3FH0A

Crystal structure of putative universal stress protein kpn_01444 - atpase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
144
structure length
125
Chain Sequence
b'SNAMILVPIDISDERIISHVESEARIDDAEVHFLTVIPSLGMDELREGSETQLKEIAKKFSIPEDRMHFHVAEGSPKDKILALAKSLPADLVIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative universal stress protein KPN_01444
molecule tags Structural genomics, unknown function
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
publication title Crystal structure of putative universal stress protein KPN_01444 - ATPase
rcsb
total genus 36
structure length 125
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fh0A00
4MUEA 2TS1A 3SEQA 3CVXA 4KR7A 1CT9A 3CLTD 3IOBA 4MW4A 4MW0A 1J70A 1KP3A 2J5BA 4EGAA 4R0NA 1KKUA 1TYDE 1VBNA 1N2EA 1QQTA 4OUDB 3P0HA 3CR8A 3AFHA 2V0GA 4NX2A 4U63A 3G6KA 2CUZA 3KT8A 1J1ZA 3FWKA 3RK0A 5BNZA 4Q93A 3FNRA 2E18A 1N2OA 1QTQA 1COZA 4MVWA 3CLUC 3INNA 4MUGA 2QJOA 1IVSA 3LOQA 1IHOA 3Q10A 1FYDA 1TEZA 4KPUB 2GM3A 4YBRA 1I6LA 3FIUA 1JIIA 1IQ0A 3A4IA 1K4MA 1U3DA 1JECA 4TS1A 2BYTA 3ND5A 3COZA 1MRZA 4MW7A 5H7XA 2B7LA 1O96A 1O0BA 4MQ6A 4QREA 3HZRA 4EG7A 1OWOA 1Q15A 3FETA 4K0RA 2QTNA 3G5AA 1YIAA 3NV7A 1WQ4A 3ZXSA 1IQUA 1TFUA 1O6BA 1NSYA 1O5TA 1TYAE 1T9GS 3AG6A 3CLSC 4JZYA 1KQNA 2QUIA 3A2KA 3D6UA 1O96B 1V8FA 3GLVA 2ZP1A 5JBNA 3AL0C 2H2AA 3IDFA 3RJZA 4DLPA 4HJRA 4MVXA 2PXHA 1VBMA 3SZGA 4PY2A 4RUKA 5LM3A 2IP1A 1ZH6A 2DLCX 2E21A 3MUEA 3COVA 1G59A 1GN8A 3CLTC 4MWDA 5HUHA 4YP6A 1WXGA 1N2JA 3ZJTA 5TEWA 2C5SA 1J09A 1JMVA 4MWCA 3D6VA 5TEVA 4CT0A 1IFXA 2QUKA 2J08A 3IUBA 4MVYA 2I1LA 4OUDA 1T6ZA 1QRTA 1M8KA 4XSVA 1I2DA 3H99A 1MJHA 2JAXA 3IMGA 4ZT5A 2PG3A 3VGJA 3K9WA 3Q4GA 1U3CA 4EG4A 1Q11A 1WXHA 4MUHA 5FNZA 5J58A 3M5WA 3QTBA 3TZLA 2CYBA 1SURA 2H29A 3DO8A 3S3TA 1LI5A 1NUSA 1JZQA 2CV0A 1PG2A 1F7UA 2R5WA 1EFPA 2HZ7A 4L2IA 1YI8A 1TYCA 2WQ6A 3CVUA 1LI7A 3COYA 1T6XA 1VLHA 3UMVA 3UK2A 1YUNA 2CYCA 2JANA 1JIKA 3K32A 4EG1A 3ZJVA 1H3EA 3HL4A 4DDMA 4MW5A 3PNVA 4U8HA 1M8PA 3UC5A 2A4MA 3RK1A 2QUHA 2YY5A 4ZCQA 1NP7A 4J75A 2X0KA 1O95D 2YWBA 4MUNA 3H9CA 3U1VA 4EG8A 3X1KA 1P7PA 1R6TA 3PNBA 4ARIA 2O8VA 1KAMA 1M8FA 1KQPA 1ZUNA 4R2MA 1RQGA 4FZJA 1EFVB 4JFAA 5EKDA 2GOYA 3CLRC 4HJXA 1MB2A 2PZAA 1NUQA 4S1OA 1U7XA 2J07A 1ZJWA 1NUPA 1OWLA 3C8ZA 3P0IA 1GTSA 2DERA 4MUKA 1GAXA 1TYBE 2QTMA 5HG0A 1N2BA 1PFUA 1XJQA 1JEDA 4YP5A 3ND6A 3TS1A 1WQ3A 2HMAA 4EG3A 1Q77A 3AG5A 5LFAA 1O94D 4G6ZA 4RPIA 1R6UA 3SDBA 1YUMA 3ND7A 4XFDA 4MAFA 1ZH0A 1M8JA 2XRYA 4P2BA 3SYTA 1OBCA 3PXUA 1D2RA 3DLAA 1N2GA 3I05A 3L92A 1MB9A 4H3SA 3IMEA 1JEEA 2E89A 4MWEA 4EFKA 3IVGA 3N05A 1O94C 3BL5A 2ZUFA 2DXIA 4I6JA 3HMQA 5DEOA 2YXNA 2IJGX 2X1MA 2DPLA 4I6GA 3P0JA 4PBSA 2O5RA 4MUJA 3ZJUA 4G5FA 3KT3A 4DDKA 2VTBB 2CV1A 1GLNA 3X1JA 2V0CA 2YWCA 3RFFA 1QRUA 3PRHA 1T9GR 5FO1A 3DPIA 1G8GA 4ZT2A 1M1ZA 2CYAA 1KP2A 2D54A 1JIJA 2WB2A 1OWMA 4XFJA 4A91A 1EFPB 3H97A 5HUJA 1IQRA 5LLTA 4AQ7A 2WSIA 3LCJA 1WXEA 2A88A 3IMCA 4NATA 1EJ2A 4DDHA 1H3NA 4ZCTA 1OWPA 3CLSD 2A84A 2CV2A 2A1TR 3KT0A 3UOWA 4CQNA 1N75A 4UZFA 1DNPA 3TQIA 3X1MA 4ZCSA 1EFVA 3AKZA 1N78A 4MLPA 2WQ7A 4MW9A 3F3MA 1JILA 3A04A 1I6MA 4Q16A 1XNJA 4CDNA 1QRSA 1NI5A 4EG5A 4YMIA 1YIDA 4MUIA 4YP7A 2CFOA 4DJAA 1U7DA 3IUEA 2DETA 3N8HA 2X1LA 3FI0A 5H16A 3CLUD 4G5YA 1EUQA 5KWVA 1NYLA 1KH3A 2A1TS 1N77A 1O97C 2AG6A 4ZT4A 4F3RA 1K92A 3QTTA 1KH1A 3N9IA 1A8HA 4NAHA 3FG9A 4ZCPA 3Q12A 4WSOA 2AZXA 2CSXA 2E0IA 5AHWA 1X6VA 3JXEA 3QE4A 3RHSA 1N3LA 4QRDA 1NZJA 2PFSA 1N2HA 3CA8A 2JA2A 3HGMA 5KCMA 4J76A 1TQ8A 5IHXA 1JGTA 4QBTA 4MWBA 5K0TA 4ND7A 1I6KA 1U0BB 1G8FA 3GUZA 1PG0A 1VL2A 1OWNA 2VXOA 1QJCA 3IVXA 1S4MA 2OQ2A 3ELBA 4GU5A 5FO0A 2DR2A 3L93A 4KPUA 1N1DA 2NZ2A 1IH8A 1O97D 1KAQA 4WNYA 1Q19A 4JXZA 3MMXA 2A1UA 1PFVA 2IELA 2OV4A 3GMIA 4I6EA 4PBRA 1H1TA 1G8HA 3CLRD 3KFLA 3DV2A 2HGZA 5TGTA 5K0SA 3VU8A 1R6XA 1MBZA 3COWA 4DE5A 2QJFA 3VRHA 1H3FA 2RD2A 5KHAA 1GTRA 5DB4A 3G59A 3NBKA 4PBTA 3IOCA 2PIDA 1PFWA 2A1UB 2A86A 1EUYA 1MAWA 1V47A 1MOPA 3UY4A 3ZUGA 1FFYA 2VTBA 4KR9A 5F23A 1KQOA 2XRZA 5DASA 1NUTA 5DK4A 3A05A 2ZUEA 1WXIA 3FY4A 1QU3A 2A7XA 3NBAA 3AIIA 1X8XA 2QJTA 3FDXA 2CT8A 1MAUA 2D5BA 1OD6A 2G36A 4KR6A 1T6YA 1HYBA 4MUFA 2RE8A 1NURA 3H05A 1NUUA 1JZSA 3FH0A 4HK4A 3LE8A 4AS1A 3CVYA 2D13A 3TNJA 3ZGZA 1Y42X 3ZXIA 4R2LA 4HPWA 2EJCA 1J1UA 4ZT3A 2Z3VA 3IOEA 1EE1A 2J09A 4F4HA 3HV0A 2PZ8A 1OBHA 4ND6A 2X3FA 1PFYA 3ZIUA 1ULHA 2BTEA 4NAUA 2EL7A 2DUMA 1YULA 1M8GA 3IODA 4MULA 4EG6A 1EXDA 1B6TA 4DNXA 2Z08A 3FHJA 3PNYA 4ZT6A 3CVVA 3CVWA 4OJMX 4ZCRA 1QNFA 4CDMA 4EF6A 3HFJA 3TZEA 3OP1A 4JXXA 1WXFA 1O95C 3KT6A 1WJGA 1MC1A 3SP1A 1F4LA 4K03A 1KR2A 1WKBA 3P52A 4E1AA 1N2IA 5J5AA 3IH5A 4MW1A 2QUJA 3E27A 1O0CA 2J4DA 4ARCA 1IRXA 1VBKA 2DEUA 2Z09A 3SZ3A 4U7JA 5IJXA 4NDAA 2NSYA 1GPMA 1F9AA 3ISJA 5J59A 1WZ2A 4MVCA 1K97A 1ILEA 2PZBA 4X0EA 4KKVA 4JYZA 3RBAA 4MW6A 2AKEA 1XNHA 3MLAA 3H9BA 1UFVA 1K4KA 1WOYA 2GKSA 5TS2A 1J21A 1J20A 1QU2A 4NZPA 3IVCA 3OTWA 1KORA 4GRIA 4MW2A 3ILVA 4ZT7A 1M83A 3SEZA 1GZUA 3TQOA 4L2IB 4BWVA 1F7VA 3MLBA 2QTRA 3N2YA 1LW7A 1XNGA 1JHDA 3MXTA 1BS2A 4UZEA 1KH2A 3FOCA 1WY5A
