4PHGA

Crystal structure of ypt7 covalently modified with gtp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
176
structure length
176
Chain Sequence
KNILKVIILGDSGVGKTSLMHRYVNDKYSCQYIATIGADFLTKEVTVDGDKVATMQVWDTAGLERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein YPT7
publication title Locking GTPases covalently in their functional states.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis,exocytosis
total genus 52
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phgA00
4LOAA 3U6KA 4QGHA 1P3JA 3Q85A 4E5UA 1VTKA 3RRNA 4URUR 1U8AA 4L9WA 4A36A 2QP4A 1E0SA 2WWIA 4CGZA 3U7HB 1T5IA 2WKPA 1M6NA 3K09C 1XJ0A 3MSXA 4TQUS 2NPFA 2Z6VA 4WIAA 3H4MA 3LW8A 1RIFA 1ZM4A 1Q21A 2B8TA 5JEEA 1RPZA 1WBDA 3MMPA 2H92A 2LKCA 4HB4A 4R98A 4EPRA 4JKIA 3I5YA 2P5SA 1CTQA 1FTNA 4JBYA 5B58C 3K70B 1LF5A 3N70A 4RFSB 2IUUA 3QPWA 2RGGA 5C18A 1AKYA 2VHTA 1E0AA 2H18A 2FWRA 5JJKA 1NBMA 3KQHA 2ZJ8A 5HZHA 3Q5DA 1MO4A 1E79D 3QQ5A 2QEQA 4V0ME 2QPTA 4AG6A 2P2LA 1U8ZA 2FOLA 3REFA 5JEDA 5CLLA 5JI2E 1U0JA 2O8DA 3L43A 2FMXA 2F3RA 2QN6A 1QG2A 4RD1A 3B8HA 4NCKA 1KDOA 1U81A 2CCJA 1E9SA 2I1QA 4OHXA 3SEAA 1UKVY 1MO5A 1L2TA 2IYQA 1SXJD 3N2EA 5FOUA 2BKUA 2FN4A 2HCBA 3NVAA 3TKLA 3LDAA 1JEEA 3O8DA 1MRNA 1QRAA 4F4JA 2OHFA 1JAHA 5KSYA 5FBWB 4ZDWA 3VNUA 3TE6A 2C5LA 1J8MF 2WJJA 2NO7A 4Q1AA 3LBHA 3PENA 1DOAA 3EW9A 5JFGA 1OB2A 1RZ3A 2ZROA 3AVTA 3MUFA 3A58B 3ZS9A 2ZSEA 3GLHA 5LB4A 4E09A 5KNBA 1TQ4A 4NYMR 1II9A 1TPZA 2YYZA 1AS0A 5JSZB 3QI2A 4M1WA 2W2XA 4EIWA 4Q7JB 2BV3A 4JSTA 1A7JA 3CZQA 4DLXA 1CXZA 4JLOA 1VYVA 1DPFA 3PEWA 4EPVA 4XIGS 3X1YA 1II0A 1TF7A 2G3YA 1KHTA 4PAOA 1T0HB 4B75A 2P6NA 2WWWA 5E3HA 5EP4A 3IILA 4ZO4A 3D31A 4C9BA 4AWXA 1W0JA 1AM4D 4EPWA 2G77B 2W2VA 3C8UA 4QG7A 3ZQ6A 2NGRA 5GJCA 4BLRA 4BASA 1C1YA 2JAQA 3BS4A 2WOOA 2XJ4A 4KV9A 5FUXA 3RWOA 4FWTA 1H8HD 2JLWA 4HAXA 2R6FA 2JIZD 2OSBA 1IBRA 2XEXA 1Z47A 4PPNA 1MO6A 1KO1A 1R0WA 1XCMA 2GBLC 3KB1A 3ZLJA 4LYAA 2FEMA 4LJ8A 4IJMA 1TAGA 3OIVA 1G41A 2J0UA 2ZRLA 3H2YA 3LFUA 4E03A 6Q21A 3K0CA 2EYQA 4G5GA 2J46A 3LV8A 4Q7MB 2GZAA 4H1UA 3NTUA 4LBYA 4R71A 2A9KA 1ZMXA 3ADKA 3V00A 2F9MA 4Q4JA 3VAAA 1TNDA 1MT0A 3VX4A 1KKLA 4TL9A 1Q57A 2WAXA 5EP1A 2QROA 4BZPA 4KFUA 1X6VA 5EE5B 3WYAA 2ZUCA 2EFEB 2GVZC 1GILA 1YRBA 1TTTA 5BYJA 1F6BA 1AIPA 4RCZA 2XGJA 4Q7KA 3IIMA 1OF1A 4B44A 2YZ2A 2CNWA 3CKLA 4PPFA 1SVKA 4QGGA 4L15A 1AS3A 4QRHA 3TUZC 3DDCA 4Q1EA 4Q9HA 1T3SA 5EE1A 4F93B 2CE2X 5HKKD 4Q1FA 1S8FA 4JSYA 2ZJZA 1BS1A 2ZE6A 4ABYA 2XZPA 4TLAA 4B2PA 1A1VA 3K70D 3GFPA 2YWFA 4KSBA 1RYHA 2D2EA 2EWVA 4PSVA 3ZZUA 3LBNA 3R8FA 3BB1A 4Z54A 2ZRNA 3NH9A 1PLJA 1ZM2A 4NONA 2YWHA 1P9RA 4M9XA 3RS3A 3IQWA 3SN6A 3AVQA 3WMGA 2CCKA 5CM8B 4B76A 2ZITA 3TVDA 1X3SA 1Z28A 2GCOA 2MSEB 4TMXA 2RAPA 3FHTA 2A5JA 5C46F 3BRWD 4LC0A 1Q3HA 1GZSA 4ERNA 3QENA 4MYHA 4QHSA 4B6FA 2ZRGA 3CPHA 4LJ4A 2N46A 4IXMA 4NYMQ 3SJCA 2F3TA 2QMEA 3GJ7A 1DADA 1EXMA 4P4SB 4D6PA 3WNBA 4BLQA 2XXAA 2IUTA 4N3NA 5AJYA 2HF9A 1U2RA 5AJVB 2QSYA 3RAPR 1UAAA 4V0MA 3U44B 1JJVA 2UVQA 3A1TA 4G0NA 4A0FA 2WV9A 4Q5IA 3BD9A 1ZIPA 4OK3A 3OIWA 3A37A 2QE7A 4JKYA 2VIIA 2A30A 1II8A 3OE7A 4RZUA 4U02A 5DO9A 3KQUA 3FKSD 1S9HA 5JHGB 1P62B 5AUPB 2JEOA 3B6EA 3A36A 1OFUX 4PANA 4PZZA 2Q3MA 1XJCA 2IL1A 3B1WA 4W5HA 5C1BA 2NO1A 5F9HA 1WE2A 3GQBA 2BWJA 3TSOA 4PO8A 3ZIAD 1NN3A 2G83A 5M04A 3Q9LA 4R2HA 1YZLA 1OB5A 2BMEA 2AFHE 2BHRA 1E4VA 3FPAA 4TTRA 5FL7D 1L8QA 2ZAOA 3VU9A 1UJ2A 3SYLA 2PH1A 4Z1MA 4TQ9A 4KBFA 5FBRB 2GXAA 2REOA 1JB1A 3J81k 1PLKA 5DISB 3H86A 3AP1A 5G3YA 1FOEB 2DR3A 2JLYA 3QF4A 4CT4B 2PL3A 2JLZA 1ETUA 1U90A 3IKJA 4PFSA 3EG5A 1E2EA 4CEHB 2VTKA 3AF0A 1F2UA 2WOJA 2AXPA 3QXHA 2C78A 4UJ5A 3RHFA 4ZKDA 2BDTA 4LV5B 3LO5A 2QAGC 5DN6A 4HUQB 3I61A 4B3DA 3IPYA 2V1XA 2PMDA 1A5TA 3E5HA 1FTSA 1IOZA 2E9SA 821PA 4HEJA 1G4AE 1G3QA 4ESVA 2Q9BA 2VP0A 3ADCA 3LBIA 3GEEA 3SYNA 1YU9A 2FA9A 3I92A 1P7CA 4BLSA 1E2HA 5A0FA 3LNCA 3C5HA 1KSFX 2CXXA 3B1VA 5EP3A 1YJ5A 4DKXA 2IBMA 2ZYUX 3IQXA 1Q44A 3MG9A 5JWOA 1F2TB 4O2LA 1RKBA 4XTCS 5J4LA 3EIQA 4N1AA 2C04A 1SHKA 4YMVA 1TUEA 4LJ9A 2CCGA 3K70C 4XWOA 3EZ7A 3QXCA 4MYUA 221PA 3CNNA 2QA5A 2QU8A 4Q03A 2GNOA 1TF2A 1GNRA 1W46A 4Q4LA 4I99A 1E9AA 5DGXA 3AH8A 4XD7A 2GJKA 1FL9A 3SDZA 2IYTA 2KI5A 4NP6A 4XH9B 2IF0A 2O8EB 2ZRHA 4WW0A 3TGPA 3THYB 2Z0MA 1EFTA 2BIFA 5DHAA 4BGDA 3W8NA 1GL9B 1Q0UA 3H1TA 2GEVA 4TL8A 1UDWA 2F43A 3RNLA 4CEJB 1MABB 3Q7PA 4XOIA 3IBYA 2JLXA 1RRCA 1X86B 4QC2A 2YV5A 3GJ6A 4JVMA 3GMTA 3LX8A 4A2QA 1OXVA 4ZIRA 1XZQA 5SZHB 4BFXA 1Z0DA 3T06B 2WHXA 3WY9A 1KZGB 4TSFD 3R8CA 1ZD9A 1DAIA 4WVFA 1P2SA 1G7SA 1OH6A 1E2JA 1OV4A 4MRVA 1G5RA 4OQNA 1VIAA 4EJSC 3O8CA 1UBCA 2FSHA 2QY9A 2GJAA 2R2AA 3C15C 2QTHA 2H16A 4CZ2A 4M53A 4OYHA 4QBGB 2LCFA 1S0UA 1NN0A 4Q4AA 2QP9X 4V0LA 3P1JA 5KDOA 3FWYA 2IYSA 1E1RD 5IHPA 2D4HA 4RD6A 4B32A 1FUUA 1XMJA 4C0HA 4TYPA 3AVWA 4JL5A 5IT5A 3FHOA 3W5JA 2WIAA 1HQCA 1RVDA 2F6RA 3QY0A 4M1MA 5UKDA 4DT1A 3B13B 3CR7A 2V4ZA 4M1OA 5FPKA 3JZAA 2ATVA 1E2GA 3TQCA 2OFXA 1OH5A 3SJBA 4J0QA 2RGNC 1CLUA 1WRBA 4Q47A 4R2IA 2O8CB 5IK2D 4XJXA 3LW7A 2FV8A 2WPDA 4IOMA 4V0KA 4JLPA 2NQ2C 5EZ6B 5HTKA 2QP3A 4DCTA 