2LR0A

Solution nmr structure of de novo designed protein, p-loop ntpase fold, northeast structural genomics consortium target or136
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
134
structure length
134
Chain Sequence
MKILILINTNNDELIKKIKKEVENQGYQVRDVNDSDELKKEMKKLAEEKNFEKILIKSNDKQLLKEMLELISKLGYKVFLLLADQDENELEEFKRKIESQGYEVRKVTDDEEALKIVREFMQKAGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of de novo designed protein, p-loop ntpase fold, northeast structural genomics consortium target or136
rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords P-loop ntpase fold
total genus 51
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lr0A00
4J29A 2KPOA 5GAJA 2LTAA 2LNDA 2LV8A 2N3ZA 2N75A 2LRHA 2LCIA 2L82A 2LR0A 2LVBA 2MR5A 2MR6A 2L69A
chains in the Genus database with same CATH superfamily
1BHQ1 1ZEJA 3RU9A 1GTL1 1SCUA 3O8CA 1DAHA 1G5TA 1HL7A 1OSNA 3RU2A 1E1QD 1YFZA 2ODTX 1E4EB 3C0KA 1KC3A 1E1QA 5KO2A 3NJ8A 4LGVA 1UXJA 2PA0A 3HVRA 3LW8A 1C3EA 1YB4A 4AY5A 2ECOA 1XZLA 1D04A 1T9KA 3IOYA 2P68A 4NMHA 5DFAA 3CUVA 2ZJ8A 4J07A 2PDAA 4FYMA 2GZHA 2P41A 3H18A 1VE7A 3D1JA 4JJFA 1ESCA 1YRLA 2JIPA 4KN9S 3DKIA 3EGDA 1CFZA 5A0VA 4CWAA 5HCNA 3WHIA 1RP7A 4MV3A 1IZ7A 4RKRA 3VDNB 4OOEA 4U2GA 5T3UA 3K9HA 4LTMA 5CH8A 3OIVA 2GD2A 2JH3A 2ODBA 3P9QA 4G8JA 3R7LA 4CMCA 5INTA 1PNQA 1IULA 4L5AA 4E14A 3TAUA 1XTJA 1DAOA 4KDEA 2HNAA 4JLJA 4KE9A 5JMWA 4HRVA 3T5AA 1WXDA 4I50F 5JXGA 4JU8A 4Y2XA 3CA8A 2NSHA 4H2DA 1TEHA 1JNXX 2O0JA 3U7QA 4OXRA 3QLUA 3V55A 5JZVA 4R2LA 4YV1A 1PV2A 1CTQA 1I2BA 4DVGA 3C2QA 1S3GA 4KLAA 1XP8A 2N46A 3F2VA 3G89A 1WA5A 2B1IA 1QTRA 2GN0A 4M9RA 4WN9A 1MO3A 1TYEB 5K3AA 4KMMA 1N5LA 2BGRA 4RABA 2QE7D 3WQRA 4JJAA 1I7PA 3CCBA 3MS2A 1ZJYA 3NVAA 3HACA 1UBRS 4ALMA 1BN6A 1ZYUA 5H7XA 2OD9A 4EO4A 2XVZA 4J0GA 4K40A 3EA0A 1U0GA 4JYBA 1HSZA 1I4TD 3FWYA 2F8LA 2E5FA 2CVHA 4F3NA 3KYBA 1N0UA 3WYEA 3R5SA 5TVGA 2VJCA 4P4TA 2P30A 3KZNA 4RD6A 1XZCA 3BHMA 4YACA 3FX2A 4D3XA 1SUIA 3ZEAA 4HY3A 3QP9A 5DZSA 2OV1A 3WRYC 3Q1KA 4WOBA 3FLBA 1USGA 3PHHA 2ZJ0A 4AROA 5T7BA 3NV7A 1KJ9A 4WNYA 3II6X 2ZUDA 3RT1A 3ZLTA 4PRLA 1NVKA 5F4BA 1ODSA 1DE0A 1P2FA 2VDWA 2CN1A 1VPVA 2H2IA 2IHVA 2NSYA 2PQMA 3CB4A 3PC2A 4MW9A 3EIHA 4K81B 3UCXA 3GJ0A 1FJHA 2OAGA 3D5TA 5DYNA 1A7AA 2I1WA 3HU5A 5ALLA 3J81k 4BCBA 2JLZA 2PWAA 1MO6A 1XDUA 5GJBA 3VH4A 1M76A 1A8QA 5KREA 1DKOA 4ZRNA 5AP9A 4IDDA 3I04M 2AH5A 2H06A 1TM3E 3OCVA 1P74A 3BMOA 4R83A 1XT6A 3LK6A 4C2BA 4D57A 1Z4NA 1IZZA 3PLRA 4BU1A 1N1MA 5EXEA 4BDSA 1NR7A 3DV9A 3ELWA 3UUEA 5AVQA 3ND6A 2JFUA 4U7WA 2FW9A 5ELMA 2SKEA 3O0DA 3SGLA 5ABPA 2LTAA 4YMIA 2LUOA 3USCS 5JY6A 3UPUA 2J0SA 1N75A 2CCJA 4Z7NB 1DBSA 5KSPA 3D43A 5AM3A 4A91A 2ZBRA 3MGCA 3PGJA 5EIXA 2NZJA 3OEWA 1X38A 2OBBA 4CG1A 5DJ5A 2BSAA 3LVBA 3L4KA 3O8QB 1BWRA 1G3IA 7REQA 3OU2A 5ENZA 5IT9A 3D5EA 2D62A 3ST7A 2XCIA 5JSZA 1KEZA 4PX2A 4YT4A 2W0SA 1KK1A 2P8SA 2WAAA 2C9ZA 3CS3A 3EDRA 2IYNA 2NU6A 2JLQA 2FG6C 1FW8A 3DXYA 1COZA 5BR8B 1IY0A 1ZRNA 1L5RA 3P9CA 1XCPA 4RGVA 3HWSA 3V4RA 4QVIA 4NENA 4MPJA 2OHHA 5CB8A 1YS6A 5HDBB 3WICA 3W8NA 4R3UC 1VHDA 2YV4A 2EX0A 2OZLB 1KORA 3ZIUA 3ZWNA 3V4SA 3U7JA 2JFWA 4X24A 1FNBA 4MDHA 1ZMXA 1KIFA 5JQGB 1XFAA 5TQ2B 2V59A 5DMHA 4IGEA 3SMVA 5HWSA 5EP2A 4ZI5A 3W6UA 1Y8CA 4BV8A 1Q0HA 1UDRA 3FLAA 3VO2A 3C24A 2X8AA 3FHTA 3ROMA 5I51A 1N8NA 1KOFA 2XB9A 4GEKA 4IRUB 2VBIA 2WIKA 3TKLA 3KIPA 3T54A 4MKIA 1QKJA 3H5OA 1YB2A 1ZXBA 4PQRA 3V34A 3JARA 2ZSHA 1JA9A 1GP2A 3IRVA 4B5KA 2C9DA 4EFDA 1HC7A 5A03A 4PC7A 1NN0A 4WXPA 1XDWA 2RGNA 2FOXA 4DIDA 1I2MA 2FQ1A 1L1QA 3A4TA 1N33B 2D4HA 1PGPA 5EXSA 3TOVA 3P26A 1V39A 3P9XA 4EHAA 4ZZ2A 5T57A 1Z4PX 2GAAA 4EG7A 4GP6A 2LCIA 4HAWA 2HEIA 2XGOA 3G2NA 3OZAA 2C5HA 4BB5A 2R2GA 4YRKA 2IUYA 3RVNA 4BX0A 5LOVF 3UK2A 4XPIA 2XYHA 2GNPA 1ES9A 1K2WA 1XTKA 1VMDA 1YJAA 3OCWA 4FP9A 4KYTA 4XDHA 3WB2A 3GEEA 1OBVA 4X8LA 5IXSA 2F17A 2FUCA 3PHGA 2GJ4A 5AJTA 3N2EA 4EKDA 4LOAA 3ZKAA 4YMWA 1XLVA 3G02A 1SCAA 5ES3A 2FWRA 1UOOA 1MC1A 2CLDX 4RJ2A 5DN6A 4EA8A 4V1CB 3K6SA 3OQIB 1JDUA 2VXYA 3EOAI 2WYWA 1PLKA 1YCGA 4NBLA 4W5WA 3ZJYA 1B14A 4M8NE 2PL9A 5AM2A 5CFNA 1IXYA 3F9IA 3QPBA 2P77A 4LSZA 5T3YA 3LQYA 2AOTB 2IIBA 2ZRNA 4KQJA 3FB4A 4BZXA 4CMIA 4O0LA 3GV0A 3JYOA 4P33A 1XE3A 3FDIA 3TNLA 4EB8A 1ZUNB 2H4YA 1O97D 4PLHA 1D3AA 1QUFA 2Q4DA 4ZU3A 4RF5A 4Y2TA 2WJVA 3R8FA 5G40A 1RC0A 2PWYA 4X91A 5K8VA 1W0JA 3F4LA 3NEAA 5CM8B 4EABA 2X8JB 2YDXA 3BZWA 4GKBA 4TSFA 2PQ2A 3SXUA 2AW3A 4FZ5A 2UZ1B 1TA0A 4QU5A 2UV8A 1OBOA 5J5VA 4NFSA 4OOFA 3MLBA 1GZ6A 4RS4A 2PGIA 2IOYA 3LA8A 4Q48A 1MJ5A 2VP2A 1FS4A 1WLYA 4S1VA 4XGKA 3ZZMA 4Z0PA 2PGJA 1CUFA 1QH0A 2BZGA 3UAZA 4EPYA 2YRXA 1KRWA 1W76A 3NHRA 3SHQA 3V00A 5BVHB 3RPEA 2HK9A 3IQDB 2CMDA 2W2XA 2ZVJA 1EJ6A 5DYYA 5ALMA 4C4TA 2JI4A 5G1NA 2TRSB 3EYWA 4RLQA 4XUDA 4JC5A 1J49A 5BN5B 1E5QA 4JUAA 4L3OA 4DRXA 1PQWA 1SIWA 1CS4C 1JZSA 3L6OO 4CEJB 2G17A 2GHIA 2R5NA 3C6KA 2Q3HA 4LEIA 4R71A 2WHPB 4DDKA 4DWWA 1JFFB 4OAPA 4UM5A 3CRVA 1MB9A 2XQVA 2OM2A 1C0PA 3VU9B 4HC4A 4A1FA 2E18A 1PX2A 4QOFA 3ZVLA 5K4HA 3ROTA 1IQRA 2YVAA 4FKZA 3CX4A 1UPCA 3EDMA 4RKQA 5JWHA 1PHRA 1Q0RA 2F43B 5CYOA 3REOA 3CLSC 