chains in the Genus database with same CATH superfamily
1Q0UA 3OQBA 2TS1A 3SEQA 4NZOA 5LMZA 3FB1A 4P0PB 3O3CA 1V6AA 4JP3A 3WGUA 4MW4A 3A6FA 1DQPA 1U1CA 3IQIX 1ZD2P 3FZGA 3GUYA 3P20A 4MV7A 9LDBA 1FQWA 3OJXA 3RUFA 5E7QA 3H3FA 4B4DA 4G4JA 4EGAA 3LQ4A 1ZVJA 4RA9B 2AD1A 1KKUA 4TV9B 5BSGA 5KNBD 3N87A 4PYLA 3QIAA 2I9PA 5B1IA 4BP1A 4DPLA 2OWEA 1Z4PX 5JSHA 3RFUA 4QYWA 4J07A 1Z2AA 3DE5X 3LQ2A 5BN5A 5NULA 5JCXA 3WYEA 1DXHA 1KS9A 5MGNA 2C7PA 2VATA 1LX7A 2I4IA 4CNBA 3UENA 1FPQA 2QVGA 1VA5A 3L9XA 4I55F 3KQNA 5JAIA 2YCLA 3BC1A 2EJWA 3F74A 2EGGA 2VZ8A 2PSFA 1IEWA 2CF6A 4GMKA 4XUGB 5IDXA 3CGWA 1VSQA 1AKNA 1Y7IA 4B45A 3WK6A 1UBOS 1IQ0A 1X86B 1DWOA 1OI7A 1L3CA 2BKXA 2JAHA 1II8A 2RBKA 3E2PA 3RU9A 3VUEA 1W5AA 1KF0A 1B26A 1QB7A 2O2JA 3KQSA 2BTQB 1DIHA 3WV5A 3L4KA 1KDRA 3OFJA 5BVHA 2W6MA 1X1SA 3WNQA 4X6YA 1CNMA 4MICA 4FN5A 1DRJA 1EM6A 4E3WA 5IHPA 1THZA 5JASA 2ZS9A 1JLKA 1RFGE 5JYDA 5FQOA 4GKAA 1IK6A 2KE5A 3AP3A 2D2EA 3FETA 5FYQA 1GRRA 3QFCA 1VRVA 3GGSA 3JQAB 1P4RA 4YMUA 1DBSA 4Q48A 1CRLA 4D4HA 5B6IA 5JDIA 2FFBA 1Q7TA 4PC7A 3T1OA 1C9JA 2WTXA 2R1ZA 3N74A 1D0VA 1EE2A 1QYRA 3D3QA 2Q2NA 4M0FA 5HWSA 3KYCA 3VNUA 1J2UA 3GEIA 1TFUA 4PFSA 4WQMA 2YN2A 1BEEA 4OH1A 3WYCA 3GFTA 3EXIA 5JYCA 4G9BA 3KFXA 2IW3A 1JVBA 4IUDS 4XYGA 3VU9B 2BV3A 3WIDA 5EXPA 5C46F 4IS3A 2QW0X 1VLLA 3H8JA 4FBMA 4JLDA 3S2UA 4OO3A 2B99A 2E4UA 3E22B 3L7AA 1ANKA 2WE7A 4A3SA 2GZDA 4LXXA 3JASA 2P8SA 1P19A 4ZALA 4MGHA 4Z3KA 2FUCA 1VBMA 2FSVC 4UBLA 3SPXA 5KTKA 2ZBDA 2IP1A 3D02A 3AF6A 3EBPA 2Z4TA 4B48A 1S2GA 3WRYC 3FUTA 4YT5A 5TXGA 1G55A 1QK4A 5TJ9A 2EFCB 3D1VA 4YP6A 2UUAB 4H4EA 3W2FA 4W1PA 1T4BA 3FPEA 5FOXA 1E60A 1YKSA 4UFPA 2RGYA 4IFTA 1NBME 1Y1SA 4Y7CA 1GGJA 3R6LA 4CM8B 1C3OA 4JENA 2QUKA 2BSAA 4J3FA 4GLJA 2FX3A 3N8IA 4AWXA 1K27A 3ZHTA 4OUDA 1QUFA 4WN3A 3JWHA 2P9HA 1YI1A 3IP7A 1WQ1R 2ZB7A 1XKLA 2D1TA 1GZ6A 1RVDA 1LZLA 3KHSA 5AJUA 3WLSA 4ZAWA 1CEEA 3BA6A 3ODPA 1SU6A 3EIWA 5BW4A 5EIXA 3V8EA 5F5XA 2SKEA 1CLEA 2PG3A 3H6GA 1P7YA 2ZRCA 3GVCA 4ALKA 3GLFA 4FMBB 2OOKA 1C7FA 3FWPA 1FU7A 3RS0A 2GS9A 4ASUD 1WXHA 4A8JB 1ARZA 4BQSA 4D45A 2JI4A 2ZUTA 4FHZA 3CKKA 3ZD9A 5HW0A 5J58A 3WKAA 3EZNA 3PDHA 2GLXA 3DO8A 1HOXA 2QM7A 3BIWA 1H2RS 3EEOA 3PSAA 2XCQA 4FDTA 4PAWA 3HP1A 3DUFB 4B35A 1II8B 2Q3BA 3UH0A 4YRRA 2P30A 2ZIUB 4WKBA 3VZSA 5FPYA 4CKWA 2NTJA 3L46A 3UEOA 5FLYA 3GF4A 1ADBA 4FDUA 4S0XA 2FN4A 4AFNA 4OQQA 4YY3B 1XAGA 3CKYA 4PHCA 5IUJC 5ALQA 3W5VA 1LWNA 1RKQA 2O3TA 5C4MA 3VVLA 2R6JA 2CJXA 5KTTA 4PZYA 2RHMA 3WE7A 1NP7A 1T0BA 4LI3X 4MWZA 1I36A 4IYJA 2WLTA 1EX7A 1FYWA 2J48A 1TJNA 2FP4A 2V58A 5DHFA 3GLIE 4YR7A 1W7AA 3MQ2A 3WGHA 2P8JA 5AMXA 1KI6B 5C3MA 1UF9A 1I2MA 3ICEA 4MQFB 5EE1A 1LU9A 2JLAA 1MB2A 4WY5A 2PJDA 1M2HA 1O6CA 2WU3A 1TJ4A 2L18A 5B36A 4PHFA 2BEVA 2EWVA 2GVDC 3HP7A 4BNZA 5C4IA 1THMA 1ZJWA 1U9IA 2VOEA 3RAGA 1Z0IA 2N1BA 4Q03A 4E7PA 1X38A 3FSGA 4YT8A 3A9VA 2FPKA 2PT5A 2I55A 1TYBE 3BCSA 2JC3A 3G68A 4BTLA 1YDWA 1GWNA 9GPBA 4B3SB 3OIYA 3RWOA 2VT3A 5B7PA 3FGZA 1LPNA 1Q7EA 2VDKB 4FSHA 1OZHA 3M1LA 1K88A 4P36A 4O2BF 1G8MA 1Y5IA 2XVMA 4DBLC 1OZ0A 3ZCVA 4GBGA 3CISA 4LQCA 4KK4A 1JFSA 2ZU6A 3DP7A 3SDBA 4LEIA 1UDRA 4LJLA 4TWJA 5ARBA 4EGQA 3CN9A 2WJIA 3ENWA 4EA6A 1PS8A 4JUBA 3TGLA 3ZOZA 2Z1DA 4A26A 4BCDA 4KXNA 3L4JA 4YLGA 2C20A 1TAGA 2LIPA 2H54A 3KWLA 3GDOA 5AI0A 3URMA 1DKPA 2IE0A 2ARKA 5BSVA 2JF0A 5C2JB 2PL3A 4FEYA 4BFWA 1SC3A 1M75A 1M33A 5L7YA 3CXRA 2PZEA 2BUBA 4RVNA 3WK4A 4J6EA 3FHTA 1CK4A 5JJLA 2OO7A 3UKOA 4JUCA 3FNFA 2WI8A 3HZZA 1KMNA 1EP1B 2VJAA 1J49A 2N46A 2YJGA 3STWA 4BHTA 4NYJR 1K66A 1L8XA 4IHQA 3E8SA 4LXTA 1W0CA 3QPCA 5CDHA 4G65A 2J0EA 2AOTA 2E4XA 4DYHA 5ERXA 3K0AA 5J1SB 2UZ1B 2PUCA 4TQGA 4UPVA 4YAFA 3BIOA 4COKA 3FNEA 5T3YA 5GGYA 4G09A 1XCJA 1P2SA 1RT9A 3O4RA 4DQKA 1NBOA 3DUWA 3FYHA 5DX8A 3GRFA 1IQRA 2VRWA 1RYMA 1Y5MA 3IT0A 3KEFA 3B6ZA 4QDZA 4K9PA 3NTXA 4Q02A 3UWDA 5A02A 3TVDA 1TTQB 3QU2A 3F7MA 3VTAA 1IG3A 3EW9A 3P2EA 2WICA 4B87A 1EG2A 4EHDA 3BXFA 3S1AB 2BOVA 3O4VA 1DEHA 5EWLA 4R2HA 1C4KA 3RAPR 3W04A 4DDHA 2XQJA 2IF0A 4ZCTA 2QORA 5IKEA 3CLSD 3HYNA 5GVRA 4MGZR 3G5UA 4PQRA 1T5HX 3M6LA 1F6WA 1BCRA 4IXMA 4HMOA 3QX8A 3I23A 2CF5A 1N78A 4ZVVA 2WQ7A 2Q4RA 1Z6GA 1WUJS 2P68A 4H15A 1QGDA 4M1QA 2AYXA 1DG1G 2RKBA 2PWAA 1SVUA 2YX1A 2VAXA 1FMLA 1TCCA 1Z29A 1V48A 3AR8A 3F4BA 1NW7A 4RQBA 4N65A 3E84A 4C9BA 4CTJA 2ERXA 2YBEA 4INPA 3V42A 2NU6B 3ESAA 3F67A 2DWPA 4IJKA 3OE1A 1ZN8A 2X5JO 2IK8A 3ABRB 1EVLA 3KLBA 2YUIA 3QV1A 5ALIA 4F4DA 1EA5A 5GZ1A 3TK1A 4QQFA 1GDDA 4LWZA 3N8HA 2QNRA 3HXOA 2G77B 3E4CA 4BL5A 3C7CB 4OJQA 2ZXFA 3QVLA 2JZOA 3UCXA 3UUGA 4E5KA 1K92A 4PHGA 1XRJA 2BBTA 5FWYB 4F8YA 4AZ3B 2GVNA 1ITZA 1JG6A 4XX0B 4G1FA 2ETXA 1E3WA 1KO1A 3QBVA 5JZOA 1C3XA 2ONYA 5FOVA 1G0OA 5JQGA 2BZ1A 1PJ4A 4XGNA 3U6KA 4ISBA 1M34A 1FXUA 4CDRA 3G0BA 4FPXA 3CRZA 1TRHA 2ZSAA 3IKMB 4M9SA 5IM4A 1SKBA 4Q3CA 1E0DA 4CZ2A 2RHOA 5FTLA 1ZEJA 2B83A 2D2XA 1CZOA 2ZTVA 4V1CA 1Q1AA 4HDQB 1JGTA 1OIXA 1ZLXA 5BWCA 3EYAA 1A8QA 1SOUA 1Y3AA 4IDNA 1E2EA 3L8EA 4IV5A 1OAOA 4P4UA 5SZIA 3AR7A 5JE8A 1Y3DE 1PYOA 1WUTA 5LUBA 3N8GA 3AI3A 4J1NA 2X86A 4RVUA 4WBXC 4F4UA 2Z8YM 5F33A 2OV2A 2I33A 1DXYA 5THKA 