A 1JDBC 2YDYA 1TM4E 5EEHA 1G8YA 2P30A 1NBMA 2I5PO 2XYQA 1NQXA 2Y93A 3CRRA 3EVEA 4H60A 5KPJA 4OXIA 4KNYA 1QAOA 4OHXA 4AO7A 3GZNA 1ONPA 1M83A 2NVUA 3OJWA 2ASEA 1PFQA 3PGLA 4AJ2A 4PPFA 1AKUA 5GADl 2UVPA 3A2LA 4V03A 3MUFA 4EHLA 3H5AA 1GY8A 3CLVA 1YU6A 2ZJOA 3CPSA 4MS4B 4R2MA 4UXHA 5AVXA 2XJ4A 5IBRA 1U9YA 3E9MA 3QFCA 1Z13A 2J6BA 2PSHA 4BAGA 4CFSA 2G71A 1CDDA 5KWVA 2CJPA 3LRPA 4BUJA 5C46F 3SHQA 1GCUA 1HYEA 1JHXA 1YE8A 2DR3A 3D6TB 2Y1EA 2Q5OA 3KB6A 1EXVA 3ZCSA 2NO0A 1RP7A 2OG2A 4YRBA 1EM8B 1KP9A 3FNRA 2CXHA 4JL8A 4CKCA 4RTOA 3ERCA 1MO6A 2D54A 4Z0PA 2WIKA 2RG7A 1IHUA 2H1SA 2B25A 2DTEA 1QHFA 4F60A 3UWOA 5BOVA 4F2DA 4BO6A 3KT0A 1QE5A 2HA4A 2H00A 2HZ7A 3NVKI 4LY3A 5EIWA 3WP0A 1QDLB 4OXQA 1P75A 1ATIA 4NOKA 1EWTA 1IIRA 2FSFA 2OGSA 4FX2A 4YMSA 4E3ZA 1P44A 4CTNA 2D5AA 3FPSA 3RE1A 4ZI2A 3I1YA 3JQ9A 4QDJA 1DBQA 4YB8A 5AKLA 5BVGA 1C7QA 1KNXA 5C1OA 4CIAA 5KSZA 2WJWA 2VJYA 1RI1A 3A37A 1KDOA 3BMNA 2K5UA 4H4EA 2AG8A 2ZYWX 4IGFA 4TRNA 3QKIA 5LZ5A 4F3YA 3H5RA 2N0SA 3U5ZB 2PUGA 2PD4A 4BNKA 2RAVA 3FUXA 2QZJA 1PR2A 2VDWA 2PJRA 4EG8A 1G5FA 1NP3A 2XIQA 3W2HA 2CCJA 4XX0A 4DQXA 1YA8A 5D84A 5J40A 3ZE9A 1IUKA 5AHOA 5J5VA 1DI0A 3TH5A 2BISA 3BS4A 3LUDA 4URUR 1TVCA 221PA 1SH7A 2RJ3A 4IBOA 1K98A 4HXFB 1JEEA 4O1IA 5EZ5A 4AWAA 3K0SA 2VBCA 4YT2A 4HTFB 4KP7A 4JI3B 2EDAA 2Y2VA 3NQ41 1KAGA 4N76A 4KDRA 3AQ4A 1A71A 3A7EA 1QMPA 3SSMA 1A97A 3EA5A 5KNDD 1Z8DA 2WV7A 3VKWA 1N3IA 1HQYE 4M6WA 2BEVB 1U8XX 4REMA 2FCRA 3U3DA 3VR5D 3SC6A 1QRAA 2X42A 2YYAA 3INRA 3Q8XB 1UJCA 4LYEA 2HJSA 2J3IA 1MQ8B 1R0RE 2BW0A 5H0IA 5BV8A 4JP5A 1XAIA 3SYRA 4BKQA 5REQA 1LDMA 3A04A 2F4VB 1F6DA 4HTFA 5TLSA 1LPSA 1RNLA 5K05A 1QTQA 4NX2A 2ZYDA 1GU1A 2VP0A 1E6MA 2GJ9A 4R1SA 1VJ5A 3B1XA 1MIOB 4L72A 2LV8A 3ZOZA 5CNJA 4AW9A 4KACA 3T9EA 3KWJA 2FJ0A 4CMHA 1RU3A 3L4SO 3QKSB 1XAGA 3KUUA 3E9EA 3H19A 4WTOA 5T4BA 5C81A 4GI2A 4JWKA 5TS3A 2QMQA 3Q5DA 1UK8A 2JD0A 2JFQA 2V8BA 3KXLA 4PINA 2VHYA 2AE2A 2QVCA 3ROEA 2YINC 4RSHA 1Z4IA 