4MGIR 2OXRA 2V7QA 1P75A 1N6RA 2C2HA 3RDPA 2IS4A 1A82A 5L3QB 3UG7A 1EESA 1NVVR 1V5WA 2BEJA 1T4GA 3LAWA 4D4JA 1PVOA 3QKTA 1UEJA 4BPBA 1NVXQ 2JDID 1F60A 4TL7A 3V9PA 4GZLA 5DLQC 4HDQB 1U9IC 1IY0A 5DHFA 3KXLA 4PC2A 3GLIE 1G4UR 1YZGA 5FBQB 2R6DA 4Q18A 4C0QC 1XCGB 1Z8FA 4PSAA 5LB2A 3VR6A 1LVGA 2ASEA 1ZM3A 2BMFA 1KMHA 1HUQA 5KO2A 4C7OA 2IYXA 2J45A 1E1QD 2CBZA 2Q21A 2FPLA 4JBWA 3MJRA 3TH5A 1DVRA 1KO8A 4MRRA 3QEJA 4YXWD 4L9SA 4DXAA 3Q5EA 1D2EA 2RGAA 3LLMA 3B78A 5EZ5A 4HDOB 2BC9A 4BEJA 2XZOA 2ZVPX 2XNSA 3SHWA 2RCNA 2RGEA 1XTIA 1UF9A 5K8LA 1E9DA 2ORWA 3JVUA 3CNOA 3TR5A 5TMPA 3PUXA 1T5LA 2IYUA 1DBSA 3ECCA 1JXOA 3GD7A 4Q4JB 1GRQA 4UNSA 1WA5A 2ONJA 1T8UA 3CRRA 3QUSA 1U0LA 3U6BA 3GLGE 3DHWC 1LB1B 3MWLA 4EPTA 4OK6A 5KPDA 4B35A 2V6IA 3QVUA 1QHIA 4M1YA 2Z83A 3I1FA 4BLPA 2QQ0A 4DCVA 1Z2CA 5GADl 1A4RA 2AK2A 2JJ1D 3THWB 1UKEA 3SFVA 1NY6A 3PQCA 4V0NA 3B9PA 3ZD6A 5CB6A 1VCMA 4JT4A 2HJVA 2B6HA 3O47A 5AUNB 4URZR 3ETLA 1Z2AA 2ODBA 2AFIE 1ZIOA 2XTZA 4NE2A 1KI3A 2A5GA 4HAUA 4DIDA 3TUIC 1NN5A 2O5VA 1EFRD 2XOKA 3TLXA 5JCPA 2PEYA 4XSGA 4I1VA 4C0AC 2YC4C 4R9UC 2R65A 2HT6A 4GOKA 1ODFA 2REXB 2BBSA 2ZPTX 3ASYA 3NBYC 4QGAA 1BMFD 3ICQB 1KK2A 3MLEA 5BN5A 2XJ9A 1VECA 4IHQA 4BRWA 4YMSA 2P6RA 1YZUA 1KYIA 3LD9A 4Q00A 4HSEA 1D5CA 4LCBA 1N6OA 3KJEA 2OILA 4HZUA 3AGQA 5J4YA 1SKQA 1L7VC 1NVVQ 3KKOA 1CJMA 2B8WA 3TBKA 2P3SA 4POAA 4TTPA 3IPXA 4TZ6A 3PXGA 2PT5A 1E9EA 3B1ZA 3KXIA 3QBTA 4IEIA 3KFXA 3UMSA 3RSLA 5TARA 4ZCIA 4C4PA 1X8JA 4UKDA 2D7CA 1NSTA 2ZI9A 3NXSA 2ODWA 2QL6A 5C2JB 3DKVA 3ZQJA 5EXSA 5CYOA 4DSUA 5IDVA 1D9XA 3LX5A 3I8SA 4P4UA 1UDXA 3DMNA 4M0LA 4YMWA 1FX0A 3L2OB 4JT2A 4HAVA 5CIQA 3MFYA 5AJZA 1ZD8A 4A8JC 4FMDB 3DM9B 3KUDA 2ZSBA 4AD8A 1L4UA 5G40A 2GAAA 1W4AA 2O8BA 2WWGA 2NPIA 4U5XA 4KI0A 2ZTSA 5BWMA 4D4LA 3R20A 1H65A 2HEIA 2BBWA 2ODEA 1K8RA 4CIDA 1K6MA 1AZSC 3RC3A 2ZS9A 1ZCBA 4JLJA 1XDBA 5J4VA 1F2UB 1GDDA 1NJFA 2F1RA 3TW4A 4AIIA 3NG1A 1E9CA 4DSOA 1P4SA 1EFCA 3W6NA 1G1MA 2YC2C 3PFIA 4PR0A 4UNRA 2RMKA 1ESNA 3WBKA 3EPLA 3IEUA 1JQLB 3GEIA 3PV0A 3ZVLA 3GLIA 3PJRA 1E2KA 4IDOA 4P33A 1JBKA 1VKJA 2DFKB 2WWFA 3OIUA 4TYQA 1F48A 5GJWC 2BKEA 2EFGA 1ONBA 2DFNA 2WM9B 4JJKA 1HY3A 2CLDX 3IHLA 4HB0A 2GA8A 4M1TA 4TL6A 4JLMA 2QM8A 4UXJA 1A2KC 2N1BA 1EFUA 1G18A 2GF0A 2I4IA 3IO3A 4C3ZA 4PPQA 3SQWA 2IS1A 1GNPA 4LSGA 2ZE8A 1E9RA 3VR4A 2R9VA 3AKCA 5DIFA 5FI1B 4TLDA 1Z22A 4HLUA 5JS7A 4OQFA 1XPUA 2ZI4A 5KYKA 2WJHA 5FPTA 3UATA 4ZV4A 1GKYA 1TQDA 2VF8A 3GLGA 1KO5A 1X1RA 2J7PA 1GVNB 2BOVA 2HF8A 1RYFA 1TUIA 3DMDA 1RJ9A 3KQKA 1RE0A 5K8TA 3FMIA 3TSWA 5JBQA 4ZCLA 5IRCD 1R0ZA 2F43B 2QAGB 4BQSA 2PMKA 2X1VA 1UKZA 4KFTA 3E70C 1GRNA 2ZRIA 2RB4A 4TLEA 1GITA 4TYWA 1LFDB 3WNDA 4RZXA 1ZC3A 1US8A 3DZ8A 4L8GA 4KO8A 3U60B 2JATA 2WMNB 3AEZA 5FI0B 1W2HA 2GJSA 4C30A 4IOJA 4EPYA 2X8AA 2CDNA 5E7MA 2QBYB 1KI7A 5FPYA 1VYUA 2EYUA 4FWIB 5TB5A 4A92A 3OEHD 1BKDR 3L0IB 4MUBA 5HCIA 4JLDA 1KMQA 1GUAA 2WIBA 4US2R 2H1LA 1V43A 5L3RA 3RS4A 5H8WA 3AVYA 3TW8B 1XEXA 2OLKA 2ZR9A 1KTVA 4LBWA 1DO0A 2XNDD 3VKGA 1PV4A 1HE8B 2W6JD 1SVMA 1QHGA 3W9YA 2IYZA 4WOPA 1XCPA 4BECA 4EUNA 3KQNA 4B74A 2R6CA 3ZGXA 2ODNA 5C4MA 2CE7A 1RFLA 2JLUA 2VP4A 3AQ4A 1MRSA 1N0UA 1R4AA 1HV8A 3MWYW 1OH8A 4B73A 4ACBA 5KU1A 1XEWX 1LS6A 1IY1A 4JL6A 4BZQA 2YINC 4OQXA 3U5ZB 1E96A 3QF7A 2MSDB 4HAWA 4LGMA 3KKPA 3E2IA 3DVLA 3GCGA 2AX4A 4EFMA 5P21A 1SGWA 4IDHA 3PVSA 2OO7A 5D3MB 1ZUIA 1E3MA 1DARA 5DH9A 4QJ4A 1NG1A 2ZE7A 3WHLA 2R44A 3GFOA 4HDCA 2P6UA 3K0AB 2BM0A 3PG5A 2JJ8A 2KBFA 4OI2A 4Q9KA 2R6GA 1XXHE 2Q0HA 1T6NA 3A4MA 2TMKA 2ZANA 2NO9A 1VHTA 1COWD 1KK0A 3K0FA 1TQ6A 2FPKA 1NL3A 4EJSB 1XEFA 4PHTA 3KKMA 4H9GA 4LDJA 2Y8EA 5DSZA 2WJIA 3D3QA 3Q3JB 2ZRPA 1JXMA 1CJKC 2PZEA 1W0KA 1QHSA 5FTMA 2AD1A 2KJQA 5JJIA 3PUZA 1S1MA 5FR2A 2YWGA 4FMDF 2BCGY 2C9YA 1EX7A 4OI1A 4OI4A 1UPTA 4LJAA 2NO0A 4LYJA 3QKRB 3NC0C 2HYDA 3W34A 2RHDA 1SXJE 1HH4A 3K09A 4DLWA 3VNVA 5CB8A 3U7EB 1IJFA 4GRAA 2ZRKA 2B21A 2HDNB 1N5LA 4Q9LA 1UFQA 3SNHA 2IYRA 1I2DA 3FFAA 2Z4SA 1D2NA 1OXSC 3U4QA 4GI7A 1TX4B 3C41J 3K1JA 3TNFA 4QM7A 1KI1A 4TMVA 1GSIA 3BH6A 5TXGA 1OLOA 5FUVA 4CEIA 2GAOA 2ZS8A 1JR3D 3CH4B 3X1DA 1W4BA 1FZQA 4D25A 1KIMA 1N25A 5KTYA 3U7GA 1CF4A 4B48A 3U3OA 2HT1A 4L16A 4P31A 1MOZA 5J5CA 5FOSA 1HTWA 4HATA 1G64A 5GVSA 5FOTA 1DAEA 4HLQB 1GL7A 4RZ2A 3RYTC 1S2MA 1P73A 3KTAA 4B6EA 3FDIA 4B3FX 2EQBA 3VHLB 4WXRA 3OEEA 1HQYE 4UXIA 4I81A 4DCSA 2H8KA 2FF7A 1NLYA 2OT3B 4F4IA 3THXA 2JJ2D 4DCNA 4XWKA 1H8EA 1OXTA 1R5NA 2C95A 521PA 5B30A 1DAHA 3QBVA 3OFNA 4QM6A 4B3GA 1YZQA 4RJLA 4Q1CA 4NBSA 5DNYB 1FPMA 2XB2A 4HB2A 3HU3A 2DB3A 3LA6A 1MKYA 2GWHA 1VPLA 1ZUNB 2QGNA 4RKEA 4X8MA 1Z3IX 2B7CA 2HLDA 4GSYA 3M1IA 5BXQC 2VLIA 2A5YB 5IF9A 5LD2B 1Z06A 4DLYA 3CNLA 1CP2A 1HA3A 2MMGA 2VP6A 4YDSA 3ZVNA 4NTZA 2QPOA 1NLFA 1KJWA 4EFLA 1UBEA 1NG9A 3CH5A 1CRPA 2FE4A 3HU2A 3QOFA 2CMKA 1W48A 3EX7C 1VCOA 3BIFA 2FFAA 3EC1A 4MRPA 2IXGA 3HJNA 2F1JA 3OAAA 2VHJA 1HE1C 4EQ6B 2J7KA 4C0KA 1ZM7A 3L82B 1EX6A 4K46A 4DLRA 3LXRA 2VP5A 4B34A 3QG1A 1C4OA 1KI6B 4D4KA 1R8QA 2ZI3A 1RC8A 2OAQ1 4KAXA 4XVQA 2MMCA 3A4NA 2WJYA 2VEDA 4Q21A 4A2PA 1R6BX 3ZZ0A 2GBLA 1E2MA 5L3SA 