4PHGA

Crystal structure of ypt7 covalently modified with gtp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
176
structure length
176
Chain Sequence
b'KNILKVIILGDSGVGKTSLMHRYVNDKYSCQYIATIGADFLTKEVTVDGDKVATMQVWDTAGLERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein YPT7
publication title Locking GTPases covalently in their functional states.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis,exocytosis
total genus 52
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phgA00
1ZYUA 3R7WB 3VHLB 5DNYB 4ZCMA 2EQBA 1XX6A 4JS0A 3D7MA 3Q7PA 4M4SA 1R8QA 4IOMA 1YZQA 2YVUA 3GJ7A 4WVFA 5FOXA 3EWSA 5J4LA 3SEAA 5AUOB 5E95A 2CHGA 1JALA 3LAWA 1DE0A 3I62A 3MWLA 3U3RA 4ZDIA 3LBNA 4RD0A 1KY2A 1XRJA 2ATVA 1XXHB 4PZLA 3QEOA 4ABYA 3QF4A 1U0JA 2OXRA 3K0EA 3QXSA 5BW8A 2XNSA 1CP2A 5IK2D 2NPIA 4L5BA 4PHGA 1VCMA 2O8DA 2GNOA 1G5PA 2KB0A 2CJWB 4W5JA 4OK5A 2GHIA 2X2EA 4XOIA 4BZQA 3TAUA 1IM2A 1MRSA 2FSGA 2PJZA 4V03A 3WHKA 1VIYA 4JBWA 4P4UA 2PX3A 2YOFA 3B82A 4ZDKA 1FMLA 5EP3A 1U99A 2HUPA 2CCJA 4EFLA 2BKEA 1ZBDA 1II0A 2ZRFA 3H2YA 3K0AA 2J87A 1SXJA 1FUKA 1FMJA 3K09A 4EPXA 2HYIC 3E1SA 1Q21A 1VECA 4HI0E 4DWJA 3NBZC 3T06B 5EUMA 3OIUA 5L3QA 4D82A 2IX3A 4QHSA 1PJRA 1EESA 2VF7A 4DCSA 3IUYA 2Q3FA 3QVUA 3PUXA 1UAAA 1U90A 4Q00A 1VYVA 1GWNA 1GOTA 2BCGY 4DRZA 2CLSA 3PCRB 2W58A 4MRRA 1H8ED 1F2UB 4B6FA 3BFKA 4JLVA 3THWA 2O8CB 3L0OA 3B2EA 4TMWA 3U7HB 2ASEA 1G19A 4KFRA 4O0MA 4Q1EA 2V7QD 3X1XA 2Y8EA 2IYUA 1VYTA 2P67A 2GESA 2QMOA 2XZPA 5GJVC 4EDHA 1W36B 4D25A 2P5SA 4GMDA 4BQSA 3U3JA 3GEHA 4LJ5A 1KHTA 2GJSA 4US2R 3SNHA 2WAYA 4F4IA 2V9PA 1PVOA 1L2TA 3REFA 1TU4A 1A2BA 3JZMA 3KTAA 1N0VC 4URXR 5EXSA 4CGZA 1YVDA 2G6BA 1G8YA 1TEVA 3SR0A 1E2HA 1VIAA 2KI5A 4EPYA 1FPMA 4HLCA 5FTNA 2J0UA 4A92A 3PEWA 5DI3B 5K8IA 5AJXA 3QUSA 1FFHA 4AY2A 4G5GA 3W8NA 2CXXA 2IYQA 4LC1A 2A5GA 2GETA 5JEDA 2IWHA 4YMTA 1Q22A 1TX4B 2V6IA 4MKFA 4NP6A 4QRHA 2QBYB 1GRNA 5JJIA 4BFUA 2IS1A 2O8BA 4PXAA 2Q21A 2ZRHA 4V0ME 1YZLA 3PUVA 4KBFA 1VHTA 4LHZA 2UVQA 1UEJA 2CL7X 3EWAA 2J59A 1XD9A 2IC5A 2NG1A 3R9WA 3GJXC 5HZKA 2PH1A 1GKIA 1P2UA 3QQ5A 4IXNA 2ZVQX 1CR1A 1W0KD 1E0SA 4MITA 1GZSA 2WAXA 1VYUA 1IY0A 3QPVA 3PUYA 3HDTA 1DO2A 1M6NA 3FPAA 1SKQA 1NMYA 3KFXA 4Q1FA 2VTKA 4PSVA 1S2MA 2IYXA 3CBQA 3G0HA 4XTRA 1J70A 4JLKA 5EP4A 3KQHA 1RJ9A 2HEIA 4LBVA 3GLHE 4DHEA 3IQXA 3TAHA 5CB6A 4Z1MD 2ZPTX 3KXKA 3QENA 3QBTA 3D8BA 2ZE5A 2PJRA 4GPTA 4LV6A 5AUQA 2F1HA 2WJHA 1QHIA 3H1TA 1OYWA 3M0EA 1COWA 4DDTA 2KBEA 3SHWA 3QKSB 2FN4A 2G0NA 4RCYA 4EKDA 1Z3IX 3JVUA 1P4SA 1NKSA 1LY1A 1T0JB 2FU5C 3LX8A 4TYPA 5FBRB 4NYMQ 1NJFA 1DPFA 1XMIA 3NG1A 3SC3A 1GP2A 1K6MA 4PHTA 3B13B 3PJRA 2YWHA 4OYHA 4L9SA 1T6NA 1DG3A 1XEWY 1FTSA 3W5IA 2J0QA 2ZITA 3WBJA 3IEVA 2W6IA 2ZEJA 5FL7A 1UBFA 4URZR 1E96A 1KNQA 5G40A 4B47A 3MGCA 4QBFA 5C2JB 1TL7C 3QPUA 4BFYA 2JJ8A 2IUUA 2OCYC 3WNDA 1HA3A 2ZAMA 2I3BA 3HWSA 4C7OB 1AK2A 1XD2B 3HU3A 3N2IA 4IVPA 2JA1A 2YINC 2OBMA 4KAXA 5JMTA 2F43B 2A3RA 1UDXA 1T3SA 1K5DA 1QHHA 4A2PA 3R8CA 3GEEA 2E1RA 3R20A 2PMDA 2PMKA 2W2VA 3K9HA 1YE8A 5KU1A 4Q1DA 5HKKD 1DEKA 3GP8A 3T15A 3C16C 2V55B 3TRFA 1US8B 5H70A 2QAGC 3FGNA 2JLQA 2VF8A 3BE4A 3AVVA 2AXPA 3QKTA 2ZUBA 2V8OA 4I1VA 2FSIA 1AKYA 1R5OA 1TPZA 2ZJ2A 4Q18A 3CRMA 3CZPA 3EARA 3KXIA 3OEHA 4Q9LA 1Z6YA 1WE2A 2IF0A 5J4VA 3T12A 1QDEA 3CF0A 5DHFA 2C2HA 4UJ5A 2ZU6A 1S0UA 2D06A 3K8YA 3IPXA 1MT0A 4WOPA 5BN3A 1U9IA 1E2LA 1PUIA 1RRCA 1IN8A 4M53A 4PPGA 3SYNA 3VR3A 3UXMA 2GILA 2R6CA 1F60A 3HR8A 3THXB 4KSBA 2J0SA 1P2SA 2ZU0C 1LF5A 4F93B 2QE7A 1XTJA 3TSOA 3VX4A 1KOFA 4EJSA 2H92A 4Q21A 2AD5A 1KK1A 2A5FA 1VG9B 2D2FA 1T0HB 5C18A 2J41A 4PSKA 1TNDA 3I72A 3EW9A 4TLCA 1PUJA 2H5EA 4WAUA 2ZE6A 821PA 2FJUA 2GWHA 1Z0DA 4US0R 4DLWA 3MG9A 4Q4AA 3CPEA 4IVQA 3VX3A 2WTUA 4XTCS 4TMKA 2I4IA 4IEEA 4Q7KA 4BFTA 2MMCA 4B76A 2QM7A 3B9QA 721PA 1CRPA 1BKDR 1G3UA 1G7CA 1N6KA 3AP2A 4HAWA 2AK2A 1CIPA 4TYWA 3QG5A 4LZZA 2BBSA 3NC0C 4A0RA 1FUUA 1KYIA 4PPQA 2GTPA 2ZRPA 3LQQA 5AJWA 2CNWD 3B1WA 4C0QC 2B8TA 2BMDA 2B21A 2RGNA 5EP1A 3V4RA 2Z43A 1KO1A 1TQ4A 5CYPA 2BMEA 4V02A 3GLFA 1LS1A 3CM0A 2ZVPX 3Q5DA 4HDCA 2X77A 2OFWA 1P62B 2R6FA 1NVVR 3AEZA 5CIWA 2GVDC 2X8AA 3A1TA 2GBLA 4Q5IA 4ZI2A 3KL4A 1OFHA 4ZIRA 1AKEA 2WMOB 1NBMA 2P5TB 2QTHA 2ZI4A 3CPHA 1SVIA 4Q4HB 2JASA 1NVWQ 2F6RA 1OH7A 4K81B 3GMTA 2JATA 5HTKA 1CJMA 3CX7A 2C99A 3FMFA 3NHAA 4PR0A 3W8RA 4HB4A 1JNYA 4KFTA 5DN6D 5JS7A 1DAIA 2ZI3A 5EE1A 3VU9A 2QQ0A 4M1TA 4MGIR 1GL6A 1Z07A 3FFAA 2LWIA 1VMAA 2Z6VA 1GUAA 2ZR7A 3RSOA 2RGAA 4NH0A 2XZLA 1W47A 3BFVA 3IPYA 4HAUA 4MGZR 4QJ3A 2NPFA 5K8UA 4OQXA 1TU3A 1IN5A 3W6PA 2ZM5A 2CCGA 2FPMA 3SYKA 1OF1A 5FPSA 3B1ZA 2JEOA 4MRVA 3K1JA 1TAGA 3QPWA 2XEXA 2W2XA 1S3GA 1GILA 4Q7MB 3TIFA 4XVQA 3KZ1E 4PQYA 5DH9A 5CDFE 2IT1A 5B64A 1T9HA 2H8KA 2Q0HA 3THYB 3N2EA 5JECA 4PC7A 3CRVA 3QSYA 3BD9A 2O0JA 2PZEA 4A4DA 4GMXA 1TF2A 5L3SB 2PL3A 1E2GA 5DSZA 1MR3F 1JQLB 1GIAA 4NYJQ 5A4JA 4HZIA 1UBCA 1F2TB 1NLFA 2QA5A 3WRYC 2BJWA 1K8RA 3NBYC 1UEIA 1V5WA 1OH6A 3BIFA 4G1UC 1UADA 1R7RA 3B85A 3QIAA 4LOAA 4PHHA 1JEDA 1K5GA 3CR7A 3KJHA 1L4UA 4IOLA 1G8HA 4DVGA 1RYHA 3CX6A 1SVSA 1KY3A 