4PHGA

Crystal structure of ypt7 covalently modified with gtp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
176
structure length
176
Chain Sequence
KNILKVIILGDSGVGKTSLMHRYVNDKYSCQYIATIGADFLTKEVTVDGDKVATMQVWDTAGLERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Locking GTPases covalently in their functional states.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis,exocytosis
molecule keywords GTP-binding protein YPT7
total genus 52
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phgA00
4Q9LA 4K46A 4HYYA 3T1OA 5AWFC 1J8MF 1FFHA 1ODFA 3A4NA 1Q44A 4Q1DA 1KMQA 1G7CA 2B8WA 1XMJA 1V43A 1HTWA 4TMZA 1JR3E 1TADA 1RC8A 1NVXQ 2CK3A 4NCJA 4MRVA 1HT1E 5J4KA 5HCNA 1W2HA 2NO7A 3PEVA 2KI5A 4KV9A 1SVWA 2H8KA 1XD2B 2CLSA 2JJ8A 4LV8B 2EQBA 1W44A 2QAJA 1JXOA 2CHGA 3AVXA 2YYZA 1P9WA 1EFCA 4Q4JB 1N5LA 4B34A 1MABA 1KIMA 4A0RA 2XJ4A 1GL6A 3QEJA 3THWB 5B64A 1SVSA 1T4GA 1QBKC 2DFKB 3FYHA 1P62B 4AI6A 1XTKA 2AXNA 4CEIA 1S0UA 1E9AA 1OT3A 1XB2A 2R8RA 4XVRA 4HAZA 3K70C 1AM4D 1OJLA 2MMCA 2JLZA 2JCSA 2CLDX 5IT5A 4O3MA 4RZ3A 4HAUA 1IXZA 4C30A 4RD1A 1F5NA 5CDFE 4M53A 4A1FA 1IY1A 5BWMA 4A6PA 1MO3A 4KFRA 4EJSA 3AVVA 4IDNA 1G4AE 1T9HA 4URZR 4EFNA 1DEKA 1XXHA 2JEOA 1ZD8A 1G8PA 3I61A 3ASZA 2J1LA 2VPPA 4LJ5A 3X1YA 4LZZA 3HR7A 1WA5A 3U6KA 4JLDA 2GF9A 5EE5B 3X1XA 1KMHB 3E70C 2DHRA 2YKGA 4FW9A 1HQYE 2VSOA 3T35A 4KBFA 3VR6A 2GZAA 1G3RA 1KMHA 2BCGY 4HLUA 2D4HA 3AKEA 4MRRA 5JRZA 2XZOA 1ZUHA 3NDBB 1P61B 3U3MA 1JNYA 4ZI3A 3WRXC 5FTLA 2D2EA 1YZTA 1OH6A 3BWDD 3ZLJA 4PSKA 2B7BA 2B7CA 3EZ6A 3W3AA 4TMTA 5J4LA 4A8JA 3A6PC 4AYTA 2ZEJA 5DI3A 5FPKA 1E3MA 1E9RA 2J3EA 2DBYA 5UKDA 1KKMA 2QNRA 5HZHA 3R8CA 4ASUA 1W2GA 3O47A 1J7KA 3OEHD 1D2EA 1YZNA 1YKSA 5AJVB 4GL2A 3F8TA 3QXXA 2QI9C 1UF9A 3EC2A 1DELA 2OO7A 2X2FA 3BC1A 3DEFA 4LY6A 1T3SA 1G9XA 3U3KA 4CEHA 4TYPA 4MKIA 3NC1C 4TT3D 4B47A 1UAAA 1VG9B 3GJXC 4Q7KA 1VCOA 2NTYC 3UWKA 3NTUA 3HR8A 3TR5A 4Z51A 1W0JA 2CEAA 3Q7PA 1GWNA 4HZIA 1OE0A 2WOOA 1QRAA 2ZAMA 1DTSA 1XZQA 4D0NA 2XSZA 5A0FA 2R2AA 3K09C 3MFYA 2IBMA 3KFXA 4IDOA 4KAXA 4FXPA 4BRUA 3EASA 2A30A 1S3SA 3BAFA 4V0ME 4MDFA 3OESA 4MYCA 4PPNA 3VKGA 1XD8A 1GVNB 4HLDA 4ZDIA 3AVUA 1IN7A 4GBMA 5FL7A 1UFQA 1OXVA 5P21A 3I8XA 3LO5A 1VECA 4CRWB 2J0UA 3IO3A 2X2EA 4CEJB 2JLQA 4FMBB 4B48A 4QBFA 4B32A 3FHOA 3QKUA 1KI3A 2FZLA 1Z0IA 2QRNA 3QQ5A 2V6IA 2PJZA 1ZIOA 4EPWA 1GKIA 1GL7A 4Q1FA 4OI1A 2DYKA 2VH5R 2FE4A 3RHFA 4DLXA 1TF2A 1N6PA 2JLRA 1TF7A 4V0OA 1MKYA 3SJAA 4OJQA 1U94A 1G41A 2ZRNA 5TY0A 5GJWC 1GZSA 1W5TA 1NMZA 5FBWB 4QHTA 5L8VA 5E95A 2OCBA 1JB1A 3ZVNA 2Q9CA 4MUAA 4IHQA 4Q4HB 3EPJA 4ARZB 2G3YA 5AUNB 5AUPB 4Q03A 2FU5C 3L0IB 2CVFA 2VP5A 4HAWA 4WAUA 2OZEA 5GVSA 1NLFA 2J0VA 1Z0FA 1E32A 1E9FA 2X1VA 3VU9A 3IPYA 4B3FX 3C8UA 1OIVA 4ZO4A 3AVYA 4P33A 3SQXA 3OEHA 2NOAA 1NBMD 2HUPA 1Z08A 2IW3A 2ZRLA 4JYCA 4IVPA 5D3QA 2JLXA 5FOUA 5EE0A 2J7PD 2YWFA 4HLCA 2QZ4A 1CLUA 3KXIA 3QIAA 4RKFA 4U00A 4W7SA 4HB2A 3K09A 1XXHB 4ZKEA 4DIEA 2XGJA 4Y0VA 1IN8A 2WSSD 4ESHA 3GLIE 2BDTA 2GEVA 3KKQA 2YC2C 1IHUA 1NVUQ 5B58C 1Z2CA 2ZAOA 2RGCA 1QVAA 4FIDA 4GMXA 4RSGA 1E69A 3BORA 1CIPA 4BZXA 1QHHA 2QP4A 5TB5A 4D6PA 4MYUA 2WMNB 1ZCBA 1PZNA 1RFLA 2QAGC 4FWIB 4RZ2A 4XVQA 4AK9A 4PSAA 3T1QA 3I92A 1NLZA 2JAQA 3CRQA 3ZIAD 4DDUA 2J5XA 2WIAA 4YMVA 4CEJA 2HT1A 4QRHA 4JJKA 4HLUC 2J59A 1ZU5A 3ZS8A 4Q4JA 2Z4SA 2GHIA 1G6OA 2YVUA 3CNOA 2G6BA 4IVQA 4Q4LA 5E4FA 2IYZA 4O0MA 1T5IA 2MSDB 4TZ6A 1Q1BA 1TMKA 4HAYA 1GKYA 1XDBA 2J7KA 1RYHA 2W2XA 5JBQA 3NKVA 1IAQA 2ZJOA 2XNSA 3E1SA 2E1RA 4P0TA 5J4YA 2A9KA 1TAGA 1SXJE 2Z83A 3C41J 2WM9B 1LY1A 2ZR7A 3LAWA 2Q6TA 1NI3A 3OIUA 3K0FB 3B9QA 1E79D 4DCUA 1KY3A 4PHTA 4V0LA 5JLJA 4NU0A 1HURA 2EYUA 4Q4AA 2B8TA 4JIMA 4M9ZA 3AF4A 3AP2A 4GPTA 4PR0A 4YMWA 4C0BA 1G19A 2XXAA 3KTAB 2O8BA 3AVWA 3SN6A 4FD2A 1L4YA 3LNCA 4JKYA 3AQ4A 3VKWA 4KFTA 1E2LA 4ACAA 5JJKA 2AFHE 4DB2A 2IF0A 1Z6GA 5JJIA 1E2DA 2R9VA 2W0SA 5CB6A 2OBMA 5JSZB 4LHYA 2DB3A 3LDAA 1X1RA 2IS1A 1G5PA 4R2IA 2V3CC 3U3OA 4TN1A 3WMGA 3ZJYA 4C0SA 4C2UA 2V55B 4HB4A 4JVLA 4JBWA 3NEJA 3IQXA 5FR1A 1DG1G 3LD9A 4RFSA 1F6BA 3ADBA 5L3SA 4XH9B 1G1MA 5EXSA 1W48A 3BE4A 5HE9A 2IXFA 4JYBA 4M0LA 4E09A 3K70D 1W5SA 2R6CA 1FP7A 2AWOA 1K5GA 2W0MA 3MCAA 4DSUA 1YZUA 3IILA 4DLSA 1M6NA 1AJEA 1SKYE 3LW8A 1P4SA 1PV4A 1RE0A 3BD9A 4JKIA 2OCAA 1DAHA 1NKTA 1P2VA 2OLJA 5HTKA 3O8RA 4UNPA 2F55A 2IYUA 1G8GA 1N6OA 3CZPA 5E3HA 4DLZA 4CVNA 3RS0A 1XBTA 4DUGA 3U7HB 4TTRA 3FMIA 4Z1MA 1H8HD 4LHXA 2F43A 1DG3A 1Q12A 3B8HA 4OYHA 4WW0A 1R8SA 1SVIA 2OFOA 1RKBA 1QVRA 3ASYA 4TMXA 4A15A 2RMKA 5FOSA 4DRZA 5CIQA 2CJWA 3B1XA 1WMSA 2EYQA 3RAPR 2VHUA 3AVOA 3PV0A 4A9AA 4HSEA 4B3XA 4TL9A 2CLCX 3CZQA 4P32A 5AJWA 5FUWA 1TQ4A 3NHAA 1KI1A 3FKQA 1BKDR 3ZDQA 2H7VA 4H1VA 2PLRA 2OFXA 1CKEA 5KNBA 3K53A 2P65A 3CX8A 1Q0UA 2Z43A 1NIPA 1J8YF 1YZLA 1X8LA 5FPHA 1MH1A 3D31A 1D6JA 2GRJA 2J87A 2IHYA 1OHHA 3CKLA 3BFKA 2IWHA 2HXSA 3PUWA 3TJZA 2H57A 1GKUB 3CRMA 1JQJC 1UBCA 2PZEA 3QJYA 3GLHA 2GK6A 1UKEA 1CRQA 1CR4A 2NO0A 1OSNA 2OAQ1 3A58B 3JVUA 3PUYA 2VYFA 2ERYA 2IXEA 4X8HA 4D26A 4TWZA 2F3TA 1BS1A 4BLRA 4M22A 3T15A 5JS7A 3FB4A 3F5FA 1ZD1A 