4ITRC 4PQYA 2KSQA 3EZ9A 1FX0B 3ZD7A 5DYIA 4BFYA 1E9BA 4PZLA 1E2IA 1P72A 3ND9A 3AVUA 1PZNA 4ON9A 3CR8A 1ZBDA 2J9RA 1IHUA 2GILA 3UK6A 2OFOA 2I1VB 4HZIA 3GLFB 4BE7B 3K8YA 3CX7A 3B9QA 1OKKD 2FU5C 3KB2A 3RS2A 4A0RA 4XSHA 3WYGA 1XXHA 1GM5A 2CK3D 4QKQA 2IWHA 3A1WA 3D6TB 3AVVA 1XTQA 5DI3B 3B1XA 1QHNA 4PX9A 4Q9JA 1XTRA 3LLUA 3CW2A 3KXKA 4MYCA 5LPNA 2C99A 4ASUD 1P6XA 4IFEA 1ZUHA 2NTYC 1CR1A 1M7BA 1S4QA 1EFHA 2Q3FA 1E79A 4RD4A 4ZPXA 3ZVRA 5JRZA 4D2IA 3EZ6A 2J0QA 4Y0AA 5FOWA 1QHHB 2WSSD 2BMDA 2X2EA 4V03A 2J59A 4BZXA 1DTSA 3LQRA 2HYIC 3VFDA 5KSPA 1JNYA 1G291 4Q01A 5FOXA 2BVNA 3CRVA 5JECA 3FB4A 1W47A 4LJ7A 1AQUA 2ZRBA 1ZINA 1UEIA 4MA4A 1IN8A 1R5BA 2FX3A 2RGXA 4OKSA 5KSOA 3PIRA 2IS2A 1SXJA 4PAMA 1JECA 4JVLA 5FTJA 1XD2A 3F3YA 4B2LA 4Z51A 4HYYA 4TN1A 4JS0A 2XITA 4BLOA 1ZD1A 5EE3A 2QT0A 3C7KA 2W6IA 4A8JB 4PO9A 3QKUA 2Q9AA 5F9FA 3A1UA 2D62A 2F1HA 2ECKA 5GVRA 1J99A 2REBA 1E2FA 4NYIR 3I73A 3N5CA 1U8YA 1Q20A 4D81A 2PX3A 3S1AB 2IK8A 1QZXA 3RANA 3RRZA 4BFSA 4DJTA 4TYYA 2FFQA 1GIAA 1N0WA 4PC7A 4LHXA 1HURA 4LX0A 4IFBA 3REGA 4LJ5A 2ZSAA 5EQTA 1OFHA 2W0MA 1KI8A 2NOAA 1WMSA 4GP7A 3SR0A 3K9HA 1R0YA 5H68A 3W3ZB 4Q66C 1E0KA 1UADA 4NCJA 2XTNA 2W58A 3T1OA 1OT3A 4IOKA 4QL3A 1GTVA 1JEDA 3CPEA 2CVHA 1OHHD 4D4MA 4NZYA 2NG1A 1P61B 1DAMA 3T1TA 3R7WA 5LD2C 1AGPA 3NH6A 1JR6A 3TJZA 3AF2A 1H8HA 3AF1A 1VIYA 4Q4HA 5A4JA 2GXSA 2JIZA 3KQLA 2GEDA 1JPJA 1T0JB 3RS5A 4MGKR 4CDGA 3AUYA 5EXXA 4M8NE 3EIEA 3BFXA 5TVKA 2PT7A 2QQEA 2O8FA 4IVPA 2GVDC 1LS1A 1KNQA 2RGDA 4DDTA 1BYUA 4Z8XA 4LJYA 1NKTA 3BH7A 4DEXA 5GJBA 2OZEA 4D0LB 1XPRA 1QDEA 1OFIA 3DO6A 4KODA 2J0SA 4ZKEA 1M74A 1YZKA 1E99A 2JGNA 3MD0A 2VHQA 4BFTA 2O8DB 3I32A 2CJWA 4MUAA 4URXR 3U3MA 4KITB 1N6NA 2HCJB 4LPKA 1NMZA 1Z5ZA 2ZE5A 2FH5B 3K0EA 3L0OA 3AKDA 1G7CA 2J87A 2XZLA 5BYKA 4MRNA 4PQFA 2HXSA 3VKHA 3CX8A 1Y63A 4QFMA 3WRYC 2FPMA 1QF9A 1XWIA 3KJIA 5JLJA 1S9DA 3SHFA 4OHWA 4TT3D 5CLQA 1X1SA 4DLVA 3UMFA 2WWXA 1Q1QA 1GNQA 1VG8A 2E87A 2PBRA 4KSCA 3UMRA 4BFVA 4DLZA 5KOYA 1S96A 5HKKA 3DM5A 1VDZA 4LZZA 4URYR 3DKPA 5L8VA 3AVPA 3K0FB 3GLHB 4MKFA 3MWJA 4DC9A 1W49A 4RFSA 5E95A 2YVUA 4IDQA 4WZAE 4AKHA 1CIPA 3TAUA 4NCNA 3GJXC 3W90A 4DSTA 4LJ6A 3WHKA 1G20E 1M8PA 1J2JA 1AJEA 5KSZA 2W0SA 4DDVA 5EJEA 1UKYA 1RW4A 3C5CA 4UNNA 1UBGA 4PO1A 1LF0A 1P2UA 2JLQA 2NZJA 4TLCA 1T8TA 1W2GA 2EFDB 1ZM9A 2WAYA 3ZJYA 4NYIQ 1OFTA 1T3HA 2VHCA 4AYTA 1SKYB 4DIEA 4P0TA 1NKSA 1Z63A 4IEEA 2QRZA 3LH5A 3SE0A 1KK1A 4YQFA 1QHYA 3JZMA 1OE0A 1XZPA 1JI0A 2O0JA 1TF5A 3NEYA 5E4FA 2ZETA 2KWIA 2V55B 3SBEA 5HE8A 4LV8B 1M7HA 1KJYA 3BWDD 3RRMA 3PEYA 4JLAA 4B71A 4G5RA 2IUSA 2WKRA 3FKSA 2IEZA 2J0UB 3ND8A 1N6KA 1G3RA 1R7RA 5JSZA 1G16A 3HDTA 1AS2A 1KDTA 1W44A 2QMOA 4PC1A 1T91A 4HUTA 3TRFA 5CJPA 1QBKC 1CS4C 4FINA 4YDHB 4DUGD 1Z29A 3BH0A 1OSNA 2O0HA 3TIFA 3ZIAA 4A4DA 4B3XA 4DLTA 3T5GA 3BGWA 3NWJA 4P3YA 3AF4A 3CF0A 3W6PA 1FP6A 4LUCA 2YHSA 2P0EA 5FL7A 5JS8A 3EIHA 1IXRC 3TVTA 4QJ3A 3UWKA 3U61B 4W5JA 3Q8XB 4F7WA 4NU0A 3V4FA 2QENA 3L8ZA 1HEIA 2L0XA 1ZU5A 2RGNA 4N0EA 1XPOA 2CLCX 2CEAA 4URWR 4UJ3A 3WBJA 2QZ4A 2ZI7A 2WJGA 3EA0A 2JLRA 3GJ4A 1WQ1R 2A5FA 4IXNA 4AG5A 2WWYA 1G5TA 2IYYA 1AGRA 3RRYA 5B64A 1CULC 4BEBA 4MDEA 3RSOA 4FCTA 4HLDA 5AJXA 2ATXA 2RH5A 4UXHA 2C03A 3KKQA 2FEOA 4A9AA 1ZJ6A 1MH1A 2EVWX 2GK6A 3CM0A 1NBMD 1WB9A 3T15A 1G5PA 2YNMA 2GK7A 1B23P 2ZQ5A 2IC5A 2Z4RA 3DZDA 3LY5A 1DAFA 3NBFA 1T3LA 3EPJA 3AM1A 2GCOB 2GXUA 2IW3A 4A6PA 4ACAA 3U3KA 5C4GB 1U9IA 2DHRA 3LXXA 1G3UA 1LNZA 4LYFA 5D3QA 1ZP6A 5JZVA 3X1ZA 3THOA 2Q3HA 4BFUA 2A78A 2AN9A 3ZYCA 4CRWB 1AZTA 1FMLA 2XXAB 4BRUA 4E22A 4HAZA 4GPTA 2XAUA 5LBIA 5EE0A 3CWQA 4IOLA 3BFKA 3VKWA 3P26A 1VG0B 1CR2A 3T1QA 3P20A 1ZNZA 5TY0A 5CITA 1II8B 2QTVB 2NMVA 4TMZA 3CONA 2YJTD 5FUYA 1UBFA 2IXEA 2C9CA 2OXCA 4M4SA 3SJAA 1OW3B 1IM2A 3WRXC 1TU4A 4C2TA 1KZ7B 3PITA 1VHLA 1YVDA 3GEHA 4LBVA 4M9SA 5JWHA 1KSJA 4X8HA 4RVCA 1VCNA 3ADDA 2IX3A 3CBQA 4KVAA 3TQFA 2DWQA 3VR5A 3VU9B 1Z0JA 1W0JD 2ZYTX 1VCIA 4TSFA 3SQXA 5DE3A 1Q3TA 1IXSB 2FZLA 1WF3A 4IVRA 3E1SA 4NL4H 3QF4B 3QSYA 4UNPA 4QHYA 2KB0A 3U44A 2ZRMA 3HWSA 2O0KA 2G9NA 4Q48A 1XU4A 1M1YE 2B7BA 4L4UA 4JL8A 1MR3F 4TTQA 1TMKA 2X19A 1E1RA 3W5IA 1TL7C 2IYVA 2J41A 2DFLA 3BJIC 2XSZA 3CIOA 2EU8A 1KI4A 3PUWA 4CT5A 1SULA 1ZCAA 1S3GA 4E07A 1DO2A 3WXMA 1GL6A 2JCSA 1GG2A 4LPSA 2H7VA 2I3BA 1RRFA 2PLFA 3TSZA 3L0SA 1VG9B 3CPJB 1ESMA 5SZJA 3JVVA 3T1VA 4XWAA 3TUJC 5IK2A 2FNAA 2VF7A 4MH0R 3GPLA 3Q72A 4U7DA 3NBZC 2HXYA 2CNWD 3WP1B 3MGCA 2OCPA 2N42A 2UKDA 2DBYA 4NH0A 1NVWQ 2J0VA 2ORVA 5FR1A 4M9ZA 4P4TA 3W3AA 2JDIA 3BAFA 3BBPA 4KLNA 4XTRA 3DL0A 5FL3A 2K5UA 4HUQA 3GJ0A 1KY3A 4WXPA 3AGPA 3DPUA 4K8OA 4NMMA 1SVWA 1OYYA 1IN4A 3T34A 2ZI6A 4FXPA 1E6CA 1N5IA 1OJLA 4P32A 1W4RA 1OXUA 1NMXA 4MRSA 1GWNA 1E4YA 3KL4A 1JPNA 4ILEA 1G21E 1LV7A 4Q19A 4UQOA 4CF7A 4ZIRB 2G1JA 4Y0VA 3WNCA 2ZR0A 2HUPA 1E1QA 1KSHA 1CR4A 2A3RA 2QG6A 3KKNA 1F2TA 4KBGA 4GL2A 2QGZA 1EWQA 5FFMA 3CZPA 4JLKA 3QG5A 4WZBE 2VHUA 2ZU0C 5E7JA 2IXFA 4YXWA 1GP2A 1NP6A 4GOJA 3W8RA 4KXFB 5EP2A 1DAKA 5F98A 5TV2A 1R10A 1UM8A 1E2PA 2VO1A 4I1SA 121PA 3ZVMA 4MKHA 4XVUA 3F8TA 3G5UA 421PA 2ZUBA 5BQ5A 4PSKA 