2LR0A

Solution nmr structure of de novo designed protein, p-loop ntpase fold, northeast structural genomics consortium target or136
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
134
structure length
134
Chain Sequence
b'MKILILINTNNDELIKKIKKEVENQGYQVRDVNDSDELKKEMKKLAEEKNFEKILIKSNDKQLLKEMLELISKLGYKVFLLLADQDENELEEFKRKIESQGYEVRKVTDDEEALKIVREFMQKAGSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P-loop ntpase fold
publication title Solution NMR structure of de novo designed protein, p-loop ntpase fold, northeast structural genomics consortium target or136
rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 51
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lr0A00
2LVBA 2L69A 2N75A 2MR5A 5GAJA 2LRHA 2LV8A 4J29A 2LNDA 2LR0A 2LTAA 2LCIA 2N3ZA 2KPOA 2MR6A 2L82A
chains in the Genus database with same CATH superfamily
3GJ3A 1IXYA 4RESA 4H0FA 1NY6A 2B4RO 1I2AA 2XSZA 3ETHA 2B2NA 1ZD1A 3JQCA 2W4MA 5IEBA 4PXSA 4UAVA 5CIYA 2PKEA 4KV9A 1CZOA 4OLJA 3PC8A 1Z6QA 1QO0D 3IILA 1WZ2A 1Z9BA 1OLXB 1J33A 1WO8A 2DM6A 3AB7A 1YS2X 1WPGA 3OQ1A 3KR0A 2AOUA 2EKBA 5FOVA 1JLRA 4JDUA 1G0OA 1PL8A 1DXQA 5FI1B 2WU8A 2QL9A 1N25A 2PYIA 1C2YA 4HWOA 1R15A 4B3JA 1AUOA 3D2BA 4DZRA 2OV8A 2PT6A 3WQSB 4F4CA 2FDCA 1KJ8A 2ACKA 5H70A 1E1CA 3OAAD 3QBJA 2V6IA 4U2FA 4F1JA 4XWGA 4M6WB 4JN6B 4NICA 4XUCA 4YMWA 4CG0A 3SJCA 2O8BA 1IH8A 3DF7A 3S55A 3PNYA 4B33A 4F91B 4Z1MA 3BFPA 2OV1A 4N3AA 3WJAA 1H4SA 2QMOA 4NU0A 2JIRA 1TPYA 1Z5GA 3FUCA 1RZVA 1TPZA 1XTSA 3PNKA 2PQ0A 4JVNA 4LQLA 4UHKA 4ZI7B 1R4AA 2Y1FA 4QPZA 5JVDB 4RIGA 4CKZA 3QH4A 4P5DA 4F96A 1N77A 4MRMB 3BFJA 3TRJA 2A1UA 3WYEA 4LEIA 1QQAA 1OAOA 2FHPA 2UV8A 2NW6A 3I2KA 4Z9FA 4CM9A 4BQFA 2EWVA 2VUIB 5CDUA 2XX3A 1JG7A 1RTTA 1L5WA 3RT9A 3R3ZA 3PFCA 5LZ9A 1OF1A 4M9ZA 4WSOA 5BNTA 2IDKA 1EP1B 4K9MA 1EVQA 1JDTA 3EBOA 5GJCA 5JNVA 1KK3A 1DAFA 4ZT7A 5IN4A 4DFDA 4DMUB 1E6LA 1Z4OA 3OFJA 1YDFA 1YUMA 4MKGA 4TMZA 1CUZA 1GZVA 1G5RA 1LUAA 1E5DA 2FSHA 2JAHA 3O4HA 3QVKA 1PWEA 4PTZA 3RTBA 3SMVA 4DBLE 1DIGA 4J2HA 2JZNA 1H1LB 2BM8A 4RLFA 5ANRB 1M5TA 3AJDA 5EXXA 3SZLA 2XGMA 1T2EA 2ANBA 4KO2S 4ZVNA 1Y9AA 5BRNA 4YJ2A 3CPSA 1CV2A 3O4RA 1BXRB 4Z4HA 4O8ZA 1C4WA 2IPXA 2GM5A 3CNLA 3EVDA 3IXMA 4M60A 3R7BA 3F2VA 3QI7A 2IGTA 1QDLB 4ADSG 1IAQA 2LCFA 5EP2A 4EI8A 5HIAA 1UXGA 1PBNA 3GNLA 4JQSA 2I99A 3NT5A 5TXGA 1YUNA 3AESA 4PV7A 3PIRA 3BN3A 2HREA 4C4XA 3G7SA 4WLUA 4Q9AA 5DWDA 1RP7A 5TIIA 3C3WA 1E4YA 3GCGA 1FZTA 5FUMA 2GD1O 3T7TA 1CG6A 5LYJF 2B9VA 1X7GA 1AM4D 3DULA 2A9PA 4A10A 1IEQA 1CJBA 1VJCA 5I9IA 5JNTA 2YZ2A 4DIUA 3V1LA 2NVUA 1K63A 3GJ0A 3T35A 3ILXA 4HNVA 2CLEB 3R7SA 1DP4A 2OILA 3QY0A 1E2FA 5FTJA 5KKAA 2WP8J 2C07A 4U6QA 1VA4A 3A3PA 3LWZA 5LU8A 3S28A 4R16A 4P93A 3MPUA 2VRCD 3CRW1 4N6OA 2LDBA 4EGSA 4AY3A 2XD4A 5DI3A 4EAAA 2B8WA 2C95A 1IDN1 1KETA 2QUAA 3CV3A 2DR3A 3C3EA 2Y4NA 3FDZB 3KU1A 4KFRA 4NENB 1TW2A 3D7SA 4TYMA 1QGUA 4GMHA 5LP6F 2OT3B 3G8BA 4NE7A 1VGRA 4OKNA 2K4MA 3IVRA 5E9JA 5HF5A 3VZCA 3Q3JB 4MW4A 4R0VA 5DRTA 4AG5A 1X7ZB 3FJYA 2PKXA 2QW0X 3VZSA 1ZZGA 3K92A 1T36A 3RU7A 2AEFA 1GGEA 4O25A 4DA4A 4ZCQA 3HI4A 1O6GA 3WY9A 3ZW9A 2OQVA 3T9DA 5ELMA 5K03A 4FHZA 4KLRA 1SBTA 3WGYA 5BSWA 3LX8A 4HQFA 4H6XA 3N2ZB 4MKHA 1JR4A 4MKXA 4YYZA 3SYMA 5AKHA 1TLLA 1WHTB 3FZGA 4EMUA 4ZK2A 2Q3JA 4OF4A 1LSSA 3BOSA 3KSMA 3LRTA 3O26A 2Q6LA 2DSTA 3HYLA 3NBUA 2VNAA 4I4TB 3NM5A 4NJEA 4RY0A 2HCJB 5ELLA 3RG8A 4UQPA 3OM0A 5CVUA 1FUUA 4TYYA 4YACA 2PA0A 3HU5A 5DN9A 3UT0A 2JDID 1SHTX 1UEXC 2IZZA 4R8KA 1ZRSA 1XRMA 4LYHA 1LBSA 4P38A 1JVBA 3HS3A 3H4IA 3TUZC 4AO8A 2BMJA 2YJNA 2GZSA 3AR4A 3MGGA 1P2VA 2GK6A 4U7JA 4XSGA 4OGWA 1NVTA 1DPFA 3CH4B 1E9EA 5CTJA 2C4UA 3C74A 4MPDA 3SN6A 5I7SA 4KIJA 1SXQA 4KWEA 2OOSA 3QUBA 4ZCTA 1JS1X 4EFMA 5DCLA 1FIUA 2PWBA 3O9MA 1KZ1A 4MQEB 3TEMA 4R2MA 2YKGA 3OIGA 2ZYGA 4OI1A 5B6JA 1FFHA 2A0FA 1AVTA 1GDTA 4Z4IA 1S6YA 2Q6OA 3BHNA 4OK5A 3LPAA 3TR6A 3C1TA 2XTAA 3A4TA 4I4IA 1ECLA 5F4BA 4Z2AA 1V8DA 5KS2A 2BKXA 1Z2DA 3I32A 3P5SA 2O2SA 4KOAA 1M2GA 1R8XA 2ZWIA 3K2QA 4KQ9A 4XGRA 2HY7A 4ZKEA 3X1JA 3ZNNA 4HWGA 4MGIR 4MQLA 1XFAA 3WYDA 2C5EA 2W93A 3VZDA 4CF3A 4A7PA 2V7GA 3FA2A 3KZNA 5IJ9A 5IYZB 1O87A 1I7SB 3TMYA 3VR6H 2YW2A 1ZICA 1ZM2A 4MPRA 4P7BA 4L7VA 1E20A 4OHRA 2GI4A 3WIDA 4C5BA 1CEQA 4W6ZA 3NBFA 5IHXA 3TNLA 3L8GA 1BO6A 1F4LA 3IAS1 4Q3LA 4ZI5A 3B52X 3G9XA 3AH8A 1Q1EA 1TT5B 2RH8A 4E5NA 4EABA 5AXAA 5IM5A 3ESDA 2OV2A 4DREA 2QBYA 3FKSD 3H2BA 3KX2A 1V0JA 2K87A 4BO4A 1N5DA 3S2ZA 2Q9AA 5TDHA 1U7TA 1SCNE 1KIFA 4URYR 1E8DA 4C7JA 3IMCA 1VRVA 1U80A 2F3PA 1NPYA 1JEDA 1Y42X 4GEGA 3W8EA 1A69A 2NQTA 2D5IA 4XVHA 4BTEA 1PT5A 2DQ4A 1Y0BA 2QD4A 4WRRA 3CE6A 5KVAA 4ARIA 3R6LA 3AV0B 4JP3A 3L4EA 5JPCA 1JHOA 2WC1A 1KSHA 4G4SP 4GX0A 4TS9A 4P0QB 1K5DA 2JIPA 2QTGA 3LWBA 3K05A 3PFBA 2E5LB 2V6BA 3SDSA 1SQGA 2RKBA 1DX6A 5BOSB 1YBAA 1RXCA 1ML3A 1UZLA 3IUMA 4OM7A 1AOXA 2Z9DA 4M2LA 2HXSA 2GKOA 2YNMD 4MYTA 4MGHA 3V34A 4H59A 4GF5A 1YRQA 2NU9B 3B9RA 2WUVA 4KXNA 3SIPA 3RQSA 1ZH4A 1MC1A 5FT9A 5F12A 4ZV9A 5JTUA 3QJGA 1QOZA 5ENVA 1EG7A 1P1JA 3KL2A 3KOXA 3OT1A 1EE1A 1OXBB 1F8UA 1QIGA 4LHXA 1JLSA 1DQPA 2PX3A 2YFKA 3RPEA 1OROA 4D1YA 4P2GA 