2LR0A

Solution nmr structure of de novo designed protein, p-loop ntpase fold, northeast structural genomics consortium target or136
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
134
structure length
134
Chain Sequence
MKILILINTNNDELIKKIKKEVENQGYQVRDVNDSDELKKEMKKLAEEKNFEKILIKSNDKQLLKEMLELISKLGYKVFLLLADQDENELEEFKRKIESQGYEVRKVTDDEEALKIVREFMQKAGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords P-loop ntpase fold
publication title Solution NMR structure of de novo designed protein, p-loop ntpase fold, northeast structural genomics consortium target or136
rcsb
source organism Artificial gene
total genus 51
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lr0A00
2MR5A 2N3ZA 2LTAA 2LNDA 2KPOA 2N75A 2LVBA 2L69A 4J29A 2LV8A 2LCIA 2LRHA 2LR0A 2MR6A 5GAJA 2L82A
chains in the Genus database with same CATH superfamily
3STYA 3GA0A 2X2OA 2OO7A 2WI8A 3S99A 4YT8A 1I24A 4LG1A 5A9TA 2HF8A 2WWHA 1I30A 4IIJA 1Z7YA 4UC0A 4G25A 2L2QA 1B42A 3QY9A 3F7TA 4PYLA 2HFKA 3TRKA 3FI0A 5B12A 4D26A 2HRDA 1QS0B 5DT9A 4LQLA 5JNSA 4QREA 1OFIA 4DN6A 1J8MF 3DBOB 3DDWA 4P7JA 4W9NC 5FTJA 1SVNA 4I1IA 4DM3A 3BT7A 1OH6A 2ZSFA 2YZKA 4DEYA 2WAAA 3BF7A 3UPUA 3D7SA 2I3BA 3X2SA 4A26A 4LE1A 1YUBA 4LJ8A 1E6KA 4JENA 4QXOA 4D4GA 4LSZA 3H9BA 1EFPB 1AXRA 5DNCA 2PWBA 4RF5A 2NZVG 3LM8A 2JCGA 4S1WA 5FLYA 2O05A 5JT1A 1MEOA 2HHJA 4OM8A 5BO5A 4LZAA 3I9OA 1XE3A 5MGNA 1UFRA 1VSTA 1IY8A 1JA9A 2AZMA 3ZI7A 4C7MA 1E2NA 1TVEA 2B3TA 1W5AA 2TRSB 3PQDA 4ZPJA 5JNRA 2REQA 1NF3A 4DV2B 4ATNA 2H1OA 3X44A 4CCWA 5EXSA 5KDDA 1DBSA 1L7PA 3QG5A 2WOOA 2QX4A 4G23A 2HI0A 3OO0A 3OPNA 3ESZA 4JI3B 1RM3A 3ELUA 1P9LA 1PUJA 3A4NA 2H7YA 4ZHQB 3GXBA 2PHZA 2Z9BA 2VJCA 5A7FA 1GXSB 1O96A 4MS3B 3WLKX 4DQDA 5GVSA 3CSUA 1ES9A 1UMBA 4Q4HA 3YASA 1ZGAA 4ESOA 5LQCA 3UWKA 4CG1A 4ZGWA 2H85A 1U0NA 4KNYA 1E9SA 1PS9A 4MRMB 2XT0A 2ZITA 1AH2A 1YWGO 1U2DA 4RF3A 3KU1A 3RBVA 3V4LA 1CTQA 3C5EA 3CO0S 3V00A 2C2WA 2Y4NA 2G1PA 3I2HA 2ID8A 4EF6A 4RV5A 2GF2A 2IYOA 3MJDA 4PW0A 1F0PA 2GR9A 4AWBA 1YSCA 5A7HA 2GN9A 5TRTA 3TXXA 2YVQA 1XEWY 3ANSA 4ZN6A 2Z09A 1CUEA 