2TMKA 3UG7A 4BLSA 1E6CA 2VSOA 2PCJA 2VEDA 5HE8A 1FZQA 3SE0A 3L0PA 4AKHA 1Z22A 1IN7A 2BKUA 1G3QA 3PUWA 5JCZA 3GJ4A 5FPHA 1KI9A 1A1VA 1HYQA 3TKLA 2GZDA 3I4LA 4DLUA 3GLHA 4PSAA 2ZJ5A 1KI3A 4G0NA 4JLNA 1FTNA 4NCHA 1YR6A 1HURA 2QMEA 5IHPA 3W6OA 1OIWA 2ZSAA 2QG6A 2A2ZA 1IAQA 4QFMA 1B23P 4EPTA 3K0CA 1ZVQA 2YC4C 621PA 6Q21A 3FKQA 1SXJE 1AGPA 4A0FA 1XPRA 1Q1BA 3U44A 2WWFA 3I8SA 3DHWC 4C4PA 3BOSA 1ZM3A 1Q1EA 2DY1A 4RFVA 1ZCBA 4JT4A 5KSZA 1WP9A 3V00A 1XMVA 4UXHA 4HAYA 3UMFA 3AB3A 3ZIAD 4GRAA 2IF2A 3PVSA 1KDPA 1RE0A 2RB4A 1KMHB 4LHWA 1JJ7A 2Q3HA 1W2HA 3C5HA 4DT1B 2XTZA 2O8FA 2GAAA 5FOUA 1SXJD 5D3MB 3EPJA 4C3ZA 4B3GA 1KK0A 2RKOA 4OBEA 3RS3A 2RGBA 3OE7A 4I99A 3FE2A 2WOJA 4Q03A 2A5YB 3A1SA 2VHJA 3NEJA 4TQ9A 1R5NA 2UZIR 4LK2A 2J5XA 5LB2A 4TL6A 2QMUA 4ARZB 1P9WA 4ZKDA 3F5FA 4CEHB 3T1OA 1G3RA 3PR1A 4OQLA 1AA9A 4DBLC 5CJPA 1G3MA 2GAOA 5FUXA 2ZRBA 4QG7A 4JIMA 4C30A 1ZUIA 3K70D 3RS0A 4B3BA 1TF5A 4DSUA 2WSMA 1W4CA 4JBYA 4U7DA 4LJ6A 2IUTA 3AH8A 4QXAA 4DLTA 2H57A 2NO7A 2QMHA 4BFVA 3GJ0A 4C0LA 2CE2X 1Z0JA 3Q72A 4FMCF 4QGHA 2ZRMA 3R9XA 5GJBA 3E5HA 1A4RA 1JAHA 4EPRA 4P0TA 1R0YA 3A4NA 4JYBA 2QROA 3A1UA 4LUCA 5G41A 1GKYA 4FIDA 1E2QA 4EAQA 3EPKA 4LYFA 4RJLA 1MABB 1J8YF 1D9XA 4GP6A 3FFBA 3TR0A 1ZM7A 2GCOA 2QPTA 5IT5A 5KNDA 1PV4A 2QEQA 4G5OA 4OK6A 4I4LA 4Q9IA 1Z47A 4Z8XA 4JZKA 2P2LA 3U7GA 3NVAA 3QKUA 3KJGA 4Q1BA 5KDOA 2F1RA 3L82B 3HYRA 4BUJA 2OUKA 3U3MA 1OV4A 3LBHA 4B3XA 2BCJQ 4FCWA 4EPVA 3AGQA 2NOAA 3A4MA 3D31A 1DAMA 4C0KA 4AG5A 1G20E 5EP2A 2QRZA 1XJQA 1UKEA 4KU4A 3KX2A 1W46A 221PA 1FQJA 2ZROA 3LLUA 2ZUDA 4D26A 2VP4A 1ZNXA 3FHTA 4JL6A 1D8TA 1N6RA 1XZQA 1OT3A 1T8UA 1IJFA 3C8UA 4LI0A 4R71A 2IEZA 1GNRA 1MO5A 3HU2A 3GJ3A 3BGWA 3VR2A 5DO9A 2W6JA 2C96A 1Z2AA 2OT3B 5FL3A 2HT6A 2ERXA 5JS8A 4RY2A 1O3YA 2J3EA 3THOA 3UPUA 2C98A 5EUQB 3GLIA 4F7WA 3DOEA 4QM7A 3T1QA 2JLWA 1ONBA 3EG5A 5C46F 1EGAA 4II7A 4MRSA 4XH9B 3K0FB 4QBIA 4NPHA 4EQ6B 4Q9JA 4HLDA 4JL5A 2FF7A 1DAEA 1MV5A 3EIEA 5JSZB 3IBYA 5LDDC 1SHKA 1DBSA 5AJVB 5FI1B 2ODNA 3CNOA 3KKQA 4XD7A 1HT1E 1W5SA 2XB4A 4PAQA 1E98A 5JZVA 2BM1A 1W49A 2EYQA 3AF3A 1Z6AA 1FX0B 5KDLA 3FWYA 5JFGA 2BJVA 1DTSA 2CMKA 5CITA 2OO7A 2ZUCA 5EE9A 4P32A 4ESVA 1COWD 1X8KA 1E2KA 3GD7A 3V4FA 3QBVA 2GXAA 1M2OB 1GSIA 5BN4A 4R98A 1IXSB 3IHLA 5E7IA 2ZS8A 4M9SA 1W1WA 2NZ8A 4NE2A 3OFNA 2G3YA 3BS4A 4DZZA 5BYJA 5F9HA 1G21E 1OFUX 521PA 2DWPA 1IJEA 1G4UR 4TMTA 1YQTA 1N6PA 5E7JA 1AJEA 2QM8A 3TVTA 3X1YA 5J4YA 4PPFA 4QKQA 3CO5A 2CLDX 3RYTC 4YMWA 4F92B 3TR5A 3UG6A 1CKEA 1Y3AA 2MMGA 3PEUA 3SJCA 3AVXA 3KXLA 2WKRA 3B1VA 3JZAA 4HB0A 3ZD6A 2W0SA 1KGDA 2YOHA 1NY6A 4A1FA 2V4ZA 2W6ID 5FL7D 1NJGA 4H9GA 3PG5A 4M0LA 2XXAA 3TGPA 2R2AA 3BK7A 4A36A 4X8OA 4FN5A 4GSYA 3WMGA 1OFTA 3ZYCA 1T91A 5EZ5A 3KB1A 1BIFA 4TMZA 3F3YA 1E69A 3ZH9B 1U0LA 4Q4LA 4CW7A 3HR7A 1E2EA 5H68A 2ZIAA 4LCBA 3RRNA 5A5GA 3O47A 4RKFA 1IY2A 1P5ZB 4AD8A 4C0JA 3NBFA 5KNBA 4LJ4A 2QAGB 2R44A 2GF9A 3SU8A 1J8MF 4LV8B 3AF0A 4F4JA 2XX3A 2FA9A 5J40A 2DFKB 3A36A 4KYIB 4NL4H 5DLQC 2DFLA 2W00A 5FI0B 2EYUA 4M8NE 2ZYVX 1GG2A 3OEHD 2PLFA 2C5LA 2WSSA 1DAFA 3ONWA 4RFSA 2BHRA 4YONB 3RRMA 1D2MA 2Q9CA 2Q9AA 2IXFA 3NKVA 1GL7A 2LCFA 1X3SA 4YMSA 1E0KA 2AFHE 3ZDQA 1R10A 1N6OA 1IQPA 1TMKA 1II8A 3CIOA 1G16A 4KBGA 2JDIA 1FP7A 1P2TA 1N5JA 1ELOA 3EZ2A 4UNQA 5JCPA 3QEJA 3U4QA 2FWRA 4Q4JB 4HZUB 2QE7D 4DXAA 4OL0A 2ANBA 2UKDA 4DB2A 2WWWA 1G7RA 2REXB 4HLUC 5UKDA 3LD9A 2O8EB 1W0JA 4A0HA 3GLGB 121PA 1OSNA 2IYVA 3BB1A 3GFPA 3Q7QA 5CLQA 4ZDJA 4IDNA 1YR8A 1ZU4A 4V0LA 1HH4A 3FMPB 5HZHA 1ZAKA 3A8TA 1E9BA 4ILEA 1MKYA 2AK3A 4O3MA 2QZ4A 5CYOA 2FZLA 1ZM2A 4RD2A 3VNVA 3IQWA 3GLFE 2I1VB 4C9BA 4D4KA 1W4RA 4OJKA 4FI3C 3SI7A 1E2IA 3ZVLA 2PT7A 2JJ1A 1NBME 1X8JA 4I81A 4PTLA 3GFTA 3QVVA 3IILA 2OM2A 1SHZA 2ZS7A 1WB9A 2DHRA 1KDRA 4BZXA 4QOSA 3MCAA 5KYKA 3B7GA 2Z5FA 1JJVA 4OHWA 4PQRA 3LA6A 2H17A 4B43A 3LY5A 5G53C 1TUEA 2V6JA 1S3SA 3BRWD 3IO3A 4OI2A 4BFZA 1NY5A 4ZDWA 3DMDA 3EZ7A 1HTWA 1M8PA 1VCIA 4HLQB 1D5CA 1XCGB 2KJQA 3WMEA 1NBMD 1EWQA 5F9FA 1NNEA 2DYKA 4JLPA 2B8WA 4WZ6A 4CYMA 3LVRE 5EQTA 4HUQA 3H84A 3L8YA 4Q47A 2FGJA 2OZEA 4DIEA 2CL6X 4XVUA 3R7WA 2VHUA 3UMRA 2CEAA 5FBVB 1E9FA 4DEXA 2ZANA 2AFIE 2XTMA 3AVPA 4A8JC 2XJ4A 3CW2A 5FOWA 1R0ZA 2ZI6A 4OHXA 2PBRA 4P31A 4TT3A 1P2VA 5LD2C 1BYUA 1JBKA 1XU4A 5SZHB 3RAPR 4A0GA 2QU8A 3VR5A 4IOKA 5H1YA 1I4DD 1TUIA 4P4SB 2ODEA 2C78A 2JLRA 2R6GA 3CRW1 3W5JA 3HPQA 4I1UA 2JIZA 1XXHA 2PLRA 5FR2A 4NU0A 3DZDA 4FD2A 5DYGA 5G3ZA 1HE1C 1NN1A 4F38A 2BBWA 1KI4A 2NQ2C 3QF7A 1KSHA 3I61A 2EFGA 5LBIA 3VQTA 4QBHA 3O8DA 1NSFA 2F55A 3BERA 2ZSFA 2SHKA 1EWRA 2CJWA 1OHHA 1L4YA 5AWFC 2GK7A 1S1MA 1XEFA 2XOKA 3CONA 4JLDA 2R6DA 1N0WA 4HEJA 3Q9LA 2REBA 2FH5B 5AJYA 2QP4A 3EASA 3U3KA 3T1VA 4ZO4A 2J46A 2GEDA 3E70C 4GZMA 4DSTA 1GL9B 1XEXB 1JPJA 3Q85A 4ITRC 4B6EA 5FPKA 1G64A 4RVCA 4LJ9A 1XPOA 1J99A 3ETLA 2HCBA 4AKGA 4YQFA 1UF9A 4N1AA 2CVHA 3FKSA 3DMNA 2QAJA 4MRNA 3WYFA 2OESA 2WBLC 4LHVA 4RCZA 1CR4A 1TTTA 5JJKA 3OEEA 2CHQA 1KK3A 1RRPA 1SKYE 1JXOA 1ZD9A 2WWXA 3DKPA 2PX0A 2VL7A 4UQOA 3EPLA 1AM4D 2VHQA 3K09C 5M04A 2WPDA 4XJXA 3S1AB 2YZ2A 1WMSA 4JLOA 3O8CA 2ERYA 4UNRA 