2QGFA 2CFTA 5EIBC 4EMSA 5JXIA 2QI9F 1EGHA 1E6WA 3I45A 3CF4A 3STHA 4DLWA 1FUIA 1JHMA 2IU3A 4GO1A 1M6HA 4PO8A 1Z13A 4D4IA 1QYXA 4DYVA 4RKFA 1YGPA 2PJZA 2BZ1A 3I9NA 1F8GA 1NBME 3KV3O 3LJKA 3QKIA 2AOVA 3KKPA 3R3VA 5ICEA 2X0NA 2Q3LA 3GIWA 2W2TA 1UPAA 1KARA 4LCBA 2QRJA 1ISJA 2XKKA 1EUQA 2UXBB 4QYMA 2DQZA 2EERA 4LV8B 3R7LA 4PX5A 1NM5A 4UUMA 4OBBA 5M5BA 4JJKA 2IS6A 5HWSA 2PGIA 3NIBA 3EW9A 2PS9A 3E2IA 4C08A 5G02A 3FOEC 1TJ3A 1T3GA 3DPIA 3AL0C 2HMTA 2ZE7A 4UMEA 3OFSA 4FE4A 1Y33E 4JJFA 5BO5A 3ZQ6A 2VPTA 3KL4A 1R4MB 1JL3A 5LZ7A 4IYRA 2ID8A 5CFOA 1VKRA 3IIKA 1W30A 4TUYB 4ZT5A 2VYQA 2A0UA 4FYXA 5FUWA 3NEAA 2OP0A 3TLAA 3VO8A 421PA 3TJMA 4BO2A 1O0CA 1GAXA 1YB2A 3EGCA 5BWLA 3JALB 5HQTA 2D1QA 3L0BA 3BJMA 4WI1A 5JQGA 3EUEA 1PJSA 5AXDA 4FYKA 4MICA 3WWCA 4DLAA 3ZWCA 1ESNA 3MCAA 3JQAA 4EFLA 4PLYA 4GICA 4DLBA 1ULUA 2N42A 1FVFA 3NJ4A 1TIBA 2ZVJA 2H57A 2XWJI 3FFXA 3LW8A 5KYYA 2ON6A 1VSVA 3WYAA 3MAAC 4J1SA 4DYHA 1HLPA 1EZ1A 5J47A 3JASB 4KBFA 1LF5A 1EJ2A 4CQLA 5I9SA 4B2PA 1WB6A 4I9UA 1TZCA 2WT4A 2YWDA 2AKYA 3IQWA 4IOKA 4PAQA 3I92A 5AM2A 4DWJA 1JJFA 4IHKA 4FGZA 1SZJG 1XHEA 4JP8A 4Z4FA 1WZUA 3OF5A 2HBQA 1U7OA 4EEKA 3T5AA 4NABA 1F6WA 1DC3A 1S2MA 1ZGAA 2OBXA 5FBRB 5FQOA 3W8DA 1MC8A 2G6TA 4XRRA 2VJMA 5DI9A 4ZQFA 4JA2A 2DULA 4RPHA 2O2YA 4LBVA 3AKZA 1JHAA 1Y3CE 2V3CC 4BGDA 4EDFA 3IMEA 4JJ4A 2A86A 4RJKA 2RI0A 4WNYA 3W9SA 4MVJM 2WIBA 2BGKA 3B1YA 5A0VA 3F7OA 1F0YA 1MOQA 1NI4A 4KSBA 4BX0A 2BKEA 3OCCA 2LCQA 3WQHA 3LCCA 3SXUB 4ZHQB 1Q5PA 2WAAA 1RAIA 4RYLA 1XL1A 4JYPA 4F5YA 1DIRA 2BISA 1SR8A 2AD1A 1RR6A 4OMCA 5DNVA 5LLSA 2ZUTA 3VC3A 4L5YA 5FL3A 1JJVA 4G97A 1XTUA 5DCWA 3N0TA 4G2NA 4HMQA 4MH0R 4BVJA 1SKMA 5PGMA 5AJWA 1YZVA 3FXAA 1D1QA 4P80A 3SY8A 4K0KB 3IQFA 1GTVA 4NG4A 1G42A 1ODTC 2HXYA 2Z3VA 2M32A 4GWGA 4LNUA 3DDOA 4HFNA 3RYHB 3ZEIA 4C5CA 5EESA 5K09A 3JYOA 1MAUA 4OJQA 1GNSA 2ZRCA 1JH8A 1V5IA 3QZUA 5FP0A 3ZDYB 4AULA 4EIWA 4X8MA 1AN0A 1K3TA 4Y6GB 3WGMA 5ICMA 4DUZB 4QNMA 1NVVQ 2V9ZA 4NMMA 4NBNA 4CHGA 2GZ3A 2HDWA 2AC4A 3CLRC 4BGVA 1Z22A 4F8JA 3SR3A 1N2IA 1V43A 2II6A 1U2RA 3BE5A 1C9KA 2OBNA 2UVQA 3AHEA 1HZZA 3MUOA 4JBIA 3QE9Y 2XW6A 3TVTA 4B8YA 3IEPA 2O2DA 1BDBA 1GNVA 1W4LA 3CT4A 4RCZA 5HVNA 4Z6KA 4AS1A 1I1OA 4PNEA 5AJXA 5MHTA 2GF9A 3ITKA 1UZAA 1E4EB 2PUWA 2G36A 1PUIA 3AIKA 3HL0A 5AKGA 1L8LA 3ZV5A 1C8VB 4NS1A 1ZI6A 2FMHA 2ZZMA 3R3HA 4WHMA 2W2NA 2G70A 1V2GA 4P4TA 2C57A 2FQWA 2LGJA 2Z1MA 2Q7OE 5KVSA 4PRLA 1R3UA 3ELUA 4WOKA 4JJ6A 3FOBA 1TYEB 1XD8A 1S4MA 5LA6F 5JO9A 2X9GA 4HXYA 4RHXA 5C37A 1XTJA 2ABWA 1XDUA 2R97A 3M6LA 3QLUA 4RCVA 4EJSB 4KVFA 3SYKA 5DP1A 4TVBA 1C7QA 1J90A 3F7TA 3M9WA 4CM7A 1CR4A 1IBCA 3TMAA 3ENNA 3QBVA 3V4VB 3TFQA 2WAYA 3ANTA 3DMDA 3IPLA 3LGSA 4WK0B 3MINB 5DX8A 3SIXA 4F3TA 2EFJA 5JQWA 4AKTA 1DC4A 2YJ3A 4YWHA 1PD0A 5D3MB 1JIKA 1U0GA 1VZ2A 4PX2A 4Y9UA 4W1RA 1U3WA 1X13A 1DEKA 4MCHA 4RL6A 2NSLA 2YMLA 5ALRA 3HRIA 4KIWA 4JI4B 2DJ5A 5HDBB 2BEJA 3MRVA 2PRZA 1RMQA 1G8FA 4L8GA 5CB6A 2RI1A 1O89A 4URHA 5CXQA 3BG5A 3DE7X 3DOJA 3BCHA 3KQMA 4LHEA 3SEQA 1DBWA 5E38A 1PSZA 3W2TA 4XWKA 1N6PA 5LLTA 2DY0A 2F55A 1OVMA 4RZIA 2Q6VA 4RQAA 2R1VB 1Y3HA 5AW3A 5JH7A 4JJAA 4BLQA 2PUAA 1J1IA 1E60A 4BP3A 4DQUA 1BEZA 3QEJA 1Y6JA 2GSDA 2OO5C 1G291 3QP9A 4RTSA 1WBBA 1SRQA 1G5FA 3EWIA 5AM1A 4OL0A 2Q99A 3GQBA 4LZAA 3DO8A 5KYWB 2WIJA 2XRYA 1JDBC 4GYYA 4R8SA 5IAKA 1RZRD 3DMPA 1J2UA 1PT8A 5EJ7A 1B0AA 4BV2A 3FNBA 3PC6A 2O7SA 2VRBA 5DGXA 4I50F 4MV5A 5JDIA 2GHQA 4PLWA 5BVGA 2BFCB 1IJKA 3LIIA 1FTYA 2GWHA 4ARVA 1AMNA 2HF2A 1S5PA 1NZDA 5LBUA 1QM5A 3U0VA 1TA0A 5B58C 4YBZA 1EFVB 3IT1A 3IMKA 3C45A 4I1UA 3D0KA 2F2TA 3PTZA 1V5FA 1MH1A 2RJ3A 4QHTA 1IVSA 3VNVA 4ESOA 5JY6A 5C0OE 3TWOA 5GOZA 5K5EA 4OLHA 2J3QA 5CLFA 2HQRA 4GOJA 2A84A 4RVCA 3A9CA 4ARZA 1QPZA 1VE5A 3EN0A 2ILVA 1H4TA 1MVNA 1ORTA 1U2QA 4I8DA 4XDGA 4IJ5A 5FLYA 3VKVA 5EUMA 3OJWA 4ZGBA 4I6JA 3KNZA 1E1KA 3CZQA 1I6WA 2P9QA 3LZCA 5E1DA 1JI3A 2O2EA 5GM2A 1T2VA 2P8SA 2ERCA 4NL4H 3TR5A 5MGBA 2PBZA 1RLTA 2GBFA 3B38A 4E2WA 3FZNA 3ZLUA 5JXHA 4DWWA 4PRYA 5JXWA 3ZWKA 3FMPB 3GFRA 2R00C 4IS2A 3L8CA 2AWOA 5KTPA 4CIWA 1ZEJA 3L7CA 4KXWA 1DCKA 4V0LA 3BGSA 1OXVA 1UWCA 3M70A 4CXMA 4CPDA 4TZ6A 4LHVA 2YXNA 3O4VA 4J3JA 3CZ9A 5K6AA 5LQJA 2A6PA 2I29A 3AY3A 4J76A 2H5EA 1ZMRA 2PCJA 4DM4A 4F92B 1KGSA 1HA3A 3A6HA 3A9UA 4J7XA 3G5AA 4RDXA 1X7HA 1OA0A 1JWLA 1SCBA 1TUBB 4Q12A 4BUJA 1UMCB 3GDHA 1AGYA 4ID3A 3VJMA 2W6JD 4ND2A 1PJ3A 1YVUA 4Y6LA 1QCYA 1M72A 2EFGA 1MV5A 3KHSA 4CKEB 2AHRA 2GBPA 5DM1A 3LQKA 1JF8A 5C80A 3ZLBA 5KNCA 1GPNA 3UUFA 2YRXA 2YWXA 3S2YA 1EUYA 4MJ7A 2YVKA 5IT4A 2BGMA 1F0KA 5ISMA 2BMWA 2EZ9A 3IR6A 2IODA 3OEED 3D43A 3DA8A 3G6KA 4IV8A 1LW7A 1WMFA 4DT1B 2GPJA 2GEKA 1X1RA 3ROFA 3DMNA 4IZHA 3GEHA 1IUNA 3ZI4A 5IDWA 3PIIA 3L05A 1Z0KA 4Z7JA 4G0QA 4D9IA 5FPYA 5C81A 1XA0A 4UU7A 3D2CA 5M2QA 4YRLA 4E33A 1TQDA 3PD1A 4YAJA 3PKZA 2QLBA 2A5GA 4B2IA 1KEZA 1G55A 3GUZA 4TV9A 1UQUA 2Z57A 1A4UA 1HY3A 4RMJA 4E2FA 1FYWA 4ED9A 1ZUD1 3J7AC 2IX3A 3K71B 3CRRA 5LM3A 4FI3C 3W3ZB 5CNKA 3KSUA 4G9GA 1CNMA 1MABB 4L8VA 5EIOA 1I7NA 4YCAA 3H2KA 4CIDA 2ZRIA 2AH5A 2BDUA 3QUQA 1DVRA 1G60A 3RTAA 1E9FA 3QE4A 1SOWA 3N7UA 4PHFA 3U3ZA 3PLRA 4HGYA 