4YI5A 4F5WA 3DXZA 4UHEA 2FRXA 1L5YA 1CZLA 1KJIA 1P3DA 2I99A 1HPLA 3DEFA 3PI7A 3U4QB 1N92A 4WA7A 3UAGA 4BMPB 1VKOA 1IQRA 3ZE1B 1N5IA 3KALA 5K5EA 3N3BC 2UVDA 1K75A 1SBNE 1TQ6A 2WA2A 3GLTA 3MF4A 3U09A 3OAAA 3HU1A 4ISBA 1U0EA 3QEJA 4BMXA 1GCAA 2H5JA 2ZYRA 3N0RA 1C4OA 1NY6A 2LPMA 3B82A 4UQLA 1K0FA 4WOKA 4O3MA 3TI7A 3OM9A 3QLVC 5DBOA 4MI6A 2O8EA 2HEGA 3L1JA 1T2VA 2BKLA 3OM0A 3P9ZA 3F7OA 3OPYI 4RVOA 4WXPA 3C85A 3I1JA 1OFTA 2ACEA 1M0SA 4X6UA 1Z7EA 5ENVA 4IJ5A 1K5DA 4TQUS 1AU9A 5L6LB 3QGMA 4E14A 2A9VA 1ECPA 2IE8A 4GW3A 2WG2A 4X20B 5DGIA 1A9YA 1GVNB 2Q5QA 2Z3VA 1EWVA 4K6FA 4M9SA 3RUFA 4L72A 3S2SA 3V1TC 4CKCA 4ZI7B 4DV3B 4J0IA 3WXMA 4AX8A 4MKHA 2SKEA 2QZ4A 3IMFA 2FN8A 1DC4A 1FU8A 1QMGA 1KEZA 3CWCA 3MUEA 3UMMA 3O8OA 2DT5A 1SUFA 2RFLA 3MWDB 4YJHB 3SGLA 4GBMA 2V7QA 2G04A 1WX1A 3H04A 3HMQA 4HNRA 3B13B 3S2FA 4L75A 2HLPA 1XZKA 1E6CA 4A73A 3CJRA 1M3SA 5IHXA 4NI5A 4XDGA 4RD2A 2V5UA 5CIQA 3ZGXA 3SNHA 1FBTA 4QXRA 2FP4B 2X0KA 4MVJE 1PVOA 3ZGVA 1ISFA 1RRKA 4QQNA 4QVIA 1ZH2A 4ETIA 2CXPA 3KQNA 3GW8A 1KKMA 4UREA 4UQPA 1D1SA 2RAVA 4YJ3B 4E6PA 5SYMA 4L73A 4FFSA 1DIRA 2ZSKA 1RQRA 2BFDB 4N3GA 1QE0A 4BB5A 1G19A 1WZEA 2XCLA 4JP2A 4C4XA 1N6PA 3UJHA 4RABA 3MLBA 2F67A 1NQWA 1VKHA 2HGSA 2IXAA 4JXKA 4L4XA 4MKZA 4D9FA 1MA0A 2NU6A 1ISSA 4ZDWA 2BWJA 2GILA 4I1UA 4K9MA 4TXLA 1SUIA 2QE7D 5L4NA 4OVKA 1OGIA 1ZK1A 4UDNA 5CFLA 1W36B 3F1LA 2JAQA 3DHYA 5JHGB 1Y1TA 3LF2A 1ZYUA 4JR2A 4BX8A 4AT1A 3ZDZB 5KOIA 1BZYA 4TUYB 3TR6A 1Z0FA 2DQZA 2JJ1A 4QECA 3WLOA 3KB2A 4GP6A 1EVLA 3V1NA 2ZI3A 5DNEA 5DCWA 2BMFA 1Y34E 3L9XA 1EXNA 2CBZA 3LY8A 4S1PA 5SY4A 2FZ5A 3H1GA 2E21A 3FHTA 1QFYA 4DS3A 5JAUA 2M1ZA 3F2IA 4NBLA 3JVVA 4C2UA 1TADA 1BH6A 3RYHA 1CF2O 1AS3A 1QONA 1VTKA 2J9FA 4AIRA 4D9BA 3ITNA 5BR4A 3LDFA 4LOKA 3VPAA 1OB5A 3HLYA 4DLSA 2AE2A 3IBFA 3RUHA 2C7GA 3RAEC 1MU0A 1I13A 4H6VA 1N9KA 4N6NA 3OICA 2AN3A 1FSFA 4LRYA 3ZWBA 1RKBA 5JI3E 1QHHA 1PNQA 1GZHB 2D4HA 2QYSA 2GZMA 3GFRA 3JR3A 4Q34A 4YIKA 4BO8A 3IAFA 3M33A 4BE4A 1J1IA 4F5EA 1TYBE 5K0TA 3R9WA 1MF7A 3QE9Y 3JATA 4R1UA 4Y18A 2WSLA 4EZBA 1Y6RA 1RYFA 4Q9DA 1GQRA 1Q3TA 3KTOA 