1OZAA 3A1DA 1NA5A 1A0OA 4IF4A 3IPYA 3AEYA 2GPNA 4XAQA 4OREX 1ICIA 4XUEA 2VP4A 3WB9A 1O97D 4BDSA 4RH1A 3F73A 1ZN7A 2YWXA 2YXBA 4RK4A 1L7XA 2XKJE 2YVKA 4YPVA 2A1UA 3Q9LA 1V1JA 2JK1A 1W73A 3DDNA 2NXWA 1XEWY 3IILA 3QI7A 1BXRB 3RS9A 2CE2X 3BDVA 3VR5D 1H1TA 4WXRA 1UMDA 3AF5A 2HK8A 4MQBA 5K0GA 3U7QB 3R77A 4UM5A 2B94A 2Z43A 4KZKA 1PRYA 2YJ4A 1OYVA 2AEJA 2LDXA 3UA3A 3NM4A 1A71A 5JG7A 1F9EA 1ECLA 3NT2A 3G8DA 3COWA 4CKBA 3PNLA 1GLGA 4AO8A 3Q0TA 4MS4A 4A2QA 4ER3A 4WN9A 4FC7A 1J9GA 1EGQA 5LXTA 3U60B 2QZ4A 1GCUA 1R0CA 1UOQA 2FWMX 2PM8A 2GTPA 4BYGA 5CDGA 1E9VA 1M6VB 4YQEA 1GTRA 1UK7A 3AQ4A 5HS6A 1N8TA 2VDPB 1V3QE 2GJKA 1G2PA 2PIDA 1LDBA 2C83A 2Z58A 3RT1A 2AQHA 1AUOA 3GK3A 1ZKMA 4XJXA 3MMSA 4JBHA 4UU8A 4YJDA 1L8OA 3QPWA 1MOPA 2DZDA 5EE3A 1VL6A 2HNAA 3K1AB 4IIGA 5JCJA 1UXKA 1RDFA 3Q3HA 1EFDN 2H07A 3CPHA 1RPNA 5A0FA 3JD0A 3AONB 5BO5A 1T3GA 1MEOA 3OZXA 4WZAE 2WTBA 1YMVA 1QMPA 2QYTA 5DSXA 3BX1A 4WK4B 3FHLA 2XQFA 4E5YA 4UEJA 2WD8A 4WMLA 2JFGA 1EGHA 1EZ1A 3OE7D 2QJTA 1OFVA 1ABEA 4HH0A 1ZIDA 2DOKA 1B43A 2GPBA 2XW6A 3R0ZA 1AQIA 4FT4A 4GE0A 4MUFA 5DSTA 3WGMA 4CL2A 5CNKA 1E99A 4DY6A 5KSOA 2F6RA 3DZGA 3RWMB 2EFEB 3KKQA 3ORSA 5A06A 1HLGA 2PKQP 3CVYA 5AIBA 4D9EA 2JZCA 3KTAA 4ES6A 2BEUA 3REQB 1XLUA 4MPTA 3WRYA 3ZXIA 4MHTA 3N3AC 1QKKA 3TKLA 4CGYA 3P2MA 4G86A 1VI5A 4ZVOA 4CIDA 5C1IA 3S28A 4N54A 4U9UA 1P0MA 1PKEA 2G6TA 4TKZA 4R7ZA 1WBDA 2FSSA 2WNIA 3W8RA 2E82A 2ZT5A 4PS1A 4E15A 1Y8QA 4KBGA 1NW4A 2RARA 3IPRA 3IP6A 1JYFA 1GT91 4LZOA 4LVOA 4PZUA 1J0AA 2IU4A 2IYPA 3RSGA 5JUWA 2YRFA 1CDOA 2MCFA 2FZKA 3G5MA 5DSZA 4L5CA 2CHVA 1UOEA 1NASA 2W6ID 3Q9SA 3FPKA 3EWIA 3CX4A 4MV5A 4UEQA 5C18A 2ON6A 3QLJA 1T26A 3I1JA 4HO1X 2F3QA 4WK2B 1N0IA 1Y4AE 2V9ZA 3H4VA 1LD3A 3DJYA 4LRTB 1WXFA 2NADA 1HZZA 1GQQA 1QZ3A 5LIPA 3K2EA 2BFOA 4GMGA 3JQGB 1MB0A 3UWOA 1RWPA 1L7AA 2AG0A 2FHSA 5HE9A 1PTJC 4ZIRA 1KAGA 2IX9A 3GQBB 4MPDA 2G25A 3B9QA 1NPTO 1LCIA 1QDUA 2W2KB 4RJ2A 4DMFA 5ITZA 4Z0TA 5IXJA 5DP1A 1TO2E 1T8YA 1F2TB 1YE3A 2DWUA 3MS7A 5FUVA 5JPCA 2GSDA 3NEJA 3M4XA 5C5DA 4ONEA 1SKQA 1Y6RA 2O8NA 4R2KA 3HCEA 4RF3A 3HVUA 2X0EA 2QX4A 4R2IA 4A10A 5C81A 1Z5NA 1QPZA 1K97A 3KLPX 1XZMA 2G9QA 1B0UA 4ESHA 5H0IA 4J1SA 3KBOA 1Z4NA 2HPVA 4ZOEA 1YQQA 1K4KA 3QEJA 4ARBA 4QUKA 2GKSA 4PHTA 5TS2A 4CLEA 1BJRE 2RMKA 3AM1A 2QN2A 1NVXQ 2JIZD 2GEFA 1Q91A 2AXNA 3E4DA 3JYNA 3WGTA 1MC4A 1QWSA 3KAKA 1YC5A 3NVDA 2D7DA 2PUAA 1S3GA 2YW9A 2CFSA 2RI6A 5B4UA 1SY7A 1RAAA 1JIVA 1PDVA 1RQXA 2JBAA 4RK0A 2IHJA 2Q5CA 4DLZA 4M9CA 3TW4A 3K09C 1H2WA 4QE3A 4CV2A 5ITWA 2ZTLA 3MOSA 3ZHXA 1XNGA 5LLDA 2H2FA 2EKZA 4ER5A 5KJFA 5C32A 2HK6A 2MIIA 5ALYA 3AEUA 1C14A 1W59A 1OX4A 1I51A 2CHQA 3H1TA 2H18A 3I39X 2VRCD 2B4YA 3T0FA 5FRDA 1GTVA 3OSZA 1CUSA 3ELWA 4Z9AA 3RFCA 5LYJA 3U1TA 3SC2A 4E5UA 1COWD 1YR1A 1DO8A 3OT5A 4QUAA 4Z4FA 3Q8KA 1KSGA 5AW7A 3PPVA 3M9WA 5G02A 3EG9A 4FS8A 2O1XA 4H60A 4KLZA 2RHDA 4V0LA 5THXA 5LU8A 5I7VA 4ZXPA 1SO8A 3LUAA 3G9TA 2JH9A 4J0JA 3E3OA 2X15A 5A6SB 4CTNA 4OOEA 1PBNA 4AXXA 3P2KA 2ZKLA 4UBKA 4Z9BA 3U7EB 4MRMA 1WHTA 2ZUUA 2FLVA 3HNPA 4L5JA 2GYWA 3K3PA 3NU1A 3BJRA 1JEQA 1HSZA 4TL6A 3FNRA 4W8OA 4XIGS 3GLHE 3WLHA 4KDFA 4ATNA 3AWIA 4P3OA 1JPJA 2JHFA 2TMDA 4G0PA 4CWAA 5ALVA 1TZKA 2VDMB 1KSHA 3K1AA 4UMDA 4FE3A 1II0A 4I50A 3QY9A 1KNQA 5DLPA 1FQKA 3VO8A 4AULA 2UYCA 3KYBA 3I6MA 2ZYUX 1QBGA 4Q4HB 1ZMBA 1VB3A 3L8GA 1L5HB 2GN2A 1DJOA 3A4IA 1TJYA 4US0R 3AV3A 1DKMA 3K9GA 5E7MA 3RVLA 3UZUA 3WGGA 3ZWDA 2JPDA 3F71A 3OA2A 5DMHA 2BYTA 3HBFA 3QKSB 4A82A 3ZCRA 4QNMA 1FRQA 2ZATA 1YS2X 5KKCA 3GJ3A 2IYWA 4BVHA 1NBHA 2P4UA 3CB2A 4H77A 1QO0A 1I30A 3HZRA 3V00A 3VPCA 4QAQA 5DBGA 3QEKA 3HDYA 3I9OA 1KDZA 3EIFA 1AK2A 2AXQA 3B9BA 2NVBA 1YH3A 1T8SA 3SHVA 2IC5A 3ECSA 3HY6A 4H0NA 5FTKA 4JHLA 2QVBA 4RIFA 4XYEA 3UK0A 3VHXA 1KDTA 4JS0A 1R7RA 1DSSG 3GOQA 2WIDA 5EY5B 1TD1A 1HQYE 2WSLA 4KXXA 1YCDA 4G5GA 5BV8A 4M9XA 3PD0A 3VSCA 5LQJA 2BCGY 3V7WA 4R1MA 4Q3EA 5NLLA 1OVGA 1PHRA 1Y8QB 4MK4A 1JG4A 1V71A 1A4IA 1IIRA 1VGQA 1T9BA 2H1HA 2XOKD 4FEAA 4AJ9A 1W87A 4ZYYA 5JLJA 1JJFA 2O3QA 1OLOA 9ATCA 2FZ4A 1AB5A 1BMFA 5FJJA 4KMMA 2N75A 4W99A 3MGKA 1SVNA 3QELA 1DBWA 3R7NA 3ZK8A 3LAWA 5HKKD 1SXJE 2F2TA 3LMKA 3BJEA 2PUHA 5AKIA 2P9YA 2PXHA 2GPJA 1CS0B 2ORED 2H7YA 3QYPA 3O90A 4OL0A 2RG1A 3I04M 5FL3A 3D3KA 2WZDA 3H1GA 3MBIA 4D6YA 5ALFA 3RWBA 1H1LB 2NP7A 1TMKA 4DV0B 4JBXA 1S4QA 3I34X 4Q9LA 1IG0A 3OI7A 2V8OA 2H5LA 3C39A 3CB4A 3HPRA 4P4GA 4F46A 2HT1A 1VB5A 3ELUA 1SUPA 2RHLA 4HAIA 6NULA 5KMGA 4GM0A 1G38A 8MHTA 3HXKA 4G0NA 4HXGA 4GUDA 3EMVA 2AZDA 5K09A 3H4MA 2H2DA 1R5BA 2P2ZA 4L73A 4P22A 1NWHA 1E3SA 3AOEA 4CT0A 4B85A 1C41A 3HDHA 3MERA 1GUZA 1TM5E 4YCAA 3T3IA 1OV4A 2Z5VA 3BMNA 4MCJA 1YJXA 4Y2VA 4O59O 2GN0A 5LQSA 2I87A 5EI5A 1AD2A 2IZOA 1ILWA 2LWIA 1GZHB 3F6RA 3WBBA 3WBJA 4P0QB 3UAOA 3RNLA 1V7QA 1Q3HA 2NXJA 4A6DA 4KNYA 5G0SA 1UFQA 2P4EA 2H2WA 4GOKA 3S2IA 3VGJA 4S04A 2ZVJA 4WVLA 2JGEA 5LSAA 1PK7A 3ERCA 5HE8A 4WVFA 5F2OA 1T3LA 1T9HA 1XWFA 2ID7A 4Q7EA 1FUKA 3ZH2A 3U3MA 2QAJA 3NM5A 5FNZA 3JALA 1YDMA 3E9DA 1PJQA 2P5YA 2VDWA 4LWOA 2P9EA 2ZWAA 2XCUA 4JLAA 4MB0A 4CG2A 3ADOA 2X19A 3OPMA 4XE5A 2ECKA 5I7SA 5ALSA 4BZXA 4C4XA 