3FH0A

Crystal structure of putative universal stress protein kpn_01444 - atpase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
144
structure length
125
Chain Sequence
SNAMILVPIDISDERIISHVESEARIDDAEVHFLTVIPSLGMDELREGSETQLKEIAKKFSIPEDRMHFHVAEGSPKDKILALAKSLPADLVIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative universal stress protein KPN_01444
publication title Crystal structure of putative universal stress protein KPN_01444 - ATPase
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
total genus 36
structure length 125
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fh0A00
3HFJA 3IVGA 5KWVA 1XNJA 3U1VA 4I6GA 3ZUGA 3L92A 2GOYA 4MVYA 4EG5A 1O95D 4HK4A 4AS1A 1GTRA 2CYCA 4U63A 1MC1A 1M1ZA 3VRHA 5AHWA 1O97D 1ZH0A 2E18A 1O96B 4JFAA 5J5AA 4ZCRA 2E21A 4RPIA 4MUIA 1N2GA 2VXOA 4EF6A 1JHDA 3KT3A 4MAFA 1Q15A 3P52A 2CT8A 1X8XA 3L93A 1NURA 3IOBA 1VBNA 1G8FA 5FO1A 5TGTA 3ZJUA 1G59A 1NUTA 2QTRA 3IOEA 3GUZA 1F7VA 1N77A 1WKBA 3AG6A 1P7PA 1T6ZA 2QJOA 1ULHA 2QTMA 3ZXIA 1IHOA 3AL0C 4BWVA 4R2MA 3AG5A 3CA8A 4MW0A 1K4KA 2J09A 2WSIA 3RBAA 2WQ7A 1WOYA 1OWOA 3IVXA 2AG6A 3RK1A 1H3FA 4ND7A 1JIJA 1OWPA 2X1MA 3H97A 4F4HA 3TNJA 2J5BA 2QUIA 2YXNA 3VU8A 2PZBA 1N2EA 2O8VA 5K0TA 5J59A 3IVCA 4HJRA 4MW9A 3COWA 4NAUA 4ZT7A 4NZPA 1A8HA 1D2RA 4DLPA 4DE5A 1OBCA 4Q16A 1NUQA 2QUJA 5FO0A 1BS2A 1PFUA 1T9GS 4YP5A 4MW2A 2O5RA 2IP1A 3SZ3A 2A4MA 1IH8A 1WXGA 3FOCA 1VLHA 4CQNA 1XNGA 2CYBA 3IMCA 1IVSA 3ZGZA 2ZP1A 3HZRA 4MW6A 1KAQA 2DUMA 1H3NA 3TQOA 1KP3A 5IJXA 1OBHA 4OUDB 4MW1A 1O94C 4L2IA 3A05A 4P2BA 3DLAA 3H05A 3CR8A 5LLTA 1NP7A 3H99A 4ZT4A 4RUKA 3IMGA 3UMVA 4MW4A 4KPUA 1I6KA 4F3RA 3QE4A 3H9CA 2Z09A 4CDNA 1EFVB 3N05A 3Q12A 3CLTC 4CT0A 3NBAA 4QBTA 1YUNA 2R5WA 4PY2A 1PG2A 3ILVA 1WXIA 3BL5A 5K0SA 2DEUA 4CDMA 3DO8A 1KH2A 1T9GR 4EG1A 1Q11A 5TEVA 1SURA 1WY5A 1NUUA 1MRZA 3N8HA 4YP7A 3D6UA 1J09A 3HL4A 3IH5A 4MLPA 4G6ZA 3AKZA 1MAUA 4ZCQA 3CLUD 1ILEA 1WQ3A 1YULA 4YMIA 4XSVA 4XFDA 2A86A 1WXHA 2JA2A 1QNFA 3P0HA 2WQ6A 1YIDA 1QQTA 1EE1A 2CFOA 3HGMA 4MUGA 1VL2A 1J1ZA 2XRZA 3A04A 2CUZA 1N2HA 3FI0A 1V47A 2D5BA 4KR9A 3K32A 2D54A 2PXHA 3FHJA 1O0BA 3CLRD 3IUEA 3N9IA 4YBRA 4ZCTA 3FY4A 1IQUA 3AIIA 3TZLA 1EFPA 4ARIA 4KR6A 1DNPA 5DASA 2I1LA 1MOPA 3RHSA 1PFVA 2A1UB 3G5AA 1GTSA 3P0IA 1KH1A 3FWKA 4R2LA 2VTBB 4OJMX 4EGAA 1NZJA 1IRXA 1YIAA 2GM3A 2JAXA 3AFHA 1KAMA 1FYDA 1KQNA 1JGTA 1T6XA 4EG8A 3RFFA 2YWBA 4WSOA 1QU2A 1TYDE 3HV0A 4J76A 5J58A 1I6LA 1COZA 3E27A 3TZEA 1H3EA 1M8FA 2G36A 3DPIA 2DLCX 1WZ2A 4MW7A 5F23A 4MUFA 4MUHA 1B6TA 2A1TS 2H29A 3COVA 3X1MA 3MMXA 1WXEA 2BTEA 1M8GA 3CLSD 3P0JA 4ZT3A 3FIUA 3ND5A 3G59A 1O96A 1X6VA 4AQ7A 4TS1A 4U7JA 1MB9A 1M8PA 2C5SA 3INNA 3FDXA 1O95C 3MLAA 1CT9A 1I6MA 1OD6A 1NUPA 3SP1A 2Z3VA 3SEQA 1F7UA 1M83A 3GLVA 2HGZA 3S3TA 4EG3A 1EJ2A 4DJAA 2RD2A 1NSYA 2J07A 1WJGA 1R6TA 1O97C 5H16A 3F3MA 3H9BA 2ZUFA 5DK4A 2IELA 1Q77A 5HUJA 1K97A 1JILA 4J75A 4NX2A 1U3CA 1JEEA 1I2DA 5HG0A 3ZJTA 3Q4GA 1YUMA 3JXEA 3UK2A 1V8FA 1KR2A 4GU5A 4ND6A 3IOCA 2NZ2A 2QUKA 1GAXA 3PRHA 3CVUA 3CVYA 3NV7A 2J4DA 4MWCA 3CVWA 3FG9A 3SEZA 5TS2A 4JXZA 4E1AA 2CV0A 1MB2A 1M8KA 2E89A 4U8HA 1J70A 5TEWA 1MJHA 4ZT2A 1K4MA 3LOQA 3KT0A 4MUKA 3KT8A 5HUHA 4UZEA 3TQIA 4FZJA 2PZAA 4ZCPA 1GN8A 1KKUA 1QJCA 2PG3A 3FNRA 1N2OA 3ZJVA 4XFJA 2CV2A 3QTBA 3CVXA 1GPMA 1J1UA 1VBKA 1F4LA 3COZA 4QRDA 3OTWA 1TFUA 1JZSA 1ZJWA 2EL7A 3IDFA 4EG7A 3HMQA 1EUQA 4S1OA 2D13A 1EXDA 4PBRA 2AKEA 4A91A 3ELBA 3UOWA 4WNYA 2A84A 1EFVA 3PNYA 2DETA 4DNXA 4I6EA 1JIIA 3ND6A 1QRTA 1R6UA 2DR2A 3A2KA 1QRSA 2WB2A 1IFXA 3MXTA 4G5YA 4KKVA 3RK0A 4NDAA 3LCJA 3LE8A 3VGJA 1O5TA 2DXIA 2PFSA 4MVCA 1TYBE 3ZXSA 4MVWA 4MWBA 2OV4A 4ZCSA 1OWLA 1T6YA 3SZGA 2IJGX 1N2BA 4NAHA 3SYTA 1N2IA 4MULA 1N1DA 2DERA 2Z08A 1NYLA 4QREA 3CLUC 4ARCA 2TS1A 3ZIUA 3IUBA 1JEDA 1N75A 3KT6A 3N2YA 5KHAA 1LI7A 1O94D 1FFYA 4EG4A 2H2AA 4PBSA 5H7XA 1G8GA 3UC5A 2CV1A 1HYBA 3TS1A 5LM3A 1F9AA 4K03A 1KQOA 2A1UA 3Q10A 5DB4A 1U7DA 1PFYA 2CYAA 3PNVA 3OP1A 2VTBA 4ZT6A 1GLNA 3CLRC 3UY4A 4L2IB 3A4IA 1MAWA 1XJQA 3CLTD 2RE8A 2BYTA 4I6JA 1N78A 3K9WA 2NSYA 3IODA 4KR7A 2GKSA 1LW7A 2QJFA 5FNZA 4KPUB 2AZXA 2B7LA 2YWCA 1J21A 1WQ4A 3PXUA 2JANA 3GMIA 4H3SA 2V0GA 4MUJA 1PFWA 1O6BA 4JXXA 4ZT5A 1TYCA 1KORA 1OWNA 2PIDA 4K0RA 5BNZA 1Y42X 3X1KA 4UZFA 1U0BB 4MUEA 1IQ0A 3PNBA 3RJZA 4X0EA 3C8ZA 2CSXA 4MUNA 2ZUEA 4NATA 4MWDA 3FETA 3MLBA 4MVXA 4Q93A 1S4MA 1XNHA 4MQ6A 1U3DA 2A1TR 1QRUA 2PZ8A 1O0CA 2YY5A 3M5WA 1LI5A 3QTTA 3ND7A 3IMEA 3NBKA 1NUSA 1MBZA 3DV2A 4HPWA 3D6VA 1QU3A 4GRIA 5LFAA 5EKDA 1N3LA 1VBMA 1KH3A 3X1JA 2X1LA 1OWMA 3CLSC 1ZUNA 1YI8A 2X3FA 1N2JA 4G5FA 1PG0A 1K92A 5DEOA 2V0CA 1H1TA 4JZYA 1R6XA 4JYZA 3SDBA 3G6KA 3ISJA 1KP2A 4MWEA 4R0NA 2QTNA 1JIKA 1EFPB 2A7XA 2QUHA 4HJXA 4EFKA 2J08A 1JECA 1JZQA 4OUDA 1J20A 1TQ8A 3CVVA 1ZH6A 3I05A 4DDKA 1JMVA 2A88A 1M8JA 1RQGA 2DPLA 3FH0A 1GZUA 2EJCA 1IQRA 3KFLA 1NI5A 5JBNA 2HMAA 1TEZA 1U7XA 2OQ2A 3COYA 4EG6A 1WXFA 1KQPA 2XRYA 2E0IA 4YP6A 2QJTA 5KCMA 3MUEA 2HZ7A 1G8HA 4DDHA 4PBTA 1Q19A 1TYAE 4MW5A 1EUYA 2X0KA 4DDMA 1QTQA 1UFVA 5IHXA
chains in the Genus database with same CATH superfamily