1IWBB 2P91A 1PR6A 3NM5A 4MW7A 1RKQA 2VDWA 4EJ0A 4W4TA 3LX4A 5M2QA 1YL6A 1AUXA 5ALDA 1MA3A 1E3JA 1JQEA 2HY7A 3MWFA 5HIJA 4B9EA 2GD0A 4Q6WA 3CH4B 3I83A 4Q9NA 1U2ZA 1T6BY 1KSJA 3HCOA 2VYND 4RHYA 1OX5A 1DL5A 4X5OA 1SBIA 3SMQA 3N2LA 2J3DA 2OM6A 3EIEA 3WGLA 3D3WA 4XE5A 4V3CA 5A5EA 3DMTC 1A1VA 5EZYB 1UBNA 3GLKA 3I1IA 3FPSA 3RBAA 1RPNA 1PUXA 1RWQA 4R54A 2V8OA 1FSZA 3NIDB 3N8GA 3PHCA 2VA8A 3L7OA 3ORSA 4M9ZA 1GNVA 1I1OA 1NMYA 4J0KA 2QAGA 1JT2A 3C0KA 4JUCA 3ZQUA 3LPDA 2NQ8A 5ALYA 1MJHA 5CNJA 4UBNA 1R7RA 4BKUA 2XGOA 2JKZA 3QMWA 2JFVA 4INPA 3R5TA 4JYCA 5AMXA 3WL4A 4C3ZA 5CAEA 1K97A 3G9TA 5DTMA 4B6PA 4UBLA 1WRBA 2AG0A 2AWOA 1QYCA 3NB0A 3DTVB 3K9HA 2ZI9A 2CCJA 3EPRA 5C8YF 5EHXA 1SOAA 1A5SB 1NULA 2FEMA 4ARCA 4ZI5A 3UV6A 3DKPA 4RXUA 2PUJA 1BEUB 5KSPA 2IBTA 3G3EA 3HNOA 1Z6XA 4M8IA 4A1FA 1IEQA 5DH9A 1HE1C 4Q12A 1VBKA 2IPOA 2IYNA 2X58A 4TMYA 1JS1X 3O8BA 3GRCA 3LCRA 4NCJA 3DMYA 4FK8A 4E1AA 1NT2A 3FY4A 3PPVA 3VR4D 5IU6A 3VR2A 4JYZA 4BPBA 4EB0A 4BVAA 4B80A 3WSTA 1M0WA 2LIPA 2WPNA 2OO3A 3LGAA 1UXGA 4R2JA 4UU0A 3HACA 5LYJB 2VAWA 2F1IA 2Z1DA 3ASZA 4AS1A 2X41A 3OJ0A 2WBLC 2YRXA 2J4DA 2OP1A 1CNEA 1JJBA 1UL1X 2X22A 1NF2A 1PFUA 3ZE6A 3ZLTA 4BECA 4ZYLA 1ZXBA 3G79A 2CXRA 1H5QA 2AXPA 1H2AS 2PS9A 1ZISA 1P4JA 4QA9A 1C3XA 2HDOA 4CHGA 4D0NA 1JTVA 4M60A 4Z51A 4EBFA 3OKAA 1DTSA 2G9ZA 1M1YA 5KKAA 2Z8XA 4IH1A 1UMCA 3RRZA 4BNHA 2DLNA 1E3QA 4R1OA 4GSYA 1RC1A 5HHTA 2HNBA 1NJ2A 1RHMA 4EEKA 3LAWA 5A7GA 3RSSA 4G36A 4R31A 3ROGA 1TAHA 4ZCQA 4G5RA 2CVOA 1Z0ZA 1U9IC 4DSAA 3K9CA 2X1LA 1P1BA 3O9MA 2J5KA 4QLOA 4KBYA 3UCXA 4ARUA 5KOJB 1VHWA 3I2YX 2PH5A 4QWMA 3VHQA 4B4WA 3TNJA 4XSVA 5I9IA 3QHPA 4H08A 1SBTA 3INTA 5E9QA 2YR0A 4FDVA 5JSYA 3RIXA 1I7SB 3UXEA 3GUVA 4KUEA 4P31A 1C7FA 1R9MA 3CF6R 3KKNA 3HJTA 1C3OB 4GGMX 5JC8A 4Y9RA 3L8CA 2E55A 2OBMA 3KEFA 4PS1A 1UK8A 1TA4A 3OM1A 3WGZA 3FHCB 5I4CA 1OX6A 3SIXA 4BLQA 3HHPA 2QSJA 3LD9A 3NVKI 4BRUA 5CCDA 1BD4A 2N3ZA 1SRQA 4ZCTA 1CEEA 1E7YA 1ISRA 3BBLA 3DHNA 4I6EA 2Z8YA 1FQWA 2FR0A 3CTMA 4OBWA 1EK5A 1CUFA 4PCAA 2BHLA 3M81A 5B7QA 2CZGA 1OLUB 2QL7A 3SK0A 3BXOA 1ZIXA 5LOVB 3FBTA 