3J7TA 2CF6A 1QHGA 2YHBA 3L6UA 4HYTA 4LMAA 4V24A 3OZUA 1X92A 3HXLA 2Z5LA 2AW5A 4ND4A 1Z4LA 2GLTA 4O2BA 4BVKA 3IPXA 4CODB 3WYDA 3WGNA 3PX2A 3QX8A 3IE1A 1KU0A 1XQ9A 1QM5A 1XD9A 3FKSD 1ZDMA 3K15A 3AKYA 4WK4B 5DTRA 3UJPA 1G9SA 3NORA 4Q1DA 3GLIA 3JYNA 3SZGA 4YRAA 2W58A 3TVDA 1K89A 3L40A 4XD7D 3MCUA 3PK0A 4B09A 4C0XA 4DJDC 1JSXA 2VQ3A 2Q3BA 3RS3A 4ZV7A 1TQ2A 1V6SA 1CB0A 2CUZA 2QXTA 2ZE5A 4JAVC 3TLYA 4D98A 5KOYA 3K9NA 5A0TA 3UT6A 1JEJA 2IQIA 4CW7A 2D4AA 2EKPA 4RPKA 2WUGA 4P2BA 4AVYA 1EVKA 1FBTA 2XUQA 5AK0A 5KNCH 3ZHZA 1DCKA 4RVNA 4MQFB 5HHTA 5IN4A 6ABPA 3S2ZA 1S9HA 3I2KA 2REXB 1C4OA 1XAIA 1UKZA 1XHLA 2XCQA 3DAPA 4Q7QA 1S2GA 5KTYA 1UMDB 2LIVA 1PTJC 1NLMA 1LEHA 4Z7QB 1MC4A 3RABA 3UHJA 4BJ1A 2GNAA 4PC1A 4ETNA 5L40A 1U6KA 2WHPA 3TQQA 4XRGA 1X7XB 4HFRA 3E4DA 2RCNA 4INPA 5B7QA 4D8YA 1RYHA 3GFVA 4HO1X 4E4TA 4ZYVA 4G23A 4I4TB 4YGYA 1SN7A 3IP1A 4YRBA 3RYTC 3A6DA 3DZCA 4IICA 3SIXA 1N9KA 1PFYA 4P4NA 3L0ZA 5AVZA 2RFLA 1NIJA 3Q8XB 4OUKX 1LI5A 3DUFB 2GA9A 4S1NA 5AHWA 1Q3KA 1VL5A 1YH3A 2QMQA 5DBOA 1R9JA 1S2MA 2CXNA 3EZFA 4L73A 3A4LA 4DQVA 3TE6A 2X77A 4EB3A 4HS4A 1O5OA 1V43A 1LNZA 3OT5A 2PUDA 2X22A 3MQFA 4G1BA 2JIMA 2XUAA 2WHYA 2ILVA 5H70A 5BQ3A 3K2IA 4GM0A 4F38A 2NLOA 3ZW9A 4FI3F 1A7KA 3HRIA 3E3LA 2Y4OA 4V0NA 3S1AA 3T06B 1RJ9A 3LC7O 3WMXA 1JHRA 2IEDA 3EZYA 2AG5A 2EAUA 3GRZA 5CLQA 1TRHA 2G1UA 3G5AA 3N3AC 2WJPA 4MGEA 2FRVA 4DMFA 4ABTA 4CQNA 3UYKA 2ST1A 4NOLA 1ONPA 3TLGB 4R2IA 4WSOA 2A4MA 2KW5A 1YUNA 1CD5A 1VDMA 2P5SA 3OCXA 4MV7A 2X4LA 2AVDA 2JCSA 1T15A 3GZTB 3OJOA 1Y8AA 4GBJA 2P7IA 5EOVA 1AQNA 3T9CA 3OMLA 3KM0A 3TMYA 3OAAA 4BVLA 3JQ6A 5A04A 2IH4A 3S7ZA 3I2IA 3O4VA 1YDHA 4YUVA 4K9QA 4QARA 3V97A 1COWA 2JJ1A 2OCKA 1IEXA 3DDHA 2X5XA 2FPOA 1PDWA 4Q3LA 5HILA 3IURA 1VYTA 2L18A 4HX9A 3CLHA 3K94A 2GT1A 3FNGA 3G1TA 1FLVA 1CZRA 4Z3OA 1RM3A 4JB0A 2ACEA 1V1MA 3Q3IA 3MTQA 4QDTA 4US0R 1A9QA 1GRNA 2GN4A 2VXOA 1E5VA 3MILA 3SZRA 1AB6A 4LCBA 2NM0A 3V7NA 4JLUA 1UC9A 1H9BA 4Q1AA 5K3OA 3M9LA 4CFYA 5JROA 2WVHA 3O4GA 1LLFA 3PIIA 5TS3A 3TTTA 2YRWA 2JB9A 3RVMA 2AOVA 2JEZA 2P1DA 1MO5A 4X0EA 5BNTA 5BV8A 3ZCPA 2NUAA 2RG1A 4JNCA 4LJ7A 4W9NA 3NIDB 1LBSA 1Z3CA 1QIFA 4BVJA 2DPHA 3AKDA 2B21A 2ZBUA 2DQSA 3PEWA 4HXGA 2M1XA 2JS7A 1ZUHA 1FFDA 3GYGA 1WSAA 1HT3A 5TDHA 1BHO1 5HA5A 4PBRA 1TA9A 4JI0B 3FJOA 4KXNA 5EKDA 3SZ3A 4DQ0A 2P75A 1JHXA 2ONZA 3NAZA 2EFCB 3WBJA 2XZPA 4IXTA 2Q45A 3CRMA 1YJQA 4A6EA 1XZDA 4U6QA 4KXQA 2AX4A 1CUAA 2EARA 5B55A 2WUWE 2PX6A 3CZMA 5DW3A 4UU7A 1LLUA 4QXQA 3H4MA 3ILHA 4KQ1A 3RKSA 1SXPA 2COUA 1U7ZA 4ZJUA 4CKXA 1GOTA 1A96A 3KETA 1TEXA 1WXGA 1F0NA 3A1EA 1VB3A 2D2EA 4MWBA 3CLUC 1EM8A 2EX1A 4UAUA 4DDHA 1CCWA 1RFGE 4WVFA 1JG3A 5GZ3A 4C7KA 3DR5A 3EA4A 1L1RA 1XQXA 5JJLA 2NZWA 1G6OA 2DHDA 4JJKA 3AI2A 1Y5IA 5LUAA 3VA7A 2OR3A 3THYB 1UM8A 1P2GA 4P7BA 3FPEA 4GI7A 5J2TB 4TVBA 1ULBA 2Y0PA 4GI1A 3ZTTA 4DUPA 1W88A 3OCZA 3CEPB 4U0KA 1RQRA 3ZIAA 2XOKD 2Y92A 3K1AA 4B3XA 5AWFC 1HDXA 4ED9A 2AMYA 1P4SA 1YWGO 1BDIA 4HNRA 3EB9A 4B84A 1CZOA 4RENA 4IUBS 5C7IO 5JFGA 5J2TF 1X14A 2OFWA 1PEYA 2O3TA 4MWEA 4L16A 2F90A 2QQFA 4MW6A 1P91A 5D1NA 3SK0A 3TDMA 4D82A 4YRSA 2ZSBA 1GTMA 2AUNA 1AO3A 1MC8A 2JASA 4FDVA 3PNBA 4CT5A 3TZCA 1JWAB 1ZG3A 3EQ7A 5TGZA 2BDTA 3U44B 1Y7LA 3V1UA 3MT7A 5ICCA 2WYHA 1ZOIA 1G3RA 3G79A 5BSTA 1U02A 3DEZA 3GLIB 1W49A 4I3FA 1U0JA 1FYVA 4BVBA 2Y27A 1E5LA 2E3JA 1HPLA 3HSYA 2JAUA 2B69A 4XUEA 1TJPB 4NDAA 3I32A 1NJ2A 4TMKA 4YXWD 5B4TA 1GQSA 5F77A 4R81A 3VJMA 2F1JA 1F8UA 1O5IA 4I55F 4KX5A 4MW0A 4TV8B 4S2EA 4X92A 1KYIA 3DMYA 5C8YA 1EKXA 2QBYA 1WCV1 2CXUA 1H0HA 4PLFA 4KGXA 5L95A 2WNIA 1GGHA 2MSLA 1CLEA 1VKRA 3KBOA 2W2PA 2Z2ZA 5HKLA 5J40A 1Z4MA 4AMUA 3TH5A 3LQ4A 7MHTA 4BDTA 4WFIA 1GQFA 4S1OA 4ZGGA 1JP7A 3BE4A 1SEVA 5J5AA 5JR3A 1P0MA 3H6GA 5H83A 4YQFA 2XWPA 4FGZA 1T10A 1UXOA 4HGPA 1XI2A 2XCSB 2K7FA 1RE1A 1QNFA 1Q1ZA 3FWKA 1LH0A 1B41A 2X7HA 1FFCA 3NBMA 2AZTA 2FR1A 2C3OA 2W2QA 4LTNA 3AW8A 2DGDA 3S0JA 4AZSA 4D0NA 4PV7A 4RY2A 1QJ4A 2NUAB 2HLDD 1XYVA 2GYYA 2PZMA 4FT2A 4TQ9A 3Q9LA 4Q9NA 4ND7A 1OLOA 3LXUX 4KLNA 3GA5A 1HLFA 3T5MA 4BBJA 1Z74A 2IY9A 3M5PA 1L7PA 3OFKA 3VISA 5KC8A 1VRVA 3JQCA 4F93B 3SG0A 2RHCA 3JZDA 1ITZA 1JKJB 4M4SA 4YRLA 3MMPA 2QRMA 1L4HA 2BV3A 4NFYA 4OHKA 1CUXA 3I9V6 1X9IA 1HETA 4Z7JA 1BH6A 4WADA 4QVGA 5CX1A 1P39A 3SBEA 2XJ4A 5C7YA 2ZB4A 3DZ8A 3IP8A 4A0GA 4IIUA 1MENA 5BT9A 1T0JB 3SQWA 3H99A 4BAGA 4WZAB 2PNJA 4EHBA 2OCLA 1UXIA 1WLSA 2P5TB 3AEKB 5LYJB 2Q3FA 3CT6A 3NHJA 1OREA 4S04A 2GO1A 3DE7X 3JASB 1FUYB 1H2FA 1NFFA 3V2IA 4PHHA 1EYZA 3AILA 2I6SA 1ONNA 1IEVA 2FZGA 5CXXA 1V0JA 1YK0A 3P9PA 3SZOA 5TQ2A 1SBYA 4YIKA 4DRYA 3NVKI 4G36A 2VP5A 3U62A 4CF5A 3THYA 4GPD1 3JZAA 5TS2A 3U1BA 3AFOA 4WY5A 4FB4A 3ASUA 4I0WB 2RD2A 4F2PA 2YL2A 1NASA 1RSZA 3L49A 4IFIA 4J7UA 5JSFA 2H5JA 3QUSA 4ZYWA 1CY8A 1QG2A 2JLXA 3NTOA 3DZFA 4IQ8A 4CTKA 5IJWA 5KTOA 2VA8A 4EF5A 1ORDA 3GVCA 4QDOA 4JI3B 1RWMA 2F64A 4QJ3A 4PLWA 1MR3F 1OT5A 1THZA 4PLGA 2VRNA 4EY8A 3V48A 4Y6GB 3JQ8A 5EJ6A 1MG5A 3PXCX 4JFRA 4BNFA 3MRTA 4XQCA 3ZWBA 5ALDA 4KAAA 1Y63A 3D6FA 4OHXA 4BTLA 2XE4A 5BWOA 3ZD6A 1GR0A 1XTZA 3K2BA 5GONB 1IB6A 2C3UA 2P90A 1V25A 2QI9F 5A5EA 2XB6A 3IAAA 