3PUVA 2QE7D 1QVAA 1ANKA 2ZJAA 4Q4AB 3OE7D 1G7TA 5FBVB 3B5JA 4PHHA 2FSFA 4Z8YA 3BFVA 1J70A 2JLSA 1E32A 3THYA 1NNEA 2O8EA 5K8UA 1PJRA 5CK5A 3KDSE 4TMKA 2G1KA 4N0DA 4AY2A 4W7SA 2ANCA 4DT1B 2JJ1A 4TLBA 3MRSA 3VQTA 1N2CE 4CEJA 1G3MA 1MABA 3ASZA 1WDTA 1BO6A 5KNDA 5B2ZA 1OH7A 4Q7LA 1CEEA 2YOFA 2P65A 3NEJA 1OIWA 2R62A 1WCV1 1AA9A 2VSOA 2CL7X 4JLVA 3SBDA 3SU8A 4ARZA 1KK3A 1NMYA 1SQ5A 2GETA 4FMCB 4Z1MD 2QMUA 5JRJA 4TQAA 4PZYA 2Z5FA 1KKMA 1XX6A 1N3BA 1EFRA 4RY2A 3EWSA 4LRWA 1N0VC 1P60A 3SZRA 2JASA 1FNNA 1KAGA 1KNXA 3D7MA 3K0CC 4OL0A 1J90A 4O2RA 3VMFA 3ADBA 1YE8A 1NJGA 2ZXUA 1BMFA 2BEKA 4R7ZA 5DN6D 2VA8A 1A2BA 5CK4A 1KGDA 2ZREA 2Q9CA 4B3BA 4ZI2A 4GFDA 1F5NA 1N5JA 2P67A 4RKFA 1IAQA 2ZJ2A 4PXAA 2CHVA 4QNMA 4QJ5A 1ZNWA 3K9NA 3K9LA 3AF3A 3I5XA 2W6ID 1D2MA 2Q6TA 3N2IA 5SZKB 1FUKA 1O3YA 2LWIA 1S1CA 4B47A 4JYBA 1KMHB 4C7OB 2FGJA 2OCAA 3KJGA 5DYGA 1Q22A 3FTQA 2HV8A 3AVXA 2O8CA 2D3WA 3QEOA 3CF6R 3X1XA 8OHMA 3EWAA 3EC2A 4OBEA 3ZS8A 1NN1A 2BCJQ 2BJWA 1G9XA 4PQRA 1EK0A 1YR9A 1QVRA 5HR5A 2GJ8A 2ZRJA 3F5FA 1XF9A 4Q1BA 2OM2A 1XTSA 3IIKA 3EARA 3LQQA 3M6AA 4NYJR 3SJZA 3HR7A 3QJYA 5HZKA 2RGBA 5L3QA 5TDHA 3SYKA 1G8GA 1P9WA 3AUXA 4LC1A 4PAQA 4PHFA 4JIMA 2X2FA 2GZHA 3NHAA 4XD7D 5H70A 4H1VA 3K0SA 3B2EA 4O3MA 4AKEA 4L5BA 4Q02A 1Z08A 3UXMA 1JJ7A 1OYWA 1I2MA 4ESHA 2F55A 1T9HA 3U3JA 1SVLA 4DRZA 1XRJA 2DWPA 2DY1A 3I4LA 2YOHA 3OHMA 1XBTA 3A6PC 1CBUA 2OFWA 3I3SR 2V3CC 3IO5A 3WYFA 2D74A 3UWOA 2GEUA 4LK2A 2V8OA 4IKEA 2PX0A 3DOFA 3SC3A 1OXXK 4G5OA 2GRJA 4I1OA 1U98A 1TEVA 2ZSFA 5AJWA 2WZQA 2QT1A 4RD0A 1D9ZA 1E0JA 3IBGA 4B43A 2IYWA 5CM9C 2PLRA 4PHGA 3B60A 1M34E 1IJEA 1XJQA 2GCPA 2XTMA 4NCIA 4TMWA 4JVNA 4D26A 1BYIA 3OESA 2OG2A 4RSGA 4URVR 1GAJA 2ZIAA 1N6LA 3HP1A 5EXPA 2FG5A 4RZ3A 3KFVA 2ONKA 4YMUA 1JR3E 4ZDJA 1Q1EA 1ZAKA 3DEFA 4KCGA 2IWRA 3HPRA 3LVQE 1SZPA 1XMIA 4DBLC 5A5GA 1SVIA 3QPVA 4HZUB 4X8OA 2D06A 2WVJA 3THWA 1E94E 2ZR7A 5EUQB 2C96A 3WMFA 3EPKA 2ZRAA 3LRPA 4QHTA 4C2UA 4B3CA 5AUQA 4GDFA 4RCYA 1XB2A 1FQJA 2QPAA 3G82C 4QXAA 2WPDD 4LHZA 1ELOA 4LWZA 1WP9A 3U2QA 3L8YA 4MITA 5FTLA 2FFHA 5HPYB 1JQJC 1G8FA 2AKAB 1KI2A 2V7QD 5J4KA 3AP2A 5BN4A 1KJZA 2ZRDA 1SXJC 1E9FA 5F3WB 2MSCB 4C0LA 5FUWA 1Z0FA 4RD2A 1Z0AA 3T12A 1P2VA 1Z83A 3PCRB 1R2QA 2A2ZA 4KFRA 2C9OA 2O8BB 4NPHA 4M21A 3RABA 4IW3B 4I4LA 3OEHA 4MGYR 4NYJQ 4G3XA 2WSMA 4DCUA 2B92A 1G17A 2XB4A 4FMCF 3U3RA 2GHIA 1KDPA 1FMJA 1XMVA 2OESA 3I8XA 3GJ3A 2VSXA 1DAGA 2DFTA 3OIYA 4JLNA 2XNDA 4TYNA 4HI0E 4GMDA 4IDNA 4JBXA 2W6JA 1R8SA 3HYTA 2WBLC 1MO3A 4QBFA 4A2WA 5JWRA 4DWJA 2G88A 3B7GA 2J5XA 4EFNA 5J4HA 3GLIB 5G53C 3QE0A 3AKYA 5ELXA 2OBMA 3CWZA 2NO6A 3NBXX 4BLTA 4G5SA 2IHBA 2Z43A 3BB4A 3ICEA 1G6HA 4ZDIA 4AKIA 3A4LA 4GNKA 2ZRCA 1ZC4A 3X1WA 3I62A 4AI6A 1G8HA 1CKEA 2OBNA 3BB3A 2ZM5A 2G0NA 5HCNA 2CHGA 2LKDA 4BFZA 2P5TB 1E98A 2ZYVX 1NLZA 3UG6A 5JJLA 1NVUQ 4BWYA 1ZW6A 1W36B 4DHEA 1AQYA 5JCZA 4Q9IA 3GLGB 3MAAC 3CF2A 4AKGA 2QMHA 1COWA 3T5DA 1DG1G 4M2LA 3U7FB 2JLVA 5CJ2A 3OZXA 1RRPA 2BJVA 3BK7A 3P27A 3FMOB 4AURA 1N6HA 1DE0A 3A1SA 1RJ9B 1QHXA 2AL7A 2H17A 1TADA 1YZNA 2XOKD 3O8BA 1L4YA 1D8TA 4MKGA 3CRW1 3WMEA 2CL6X 4F91B 1BIFA 1G7RA 1ZU4A 1Z6XA 4G5QA 1KDRA 1P9NA 2F9LA 3H84A 4QBIA 4LBZA 1KO4A 4MQBA 4OK5A 3P4YA 4F4CA 2E1RA 3QXXA 1Z6TA 1US8B 1WXQA 3FYHA 4NDZA 1CJUC 1GKIA 3IDQA 1SVSA 1NRJB 3P4XA 4PPGA 2NZ8A 4M1SA 4D80A 5CDFE 4G01B 2ZJOA 1FQKA 4YONB 4FI3C 4DLSA 3FOZA 1OPXA 2GKSA 3CUEF 5FPHA 1KO7A 4JVSB 4FCVA 2OV2A 4W5WA 3EZFA 1E2LA 3OF5A 2IHYA 3EZ2A 4LI0A 1PUIA 1U99A 2FSGA 1XEXB 5G41A 4MKIA 4DDUA 1AK2A 3QKSA 4BUJA 2A5DA 1OIVA 1JAIA 2C77A 3SFZA 3ZZTA 2UZIR 3HYRA 3NIBA 1QG4A 2FZ4A 3MCAA 4KYUA 1JR3A 5EE9A 1E2NA 2VRWA 2AK3A 3FHCB 1XD9A 1ZRHA 4FIDA 5CYPA 2H5EA 1IN7A 1Q12A 2EFCB 2QAGA 3GJ8A 2BBTA 3AV0B 3FMPB 1YKSA 1XFAA 3EASA 2ZJBA 3VTKA 2CHQA 1W1WA 4WBSA 1E2QA 1FW6A 2ZAMA 4GT1A 4OHVA 3FKQA 5K8IA 2WTUA 4ARZB 3FVQA 4PTLA 5GJVC 2YOGA 1G8YA 3RVBA 3UANA 1N6PA 2JJ2A 3QIAA 2ANBA 1FP7A 1Q1ZA 2QBYA 4V02A 721PA 4A1FA 2FSIA 1KOFA 1I4LD 1HT2E 1NI3A 3ZH9B 2C8VA 1B0UA 3B82A 2J1LA 2QAJA 3NDBB 3BC1A 3NDPA 2AKYA 3NHBA 1EG7A 1U94A 4C0SA 2IA5A 4YLGA 2ERYA 2NIPA 2G6BA 2OAP1 1VYTA 2PZFA 4A82A 4G1UC 4EKDA 1XTJA 3EPHA 2FJUA 2XSZD 4XVRA 2PJRA 1Z6AA 3F0TA 3CO5A 4ZCMA 1JALA 2ZJ5A 3SI7A 4OQMA 1WBBA 5KPJA 2QRNA 3UPUA 1M7GA 2VH5R 5EXTA 4IDPA 4RFVA 4WA7A 4GOXA 5KHOC 4NKRA 4ZDKA 4FCWA 3X2SA 1Q1BA 1G6OA 5D3MA 4OJQA 4AYXA 4GMXA 5FPSA 1XP8A 3T35A 3GLFE 1IN5A 4KFSA 1ZVQA 4CW7A 3K0AA 5AUOB 3QNUA 4F38A 2VSFA 3U4QB 3L0PA 5G3ZA 1W36D 1N6IA 2GCNA 3SOPA 5KDDA 5LDDC 3R9XA 2J7PD 1X8KA 1GRRA 1P5ZB 3RLFA 5KUTA 4CEIB 4D0NA 4GP6A 2DCUA 1K5GA 2XX3A 4EJSA 4KYIB 1G8PA 2X77A 5B57C 4W9MC 1P2TA 3BORA 3GJ5A 3BOSA 3M4YA 1J7KA 1Y3AA 3PUYA 1E2DA 5FTKA 4M22A 2RGCA 4LHWA 2ZSDA 4EDHA 2QI9C 4WZ6A 5AK0A 1OKKA 1FFHA 3CRMA 3W6OA 3WP0A 1BH2A 4KHZA 2JA1A 1N5KA 3VR3A 3KTAB 2VYFA 2CK3A 4D0GA 3EA5A 1YR8A 4FD2A 3AVOA 4KVGA 2OEPA 4O0MA 2QUZA 1YRAA 2AWNA 3CRQA 3QKRA 4FN5A 4TWZA 2FFBA 2CL0X 3IHWA 5SZIA 1YZTA 2W83A 4HB3A 5JMTA 3THXB 4ASUA 4KU4A 4BFWA 1DEKA 3NC1C 1D6JA 1YHNA 2V6JA 3IUYA 3EXAA 1GFIA 1KI9A 3KZ1E 4YMTA 2RKOA 3LVRE 