4X8LA 5IF9A 1OPXA 3KXLA 3L8YA 4FMDB 2H5EA 3DHWC 3SFZA 1I4DD 1NL3A 3MG9A 2BHRA 4B2IA 1XX6A 1XTJA 3K9NA 5G41A 1VIAA 1E9EA 2QT0A 1KI6A 4BECA 4AURA 2QY9A 3WXMA 1UBFA 4Q7JB 5KNDA 1Q1QA 1SKYB 1GG2A 4JLNA 3OIYA 2AHOA 4HDQB 3V9PA 2FSIA 4NDZA 2EU8A 4QOSA 3AUYA 5G3YA 1EESA 4Z8XA 5HR5A 3BFVA 2PH1A 1B23P 3SE0A 4UKDA 4QGFA 2VIIA 3GLFA 3UG6A 5J4VA 2AK2A 4UNSA 2LKDA 5SZKB 2PCJA 5FPTA 4CIDA 4FWTA 4GFDA 1U81A 4XOIA 4Q9JA 5CYOA 1FPMA 4US0R 4Q1EA 2C5LA 4FCVA 3LQRA 4KVGA 3CF0A 1TPZA 2ZE7A 3Q5DA 2PZFA 4OL0A 2V1UA 1NJGA 4UXHA 4AIIA 4W9MC 2JLYA 2OUKA 3U4QA 3I1FA 1KOFA 1T3LA 4PO1A 3VKHA 3GQBA 4DSTA 3CX7A 1S96A 3BB4A 4BFVA 1G7SA 2SHKA 1QHIA 3VHXA 4LJ6A 4PX9A 1P5ZB 3PXGA 2IEYA 1KO7A 4L5BA 1NSTA 1E9DA 4G3XA 2GK7A 4ZPXA 1A1VA 3K0FA 5H1YA 1FUKA 3MJHA 5LD2B 1ZD9A 2QN6A 3A1VA 2NZJA 4JL6A 5BN4A 2EW1A 4CT4B 1X6VA 2ZXUA 1Q1ZA 1J70A 3THXB 1EX7A 3MAAC 3A4LA 3CRVA 5FTMA 2QQ0A 4MGIR 3W5JA 3P4YA 1TNDA 2WJYA 1KAOA 3FFBA 2QU8A 3A1WA 2OBLA 3VMFA 1BMFA 4E07A 1GDDA 4WZ6A 1E0JA 1EK0A 3DZDA 3NBXX 3H0KA 3B9PA 3QVUA 4IXMA 4E22A 1D2MA 1XPRA 2KSQA 3K9GA 3LQQA 3L43A 3GP8A 2EWVA 1NF3A 3GJ8A 3R9IA 4DBLC 1SXJC 1WBBA 1ZW6A 2C77A 1AGPA 5FPSA 2GJKA 2IYXA 2VHJA 1R0ZA 2AXPA 3P20A 2CNWD 4WIAA 3SI7A 1E94E 3EIQA 5H70A 3ZQJA 1TTTA 5IK2D 5J4HA 3QKSA 3W8RA 1MRSA 4KJZA 1KDPA 1TEXA 4MH0R 1U9IC 1XTSA 1TU3A 3REFA 4IOJA 4XD7D 4Q21A 2ODEA 5LB4A 4IKEA 3DKPA 4LJ8A 2VHCA 3WMEA 2ZS9A 3ZZUA 4EFMA 2AD1A 3AKYA 5GJVC 2HYDA 2YC4C 5M04A 5JRJA 2ZYVX 4CGZA 2MMGA 5IK2A 3LH5A 4BLSA 1JAHA 5TARA 1D2NA 2V6JA 2W2TA 3SNHA 1DOAA 1XD2A 2YOHA 4URUR 5GJBA 2ZROA 4GOKA 2XITA 1KO5A 1UBEA 2IYSA 5EE3A 4P4TA 3DM9B 4II7A 1YJ5A 2BWJA 5J40A 3WMFA 2AWNA 3MJRA 1OB5A 4DSOA 4UXIA 1K6MA 3A1UA 1P2TA 3CW2A 1KSGA 1L7VC 2VHQA 2OAP1 4RD4A 3BB3A 4OK6A 3GEEA 4D4LA 4EPXA 4DZZA 5KHOC 3SYKA 3IBGA 1V5WA 2GVDC 1GRNA 4JT2A 1S8FA 4GSYA 5AJYA 2UVQA 3JZMA 1SHKA 3ZH9B 1LVGA 2BKEA 4QKQA 2F1JA 2JLSA 3SYNA 1KKLA 3AVPA 4RY2A 4LV6A 1G5RA 4CF7A 1Z6XA 3C16C 1PLKA 4R2HA 3NWJA 1N6RA 3FE2A 2GJSA 2H18A 3KB1A 3R7WB 5A5GA 3J81k 1ZU4A 4PQYA 5CK4A 3PEUA 1JALA 2KE5A 3GJ6A 4KLZA 5E7MA 1VDZA 3EC1A 4IDQA 2QE7A 4NYMR 4Z54A 4PAMA 1M74A 4PZLA 4IRUB 3OIWA 2ZRDA 4JSTA 3ZS9A 1XEWX 3C14C 4BFWA 1GIAA 1WDTA 4GT1A 4O2RA 3QKSB 2WZQA 3L0PA 4IEIA 3D3QA 1T0JB 2C98A 2XTZA 2RGGA 5J47A 4PPGA 1KI4A 3CPJB 4XTCS 3T1TA 2QAGB 2XB2A 5HPYB 1NBMA 3QOFA 5FI1B 2ZJYA 4NCIA 2GTPA 4M4SA 1ELOA 1VHTA 1ZM7A 3VHLB 1TQ2A 2VEDA 1Z8FA 4BQSA 2ZUCA 1TQDA 4UXJA 3RNLA 1A5TA 4A36A 3C4JA 2QPAA 4DLUA 3WNCA 3CF2A 3P32A 3IHLA 1Q22A 4B35A 1FNMA 3H84A 4H9GA 3MMPA 5JCZA 2ZYWX 3BS4A 1L2TA 2OM2A 1E2FA 1UM8A 3ADKA 2ZRGA 2WJGA 4R9UC 1GRRA 4FMCB 3NXSA 3UK6A 1BYIA 2C9YA 3PCRB 4CYMA 2D2FA 4M9SA 1UBGA 1N0VC 2P67A 5KPDA 1U2RA 2BBWA 4DLYA 4JJZA 2BMEA 3VTKA 2WJHA 3B5JA 3I62A 3DDCA 5CLLA 2GJ9A 2FPLA 3RS4A 2JJ1D 5F3WB 2P6RA 4LJ7A 1Y63A 1XZPA 2QTFA 4JLAA 421PA 5BN3A 1WBDA 2R6DA 1S4QA 1ZINA 4DCNA 1F2UB 2WVJA 2ZJBA 1Z06A 4M1SA 2BBTA 2BEKA 2J46A 1LS6A 2RGAA 2WWGA 1UKZA 2PEZA 1ZAKA 1FQJA 4NYJR 1Z63A 2OHFA 4PQRA 3TUJC 4K81B 4E5UA 5JFGA 3DL0A 3EZFA 2VP9A 4LI0A 1OH7A 2QMEA 2ZPTX 4LHZA 1R5BA 3B1ZA 4M2LA 4O25A 5B2ZA 4G5GA 1TUEA 1T0HB 3W6NA 2IUUA 3EPHA 1IJEA 2YV5A 1ZVQA 3CONA 4TL8A 2G1JA 1H8ED 2A5YB 3TUIC 4CEIB 1M34E 2MSCB 4EPRA 4HLQB 1G16A 1Q20A 2ZYTX 2XTMA 1RRPA 3MWYW 5C4GB 1P3JA 5JJLA 1OFIA 2H1LA 2ZU6A 1RZ3A 2GXUA 2KB0A 2WBLC 5CM8B 3QSYA 1H8EA 2NZ8A 2QORA 2DR3A 5KDLA 1E1QD 5L3RA 4YXWD 1CJMA 3P26A 3AUXA 3IPXA 4F93B 5TDHA 1OFTA 1RRGA 1KI2A 2P0EA 5F2EA 2GZDA 3ZD7A 5IHPA 1KZGB 4ESVA 2FFHA 3LLMA 3R9XA 1E2GA 4NE2A 2PZGA 2IX3A 2WOJA 4YONB 1VYTA 4CDGA 2QM8A 4RFVA 2ZSFA 4DEXA 4POAA 4NCHA 1QG2A 2YOGA 2O8EA 1KK1A 4GRAA 5L3QA 1VG0B 2C04A 4MKHA 4Q1BA 1DAMA 1W36C 2Q9AA 4C2TA 1U0JA 4K8OA 4F4IA 2QROA 3RS2A 1E79A 3TE6A 4R98A 2ZE6A 2IK8A 2JJ1A 3BH0A 3BK7A 2IS6A 2F43B 4BLQA 5KDOA 2IUTA 2CMKA 3SOPA 1MO6A 4BZQA 3CPHA 4KYUA 3B60A 1N5IA 1Q3HA 3DPUA 2QE7D 4OK5A 2CVHA 3KJGA 1BH2A 2ZJ5A 2OT3B 4LCBA 4PC7A 3WYGA 3SQWA 3NDPA 4MKFA 1F2TA 1DO0A 3GJ3A 2NPFA 4PHFA 3V4FA 3WRYC 3PUVA 1KSHA 3KXKA 3TAHA 5K8IA 5KNCA 3LVQE 1G3MA 4TYYA 5DH9A 4LBVA 5SZIA 4PC2A 5KOYA 4LJAA 1IN4A 1KAGA 5FBLB 4Q4HA 1DAKA 3RS5A 2JATA 3Q8XB 1HQCA 2ASEA 3KKNA 1CF4A 3WHLA 1AQUA 1E0KA 4BE7B 5FH9A 1FTSA 2C2HA 3HPQA 4L15A 3N70A 2QEQA 2IYLD 1CXZA 2QPOA 2F3RA 2YWHA 1RJ9A 2RH5A 1UJ2A 4FMDF 3VR5A 3CH5A 1E9BA 1JEDA 3ZGXA 4JT4A 4DDVA 3THYA 5JEEA 5G40A 5DN6D 1NSFA 4IOMA 1ZM3A 1T5LA 4MGKR 5DYIA 5JMTA 1ZJ6A 3FKSA 5KDDA 2JDIA 1YQTA 3TBKA 1XF9A 4Q4AB 3DZ8A 1CJVC 1SULA 3HWSA 2PLFA 4F4CA 3U3JA 2CCJA 2ZI3A 3NEYA 1E1QA 5EQTA 4ARZA 1ESNA 3FHTA 1KI9A 4C0KA 4IFEA 4A2WA 2XEXA 3GLHE 2WV9A 5FBVB 3KQHA 2BV3A 2LCFA 1P72A 1S9HA 1GP2A 4KLNA 2G0TA 2X8AA 2IL1A 2X77A 3RRNA 5HKKA 1KO8A 1U98A 3K0EA 3K1JA 1O87A 1YZGA 1KTVA 5DE3A 1ZNYA 3TW4A 4V02A 2BBOA 4MDEA 3QXSA 1P6XA 5C18A 2DFLA 3PJRA 1KHTA 5HZKA 5JWOA 2J41A 4LBWA 4PO8A 3THOA 3DOFA 1TU4A 2XXAB 1Z83A 4LSGA 3GD7A 3PVSA 3ECCA 4IFBA 2WAXA 4BPBA 4AG6A 3K9HA 1E2NA 3BFXA 2JLUA 2YZ2A 3IIKA 1N2CE 1II0A 2XNDD 3QG1A 4RVCA 3LBIA 2ZE5A 1ZNZA 5H8WA 2Q9BA 3IKJA 3KKPA 1QHHB 2CXXA 2IYTA 2W6IA 2ZRKA 