1NA5A 5AO9A 4MV7A 5EEHA 3RVJA 2R48A 3BOSA 3OT1B 4F0JA 5KWVA 4OKNA 4HGZA 3U1VA 2JIQA 2XMPA 1EVLA 3DMFA 1G7TA 2MYNA 3RSSA 2NTJA 1CR2A 1VHQA 2XT0A 3A6DA 4XEHA 4CNBA 1QDEA 3IOMA 4W5WA 3ZY5A 4LDRA 2OKCA 2WQZA 4KIFA 2F8TA 2RI1A 5KTRA 4E5KA 3AHHA 3BTVA 1CYDA 3F7MA 2H07A 2OGZA 3H2BA 5FWXA 1JXOA 2ZTVA 4OBBA 3VDMA 3HL0A 1KMHA 1GPDG 1TUEA 3A9SA 2E21A 3PB3A 4FMCB 3SDZA 4Q1AA 3DDSA 4Z0TA 3T0GA 5H9WA 1SVUA 5KQLA 4JUCA 1Q3KA 1T5OA 2FK8A 2VXCA 2WYVA 4G24A 4L4RA 5I7RA 4DB2A 3HDYA 2ZYVX 4DN6A 1T5SA 4Z9XA 5F2KA 1V96A 2Q6OA 4H35A 4RHYA 3K0FA 4C5CA 5KHOC 3NHBA 2ZM5A 4GUDA 3VZDA 2WNIA 1NVFA 2QI9C 1KOGA 3GFSA 4QVIA 2FF5A 2PD4A 1N92A 3W1WA 3FHLA 3W9UA 4B3FX 1X7XB 2VTVA 1N0WA 4FNAA 3PHGA 4TQ9A 1HLGA 1P1JA 5D5HA 4AZSA 1AY0A 2Y0EA 4J3FA 5F78A 2R00C 2QM8A 2Z5VA 3I1IA 1FMLA 2HEGA 4HAWA 1DV1A 2NXWA 2YICA 1K7YA 1XTUA 3UJHA 1FP6A 1USVA 3WYFA 4R2MA 4AO7A 2V7TA 2FR8C 5BR1A 5DI3A 1USGA 2RI6A 4P32A 4U5QA 3A3YA 1M72A 1IG3A 1QYWA 1R6VA 3DHEA 3GL9A 5ARBA 3LA6A 1GKKA 3WA6A 1VPEA 1H6CA 4A73A 1EFLA 1X2BA 3PHCA 4GNKA 2ZAIA 1V39A 1J8MF 4TTJA 4WADA 1R4AA 1LH0A 1RXIA 3E9CA 2AFIA 3OVMA 1ZX1A 2IQ5A 3MK31 1PN3A 5CP8A 3KQLA 1JYSA 3RHTA 1EWTA 2PGOA 5J59A 2REBA 1L5KA 1ZISA 2Z9BA 4MMYB 3AVYA 2Z43A 5KWJA 3IAS6 1PTKA 1KO5A 2H48A 5FRDA 5JCJA 3RKSA 1NXSA 4DJTA 4DV4B 4LTMA 4C7VA 2R84A 3KSDO 4YAFA 4D9MA 3N8NA 4MW2A 1N3BA 2AZMA 3PC8A 3WLKX 4YMTA 4C7OB 5HF6A 3LUGA 9LDTA 3UIEA 2OZLA 4JDPA 1HNZB 5F2EA 5CFPA 1U7TA 4PS1A 3QHQA 4PLCA 5DRYA 1YMVA 4F2WA 1EFCA 3M4XA 1JG6A 1K9SA 2H3HA 1KI7A 3C7KA 3G5LA 3R6WA 1O89A 1C30A 1P2SA 1RI5A 1U4NA 3BH6A 1H1DA 1XLTC 2WUWE 1BKDR 4RLQA 5JH7F 7REQA 3SXUA 1WR8A 5IJ0B 4IMRA 5EMLA 5JZSA 1JIVA 2HSZA 2LBPA 3KPJA 1KJZA 1KP3A 1Y80A 3BPSA 3HZHA 3WMFA 4TLLB 4XGIA 4E6PA 3C6YA 1NQXA 2PZFA 3I6YA 5EKXA 3WISA 3PX7A 3UPUA 3DLAA 2QN7A 2P3QA 3CH5A 4E4YA 5KYTA 2BEVA 1KI8A 1AA9A 3GPLA 2ORVA 3MTIA 5EJIA 2CZCA 1KEVA 1U7ZA 1E7QA 1Z25A 2DUNA 3GVPA 1YE5A 2C2KA 1UCFA 3BCHA 5ALOA 3ZBQA 3P9CA 1GGNA 2FMIA 5CXQA 2VCHA 2HTFA 1EAYA 3FVRA 3NH9A 1A2BA 1Z4MA 5H5JA 5E0OA 4MYUA 4EI2A 5C4IA 4OLJA 3G0GA 3T3HA 1OXKB 5AHXA 3HH8A 1H4SA 2RH8A 3JYLA 4NI5A 5IAGA 1YL5A 4CKEA 4UTRA 4QJIA 3A25A 4WACA 3O90A 2CEAA 4KR0A 4YRFA 5CVEA 5LQNA 3DFFA 1H2AS 1NPYA 2E5FA 4IICA 2PUVA 1EFDN 1TGVA 1UBKS 1DAHA 3GA7A 1M1NB 3C4JA 3WK8A 5HS4A 2VJYA 1R4ZA 3M5DA 1DWOA 3FWPA 4AN4A 2LGJA 2YYZA 3K5WA 2RGGA 2VYND 1LCIA 1NKTA 1XTIA 1CJMA 4PZPA 1KS9A 5JPCA 3MGBA 1J90A 3FOZA 2IQIA 4IMIB 2VDJA 2HQSA 3ZZ0A 1IBRA 2OR3A 1CF9A 2A86A 2I3ZA 3DBVO 2J45A 3K9HA 4KX5A 5KUTA 3DBOB 3W9SA 4EVQA 1Z4OA 4ZANA 1GQRA 1XZIA 3DCJA 1XCPA 1SKBA 3G2KA 3WKBA 4PPFA 2DYKA 2JK1A 3JQ8B 4OD0A 1BHJA 4M9RA 4OHPA 2GCGA 2ZUDA 4QXPA 2Q4OA 4EQZA 4D4HA 5KNCH 1N2HA 4X24A 5CYOA 4C07A 1DJOA 4OHRA 4EW6A 1NHWA 3D1JA 5KYXA 3ILYA 4G5XA 4AYTA 3LUDA 5ITZA 2YCLA 3H2JA 3VV3A 1QV6A 3WQRA 3LQKA 4NFLA 3OICA 3RFTA 2CLIB 1QR6A 3QKSA 2CKDA 1U3VA 3TECE 3TCNA 2M1ZA 3H2KA 5K1ZA 2A0FA 5ITWA 1E2JA 4NPCA 3PGA1 1E0DA 1MABB 1FQOA 3Q15C 2ZTUA 2UAGA 4CG2A 5B30A 1XQ1A 4DPKA 3TLGA 3STTA 2P9CA 3MWLA 3KB1A 2VJOA 3OOWA 3N2GB 4WZZA 1AHPA 3WQSB 1P2BA 1JE1A 4RXMA 3CPJB 1NZJA 2R7LA 4RNDB 4JP3A 3EGEA 4J16A 1VMIA 1T3TA 2Y66A 3ABRB 4OQDA 5BURA 1MH1A 2FFAA 4NBSA 4RQTA 1JEOA 3B8EA 2X4LA 3VMFA 2W6CX 3A70A 1R50A 2RGAA 2W6IA 3DC2A 1OIWA 3DKKA 2ICAA 3JQBA 4I4TA 4RYDA 2NXJA 1PYDA 2HLDA 2WF5A 3G2JA 4LJ9A 4AKTA 4DABA 2P3OA 2VRCD 4WBNA 1SCIA 4QEKA 5CFQA 4QDKA 3LY9A 3QLUC 1AUVA 1X77A 4IV8A 3KKKA 1MX3A 2C97A 2EBFX 2LW7A 3DBIA 5BV7A 4A8JB 3FYSA 2HIMA 2VZ9A 4Z9YA 4QTZA 1RKUA 4TMTA 3R20A 1K1EA 4EHBA 1S1CA 4LWZA 3CNOA 3R75A 4KREA 1GCUA 2D62A 2NZXA 3AESA 5FEMA 2H1RA 4IP0A 4BFXA 4BQPA 3KETA 1D2EA 1THMA 2PGLA 1C1HA 5ALJA 4ZZ1A 1QJ4A 5DN6A 3P0JA 1L8LA 2BEWB 1JI0A 2DCMA 3TQRA 2QRUA 4HYEA 4Z9AA 5JW6A 1T0PA 4E33A 1SCUB 4TS1A 1ISHA 1RPNA 4FQ7A 2V6JA 3E18A 1CTQA 3FHCB 4DIKA 4JAVC 1E1QD 2EGGA 2CDAA 2XNDA 2XVAA 1M83A 5F98A 3Q9SA 3F8TA 5AW2A 5EXDA 4ZYWA 4J03A 2PXCA 5GJBA 1P80A 1T5DX 3JWHA 1P0QA 4LHXA 3LNTA 4OGGA 4YCJA 4EBFA 4W1SA 4PRLA 4KO3S 2AFRA 1SC9A 5SZIA 1L4MA 1T2AA 4QXMA 1RLOA 3QY9A 5KDDA 2P3LA 3U9LA 1VL8A 3EISA 1D5CA 3SE0A 1U3CA 2NIPA 2MT9A 3MMPA 3NUQA 4HSGA 2YZGA 4YMHA 3PQ2A 6PFKA 2UKDA 2PGXA 2W2QA 3VSEA 5TQ2A 4F8EA 1DIGA 1NG9A 1BX3A 5KTKA 1MU0A 3FPSA 1A88A 1KI2A 1XEWX 4FGSA 4BE4A 4JT9A 3V9AA 3CNBA 5BMOA 1W36D 1FF9A 3AF6A 2EFHB 4HNUA 4YCMA 3SYLA 3PEFA 1TEXA 1TF2A 2VNIA 2Z2KA 5BR4A 3W2HA 4P9NA 2NO5A 3OEEA 5TS2A 4WFQA 1FU4A 1F4VA 2FPWA 1MXHA 1IVYA 5JSZB 5NLLA 1L4YA 2YJ4A 4W7HA 4XX0B 4B6RA 4BNIA 5AK5A 3D2CA 4Q66C 5AI5A 2GLTA 2WG2A 3MGCA 4UZEA 1T34A 3MJVA 5JAMA 4TT3A 1UBEA 2INGX 3G9ZA 3EHEA 3DEJA 4X41A 4RGBA 4AZVA 1E3TA 4GXQA 10MHA 5BMVF 2FPOA 3DEFA 1NVXQ 2OYSA 3C7DB 4GPTA 4WZBA 1Z6PA 3CVXA 1U28A 1RRCA 3A31A 2X2OA 3R7DA 3F5QA 1OYVA 2I22A 4QRDA 3AEQA 2CLHB 1HRDA 4B33A 1JZSA 4QYSA 5CYFA 1FUEA 2HIAA 4M9ZA 4RZIA 2EWMA 1IWPB 1SWVA 2P68A 2XVYA 4R3UC 2J3IA 2IPAB 4O1HA 4B2YA 1ENZA 2UZ1B 4II2A 2QMOA 3JYOA 1SCQA 2Z4RA 3L8GA 1AK1A 3U48A 1PT6A 2I6TA 1U2QA 4MIEA 4OI4A 1D04A 4R40A 1GPBA 1WV0A 3B2NA 2W6PA 4P4UA 1WKCA 4X6LA 2P35A 3O95A 4WL0A 1ZA2A 4JBGA 