2VP9A 3VX3A 4TMTA 3QPUA 4JJZA 2WSSA 2GESA 4OJKA 1G19A 3GP8A 3VHXA 1DS6A 1Z07A 2QNRA 4MGZR 5FOVA 4AK9A 3A1VA 4EPXA 1W7AA 2WWHA 2FGKA 3T61A 5CIWA 2ZS7A 4WAUA 3RS7A 3QXSA 2IS6A 3R9IA 1KY2A 2KBEA 4M1KA 4A0GA 4D82A 4LV6A 1I4DD 1IXZA 2GJ9A 5CDFA 1TQ2A 4JZKA 4FW9A 5ANRB 2D7DA 2YWEA 3HU1A 2V1UA 2AD5A 1IY2A 1Z0IA 2EW1A 3A8TA 4QOSA 4X8LA 5F2EA 5J40A 1CJTC 4GBMA 5FTNA 3KJHA 4HAYA 3CLVA 2PCLA 4JLBA 4OI0A 2IF2A 1W4CA 3HPQA 1NF3A 1RRGA 2KE5A 1Z6YA 2RHMA 3FFBA 1F3OA 4CYMA 3AP3A 2VL7A 2BBOA 1MV5A 2CVFA 2AHOA 2H57A 4F92B 4MDFA 2R6AA 3CB4A 3ONWA 1C9KA 1AKEA 1HT1E 2DYKA 1O87A 3K53A 5JI3E 5L3SB 2WICA 3TMKA 3C14C 1BOFA 1R0XA 1NIPA 4LHVA 2WJVA 3QVVA 2IEYA 1PUJA 1DELA 3RWMB 1LTQA 1TU3A 2EWWA 3O8RA 1NBME 4DZZA 3HR8A 5AR1A 2SHKA 2IYLD 4K81B 4S35A 2DWOA 4HLCA 1OHHA 2R8RA 1NIJA 1ZNXA 1W0KD 2PCJA 4KJZA 2ZJYA 4B33A 4CVNA 4IVQA 2ZUDA 1HYQA 1W5TA 2QTFA 4DSNA 3D8BA 1R5OA 4PC3A 1XXHB 1DG3A 2G0TA 1KSGA 5KDLA 1XEWY 3IEVA 3MWKA 4DDWA 4JYCA 1Z6GA 5FH9A 4RD3A 4EAQA 4HLUC 4C0BA 4EQ6A 3QXJA 2VP2A 1W36C 3BERA 4LY6A 4AC9A 4DVGA 2J3EA 4P4SA 3I72A 4UNQA 2ZYWX 1KI6A 5HE9A 1YQTA 3DOEA 1EWRA 2AR7A 1YR6A 3AB3A 5L3VA 4DLUA 2PEZA 2VQSA 1CR0A 3MJHA 4IRUB 4NCHA 2DPXA 3C16C 3EAQA 1EGAA 1KAOA 4ZI3A 3TR0A 1ZYUA 4OHZA 3CX6A 4YC7A 4OHYA 2V9PA 3GLHE 4JMPA 1IONA 2HJGA 3Q7QA 3UKDA 621PA 1IN6A 2O52A 4AYWA 5BW8A 1GKUB 4A15A 1SXJB 1GOTA 2BM1A 3BE4A 5E7IA 1XD2B 2F7SA 3M0EA 1SVOA 3BXZA 5FBLB 1XMSA 1XNJA 1X8LA 2QORA 3TK1A 4DEYA 3GLFA 4OQLA 1AN0A 3H0KA 4TT3A 4NHOA 1NY5A 1Z0KA 2ERXA 5JHHB 3FMFA 1XTKA 4O25A 3B85A 3V4RA 2OE2A 4II7A 2AWOA 2IT1A 3OEED 5EUMA 3FE2A 3TAHA 4S2EA 4QBHA 1SKYE 4I1UA 4QGFA 4U00A 5DI3A 2ZVQX 2C98A 3ZDQA 2PZGA 4M9QA 1LW7A 3IGFA 4LHYA 2WKQA 2GZDA 4US1R 2YKGA 1H8ED 2FDCA 3NKVA 2ZRFA 5J47A 1K5DA 1LY1A 2D2FA 3OFND 2BMJA 3R9WA 2F1IA 2VBCA 1VG1A 1PLLA 3LWNA 1QHHA 5DI9A 2GTPA 3C4JA 2ZU6A 3PEUA 1E69A 4CEHA 1CU1A 3G0HA 1U0HC 2CLSA 2VPPA 1IQPA 1CRQA 4A6XA 2OUKA 3PR1A 4PC6A 2QSZA 2HLDD 1M2OB 2EFHB 3K9GA 4MYTA 1S3SA 2W00A 1OIXA 3B1YA 2ORIA 2GDJA 2V54A 1YR7A 1I4TD 4TZ0A 3R7WB 2OLJA 2UZ3A 3VR2A 2ZEJA 4DB4A 4A0HA 4A8JA 2AXNA 2ZI5A 1XD8A 5KNCA 3IIJA 2OCBA 4GZMA 4Q4HB 4DB2A 3KUCA 2QM7A 1TEXA 3QKSB 3VR1A 3OAAD 3PEVA 3KX2A 1CJVC 5AWFC 1ZNYA 1J8YF 4KLZA 2O8FB 1NSFA 1SHZA 2WMOB 3RS0A 3AKEA 3GFTA 4FMBB 5H1YA 3S1AA 2A7QA 5BN3A 4LYHA 1G3IA 2PJZA 4US0R 4QNRA 4V0OA 4Q1DA 2GXQA 2OCYC 3FGNA 4B2IA 1FNMA 3UIEA 4DUGA 2CJWB 3RC8A 3P32A 2OBLA 4C0JA 3SS8A 1W5SA 2W2TA 2GF9A 1VMAA
chains in the Genus database with same CATH superfamily
1ZUD1 3DE3X 2WSYB 4DEVA 2C0PA 2Q9UA 4CG3A 4OMDA 3K9QO 3CS3A 4YRKA 3DZBA 4URUR 1U8AA 2J30A 3G2OA 1VIDA 4CGZA 3L6OO 1CY0A 3V2IA 4EH1A 3K09C 3ZV6A 2NPFA 1WDLA 2NLOA 1ZX1A 1GNVA 4TQUS 2GBPA 2UYYA 5KVCA 4IIJA 4FGUA 1N2XA 1ZM4A 1WBDA 1RPZA 3IPRA 4DPLA 2WF6A 4HB4A 4WBNF 1R00A 1CTQA 3BXOA 1G9TA 3GWGA 4JBYA 3WYEA 4ABTA 4GE0A 1U7WA 4R2LA 3OETA 5CA0F 3SVLA 1W4LA 3TO5A 1AKYA 1UH5A 1A1SA 5K03A 1OGJA 1D3AA 3RVSA 1G98A 1X19A 2Q1UA 2FWRA 3SX0A 1VPVA 2ZJ8A 3WIEA 1RM3A 1E79D 2QYTA 2OKCA 3D4OA 2QEQA 3QQ5A 4V0ME 4OB6A 4RF5A 2QPTA 1IBMB 3DMRA 1PJ2A 2YFHA 1JU3A 2YZ7A 2Y4NA 4ZYWA 5BNWA 5JEDA 5LZ9A 1NQUA 1XXLA 3DR3A 4YI5A 1UP6A 2F3RA 3K8QA 4U7WA 1RACA 1Q3KA 1T9ZA 5BUZA 5ISMA 1EEHA 1DINA 3TINA 5LMZA 2Y2UA 3J7AC 3HY4A 4M9RA 1E4EA 2HCBA 1PT7A 1QKIA 3NVAA 2VT7A 1JEEA 3LDAA 4Q39A 1NVTA 5BNFA 1DWUA 5EWMB 1MRNA 1QRAA 4KN5A 5GONB 2VDWB 3V4VB 4CL8A 4DCCA 3VNUA 3K8OE 4ZAFA 1GO2A 4PYMA 2FQ1A 2NO7A 3FZGA 4EGSA 1MC5A 3EW9A 4GM1A 3BDVA 3LI2A 3FROA 3AVTA 2NSJA 2Z5LA 3N0XA 5LB4A 2JGAA 3PJDA 1T5HX 1KBQA 1IQRA 1HL7A 1XU7A 3TDKA 5FUMA 3FGPA 5KNCH 5EUBA 3RC7A 3QI2A 2F1KA 4HQFA 3K1ZA 1GTMA 2FWNA 4DA7A 4EIWA 4IGIA 4GG1A 1RPNA 1KAQA 3L1JA 3LHKA 3CZQA 5P8WA 2AQKA 1Z39A 1ZOLA 3BFJA 4NFYA 1RRMA 4BDTA 4C1BA 2V7WA 4YJ2A 5JARA 1M2KA 4R1SA 1KHTA 3VPGA 2GNAA 2SCUA 1U1EA 1VKZA 1Y80A 4EHAA 3AZPA 3T5AA 1T6YA 2FSSA 1BX1A 2P6NA 4Z1OA 2I9KA 3DEJA 5CVUA 1EWVA 3D31A 5AT1A 3PPXA 4LXYA 4EPWA 4PXSA 1GD1O 3C3MA 2C2BA 3HMQA 2W2VA 2YHIB 3G5TA 4MLDA 1CCWA 4Q05A 4RM3A 4XYGA 3R8XA 3NIWA 4JCCA 3D6JA 2D5AA 2WOOA 2I6UA 5JQGB 4GUAA 2ZBGA 3K20A 1BGXT 4KQXA 4TWRA 3C70A 3REQA 1YNSA 2I80A 2OSBA 1IBRA 5CFOA 2C29D 3COPA 1NDUA 1KO1A 1ONSA 1R0WA 2GBLC 4YCJA 4BNVA 3ZWVA 3ZLJA 1IXYA 2RSLA 1MA3A 5DSTA 1HRKA 4F2GA 4NQZA 2Y0PA 3GZTB 1TAGA 5DMXA 4C3UA 1G41A 2ZRLA 1T9CA 3LFUA 3DXZA 2E4VA 1OYOA 1M6VA 4JB2A 1SCDA 2OHIA 3QMMA 4G5GA 3RT1A 3U6KA 1K6JA 2O2XA 2R1UA 3JWPA 4LE1A 4JYAB 2JBWA 4H1UA 1H4TA 3NTUA 2PKQP 1AGXA 4LBYA 4QODA 2A9KA 3OT1A 1QRRA 2F9MA 2VHEA 3ZWBA 3VM6A 3PNQA 1FFGA 3SCZA 3T7EA 3VVCA 1Q57A 3B1FA 3C98A 3MUNA 4WY5A 4Y9SA 4AIRA 1E64A 4MPRA 3DF7A 1Z5WA 1TTTA 3EF1A 2OP1A 3DC7A 4D99A 1Y1LA 2OUIA 3IHKA 1F6BA 3ESZA 5I7AA 5DCYA 2FXIA 1HDZA 4RCZA 2XGJA 5DHRA 1YQUA 2Z9BA 3WB2A 4FFRA 1FY2A 1SBCA 1N5MA 2VDKB 3H42B 1GQFA 5CD9A 5FUBA 5D86A 1SBTA 3PC8A 3JQGB 3H87A 4QRHA 2GA9A 2VTDA 4OOFA 4Q1EA 4TV9A 1SHTX 3G5LA 4Q9HA 4AJJA 4F93B 5HKKD 4NZNA 4Q1FA 3EHDA 1A1VA 1QF7A 1JB9A 3GI1A 4LZJA 4UZEA 3GFPA 1PK8A 1SUEA 3P7MA 3ZZUA 3UKOA 5BWNA 3NH9A 4NONA 4E3WA 4F5EA 2YWHA 3QVWA 1PD0A 