4PHGA

Crystal structure of ypt7 covalently modified with gtp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
176
structure length
176
Chain Sequence
KNILKVIILGDSGVGKTSLMHRYVNDKYSCQYIATIGADFLTKEVTVDGDKVATMQVWDTAGLERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis,exocytosis
molecule keywords GTP-binding protein YPT7
publication title Locking GTPases covalently in their functional states.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 52
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phgA00
2GF0A 5KDDA 2BEJA 2W6ID 3CBQA 3QKTA 1Q1BA 3L0OA 1UKZA 4J0QA 1SXJB 2PX3A 1XMSA 2QI9C 4HB3A 4NKRA 4C0AC 2BVNA 1HH4A 2JAQA 4V0NA 1KAOA 1NN0A 3UG7A 4A0HA 1G3UA 3KB1A 2D7CA 2QQEA 2HLDD 2ZJBA 3CNLA 2G0TA 2A5GA 3TGPA 4IEIA 1COWD 1VYVA 2JJ2A 3PEWA 4V0ME 2D06A 4A2QA 2HXSA 1XPUA 2W83A 3DPUA 1J8MF 2RGBA 3WHLA 1N0VC 1SVOA 1Q1EA 2XOKD 3QG1A 2D74A 1P2TA 3GLHE 1NNEA 1FUUA 3QG5A 4PQYA 3AVTA 4OHXA 2QPAA 3LBHA 4PSAA 2XJ9A 1NVVQ 1T8TA 1W48A 2IEZA 3I92A 1EGAA 4Q1EA 3HJNA 3U7EB 1KJWA 3I72A 2JLVA 3GLIE 2RGDA 1OW3B 4OKSA 3L8ZA 5J4YA 4MITA 3U4QA 1OHHD 2YHSA 1EK0A 2F1HA 4W5JA 2DCUA 2GTPA 4OK3A 4QXAA 3T12A 4B2LA 4MRRA 1ZU4A 1A2KC 1L7VC 3BC1A 3KJHA 4RD1A 2JCSA 2WJYA 1CIPA 2ODEA 4UNQA 4URWR 3VKHA 5J5CA 1JALA 1J8YF 4KJZA 3RVBA 2N42A 4IKEA 5JSZA 4FWIB 1NP6A 4RCYA 3BXZA 4DVGA 5JI3E 3W3ZB 3C5HA 4DZZA 2SHKA 1TQ6A 2F3TA 1UDXA 3RC3A 4RD4A 2V4ZA 2R44A 5FTKA 1LNZA 2QM7A 4PO8A 3W8RA 2JA1A 1L4YA 5D3QA 4DKXA 1H8ED 4V0KA 1RC8A 2JJ1D 2OCPA 4B3XA 3FMIA 2ZR7A 3U6BA 4QHYA 5M04A 3FMOB 4GL2A 2GF9A 3FTQA 1Q20A 1KY2A 1M7BA 4ZV4A 4ZCLA 5JEDA 4MKGA 2GA8A 1TEXA 4QM7A 4JIMA 1F3OA 1GRRA 4E5UA 4PPNA 4DLVA 2CNWD 4G3XA 1V43A 2IUSA 1FMJA 2GKSA 1E9BA 1E9CA 5DN6A 4B75A 3I1FA 4N0EA 5FUYA 1SVSA 1ZNYA 2RGXA 4DXAA 3ZGXA 3FVQA 2QSYA 3I4LA 2NMVA 1KK3A 5CK5A 1N6IA 2YVUA 3A6PC 2NZ8A 1CR0A 2A78A 2HT1A 2CCGA 1CP2A 2WJVA 2HUPA 2JLZA 1EFTA 3FGNA 5FUVA 1YR8A 4G5RA 4K46A 4WZAE 4Q01A 4A8JA 3GFOA 3Q72A 1GKIA 1ZC3A 3LLMA 3K53A 5FBVB 4LC0A 4U00A 3IHLA 5BQ5A 5CDFE 2X2EA 3BWDD 2BCGY 4QBIA 1Z22A 5JI2E 1G21E 1P2UA 1XJQA 2WMOB 4NYIQ 1XP8A 2RGNC 5J4LA 3BORA 1CBUA 1Z5ZA 3THYA 1CLUA 2EFDB 2RHDA 3AKCA 2ZYWX 1N6NA 1OPXA 1VYUA 2F1RA 1TNDA 2ZJ5A 2Z83A 4B74A 4DT1B 5BN3A 1OFTA 2ZI5A 2ZRCA 2QGNA 821PA 4DEXA 4GDFA 3PFIA 4M1TA 4DLUA 4C2TA 5IK2D 1CRPA 1RYFA 4FD2A 1OKKD 2W2TA 2GXAA 2VF7A 1NG1A 1KTVA 4UNNA 3QNUA 3THXB 1YJ5A 3T1QA 4PTLA 3SYLA 4RD2A 521PA 4AG5A 1WMSA 5LDDC 5AUQA 1IN4A 2D7DA 1UBCA 3KKOA 4NYJQ 3FKSD 2ZRNA 1EG7A 2BMEA 3GJ0A 1CTQA 1XTRA 3LDAA 3BJIC 1U9IA 1VCOA 5FBWB 4MRNA 1UBFA 3PIRA 5FUXA 5IDVA 2DFKB 2KBFA 2MSDB 3UK6A 3OEED 4TWZA 1GL9B 1GZSA 2CBZA 5JS7A 5F2EA 4TQUS 1E9FA 1GVNB 2YOGA 4TYWA 2WM9B 1YQTA 4OHWA 5HKKA 2QMOA 3R9XA 3RRYA 2NGRA 5JRZA 3KKQA 2HF8A 2QTHA 3HP1A 5HCNA 5AUNB 2VSOA 4DLSA 5EZ5A 4FMCF 2F7SA 4A2PA 4PZZA 4DSNA 3AEZA 3B78A 4URVR 3L8YA 1E4YA 4NCJA 4Q4JA 4EQ6A 5DYIA 5IT5A 3CZPA 4GSYA 4A6XA 5JBQA 5DISB 2JEOA 1KNXA 1PUJA 3JVUA 3PVSA 5G41A 4AKHA 4D0GA 5JLJA 1KSJA 3KX2A 4GP6A 4Q1CA 3X1XA 4JSYA 2P65A 2E9SA 1MR3F 4JLMA 5DI3B 3TSZA 4QM6A 1YKSA 1G8GA 1KY3A 1LS6A 1TADA 3N70A 1AS3A 4Q9HA 2J0SA 3AGQA 1ZIOA 4WW0A 3FFAA 5FTLA 1T3SA 1TF2A 1IN6A 1NIJA 3LQRA 1XMIA 4DBLC 2AK2A 1ZUHA 4Q5IA 2BBSA 2FE4A 4QGAA 2ORIA 1VIAA 1GL7A 4W5HA 4DSTA 2PZGA 4JT2A 2I4IA 4C7OA 1UADA 2H7VA 3C14C 2C04A 1KDOA 1U0HC 2HEIA 3NHBA 1SQ5A 2VSXA 1WRBA 4KV9A 3RYTC 1T4GA 3L0SA 4DIEA 2RHMA 1BOFA 1GNQA 1PLLA 2DYKA 3AF2A 1KI6B 3GLFA 3LA6A 4TYPA 5TXGA 1E1RA 2VTKA 2H5EA 5A4JA 1O3YA 3ZLJA 2QPTA 2OM2A 3I73A 1G18A 3A8TA 3QEOA 4I1UA 4U5XA 4DCNA 3ZD6A 4EPRA 1KK0A 2JGNA 4TQAA 3BGWA 5IK2A 2ZUDA 5GADl 1G3QA 1OKKA 3ECCA 4KYUA 3IO5A 2IWRA 4EDHA 4MYCA 1KDPA 4JL6A 4PZYA 1OXVA 4P3YA 1TQDA 2OV2A 4LYFA 2AKAB 4S35A 3U3MA 2GJAA 5D3MB 4FI3C 4TMKA 4PANA 1FTNA 3UXMA 3SN6A 2VA8A 4B3DA 2XZPA 1SKYB 2C98A 5B64A 3DZDA 5KPDA 2BBWA 5CYOA 1T8UA 4OBEA 4E09A 2OBNA 1UDWA 1WQ1R 1VKJA 4OJKA 4QL3A 3MJHA 4Z8XA 1R2QA 5E3HA 4RKEA 3U44B 3G82C 4Q7KA 3MMPA 4MKHA 1QVRA 2FPKA 4US2R 1PVOA 5BWMA 1HA3A 4QBGB 1G5TA 3ZQ6A 4ZCIA 3NWJA 3IGFA 4OK5A 4PC7A 1K8RA 1ZP6A 2XSZD 5JCZA 3QPWA 4H1VA 4V02A 4BFVA 1SXJE 2TMKA 4Q9IA 4NE2A 4ON9A 1UEJA 1E1QA 4MH0R 2F55A 2PEZA 1TQ4A 1YZTA 3MUFA 3SE0A 4H1UA 4M9ZA 2WSSA 2VQSA 1S3GA 4JT4A 1MRNA 3S1AA 5FBQB 2WKRA 4HZIA 4F4IA 5CM9C 1F5NA 1F2TA 1KK1A 3TRFA 2HF9A 2PT7A 2FPMA 3BB1A 2B8TA 2ONJA 1CKEA 4DRZA 2FZ4A 2ORWA 2XAUA 4DIDA 3KXIA 1G291 2G0NA 2J59A 3HU2A 2OLJA 4TL7A 2P5SA 3PXGA 1LY1A 3K0AB 4PC1A 3JZMA 2XZOA 4DLXA 2ZS9A 3GLGB 4EAQA 3AVVA 4Q7MB 3GFPA 1ZNZA 5J4HA 1DAMA 3QJYA 1T3HA 1WB9A 2IF2A 4AG6A 3FMFA 1F48A 1E2EA 4UNPA 2D2FA 4Y0VA 4ACBA 3SHFA 2ZVQX 1RJ9A 1KMHB 2R6CA 3GEHA 4Q00A 4ESVA 4HZUA 2GJ9A 1ZD9A 3ZS8A 5LB4A 3SZRA 2ECKA 3KKNA 1B23P 3AQ4A 4LJAA 5CK4A 4GOXA 1G8YA 1R4AA 2H92A 2P6NA 2QMUA 3A1VA 4A2WA 3AM1A 1JJ7A 3A1UA 4B73A 3AVWA 3SOPA 2HCJB 2R6AA 3K1JA 4A4DA 4W5WA 2XTMA 1GOTA 5E4FA 1P3JA 3VR4A 2RH5A 2JASA 4KVGA 2OFWA 5JWHA 2NO9A 3THWA 3WYAA 3O8DA 4LCBA 2QA5A 3RNLA 3C5CA 4DDWA 3RWOA 3GJ7A 1FP6A 4NYMQ 1G5PA 4LX0A 2O8FB 1F2UB 4GT1A 3KTAB 3NC0C 3UWOA 4TSFA 3X1ZA 