3GJ6A 1W9HA 4CLDA 3WWDA 2HZ7A 1DARA 1YI8A 4I1UA 4J0QA 2D0OB 5CG1A 4LDJA 2X8WA 2VUTA 1L7PA 3OOSA 3SJUA 1B0PA 1VLVA 5J4VA 5KTPA 1GZ3A 2B69A 5FUQA 1NYTA 1Y8RA 3HFGA 4X1IA 1SHKA 3R3YA 4IXNA 4UAUA 1EGVB 1R15A 4MDHA 1V41E 3FKSA 4RGQA 1UBMS 4DW8A 3ORYA 4X1YB 4J75A 3U3RA 3KZVA 1PK9A 4JHXA 3AVWA 3H0CA 5K0EA 3ZR4B 3MZ0A 2GXAA 2YW2A 1RSZA 2WF6A 2H8GA 2RGUA 3AHEA 1KQPA 2FDRA 1DE0A 3WGOA 4R2MA 4WPGA 4ZJYA 5KPJA 2AL7A 3DHVA 3A26A 1ONOA 5CLFA 1RP1A 1NKTA 4KQKA 1KQGA 4RE6A 4J3NA 3A3KA 2WD9A 5FI1B 1Z39A 4H1WA 5EJ4A 3LD9A 4HH1A 3P0IA 2VQEB 2ZIGA 2Q3FA 2XGGA 3ZLBA 4IFIA 4P8RA 1BNCA 4P08A 3ZCXA 4Y6SA 5C7OO 4PPNA 1XK7A 1V2HE 1N0UA 3U9TA 3NCHA 2VF8A 1XKTA 3LCCA 3OF2A 2VJKA 5AOCA 5LP6B 3ROGA 5A6SA 3I9V6 3Q3IA 4KQIA 1YB4A 3IHKA 4EG3A 2WNSA 2Y9MB 2ZE5A 1NMQA 1YGYA 5DIFA 4OQLA 4RPIA 2FCAA 2ZSDA 4Q3KA 4ZRMA 1YFLA 1GA1A 4ZWNA 5BVHB 1M8JA 2X22A 4Q9HA 3OFSA 1KYWA 2FRVA 1KVUA 1ZS9A 4QPNA 2WTUA 2XB4A 1ZIPA 1NJ8A 1JLMA 3BHJA 2QUAA 3ZDZB 3M6IA 1FJXA 1HGXA 2UYHA 3QE9Y 1DLIA 2E89A 2C2ZA 2IYVA 1M2EA 1CJBA 1FTYA 2PT9A 3A3NA 1V7PC 5JFOA 2XQVA 3F4LA 2I65A 2C04A 4FS3A 1TJ5A 3PQDA 5AOAA 4Z7QB 1V96A 3QE3A 4FYJA 4JL6A 3H2KA 4J2HA 2X1MA 3A6LA 2OSBA 3EAGA 2JH8A 4NJEB 2JFPA 4XSHA 3QVVA 2FI1A 4GXQA 2UVQA 3M6FA 5FOSA 8AT1A 5HEKA 2O2DA 4JVLA 4CUKA 3DBLA 2P9FA 2BH2A 1VSBA 4QPZA 3KJZA 2VDLB 2V3VA 3K5WA 2IWRA 2OXTA 3BMCB 3AVVA 1JL3A 4YJHA 4C06A 4NMMA 3V8MA 1FBNA 2B4QA 3GLIB 1P33A 3FTDA 1DAPA 5CM8B 2EGUA 3QA3E 1Y9JA 5HM8A 1WEKA 3ZG6A 3L79A 3MYYA 5LLTA 5AH0A 3LKVA 5CVCA 5EMKA 4KYUA 1KY4A 3U31A 1RRVA 3JYHA 3AUSA 3NAGA 1XVTA 2PMDA 2QROA 3JU3A 3PNSA 3PRKE 3AKYA 5LWQA 3RVSA 2BGNA 4L6CA 2IS6A 4MKXA 1CUAA 2YV1A 3AJEA 3CINA 1DKNA 3A4NA 1GJRA 3CUYA 4GOJA 2OE2A 1FY2A 5AVKA 3RHTA 2WIJA 4FGLA 3B1YA 3ZVMA 4OVKA 3PUHA 5DX1A 5L6MB 1T9AA 2PJRA 4UEWA 2JFZA 1V43A 2PANA 2NO0A 2ATXA 4XEUA 4LHVA 2QX8A 1H1LA 2DYKA 1R9NA 2XYQA 4K6MA 1YJAA 2FOIA 1W0JA 3W9SA 1PT8A 1OT5A 4JODA 1AOXA 3STYA 3OBIA 1IAVA 1EWVA 4N8DA 4O4JF 3AW8A 3GARA 4X3OA 4URFA 1UAGA 1DWQA 4LDNA 2QD5A 3T7CA 2IHZA 2QL9A 3AI2A 3K6JA 1DFIA 1FDTA 5TDHA 3DONA 4X8LA 3NUGA 4FOLA 4DGSA 2B82A 5D00A 4C5CA 1TCVA 2BGIA 4M2LA 4ZZ1A 3PXAA 1QSGA 1FW8A 3FI0A 1SQSA 4ZOCA 3ZS8A 4JT8A 3QUAA 2P41A 4LRQA 5JNRA 1PQ4A 1O97C 3QRWA 3C5HA 3N59A 3WISA 5GP1A 3OTIA 1BWQA 4K0KB 3HUTA 3K0AB 1WPQA 2ZJ5A 4X1IB 1ZHFA 5F78A 2REBA 4LJSA 4LNUA 1QQAA 2D62A 2AZXA 3K1TA 4FQ8A 3S40A 1JEOA 3LRTA 4H3HB 2P27A 3W8NA 4B3CA 4XB2A 4AG6A 4BMNA 1J5XA 1Q44A 2WQZA 2YDXA 3VU3A 3I58A 4FIDA 4FK8A 4CL3A 4DC1A 1E6MA 2GILA 1P6QA 1D2CA 2JFQA 2HMTA 1LGYA 3I2HA 4UKDA 3NDRA 3UT5B 5G4KA 1I9GA 3QF4B 3KXDA 5JTTA 1GYRA 4L57A 4QBGB 5GIPE 4JJIA 3W90A 1SIOA 3IAFA 4ND7A 1M2JA 1UQUA 4BQOA 3JAWA 4NE9A 3OFNA 3R2JA 4MI9A 3V8RA 1PG0A 2CXTA 4WDQA 2W2NA 1RM5A 4DIKA 1OTHA 1RE0A 3DQPA 3PBKA 9MHTA 1CF9A 1PUIA 1ISJA 3IVXA 4GU5A 4RQUA 1G21B 2CXNA 4U2FA 2BKEA 4EDHA 2EATA 2J3KA 4MGIR 1RI1A 2Y2UA 4UOZA 1B8UA 1T25A 4RIHA 3WYGA 3AGPA 5BWOA 4JELA 3DHEA 2ODTX 3G1UA 1IM2A 3NHZA 3ZJ5A 2I7XA 1SRRA 1L5RA 3FBTA 3H3XA 4EI2A 4REOA 4DR7B 2GKOA 1A77A 1IY2A 4DJFC 2B6HA 2FCRA 4KFTA 2PNJA 5JANA 1LQTA 5AJVB 1JKJB 4JY7A 2UXCB 4LFCB 1V5GA 4X54A 3PC8A 5TF0A 3OEYA 2FPXA 3EF0A 1NL3A 4R1OA 1KEKA 3R24A 3OX2A 5IMBA 4JYMA 2CC2A 1SUIA 1MU0A 4UE2A 5A5FA 1JDSA 1Q6ZA 3QVXA 4TROA 3VPDA 3KU4A 4LJ7A 1T5SA 2Q6TA 1XMVA 5ICEA 4Q9IA 4IUYA 1M9NA 3SQDA 4ZARA 2C8LA 3NUZA 2O6HA 1FQOA 2COKA 2CZQA 3GDGA 3M6AA 4G5XA 5B58T 1AZTA 3MJTA 3ROEA 4OLJA 3GFSA 2PH5A 1P1HA 3ZTYA 1W94A 2DKOA 4LFAB 3JQQA 2GJAA 2ZIAA 2AW5A 4MWOA 2WJ6A 1TUBA 3N2KB 2NLOA 1F6DA 2Q2OA 3RKUA 4HAXA 5DK4A 1PTKA 2FFJA 2Y0CA 1NF3A 4FZ5A 4TUYF 4JX9A 4TMKA 5DN9A 2JRLA 3SX0A 3TOZA 2C31A 3HACA 4JV5B 1N4DA 3OESA 4S2UA 3WLFA 4CBVA 2CT8A 2VHEA 1IXZA 4L16A 1TKBA 2ZBGA 3D6AA 5IVDA 2G1JA 1DAHA 5C52B 4MYUA 5GIOE 1H9AA 3CVJA 5EXDA 3OM8A 5FL7A 5JZBA 5FOWA 4ZZ0A 1ZK1A 3GUVA 4N40A 2VPQA 4WRRA 3WYAA 1ISHA 5BR7A 4HQ6A 2O2YA 1Y5LA 2Y76A 3JYOA 4E09A 3TRHA 2GUGA 2OCGA 1DCFA 3E7XA 3SF0A 4BV8A 4DXHA 1ZNXA 5IXSA 4GSYA 3RG8A 5KYUA 2C7QA 2DQZA 3I9KA 2BBOA 3PZBA 1EE1A 3AYZB 4DZRA 3EEBA 5G40A 3WSTA 4LISA 1M3SA 4NOLA 2A5YB 3KQHA 2OGSA 4HF7A 5AHXA 4ND6A 2GNOA 2YMLA 2Q1TA 1N8NA 2YQ4A 4UEKA 3HLYA 4X94A 1QGOA 1J8QA 1XD9A 4XB6B 4BFTA 3CNLA 4I50F 1NQUA 4YREA 3PC6A 3VHRA 2P65A 4OBEA 4QU8A 3P96A 3HEMA 3LPAA 4RCYA 3CKLA 3RRJA 3C5WP 2Q1SA 1M6WA 2Z08A 5FT9A 3B6KA 2VUHB 1Y7PA 1QGED 3LUBA 3R7WB 4NCBA 3PGMA 3QXCA 1VA4A 2B2XA 1TUGA 4YFVA 3UMBA 2A59A 5AWFC 3PUWA 2YNMC 1KWKA 3ZV3A 4KR3A 2PJUA 4IRUB 4MAAA 4QDUA 3WKBA 3KXIA 3R5FA 4L4XA 3P52A 4HGZA 1K06A 5DM4A 5AR1A 4AJKA 2CBZA 2GN4A 2Q28A 1SPXA 1QFYA 3D8BA 3TBKA 3NEYA 5DM70 3NKLA 3IO5A 3OQ1A 3AETB 2ORIA 4UEOA 4Z51A 4O2LA 3LO8A 3UM9A 3DNMA 2H48A 2Z09A 3FFBA 4ZVMA 4D6PA 2JJ2D 1GPMA 2WUGA 2J3QA 2AKYA 3HEBA 5CB6A 4RH3A 4MVCA 3OX4A 2OMKA 3ZN2A 4JYZA 2XMQA 3ZK7A 1SOVA 2EJTA 1JAHA 1ZH8A 5EIBC 5REQA 5K3EA 2QAIA 3TI9A 3RREA 3BERA 1A9ZA 2MINA 5HNKA 3FUVA 1RXIA 5DTIA 3LSYA 5KHLB 1FU8A 3D5TA 1I8TA 3K70D 4ABYA 4MW2A 1A2QA 3F98A 1WUHS 3RJ5A 1LI4A 1M83A 2FSGA 1UT8A 1UP6A 1W85B 2RGWA 3DF9A 3N2LA 3OPYB 3TQOA 3WDLA 5DHQA 3FPLA 4LOAA 3WLEA 