2HO5A 1CJVC 1V6AA 1X86B 1BW9B 2G04A 2HWXA 3BRCA 2Y1CA 4MUNA 5KKNB 3LHDA 3S29A 2VKTA 2Y8EA 5J4HA 1LY1A 1WHTA 3KOZA 3HC7A 5AW0A 3PNOA 4MRVA 4AJNA 2E49A 3MJHA 3KDPA 4MWSA 2C07A 2AZDA 2D8AA 4WCVA 4DHWA 2C99A 1N6KA 1AF7A 2MR5A 1YULA 5DYWA 3VHXA 4Z6KA 3FTDA 2A57A 4HRYA 3TZLA 1ABBA 3RRNA 1ZSNA 4EO9A 1MW8X 3VR4A 2FP4A 3AV3A 2A9VA 2AZMA 4TV8A 1FDSA 4H31A 4KFRA 4DEVA 1ZVQA 3W6NA 4F04A 2GHTA 3C97A 4ZXPA 3SMQA 2VNKA 3V4PB 1EEXB 5FPPA 1II9A 3ZWPA 1DKPA 3B1JA 2F4VB 5IZCA 3EZ6A 3TAXA 1F0KA 3K6KA 3WLNA 3ZHSA 4P5DA 4EEXA 2Q6KA 3NHFA 4RVOA 1X13A 1JYEA 3FYUC 5HF5A 4BTVA 3JAMA 5F52A 1TQDA 1VSQA 3IXMA 4RZHA 5EUCA 4F4IA 5IABA 2NVUA 3G23A 4HLCA 4MLPA 2O57A 4AWAA 3TW8B 1QHHA 2OZKA 1G9TA 2ZWOA 4FLFA 1OU4A 4EUKA 5CB0A 1PWXA 4R6XA 2R85A 3CNLA 1LW7A 4EUHA 3F7TA 1W85A 2V7TA 2H4ZA 1OX4A 3L7KA 5A5DA 2PKEA 3ZHYA 1NMEA 1FMTA 3FMPB 4EO7A 1GGJA 1EK1A 2FRXA 1A2KC 2HCFA 1RXCA 1ID8A 4E5VA 2Z3VA 4ZZ3A 4QSMA 4K9NA 3IXQA 3CNOA 3PPWA 1MVOA 2PZJA 1QSGA 2PNFA 4FEGA 4RVHA 3RTEA 2XNHA 4Z9AA 1BO6A 2W6OA 3IR6A 2XDWA 4DSUA 5DHRA 1I4OA 2VTEA 4MJ3A 2BP7B 4YBRA 4ZDWA 1H1DA 2H7XA 2DWQA 3W8EA 5H3HA 4K8RB 4OGFA 1JT9A 1GL3A 2H9IA 5C1DA 2D0DA 1OAOC 3IBGA 4PW0A 3ZS8A 4HH0A 2VF8A 3GPDG 3C6YA 3MS7A 3OQMA 1E61A 2PXXA 4PWZA 3EEOA 4GZ5A 1YR2A 2CDBA 1F8XA 1JYSA 1TE2A 1ULZA 4LG1A 2V7BA 4NABA 5B7NA 1X87A 2IEBA 3V2UA 4B7UA 1VCOA 5THKA 3R23A 5IDXA 3H6KA 4KO4S 1LW6E 3H9CA 4OD0A 2RHGB 5KKAA 4MOWA 1GGEA 3FFBA 4AKTA 1SQ6A 4F3RA 1KH3A 3P27A 1GTRA 2YFQA 3DTTA 3LO5A 1R4MA 1YJXA 2IUFA 3ME5A 2OO7A 2F00A 3BGVA 1I1QB 2O2EA 1YJ8A 3A6JA 3NFRA 1RS0A 4IJ6A 1G64A 2FRDC 2H0AA 5CYPA 4DG5A 3R41A 1P81A 1DG9A 1MFPA 1PLLA 1Z25A 1XQWA 3BMOB 4RHCA 4LNUB 1LBQA 4YDRA 4B34A 4BKQA 2BHRA 4LCJA 3M1YA 1NOIA 3FZGA 4OHPA 4AURA 3WGHA 4FFMA 2JI6A 1LC3A 4BN5A 4DDWA 4L5YA 4RMGA 3T9EA 1XWWA 5DHPA 5B36A 3WJAA 4LE0A 3QKRB 1QGED 3FUWA 4LW8A 1RQGA 5FBLB 3CLTC 1GZSA 1BHJA 3EXFA 3FPHA 3KB1A 3ZNQA 5IDWA 1A9TA 4XIIA 1O57A 1K9VF 3I1YA 5FWDA 1BZYA 4M49A 3IOEA 4QASA 3W3AD 4QGFA 5IWAB 1E66A 2ZYWX 5L9AA 1E2FA 1VJTA 2I3AA 3MGKA 2P9GA 3F7OA 3F97A 3TFOA 2G80A 2IGBA 2P5YA 2FN4A 4RDCA 1GNLA 1VSUA 4XTRA 3WRYA 3HHEA 1XTSA 4HZUB 1Z0UA 4LGCA 3VNAA 5BW8A 4I9GA 5DWDA 5D84A 4GLJA 2H2HA 1SBIA 1FP2A 4LZWA 5KS2A 3W5SA 2HA2A 2FZ5A 2EW1A 4TMVA 4R9UC 5D00A 4BO4A 4EP1A 1WBDA 2QSYA 1FPMA 4LXYA 3EOBI 1UPBA 4FOLA 5JIBA 4QOHA 5BSEA 5LZ4A 2C96A 3WXMA 4XLZA 4BMXA 4A73A 3TD2A 2OBMA 1RRVA 2VF2A 3A14A 4JMPA 5GINE 4NJMB 1OWMA 3WQQA 3KT3A 1Z8HA 2Y1FA 1ST2A 3TBKA 2ZRJA 1CEYA 5T4BA 4ENSA 3GVPA 5FPYA 1YDWA 2IYAA 2OQVA 4AMVA 3RVRA 3NPAA 2CMFA 2GI4A 4WBXC 4A3SA 5DXAA 2Y6UA 2ZJBA 4PTYA 1JEQA 2EFYA 3LUBA 4RE6A 4KR9A 3M3DA 5MN4A 4BNMA 1TQHA 1IB0A 3H05A 3KRTA 3GYBA 1G8AA 5G0VA 2KWIA 2F62A 4IO0A 1UBUS 2GN1A 3AEXA 2O3SA 2H63A 5DGDA 4PYJA 1P1JA 1GZ7A 1TCUA 1VYUA 2CB0A 1KFCB 2XWBF 1U2DA 2AEJA 3OQVA 4OBXA 1DOAA 2ZKLA 2WFZA 3LT2A 2LDXA 3U7QB 2EQAA 1BKDR 1J70A 1KU6A 1X1RA 1L7XA 4KAFA 2XKKA 4CVNA 3GLUA 4TZKA 5CXSA 1C2TA 3BERA 3ELYA 4NEHB 3CVXA 1H2BA 3HXPA 3D9QX 2GM9A 2YXDA 4QU9A 3KJNA 1Z07A 1SK8A 4Q3AA 2Q0SA 4KX3A 5DIFA 2X7XA 2H7YA 4RSHA 1OBFO 1A72A 3QLJA 4AZTA 2WJGA 1Q0UA 2P2CA 1ZQ1A 1OBHA 1HEYA 1G5PA 4BC1A 4LRYA 3KAKA 3T94A 2JGIA 1W5SA 4EKEA 5KYVA 4KIFA 4UMFA 1K3UB 3V5NA 1Y89A 4BB6A 5HE9A 5CJ2A 3D6NB 5F7XA 4GXNA 2EFDB 2FE4A 1QONA 5KOJA 1UK6A 1O9BA 3PEVA 5EE1A 4B9AA 4AJJA 3SJBA 3FTQA 1OROA 3PEEA 1E79D 1IONA 1OXXK 2YVLA 4J0FA 4WJZA 3KFVA 4IEEA 4PPGA 2D59A 2I66A 1ISHA 5UKDA 3SM3A 5GADl 3L0OA 4FS8A 2GDJA 4JHXA 3UFXB 3JQ9A 4LBYA 5F7ZA 2ZSIA 3UJ9A 3AUXA 1T24A 2CNOA 4BQQA 5KQPA 5DV9A 2Z6UA 3A6HA 4C78A 5BPHA 2H1LA 1NQ5A 2PSJA 2P35A 3NHBA 3PDCA 3R76A 3THSA 1VKNA 1U2QA 4MYUA 2X2FA 4RVFA 1YR7A 3VJRA 1DQPA 3HJCA 4HNSA 2V4ZA 1H6AA 2D1FA 5IFLA 2FYTA 2VYQA 1LK5A 1Q0LA 1OAOA 3CZQA 5KWJA 3T4PA 2IKSA 4GBED 4NS4A 1E7MA 2VBGA 1M1YB 4EI7A 2JF0A 1DUVG 1M2KA 4B5LA 1H42A 1YVDA 3WLQA 4W1RA 4EK9A 3L79A 2I3BA 4Y2PA 3TQRA 5EJ8A 1G2QA 1Y1PA 2Q3CA 5ARCA 4X1IA 4OQXA 3I39X 3Q3GE 2AOUA 4MWDA 4R40A 2G67A 2NUTB 5EPEA 1F2TA 1NZJA 5FUWA 2F1HA 4Z51A 1DHTA 1F51E 1ZK3A 2P67A 5EZQA 2ETXA 5B6PA 2QAIA 2FJUA 4ZQIA 3H3JA 1WKVA 5FFFA 2QR3A 1B43A 1W36B 3B51X 5ICSA 4IF6A 2J6BA 3AKZA 3FDXA 2PV7A 3IAFA 3AVPA 1PGOA 5FUBA 1AXEA 2HJHA 2IT1A 4IG4A 1I4EB 3QNWA 4HPXB 1JQJC 4UNPA 3ED1A 2POCA 2BI7A 3A1VA 3H17A 3OEED 1Z7WA 4QFMA 2PUFA 5L3VA 4OEHA 3KKOA 3DL4A 3CNEA 2PV0A 3GG2A 5L3SA 4JQCA 3ZZNA 2BFWA 2BY4A 4HAUA 1GRRA 4L6CA 4G41A 4Q7KA 4QXMA 3S2GA 3ZLJA 2WFLA 1PG2A 1XAGA 4GI3A 1V1RB 3C6QA 1SCQA 4DV5B 1BDHA 3DLTA 1E1LA 3IEVA 4G01B 1TZMA 1XZ8A 2FEKA 2C04A 4G4SO 5D8DA 1DMRA 3CF0A 5GP1A 1A8PA 2HF2A 3I9NA 3RRZA 4UPEA 4PIMA 2FN7A 4BWGA 1RAIA 3G0CA 2VAVA 4LE2A 1SVOA 4HSEA 4PTZA 3GIWA 4B7AA 1RPNA 2FGJA 1CVLA 2MTBA 2PMFA 4YCJA 3AOEA 5EHNA 4BJHB 2NU9B 2Q2NA 4CCYA 1LD3A 1A2OA 5F2EA 1YONA 2JFFA 3K31A 1Q17A 3N70A 5KVQA 4GZ6A 3IA2A 3JX9A 2UVQA 3MRVA 4C0HA 1HDYA 1SBZA 3F1KA 3FZQA 1I24A 3H5VA 1S8AA 4PIVA 4GF5A 3B82A 1YE3A 2PIAA 2XECA 3WB1A 3UCEA 2W9XA 3EFHA 1KKMA 3OE4A 4BVGA 1YQ9A 1M6NA 1L5MA 4M46A 1E3WA 4ZT4A 4N5DA 3ZWMA 3UV7A 4EH1A 4UUOA 1SXJD 4BP1A 1WXWA 2OT3B 2VDQB 1UL1X 2R4QA 2Z4TA 