1AKEA 1DG3A 2QU8A 4KCGA 2CEAA 3CPHA 4Q18A 1XJ0A 2J0VA 4X8LA 1R5BA 3D6TB 3RS5A 3K0SA 1Q21A 2GEUA 1XRJA 3W9YA 4MGKR 2QM8A 3B1YA 5CM8B 2WWHA 3KDSE 3KB2A 4NONA 1E3MA 1P2VA 5SZIA 2ODWA 3KQHA 4LBZA 4TLEA 2JLWA 4KLNA 3R8FA 2IHBA 5KDLA 3B9QA 4YMSA 1N5LA 1R6BX 4Q1DA 1BMFA 2ZE8A 3CWZA 4PHFA 1QHHA 2EWWA 2V9PA 1GG2A 3SS8A 1KSGA 3E1SA 3KQUA 5FI1B 1RKBA 3KJEA 3QKSB 2IK8A 2BIFA 3BFXA 1JPNA 3GJXC 2DFNA 1X8JA 2DWQA 3LV8A 4LUCA 3AKEA 3ZZ0A 2DFTA 3I5YA 2QE7D 1E9DA 4Q21A 4XIGS 3UWKA 1OH7A 1Z3IX 3MWJA 4BLPA 1E2NA 1TUIA 2C2HA 3CW2A 1XWIA 1FMLA 4B76A 3AP1A 4GMDA 5AJYA 1W0KD 2R2AA 3ZZUA 5LPNA 4PFSA 1L4UA 1VCIA 3QIAA 1P9WA 4QG7A 1T9HA 2ZR0A 1KOFA 2BKUA 2Q9CA 4B43A 3FHTA 2AN9A 1GM5A 3VKWA 1TPZA 2O0JA 4P4TA 4EPWA 3MFYA 1KZGB 3PUWA 2W6JD 2VHCA 2OFXA 3BFKA 1YHNA 2ASEA 1Z6GA 1IHUA 4D6PA 2WJGA 1TU3A 3QUSA 1E9EA 3W6OA 2Z0MA 3V4RA 5JWOA 1JR3D 2GK7A 4IVPA 2JIZD 3NEYA 1US8A 2R6FA 1SVMA 2ZJZA 4PX9A 2RGEA 4DUGD 3TVDA 1YVDA 1G19A 3UATA 2ATVA 1Z6AA 1S96A 2CE7A 2QTVB 1RRFA 1T6NA 2Q9BA 2VHQA 4EFNA 2G1KA 1SXJA 2YC4C 2Z5FA 5LBIA 4BUJA 1VIYA 5BYKA 5JHGB 1HE1C 5KNCA 2AWOA 4IFEA 3SI7A 1KO8A 3GFTA 4LJ9A 1XFAA 4S2EA 4HAVA 2ZRDA 3FPAA 2ZR9A 3QY0A 1R0ZA 2GJKA 1N0WA 3K0FB 4LHWA 4DSUA 2MMCA 4RD3A 3WNDA 1NVUQ 2ZI6A 1W49A 3V9PA 3GPLA 2EYQA 1FW6A 1KI2A 2WHXA 2GK6A 2OCBA 3PG5A 2C78A 3RDPA 3T1VA 2FFBA 2ZI3A 4M1OA 3EAQA 4IHQA 1OFIA 2YKGA 2IHYA 2ZPTX 1KK2A 4KO8A 2EW1A 4QKQA 3UPUA 1D8TA 3T5GA 2CL6X 1W0JA 2RGGA 2I3BA 4ESHA 4JZKA 4LZZA 2XEXA 3PUZA 4BFSA 4D81A 3LWNA 2IYXA 1E9AA 5JJIA 4G5GA 4M1SA 4PC2A 3U61B 2FSGA 2IT1A 3KKPA 4PHTA 4WA7A 5EE1A 4BWYA 2GXUA 2XX3A 3SBEA 4A0GA 5JMTA 1KMQA 1G6HA 3D7MA 4GP7A 3T35A 5H8WA 3TSOA 1TAGA 2REBA 4C0LA 1FP7A 2GCPA 4DB2A 2QRZA 4HB4A 3PR1A 1P61B 4YONB 1ETUA 4MRVA 5TY0A 4HAWA 2ZYUX 3KFXA 3WP0A 4U7DA 4K81B 1OYYA 4Z8YA 4B6FA 5B58C 3U3OA 1NN3A 1XEWX 4NCIA 1N6KA 1HUQA 5A5GA 2B8WA 4F38A 2IYZA 2W6JA 4KSCA 1BS1A 1Z6YA 4QBHA 2GXQA 5FL7A 1DO0A 3NHAA 1MRSA 4HAYA 1MO3A 2GBLA 4KFSA 2WAYA 2H16A 1G41A 1H65A 3B1ZA 1U0LA 5DI9A 4HDQB 2JJ8A 1IN8A 2AWNA 3UMRA 3IPXA 5DHFA 2J45A 4WZ6A 4DUGA 5KPJA 3RS3A 4JLKA 1GWNA 2FGJA 3H4MA 4CT5A 3LLUA 4MA4A 5TV2A 2Z6VA 1XXHB 2IWHA 3OFNA 1HV8A 1QHYA 2AD1A 1NVVR 2QGZA 2ZVPX 1G7TA 5KSPA 1D2EA 4IFBA 1ZD8A 2J5XA 5JRJA 4MKIA 1E0KA 1AGPA 1A2BA 2HT6A 2UZIR 4MYTA 4HUQB 3Q9LA 3GEEA 2RGCA 3HWSA 3GJ8A 3SDZA 2CLSA 3B85A 3U5ZB 3SJBA 5KO2A 3K9LA 2QUZA 2QORA 3PQCA 5G3YA 1NSFA 3ADKA 4F7WA 2ZIAA 3OIUA 2Z43A 1U8ZA 2BMJA 2VP9A 1Z83A 4HEJA 1ANKA 3W3AA 3CF6R 3PEUA 1X3SA 3QOFA 1EESA 3SJAA 1GNPA 4PC3A 4RZ3A 4DEYA 3VAAA 3EPJA 4HLDA 2EFCB 4DDVA 4DT1A 3K9HA 2QROA 1E0AA 3KXLA 1IXZA 2H18A 2OSBA 2REXB 1KI3A 4AURA 2LKDA 5IHPA 1HT2E 3LRPA 1MO4A 1U0JA 1DAEA 5DE3A 5HCIA 4ASUD 221PA 5AJVB 2ZI9A 4GBMA 3B5JA 4URUR 2ZSAA 4PXAA 5JS8A 1E2JA 2H57A 3THXA 3LVRE 4KBFA 1R0YA 2FEOA 3T15A 3TKLA 1MT0A 3P4XA 2Z4SA 4TMVA 3QPUA 3EC1A 1F6BA 2NZJA 3B6EA 3C8UA 4FXPA 3SNHA 2F43B 4G1UC 4YXWD 2QT0A 2QZ4A 2AXNA 3A4LA 4GPTA 1KZ7B 3OE7D 2CCJA 2OHFA 1XD2B 1G4AE 4ZKEA 3SEAA 3MRSA 4DCVA 3TQCA 1UEIA 1MOZA 4WIAA 1NKSA 4YDHB 5C1BA 3BH6A 4MUAA 1W4AA 4B3FX 5K8UA 1HY3A 1KO7A 3ONWA 3OAAA 2JDIA 2VP0A 1KI4A 2GEDA 1I4DD 3CM0A 1QHXA 4Q4HB 1KKMA 1YZGA 3VR1A 2FJUA 3QENA 1R7RA 5JFGA 3H2YA 1K5DA 1QHSA 3CONA 4QGFA 5FBLB 2ZSBA 1CJUC 3SYKA 2FU5C 3GD7A 2ODNA 1IN7A 4A82A 3RSOA 4ZDJA 4M22A 4OI2A 2OCYC 1S9DA 3KQKA 4B48A 1IJFA 2X19A 4NYIR 1M74A 3H86A 3PCRB 2FG5A 4KHZA 3UMSA 3TUZC 4JBXA 4R2IA 2HDNB 5DI3A 2GVZC 1DG1G 4C30A 1CEEA 3W5JA 2RCNA 2YJTD 4A92A 3GLFE 3ZQJA 2J3EA 3NH6A 1HEIA 3QPVA 2BCJQ 1M7HA 4O2RA 4ITRC 4C0QC 3U60B 4HLUC 4MYUA 1LV7A 4UKDA 2F3RA 3KXKA 1ZINA 1DELA 4FMDB 4IW3B 2A3RA 1ZCBA 1P60A 2LKCA 1VMAA 2EVWX 3AGPA 1P5ZB 2PJZA 4JLNA 1J90A 1K5GA 1W5SA 4F91B 3PENA 4WXPA 4NYJR 4UJ5A 4I81A 2OT3B 2H1LA 2QMHA 3IEVA 5KOYA 4QC2A 2UKDA 2ZYVX 1CJMA 1JECA 1KI6A 3NVAA 4HAZA 3VU9B 2GZHA 3D8BA 4V03A 2ZRPA 4RFSB 5H68A 2CJWB 4BE7B 2ZAMA 2GZDA 2YWFA 3LFUA 2FEMA 4M8NE 5FTMA 1KYIA 1K6MA 2W6IA 2Y8EA 3TQFA 4D2IA 3IILA 2ZJOA 5F98A 2DB3A 4BLTA 1EXMA 4ZDIA 1XTKA 3IPYA 4M9SA 5JECA 1TUEA 4CEIB 4IOKA 2ZRAA 4PSVA 4EPYA 2ZETA 5D3MA 4G0NA 3O8RA 4JLPA 2GCNA 4EJSC 2HLDA 4MKFA 3PUYA 5SZHB 1CR4A 4D0LB 4G01B 4WXRA 4DCUA 4B3GA 1COWA 5KYKA 4BFZA 4G5QA 1NKTA 3G5UA 4YDSA 1CF4A 3MLEA 1UF9A 2WJHA 3LVQE 1W5TA 1G8HA 1U8AA 2ZITA 3FE2A 4KAXA 1S1MA 1NLFA 2CHQA 2XOKA 3HDTA 4D4LA 4RJLA 2EFGA 2V7QD 3A4NA 4GFDA 3U44A 1O87A 1VYTA 1SGWA 3OF5A 1U81A 3TJZA 3W6NA 2DPXA 5F9HA 4TZ0A 4W9MC 2IL1A 1E2QA 4TT3D 721PA 4OI4A 3KJGA 2P67A 4C0SA 1OHHA 1P73A 5DNYB 3R7WB 1TU4A 2QT1A 3CH5A 1N5JA 2IXEA 2WV9A 4GOKA 1BH2A 3L82B 5H70A 2ZRBA 2V6IA 4OI1A 3K0EA 5CITA 4MRSA 5JEEA 1ESNA 4LPKA 3TR0A 1E2IA 4ZCMA 1FUKA 3CRQA 5AUPB 5G53C 4O3MA 2K5UA 4JLOA 1OXUA 3AB3A 2QY9A 3ICEA 4D0NA 1W46A 1DAHA 1ZC4A 3REGA 4X8MA 3U6KA 1LB1B 2GHIA 3X1DA 3HPQA 3CR7A 4DLRA 2FFHA 2PL3A 3K0AA 4C9BA 3GLGA 1JXOA 3TNFA 3ADDA 4AYWA 2VLIA 3CZQA 4OHYA 1G1MA 1H8EA 1T0JB 2WJJA 2JJ1A 5A0FA 1P9NA 2VH5R 2EFHB 3AV0B 1CJVC 3TSWA 1ZIPA 4JBWA 4JKIA 5DSZA 3CX6A 5EP4A 5K8IA 1YZUA 2FWRA 1KMHA 3FOZA 2YOFA 4O25A 2NPFA 3D3QA 4U02A 2PEYA 1QG2A 