3FJYA 2ODPA 3W1VA 3EDCA 1ORDA 2WUDA 1DV1A 4J7AA 2Q6VA 3AVQA 1X13A 2FP4A 2CN1A 4NV1A 4O3FA 3JD1A 2GCOA 1E7QA 2CLEB 3KSUA 2PRKA 4FGZA 4NENA 4MYCA 3RBAA 3HA5A 1LUAA 3RR2A 5HKAA 1DRJA 3FHTA 4M7PA 1TW3A 2DUWA 3E3MA 4LC0A 4QHSA 5DX0A 3U48A 4LJ4A 5EJ6A 4LKOA 4NYMQ 2JRCA 2OVFA 3ILSA 4O2BF 3SJCA 1DKOA 1DADA 2PH7A 2FR8C 3CHYA 2YCBA 4B2YA 5LQDA 3HP7A 1EXMA 4HRAA 4PYJA 2FLVA 3AHDA 4FHCA 4KQHA 5FPPA 5JSKA 2B4AA 3UT0A 1U2RA 5AJVB 2DCMA 1VE7A 5FJJA 5IN5A 4XVHA 2JFBA 3ZE6A 1YOVA 3U44B 5CEFA 3OX1A 3L84A 1HLDA 3AU9A 5DX1A 5AVQA 4Q5IA 2P2GA 2GT1A 1ZIPA 2YWJA 2FPGB 3OIWA 4JKYA 2VIIA 2A30A 2O4CA 3O5AA 4HX9A 5LP1A 1F2VA 1S9HA 2RIRA 1XCJA 3ZWKA 4P3XA 1ZMRA 1P5FA 1GAEO 1P62B 3PHIA 1NHGA 3H5VA 3L4SO 4AXXA 3B6EA 3ZCQA 3LL7A 3H6KA 5IVHA 1UFOA 2FEAA 3B1WA 3KQTA 2Q3DA 2ZOSA 1H3NA 1OWNA 5C1BA 4QXOA 4YJHB 4E14A 4H3HB 5EJ7A 1WE2A 3GQBA 5F9HA 5LR6A 1WABA 2IDKA 2GPSA 4PO8A 3ZIAD 5M04A 3Q9LA 2ZVJA 5CX4A 1OB5A 2XR1A 4OIFA 2BMEA 1QGAA 3WWEA 2R2GA 2OR3A 3FPAA 5IM4F 4J2TA 4UTPA 1OWPA 3E4DA 3QLUA 1ZGJA 1STOA 4UBMA 5B3JC 1GARA 1XL0A 2PH1A 3BSWA 3GBPA 1JB1A 5HJ5A 1PLKA 1QZ3A 2IZ5A 5DISB 1M2GA 4FQ8A 1WTAA 3H86A 2Q3BA 1UJCA 1EVLA 3AP1A 4MIKA 5G3YA 2JH8A 5B1YA 1PP4A 2R8BA 3MJFA 2PL3A 4JOCA 2G80A 3JZFA 4LXQA 3OOJA 3RTBA 4PFSA 4A0SA 4AJ9A 1M2EA 1C9DB 1E2EA 1LDGA 3R7SA 5GGXA 1YC2A 2WOJA 3QXHA 4QTYA 4Z0TA 4LV5B 2QAGC 2AC7A 4QDKA 1YJXA 1B8UA 1ZIDA 4Y1RB 4XXHA 1AV7A 1E7SA 1A5TA 3E7DA 5AOBA 3PC6A 2YNMD 2ZBFA 2PGLA 5C34B 3G13A 4HADA 2AUTA 5BYBA 3W4JA 4ZYVA 3LBIA 2UYGA 2A1TS 4PZAA 1P1RA 3SYNA 2FA9A 1P7CA 3OX4A 3WKCA 3JXEA 1GTJ1 1U3FA 2YV4A 4P36A 3TYXA 3B1VA 1RWNA 4FXOA 4PBSA 4UBOA 3AILA 1A98A 1VJDA 3LQYA 5TF4A 4ADSG 1PL7A 2IYFA 5JWOA 3DBOB 4ITUA 2AN3A 2JB9A 5KX5F 1T4MA 3EIQA 3OX3A 8ATCA 4TKUA 5BRJA 4YHHB 2RK4A 1OLUB 1QRTA 4FR0A 5IULC 4N1AA 1ZIYA 4FHDA 2H06A 3GRYA 4ZVUA 5FHQA 1S4MA 4N12A 1NBIA 1TUEA 1EVJA 5B1SA 3SSAA 4QQRA 3RREA 2CWDA 2JIDA 4AUNA 4DLLA 221PA 1UT6A 2QA5A 5CAEB 2AZTA 1LNSA 4S12A 4BVJA 4Q03A 4PIVA 1C0LA 3RKRA 3KCNA 3KYDA 4Q4LA 2IIPA 4TTSA 1WVMA 3S44A 2B4RO 5AVZA 4FOTA 2GJKA 3DJYA 3U1TA 2VYND 4HYEA 2P0YA 4X6LA 3V8NA 2JFYA 2IYTA 2F3QA 4JJEA 4HC4A 4QD3A 2O8EB 2N75A 2ZRHA 2BI7A 2VHWA 4ZCRA 4HWPA 2WHRA 2Z0MA 4RPKA 1MFZA 4XIFA 5EEGA 1Q0UA 2YFYA 3MM4A 1A8HA 4G1EB 2VUHB 2AXQA 2VYQA 4PZCA 4TL8A 2F43A 3RNLA 5LXTB 3DXYA 2VRCD 4UOZA 4CEJB 3LKVA 5LOVF 2C2YA 2VAVA 3Q7PA 4XOIA 3EGIA 5THXA 3IBYA 3ERCA 3T4UA 2FW9A 1G6KA 1OBCA 2GBIA 2QMYA 4JVMA 3GMTA 4GGMX 4UU0A 4A2QA 1OXVA 4QZVA 2ZUSA 4ZAWA 1J0BA 4LXUA 3UMBA 1Z0DA 1J8VA 3H5NA 3VR5D 2WHXA 4LN1A 5BMVB 5CG1A 4LMRA 3WY9A 1NJSA 1YOBA 2OXIA 4OHCA 1T4BA 4TSFD 1ZD9A 2IU0A 3WFZA 1P2SA 1G7SA 3UFBA 4V1CB 5EY5B 2GRAA 1DCTA 1AO3A 1ORIA 3HKDB 3HKCB 1VE6A 4LXTA 2AV6A 4OQNA 1G38A 2WT8A 3O8CA 2FSHA 4QFDA 4OFBA 1Y3CE 3IAM6 5ECDA 1T5TA 4OU4A 3IP1A 1QLWA 2R2AA 4ZYTA 3ET4A 2C8JA 3TCKA 4WK0B 3GVCA 4M9UA 2VJOA 1PR3A 3H3XA 4QBGB 4DCPA 1W8DA 1NN0A 2I4LA 2YIJA 3MERA 4LCJA 5IDQA 1HLFA 3CX4A 3FJOA 5A4AA 1KQOA 2ZAIA 4YI3A 4X24A 4C03A 1GHTA 4UAUA 4EKNB 4C0HA 3QNWA 4WN9B 2P41A 3SICE 2OGWA 4JL5A 2BGJA 3W5JA 2WIAA 1UFKA 4II3A 4PLFA 5F5XA 3MAGA 4AX8A 4QXPA 1AUPA 3HQ4O 2HMTA 3CR7A 3DLIA 3NCHA 1RYMA 2BHNA 3NRBA 4M1OA 2QRQA 1WD7A 3C1UA 2OOKA 3IX7A 3JZAA 3AHIA 2V74B 3Q3GE 3WLIA 3RTAA 4J0QA 3SJBA 2RHTA 4INPA 1SZDA 1YMUA 3OLYA 3PKIA 1WRBA 3O8QA 4M6WB 4QOFA 1M1YB 4XJXA 3LW7A 1R8JA 3IUEA 4IOMA 2NSHA 1BDIA 1YI1A 5HTKA 3MYYA 1PKXA 5B2FA 4KQ1A 4MGIR 5EKTA 5K0ZA 2V7QA 1TRKA 1NUTA 2C2HA 2W2NA 3U1BA 5I3CA 1AG9A 1EPUA 4WCDA 3FSGD 1U4NA 1V39A 4MVCA 1P17A 2WQ7A 2XNKA 1N2IA 4KE6A 4OA5A 4TL7A 3V9PA 2Q99A 3ORHA 4R0MA 2I4OA 3EXHB 1Z26A 3FR7A 4D9HA 4P86A 1KYVA 2AX3A 3UQZA 2PL5A 4YFYA 2J3QA 2DVMA 1RQGA 1YZGA 3NETA 4FYIA 2BSAA 1ITZA 2NYVA 5F3DA 3ZY5A 4PQGA 4FSXA 4F9TA 5L9AA 2EWMA 3DYBA 1T2AA 1HQKA 4JUCA 4MA5A 1LVGA 1I2AA 2ASEA 3NJ8A 4NU5A 1PT5A 5THKA 2QTAA 4LWPA 1HUQA 4ZYLA 4AJ1A 3WOHA 2ZYDA 1P6QA 2PZBA 4GC5A 1DVRA 4NMXB 2A4KA 4MVJP 2D00A 3QEJA 3QVGA 3WQSB 1GPJA 4DXAA 2PL1A 4YXWD 4RL4A 3OZFA 2JGDA 1JQDA 4GKVA 2RCNA 2RGEA 2ZTUA 3TR5A 2C9BA 4YRNA 3MXTA 5I4IA 1OILA 4QPJC 3UUEA 3PUXA 2C1ZA 2IYUA 2CVPA 1JXOA 1L5HB 2J5QA 3WYDA 1FXWA 1U0LA 4FOOA 1LQUA 1SC4A 3DHWC 1RKXA 3GT4A 3TB4A 1ZG3A 2WDPA 3MWLA 4EUSA 4PNPA 5MGNA 3TLEA 3TX6A 3ASUA 4OK6A 1JQ3A 3HXKA 5KKCA 1X1AA 4UHEA 4BNKA 4UVIA 4RE6A 4Y3UA 3EWNA 4CG2A 3DE7X 1XKQA 3O8OA 2OZLB 3PRYA 4C4YA 5GADl 3LKDA 4ZHQB 3U49A 4X97A 3W2TA 4KQMA 1K9SA 4P9NA 5BOVA 5CB6A 1VCMA 5KNDD 5DB4A 1X15A 4BE9A 2I4RA 2IIQA 5HBRA 3HXMA 4B82A 4FDUA 1JE0A 4WGFA 1CUUA 5JO0A 5AUNB 4IGKA 3DWFA 1A4UA 1L4LA 1DJNA 5LJIA 1Z2AA 2ODBA 3T9DA 2O3TA 2HMWA 2XTZA 5M3BA 3QEMB 2HHHB 2XCLA 2PLAA 3W6ZA 4YBRA 4PONA 3SEQA 4ED9A 6REQA 2Q5LA 2J67A 1I1HA 2R751 1I4WA 3C6QA 3CLSD 3MCWA 1NPTO 1UWLA 2YC4C 1TVMA 4HL6A 4L02A 2HT6A 4XM0A 1CEYA 4GOKA 1JMKC 5E6UB 3KOOA 3O4HA 2YWDA 4U3JA 2I1LA 4Y2YA 1KPHA 4MUXA 2WU1A 3ZDBA 3WL7A 4UULA 4CU5A 4TS9A 4CQMD 5C3MA 3MLEA 5BN5A 4DDMA 1IZ7A 2OOSA 2VF5X 4IHQA 4JWTA 2VAWA 2OFPA 5EIXA 3LBYA 2GHRA 5AHXA 2EBFX 4D4HA 4KR0A 5E9AA 4LCBA 2R1VA 2EEPA 3JYQA 4EY5A 5DK4A 3A3YA 