3A1SA 4KYIB 4R71A 1OFUX 2WHXA 1SXJB 1NG9A 2ZR9A 4URXR 4WZAE 2F1RA 2VBCA 3CBQA 4KO8A 3F3YA 3EA0A 3W34A 3B1YA 4D4KA 3ZYCA 5C4MA 3FHCB 3AP1A 4A8JB 1H8HA 1N0WA 1G17A 3RC3A 3L8ZA 1S3GA 2J9RA 2ZQ5A 4IEEA 1DVRA 3KKOA 3Q9LA 4B3CA 3RRYA 1L4UA 1FX0B 4GZMA 4IXNA 4HDOB 2G0NA 1E1RD 1YR7A 3VR4A 2IXGA 4W5JA 3T5GA 2NGRA 4QGHA 4JLPA 4ZV4A 3ONWA 5CITA 1OFHA 2Z4RA 1ZM4A 2ZRFA 4F4JA 2ORIA 4L9WA 2WPDA 4BFXA 1R7RA 1VCMA 1XD9A 4B43A 2VQSA 5JI2E 1E4YA 1ETUA 3M0EA 3MWLA 2YINC 4IOLA 1O3YA 2WJJA 5AUOB 1ZCAA 1G6HA 4EJSB 2GDJA 3FKSD 4RD6A 5ANRB 2HV8A 4V0NA 1M2OB 1OV4A 4AYWA 2QQEA 3LLUA 3U6BA 4GZLA 3GLIB 3A8TA 3GJ0A 2PBRA 3QKTA 1JPNA 1S1CA 1WCV1 1D8TA 2RGEA 2HF8A 3CWZA 3TSZA 4UNRA 3KQLA 4EFLA 4PQFA 2GCNA 1QHSA 3GPLA 4EPYA 3BXZA 1W4CA 4PC1A 2CNWA 5FL3A 4G01B 1GILA 2ORVA 1TL7C 1YR6A 4OK3A 2ERXA 1JR6A 3QXHA 3VNUA 2C03A 3GFTA 4LYAA 4G5QA 1PUIA 4F38A 1T8UA 2YWGA 3M6AA 4BRWA 2O8DA 1OW3B 4KITB 1G3IA 3EPLA 1KK2A 1KJWA 1NKSA 2ZI7A 4DB4A 3Q85A 4LYFA 3EZ2A 2W2VA 3KKMA 4LHVA 1EWRA 2WWIA 1AN0A 3TVTA 3QPUA 4A4DA 2FH5B 4L9SA 3ETLA 5SZHB 5DI9A 4Q48A 3UPUA 1R0YA 2HXYA 4HZUA 3BERA 4ITRC 2VF8A 2H92A 4JS0A 3K70B 2VO1A 3EA5A 1UPTA 3EIHA 1XU4A 3I5YA 1WB9A 3TSOA 1ZMXA 1Z6YA 1HH4A 2OE2A 3PR1A 3W8NA 3KQNA 4OI0A 3IO5A 5EZ5A 1DAFA 1US8B 4N3NA 5L3QB 3IBYA 3Q7QA 3RWMB 4ZI2A 4D81A 1E2QA 2ZU0C 1W0JD 1MABB 4MGZR 2VF7A 1SGWA 4Z1MD 2VSXA 1Z6TA 5JCPA 4HUQB 4A0GA 1DAEA 3FMPB 3SC3A 1E2PA 1FNNA 4M1YA 4JBXA 1LB1B 1PJRA 4Q66C 1NVVQ 3N2EA 4JVSB 4QM6A 2E9SA 1EG7A 3TIFA 3NH6A 1X1SA 1VYUA 2R6GA 3VX3A 2GILA 2AX4A 3PUXA 4LUCA 4S2EA 4BEJA 1ANKA 2BC9A 4EQ6B 5AR1A 3QKRB 1T91A 5EUMA 2XZLA 1FMLA 3WP0A 4B44A 1IOZA 1N3BA 1CR1A 4TT3A 1KJZA 2FFQA 1HUQA 1NG1A 4L16A 3UMRA 1DE0A 2FWRA 1C1YA 1LF5A 1KNXA 4XWOA 3CPEA 5BN5A 5CJ2A 2HEIA 2B21A 4RD3A 2V1XA 2C9CA 2GBLC 2A5JA 5C2JB 2FN4A 3NG1A 2IS2A 1NN3A 1HYQA 2WWWA 3HDTA 2ZSDA 3RANA 4LJYA 4XD7A 1WE2A 1KZ7B 1IY2A 2N42A 3QXJA 4A82A 2ZJ2A 2OLKA 4TMKA 4OHZA 1UADA 3OFNA 3FDIA 2ZJZA 2ZITA 3L0OA 3T1VA 2HYIC 1N6KA 4AYXA 4A0HA 4D80A 3UXMA 3QUSA 4OJKA 4ZCLA 3VR3A 2CE2X 1LS1A 1G8YA 4PXAA 1JR3D 5DI3B 4LK2A 3I4LA 5KU1A 1N6NA 5IRCD 3FGNA 4B74A 2ZRIA 3QBTA 4MYHA 2FNAA 1KI7A 4MKGA 3AKDA 4LYJA 3GMTA 1OYYA 3GEIA 3LVRE 1T6NA 2JIZA 2IUSA 3AVTA 1W49A 4TLCA 5EE1A 5FTNA 5FOXA 3C5CA 1HE1C 3CUEF 3O8BA 3U7EB 3X1DA 4I4LA 3SR0A 1JECA 1G291 1F48A 2ZUDA 3NC0C 4C0HA 2HJGA 4Q18A 1XXHE 3QPVA 1KDOA 5TXGA 2IEZA 2QMOA 3H86A 1P60A 4NCNA 3KL4A 3OHMA 2PL3A 5L3VA 3TLXA 3IEVA 5TV2A 4YLGA 4M9QA 5GJCA 1MRNA 1ESMA 1SXJA 4M1OA 1E9CA 4Q01A 3SDZA 3TGPA 4A6XA 1DBSA 1XEFA 1OKKD 1SHZA 2ZIAA 1ZC3A 2QMUA 1QHYA 2RGDA 2HDNB 2HT6A 2ZRAA 3QG5A 2R62A 3PITA 2GCOB 1VCNA 1Q3TA 1XCMA 3IEUA 4AY2A 2OG2A 4QBIA 1GUAA 4Z8YA 1IN5A 3X1ZA 4XVUA 3P4XA 1KGDA 5JECA 2J7PA 1K5DA 1YZQA 2ZVQX 1OKKA 2WICA 2ZSEA 5KPJA 1XTRA 3TQFA 4DCTA 4ON9A 1ONBA 4UNQA 3VNVA 2B92A 3A36A 1P75A 4XSHA 4LV5B 2FF7A 3H2YA 4QXAA 3B1VA 1Z28A 4N0EA 3HP1A 3EXAA 1II8B 2REOA 1AK2A 2RHMA 1I4TD 4C7OB 2FSFA 2GNOA 3EZ7A 2QL6A 1VG1A 1AZSC 3OAAA 3OE7A 4MUBA 2QGNA 2B6HA 3FVQA 1HV8A 4DEYA 2QPTA 3K0CA 4TSFA 2HJVA 4QC2A 2YHSA 5FL7D 3GJ7A 5C1BA 2XTNA 3HPRA 2FGKA 4NTZA 3U4QB 1Z0JA 2WIBA 4NCKA 821PA 3CLVA 3RLFA 3BH6A 1UDXA 4KSCA 1IXSB 4P4SB 1KNQA 1EFHA 4L4UA 5JEDA 1Z0KA 3CNLA 2JIZD 4NMMA 2FSHA 4QNRA 2F9MA 3KQUA 3I3SR 2Q3MA 4ZDWA 4QM7A 2ODWA 1MOZA 2UZIR 1KDTA 3NIBA 4WZBE 4BEBA 4DC9A 4TLAA 4QBHA 2ZI9A 3RRMA 3TUZC 4NYIQ 1TF5A 4NKRA 2OFWA 3GJ5A 1X3SA 4OQXA 1U9IA 2O0HA 3AV0B 4C0LA 1N6LA 2X19A 3KJIA 4DIDA 1XRJA 5JZVA 3CR7A 1SVLA 1UDWA 4RCYA 3ZVLA 3OIVA 5FR2A 1QDEA 1LFDB 1Z5ZA 2DPXA 4M21A 1I2DA 1CS4C 4MRPA 2FPMA 4XWAA 1XP8A 1II9A 2JJ2D 2NO9A 3K8YA 3NBYC 1QF9A 1XEXB 4FN5A 4M9XA 2PJRA 2VP2A 1NN5A 2GF0A 2REBA 3RRZA 3VAAA 5C46F 1C9KA 3HYTA 3QY0A 2Q21A 2RGXA 2IHBA 3KFVA 4LJ9A 3U61B 3LA6A 2E87A 3TSWA 1XJ0A 4RZXA 2OSBA 4Q00A 3IHWA 3TRFA 3DM5A 1ZNWA 2FZ4A 4MRNA 1W1WA 1CRPA 4HZUB 1LV7A 1EFRD 3U3RA 2QM7A 1XEWY 1KK0A 1W7AA 3B6EA 1NMXA 3W5IA 1JR3A 3W90A 3GFOA 2C96A 4PAQA 3U7FB 5F9HA 1A2KC 2YNMA 2ZRBA 4Q47A 4A2QA 2O8DB 1NBME 1HE8B 2ATVA 2EVWX 3FTQA 2PCLA 4Q9IA 4PHHA 2AFIE 2J45A 4LBZA 5KSZA 4BFTA 2FDCA 2CJWB 2ONJA 3SZRA 1N5JA 4PAOA 1M7HA 2XJ9A 2DWOA 1G3UA 2QG6A 3K9LA 3ZQ6A 5A4JA 4D25A 1XNJA 3QE0A 3AKCA 3DOEA 1G7RA 2WMOB 4KSBA 1J2JA 1FQKA 2REXB 5EE9A 1TQ6A 1UEJA 4W5WA 3C7KA 1D9ZA 5DO9A 4XTRA 2GZHA 1FOEB 1WQ1R 5FUVA 2G77B 4NP6A 3CNNA 4YXWA 5CDFA 4U5XA 2PT5A 1W36B 2IF2A 2AKYA 2JGNA 3ZIAA 1JQLB 2O52A 1MV5A 2ANBA 3PFIA 2QUZA 2R44A 1SXJD 4GI7A 4KHZA 3TQCA 1Q57A 4LYHA 1ZC4A 4IDPA 4JLJA 3GLGA 1MO5A 3SJCA 1SKQA 2RAPA 3HU2A 3IGFA 4IVRA 4RCZA 1G3QA 2V7QD 5FOTA 4KVAA 2QGZA 3T34A 2C78A 2EFHB 4W5HA 5KO2A 2V4ZA 2GWHA 3C15C 1Y3AA 5FOVA 2PEYA 4M8NE 3LX8A 2Q0HA 5FI0B 3GJ4A 5L3SB 1U8AA 3HYRA 2Z0MA 4ZIRB 1II8A 2ZTSA 3AF1A 4TL7A 4NHOA 2V8OA 2R6AA 2ZE8A 4OI4A 1NY6A 2A78A 2P5SA 3TH5A 1C4OA 3ND9A 4A2PA 4KCGA 2Q3HA 4QFMA 1ZNXA 2CCGA 4JSYA 1KYIA 4XIGS 4LPSA 3KJHA 4OKSA 4C3ZA 3PIRA 2VRWA 1WRBA 2NIPA 3PENA 3OE7D 1ZP6A 3CWQA 1W36D 1VHLA 2I1QA 2ZJAA 4LDJA 3QF4B 2GCOA 2RKOA 4D0GA 5TMPA 4YMUA 2I3BA 2C95A 4ZKDA 4FI3C 2ONKA 2VP0A 1XMIA 4JLVA 