3DDCA 1F2UA 3U6KA 5JWHA 1CEEA 3T34A 2D62A 2OXCA 4G5RA 1Z0AA 2XSZA 1E9RA 1ZNYA 3C5CA 1XTIA 3N5CA 4PC3A 4DDUA 1JXMA 4M22A 5AUNB 4M9ZA 4CEJB 1M7BA 3TQFA 2ODWA 1NRJB 8OHMA 3O8RA 3K70C 2ZRNA 5CM8B 4BGDA 3KB2A 3EX7C 2CCKA 2QN6A 4CEIB 2YWEA 4N0EA 3B6EA 2IBMA 2ZI7A 4FMDB 2ATXA 2KWIA 1XTRA 3QKRB 1A5TA 4FCVA 3JVVA 4U5XA 3SYLA 2IXEA 3WXMA 1BS1A 3PIRA 3SDZA 1R0XA 5DGXA 4OHYA 1DG1G 1Q20A 4MUBA 3VKGA 2VP5A 4E09A 3ZJYA 2OBLA 1U8YA 5DI3A 2NO6A 4URYR 5GJWC 5FH9A 2ZREA 4M1WA 5FTLA 4IVRA 1KJWA 3EAQA 5A0FA 2BIFA 4A2WA 4P4TA 4JT2A 1D2EA 3NWJA 2CBZA 1Z6XA 2Z4SA 4Q66C 4AK9A 5TARA 2DB3A 3CKLA 4TZ6A 5KPJA 4Y0AA 1NL3A 3OE7D 4DDWA 2AL7A 3AVWA 5JI3E 3ND9A 2QBYA 3RANA 4Q7JB 2RH5A 3FOZA 1AS0A 3QOFA 4QGAA 3EC1A 1RC8A 3AVTA 5GVRA 4BPBA 4NYIR 4DJTA 2QT1A 3NHBA 1ZC3A 5CJ2A 4FWTA 2WKQA 2X19A 1E79A 4PZZA 2GJ9A 2OV2A 2WIBA 3I92A 4DSNA 1CS4C 4IJMA 1QHNA 4TQAA 2GA8A 3IIMA 3GQBA 4L4UA 3U7FB 2BEJA 3BBPA 2ZRAA 1XD8A 2MSCB 3E2IA 2CK3A 1JECA 2QENA 1OXVA 3G5UA 1XWIA 4R7ZA 3B9PA 4HB2A 4DSOA 4Q1AA 3VKHA 3CH5A 2VPPA 3ZZ0A 1G6HA 2JLZA 1NVVQ 4RZXA 1T8TA 4GP7A 2ZI5A 2H18A 2ECKA 2NTYC 1P75A 2DFTA 2VHTA 3P32A 1HY3A 3SBDA 1QHSA 3QG1A 3QJYA 1XNJA 2DBYA 1W44A 2YC2C 4MUAA 4YMVA 1AQUA 1II9A 3TH5A 2RGEA 4TL9A 4B73A 2GJKA 2NO1A 1G3IA 3P4YA 3NDPA 3BB3A 3L2OB 2IYWA 1WRBA 3MAAC 3QKSA 3RS4A 1ZP6A 3UIEA 3P20A 5H8WA 2HLDA 2RGGA 1KSGA 3ZS8A 1QG2A 1JR3A 3GLIE 3OF5A 1NP6A 2D7DA 3H86A 5FPYA 4NCJA 1SGWA 2HDNB 3GEIA 4L8GA 1Y63A 5B2ZA 1EFRA 4LBYA 2X2FA 3B60A 2FE4A 3VR6A 3KJEA 4BFWA 4URWR 1D2NA 1OJLA 3EA5A 1FL9A 3KQNA 4AI6A 1KO4A 3KKOA 3PEVA 3WNBA 1Z6TA 4QBGB 1E32A 4DC9A 4MRPA 4QJ5A 3IO5A 2PCLA 2YWFA 4POAA 1OH5A 2OLKA 4M1MA 4C7OA 1XD2A 2WKPA 2AHOA 2XITA 3AP3A 1P7CA 5CK4A 4TYNA 4ERNA 3OESA 2WM9B 4RKEA 5F3WB 2F43A 3OHMA 3LO5A 2G77B 4QGFA 3PXGA 1VHLA 4B3DA 4D80A 4TL7A 4MQBA 4WZAE 1XPUA 1IHUA 3I8XA 3BH0A 4KV9A 4XD7D 1UKZA 1ZM9A 1IXRC 5P21A 4LJAA 3C14C 4LJ7A 4MGYR 1US8A 2AWOA 4YDHB 4Q48A 2C9CA 3ADBA 1QF9A 1YHNA 3AM1A 1NG1A 2XB2A 1AGRA 3LV8A 4UXIA 4RZ2A 1KZ7B 3D3QA 3ZVNA 1RFLA 1YR9A 5C4GB 1NN0A 2OSBA 4OQMA 2OCBA 3MLEA 3OFND 2BBTA 2P0EA 2QI9C 4GOXA 1N6LA 1G8PA 2QSZA 4JKIA 1ZW6A 2AN9A 1WA5A 3CRQA 4PC2A 3SFVA 2WJGA 3FB4A 5KDDA 1DAHA 3EIHA 1C9KA 2BWJA 4MYUA 3FHOA 1KJZA 4M2LA 3THXA 3HYTA 4MKHA 4D4LA 3TVDA 1W4BA 2R6AA 4PO9A 3U2QA 2VSFA 3WBKA 1DOAA 3PQCA 4O2RA 4OJQA 1OE0A 3T61A 1A7JA 2BEKA 2OFXA 3KKMA 4JLBA 3ASYA 1E3MA 1U9IC 3HP1A 5FTMA 1TF7A 1M34E 3MWYW 4XVRA 2FV8A 1CU1A 4BLQA 3P26A 4FXPA 4OI0A 4M9XA 3I73A 2GK6A 5FTJA 1JEEA 1Q1QA 1VG0B 5DI9A 4FWIB 4MDFA 4DDVA 4EJSC 1Q57A 2QP3A 3RABA 4TYQA 3AF1A 1XTKA 3UKDA 2ZE8A 5G3YA 4B2PA 4W9MC 4KLZA 1KI2A 3AVUA 1R0WA 2O0HA 2N42A 4RD4A 1J90A 2G1JA 4MH0R 1NIPA 1AZTA 1AZSC 1KI1A 2WZQA 1JQJC 2OILA 2R8RA 4H1UA 4RZ3A 3WRXC 2WSSD 3R9IA 1P60A 5F2EA 3KQUA 1DAGA 1SZPA 2V3CC 3LWNA 4KODA 3CLVA 4R9UC 5TVKA 3ICQB 4PAMA 2BMJA 2HXYA 5TB5A 1P61B 2A5JA 3EPHA 2ZETA 2F9LA 4NBSA 4HAXA 2IYZA 4WA7A 5JLJA 5B58C 4K8OA 2DR3A 4LSGA 2VIIA 2CL0X 3SOPA 2CHVA 1WBDA 2JDID 4EFMA 1NKTA 4L9WA 2GEVA 4PQFA 1GFIA 2Q6TA 4M1SA 1SVLA 3V9PA 1HUQA 2O0KA 1S9HA 1LVGA 4DUGA 4F91B 1QVRA 1U94A 2RGNC 2RMKA 2GZAA 3C4JA 3ZVMA 1RPZA 2C03A 1XEWX 2ZSBA 2A9KA 1W0JD 2WVJA 4Q4HA 1ZMXA 4KVAA 4TTPA 4LX0A 5FBWB 2V1UA 1XZPA 4TMVA 5JBQA 1E9DA 1Q44A 2PT5A 2GBLC 1PLKA 3RS5A 2A7QA 1Q1ZA 4E03A 3DEFA 3L8ZA 1ZIPA 3DKVA 3LFUA 3A37A 4RSGA 3HJNA 1L8QA 2J1LA 2QSYA 4JMPA 5EZ6B 5C1BA 2FOLA 1E9EA 1JI0A 4BRUA 3GFOA 2QORA 1LV7A 3VAAA 3CWZA 1NG9A 4I1OA 1BYIA 3SJAA 1N2CE 1Z06A 2FPLA 2WOOA 1X8LA 2XTNA 3ZZUA 1XTQA 3T5DA 2VP9A 1MH1A 1F6BA 1ZD8A 4IDQA 2JJ1D 2GXUA 4PPNA 4HSEA 3RS7A 3ASZA 5B57C 4B2IA 4PZYA 1ZJ6A 1X1SA 4ON9A 4TTRA 3THYA 1G1MA 4CVNA 4Q02A 2FX3A 1GITA 5L3RA 1LNZA 4PX9A 5L3VA 1D9ZA 5L3SA 3AVYA 1E1RA 1ZU5A 4QNMA 1WBBA 5BYKA 3KKPA 4ZCLA 3VR4A 4IRUB 2RHMA 4FINA 5HCIA 3SFZA 4PC6A 1F2TA 3REGA 1T5IA 3SZRA 1N6NA 4XSGA 3ZS9A 1XP8A 1B0UA 3WP0A 1G17A 3LH5A 2GKSA 1Q3TA 4JSTA 3ZQJA 2MSEB 2Z0MA 1CBUA 4BFXA 1OFIA 1XXHE 2WWGA 3BH6A 3NIBA 4M21A 4BECA 4LHXA 5KSYA 5DE3A 2AR7A 3Q5EA 1ZIOA 4TTQA 4A8JB 4MA4A 3FDIA 1E9SA 1G9XA 2CLCX 2OCAA 2BVNA 3CB4A 5LD2B 2BC9A 3A4LA 2QRNA 4TT3D 3TW8B 5HCNA 3IBGA 2QTFA 1AQYA 4QL3A 4AYWA 5IF9A 2OCPA 1E1QA 4KJZA 2JAQA 4UXJA 3QXCA 3KJIA 1N5LA 3NC1C 3IIKA 5F98A 1YKSA 5FOTA 3MFYA 2JIZD 1G6OA 4RD3A 1HQYE 3UWKA 3X1DA 1CJVC 1LB1B 2YWGA 1SULA 3EZ9A 5GADl 2HT1A 3OAAA 2ZTSA 3ZGXA 3Q3JB 4YMUA 3QF4B 3LDAA 1OHHD 3AGPA 1E2NA 2XOKD 3BB4A 3K0CC 1J2JA 2EW1A 1OKKA 3J81k 2ZJZA 4GL2A 4AC9A 4W5HA 2O8CA 3DOFA 4D2IA 2IK8A 3W34A 3W90A 5JHGB 2O8DB 1CF4A 1N6HA 4YXWA 2IWRA 3EXAA 4TSFA 1NSTA 2FNAA 4C0AC 2VA8A 2XNDA 3RC3A 3EC2A 3EA0A 2B7BA 2ZRJA 1WDTA 2HXSA 4QGGA 3SJBA 2ZXUA 1KMHA 2H1LA 1GRQA 1XJ0A 5EXPA 5SZJA 3FKSD 2QUZA 4JKYA 4DT1A 3F0TA 5D3MA 4ZI3A 2WMNB 4FCTA 2YYZA 3BJIC 3KUCA 2IS2A 5EE3A 1DO0A 2EWVA 2YV5A 3TSWA 3LNCA 2EFCB 4IHQA 3K0AB 4KHZA 1R4AA 1E2JA 1SXJB 2WJJA 4ARZA 3B1XA 4CEHA 1BOFA 2J9RA 4A8JA 2IHBA 3B8HA 2EFHB 4US1R 4DLSA 1GNPA 1KJYA 3LXRA 5FTKA 1Z29A 1G5RA 4AYXA 2WPDD 4LY6A 2IA5A 5L3QB 1T5LA 3B78A 1SVOA 4GBMA 2L0XA 3N70A 3SQWA 3WP1B 4P3YA 2IYTA 