3C3AA 4UATA 2HT1A 1E6KA 1CG6A 2WU4A 3F5DA 5F98A 4BKMA 1ZONA 5FNZA 1Q21A 3CNBA 4DCTA 2AJ8A 3RC9A 1XPUA 16PKA 1M7BA 1LJLA 3UGKA 2W2MA 1AQLA 1KOJA 1SKYE 1MORA 2DOKA 5BVGB 5JJCA 5FI1B 5DYGA 3INYA 4KWTA 2CL6X 4BGVA 4Y6SA 3QWIA 1HURA 4V02A 3EAGA 3LY8A 4I6GA 2OPHA 3TL6A 4OGWA 4ZOLA 5BNWA 5YASA 1FDTA 4PQEA 4MVJF 3WHLA 2PGOA 4D0LB 4FOSA 3Q40A 3HJFA 3GNLA 3SM9A 3NB0A 1JQLB 3ZQ4A 3LPNA 4K2HA 3JALB 1GL9B 2X86A 5JI2E 5BSWA 3VVCA 3W06A 3WKAA 3DPIA 1TM2A 1O6BA 2FSUA 1T9CA 1X3LA 1XXLA 1AQJA 4NYMR 3P9KA 4IKEA 1NLYA 2QUJA 4JBLA 3H9EO 3NC0C 3AIMA 4I9FA 5FPHA 5BP7A 2PEYA 1Z0DA 4BO1A 4BYMA 2G07A 4TMZA 3NTRA 5HS6A 1TZBA 4C4AA 2V7WA 2WAOA 5ILGA 1KGSA 1JVSA 1RXUA 3MXOA 3M82A 4H7DA 3ZYZA 1UDAA 5K99A 2I1VB 2RHJA 1R9MA 4PR3A 5ALWA 2VAWA 4ZYLA 1UEJA 1IWOA 3ET4A 3GGDA 4C04A 4ND2A 3OIWA 5EJAA 2IE0A 1NPYA 3LT5A 3RVSA 1GARA 2ALJA 3U4QB 3FKSA 3CINA 2FAXA 4RQAA 4E08A 1CF2O 2RJ3A 2QGFA 4PZPA 3FNEA 1IY1A 2CW5A 2J45A 4IWXA 1QHHB 1DKLA 1IZ0A 2ZYIA 4D8TA 1BNCA 3LKVA 4DCNA 1SHKA 1UFVA 1L0BA 3N6RA 3OC6A 4JD5A 3VKFA 3VU1A 3O90A 3WO1A 1TUBB 2ONJA 2V1XA 2ZUCA 1IHPA 3OJWA 3OF2A 5EIAA 4M54A 1T3GA 3CLSD 5LQAA 3D0QA 3M4JA 4AUNA 4EYGA 4R8KA 3HXTA 3TSCA 2ZT6A 3AL3A 4TT8A 2TSYB 2GBLA 4HLUA 1YQDA 2Q0XA 4EVIA 4JJZA 3EEFA 3PXBA 4K6MA 4UW9A 4DV4B 3AM5A 1J0EA 1RABA 3V1LA 3ZE7A 1E4VA 4FWIB 1MEJA 4RTOA 1EINA 521PA 5TX7A 5BUQA 4WNIA 3UG7A 4FFDA 4CETA 1EX6A 4L9AA 4Q18A 1SU6A 3KT8A 2PZLA 2N9UA 1DS6A 2WG1A 4EMSA 4XTCS 3ESXA 4M8LA 4YJGA 4ZQFA 3QIAA 1Y1SA 1DRVA 2HM7A 3EUAA 4M0PA 4QNMA 4MMZB 1QYCA 3Q3EA 3WFZA 5I7VA 3V46A 4B3CA 5L51A 3ICQB 1M73E 3I92A 2RGEA 1MJFA 1CUSA 1HQCA 2YOFA 4IWYA 3WFJA 3QEMB 4C0SA 5IDQA 5JVDF 4FCVA 4MMYB 5EC8A 2G76A 2Y0EA 2G8NA 2H1IA 3OZFA 1ABFA 4MI1A 1L8QA 1XV5A 3H9GA 1NVUQ 3QOWA 1WMEA 4ZIRB 2I99A 1AB5A 2AFRA 3W77A 3RJ9A 1FNMA 1JEYA 3AL0C 3ENQA 3L41A 3L6DA 3O6VA 3VNBA 3CNNA 3UK1A 1WO8A 1KZ7B 4O4JF 5AI9A 3TUJC 4DHEA 4F9TA 2P2LA 3ZJ4A 4XM1A 1NQXA 2IHYA 1XG5A 1N57A 2X76A 3IULA 3Q9SA 2EGGA 4WERA 4JI1B 4YCSA 1Z0FA 1G8KA 2BONA 2O8VA 3PC3A 4EOGA 2X0EA 4DQDA 2RHWA 2VDPB 3WMEA 4AP9A 4EHIA 1Q1BA 3OX3A 4PZUA 4XOUA 2BDUA 2XF2A 3KSDO 2FSFA 4ENRA 1YA6A 1WDLA 4ZCTA 1AKEA 1D0IA 4FMCB 1DADA 2O3RA 1UP6A 3PFFA 4FLMA 2A94A 4BNKA 1ESZA 4CLEA 4BUCA 4F9FA 2Z08A 4BMPB 4RD2A 4RL4A 2D7CA 4GXQA 2JD1A 3C3KA 4BNGA 2AXPA 4ZDJA 4FQ7A 2QDKA 1OXKB 1RXIA 1RU3A 1Z2PX 4IIEA 2VYFA 2BMFA 1H6DA 2W93A 1NW7A 2YZNA 4FBLA 2P4HX 1W75A 1JE1A 2VF7A 3W2HA 1CNMA 4PSDA 3CU5A 5ESXA 3DTVA 4N6NA 4BASA 4BLOA 4CMEA 4Q16A 3ERCA 3AETB 3ZXUB 3UY4A 5EWMB 3HUDA 4NOMA 1T1JA 2XRMA 4BU0A 5AVSA 5BR4A 4PSCA 1RM0A 1H1LB 5CYFA 2LVBA 2XQFA 1NF9A 4NOJA 4TMWA 5LB4A 4EARA 1D09A 1ADYA 1C3XA 4ESOA 4PXYA 3WLMA 4KI7A 5HBRA 1YBFA 5LZ7A 4F2HA 1AC5A 2IOFK 2H59A 3D3EA 1H2RS 4H3VA 4LQCA 1D2RA 1GZDA 5AJUA 4B3BA 1JQ3A 1ORRA 1P62B 4PG8A 4J4TA 3G6KA 2B2NA 4L6AA 3J81A 1M2VB 4KITB 1YRQA 2JJ8A 1JW9B 3AH8A 5IEJA 1M72A 1WZIA 4HAOA 4KRFA 2ZRCA 1UKAA 1BH2A 2ZK7A 4YRJA 1T26A 3UNXA 2EF0A 3T15A 5B5SA 3T6KA 5F21A 2ID7A 1U6JA 2ZOSA 3LYUA 4MICA 1OLUB 2AGVA 1PZMA 3RIGA 4ZDIA 5IZCC 4J1TA 4PRZA 4NULA 1TUBA 3ICOA 2VZ9A 3PC8A 1E6UA 1IDN1 3R3WA 1JIQA 3V8RA 1NVTA 2WNSA 3TLJA 2MYTA 1KFEB 2V5VA 4J7XA 4D6YA 1XEFA 1YV9A 4ME6A 4HEQA 4A6XA 4BV2A 5KYUB 1ZOSA 1L8OA 4QPCA 1I0ZA 2VPPA 2WB4A 4D9KA 1QTNA 1Z45A 2B9VA 4GOJA 5AHXA 3WRXA 1BX1A 3RRFA 5HK8A 5K3BA 1BVUA 5HVNA 2C00A 3OUTA 4DIOA 5FFMA 2IWHA 3U44A 1R6VA 2UDPA 3BZBA 1FX0B 3C5HA 1PL7A 1Q92A 3ZR4B 3LL4A 3SXPA 4DGQA 1E5TA 3U7HB 1HRKA 2AKAB 3IUNA 2P4UA 3L3BA 5KWIA 1O95D 2YZ7A 2CFTA 4BVFA 3CLRC 2H92A 1Q16A 3KCQA 1XDGA 2Y76A 2DBRA 5AVJA 4Z0TA 4K8OA 3EGIA 3U6KA 2FX5A 4YLGA 1HQKA 3NS7A 3E8SA 3N53A 1EGQA 1JECA 3UQZA 3IP7A 3UZUA 4BNLA 2DXIA 2VSYA 5DSZA 1ISRA 3UOAB 3DBHA 5COAA 1XDBA 3DFMA 4DF3A 3H4IA 3CX7A 2AIRA 2EJTA 4GGOA 1GCOA 2O2JA 4DJFC 5BSGA 1NM5C 3ABSB 3FY4A 4WUTA 1LPAB 4XWWA 2Q5HA 3AOGA 4IX9A 3CVJA 1NNEA 5EMJA 2CMGA 8GPBA 1X8JA 4NDNE 4KIJA 2IFTA 3CRZA 6ADHA 5KNCA 5DCWA 3OJCA 3DLHA 4HYQA 4RF2A 2YDYA 2JLYA 1LVHA 3HQ4O 3FAZA 3SC6A 3VDXA 4EB6B 1NQVA 1WPQA 4QE3A 4C4XA 1KH1A 1UK8A 1YASA 2D5AA 2R7NA 1LC0A 5AOVA 1VE1A 4DUZB 1CKEA 2B3TA 4XD2A 4DJEC 3LLMA 2YY7A 4LRSB 2DBYA 1S96A 4MVJD 1KMHA 5IJ9B 4OI0A 1DBIA 2C1EA 5KVVA 5FDFA 2AQIA 3DGFC 3EDQA 2ID4A 2VVTA 1ULHA 3B89A 3TR0A 4UVHA 4YCDA 4EHJA 3KR1A 1V7QA 3LZDA 4J91A 4RJIA 5CLLA 1B42A 5B30A 2FRDA 2HLHA 2MMCA 3D7SA 3AM4A 1GGKA 1PQYA 1OLXB 3F67A 4F3CA 5CDFE 3VPAA 1EEHA 1WZCA 3HUEA 1VPEA 3JAWB 3BFPA 4JEHA 3DDOA 5DCLA 5JZ9A 1MX9A 4QRHA 4MUEA 1E9CA 1R18A 4CKWA 1ZR2A 3GEMA 1OUMA 1T6XA 2JFGA 3IQFA 5CFPA 4CT0A 3ILXA 4FFOA 1XNHA 2O1EA 2QTVB 4MRMB 4UE6A 2ZJ1A 4EKNB 1JFLA 1IK6A 5KJEA 2Y9MB 3S8MA 2MU1A 2FFBA 4HDCA 2QV0A 4FHZA 3LKZA 3N5CA 4KZPA 1DXOA 3JRXA 3RW9A 3OCYA 4PZCA 1CHDA 5KJ1A 2RAVA 4MV5A 2F9LA 4EW6A 4WX2B 1N34B 1KMMA 2EZ4A 4X63A 3TLBA 3MUOA 1BGVA 3U19A 4Q3CA 2IEYA 2XUGA 1FL9A 2HLDA 2ZTUA 1SKUA 3ZDCA 3EGDB 3R5TA 3Q7SA 4QYSA 3PX7A 3E5MA 1AD2A 2RAPA 4ISBA 1U65A 1GEGA 2C1XA 4GMXA 4MUYA 2D3TA 1XRNA 4ALLA 4IDPA 4R05A 4OY3A 4DR5B 3ZHRA 5JAHA 2ZB3A 2VFAA 2HQRA 4UXJA 1E7RA 4RSGA 2WWGA 2Q21A 1XXHE 3CB2A 3GRRA 2NQTA 1IPFA 2CEAA 