2AFHA 1ZN8A 2O3SA 3NC4A 4I8XA 5HMMA 1YI1A 4KE7A 1Z75A 2D74A 5AJZA 5KUTA 2ZXUA 3K70D 3CPEA 4MS4A 4K8RB 4ZYTA 2B8NA 4KKVA 4ESVA 5K6AC 1YUMA 2BR5A 1NRIA 1SG6A 4YONB 4E15A 4E88A 1LLUA 1F1BA 1CE8A 2C5EA 1ULAA 4IEEA 1BMFA 1XA4A 1HYQA 3OT5A 4LJSA 5T4FA 3HUUA 5TQ2A 3S5UA 5KPDA 3UICA 3O3NB 3VC7A 1GDTA 1MB0A 3ZU2A 4RX1A 4FYHA 2O2GA 2QXUA 4UBKA 4DQUA 5U9CA 1ZM4A 1R8JA 1ZH0A 2E85A 5AD1A 1AK1A 2EKLA 1RYDA 4CKXA 2CBGA 2PGOA 1LDGA 1U9JA 3BS4A 1MPTA 1E0SA 1K68A 3ILSA 3LVBA 3KTDA 1AQLA 1AN9A 1KH1A 2OD2A 2Y0CA 4XB1A 4EQZA 1CR1A 3W5AA 5D5QA 3EN0A 1G38A 4ZC1A 1FRQA 2Y67A 4AF7A 3VR1A 4BCBA 3LZCA 3QKSB 1Y3BE 3F96A 4UQOA 1F0NA 1JQBA 3RDPA 1YNSA 2QRGA 3AP1A 1HE5A 3E61A 2ZE5A 3BEDA 4Q3NA 1GKUB 5DF1A 1ZHOA 1NUPA 3W7AA 3GGJA 4AKGA 4FE4A 1GFSA 4CXMA 1FCJA 4DNOA 1G3UA 4PHCA 4MIOA 2WIDA 3BAFA 4DDUA 2XEXA 1L5LA 5K51A 4QQ8A 5F1PA 1E6LA 3FOWA 3TM5A 1G8GA 1DLJA 3A8TA 1P7YA 3O9VA 5EZSA 4BVLA 1PP4A 4XIJA 2C7QA 3K6JA 1SXJC 4PYIA 1FY2A 4PBTA 4JDPA 1J0DA 4ZWNA 2WMDA 3AKYA 2VK2A 3JQAD 1IXKA 3GP3A 3IXMA 4F04A 4RTPA 1ZRSA 2XMPA 3KQHA 2CDRA 1EDEA 2EQAA 3IOCA 4J4HA 4F3KA 2RHLA 5HPYB 2XMBA 4B3TB 3OF5A 2R8RA 1IBLB 1E3WB 4BLUA 1Y5RA 2XDQB 1LBQA 3M34A 3CE6A 2QLTA 1YR1A 3EMBA 4RIEA 4A2PA 2PEYA 2V96A 3AM3A 1PV2A 3H99A 2YJTD 4M0LA 4TV9A 1MX1A 5DBHX 1EDOA 3K6KA 4P4NA 3SX4A 2V7GA 4HP8A 4Q0MA 2JATA 4MRAA 3SE7A 2MYNA 5EXPA 3WVNA 4F56A 4E2XA 4DGQA 1KAOA 3IBSA 4O5OA 3U4HA 4E4TA 3PJRA 4D57A 3BH6A 1PQPA 3DM5A 3MUFA 2YJ4A 4UOQA 3V8RA 3A7EA 1R66A 2O48X 3C1TA 1OYYA 4KZPA 5B3JC 2DSTA 2ZJ5A 4QOFA 1NXVA 5I9BA 4EHFA 1YCHA 4U9HS 1PV4A 4ZO7A 1EUDB 1ST2A 2O7NA 5AHOA 4YUZA 4AKIA 1YZFA 4WV3A 3IH5A 4BNFA 2XF2A 5EP1A 1RRMA 1USIA 3N28A 2AEJA 2QPAA 5HBRA 4RKFA 1NX9A 1BW9B 5ALGA 1P2TA 1NW3A 1F8GA 3G68A 3GJQA 3OETA 3VOSA 1EEHA 4Q1AA 2G40A 5E3JA 3VAAA 2FV8A 1VMEA 3CT6A 4L4RA 1TZMA 1Z4NA 2AQKA 4ZVVA 4EKNB 1YGYA 4TT3A 4Q47A 3G88A 4CM4A 4YY3B 1E3LA 4JP5A 2V98A 1AZTA 2VNHA 3NTLA 6NULA 1GSAA 1D9XA 3FCSB 4GT1A 4RA6B 3DLIA 1N2SA 3W8EA 1AUQA 2YX1A 1DJNA 2GTPA 1CKEA 1ZKDA 4M0DA 1H2RS 3T7JA 2A33A 1GKLA 2XKBA 5ISMA 4PU0A 5J2TA 2D5BA 1PGNA 4EY6A 