5DSZA 5AUQA 4BFUA 3QNUA 2IYQA 2QBYA 3NVAA 4B76A 1U0LA 4NPHA 1KO4A 5DISB 3JVVA 1CJKC 2QENA 4HI0E 5JS8A 5B30A 1YR8A 3SBDA 1D9XA 1QG4A 1YZKA 2W58A 4KFSA 1FL9A 2ZRHA 3UIEA 1CEEA 1IY0A 1CR2A 2VLIA 1OF1A 1XMSA 2IA5A 2W6JA 3LX5A 4V0MA 2BM1A 5G3ZA 5FUXA 4C9BA 1GTVA 1U0HC 1Z07A 1OYWA 4Q19A 5KTYA 3BB1A 1AS3A 4AKGA 3SEAA 1M7GA 1IJFA 3PQCA 3WY9A 3ZZTA 3B2EA 2Z5FA 4B3GA 1FZQA 1TEVA 2JDID 2QP3A 3VR2A 2W83A 4AG5A 3CRW1 3U44A 2GA8A 2GEDA 2GJAA 2WAYA 4OI2A 3EIEA 3U2QA 1KY2A 3W9YA 2BJVA 1W46A 1A82A 2F1IA 2OILA 4B71A 4URWR 4D4JA 2ANCA 1PLJA 3ICEA 5CLQA 2WTUA 4EIWA 3IDQA 4AD8A 1CJUC 2F9LA 2GESA 1QHGA 2A2ZA 2DWQA 1BMFD 2VP4A 4PC6A 1S1MA 1NIJA 4IOKA 1JXMA 3E2IA 3FWYA 1ZM2A 1TUIA 3IIMA 3HU3A 1P73A 1ZUNB 4DCSA 4Y0AA 1U90A 1OH8A 4AKEA 4Q9KA 2R6FA 4U7DA 3ZD6A 3KZ1E 2EFGA 4D0LB 4TLEA 1HY3A 1X8KA 5CIWA 3P27A 3B78A 3KTAA 4JMPA 2D7CA 4DCVA 3EARA 2O8BB 1IN6A 2FPKA 1Z0AA 1GL9B 2W6JD 4BFZA 2C99A 4QG7A 1MR3F 4PPFA 4UJ5A 3ADDA 1OHHD 2F1HA 3RABA 1F2TB 2BOVA 4Q5IA 2CL0X 3L82B 4PZYA 2A5DA 4RFSB 1L8QA 4N0DA 4GOJA 3NBFA 3BGWA 3NHBA 3P1JA 3MRSA 4B2LA 2Q3FA 1NN1A 1XWIA 2XOKD 4F7WA 2OCYC 1HEIA 1E6CA 2BMFA 1CP2A 5LBIA 2AKAB 4HAXA 3QXCA 1KDRA 1T3HA 2D62A 4RD0A 4TQUS 3MWKA 5G53C 1WXQA 3CF6R 3OFND 3I5XA 1J99A 2V54A 3QI2A 5DGXA 4RJLA 2O8EB 4TMVA 1E98A 4JLBA 1XJCA 5D3MA 4I1VA 4C0JA 3OEEA 3WYAA 4F91B 1XMVA 2GKSA 4F92B 2RB4A 5E7JA 4HUTA 2FG5A 4WXRA 4JZKA 4TYNA 3TR0A 4X8MA 3QF4A 4TYQA 5JHGB 3GLFE 3SHFA 2J0UB 4C7OA 1DS6A 2QA5A 3HU1A 2F7SA 1R0XA 1P9NA 4NYJQ 3CRRA 4TTQA 1EGAA 3AF3A 2QRZA 4BUJA 1JI0A 4FINA 4Q7MB 1VKJA 2V7QA 4BLPA 2JASA 5LPNA 1W4BA 3RWOA 2XB4A 1W0KA 5K8TA 4QJ3A 3MD0A 2DY1A 2IYRA 4GDFA 1KO1A 2CHVA 1G21E 1JBKA 1E2EA 1GITA 1TX4B 2C9OA 2DCUA 2EFCB 3WNBA 4KU4A 4LBYA 4ZIRA 2RGNC 5EUQB 4FMCF 1DO2A 1F60A 1OXUA 3H1TA 4KODA 3KUCA 1OLOA 4LX0A 2O8CA 4DLRA 4PFSA 4UQOA 4TLBA 4B3DA 4HB3A 3V4RA 4Q7LA 1J90A 4BLTA 2IYYA 1E99A 4QHYA 4B6EA 2OXCA 2ZYUX 1KK3A 2J0QA 2CK3D 1UEIA 2ZJ8A 3PEYA 2I4IA 1M7BA 1P9RA 2OXRA 4OQLA 3REGA 3THYB 4AKIA 2VTKA 3TKLA 1RJ9B 2AK3A 4ZCIA 4BLOA 1E9SA 1G4UR 3AGQA 4XSGA 4CW7A 5FUYA 5BQ5A 4DHEA 1AZTA 2D06A 1EFUA 3QEOA 5EJEA 2O8CB 1F2UA 5KSYA 1A7JA 3M1IA 1H65A 1X8JA 1LTQA 1AS0A 5CM9C 1RVDA 3T61A 2WWYA 2ZSAA 3GLFB 1HA3A 1N6IA 2QP9X 1SZPA 1G8HA 1FUUA 2CE7A 1IQPA 4JL8A 1K8RA 3K0AB 4M1MA 1EWQA 4IW3B 3RS7A 4DWJA 4JBYA 3NH9A 4ZDKA 2A7QA 4LJ4A 4I1UA 1W4AA 3OF5A 1Z0DA 3UATA 2OV2A 2GXQA 3V00A 4OHWA 2BJWA 3RYTC 2GXAA 3UMFA 4YMTA 2AD5A 3I32A 1E4VA 4TL6A 1SVKA 5TVKA 5DHFA 4HUQA 3S1AB 3KB2A 1Z2AA 3T5DA 4I81A 1BYUA 1M8PA 3KUDA 5F9FA 3M4YA 3S1AA 2JA1A 4XWKA 1US8A 3A37A 4PO9A 2CHQA 1G7TA 2IYVA 4US2R 1XCPA 2KJQA 4A8JC 4D2IA 2ZM5A 3QKRA 3EAQA 2XAUA 3EZ9A 4WOPA 2QT1A 2R65A 4EQ6A 3B85A 521PA 3SFVA 3LBHA 3DKVA 1GNRA 2GAOA 5KSPA 1Z47A 1ZRHA 3MUFA 2WKQA 4RD2A 4TYWA 2FEMA 4EUNA 2CL7X 2XX3A 2BEJA 2BKUA 2GETA 2GEUA 1KJYA 3N2IA 5EP2A 1BIFA 2HCBA 4EAQA 3WYFA 2WWXA 1DPFA 1RRCA 1JJ7A 5KSOA 4HATA 4WVFA 2FEOA 2DFNA 1GOTA 1R0WA 3EG5A 3FMOB 2P6UA 1I4LD 5HCIA 2BIFA 3Q72A 2ZRPA 3BRWD 4MRSA 4QJ5A 1NVWQ 1DAIA 1G5TA 4OQNA 2IWRA 3TMKA 2WJVA 4BWYA 1U99A 5EP1A 4I1OA 3ZVMA 1Z22A 1ZYUA 4QGAA 1I2MA 3WBJA 2GCPA 3GLIA 3LFUA 4NL4H 2FFAA 1OXSC 5EXPA 3RDPA 2CDNA 1DADA 1U8ZA 2NO1A 4OQFA 4AC9A 1YRBA 2AR7A 2GJ8A 2PMDA 3CH4B 3K0AA 3QBVA 1W47A 4LGMA 4OBEA 3K0SA 1CJTC 1A4RA 4DXAA 3U60B 1E2KA 3DMDA 2XSZD 5FFMA 3W3ZB 4QL3A 2LKCA 4PANA 1EFTA 4NBSA 2P2LA 3RSLA 4DLVA 5KYKA 4N1AA 2TMKA 1PVOA 2BMDA 3SBEA 1P7CA 4AKHA 1E2MA 1Z3IX 1R4AA 2EFDB 3EW9A 3RS3A 3OAAD 1W0KD 3AP3A 1G8FA 3UG7A 5JWHA 1CU1A 2EFEB 1JPJA 1UKYA 3DO6A 4L8GA 3D8BA 1E96A 2ORWA 4YQFA 5JSZA 1AGRA 3U5ZB 4EKDA 2RCNA 2OEPA 3LXXA 1BO6A 3FMFA 1G18A 1ZBDA 4M1TA 2ZI5A 4YDHB 1HT2E 4WBSA 4DSNA 5KUTA 2FA9A 2GAAA 1GAJA 4JLMA 5BXQC 1G64A 2P6NA 1VG8A 3BBPA 3O8DA 1P2SA 3X2SA 2N1BA 3AGPA 3W6PA 1CR0A 1E2HA 1Z29A 2QBYB 4JVNA 4ACBA 3GEHA 2QTHA 3LW7A 2ZRJA 1NLYA 5BYKA 1G20E 2CBZA 5HE8A 3BJIC 2BVNA 3LY5A 4G5SA 2HCJB 2XZPA 3B13B 3BOSA 3K0CC 1LW7A 4GP6A 3T12A 4JLOA 4ASUD 3EWSA 4ZDJA 5EXXA 2A3RA 3WP1B 5DHAA 3ADCA 2ATXA 5HKKD 1OXXK 3LBNA 4YDSA 2ZANA 3SS8A 1YE8A 3AM1A 1DAGA 4MYTA 4U02A 4LC0A 4D82A 1FTNA 4TSFD 4US1R 2CCKA 4DDWA 3CR8A 3SYLA 3Q5EA 5BYJA 3JZAA 4G1UC 4FCWA 4URYR 1T8TA 3THXA 2FX3A 3AEZA 3G5UA 2G83A 4QBGB 4Q1CA 5DLQC 2BCJQ 2Y8EA 4TLDA 4Q02A 1E2IA 5FBRB 1GNQA 4TMWA 5AJZA 1JJVA 5D3MB 3SU8A 4M1WA 5JWRA 4PHGA 4YC7A 1R8QA 2V9PA 3C5HA 2ZVPX 4YMSA 4BZPA 3GLGB 1R2QA 3UWOA 2RGBA 2FSGA 3UMSA 4BGDA 4LHWA 1B0UA 5AK0A 4B6FA 2FFBA 4PSVA 2D74A 2ZRMA 3H4MA 2WSMA 1EFRA 3IUYA 4WA7A 5FTKA 3AVQA 3L0SA 2NPIA 2JJ2A 1ZIPA 1YHNA 2CL6X 2FV8A 3GCGA 4LC1A 2D3WA 2L0XA 3KJEA 2QSZA 4HDCA 1RYFA 2O8FB 4I1SA 1F3OA 3WBKA 2QSYA 2W00A 2LWIA 2VP6A 3T06B 4DLTA 3D7MA 1ZUIA 3VFDA 2XNDA 2K5UA 4DT1B 4C4PA 3A4MA 3KDSE 5DYGA 4CZ2A 4LWZA 1RPZA 121PA 2WSSA 4GP7A 4Q1AA 1NNEA 1GSIA 3R9WA 1NN0A 4B75A 4IJMA 1CULC 4G5OA 2O0JA 3AF0A 1VCIA 2NO6A 5H68A 3ND8A 2OESA 2NMVA 1CTQA 2GXSA 1R6BX 1XPOA 1FP6A 1QHXA 4I99A 4A0FA 2FGJA 3DMNA 4EPTA 1N0UA 1QHNA 5DIFA 5ELXA 1W4RA 2IYWA 2AL7A 2Z6VA 3SHWA 3UKDA 5E7IA 3IQWA 1NRJB 3QVVA 2JLVA 2ZI4A 1MT0A 