1ABBA 4FOTA 4N3CA 1X3LA 1XEWY 2FAXA 3HB7A 2COUA 1QDUA 2JEZA 4PC7A 2I7TA 4NTZA 5D2CA 3AETA 2VT6A 4MO9A 4CBVA 1U3UA 4N7MA 2VHXA 1QRSA 3EQ7A 3GRYA 4GI5A 3RC3A 3NIGB 4DRYA 1DKOA 4JLBA 2ZJ8A 4UE6A 5UKDA 4DAOA 13PKA 2WP0A 3C3KA 3KKMA 3U19A 4FLMA 1X1DA 1SQ5A 5AK6A 3SHTA 1FNCA 3OQPA 5D3ZA 2ZUBA 3O4VA 1U8CB 4YS6A 1E9DA 1RKVA 3ABOB 5FEUA 1GPWB 3AM4A 1KK0A 1PR0A 4B6EA 1PV1A 3GVCA 3E53A 4J0GA 4KMMA 4EATA 4R9NA 3D3WB 3WLNA 1RJEA 4X44A 5HILA 1UBCA 3SYTA 4EY5A 4YROA 1N25A 3VNRA 2O8EB 2GJ8A 1KMCA 4ZQEA 2QHXA 3SLKA 1LV7A 3OJXA 4S1TA 1QWOA 4PGHA 2PKQO 1C9KA 1FP4B 3HE3A 2WHPB 1JEDA 1XPUA 2GHQA 4Z53A 3ETEA 1WHTB 4UMFA 4RLHA 2XV1A 1O94D 3A2LA 4Y2UA 5AK0A 2HK9A 1D03A 5TLSA 1YHZA 4Q34A 1MT0A 1KQ3A 2BIFA 3CIOA 3VKGA 1P4AA 1YQWA 1VJGA 5K3DA 1ODLA 3LO8A 4U02A 1ZL0A 4XA8A 1GD1O 1YJQA 2RONA 3HCCA 3L6RA 4OY3A 1HV8A 1KY2A 2V7XA 4MXDA 1PFYA 2I1QA 4P08A 2I66A 4F45A 4YRDA 4BNJA 3UY4A 1JLLB 4H6VA 3SVZA 2VXBA 2MR5A 1COWD 1CC1S 1E9RA 1UK7A 3QXXA 1ND6A 5G4KB 2WFLA 4G65A 2VHQA 3S6JA 2AE2A 2WVGA 4JJFA 2O7SA 4C88A 1LW7A 2F7SA 1D09A 3LFTA 3KK0A 4WFIA 5FNZA 5J2TB 1YJAA 3AVWA 5HOEA 4RZ2A 4UUOA 1J21A 3ONWA 4EGSA 3IP8A 1D1QA 1X42A 4OBXA 3W5VA 1JEQB 1L4LA 3FPEA 2C9DA 4ZO9A 3TWOA 2PIDA 4BXOA 4LY9A 1Y42X 3B3QA 1W0KD 4C0SA 1UKVY 4JWKA 4AO6A 2AF4C 3ZZ1A 1G60A 2ZROA 2QZZA 4QUJA 1ZOPA 1CB7A 2CHEA 1URPA 4BVLA 2QE7A 1V5GA 1HQDA 4HRVA 1EQAA 4F8YA 2CMKA 2BTQB 2Q2OA 4V0RA 2QNBA 5LBUA 1Q83A 1K7XB 3PC4A 4F5DA 2Q4RA 3UOGA 1KEEB 1O0CA 5CT9A 1AOXA 2C8JA 3QMVA 2YXEA 1IY0A 1TLFA 4QU8A 2HMWA 1CS0A 1N4DA 1Y5RA 3UA3A 1OXTA 1WCXA 1LDBA 1UMCB 2C4NA 2FFJA 2HF7A 2O3TA 1H5QA 3BXZA 3O5AA 4PSDA 4MVJA 2F3RA 4WBXC 2YWXA 2ZVQX 1RW4A 3WK5A 1FFHA 1KK1A 2GA8A 2PRSA 3PQEA 5LQRA 1T2CA 3U31A 1H2WA 3QG5A 2J8ZA 1E3QA 5JXGA 2XZOA 3W5JA 2GF0A 3EMVA 5IDQA 4NQZA 3IV9A 2ECOA 5E6RB 1US8B 3WLPA 3EIFA 2F55A 1MKYA 4UBKA 5E3HA 3TLEA 4XSGA 3VR2A 4V0SA 1PTJA 2DKFA 4KQEA 2XQFA 3G6KA 2IH2A 4KV9A 4M98A 2HNAA 2DFDA 4B2LA 1LSOA 1K63A 3DDNA 5BPHA 1RHJA 1MJFA 4ENSA 2JIZA 5FPQA 4G5GA 3F7NA 4P33A 4Y9SA 2G9ZA 1VP3A 1YKFA 3B48A 4KLAA 2FRVA 2EZTA 1ZKMA 3L8EA 4HNHA 1X2EA 3MRSA 1I3CA 4DCCA 5D7BA 3P9XA 4M1ZA 1QFZA 1R0WA 3GRCA 5LJIA 1NPDA 2ONZA 3ASYA 3SR4A 2ALJA 3HEMA 1MNQA 4ID9A 1XL0A 1CUZA 2R1VB 1TZMA 3BAFA 4JEIA 5FR1A 1KU6A 4P1ZA 3OLCX 4JNCA 3C7TA 4MWSA 4CL8A 2CD9A 2RBKA 3FPHA 1KU0A 1SFRA 2IUTA 4EFMA 5AICA 1E7YA 1IE3A 5MF6A 3LX6A 4M88A 4IINA 1O95A 2AQ8A 1JKJA 4E5UA 4R6XA 3LRXA 1PQ4A 1CULC 3DXYA 3DSRA 3IVGA 5FQNA 2FRXA 3AY7A 4OIFA 1VBFA 4E88A 3QNUA 3ILHA 4UJ5A 1RHUA 2BI7A 4I50B 3P19A 4DYDA 4FCCA 4LXHA 5SZJA 5DSXA 1YZLA 3EGDB 2VNSA 3HFSA 2CJFA 4GX0A 4Q03A 5IT4A 1R10A 3BBLA 4OB6A 1MC1A 1TLTA 2XA1A 3W2TA 1ARZA 3D4OA 1XDDA 3LKDA 5EHZA 3LSYA 4ARUA 3AINA 1K5GA 1OPRA 4MITA 4MR9A 2B4TO 1W2GA 3KVNA 4PLGA 4X7PA 3X1ZA 1U0LA 2HA0A 3ILXA 3LC1O 1PZNA 1TCUA 2ZYIA 1V6SA 4MVJM 4EF6A 3C85A 2VP6A 3IIJA 1GPNA 1HFEL 5B6IA 4O2RA 1F14A 5F77A 1P5HA 3NEYA 1ECPA 1U04A 2F43B 2TMDA 5F3DA 5JBIA 3JQEA 1XTQA 4B3IA 1PHRA 4X60A 3QEMB 4TMFA 1VKNA 4CLOA 1BGVA 2XY4A 3KVOA 2AG8A 3DKPA 3OKCA 3WYDA 1W47A 2QTRA 4JU9A 4LYEA 2JGAA 3SBEA 1JJFA 3PV0A 4CI9A 3HBFA 1L4UA 1N77A 1V9CA 6NULA 3WLIA 4ZALA 4EQ6B 3PL1A 3BKWA 4JI0B 4NSNA 5LJLA 1YOVB 4K9MA 1ZMOA 1T5HX 1FFGA 2ACKA 5IP5A 2ZG6A 1ID8A 4OHXA 1TAHA 4L5JA 3PSAA 3WYGA 1N9GB 4I66A 1JJBA 4K6GA 2FFRA 1EB9A 1GKIA 2W00A 1Z82A 3K0AB 4OQXA 3RS9A 4I55B 4P4NA 5CYPA 2OBMA 1SVIA 1ZXBA 2F6RA 1OWOA 1TW3A 2C82A 2HSJA 3IVXA 1KMMA 1P73A 2EBWA 2QORA 1QZUA 3O38A 4IQFA 4BASA 2ZT8A 3PICA 4JCOA 1WEHA 5BYJA 3WLMA 1RPZA 2MINB 3EPHA 4LRQA 1V1RB 4LRUA 2O8VA 2FX3A 2JBWA 1TJNA 1Z6AA 2AH5A 1W4LA 2NQ8A 3QPCA 4HNAA 4R9UC 2DUWA 5HQ3A 1U81A 4RIHA 4FYHA 9GPBA 3R23A 3V80A 5JH7A 2AYXA 3UKDA 2IKSA 3D5EA 1DIOB 3RVKA 1IMOA 1O87A 1TJPB 4P7JA 1SHTX 5E9WA 5JNWA 2Z5GA 3DL0A 2QTVA 1G16A 2BP7A 3AGPA 3IIKA 4DC0A 4F5EA 2FSGA 3W5BA 3PF8A 4BP9A 2JJ8A 2A4MA 3K1ZA 4BWFB 2AOUB 2H2IA 3VC3A 1Y98A 1W0CA 4HZUB 1TQ6A 1KNQA 1VLHA 2RMKA 1Y7PA 2G6BA 4IDNA 1XKQA 4LV6A 1CDEA 3FUCA 3W8FA 1E94E 1OYWA 3FIJA 3SOZA 1EWKA 4CKBA 4ZI7B 3DFIA 5J2UA 3WLOA 1WLYA 3VNAA 1NZDA 3I2GA 5KVAA 2PGNA 4H77A 4NZYA 1KOLA 4BN0A 1CQJA 3FTNA 4PS0A 1RVV1 3VHXA 4D8UA 1JDPA 4OI0A 1OPXA 1F9EA 1QV7A 4XWOA 2YJTD 4RUKA 4RACA 4EUHA 1DBSA 1NBWB 1VKJA 2EJTA 2WF8A 4KLRA 5EA2A 4LDZA 2QVYX 2D00A 1TA4A 3H9CA 3AVOA 4G63A 2BBOA 2Y6VA 4Q82A 4UNNA 1E9FA 2DG2A 2GEBA 3QPVA 4AYXA 5JAOA 2JVJA 1Y8AA 1SBYA 3KBBA 4IGIA 2ZVDA 1X1EA 2YYAA 4RFSA 1V45E 3SHWA 1X92A 4ZREA 1ABEA 1TAUA 5HIMA 1AUXA 1MMFB 3BL5A 5K0SA 1WCIB 2ZBQA 2B82A 2W11A 1D0SA 2HM7A 4PZZA 1T4BA 4P54A 3ULKA 4AJ9A 5AUQA 1PQYA 3MWDA 3RSCA 1XGKA 2PR2A 3IH5A 4TUYF 4WCFC 1T8PA 3DW3X 1L6RA 2UYGA 1XF9A 2KLBA 1K89A 3P4XA 1QIJA 2Y0CA 1E1NA 2QIOA 1X1QA 4HYQA 5JY1A 1QK4A 5DOZA 3P97A 3TPCA 5H8WA 2K2QB 2IXFA 1TKBA 3LM8A 1VL1A 3T06B 1GG9A 2IA5A 2JRLA 2X22A 3H9QA 4TROA 2J32A 4YHBA 1H5UA 4LSGA 3X2SA 1E2HA 2B1QA 2O0KA 3GLHE 3BK7A 3B1VA 1Q92A 4ME6A 5H82A 4YLGA 4CUJA 5LDGA 2I87A 4X7BA 5FJJA 5DYYA 2QRKA 1V8BA 3BFXA 3UMSA 3AHFA 3PD7A 5ALQA 1JG3A 1J23A 1XF1A 2AE1A 4NABA 5HQJA 2PX3A 1U7WA 1QFXA 2WU4A 4M9CA 5K3BA 3HG7A 