2J46A 4EFMA 4E22A 2XXAB 4F93B 1MABB 4QFMA 3EIEA 4ZPXA 2CNWA 3QEJA 4L8GA 3HPRA 2D2EA 4NZYA 4ZKDA 1P72A 3CF0A 1KSHA 4Q4LA 1D6JA 4D4JA 5K8LA 2JLXA 4LRWA 3MG9A 3QXCA 4PO1A 1Z0FA 2GEVA 2IYLD 4BLRA 2BOVA 2QENA 3OHMA 2C96A 4PAQA 4LY6A 3AVQA 1W1WA 2VHJA 1DS6A 1Z2CA 1DPFA 3K8YA 4A0RA 2X8AA 3FKQA 4AIIA 1XEXB 2WPDD 2O8FA 4UXHA 1F2UA 2YV5A 2QAGB 2FN4A 2ZU6A 3DDCA 4L15A 2V6JA 1GKYA 2ZE6A 5BW8A 4LJYA 3GQBA 3UG6A 2IS4A 1U99A 3BB3A 3G0HA 3VNUA 5EE9A 3ZIAD 1XTIA 2WAXA 5CIWA 4ILEA 3IHWA 1W2HA 4RZ2A 2OBLA 2R62A 3LXXA 3KQNA 1Z47A 4Q7JB 2HXYA 3LW7A 4YLGA 2PCJA 4HSEA 1JQLB 4LK2A 2G77B 4AC9A 1IBRA 3VR3A 2OESA 2MSEB 4FMDF 4NCHA 4P31A 1XTJA 1BYUA 4UXJA 3MCAA 1NMZA 1ZMXA 5FTNA 5EE0A 1KDTA 3B1XA 2VIIA 3K0CC 3OEHD 1KJYA 4TLBA 4TQ9A 2HJVA 2X2FA 1HTWA 4Z1MD 1W47A 4LPSA 1IOZA 1TMKA 1LS1A 3FKSA 5G40A 2OAP1 3GJ6A 3KJIA 4PPFA 1Z8FA 3GP8A 1S8FA 1NN1A 1NMXA 2WIAA 4NCNA 1KGDA 1NIPA 3O8CA 2WWIA 2V1XA 1S4QA 2ZJ8A 3ETLA 2G3YA 3TIFA 2O8BB 1FQKA 3OEEA 4RSGA 1E9RA 4HLUA 4XD7D 4OQNA 3M6AA 2A7QA 4I99A 1X8LA 1CJKC 4JL8A 2P5TB 2BMDA 5AJXA 5J4VA 4X8OA 2QP3A 3VHLB 1D9ZA 4QJ4A 4BECA 3TVTA 1AZSC 1NN5A 4JVMA 1Z29A 3T1TA 2A5JA 4LHYA 1DAGA 1KI1A 4B44A 4NYMR 5ELXA 4HUTA 2ZTSA 2Q3MA 5LB2A 5KDOA 3T06B 3EA5A 1NJFA 4B32A 2XNDD 5DLQC 1JBKA 1U2RA 3HR7A 1NF3A 1WBDA 2KI5A 2VP6A 4OQFA 1W4CA 2KB0A 4NU0A 1VDZA 2BHRA 1OFHA 5SZKB 5J4KA 1ZNWA 2BJWA 2W0MA 4M53A 5FOUA 4BEJA 1OXTA 1II9A 3CUEF 3Q7QA 3DMDA 2V1UA 3THYB 4AYTA 5HZHA 1M6NA 1C1YA 4PHGA 1BYIA 3AVPA 5CB8A 1Z28A 3E5HA 1DTSA 3EWSA 1T0HB 1YZLA 2YZ2A 2PMDA 2ZUBA 2DWPA 3X2SA 2A2ZA 3K0FA 3EIHA 2C9CA 1C4OA 3R20A 3LNCA 1AQUA 1E2PA 2ZRLA 1N5KA 1E79D 1QDEA 4R71A 4D80A 5FTJA 4AKEA 3O47A 2GAOA 1Z06A 2RGNA 2AD5A 5FPKA 1NL3A 4M1YA 1EFRD 4HATA 1KI8A 4MYHA 4EUNA 1G8PA 3ND8A 4Q19A 3K9NA 2DFLA 3IIKA 2C9OA 3QF7A 4OHZA 2FFQA 3OEHA 1VG8A 3TLXA 4DLYA 2WIBA 4EPTA 2PZEA 5P21A 3T34A 2GZAA 3I3SR 4XSHA 4FINA 3IIJA 4PAMA 4Q7LA 1OYWA 1A5TA 4M9QA 1Z0DA 3OZXA 2CDNA 5AR1A 1L8QA 2CE2X 1XPOA 3Q85A 3T1OA 1YE8A 1IAQA 3LXRA 3W6PA 1E96A 3R9IA 2NQ2C 2BKEA 4PR0A 4XD7A 2IBMA 1NVXQ 4M21A 4Q4JB 4IXNA 4EPXA 3GLHB 4MGIR 3CLVA 2IX3A 2D4HA 5DYGA 1OIWA 3MGCA 2Q3HA 1YR7A 1IQPA 1LFDB 4GMXA 3VR2A 5HR5A 1CU1A 4CZ2A 1XEWY 1TX4B 1DVRA 2ZS7A 4K8OA 4DLZA 3GLIB 4O2LA 1KSFX 3DM5A 3NDPA 2XSZA 2F9LA 1BO6A 1M1YE 4A9AA 1SVKA 4NTZA 3AP3A 3LD9A 2QP4A 2ZRMA 1GNRA 4FMBB 4NL4H 3IQWA 4TL9A 4US0R 2NG1A 3SU8A 4RD0A 3PJRA 2G6BA 5FBRB 3FHOA 1VECA 1VTKA 3PUVA 3Q5DA 1DADA 1WA5A 2D3WA 5E7MA 1P2SA 1WDTA 2P6RA 1TL7C 2NIPA 4LV5B 1CR1A 1MO6A 4JVNA 1D2MA 3ADCA 1GP2A 1XXHA 4CRWB 1XCGB 4C0JA 1RW4A 3RABA 4DJTA 4XVUA 3VX3A 2FOLA 4Q9LA 4XTCS 5HPYB 3BOSA 5C4MA 1ZYUA 1GFIA 4PC6A 4TMXA 3L0IB 3OIWA 4HUQA 1NG9A 1D9XA 3NH9A 4NHOA 1XZQA 2J7PD 2QNRA 1NBMD 3IEUA 4B3BA 3AF0A 2IS2A 2FSHA 1EFRA 4WOPA 1XB2A 3MD0A 4QRHA 1W4RA 1IM2A 4B2PA 2VO1A 1W2GA 4LHVA 2O8CB 2WVJA 1IY0A 3MWLA 1MH1A 3HU3A 1PV4A 1SZPA 4Q4AB 3LX8A 4IJMA 4ACAA 3EZ7A 1N6OA 3DMNA 3K0CA 1UPTA 1P75A 2V8OA 1QHIA 1G20E 1I4LD 2J87A 4POAA 3FHCB 3P26A 2XZLA 1FZQA 3WP1B 3CPEA 4C2UA 4JBYA 1ZNXA 4HDCA 1A1VA 3N5CA 1RRGA 4TN1A 3EA0A 5CJPA 2VP4A 5C46F 2R9VA 5BN4A 1CRQA 2ZRFA 4KFUA 5HZKA 2C03A 3AF4A 2IYRA 3QXXA 1EFUA 1E9SA 1NSTA 1Z07A 5BXQC 4FCVA 2X1VA 3A36A 1CXZA 3MAAC 1G7SA 2MMGA 1SVLA 2VSFA 4TMZA 1DAKA 1UKEA 4ZI3A 4RZUA 3WNCA 3WMEA 1XU4A 3IBGA 3QVVA 2XITA 4IDHA 3A1SA 4R2HA 2ZM5A 4D4KA 2GCOB 3MWYW 2QAGC 1R10A 2QTFA 1J2JA 3AKYA 2BBOA 2P2LA 2F43A 2OAQ1 4PO9A 4RFVA 4L16A 4WZBE 3U2QA 1OH5A 2ATXA 4RKFA 1G64A 2PMKA 4F4CA 3RC8A 3W5IA 5FR2A 2VEDA 4N0DA 3I62A 1N6PA 2V55B 3MJRA 4IRUB 4IEEA 2AXPA 4G5OA 4DWJA 4EIWA 1IN5A 3CRVA 3DM9B 4TL6A 4AD8A 1TQ2A 4D25A 2XTZA 4DCTA 4RVCA 4OYHA 1Q3HA 1FOEB 3SR0A 1XPRA 421PA 1WE2A 1LVGA 5F3WB 1JXMA 1SULA 2QE7A 3EZ6A 4NCKA 3L2OB 2O0HA 3IUYA 4NBSA 5FL3A 5FOSA 4LJ8A 5FPYA 4M2LA 1W0KA 4H9GA 4PPGA 1EX7A 2CHGA 3ZVLA 4DB4A 3AVOA 1KI9A 3NG1A 4UNSA 1R5OA 3NIBA 4QGHA 2VHTA 4LHZA 3M1IA 4WVFA 3C16C 2CVHA 1NBMA 1TF7A 3ZH9B 4BFUA 5J40A 3THWB 2QBYB 2WZQA 2VPPA 2QAJA 4QOSA 2FPLA 4IVRA 1M2OB 4G5SA 1DEKA 1CULC 3KFVA 5DGXA 2ZJYA 3W8NA 5L3QB 5JHHB 2R6DA 3O8BA 3ZD7A 2OBMA 3TW4A 5EXSA 1JAHA 4JVSB 1EFCA 2A5DA 5IF9A 1JR3A 2JIZA 3VU9A 4JJZA 5EXPA 5HE8A 2FSFA 2F1JA 1JEDA 5GJBA 1U98A 4RFSA 2CJWA 4OL0A 2ERYA 4JJKA 4QNMA 2BJVA 2CHVA 2WWWA 2YWEA 4IOLA 2JJ2D 1XNJA 3B1VA 1SKYE 3A58B 4EFLA 4HLCA 2QPOA 4TTQA 1GRQA 1XBTA 2W58A 5AWFC 1QZXA 2P3SA 4C0HA 3NC1C 4KLZA 1WBBA 3NBFA 4CEIA 1SVIA 1E4VA 4KXFB 4HI0E 1QHNA 3RS7A 2IF0A 1N6LA 4OHVA 4KYIB 3V4FA 5ANRB 2OUKA 4L5BA 4CEHB 2B7CA 1Z2AA 2IYQA 1NY5A 1PUIA 4GZLA 5HE9A 1X1RA 2GRJA 4TLAA 3AVXA 2C95A 2J7KA 5EE3A 2OE2A 2YOHA 3WYGA 4ARZB 1FNMA 1NLZA 4Y0AA 4E03A 4CEJB 2F6RA 1N5IA 3HYTA 5GJVC 4A1FA 4LDJA 4DSOA 3U7GA 3QBTA 4TTRA 1G7CA 4AI6A 3LX5A 4F4JA 3U7HB 3RRZA 4X8HA 3W34A 2WWYA 3KUDA 4P32A 4Q47A 3REFA 3SQXA 4LC1A 2J9RA 1RVDA 1U9IC 2F1IA 3MWKA 3B60A 2NO0A 1G3IA 2HCBA 3IKJA 5L3RA 1DARA 2ZRKA 3NKVA 1UM8A 4QHTA 3R7WA 3WRYC 2OXCA 3ZYCA 4MGYR 1OXSC 1DAIA 3GLGE 5EUMA 3QXJA 4HAUA 3HYRA 4LOAA 1OF1A 1NJGA 1BKDR 2IC5A 4XWKA 2BMFA 4JLBA 3ZVNA 4BFTA 2Z4RA 2BWJA 3TW8B 3QBVA 