5FR2A 2WAMA 4R7TA 3H4MA 4I2NA 3LH5A 2Y66A 1KERA 1V16A 1G2QA 3ZGXA 3ZXUB 4E7OA 4OHYA 4TYWA 4V24A 4NULA 4Q34A 1DXOA 3W6ZA 2WYVA 4LY6A 4F4DA 3ZD9A 2JG3A 3EA4A 1E66A 3QF4A 4MS4B 3V1TC 2V3VA 1I4WA 2X5OA 4OEHA 2YIMA 3IC5A 3PDHA 4C04A 5BVHB 1QFXA 2Y1LA 1C50A 4X93A 1QB7A 3YASA 2MSCB 1CIJA 1QNFA 1H2BA 4QJIA 3BA6A 2FSVC 3ZVLA 1PNRA 2FUKA 4M1SA 4EKEA 1RKXA 3ZGLA 1T4CA 3E9NA 3H5WA 5FJJA 1CY1A 4IKEA 4M9QA 4EF5A 1CS0A 2GCEA 4OLBA 1T8PA 1WXDA 1GO2A 2R6FA 2Y0PA 3L5OA 5B7QA 3GCZA 1TCUA 3GVCA 1AKRA 2O8DB 3WJ2A 4ZJPA 1MFPA 4X0EA 1PRYA 1QE3A 1YMUA 3GJ7A 3NHUA 4P7GA 5DTEA 3O1JC 4DUGD 4AKGA 2A4KA 3E3AA 4HPJB 3W6PA 4EKIA 4HXFB 2O52A 3NU1A 5AT1A 1YBVA 4J2OA 5G53C 1EXMA 2XE7A 3FKJA 2PQMA 1KU6A 2H1CA 2JIDA 3H19A 4JVSB 4QYWA 5FPPA 1WW3A 4AL4A 2JAUA 4Q4AA 1I4LD 1Q7TA 1AJEA 2HQSA 3DFZA 3ESRA 3GF4A 1DI0A 1E2IA 3GZNB 5EHGA 1GGVA 1X1CA 3RVSA 1KJYA 3LOQA 2A3RA 2Z43A 4YQYA 4WA7A 2VJNA 4NMLA 4WVFA 5JCOA 4FZ5A 5AJYA 3LGXA 5CDFE 5DLEA 3H87A 3X1XA 4AP9A 5H81A 3I23A 3QELA 4JI1B 3UHOA 4BMYA 4RA6A 1AY0A 3CH7A 4S24A 1YVEI 1Z0ZA 4AUMA 2P40A 3H4VA 2G04A 1II0A 4MW9A 3FBGA 3V8QA 1HETA 1H2EA 1L5LA 2WTUA 1FRFS 2Q4TA 4UE3S 4PONA 4ARCA 1XZEA 3CR8A 3GA0A 3QTLA 5L7YA 5JEDA 5LQDA 1SZDA 2PGOA 1H5UA 3SQWA 2X41A 5TV2A 3WL7A 3WOVA 3TQTA 1U8FO 3HB9A 1AK9A 2GN2A 3LPLA 4PAOA 3SF0A 1NZJA 1RCTE 1RXIA 3H7AA 1CRPA 3HP1A 1FLAA 4TMWA 3SX4A 4CKBB 2VSOA 3EAQA 4HGZA 2ZB2A 3T52A 3IIJA 1P7ZA 1B1CA 2F00A 3ESAA 3DNPA 1JB1A 1YRWA 3D3NA 3GI1A 1HE4A 1DBPA 2CZGA 2XVZA 3B9PA 5CA0F 3WNBA 1XRSB 3N07A 2IQ5A 4G0YA 3GO4A 2E89A 2L69A 4KRGA 1VE1A 3EOAI 4KXUA 4LRTB 4NBWA 5KJ1A 4IMIB 5KQGA 3RASA 3GPDG 4R83A 2P6UA 1JXQA 5LP6B 3QLTA 1YJCA 2PK3A 4KN8A 5IDVA 4F2WA 1VJTA 5IM4A 1DT3A 2I7XA 2J3MA 2VEOA 1GUYA 2Z4SA 4Q3AA 5HMLA 3D4LA 4BC0A 1NATA 2I76A 4C7OB 1DX9A 1W76A 4OJNA 1Q0ZA 2EFEB 2GN8A 2ZT7A 3HUTA 2WF5A 3PB3A 5AW5A 3TGWA 5D3KA 5ULLA 3Q6MA 1EWYA 1QFSA 2RH9B 3JWPA 4FHCA 4G85A 4RY2A 5IMSA 2QZZA 1V26A 1OREA 1F17A 2H1OA 3DW3X 3IVGA 1XCBA 4N8DA 4PM4A 4W5OA 2B98A 4O4IF 4LE2A 5E6SB 3CZRA 4JLOA 5LIPA 1FDSA 3T3PB 2IYQA 3QW2A 5C1IA 4TRRA 3SR0A 1TJYA 1QHSA 2JCXA 2EKLA 4BNDA 3RSFA 2G72A 4DLYA 1KYIA 2E3JA 3HGTA 3CZ4A 3TEJA 1XU4A 1K06A 4Y9SA 2AG5A 2OCIA 1DFIA 4EHJA 4PCUA 3JQGA 1NHGA 3GGCA 3NOVA 2OM6A 3HZZA 4G8JA 4L8FA 5A9SA 2CK3D 2GD6A 4G1FA 5TEWA 4EKDA 5JMWA 2H4WA 2D5CA 1ZI8A 4JP2A 1WA5A 2BWJA 4KREA 3UT5B 4IOMA 5CVVA 2DXIA 3K0FB 4P7KA 2F8TA 4KIUA 3SFTA 1U02A 4C4RA 1ZG3A 4IMRA 1YRHA 1XA4A 1NW3A 1Y81A 3G17A 4L5AA 4YO7A 1ONBA 3U60B 4GR4A 1IN7A 4O4LF 1DAGA 1YB6A 3SS9X 3ZXYA 3EIUA 1IE3A 1VP3A 3KQSA 3R3SA 2G09A 4C2BA 1OQAA 1XO1A 1AK2A 2Z09A 3GLHE 1IAVA 3O9ZA 3GLIA 4IICA 1FW6A 2QRGA 3FNFA 2A67A 2D8AA 3OLQA 2QQFA 3BCRA 1EFTA 3O4IA 4QICA 5EC8A 5AUQA 5KNBA 5SZKB 1PN3A 2G71A 2EP8A 2R4UA 3K32A 4B3DA 4B45A 3I9LA 2IFTA 1T91A 2J0EA 4WKCA 1RKBA 3R24A 4C30A 3NBQA 2WWFA 3X43A 4D0GA 3NANA 4Q1FA 5E6UA 2DAPA 3W8RA 1RWKA 1SCQA 3GAFA 5BUCA 1XLTC 3AFGA 3K96A 2LWIA 3C98A 3AG5A 4B6QA 1E6KA 3FE2A 3QITA 1ZUNB 1I10A 4RZ3A 5TE9A 3TQRA 1T4MA 3LECA 1EDEA 1W8IA 3W79A 4IIVA 1XELA 1EM8A 3EFEA 5C31A 5A5FA 3PI6A 3C85A 2X1MA 4JASB 3MTQA 1ZVKA 2Q5OA 3T5PA 1U99A 3JQ7B 1O03A 1YD7A 2QHXA 2WAXA 3DB2A 1ZN9A 2C9OA 4IJMA 2Z2YA 3QMWA 4KSYA 2YICA 4R5MA 1PL0A 3M3PA 2R60A 2ZSBA 3H11A 4RMNA 3CTMA 2QK4A 5E7IA 1PJZA 3LGAA 3M81A 3Q85A 4U2CA 1GITA 1J8DA 1ZUWA 3WLAA 4MQ6A 1CY0A 1ODKA 2Y6UA 3CLHA 1L4GA 3A0UA 3C8HA 4A8HA 1LVHA 1HL3A 1RWPA 4K6CA 2QJRA 4ALMA 1W96A 4AZVA 6REQB 2PLAA 3M5PA 3VTFA 5CT5A 1SIWA 1SC4A 3A36A 4QBHA 1MIOA 1NW5A 2MTBA 3FCXA 1KZHA 4AIIA 4B3HA 5A3VA 2QAGA 1Z35A 3VR0A 4DR6B 4WFJA 5B36A 3CBQA 1YHZA 1DE0A 5DNCA 2O8FB 2G77B 3GDOA 5L4SA 2PT9A 1ULSA 3EUAA 1J24A 1M6VB 3K9QO 2EATA 4MGYR 4XB2A 4OM8A 1II8A 3RS0A 1O96B 2B5VA 3DUWA 2XB6A 3B3FA 5AHRA 3V80A 2QUZA 2BV3A 4BXOA 3JAWB 3PJRA 1AHNA 5DNWA 2XCSB 2YY7A 3NKLA 4P3YA 3WLNA 4EHFA 4CIAA 1GL3A 3AQIA 3WBFA 4IX1A 4R2WA 3H2SA 3ZUPA 4LFCB 2DHQA 3TZBA 4N48A 3L1HA 4IS3A 4OQMA 1ISIA 4H31A 5KTKA 2ZULA 3U39A 1W5TA 2NLOA 2YS7A 1E2EA 5LFAA 4AROA 2D1TA 4BTLA 3S8EA 4OSPA 2FWJA 5D8DA 1EUDA 1G8YA 1D04A 3G59A 5JCZA 4V0KA 2GCGA 4D25A 1PKXA 3CZCA 2BPOA 2WABA 2YN0A 3N5KA 4TM8A 5EMHA 2I0FA 2Z04A 3DOIA 3L0SA 1VRCA 1PV2A 1OFUA 4KAFA 5CVDA 4FYYA 4B47A 4ER0A 2WOOA 4Z1MD 3O3NB 2Q9UA 2CMKA 4RM3A 1T10A 1XHFA 1YASA 2CBGA 2QSUA 1RP1A 5KOHA 1T9HA 2R1TB 3CUSA 2EBWA 4RHYA 1WQ4A 4CUKA 5T64A 2EXXA 1P0FA 2SNIE 2X76A 1Z5NA 2ZB8A 4YAWA 2XI4A 2CVQA 3GLGE 4HFJA 3DLHA 3THXA 1PNTA 1DIAA 3EXEB 4JKOA 4I6EA 3BXXA 3WHIA 1DRKA 4BGIA 4DA0A 4EARA 1W4CA 1RLJA 1VYHA 1R10A 3EDQA 4HD8A 3MWDA 4FS8A 1Z0DA 3ROTA 2ZKLA 3GJTA 1A9TA 2LTAA 4YUAA 4LTDA 1GRVA 4X1YB 4R0NA 4NWIA 1C80A 1EK2A 1SXJA 2O05A 2YS6A 3AY0A 2HI0A 5BRAA 2WU0A 3ON5A 4N0MA 4ILEA 3L2OB 1I4DD 3IP1A 2PUGA 3HSKA 4RA9B 1TXGA 3U9TA 4LG1A 3AF2A 2QOEA 3FDXA 4I3GA 1S8OA 1PR6A 4WXMA 2WSSD 3M0EA 4EUNA 3VVLA 5TMPA 1MAAA 4OX9B 4P0PB 2CVHA 2D3TA 2PV7A 3GGPA 2BRUA 1U9CA 1ZIOA 2IXAA 2B7BA 5JI2E 1XPRA 3VGPA 1LQ2A 1W1IA 3BAZA 3QU7A 1JHZA 1UF9A 3R3UA 4F72A 4QXPA 1HQDA 4NPCA 1GSIA 1EVIA 2VP5A 1GFZA 1QK4A 2IF0A 1GXSB 4HDCA 3IRVA 3KJNA 3UMCA 1U2TA 4P4SB 2INGX 3Q0IA 