3W04A 5JAOA 1Y9JA 5K2OA 1SUEA 4PC6A 3HM9A 1D2NA 4KNVA 3EVFA 4Q21A 4FS3A 3WGVA 4F97A 1PZHA 4BDSA 1LI4A 2VDLB 2W93A 3O8LA 2D1SA 4HL6A 4BQSA 3M49A 2NU9A 3C3JA 1IPFA 4C76A 1OI3A 4OGWA 4M8NE 2JW5A 2P0YA 1IXSB 1RYBA 4LI3X 4NATA 1I3MA 4V1CI 5JCOC 3E70C 4XWGA 3PFKA 1H69A 1FPMA 1XZAA 2JGFA 4IVPA 5E1DA 4BP8A 2OGZA 1OHHD 2JLBA 3GT0A 1I1HA 2RGCA 1HR0B 3N8IA 3JQ8B 3WISA 2VHTA 1DBIA 2GEUA 4B8YA 3GUYA 3I72A 4DCPA 3QHAA 1L8QA 2B25A 2QX6A 2NUBA 1VP9A 4QASA 3H4MA 3OOEA 3EW9A 3BE8A 1LPOA 1SQ0A 4A5SA 5EHNA 2WU4A 3DW1X 1MIHA 3K16A 4QSHA 1WLSA 4WKBA 4D9EA 2W6IA 4NDNE 3IRUA 4BO4A 1A98A 4BVEA 5EP2A 3WGKA 3L6DA 4EHJA 1E0JA 2QRHA 1ZLYA 4WOBA 3HKDB 1YVDA 4ETMA 5TLSA 2WD8A 5ESDA 4ZU6X 3M70A 4JIMA 4PZEA 4D9CA 3L18A 2XOKA 2ZXEA 4PPFA 4BMVA 5IN4A 5AM4A 1DP4A 3DPSA 4L5CA 2C4KA 3N8NA 1CY4A 3D0KA 4MVJA 4D74A 4F91B 2ECOA 2WUGA 2YIJA 3SHOA 4BLWA 4F6CA 2V0NA 3PC3A 1GPNA 3T94A 4B4UA 2AJ8A 2CUKA 1BDIA 4HZIA 1XO1A 2GXSA 2ZBUA 4J75A 4ZCSA 3AF4A 1JKFA 3FVQA 5LLDA 3B2QA 2X3FA 3K71B 3FLBA 1TZ2A 2Z04A 4UPEA 5LDHA 3TECE 2IPMA 3HYTA 3MSCA 3OJCA 4HSEA 1LBEA 3Q8WA 4TM8A 3AK4A 2W2QA 2I2CA 3Q0EA 5H1YA 2Y1CA 4WZZA 3ZOKA 1AGYA 1QK4A 1XQVA 1N2CE 2XNCA 3CJQA 1BU8A 3DL0A 4J1SA 3EC1A 5H4GA 4KHPB 3WY9A 4HFNA 3E53A 1IG3A 1TMYA 4MDHA 4RANA 4IILA 1DWUA 4NU6A 3IAM6 3L1IA 3UAYA 2BMVA 2V7VA 3U44A 2ZIXB 3ZXSA 4X8OA 3GT3A 1Z34A 1KXZA 2XTZA 3BKXA 5EEGA 4V2UA 1PJQA 1EK1A 3DVSX 5LP6A 1C7RA 2I7VA 5KBYA 4YREA 5JISA 1WKVA 3PHBE 4MLPA 3OJLA 3JWPA 3RT7A 1IM2A 3FG9A 5CX4A 1P6XA 1Y9EA 1Z36A 1GAEO 4TXMA 5LZ8A 1BGXT 1J5XA 3ZHSA 5L4LA 3P2OA 3SCZA 3CMCO 2QHXA 2WIAA 3I5MA 3CYFA 5C5CA 3I8OA 1SRRA 4YWJA 3SXJA 2IIBA 3EMVA 1E2BA 3TZLA 2ZAGA 3IKLA 1G8AA 3KQWA 3PGA1 4IIYA 3LWNA 4MJLA 3E5RA 6Q21A 5LNK1 2IH5A 2JEZA 2W8ZA 4RY8A 3AR2A 1LSSA 1Y5LA 4EQ6A 4M7OA 2B98A 4HH3C 4I3HA 4ROSA 3W2IA 1EVIA 1VIAA 4KLRA 1E92A 4K46A 4QEKA 1M6WA 3G2QA 4DSTA 3C8HA 4C0WA 3KKMA 3VDQA 3WNBA 4LOHA 4I5GA 4BFWA 4AZ3B 3LA8A 1GPWB 4UCWA 3LZ6A 3R7WA 3RVBA 3NGMA 3TLEA 2P4UA 3N75A 3BXFA 2W8BA 2YMLA 3P1JA 2Z0MA 3NIFB 4KN9S 2IZ5A 5E7QA 3T1NA 1T3ZA 4Y0VA 3C7CB 1Z4LA 3EEFA 1B16A 