2KE5A 5KPDA 3ND8A 2XSZD 4MYHA 5JI2E 2EWWA 4B35A 3EZ6A 3R8FA 3DVLA 5BXQC 3FMIA 1G7TA 4S2EA 4JLAA 1W36D 3K70B 1Z0FA 2AD1A 4IEIA 3CPJB 3THWB 3IDQA 1OXSC 4BLPA 1MO4A 1P9NA 4G01B 3KUDA 2C77A 2J45A 2XAUA 3Q8XB 1MABA 1KNXA 4S35A 2OEPA 3VTKA 2F1IA 1I2DA 2ZRDA 1I2MA 1UM8A 1NMXA 1NVUQ 4NMMA 3BAFA 4PC1A 2CDNA 2DPXA 1JB1A 5DHAA 1H8HA 3TUJC 2QTVB 5FUWA 5KTYA 4A15A 1RRGA 3KTAB 1YZTA 2FEMA 2FSHA 1GKUB 1DELA 1N25A 1PZNA 2FEOA 2ZR0A 1W7AA 1GTVA 1BH2A 2J0UB 2OHFA 1YZUA 4PAOA 1SVMA 4B44A 1NI3A 3AUYA 2RGCA 2HCJB 4KO8A 1ZNWA 1OPXA 4C2UA 1ZRHA 3QY0A 3W9YA 2OAQ1 3LQRA 3RSLA 1E4VA 1KK2A 3HPRA 3CWQA 4D81A 1CXZA 3MRSA 5E3HA 1BO6A 5TV2A 3WYGA 3ZQ6A 1E79D 4MDEA 4U00A 5LB4A 1KI7A 2O8BB 2JJ2A 2DWQA 5TDHA 5DISB 1OB2A 5J4HA 2NZJA 2W83A 1Q0UA 1KTVA 1KMQA 1YZKA 1KI6B 1RW4A 1TQDA 2NGRA 4MKIA 4GZLA 1LW7A 4YLGA 3TJZA 3ADDA 2CK3D 1T3HA 3O8BA 3W3AA 4X8HA 3TMKA 1XMSA 4EQ6A 2ZRCA 3K0FA 1DADA 3PENA 5FPTA 1JR3E 4HAVA 2BV3A 5JSZA 2R65A 2FMXA 1E4YA 4DCVA 3MUFA 1QG4A 5BN5A 4JLMA 3RRYA 1E9CA 1OXUA 3DM9B 3H0KA 2VRWA 4N0DA 1ODFA 1LF0A 1QVAA 3BXZA 1CR0A 3K9LA 3MJHA 1FX0A 2QT0A 3LXXA 3TK1A 4PO8A 1RJ9B 2ODBA 1IY1A 3ZIAA 4TYYA 5JWRA 1LTQA 4XWOA 4LJYA 3ADCA 1NMZA 4ASUA 4B71A 1ESNA 2HLDD 1P72A 2B7CA 4GNKA 2GJAA 1JR3D 2WICA 4A6PA 3A58B 1E2PA 5E4FA 1Z0KA 2ZR9A 1G41A 1RIFA 1WXQA 4AG6A 2D7CA 2VQSA 1E94E 1EFRD 4LHYA 4NZYA 5BQ5A 3KFVA 2ZYWX 4Q01A 2OLJA 2GCNA 2GEUA 2WHXA 1TQ6A 3L0IB 3OIYA 2F3TA 2VHCA 3LVQE 3M4YA 4Z8YA 4RD1A 1U2RA 3AKCA 1KAGA 4B74A 4WXRA 5KSOA 4G5SA 2FGKA 1GAJA 4QHTA 1EG7A 4ZV4A 2AKAB 2ZS9A 4YDSA 1NN5A 2IEYA 4V0NA 4DB4A 1TEXA 4PANA 2V1XA 3RHFA 4D6PA 2F7SA 1N6IA 2GF0A 3TW4A 2N1BA 2X1VA 4NTZA 3CUEF 4B3CA 3A6PC 2GJ8A 1NF3A 3LW7A 1S8FA 1UDWA 3KDSE 4IXMA 4LJ8A 3MMPA 3ICEA 4FMDF 2JCSA 5J4KA 1E99A 4Y0VA 2WJIA 1MO6A 1RRFA 3NTUA 4OHZA 4E5UA 4Z54A 2D2EA 3I3SR 4XWAA 1OB5A 2QAGA 1QHHB 1Z83A 2WIAA 4JVNA 3A1VA 3BORA 3EZFA 4NHOA 2NO0A 4ESHA 1M1YE 3TLXA 1GDDA 4BLRA 3ZD7A 5FBQB 4LPSA 5CM9C 4TN1A 2HYDA 2GRJA 4OQNA 2IYLD 1JAIA 2V54A 1JR6A 1XFAA 3IEUA 3I5XA 2R9VA 4ACAA 4M1KA 1PLLA 4OI4A 1TQ2A 1BMFA 3A1WA 2ORIA 1WQ1R 4TLDA 2ZAOA 1UJ2A 1EFHA 1XBTA 3AKEA 4BEJA 4OK3A 2OAP1 2RHDA 4CT4B 1KKLA 4DLZA 2G1KA 4OQFA 2CE7A 4Q4JA 2AWNA 3HU1A 4HZUA 3AF4A 1KI6A 1A82A 4JVLA 2DWOA 1CRQA 3QXJA 4BASA 4RD6A 2ONJA 2O8EA 3BC1A 3GLGA 1U81A 3AUXA 4KYUA 2FG5A 1KI8A 4UNNA 4F4CA 2FFQA 2FFAA 4TL8A 4OI1A 4EJSB 1G4AE 2PZGA 3OIVA 4J0QA 4DCTA 2VLIA 1G8FA 2O52A 4LWZA 4B33A 3TUIC 5K8LA 2ZJ8A 4QM6A 3LX5A 3QNUA 5FOSA 5JRZA 4A6XA 1HE8B 1SXJC 1S4QA 2QQEA 3I5YA 4JYCA 4LPKA 4NCKA 4B3FX 2WJVA 1ZD1A 3GPLA 4C2TA 1YU9A 2IS6A 4Q4AB 1F3OA 2A5DA 4KCGA 3GJ6A 2VYFA 1VKJA 2EFDB 2AKYA 4JJZA 4R2IA 1EFTA 3K53A 4LGMA 3ZZTA 2OFOA 3X1WA 5KHOC 4ZPXA 2N46A 4NYIQ 3SN6A 2XGJA 5JRJA 3QXHA 3CH4B 4TMXA 3QE0A 1IOZA 2RCNA 2VP2A 4LV5B 3TNFA 3CF6R 2BBOA 4HUTA 1QBKC 3WMFA 4WXPA 2G88A 4NDZA 4W5WA 3UATA 2RGDA 3DO6A 5CK5A 2ZE7A 2HJVA 3WHLA 2QY9A 1P6XA 2IYSA 2J7KA 421PA 1CTQA 1CJKC 1O87A 2F3RA 4DUGD 2FSFA 3D6TB 2NMVA 1IN6A 3GLFB 1Z6GA 2PEZA 4P33A 3T1TA 2KBFA 1H65A 1NLZA 2JLXA 2ZJOA 3VHXA 4DLVA 2ZYUX 1EFUA 4TZ0A 4C0BA 2VP0A 1L7VC 4KLNA 4JBXA 4Z51A 4ZIRB 5CB8A 2P6RA 3MWJA 2J7PA 4DKXA 3VR1A 2AXNA 2ZSDA 4M9QA 1ZUNB 3AVQA 4OKSA 1IN4A 1JPNA 4U02A 5GVSA 3FYHA 2VSXA 4DLXA 4D4MA 4K46A 3VU9B 3DZ8A 1VPLA 2FFBA 4P4SA 5FOVA 1E0JA 4NYMR 4QC2A 3U60B 4EIWA 4WW0A 2RGXA 1Z08A 4UNSA 4I1SA 1WF3A 3NXSA 5HE9A 3NDBB 4HYYA 5JHHB 2AX4A 1Q3HA 4TLAA 1ESMA 4DIDA 4O2LA 1ETUA 4BEBA 5EXXA 1UBEA 3M1IA 1E1RD 1VCOA 2I1QA 2VH5R 4B75A 3K0SA 1UFQA 1P3JA 2YJTD 1TADA 1MO3A 4CZ2A 5IK2A 4C0SA 4GOJA 1MOZA 3AP1A 1XEXA 3TQCA 2FPKA 2UZ3A 1EXMA 2WV9A 4IOJA 1OW3B 4ZCIA 1AIPA 5FFMA 4B32A 1XF9A 4D4JA 4UNPA 1FW6A 3LLMA 2ZQ5A 1E2FA 3DM5A 3FVQA 3MWKA 1HQCA 3VNUA 4KXFB 2LKCA 1UKYA 1EFCA 2NIPA 4L16A 2XJ9A 3AVOA 3LBIA 1XCMA 5ELXA 4KSCA 2VO1A 3S1AA 4DCUA 3CR8A 2YKGA 1E1QD 2W6JD 4AKEA 3IIJA 1KZGB 4CT5A 4MKGA 3GLHB 5AK0A 1YR7A 4CEJA 3K9NA 5SZKB 1H8EA 4RZUA 5BWMA 2ZSEA 3PUZA 2A30A 4CEIA 3OAAD 1CJUC 1KO7A 1ZNZA 1QZXA 2V7QA 3QKRA 4IDOA 4XSHA 1SKYB 3IHWA 1SVKA 1ZINA 1OKKD 3U6BA 1QHYA 3RDPA 2QPOA 1V43A 4DCNA 1W36C 3U44B 3RS2A 2FDCA 3AV0B 1T4GA 2QPAA 1RVDA 1WCV1 4EFNA 4TSFD 4YXWD 3ZLJA 2XNDD 2Q3MA 5EE5B 2YHSA 1Z8FA 2ZRGA 2HF8A 1W2GA 2IW3A 3DPUA 4BLTA 2J0VA 3KQLA 3BFXA 5J5CA 2GVZC 5IDVA 2R62A 2ZYTX 2IXGA 4AURA 2O8FB 1SQ5A 3AQ4A 3H4MA 4HATA 4JL8A 3TBKA 2P6NA 4CIDA 2GXQA 1XCPA 1XB2A 3CZQA 2E9SA 4NCIA 1Z5ZA 5KSPA 2ZI9A 1LS6A 2ZJBA 1CR2A 5JJLA 2HV8A 1G5TA 2GXSA 1OH8A 2H16A 3X2SA 4KI0A 1X1RA 2JLYA 1RZ3A 2D74A 4CRWB 1P73A 3AKYA 2ZRLA 4GFDA 4R2HA 2DFNA 4UKDA 3TSZA 4LBZA 5TY0A 4D0GA 4G3XA 4UJ3A 1G8GA 2QGNA 1R5BA 3SHFA 1W0KA 4IDPA 2ORWA 3M6AA 3AF2A 1ZUHA 2PZFA 3F8TA 4BRWA 2EVWX 1HT2E 3BH7A 5C4MA 2P3SA 5D3QA 5CLLA 4V0MA 2BDTA 4MGKR 4URVR 1H8HD 5KNCA 5HR5A 2GDJA 5TXGA 4PHFA 1QHXA 2GCOB 4LC0A 1E2DA 3VFDA 4GT1A 2OE2A 4M1YA 1GVNB 2D3WA 4MYCA 4Z1MA 2ZRKA 1ZCAA 3CX8A 1KDOA 3AKDA 4DLYA 1FP6A 1CULC 4Q9KA 5DYIA 3TUZC 2G9NA 4Q19A 1U98A 1IBRA 4BE7B 1OLOA 4Q7LA 1XMJA 1R8SA 3RWOA 1OIXA 3GJ5A 4KFSA 2EFEB 2YNMA 3FTQA 3MSXA 4EPWA 4N3NA 2W0MA 2DCUA 3U5ZB 