4D81A 3ITNA 3ZYZA 2E5WA 1SUEA 1G5FA 3VVMA 4DV2B 3HTXA 1OXMA 5LIRA 3LCRA 4MI3A 2JVKA 2Z0MA 2QG9A 3KUUA 1Z5ZA 3R9XA 3QF4A 1CZHA 2J6CA 2PA3A 3E9YA 2FUKA 2ZJ6A 3CLTD 3EJ6A 2YICA 2JLBA 3CH5A 4II2A 4B6GA 5HM6A 5IYZF 1KP3A 4PAMA 4R1QA 1LUAA 2GAJA 521PA 3WA6A 2O2ZA 3EIQA 2FF5A 2ZB4A 5SY6A 2IV7A 1B4DA 4JZKA 1USVA 1G1MA 4MS1A 4BFLA 1Q3TA 2GAIA 1NFRA 3B1JA 4PPGA 5A0TA 3F6EX 7REQB 1NXTA 1PSDA 3HB5X 3JW8A 1I3KA 3G6KA 3IVRA 1J1ZA 1SXJD 1XJWA 2B25A 2YWDA 3EGEA 2VTDA 2HIGA 4GPTA 4OIMA 4QLOA 2P78A 1SBCA 5JW6A 3FRJA 1M6NA 2IOHA 4MKGA 2CXOA 5IT9A 1LNZA 1A7JA 1XDUA 2JD0A 3FNHA 2X40A 1X1AA 2BJHA 2R6ZA 3UAYA 4DBVO 4ENWA 1L4LA 5AW0A 3OU2A 5G3YA 5A7FA 1BX0A 2G8LA 3PX3A 1G20B 4EL5A 1IVSA 2ZSIA 3GJYA 4YROA 2JCBA 3EVGA 2ZRAA 3O4IA 4IBOA 3GRRA 1M6YA 3HHEA 1BN6A 4NDZA 4PAQA 1TYEB 1W75A 2VF4X 5EHQA 2QR5A 1JIIA 2JFXA 3IDAA 4OM7A 4BNVA 4UUBA 2PBFA 3H11B 4HLQB 4MIKA 4YCBA 5U4QA 2DECA 4LPKA 2OM6A 4TS1A 3PFNA 4XQCA 1WNFA 5DTMA 1IRIA 1OJLA 3VKHA 1MRZA 1HLFA 4HRXA 5MFZA 3ILHA 2HB6A 4EZBA 3I3OA 2CDAA 1GL3A 1I32A 3I9JA 3LY9A 4L3WA 3NHKA 4NEQA 3WL8A 3OMXA 5DNYB 4MKIA 1C3EA 4DKXA 2XUZA 4HZUA 3GGGA 4OPMA 2PSHA 3HKBA 3HU1A 2ZGVA 2AN4A 3IHLA 2FZLA 3IHWA 2QLBA 1L1FA 1QIJA 4JI6B 4BNNA 3SM9A 4ZC1A 5IYZB 4HDNB 5FWXB 1A9PA 1IZ9A 1M2KA 4X92A 3X0DA 2XXAA 1S3IA 3AZPA 1WE2A 5JAHA 5K3BA 1ZEMA 4HEQA 5MN5A 5H5JA 1YRWA 3DL4A 1X13A 1E7MA 1SXGA 1VIDA 4IMJB 3OAAD 3IPLA 1PO7A 5JXIA 4GFDA 1I2CA 1RAIA 1U1GA 1N2XA 1ENZA 3LZCA 5CX4A 5D84A 4YT2A 4PLPA 4QQ8A 3UHFA 1PP4A 2NXCA 2H6EA 3D6UA 3JD1A 1ECCA 3T7SA 3RC1A 4COOA 4DLYA 2I03A 1JRLA 2PL5A 2ZRHA 1E1NA 3D7SA 3AL0C 4OFZA 2YXLA 4DLPA 2ZW9A 1TVCA 2PA0A 2D6FA 4CIVA 4IZHA 1OA0A 3OKCA 1NULA 1EUCB 5JAMA 2GCOA 4TMXA 3QEMA 5ICCA 3E3LA 1W0JD 3EDYA 4YK7A 2ENWA 1TQDA 2ERYA 3EIXA 4G0VA 3R6TA 2RCNA 3P2OA 4TWIA 4A2CA 4X5OA 3AESA 2L2QA 1RMTA 4GDFA 2VP5A 4MR9A 5KNBA 4E70A 3DO6A 3ZV4A 1B42A 4OP1A 2W2LA 4FYWA 1UDBA 3DM9B 4GF5A 2C97A 4OB7A 1QVVA 1G9SA 2G28A 4X00A 5E3HA 4KXWA 5CVEA 1XCMA 1PG5A 1T6ZA 3NBQA 1ZWKA 3KKLA 4RFVA 2Q4EA 3GP5A 3MWDB 3PQ8A 5FBWB 2A5FA 4L28A 1DKLA 4V39A 3R8XA 3UT5A 3EMBA 3QKSA 3FF4A 1I7DA 2QRJA 3DYBA 3C8UA 1KJZA 3EGDB 2XUHA 3S68A 1NXPA 4BO8A 2IZZA 1VJDA 4YV0A 4DM4A 2Z2JA 3JAWB 4L5BA 4W8GA 2JEZA 4LMBA 2Z56A 1A8SA 1C9YA 3LWDA 4QA9A 4CLHA 5AW1A 2Q3EA 1BMDA 4OU5A 3DWEX 3U5TA 3R5TA 1ZOPA 1LI5A 2IOYA 3W8FA 4DZTA 4PR0A 1I3CA 5JNSA 1ECPA 3PWZA 3OCUA 1EFUA 3HN6A 1JR6A 1AK1A 3T52A 1YUNA 1S8NA 1Z4IA 4KO2S 3BE6A 4I2VA 1SBIA 3W3AH 1EHIA 1F3OA 4Q66C 1ORWA 2B4AA 1FNMA 2QRQA 2Z5FA 3IQWA 4RK7A 5TB5A 4ZCQA 3VH1A 3VJLA 1P2GA 5K05A 1T4MA 2H57A 1ONBA 1TM2A 4I5GA 5TQ2B 4EY4A 1QF6A 1EWKA 4ENQA 2ZRJA 3YASA 1T10A 1ZIOA 3D7LA 3KOOA 2VXBA 2FMXA 3Q0IA 4CMCA 5C1BA 5IFKA 3BZUA 2VKTA 4KAAA 4JKOA 5HYVA 4HQOA 3RAEC 1PX0A 1YB5A 4CIWA 1MOQA 5EPEA 3QW4B 5KQRA 3LQ1A 2WV9A 4EQ6B 2PWBA 2Q3LA 4F4CA 4XDHA 1N34B 5EC8A 1U7XA 2QGZA 4BC1A 3UFXA 2JCXA 1ZD1A 4GRAA 3EY4A 3KNZA 1BW9A 5FFFA 3TW6A 4R9NA 2QU8A 5FOUA 4BNXA 1DUIA 2D8AA 5CCDA 3HI6A 4GP9A 1QGAA 3CY6A 5H8WA 1WZIA 2FEOA 2IYXA 1W49A 4KG7A 1U6IA 5EZYA 2H1CA 2HEGA 1H9BA 5FUWA 1MO6A 1XU9A 3HZHA 1ESDA 2W43A 3KUKA 4AYXA 7REQA 3AY3A 4E22A 3C3DA 2YC2C 3AG5A 2VK2A 1MQAA 3PHGA 4AIIA 2G71A 2RHTA 3WAGA 2MYNA 3HFRA 1K0UA 3MGAA 4PYNA 1V4NA 3THXB 1GGVA 2P2LA 1WCWA 3DZCA 4KSYA 5BT9A 4ZVUA 1XMQB 1Q21A 3GVXA 4PE5B 1XCPA 4UOQA 2CK3A 2GD2A 3V7YA 2PO7A 3D4IA 3DEFA 4URHA 3RYFB 2LKCA 2HJSA 3H2GA 2XTAA 2FG7C 2XF2A 3ZBQA 4D0GA 1BMFD 1T9ZA 1X7GA 1HURA 3UH1A 3THOA 4A7PA 4C3UA 1XCGB 3O5AA 5BRNA 4I6GA 1H65A 4YAGA 4GXNA 3DZBA 1EP2B 2BVNA 3ZJUA 4B46A 5F3RA 2ECOA 4FYKA 5TF4A 1SHUX 4DDKA 3TCXB 2NX2A 4B43A 1E3WB 5DV9A 3GWGA 2CYAA 3Q7RA 1H2AS 2JLRA 5IFLA 3R4CA 2QSJA 3HN7A 1E32A 3LQRA 3MK31 4HPJB 2ZREA 4BX9A 5EHXA 1S96A 1V26A 2NO4A 1WEHA 3FCOA 1TLLA 2FSHA 3HJTA 2O3JA 1JDNA 5E2BA 5PNTA 1JDJA 2Z2XA 2XLCA 3ZWBA 3TG2A 3DFIA 5K51A 1EZ4A 2WSIA 4PHHA 3LCJA 1YVPA 2V5UA 4BLTA 1HC7A 2PZFA 2A88A 2R65A 5T6BA 4PN7A 5DWQA 2XI4A 4GDMA 3R0JA 2HAEA 1DFGA 1DEXA 1ELOA 4Z86A 2BP7A 3NYWA 5IKOA 4M1KA 4P5DA 1ZYUA 3HJNA 2BELA 5F1YA 3RSQA 4F2HA 2WMDA 4LF9B 1VHDA 4CPDA 5KEIA 1EB8A 2ZDGA 2C2MA 1H2HA 3GLGE 1DQYA 1T15A 3QEMB 4WLFA 5CBPB 3QPBA 1PL8A 3TB6A 3O74A 3RUAA 1WCV1 2VG8A 1K98A 2FZ5A 2JLSA 2W6PA 2W9XA 2FU5C 4IY1A 2HMUA 3LG2A 4Z4CA 1RLIA 1UMDB 3QLTA 5IF9A 1AXEA 1QYDA 3FVQA 5E1OA 1CR6A 2AQKA 3KKMA 1G8SA 1GGHA 3U48A 1H1DA 1UM8A 3G9XA 2G40A 3V4ZA 5HFAA 3ZCUA 2I91A 1QHXA 3DBVO 1YRLA 1RZUA 5DNUA 5BT8A 1U7DA 1AKVA 2JJQA 3OOJA 3PF8A 4FMDB 4GBED 3OTGA 4TL9A 4DCOA 2NZXA 4RMGA 5LZ4A 3NCTA 3KIPA 3EUWA 5H16A 1QIEA 4N5NA 3TPFA 1KTIA 2FVYA 1NYLA 4RZ2A 3FZQA 1EUQA 1LLDA 2I7TA 1QV9A 1WPXA 3DOJA 3KQWA 4LV8B 3RYHB 4MOWA 1VBFA 2J7KA 1ZONA 4TSKA 4FHGA 4UAJA 2PUWA 5B57C 2GFIA 1TMGE 3R7DA 5IRCD 2GF0A 3AUUA 3BE4A 2HD4A 5CG2A 2VBIA 2J5KA 3EXG2 1YQEA 1XCBA 2P67A 1NTRA 2JJMA 2C5HA 2UVPB 1DIOB 5ALXA 5GADl 1NVVR 2QI9C 2FR0A 5H3CA 1YKGA 1LSJA 2CUTA 2JGFA 2XVZA 2A0WA 3O3NB 3NTVA 4HB2A 4IJ6A 3ZGYA 4OU4A 3ZI0A 2HBRA 3BFKA 4MLZA 1Y6GA 1H5QA 4MR8A 5CEJA 2V3WA 1KJQA 1XZKA 1A27A 3B9PA 3FRIA 4Q7LA 3LIIA 5HX7A 4DQXA 3D3WA 1QV6A 4V24A 8ADHA 