1N2EA 1PLLA 3AUXA 3LNCA 1XZBA 1G5QA 3UYLA 3ZY6A 2ZUCA 2JA1A 1EI9A 1K1EA 4HPXB 2O2HA 1II9A 1ZUNA 1R00A 2H4XA 2ZBPA 5JCJA 1QF6A 3G2LA 1P0CA 1VOTA 2PPVA 1B6GA 4LOLA 3P9XA 3CZCA 2AKYA 5DEIA 4EB3A 5B6PA 1QG4A 3VKHA 3NTOA 2J30A 1HYGA 3B5IA 5AICA 3QWAA 3K2QA 2O57A 4G1FA 4AMGA 3JSAA 1ZCFA 1KIMA 2QD5A 3R74A 5BSWA 4KIWA 1OXSC 2ZDGA 1RJ9A 3FDIA 4GP9A 4US1R 4FINA 5DYIA 3RUEA 3JARB 4PG7A 1V16A 2GM4A 1T6ZA 1OQAA 1S3IA 2YVAA 4KQ1A 1MFZA 1K9VF 1J20A 4Y2SA 3TGWA 1AXEA 4XEHA 3DCIA 1C8BA 2BGTA 3I6BA 2ZYTX 4J16A 4RIHA 1XPOA 2HJVA 2ZJ7A 1AA9A 3QEMB 4PQEA 3WRYC 3Q8KA 3SQLA 3P94A 4ILEA 2H1VA 4TMVA 2GVDC 1OA0A 1BJKA 4JJ6A 4ZK2A 1IN1A 1HDYA 3NRBA 3Q1LA 2NZYA 2I66A 3TMKA 4E31A 4D2IA 2ZYGA 4Y2HA 3WHIA 2VF2A 3U61B 5BN5B 4Y1EA 3TIIA 6PFKA 3W79A 3IO5A 1L4FA 2AR9A 2Z2KA 3U3OA 4HLCA 3QWFA 3QSYA 3RUAA 2Q29A 4WEQA 3MGAA 3NJ4A 2R68A 3WLHA 1JAZA 3HCFA 3RC2A 4AP9A 2MYTA 5AESA 2FSFA 1HE8B 2FH5B 2QVLA 3SS8A 5JS1A 3ZJUA 5ULLA 1CQIB 2AZ4A 2VUTA 3ZU3A 3NOVA 3CR8A 2PY6A 3TNFA 3EVEA 1YA4A 4L8GA 1B74A 1MT3A 3U17A 1QTQA 2FWAA 3AERA 2Q5OA 1H2FA 4WBXC 5HK9A 4RW0A 1LW6E 2ZVPX 3N2IA 1SOWA 2YZGA 3PYLA 1UDRA 4JJAA 4WL0A 5ERYA 5LXTB 5DM60 1U0BB 2DFTA 2QLFA 1UBGA 2GNAA 2YWEA 1U0TA 3GIWA 4IHJF 4LEIA 1CU1A 1NUQA 4PYNA 1P9WA 4WX2B 3P9NA 4Y9TA 1WDWB 4YTEA 3N0VA 3U16A 5FTWA 2R5FA 1U1FA 3NGLA 3PU6A 4MP3A 1J0CA 3W5CA 1NFFA 2BMWA 2OAGA 5JG7A 4MK4A 1PDVA 3PNBA 1N8TA 1P60A 2ATCA 2C1ZA 4XPIA 5DHQA 5K0EA 1V47A 2Z5LA 5FH9A 4GR9A 2HO4A 5J3JA 3PRKE 1J0BA 5HF8A 4DSZA 2O5EA 3BX1A 3USCS 3GV0A 4Q1CA 2DY1A 1EFVB 1K4YA 1VJDA 2E49A 3E7PA 4BLVA 1FTQA 2QUKA 2XAUA 2IL1A 3MRSA 1SHLA 5F76A 3AUSA 2H0RA 3RTBA 4JBIA 4WTOA 2HLDD 2PZEA 1ESMA 3P9PA 4RJIA 1QE5A 2YJNA 1PL8A 2GSWA 3OD1A 4X6LA 3JQFA 4D8YA 3MA0A 1Q3HA 1KGSA 1DRJA 4FGSA 4JT9A 3URMA 4ENVA 2PL5A 4JCOA 4ZTUB 3MRXA 3MMZA 3OEWA 3UN1A 3L07A 3RVDA 2FUG6 2BKUA 3EPKA 1VLLA 3BMNA 3L7LA 3NV7A 4Q7KA 4XIFA 2EYUA 2A9FA 1K3FA 1TT7A 3ZDCA 1HTTA 4BX2A 1KY2A 2LKCA 5L51A 4MKIA 1G7TA 3ZEIA 5DK4A 2FLVA 1JXOA 5B4TA 2QN1A 3VYRB 5GJBA 1IZ7A 3MBOA 1W581 2F17A 2W11A 3RUDA 1E3EA 3O4FA 4U9UA 1F0YA 4IVQA 3IURA 