4PHHA 3GCGA 2EQBA 1Y3AA 3E2IA 2ZREA 4LV8B 5B57C 4Q48A 5L8VA 1Z6TA 4LYJA 4EJSB 2DR3A 1HYQA 3QQ5A 3UANA 3UKDA 3WBJA 2V54A 2O8EB 2UVQA 4CF7A 5KUTA 2WWGA 1VPLA 3RWMB 4BGDA 2KSQA 4N1AA 2A9KA 2L0XA 3QKRB 3M4YA 5E7IA 5DN6D 3FDIA 2J1LA 1RIFA 1W7AA 1PLJA 4FWTA 5C2JB 2B92A 2YWGA 4NPHA 3QXHA 1P4SA 2QEQA 1M7GA 4M4SA 3I8SA 4KBGA 3W90A 1SHKA 2O5VA 1Z0JA 3VHXA 1W36C 1I4TD 1V5WA 5EZ6B 2G9NA 1JAIA 2XXAA 4AK9A 4FMCB 1MABA 1GL6A 3TAUA 4JSTA 4MGZR 4OQLA 4Q03A 1Q3TA 4UNRA 2B6HA 4GI7A 5TDHA 4D4MA 4ABYA 2QMEA 3BFVA 4PQFA 4JYCA 3WHKA 2GWHA 5GJCA 2C9YA 3QF4B 3R9WA 4TYQA 1RPZA 1MKYA 1PZNA 4PAOA 2FMXA 1E2LA 1Q0UA 4CDGA 5KSYA 3SFVA 2BC9A 1ZD1A 3BIFA 2ZJ2A 3UIEA 1OE0A 2ODBA 1HQCA 1S1CA 1XEXA 2Q3FA 3HU1A 3VX4A 4ZIRB 3EW9A 5EP3A 5CIQA 2WOOA 2QAGA 2PBRA 3RANA 1OFUX 5CLLA 4BPBA 1DO2A 2PZFA 3BD9A 4DHEA 4KFRA 2AX4A 1DBSA 4M1WA 3WMFA 121PA 1UKYA 4P4SB 1VCNA 2IEYA 3I61A 1XMVA 3WXMA 4BRWA 1F60A 2JLYA 4I4LA 1ZVQA 2FV8A 2CK3D 2ZRJA 2J0UB 1AS0A 3NXSA 4RZXA 1S3SA 1LW7A 3LQQA 4OQXA 2O8DB 4A15A 1E98A 1II0A 1NMYA 3ZVMA 2JLQA 3SHWA 1Q57A 5GJWC 4CW7A 3IO3A 4ASUA 1EFHA 4XVRA 4YMVA 1X86B 1N0UA 2N46A 1RRCA 4QGGA 3K70B 1UBGA 1W44A 4N3NA 1FX0B 1FFHA 2IXFA 2OEPA 3PUXA 2EU8A 5E95A 5HKKD 3TK1A 2J41A 5FH9A 4UJ3A 2P6UA 3OESA 4C3ZA 3LW8A 1WCV1 2WBLC 3SJCA 1TTTA 2BM1A 4BZPA 4CIDA 1UBEA 1G4UR 1JB1A 2RMKA 1AM4D 3FB4A 3RSLA 5L3SB 2O8BA 3CH4B 4YXWA 5BYJA 4IXMA 3OE7A 2AK3A 3ZS9A 3DEFA 2AFIE 3DOEA 1II8B 2X77A 4AWXA 2R6GA 1UAAA 3U3RA 2HV8A 3F0TA 4P4UA 4TYNA 2WMNB 1XZPA 3RHFA 2GXSA 2CVFA 4GZMA 3VNVA 5JZVA 1GDDA 4LV6A 4KSBA 3EPLA 2GJ8A 4DCSA 1FQJA 4B3CA 1G6OA 5EQTA 2JLSA 3IIMA 3JZAA 3BRWD 1DAFA 1U94A 3B2EA 5EP2A 3EPHA 1D5CA 5KSZA 2DY1A 4CVNA 4Q66C 1W36D 2FF7A 2A5YB 4OQMA 4QBFA 1E2FA 3SQWA 2FX3A 1NY6A 2RB4A 2YINC 3WYFA 4IDQA 4Q9JA 2IUUA 5EXTA 1AQYA 4C0KA 2ZI7A 1J99A 5FPHA 3EARA 1Z08A 5K8TA 3D31A 1ZAKA 2Q21A 1ZBDA 3CF2A 1E1RD 3EC2A 4JLJA 5F9FA 2P0EA 4JLDA 1Q22A 5TMPA 1IY1A 2ZSEA 3N2IA 2G83A 3TBKA 1KO1A 5DO9A 1B0UA 2OG2A 4BLQA 1N25A 1OLOA 4QHSA 4PSKA 5FOWA 4BFWA 2KJQA 1E2GA 1A7JA 3CRRA 3F3YA 2IA5A 4AKGA 3CO5A 1XJCA 4R9UC 4BLOA 1G8FA 2FDCA 3X1YA 2EYUA 1EWQA 2E87A 1IXSB 1JR6A 1TEVA 1G17A 3Q8XB 3VQTA 2GVDC 2XNSA 2PH1A 5JJLA 4MDEA 1J7KA 2CK3A 1R8SA 2OFOA 2AR7A 1C9KA 4DLWA 3VKGA 1KAGA 2OILA 3Q7PA 2O52A 1JI0A 3CX8A 4IDPA 3AP2A 4WBSA 1E69A 3LBIA 4JKYA 4L4UA 4IOJA 1RRPA 2DWOA 1T5LA 2O0KA 5AJZA 5FFMA 4HLQB 3EXAA 4LYHA 2Q9AA 4HB0A 2CL7X 1QVAA 5TARA 4BFXA 2ZRGA 3C41J 1N6RA 5TB5A 1PLKA 3P32A 3RS2A 1J70A 4M0LA 4V0MA 5DH9A 1SHZA 4TMWA 1ZM2A 3TAHA 4LI0A 3ADBA 1E2KA 2LWIA 4DLTA 4CGZA 1OXXK 5JCPA 1E1QD 3U4QB 4YMUA 1E0SA 3KTAA 2GDJA 1AS2A 1WF3A 2W2VA 2WSSD 3GLHA 3EPKA 2JLUA 5B30A 3CKLA 4CT4B 1BIFA 3K09C 1QHGA 2V7QA 2IS6A 2ZSFA 3Q5EA 1XMJA 4ZO4A 1P62B 3QI2A 5KTYA 4LYAA 1N2CE 2I1VB 3PEVA 4BZXA 2D62A 4L9WA 5JJKA 5JSZB 2OZEA 5KHOC 5C4GB 1E2MA 3GLIA 4DC9A 1OB5A 3FMPB 3CRW1 1RYHA 1T91A 2GETA 4TT3A 2LCFA 1Q12A 1XXHE 4JLAA 5AUOB 1ZUIA 1YZKA 4GOJA 3WRXC 4OJQA 2RGAA 4B47A 2WWXA 4TL8A 1LTQA 3EZ2A 1KDRA 4XOIA 4NH0A 4GNKA 3QKSA 1VHTA 3AF3A 1D2NA 1Z6XA 2ZEJA 4IOMA 1EX6A 1XD9A 1GRNA 3SBDA 5KNBA 1QRAA 2ZJAA 4AY2A 2R65A 2XTNA 1JQJC 3EZ9A 4D26A 4FIDA 3B13B 3BB4A 2YWHA 3B8HA 2IW3A 2VF8A 3P4YA 3KQLA 3L0PA 3BE4A 4IDOA 1X6VA 1CS4C 1SVWA 2IYSA 4TLDA 5CB6A 1XF9A 3VR6A 4KI0A 3AF1A 4TLCA 4Z54A 3NBZC 2BBTA 2YNMA 1FTSA 2AL7A 1CR2A 4B34A 2IYYA 4NMMA 3MSXA 4I1SA 1H8HD 4FCWA 2QQ0A 3KKMA 1ZM4A 3LBNA 3DKPA 5CYPA 3QXSA 2HJGA 1SXJC 3CNOA 2GJSA 1M34E 1ODFA 1ZUNB 1X8KA 4JYBA 4Q02A 2WKQA 1ZCAA 4A8JB 2O8CA 2FGKA 4NP6A 3WY9A 1I2DA 4MDFA 4Q4AA 1QG4A 4TSFD 1KHTA 3KL4A 3TR5A 3BBPA 4LWZA 3A1TA 4NDZA 1L2TA 1YRBA 3FYHA 1XCMA 3C4JA 4UQOA 2ZRHA 3CWQA 4BFYA 1ZM3A 2ZU0C 1S2MA 4JL5A 1E0JA 1OIXA 4YQFA 1A4RA 2QRNA 2A5FA 3EIQA 4FW9A 4EJSA 2Q6TA 4LBVA 1YZQA 5LD2B 4YMTA 4GRAA 5UKDA 2WPDA 3DKVA 3EZFA 2ANBA 5CDFA 2RAPA 5FPTA 4B33A 1PJRA 2GAAA 4Q9KA 4XWOA 1Z0KA 1BMFD 1KKLA 4LHXA 5EJEA 4EPVA 4LJ5A 1AGRA 3ZVRA 2AKYA 3E70C 4IVQA 4A6PA 1OH8A 2PJRA 3ZIAA 4ERNA 2YYZA 3T5DA 3PEYA 2AFHE 1NRJB 2GCOA 3NDBB 1R0XA 5SZJA 1IXRC 4XH9B 2PT5A 1GSIA 1N3BA 3P20A 4BQSA 2CLCX 2CMKA 4O0MA 2FFAA 2XGJA 4OK6A 4E07A 1E32A 1OB2A 2WICA 4LJ4A 3ZZTA 3U7FB 5JWRA 3ASYA 2ERXA 2VYFA 2XJ4A 4Z1MA 3I32A 1T5IA 2FH5B 3CRMA 3NBYC 3R8CA 1DE0A 2GESA 4HYYA 1NLYA 3GMTA 5EUQB 1ZRHA 1NBME 1NVWQ 4QJ5A 1HT1E 2A30A 1Q1QA 2GBLC 3K70C 3QKUA 3VTKA 3PV0A 2CCKA 2R8RA 4HB2A 3RAPR 2ONKA 3SC3A 1G16A 1Q44A 2VRWA 4PQRA 3ZJYA 4V0LA 2J0QA 2ZE5A 3DZ8A 5EXXA 4EQ6B 2WKPA 3B9PA 2MSCB 2CL0X 2B21A 2Q0HA 2HYDA 2ZE7A 3BH7A 1OIVA 1UKVY 3Q3JB 4CYMA 4LBYA 1H8HA 4LGMA 4MUBA 5FI0B 1I2MA 1JR3E 1LF5A 1P9RA 1XX6A 4Q1FA 5HTKA 2IUTA 3U3KA 2HYIC 3AVYA 3BERA 4BRUA 3B7GA 2QBYA 1X1SA 1GIAA 1QF9A 3EASA 3TH5A 1N6HA 2JLRA 2C99A 1E6CA 5L3QA 4KODA 1SXJD 1OJLA 4JVLA 5AJWA 2NO1A 1JJVA 1LF0A 1S0UA 3SYNA 3WMGA 1ELOA 1W36B 4RY2A 3SJZA 4QJ3A 2XNDA 4KVAA 5FOTA 4C7OB 1Y63A 2GILA 3KZ1E 3NEJA 4Q1BA 3I5XA 2IYVA 1P7CA 2JATA 2H8KA 3K9GA 2W00A 3C15C 2XB4A 1WXQA 2C5LA 4BZQA 2FSIA 4QNRA 1W4BA 3I8XA 3GLFB 2QSZA 3DOFA 3RRNA 3OIVA 2C77A 2DHRA 3BH0A 4WAUA 5CLQA 3SFZA 1ZM7A 5FPSA 