3AC0A 1A50B 1OAOC 1QF9A 5D6NA 2EF0A 3AFIA 1LY1A 2YOHA 4HYQA 4DN6A 1U0EA 5KINB 1PT6A 5KQLA 3G0HA 1AO0A 1S4MA 1MJGA 3RROA 2YBDA 1GQFA 1CW2B 4LOHA 1N1DA 1M1NA 4PQFA 3M9XA 4FZRA 2YHSA 4J03A 2B8NA 3IV9A 1OY1A 3MWFA 1CEYA 4W5QA 4Q00A 1U5CA 2V7QD 1CQXA 3PEFA 4PX2A 5FA6A 3U13A 2YZ7A 4G97A 2PX4A 1B3BA 3W3ZB 2Y67A 4ADSG 2QV7A 1QFXA 4RHEA 5DM60 1G8HA 4RPKA 5AK0A 1H0RA 3HWRA 3KFLA 5E1DA 2FEAA 3WYNA 4EQZA 3AOGA 2PUBA 4Q01A 1KS2A 3IALA 4YMWA 3DW3X 4HXFB 3FYSA 5JQGB 2HWWA 4NBVA 4YXFA 3L18A 1ULAA 2WAMA 2XMGA 2A2ZA 2QJFA 2JD2A 1Z4MA 1XJ5A 1Y1TA 5FLXA 1S8OA 2B6NA 1BIFA 2EKLA 2I54A 4IWYA 4F5ZA 3NBKA 4JAVC 1YOVA 2DT5A 5I9MA 3L05A 3R20A 4YCSA 2NTNA 3E18A 3WGZA 3UMYA 4JR2A 5BNIA 3OWXA 1PFWA 5SYAA 3WMWA 3B5IA 2RIPA 1WUKS 3GROA 4IAOA 5HRUA 1X1QA 3TIGA 4NYMQ 1G3MA 5KWJA 3RE1A 3I09A 3ZUGA 4ZAXA 1DRUA 1XO1A 1HNZB 1IL0A 3BXZA 3ND9A 1BCSB 3KL2A 4KBFA 3L8DA 5FPSA 1C3JA 3WGKA 5AP9A 1DOAA 2VJLA 4F3YA 2WUFA 4N9WA 5C5CA 1P0IA 5CFQA 1DHRA 2PYIA 4UM9D 4EX7A 1QU3A 2KBEA 4YXWA 3KUCA 2H63A 1TZMA 4LVNA 4S35A 3IKTA 3H6KA 3GGDA 1OB2A 4L4SA 1MH9A 3IBSA 5AK3A 1U9ZA 2RE8A 4OF4A 4HVTA 1BXRA 3LFHA 2VQSA 3E0QA 2C2KA 4PLFA 4PQEA 3TDMA 4UTOA 2RJNA 4R1TA 2XHEA 3D8TA 5GV8A 3GDFA 3T3DA 1C9KA 3K0CC 4QUHA 4Y2PA 1MT3A 7AT1A 5LBUA 5HP4A 2DB3A 1FK8A 1ODTC 1X9IA 2JLCA 3ZE9A 4ZT3A 3DLPX 5L7WA 2NP6A 3NDBB 1GGEA 1Y9EA 4GPZA 2DUNA 2V65A 2R2AA 3T9DA 4MAMA 3ZPXA 8GPBA 4DMUB 1CV2A 3HV0A 2WF5A 4W7HA 3D6NB 3V46A 1LDYA 1HNXB 1P17A 2QLTA 3CRRA 3IT1A 2UZ0A 2FPRA 4EDFA 2EL7A 3QWHA 4RAQA 4EKGA 1KJIA 4TLDA 3U6BA 3GEEA 2PZJA 3D6FA 4EG6A 3DOCA 4FYPA 4DV6B 3FVWA 3FHJA 1CY1A 2OLJA 5T41A 1JHMA 2ZBPA 4BCBA 3T4PA 4MDYA 4IRXA 3DYIA 4D56A 3G3EA 2PGLA 4ON9A 4MA4A 3LF1A 4M9UA 4NENA 3ROXA 3SEAA 4OQMA 4EF6A 1X0VA 2HFKA 4RV9A 2GAAA 3AEQB 3IERA 4D8WA 1GCIA 2OTCA 4N49A 3AKCA 1F4LA 3LXRA 3WYDA 5I51A 1OXKB 2UKDA 3DF7A 5T4HA 3WWOA 3P32A 4CEIB 1VZ3A 4KREA 3G88A 3BIJA 2PFGA 2GM4A 1C7RA 2H51A 4B44A 4ARCA 2DH6A 2ZYGA 4H6WA 2C59A 4UPEA 1K3UB 3OZEA 4TVSA 4QM6A 4R05A 1HBJA 5EVJA 1VL8A 1A3CA 1AE1A 3CONA 5IJXA 4N9QA 3DLHA 1W5EA 3EQ2A 4R3WA 2NSJA 3K0KA 3T0GA 1L2TA 2Y9PB 4CKCB 1I7SB 3GLGA 2AKEA 1M54A 4MW6A 4WT7A 1F12A 1A88A 2G5PA 2H17A 2J45A 5J4HA 1ZSNA 4B0OA 2J9XB 1TQ6A 1WBJB 3KZNA 4QUJA 4UREA 1EK5A 2NO1A 4P3PA 3PE4A 7ADHA 5FI0B 3K15A 2WJ3A 1XLTC 1RAHA 1O8CA 2XKBA 16PKA 5SZJA 4JIGA 1QANA 1U2GA 2FZWA 3K2QA 3PE6A 4J0KA 4LJ4A 5AJZA 2NT3A 2QN3A 1CUDA 3OICA 2REQB 3C3PA 1GAJA 1G9XA 2EX0A 1PR6A 3KXKA 3UV6A 5FEUA 1FTSA 2Y66A 1JHDA 4OSPA 5JHHB 1XSEA 2E4VA 4L22A 4EA9A 3RVJA 1N36B 3HVRA 1ISFA 3FOCA 4OGGA 3T94A 5SZKB 1LRKA 2DCMA 4U5QA 4CLOA 4LYGA 1P8AA 3U7FB 3E2IA 3K0FB 3K1ZA 4RU1A 2W2KA 3AX6A 1MUUA 1U0HC 4QUBA 3V9PA 3L01A 3PL1A 1GSAA 3NS7A 4ICIA 4V03A 3KB1A 3UK7A 3FDZB 3EHEA 4YRCA 4AZWA 4BRWA 3Q15C 2N1MA 2FUNB 3IT2A 5EP3A 4DV3B 4HPXB 5KYWA 4ABTA 4OUDB 4WCFB 3S5JA 1RVV1 4JVNA 2L19A 2AN1A 4RS4A 3TZHA 4D26A 3KVNA 1EIZA 1FB5A 1N5KA 2HDOA 3GZNA 3KT8A 1U0FA 3ITKA 3O8OA 4GMFA 5HMMA 5JC8A 3JD3A 4K6FA 3W05A 2ZM5A 5BNZA 4XEHA 4FHEA 3PXCX 1N8KA 4AWBA 1QPGA 1NVUQ 2ODWA 3LGSA 4O4IA 5EJAA 3MBKA 3OIFA 4PLZA 3QXGA 1LZKA 4X6LA 3WFJA 1KP9A 3NPMA 3AHHA 4EB6B 5CT5A 4QXPA 2ONJA 2WDZA 4I3GA 2B1QA 2LCFA 3H5AA 4ZOLF 4IX9A 4MVJI 2FF7A 3C87A 5M34A 1XHEA 3IUMA 4KPUB 2Q4BA 2DQ4A 4YBRA 1HWYA 2X9VA 5ELXA 1QH8B 1E77A 2XA9A 3B3JA 3JPWA 1NVGA 3OFVA 5ICMA 3KO8A 4Y3UA 4Z3DA 4L6IA 2HQOA 2VK1A 1ZL0A 1TD9A 2HEIA 2I2CA 1BAPA 1LS1A 2DHDA 3NNSA 5EZSA 4AUKA 3M33A 4CMBA 4LI0A 1VE6A 1U9CA 3LY5A 1SXJB 2ZT7A 1G64A 3K4HA 4QREA 4BQIA 5F7JA 1XA4A 3QWIA 1Q15A 2I6QA 4B7UA 2AEFA 4L02A 3SC2B 4K0RA 4C4ZA 1UADA 4WL0A 4BO0A 3BF8A 5B2FA 5FCDA 3N6VA 2YZ2A 4EB8A 4L4RA 4XJSA 5IG2A 2QIPA 2XYGA 3CF4A 4UOEA 1V1RA 1TW2A 1KOFA 3O47A 5DU2A 2QTHA 2EW2A 4FKMA 1TKRA 4RV5A 3R40A 3IE1A 1KU0A 3EIHA 4G63A 3ZHZA 1V37A 2P9QA 2VRBA 4TUYA 1Y1KE 2FN3A 2VPWA 1NIJA 1CIVA 1NVKA 3GT7A 1AUQA 3S7TA 3SBDA 4B3XA 5JNTA 4AYWA 3C3BA 4O8ZA 1OAAA 1THTA 3GZ4A 3NUQA 2M6LA 3GLVA 5ES3A 5EEHA 2MHCA 4DLTA 1J25A 4HJRA 2GBLA 4PY2A 4QSHA 5KX5B 1O77A 5AVTA 5BPFA 1R8SA 4MQ5A 2CLOB 1ZGZA 1J0BA 2WBLC 3EPLA 1E2HA 2WA1A 1AKMA 4YX9A 1XOIA 2R8RA 2DQYA 2I7DA 5AM1A 1G59A 4FB4A 4ESEA 4MWDA 2CUNA 3Q9UA 1T0PA 2FEWB 1ZQ9A 4XIIA 5C8DA 3A6ZA 3TSCA 4ALJA 1FXWF 3HR7A 1P4GA 2OZLB 1JMVA 1GDHA 2Y0PA 1IM5A 3B1ZA 4Y67A 3WGVA 3JYPA 3UWMA 3ZNOA 4DBZA 3H9UA 4YR9A 2C7VA 1YD7A 2IOFA 1EXWA 4DS3A 3RUIA 2EFYA 2OGUA 3PQ7A 4LXHA 2RGGA 3IQDB 1OROA 3NORA 4IIBA 4UCWA 4A9AA 3U09A 4CFZA 4MR7B 4YMGA 2ZRFA 3JYQA 1ZH4A 3E9ZA 1KZGB 3IUPA 4HNRA 1ZRSA 4LRUA 2FXIA 1U1DA 5L4LA 4JQYA 5E6UA 1K08A 1SJ9A 2A14A 4KFUA 3K8QA 1E89A 2BCJQ 1PI3A 2XMBA 2QAGB 3P9NA 4HZUB 4DCGA 5BXQC 1E7SA 3MWKA 3VDRA 4QDJA 2CYBA 3KZOA 5TQJA 2Q7XA 3AILA 3V4RA 1AVTA 1JR3D 4KO3S 1NXOA 5KNCH 2IXTA 1IY0A 1KTVA 3E9NA 1EFPA 2QYSA 5ALDA 1TYCA 2HUPA 3GL9A 1J8DA 1MV5A 2XJ4A 2ZRNA 3F0TA 3FNIA 4RD6A 4HNVA 4MKFA 3VA7A 1K6XA 2H1SA 1IQPA 1MEEA 1OASA 3C6ZA 3WB2A 5HUQA 2VLIA 2CYCA 2Q46A 4GMHA 4OQNA 3UJAA 3TIVA 1QHYA 1MQ8B 2JH3A 2XCRB 4YRNA 4R0VA 2YFQA 5DLQC 5CIYA 1ZN9A 3U4IA 4MNTA 3AVPA 2A4MA 3TPZA 1KOGA 2O54A 4N3NA 3NDPA 4DV7B 4E6PA 4N01A 4NCAA 