1KAOA 1KSJA 2WWYA 4HB3A 1VDZA 4XWKA 1VTKA 4HDOB 4BLOA 2Z4RA 1DAKA 2JJ2D 3GCGA 4X8LA 5L8VA 3CRRA 2C95A 4L15A 3UWOA 4LDJA 1F48A 3CNLA 4MYTA 4WZBE 5FUVA 3MD0A 5LPNA 1C1YA 2RAPA 3P4XA 4CF7A 4JLJA 2WJYA 1U0HC 1SVWA 4JVSB 1T3LA 1S9DA 3OZXA 3G82C 4NYJR 2FZ4A 2QGZA 1CJTC 1U8AA 1EK0A 2VP6A 3X1ZA 1KSFX 2C9YA 3UANA 3GLIB 2C9OA 3T5GA 3EIQA 3KQKA 4NONA 1GRRA 1F5NA 1E9AA 3P1JA 4LYHA 2FFHA 3W6NA 1R2QA 1MRNA 1J7KA 1M74A 3LRPA 3LW8A 2P6UA 2WWIA 4TLEA 2IYRA 1IXZA 1EX7A 2KSQA 4X8MA 3SJZA 3WNCA 1KO5A 4KITB 4V0KA 4IW3B 1U8ZA 2B92A 5HKKA 4XIGS 2BMFA 2EU8A 1Z0IA 1KKMA 2GZHA 1XJCA 2A78A 5AR1A 4ZKEA 4ASUD 4WIAA 1FNMA 2BM0A 2ZJAA 5J47A 4LBWA 1N0UA 5SZIA 4AIIA 1AS2A 4H1VA 1UPTA 2F9MA 2JGNA 2QNRA 4Q1CA 1NN3A 4TLBA 2B6HA 2WWHA 2ORVA 4A9AA 2C04A 1KDTA 1GNQA 1ZM4A 1W4AA 4D0LB 1S1CA 1ZC4A 2VBCA 1NVXQ 2BOVA 3PEYA 2JLUA 1OXXK 3ADKA 2NO9A 1XTSA 3QXXA 3P27A 4LRWA 3B1YA 4TQUS 4PFSA 4E22A 3K9GA 3NH9A 4EUNA 2F1JA 1KIMA 1OYYA 4QJ4A 2PEYA 4CDGA 4A82A 1A2KC 2XXAB 4DLRA 3IGFA 3RWMB 5CIQA 5KOYA 4WBSA 4PO1A 4D0NA 1YRBA 4W7SA 1IONA 2QP9X 1Q12A 2CVFA 2MSDB 1VG1A 4IKEA 4NCNA 3L43A 2P65A 2OG2A 3RNLA 4M1OA 2Q9BA 4FMBB 4DEYA 2O5VA 3B5JA 2K5UA 2G0TA 3U7EB 3SBEA 1YRAA 1NLYA 5IRCD 3SQXA 1P9RA 2ZJYA 1M7HA 5FUYA 2GCPA 5JEEA 3SS8A 2C8VA 3W3ZB 1AS3A 3GLGE 2HF9A 4KVGA 3KKNA 2ZRIA 3BWDD 5B30A 4KFUA 5TMPA 3L0SA 1ANKA 2QL6A 1NIJA 3VKWA 1RKBA 4C0HA 4HDQB 1UBGA 1BMFD 3NEYA 3PFIA 1Z2CA 4RFSB 3I1FA 1Z28A 1I4LD 3UK6A 1M7GA 4V0OA 5EJEA 1G291 1VG8A 2REOA 5AJZA 3U61B 2CNWA 2H7VA 4JJKA 4E07A 2JLVA 4LYAA 1GM5A 1FNNA 3VMFA 5JWOA 2JLSA 4HLUA 4QHYA 3UMSA 3FHCB 1II8B 4B34A 3C41J 5EE0A 4BFSA 3U4QB 1N5IA 3WY9A 1HV8A 3C7KA 3NH6A 5HPYB 2XZOA 4AKIA 1OIVA 4OHVA 1XDBA 4TWZA 1LFDB 1RYFA 2D4HA 4AYTA 2G83A 3NBXX 1S96A 1KO8A 3CNNA 3RC8A 3OEED 2W2TA 2IHYA 4LYJA 3GJ8A 4ACBA 5FBLB 4QNRA 2HJGA 3I32A 4AWXA 1I4TD 1W5TA 2IYYA 4URUR 1X86B 1DS6A 3ECCA 5DN6A 4IFEA 2ONKA 4NKRA 2Z83A 5KO2A 5KUTA 4Q9HA 5FR1A 4GDFA 2E87A 1UKVY 1VCNA 4A2QA 5K8TA 3RLFA 4GI7A 1W48A 2LKDA 4O25A 5DIFA 5EXTA 2IS4A 3CF2A 4FMCB 4G5QA 1D6JA 3ZVRA 1G18A 2OBNA 5E7MA 3U3OA 3OIWA 3WYAA 1N3BA 1X6VA 1PLJA 2IL1A 4JVMA 4YC7A 4B48A 1HEIA 1YJ5A 3IKJA 1FOEB 1CLUA 1C4OA 3PITA 4BWYA 4IDHA 4BZPA 1AN0A 3MJRA 4GOKA 2ANCA 2IUSA 4HAZA 4JSYA 3QI2A 1R6BX 5AUPB 3C15C 3RRZA 1FQKA 5GJCA 1E0AA 5ANRB 1N5KA 1YZGA 1Z63A 1QRAA 1DARA 4B2LA 1DVRA 3FMOB 3DL0A 1G7SA 4HUQB 2J7PD 4FW9A 5CDFA 3RVBA 1YZNA 1EX6A 3PV0A 1OXTA 4IFBA 3T35A 1QHGA 3TE6A 1E2MA 2YOGA
chains in the Genus database with same CATH superfamily
5AP9A 3VHLB 3LKDA 4C78A 5DNYB 2W6PA 2EQBA 1FPQA 5K45A 2YWBA 1D4AA 3Q7PA 4JS0A 2PUBA 2AN4A 4C3VA 1I0LA 5HEKA 1P1CA 1CFZA 3OQHA 2LCIA 2Q5QA 2XH8A 5J4LA 1NRWA 2YVUA 3GNSA 5JV5A 4R83A 3AJDA 4GUDA 4S1VA 5T4HA 6LDHA 3Q8KA 4B4DA 3HA3A 2CHGA 2QRVA 1ITZA 1JALA 1J2EA 1DE0A 2AHRA 2DTXA 2FPGA 2HJHA 3CG0A 3QGMA 2FPPB 5C0OE 4CKYA 5K0CA 1C14A 1KP9A 3DFKA 3QYJA 3GFRA 1B26A 1P4AA 3H19A 3IHTA 3AXSA 5F64A 1KY2A 3L06A 4F1WA 4PFKA 4PZLA 3QEOA 3DW1X 5BSVA 2FOXA 3HXOA 5DZSA 4EUKA 5EWLA 1VRVA 1PRYA 1G55A 2GAJA 2JH9A 3HDQA 1GCIA 4PYIA 5G4KA 5IK2D 3EGOA 5JW6A 4P98A 1T43A 3KEMA 3TIGA 1LI4A 4DW8A 3JAMA 4PHGA 4CUJA 4F5WA 2Q46A 4I5DA 2O8DA 4BNMA 1WS6A 2IOYA 4HQFA 2CJWB 2WTNA 2OMEA 3AMVA 3L0CA 4HJRA 4M60A 4PHCA 4Q93A 4UEOA 3V4VB 4F7DA 4KYTA 1IM2A 1MRSA 4V03A 4P4UA 4UVHA 3TB4A 1C0IA 2PX3A 3B82A 5CVJA 5DTRA 4LF5B 1JE0A 1FMLA 4FFLA 4GPBA 5EP3A 2R66A 3HEAA 4COOA 3PC8A 2HUPA 3AR7A 2W6MA 1U80A 4EFLA 2O6HA 4X6XA 3VPGA 5G0SA 1ZEMA 1KYTA 3GXOA 2I4RA 4WKOA 3S68A 4A1OA 2Q27A 3TINA 2CNDA 3NOQA 1FMJA 1L4NA 4KEAA 3ORQA 4EPXA 3R6LA 3WGIA 1Q21A 2HHAA 4K9NA 4ZO7A 4HI0E 3D4BA 3NBZC 1BXRA 3M33A 3PD7A 3U4HA 1SH7A 4E2XA 5HF8A 2VF7A 5FNVF 2A9VA 3AW9A 4DCSA 5IUKC 2GJ4A 1BWQA 2H1FA 1WVGA 1CF9A 1Y5IA 4LDQA 1BD4A 1VYVA 4Q00A 2XE8A 2PKQP 4QDTA 4X9XA 4XRRA 5DYWA 4D9BA 4RX1A 3KZCA 3BSWA 4LE2A 4EY5A 1O2DA 4MRRA 5AVTA 2Z9BA 3ZCUA 1H9BA 4D3DA 2JFWA 2O8CB 4CKZA 3PL5A 3B2EA 3OP1A 1WD5A 2BFWA 2FWIA 4XSVA 1M3SA 2GOYA 3FWPA 3KU1A 4MWDA 4O0MA 3WAGA 5D00A 1E63A 4KO1S 1VYTA 2GESA 1ETHA 2BGJA 3PX7A 2IZ0A 3AHIA 1Z5OA 2HA5A 2XDAA 3A14A 4IL5A 5KBYA 3GEHA 4BQOA 1T35A 4R0VA 4C7KA 5A5EA 1JLMA 1G21B 1KHTA 2XF8A 1EGMB 3MRVA 3WRWA 4C07A 3G8CA 3O3CA 3EIFA 2HW8A 2WAYA 4JC0A 3U4GA 3UHFA 1XVUA 4F04A 3PGXA 1L2TA 5ALKA 5ECGC 1TU4A 3JZMA 2Q28A 5T6MA 2V5VA 3VC2A 5EXSA 1X0XA 3SIPA 3UMYA 4CGZA 2G6BA 2XRYA 3UJHA 4GR5A 1E2HA 1KZ6A 3Q98A 4EPYA 1FPMA 3GBPA 5FTNA 2J0UA 5JYCA 3CRNA 1JYEA 2CXQA 3WFIA 2HU8A 2WAAA 5ERGB 4C7BA 5AJXA 1JG6A 1ISGA 2P9EA 2V45A 1ZOIA 2YV1A 5EMJA 4AY2A 2QZSA 3LUJA 4OP2A 2CXXA 1USIA 2UZ0A 4MP6A 5K8CA 4Q3CA 4D9NA 3ETGA 3GT3A 1QQBA 3EVZA 2P9TA 2V6IA 4NP6A 4YRRA 3WHIA 4JX8A 1GRNA 5TIIA 1DFHA 1JEQA 3M6UA 3O8QA 1E5XA 4KJXA 4UBMA 2X4GA 3CHYA 5IX8A 5AXAA 3L7YA 4C88A 4DCPA 4CG2A 3C5VA 1Q7CA 4LHZA 3KUKA 1P9LA 2UVQA 1UEJA 3OSUA 1I6LA 5EWMA 5FA8A 4Z5XA 1KEEA 4Y2HA 2NG1A 1OX4A 4AS3A 3NP7A 3R9WA 2OVBA 2PH1A 3AU8A 1GKIA 1P2UA 1I36A 4W9RA 3G1TA 4KQ1A 1JIUA 2ZVQX 1A77A 3SZGA 1QIJA 2Q1WA 4MITA 4DXHA 3D3KA 3PC2A 1WHSA 4IIDA 4OMUA 4CFSA 3QPVA 4D4IA 5HRCA 1PW7A 3HDTA 