1Q1ZA 2FNAA 3A4MA 1W0JD 3KUCA 3BAFA 1ZM9A 1IJEA 2WWFA 4TMTA 3FWYA 2IXGA 4URXR 3LO5A 4B71A 1QBKC 1HURA 2EFEB 1G5RA 4KFTA 4BASA 1E79A 3WNBA 2E1RA 2I1QA 4A0FA 5CJ2A 4CEHA 5B2ZA 3K09A 1AIPA 1GITA 1P6XA 2WSMA 5GVSA 3J81k 2VHUA 621PA 2NTYC 1R0WA 4ARZA 2NOAA 4CEJA 2PCLA 2YC2C 3JVVA 3EX7C 3FFBA 2FZLA 2PLRA 3H0KA 5FUWA 3RS0A 3U3JA 1XEFA 2OCAA 1AN0A 3IBYA 2KWIA 2VP5A 5TVKA 2IYWA 3TUJC 1RZ3A 1KIMA 3IDQA 1YZNA 2BDTA 4XJXA 3TE6A 4M1MA 4TYYA 2ANCA 4ZDKA 3B1WA 4KU4A 5J47A 1MV5A 4LSGA 4ZI2A 4B6EA 1VG1A 4HAXA 4XSGA 5FOVA 5KU1A 2F9MA 3LH5A 2NO7A 2NO6A 3GEIA 2IYTA 1TF5A 4AKIA 5FL7D 2ZAOA 3LY5A 1XDBA 3CX7A 3M0EA 1U90A 4P0TA 3A37A 1XCPA 3K70D 1KNQA 2G1JA 3GJ5A 5L3VA 2ZSDA 4UXIA 3P1JA 4FCTA 3GJ4A 3S1AB 3EWAA 3DHWC 1E99A 1YR6A 1F2TB 2VP2A 2ORVA 1CJTC 3A1WA 3H1TA 4R98A 4Z51A 4US1R 2OXRA 4B35A 2O8EA 1RFLA 1OV4A 3VR5A 1DOAA 2BV3A 3F8TA 1IONA 2C8VA 1FPMA 3EG5A 2VL7A 3QKRA 2QG6A 3BS4A 1XD2A 4I1OA 2RKOA 1HQYE 3QVUA 2QL6A 1KJZA 3OFND 4PPQA 1JNYA 3TUIC 3OIYA 5KNDA 2FA9A 1E2HA 3CIOA 1KO5A 2REOA 2PX0A 1Z63A 4DDUA 3CPJB 4Q4HA 2ZXUA 4JLVA 4PZLA 1GAJA 1NI3A 1U8YA 4W7SA 4XVQA 3PITA 3RLFA 1RJ9B 3NBXX 3H84A 2W2XA 4HZUB 2IYUA 5BN5A 4M9XA 2EWVA 3ICQB 1E94E 1XTQA 1R5NA 4C0BA 2OLKA 3QE0A 3T61A 1FL9A 2PLFA 2V3CC 1AKYA 1ESMA 2ZQ5A 1M8PA 3LAWA 4MQBA 4D82A 2CXXA 4F92B 3IQXA 5H1YA 3QF4A 1JPJA 5EE5B 1A82A 3DVLA 1AA9A 2J7PA 1OH6A 1ONBA 1OSNA 3THOA 2W0SA 4R7ZA 2BEKA 4MRPA 3WBKA 4I1VA 4ZIRA 2ZUCA 2IS1A 1GTVA 3RRMA 1AK2A 3X1WA 2QP9X 2VBCA 1JEEA 1ZJ6A 2NPIA 1XD8A 1RE0A 2BM0A 1OT3A 3AUYA 1YR9A 4IDNA 3BK7A 1YU9A 2ZROA 4P4SA 5C18A 2AHOA 5IRCD 5FR1A 3TMKA 2WOJA 4A8JC 6Q21A 2J0UA 2OO7A 1UJ2A 2O8DA 1FNNA 2N1BA 2ZYTX 4JS0A 1GILA 3CNNA 4XTRA 5EP1A 4V0OA 3VMFA 1G9XA 4M1KA 5G3ZA 5E7JA 4TZ6A 4II7A 3DO6A 1EWRA 2B7BA 3VFDA 3UMFA 2ZI4A 4L9SA 4Q1AA 1FX0A 1R8QA 3AKDA 4YC7A 4YMWA 5FOXA 4OI0A 4RD6A 2KE5A 1QHHB 2ZRIA 3RS4A 3P27A 2KBEA 1E2DA 2JDID 3OAAD 5AK0A 3GJ3A 5LD2C 1GUAA 4HDOB 3CB4A 4C4PA 4FN5A 3AH8A 3AUXA 4ZDWA 5L3SA 4DDTA 2WTUA 3L43A 4JMPA 1VG0B 4BEBA 1AJEA 1WP9A 8OHMA 5GVRA 1ZW6A 1IY2A 1II8A 1T3LA 2H17A 1YRAA 4LJ7A 3C7KA 3HR8A 1S9HA 2XB2A 1Z0IA 3ASZA 3CR8A 4AYXA 4BLSA 3QSYA 2ZANA 4XWAA 1AZTA 1UFQA 4B2IA 1XTSA 4LJ6A 4A36A 2WJIA 3F5FA 5KSOA 1SKQA 5DIFA 1G7RA 1KO4A 1VHLA 5DHAA 2DBYA 2QN6A 1G3MA 2G88A 1ZU5A 1VG9B 4LBWA 1GKUB 4URZR 1Z0AA 4P33A 3ZDQA 4KITB 4EKDA 4URYR 3V00A 2UZ3A 3AVUA 2CLDX 3DL0A 4TTPA 1HE8B 3B82A 3N2EA 1US8B 4RCZA 3ND9A 1MO5A 1G3RA 2ZS8A 2GNOA 3NTUA 1VCMA 1KI7A
chains in the Genus database with same CATH superfamily
1XJWA 4ECEA 1GPLA 2C7VA 3QJGA 3PQ2A 4YIKA 3G68A 1Q1BA 2JIPA 4G36A 2P2SA 4JB0A 2PX3A 1FBTA 1KMNA 1R3DA 1Z7BA 3D6FA 4DGQA 5EPOA 4F7DA 1TD1A 1JG7A 3GWZA 1M0EA 4AG3A 1O97D 4QQ8A 1R5JA 1NNUA 3I2GA 4CLDA 3R77A 3S8YA 1P4AA 3KB1A 5EPUA 2NU9B 3WXBA 3DKKA 2FN8A 1O94D 3TGPA 4CMCA 2V7BA 5LZ9A 1AQ6A 1COWD 2VNJA 4AJ4A 1U28C 2BPOA 3LHDA 3VNRA 4LTDA 2FWNA 1KQOA 2NU7A 3ZGVA 5LJLA 3VYWA 5C8VA 3DPUA 1U0TA 3KJQA 2JVIA 5EQFA 3WHLA 3EVEA 1N0VC 3A06A 3RFUA 1JI3A 3C5EA 3WLPA 2XOKD 1FU8A 2LV8A 4UHCA 4EA6A 3E9YA 1KC3A 1RJWA 3OQVA 3O92A 4XEHA 3AVTA 4I5EA 1EKXA 2HRZA 3KCQA 1NVVQ 1T8TA 1JHYA 3PPIA 4GOMD 4PSAA 3RPEA 1NURA 3K0KA 1Z7WA 2PNFA 1VGVA 2Q1SA 3RYHB 3ZUPA 2IKSA 1UPBA 5J1SB 4A8JA 3UAYA 1MQ9A 2VR1A 2AJCA 1B2RA 2BMWA 2RGDA 3GV0A 3PFKA 3QMMA 2ZYIA 1SPBS 3V7FA 3HYNA 4L8WB 4RY9A 4BNTA 5K4GA 4MITA 1M2WA 1X39A 2YHSA 1EK0A 2GK4A 1L5SA 2VAPA 4WX2B 3IELA 2W90A 5JUWA 2BEVA 4B2LA 3ELYA 1VJ0A 2FFRA 3GBSA 2V59A 4MRRA 1A8PA 1OLUA 1XVLA 2R7KA 2WRZA 4YV1A 2OPHA 1A2KC 1J23A 1D04A 1FUEA 4N6GA 2CV2A 3IS3A 4FCCA 2ODEA 2DPYA 4HFRA 3VKHA 3CTMA 5J5CA 1JALA 4QYWA 3RVBA 1G8MA 2VDUE 3BXXA 4M7WA 1GQYA 3V6MA 1YK1A 4DVGA 3LZ6A 1MF7A 2XUJA 3LCVB 4P22A 1SCUA 3OZAA 1SD2A 3W3ZB 3QV2A 3RC3A 1A69A 1TXGA 3I2KA 1FXSA 1ST3A 3A31A 1D0SA 4H2DA 2KQUA 2R44A 4TXJA 2C59A 5FTKA 4NVRA 2OOKA 4QQKA 1ONSA 3KYJB 4V3CA 4ID9A 4KP7A 2H3EA 3ILXA 2OZVA 3W8RA 4FFPA 3TZBA 1GPKA 2X3UA 2JFHA 3V1TC 1I0LA 1H8ED 2VXCA 3TCNA 1YCHA 2JJ1D 1HOTA 3OEYA 2C07A 1UAGA 3MSCA 4W1QA 4GZ6A 3ZWAA 4RENA 1T0PA 1Y5IA 4CMHA 4F3KA 2HPVA 3KWLA 5M04A 3FTQA 1Q20A 2XRMA 2XQIA 3V55A 3ENZA 4G2NA 5CDHA 5EJ5A 2AQIA 4MKGA 1TEXA 1B16A 2HSEA 5IP5A 2IHUA 5DU2A 1SQGA 2DRIA 4JB2A 3H11B 4QEZA 1KETA 3AFNA 1R88A 1PR5A 5DN6A 1AUVA 3RARA 4PYKA 3QX3A 1XEAA 3I1FA 4LQ4A 4KXVA 3EFHA 3NJRA 1Y8RB 4PLTA 4DXAA 4FN4A 5T7BA 4TKLA 2XCIA 2Z9DA 1U65A 3CLTC 1EX1A 2IZ5A 4IBOA 5EWJB 2QOEA 2GHTA 3GC6A 3ZV3A 3A6PC 1BCSB 5I9NA 4O4IA 3FDZB 1P29A 2A78A 4E46A 2W2LA 5FBKA 2ERCA 4XFDA 2HAEA 3PQ3A 3FGNA 3EGCA 1EQAA 2PWPA 4Q01A 4E6EA 3MWEB 1ND6A 1OREA 4WH0A 4PRKA 2NADA 3Q72A 3LDUA 1GKIA 4WVLA 3QU7A 3IHLA 4J0JA 2BN4A 3MC1A 4L4XA 5BQ5A 5KJEA 5CDFE 1R15A 3OC0A 1PJSA 1NU8A 2Q27A 3N53A 1G21E 1JIUA 1XMPA 4S1OA 1XP8A 2G25A 3CURA 4CMAA 4F4DA 5A5VA 2YV1A 1QGAA 2J48A 1B8NA 1CBUA 4U0JA 4QT4A 1CLUA 1NC3A 2EFDB 3E3AA 5D8DA 4PQGA 1VLLA 4IHAA 1XCLA 3AKCA 2ZYWX 4GX5A 2GTHA 1OPXA 1DWOA 4HXEB 3LDGA 1E1CB 1I4OA 3C4QA 2ZI5A 2YZKA 1V5GA 2J30A 4K9RA 2QGNA 1Y9AA 3SSAA 2BRUA 2VJOA 4ZCTA 5LWQA 1AXRA 4DLUA 3QIVA 4M1TA 1DJMA 1M5UA 5IK2D 