1XPUA 3LWNA 5GVRA 3PUZA 4EJSC 1ZM9A 2ZI6A 2ZRCA 4V03A 3FFAA 4PC3A 1OXTA 3TAUA 3HJNA 3L2OB 2ZREA 3CM0A 3ZVRA 5IDVA 4DUGD 3FOZA 4DJTA 2UKDA 2I1VB 2WPDD 3U44B 4P31A 2YOFA 1Q1EA 2BM0A 2BMJA 2ODNA 4DKXA 1WP9A 3LRPA 1XCGB 3RSOA 621PA 2IS4A 1GRQA 4C0QC 4GMDA 2G9NA 3TVDA 2J0SA 3KX2A 5LB2A 3CO5A 4XJXA 3IIJA 4HAVA 4KBGA 5BW8A 4PZZA 1KSFX 4QGGA 3TK1A 3OZXA 3X1WA 1AQYA 1SVMA 3ICQB 5CYPA 2AN9A 2OBNA 1XJQA 2FJUA 4IDHA 4AWXA 5EP3A 1QZXA 1LF0A 2ZUBA 1VMAA 2A5GA 5K8LA 3GFPA 1COWA 1VPLA 4JL5A 1NVVR 1VYVA 3R20A 3MGCA 1IONA 5GADl 4MITA 1XEXA 5JI3E 1GM5A 4KFUA 1AKEA 4MQBA 2JLWA 3OEED 2G1KA 1JAIA 2H17A 4LRWA 4DVGA 1RRFA 4JLKA 721PA 4CEHB 1YU9A 2PX0A 5CJPA 4OHXA 2ZETA 4S35A 1WF3A 3QPWA 1AIPA 3I72A 1VTKA 2ZS7A 1NMYA 5FTJA 5FBQB 3MWJA 3N5CA 1FW6A 6Q21A 2UZ3A 2FOLA 2IC5A 2NG1A 4BFYA 4P4UA 3RVBA 3EPKA 1U8YA 5SZJA 2WWHA 3B82A 1RIFA 4GNKA 4P3YA 1Z6AA 2O5VA 4NZYA 3NBZC 3A1TA 4QJ4A 2G88A 2O8FA 3I73A 1EX6A 3CB4A 1FX0A 4RZUA 2N46A 5J5CA 4RKEA 4MGYR 8OHMA 1E2JA 4EDHA 1AS2A 2PX3A 3U7GA 5EZ6B 1P2UA 221PA 4X8OA 2IT1A 3E5HA 5CK5A 1COWD 1M1YE 3PEWA 3LXRA 4D4MA 1E0AA 1KI6B 2KWIA 4G0NA 4QHSA 4URVR 2HLDD 1GFIA 1A2BA 2ZS8A 4B33A 5FPYA 5LD2C 1AKYA 2DWPA 3GLGE 2D7DA 3WHKA 3BH7A 2DFTA 4V0KA 4JVMA 3DVLA 1NY5A 3RC8A 2F6RA 1MO4A 2GVZC 2QMHA 5LDDC 5F98A 2VA8A 2KBEA 2VHTA 1E1RA 3LV8A 2EWWA 4UJ3A 1R5OA 3GLHB 2ZR0A 2HLDA 4KI0A 2RHDA 4ILEA 2ZSBA 4M1KA 3VR1A 4CT5A 1D5CA 1YRAA 3TW8B 4G5RA 3F0TA 1SVOA 2NQ2C 3W6OA 3THWA 5CB8A 2BBSA 4NONA 5EP4A 4B2PA 4OHVA 4WXPA 5K8UA 5DNYB 1SQ5A 5EXTA 1IXRC 2QTVB 1VIYA 2MSEB 5DN6A 4NYMQ 4BFSA 3SJBA 2PMKA 3AF2A 4ABYA 1AA9A 1N5KA 1PLLA 5FOWA 3VU9B 1UKVY 1Q21A 2WKRA 4PPQA 1XTQA 1NP6A 2P5TB 1S9DA 4ERNA 2ECKA 3MLEA 4HEJA 4TZ0A 3CX6A 2WJIA 1KI8A 1RW4A 1OIXA 2HF9A 1IM2A 5AJXA 2VSFA 3Q3JB 4KXFB 4PTLA 2C8VA 4DDTA 4R7ZA 3MSXA 4NYIR 1OB2A 4A92A 4LOAA 3G0HA 4LPKA 3EX7C 1LNZA 4OHYA 3BIFA 4EPVA 3AH8A 3I8SA 4TQ9A 1YVDA 3G82C 3QENA 3VX4A 2W6ID 1YR9A 3R7WA 4P4SA 1FMJA 2OCPA 4TQAA 3WNDA 2QAGA 4TTPA 1N25A 1EXMA 2FMXA 2VL7A 2PT7A 3KQKA 1XFAA 1JEEA 1R10A 1KSJA 1X86B 1E0SA 1PUJA 1IBRA 4H1UA 4B73A 4MA4A 2ODBA 2KBFA 4OQMA 3SJZA 4DLWA 2XOKA 1R5NA 4O2LA 4C0AC 3CIOA 4BASA 1GNPA 4DT1A 3D6TB 4B3BA 3QF7A 1NJFA 2YJTD 2O0KA 1XTIA 2YWEA 4UNNA 2GBLA 1BOFA 1DARA 3EWAA 4Q9HA 5B57C 1CBUA 4QNMA 3O8CA 3UANA 1OH5A 4GOXA 2WWFA 3R8FA 3B7GA 2P3SA 2H16A 3B1WA 4J0QA 4ZCMA 1N6HA 4HB0A 4NH0A 3AB3A 1S2MA 2A5FA 4E03A 4FCTA 2WKPA 3PG5A 1OIWA 3FPAA 3ZZ0A 3TNFA 5JHHB 2RGNA 3VQTA
chains in the Genus database with same CATH superfamily
1VC2A 2BRUA 2FW6A 3DBHB 2POCA 2JCXA 3L7YA 3LP5A 4RV4A 5AWFC 1J8MF 2KPOA 3ORHA 3AHDA 2C0QA 1Z5VA 2VP3A 1GR0A 1KMQA 1L6IA 4ICIA 2AB0A 4Y9DA 4ZXFA 3LRXA 2IZZA 2J9XB 1D0SA 2P40A 1NZJA 1O6GA 3PX2A 4J76A 5DASA 1V43A 4O63O 1JDBB 3S2FA 2OFPA 4WK4B 1PV1A 5TVGA 1BG6A 1M6VB 1NPTO 3FGZA 1NVXQ 3T1YB 1ZR2A 2HC9A 4NCJA 3VYTB 5CB4A 1XKQA 2YHBA 5HCNA 4CDNA 1W2HA 4IUYA 2QM0A 4KAAA 4AS2A 2VHVA 2I6QA 3GH3A 2CLSA 5LA6A 3QYPA 4XIFA 5H3CA 3IODA 1JXOA 3GDOA 2CNKA 5HRCA 2A0WA 2YYZA 1RBQA 2CXUA 2QN3A 3JQAD 4IIVA 2GYWA 4IFTA 1E7SA 4EGFA 1KIMA 1RBMA 2XJ4A 4A0RA 3QEJA 1IBSA 5B64A 1YC2A 1X42A 2YH2A 2O1XA 3U31A 4V3BA 3U80A 3ZZ1A 1Q6ZA 2VUUA 3QX9A 1UAGA 3DMHA 2I80A 3CUTA 2W5UA 1S0UA 3KTOA 3HXPA 4O1IA 2WIDA 2O59A 1E9AA 1ADFA 3Q4GA 2NQ8A 3V8NA 3HVJA 2F00A 2MMCA 2JLZA 1GV0A 2RAVA 2VYVD 4O3MA 4RZ3A 1DDOA 4RZSA 4CUKA 2OCIA 3LFHA 4DLPA 3EXEA 4C30A 4H77A 3WMXA 3HKEB 4BWGA 3K2IA 1XL0A 2O3JA 1URPA 4GEGA 4NR0A 4JODA 4OXYA 5BOSB 1RWNA 2I3AA 4A6PA 4CL2A 2NUAA 5J2UF 4JR0A 3TOSA 2W6MA 2FMTA 3E8SA 5CXXA 3SIXA 1TMOA 2JH9A 3CZAA 3AUUA 4CLXA 5IASA 2VDQB 1G8PA 3PE6A 4BDSA 1GUDA 2UV8A 1VKHA 3FDJA 1ZS9A 4LQCA 3HR7A 4KIUA 3SQOA 4J90A 3O1LA 5EE5B 4EHIA 5ESWA 1CUEA 1KMHB 1PU2A 2DHRA 2YKGA 1TTHA 4O1HA 3V2HA 3ZWCA 4BNIA 1KY5A 3V8QA 2BTEA 2JVKA 2VSOA 3A0RB 1E3JA 1HETA 1ZOSA 1HMPA 2GD0A 3CEPB 4IXWA 4BC0A 3FVRA 4HT3B 1ZUHA 1RCUA 1XRQA 2LGJA 2XW6A 3ILSA 4GZ5A 1Z7WA 2GCIA 2IQ5A 1XNGA 2R7MA 3C3AA 4W63A 2B5OA 1NW5A 2D2EA 2WSIA 4B7AA 4DUPA 3BWDD 2E85A 2IDKA 2RHLA 3EZ6A 4TMTA 3DL7A 4QXPA 4AYTA 2P9QA 4EFKA 3HV0A 3KR2A 2AIRA 5JCJA 4DYDA 5FPKA 1C4WA 3KEMA 2DBYA 3VU1A 2H0RA 4Y30A 1Y3HA 2FG6C 1TLTA 2CDRA 1J7KA 3S55A 3HO1A 1U2SA 2IIPA 1YKSA 3DV9A 3V4OA 2H1HA 4GL2A 3F8TA 3U7JA 2TSYB 3OC6A 2X7JA 3EC2A 4KWEA 1DELA 1R9NA 3TZKA 3KWJA 2D4AA 4LY6A 3U3KA 2A33A 4UOZA 2NNWB 2I2WA 3H2GA 3QW2A 1MHTA 5JS1A 1UAAA 2VDJA 4A8TA 4Q7KA 1VCOA 5T8KA 1ZJYA 2WVHA 3HR8A 5L6LB 3I45A 4KN6A 2CEAA 3Q7PA 4A27A 1SY7A 2DZDA 1YCFA 5I5GA 3WZ2A 1OE0A 1YB1A 3ISVA 2GYUA 3T4XA 4EHBA 2ZAMA 2R6HA 1DTSA 3BZWA 5M29A 4G0OA 2XSZA 1FYDA 3C43A 4O4IA 1PO7A 5DSTA 4KMOA 4BAUA 2EX4A 3KFXA 4D8TA 3N2KA 4PZ9A 4HEHA 3T8YA 1A9ZA 2A30A 3BAFA 3UFXB 4V0ME 1KIAA 3DFIA 4C4SA 1XD8A 1DIGA 1GVNB 4HLDA 1XDWA 1HLGA 4N7MA 4BP8A 4XWYA 4ZU6X 3KUXA 1DXOA 5L45A 1UFQA 3DAPA 4PLYA 4X61A 4TSKA 3LO5A 2A0XA 3GPIA 1DDGA 1IEVA 4CEJB 1ZK3A 3EQ2A 5DGIA 5TRTA 5LLTA 4RVUA 1U3CA 4HNQA 4CTMA 4CLRB 4C4TA 1GTJ1 2EATA 1EJBA 4MVWA 4B32A 2ODQA 3BTUA 1QRTA 3QKUA 1B26A 2FZLA 1ZXBA 3FSGA 3E9MA 4KOEC 5D3KA 3BT7A 1ZCFA 2Q8QA 3ROFA 