3ZY3A 1MIOB 3GUYA 5DLQC 3NAGA 3EWIA 4FOOA 4FR2A 1EGVB 1JHYA 5B37A 5IU6A 2WQZA 3JQBC 1GTG1 3BFKA 2HSGA 4V0QA 4G2TA 3EXHB 1CE8A 4KSCA 1OVGA 1T9HA 1RHJA 2JGJA 3A1UA 3FMOB 3K35A 4YP5A 5AM4A 4KXUA 4B4OA 4GPZA 1N6IA 3BXFA 1D6SA 4EATA 1YRHA 2I2AA 2HWWA 3FYSA 5CJJA 1PS0A 1YZYA 5BSUA 3U5ZB 4R1OA 5G2OA 2GD6A 3BN3A 3AVXA 3PSAA 4KZKA 1X1DA 5FYQA 4D0SA 3VSBA 1QRDA 1RIFA 1FTQA 5F2KA 3VSEA 2YWEA 3NT4A 4CEIA 4ZANA 2O52A 5CMLA 4C0BA 4JLOA 2ANBA 5JD5A 2GPAA 2IIVA 3M5WA 2WKQA 3QJ5A 5AJYA 2J5BA 1CUJA 5EE5B 1V16A 4YJ3A 4IXWA 4PZEA 4JP8A 2QX6A 1P4GA 2WG0A 4ZK2A 5BR1A 4I1SA 5AK3A 3BH0A 4LX0A 2FF7A 4F4FA 2I8AA 1YL6A 2FR8C 1WDKA 1U2SA 2VTKA 5THXA 3LVFO 1OHHD 4KR0A 4B73A 4NXNB 4X7MA 2B92A 2WTXA 5FBKA 1GDDA 2NXWA 5IDYA 1IOZA 1KJJA 1RYMA 2QE7A 3UN1A 1Q0PA 3NVDA 4WACA 2HQBA 4QUKA 1ESEA 3AHFA 3LGAA 3T1VA 4A6DA 2OBNA 1JN0A 2GX6A 4DUGD 3BOSA 2GARA 2AFHB 4W6ZA 2QM8A 5TMPA 4TN5A 1X19A 4E2WA 3JD3A 4AU1A 4U2EA 3EDOA 4LMRA 1T5SA 3STHA 2FW7A 1O03A 3I3SR 3MSXA 3EMBA 3C1UA 1OA1A 1KR5A 4ZEXA 5LBUA 4NV0A 2AUMA 3D6VA 5F1KA 1M6YA 2Q1TA 3P9RA 3B1KA 3TB4A 4LRXA 4K26A 2WYOA 2QYHA 3DCIA 4H59A 5D2CA 5HXAA 5K8TA 2HUPA 5EKTA 5H59A 1QG0A 2OQRA 3HCEA 3DYVA 2FW1A 4RY0A 3WLRA 3EGWA 4DLYA 2HDHA 1XRPA 3NO4A 2YINC 3Q5EA 5LYYA 1NE2A 1TLFA 3S2SA 4UEJA 3HEBA 4DMCA 1OFUA 1EBUA 3JQ8B 4NZMA 2X7JA 3FHJA 4PLPA 3UMJA 3K20A 5J2TA 1E6LA 4NG4A 4KACA 1G8PA 2HN9A 2DT5A 4NBVA 5F4ZA 1UM9A 2YN2A 3R4CA 1F1JA 3ROGA 1QQ5A 2X4DA 4UE3S 2GS9A 1XZMA 2Z8ZA 4LDNA 3UBMA 3GGPA 4DWVA 2WSIA 4I1OA 2C7OA 1OTXA 1M34E 1V11B 2JGDB 3B60A 1J2TA 2OMKA 4B4KA 1YQTA 2I4OA 1FFYA 5E6SA 3B5EA 2Q8NA 3NBKA 2VK1A 1M0WA 3OPMA 2JEOA 3H5WA 3T9DA 1Q7BA 3W05A 5DGHA 5KEIA 4PSAA 4Y6RA 4OU5A 3CMMA 2JCYA 2W6PA 3HDGA 4IIBA 2Q8PA 1TD9A 3U40A 1PD1A 8LDHA 1J1UA 4EGFA 1BX0A 1F48A 1UQUA 4YUYA 3RKRA 4BRZA 3U60B 1UWVA 4U0JA 3T8YA 4X95A 2IU4A 2ZS8A 3PG5A 4I8IA 2GBPA 4LQLA 4DXDA 3BIFA 2GUGA 4OAQA 3V8PA 3VZBA 1UDXA 1RRGA 2DJ5A 3HKBB 2D8MA 4TTQA 4ZVKA 1ZW6A 1QK3A 2D1YA 1LDYA 1SKMA 5BT8A 3LJKA 1PWHA 4GSKA 2GXQA 2QAJA 1P1HA 3AVOA 4K9LA 3C87A 4RHUA 3HADA 5F76A 3TTSA 3GCZA 5TJHA 4FFRA 4I7EA 4QXPA 4AY2A 3ZJ5A 2C42A 3A6EA 3HSKA 2A3RA 2PMWB 2WOJA 5SYMA 3AZQA 1I5OA 3N2GA 3PSHA 9MHTA 1LXCA 3OFJA 4TRMA 5E7JA 2LP4Y 4HLQB 3IP6A 4A7PA 3H13A 1ZZEA 5G4KA 1RP1A 2WSLA 3AB3A 3AO0B 3B3QA 3H1TA 3WLTA 3E9DA 3UJNA 5F23A 3E27A 3IVAA 4QOEA 4FYWA 2Y1LA 2VPXA 4OMDA 5AKYA 4P4SB 3B7PA 4X65B 2PH7A 1UAGA 2J3IA 1HEIA 1Q1GA 2NNLD 4ID3A 3ZV4A 2HXYA 2A35A 3TRDA 3WRVA 2O8EA 4MR8A 4LHVA 4UAJA 4X6UA 5K0LA 1MQ8B 3OETA 7REQB 1EFTA 3CW8X 1VLQA 2RKWA 1VZ2A 2O23A 2BUBA 3IAS6 4X00A 5ALUA 2W2OA 3R0QA 5JECA 2GEBA 2IYTA 4URWR 3CKKA 4D43A 5M04A 2HNBA 4CKWB 2ZBVA 2H4XA 1VYHA 4XM2A 4ZCMA 2V7QD 1L2TA 1UK7A 2EKQA 3C85A 1Q2UA 3GRPA 2WMNB 1DZIA 3OP4A 1YI0A 3U4AA 2WLTA 1ZUNA 5LPNA 1E6EA 1K66A 3RFCA 4ZOCA 1XXHA 2HY7A 1VIYA 4E09A 4EAQA 5B57C 1XAHA 3C7CB 3VR6A 2H08A 1DLJA 2OILA 3LRPA 3H1GA 3PNPA 3NWBA 5GGXA 1TECE 4P82A 2GLUA 1MPTA 3L8EA 3MWLA 4X60A 4A92A 4EWLA 4YMGA 3UIEA 4CI0B 5ICGA 4QOJA 1DMSA 4W4TA 1IH8A 5LBIA 2NZ8A 4ERXA 3QVGA 5JJBA 3GF4A 4BRSA 2UVPB 5DEOA 3QEMA 2BCJQ 4Q9DA 3MTAA 4L27A 2XT9A 5AVOA 2QVLA 4LYFA 4GDFA 2DE0X 2IUTA 2DF8A 4EG4A 2QTCA 1SVIA 3K9GA 2R2AA 4Q4JB 2PMKA 4GMFA 1NURA 3GRAA 3PUZA 2H07A 4EG8A 3JD1A 2A0XA 5SZJA 1GNQA 2LXNA 2WKPA 2PRKA 3WYNA 3G5UA 4IF4A 4B4VA 1MPXA 1SQ5A 3TRKA 1IWBB 1PW7A 4ETWA 121PA 2PHZA 1L3IA 1PKEA 3AFGA 4LSWA 1SXIA 2YY5A 4B17A 1LGYA 3C7TA 4XCVA 3PFNA 1Q77A 2IY8A 1YB6A 1A4IA 2G7ZA 4FC6A 4Q1VA 3HDVA 1T3ZA 1BE6A 1VJ5A 4Z9YA 2XBMA 3LT4A 4DDUA 4W5OA 1SIOA 4KH0A 5JPCA 1ZM3A 1FSGA 3KVVA 1Q95A 4IJMA 3DE4X 2HFKA 4P3OA 3OOJA 3R6GA 3UWKA 3D3WB 1G4AE 3ADPA 1V7PC 2IHUA 2UUBB 3AFMA 4RO0A 4P1ZA 4F4DA 2UUOA 3G2OA 5JSYA 1OC2A 4ZODA 5BR7A 3E22B 2G0NA 4KREA 5A9SB 2SBTA 3RCBA 4JA0A 4RA9B 1AUVA 1HK7A 4ANFA 3PUYA 4EBFA 4Q3NA 4Q15A 1Y0BA 2PKCA 3GLGE 3W7VA 3OOWA 4HQKA 1RHQA 3A26A 1GQ2A 2YY6A 1QP8A 5CBPB 2YJ4A 3HJTA 4QT0A 1Q1AA 4RHXA 3KHUA 1PSDA 2PYDA 2X0NA 1QCCA 4QEZA 4ALIA 5TMDA 1OH7A 1FP4B 1QH8A 4XUCA 1N1DA 1J2EA 5P8WA 3QMPA 5KDOA 1VLJA 1L9XA 3WLOA 1K0UA 4CLXA 3RJ5A 4V1CI 4TLLB 5L6LB 3L46A 3OWOA 2A6PA 1QMPA 4DNXA 1OMOA 1ZS9A 2J33A 2XXBA 3CVYA 4NBUA 1QLWA 4W8GA 3QU4A 1C3VA 2NYVA 5LU8A 5LP6C 4D80A 1HGXA 1XLUA 4JODA 3OPYI 2R8EA 4MXDA 3GEBA 5C53B 1EPUA 5IT5A 3ZVKA 2NACA 1UOQA 5T4HA 3HB0A 3RBXA 4BLTA 3N0XA 1ECFA 3E2PA 1U4OA 3EN0A 4EQ6A 4LF8B 3I6MA 1JLRA 4LFBB 1R8JA 3W2FA 3E15A 2G71A 3WA7A 4A0SA 3QMVA 2VSOA 4PX3A 1SZJG 4KHPB 4ZQCB 4WV3A 3ZGNA 4B6GA 1MHPA 3TGLA 3K0SA 3H8VA 4R68A 3NDIA 1OASA 4A1OA 4YRIA 3ACDA 3D3NA 3ZNOA 1O54A 2Q6TA 3C5CA 3CUUA 4EL5A 1U1DA 3PQEA 1FDOA 5BOSB 3ETGA 2YMQA 2P9BA 2YOHA 3GT3A 3K5HA 5J9FA 1JFSA 4R8MA 4B8WA 3WDMA 5DHSA 3OQNA 4WKNA 2GWHA 2XBLA 2JAQA 2IYWA 3WAGA 4ND3A 4FWBA 1PJZA 5IAJA 2FY8A 1MVLA 3U49A 4DVJA 2ZIFA 1J99A 2ZGVA 5H5JA 4A8JB 2IV2X 2L82A 3K0FA 1DEHA 2EATA 3DVAA 3P2IA 1NSTA 2EWMA 3M6MD 1WETA 3N8NA 1LK0A 4ES6A 3NASA 5CCXA 3AJRA 4PHCA 4TT3A 4Q3DA 2WJ6A 2VO1A 3DBVO 4H7HA 4IRMA 2XWJI 2J0UB 1M1YA 4G97A 3AEUA 2ZAYA 3MBKA 1G3QA 4Y9SA 1PI3A 3UATA 1SXJE 1E0JA 2IOHA 4JLAA 4F3KA 4JP5A 4E30A 