4GLLA 2HMSA 2F3RA 3H9CA 1PNVA 1E79A 1OFIA 4PSVA 5H9VA 1F38A 4XGQA 2GD0A 1M34E 1X7XA 3SIWA 4XQEA 4AG5A 3IP3A 4KQFA 5GQSA 5AIAA 1C9DB 3OCCA 4X85A 2J5XA 2HYIC 5EKDA 3JQ9A 4RH0A 3LHSA 3TTSA 2FRDA 1VMAA 2QVLA 4CQLA 1EK2A 3V1MA 3IGFA 4I1OA 5BWMA 2IXEA 4MR9B 3O4FA 3T4UA 5DHAA 3DD1A 1AHIA 4TX1A 1UWKA 2AUTA 1KVQA 1ZK4A 4R2XA 4DXDA 3OTHA 2HSGA 3L7JA 3AR4A 4P33A 3TUZC 5HZGA 1COWA 1PFUA 1T2UA 3EZYA 2HSEA 4EEKA 2GN8A 4MRPA 2Y1EA 3ANXA 2X7JA 4PZEA 4V0SA 1SVWA 1F1JA 1ADJA 2GCOB 2IGBA 2LBPA 2N3ZA 3JQBC 4M89A 3ZDRA 3GMTA 2IF2A 2J9ZB 3EVCA 5DBFA 3EXFB 4RA6A 1PV2A 1Q77A 4GPD1 4YRJA 3MTQA 5EWJA 3S8MA 4XFDA 2RHHA 1E7WA 4LZWA 4MAFA 4UVDA 1ZH0A 5IUKC 3PUKA 1RBQA 3SLRA 1A9SA 3OJOA 3N53A 1WV1A 2A0YA 3OG9A 4KDCA 1JYEA 4ZOBA 4IIXA 3ZNNA 4D9NA 1AUVA 2DWQA 3JATB 1U1FA 5A4IS 1JLRA 5K0JA 4OSOA 1ZHHA 2XTNA 4OGKA 1XDDA 1JXOA 2Y1DA 3HKDB 1GZSA 2OYCA 4BFUA 1L6RA 1MCZA 4NYJQ 3U7IA 1KY5A 1O94C 3UHAA 3BL5A 3BYZA 3DL7A 3ZHYA 1O95A 4C6HA 1L4FA 1YS9A 1ZMTA 1LPPA 3HMQA 4PG6A 3LT5A 5IZCC 2QQ0A 2JCSA 5BMVF 1TADA 2ADMA 2Q5QA 5FBLB 5HMLA 2JHPA 2P3SA 4XLLA 2O8DA 2NO9A 1EU1A 4PLYA 4KCGA 4E12A 4RANA 2GJ9A 5DP2A 3VDXA 2VTBB 3M6MD 4YCJA 1I7PA 3X1JA 2XY4A 4D4IA 2HSZA 3BILA 2DKFA 2SKDA 4IVRA 4ESOA 1OXSC 1J90A 1KFKB 3DPIA 4QRHA 5DXAA 5IM5A 4R84A 5HXAA 1JU3A 4F86A 3WIUA 1UEJA 1YQXA 2JGMA 5E6SA 3V97A 4GX5A 3RVOA 1STOA 2WWXA 2GYYA 4CMEA 5I7HA 2DHQA 4R3UC 1CQWA 4OI0A 5I5EA 1YR6A 2RCYA 3GFGA 4D9BA 4UDOA 2GN6A 3F6PA 1IEXA 1AHNA 3M1YA 2GWHA 2M6KA 4D46A 2RH8A 4F06A 2C92A 2YIMA 1SC6A 4PINA 4TZ0A 1RQLA 3ZUPA 4JYAB 2IPMA 3N3BC 1RC8A 1YT5A 3CRQA 3O7WA 3OCWA 5DI3A 4ZVQA 1L9KA 1GP2A 1NLYA 4IDAA 1T0HB 3KT0A 3L0CA 4WHMA 4HDRB 4HSEA 3SQWA 4JBGA 5ALHA 2XZLA 3C0KA 5LQMA 1AM4D 1IULA 1XTIA 2D4AA 2IPOA 2RAVA 3LBIA 4FR2A 1KXZA 2R60A 1DKRA 1PUJA 3N8DA 1CJSA 2CWDA 3O8LA 4Q1AA 4BNDA 3R23A 3AUTA 1GZ5A 3OE4A 1P1KA 2KJQA 3VR5H 2H4HA 1N5MA 2RHBA 2XDWA 4JQSA 1P0QA 5EKUA 1FX0A 1XEAA 4ZVKA 1B8PA 1Z47A 2EFJA 2PXAA 2W48A 5D01A 5E7JA 3VKFA 5B3LA 1OOEA 4TTIA 3U44A 4MTCA 3EW7A 1I24A 4FFWA 5D6OA 3UAZA 1N8SA 2CFOA 3UJ7A 1J33A 4MB2A 1DAGA 2Z2ZA 3QLVA 1F48A 4G5YA 4HQRA 5BV1A 3FIJA 4WZBA 1KH3A 2IIQA 4UASA 2VWPA 4IQ4A 3E3AA 4BKUA 3RUDA 1OXVA 4WJKB 3OE7A 2YN4A 4YRQA 5FI5A 3PEWA 3WGQA 4GWGA 2GEBA 3OCVA 3PDIB 4JLJA 1DXOA 1Z5PA 3TPCA 2ZJFA 2E0IA 4HWKA 4OKSA 2J5QA 2C96A 4EGJA 1IPFA 3COSA 2FR8C 4Q4JB 3ILXA 2Y99A 3RK4A 1QHGA 3SEFA 5IKXA 1PNTA 4BGDA 1GADO 3FUUA 3PQCA 1XZDA 3KD2A 1O1YA 4RDHA 3GZTB 3UKDA 5A04A 3PFCA 3LUPA 2MSCB 5P21A 2GESA 2VYFA 3H65A 3KR9A 4EHHA 1WMBA 4QBTA 4MWBA 5PGMA 3CNEA 3I6IA 2OYSA 2Y4OA 4RZSA 2R8XA 3O31A 3TLBA 5K0NA 2A5DA 1D4OA 2C0CA 3F9CA 3QW2A 1CRZA 2XWJI 2I6UA 2JDID 2ZUBA 3LPLA 4S1PA 5KNDA 4B80A 1NJFA 2AJCA 3F90A 2RGDA 1N6KA 1PF7E 1EESA 2W90A 2ZU0C 4KSBA 3IVAA 1ECFA 5G0UA 1AHPA 5CBPA 2QM0A 4G0XA 3J80A 2XIJA 4WKNA 4UXIA 3K20A 3L7NA 3DCYA 1LVUA 1VPDA 2OGTA 1UDAA 3OZGA 2CNLA 4EITA 4AJPA 1JFFA 1MG0A 3G2QA 2PMCA 1RWQA 2RB4A 2YS7A 4UQOA 5GWXA 3BH6A 5TGTA 4N03A 5L3ZA 3A4LA 3MT0A 4KQ2A 1GNRA 3BMQA 3GGPA 4KIWA 2BWJA 1KZ9A 4HH3C 4JI7B 3QLVC 4A4DA 5L7TA 5CNMA 4PG8A 2FW9A 3R5XA 1KFEB 4OQDA 2ZSFA 2QTGA 1DO0A 1KL7A 3D8RA 2J59A 2BFCA 3IOCA 1PWZA 3MS4A 1DUSA 4YS6A 1EJBA 2PRJA 2QZZA 1PN3A 3SX4A 4M0CA 5F4BA 3FJOA 1ADGA 4QVKA 5IJ9B 4JXKA 1EWYA 2I3GA 2R4UA 2NT4A 2GARA 2P2DA 4C89A 3B2QA 2A9PA 1TCAA 2YVUA 5E2AA 3ET5A 1TX4B 3IAS6 1KQOA 121PA 1X1EA 2H52A 4ZYZA 1DMRA 2AI3A 5HOQA 3KP1A 4AJ2A 1E1LA 1E8MA 1HLPA 4UQLA 3MBOA 3PR1A 2F9LA 1RYFA 1YB1A 1CR4A 2Q6VA 1PZEA 4BQEA 1XYYA 4RULA 1G5RA 2JLVA 1W52X 3GI1A 5FIUA 4W82A 4O2RA 5AXDA 1QVRA 4QDOA 3R7BA 4LX8A 3RLIA 3AWDA 4MUYA 3QMPA 5LQCA 3BRCA 5C5EA 3FWHA 4ENTA 1VYUA 3WR5A 3EVBA 3ZTWA 5CVDA 3JASB 1QRDA 4HPWA 3IUYA 4LSZA 1EHCA 2H2HA 4Q4JA 4TTVA 3WIOA 2FSUA 1N9GA 1Z6ZA 1DQRA 3HFSA 2H5IA 4IILA 3EYWA 4R41A 4HTFA 4JOQA 4R68A 2Q1WA 3WICA 4D4JA 4EX6A 4PGFA 3ADBA 1Q83A 4KPYA 4DVGA 4JDUA 4RBNA 5DEIA 1GEEA 1CVIA 2CNDA 2H16A 2QE6A 4YJ3F 4EAQA 3B1FA 3NW9A 5HJ7A 5JWRA 2FPPB 1T3ZA 3S2GA 5EIFA 1WDKA 4P7JA 2I3DA 3ONVA 5LB4A 1PFYA 1NBEA 3QVJA 3ZNQA 2J6BA 1H6DA 4NAUA 2HWXA 1KO7A 221PA 1T3HA 4N6OA 3FNBA 2JZNA 1I1HA 2YZMA 2VCEA 1GNQA 1KMHB 1LW6E 5ARDA 4Y9RA 2ZUSA 3GLIA 3KQKA 3U44B 3SYMA 1LS6A 1UM9B 1O95C 3PS9A 3TAXA 1LRJA 2GF9A 2P2NA 2X7HA 2RK3A 5L95A 1LLQA 1E1YA 1SCDA 1WKBA 3DGFC 3HNOA 4I4TF 4IDFA 5I7WA 3TG8A 3NVMB 1Z63A 4AUMA 3WZMA 1UMBA 3Q11A 1VIVA 2DULA 1CP3A 3F6YA 4N12A 3GG9A 1GCAA 1DEOA 1JFLA 3ENQA 3ADDA 1JNXX 5TIIA 1YE5A 3OM9A 2XGSA 3QBDA 2DEUA 2JIZA 1JH8A 3L0BA 3UJDA 3TQTA 1VPEA 2MR5A 2NTEA 4KWHA 2BSXA 2PZBA 1ILEA 1WCXA 3WHPA 3OPNA 4FMPA 4C4RA 3KTOA 3AY6A 1D0SA 4RESA 4E2WA 1OH7A 5E2IA 4INJA 2XD4A 2D1QA 1QE0A 4K9RA 4KQMA 1QU2A 5K01A 2ZYSA 3GJ0A 4HH4A 2WP8J 4DUZB 4HFRA 1QO9A 3WRWA 3CSSA 1FFXA 2EVWX 2ZG6A 1MR3F 3GOHA 3KE9A 3ILVA 4MP8A 1XP8A 4IL5A 1BMTA 4QOSA 3HLKA 5ITSA 5JI3E 1G5PA 5DBIA 4HVLA 1OB5A 2H65A 3GUUA 2B21A 4A27A 1LBEA 1LDMA 1OW3B 2QVCA 4EPYA 3UJCA 3HRIA 3TTXA 3L7IA 4V0QA 4MVJM 2P62A 1P81A 3ZGNA 2WKWA 3EXFA 4AUEA 4XWOA 3WWYA 2HXYA 2QT9A 2F4NA 2Y6UA 3NWOA 1KI2A 4Q1VA 3WJ1A 3WS7A 3AU8A 1CLUA 2HU2A 1CUYA 1TU4A 4XVRA 