1W4AA 2OKGA 3WRYC 2C58A 4GKAA 4QT4A 5I7EA 4IGFA 4JYPA 4UMVA 4F3NA 3AIIA 4UDNA 1SUAA 1KZGB 4KR6A 2P9BA 1CY2A 1A3CA 1NMYA 4QTTB 4DQVA 1IOLA 4QPCA 2PBRA 2I0FA 2W6OA 2XW6A 2YXDA 3IX7A 4GKVA 3QFSA 3WGLA 1JHYA 2NU9B 5FPHA 1X7GA 4YQYA 4CG0A 5F1OA 5IMBA 2YXBA 3KXLA 3ZWAA 4KPYA 1R3DA 4QUGA 1OCEA 3A11A 3VSDA 1WZCA 1Y3AA 2J87A 1P31A 2JAXA 2Q27A 2YASA 3GI1A 1GNVA 4FUQA 3BQNB 1CVIA 1DINA 5TQ0A 4X94A 3TW0A 1LV8A 2IIBA 2ISCA 2ZM6B 2R8OA 1OFHA 1KARA 4PQFA 4BFLA 4L76A 1V8DA 1BDHA 2GYVA 1NW8A 1YZTA 1NNI1 2H0RA 3UWKA 2NUAB 1FNDA 2WJ3A 3E8SA 5TRTA 1KE2A 3HJGA 3TLKA 5I9NA 4HV4A 1ZD5A 1MQ8B 1OJLA 4EPRA 5FPKA 3BGVA 1YS7A 2RHCA 1FW8A 4WCDA 3WLTA 1ODFA 5DTMA 4X8HA 3BF8A 3TVYA 1T1SA 2IY9A 4A7PA 4B35A 2IS1A 3CT6A 3OTGA 3L0BA 4UCQA 4X92A 2AZDA 3WLLA 3O7MA 5K7SA 1B6TA 3EXEA 3OCYA 3SVTA 1VPTA 1DWQA 3E4DA 3HGTA 1JRLA 4RDCA 2EERA 1FA9A 4GS5A 4P2GA 1G291 4ATNA 3DTNA 3KTAA 1C0IA 2GZAA 3H5OA 1OFGA 1TCCA 3ND5A 3T7EA 2G40A 3CW8X 2QM0A 1KO1A 2I1WA 3W3AD 1WUHS 1EGAA 4IOJA 1UPUA 4MOWA 3MBKA 5K03A 1ZHOA 2Z3VA 3AVQA 4FFBA 3SEQA 2FWNA 4P3PA 3V4PB 1L4KA 2MU1A 1RKQA 3DD1A 2WZBA 3NONA 3NVMB 2HO4A 5EMNA 3QE3A 1D0VA 3U60B 1W0JD 1WPQA 4KJZA 1PNOA 1VLLA 3RVQA 1QDLB 1ZW6A 3FPGA 5FPPA 2QSUA 4LYDA 2AC4A 1R6BX 2WJHA 3C3JA 4D9HA 3EBLA 5LQUA 1XU7A 5FYDA 4DADA 5AVVA 4L5IA 1BOOA 1NJ2A 2P78A 1JEAA 3B85A 3HY4A 3Q0EA 3B1JA 2BMJA 1JILA 3K8YA 4O2AA 5H81A 2ZI6A 3X2EA 1E2BA 1UC5B 2GRUA 1BN6A 2I7DA 2ZYGA 5EIHA 2EIXA 3R0ZA 1BCSA 2Y71A 3O9MA 2YNMD 4BQIA 4W1PA 1P9NA 2AS0A 4W9RA 1LSSA 3E7PA 5KSOA 3IIMA 5AM0A 1I32A 2C9MA 2PR7A 3BXFA 1H85A 1PYOA 2NTNA 3S7TA 3AJEA 3MILA 2NZ2A 3Q87B 2ZQYA 5ALYA 5LMZA 1G19A 1FQWA 1TL7C 3BMQA 3GEDA 2HQ1A 4AROA 1E9SA 3TD6A 3E8MA 3FDFA 2ZR7A 8GPBA 2O8BA 4KDFA 1JJAA 4YXFA 1UBMS 4X3CA 4B3SB 3TYXA 4UNPA 1QAOA 2WR8A 2PZJA 3RYFB 5LDDC 2BFWA 3LI2A 2JZOA 2WUGA 4BWYA 3R5JA 3GEIA 4LCEA 1YZNA 3IQGX 1EX6A 3IO5A 3AL2A 5DPMA 4L8VA 4CETA 3EW7A 1C1XA 2H2WA 5HZKA 3UMBA 1XVVA 3HR8A 3VX4A 2EGUA 221PA 1LPNA 2FSPA 4B4UA 1PJRA 4KWEA 3F5MA 3RUDA 3F4BA 3EEYA 4ESVA 1W9MA 4JEMA 1KR5A 1N2OA 2NT3A 2QW8A 1PJLA 3QWIA 4RZHA 5KKNB 1T0UA 1D2GA 3C97A 1TAGA 4QL3A 3C8MA 4XCVA 5JRDS 3UW1A 5MN4A 1KJIA 2WJVA 1XUOA 3ZHYA 4JVSB 4OMFG 5IXSA 1OILA 2FP3A 1B42A 1WUJS 4AUEA 4E2ZA 4ETNA 4D9IA 2GEVA 1PGJA 1QTIA 4MJXA 1SOWA 4PINA 5JQGB 1VJ5A 1A8IA 3ICCA 3I04A 4IUDS 1RJ9B 1V1MB 1PWXA 1ZJ5A 3L9XA 3WYAA 3JAKB 4YRMA 4C4RA 1W46A 2Y99A 1MOZA 2EEPA 2G9RA 5CB6A 1TRKA 4GKBA 1XA4A 1RQPA 2R2GA 2YRFA 3BK1A 1N5JA 1EFVA 4XCXA 3D2BA 4G4GA 2XMCA 3FOEC 3LLSA 3SC2A 1C9NA 4GR4A 3GCWA 4B71A 1HZJA 5LPNA 1Z0UA 3ZWKA 1QIMA 2AW5A 3KXKA 4C0AC 1YGYA 2XLBA 1GJRA 5JJLA 4DWWA 4ZRMA 3FDIA 1XEXA 4WKCA 2WB2A 2QV7A 2W2KB 1OC4A 2BZSA 2R7KA 4R2KA 3LCCA 3RANA 3IB6A 4ZEOA 1B8NA 1NDHA 3EMBA 5KNDD 2DWPA 3FPCA 2ZWMA 5DXJA 1GCOA 1X19A 4RVHA 5GM1A 1U7UA 3HKEB 2X9GA 4FOOA 3TLZA 5BVGA 1P4RA 4S1NA 3VU0A 5KJEA 4XVUA 3UCEA 3TJRA 4Z3OA 3KVYA 2H1VA 3PWSA 3O1IC 4ZCSA 4KK4A 4GHWA 1HE3A 4WASA 5HKAA 1H2ZA 1KTVA 2QAIA 3NCHA 4L6CA 3UWDA 2D4HA 3PIRA 2ZRJA 1JEYA 2I91A 2H4FA 1X7WA 2PQ6A 2CXRA 3QMPA 4LHEA 3GZNA 4AURA 4TV8A 4UNIA 4INPA 3VC1A 5BSKA 1NQ5A 3ZIUA 5F7OA 2JGEA 1Z33A 4C3UA 4ZHQB 2GKGA 2C2OA 4LJ6A 3SX2A 1GUBA 4CF7A 3OBIA 1WPRA 1X7DA 1F60A 4RKWA 5KHAA 5JXWA 3JAMA 1J7JA 3AIMA 1MENA 2OLKA 1T4DA 1P44A 4GR5A 3N0RA 4TYWA 3U0VA 1X74A 5JAHA 1ULSA 4EG4A 5DNCA 5CG1A 2V8BA 2BFAA 1R12A 2VHVA 1E3MA 4BQRA 4HRAA 1MQ9A 2E1RA 4JP8A 1X70A 4DKXA 1RLMA 3ACBA 3MCVA 2QQFA 4ETIA 4F11A 1GKYA 2ZQ5A 3GOQA 4LZNA 5D00A 3GEBA 2GBIA 3TZ6A 3IUYA 3WWEA 1WA5A 5ECWA 3SZOA 2CVZA 1XRSB 3R7SA 4Q3LA 2BYTA 2UV8A 3IVMA 4IIGA 1RWQA 3I04M 4R9SA 1VRWA 3DL2A 4DIUA 5C52B 4ZRDA 3GJQA 1M2HA 5JYEA 2OM6A 3MOGA 1LTHR 1RRGA 1WQ4A 2JANA 4KQ1A 5B1SA 3GH1A 4RK0A 2XOKD 1H2HA 2C88A 4OQNA 4ZT5A 3VH3A 4MV6A 4K0RA 3HWSA 3A4VA 1E77A 1JSCA 3LUAA 3CBGA 3NH6A 4ALLA 5BW4A 1FOEB 3ZE2B 3IV6A 3H04A 4MMXB 2ZUEA 4BCCA 4JLOA 4K7JA 2O0LA 3MC1A 3CB2A 1ZMXA 3SBDA 2ZIWB 1M3SA 4Q93A 3BJMA 1S9DA 2C96A 4S0XA 1HXHA 2DRIA 2XEDA 3AHEA 4Z3DA 4X8LA 4R81A 121PA 2OXIA 1GZ6A 5CVCA 4FU0A 5IFLA 3TMKA 3PEUA 4X61A 3U26A 4QAQA 2D1YA 3W1EA 4F2PA 2X5NA 1NUSA 1XKTA 2ZTHA 3KG2A 1KEKA 2Q9BA 3KIPA 2NMVA 1K68A 2OLJA 3MAGA 4EHIA 1XA0A 5KVSA 1IEWA 2KM1A 1TUGA 3D2LA 1JWBB 2RJNA 3BMOB 2DT5A 4GEGA 4GO1A 1Y1RA 3CLSC 1OY1A 1HI9A 2X42A 1UFOA 4LBZA 1RI1A 3U3ZA 2GNOA 5JATA 3CW2A 1PG0A 5LC1A 2BBTA 5BXYA 5CURA 1UMDB 4ABYA 3N0VA 3OE4A 2IXDA 1I1OA 3JZDA 3TNLA 5JZMA 1GM5A 2FPSA 2WT9A 1RC8A 5ECDA 1VRVA 1PEYA 2JEOA 3MD9A 4OYRA 3ROEA 1TOAA 3NRCA 1WVIA 4MRSA 4GGMX 4YRKA 4FN5A 5KC9A 4YV1A 1JU4A 1OA0A 1IN6A 5I01A 1RU3A 2C4UA 2X13A 3G3EA 2GEFA 2BGNA 3GPIA 3RU2A 4QTYA 1B14A 1LKZA 1BXKA 2PMFA 3NDBB 3VYRB 1KA9H 2C9CA 2WWGA 4JLPA 5I8WA 4FX5A 2Y1XA 3DZBA 3IMKA 2P7IA 1GSIA 1F17A 1H2BA 1JQEA 1Z08A 2CXTA 1WP9A 3FH0A 3KUXA 4GMDA 3MMZA 3NGLA 2NN3C 2RGNC 5AVOA 3H19A 3F4KA 4TLEA 3UAGA 4MPJA 4UPDA 5C1PA 1TU4A 2C4VA 3I5XA 1S9HA 1M2VA 4MTCA 3DFKA 2HZ7A 5HE8A 2HBZA 4BL5A 5U9CA 3WHLA 2Y1EA 2JFPA 1R16A 2IV7A 1TYAE 5AJWA 1PUXA 1ZNZA 3K20A 4A0GA 4DSTA 4KO4S 1QOQB 1SUPA 5DNAA 5IHXA 1HT1E 4EABA 3KQHA 4BKOA 3CO0S 