1IPFA 5DLQC 2RHWA 1FYFA 5JCXA 5IVHA 4D57A 5IKMA 3NDPA 3ONNA 4IHAA 2HTEA 1GG9A 2XWBF 4N6NA 3K53A 2UYQA 5I7OA 3P9SA 4MAMA 2ZJ4A 3IB3A 1JJ7A 1SUDA 5KMGB 3C6ZA 1X9GA 1A7AA 1Z74A 2OD9A 3I58A 3IULA 3N5CA 3EQ6A 3C3MA 4KLZA 4NZ9A 1Z5VA 5DKFA 1O77A 4K9OA 1G9TA 4RFVA 4WN9B 1E61A 1ZO8A 2LD4A 2P62A 1TTPB 3HN6A 5K3BA 3WKBA 5ALMA 2J9RA 1IDOA 4PFKA 5DGHA 3RFFA 2YWJA 4EECA 1JU9A 2C84A 1RJWA 3GLHB 3MWJA 1R6AA 2XCQA 4L15A 1ZNZA 4M1TA 4XQ0A 1CS4C 3LF2A 4JLPA 4WCFB 4LXTA 1M1NB 1XAHA 5E8RA 4BFWA 4RGBA 4BO3A 2OGSA 4DA8A 1QCCA 2PWAA 4U6NA 2PM8A 1PUJA 2Q3DA 2JVJA 1S96A 2Y1GA 4CL2A 1QCZA 4HQ6A 2ODAA 2VJCA 4RFSA 2HNKA 1UKEA 3FIJA 3Q2OA 4HN2A 2PE5A 1ZAKA 2ZW9A 1WMBA 2WZCA 3PBKA 5LKRA 3SR4A 2NYRA 3D8SA 3P9KA 1OVGA 1W73A 2YV4A 1OY1A 4B3BA 2PLFA 1UPTA 1QYVA 2FJPA 2TMYA 2J46A 3F7MA 3WGJA 3BL8A 1X1AA 4EJ2A 3QFTA 2A5LA 1ABFA 5DE3A 4CG2A 3ADPA 4HWRA 1V9SA 2PJDA 3KWJA 5LA6B 2PD6A 3ZNOA 3AEYA 5KX5F 1SKUA 1HORA 3TECE 3HCRA 3SE7A 1P5ZB 4PYRA 4DMHA 2PEZA 2VUUA 4PPQA 2EAUA 4TLDA 4KU4A 4GMGA 3ZDFA 4ND6A 3DEIA 5KYUA 2AMYA 2CD7A 1MRSA 1Z5PA 3PNPA 4IIFA 4MR7A 1EWQA 1I7QB 4QPPA 4JOCA 3V7NA 4DRXA 4Q9DA 3OP4A 1KRWA 1T5LA 3KVYA 4JNCA 2ZYRA 4P33A 5IK2A 4L51A 2HSDA 2VK4A 5AYVA 3F67A 4DR5B 4ZCLA 2XVXA 3DEJA 1Z36A 2Q2OA 3H97A 1KYXA 3KELA 4H27A 4HZUB 3V5NA 1XRPA 1NQAO 2EBFX 5AUPB 2A57A 4GSYA 2BJWA 1HQYE 2PMKA 5FO1A 1L1EA 2CXTA 4QG7A 3PXEA 1AUPA 4XIYA 1N9KA 4PZUA 1PJ2A 1Z7YA 3JYHA 1SHZA 3DD1A 1FL9A 4C21A 2E48A 4WKNA 2EZ8A 3W2FA 1W0KA 3FZQA 5EGNA 4EL5A 1PYDA 1HFEL 2H2IA 1UL1X 2FVYA 1NBEA 4B8WA 4ETNA 2AXNA 3BWVA 4RTLA 1EGQA 3P26A 2A8YA 3GGJA 5FUVA 3RARA 4B46A 4ENRA 3FETA 1ZGBA 5AK5A 4X24A 5ALPA 5FPHA 1IZ7A 3A6LA 4TXJA 2I4RA 4HUTA 3MJVA 1RAGA 2Y05A 1H65A 4G25A 4XPZA 2BDTA 2I2FA 4ETWA 1HYBA 1HDXA 1N5OX 1N8TA 4NMXB 4E3WA 3DM5A 3H04A 1TM5E 4Q7LA 1GAEO 3CA8A 4KQ1A 5DX1A 1Z29A 2GZAA 1LA2A 2OQ2A 4MDYA 4PRZA 3WIOA 4ZDJA 4PXYA 3E5MA 4UBOA 4W99A 2CL6X 3OZDA 5T4BA 2JIBA 4LY0A 4NYMQ 3ZIUA 4MWEA 4YAUA 4MYRA 3GLGB 1BZYA 1DL5A 4MJLA 3IHWA 4P4NA 1E3WB 3M4NA 2EP5A 4X6LA 1EXNA 5DWQA 1QO7A 5EKSA 4Y7DA 4YQEA 4U8GA 1ZR4A 1SAYA 1UBJS 2AKEA 5F77A 5SY6A 4G4GA 5IJ0A 5BRJA 4QBGB 1QR2A 3BDAA 1OYYA 1TU3A 4FOOA 1LRKA 1GUFA 1OLSB 2OOKA 2QUBA 4N5IX 4A3SA 3HCCA 1KKLA 4XCQA 3CKLA 3RAFC 4E09A 3CUUA 4FNAA 3ROGA 3FNGA 1VLVA 3SBDA 3TQHA 1NJ1A 2B78A 3B8HA 5CFLA 2EIXA 2YY5A 4UTOA 4G5GA 1GEEA 3QYJA 1X1QA 4REQB 3RRZA 1KQFA 3THYA 5AK6A 1ES9A 2IJGX 1BX1A 1KZ7B 2R66A 3DOFA 4ZVVA 4AZ0B 2FMTA 1ZOIA 3BZWA 2IUEA 1ORRA 4R84A 3TW6A 3WMFA 1FS6A 2JJ1D 2VTEA 3DOUA 3BIXA 1ZR2A 3NT2A 4Z49A 4ZVSA 2GZMA 4G89A 3O8BA 1DWQA 1FLNA 5E2AA 3F0TA 3MJ4A 2Y3IA 2FPGA 1Y9JA 3LL4A 4MWGA 4B6OA 4EPYA 1TVEA 3Q9SA 3VHLB 4EATA 3Q41A 1KEWA 4UHEA 4GZ3A 1NQ5A 4KFUA 1WMSA 7YASA 2BF7A 1KY4A 5GONF 3SKVA 3SM3A 5KKNB 1N3LA 4NTZA 4W8OA 3TN7A 2PVSA 3W5AA 1I32A 1XZFA 2JIZA 5FA8A 1EAYA 2A9FA 2H7XA 4Q02A 2XCOA 3KSDO 3VX3A 3HR4A 4CIVA 3MLBA 5FWXA 3BUSA 5FUXA 3SQLA 2AUNA 4R01A 4CVNA 4PHHA 4RL4A 1YQGA 3OJ0A 1PFWA 2PX8A 1WX1A 2Q1YA 2YHSA 3NWBA 2ZDGA 3LP5A 3FUTA 4D96A 4ZMBA 3PF9A 5BSEA 4JUIA 1U7HA 4WZZA 1A4XA 5D85A 2AXQA 2E4UA 1Y1SA 3HCPA 3BRSA 3OOEA 1UAGA 1I3NA 5IFKA 3NUGA 4URXR 2FVXA 1KK0A 4X3PA 2M2IA 2QN2A 3MS2A 3PFHA 4RF5A 2WDPA 1W35A 4GKBA 3IEUA 4HDNA 4PC1A 2RIRA 1XZDA 5M3BA 4GPAA 1Z8NA 4J0DA 3NIDB 1V4NA 3H1FA 5EIBD 4GI3A 3JQAD 1KAEA 2LVBA 2NVWA 2REQA 3G88A 2BMDA 3KKOA 1C3OB 2WUFA 2EG9A 1I2DA 3MA0A 4UMVA 5I7AA 4B84A 1C9JA 1DKLA 2HLHA 1M2VA 3HDYA 4RO0A 1I2ZA 4HWKA 2QAJA 4KMOA 1SD2A 2C2KA 2EJCA 2NUBA 1U3FA 3ZN2A 5M29A 2Z1DA 3ENKA 4RPIA 1KP3A 1U2DC 3FPHA 3NKVA 5AKXA 3SKYA 3ODGA 2HJGA 4DANA 1LC3A 1B93A 1BFKA 1P81A 1JAIA 2VDPB 1U0OC 3JW8A 3O8QB 3OZVA 5E9AA 3U44B 5AHKA 3VV3A 4NCHA 1E0KA 1FLVA 3C3DA 1MQ9A 3GRUA 2HDOA 4AKHA 1RADA 3VTKA 3LOPA 4DJDC 4C6RA 4IY1A 1XZJA 2PKWA 1ZIYA 1WP9A 4MW2A 4Q21A 2RB5A 4OXXA 2WD7B 2YJZA 2YXBA 1QB8A 2G17A 1N3YA 4BVAA 3DTVA 2HLNA 4P7JA 1ELOA 3DAPA 4Z1OA 1A9YA 4J43A 4R3UC 2A7XA 2X86A 1Q20A 4G4JA 4YP6A 4CMIB 1CEYA 4TS1A 1M33A 3COZA 2P78A 1GCIA 4B3FX 4G5QA 1LVUA 2GWRA 4FE3A 4GUAA 2QVBA 4C7XA 2PWYA 2XCIA 4WGGA 4ITUA 2BHRA 5EYPB 1U4NA 3GMSA 4PX9A 2IVZA 3L7NA 3SEZA 2GOYA 3AR3A 4OI2A 2Q3CA 3ENVA 3U17A 3PUZA 1XP5A 2IRWA 1N2CB 3IO3A 1F20A 1RQRA 4KDCA 2WUWE 2XADA 2C1EA 2ZB7A 1OLXA 3HZRA 3BGWA 2ZFUA 1EFKA 3G2PA 4OHCA 4V38A 3SLGA 3D3WB 3ZJ4A 2ZI7A 5KCZA 1XMJA 3GHYA 2BIFA 3E22B 1NF8A 3B6EA 1ZOSA 3LHIA 2XD9A 2RMKA 4NOKA 2XMPA 1P1IA 1NR1A 1WXFA 1XTVA 4BFLA 2PKQO 5CK5A 3HA7A 4I1OA 1NV8A 1CY2A 1PJAA 5HX7A 1RSZA 4R1QA 3L0ZA 2H11A 4GOXA 4NK4A 3DFMA 1A98A 4XAQA 3TSZA 3V42A 3ZWNA 4B81A 5I6DA 4M6WA 5BWCA 4MPJA 1SY7A 3OE7D 1Y82A 4WCVA 3ZXIA 1DO8A 3H2ZA 4IVNA 1GPUA 4RZ2A 4ALIA 2F1RA 3QKRB 6PFKA 3O1HB 1WPXA 2FYTA 5JTTA 3C6BA 4ZAGA 1Y9ZA 3FPJA 1ZI9A 3OX1A 3CJTA 2G80A 5GGYA 1CHNA 1KI2A 5F7OA 5ABPA 5LZ8A 1S0UA 2E21A 4MRMA 4GYWA 3Q8WA 2W2KB 2JEYA 2GAOA 3CW8X 4C4AA 4BE7B 5CA0B 2SKDA 1QF9A 3VMMA 5IULC 1D2NA 4Z7NB 2FLWA 4NU6A 2BMAA 2GD2A 4LQDA 3I9MA 3PC3A 4P0TA 4GFDA 4RE5A 5F3DA 1QAMA 1DJLA 1KI4A 1NN0A 1ADFA 1ZEMA 1VL5A 2O5VA 3JPWA 2OCPA 1LFDB 3NYRA 2ZETA 4UTXA 1XMQB 1UWLA 3DT8A 3IYLW 3TB6A 1V71A 2I2CA 