3TLMA 4WWHA 4EO9A 1GL7A 3NHRA 4ER3A 4OI1A 1OTYA 4K26A 5I45A 3G2IA 1EM8B 4QDZA 3GY0A 4B79A 2VH5R 3GP5A 2OXTA 2FE4A 1YVRA 1EAMA 1RYZA 3E4CA 3ZJ4A 2AUNA 1L8XA 2HZBA 2C92A 4ETNA 5MDHA 1VGQA 1TF2A 2PUHA 2W2PA 2YWRA 3I9FA 3JVEA 3A6EA 3O73A 2JLRA 1TF7A 3GNQA 3JARB 1BU8A 1O08A 1VIDA 2Q5OA 4GEKA 2Z2ZA 3QUQA 2MYPA 2ZRNA 3E6AA 4L73A 5BVHB 2AQHA 3QX3A 1GA4A 4FZ5A 1BVUA 3UOGA 3FW1A 1XL1A 3E58A 4EMUA 2OCBA 4Q4HB 2O7NA 1BGWA 3DDUA 4KTTE 4RZIA 1ICIA 1AZLA 1QH1B 5AM5A 2G3YA 5AUNB 5KKCA 1C1XA 1IJBA 4Q03A 3H8SA 2FU5C 3ESCA 3L0IB 4AY6A 3UW1A 3A31A 5K8CA 3RD5A 4KRGA 2NU6A 4E6PA 3DL2A 3IVAA 1KZ4A 1CUHA 1ORIA 1XZIA 4HQFA 2J4FA 1E9FA 1TRKA 2X1VA 2OA0A 5JCOC 3L5OA 1GAXA 3NTLA 1D1QA 1MF7A 4EKIA 1IZZA 3LNTA 4P33A 3SQXA 3JWJA 2V7UA 3OEHA 1RACA 4OF4A 4PSUA 1WY7A 1UJ6A 3JQFA 4H6PA 3KCQA 3KR1A 4CKCB 5AVOA 2ZTLA 3EEQA 1J42A 3TZLA 4REQA 3VA7A 4YCNA 1NDHA 2QZ4A 3KXIA 4RKFA 4ZAFA 4JI5B 3K09A 3AETA 3RYHA 3VR6A 3W78A 4UUNA 1RJEA 4FP9A 4UATA 2AEMA 2FMHA 4YUZA 5HA5A 5AVXA 4WH0A 2AVDA 1E61A 2I66A 3A2MA 1IHUA 3A9CA 4GUAA 1AQNA 1NVUQ 3VJLA 3TZHA 5KWEA 2ID4A 2VUIB 3IAAA 3L0BA 1QAOA 3KVNA 1Z2CA 3AFNA 4L9RA 3ZVKA 4PRZA 1ONPA 3K1AA 3UWDA 5C52B 4PYJA 3KQWA 4QUGA 4RSGA 5TJHA 3RAFC 5DB4A 2IE8A 2B98A 2QQGA 3K94A 3S40A 4BZXA 2QP4A 4N5MA 3ZBQA 3BJZA 3OLQA 1XJ5A 4QFDA 3LIIA 2FWBA 2JFQA 1PZNA 3HB1A 2V7VA 1KL7A 1TUGA 1Z13A 1RFLA 2P8SA 2AN5A 5AXCA 4BVFA 2DHDA 3I92A 1NLZA 3ZIAD 1QGOA 1K6IA 2OQIA 5AM2A 4YMVA 1FLAA 1C8BA 4QRHA 3C74A 4ZEXA 3RR2A 3MJDA 3DOUA 3TI7A 2HT1A 1CVLA 4ARIA 2G8LA 2R5WA 2J6HA 2MINB 1JBQA 3CNOA 4LGCA 3EYAA 3QU7A 5CCDA 2IYZA 5EMLA 4C89A 1FVHA 2MSDB 5CVEA 2X9QA 4RS4A 3SYTA 5K03A 4TZ6A 1TMKA 2HRQA 2EFJA 1XHFA 1H05A 4HAYA 1QRDA 1VSTA 2J7KA 2D6FA 1WQ4A 1U5BB 4G5YA 4IRXA 2XNSA 1E18A 3VBEA 3E1SA 1AMNA 2WT4A 1TCVA 1Y6QA 1TAGA 1N75A 4M98A 3NONA 5DTEA 3K30A 1LY1A 4ITVA 3LAWA 2E49A 2Q6TA 3NT2A 4NXNB 2QDKA 3HKBB 4ENSA 1JIKA 4FFRA 1E79D 4ZREA 4UE3S 1KY3A 4LZLA 1B15A 1WCYA 1YB7A 2NYAA 4RE5A 3FCSB 2ZVJA 3N8KA 4O4JA 3R9KA 2VPWA 3RTDA 4MICA 1XRNA 1Z56C 2B8TA 2MJLA 3PD7A 3JTEA 4JIMA 5ALSA 3R8XA 4PR0A 3WIVA 2FFJA 1G19A 1HRKA 1WEHA 3KTAB 1MHPA 2OD7A 1GPYA 1Q6YA 2V7WA 1L4YA 1WMBA 3G2QA 4QRDA 5WRFA 4A3SA 3Q0IA 3SOZA 4KFTA 4TRRA 4J8PA 3WLIA 4DB2A 5JJIA 1JEQA 3GOQA 4R68A 4WCFC 3MAJA 3R0IA 3P9SA 1Q77A 4I50F 3D2BA 5CB6A 2IS1A 4LHYA 1LPMA 4ZU1X 4PLZA 1IWOA 2GHRA 3P45A 4KAJA 3U3OA 1QUFA 3Q7TA 4TN1A 3ZJYA 4C0SA 1JYSA 1QE0A 4W9NC 4HB4A 1ECPA 3LC1O 4JVLA 1Z6PA 4IR7A 3IQXA 4K0RA 1HMYA 4EJ6A 1TT5A 1F6BA 1L7BA 4RFSA 3RBVA 1G1MA 3ADBA 1ZGBA 4FNGA 2IV2X 2XB9A 3MK31 1W48A 5EXSA 2IXFA 4QU8A 3ELBA 4FEAA 4JUAA 4ZYVA 3ABRB 3UMMA 2VT6A 2ZJ7A 3GV0A 5HXAA 2CLEB 2HHCA 2W0MA 3G49A 3JYQA 4DSUA 4DNPA 1YZUA 4BCBA 1ZVVA 2B0CA 5EVCA 2GGSA 4E33A 3DP7A 3WWDA 4JKIA 4NZMA 4TM7A 3LC2O 3FUVA 5KYWB 1DGQA 1NLMA 1BN7A 1H2RS 1S2GA 1NKTA 1P2VA 2O3QA 3E05A 3L1JA 2HU8A 2C5SA 3R3SA 2DR0A 1H0HA 1V3UA 2I29A 1N6OA 2IYUA 2BGUA 3VPGA 5JZSA 2ZYIA 4K2HA 3RYHB 3QMVA 5JNUA 5BVHA 1JZQA 1ZOOA 3A25A 3B51X 3FMIA 1HXHA 1YO6A 5JE8A 1HDIA 1OLUB 1UJBA 1GT91 2OKGA 1T29A 3A27A 3IAS1 4OYHA 4RGBA 5DV9A 1SVIA 2OFOA 3GDGA 2WRZA 3I5AA 1SCJA 4RH1A 4KVFA 2P4QA 5FCDA 3LHKA 4TMXA 5JADA 2XIJA 1KRWA 1IQUA 1ULHA 2WHPA 3JQ6A 3IBTA 3PL1A 3AMVA 5ERXA 5COQA 4KH0A 3B1XA 4U8HA 2Z1MA 3OE5A 1XTUA 3LTEA 1PR9A 3WLAA 1PEDA 4B3XA 4BVBA 5FUWA 4P32A 4HTAA 3KUKA 5YASA 3ABZA 3ZDQA 2QTTA 4MB6A 4BVJA 2PLRA 1CKEA 1J0CA 4D8WA 4DMMA 3I12A 2AF3C 1Q0UA 3R5XA 1PYOA 3A1EA 1KMIY 2YJNA 2PBZA 4M8SA 5FPHA 4Z3KA 2XE8A 4JQSA 2PKQP 2OGZA 4M55A 1TTPB 2X6RA 4M7OA 2IHYA 4NQRA 1OHHA 1UBNA 3BFKA 2IWHA 4C87A 3QMWA 4XWWA 3OKAA 1Q19A 1CRZA 3GCDA 1F1JA 1GKUB 1JQJC 4EVSA 3HEMA 5K0TA 1T5HX 4O8ZA 4BO9A 3GLHA 2HHAA 4II3A 2ZYHA 3A58B 3BGDA 1CR4A 1DCFA 1ID1A 4O4IF 3IKMB 2IXEA 2BFCA 3CXRA 3LHIA 1YFKA 2YQZA 3OCUA 3DV0B 5FWNA 2NU7A 1JUDA 2AS0A 2RG7A 4X8LA 1SOAA 1V3VA 2Y1XA 1VLLA 3SIPA 3D81A 5IYZA 4OOFA 3H8WA 4ZI7A 2IEBA 3HI6A 3LPDA 1XX6A 3HN7A 1SXQA 3ELUA 5IZCC 3SHVA 2H0QA 5IW8A 1E9EA 3ZE8A 3AB8A 3OOHA 3RNOA 3R7AA 4YAJA 1SURA 2C42A 1EKXA 4JQYA 3PEEA 4UVHA 4X63A 4ZVQA 2VC2B 4FYKA 4PRKA 3MWEA 1Q1QA 3SBOA 3HB7A 3R4CA 1PKEA 3MXOA 5D1NA 1YF3A 2DRIA 4ANFA 1X7ZB 3IP5A 1EWKA 1S3IA 1N8NA 4RDHA 4ZRNA 3I2HA 5FWYB 1BRTA 2VUHB 3SE0A 4FFPA 3H3JA 5J4VA 1PJZA 1M33A 4U2EA 4ZYXA 3FLEA 2HSDA 1L5QA 1U81A 3TCKA 3OSZA 4XOIA 3CVWA 3EG9B 2ENWA 1TJPB 1UMCA 3UHAA 2GBCA 2EQ5A 3RYCA 3EMKA 4US0R 5DLDA 2C5LA 1L6RA 1QC5B 3CF0A 1W5BA 3AJ8A 5GONF 1TPZA 2C7OA 1ZVKA 3KPWA 3PKJA 1QTQA 4HWGA 1O9GA 3KHTA 1WSWA 4W9MC 1W75A 4AIIA 5K0CA 2AOTA 2GPJA 2GPTA 1KOFA 4O02B 4CCYB 4DRXB 3PI6A 1CE8A 3F9CA 1RLJA 1S96A 1KY4A 2AG0A 3BB4A 4BFVA 4I2NA 3UM9A 5K6AC 2PZLA 5BSUA 2IU0A 4MARA 1PZXA 3USES 4KUHA 3PXGA 3WL3A 2IEYA 4F1JA 1TM3E 1E9DA 3NVDA 4YUWA 2V6BA 3DVQX 5G2OA 3EC7A 3FJYA 5F7ZA 2FSUA 4KL8S 3RM3A 5LD2B 4J0HA 1ZD9A 4BC1A 3UJBA 1Y1TA 3GZ4A 2ST1A 1I32A 4HG2A 1J0XO 2EW1A 2FQWA 4KMSA 1X6VA 4LG1A 3PX7A 1Q1ZA 3MAAC 4NFLA 4MVJF 4REOA 3A4LA 3CRVA 5D5HA 4FQ8A 4EX6A 1QYWA 4MGIR 3VSBA 4X64B 3P4YA 2NACA 1N33B 3WHPA 1R6UA 2QYHA 1UT5A 1NGSA 1SHJA 4N3BA 1E0JA 3HDGA 5K2OA 