1NTOA 4NVRA 4C3OB 4HVCA 1DJNA 4XOIA 1ZR4A 3SJZA 1ORHA 2B82A 5EYPB 1PK9A 5B1SA 2ZJ6A 4WZBA 2V6BA 1E63A 2A58A 4FZVA 1A95A 4K9DA 5G02A 2JVJA 3FG9A 4NYJR 1UJMA 3WK4A 1QANA 1NWCA 4N4AA 2YWRA 3E9MA 4DR2B 2AS0A 1UADA 2C95A 4YJHA 4PAOA 2HWKA 2JGNA 3PUKA 5FA8A 3GD5A 5HQ3B 2AN4A 3MFYA 3QKRA 4RK4A 4F91B 2QLBA 4F9EA 3B1ZA 1EDDA 1H2XA 1X94A 4C0WA 5K3CA 4QXOA 3F6CA 4DE5A 1RI2A 1BYUA 1N2CE 2AE2A 2LNDA 2W00A 3GH1A 4JX9A 3FUVA 4N0DA 4RNCA 2GK3A 1KARA 4UHCA 1W29A 2HIHA 4HEA6 1C81A 1D2AA 2ZIVB 2H0RA 3UMFA 1YK1A 1PL0A 1F4PA 1NBME 4S1PA 4JT9A 3C74A 4G0UA 1EHIA 4YPVA 3S1AB 1TYDE 2I6UA 1W0JD 2WFLB 3P0RA 3CPJB 4GPEA 3SX2A 5ALRA 4HZUA 3CZ4A 2J4DA 5JAPA 3ADBA 2QXUA 2VDUE 4H17A 3CZPA 5KOHB 3VOTA 1RLOA 1P1IA 1E2GA 3PFIA 4E1VA 3NM5A 5T41A 4HL6A 2HC9A 3D2LA 3H2JA 1KH2A 1RPAA 2R00A 7GPBA 5JCJA 5B58C 2O8CB 2R47A 4HK4A 2VP4A 4WL0A 2ZXFA 3GQVA 3CLRD 2P9JA 4RCZA 5I01A 5LC1A 1HEUA 1ODIA 5BRAA 1SC1A 1UEIA 4PO9A 5ALXA 2BTEA 1CJMA 1XL0A 2VAPA 4ER0A 2G08A 3FPBA 1GZUA 4LWOA 1ZIDA 1L7AA 2JHCA 3AQ4A 4KLCA 3FTFA 4G5SA 1Y37A 4YONB 2WUFA 4YO7A 3T34A 2PD4A 2H4JA 3I9LA 1EZ1A 1G17A 2OM6A 3CKLA 4QEKA 2V9CA 4CU2A 2JFBA 2XHZA 1T2CA 3IV7A 1EX1A 3ELBA 3F74A 3K7EA 4M8IA 1JQBA 3S2IA 5TQJA 4RULA 5H68A 1TKAA 2IP2A 4O4HF 3FFWA 4AP6A 4YMLA 3T5DA 2NO9A 5HKKA 2XIJA 1L7EA 2RGWA 4NK4A 1SIUA 2I3DA 3PGXA 4LF6B 2G1KA 4OXKA 4BLVA 4EHKA 3AERB 1PQ4A 3H2KA 3O2JA 2UYYA 5FLKA 5AI6A 1LLDA 1K97A 4BNNA 3FPCA 2Y9PB 4LF9B 1RIIA 4Z86A 1IMOA 4U00A 4NARA 2O50A 2CV1A 3IHLA 3DDCA 5TQVA 5EZ5A 2PT9A 1QFXA 2RBKA 1ZIPA 3QLUC 1TK2A 4CM9D 4TS9A 2OEPA 5LMUB 3RJTA 2QA5A 4FDMA 1IL0A 4J76A 1DCMA 2JI8A 3A9TA 1X6VA 5AW5A 4AW9A 3OE7A 4JYZA 4C87A 2YJZA 5JSHA 2QRPA 2VDNB 3THXB 2B7CA 2REOA 4KMSA 2JFNA 5A7GA 4GKKB 2LZ0A 1QYDA 1AHNA 2Y3IA 3EDCA 4YP9A 4TQGA 1AN9A 3I9KA 4IIHA 2II6A 2NXCA 3Q5DA 1A97A 5E6UB 2OAQ1 4BO8A 4IJQA 1IUOA 2F1KA 1E7WA 1GILA 1O95C 1PR4A 4G5YA 1E1RD 1NDHA 1LPOA 3E7PA 1TO6A 4XWAA 4D7AA 2REQA 1ODKA 1FY2A 2PANA 2OP0A 3MMNA 2WPNA 5HZHA 5HIAA 5EGSA 1YR8A 4MARA 3ZDXB 5K5EA 2V6MA 2C2OA 1UPTA 1RYBA 1Z0ZA 2NX2A 2FW0A 4ER3A 3RRMA 4DT1B 1TGYA 3DA8A 4UQPA 1GQOA 3NBZC 5JAMA 3UYLA 5WRFA 2X41A 1C8BA 2Q7XA 3W4JA 3ZZUA 1D2HA 3GVHA 3BFXA 2Z2YA 3AU8A 3UK6A 1ETUA 3WWPA 5L45A 2VPTA 2ZS7A 3EPPA 3GDHA 1VLLA 3RF7A 3TVYA 2FOIA 3RSFA 3GX1A 3VQTA 2CY0A 1V9CA 3W9SA 3Q8MA 1ISFA 4XFKA 5LBTA 2JIOA 4MVJH 2XDYA 2I62A 5FNVA 4B79A 4BLQA 1FQKA 4QATA 5I9NA 3LL7A 3FTEA 3DNMA 3EF1A 3BL6A 4UBMA 5BVHA 3K96A 3K09A 4GZLA 3WL8A 5FBQB 2D0PB 3FOZA 3EBPA 5BUSA 3KPJA 3TSYA 2VNIA 1DC4A 2BFOA 1QZ3A 2DP4E 2PA3A 3LP8A 1Y34E 3F0TA 1M8PA 1XYGA 3PC4A 2PTGA 3COPA 2Q4BA 2JKVA 4LK3A 4MUJA 4Q47A 4TXMA 3RUAA 421PA 5ITWA 2X6QA 3EMVA 1RXSA 1H4SA 1WQ4A 4DC9A 2IYRA 3M9XA 1X0XA 3MTDA 3O7WA 1PP4A 3AVWA 4RPHA 2P78A 1CLUA 4M0FA 1KEEB 2NXJA 2FPIA 2R9VA 4DL9A 1MA3A 3OM1A 2GCGA 4HLNA 2G82A 4JL6A 3B7GA 5HFNA 3VZDA 5AM1A 2X40A 5E6SB 4A8JA 1EB8A 4G5QA 4NBKA 4PPNA 3VR1A 2V65A 2ZG6A 1P0PA 2AF4C 2MR6A 3I6ZA 3L8HA 4M1TA 3K72B 2HSEA 2VJPA 3DAHA 5FULA 4KFTA 4LNAA 3HS3A 1UUFA 4ICIA 3B53X 3BULA 5IKPA 1P5HA 4P0QB 1P1KA 1WMAA 3PF9A 4XX1A 4TTJA 3ENKA 3TIGA 1MX5A 2VJQA 2B5WA 4J1NA 2IYEA 2ZSAA 3E3AA 3HE3A 3FMIA 2FEPA 3ESAA 1B2LA 1MXFA 1BA3A 1DP4A 1O8BA 1PX0A 3E5NA 4L3VA 6AT1A 1SPBS 2XEXA 1I1OA 4HQLA 2QN1A 5H3CA 2ISSD 4JXJA 5HOEA 3E48A 1Z22A 3HA2A 1W25A 1I3NA 3H2YA 3PGLA 4X85A 1JQEA 1L3BA 1L5VA 1S2OA 1U4SA 1WY5A 1Z47A 5LNK1 3IUBA 2I2FA 5L53A 1AA6A 2WJIA 2X8BA 4A36A 1PW5A 3ZTWA 3UGTA 5DK4A 4RK0A 1EK5A 1OOEA 2AC7A 1VDZA 2X8LA 3GJXC 3H3FA 4DXAA 3A28A 1BXRA 4JEIA 1W2GA 2C5FA 4LV8B 1IATA 3OZGA 4WCFC 4GKAA 5E9AA 3RWOA 4OQFA 2IYFA 3TD6A 3AX6A 2A5LA 3H9JA 3NXSA 1NR5A 4GE0A 1Y1QA 1ADGA 1E2KA 3RYIA 4DBZA 3KUXA 4G09A 1N0VC 3L1JA 3MMSA 3F6EX 3MWEA 4JOBA 2IOQA 3TIFA 4KCGA 4MYHA 1Z5NA 4ZCQA 5KDLA 3WNZA 1QQ7A 3CEHA 4FSDA 4U2CA 3I64A 3KTFA 4WY2A 1XZHA 2Q41A 2VT2A 1KI6A 5HRUA 4JDUA 2HRRA 5HMMA 5FWXB 5A2GA 2QX7A 4CNBA 5JE8A 2VUIB 2OXTA 4CDMA 5D1HA 2M1ZA 1ZGJA 4Z0HO 1EWRA 4B31A 5B4UA 5K09A 1U0HC 2DPYA 3N1UA 3OAAD 1XQYA 4WRRA 2WAXA 4GOOD 4DYHA 4YRZA 4PAWA 1RDFA 5NLLA 4RL6A 4F56A 1DX4A 4R1UA 5CVUA 5E2IA 4GR5A 3S55A 3B2QA 1VSVA 4UUAA 5FJJA 3MT8A 1TVMA 4O2RA 3D7MA 5L3SB 4RTPA 3PQ5A 5F3DA 1TMYA 1YI8A 2YVUA 4GVXA 1DFGA 3FTNA 1Y1TA 1ICEA 1SC6A 2Y1XA 2X2OA 1OYYA 4BQFA 5KTSA 4OLBA 3DCJA 4JV5B 1SUEA 1BROA 3H3XA 4D97A 1PZHA 4JP2A 4IVRA 4ZEMA 3VUEA 2DPMA 3O74A 1XZEA 1XJWA 1YS7A 1Z39A 2A9QA 2ZI6A 2ZYGA 4I9UA 5IPFA 2AJBA 2OUKA 2PRIA 4NC9A 5D5HA 1YBAA 3SYRA 3TTYA 3AW9A 4PG5A 3ER8A 1PUXA 2VQSA 2Q6VA 3N0WA 3ETDA 2F8MA 3JQ9C 3R9XB 1XRQA 3HL0A 4PYKA 1XTBA 1S02A 1HKUA 2SKCA 4JZKA 4QZVA 2BKXA 1NZDA 3UGJA 1VQ1A 2D5LA 1NV8A 4JA2A 1VC2A 5IJ0B 4QXRA 4V3CA 1V37A 1L6IA 2ADMA 4QWWA 1BWSA 1CJTC 2I22A 5HP4A 4O4JA 3WV4A 1YL7A 3LF1A 4RJLA 1JFVA 2JJMA 1ZI6A 2IYXA 4EFMA 2X1VA 2XGMA 2BF7A 1PRYA 1W1UA 1NFRA 2WR8A 2BAGA 1PJAA 2HRQA 3R24A 4MA5A 4MUBA 3BSSA 3MAAC 4JIGA 1YE8A 2ASVA 3QLEA 5ALGA 2EDAA 1WZUA 5EXTA 3RROA 1E2BA 4C3VA 2AG0A 3K1AB 4GKVA 4DYVA 5IHXA 4MUFA 5J5CA 3KQYA 3FCAA 2G63A 4GLOA 1DX6A 1SUCA 2Z9DA 3LPLA 4I55B 1J24A 2FPUA 3PQ6A 3QEJA 4WFKA 1XNQB 1LV8A 1A98A 4KR3A 