4RV5A 4OHFA 3GLTA 4D4JA 5CX4A 2GBGA 4F0JA 3JZIA 1SULA 2P2ZA 5EPUA 3C39A 5JZMA 3HGQA 5IANA 1STOA 3PICA 2ZCVA 1Q0SA 1V3QE 1MGPA 4I1SA 4N54A 4W5JA 4XASA 3Q5DA 3SGLA 2W42A 1H1LA 4EEZA 5EKUA 3TGLA 4O4IB 5IZ4A 4GZ6A 1FQOA 1Z6XA 2XCTB 2BFDB 2VT7A 3RUDA 5LXTB 4OUDB 1RTKA 2OCBA 4AJ4A 4LC0A 2HT1A 3EXIB 3RSLA 1W0JD 1Y4SA 4WVLA 1JGTA 4YMUA 2VJOA 2X4DA 1W4ZA 1GR1A 1MO6A 1XZKA 1YJ5A 2JAWA 2HXGA 1JQBA 4LX8A 1DMSA 2FK7A 4X7PA 5EXEA 4FGSA 5GV8A 5WRFA 4POOA 3BBLA 2R5WA 5C2JB 1FNCA 2I22A 4AJHA 1A1SA 3AETB 2P9FA 3TLGB 1LY1A 5EUBA 5HCUA 3T3HA 4MTLA 2OCGA 2XBLA 3DWFA 4M76B 3QYAA 1C8KA 1EX9A 3NTRA 4S3MA 4TKUB 4E4YA 4ID9A 5BY2A 5HS6A 1IBMB 3EVBA 3RFTA 3UXYA 2WFLB 4EW6A 3KYJB 4NFLA 1CQZA 3PEFA 3IA2A 4M83A 4C4SA 1JSCA 4B3CA 3R5HA 3MQFA 4LJ7A 8GPBA 4EM6A 4ZOQI 4UE2A 5EKXA 4DAOA 2IBMA 5IG2A 5M7EA 1NP7A 1GUAA 3PTLA 4ND3A 4RIHA 4O4LB 4G0ZA 4YCNA 2C3OA 4E5YA 4FGJA 2CW5A 2XODA 2XT6A 1QXSA 3HO6A 3QU9A 1BX3A 5DXFA 2JLZA 3AI1A 3FPCA 3RJZA 2HZBA 1LRJA 2A9OA 1IZ8A 1GYRA 2Q3BA 2ZBDA 2OWDA 3OTHA 3WV4A 2AJLI 1Y3BE 5CT4A 1PK9A 1EU1A 3EDOA 3FDZA 2FPRA 3NC0C 1OMOA 3RVJA 4B44A 4OJYA 4NENA 2OORC 3V4PB 3G5UA 1THZA 4LC9A 1XPOA 1IZ0A 2VNJA 5FD8A 1BVHA 3VHXB 3N2NA 1G21B 1C1YA 1Z6AA 1ONOA 3ROPA 3KXLA 1UOQA 3GROA 5DYYA 3RBZA 4C7VA 1GTRA 3N8KA 2HDHA 1QMGA 2IX9A 3WIUA 3FRIA 3WB2A 4BE4A 3JQFA 4YK7A 3AUAA 3K0BA 2UXDB 5DISB 3FR7A 3QK7A 2ZJAA 1CUXA 4PR3A 2HV9A 3L6DA 4DZTA 4I1PA 2BMFA 3U7HB 2XE6A 4MV0A 2R2GA 4BQQA 1FPMA 1NW8A 5FRDA 2I6GA 3SU8A 2X1LA 1TJ5A 1IBLB 2I67A 1WHTA 3GH1A 4HLCA 3ANLA 4L02A 4D7AA 4RHFA 1SVKA 5T41A 1D2MA 1NMXA 2VDQB 5G0SA 3D81A 4ZCMA 2QZJA 1Z7EA 2YBEA 3TPZA 3RAGA 4TXMA 5LBTA 3F98A 4L4YA 2GF0A 1T0JB 1Q77A 3D7MA 2C9CA 3DFUA 3A14A 4DSUA 2PNFA 3D64A 1H6BA 4RACA 4H7IA 4ILKA 4AG6A 4M98A 3O9VA 1PT7A 4B85A 3I28A 2DTXA 2HK6A 2ICAA 3IV6A 3GRPA 4HUQB 5BN4B 3GFOA 4QT0A 5AI9A 2XMGA 4GI7A 2V74B 1ADCA 1SB8A 2AT1A 2R751 2YW9A 3DBOB 1HLGA 3JZFA 5H59A 4COOA 4DW8A 2LIVA 5K0CA 4Z0NA 3JVIA 1EA5A 1CR6A 5DTJA 4S1PA 3DMTA 2QN8A 4W4TA 3E5RA 3ZGYA 3VJRA 3QPBA 3I39X 4ND8B 2B8TA 1UKVY 3H5IA 4IO0A 3DBIA 4L6CA 4NSNA 3WDLA 3U3MA 2VZLA 2IY7A 4K88A 4J0QA 1WCXA 1CULC 4G1VA 5DIZA 1A7UA 1H23A 4RJ2A 3WZLA 5IYZA 4B3SB 3JTMA 4FQ7A 2YVAA 4ER5A 3WSWA 1OWNA 2XB2A 1TE2A 1WUYA 2IXFA 4G5HA 3EIQA 1G17A 3C4VA 4DLXA 4RGQA 3G1TA 1U8AA 3G2HA 3RF7A 2XYRA 3ADBA 2PX5A 1L8AA 4IDEA 5FH9A 1HSOA 3D2AA 3TTVA 1ZOOA 1I6MA 2XUJA 3DONA 1ZYUA 3K6KA 3Q3EA 1Q3TA 1Z6PA 2O4CA 3MGKA 1U9JA 4KE6A 3R5SA 3O75A 2PG3A 4F4JA 1XCJA 2IUYA 2A4MA 1CQIA 3U40A 3HHPA 4G1UC 1PTKA 2JAOA 1G6HA 1M6NA 1RWXA 2Q5JA 1QBKC 3WNVA 3L49A 3B3GA 4DDWA 5C1PA 2FU5C 4RK0A 3ZD7A 1KJIA 1D2RA 1Q15A 2IP2A 3O83A 3TZ6A 1P61B 1XZQA 2WTEA 2EVWX 3L8EA 3QBDA 2GPWA 4J4BA 4L5JA 2P30A 3SI7A 1RT9A 1SOAA 5DW3A 3TYXA 1D6MA 1SIOA 3AHCA 2QV0A 3K0AB 3B6IA 1GDHA 1PVDA 2WFAA 4Y6SA 4CM8B 5I7UA 3DZDA 5FTLA 1UIRA 3T0GA 2FDXA 1NAHA 5HIMA 1R0YA 1RRVA 3LX6A 5BMVA 3RK1A 3HJFA 3MVEA 1B6RA 5FFFA 5BOSA 4BNUA 2IW1A 3RWOA 1FQWA 2Y67A 3VU1A 4V03A 2ST1A 1ODCA 1XCOA 2OGWA 2BD0A 4OHWA 2BMEA 3VRHA 4CLOA 1P0CA 2NU9A 3CUEF 5BT9A 4MLPA 1ENYA 3G89A 5KZMB 1X15A 3COVA 5CAEB 2PZLA 4DLUA 1CDZA 1JXAA 2FZ4A 2YC2C 3ACCA 3VU3A 3NI2A 3RAPR 1QCDA 4HNHA 5FF9A 3ZU4A 1U9YA 2FZWA 3TTUA 1Z06A 4TL9A 5AW7A 2Q0HA 1VIAA 3PEUA 5IKPA 1ARZA 1Y8AA 3B1ZA 5AW2A 4KMRA 3D8NA 5EP4A 2A9RA 1TL7C 3GGOA 4KUGA 3TD6A 4EFKA 1N75A 2DERA 3V2IA 2FW9A 3NVDA 2WMDA 1E2HA 4XR4A 4WBNF 2BMVA 1OX5A 3VNAA 1RAFA 3R7DA 4JUCA 3TLJA 4BCCA 2COEA 3HCAA 3OHPA 3O7WA 4DDMA 4LZNA 3WGIA 2XOKD 2J30A 2HTFA 2R6CA 3BSSA 1ZK4A 3IAFA 3TOSA 3HCDA 4MQBA 1HE3A 4Y9TA 2A59A 1P33A 3PYMA 1CK4A 1KJZA 4MW0A 5NULA 4M36A 5T57A 1E3SA 1FTQA 1DIHA 4KO1S 4NCBA 2CVFA 1R4MA 1HSZA 4F11A 2XUDA 5E8JA 3W3AA 1OPRA 3TIXB 3WGTA 2QT9A 5FTKA 1FBTA 4TUYA 3K09C 4R2KA 2GETA 4ME6A 3IHKA 3VBEA 3R75A 4YCLA 2GO1A 5AKJA 3PXAA 3UO8B 4DMLA 1D9ZA 1VKNA 3P9QA 4FR2A 4EHIA 2QTMA 5AW8A 4HAUA 5JY1A 4ZCIA 4FNMA 9LDTA 4HX2A 3F2IA 2J32A 4KVAA 3V8EA 2ES4A 5B3JA 2F67A 2JASA 1VPLA 4R81A 1YL7A 3JWHA 1DHRA 1H2WA 1ODJA 4QWMA 4R2JA 3VO2A 4YV0A 3IE1A 1IC6A 1P2GA 4FZ3A 3JASA 3F3MA 2CLIB 3VR3D 2RHRA 2WBLC 4KYUA 2WQZA 4PCLA 5CRIA 2WK1A 1UJCA 3R76A 1F6DA 3NTVA 4G4SO 5J5AA 2UYCA 4AI6A 4YI3A 1ZQ9A 1HRDA 1YZHA 1N7GA 4GC9A 4FDAA 4H7PA 2J3DA 2O07A 4TTPA 1UDXA 3DC7A 5JATA 3DE3X 1X19A 2EYQA 4NH0A 4E03A 1T43A 2ZT6A 5HPYB 2WJJA 3TAXA 4LHWA 1JFLA 3FDFA 3ASZA 2WIDA 4U2DA 3GGDA 1NVDA 2W8ZA 4EJMA 1SU4A 3IOMA 3OUUA 1HNWB 2JGDB 5KX5B 1HOXA 4AB1A 4QYIB 3AKCA 2EGGA 1RWMA 5C35A 1OH8A 2AC7A 3L1VA 3Q87B 2W2XA 3LNTA 4OU4A 4ZHQA 2Z0MA 1PJBA 2ZI3A 2VCYA 1MKYA 2EU8A 3KQKA 1Z73A 4CT5A 3ZDEA 4C2AA 3Q3GE 3FUVA 1RWWA 4MA4A 4I66A 3DLCA 3L7MA 4IH9A 1MOSA 5ETJA 3K31A 1GILA 1P17A 3CLUC 3IP3A 4N7RA 2QNIA 2W2VA 1O95A 3AFHA 1EVJA 5FUBA 1L7VC 1SD5A 3RYHA 3AB8A 4C78A 2EGHA 1TKCA 3N59A 1A5BB 4M1WA 4FYMA 4KX3A 4OHBA 4CKWB 3MWFA 4KRFA 1K7FB 4QOGA 1E1RD 2OWEA 1K4MA 5I9BA 4FE7A 3ZHXA 4PQRA 1JFTA 3CF2A 2J87A 2Z8YA 4C3OB 3T7AA 3C7AA 1CJMA 1DO2A 2GJ8A 3AEQB 3JRWA 4M22A 5TQVA 3MEQA 5ALQA 4G1BA 1TYAE 5CDTA 2Q7XA 3ICVA 1JZTA 4JWKA 1Z7BA 1HL7A 3Q6NA 4YJHB 5LMZA 3L02A 4WK2B 3GNQA 2R7AA 4Y2UA 1TZKA 