4JGIA 3LPCA 4N3NA 4OFWA 1C9JA 2ZI9A 4I6GA 1ISRA 4AJLA 1OZ0A 3BA1A 4X1KB 1QZ3A 4U6NA 3DT8A 1T8YA 3ZWNA 1RI4A 4FT2A 2VP0A 4DL9A 2B8WA 1JNYA 2PUWA 4DMMA 2P2YA 4BFVA 2ATIA 4LFCB 4B1FA 5K3EA 4FJ0A 2AN3A 3U37A 2NV0A 3KV1A 4DXDA 3C3EA 4UULA 2FUKA 1GQQA 1JHAA 1MFPA 1XMXA 2BHNA 2B4YA 3NYIA 4GFDA 4KLZA 4PRZA 5EP4A 4ZCRA 3EF0A 1DVRA 3AR7A 2VXOA 3BEOA 4MJLA 4US1R 4RD2A 3P52A 5LOVF 1Y4ZA 2G5CA 3B9QA 2DLNA 1DAFA 4O4IA 3QPDA 5BWCA 2IUFA 2WNSA 4UXJA 3O1LA 5BUZA 3PCXA 3UTCA 3EVAA 3PRYA 1QLWA 3GHHA 3IEIA 3IOEA 4A3SA 2HA7A 1D2NA 1O58A 4DM4A 3OIDA 3S1AB 2VKQA 3GW8A 4Y67A 1DBVO 2OG2A 4NYJR 1KSHA 2NLOA 5IBCA 3DGFC 5DNVA 5EJ2A 1XPRA 1IZYA 1Z47A 1XP8A 3VUEA 1Z8DA 5K2OA 4X8MA 4FQ5A 3MBOA 1GQSA 1V0JA 1XZAA 4JN6B 1OLSB 2IU6A 4BX0A 2W90A 1YO6A 2OM2A 3IPRA 4Q9AA 5EERA 1Q5PA 1WOYA 3HWWA 2AV6A 4WBSA 2ZI3A 4ALKA 3QE9Y 3I64A 1H3FA 2AKYA 4KX3A 4V3CA 1MX9A 3FE2A 3I9V1 4IRMA 2X1MA 3H97A 3L4BC 5FD8A 3ZDCA 1WULS 4PIMA 1L7XA 4Y0VA 1KZHA 4Q7MB 2B8NA 1K8ZB 2FXVA 1QBGA 4PCLA 2W2TA 1NU6A 3HO6A 4LDJA 3IP6A 2XUDA 3HBLA 1M76A 1NXPA 1WDTA 1NXQA 3QVVA 2H4XA 4X71A 3O4GA 1D2RA 2HF8A 3DW1X 4BTLA 3KSBC 4Q16A 4OQPA 2RDMA 3DAFA 3SNHA 1G63A 1PT9A 1Y5IA 3H84A 4YP5A 2WNHA 1XMVA 2X8LA 3WIUA 1QIDA 2P9TA 5BRAA 1C2YA 4F4UA 2BGGA 3MNFA 1P91A 16PKA 1K8YB 3B12A 4AWXA 1E1YA 3GLRA 2QPTA 4FMCF 4GICA 4MCIA 4MLCA 4C14A 4CTNA 3EX7C 2O8EA 5MFZA 4LY6A 4PW0A 2I4IA 3GT3A 3X1YA 4QBHA 5L51A 4CEJB 3LHDA 3KB6A 4F1KA 3GIWA 1D1SA 1SXJA 4ABTA 2CL0X 2NZYA 5SYNA 3A6JA 3ETGA 2Q9AA 2NPFA 1FFBA 1JFLA 4RANA 1EUZA 5AMXA 1KHHA 2YVQA 4TZKA 4F71A 1SZCA 4NAVA 5C1DA 2HU7A 4G56A 4W5NA 4HC4A 4N7BA 5B1IA 3DXZA 2HX1A 1V3UA 3IMGA 4MW4A 3KR2A 4DPMA 2H0QA 1YMUA 2PANA 2Z5LA 3GD5A 2XT6A 3F49S 2YFYA 3K9BA 3CRW1 3MD0A 4MIYA 2JAWA 2Q2NA 5B58T 2EYUA 2VJKA 4NCHA 1V71A 3DTTA 3RHFA 1PBTA 1GAQA 3DB1A 5BQXA 3BS4A 1JHVA 3RAEC 1O2DA 4FLEA 3D43A 4BO1A 621PA 3TZHA 1K88A 3ZHUA 1I7QB 2VUHB 3LH5A 2VTDA 1MRNA 1Q11A 2G6TA 1Q6ZA 4E3ZA 3RBXA 1OF1A 5DTIA 3SQXA 2X40A 1P2VA 3DR5A 1IK6A 1DJNA 3IGFA 1PZEA 1DRVA 1X80B 3NBZC 4GSLA 1MAUA 4MLPA 4WIAA 1FYXA 4KQMA 5B1YA 5JEDA 1IYZA 1FFXB 5DGXA 4HAZA 4FGKA 1WD5A 3KLPX 2ZYHA 4QULA 3O9ZA 3A6GA 5B12A 2VK2A 2YHUA 5JLAA 3X2FA 3BRQA 4R0MA 5KWIA 1L7PA 2JA2A 2GD1O 4M46A 3P2IA 3ZDFA 1E20A 1SUIA 2YKGA 3RJ9A 5CB4B 3ZVMA 3KOYA 4DA4A 5DHRA 3A3KA 4UBLA 2B4QA 1LBTA 1TU3A 1YAJA 4BE9A 2F1HA 2QSYA 4PIVA 3C7AA 1CUYA 3KC2A 4M83A 4UD6A 2VQ3A 3PFBA 1ATZA 1EVJA 1XVIA 2D54A 2YZNA 3FHJA 2JLXA 1O0BA 3HJTA 5H4HA 2V5AA 4QOJA 1QZXA 4I5FA 1FNSA 4GECA 3FY4A 5FA6A 2VUTA 5HKLA 2X3YA 4MYHA 1YZFA 1TVCA 2K4MA 3VV2A 4CG1A 1ISJA 2WD7A 2FHPA 3RC7A 5CVTA 3E35A 4YJ2F 5D87A 4RA6B 3UXEA 3TQHA 4D79A 3IV7A 3K3PA 1IY2A 5DISB 5EE9A 2I2DA 4DIFA 2VRBA 2VQSA 3IXQA 4GSKA 2MDTA 4YR7A 2EATA 1FUUA 4FSDA 2YFQA 2VZ8A 5HZMA 2DH6A 3DZJA 4KFRA 4HSEA 4IDAA 3VNUA 4UARA 3RADC 1B6GA 2JFOA 3K1YA 3BZBA 3PX2A 4PZ9A 5LBIA 4PPNA 3VPBA 4BQQA 1Q44A 5A3QA 1UDBA 2HA2A 2C59A 2R1TB 3A6LA 3KWMA 4XWGA 5F5NA 1WF3A 1AE1A 4M7OA 3W6UA 2QROA 2ZEJA 2GUWA 1NJ1A 2OB2A 5FUWA 4ZCIA 4AX8A 1E6WA 1SKMA 2ZTSA 3AHGA 3QELB 1DZIA 5COBA 3RUIA 4FSXA 4A1FA 4BFWA 2IXGA 4GC5A 4BZWA 2IXTA 2CY0A 2GPJA 4NONA 1PL7A 1QONA 1TJ3A 5CLIA 3CUVA 5IDYA 1QYRA 2H29A 1NP6A 5K0EA 1U90A 3K6SB 4DV1B 1JKIA 3DEHA 1R1DA 1DG1G 3ASUA 2JHGA 4FYWA 1P61B 1GP2A 1UOEA 2XWJI 2YV2A 3U81A 1X6VA 3AUFA 4HNRA 4LBVA 2ZTMA 1ZA1A 3HP7A 5LUBA 5GAJA 3DV9A 3QEOA 4YRRA 5C35A 1Q1GA 2QX8A 4MS4B 2O48X 3EF3A 1U5CA 2HWKA 3L4SO 4FHGA 4YIKA 4ZEWA 3S3TA 5C8YA 3T1HB 4GLFA 4GWLA 3WMEA 5L3VA 4J4HA 4TZTA 2AQHA 2IXEA 2QBYB 1FUYB 1JDTA 4AJOA 4EUSA 2ODQA 2PTHA 1EM6A 4MWOA 1EESA 3E1SA 2BFPA 2ECFA 5ICEA 5J4LA 3KEGA 4J94A 1B7GO 5E1MA 1D6SA 1SA0A 3PF9A 4PWYA 1L5GB 2YIDA 2DQSA 1DBQA 4FFDA 4IEIA 4M1QA 2L0XA 4WK2B 3T5AA 1PAUA 3OZAA 3ZWBA 4MEJA 4NHOA 1NN1A 2CXXA 1LLFA 3ETLA 5EIAA 1KDYA 1USIA 1U0GA 4WDQA 1W59A 3N0TA 3G79A 4PFQA 5FNVA 5HG0A 2FPLA 2WAAA 2ZYWX 4JT4A 3GELA 2IUYA 1FVOA 4RY9A 5FBZA 4FZVA 4U5XA 1K75A 2VVTA 1BIFA 1XTBA 4UFPA 5DLYA 4R9VA 3LPDA 1JH9A 3VR6D 4DQ0A 2ZYAA 2HTEA 1DKQA 3AERB 4YAEA 1DTSA 1GQYA 4MUYA 1SUSA 1UOOA 3CVUA 2R4UA 4NCKA 1XAGA 4K1XA 2OGSA 5CLQA 2R6HA 2AJDA 3R7BA 2NTVA 3SAJA 1OI3A 4RA9B 4KQFA 4UCFA 1GDHA 3EXFA 1X7ZB 3ZXYA 2YZ2A 3MHPA 3N70A 4EMBA 3R76A 3AVPA 1VIMA 3NC1C 4ZO7A 5FJIA 2Q7DA 4DILA 4EW1A 2X19A 5HHTA 2WJ4A 3O1HB 2WV9A 4PYRA 4KQXA 2P5YA 3D7LA 2EW1A 2JIPA 5AVYA 2A8YA 3NPAA 4PO1A 3SX0A 3QLEA 1I9GA 4LXXA 1IN8A 3ZJVA 3TPFA 1I2MA 3PXCX 4C78A 2AX4A 1YQEA 2CDCA 1AV7A 2R00A 3WS7A 5CDUA 5DWVA 1VBKA 4RVGA 2EFYA 2PLRA 3FYUA 2C5LA 3AB3A 5BN4A 2WKQA 4HAOA 3L3BA 2GCOB 4D9CA 2PT7A 4EX6A 1P4GA 1HNNA 2XYRA 4QFDA 5HIJA 1RCTE 3RUCA 4LHVA 1DMSA 3G2HA 5GWXA 3SXPA 1T0JB 2FR8A 2P77A 3KJQA 5K3AA 3KKQA 2A9KA 2JAQA 2IYPA 3AP3A 4AY3A 3JQQA 1EIWA 4OYLA 1HC7A 1V35A 2B0JA 2FEOA 2XIJA 2FW7A 2QF7A 4IGKA 2W2MA 4OU4A 5GPBA 4Q15A 2W0MA 1Y5LA 2RKOA 3PXEA 3V7FA 1MA0A 2Y9MB 3PNYA 3KZVA 4Q37A 3BE6A 4CEIA 1LU9A 1P6XA 3FF1A 3GP3A 3IELA 3JS5A 4XPIA 3QKWA 4DIMA 2N75A 5I4CA 1JIIA 3V8NA 1QHNA 2J6BA 5EEGA 2NSHA 1XALA 5KOJA 2ZVPX 3U3KA 4CM8B 1IAVA 1VE9A 5JD4A 2VJLA 1VTKA 2DPGA 3SQLA 1NRWA 4HFRA 