3AP1A 2EBFX 3LPAA 2WVAA 1SQFA 3TTVA 2CCGA 1PZGA 1ZO8A 3UPDA 1KO8A 4DPMA 2B5OA 3D7RA 1JQAA 4EG5A 2QEQA 5LJIA 4HWPA 2WM3A 4P4LA 5JEDA 4RYLA 4BFWA 2GBLC 3I76A 4CKCB 4IY1A 2JCGA 3AVVA 4YAEA 3JY6A 1JHUA 1B7GO 1PGJA 2AYZA 4QFDA 2JCVA 4X3CA 1LX7A 2BMWA 5BWNA 2C9YA 2IUEA 4E6EA 1T9DA 4XRRA 4N5NA 1F17A 1GQYA 3I5AA 3SIWA 3UAVA 1K6IA 2O2SA 3RVJA 2ET6A 4AJIA 4D4JA 2NIPA 621PA 2IYPA 1VG9B 4YVFA 4MGYR 3FKQA 3L0CA 3RHZA 3R4VA 4F4JA 4UREA 2VC2B 5LR6A 2BKEA 1GAWA 4O08A 3E05A 5ENVA 2KSQA 4M1WA 3JWHA 2NZYA 4WOJA 4ZYZA 1ZNWA 4AKHA 1FXSA 2CDNA 3IIKA 4AQDA 3L2OB 1UZAA 4E12A 3QWHA 4ZO4A 5GJCA 4TS4A 2JFPA 4RLHA 3E9YA 5E1OA 3SJUA 4BQSA 1IBKB 2H51A 3FF4A 1SXHA 4LS3A 2QQ0A 4KE8A 4M6WB 3BGWA 2DB3A 4KUHA 1B8NA 1E59A 1J25A 1J97A 2F48A 3GUVA 1DQNA 4L15A 4LOHA 1U8ZA 3QLVC 3V7UA 3X1KA 1E92A 5LL6P 1LDGA 2BSXA 2JRCA 3FI0A 3M0EA 3RFUA 3TR6A 3GEPA 4JBIA 3JQBA 1KPIA 2WSSA 4L7VA 3N0TA 2ZCUA 1OTYA 3TM5A 1EVLA 3I8XA 4B82A 2FE1A 4Z53A 3FYDA 2WSSD 2EBHX 3EQ6A 3W0LB 3SQXA 4MV8A 3X0DA 2EKDA 5M34A 3GLGA 1DIOB 2PS0A 3H5TA 4L78A 1AV6A 5FYDA 5KYKA 2WU1A 4QQ8A 4DAEA 2FDXA 2PT7A 3LTEA 5SY9A 3RS8A 1QPZA 1JKJA 3NV9A 1ECGA 5B6JA 1GRVA 5D5PA 3ORYA 1Y7TA 1LU9A 2DY1A 2WWYA 3HJBA 3RU3A 1PL8A 2XB2A 3PUVA 4IDQA 1DRWA 1XDSA 5JZSA 4EAAA 1YS1X 2JW5A 3T38A 1CYDA 1R0RE 3T61A 5LN1A 4BQEA 5HZGA 3SF8A 4FSHA 4AZWA 2GCOB 3HEAA 1HDOA 3GPIA 3QKTA 2YWBA 3QY9A 1QO9A 3LM8A 3PRYA 4XQGA 4UM7A 3ZCXA 4AC9A 1DQZA 2I9KA 4Q7JB 3WIVA 1UBMS 4LDRA 5T8KA 3SPXA 2MSNA 1FIUA 3ZH9B 2CDRA 3G2HA 3WJ7A 5BRNA 2JGAA 3R0IA 3S2FA 2D54A 2D06A 3W9BA 4Y2QA 4PAGA 1U81A 4ZT3A 3UWMA 3SX4A 3EDYA 4PO1A 4EJMA 1GO2A 4UPDA 5LXTB 3ZV5A 1CQXA 2FW8A 3I83A 4BKRA 4CG0A 4EW2A 1NI3A 3GLVA 3LFTA 3N87A 1KP9A 4I14A 4LBZA 3N2KA 2IE8A 3LBAA 5HFJA 3PRHA 5CW1A 1N2OA 2W22A 3VU9A 2QZPA 5HMLA 2G9ZA 3IPAA 1NUAA 3D0OA 1OH6A 1JEOA 3A2NA 3EC7A 3OUZA 4K9PA 4P7FA 4WLUA 5J2UF 1QHIA 2XADA 4LY9A 4OQZA 3W9YA 2XODA 1GXSB 4AQYB 2AWNA 5A3VA 1YAHA 3VFDA 1WR8A 1JPVA 3NH6A 3L5KA 4W63A 3RS0A 1BMFD 2Q7DA 2YNMA 3IP9A 5D3ZA 5GONA 4CN9A 4RIGA 3B9RA 4QYWA 2XUFA 5TQ0A 2ODEA 3R7FA 1BMFA 3IKMB 4B87A 4BMDA 5L6MB 5LQDA 3GCDA 4D56A 3AC0A 2HU7A 4DLUA 5I8ZA 3A6GA 3HKDB 3AUYA 1JLLA 4G0VA 3UH1A 4M1MA 3H8WA 5ALOA 2WHRA 4GYYA 5I4IA 2UVPA 3AT1A 4R7GA 4LXHA 4AG5A 3CXRA 3QXGA 5DM4A 1QYRA 1G19A 1NL3A 1YVPA 2DJIA 2QZJA 3LPMA 1NMQA 4RWZA 1E2IA 1V5FA 1TQ6A 4U7DA 4RACA 4ZC1A 1KL7A 4LVCA 3KHSA 4Q5IA 1IN8A 4HFMA 2JNWA 3SIRA 1LB1B 5GJVC 4BL5A 3PLAE 3HBAA 1A7UA 1OA0A 4FMBB 4WXRA 3AMVA 1EE1A 3D1VA 1FA9A 1DLIA 1W0KD 3ISTA 4KLZA 2CSUA 4CHGA 2IL1A 3KPWA 1VMEA 4BAZA 4PPQA 2OG1A 2Z9CA 1SXQA 2FFJA 1J2YA 4UBNA 1Y8RA 1L8LA 1TL7C 3EVFA 2HQ1A 3E53A 4X1KB 4UBJA 3ZHTA 4TTPA 4NNOA 1ENZA 2AFIB 2V97A 3LFUA 1R6TA 1DC3A 3ZXXA 1LQ2A 1RAFA 3C43A 5FNVB 3INRA 3K1ZA 2D1TA 3C3EA 1S8NA 1RD4A 2W6IA 4A8JC 1J9GA 2AR9A 4PIPA 2WIJA 5ER6A 4IDNA 2GETA 3SR4A 5KNDD 4UDYX 2OCAA 1AGYA 2AA3A 3T52A 3PWSA 3W6PA 1RYFA 2Q5OA 1Z35A 3RSSA 3WC4A 1AKYA 1P5JA 4BMNA 4CTJA 2ONKA 4DPKA 1T0IA 3O8QA 3M6IA 3EY4A 5CNMA 5IH3A 4BUJA 1I7QB 5IJ0A 2Q46A 4DJ5X 4HADA 5B2ZA 4OHZA 2WWHA 5A1TA 3REQB 1J0XO 1SUAA 2ILTA 1FNSA 4Y1GA 4ZAWA 4AD8A 4DLVA 3ZLVA 5EMLA 3TUIC 3KSAC 4C6HA 4TUYA 1QFJA 4RVGA 4GO1A 1OILA 4N5HX 1Y6FA 2HPZA 1C29B 1UBJS 2VK4A 3BCHA 1CUDA 2Y68A 1CIJA 3JWIA 3KXIA 1CUYA 4PYOA 1FJGB 5FTKA 2I7VA 3HO8A 4L8WB 5T6BA 4MWGA 5HBGA 1VHTA 3B38A 2E4AA 3ZLBA 4CM4A 1LBEA 3AIOA 2WWVD 3CVUA 2D3WA 4DZTA 1L5FA 2JLSA 3NCHA 1SKBA 2QN8A 1CY1A 4RD0A 4AN4A 2REBA 2W90A 4NPAA 1ZN8A 1R4MB 3O1HB 2BMAA 1U5BB 4XDYA 3X1WA 3KOMA 5ED0A 1AKUA 1F5SA 2XMSA 5ULLA 1TJ5A 1W4LA 5J4KA 3NT5A 3S5JA 4GQBA 3LWNA 4HX2A 2N3ZA 2CNNA 3SU8A 4JBXA 4GNKA 1EM6A 2VLBA 4CDRA 3LXRA 3O2SB 3OTWA 4YS6A 4MW4A 5SY4A 2ZI4A 4D5EA 2B8NA 1O7JA 2B98A 2XPCA 4UHBA 2QT9A 2CV0A 1G5IA 1OVMA 5JXIA 3HKCA 1YAJA 3X2EA 3P0FA 1PKXA 3WWEA 1KJNA 3BSYA 3VU3A 3NHKA 1YTUA 4DTIA 4QELA 4Z1MD 5F2NA 1R7RA 4HEHA 3B6IA 4BKPA 4B35A 5F3WB 1EGHA 3PWKA 4GSYA 3L7OA 3MQ4A 3GMIA 1N3YA 4O2AF 3UA4A 1IXSB 5JEEA 5CP8A 4EYSA 1SO8A 3UG6A 1ZLYA 3HRKA 3LWDA 1DT5A 2BW0A 4NYMQ 1GAEO 3BA1A 3OJFA 2B94A 5ALFA 1VG8A 3INNA 3G5MA 3CZAA 4ZALA 3RRBA 3GC6A 4R8LA 5FWXA 2BFCB 2ZRMA 4WFJA 3D8NA 4X3OA 1CUHA 4TUYB 1QTQA 5DTIA 1YVRA 4MEJA 4GL4A 3AWDA 2G1AA 2BFAA 5EMKA 4M88A 1W44A 5DHTA 3RC7A 1G3MA 4C05A 3O2QB 2R8OA 4LKOA 5IDVA 1MGOA 1E3TA 4HCJA 4HVAA 3ZWVA 1OT3A 1VE6A 2L2QA 3CISA 5C52B 1QH8B 1V26A 1HBJA 2F9FA 2FPRA 4WN3A 3Q6NA 4QJBA 5GMOA 3Q0TA 4NENB 2ZRPA 5JPDA 1G5RA 3HLKA 2D6FA 3M3HA 2O9JA 4UBLA 4RLFA 5JALA 1HYGA 3BFJA 2VOJA 3M1AA 4ZYTA 2IX9A 1OR8A 1MRSA 1R8SA 3C3XA 3R5KA 3S2YA 1CJUC 4E33A 5F73A 5CDFA 3A1TA 4J8PA 4U7TB 1KE2A 1R8XA 3LWZA 1P9NA 3T1YB 2DY0A 3KU4A 3DZDA 2FG7C 2OOSA 1AKMA 2RIPA 3ZE9A 2HB6A 2LRHA 2RBGA 4UPVA 4Y2YA 3W5BA 4GLBA 1Y82A 1USKA 1DVRA 2EP8A 3OU7A 3QVUA 3QBVA 3TG2A 2FEMA 1XB2A 5IT0A 1KEWA 2J9FB 2AX3A 1KEVA 3ND5A 2OFOA 2ERCA 1SD5A 3O95A 1UF9A 3MWKA 4RM2A 3JQDA 4F6LA 2Q6OA 1JIJA 4V0KA 1NW4A 5AO9A 2HJVA 2H2GA 3GMSA 1XZKA 3DOCA 3RFTA 4YMVA 1TVKA 4E13A 3IRUA 1U9IC 5DNUA 1ZNQO 2EJBA 1XKLA 3RYIB 3LC0A 4QUHA 1KQFA 1R0BA 1QF9A 2QE6A 3GOHA 3WJ2A 2Z8YM 4O59O 1R4ZA 2CLHB 3A9UA 