3LA6A 5DB4A 4BPRA 5JS1A 4WL0A 1WTAA 2RGYA 2IUTA 2X3YA 1JHDA 3KQHA 1BDHA 2P9HA 4LFBB 3A3OA 1EUZA 1SHJA 3BA1A 1E4EA 4QE3A 5CTAA 2HIAA 4UHFA 3IR5A 4IJKA 5CU7A 4TTTS 1G8HA 1IRIA 1QJ4A 2YWBA 4Q9LA 3UAXA 1E9RA 4N5HX 3ZKWB 4L3VA 3REFA 5F2NA 3VQTA 3RUEA 1TNDA 1VFPA 3NUZA 1U1IA 1I1HA 3B51X 3DDNA 4Y2GA 4YJFB 4EA8A 3IURA 4ZU6X 3I1JA 5T7BA 5IKOA 4K9LA 4L28A 1YE8A 3F4LA 4BN5A 1Q1QA 3DMRA 5ALDA 4C0LA 3GJ5A 4H60A 4YRSA 3U7QB 2EL7A 3PTAA 3UJCA 4EJSA 3PR1A 1T6BY 2B37A 1CZLA 1H66A 1XE3A 3GGSA 1DUSA 4PPFA 2Q45A 3MAJA 2JHFA 4RENA 3UN1A 3VISA 4BAGA 3V4RA 3NLLA 3E23A 4RETA 5JSQA 5LMNB 4RE6A 4RF4A 4YJ2F 2H18A 5DNAA 5A2QA 3ORYA 3B9BA 4QXQA 3UMMA 1WOMA 2BR4A 5D3MA 1DWOA 2CNOA 1W34A 1QU2A 3ADKA 4MUYA 4B5LA 4BJHB 3RVBA 3F5FA 3F1KA 5FA5A 1HYGA 4J16A 5CK4A 3ASUA 4JL5A 1MQSA 3DS8A 2B92A 4FCWA 3LLCA 3G9TA 1MP0A 2FFQA 1UJ5A 1WKCA 1Q2UA 4YRDA 1AGXA 2XOXA 4TXNA 2WJWA 3DAHA 2VTBA 1U0LA 2IHJA 2R1VA 2QDXA 4X1IB 2C4NA 3QWIA 2ZTMA 3CNQS 1IN6A 2OUKA 2VUSA 4L4UA 5JAOA 2B6HA 2ZXFA 4TROA 2ORIA 5EIEA 1XN1A 1L7MA 2BFOA 3GCXA 2CFIA 2CCGA 3DAOA 5KYWA 3RREA 3UHPA 3OH8A 4YP7A 2GZ1A 1FFXB 2YH2A 4UEKA 4MK4A 5C34B 5HUJA 4B9EA 4UKDA 3BK7A 3NBYC 3LUPA 1RYBA 1HDGO 2C29D 2C0CA 1WCWA 2DT5A 2XNCA 1WXXA 4PLZA 2ZBGA 2NX2A 2XDQA 3KD3A 5J1TB 4CGYA 1UBLS 5JARA 1EDBA 3A2KA 2BFCA 3ONDA 4PZAA 5JWOA 2YIDA 1SWVA 3ZBUA 3ZJYA 2D7JA 3BJRA 1KO5A 3FBTA 2PUCA 1LNSA 1CDOA 2ZAIA 2AIRA 4ZAXA 1GNPA 4WLFA 3O90A 4JCCA 4Y0VA 5AIBA 5ESRA 1PYGA 3SK0A 4N9QA 3EGWA 3DYBA 2GYVA 2DFVA 4FZVA 2I54A 2J1LA 5LP1A 2QNRA 4YCDA 1YJXA 1O7JA 1AXGA 1SCUB 1J07A 2IPLA 4QLAA 2DLCX 2DOKA 3P2JA 3OLZA 5B6PA 2GNAA 5TEVA 1GPH1 4TV8F 2L18A 1E3TA 1K0FA 4DC9A 1LWOA 3E5HA 4FFBB 3N1UA 4BU0A 1AH2A 4MJ3A 3SM9A 2XTMA 3GXBA 1SD1A 1CJCA 2IPAB 5KC8A 1CYDA 1TUIA 2FJUA 2GZRA 2IYLD 2J9YB 3NASA 2PH3A 4MB6A 2VF8A 3KQYA 4ZO6A 4AN4A 1BJTA 3W5BA 5ADVA 1YMVA 3DDWA 4QFBA 5AK0A 1WRBA 4IILA 2IELA 3QPUA 4F5DA 3A1NA 4AZWA 2Q0SA 2CJYA 2FOLA 2XHEA 3CB4A 2GD0A 2WVHA 4W9MC 1TUBA 1UT5A 1UMCA 4LOLA 1U0FA 1I2MA 4QJ5A 2PJRA 2M6SA 1CHDA 4ZPXA 2J3EA 2X7HA 3KR9A 4CLEA 2OAEA 4CKEA 4V2UA 4DR4B 3H3FA 2FEWB 1XHLA 5CYOA 4CUZA 1HX7A 2YVUA 1Q83A 3KKQA 1VTKA 1EZZA 2P68A 2V4MA 2YJ5A 4LVNA 5IUJC 2C2GA 2XIQA 4NNJA 3BC1A 1VJDA 3ZZMA 3M6UA 4DJEC 1U2SA 1C7FA 3REGA 1AXEA 1Z6GA 2K2WA 3MWKA 1AD2A 2DPXA 2QVCA 4QEZA 5KU7A 2VZEA 2G6BA 3CCCA 1XT6A 5KQPA 4LF8B 1L5VA 1PFVA 4IIJA 4DT1A 2MSDB 4CRWB 5BQXA 3HWSA 1DAMA 1JG1A 3NCTA 3V1YA 2MU1A 3KZKA 3OLWA 3PHGA 4LIPD 2P4SA 3T3MB 1NMZA 4D9GA 4M0MA 1FSPA 5AVSA 4D43A 3ML1A 2IHKA 4U1RA 4WDRA 3X2SA 5JU6A 4JBLA 1WCV1 3K6SB 2NZYA 3T5TA 3MUFA 1KDRA 2MSNA 3OE4A 4PGHA 2GJ4A 4WLEA 1RYFA 1QDUA 1XCGB 3K4HA 3OZFA 4NAUA 4LSGA 4BB6A 1W25A 2H4HA 2ZJFA 4Z54A 3G0OA 1JILA 5A6VA 1J23A 1NF3A 2I3AA 3WB1A 3IODA 2PKYX 4HNQA 2BW0A 4G8CA 5J5CA 2BH2A 4LKOA 4GZMA 4TXHA 4XEHA 1DU4A 3UF0A 1MABA 2R44A 4QVIA 2VYND 1M8PA 3GLQA 4JL8A 2RHLA 3CQ9A 2HBYA 2WHPA 4XOUA 5KWJA 3TZLA 1ITZA 2OGZA 4D41A 3KKNA 3VOSA 4EA6A 2R0QC 2BJHA 1A96A 1T26A 4YAGA 1JQEA 2JAQA 3U2QA 3ZDRA 5K05A 2HA4A 1L6RA 2ZRQA 4P92A 3HSSA 4CKYA 2UVDA 2ZCUA 3W90A 1XMXA 3I53A 3PNMA 5L3VA 4QSMA 2GBLA 1J21A 2G4CA 4MS4A 3D3KA 4QRIA 2C4MA 2DZDA 4HAXA 4PYOA 3ZCVA 5BVHA 3KJHA 1J6UA 1GKUB 1BRTA 2X9LA 1A76A 2ZJ8A 1GLVA 1EVEA 1JW9B 5DHFA 3QPCA 1E2NA 5EGSA 1TQ4A 1PZEA 1M76A 1P7YA 1W5AA 2WEKA 1DAOA 2I1LA 4X8LA 5HG0A 1M7HA 3HBAA 2VP4A 1GVNB 3E0XA 2BE7A 4NDZA 2EBUA 2GEFA 4PZ0A 4TWBA 4W7IA 4ZOLF 4MUNA 5T4EA 4B4UA 2Q2WA 5EP1A 3L4BC 4LWZA 2H06A 4AWBA 2VWPA 3DXZA 4NE2A 2J5XA 2YQZA 1H3FA 4XWTA 3QKWA 3WAJA 4F86A 3TJZA 1JB9A 2NT3A 2O8DA 2B2CA 3DNFA 4Y2YA 4Q3OA 4LOIA 2QROA 3A04A 1E0DA 3CR3C 4AJKA 3D54D 1P7VA 2GB4A 4UDOA 4DLZA 3QSGA 3T1HB 3EA0A 1F7UA 3DV0B 4O4JA 3OQHA 3CXRA 1KIMA 3IUQA 3U81A 3WLLA 5IK2D 1N0HA 1OT5A 4JH0A 4DJAA 4L0MA 3GUHA 1Y8RB 4M8IA 4E88A 2NQ8A 1CFZA 2Z9CA 3GZNA 2IOHA 4DBVO 4E0BA 1YZGA 3QXJA 2EZTA 2XNDA 4X41A 5EZQA 1E3JA 5F76A 1U7WA 4X90A 4FBGA 1I14A 4OXQA 2IITA 3NALA 4IGIA 3ELDA 3FWNA 4I5GA 4YJGB 5AVUA 1I01A 4CM4B 2X5JO 4QDKA 3RQIA 4UOQA 5FBQB 5IKEA 4EF6A 2HW8A 4CEJB 1TIPA 2O8EB 2ZRLA 3PA8A 1JZSA 2G9ZA 1ENZA 5JQGF 4KCGA 1L3BA 1E63A 5BNIA 2BKLA 3VUFA 4PHGA 2H7YA 1UQRA 4YASA 2B25A 4WEOA 4PLGA 5LZ5A 4XUDA 1ZHFA 1VPEA 3ZCUA 3FIUA 3E1KA 3QG1A 2CDAA 1WL8A 5J58A 4LRQA 3LVRE 4CKBA 1X2BA 1AQIA 5CBPB 3Q2KA 5FWAA 4AQ7A 2UKDA 5CVJA 1P6XA 5CLJA 2VDVE 2I5PO 3LBHA 1FS5A 1WW2A 1MQAA 3AVQA 3OD5A 2QSZA 3NIFB 4B6SA 2XE8A 4BFUA 4KJXA 1SBNE 3WL8A 2HR1A 1J0BA 3RSCA 5E95A 1XNQB 1SM4A 1WG8A 3CLVA 1N6HA 1IY9A 1E9AA 1NMSA 1WR8A 1LQUA 3JD2A 4INOA 4DDUA 2V6GA 1LX6A 5HF8A 4G5XA 2NGRA 2PEYA 3QUAA 5CR9A 3WZ2A 3SD7A 2J0QA 3HEBA 5CNJA 3VR2D 1H69A 4K9NA 1R2QA 3NDIA 4BMZA 1ODIA 5JV5A 1D4ZA 4R2HA 3ZJVA 1O3YA 1TJNA 1E6UA 1VYTA 1WSWA 2P0EA 4PIMA 1ECCA 2C8JA 2XVAA 3C1AA 3FCAA 3DNMA 4G1MB 3MXTA 1TO6A 4GGMX 5KYVA 1ZD4A 4OQXA 1Z4QA 3TIFA 4FINA 4Z9YA 1JBKA 3IS3A 4WAUA 4RORA 5B3AA 1EQ2A 3GHHA 2POCA 5E6SA 1FMCA 2IZ0A 1U1FA 3VXKA 4C43A 1KPIA 2BY4A 3FYUB 2PMWB 1QDEA 1RJ9B 2Z5GA 5E0KB 5JS8A 5JSKA 2JFVA 4K9KA 4P5EA 3VYSB 4S1NA 1XLWA 5FAKA 3UMRA 2XT9A 5F2EA 1BU8A 1G66A 1U28A 4LJKA 4K05A 5HRCA 1F14A 