3WZ2A 2V97A 1YQTA 4HWSA 4NULA 5CAEB 2H63A 1X0VA 2O50A 2V7WA 3IMEA 3FVWA 3M3DA 3WGYA 3ZCQA 1Z39A 4F6LA 1GQQA 1VPEA 5J4VA 5EKSA 2EZTA 4LJSA 1UFOA 3IJRA 2OR3A 3IAS6 4HFMA 4LWQA 4AMGA 2F8TA 1YGYA 4LOKA 4MHSA 1UEJA 1SU7A 3EE6A 3HN7A 5G1NA 1PUIA 3SGLA 2NU6A 4UHBA 4MYHA 2G1UA 2J3KA 4Q7KA 1UMDB 3OZUA 3IEPA 1H69A 4KIJA 4LJ5A 1VBMA 4OX9B 1U3TA 4A0RA 3ESXA 4QGAA 1JQBA 3E9ZA 1KYWA 2O0MA 2P2ZA 1RBQA 3AI3A 4LSWA 1IMJA 2W2TA 1G5QA 4LHWA 1WSWA 1Z0ZA 2EW1A 4O4HB 4BKPA 1UPBA 3EC7A 1QAMA 1BJRE 3S27A 3TB4A 4XDGA 3ONVA 4NZOA 3MGBA 3ZWCA 1T29A 4DCNA 1AS2A 2OL4A 2C7VA 5CBKA 3AF4A 3FCCA 1A4XA 1X13A 1I80A 3X3HA 4BVKA 1JDNA 2EZUA 3L49A 4NSNA 2YJ3A 2WNHA 4CU2A 2C31A 4BNTA 3R8FA 2C97A 3IE2A 1DO8A 3IKJA 4BNHA 2AVDA 2OZEA 5KX5A 1F8UA 3TFQA 3AF0A 1U5AA 3QU4A 3QVJA 4MPRA 4U39A 3TIIA 5I5EA 2Y1FA 2PYDA 1MB4A 2DKFA 2CMFA 3C41J 2W2KB 4L0QA 1PR1A 3CTMA 5EHGA 4PC2A 4LDRA 3I30X 4QQ8A 3DKKA 2WYWA 3JY6A 1EG2A 3CUSA 3MUNA 4FU0A 1JYSA 4PFSA 4JT8A 2D2XA 5JRZA 3FG9A 4HVTA 5AQ1A 5EIFA 3EFOB 2FJUA 3E22A 3X1KA 4XD2A 3CN7A 5CURA 1CY4A 3UCFA 1GOTA 4WECA 5KTRA 4LHXA 1C1XA 5DCYA 5ECGC 3ZGXA 2HGZA 3W3AA 2GH1A 1T1RA 1NVEA 1C1YA 4V24A 1NE2A 4ZVLA 3E5RA 1NFFA 5F2KA 1T8SA 3BGOS 1K5HA 2AEFA 4INJA 2AIRA 1U2PA 5ALFA 2CLSA 1XPOA 4QFCA 4BX3A 3EPPA 3NGLA 3UKDA 1PSZA 1JDZA 3ZHRA 4M9XA 3GAMA 1G4AE 5I7AA 3T6KA 1C4OA 3S68A 2DBYA 4E5SA 1TYBE 4X94A 2HQSA 1OVGA 1K8YB 2GMWA 2H8GA 3OTQA 4NFSA 3HPRA 4NI5A 4J0QA 3ZV7A 5EXSA 1P80A 5B1SA 2ZYSA 4WUTA 2B30A 2XGOA 4H7FA 2LW7A 4J0EA 1ONNA 4LBYA 3DMDA 1XEWY 3PITA 1FLNA 3QVOA 4LF9B 5HIMA 4FZVA 3VR2A 2P3LA 4ZCPA 2EZ8A 3N9IA 3UQZA 4CKEB 1RI5A 4FWTA 1ZL0A 2O5VA 3B48A 4TWAA 3T7JA 2XUFA 1L5HA 6CHYA 3ELWA 1XTTA 4ACBA 621PA 5FHRA 5JR3A 1XCBA 2ZJ3A 3KU1A 4MTCA 3TI7A 1Q0QA 3V46A 3ET5A 2VI5A 1Z16A 5E0KB 4AJLA 4JYZA 3BWXA 3BCSA 3IP5A 3JS5A 4I9FA 3B1JA 4HB0A 2FPPA 4AZ3B 2JJ2A 1YHYA 3F71A 4OHMA 2VNJA 1JHQA 1QIGA 5I7RA 1BXGB 1Y3BE 4QT4A 2AEMA 2PZBA 3LQRA 4DHWA 1CJBA 1D2NA 1YFZA 5BMOA 