1KOGA 4GOND 1RYFA 1LWOA 2W2TA 2VF7A 1NG1A 1YUBA 4GMKA 4UNNA 5K4AA 3QLEA 3T1QA 4MPPA 521PA 4AG5A 1KU6A 2I4MA 2QUIA 4LCEA 3KZNA 3JQDA 4HWKA 5AUQA 3UOAB 3IJRA 1ZRSA 4A73A 1TVKB 3VKVA 1UC8A 4U2CA 1PR6A 2PV0A 5CAEB 1A2OA 1HT0A 1PS9A 1RXYA 1XTRA 4QQRA 2QRLA 2E7ZA 3DWEX 1RMYA 3F47A 4UEOA 5FBWB 3VGJA 1ISIA 5IDVA 3QVSA 2DFKB 2KBFA 2MSDB 4TWRA 5KB3A 2JGIA 3WLHA 4LZNA 5B1DA 3HQ4O 4CM8B 3DHNA 4M0CA 1O5OA 1RXUA 2H51A 2Z2IA 3OEWA 3Q9SA 1Q0QA 5JYCA 1E9FA 1EPUA 1V95A 2FRVA 2YOGA 2ZUSA 4NSNA 1ZMOA 5AVZA 5HKKA 1HLPA 3T3GA 3RRYA 2D0IA 5HJ5A 1OBVA 1QE5A 2NGRA 1S5PA 1MEOA 3GP3A 4I3GA 2FG6C 3KKQA 5JRZA 2C83A 3V46A 1FTQA 1Y8QB 5AUNB 5JNTA 4OXRA 1IL0A 1CUZA 1IB0A 5T64A 2WZBA 1M1NB 3FGPA 3OOYA 1BFKA 4GYKA 3ZI4A 4DSNA 3CE6A 1J5PA 3B78A 4LKOA 4FONA 4HAOA 1GO2A 4NOLA 1KDZA 4MQMA 5AMXA 5IT5A 1ZQ9A 4QE3A 5F7ZA 1GGVA 4MTCA 4ATNA 4YB8A 4CN8A 3K20A 5HOQA 2JEOA 3PVSA 2PUCA 3LPAA 2I7CA 2ODPA 5JLJA 2GD0A 5JPDA 4MGEA 5ALIA 1MR3F 3PRJA 5DI3B 1H1LA 1MA0A 1YKSA 1M2JA 3R6GA 1GUDA 4OFBA 4FE3A 3AGQA 1QIJA 1EK5A 4WW0A 3TEFA 2HRDA 4FDTA 3CLTD 3R8XA 3SF0A 4G5FA 1XMIA 2HNAA 4DBLC 3ABIA 1LPAB 2UXBB 2AK2A 2JC3A 3T9BA 2BBSA 4ZI7A 5LN1A 3MJEA 2I4IA 5AOVA 2H7VA 2C04A 2JF0A 1RZUA 1JZQA 3KIPA 3BXHA 2HSGA 2P8JA 2VSXA 4ONEA 3RYTC 1T4GA 3HNOA 3F49S 4R01A 1QSGA 4GLOA 1RWVA 1UJ5A 4RFLA 2Q2NA 3FTPA 1KF0A 4GWGA 1U5CA 2W5UA 1O3YA 3BD6A 4M1QA 2ZULA 3HKBB 3O5AA 1KK0A 3R2JA 2X0DA 1XG5A 2JGNA 3DHYA 4BIIA 1SUDA 3E6AA 2JAUA 4TQAA 4LHEA 2ZCVA 2ZT6A 5KZMB 4NR0A 4J3JA 4OXQA 2I7XA 3D1LA 4F0JA 3JQPA 1TW2A 2O2IA 2Q9UA 1OKKA 1YQGA 4IX1A 4KL8S 4KYUA 1Z88A 3W5HA 4YV2A 7REQB 5J3JA 4JQZA 4RMNA 1F3LA 2CDCA 1BXKA 3HUEA 3U0VA 1YC5A 3H2KA 4S35A 5HRAA 2J3KA 2QV7A 3CT4A 1FP4A 5D3MB 3I9V1 2GHQA 3S40A 4DSZA 1Q92A 4J2OA 3PC4A 1RABA 1V3VA 5K3BA 1Y1KE 2QZ9A 2N9UA 2XZPA 3FTDA 3H19A 2H4XA 2JFFA 3WGVA 2CV0A 5B64A 1Z0ZA 4O2AF 2LIVA 4FYJA 2BBWA 4BO6A 3A4IA 1TI7A 4OBEA 1JDNA 4NABA 1SC3A 4BE9A 2A1TR 2ZBEA 1TOAA 3A6KA 3P9SA 2P1DA 1N4AA 1GQFA 4MHSA 4QL3A 3JTEA 1JSXA 4OUKX 1V25A 2SBTA 2EBFX 1XKLA 3BWYA 4FFLA 2Q99A 1GUBA 1PEKE 1R2QA 2FW6A 1WPXA 3KYCB 3G82C 4K7JA 4PWYA 4YJHA 3RO7A 2F1KA 1UBNA 3JAWB 1P1CA 4DFDA 3DE4X 5FIUA 4Z53A 1R4NA 5DLPA 1PQUA 5FJJA 3F9RA 3ODGA 2EP7A 3ZQ6A 3R7NA 4AJIA 4ZCIA 1L5KA 3NWJA 2WM8A 3UK1A 4K9KA 5IULC 2FRXA 1ZP6A 5JALA 2Z1NA 3IOYA 4NE2A 1E1QA 4LF7B 2X8JB 5TJ9A 4KZPA 3SE0A 4EECA 2XYVA 2I2XB 3LYAA 4FTWA 4H1UA 4H7PA 4HMPA 1GPNA 2WB4A 5KHLB 1H2HA 3NALA 3S1AA 2WKRA 3O4HA 4X41A 1IQRA 3GDOA 5JSHA 3TRFA 2HF9A 2ZYSA 4C4ZA 2FPMA 5KCZA 4J94A 1I6KA 1DC7A 1YOVA 2ST1A 3HMQA 4BPRA 5JARA 4UUPA 4WKBA 1EXWA 2XAUA 1KJJA 1TJYA 1VJRA 4HH0A 3OCUA 1V4NA 4AMZA 2CXRA 4ZYVA 4LOIA 3PXDA 1XTVA 4E6PA 1HDOA 4H7HA 3HU2A 2QR3A 1VA5A 2OLJA 2QT9A 5I7OA 1LY1A 5CVDA 4GP9A 4PC1A 5HUJA 4L0MA 2WUGA 4QSHA 1UMKA 1DAMA 2O6LA 3DAFA 5IKMA 1DLIA 3FD8A 4EJFA 4AG6A 2X4GA 5AOAA 4CV2A 1IWOA 1JJFA 3VGPA 1GA4A 4A03A 3BQ9A 4R9NA 3KD2A 2GT1A 3P94A 4K9QA 4MPTA 2XDQA 1RJ9A 3HLKA 4EY8A 5BR1A 1OZGA 4ESVA 4HZUA 1BJKA 1D4AA 1C8BA 3IDFA 1YB1A 4AQYB 4DMRA 2EJTA 2GJ9A 3OLXA 4M1EA 5LB4A 2ECKA 4KK3A 4P3NA 4L6AA 5J2TF 1K27A 3LJKA 4UD6A 1L5YA 1G8YA 1TTHA 1PIWA 2Q3JA 2H92A 3I01M 2OYRA 3AM1A 1EBBA 1SOUA 4P80A 3AVWA 3A1UA 3EDCA 4B73A 3SOPA 2R6AA 3WGGA 1E5VA 3K1JA 4A4DA 4W5WA 2XTMA 2CYAA 1H0HA 4KO4S 4TS9A 1JUDA 2EKBA 4FHCA 4BTLA 5BRAA 2GHRA 1OBFO 3THWA 4F2DA 5CVTA 3AJRA 3AERB 1E66A 4J0KA 3RNLA 1NT2A 3C5CA 2GEJA 3L4EA 3AX6A 3GU3A 2AH5A 4YRQA 1P1FA 3WDLA 1KGSA 5TGTA 3ZWWA 3A1FA 4BXOA 1EBUA 2A0KA 4LX0A 4DG8A 1F2UB 5JNRA 1SAYA 3O7WA 3UWOA 3CPHA 2FB9A 3E9ZA 3HB7A 2J0VA 3F96A 4P0QB 4D8XA 1RXIA 3IR5A 2ZWAA 4LY0A 1E1LA 2QUBA 1Q21A 2GEUA 4QXPA 3T7AA 3PR3A 3W9YA 4EFDA 1V4BA 5CM8B 5KYUA 2WHYA 4IP0A 2B4RO 1PZXA 3STTA 3KDSE 1B15A 1UM9A 3EQ7A 2IHZA 3S2UA 4D3FA 1XZEA 4RULA 1QO7A 4UPEA 3GI1A 3R1IA 3CH7A 4M0EA 5LC1A 1GTG1 1GUFA 1OX5A 3R7FA 1C3JA 2ZVDA 3BF8A 3CW9A 3TXYA 3ZGLA 4TLEA 2QVCA 1N77A 1IYZA 2IHBA 1ZNQO 2HWKA 2PPLA 5J23A 1V1MA 4OQDA 1IUKA 1JA9A 1N5LA 2H1WA 1UKBA 4O8CA 1BMFA 3I09A 2ESRA 2V9PA 1BHQ1 5CX1A 1GG2A 3SS8A 4YQZA 3RRFA 1DWQA 4AECA 3RVOA 1J1IA 5ALJA 2IK8A 2FOIA 4CM4B 2DFPA 2QGFA 3FVTA 2G17A 3GLVA 1SUPA 5AIAA 1X8JA 2X13A 3A6EA 1F5SA 1XHFA 3R3WA 5CJJA 2RFLA 4MULA 1AO3A 3I5YA 3MEQA 1J8VA 1B42A 3EGEA 4J4HA 1M2EA 1Z3IX 2VQ6A 1E2NA 2HLHA 4HNSA 3JZIA 4MKZA 1GZVA 2QIPA 4E5DA 5AJYA 2A9RA 5K3AA 2ZIVB 4YACA 3QYPA 4R9VA 5IJAA 3UK2A 1GU7A 3QIAA 1T9HA 3QITA 4Q24A 1IB6A 2BKUA 2H4HA 4AUNA 3A3OA 1OU0A 5DASA 3DEZA 2AN9A 3NOVA 4G97A 1PW7A 1M2NA 1X15A 2X5NA 3P9IA 2CN1A 5JSYA 3WIOA 4EPWA 3AOEA 1U3UA 3MFYA 3TNDA 4MUHA 3S3TA 2W6JD 3JATB 5HRCA 2LD4A 1MC5A 3KQOA 1IHUA 2G6TA 4CKBB 4GQIA 4D6PA 2OKCA 2AFIB 4JBLA 5F35A 2B5OA 3CUSA 3QUSA 3VUFA 2PH5A 4JOCA 1PSWA 3V4RA 4JGBA 1PJQA 4B3SB 3NNSA 1GDHA 4F56A 3BD7A 3NEYA 2EG9A 2R6FA 1SVMA 2ZJZA 5EIWA 2GCEA 1PGQA 3RK1A 5LMCA 2CWDA 1X9HA 1ZUD1 3UHOA 1CQPA 2XUOA 1OZFA 2ATVA 2C9MA 3SFTA 7ADHA 5IKPA 1RM5A 3QSGA 1XZIA 3PC8C 2W37A 2IE0A 1I3LA 2G1KA 2WT9A 3ICCA 4MVJP 4Y1EA 1O6GA 1YJCA 2SECE 4EG1A 3BK2A 5FEUA 1FXUA 4OCZA 4IM7A 3SI7A 3GFTA 3NASA 2I2BA 4HWGA 1RQGA 3D8NA 