2CB0A 1VKHA 2W93A 4GYYA 1AMNA 1CUVA 2J3MA 2VZEA 5JCOA 1QIHA 4QOIA 4TN1A 1XXHE 3AYXB 4BCCA 1GZ7A 1S3SA 1TFRA 2F48A 5CK5A 4GAEA 4G37A 4GPAA 4Q3DA 4LF7B 1I14A 3M70A 5F7XA 4LDQA 1TC2A 4IXDA 5DNCA 1Y6JA 4C30A 4BVEA 3AJDA 2CUZA 1XBTA 2XT9A 3MLEA 3D5QA 1UWCA 4INOA 4L78A 2H00A 2JGDB 4Q3BA 1LPSA 1BRTA 1XTBA 2GMWA 2R4QA 1CJVC 3B1XA 1M7BA 4C1BA 3GPLA 1RPZA 4IDGA 4JU9A 1GAQA 3QXHA 1XXHA 2HOQA 1F4PA 3LYAA 1RRMA 4GOOD 2XWSA 4UTVA 2Z6AA 2GHIA 4PTYA 5BYBA 3OP4A 4RWZA 3KXLA 4IMIB 4LCEA 4TLLB 2V8BA 4E08A 4MJ3A 1TEZA 4B82A 1KARA 2H9IA 2B92A 3U7GA 3R0VA 4CCSA 2MYTA 3L02A 2WT9A 3OEHD 4NFLA 5KQSA 5FBHA 2OCYC 3U4HA 2J3EA 3WHIA 1KI4A 5H7XA 2GBPA 3B60A 2G0TA 3CEJA 4N7JA 7GPBA 3KJIA 1AX9A 4LC1A 4JX8A 2OBYA 3TW0A 3CEAA 4JBYA 4JLSA 2FV8A 1AURA 1GPJA 1SUWA 1WABA 1Q1GA 1A7AA 2EKPA 2PSSA 1Z36A 3NPAA 1KI7A 4Y2XA 5HCIA 4FMCF 4YCCA 2RHWA 5CT6A 1GRQA 3CF4G 1CUJA 3IAM1 4P4TA 3DDCA 5AXAA 4OYYA 1R4MB 4PYQA 3ZXSA 3FVRA 5EHGA 3BGOS 5ECGC 2XPCA 3OPXA 3BB1A 1L5HA 1UINA 4GZ3A 3ANYB 2ZYVX 1YBHA 4LV5B 1L4YA 1QC5B 3SXUB 1ABBA 1PWEA 5TVGA 3W5SA 1QMGA 1ZJZA 2Q5LA 1PBTA 3AH8A 1N6OA 3CZ9A 4KZPA 3MCUA 4OQEA 4QJBA 4R8MA 1XTRA 4E2XA 4EJSB 4RF5A 4L8FA 3Q8MA 2JFHA 3RIGA 2OK8A 7YASA 3W2GA 1SQGA 3PCTA 2QZSA 2O2IA 1IN7A 5JOQA 2XA2A 2HJVA 3W6ZA 1I3LA 4XDYA 4HSGA 3LDFA 3MUEA 2X2FA 2NZVG 5LP6A 4E07A 6CHYA 1JEAA 2G9UA 1RI5A 2NQTA 3GN1A 1UJMA 1WPGA 3K31A 2HREA 3PLNA 1LC0A 2P9ZA 4RNCA 2EZ4A 2OP1A 1M2VB 4CEIA 4KJXA 1PT7A 3RODA 5LMUB 4HX9A 3W6PA 5EMJA 4PQYA 3PV0A 2BBSA 1KPHA 3KX2A 1P4JA 4BUCA 4AI6A 5K6RA 3D6VA 2AMFA 3ASVA 1TM4E 4PC3A 3PX7A 2O0JA 1TJPB 3A70A 1AKYA 3CR7A 1B8NA 2HK7A 3M7IA 4M1ZA 3T5MA 4BJHB 4RGBA 2GVZC 1J2RA 1Y33E 1P8JA 4DVJA 1P3JA 3H5IA 2IHVA 1DWPA 4TMVA 4LZAA 5HK9A 5J2UA 2UZ4A 1X92A 3HO1A 1U0JA 4Q15A 3TR0A 6PFKA 5F7OA 4NARA 3TTYA 1MW8X 4R7GA 1XTSA 3PCRB 4HWPA 1EGAA 1R8YA 4XOUA 2K6GA 2J85A 1RZVA 2JAWA 4XJVA 3EPPA 1CDZA 2PZGA 1VG9B 4IGFA 5EP2A 1XMPA 2UYQA 3O2QB 4X90A 2MR6A 3RYIB 3G2KA 3NT4A 1F7UA 1Z25A 1H8ED 4L2IA 2Q0HA 5CFLA 3Q2KA 4WXPA 2B4RO 5CCEA 5E9QA 4ER7A 3BQMB 3VAAA 2NU8A 2WVJA 2Z8XA 1HL7A 4ZRDA 5IJAA 1OZGA 4XIFA 4ETIA 2VHXA 1O7JA 4TUYB 3EZ2A 4XM0A 1VG0B 1L4EA 3QWBA 4XTCS 1E5DA 3GC6A 1I13A 5TLSA 1S8FA 1F8UA 2X0JA 3ABQB 5AHRA 4BWGA 1V7CA 3IL2A 1ZVMA 2PQ2A 3A6HA 2FFHA 4JYPA 2GK3A 3TN7A 3BMQB 4MUNA 1JKMA 3DXYA 3FUCA 1GGKA 3EWSA 5SICE 1P7PA 1YDHA 4YTEA 3TOXA 2J9RA 1TIKA 3AF0A 3A2MA 5JXWA 2YYSA 1QX3A 1EK6A 5BUCA 1ZU4A 1A9YA 1G3IA 3RM3A 1YCFA 3F78A 2F1IA 1I0LA 2H3EA 1XTJA 5IANA 2C7GA 3C6KA 3LV8A 4FWBA 3THSA 3ZV5A 5KSZA 2IH5A 3BE8A 4R2WA 2GHQA 1I01A 4K3UA 4O2AB 4O3FA 3O7MA 3IQEA 2QVYX 2Q0QA 2Y8EA 3HKCA 3KC2A 4HRVA 1NDUA 4C2UA 1P1CA 2ZQZA 1NATA 3GLHB 3THYB 1E20A 4PSUA 4DUYB 5FNVF 4TTAA 2IBTA 4D0NA 1KVSA 3DEZA 3HJAA 4EOGA 1ESCA 1CNFA 2W8ZA 4ENPA 3EF3A 3DMTA 5AQEA 3IP8A 4C0JA 2F3TA 2R7KA 3FPFA 3GNSA 1R8XA 2VCHA 3JR3A 3L7KA 2OSVA 3VR4A 1FUYB 1BQ4A 1TL7C 1Z6XA 1A9XA 2ZJ7A 1CZUA 3BMOA 3KVVA 1N6HA 2C2GA 3LCUA 4BLSA 3KOUA 4CN8A 1ZM3A 5CPFA 4ZMRA 3WMXA 4RKRA 1B3RA 2JIQA 3F8TA 3IAEA 5C37A 1K6EA 2IXBA 1HDIA 2OD2A 3D9QX 3QKWA 4F9TA 3FMVA 5B64A 4GVLA 2HCFA 4E4TA 1IU9A 1CY8A 1GU0A 5CNIA 4AMUA 2IJGX 4Z5XA 3OJCA 3V5NA 4AMGA 4CLRA 4IXWA 3LX4A 2VHZA 1C0PA 2OFWA 1J2JA 3BTSA 2O8BA 3HV2A 5EGSA 1PK8A 3ET4A 3HQ4O 3N28A 2CV1A 2YWCA 3O2NA 3KJHA 1EB9A 2HDWA 2Z9CA 3PRHA 4AY4A 1QRUA 2R84A 4O4LF 2BEUB 3RDPA 3E9CA 3ZU4A 3DTVD 4WA7A 4Y6LA 4QJ5A 3V80A 1EFPB 3I64A 1IPEA 4BQPA 4PLCA 4WEOA 1MP0A 3RADC 3E81A 4GLBA 4X65B 2FETA 1HRKA 3OM0A 1L5NA 5LWHA 1USIA 3DAHA 3DB1A 2X41A 5KYTA 1KY2A 4KE7A 4CODB 3N2IA 4G23A 2YIDA 4NZNA 2WM2A 3TVYA 3INGA 3O83A 4TXJA 1RC0A 1X7HA 2COEA 4NIMA 2IWHA 1W34A 1ENPA 4Q7JB 3IMCA 4X1OA 3ZBUA 3P94A 5F76A 1Q84A 4S1TA 4F2PA 4O4HA 4D4KA 1CRWG 2V6FA 4BEBA 4IHJB 3DZFA 3ZBTA 2ANCA 3FSRA 1M7HA 3IS3A 1V4VA 3UGTA 5KVAA 4EO7A 5LDHA 3Q6NA 3IB3A 1IY8A 3UAGA 4ZTBA 3AKZA 3E7DA 6REQA 1N7IA 4LNAA 4D3ZA 4RHFA 3DFFA 4POOA 1QOZA 2PU7A 4IEEA 2FX5A 4C7KA 2PO5A 1DC5A 3BB3A 1OH8A 4O1MA 1E3EA 4L50A 4CMAA 3GQBA 4DLWA 4FD2A 1O6FA 1PGNA 2XAAA 3KHUA 5IT4A 1VLJA 3LQYA 2QPLA 3IE0A 1DT3A 1FNNA 4WNAA 3GCGA 3LU1A 2ZJBA 4M0PA 2O7QA 1Q1QA 3STUA 2RGXA 1RYBA 2B0CA 3W4KA 2LGJA 5EP4A 5HJ5A 3IESA 3DT6A 2NUPA 1YTUA 1C3VA 4RPHA 4AKGA 1XRSB 2ZRKA 4YP7A 2QQFA 5KQMA 1B8OA 3NHMA 3TW8B 5I45A 2X4LA 3PEYA 2YFYA 2HNKA 2XRMA 1DVRA 1WZEA 4WX2B 1YFZA 3G0GA 3BGDA 3MRVA 3NIGB 1WAMA 4C7XA 4Z4IA 2EXXA 3HUDA 5HPYB 1XZBA 2RHRA 3PNQA 3CUKA 3A1TA 4DDUA 4EI8A 1JLLA 1ZJ6A 3GAMA 1RJWA 4UMVA 1FRZA 1H4QA 1VPWA 1GLVA 1USGA 3BGVA 4YUZA 4TV9A 1JI0A 1BROA 4HEHA 1R1DA 3MYRA 4LTMA 7MHTA 1X7WA 3N6RA 1VIYA 3D7MA 2ZCUA 2ALJA 1V9LA 4CUJA 3S4YA 2O8BB 4LPSA 3STVA 2MINB 2X9LA 3WB1A 3ZI4A 4G4IA 1E4YA 3KV3O 1X2BA 3V33A 1I6KA 3OCXA 2C7OA 5JATA 1GOTA 4GM4A 1P1JA 1N0WA 1XFDA 1GT6A 3F46A 5I48A 4RTNA 2GXQA 3UJHA 2PCLA 3CRW1 4IS2A 4ZAGA 2LVBA 1NVTA 2OQ2A 5BPHA 2DR2A 4CEHA 1Q5PA 1L8QA 4H35A 5KTSA 1U9JA 6GPBA 2AOVA 2D5IA 4FFNA 5AOVA 2X9QA 2C95A 3Q2IA 4HLCA 4CF4A 4MRMB 3USCS 1UJBA 2LCIA 1GFIA 4DREA 4Z6KA 2OV4A 4NYIR 5EP1A 2E4YA 5EMMA 1F06A 4U6SA 5UKDA 3FNGA 2ZZMA 4BV9A 3P2YA 4FQ5A 3AGQA 1GUYA 1F2DA