4H1WA 4A1OA 4HAOA 1U2GA 4CCSA 1UK8A 1VL0A 3BULA 4MA5A 3JVVA 3BWCA 4Z86A 2WZQA 1UADA 1Z38A 3AM4A 1VCNA 4TKZA 5ERYA 1IK4A 4ZYTA 5AO9A 5DZSA 2AF3C 2WD8A 3T94A 2AXEA 1XLVA 2ZSDA 3UT5A 2ROQA 3K0FA 3FDIA 4FEAA 3TEFA 1E79A 4KQEA 4GQAA 1PTJC 3SZUA 4M0FA 4DA7A 3WNCA 3A1FA 4XD7D 3DVAB 3E3LA 5AI8A 4D46A 3W78A 4EPWA 1I6KA 4BWVA 1QHFA 1YQWA 2IP4A 2NO9A 4BRZA 4DXDA 4E12A 1INLA 2OY0A 3HC7A 4K8OA 4BO9A 4E5SA 2OMKA 2HU2A 4JQZA 3H42B 2VP2A 1V1MB 3W7VA 4EHNA 5GJBA 1L4HA 3ZE8A 1Y8ZA 4GC5A 3ZZUA 3CSUA 1TKRA 5AM0A 2GNPA 4BZQA 4RVOA 1MOZA 5J4LA 5EIAA 4C14A 5BSHA 4YECA 2C4KA 5JI3E 4YPVA 4F6LA 3GLVA 3C1OA 5CCDA 2O2ZA 4YCCA 3L6OO 2FRVA 5BV1A 2BGGA 1W5FA 2JANA 2QENA 5IWCA 1R27A 1JKFA 1PNVA 2R84A 3FG9A 2FI1A 4C0SA 2BBTA 4KXFB 1ZUNA 1PJ4A 4AXBA 4YUYA 2P3OA 4J1QA 2XJ4A 2OV4A 4QQKA 4UUPA 1P1BA 3ZZ0A 4UNIA 4R6XA 4IQ4A 3EIOA 1V25A 3I1YA 4JIMA 2CHEA 3Q10A 2V0GA 3JQ7A 2DU8A 1L4UA 1XQVA 5IJWA 3PR2B 1UBFA 2D74A 3W1VA 3ZV4A 1COWD 2QQ0A 4RGVA 5K4AA 2CHVA 4CE6A 2RHOA 2IWRA 1SJ9A 4Z2YA 4HDKB 5CFZA 3A1WA 1M1ZA 4BB5A 3QLVA 2IV2X 4RPGA 4EO9A 3WB9A 4KQCA 1GRQA 3ERCA 4M7OA 4PQYA 1ST2A 2YXEA 4ZTZB 2PUDA 3E3MA 3GEDA 2D06A 5I7FA 2D0DA 2GJAA 4BNNA 4E1AA 1RXVA 3OUZA 3ZHSA 3PA6A 5DSXA 6REQA 1AHIA 4O2BF 4P82A 5DYIA 4PZCA 1YIOA 2FWRA 1CIVA 2AEEA 3UJAA 1GGNA 3REQB 5K8JB 2CB9A 1VIDA 2FUG6 1GARA 1C30B 1WNTA 2V96A 5IPFA 2O5EA 2Q5EA 1TC1A 4WPGA 5CT8A 1ZU5A 2O8FA 1LSOA 4XGIA 2ZJ0A 1M6VA 4BFZA 2IYPA 3NTXA 3ONFA 4X91A 2DPMA 1HLDA 1RJEA 2BGRA 2GPYA 1O96A 1TM4E 3F49S 3OCJA 5FI3A 3A37A 1ORIA 2ODBA 4PZLA 2CKMA 1QZUA 4B34A 3NWOA 3UUGA 1HE1C 2I91A 5TT0A 1N8KA 2VT6A 3X1DA 4ALLA 1UKYA 3LUJA 4WBNB 3EWAA 4UE6A 3O95A 4CIXA 4EHLA 5HIKA 3U56A 4JP1A 5KB3A 1R1DA 5EWLB 3SFVA 2VJLA 4GPD1 1DBRA 5DM4A 4HC4A 1PS8A 3AILA 4MV3A 4OHXA 4BBJA 5C1OA 2WQ7A 2I1VB 4ZOCA 4M21A 2FV8A 3VSEA 1YI8A 1JPVA 2KX7A 1WV0A 2R1ZA 1NPTO 4E08A 1RYEA 4UBNA 4S04A 3D5EA 2DGDA 1G8SA 3WK6A 2LZ0A 3GRFA 4GPBA 4ZQGA 2O23A 1NSFA 3B5IA 4YHHB 2JLAA 5K0ZA 4IQGA 1TJPB 2I7VA 3KJQA 3LY7A 2P90A 2O7VA 2RI6A 4JYAB 2ZIXB 1CTQA 3NATA 4OP1A 5FWYB 3SHTA 2R1TA 3JWGA 2WOJA 4AF7A 1SBIA 4M8LA 3GVIA 3IIIA 1DBVO 2QYTA 2FEKA 3SDBA 1S3FA 4S0ZA 2ZJOA 4QELA 4Z0PA 2E7ZA 1X0VA 4EB8A 1HGXA 1NNUA 4GM1A 2ONCA 3ZG6A 1XDBA 1V8FA 4R1OA 3ZCRA 5I01A 5B57C 1PZHA 2G9UA 4E4RA 3GLFE 5A0TA 2LP4Y 1SUBA 4X1YA 3HXOA 4A0GA 2GCOB 2OZEA 4PBRA 3DLBA 2KSQA 5LYYA 2V7PA 4C6SA 1ZJ4A 1P4RA 3A3YA 5FB3A 2VNKA 3QYFA 1JR2A 1QBGA 3MT7A 4RA9A 4F71A 2O1SA 3T5BA 3CVWA 3RUAA 2W6PA 4FM9A 2KS6A 1ZLXA 3WK5A 4ZJZA 1F4PA 4FEYA 4UNNA 2BL4A 4A6XA 5C8DA 2QRZA 5AVQA 3EUWA 4KUEA 1PQWA 1KH3A 1AUVA 3MBIA 3RIEA 1TGYA 1M2KA 2GPAA 3GCDA 2GAAA 3PQ7A 3I2IA 4N01A 4RH1A 3PUWA 2EBHX 2WJZB 2JIMA 1FFDA 3ABOB 3BB3A 3K9CA 2GVZC 2UZ0A 5IABA 5KTYA 4LJ8A 4UD2A 1FJXA 2UUCB 1A3CA 1K2WA 3ANNA 5L8VA 3FYTA 2DY1A 2VXYA 2ZJ3A 4G5SA 4M1QA 4BP1A 5H8WA 1M83A 5BPHA 4DV7B 1FX0B 3LE8A 2PZAA 5AK4A 4L4SA 4F46A 2IHVA 3BE8A 4P4SA 4ENTA 3SJUA 3U7FB 1TVMA 2H4JA 3FOWA 2SKCA 3R0ZA 3FTEA 1DGQA 1UQTA 2GK3A 2XZDA 2QM7A 4N0QA 1RAHA 2AOTB 2Q4EA 2RHJA 1BEUB 1JSRA 4OH1A 2QN1A 4M55A 1OFIA 3TX2A 4JGGA 1D8TA 1ZGHA 5KMGA 3VSCA 5HP4A 1QAQA 2A5YB 3IP8A 5JE8A 1QIHA 4C0BA 4DXAA 4GAEA 3WBBA 2CL7X 4Q6BA 1BGVA 4JEMA 4I5EA 4WN9A 3WWDA 1VJGA 2Y71A 4CDNA 1NIJA 2O8BB 3W5CA 3E9QA 3GIDA 1A9XA 1KY5A 2BONA 1QZTA 3IP5A 1LV7A 3GLHA 3A28A 3HCEA 1YA4A 3RYCB 1SOMA 1H9CA 3NBXX 4WCFA 4WJKB 1M1NA 5J1SB 3L8YA 4CV3A 1ZD5A 1DG9A 3SYTA 3BCUA 2R5FA 1IB6A 3WO1A 3VTZA 1P62B 3FAZA 4II3A 5FHRA 4EZIA 2Q6TA 3MTBA 2G9VA 3AY6A 2NU8B 5I3CA 4JV5B 1JIUA 3IALA 3LP6A 2IHUA 1JWAB 2AJCA 3KYIB 4TVOA 1Z0JA 2X9QA 3UYLA 5SYNA 2AR7A 2AG6A 1KQGA 1KPGA 2OGTA 2FLKA 4MGZR 5D5HA 4F1WA 1UMBB 5BNZA 4U63A 4J3FA 5D51S 5JCJD 4NBKA 4DR2B 2OKGA 1QGAA 1T3HA 1XLUA 1RQPA 1G8AA 5A05A 1MV8A 1RYDA 3P0IA 3JQEA 2JA1A 4PGGA 5A4AA 1YKSA 2VHZA 1WXWA 1NFQA 1W0CA 4FI3F 4EDHA 5DTQA 3VR6A 3N8DA 3EIHA 2X7XA 2MDTA 4XKJA 5LA6A 4ECAA 3T0FA 3EB9A 1KAMA 4OFZA 4WECA 2EQ5A 2F8SA 3G0GA 4PFJA 1XZMA 3RCBA 2YJTD 2Y92A 1VDZA 3P9YA 4J0IA 2EDAA 5KVCA 4JLBA 2XGJA 3IDSA 1C0EA 3RVRA 1T9ZA 5JADA 2XUFA 4YJ2B 1R88A 1O0SA 3RU9A 3KIPA 4FDUA 4DEVA 3BTUA 2VZ8A 4TT3D 4F9TA 3C6YA 3ETCA 5AUOB 2Q2QA 5KUTA 2ZQYA 4FCTA 4ZZ2A 3QF7A 4K9PA 2JGRA 4J4HA 3R8XA 2DLNA 3IT3A 1Q12A 2QRUA 2VP9A 4HNRA 4X7MA 1ND6A 3TSWA 5AVVA 1M2JA 1SXGA 2GHIA 1AKNA 1MW9X 1HT0A 3KP1A 4HZUA 3MTEA 2GJSA 4K2AA 4QBIA 4R98A 3MJRA 1ZH6A 4PS1A 1WM1A 3AESB 3OZXA 2XCUA 3CFYA 4AS2A 2H07A 3AJ9A 3K8QA 1E77A 4BLUA 4MJXA 2HPZA 2RFLA 2O5RA 3GDGA 1FYXA 4XIGS 1E4OA 4N8SA 4YRFA 2MYPA 3FNIA 4U0JA 2FWBA 5AJVB 5DNUA 2FWNA 3HY4A 3FTFA 4HL6A 3UC5A 2O6LA 2YMQA 3MS4A 3MG9A 4BRUA 4YRGA 1QZZA 2W4IA 3HLYA 2DTDA 4HVAA 5KTRA 1X14A 3OKPA 2IOQA 1DEHA 1Z45A 3SYLA 4ZQCB 2I71A 4QJ3A 1H8ED 1XZPA 1B6GA 4I50A 3DLAA 3L6RA 4UVIA 2IIVA 1F38A 4MYSA 2D2EA 1KOLA 3X1YA 2D1FA 3KEFA 3PDWA 4MUHA 5TS3A 1K5PA 1ZN7A 1MEEA 1Y3DE 1MUUA 2CE7A 2V58A 3I73A 1N1MA 3UK7A 4BFTA 1Y5RA 2ARKA 2DLDA 3DW1X 5A1JA 4TQ9A 1GRCA 4AY5A 5JANA 1FNSA 5K0BA 2C99A 2Q1XA 4LFAB 2ZROA 6ABPA 3AP3A 5L9AA 3PXXA 2YFYA 1SG6A 1IXRC 5BN5B 4XVQA 5F9FA 1XJCA 4FQ8A 2FN4A 2PAFA 3MAGA 4LRWA 1X1TA 3QKTA 