5ED4A 3HE3A 1M6NA 3KEFA 4ROTA 3EXHC 3FPAA 2EJWA 2QB5A 1UOEA 3PQEA 4EM6A 3K4PA 2MJLA 2MHCA 4PSVA 4KO3S 1SBYA 3IP6A 5KJ1A 2FR0A 2GHQA 1DKLA 4NEHB 4OQDA 4PWYA 4X91A 5F5LA 4OXYA 2OM6A 4CIAA 3BQMB 2X1LA 5DTMA 5JQWA 5EP4A 3AHCA 4QXOA 4JXJA 2HEIA 4P3XA 3F8WA 3DR5A 4LBVA 2QVYX 3A10A 3UV3A 4Z1MD 5LN1A 4JOQA 3QENA 1V6AA 3QBTA 4EKEA 2PJRA 2F1HA 1XSEA 4UASA 5A5FA 2WJHA 1QHIA 2V65A 2TMDA 3S2SA 1Z7EA 3UT5B 4K0KB 2GLUA 4DDTA 1N2IA 5C1OA 1SZJG 4RCYA 2VXCA 3AG6A 4EFDA 5DRTA 1Q0HA 1T0JB 1ORHA 1XMIA 1L7DA 1VJGA 3F71A 3IUJA 2QUIA 1O95C 1K6MA 1PGOA 2ZYIA 1D1PA 1OTHA 1MO2A 1SC6A 2DPYA 3HL0A 3B13B 3KEOA 4OGWA 2XE6A 1CV2A 5AW2A 1QFSA 3LTEA 1BU8A 3GVHA 4L9SA 3SQDA 3LXUX 2YJ5A 1EFKA 1V8OA 3LQFA 3EVGA 2GCGA 4BMPB 1ORVA 1YZFA 2SICE 3AF5A 3HDJA 2OCKA 3KD2A 2H52A 2ZEJA 4WKPA 2ZM6B 1W93A 1GZDA 1MB3A 4URZR 1KNQA 1FC0A 4B47A 3MGCA 4QBFA 3MT9A 4QTZA 1LSUA 5C2JB 2AH5A 1HZJA 2M32A 4NJOA 2JARA 1E59A 2XCQA 3DE6X 1HA3A 3U4AA 2ZAMA 2I3BA 4BLUA 3RK0A 3VYUB 5EIHA 1G21A 3IUNA 1XNQB 2Y71A 1MQSA 3N2IA 4CF4A 1XDDA 4IVPA 3CSDA 3VZBA 1RWKA 1VSTA 3EQ2A 1PK9A 3V3KA 1K5DA 5F7ZA 3UWDA 3LE8A 2VJYA 3GEEA 4RA6A 2PMDA 2W2VA 3ET4A 4E12A 3AOEC 3K9HA 2AG6A 4Q1DA 2EZTA 4K9LA 1ABBA 5HKKD 3M8KA 3GP8A 5HIIA 4M0FA 3MQFA 3FDZB 3TRFA 3IEPA 1U5AA 4XUCA 4Y2PA 1HTBA 2VF8A 2W6ZA 3B38A 1MA0A 1U4OA 1KBZA 3CLUC 4AJ4A 1DFIA 2JLBA 2LW7A 1AKYA 1R5OA 4Z3KA 4OHCA 3GGCA 3L84A 2C2WA 3KLNA 4ZI7F 1FJ2A 3ZD8A 5AOVA 4ALJA 3RVPA 4PQEA 4W99A 2HRQA 1R66A 1WKBA 3NOVA 5DHFA 4KTTE 2GM9A 1RSZA 3WK7A 5L40A 4DYVA 2D06A 1S2IA 3CGWA 4DBVO 1JDBC 1MT0A 5JVDA 1Q1AA 5AOCA 3WKEA 3ZGYA 1N78A 1E2LA 3PYXA 1IN8A 3DC2A 3SYNA 4ZRDA 1YQUA 4QLBA 4YRCA 3HR8A 3CGGA 1OGYA 4PYNA 3RIEA 5FPQA 1P2SA 3H4TA 2PGLA 4BN0A 1SIWA 1UFVA 4EJSA 1DRWA 2H92A 4ZZ3A 4H1TA 1RPAA 3TJRA 1GVHA 2D2FA 4F4UA 5HM8A 4IMJB 3S6JA 1F2VA 2X40A 3PDWA 3IVMA 1WXFA 3VUEA 1ADYA 1J0DA 2NO5A 4L7VA 1I13A 1TJ4A 2CFSA 3G2OA 2QUKA 3L1UA 4WAUA 3S81A 3E8XA 821PA 4DLWA 2GWHA 1CZRA 4YB8A 4HPXB 3KIPA 5IJZA 4FR2A 1VJRA 3RSQA 5H82A 2JI4A 5LR6A 1QB8A 3IHKA 4NEGA 4FFSA 2A0KA 2DFDA 1BX1A 4O5OA 2VWHA 4Q7KA 4BFTA 3GG9A 3SC6A 4D3FA 4ZYZA 1CRPA 1YK1A 4IFTA 3UMBA 1QO9A 1BKDR 4H0CA 1G7CA 1G3UA 1N6KA 4JFRA 1R12A 3JVIA 3ORYA 3IT1A 4LFAB 1RACA 3FDXA 2AK2A 3V4PB 2HWWA 3LF1A 3KQWA 5ADHA 5ILGA 3NC0C 3O4FA 5CGZA 1RRCA 3DMHA 3R44A 1JNXX 3CUSA 4DV1B 4C4TA 3W9UA 1ADBA 2ZRPA 3L8EA 3WFZA 4BQQA 4C0QC 4WXHA 5FEMA 4BC0A 2RGNA 5TX7A 3K6JA 3ETEA 4A0HA 3VGPA 2CVOA 3I6MA 2M6LA 1LS1A 5AVRA 3BJMA 1P62B 5CIWA 2ZG6A 4FHFA 4KQMA 2GVDC 1YBMA 1DAOA 2FDXA 2X8AA 3A1TA 1GPBA 3ILYA 3OM1A 3AETB 3P9SA 3X1KA 4P5DA 3BMOB 2JFVA 3K96A 3NIWA 4ZI2A 5A1TA 2MYUA 2LDXA 3E7DA 4BDSA 2PBLA 1HZZA 5AVJA 1RIIA 3CPHA 3IBCA 3JV7A 3DVQX 3U7JA 1GQ2A 1PP4A 3H5RA 4P3KA 4D8WA 1ZUNA 1U0EA 2ZCJA 1OH7A 2X5JO 4IP0A 4K81B 4NSNA 3K05A 3RIXA 3CX7A 4E14A 2W2OA 2PXAA 3FOCA 5FI5A 1IWBB 4KFTA 2Y1OA 1KR2A 4FQ7A 3NWOA 2QQ0A 2VRBA 4IVNA 3V5NA 4DA9A 3B9BA 1GL6A 3FFAA 3SD7A 4D97A 2LWIA 4O2AA 2AYXA 2XDQA 3FCXA 1NV9A 2MT9A 4JBGA 3RSOA 3WGNA 2XZLA 3BFVA 3W2FA 1A4UA 4OJNA 5DHUA 3WL4A 3V7NA 5FA5A 1G8SA 4QJ3A 4ZOAA 2NPFA 1EU1A 5K8UA 4YJ2B 1TU3A 3QTTA 4MB6A 3W6PA 4IIVA 5AOBA 1SQFA 3FI0A 4XR9A 2QLBA 3B1ZA 3HY6A 2Y27A 4U7HA 3E53A 3SYKA 4BWFB 5IT0A 1TJ3A 3A26A 3V7UA 2VTVA 4JOCA 3K1JA 1TAGA 3MOIA 4N65A 2C92A 1S3GA 4LNHA 4EW1A 5K5EA 1P0CA 1QTIA 4HNQA 4JP1A 4XVQA 4UBIA 5DH9A 5CDFE 3GHHA 2XNHA 1KJIA 2H8KA 3BICA 3ZHZA 5SICE 4JGBA 1GN8A 4DQVA 3IAAA 4CQJA 2O0JA 4UTZA 5TEVA 3E9YA 1QTNA 5F12A 3N07A 3TQOA 4HNAB 2PL3A 5DSZA 3WI7A 2YIJA 4CG0A 2O4CA 2OCIA 1F4LA 1A8IA 3B2NA 1RPTA 3TOXA 5J43A 1EM8B 2PH7A 3EG9B 5AKEA 4PY2A 2K2WA 2QG4A 5A4JA 3BHNA 4EENA 3AFIA 1K86A 1F2TB 1NLFA 2E6UX 3WRYC 4MV0A 5G1PA 3NBYC 4BNZA 4LAFA 4UAUA 3AIMA 5LKRA 2MYPA 1F1BA 3GGJA 4G1UC 3U7QB 1UADA 1WUIS 4PHHA 1VPTA 2IPOA 3AWIA 3BPSA 1FDUA 3K32A 1L5MA 3LO8A 1L4UA 1VP9A 1G8HA 1XV5A 2H07A 2JL1A 2ISQA 2QQ5A 3CX6A 3ZPXA 4BVKA 4D8TA 5F7OA 3UG7A 3F97A 1T2UA 3PNMA 4GLJA 1O6CA 1ZPDA 1B6TA 2VEDA 3DAGA 1C9JA 1FBNA 3VSBA 4AN1A 4CFZA 1VB5A 1J5EB 1IN7A 3QMVA 1DXQA 3GRVA 2BKUA 4JUAA 3UYKA 5IKPA 5TQ2B 1PQ4A 4OFBA 5FPHA 3COJA 3OY7A 1A1VA 3CVOA 4F3CA 5HZGA 2AJ8A 3G1UA 4YUYA 4H7JA 2FWJA 4PSAA 4PN7A 2ZJ5A 3JZFA 1KI3A 3HY4A 5I7HA 1UMBA 2BRUA 2DBZA 4PNPA 1FTNA 3F5MA 4JYZA 4HBGA 2QMEA 3SFTA 2NTVA 4MVJD 4BVBA 2NO4A 4W5TA 1B23P 2B1RA 4EPTA 5AQEA 2RHCA 4RTOA 1GCGA 5B3AA 4KR2A 4B6JA 6Q21A 4QDKA 3FKQA 3LDUA 3OPMA 3RWBA 3DMTA 3NO4A 1XPRA 2BZGA 4QOJA 1INLA 1TJYA 4G24A 4IDDA 1NOKA 3OJLA 4BMCA 1A88A 1GKLA 3HNPA 1N2JA 1U0GA 2WTBA 2YN4A 1YKGA 4MAMA 1M2WA 4MPTA 4J0HA 4CV0A 3TZBA 3EEFA 1CIJA 1ENPA 3BGVA 1LFAA 2VRNA 1NAIA 1XZJA 4U7PB 4X64B 1D2AA 1ODTC 5AHRA 2IF2A 3VOAA 3QZUA 4KK4A 2RB4A 2GQ0A 4LHWA 5EJ9A 5LJIA 4RGQA 5EUBA 1A69A 3ESBA 5D3MB 1XN1A 3K6SB 3EPJA 1ISFA 2PS3A 5JSYA 1H3NA 4BJHB 1DEHA 2XT6A 4C3ZA 3RB8A 1DV1A 3GLSA 4MQFB 3FE2A 5DBGA 2WJ3A 2OHVA 2VHJA 1YJQA 3A1SA 3NEJA 1IK4A 3QV2A 2J5XA 5IMSA 1J39A 2YZMA 2ZCVA 4LYDA 4OHBA 1P9WA 1LRKA 3NUQA 4ARZB 4DV0B 1JR2A 4M7RA 3SKXA 4EGJA 5C53B 3PWSA 3GN1A 2FLKA 2GX6A 3LCCA 5CJJA 3V34A 5AW3A 2JA2A 1IAVA 