4KFTA 3BQ9A 1B8VA 3WOVA 3WGYA 2ZVJA 2H63A 3KLOA 5ALNA 5TPWA 2LVBA 2L82A 1DQZA 3ZHQA 5KWEA 3R5XA 3WGKA 4LZPA 2B4KA 3T12A 5FXMA 1A9XA 1QHEA 4OO3A 2A5FA 4UVIA 3KEMA 5AJUA 2WWWA 2O7RA 3N7TA 3RC9A 1Z06A 3GIDA 2BM0A 4PAOA 1W75A 4E32A 2WIAA 5DNWA 4CTMA 4J0JA 4QNMA 1NYLA 3WKAA 4AK9A 5DHFA 3GGJA 3TMYA 3MCTA 2HL6A 4MGEA 4DOMA 3BSWA 2DP4E 4DA9A 2IYQA 1CRQA 1OYYA 4HDMA 5I8ZA 1DZ3A 1Z63A 5BOSA 3SD7A 4XARA 4FCTA 4GBGA 1G8MA 3VGPA 2GD2A 2I2CA 1PG5A 2WE8A 3IURA 4GDFA 1A76A 1G8GA 2CGEA 3E9EA 3RSGA 1Z4LA 2W22A 3S0JA 4BLRA 4EPWA 4MP6A 1XNQB 3NAQA 4F3KA 2R8RA 3L40A 4XE5A 4NICA 4AS2A 4C1BA 3GQBA 1YCFA 2GJ9A 3FRHA 3JALB 3KHKA 4WXYB 3SJUA 4E5VA 1RXVA 2QVXX 5CTJA 4FDTA 1V5WA 3DL4A 2K7ZA 4JA0A 3WHIA 3PNVA 1JXAA 3F46A 3FR8A 3AJRA 4X90A 4L2IB 3QOWA 4UHBA 4EYEA 2COKA 2PFKA 2W5UA 4M8SA 4RU1A 1GL3A 4O6VA 4MCHA 5BSFA 4LFAB 3ZGVA 1X0XA 1RCUA 1YWGO 3SLRA 4KR7A 2GTHA 1OAOC 2FR1A 1SVKA 1QGED 1ACMA 3DUFB 3P2OA 3TKAA 5BVHA 2B6HA 4PR3A 3RBZA 1GT91 2B7LA 4PIPA 4KOEC 3T1VA 2JGNA 4EY8A 4MUJA 1IEQA 3LTNC 3ZHTA 2WUDA 4JXXA 2IF0A 2LKDA 3E9QA 3U39A 5EPOA 1GZSA 1Z5PA 1TZCA 4NP6A 2FN7A 4XIJA 1JX6A 2B1RA 3IDZA 2E5LB 1W85A 2VPPA 4DQKA 3DM5A 3FOBA 1IVNA 1HE5A 2I2WA 3FN4A 2YRWA 4QAJA 4NFYA 3T9BA 2LDBA 2B5WA 5LA6B 2DZDA 4MPTA 5CB8A 2I2AA 2P1ZA 3P26A 1R15A 1DKMA 1XDGA 3K9CA 1BN7A 1M2JA 2A1TR 3KYJB 4HUJA 4XD7D 1OLUA 2GESA 1EE2A 3LCUA 3STHA 2NVBA 4KB5A 4YCLA 3E1KA 5AKHA 5EJ6A 1ST2A 4U6SA 2WLSA 2VEOA 4K9DA 4RFVA 5FTLA 2O07A 4P7BA 2XTMA 5AYVA 4CM6A 4IHJA 3ZW9A 2VPIA 3MS2A 2WPDA 3QKRB 2DSTA 2UZ4A 3G8YA 4AJPA 1U7HA 3QA3E 2CLDX 1Y8RA 3ZQ4A 4M21A 3FPJA 4RHEA 4INJA 4US2R 1HNWB 1NY6A 4CN8A 4PC1A 3V1NA 5IXYA 1HETA 1Q0PA 5HK9A 1KYVA 2C1XA 2XMBA 4GP9A 4HDSB 4LJ7A 2RGBA 2NVUA 2A94A 1R6XA 1SRRA 2QVGA 3OF3A 4QU0A 4LOJA 4JBLA 5E4TA 4FGJA 5EUQB 5JZOA 1QUFA 1QO0A 3ZV6A 4OAOA 1MGPA 4G0VA 5F2OA 1VM6A 1YVDA 2K6GA 3QLUA 2EBUA 4HMOA 3HP4A 3JQ7B 5DM60 3G2IA 5EIBD 3OQIB 1O77A 3H3JA 1U7OA 5J2TF 3L4EA 5TV2A 4BNZA 4KKXB 1Q1BA 1D8TA 1LPPA 3IERA 5PNTA 1CUUA 5DTQA 4FGUA 4JLVA 2RHGB 3EVDA 3SZUA 2XCRB 2JCGA 1VDZA 4XR4A 3EIWA 2EJCA 2GM9A 2O1WA 1FZQA 3HPRA 2PKRA 1P1CA 1X9HA 5JU6A 2R7AA 3M2PA 3L7CA 2QLFA 3M6LA 2EL9A 4LNHA 2BGTA 5IF3A 3QX3A 1KQPA 2O59A 5GJCA 1BU8A 2IYXA 3TUIC 2JDIA 1CEYA 2QZJA 2V55B 1ZW1A 1SOVA 4JFRA 1EUYA 1CDOA 1V3VA 4E5NA 1PJ8A 1OVMA 3QZUA 1P62B 1U0HC 3IKMB 1QS0B 5IM5A 3ISVA 2GBLC 1WHSA 1NZFA 2AXQA 1V7CA 3SEAA 1E3IA 1XAHA 4N40A 4EG5A 4FFVA 1DEOA 4L3OA 2XUGA 1FUKA 1RQ7A 2IGTA 3CVJA 4JD5A 4QFCA 3BGIA 2HBRA 1JHUA 4JQSA 3U7EB 5LOVA 1A2QA 4A03A 5L7TA 3ACCA 1KDTA 2HCFA 3AV0B 3NVKI 2XCQA 4UQPA 3IBFA 4EENA 5ED0A 4M1EA 7YASA 4OB8A 5EHIA 1ZH0A 4B3TB 1LVHA 4M89A 1M6VB 2D8AA 2WF9A 1VJTA 3KR9A 2CF5A 3OLVA 4FE3A 4JGGA 4E51A 4V1CI 1AKUA 2AD5A 1CRZA 2VBGA 4BV8A 1YVEI 1Q15A 3HKCA 3QMWA 2CT8A 5LXTF 8AT1A 5IXJA 3H8VA 1GITA 1V43A 1FVHA 3K8QA 3QEBZ 3HRIA 4A9AA 1KJNA 2YWEA 4GPD1 1I0ZA 2OXTA 1MP0A 1HUQA 2JLSA 2VNHA 3BGSA 3BL8A 3Q3JB 4D98A 3QBTA 1VHWA 2RK6A 1LS6A 3DVLA 3G2LA 5A5GA 6ADHA 3UKJA 1D4AA 3EGVA 3GUZA 4UUNA 4J3JA 1Y82A 3EG9B 5ALRA 4M0KA 1XXLA 3G0HA 1EWQA 5B2EA 2JFZA 5LZ4A 3K0EA 4JL5A 2YY7A 3ZU5A 1D2HA 5U4XA 5CA1B 4CODB 1PLJA 1ZNQO 2DVMA 4OOEA 3DHWC 1YZVA 3B20A 4DUGA 5B36A 3T54A 3UCFA 3M9WA 4DV7B 1IK4A 2OV6A 2F1IA 2IYOA 3WNDA 1T1GA 4YWHA 1NMEA 2SECE 5KVQA 4TKVA 2MYPA 1W93A 3FKJA 1KP9A 3RKRA 4MKGA 1OWPA 4CMJA 4L8FA 3SK0A 1E64A 3AZPA 1QQ7A 3TKYA 2H1WA 2AHOA 2CLMB 2J5BA 1CUFA 1N6IA 4JVOA 1RC1A 4YT2A 5F21A 2LRHA 4OX9Y 4GZ5A 3ORHA 1ZP6A 5JASA 1UUFA 2OYCA 4MW9A 3AR2A 4NCXA 3CQ9A 1JJVA 1G5QA 2CVOA 4UM9D 3UAXA 4EHKA 3HBMA 3ZU3A 2FPGB 5DM1A 4K9NA 2NSDA 5IF9A 3SU8A 4NJEB 5FO0A 2O8FB 1PFUA 3ENWA 2V1XA 3OT4A 3UB3A 2IP1A 5IN5A 2HA5A 3CMCO 1NBEA 2FGJA 4IV0A 1NHGA 1Z4PX 2NU8A 1GGHA 1IH8A 3DVAB 4PQEA 4MV0A 3CKYA 4RJLA 3L6UA 2CYBA 3GJYA 3VR5A 3N53A 3N8IA 4DBVO 1KJQA 1U6JA 3ZTWA 2ZB7A 3BILA 3PFIA 4URZR 5A06A 4DANA 4GOKA 2EZUA 2F17A 4OUDB 4HG2A 4JQYA 4MW1A 4Q1EA 4TTTS 2OPBA 3K31A 4QVKA 1PWEA 2JIDA 3B38A 3PQ8A 1E2QA 1IIBA 4TLDA 2BPOA 1CJVC 1KDOA 1DX4A 3PDIA 4G4SP 1L7NA 1OXXK 1ZXLA 4RK4A 5IYZA 1EFAA 1GRVA 1VI2A 2JI6A 3GX1A 3FDJA 1YRLA 2ATEA 2AMLA 1ZAKA 2BFBB 2Z09A 1FYFA 1YRHA 5KU7A 4UREA 5EQFA 4A5SA 2O2JA 3L02A 2AYZA 4HNGA 2XTNA 4I55F 3STWA 1KRXA 3VDRA 5M29A 4MHOA 4QBTA 1X3SA 3Q3EA 1QE3A 5CJJA 4U4AA 3JAWA 1M34B 2V3CC 3MTQA 1T9ZA 3ZE0B 4EYGA 5BR8B 4DQUA 2FPXA 3K92A 4PGAA 2E1PA 1EJ0A 2D0PB 4KYVA 4N6OA 3RLFA 3WP0A 4M1SA 5T5QA 1XRQA 3PCTA 2V7BA 1FY2A 4YNBA 4PLYA 3TSYA 3H13A 4JI8B 2QL7A 4JC4A 4CR6A 5FPYA 3U3DA 2C1ZA 1UXOA 1UC4B 1XHLA 1B8UA 1KY3A 1YULA 1Z5NA 3AHIA 3JARB 4DC1A 4EEXA 3G1UA 2LKCA 2PO7A 2C92A 1IL0A 4AX4A 4URYR 4WOKA 3HU1A 1P17A 4LOKA 6AT1A 2R62A 3OEHD 3HBNA 2CUTA 2PBFA 5L7WA 5ES3A 3CR7A 4ZEXA 2ZSEA 4HFMA 3O3CA 4B3CA 1UMBB 2XRZA 3L2OB 2WJYA 3M4ZA 3AO0B 1ZH8A 2XECA 5B2ZA 4D0RA 3CY6A 4HQNA 4W1RA 1JMKC 4RL4A 3ZWVA 4ZI7F 4HDNA 5K3FB 4BRSA 2AYYA 2NZ8A 2ENUA 3K32A 3MB8A 4NE7A 1N3YA 2GPAA 1XJ5A 4BFYA 1DBIA 4N8DA 1VG0B 4JODA 4LA4A 1EPUA 4GLLA 1PWZA 4WV3A 3TDMA 4N03A 1DBPA 2QRGA 1QK5A 5DASA 5FL7A 4B7CA 1PZHA 3ITDA 4BNFA 2KW5A 2WJAA 3V42A 3QOYA 4YV0A 