3FPAA 5CHEA 1TKCA 3DS8A 5AHXA 2WILA 4DBZA 3FNFA 4PY2A 3L0BA 3ZBUA 2WJ3A 4PBTA 2YXBA 2ZTHA 4KXQA 4LOKA 1NVUQ 1MZVA 2GO7A 3FPCA 1ZIDA 1GNVA 2P7IA 2TECE 3V9PA 1T1GA 5A1TA 1R0SA 3GPLA 1SQ0A 2FN7A 5EG5A 1FW6A 3PG5A 3EFBA 3RDPA 2C78A 2FFBA 3O8LA 1E59A 1LPPA 1IBCA 2ZIXB 1OFIA 2IHYA 3TINA 1H85A 2BW0A 1KK2A 2Q8NA 5C51B 1BDIA 4ZCPA 4BRUA 2G82A 3OO1A 2EW1A 4QKQA 1HX7A 4YJDA 3CLKA 2OP1A 3OQJA 4JIGA 2O4CA 3T5GA 1XC7A 4LTNA 4CM8A 1EFVB 1NJSA 2XY4A 1LQ2A 3G0OA 1D07A 3ONEA 3KTOA 4HY3A 4FIZA 4JZKA 3R7LA 3OF3A 1Z6PA 3UT5B 5JH7F 1H2AS 5ESRA 5K0FA 1KMMA 1MOSA 4HTFA 4PC2A 3NKLA 1N2BA 3NCHA 4G24A 3TIXB 1VXOA 4U9HS 1YCGA 4MLPA 4WA7A 4CF5A 4BWYA 3QUAA 5H59A 4ZYZA 3LHKA 4GSKA 1VJGA 4UBKA 1PO7A 2VNAA 4UZFA 5BYBA 4ALJA 1KMQA 2WHEA 4DADA 3D7MA 1TM7E 3T35A 3VO2A 5H8WA 4XZ3A 5LYJB 1DCKA 4CMEC 2REBA 1UMCA 4C0LA 3QPCA 2GCPA 4GE0A 3RSHA 3EXIB 5LFAA 1I7SB 4DB2A 2BFDA 1FU4A 4U0KA 4F4UA 2OC9A 3O83A 1NULA 1U0FA 2BAGA 3NP7A 2VQEB 2EJBA 1DIOB 1ETUA 3LMKA 3HXPA 3TPZA 1F1JA 3LLVA 1O2DA 1OYYA 4HRYA 3SCZA 3U7JA 1DRVA 2AZ4A 2CB0A 1S89A 1NN3A 1PU2A 3IUSA 1N9GA 4I5DA 4I9NA 3ZU6A 2ORYA 2DUJA 5EOVA 4X66B 2GWRA 2NU8A 4HBGA 2B8WA 3B38A 4CNQA 4F38A 4RF2A 1Z37A 2ZJ0A 3WOVA 5ISMA 4QBHA 3E9QA 5FL7A 3E3OA 3S4YA 2BH2A 3RADC 4F04A 3E9EA 4HAYA 3SMQA 1Z2EA 2R6R1 2R6JA 4CKXA 5BWCA 5K0GA 5J59A 2BZ1A 4PM4A 2A9VA 1YC2A 2K87A 3OQIA 2XNCA 1VI2A 4GPBA 1EIZA 1Q0SA 4HDQB 4L74A 4RKYA 2AWNA 3WK6A 2J6BA 3IPXA 4EW3A 4EUSA 6CHYA 3HVUA 2I4TA 4DUGA 1LPNA 2D2VA 4GLJA 4JLKA 3RS3A 1RJFA 4BC0A 5KPJA 3WS7A 3H2IA 3L77A 4LSWA 4YRIA 5KVSA 2EX4A 4O2AA 2FSVC 4S1WA 1YVUA 4JJAA 2KW5A 3LLUA 3R6WA 1OFUA 3H7IA 1EUCB 2FYTA 4WA8A 5MHTA 3KP1A 3H1EA 5K9ZA 3JTMA 1U2DA 1D1SA 2QGZA 1G7TA 4L5YA 4EMTA 1E1KA 1QIDA 3E4DA 4ZO7A 4DG9A 4Z49A 4MKIA 5JRJA 1E0KA 3LGAA 4N8DA 1PD1A 3A9UA 1A8QA 1KY4A 3V4VB 2QHXA 3IB3A 1FVXA 4CFSA 5BVGB 1DC4A 3U5ZB 5KO2A 2XUAA 2IUYA 3V8PA 1RPNA 3INNA 2QORA 1G98A 3ZXXA 5JU6A 4C6RA 1DBWA 2G70A 3PQCA 5G3YA 3RASA 2EKDA 2AMVA 4GMHA 2W11A 3LVBA 4LZJA 4EYOA 2QJWA 1U8ZA 4P3KA 1ZGGA 1IXKA 4S1TA 1XKQA 2KHZA 1QFJA 3IMKA 4IHJF 3CX3A 4JR2A 2VT2A 4G8CA 2JHAA 4RV4A 2C4HA 1EESA 1RPAA 4LRTB 3SC6A 4F3TA 1QAMA 4XGKA 5IEBA 4RZ3A 2VJBA 2QS9A 5ALSA 3MT8A 4HLDA 2EFCB 4RVSA 2PFSA 4DT1A 2QROA 1E0AA 2XTJA 3CIFA 4IJVA 1IXZA 1O57A 1DCFA 2OSBA 3B53X 4ERXA 3BX1A 3RG2A 1HE3A 2JVKA 3HN6A 4EABA 3WQHA 2D8AA 1J0DA 4AURA 2LKDA 2I99A 4CCWA 2VBIA 5BMVF 5DE3A 3GYBA 5HCIA 4OH1A 221PA 5BN4B 5AJVB 3AJDA 2J8ZA 2ZI9A 4URUR 3THXA 1DL5A 1GR0A 1V45E 3L1UA 1KY5A 4KBFA 2VNKA 4TZTA 4B6OA 1EVKA 3STXA 1RWNA 3T15A 5H9WA 1G20A 3NTOA 4W5RA 1Y6JA 3IDOA 2CKMA 5ALZA 4EHAA 3GH1A 3DE5X 3ITDA 1STOA 1HKHA 3KOUA 3HA3A 3ROMA 2ZBDA 2HK9A 3SHVA 2UXDB 2A33A 1T2AA 1NW3A 3IVCA 3FOAA 1AHPA 5J2TA 5KKAA 3K6KA 1N2HA 5D01A 2ZRQA 4G1UC 3SZGA 3WRWA 5CXQA 2ZJ7A 1PGOA 2QZ4A 2ZWIA 4U2EA 4Y3UA 3G0BA 1PF7E 3CFYA 5FBHA 4ZKEA 1I30A 1RWXA 3KL2A 4KQXA 5DT2A 3CY6A 1HM5A 3GRRA 4ALMA 4RMHA 3ORQA 3BH6A 4MUAA 1NHWA 1BXRA 2MYNA 3ICVA 3AF5A 4OXNA 1F9EA 3F3KA 1JZTA 3OZDA 3ONWA 3GBPA 4DQKA 2AFHB 1SXGA 1P1IA 1KI4A 4MWSA 1ORIA 1QHXA 4Q4HB 1KKMA 5DBEX 3VR1A 3BVPA 3H2YA 1YJAA 4JJFA 1K5DA 3EY9A 3N2LA 4N41A 3AEQB 1QGYA 3ONFA 3ZHCA 1ML4A 4ZCMA 4N7BA 5BSVA 1U0SY 1IN7A 3L7LA 2W7TA 3KR0A 4M22A 2UYGA 2G80A 4EHLA 2PGXA 1O03A 2X19A 4NYIR 4R0VA 3PCRB 2GZSA 5ULLA 4DM4A 2PLNA 1MV8A 4JBXA 4R2IA 1VLZA 2ZR8A 1OZAA 3FLBA 3KUKA 4X97A 1AGYA 3W2TA 2GVZC 1FJ2A 3A27A 3ENKA 3HS3A 1DG1G 3OIGA 3PT9A 2D6FA 3PDUA 4C30A 1ZCJA 2BEUB 1Y5LA 4HFJA 5EJIA 3W5JA 1TYCA 4A92A 1CEEA 2J3EA 3NH6A 1HEIA 3QPVA 4D9FA 3MK31 1IN1A 3K15A 3U60B 1WU7A 4C0QC 2FFJA 3AEUB 4H0CA 4HLUC 1K4YA 2J3HA 3FWZA 2XB6A 3BIOA 3N87A 5THKA 5C7OO 5AICA 2H85A 4WN3A 3LKZA 1NF8A 1P60A 2LKCA 1VMAA 3TI9A 1J09A 5LQCA 1ABEA 1W5SA 1DPGA 3PENA 2D1FA 5EWMA 5KOYA 4O63O 2UKDA 1Y6QA 4UDYX 1CJMA 1KI6A 4RZIA 4V0RA 4S12A 3VU9B 1XTTA 1Y1QA 3WKEA 3EF1A 4QRIA 1SD5A 2QLLA 1WKVA 1UDBA 4PEVA 5T4BA 2DFDA 4I0WB 4YHBA 4ZHQB 2GZDA 2NPOA 3WLQA 3F9IA 3KK0A 4G4SO 2AR0A 2UAGA 1O9BA 1POXA 3IILA 5AM4A 4UASA 1N5MA 3AR9A 4E5VA 5F7OA 1ATIA 1LLQA 3O03A 4ZDIA 4KWTA 5TLSA 4D02A 5KHAA 1KMCA 5IC6A 3URMA 4RY8A 1QYVA 3EEQA 3O9MA 4Y2XA 1H9AA 5BW4A 3GN2A 3FOWA 4PSVA 5FLKA 5ECWA 4CQJA 4H7EA 5HF5A 3RT9A 2C88A 4G0NA 4JB3A 2OP0A 2ZIFA 1X7YA 2IOQA 4XIYA 2HY7A 4C76A 2NZVG 4EEZA 4EJSC 4DL9A 1CR4A 3LK6A 3L7IA 4BNMA 2BCEA 4WXRA 1U9JA 1OI4A 1PTJA 1MHTA 4DQUA 3G5UA 4YDSA 3OTQA 3TEJA 3LY8A 3QTBA 1I3CA 1WNFA 1QGZA 3LVQE 4U7PB 3VPAA 1P7PA 1AO0A 1U8AA 1YL6A 1N57A 1U7TA 2A1UB 5E3IA 3OG9A 4IZ6A 1NLFA 3E22A 4QBKA 4R9RA 1IU9A 3HDTA 5LZ8A 4K9SA 2O5CA 5AI5A 2JRLA 4YRTA 4J6EA 3F7TA 5IKOA 3M5WA 3LIIA 3FI9A 4OUDB 1Y4AE 2F1OA 4WCFC 5AW6A 1KYWA 3C98A 1VYTA 4ZVTA 4YCLA 4DUZB 4KH0A 4H0FA 3TJZA 2OLEA 4KXUA 3OPXA 3TW0A 1NM5C 3LQYA 2FMIA 1W25A 4CIAA 4K5QA 4WLNA 1YR2A 3H9GA 3EG9B 3TCKA 721PA 3A26A 3MLAA 4MS1B 1UKAA 4OLAA 5ALDA 3OZWA 1AK1A 1KWKA 1Y9ZA 3USCS 2OHJA 2WD7A 4BVFA 1BH2A 3REQA 2ZPAA 5CT8A 4OI1A 3W04A 4BNKA 5B7PA 4BJ6A 1Y9JA 5JS6A 4FJ1A 1W581 1G8JA 1E2IA 2YHAA 1FUKA 3EDRA 3SXJA 3TR0A 4BX8A 3LE8A 4E7OA 5AUPB 2ZZNA 5JXIA 1OXUA 2JCGA 