1JQDA 2B25A 3JD4A 5H9WA 2ENUA 3ED1A 1VP3A 4QG7A 1QYXA 4B3BA 5B3LA 1K2WA 2GB4A 1QGUA 4JBYA 3TZKA 2HJWA 2IUTA 3AH8A 3L4EA 2H57A 4C06A 3HO1A 2HCFA 4RXUA 1N2XA 2CE2X 1Z0JA 4FMCF 5C8ZA 1IB0A 1FYDA 2VDKB 3E5HA 3FSGA 3EBLA 5AM4A 1SC3A 4A5OA 2WT4A 1E2QA 2FFRA 1DIAA 1ABEA 1H2FA 2L82A 4DRYA 3IRVA 3R3ZA 1J8YF 5AJHA 3DB1A 5DM2A 2GCOA 5HQTA 1PV4A 4G5OA 4C05A 3DTYA 2VC2B 3HUFA 3NV9A 4LIPD 4Q9IA 4Z8XA 4CMCA 5KYUB 3QKUA 3KJGA 4FVTA 4Q1BA 1K6EA 1CUZA 1JFRA 4LVOA 5JD5A 1TAHA 4EDFA 5BVGB 5KQMA 4CR8A 3PDUA 4FCWA 3DZHA 4YRPA 3AGQA 1RPNA 1X9HA 3IUMA 3A4MA 4IHKA 1ZO8A 5BNIA 1NUAA 2X0KA 1G8KA 1XIVA 2J5RA 3DNFA 3K1AA 4GYKA 4MVJP 3REQA 1E2UA 3A9CA 1VIMA 3AEYA 3QVGA 5THQA 1ZG3A 2ZROA 1IHDA 4WFKA 4IF4A 2B3DA 4JL6A 4OUDA 3RJ9A 4EO9A 1QP4A 3HO6A 3I12A 4MR9B 2HF7A 1BD3A 4IXDA 3E2MA 2YNMC 3NJ8A 4B8ZA 1C9EA 1GJRA 1OGJA 3HU2A 3PPVA 1WULS 1I3MA 2Z9DA 1N9GB 2C96A 2I8LA 4ANFA 2E55A 1CUUA 2CD9A 3CMMA 3LYUA 5JS8A 5EIBD 3VPCA 4RY2A 1C7RA 1O3YA 2ZUUA 3EEBA 3OTGA 4M7OA 4ESOA 5BNTA 3UYLA 5EUQB 3EXHB 2XBLA 3DOEA 4PVDA 1FSFA 2VAMA 3NOOA 1WUJS 3W78A 1Q77A 2LRHA 4Q9JA 1A27A 2DHQA 2FQYA 3NT4A 1XHFA 4IGFA 3RIYA 2AZ4A 1BX0A 1YHYA 1O08A 2FF7A 3K2EA 5JSZB 3EIEA 4AWAA 4WBNF 4TN5A 4P08A 4BVFA 1L5FA 2B8JA 3GRUA 3BDVA 2ODNA 2ZDHA 2A5LA 4PAQA 3GGOA 1H0RA 2OO3A 3AF3A 3AINA 3ZKWB 1FX0B 4E5NA 1TVKA 3CV3A 3NEAA 2GR9A 3MGBA 3OZUA 2P9BA 1U31A 3NYQA 4L4YA 1U4SA 2X0DA 5AKYA 1COWD 2YY5A 3GD7A 4BGIA 1AA6A 1M2OB 1GSIA 3T94A 4RESA 1W1WA 3KKZA 4DZZA 3ELUA 3BS4A 1OFUX 2R1VA 521PA 5BY2A 2DWPA 1IJEA 4B0OA 4JJ4A 1YQTA 2D2VA 1VM6A 4YP0A 4XCXA 3TD6A 2QM8A 3F6RA 5M5BA 3E9EA 1H3EA 5U4XA 1I5RA 5CEFA 3BXGA 4TS4A 5BUQA 2C0PA 3V2GA 4YMWA 2FPIA 5A4MS 1PN3A 1OI7A 1KDVA 4F11A 1CKEA 1O54A 4KQXA 3ZI7A 3SJCA 3AVXA 1RP1A 1PSDA 3ZD6A 3OCUA 3C3DA 1EUQA 2W0SA 1XI2A 2YOHA 4A1FA 4B4KA 5DMXA 2ECPA 2DOKA 4BKOA 1NJGA 1JIJA 4PLHA 4JI2B 3PG5A 4M0LA 4HX2A 1RZRD 3L46A 4A36A 4FN5A 4HG2A 4J3JA 3WMGA 1OFTA 3T1HB 1RAAA 1VFNA 2A0WA 3FPSA 3ZYCA 2ZXEA 4E5MA 2H1OA 4I5FA 1BIFA 1LTKA 4HXEB 4O2BB 3V1LA 1E9VA 2GM4A 3ZXYA 2BD0A 1OBFO 4UCXA 4HXGA 2H4JA 1E2EA 4CLOA 3P8ZA 4ENVA 2GHRA 4YWHA 1RWPA 3JQDA 1DBWA 2JIDA 3BMQA 3O47A 3FPJA 4H3SA 2W6NA 4NH4A 1UXIA 1WNFA 1K8XB 1XMPA 3TBHA 4ZYTA 2PSJA 4C0JA 3NBFA 3PP8A 4RK0A 4UATA 3G3EA 3OJXA 2CXHA 2HDOA 1U7TA 2GF9A 1QX4A 2YVAA 1QQ7A 5JDIA 5DLQC 4YJGB 2LP4Y 1M34A 5FI0B 4E46A 2EYUA 4Z99A 5BYAA 1DKQA 2O2YA 1GG2A 2O2ZA 1LBSA 3JSAA 1NHWA 1BVRA 2JCXA 4ML3A 2C5LA 3RG8A 4C21A 2I0FA 1DAFA 4CLHA 4RH3A 3HMKA 4BKUA 1D2MA 2Q9CA 4K6OA 1JP7A 3PC4A 5A7FA 1GL7A 1SELA 1Z88A 1DQZA 1X3SA 4ZVOA 1Y8CA 1JDBB 1X7WB 1C4XA 3ZDQA 2H7XA 1R10A 2DPLA 3ZU2A 1II8A 1G16A 3QUQA 2GSDA 1BJKA 1P2TA 4PSUA 4UNQA 4AM8A 3QEJA 2PZLA 3HCNA 2F4NA 2R5NA 4HZUB 1F4PA 3HXTA 4O4IB 1BSVA 4OL0A 3ZHRA 2ANBA 4K7JA 4NBUA 1IY9A 5JNRA 2BZ0A 2QN3A 2VVTA 3KJNA 2REXB 3M5CA 3OMXA 1UINA 1EUDB 1GEGA 1I24A 1NULA 1SOMA 121PA 1JHOA 1O96B 1OSNA 2B5OA 4MIKA 4X93A 3I04M 5L51A 4YRMA 3EPRA 3E9CA 3WHPA 4ZDJA 1B1CA 6ABPA 1YR8A 4Z4IA 5DHSA 4K86A 1HH4A 1TM5E 3MPOA 2IY8A 3FMPB 3FWKA 5KQRA 2V7VA 2OFPA 1PR0A 1L9KA 1KJJA 1E9BA 3BRCA 3UA4A 5HTOA 5A6VA 5MN5A 4XM0A 3KQPA 2WD9A 2Z2XA 3FGPA 4IS2A 5CYOA 3SF8B 1O1YA 1TLTA 2PZKA 3GLFE 4AF8A 1JB9A 4MW2A 1LJUA 2O5RA 1QR6A 3AYXB 3OCZA 4N5MA 2BFPA 4QPPA 3WLMA 4F5EA 4QPZA 5HW0A 5TJ9A 1W4RA 1HRDA 1P1JA 1VKNA 2H48A 1E2IA 4R8VA 3ZVLA 1Y9EA 2PT7A 4ZOLA 2AOXA 2BI4A 1NBME 1CDEA 1S02A 1X8JA 2XD4A 3LG2A 2Y1XA 5AMXA 4CCWA 1JILA 1Z5WA 2J3IA 4N5DA 3GFTA 3ZDFA 1SHZA 2P2DA 5DBIA 3CKKA 1KDRA 1NQUA 4M46A 1JEOA 4QOSA 1YJXA 4R68A 1EP3B 4BZXA 1H4SA 2A92A 5K0GA 1EAYA 1WZUA 4MJLA 1FMFA 3OZDA 1OYOA 1CY6A 2QZJA 4PQRA 3LA6A 5TGDA 1YTUA 4UBKA 1JBEA 2FEAA 2ZJ7A 3VSEA 1TEZA 2V6JA 2BMWA 1OOEA 4I08A 2QVBA 3GA0A 4OI2A 1N2CA 3MGGA 3OJ0A 3UJCA 1TZBA 1NY5A 3DMDA 3PXXA 1PX0A 1QLWA 2O2EA 1M8PA 2AMYA 3QQPA 2OOKA 4OQPA 2XB9A 4OIMA 4E32A 3VSAA 4EHLA 4MARA 3AHEA 3G6KA 4G86A 4INZA 1WUYA 2QX4A 4TPKA 3LVRE 3P0HA 1B15A 4KV7A 5D3KA 3WGZA 4C4YA 4BQEA 3H84A 5DBFA 3LFTA 1J49A 3VHXB 4ECEA 4DRXA 5CBPB 1MV8A 2H1CA 1SUWA 2CL6X 3W06A 4NFYA 3JQ8A 1AK1A 3UMRA 3AOEA 4ZU3A 2BFDA 1RQNA 4KR0A 2Y1DA 2GEFA 3F2VA 1GTRA 2XJ4A 4XFJA 3H1GA 3JQFC 5FOWA 4MMXB 4CL0A 1DIHA 4QUAA 2J33A 4FT4A 1ODSA 4J9UE 4OHXA 2IP4A 2JCYA 1BYUA 4UARA 4A0GA 4FWBA 4E5KA 1SOAA 2QU8A 2QWXA 2GCEA 3BXEA 3VR5A 5H1YA 1Y7LA 1I4DD 3NC4A 2AOUB 1GY8A 2BGNA 4PCAA 4D9GA 4M0CA 1QS0A 1T9DA 4ZAZA 2EGHA 2R6GA 1FFXA 9ATCA 5FFFA 4KMSA 1KZ1A 2V6GA 3HPQA 2F8MA 1XZLA 2GN6A 1XXHA 4HYEA 4NU0A 1FXWF 5G3ZA 5BOSB 1NN1A 1SG0A 3UQYS 1KI4A 4A6DA 3TX6A 4PINA 1ZDMA 3H1PA 4HDMB 5IBRA 3O8DA 5LBIA 4CMIB 1NSFA 2F55A 2SHKA 3NYRA 5E6SB 1BVYF 1OHHA 3DZBA 2EBWA 4JLDA 4BEWA 2JIPA 1DP4A 2R6DA 2WU0A 3ETNA 1DEOA 1RR6A 3OCXA 4KQCA 1HOXA 4U2CA 4UW9A 4HEJA 1EQ2A 1U3UA 2FH5B 2ET6A 5GONF 3QWFA 4YRFA 3T1VA 5C8XA 2TMGA 4A3SA 4ITRC 1JPJA 1IIRA 1E18A 2C3OA 2NSJA 3P2IA 4GL4A 1G64A 4B6EA 4EUFA 4EY6A 2QSJA 5BNWA 4AKGA 3NX4A 3A3PA 5B1IA 4CUZA 3E0QA 5EZYF 4RKYA 5EIWA 3WLQA 3INRA 4WFIA 2YBDA 3HJAA 2F17A 3MCWA 1GRVA 1OBHA 1YJAA 3O2NA 4L2IB 4RLFA 3VH3A 3AWDA 2RHLA 3BL6A 1NZDA 2CHQA 