1HH4A 4MA0A 2YZMA 4NV0A 1GTJ1 4B3JA 4JUFA 3P0IA 4D4GA 2ONCA 1JFVA 4X66B 3E2PA 3FWKA 1X0VA 2V58A 2I7CA 2V74B 3THOA 4MWZA 4BLQA 5JISA 1Y48E 4RJTA 2ORED 1T4CB 4JL6A 3O2JA 1ZK3A 3HZZA 4EAAA 1ODCA 2JG3A 5I48A 3PVSA 3CG0A 3LZCA 1FYVA 4LOLA 5CXXA 2JFXA 5A7HA 2JCVA 3F1KA 3FUWA 3IAHA 1P0FA 2Z04A 5L4LA 2XDWA 2ZTLA 4NU5A 4TQGA 1Z0IA 4B40A 3HSYA 1JKXA 1J7KA 5JFGA 1Q7TA 5IH3A 2Z1NA 1T8RA 4DDVA 3DZFA 1SCJA 4BLUA 5NULA 4TVSA 2HJGA 1QRDA 2NM0A 4JOQA 3SC6A 1UH5A 3N39C 4PF1A 9ABPA 2BHLA 1CR0A 2PKWA 5AW7A 3VR1A 4KC0A 2C95A 3AM1A 4P5DA 3FLEA 2Q6VA 2BTEA 1M8GA 4D3DA 1RAFA 2WB4A 2PA3A 1RWXA 3ENNA 5G4LA 4RD0A 1AN9A 3U61B 3SDSA 4PZCA 1P77A 2G67A 4F93B 2C9BA 3PFHA 3J81A 3C3AA 1T4MA 4HAIA 5ARCA 2QXYA 4L0DA 1GDDA 2ARKA 5I7HA 3ANNA 3DT9A 4CIXA 4DCMA 4GM4A 5CCBA 5JO9A 1UQUA 2P90A 4POOA 3RTEA 3C5HA 1G18A 1ONBA 4H4DA 2VLBA 4R16A 2BGIA 3OAAA 4YECA 2H2HA 3DTVB 1YBVA 3QUQA 4OLBA 1YZKA 4EHHA 2FRDA 3BQMB 3FCAA 3GCZA 4QM6A 1O97C 3OM8A 1F6DA 5CA0A 1EFUA 3Q98A 4UXIA 4IIFA 3PHBE 2FWAA 5AESA 1NBIA 3J7AC 4KXVA 4RKYA 3DZHA 2WICA 1I51A 2NO7A 3LC0A 3BD6A 4J75A 5GP1A 4D0GA 3UBMA 4FYKA 5DHPA 1ESNA 2BR4A 4WJKB 4Q9JA 1JPNA 3N1UA 2HFJA 4PYNA 1XYYA 3E1GA 1BCRA 1L4FA 2YVAA 3VPCA 3PUIA 2QL5A 4BN5A 2GDZA 4CTKA 1F3LA 4V1CB 4K26A 4UOZA 2HXYA 1GTVA 1USKA 4DMLA 3FPKA 3I6QA 3UK2A 3D6NB 3E5MA 1BWRA 2DFKB 1II8A 1A50B 2QGNA 2EW2A 3EBOA 2J9XB 1QAMA 2VQDA 1BVUA 1AKEA 1LLDA 2FFQA 4KO1S 2XUPA 4QYIA 5GZ3A 2I4RA 1VGRA 4M9UA 4CUKA 3DCYA 1JBEA 1GPJA 1LA2A 2P79A 2R5NA 5KS2A 3EVFA 4H27A 3L7BA 5F5XA 3UW3A 3OZDA 4DA8A 3L9WA 5I3ZA 4OQEA 2GEUA 1QYDA 2NUBA 2FPPA 1C0KA 1ODJA 3SZRA 4B79A 1VLQA 2JGDB 1ORRA 4MR8B 4LDNA 5MGBA 1ZMTA 5K0ZA 1HDEA 3KT8A 3KYDA 2J0VA 5LQKA 3O2SB 3LKBA 4QUIA 5EYPA 2R68A 5KZMB 4UVEA 1ZUD1 3T3OA 1R8YA 2DMRA 3LOPA 5C3UA 1IN4A 1LEHA 1FLDA 3PJRA 4FYVA 3ZDXB 1PZFA 1OZGA 3IPLA 1BO6A 2A0YA 1NE7A 1UXGA 2BEKA 1GPMA 2ZIVB 1M34E 1YC5A 3OF2A 4BVGA 1JLHA 5FWXB 1DC6A 1TFUA 3BTUA 1I33A 1I3MA 2CDRA 1KMHB 5IEBA 1MZPA 1C3VA 5JD3A 1T8TA 1TCAA 2WTNA 5H4GA 5L40A 1JR4A 5EOVA 3ZLTA 1S89A 3FSGA 3PGVA 4S1OA 3T15A 1AQ6A 4HXFB 4XGNA 1FFDA 4EJ0A 3NPMA 3EASA 4ICIA 2BZGA 3K0FB 1KPGA 4ID3A 2WJIA 2P2LA 4LCBA 2VSOA 2WK1A 1LY1A 4CM9A 1NVKA 3EWAA 2OPHA 2FWIA 3M6MD 3R1IA 4XW2A 4DNXA 2DWUA 2XF8A 1EVZA 4RPHA 1P4HA 2ROQA 3IKVA 3BF7A 2HDHA 1K3TA 1TJYA 5DBOA 4B4OA 2IY8A 1XTZA 4H7KA 4RF5A 3H11A 1UP7A 2CEKA 2GPNA 3B78A 1KYQA 4P34A 5E7IA 3SM9A 5DI3B 3HUTA 4BLOA 1TKRA 1ZWKA 3DMYA 3O8BA 4Y18A 4OJYA 4BO4A 3ZVKA 2IE8A 3HLKA 2ZBUA 3KLNA 4J0HA 2CNWD 4N5LA 1MEEA 1J8VA 1WUTA 3GXOA 1QYVA 5E38A 1NF8A 1KC1A 1H69A 3H6GA 4AMGA 3VSCA 4EJSC 4U7HA 1GUFA 1XQXA 3IT1A 1WS6A 5JLJA 1IN7A 4MV8A 2AFIB 2VNJA 3SZGA 4JLNA 3WQHA 4LECA 3GP5A 4C0HA 3UMYA 4NZZA 3D0KA 2TMGA 2WABA 3H0CA 1X94A 2OUKA 2UYYA 3BRSA 1M73E 2IYZA 5EY5B 4BBZA 3BMNA 3WKCA 4B83A 3OX2A 5B7PA 5MN5A 4ARCA 2OEPA 5K5EA 3BM5A 1N75A 3BH0A 2X6RA 3PHLA 2ZE6A 2LZ0A 3KT6A 3N2YA 1Z83A 3QEJA 3UOAB 1QC5A 1KVQA 3BSFA 3L04A 4QJ4A 2XYHA 2OZLB 2VLIA 5D3MA 4NDNE 1W30A 4KHZA 3DFZA 3SQNA 1U3TA 5JQGF 3HUDA 4MCJA 1YF3A 2H4JA 3MS7A 4PR0A 3ZBPA 2ZRAA 3PFFA 4QTXA 3ZDYB 1TB4A 1VHJA 1SK8A 2ZUVA 2P40A 2ZZKA 4G8BA 1GT6A 4JR0A 5E4YA 3AF5A 2D59A 2E55A 3SXUB 3T52A 3T6KA 3H5LA 3FGZA 3OIYA 2H2DA 1NUAA 1UC8A 3E3LA 5EXPA 2IX3A 1P8AA 2HUNA 3T5BA 3RWOA 3OZBA 5L3QA 1R88A 1MAWA 3CLTD 3T3MB 4KYTA 2YCBA 5JT1A 4F6CA 1NDQA 3VM6A 4F6RA 5CIYA 3LKZA 3R7NA 2BEVB 2AUMA 4WCFA 3TSOA 4D8XA 5BT9A 1RXCA 4TM7A 3JYHA 2RAPA 4EYKA 4FDUA 3W0LB 3JRXA 4NMMA 3IE0A 3T61A 3ZGOA 5I9LA 3BMCA 5T4FA 2KHZA 5BR7A 1O6BA 2F1OA 3NGMA 3BWBA 5ALDA 3LBAA 1C3XA 1Z2PX 1H4TA 3LBNA 5B3AA 2Y27A 2H9AA 2RB5A 3TUJC 4KZKA 4IUYA 2KLHA 2ST1A 3NUGA 5E7QA 4EYOA 2KBEA 4LW8A 5FULA 2QYTA 2QTBA 4AQDA 4E5YA 2PRIA 4LHSA 3RS0A 4KE7A 2XAUA 4GG1A 4NYMR 4F5WA 1GTMA 2JAUA 4FGZA 1EE9A 4IX9A 1ZJJA 1F38A 5YASA 3ZHZA 3C48A 1ATIA 2FWRA 3WRYA 5LD2B 1YR6A 4G36A 3WYCA 4BO0A 4ZMSA 2YQ5A 1LBEA 1M7HA 3K2QA 3IUSA 4GF5A 4Q21A 4YT5A 1M6WA 3WBFA 3ZH9B 1XAIA 3IXLA 1BJTA 4QRHA 3A4MA 3EFOA 4OLHA 4QNNA 3JQ9C 4X5OA 4ZHQF 1FTWA 4L5AA 1SZDA 1QG0A 4R31A 2PNJA 3OEYA 4Q9IA 5EQTA 1ORWA 3Q72A 3Q0TA 4Z54A 2X1LA 1EJBA 1OWMA 1KAOA 2CUNA 4XIFA 1VQ1A 2ZBVA 1ZUNA 3I3SR 5J3JA 1G7SA 2AIRA 2OAQ1 3E5HA 2XCUA 4JI1B 3KKEA 1SB8A 4B4KA 1CVRA 4LMBA 2PU7A 2P8SA 1BMFD 1U98A 4AKSA 4H6XA 4YVFA 5CLGA 5KYXB 3GO4A 3B70A 3THYA 4ZQGA 1FXWA 5ITZB 5G1NA 2ODWA 1NM5A 2WFZA 3CZ9A 2NUTA 3DTVD 1S3GA 4LE1A 3C1TA 1ZL2A 1KP2A 2ET6A 4GDMA 3QKSB 4PZDA 3HNRA 4NBLA 5AM2A 2WIDA 1JIKA 1G3IA 2W7TA 2C3OA 5BQOA 2J08A 4DIBA 3VO8A 4W8OA 3TSWA 1XBTA 4D26A 5KX5A 1T5BA 3TLGB 2EJVA 5F51A 1C4XA 2G04A 1JDNA 2JL1A 3W8NA 3FF4A 3B1XA 3HQ4O 1WW8A 2BR5A 5KJ1A 4LK2A 2H1IA 2AQIA 3ANXA 4CKCA 3EDMA 1EAMA 4BGEA 3ZQKA 4ZYZA 2VUIB 3COYA 4O4JF 5FX2A 5E6UA 2QTCA 3NLLA 4D81A 1G8JA 1T13A 3OD5A 4D43A 5DWDA 3WNZA 4K86A 4R1LA 2PSEA 3JD4A 4MVJI 2GKOA 4I4TB 3E7WA 4ZVQA 3BXGA 3M3HA 5J5VA 3RSQA 3I09A 4IFBA 2PSSA 3K15A 4WBNB 1TQ2A 2BKVA 4PN7A 1GL9B 4BMNA 2I8CA 3GAMA 1ILWA 2H5EA 4NS1A 1Z75A 1UBFA 4V2UA 4EGJA 1H0SA 2H6EA 4PCUA 1XZCA 3VVMA 4BNUA 2YHIA 3GZTB 3BE4A 1WW2A 4C30A 2CXNA 1AXEA 4CTJA 