3AI7A 4BEWA 5J2TB 4HZUA 2WV7A 5J4YA 1SKQA 2O48X 3VU3A 4YA6A 2HREA 3FZNA 3S0JA 1VPWA 1CJMA 1V25A 2B8WA 5G1OA 1MEJA 3H7AA 4YCSA 2PGJA 1JHRA 2VBGA 3G0OA 3GRAA 2XXJA 5ICMA 2IW1A 4R5MA 2G4CA 1KZ4A 1YZVA 3B1ZA 1SBZA 1UPCA 3PNSA 4IEIA 1NMQA 5EXDA 3S68A 5HJ7A 5JC1A 3AL0C 3BBLA 3HJBA 5H7XA 3L4EA 1X8JA 2D7CA 1FMFA 4HDKA 2ZI9A 4O4IF 4KFCA 1V7QA 4FQ7A 2CUNA 2WYUA 2H1HA 5C2JB 3DKVA 2BE9A 3UBTA 1YGYA 2R7AA 3G2NA 3KV3O 1Q83A 1DUIA 3OIFA 4ND5A 4XM2A 5EXSA 3ZQJA 4AS1A 3HG7A 3OZBA 2R8EA 3PPVA 4XGRA 2OFFA 3LFTA 4XQ0A 2YWXA 4ECEA 1GGEA 1T0UA 2JAWA 1Z9BA 1O6BA 2AI2A 3DCNA 3L2OB 3O2QB 5A9SB 5JZOA 5TLSA 3ELYA 3GG9A 4YK7A 4BJ3A 3RUEA 3MFYA 3MTEA 3C85A 4LYYA 1GCIA 3BILA 3E0XA 1ZJJA 2P2DA 1TFRA 2Q6KA 4LTDA 4KUGA 2JFZA 1C30B 4AD8A 2NPIA 3KR0A 4KI0A 2ODTX 2GZ1A 5BWMA 2HMSA 3R20A 1ULBA 1H4QA 1H65A 1Z12A 1FF9A 1C5KA 1IYZA 2C5GA 2JARA 1K6MA 1AZSC 1T9AA 2YASA 2HQRA 3RC3A 4EOGA 3JD3A 5E9WA 1I9GA 4JC5A 3DTVB 1F2UB 3TW4A 2Q1YA 1NAHA 3IDFA 1P4SA 3HADA 1KDYA 4ILKA 1G1MA 2N0SA 4QYSA 3RASA 3DH0A 3RU9A 3UJ8A 1YZFA 1NI4B 1M1NB 2EAUA 1MLDA 4B83A 4UNRA 3N87A 2J9FA 3CSDA 1VLZA 4LRQA 2YYAA 1P3Y1 1ESNA 3RUAA 3T99A 3ABOB 3PB3A 1PIWA 3UJ7A 2I7TA 1LBIA 3UNXA 1E2KA 1PJCA 4XQGA 1USVA 1S2NA 1IEQA 4IDOA 3QP9A 3ETGA 4BNFA 5ERXA 2M32A 4GOMD 4RS3A 5CRIA 3OIUA 5GJWC 4CETA 5K6AC 1FYDA 4UZSA 4D4IA 4MV0A 4MV3A 1MIOB 1EJ0A 5IAAA 4DR3B 4MTLA 4WFIA 1E3WB 4JJKA 4BL5A 1UXIA 1VXOA 5EGSA 5I7SA 3E2PA 3IT1A 5B12A 3JS5A 5JXJA 1P3DA 1HFJA 5LQCA 3ZDZB 1PX2A 4UXJA 4ZYYA 2FZKA 1LPPA 1ZEJA 1LTHR 2QJWA 3LVFO 1HBJA 1PGPA 1PJLA 1WW8A 2GF0A 2I4IA 3IO3A 3SQWA 4JB8A 2IS1A 4AL4A 1BHQ1 4R9RA 5JCOA 4LSGA 1FVXA 2JCYA 2K87A 2R9VA 2CMFA 1Z22A 2EZUA 2KHZA 2PWBA 2D7JA 4HR7A 3W78A 1EB8A 3GLGA 1PWZA 2HK7A 4H1HA 2QRVB 5IH3A 3PXEA 4DPMA 3VPDA 4AZ0A 3RV4A 1XVAA 1DXHA 2HF8A 3PXAA 1BD4A 3HN6A 2DECA 1RYFA 3B36A 3D6MA 1VGVA 1YFKA 5AI6A 3X1MA 4A27A 4D97A 3TSWA 2RHWA 1D1PA 1VKNA 1P6UA 3I23A 2PMKA 2OENG 3C3DA 4KFTA 5K3EA 1GRNA 4R2XA 4UVEA 5AW3A 2ZRIA 3AUFA 4YRBA 1GITA 1M2VA 1W1UA 2ZRQA 2IEAA 2NSDA 4CUKA 3R7FA 1T9BA 1V2HE 5HMLA 2LIPA 4BC0A 3K1TA 2ZJ7A 2VATA 4U7GA 2IZ6A 3ZW9A 1Z7GA 5LBTA 1BE0A 1SVUA 2AOXA 1XVTA 2HBZA 2JATA 2DLCX 3UMVA 3ZGVA 4QPNA 3RC2A 1X39A 3WBBA 2OO5A 1MF7A 4I8XA 2OBBA 3OEHD 1GGNA 2H5LA 4FS8A 2UVPB 3TLKA 1ADCA 1U28A 1XRNA 2YJ5A 3Q3HA 5E1BA 1EUDA 2WIBA 1V43A 3RS4A 4DM4A 3AVYA 4XKJA 1SQFA 3TW8B 4WV3A 3ZBPA 1CB0A 4BBPA 2ZR9A 1KTVA 3U4DA 5CCEA 1FDUA 3S99A 5ADHA 3VKGA 3CB2A 3E22B 4AUEA 4CCYA 2W6JD 3HH8A 3L04A 1SVMA 2C9MA 1OI3A 3DZIA 4WOPA 4N65A 3L92A 3EQ7A 1FPQA 3OQJA 1A9PA 4BECA 4EENA 2R6CA 2TMGA 4ZAYA 3AG6A 4WNIA 5EPOA 4RSRA 2QLBA 4TTVA 2JLUA 3WC4A 3AQ4A 3BRCA 1N0UA 5SV2A 4IQFA 3PFHA 1OH8A 1UP4A 1GEEA 2NW6A 3UKJA 2GFQA 2PS3A 3L8MA 1GGMA 1KE1A 4ACBA 4B73A 1MEOA 4BZQA 9ABPA 1TPYA 5LVAA 5ALVA 1AKVA 1WZIA 4UEQA 1P80A 4P53A 4X64B 4EL0A 3QF7A 1SFRA 4O29A 1L7PA 4HAWA 5KMGA 5LNK6 2XV1A 3R9KA 3E2IA 5BUCA 2AX4A 3BHJA 1UMCA 4RSHA 1BWQA 2OO7A 3NGLA 1J5XA 2PKXA 2R79A 1E3MA 2ONCA 3ZNPA 1UR5A 3MLBA 1LBEA 3R4VA 3GFOA 2WJWA 4AZWA 4G2TA 4L8FA 3K0AB 4J7CA 2KBFA 1PI3A 4J0EA 1F20A 1T6NA 2HPHA 3OJCA 2TMKA 3DTVD 4BXOB 1Q16A 3WZMA 3HZZA 1KWGA 3R9XB 4JXXA 1COWD 1KK0A 2SKDA 5BSEA 2DFPA 2PO7A 2FPKA 3EVGA 4MV9A 5BSTA 1VE5A 1XEFA 3BTOA 3WTBA 3V2GA 2V96A 4DQ0A 4IYJA 3KKMA 4TMYA 2DERA 1ATIA 1EQ2A 4GAEA 4I9GA 3FNQA 4N47A 1C1DA 2MT9A 1G66A 5DSZA 2OL4A 1YB4A 4GI1A 2PZEA 3SK0A 2B69A 3OFSA 3PUZA 5L51A 2D13A 2QYSA 5FR2A 3A10A 2HKIA 1Y9ZA 1JLMA 4DQDA 1EX7A 4OI1A 1ML4A 1XWWA 4OI4A 2W4MA 2EHDA 3I76A 2NO0A 3AG5A 2WK1A 2HYDA 5IKOA 3PC8C 1HH4A 3VNVA 3N75A 5A7FA 2X23A 1YMVA 2CVOA 1QH1B 4MRMA 5E8JA 5KNLA 3DZGA 1AGNA 1QXSA 2FVXA 4X0EA 2B21A 4YX9A 3MQFA 2GYWA 5BO5A 1UFQA 4RGYA 3UMMA 3TOXA 1CQZA 3FOWA 2I2FA 1I2DA 1OWMA 4FP9A 3V2HA 1D2NA 2C3UA 4TRJA 3TX2A 4YT8A 3C41J 3TNFA 5EJMA 2P11A 3GD5A 3L6EA 2GYUA 1Q17A 4WPGA 2D3TA 3MQ2A 1QMGA 5FULA 4E5PA 2GAOA 2XPCA 1JR3D 2OY0A 4D25A 4H35A 1HDIA 2A1IA 5KTYA 4MUFA 5JNUA 2VYVA 3QX3A 4LZOA 3LL4A 4MWCA 4RF3A 4MCHA 5FNVA 3T7AA 4X92A 3U0BA 4L16A 4DADA 3KR2A 6PFKA 5HXAA 1BKYA 2ZXFA 1DHRA 5JSUA 3AZQA 1MOZA 2VP3A 3VSCA 2IX9A 5J5CA 3D0OA 1HTWA 1G64A 1EFAA 2X3UA 5HIJA 3FNIA 5IW8A 1IUOA 2ALJA 3IHTA 2ZUUA 1PQYA 3RYTC 4RZ2A 2G08A 5CVDA 3TLBA 3CWCA 2Z1DA 5IC6A 3X43A 3FDIA 3PQFA 5ALUA 3V4RA 2BZ1A 2AEJA 2C59A 1RD4A 3NEPX 5MN5A 4K86A 2H8KA 4NZOA 3Q8LA 1SUIA 4RPIA 5CR9A 4D9MA 1OU0A 2V7TA 5DZSA 3GUYA 3LNTA 2B4YA 3QELB 1KEEB 5AP9A 1WSAA 5JADA 4QM6A 3R5TA 4U2DA 4RJLA 4GVLA 4ZQBA 5J1TB 3ECSA 4PV7A 3S2FA 1P7VA 1K4YA 1QIGA 5E7QA 5BQOA 5LYYA 3LA6A 4DMUB 1JEQB 3H9BA 5HSGA 1AQNA 1UQTA 1ZUNB 4XX0B 1VL1A 4BJHB 4GM4A 3ZX5A 3CRZA 2F3UA 1KAHA 4CKBA 4KPEC 1JA0A 4EFKA 3VBCA 3GV0A 3RGGA 3O1LA 1YCDA 1U80A 2C2MA 1QVZA 3CNLA 4DLYA 1XC7A 1JSXA 1XRSB 2JFUA 2ACEA 2QPOA 2XKJE 2PA3A 1KJWA 1UBEA 1NG9A 1CS0B 2Z3VA 3CH5A 5L7YA 1T9GS 3QOFA 4ZREA 4DCOA 3G85A 2HN9A 3EC1A 4L51A 1HOXA 4MRPA 4U6QA 1PEAA 1B15A 2C1EA 1N34B 2G5TA 4RQTA 3UMYA 4HGOA 4K46A 2VP5A 4CIYA 2NUAA 4I14A 5DBIA 1WVGA 3ABZA 5C8YA 3TBHA 1A8IA 2PUGA 4D4KA 2QPLA 4RVFA 3FIUA 3S55A 2OAQ1 4KAXA 1CY7A 4XVQA 3A4NA 