4CEIB 3FJYA 2XNHA 1E18A 3CJTA 4CDRA 4NE7A 1VG9B 4KWHA 1OCEA 1S5PA 2HV8A 1VIDA 4LNHA 4U8GA 1XJ5A 4YR9A 2G3YA 4I1SA 4UAJA 1E1NA 3P2KA 3B5EA 3JYOA 2PE5A 3OX4A 1DFIA 4C1BA 3L7DA 4JFAA 4YT4A 4FBLA 5LZ7A 1RWMA 3NNDA 3R8CA 4PSKA 2QR3A 2AJDA 4LUCA 5EHQA 1RFLA 3EWAA 4PBSA 1IVYA 4X94A 1BVRA 2PS1A 4GUAA 4IBOA 4MQEB 3W9YA 5TF0A 1XTUA 2XE7A 1ESDA 4HZGA 4UE2A 3R7SA 1KZ6A 3K0AB 2V1XA 5JZ9A 1KTVA 4J7AA 1SWVA 4KIUA 4EYSA 2GBGA 1T9GS 4L85A 2FPPA 2UKDA 1VB3A 3ZCPA 1M1ZA 4K86A 1NWCA 5IKMA 4WK6A 1RQNA 1KZGB 4QUEA 1ZMRA 2PRJA 2Q46A 5CDYA 5A4DA 2DFLA 2W2KB 4JLJA 5IWAB 3AT1A 4Y2UA 1E89A 3G0BA 4RZ3A 4EG6A 3T3NA 1CXZA 3UGKA 3ZEAA 2Y1WA 3VJMA 4ANFA 2H4ZA 2XPCA 4NJMB 4NTZA 1NUTA 4G0ZA 3LI2A 4P32A 3VZRA 5K45A 1K8YB 1D0VA 4AX4A 3GT7A 2G17A 2ZJFA 3B9PA 3NC1C 5JHHB 4KPYA 1ESZA 4P98A 3T9DA 3ASYA 3QVGB 2PQ0A 4DV0B 4DBLE 2GWRA 2FMTA 2JAWA 1V7PC 3HGTA 1NR7A 1XL1A 3GYGA 4WKPA 1JMKC 1RCFA 1ZNZA 4GEGA 5DGTA 1JEYB 3BD9A 1DUSA 3DKKA 4UTZA 5CVVA 1WY5A 5J58A 1U3GA 1OZAA 1W46A 4UM9B 4D8TA 3C7AA 1UPAA 2XJ9A 1DKUA 1FVXA 5FO0A 3TLZA 2YYAA 1IJFA 4IIJB 4CCYA 2GPJA 3VH3A 4P54A 3DPIA 1MT0A 2O52A 2PSHA 2X4GA 3VI4B 4F93B 1HFKA 1SXQA 3PX7A 2CCKA 1P0FA 3KHTA 3N3AC 4NMLA 1GVHA 3ET5A 4GWGA 1DQSA 2GBLA 4B76A 2J07A 1TX4B 4FLFA 5JRDS 3KU4A 5FPQA 1R8QA 4JEUA 2NO0A 1D9ZA 2ERXA 1XWIA 2GF0A 1LBSA 3LTEA 3DONA 1VCIA 2A58A 3M3DA 1K06A 4DR5B 1ZSVA 2ODPA 1USUA 4WKNA 1P1FA 1XRPA 3BK2A 5TT1A 2VTVA 4YO7A 1Y48E 5GM1A 2IXBA 4JCCA 3N39C 4ZVSA 3ESYA 4JLBA 4D9IA 5CITA 4YC7A 3ZV6A 2CJPA 4G0YA 2IYAA 1WB9A 1WUYA 3WYEA 3TNLA 1NBMA 3G6KA 1QQBA 2FQQA 4MA0A 5G40A 5U4XA 4YCMA 1JKIA 2FGKA 4UHCA 3NHAA 3R0VA 4OXRA 1OWPA 1GLNA 2REQB 3OWXA 4ETWA 4FWTA 4KV7A 1QV6A 3FOBA 3QNMA 2XMDA 1IAQA 2OCPA 3IEIA 3KR2A 5KNDH 1PQWA 4KDRA 1GD1O 1HZJA 1QVAA 2B34A 2VI5A 4QDTA 1ICIA 4BP1A 1B8OA 2IX3A 3HRIA 1SIWA 1O96B 4BAGA 2OFFA 2VC2B 1UMBB 4Q4HB 1W4CA 4EKGA 2V6GA 1J7KA 1P0PA 2ZS8A 3L0DA 3ND9A 1XF1A 3WWZA 4BTLA 2OM2A 1GQYA 4FT4A 1AZLA 3RVOA 3N53A 4RTQA 5IT4A 4ND7A 3UC9A 1EPUA 1O5IA 3IHWA 2O4UX 2P2LA 4H2DA 4B6QA 3HABA 4O1IA 1FX0A 1ULHA 3H5VA 4MV0A 1CUJA 4QYTA 4GOMD 