3KOZA 3AESB 1UPCA 5LXTA 1QNLA 3KOUA 3RHZA 2AMVA 5ALWA 3LXUX 2ZIUB 3KSUA 4XOUA 1HDRA 3VOAA 1AXGA 3OZCA 1KERA 1GWNA 4MDYA 3TUZC 1AG9A 4YWJA 2VPZA 4RK5A 2HDOA 4ZAGA 4YPVA 2Z8ZA 3TMAA 4HH0A 1ZRHA 2WTXA 2Q6KA 3AM5A 1E3JA 1GAWA 5HA5A 4K2AA 1P1RA 3MYYA 1N5RA 3GEPA 2YOHA 1UJNA 3EQ2A 4FIZA 2RAFA 2XOXA 1RQNA 3K2IA 1DUIA 4G85A 1G7RA 3IOBA 4EA8A 4G9EA 3OLWA 4FE4A 2FZ4A 1PLKA 2W93A 1TCBA 2ZRPA 3E9ZA 4M37A 4W8HA 1Z7GA 1LFAA 1ZJZA 4ZV9A 1UT5A 3X3HA 5KPJA 1ZG3A 3OTOB 2CLSA 2AFIE 4RIEA 2O50A 4LF8B 4DCUA 2QN2A 4HRXA 1NQOA 2QM7A 1Z5UA 1YZHA 1T6ZA 4ISBA 4CF5A 5IKMA 4HB4A 4P58A 4RLSA 2OECA 2RHBA 2QTMA 3SF0A 3FZGA 4DGSA 3ER9A 4CV0A 1OMOA 3UJ7A 4ZO8A 2FDXA 3AG5A 1T0IA 3CSSA 3G5UA 4IVNA 3U3RA 2XMRA 4BLSA 1WSAA 4W99A 4QHYA 4EEKA 3P0RA 4JLWA 3ZH2A 1NI3A 3DOFA 4XDHA 5TQ2B 3K1TA 1KK2A 2QR2A 5CEJA 2F90A 4UOQA 1MVLA 1WMBA 3SIRA 2ODEA 2ZJ5A 4OGWA 3VSBA 1N0HA 2WVHA 3BHJA 4LKOA 3TJMA 4A36A 3C5CA 3KO8A 5MHTA 3P20A 4IOKA 4RPLA 2YBDA 4YJKA 4M6WA 3VU8A 5AW0A 5C8VA 3H4IA 2K2WA 5JV5A 1O4VA 2YUTA 5F3WB 1JLRA 3ZKWA 4P35A 4E09A 1E32A 3LRTA 3TFOA 4ZT7A 3WLSA 1XZJA 3O8DA 4R2XA 4N9QA 2NO0A 4UD2A 2BMVA 5CDYA 2XF2A 5KVCA 3EB9A 1SIWA 4JSYA 1J2TA 2O9JA 3GV0A 1PT8A 4UTVA 5ADVA 2D0OB 2QTAA 1X1RA 3JVVA 2AFHA 4CMBA 4YRAA 1A4RA 2JBHA 4B6OA 5J43A 4KGDA 1E6MA 5K6RA 4L8LA 5LQCA 3CH4B 2HD4A 5JCJD 4CQNA 3CPSA 3NJ8A 4KP7A 1OTXA 3HB0A 5LQMA 1LWNA 3IJEB 1N7JA 3F67A 4WZBB 4PC3A 2IEDA 4MRPA 1SKAA 2FPRA 4YUWA 3AEQB 4C04A 4C0LA 4PO3X 3TQOA 2Y1WA 1POXA 2FOIA 3JZFA 3OOEA 1ZIYA 3W4IA 3HCEA 4H60A 4EPYA 3J81k 3GGOA 1J9ZA 1ZRSA 3AJAA 3NTXA 5DHSA 1J22A 1C8LA 2OG1A 1DEHA 3NAGA 1E59A 1QH9A 2XWBF 4M8IA 4DAEA 4QATA 5LLTA 2GPTA 1HEUA 1M6EX 1IJEA 3EQ6A 3I5AA 3RVLA 2F48A 4E6EA 4EK9A 3NRBA 3P9SA 3T9DA 4TL8A 5ELXA 3M6FA 3LP8A 4GBED 4TRRA 2J5RA 3C5WP 1QV9A 3E82A 3KQVA 1SU6A 1SD1A 2NGRA 1B43A 3TQSA 1P9LA 4TTSA 4BX9A 3WDSA 1N2ZA 3AJ8A 3D3NA 5KDLA 2EDCA 5G0WA 3FLMA 4TV9A 4WKGA 4CT0A 1DQNA 1II9A 1P2DA 3AUKA 3OZWA 2YV5A 1YR1A 3GDGA 1RVDA 1W35A 1SU4A 2GH1A 2V8OA 3ILVA 3AETB 4ESHA 1WXIA 4XUGB 3HYTA 3IAS1 5FLXA 4IILA 2PXXA 1ND5A 2WILA 1PS0A 3OJFA 5DKFA 4WLVA 4E14A 1D2CA 3DPUA 1V3TA 3MT7A 3VJKA 3T3NA 4F91B 4BKPA 4V39A 4LQDA 2QRZA 3OA0A 4MUAA 4ZCQA 5HJEA 4BGDA 4URHA 4K3UA 5TF4A 2BF4A 4OJNA 4I3HA 1FQKA 3THSA 1R2QA 4D3SA 4DA6A 2NO9A 4PONA 4EWLA 4XLLA 4UASA 3C3YA 4G0QA 3T1NA 1NVEA 4NU6A 1AKVA 1PWYE 2J3DA 3KAJA 1CHDA 4UUQA 4KLCA 1K7CA 1SXHA 3DDHA 5CFRA 2BKEA 1MQSA 5KTPA 2G17A 5KJFA 1MZVA 4MRVA 2OENG 5HIAA 3KDSE 4EFNA 3A6ZA 2CVPA 4OUKX 1GFZA 3FI0A 4QDTA 3R8XA 3V00A 5FQOA 1EVIA 3K70B 3ONFA 3D4IA 3OT5A 4YGYA 1IATA 3OM1A 1PL0A 1Z6ZA 5A6VA 5IZ4A 1O5IA 1CUJA 4R98A 1A9TA 2WIKA 4UQLA 4R1NA 1EFPA 4XTRA 4M8LA 3LX4A 3PNOA 4FVTA 4U8GA 1M5UA 4UU0A 3Q5GA 2B69A 2OFWA 3GRZA 4B34A 2JC3A 3NEJA 1GTSA 3GHYA 2VJQA 4PVDA 2F1RA 2WTMA 3QNMA 1KEZA 4S1PA 4N49A 3PGJA 1KIFA 4Z0NA 1R9GA 3JQFC 3UGQA 4KBFA 2PQ2A 4L9WA 3SZMA 2O8CA 2YUIA 5GOZA 2FWBA 2V45A 1PX0A 2WFLB 2ZATA 3FWHA 3PZRA 4JASB 5EQDA 5IVIA 2OAEA 2QK4A 3BD8A 4O33A 1VPDA 1NLYA 1U63A 3CJQA 3OU6A 2I5PO 4L4XA 4P3NA 1JBQA 2CLOB 3AM3A 4M4SA 3RVNA 1L7EA 5I7WA 1U3FA 3LWNA 2G4VA 4M2LA 5J58A 1GZVA 4XVQA 4BXOB 5HP4A 3TZEA 3V97A 4PLWA 1R6DA 1I2CA 1K7EB 4BFZA 5B3KA 1GSAA 4GI2A 4EUNA 4D99A 1Y1SA 3UUWA 1U8ZA 3QF4B 5BYAA 3W5CA 2HLDD 4C5AA 3DD5A 4O2LA 2OXRA 1DRJA 2QN8A 2FN9A 3EZ9A 2XE4A 4M0LA 4YRTA 5LD2C 2Q99A 4J3NA 3PXAA 5CMLA 3C2QA 3KJEA 5CB4F 4GPZA 1FBNA 1MO2A 4BQSA 2H5IA 3G59A 2RHWA 3KYIB 4PLPA 3T5MA 1CS0B 3R3SA 2Q6LA 4IIUA 5A9SB 5E2AA 2R2AA 3WDMA 1H6AA 3CUSA 5GV8A 1H05A 3LWBA 5DN6D 3HM9A 1WSBA 1P33A 4IHKA 3VR4H 2CJYA 1PS8A 4L15A 2SCUA 1BX1A 2WE7A 4MWGA 4IH4A 4QYWA 3ADCA 2IYNA 3A9CA 2GN6A 5IBPA 5FL3A 5CX1A 4RVUA 2RGNA 3DOHA 3H9BA 3KJFA 3S2GA 2XNDD 5GJWC 4IWXA 5CHYA 4F2GA 2OOKA 1NOJA 1RBZA 1WIWA 1DOHA 2MMCA 3DZ8A 3D8BA 4CL0A 3DH0A 1IHYA 1T5IA 1UKAA 3OZGA 1MTZA 4M60A 2V4ZA 1XG5A 3TRHA 1O08A 5K45A 4GMXA 1Q14A 3B89A 5LLSA 4H16A 2NTEA 3CONA 2WWXA 1NWHA 4DUYB 2C84A 5IVDA 1CUGA 2PD6A 2RH9B 3IQIX 2VQ6A 3EA5A 4JNKA 1YRYE 4RIGA 4IZOA 4XUEA 5BSWA 3U4QA 5IKEA 4BBJA 1HE8B 3DL7A 2NQTA 2XE7A 1GAXA 3CPHA 2QUKA 4WZBE 1DQRA 2XMZA 1KMIY 4GGOA 4KGXA 2YC2C 4BEJA 1CUDA 3U5ZB 1H4QA 2JKYA 1CIJA 1G1MA 2BV3A 5CRIA 3CVWA 4FB4A 2QN6A 4UEWA 4US0R 1GZ3A 2E4WA 1QGOA 5F1PA 1WMAA 3CN7A 3ECSA 2Z5FA 2HWXA 3V1UA 4IIHA 5JXHA 1M8KA 4ZAWA 2AVDA 3I9NA 4FD3A 1U1IA 4CF4A 5JSQA 4WKBA 2J9FA 2W2OA 1RKXA 3H1FA 4BB5A 5B53A 3VUFA 5JZVA 2DBQA 1KJ8A 1R0RE 4WDRA 3HDTA 3ST7A 2W4IA 4DRXA 3OEED 3DDCA 1JR3A 2H1CA 4KI0A 5DLQC 4GEKA 5E2IA 4M1KA 3GLQA 1OFUX 4D6XA 2P9GA 4BZPA 5K8LA 2D7DA 2CV2A 3BHMA 1A5ZA 1GILA 2PQ0A 3LRPA 4Y3UA 1MHPA 4I5DA 5I4KA 3QW4B 4TT3D 3ODPA 4CMEA 2EEZA 2XKKA 2Q3MA 3F6BX 1YDEA 5CNJA 5JIBA 2UZAA 4MR9B 3ZLJA 1ODKA 1ZU5A 2Z1DA 4WKPA 3ROMA 1ZVKA 3ANMA 3V1YA 3IEXA 1N8NA 1AD2A 3ESRA 4NFSA 3PZBA 4R5HA 4ALNA 5KJ6A 2IZ6A 1GRCA 4BUZA 1M1UA 3LBFA 3QV2A 2GJ4A 2F62A 3IP5A 5ANRB 1L5MA 1QCZA 3C3MA 4OFXA 4CLOB 3TLMA 3L4BA 4GMKA 2V6IA 5L3SB 2WFMA 3Q3CA 1GFIA 1SC6A 3P0FA 4G41A 1XCGB 3EAQA 5JI3E 3N86A 3N6VA 4UHHA 1QRTA 4DR1B 1R0LA 3TXAA 1NYQA 2Z6AA 5G2OA 3WK6A 1V1JA 3OC0A