3H0KA 1LBHA 3R44A 1JHOA 1N7JA 5HK8A 1H5UA 1K5PA 4P1ZA 2UZ4A 1E4OA 1WXEA 5JPCA 4MP8A 1A5AB 4O2BB 3OLVA 3RF6A 5HTOA 1V6AA 2FR1A 4BNVA 1W88B 4YJHB 1WBBA 5C0OE 3RW9A 1AGPA 5FPSA 3TF5A 5L7YA 1Z26A 2E4WA 1UKBA 3MWDB 1TTTA 1GGFA 4FSXA 1EE1A 3QKSA 4OLJA 4S1OA 3WGUA 5C1DA 5JH7A 5JFOA 1TEXA 5C8YA 3G2PA 4GR9A 4OBBA 4Y6PA 4YCDA 3REFA 3L7BA 4IOJA 2IZ5A 4XD7D 1D4OA 1JQ5A 1O4VA 1XDDA 4IKEA 4LJ8A 1H4VB 2YZNA 3R7NA 2ZS9A 3PDIA 3PGKA 1MPTA 2PQMA 2XA2A 2C2XA 3UTCA 4A0SA 1DC7A 4BV9A 1EFVB 4ENPA 1G9SA 4U5QA 2LCIA 1MBZA 2YC4C 5HEKA 1BKSB 3G68A 4JB3A 1CZNA 1AT1A 4ND3A 4PVDA 1G1AA 5D7NA 5TARA 2BZ1A 4IV5A 4DA4A 3B36A 2X5XA 1OT5A 4KO2S 4UEKA 4URUR 3WQRA 1F8XA 1PR5A 5HIJA 5JYCA 3AR2A 1CNFA 1HZZA 2BM8A 2IYSA 2W8BA 3C3CA 3HLYA 1PW7A 1T6YA 2Z5VA 3DM9B 1IC6A 2FRDA 3F6CA 1I01A 3QMPA 5BMVA 1VL2A 3BUSA 4BKQA 5JV5A 2X9GA 2WDPA 3VH1A 4UXIA 2XWBF 3RVRA 1SBIA 1RWBA 3HA5A 3QNMA 4WGGA 3BB3A 1BE8A 1NP7A 4K5QA 3C7DB 1ZAYA 5KOHA 4JB8A 3EGCA 5KHOC 1XLVA 2QS9A 5DHRA 3SS7X 1C7EA 5JALA 4Q7EA 3ZV7A 4IDGA 1V5WA 2GVDC 5AJYA 3A28A 2D1TA 3DTTA 4L4RA 2HU7A 3I2YX 1E5VA 2F1JA 2AF4C 1YE5A 3AHIA 4LDZA 3TLBA 2AZTA 1BX0A 4M9CA 2PWPA 1Z6XA 2Y1EA 4RIEA 3C1OA 4R2HA 4KPGA 2VDUE 2ZSHA 5HP4A 3R7WB 1E7MA 3YASA 5A5GA 4HNUA 1GNTA 4PQYA 5FEUA 2YHIA 3JU3A 1JXQA 2NTNA 4BO4A 1HEUA 3PEUA 1E1CA 4EHLA 2PYDA 4PYQA 2RJNA 3NJ8A 4MX8A 3UGQA 4BMZA 4G2NA 4HYTA 4UBIA 5B2FA 2I87A 3FPCA 3Q1KA 1B7GO 2P7HA 2PGDA 5IJXA 1G6Q1 2CFIA 4PZLA 2H54A 2ZRDA 2J3IA 2GM9A 2C8JA 4WEOA 3AR3A 1P0PA 2DQSA 2G25A 1ZXLA 4MVJI 1NR5A 4GUDA 3VZDA 1PZMA 2FDXA 3IOCA 3BKWA 3TIXB 2Z56A 3L0PA 3IT1A 2O2CA 1A5BB 3HWX1 2AI2A 3I4FA 1K7EB 1R8YA 2EX0A 3KXPA 4H59A 4ZVRA 5BMVB 1DKQA 2IBTA 3PF9A 2Q5CA 2M9MA 2X1LA 4LMAA 3M6IA 5L4SA 4KYTA 3TBHA 4XTCS 4K2AA 1EP2B 2QAGB 3WL5A 4DJEC 2RK3A 1RMQA 4MAMA 5KTRA 1PJQA 4O2BA 5HKBA 1G2PA 3A6ZA 4A1OA 4L0MA 3VHLB 1TQ2A 3I8OA 5BVGA 4TXNA 4CQMA 4UXJA 1EDOA 4UUPA 3DAFA 2QPAA 4M0UA 3B9BA 3K5PA 3P32A 4C3UA 1D6NA 2Z98A 4H9GA 4LHEA 3U4MA 2IIVA 2I4LA 2ZYWX 3K9QO 5TJ9A 5JCZA 3FPLA 5TIIA 5F3RA 1JIVA 1L2TA 1NZFA 3SSOA 4R9UC 4JELA 3R5TA 1C3OB 2V8BA 4TGLA 3VPFA 2D2FA 4M9SA 1JDZA 4D5GA 2NPOA 2YS6A 1A1SA 3SJUA 5KNLA 1P7YA 3ORSA 4HN4B 5ES3A 1VL1A 3SJ7A 3PNOA 4DRXA 1G2OA 1MO2A 3B5JA 1XK7A 2ZXEA 3E9ZA 1UXHA 4QEKA 2C1XA 1Z5UA 1Q7RA 1OPRA 3W2GA 3W4JA 2QTFA 3V6LA 4CM1A 5BN3A 1BEUB 2BN4A 1S4QA 1ZINA 2WVJA 4BQQA 1USWA 4M1SA 4LXHA 3RSZA 2PSDA 2BEKA 3ND6A 4V3CA 2QYTA 3A6HA 3WK9A 2WWGA 5B5SA 3GNLA 2PEZA 1ZAKA 1FQJA 3P0IA 4NYJR 4AQDA 2PZBA 1NOJA 1TZCA 2C9MA 3DHVA 4K87A 4K81B 4E5UA 5KVCA 3MD9A 3MMZA 3HP7A 3PFBA 3OH8A 2AZDA 1KAEA 4KGZA 2Z8XA 2I4OA 2QMEA 3W5BA 4CHGA 2FPXA 2WKWA 3CZMA 5EXEA 3U4GA 3EXIA 1VPWA 1RJDA 3N0VA 1ECCA 2QU7A 1V96A 3PJFA 4O25A 1T9GR 3TLCA 5B2ZA 2P9YA 5DMHA 4P36A 4AG3A 2ZAYA 4F86A 1T0HB 3W6NA 2VRBA 5IDQA 1PV2A 2YV5A 3CONA 3ONEA 3LWZA 1U3WA 3JZDA 3V42A 5FV7A 1GKKA 1HTTA 3SSAA 2GJ4A 3TUIC 2Y99A 4G25A 3UZUA 1IB6A 1Z74A 1UUFA 4MPDA 4LZWA 4EPRA 2C7PA 2UYHA 4H3SA 4OHOA 3U9LA 1G16A 2G9RA 4R0NA 1RRPA 1U11A 3MWYW 1YJXA 3ZHOA 1SH7A 4DG5A 5JJLA 1R0RE 4IO1A 4GVPA 3THRA 2ZU6A 2BHTA 1MW8X 3RV4A 5F12A 4CDRA 2CLHB 2FEXA 5EXDA 2QORA 5JO9A 3ZKAA 4EGJA 4PYOA 4L57A 2WAOA 2WKSA 3I23A 5L3RA 1CJMA 1VB5A 3KEGA 2J07A 1UP6A 2QQFA 1ZSVA 3HJTA 4RK6A 3BWMA 4YQZA 1OFTA 1WUYA 5A1TA 4HNAB 3ACBA 1TI7A 3UA4A 1AQ6A 1L5OA 1RQPA 1U2DC 1CJBA 2WAMA 4ROSA 4TKVB 5IHPA 2A9JA 1SD5A 4MCAA 4RACA 4EJ0A 4E5NA 3MPOA 3RYIA 3UJ3X 2G63A 1V7QA 1E2GA 3AHHA 4Y9SA 2PZGA 4OGWA 4OUDA 4YONB 3G1UA 5E2BA 4JIGA 5CT4A 4RFVA 4F45A 3NIFB 3TG8A 4D44A 3PHIA 3NYIA 4QUIA 2QJFA 4M46A 1QLJA 1QG2A 2HF2A 4BGUA 1P8AA 2O8EA 1DCTA 1HZZC 1SC6A 2C04A 2B35A 2WWRA 5EVJA 3REOA 5KZMB 1JDPA 4QVGA 4JI8B 1DAMA 4K8OA 5DOZA 5AHXA 1ODSA 1MV8A 2XA9A 3CNHA 5AQEA 1XZMA 2HQSA 2J3JA 5A6SA 4Z9YA 2JJ1A 3BK7A 3I2GA 3NGXA 1CIJA 3PFGA 1U0FA 2B83A 3PGJA 3QLTA 4XM2A 5HBRA 3ZUGA 4AP9A 5HM8A 1N9KA 1DXQA 2IUTA 4MNTA 3GFSA 1RHQA 4LJRA 2Z95A 4TS1A 3RFUA 2IZOA 4R0VA 3T0IA 1Q3HA 1UWKA 1WABA 4OG2A 2QE7D 3NWOA 3IXQA 1ECLA 1BH2A 4OGGA 1OZAA 4TS4A 1U7ZA 2QXYA 2C5HA 2V96A 3L05A 1M76A 3NDPA 3PZBA 4LOIA 4EI2A 4YY3B 1X7YB 4N6GA 3IL2A 1NM5C 1GZUA 5BNFA 5IX8A 3VPSA 2HNAA 1BE6A 4I08A 5K8IA 3WGLA 4E94A 3LVQE 5KNCA 4TYYA 1JPUA 4R83A 3K5IA 4BNHA 4LBVA 5SZIA 1YMVA 2WA1A 4GBJA 4PC2A 4U1RA 3KT0A 1TYEB 4Q4HA 5ALZA 4CKBB 1P19A 1JG3A 1O95C 4QDXA 1HQCA 2ASEA 2Z2KA 2WWTA 1CUUA 3WHLA 1AQUA 1E0KA 2Q8PA 3EW7A 1P7ZA 3KNZA 4X95A 5FORA 5FH9A 4UBMA 5ADUS 2C2HA 2WHQA 3CLUC 1AHHA 2XNHA 1QANA 2QPOA 3MGGA 4U2KA 1MQSA 3WLOA 1UJ2A 4FMDF 1JEDA 3A6FA 2LR0A 3THYA 5G40A 1S8OA 5IKXA 3M5PA 1TFRA 3LCCA 4OL9A 1ENZA 1T5LA 5DYIA 5KREA 3TJMA 3P9XA 1SCBA 2CN1A 3DT6A 3ISTA 3L92A 4IUBS 2IPAB 3ES9A 4HQLA 4CTNA 2JDIA 4YROA 4XLTA 3TSAA 5BSEA 1IPEA 1HOXA 1HZJA 1EINA 1PT9A 1TYCA 4K9PA 1DKLA 1SULA 2IV7A 3UK7A 3PTZA 4F4CA 2GH1A 3U3JA 1FRFS 3NT5A 3D2AA 3H6KA 1IEQA 1Q50A 2R8YA 4ISCA 4NLLA 2OP0A 3WGZA 4XQGA 4G67A 4G0VA 2EAUA 1E7YA 2XEXA 3A9RA 3CE9A 3UNXA 1IZ0A 1Y98A 2X3YA 3KSMA 3ADPA 4M0DA 5ITWA 1FQOA 5EIHA 3EGOA 5KEIA 4CM8B 4YX9A 5A04A 1QB8A 2R5NA 3VR6H 2IL1A 1FUEA 2X77A 2I9KA 4P6VF 