4O4IF 2AJCA 2AI2A 2E4VA 1FUEA 2MT9A 5DP2A 5SZHB 3H7IA 3DEIA 3IJ5A 4CEJA 4KP7A 5CX1B 2YMLA 2C4NA 3I0MA 4GM4A 4I1IA 3KQHA 3AF0A 3FVQA 3OFSA 4YUXA 1DC7A 2Q9CA 1T5HX 1E99A 1TMGE 2GJ8A 2DQ4A 4BPRA 5A4MS 4I55A 4MWTA 2E5LB 3NGLA 2Z4SA 1Q50A 3M4XA 1T8RA 4QG3A 2Q99A 3DDWA 3ROFA 1STOA 1DHRA 2F43A 3QV1A 1U8EA 1Y3FE 5EN4A 2VHXA 4PHTA 4JLWA 2JGFA 5JXHA 3WGKA 2EJUA 2RARA 4YWHA 2VHUA 1WB5A 1G8FA 5FB3A 5AVYA 3IB3A 1JA1A 2A2ZA 2J7PA 1XX6A 4WTOA 2W98A 4AJ9A 1BJTA 2OCXA 4FNOA 1BX3A 4HN4B 3SSMA 4IVQA 2ENWA 1Q44A 1QGDA 1RCUA 3BTVA 1P5FA 2G88A 4I81A 1Z6GA 1XUOA 1H2AS 3NHWA 2BEJA 3NXKA 4NYIQ 3UC5A 1X80B 5LD2B 2X8JA 1BD3A 3QPWA 2Y0DA 5AXAA 4E07A 2ZQZA 2O0LA 1L7NA 2J3QA 2DQKA 1XVIA 4REQA 1E5DA 4MS1B 1V71A 1A5AB 3FUXA 4Z4CA 1OIVA 4IQ0A 1T2FA 5REQB 1WE2A 4ZOBA 3LOQA 2RK4A 3A3YA 3PWTA 3DMGA 4MV0A 4YAIA 1CUUA 3GJ4A 1FBNA 4MQMA 4P92A 4N5IX 4JQSA 4D9JA 1Q84A 4YBZA 5E3HA 5IWCA 1SWWA 3C1TA 3B78A 2C94A 4IDFA 4BNVA 1EFHA 4ISCA 2WM8A 3T3PB 1U1IA 1QO0A 2B1RA 2WE8A 4C30A 1W48A 1TAHA 2QVXX 3HL4A 3MLEA 5HGJA 1GZHB 2YV2A 1P8JA 4YUWA 1AHPA 1A2BA 2AV6A 4EITA 3L07A 2C4VA 1TIPA 1WXFA 5CFQA 2WT4A 2AD5A 2G9QA 1O97C 1TB4A 2W6MA 3O9VA 3TFQA 3W5JA 4GWLA 3GFRA 4LRUA 5ECWA 1P0QA 4B3GA 4M21A 5ITVA 4PNZA 1TIBA 4D3YA 3FYCA 3K0FB 2GN8A 4V2UA 3EXEB 2FZKA 4OJQA 2IF2A 4ZREA 1ATIA 1HY3A 1YBHA 4E5MA 5KYWA 4DLRA 3V4ZA 5C5IA 1EFVB 3P4YA 1QIEA 4AAYA 2GO7A 5F9MA 3WO0A 1UZLA 2CBZA 5TXGA 4AF6A 2QTFA 4B4DA 3GPBA 1C7FA 1I2AA 1FU4A 1PFKA 2DVMA 2ID8A 2RH8A 3DG9A 3MFQA 4LNHA 3KVRA 4YTEA 3T7DA 1AMOA 2QBYB 2YCBA 3BIXA 3G82C 3GZJA 3HA3A 4MVJI 2CNKA 4CKCA 3N2ZB 2ZVQX 1ODLA 2ZPAA 1BFUA 3FWZA 2JHAA 2O2ZA 5F9FA 4RU1A 2FZCA 1YB1A 4WZBB 2MJLA 3H5LA 4UUNA 4Y6PA 5C32A 1JR3D 1QCZA 2I2CA 1SULA 2MYPA 2YQZA 1X74A 1UKVY 3GT4A 2OHVA 3HCCA 3L5OA 3O8LA 4FCTA 4IAOA 4MMXB 3SQNA 4DMRA 3STWA 1B3BA 3E03A 3GT7A 3DEJA 2XOEA 1XTQA 4AKGA 2HBYA 4TLEA 1GTVA 3ENVA 3ZTYA 3GRCA 4MTLA 2GK6A 4Y1EA 1HO3A 2IXFA 1TVCA 4GMGA 1W93A 3KL2A 5JDIC 1BEEA 1JJIA 4OBWA 1WD7A 2FX3A 3GWGA 2WYVA 4KXXA 4JVSB 4RESA 2Q9AA 3BXZA 5CVDA 1LLCA 1HZZA 3DWIA 3RIEA 2FNAA 2GXUA 1RCFA 3HM9A 1IC6A 1DDGA 1T35A 3O8NA 2BEVA 3T0GA 1IJFA 4KRGA 4RFVA 1B15A 2BFCA 1KF0A 5AJXA 3L0PA 3K4PA 4TKUB 3B5JA 2IK8A 4W9RA 5CURA 1JG1A 2QTVA 5DHQA 5J59A 4G1FA 3WGZA 3JD4A 3ORHA 1K4YA 3T4UA 4RJKA 4BB9A 2R1TB 4KVZA 2D0IA 1B93A 2O5RA 3C3CA 5EUBA 1XROA 2VAMA 2HA0A 1S2IA 3KYCB 1T5LA 5EZYA 3LUAA 1KVSA 3LGSA 4WW0A 1XTIA 1K5PA 4BLWA 4FHEA 1OGIA 3AG6A 5I5GA 3LDGA 2D1SA 1ZNZA 1OD6A 4HNTA 2Q1YA 1GZVA 4ZDKA 2UXCB 1TFRA 3I9FA 1R6BX 1ZJ6A 2B0CA 2I8LA 2KQUA 1HDCA 4HG2A 4HH4A 4EUNA 1M2JA 3P4XA 3SQOA 3IVXA 1MB4A 3OHSX 3L6EA 4C0KA 1EZZA 4CDNA 2QLLA 1F7UA 2IDMA 4WEOA 4M53A 4XWTA 1LFAA 3FN4A 4HLUC 4QBKA 1MA0A 4TSFD 1AXRA 1K6JA 3MMZA 2I4RA 2OO5A 1Z73A 1DFIA 4QODA 3UMBA 3TRFA 4L4UA 2WT8A 3WADA 3ILVA 2IZ5A 3KBBA 5ECGC 2PD3A 3AVQA 4R41A 2OKCA 2VDJA 3GCWA 3MD0A 1GHTA 4DNQA 3S8EA 3RQIA 5KSOA 3TSAA 4CTNA 1AQYA 2CHUA 1HH4A 1CUWA 1XEAA 2CJWA 1R5NA 4PS0A 3JQEA 2DKNA 1JVBA 3KPYA 2W6NA 2XVXA 3MUNA 5I6DA 5KYGA 2BEVB 4G4JA 1GGFA 1KK2A 2XTNA 4JFAA 5TARA 3WKBA 2P5UA 1CB7A 4ZVTA 1YMUA 2C78A 3L93A 3PI6A 4FYKA 4CLDA 1G21E 1JAXA 2RAFA 2VYND 3S28A 4BEVA 5LB2A 4II2A 1FX0A 1T6ZA 1TO1E 1MB0A 3QNUA 3L77A 1D5CA 4JBHA 2O8DB 2GBFA 4UBKA 1RWKA 2AOWA 3ZV6A 3PITA 2NSLA 4CM5A 2XAAA 3NOVA 4UNRA 3QIVA 3MIIA 3THXA 4K0RA 3AUUA 2XX3A 2CNWD 4AUKA 5HM8A 4RTRA 3TTWA 4AF7A 3FVTA 3HVHA 4LAFA 1CPYA 4K2AA 1IIBA 3VJLA 3TM4A 1EUCB 4YAJA 5HX7A 1DTWB 1SUSA 1Q91A 1BS2A 4IV8A 4Q3KA 1E2HA 1HF3A 3OJ0A 4HDMB 3DNPA 3HDHA 3LNTA 4MVJA 3CKYA 4R6WA 2WPDD 1U0SY 2X9QA 2XMQA 3ENZA 2ZYHA 5CIYA 3FZYA 3GRUA 3U4DA 2ES4A 4M0MA 5GTDA 3HYNA 1D4FA 3LDAA 2C5AA 4M37A 1KQNA 2DC1A 1ECPA 3QW2A 4Y2RA 4ZWNA 3HU2A 3GY0A 1ELOA 4AUMA 3PCXA 4YPFA 3KDSE 1W34A 3ORRA 4KH1A 4LYAA 4N3CA 5HRCA 2ECFA 1IHOA 2PUTA 2W6QA 4LV5B 1T6NA 4B44A 1NKSA 1IZYA 2X3YA 3JARB 4YMTA 4XJSA 3ZGYA 4PZYA 1P2SA 3ZHXA 5KTTA 5MDHA 4HWRA 3OSZA 3IQEA 4CM4B 3QX3A 5CA0B 1V8OA 4MPTA 2CJWB 5BW6B 2PR7A 2ZIUB 2CJYA 4I2NA 3KR0A 4F8YA 1TI7A 2P79A 3C3PA 2HSWA 4GE3A 4I4CA 3G2LA 1IK4A 3USZA 1A9XA 3X3HA 3F71A 3E9QA 3LD9A 3JQAB 4H6XA 4JR2A 3CTMA 4L50A 4Q82A 4DRXB 5K20A 1GPYA 4M7OA 1GGMA 3AK4A 3T95A 5ARBA 3RHFA 1YO6A 2OXEA 4HB0A 5AI5A 5HKOA 3TGPA 4EA6A 2IWRA 4J75A 1M1XB 1EB9A 3RYFB 2G77B 3CH7A 2QT1A 4DA7A 2XB8A 4DILA 4QQKA 4QUDA 1KE1A 1R88A 3ZWXA 1U8UA 3PDWA 1VB5A 5LXTF 3UHAA 3MJTA 2FPMA 3NJRA 1QFZA 2PJUA 2AXQA 2BI4A 4L2IA 1B73A 1QRRA 3MWFA 1M9NA 1SCBA 1NVVQ 3NX4A 3JZFA 3G2KA 1FXWF 1ILWA 1A69A 1YRYE 4EM6A 2GZ2A 3U39A 1Z7YA 3GLKA 1KI8A 1KMNA 2RCYA 4J1QA 2GMWA 4L07A 4R54A 5BQOA 2CFSA 3VYVA 4IFTA 4Q6BA 4PFJA 1PZXA 4RTSA 3C6MA 1FVFA 2QQGA 3K8ZA 4U63A 1EJ0A 1HL3A 1NP6A 2HBRA 3G1UA 3JRWA 3AETA 3L7NA 4OHUA 4W7IA 1WPGA 3VMMA 3ZDFA 3W4KA 1C7QA 4EKYA 1E8NA 1WEHA 2G3YA 2R44A 2VYVA 1TAQA 9ABPA 5EHZA 1IE3A 5DBIA 2V7EA 1JT2A 3ROKA 3CPHA 3IUEA 1RC1A 2B2XA 3F78A 3OTOB 1L4MA 1FMCA 5MGNA 1GDHA 1N9ZA 1QHFA 4R2XA 3RS7A 5AVTA 2W8BB 1EGMB 4GRDA 1MD9A 4QO8A 4LJYA 5LFAA 4M38A 3KHTA 4PQYA 3DOIA 3T1NA 4JBNA 1GN9A 1SFRA 3IHWA 2ZRHA 2IS6A 2XKBA 4FFBB 3SZMA 1H2HA 2PFSA 3TOSA 2P6RA