5K6RA 4UHKA 2VEDA 1JSCA 1KU0A 4C04A 5BQFA 1QVVA 5ITWA 1MDFA 3WK5A 4CQJA 2GTIA 4M60A 1H9BA 3FDFA 3R3UA 5CLIA 2VT2A 2GD6A 3PK0A 4EW3A 3L1UA 1B8PA 3L4BC 4LW8A 3TLMA 5KYVA 4DIFA 2Y05A 3M2PA 4O1MA 1EA7A 4PZLA 3ND9A 1P72A 1ZK2A 3ZWQA 1AB5A 3AVUA 2I65A 4ON9A 1CUAA 1E5DA 3NI2A 2ZIVB 2VT6A 3LE8A 2GPTA 5BUSA 4LFBB 2I4MA 3GJTA 3KYIB 1VPEA 4AAYA 1AQLA 2H3HA 2GILA 1OXBB 2XUFA 4IXDA 1NASA 3R6WA 2I1VB 3EN0A 3GLFB 4ZVOA 1Y5MA 4D3DA 4ZO7A 4M0MA 4AG3A 1RBYA 2FU5C 4JEIA 3KB2A 1P45A 3FWHA 4CLOA 1QG6A 1AQ6A 3RIMA 1PJ4A 3EB9A 1XXHA 5IFKA 1GM5A 2Z5VA 1PNOA 1WZCA 2B3TA 3IEPA 3M9LA 1FJXA 1CY6A 3SDSA 5DI3B 1A88A 4KMOA 2F64A 2H4XA 4LDAA 5AVXA 1XTRA 3O3NB 3KXKA 2EZTA 2DETA 1JF8A 2AG6A 3K1YA 1HYHA 1V1JA 1ZUHA 1CR1A 1S4QA 3GK3A 1EFHA 2Q3FA 1E79A 4K9MA 4KVZA 4ZPXA 1BXZA 3ZVRA 5HOEA 5JRZA 1XQXA 5KOIA 3HYNA 5PNTA 3UTCA 3ICVA 1QV9A 4DG8A 2BMDA 3P9SA 4O1HA 2Z2XA 2J4FA 1DTSA 4BZXA 1SD5A 2IFTA 3BAZA 3D4PA 2XLBA 3VZRA 4ZOQI 2BKVA 3PNYA 1ZH6A 2JFHA 2NUTB 1GTL1 1AQUA 2ZRBA 1ZINA 1UEIA 2PWZA 1A7KA 3MOGA 3NHRA 1R5BA 3H4TA 3PSHA 1PS8A 1DC8A 3FNBA 3QPDA 4UMVA 1I7SB 4K6GA 1RXIA 4J29A 4FGWA 5G02A 4HD8A 1JECA 4B2LA 2ZUVA 3OH8A 3CF4A 1D0SA 5F51A 3P2JA 1HT3A 5LPNA 3VAYA 1OWOA 1RPAA 2HEGA 5DW0A 3OICA 2IYOA 4FE7A 4A8JB 1DRKA 1CVLA 4BNTA 1EP9A 3R7LA 4JROA 3A1UA 4U5QA 1Z73A 1J99A 2REBA 5G4KB 1M2HA 1E2FA 1ZK3A 3FUUA 3COZA 5F77A 2CDRA 2IHTA 4J4HA 3USZA 3W9SA 4UE3S 1XCBA 4PG4A 1FJGB 1Q20A 1UT8A 2B82A 4D81A 2VNHA 1FSZA 3S7ZA 3WKBA 2GX6A 1P0FA 4H4EA 5KTSA 4G5HA 4FJ1A 2IEDA 2IK8A 4BFSA 4V0RA 3RRZA 4LVOA 3UOGA 3TDNA 5JBIA 4QUIA 1E3DA 4GXTA 4JB0A 1RU3A 4E2XA 4FM9A 1H23A 2MHCA 2ICAA 4RESA 5EQTA 5CA1B 4DR5B 1KI8A 3Q0EA 4R1NA 1R0YA 3VC3A 2QV0A 1NJ8A 5EIBC 4DC1A 1E0KA 4K26A 3FVTA 1G42A 1RLIA 3IMCA 1ZXXA 3WGOA 5A1TA 3BRQA 3T1OA 1SQGA 4BVBA 1NP3A 4ZI5A 1DG9A 3LUBA 3SG0A 4PU0A 3LYAA 4R0NA 4Y6OA 3IE2A 1YQXA 1V1MA 4KPUB 3NBMA 2PXXA 2PSJA 3EIXA 2IITA 1S8OA 1ZWLA 2EG9A 3GPIA 3SKVA 4RY8A 3VKFA 2A1TR 4BTEA 7YASA 4RHYA 1ML3A 1DJQA 1FYWA 1IVSA 3AF1A 1VIYA 3JYPA 1EVEA 1RHQA 2GXSA 4QU5A 2GPNA 1P4RA 3D02A 2J0EA 3W7AA 5CBPA 4QG3A 1LGYA 4DTIA 4AZ3A 1Y6QA 5EXXA 4M8NE 3EIEA 4Y2UA 2A84A 2I54A 3I6ZA 3HK2A 1NW5A 3C6ZA 1LS1A 3K30A 3HCFA 4Z8XA 4LJYA 5CT5A 5DTMA 2MR6A 4KGVA 4DEXA 1XRRA 4Y7DA 3OM8A 3TBFA 1Z18A 1OFIA 2JFQA 3HJHA 4AN4A 3I1IA 4MIOA 1L7AA 1ZMOA 4KV7A 4LQLA 1L4GA 4BFTA 4MDHA 4B85A 3NAQA 2D8AA 1N6NA 3Q7RA 3KB8A 4N39A 4WUTA 1CF9A 4LPKA 5JH7F 3K92A 1GR0A 3U7JA 1N9GB 3H11B 5KB3A 2NTVA 4Z7QB 2I4TA 3K0EA 3GAZA 2L82A 3L0OA 4OH7A 1G7CA 1T5BA 3VHQA 1L5MA 1Q14A 2A5LA 4MW0A 5U1PA 4MRNA 3EY9A 4AMBA 3RG8A 1H6BA 1A7AA 1Y63A 2FPMA 1XWIA 1Y89A 2EC5A 2E4YA 2ZYIA 3K35A 1XUOA 2FPPB 3PGXA 5JJ5A 5CLQA 5EZYB 1X1SA 3UMFA 4WXEA 3K2IA 3OCJA 5G2OA 3COVA 3OLCX 4KSCA 3UMRA 1ESZA 3TGLA 1L5QA 1R50A 1TM5E 2GMWA 5HKKA 3ZWYA 4H4CA 4LZZA 3A9UA 1XVLA 5L8VA 1TC2A 3K0FB 3VDQA 5MN4A 2VDUE 3M6LA 3MRVA 2PWPA 1MV8A 1V9LA 1Z4IA 1WY5A 3AEUB 3ICPA 4JBLA 5CT6A 4NCNA 4UE6A 3WLSA 3W90A 1N8TA 3MELA 4LJ6A 2FETA 2JVIA 1TAUA 1AJEA 3H2SA 5ALXA 4DDVA 2H00A 1PSDA 3OU7A 1RW4A 2VXCA 3BPSA 3C5CA 4YQEA 3HN7A 4EB0A 2PX2A 1LZLA 4PZUA 4UNNA 4EGQA 1JAZA 5JY1A 3B9RA 4LSWA 4YLEA 1Y6ZA 5EWLB 4BTLA 2EEZA 5EJIA 4GO1A 1T24A 1VRCA 1RJWA 1SKYB 5DWVA 5ITVA 2QY6A 5FLEX 3EC7A 2DQ4A 1G5FA 1Z63A 4IEEA 4MWTA 1XQYA 4KN6A 4CKXA 3DEAA 3W77A 5GONA 2VDWA 3NASA 4BQIA 2RONA 4YQFA 3QVKA 1XA4A 4DNPA 4MO2A 3RRFA 1X1BA 3MIZA 3NEYA 3R41A 4LX8A 1MZPA 2XVYA 4WK4B 4C87A 3OMXA 1VHQA 2BR4A 5HE8A 4LV8B 2H2HA 1M7HA 1KJYA 4JLAA 5LUBA 4ATNA 4LOHA 4BJ1A 1QE0A 4B4UA 4I3FA 3SP1A 1VSBA 5GGYA 3UTDA 2BEWA 2VJDA 1N6KA 3E9MA 3LF2A 4NU8X 4HAOA 4AM8A 2V5VA 4ZJZA 3TNJA 4Z4IA 2VSYA 1QBKC 5F5NA 4FINA 2C7OA 4O08A 3Q6NA 4CDRA 4HBZA 1X0VA 4DUGD 1YF3A 3U62A 3BH0A 1A97A 3ZIAA 4YR7A 4LXGA 3ROFA 3AF4A 3AXTA 1VMEA 4IQ8A 4GPEA 2BRUA 2E3JA 1OV6A 1FE8A 4KKVA 4L5CA 4M7RA 4QJ3A 1K7YA 5EHIA 3U61B 2II6A 2GNPA 1HTBA 1SIOA 3HYCA 4I8IA 3DMTC 3E9NA 2O7NA 2YHIA 3O2JA 3V4FA 1N1DA 4IGFA 5AKKA 5KJFA 3RAFC 3DFZA 2NVOA 1HEIA 1AHHA 1QJ4A 3EQ8A 4CV0A 2CLCX 4XYMA 1RBQA 2CEAA 2WVHA 3CZCA 1UBRS 2HFJA 3NEAA 2NQ8A 4PAGA 1TUGA 3WGYA 2QZ4A 2ZI7A 3MJDA 1S2IA 2WJGA 3GJ4A 4IXNA 4BMXA 3GC6A 1JEAA 1WCYA 3QTTA 4ZGBA 1QO7A 1G5TA 4I08A 3KPWA 4INJA 3C5WP 4B17A 1CUZA 4RTSA 2XGOA 2EBWA 2EBHX 4HLDA 1JDZA 4CQMB 5LP6A 2RH5A 2VLBA 3ABSB 4UXHA 2FEOA 3CE6A 2GK6A 3UB4A 4BN4A 1ZJYA 3J7TA 2YNMA 4A6EA 4L22A 4Y0NA 4Q3LA 4W8OA 4BQRA 1IBLB 2CL5A 2IPLA 1B23P 2I03A 5KHLB 3EPJA 2XUQA 1TGVA 3VZPA 4RTNA 2RBEA 4OREX 1W34A 4IXTA 2R85A 1XTTA 1BEZA 4H7IA 4KK3A 5JZVA 5CT9A 2XNCA 4QDUA 2Q3HA 3H2IA 5FWXA 4OM7A 4IDEA 1JHAA 4R54A 2XXAB 1X2BA 5F2KA 4HAZA 5HP4A 1Z5PA 2CXUA 1INLA 1GVHA 2XAUA 3B53X 5LBIA 3RIGA 4CQNA 3CWQA 5DLEA 1KVUA 2EF1A 1VG0B 3JQGA 3PEEA 1BCSA 1XQVA 5IYZB 1CQPA 3P20A 3CNHA 3I0ZA 2CD7A 1ZNZA 1Z2DA 2X9GA 1ESEA 5KNBD 4GQBA 2NMVA 4LI3X 2CB0A 2VYNA 3KLNA 3Q0TA 1ENPA 3DVAB 4TMZA 2JZCA 3NWBA 5B7QA 2IXEA 3KQVA 4AS3A 2C9CA 3NKFA 3SJAA 3CBGA 4BX8A 1OW3B 2DULA 5I4BA 4OVKA 1J06A 3TB6A 5KU7A 2UYOA 2NVUB 3WRXC 4BP1A 5CVTA 1SBQA 4C2TA 1FFAA 1KZ7B 2VRCA 4NNOA 4RE5A 4D57A 1R6UA </