3QXJA 3JAWA 3TF5A 1ZUHA 4EQ6A 1JZSA 2VF2A 5L3RA 1GXSA 1P1FA 5C7YA 3EW7A 2ECPA 4U2GA 2C7RA 3DTVD 1J1UA 1YXMA 3I9V1 3T1VA 5I8WA 3T3NA 1YQQA 2YWDA 4PCVA 4MI9A 3R6TA 3M3HA 5B58C 3HV2A 1KZHA 3KXPA 3KSAC 5ALXA 4NK5A 3C3BA 1P45A 3RANA 5LCXA 4Y8VA 2YR0A 2UZ0A 3PFNA 4FK8A 3LBYA 4HZUB 4RK1A 4TTRA 4BVJA 3A0RB 2ZT6A 2BHRA 3AY3A 4ZDKA 3OIYA 1V8BA 4FOTA 4MYUA 1BCSA 4XD7A 2JIMA 5IWCA 1NC1A 4KUGA 5GQSA 4RV4A 4TLBA 4BQQA 1FX1A 1CIJA 2EL7A 5LQUA 1GQ2A 2FSIA 5AJZA 4HYEA 1ZAYA 3DOHA 1P33A 2YHIA 5JRJA 1A2BA 1M8FA 1NX9A 3HB7A 4I46A 4XUEA 5THQA 4BN5A 1KJYA 1SC9A 4PC3A 1C7ZA 1JMVA 2JIZA 4GLFA 1DTWB 4HN4B 1ISPA 4X91A 3ITKA 4Z4FA 2NO1A 3SAJA 4R8LA 5EGNA 2ZETA 4A0SA 5IF9A 3D4IA 4AIIA 4EKEA 2ZZNA 3PE3A 1BA2A 1WZ2A 2DF8A 4G07A 4MRAA 1HFEL 3TVDA 1RJ9B 1O97D 1DARA 3H1GA 5MDHA 3WJAA 3GAFA 1DKPA 1M8JA 5IKEA 1MGOA 5U4QA 3E23A 4EKNB 2GRUA 4IIHA 3URMA 5KYKA 2G7MC 5LNK1 5LYJA 4C0AC 4J7UA 3AUAA 5HS6A 1BFDA 1F4VA 3EMBA 4KIGA 2F43B 1O89A 3HA7A 3GZTB 4LGCA 1JH8A 4Q4LA 5F2OA 1W4RA 5FBQB 1N33B 2BJWA 1K6JA 5DIZA 3AIOA 3L0PA 5TJ9A 3VVCA 4B0OA 3T5PA 4AQ7A 3IQIX 3FN4A 5M3BA 2JDID 4E12A 1T1GA 1W36B 2IUFA 1ZI9A 3OPYI 4C03A 4RADA 1TZ2A 2PGNA 4IF4A 3HKBB 3EODA 3O1IC 3WBJA 4TZ0A 3T54A 1AUOA 5BYAA 4QWWA 4QBHA 2NU8A 2HYIC 5JS2A 4MUIA 2X3UA 3ZXUB 1E5DA 2YJ6A 5FPKA 1BKYA 3PX7A 3A1NA 3IAM1 2A94A 2BSXA 3K35A 2DBZA 5JYBA 1Y98A 2HU7A 3K9HA 4RVNA 4F1WA 2IPLA 2P6NA 1HYGA 3UMMA 3NLLA 1X7WB 3G5TA 3L9WA 1M8GA 4B6GA 3ZLTA 1J42A 3JQAA 5CVDA 1D7OA 1NP7A 1QQ5A 4E30A 4A2WA 4U6SA 4Q9IA 4G5HA 4Y9TA 4ZJUA 1LI7A 4MVCA 4MI1A 3TL2A 4Q7EA 5H82A 2QVBA 4D0NA 1GPJA 3BF7A 3BIJA 1JKXA 4OCZA 5BR1A 2VAXA 1IUNA 3GDOA 2WRZA 4B6RA 3HCPA 4FZ3A 5AKGA 3R3VA 1NHGA 4HPWA 4QTXA 9LDBA 1TCCA 2QD5A 3CWCA 4N7RA 1MJ5A 4K8RB 3RROA 2JLRA 4O4LA 2C84A 3BREA 1OXXK 3K4HA 2XE6A 1WAMA 4QPDA 1N9GA 4W4TA 2DBVO 3M1YA 2VUUA 2JKZA 4TN5A 1LVGA 1L4UA 2OZKA 4UUNA 4WV3A 3U31A 4ANFA 5I7OA 2FXVA 1G17A 4IIVA 2YV2A 3HUUA 1L3IA 1E2EA 1TZJA 3GFVA 1XDZA 