2FWAA 3DLHA 4FGKA 4KQ9A 1X1EA 3IPRA 4RGQA 2QZSA 1OUMA 1WUJS 3DSRA 5DE3A 4F46A 1TVCA 1A72A 1SHLA 1SCQA 4AO8A 1KQPA 5JARA 1Y37A 3QXSA 3BA6A 3F3MA 3OCWA 5C18A 2JH3A 1C7IA 1NVTA 1T5SA 2WSLA 3JAWA 3LCVB 3MT0A 5DM2A 4NBRA 5HZKA 1TU4A 2J67A 3BD7A 2XXAB 4DYHA 2C59A 3PVSA 1LX6A 3LGSA 1YIDA 4HPWA 4EW1A 5FAKA 2WAXA 5DFAA 1VDMA 2PAFA 2YRWA 4AG6A 2JLUA 2ID7A 4WT7A 3TXYA 3IIKA 1N2CE 4O59O 3ZWMA 4IPTA 3M1LA 4RVCA 4G8CA 2ZE5A 3EVAA 4M0CA 4A8PA 1LDBA 5IBQA 2CXXA 2IYTA 5TPWA 2WIFA 2ZRKA 5JFTA 1YA4A 4LVUA 2BGTA 2PX2A 3U9SA 2ZR9A 5E3IA 3ZGOA 4RPCA 4KO8A 5HZMA 3EDMA 3NIDB 4BBAA 4EZEA 3EA0A 4OTZA 4L72A 3FVTA 1XDZA 4S0ZA 3BG5A 1D7AA 3V9AA 4DIOA 2LBPA 2O7RA 4IWNA 3FHCB 4JGGA 1SO8A 4XZ3A 4CQLB 8ATCA 1HNWB 1CERA 1W25A 4COOA 2OQRA 3FRIA 3G79A 4B3CA 1U4OA 4WJKB 4YVFA 1GNVA 2VYCA 3V1NA 1KDZA 1WZCA 3RODA 1EHCA 1QWOA 2WU4A 3I53A 1G98A 4RDIA 5FUMA 5JNRA 2G76A 2JANA 2NGRA 1WM1A 1WX1A 4JLPA 4QGHA 1RLIA 3RFXA 2EL7A 1CUIA 4XM1A 3ONWA 5C5IA 5C9ZA 1H94A 2ZRFA 1ENOA 1PT7A 4L9WA 4BFXA 1R7RA 3KV3O 3P2IA 5JI2E 5FXMA 5GV7A 4ZYUA 2QZPA 1BW9A 1ETUA 4UVIA 3RU2A 5A0TA 2W42A 4K6KA 2F3SA 1QX3A 1Y5LA 1FBNA 1ZGAA 2IZ0A 4PVCA 5CNKA 4LHSA 4L0CA 5L4LA 3BMOB 4YBRA 1QTNA 2Z1NA 3JD4A 4U2BA 5GV8A 3HJHA 5CJJA 4DXHA 2QQEA 1E9VA 2EF1A 1T25A 3TZ6A 4ZGWA 3A8TA 2A0UA 1C7ZA 1WCV1 3CWZA 3TSZA 4MMZB 4UTPA 2VZEA 2Z2YA 4F9EA 5AD1A 4PQFA 2GCNA 3BVPA 1QHSA 2B2CA 1VB3A 1EE9A 4EI9A 3GPLA 3BXZA 1W4CA 1YQEA 4RA9A 1WXXA 2HMYB 5AW5A 2CNWA 4JMLA 2ORVA 4E2YA 2QD3A 4LOKA 3G7SA 2WB2A 3NJ4A 1Y8QB 1N4DA 4OK3A 3UC5A 1S3FA 4Q6WA 1ABEA 3K8OE 5A3QA 3LX6A 1NXOA 1CZUA 4G4GA 5LMCA 1T8UA 1PSZA 4ARBA 2ZUSA 1PQYA 2O8DA 3KZVA 3L07A 2J30A 1E6EA 3OZUA 1HO3A 5DHTA 4MUHA 1KERA 4DB4A 4N9QA 4BMNA 2I6TA 1NBIA 3FTPA 3IQDB 3JQ8A 4YTEA 3EZ2A 3CZRA 2AJTA 5JS2A 2YVQA 3T7EA 2NYVA 3V7YA 1WD5A 2QD4A 3TVTA 3QPUA 1MX3A 1C3OA 3E3MA 4L5AA 3ETLA 3BL6A 4CKWA 5EIFA 3UPUA 2HXYA 4HZUA 3BERA 3P9PA 3VR5H 2VF8A 3ZLVA 3ZW7A 1F2VA 1QVZA 2WE8A 3EIHA 1FYXA 3I5YA 3TSOA 3I6YA 1ZMXA 1Z6YA 2OE2A 3W8NA 4AZTA 4FUQA 4BJ3A 3KQNA 4XEHA 1NJ8A 4NOLA 2E7ZA 3PD0A 2FF5A 5THXA 2PLWA 4X6LA 4FZ3A 5CLHA 1AUVA 1VA5A 3ONFA 1JR2A 4GXTA 3RWMB 4D81A 5MFZA 3VHRA 2CKMA 1W0JD 3EFEA 3FOCA 2VF7A 1SGWA 1VI5A 4MGZR 4P4NA 4QU0A 3PPVA 2JIBA 5JCPA 3PPIA 4LF5B 4K0KB 3ZIDA 4CNBA 1WL8A 2GA9A 3K8QA 4FBLA 4Y2JA 4V0RA 4JBXA 3PXUA 2FAXA 3LL4A 3PFWO 4MHSA 1PJRA 4Q66C 4F4DA 5KQLA 1B76A 1NAIA 1NRWA 1NVVQ 2V97A 3WADA 4QECA 1Y4AE 1Z5WA 4TN5A 5H5JA 5K4AA 3DVSX 1MJGM 3JWIA 1J0BA 2BLNA 1QRUA 5SICE 2GKGA 1X1SA 3GA5A 1F7VA 1VYUA 3VX3A 5LZ7A 4C6HA 3SSMA 4NS4A 4F72A 4LUCA 3W9UA 1BAPA 5M5BA 4ND8B 1WDKA 1N2SA 5JC1A 4Y1RB 5EESA 3RKSA 4Y2VA 1I1NA 3TNJA 3TXXA 2DKFA 1N3BA 3SBXA 5JXJA 1CR1A 1F7UA 1T4MA 1BH6A 2FFQA 1HUQA 1XDSA 3IXMA 4TT3A 5CA0B 2QLNA 1DE0A 3K4QA 4O1MA 3D2LA 3GX1A 5CJ2A 4KO3S 5C2JB 3U4CA 2ISSD 5I7WA 2IS2A 3HDTA 2OGWA 3Q1LA 2JB9A 2ADFA 3JWEA 1WE2A 4BBZA 4EHNA 3OU2A 4RJ2A 3PRYA 1R15A 1L4GA 3M82A 4TMKA 4DC1A 4DE5A 1Z5NA 4CEIA 2ZJZA 2X0NA 4GE0A 3L7LA 1IE3A 3T1VA 4A16A 4A0HA 1WVMA 3QUSA 2CE2X 3R6WA 1KEZA 1YC5A 4PXAA 3ZHCA 1UPBA 1G5QA 5BUCA 1DJPA 2J5BA 2UZAA 1JR3D 1Y9JA 2WT9A 4LK2A 1ESZA 1GTG1 2WG2A 3DUWA 5DI3B 5G4KB 3DZFA 3FGNA 4B74A 3FYUC 3Q9UA 2ZRIA 3QBTA 2FNAA 4MKGA 4LYJA 1YB5A 5EJAA 3GEIA 3N6RA 2IUSA 3IBFA 1G20A 2D0IA 2NQTA 5F21A 5FOXA 3AVTA 5FYQA 5E1MA 2GEJA 3SX2A 4IH1A 1HE1C 1VMDA 4G0YA 4OMFG 3X1DA 1YCDA 1JECA 2P2GA 1F48A 3DBVO 3VBCA 4GL4A 4AP6A 4AROA 2BZ0A 4C0HA 2NP7A 3GW8A 4UHEA 1E8DA 5JS6A 5GZ3A 1GV1A 2V9CA 1M0WA 2E4VA 4LZOA 3H86A 2FZGA 1TOAA 3ZWWA 2XCIA 4WNAA 3FLMA 4NCNA 3O9VA 3FNGA 4K40A 1D6MA 1N9ZA 2GVNA 3UAVA 4QG3A 3WGIA 3TLXA 4B0PA 4BN0A 5EAIA 3IEVA 1U9YA 3MS7A 5TX7A 2XBUA 5TV2A 2CDAA 1SQFA 4M9QA 4JJ4A 4UPEA 3TGPA 1K8QA 5CA0F 1E59A 1UQTA 1V37A 2L69A 2ZIUB 2ZWOA 3O4RA 4OQ4A 4R5MA 1QOQB 1U2PA 3A70A 2QMUA 2HDNB 4LXIA 3JPWA 5TGTA 2G7ZA 1NF9A 2ZRAA 1SBTA 2R62A 3PITA 4LNUA 3ZI4A 3Q40A 3B2NA 1JG6A 2FEPA 3C6MA 3T7DA 3RK0A 4EABA 3CCFA 2OG2A 4QBIA 1Z4KA 3ULKA 3X1ZA 1PI3A 4XVUA 2E4XA 1CQWA 5JECA 3GARA 4W1SA 2I2XB 2YVAA 1H2XA 2VUSA 2XH8A 4HGYA 4DMUB 2P3OA 4P58A 1JJIA 3H83A 4I36A 3PNQA 2VRCA 3TQFA 1YTUA 1GEEA 2W6NA 4R3WA 1ONBA 4UNQA 5TSDA 3W5DA 2EKZA 5IYZF 1P75A 4LV5B 4O4LB 1HK7A 2FF7A 1PWZA 2QVXX 3V2UA 1NJ6A 4H7FA 4YJKA 2L19A 1K7SN 5AW7A 3HP1A 1TM4E 4Q9DA 2H1OA 1I36A 3EXAA 1II8B 2REOA 3LZDA 2JGDB 3FNRA 3WDMA 4C7OB 5FQNA 1LPOA 4UUQA 1I10A 2ZBUA 3EZ7A 2QL6A 4X45A 3A9WA 2YJZA 1JWLA 4RPKA 1IQRA 2AN4A 1HV8A 4YACA 1U7OA 1HLFA 3EIWA 1DBRA 1QKJA 1ENYA 4TSFA 1ZD5A 3SEFA 3R3YA 1YI1A 4JJEA 4QC2A 1ILEA 2HHHB 4H7HA 5CPFA 2VCEA 1EG2A 2O0LA 3O4VA 5CDTA 2FGKA 4R8LA 2RH4A 2WIBA 4OFWA 4ZOCA 2W4MA 2VYVA 2AFVA 3OQBA 4H4CA 3OTOB 4ZVSA 1IOVA 1LFAA 1EDEA 3BH6A 3SG0A 4IQGA 3NAZA 1XGKA 1IXSB 2JD2A 4KSCA 3WLKX 4L4UA 4DS3A 4F2DA 5JEDA 5IFLA 5LFAA 4HDMA 2FSHA 4I5FA 2ZYGA 3KQUA 1IK4A 5KQGA 3I3SR 3GUUA 2BFOA 4JI4B 4LN1A 2R85A 1MZVA 1A8HA 3E18A 1PR3A 2UZIR 3IV7A 4WZBE 4BYMA 4BEBA 4DC9A 5CFZA 1UPXA 4GOMD 4QBHA 1JV2B 4JOCA 3QSGA 3SC6A 4D3YA 1UWVA 3RRMA 4YWJA 4D9NA 2J3DA 3IJ5A 4FYIA 2WVAA 1A7KA 3I05A 3ZWXA 4NKRA 4CFYA 1SM4A 3T9CA