4ZJYA 1N32B 3ICEA 3KAQA 1TE2A 3VVCA 4IGIA 2ZBRA 3GFVA 1YE3A 2PWAA 3DZKA 3C1AA 5C5DA 2HQ1A 2IOYA 2X76A 4R1QA 4X8MA 5C34B 5L6MB 2GHIA 4DLRA 5I7SA 1ZWLA 4L9RA 4OBXA 3OIFA 2BHLA 5D7BA 1FQOA 1BDJA 3NGXA 5F3RA 5LDHA 1OFVA 2Y0CA 5HFJA 3GQVA 3CZQA 4ALNA 5JH7A 3O8OB 4U9UA 3Q6NA 5A0FA 2WAAA 1U2GC 2C2ZA 4L51A 4YREA 2EFHB 3ZNNA 4Q3OA 4N76A 4INOA 1PT8A 3TSWA 1Z5NA 3V4SA 4G0MA 5K8IA 1M2HA 1YZUA 2FWRA 1LJUA 3G2MA 2FW9A 4XCVA 4Z7JA 4O25A 3IKVA 2GZRA 4XRGA 1Y7HA 3OJWA 3VHXB 1K7FB 4EFMA 3BL5A 1RXEA 2JGFA 3PYXA 4C88A 4EHIA 1MABB 4QFMA 4ZPXA 4BTVA 2CNWA 4JP5A 4L8GA 1U3GA 3ANMA 4NZYA 4MUEA 2HBZA 1KZ9A 4K0RA 3CF0A 2EIHA 4D4JA 4WBNF 2VHYA 3UMYA 1ZOLA 3ZLUA 1J0CA 4F4HA 1VMIA 3CGGA 3E9CA 3KQYA 1YI1A 4NJEA 4NZZA 5DP1A 3PI6A 5EPEA 1EUDB 2H5LA 4OV6B 4LY6A 2Y67A 4IICA 1UBTS 1U7PA 1W1WA 1DS6A 1UPCA 1Z2CA 2ZJ6A 3JQRA 3RAGA 4A0RA 2X8AA 5LP6B 2FCAA 2O05A 2QVZX 3I9V6 3QW2A 4PLZA 3ESXA 5U9CA 2WPDD 1XNHA 3Q3CA 2DPLA 2YV5A 3N8IA 3KNZA 4UXHA 2QYTA 5HKOA 3AILA 4LYDA 2IIBA 2J3DA 2M6RA 2IS4A 3ER8A 3BB3A 3PVCA 3G0HA 5EE9A 3ZIAD 1LDNA 3FX2A 3SX0A 5CXXA 3IHWA 3L9WA 1E3IA 3TRHA 2R62A 3LXXA 1UFVA 1Z5VA 4MMXB 4C6HA 3G2PA 3M3HA 3OZ7A 2HXYA 4RPLA 4YLGA 3KQNA 2ZGVA 3SR4A 3HDJA 1KORA 1JQLB 3TNLA 1SELA 2V7UA 1JE0A 5ALFA 3VR3A 1GTRA 3JAKA 4FMDF 1YZVA 3BJRA 1XTJA 5KJCA 1UWCA 3FVWA 4UXJA 3MCAA 1E2BA 4LCJA 5EE0A 1KDTA 2WM2A 3K0CC 5J2UB 4IRMA 5K3DA 1CS0B 2HJVA 2HWWA 4XB1A 1HTWA 5M29A 2PAAA 4Z1MD 1W47A 4FNMA 1AMOA 5DGIA 1X1EA 1OAOC 2FWJA 1ACLA 1K9SA 3B6MA 3EQ8A 4HXFB 4W7HA 4JWTA 2GK3A 2JJYA 2J33A 1R6DA 1KJIA 1R37A 2I2AA 3MXOA 3R3UA 1Z8FA 3C6KA 2SKCA 4AY4A 2E37A 5JVDF 2X8BA 5DNCA 1NMXA 3WIBA 3L07A 1BDMA 1NF2A 1S4QA 4MROA 1JT2A 3UGKA 1NVTA 3NB0A 1B0PA 1LD3A 1L0BA 1ZBQA 1X9IA 2MOKA 4XD7D 4AIRA 2BKVA 1IBLB 4OQNA 4GM4A 3DL4A 1BDBA 3HO8A 1MJHA 2WZCA 1G42A 3FRHA 2I03A 4M0FA 2FR8A 1Z8NA 3D0QA 2ZSHA 4EA9A 1JA0A 1LDGA 1MOPA 1QTIA 1NUQA 4IHJA 3MJTA 4RTJA 4QJ4A 1QQTA 4BECA 1AZSC 2FPUA 2C4TA 2G4CA 5A3QA 4INPA 1YIAA 4FHFA 3V8QA 4DTIA 1BROA 1T3GA 2IOHA 4DY6A 5AVXA 4YP7A 4NYMR 4I2NA 1PNTA 4GBJA 4MKXA 5U4XA 1KPGA 2PDAA 1PFQA 3KJXA 4LE2A 4PR3A 3ZWDA 4ER0A 1QGUB 1TIBA 4N5NA 3QLTA 5BMVA 5TJHA 3EA5A 5DXFA 4B32A 1CZKA 2XNDD 3AL2A 4MMZB 2FPWA 1RWKA 1NP7A 1U2RA 5E6UA 1WBDA 3VI4B 4RSHA 1N7HA 1D1TA 2BHRA 4HH4A 2FLKA 2BJWA 2BTOA 3DGFC 1XZNA 4LMPA 5FOUA 3G1TA 5DCUA 2AG0A 2P78A 4DMMA 1OXTA 5IS2A 3M5CA 2V1UA 5DNWA 3AR6A 2QTVA 2FMHA 1KQPA 4QUIA 5BWOA 2BSQA 3T7DA 1MP0A 1Z74A 3HCDA 3M4ZA 3VPXA 1Z28A 3E5HA 4IX9A 4J3NA 4BNJA 3IAHA 5JMOA 3C5VA 2YRFA 3HDHA 1PJZA 2B4TO 1KFBB 2A2ZA 3R9KA 1BQ4A 3ITNA 3CT6A 3RKRA 3EIHA 3R20A 5KINB 1AQUA 1Z0SA 2WWRA 3WJ1A 5JDIC 3MTQA 1TVMA 2ZRLA 1N5KA 2IZ7A 3C1TA 3KU1A 2XWJI 5CA1F 2KPOA 3BGSA 4FC6A 5LYYA 3SM9A 5JD4A 1EWTA 5FTJA 2PJUA 3A6DA 4AXXA 1EWYA 2PQMA 3DWGA 4HRXA 5IBQA 4NZPA 1I5RA 3BA6A 4JD5A 1I33A 2CVQA 4KPUA 2C5AA 3OU7A 2EIXA 1QX3A 3GT0A 3KKEA 3K9NA 3BT7A 4YLEA 1E3TA 4M9RA 2PU7A 3OKCA 4QECA 1OGIA 4OHZA 2Z5GA 3TLXA 3FCOA 5CNMA 2P8SA 1DKPA 1FFSA 2QR2A 2PZEA 2XH8A 4FKZA 5JCJD 5P21A 3BILA 5TQJA 1JZSA 4XSHA 3SVZA 3NV7A 4G8DA 1T9DA 1Y7PA 2Q5OA 2R47A 4OJYA 4Q7LA 4N5HX 4M9QA 2RG7A 1ESEA 1Z0DA 4J16A 4TM7A 3FROA 4QYIB 2PRSA 1IE3A 1I1OA 2CE2X 2OYCA 2JLCA 1X0VA 4GM0A 1YE8A 1CPYA 4MJ7A 4D46A 2HMYB 1TIPA 1IAQA 4I6JA 1NQXA 4L50A 4V24A 4GR5A 4XFKA 2XT9A 4MWEA 2NQ2C 3R5XA 2BKEA 3EZYA 4PR0A 2EHJA 4OP2A 4WE3A 2G08A 3A3NA 1UK8A 3BGIA 4TRNA 4KPFC 3ZEIA 2B69A 2Z2JA 3TDKA 5KX5F 4IXNA 2D54A 3H6HA 4I5GA 4EPXA 1XLVA 3R5HA 1Y89A 1XT6A 4NNPA 2NUAB 3CLVA 3DBOB 3NIDB 3IR7A 5KWIA 1GZ6A 3RKUA 5JCXA 3DT6A 5EIAA 2Q3HA 2WF8A 2C3UA 3E7XA 1IUNA 4F1WA 1ZIYA 5KTNA 5GZ3A 2HN9A 3N2YA 2J4CA 1GRVA 1KZ4A 3QYFA 1VI6A 4XDGA 1ADFA 1UMDB 3RQIA 2I4LA 1KSFX 3GLIB 3NDPA 2XSZA 3ED1A 3T3OA 2IITA 3UV7A 1WZUA 2C58A 2VDNB 1BMTA 3COWA 3JQFA 4H0NA 4MJLA 1WHSB 5ALNA 3WFIA 4UOZA 4IR7A 2IVZA 4JA2A 4Q7EA 4C4TA 1UBMS 1SUBA 1P4HA 4GEGA 5BQ3A 5KNDD 3IQWA 5E2AA 3ZWCA 1X38A 3SU8A 3PQ8A 1DJQA 5A9RA 1N2CA 3FHOA 5ECDA 1VECA 1L7BA 4AP5A 2HMUA 1DADA 1WA5A 2AW3A 1QRDA 2GMWA 3LUBA 3N7AA 4Q3BA 4YI5A 4HNVA 3F8WA 2HLPA 2G72A 4JEHA 5EP3A 1YS1X 3ICPA 5CTAA 2IEGA 2HJRA 1CR1A 1D2MA 4MW1A 3UMVA 4UVEA 2QSJA 3IOBA 2XGSA 1NNI1 3ED5A 2ZIWB 3WTCA 3F73A 5IDYA 2ZDHA 3OX3A 3SAJA 3UJCA 4F46A 4CETA 2FOLA 4FPXA 3X1KA 4HVLA 1Y8ZA 3BMQB 2CUZA 4I1PA 3H5VA 1PSZA 2C1EA 1ZYUA 4FR2A 4NJMB 4DLBA 2YMMA 5KQLA 4HUQA 1NG9A 4NHOA 3NH9A 4G0QA 1XZQA 1V6SA 2IIPA 2J7PD 5AK4A 1ESCA 2C7PA 3DTTA 2G71A 2ADFA 2IS2A 3SE7A 2FSHA 1TLTA 4FM9A 2R11A 5KYNA 3MD0A 4X85A 1CQJA 4BQNA 2RD2A 2XB8A 3CSSA 5B5SA 4LHVA 3Q8LA 4V2UA 2Y1CA 3HWX1 2N75A 3NWEA 2QTBA 1SZPA 3DOUA 2A9FA 3CEPB 4IJMA 4Q4AB 1HXHA 5L40A 5EUCA 1L5OA 4MVWA 2HWUA 3ZCXA 5CFNA 3K71B 3Q11A 2GM4A 2Y9PB 2RONA 1Z25A 1SQ6A 1P75A 3KQWA 5EYPB 1G20E 2J87A 3T7SA 4E33A 2N47A 3FDXA 1NHGA 1CHDA 4DLNA 1Q7CA 2C8JA 1VA4A 3I4CA 1BMQA 4KDEA 1OLSA 3SR3A 2CHUA 5HTOA 3CPEA 1BCRB 4NECA 3N5CA 2EW8A 3HJRA 3QEMA 3EA0A 5JYDA 6ADHA 1A1VA 1VE9A 1C0PA 2R9VA 2Q3CA 2ZRFA 3FWHA 5HMLA 5HHTA 1THTA 2PUVA 1WJGA 4HFNA 4LRUA 4UM9D 5BNFA 1Z07A 2GPBA 4ENRA 3P9RA 4FCVA 4RHTA 4ESOA 2PWYA