1SKYE 3AI2A 3K7EA 5BYBA 3L7MA 5AVZA 2CVZA 4BV8A 1AKWA 3N2KB 1PT5A 4L57A 4MRAA 4B84A 1DTWA 2UYQA 3CT4A 4UQOA 1RQRA 2VAXA 3EPLA 3SAJA 4FE3A 2F1OA 1TM4E 4RGYA 5KOHB 2WPDA 2WLSA 2FN7A 1TJPB 3IJEB 3TOCA 5MFZA 5I9NA 1N5DA 2YZ2A 3P4UA 5EOVA 4DADA 2CZGA 2RHGB 1E1LA 2OL4A 4UNRA 2WPNA 1Z4JA 1T0PA 4PC3A 3C5CA 1PR9A 3QA9A 4EMBA 1T1SA 4DDUA 1N3LA 2GEKA 1AKNA 2C29D 1K6JA 1U2SA 2C57A 1KDZA 3I28A 3PT9A 5LP6A 5EWJB 3TQFA 4ARIA 4JNCA 1NRJB 3TDKA 3A6LA 1UZUA 4D02A 2UVPB 1WQ3A 3IXLA 1XLWA 3CUUA 4YALA 2QN6A 4MWTA 3O8LA 2IHJA 3B6EA 2IBMA 1I1HA 1SK9A 3USZA 4F9FA 2KWIA 1KEVA 3I9OA 2WTAA 5C81A 4R69A 1BS1A 1USWA 1E3DA 1FF9A 4OHYA 1X1CA 2HPHA 2PFSA 2W8BB 5LQNA 3KWFA 3R3VA 4AW9A 1Q20A 2VNHA 2VNJA 1SZDA 3D2LA 3LWZA 4ZYLA 4Q4DA 3VKGA 1N8SA 5E1BA 5DI3A 1KJNA 2NO6A 1NBAA 1PEKE 3P0EA 4C04A 5A9SA 3OQIB 4OF4A 5IDQA 4P4TA 3P5BA 1USKA 5KAMA 2IIBA 3OEYA 3NHPA 3ZUGA 4TZ6A 3CKLA 4KI7A 2ZBEA 4PR3A 1FDVA 1OASA 2ZYAA 4BX0A 4N9WA 4HEHA 1NL3A 2BFBA 3C5WP 4BB0A 3AVWA 3PX2A 5JI3E 1CR6A 1DRJA 2ZYDA 3ND9A 3ZX4A 5H4GA 1JHDA 1T3ZA 2ETVA 3AY7A 3ERCA 3PU6A 5EVJA 4BVLA 2KYRA 1YDGA 3GDWA 4II2A 4H18A 4ITUA 3NHBA 1ZC3A 2DPMA 1ECFA 2XEDA 4R7TA 1A5SB 1FA9A 3PDHA 4OAPA 3WWCA 1E79A 2IITA 1L5KA 3GGPA 2NP7A 1FFGA 4EPRA 3I92A 1NUPA 2IQIA 5A71A 1GGHA 2NAFA 3O4RA 4INOA 5KEIA 3IRUA 4I4CA 1SG9A 1BS9A 1XTTA 3IUQA 2GA8A 3IIMA 3QOXA 2HRRA 3GQBA 4QRDA 3PHJA 3FMVA 4L4UA 4DPMA 1TM2A 2ZBGA 1D6NA 1XQWA 1WIWA 2F2TA 3BBPA 3N75A 4NZZA 4CMIA 1ZSYA 2CK3A 3GEMA 3NAMA 1UBHS 1YKFA 3B1FA 3RVMA 1XWIA 3G0DA 4GAEA 3EISA 1WCWA 1B8NA 3FR8A 4BTVA 1KH2A 3FUUA 3GA5A 1JHQA 3LDFA 2JLZA 2COUA 1NVVQ 4QYMA 1T8TA 4GP7A 5GM1A 2QK4A 4J8PA 4XB1A 1AY0A 3PWTA 2HCRA 2P1DA 3QG1A 1XNJA 1VLQA 1MFZA 1II9A 4OHRA 2OVFA 2RGEA 1FFEA 4TL9A 4QWMA 2GJKA 3PFWO 3FPCA 1KMIY 4ETIA 1G3IA 6NULA 3AFHA 2QJRA 3UCEA 3G23A 3A27A 2PGIA 4IJ6A 3MAAC 5EJ2A 3EEOA 1Z4IA 4MWGA 4ZC8A 3P20A 4U5QA 3TXXA 4HDRB 3GLIE 3FTFA 2IXBA 3WYCA 4BLWA 1BCRB 3OF5A 1NP6A 3PQ5A 3PNOA 4DJAA 4JOBA 1AUXA 5FPYA 5IAEA 3AERA 1SGWA 4E2YA 2NV2B 3CJRA 3C1AA 5JBIA 3G5TA 1L7QA 3ZCTA 3B60A 1L4LA 2FRDA 4YT4A 2OXFA 2PYIA 4CTKA 3KAPA 3TCXB 5JXHA 3DV0B 1JJAA 3VU1A 3D4PA 3KJEA 3VR6A 2E21A 3DDSA 2I78A 3AFGA 4UD2A 4URWR 5JS1A 4WCVA 5IM4A 1PNOA 3U4IA 4NMXB 3UVEA 3PWKA 4R8MA 4EA6A 1XO1A 5J3JA 1SCIA 4K6CA 3WNBA 1RMQA 1B3BA 1Z6TA 2Y0CA 1E32A 1ISPA 3DTVB 4LOKA 4MRPA 4QBGB 2R4QA 1DTEA 4L22A 4POAA 4QJ5A 3A1DA 2OLKA 3DFZA 4M1MA 4C7OA 5HS4A 4PG8A 3ZVKA 3AL0C 5CK4A 3QXGA 4C7JA 4FW8A 5U9CA 4PIMA 3OESA 4FSXA 3WL6A 1QKJA 3E3MA 1KZ9A 3CEAA 3FHLA 3C3PA 3OHMA 2WM8A 4AZVA 1XAIA 4ZQHA 1RYBA 4FQ8A 3LHDA 4D80A 1JFFB 1RXEA 2DUJA 4Y1RA 2C07A 5FO1A 4TUYF 2QKYA 2PMWB 1WDMA 3D1LA 4KV9A 4XD7D 1JTEA 3SLGA 4HNVA 2EKQA 3ESRA 1C0EA 2F8TA 4Z4EA 2IKQA 1M5TA 1Z3CA 3ELWA 3I0ZA 3AY3A 5BR4A 3OQ1A 4LJLA 3WIVA 3FNFA 1US8A 4EA7A 2WE7A 5DX1A 3VVMA 1IDN1 4MNTA 5HS6A 1K97A 1QF9A 3MPUA 4M89A 3RT9A 4DG8A 1K88A 1YHNA 2WU1A 4RADA 3M9WA 1NG1A 3L18A 4PLPA 5BSGA 1I30A 3I9JA 3DWGA 3PQ2A 4O02B 4NU5A 3KOMA 1Z82A 3COSA 3PRJA 4UVGA 3T5TA 3THSA 3O4IA 4JBHA 3MLEA 3G2IA 3DDWA 1F17A 4I8IA 1XQXA 5C8YA 4AJ9A 1DJLA 2Q4DA 3L6UA 4CF3A 4R5MA 4YRKA 4WL0A 1FSZA 3CRQA 3FFTA 2Y93A 5F7XA 3A05A 3DEHA 1OY1A 3V1KA 4FUTA 5KDDA 2BH2A 4NICA 3F2IA 4OQEA 3FHOA 2HJSA 3M6XA 4XD2A 3VJKA 4R0MA 1SXGA 4O4LA 5AVQA 3OO0A 3PICA 3QVLA 1PE0A 5IM5A 3RPEA 4XIYA 5KX5B 3KO8A 1UMCB 2BE9A 1C7FA 2QR5A 3FJ1A 3ZW9A 3A6DA 1L5VA 4OM8A 3UHAA 2WYIA 3UCXA 2BEKA 2VCEA 2Y2UA 4JLBA 4BWGA 1E3MA 3VISA 1YQEA 3GUVA 4FCCA 3L1VA 1TF7A 4XVRA 2BFCA 3ZWNA 4X45A 3H2BA 5IARA 3P26A 1OI2A 1U2QA 3JASA 3ZNNA 2P9CA 2FP4A 1E77A 1WSBA 5B1EA 3THXB 4EX6A 1Q1QA 1VG0B 2IE0A 3IS3A 3OT1B 4PZEA 2XOXA 3ZU3A 1ILEA 5GGYA 3L7KA 4UUQA 3IE0A 4DYDA 2XUAA 3EIOA 5HMMA 4MV4A 3UKDA 7ABPA 2JFZA 3NGLA 4PEVA 1OYVA 1YVRA 3GT4A 1Y1PA 1YACA 4ZQFA 1I51A 2QZZA 2EF1A 3AVUA 2WD7B 4BNIA 3QPBA 4RVFA 4Y2VA 1TZCA 3QWIA 3L79A 1ZH4A 4MRMA 1GPH1 1AE1A 1Q7TA 1RLJA 1NIPA 5GV8A 2G71A 1AZTA 4FKMA 1L7OA 2HADA 4JC8A 3UJ8A 1VKHA 4CR7A 1VBFA 3OCWA 4DC0A 2R8RA 1Y8AA 2X6TA 2WSSD 5L4SA 1P60A 4RE5A 6REQB 1J24A 1DAGA 2YZNA 3NHFA 4ODIA 4R9NA 3VH1A 2V3CC 4WPGA 1ML3A 1QC5A 2BMJA 4PSCA 1SRRA 5C3UA 3UV6A 3IESA 5K0FA 3RBAA 2EHJA 2F9LA 3GFQA 1YDMA 3DBIA 1JRLA 1LSOA 4I5EA 4XGRA 2VIIA 5AESA 5DX0A 3MTAA 2Y4NA 5F3DA 2XRMA 4DAOA 1YR1A 4EFMA 2A9QA 2I65A 2O54A 4PQFA 1C9DB 1VQ1A 3WDKA 2C20A 3LIIA 1H5QA 3W6ZA 1RAFA 4X54A 1HUQA 1YBHA 2O0KA 2QYHA 4DUGA 4U7JA 1QVRA 4GX0A 5MGNA 2W42A 1RPZA 3PT5A 4DQUA 1E4EB 2C03A 1XEWX 4Q4HA 5BQXA 1W0JD 2WVJA 2A9FA 5FBWB 1ZVJA 1PJQA 4IDGA 1GZUA 3RSGA 5KOJB 3OZVA 4U63A 2V1UA 5CDUA 3UJNA 4DR4B 1DXOA 3IDOA 3RS5A 2GBLC 1UPBA 2P5UA 3W79A 3L8ZA 2QYOA 2OORA 4RHUA 5JROA 2L19A 4JGIA 4JITA 3RREA 3ZHYA 4RSGA 4OMFG 2OD9A 3B3FA 2Q41A 3F6EX 4IAOA 5C1BA 4BRUA 1JI0A 3ABIA 1IVSA 1LV7A 5FWAA 3VAAA 4JR1A 3CWZA 3MTDA 2UZAA 3SQLA 3WGVA 3CY6A 5KVSA 4CM3A 1NG9A 2GMWA 3SJAA 1NYRA 2PTGA 2R3SA 1MDFA 4UDNA 3T5DA 4IINA 1EVYA 3GA7A 1OJ7A 1OMOA 5BR7A 2NUBA 3IULA 3QX8A 3AG5A 4DOMA 5LZ2A 4GBED 2VJKA 4DGSA 3TR6A 1MVLA 4YRDA 4QUHA 1IUOA 3RS7A 3ASZA 1JWAB 2GYWA 2Q2OA 3BE6A 4B2IA 1ZJ6A