3BUSA 4O4IA 4QHTA 4Y1GA 4ZOLA 2I2AA 4FZ5A 4NFYA 5ALGA 4PG5A 3FBTA 2XUPA 5HDBB 3ZKWB 1JR2A 3OEED 2GM3A 5I9LA 5IJZA 3F2VA 3BFJA 5H1YA 3NATA 3ME5A 5AFSA 4WT7A 1E94E 4EW6A 3N2KB 4YQYA 1B0ZA 5JQGF 1R8JA 4I4TF 2ZS8A 4PBSA 1NI5A 2D3TA 1M1ZA 4MUKA 3WB9A 4RD2A 3WLTA 1JZQA 1JECA 1N25A 1W5SA 1NW5A 4J4BA 1EX6A 3EFHA 4OAQA 1NKVA 4NZMA 1J8MF 3A1TA 2ZRLA 1KY5A 2FX3A 3MWLA 4RPKA 2O54A 5TQ0B 2X0EA 4HDRB 4JLPA 3LFUA 2RGDA 3OWHA 4P36A 5KAPA 4BFVA 5TMPA 1H3EA 3W5AA 3G6KA 3R0ZA 3CH6A 2ZS7A 1N7GA 3DDUA 3SY8A 3FLEA 3OETA 4Q4JB 1YS7A 1RAAA 2BMFA 2P78A 3GAZA 1ESMA 3KEGA 4ZOEA 4OHZA 1DHRA 4HJRA 3LXUX 4DQLA 2O2EA 1FXWF 1U5BB 3KHSA 3TR5A 2I67A 4KXYA 4EHJA 4BXOA 1ZK0A 2P1ZA 4HSEA 3ZHCA 4D82A 3HXMA 3EC1A 3WA6A 5FO1A 1ZINA 3LT1A 4MP3A 1BU5A 1OIXA 4DA0A 4RVCA 2AOVA 1KFJB 3CZ4A 4LYJA 4R1UA 1Z8NA 2A0UA 2SCUA 3NDPA 4FYXA 4XDHA 5CM8B 3WMXA 2MYNA 3O7WA 1OQAA 4GRDA 3V1MA 4CIYA 3MF4A 2JD2A 3ASYA 1CBUA 1E99A 3DP7A 4TM7A 1VL5A 2O14A 1SC1A 1SD1A 2OORC 4BO5A 3EGOA 5FL7A 5KYUA 3CLRC 3R40A 4Z4HA 4EW3A 2GAIA 3GLTA 4X1KA 3OZXA 5A02A 2EKQA 5HS4A 4C7OA 2JHCA 4LI3X 4AP9A 4C14A 3G88A 1X39A 2CFTA 3QVUA 4GX2A 3WFIA 5JCOA 3CXUA 5HE9A 1JA9A 2G5TA 3W9SA 5J1SB 4PHGA 5EIAA 1TZBA 2V9PA 3KPVA 4U7GA 1XTIA 5TT0A 5J4LA 5LMCA 4K40A 2N47A 5KNDH 1H8HD 1R9NA 2OBMA 4XJSA 3RUDA 4B3FX 5JC1A 3JD2A 1P39A 3HCCA 5HCNA 1IN7A 3B2QA 2FSVA 1XQYA 1ZOSA 3A27A 3LPNA 4TTVA 4YRCA 1AKEA 4PC7A 4D46A 4L9SA 1WDTA 3A1WA 4QYSA 2IYVA 2GJ4A 3COYA 4MWEA 1YQWA 1SIOA 1XLUA 3IPAA 4GR9A 4RZ3A 1GZHB 1DUVG 3OZWA 3U56A 3K9NA 1R6XA 1WV0A 2PL9A 3HJFA 2FUNB 3VNBA 4PAOA 1FFXA 2ODAA 4CM3A 3S99A 4ZTUB 4MYSA 4QFMA 5DLDA 4IJ5A 4O8ZA 3RUAA 1KJNA 3NHFA 1Z6AA 3HE3A 4NBUA 4CPDA 3NUGA 5JO0A 2IY8A 2WHRA 3QXSA 5IASA 2BM8A 5EJFA 3RJTA 5IFKA 3RAEC 3AVTA 3KAJA 5DGHA 1P72A 3T95A 1O03A 3U4HA 1PLJA 5CDGA 2XVAA 5CDUA 5E6RA 4KI0A 1GXSB 5JZVA 1H2AS 1QHHB 2WU4A 1JG3A 4AJNA 1L7OA 3JYQA 2RGUA 2NU7A 3GV0A 4BEWA 1WV1A 5CEJA 5HOEA 5K3AA 3GQBB 3U7QA 3V3TA 2GDZA 1RM3A