4C5AA 1E0SA 1M0TA 3D4IA 4NBRA 4NAHA 4RUKA 5ERXA 8ATCA 2DB3A 1ZN8A 2V7BA 1KO8A 2H2GA 2XQIA 4HLDA 3UWSA 4KUHA 3W04A 1LRLA 3SLKA 4CDGA 4CT0A 2B5WA 1UXOA 3VAYA 2HBZA 3ECCA 1SNYA 2DVMA 1Z5OA 1ZITA 3HKCA 1H94A 4FYPA 3G2IA 4J4TA 4NZOA 5LB2A 5KOJB 2DPLA 3F8WA 2FZKA 3VPHA 4G36A 6ADHA 1JFRA 4TV8B 3GLFB 1ESDA 1P2TA 3HR8A 1H93A 3EGIA 2Y68A 1OLSA 1TM2A 5SYAA 1XL0A 3F5SA 1QX4A 4TWRA 4UHHA 2Z6QA 1TMGE 3ENZA 3TE6A 2KW5A 4B6PA 3D6MA 2NTVA 5F3WB 1QG4A 4REQA 4AZ0A 2BFNA 3X1KA 1EGVB 3WWYA 16PKA 3JWEA 3NTOA 4L2IB 1NJ8A 1XQXA 3ROEA 4RS3A 4CODB 2JLUA 1P5FA 3R0IA 2OCKA 4XA8A 3ZU2A 3JWJA 3DMHA 5DHUA 3SC4A 2B20A 1A4IA 1W7AA 1N0WA 3HDJA 1DDOA 2OYSA 2KHZA 4YAEA 3WDMA 5JZSA 3NGXA 4EI9A 4F2HA 4RV4A 3E9RA 1OYOA 1P6QA 3M1LA 2CXRA 3PKJA 5B2ZA 5IAAA 3INRA 1U94A 2I6SA 3UCFA 3LSTA 3R3YA 2AUMA 4D5GA 1FQJA 1OH6A 3HUEA 4C3VA 1E9CA 5ECDA 5LDGA 3L92A 2X13A 2REBA 1FUKA 5DYGA 1AKYA 1EX6A 4HF7A 4XTRA 1Q6ZA 4FD2A 3GPCA 3HJRA 1E18A 5BR1A 3EW7A 1L8XA 1H1TA 2WWRA 5IJ9B 3BQMB 1U5CA 2PGXA 3HMQA 3FYCA 3C1UA 3Q7SA 2ZRFA 1YU6A 1RPAA 1SVLA 4N3GA 2FFJA 3MB5A 3VPCA 1SQ5A 4BYMA 5JASA 3IKTA 4MV1A 4HNAA 2JD2A 2ZU0C 4IOJA 4OBXA 1Y3FE 3K8ZA 3ZDZB 4FIZA 4PS0A 4QGGA 4QUEA 5IX8A 4IH1A 1HT2E 2FPKA 2F3RA 3OWHA 1P8JA 4TTJA 3A32A 2BM9A 2P9EA 3QTBA 4JQYA 2Z98A 2PYDA 3FVQA 2IZ5A 2WE7A 1N4DA 4I9FA 2ISCA 2IYVA 1R0CA 1UKCA 1ZCAA 1SGWA 2W48A 5BV0A 1MT0A 1C1DA 2BUAA 2CVPA 1ONPA 3E82A 4UNSA 5BORA 5LZ2A 2LUOA 5HK8A 1C3OA 4AVYA 1UPXA 2X8AA 1W5EA 3N3AC 3OETA 2E18A 2GN6A 4GOKA 1JLMA 3OZCA 4U7FA 1I5RA 5D87A 4P9NA 5H83A 1QRSA 4D9CA 1F6BA 1OFHA 2HRZA 2G7ZA 4YHBA 3GN2A 5AP9A 1P2SA 1G5TA 2E2WA 1GM5A 4HEA6 2BM0A 1W2HA 3WRWA 3EEQA 2JLCA 1UBTS 3WWEA 5JBIA 4O4HF 4QVKA 3U44A 3QNMA 4GPZA 1GR0A 2Z8XA 1TADA 3QBTA 1P45A 1ZRHA 5MN4A 1JQ3A 3K3PA 4PEVA 4BQIA 3TBFA 2VPPA 5AVRA 1GCAA 1VPVA 1RYNA 4RNDB 4RK5A 4AUNA 3QMPA 4EY7A 4DV3B 3ESXA 1XUOA 1A8PA 3KTAB 4ZC1A 2HRRA 1NQWA 1W19A 4WBSA 4ZOLB 5H02A 5HNKA 4MZDA 1FSFA 1COZA 2VUTA 5JIBA 1CY6A 3MMPA 4WACA 3ROKA 4RIIA 4UTNA 2OCDA 4ACAA 4YDHB 2GTIA 4CMIA 1BMFA 3UHJA 4O08A 3GC6A 5CEEA 3UIEA 3UEOA 4P3NA 3VU9A 4CEIB 2GJKA 2P5YA 2QQEA 3O82A 5ALIA 3I9KA 4RLHA 2BHNA 4JU9A 1BROA 5EYPA 1V6AA 3BXZA 3ABSB 4QD3A 2ZVDA 1KK2A 2IXEA 4GGPA 4NCJA 3MHTA 2JJ2D 1YMQA 4O63O 4QLBA 2D0IA 5BT8A 4JUDX 5DTIA 2X58A 3WFJA 2D1YA 1XRQA 1N2CA 3RB8A 1RJDA 3PRKE 1KI6B 1N34B 1EUCB 1Y4UA 3M5WA 3WGOA 4BASA 4NLLA 1CUDA 1RI3A 5EQDA 1LDMA 4ZVMA 3CUKA 3OX3A 5EG5A 1ONNA 3D3WA 4JGIA 4D0RA 5JLJA 1SU8A 3R9XA 1M2HA 2X5NA 3KT6A 2ID9A 3E22A 4P3PA 3UA4A 4MNTA 5AFSA 3IDQA 4GE0A 2UZAA 1QTRA 3KG2A 2VKTA 5BP7A 2A1IA 4M1OA 3H5NA 4OREX 3PF8A 4OGFA 4WADA 5JQGB 4LNAA 4MA0A 4J8PA 5LIRA 2E82A 4HNGA 4CTMA 2GEVA 3BT7A 1AF7A 4YN3A 3EUFA 5LVAA 3W2GA 2WT9A 3JQAB 4DV5B 4NAVA 1NDQA 1IL0A 3OIWA 4NX2A 4R8MA 5CG1A 2CXHA 5C4MA 3PDIA 2HMUA 1AZSC 3QKRA 2Q4DA 4HPXB 4ZEMA 1GPDG 2HFKA 4DIEA 2M6KA 1LK5A 1G5IA 1O6ZA 3WQQA 4CQLB 3TW0A 3IAM1 3I2HA 1ZZEA 3PGMA 3NCHA 1DWUA 4MYDA 2AXPA 4HRVA 4XSVA 2QMZA 2W2KA 3U3DA 2GCIA 5CA0A 3EMDA 4F4HA 3OMLA 4FLEA 2NTNA 2ZUCA 3CLUD 3K5PA 4OG2A 1HPLA 4FJ0A 4OYLA 1ZJWA 1DV2A 4IF6A 5DBEX 5MN6A 4MHOA 5JALA 1MC5A 1E99A 1OBVA 3B48A 3DEHA 3K15A 1BDJA 3WXBA 3ZUGA 4D9EA 2VJMB 4K0RA 3AF6A 3Q15C 2ZYTX 2F90A 2V6JA 1P31A 2RBEA 1HNZB 2OZVA 3FCYA 3T7JA 4UU1A 1EWKA 3FMOB 3CS3A 3L0IB 3IELA 1YR1A 3RABA 5K0TA 5CIWA 1NI4B 1PK7A 2NACA 5CNMA 4B79A 2HQOA 4EQ6A 5TGDA 3UICA 4OOEA 4PR0A 5I5EA 1B42A 1G4UR 3LCMA 3B2NA 3ILVA 3EGXB 1LV8A 1Y3IA 4HLUA 4XI9A 6AT1A 5JYDA 2RGDA 1U3DA 1ADJA 2J4FA 2XZOA 4G0UA 2BFDA 3P0FA 4OUDA 4OQLA 5FO0A 3HI6A 4AJIA 3I1IA 3EXIA 4F97A 2E49A 2R5NA 2CJXA 3STTA 2CXPA 1DQNA 3L1UA 4DSNA 1GLGA 1QO0A 2O8CB 2QQ5A 1SMKA 1HO3A 2CYCA 2ZUBA 3FGOA 4RSGA 5DTRA 1E0AA 2PA3A 4FDMA 1JKIA 2NUPA 4GMKA 2ISSD 2PT7A 2Y27A 4XGQA 3AETA 3TLGA 3JARA 3WR5A 2QAIA 4FJ2A 4RGYA 4RPJA 4OH7A 1RE0A 4TKUA 3K6JA 2QMUA 3RHFA 2EF0A 4N47A 5KSWB 1GQRA 1US8B 1KKUA 2WFLA 3EISA 4H7DA 4BQOA 1KQ3A 2LXNA 3OF2A 2VQEB 3H5VA 2APJA 2F3SA 3IEVA 3I4CA 1A9RA 5C53B 1ADYA 1IXSB 4MAAA 1B0UA 3FOCA 2HDNB 4GKKB 4O4LA 2RGUA 3DF9A 1R7RA 1DJPA 5CB8A 3WLMA 3OQOA 3OKFA 4PY2A 2K2QB 4P1ZA 3P27A 2MYUA 5TC4A 3VPDA 5JZOA 5EUQB 3N75A 1H4QA 3MS7A 2VT3A 2C2YA 3CVVA 3OZWA 1V8ZA 4ATNA 2VPQA 3IFSA 3QWHA 4WXYB 1JG3A 2L19A 1B74A 3NXSA 1ZPDA 4OFXA 2JVIA 1BE8A 1ZD3A 4K3VA 2PRJA 4MINA 1X7YB 5COAA 4YIHA 4IGKA 4GH5A 3RJ9A 1EWRA 3PGVA 4XQCA 2FPXA 4EMTA 1KAQA 1NXOA 1U3TA 2QTLA 2JKYA 3AJAA 3BF7A 4MWCA 4MRAA 1KE2A 4B7UA 1AV6A 3VHXA 1G18A 1G21A 3GEBA 3CR7A 4TSFD 2Q62A 5CB0A 3ABQB 3OPQA 5B55A 5C46F 3AL3A 3ITNA 4MWSA 3R6GA 4HR7A 2RK3A 4HJXA 4UBMA 1QKKA 1PX0A 2VI5A 2N1BA 4PTLA 4L75A 3O74A 1XKLA 2A9VA 2DX7A 2AJBA 2HUPA 2H6EA 5TARA 1A82A 4U00A 4O0MA 1QFJA 3HCBA 1O94C 1TQ2A 3OQJA 4YR7A 1C9EA 3UB2A 3HP4A 1Y8CA 5LDDC 3RC8A 3RIGA 1NVVR 3D7KA 1M54A 1FB5A 2JAPA 2A1TS 2G4LA 3GYGA 4KKXB 5EVCA 5T4HA 4ERXA 1VL6A 1CPYA 2E85A 1O57A 3TZKA 3U5TA 4IF4A 1V1RB 4Z5XA 4LXXA 4O2AF 1TF5A 4POAA 5ALYA 1ATIA 4D3SA 1WBJB 1LGYA 2FOXA 1H2YA 1GGJA 1RI5A 3AUFA 3DVSX 4Y2VA 4QTZA 3EQ9A 4XPIB 5CHEA 1Y80A 1U98A 4JL6A 1L5ZA 1UK9A 2Q8NA 2YZGA 3QOFA 4G26A 3S40A 2CNDA 2IPOA 2QMEA 3FHO