4TQ9A 3ZE0B 3UHJA 3QMMA 5EE0A 2IDJA 1X2EA 1TTQB 1FS6A 1S7CA 4BX0A 4HYEA 1JDBC 2GJKA 4NC9A 5ELMA 4ITVA 1FRZA 1UADA 1E4OA 1GL6A 2GPNA 1GILA 2W22A 4NENA 2FZWA 1JDJA 5DTQA 2OO5A 4JMLA 3UC5A 2GZRA 4K87A 5IULC 3TSWA 2CL0X 3FFWA 4IDQA 1U31A 1VHJA 4KU4A 4HS4A 4W7HA 2ATEA 2YOFA 3VYVA 4OXIA 2XSZD 3ZXYA 1COZA 3X0DA 4C21A 4Q4LA 5BN3A 5GADl 2PKEA 1VC2A 2BUAA 4TXNA 5K3CA 1E1MA 4EABA 5IH7A 1XYGA 3N2YA 2G9NA 1Z5NA 2B4YA 2OXEA 5BRNA 3MSXA 3LRPA 1IC6A 1OSNA 3Q2KA 4CVNA 1PQ4A 3FZGA 3E9MA 3RS5A 4OBXA 2LUOA 1VLZA 3F6PA 3IPYA 4ME6A 1UBFA 4ZVRA 2O8EB 3PVCA 2FSIA 2YXNA 1O6ZA 2V7UA 5K01A 4DSUA 1ZGGA 1TUBA 3E8XA 4M9UA 1DMRA 5L40A 3IUEA 1DXQA 3AU8A 3RASA 4PONA 3DVRX 1N2CA 1BGWA 5IF9A 2O0LA 2ZSDA 4RMJA 2NXCA 5HEKA 3ORRA 3KQSA 2Y0DA 3F5DA 2IYVA 3EYAA 3SYKA 4CKCB 2AK3A 4EP1A 4MI1A 1IIBA 1NQUA 1XTPA 2JASA 2Q7XA 1J2JA 4HGPA 4LTNA 3OO1A 1E2GA 4FJ2A 5TQ0A 2VP2A 3O8OB 4BNZA 4CIAA 5JBQA 3II6X 3B1VA 1HKHA 3FMIA 3D02A 5E1OA 3THRA 4FBGA 3CBQA 3PEUA 2E5LB 4V0MA 4KR2A 2X4DA 3FNFA 4DWJA 5JARA 2HDHA 2OHHA 3L0ZA 1ODJA 2BBWA 2EJUA 4HF7A 2A88A 3VC2A 3FD8A 2C2OA 1QHGA 4IXNA 4JFRA 3O95A 4GGOA 4MUMA 4C0HA 4YR7A 1NN5A 5K3EA 1KA9H 1DG9A 1PZFA 1SVIA 4JC4A 5LQRA 3RG2A 2VT7A 3ROMA 1X1TA 3LIIA 5FBVB 2QG9A 4BQQA 5ADWA 1YA6A 3TWOA 5HBGA 2IT1A 2YJZA 4I9HA 4RLHA 5L7YA 3CVYA 2H57A 2WB2A 1CNFA 1TQHA 2GCIA 4FVTA 1HEIA 1W0JD 3PNPA 2CSUA 3QE3A 5SZJA 4JAVC 1Y1QA 3EUWA 4LISA 4EPWA 2NU6B 1T6XA 1DKNA 3M6WA 4IDFA 1I0ZA 2XWSA 2HU7A 5IRCD 3CKLA 1Z28A 3BMOA 3LPMA 2SKCA 3IR5A 5HF9A 1QG6A 4QOIA 2C1XA 4FM9A 1GL7A 2OP0A 3O1LA 4KN6A 5HWSA 2IK8A 3IQDB 3A9TA 4QBHA 3WDLA 2HSJA 2Y05A 4FCWA 1JQAA 5C31A 1ISHA 2FYTA 1I6LA 2UYOA 3AO0B 3LSTA 4IFBA 4JJZA 3R3WA 4Q16A 4RD4A 3SF0A 1HDXA 4W5HA 4X7BA 1DG1G 5KU7A 1CB0A 2R6HA 4X97A 1YS4A 4IOLA 1AVTA 3BCRA 1WB6A 3WZLA 3RYHB 4MB2A 3RJMA 4FHZA 4DKXA 2J9FB 1VL5A 4GPAA 4NHEA 3P96A 1KIFA 4FGUA 4WCFA 1Z0IA 1BX0A 3D2LA 4JUAA 4MV7A 5DBGA 1Q1ZA 1XCPA 1UC5B 3ESXA 1F9EA 1AKNA 1Q0QA 3QE4A 3VVMA 3M5PA 3E4DA 2EKPA 4FNGA 4WZ6A 4G0WA 1GKIA 1ZQ1A 4A10A 4D79A 5L7WA 3FCYA 4C5BA 2OFWA 1QV7A 3KG2A 4QRDA 2HTFA 2Y3IA 4XR4A 1HY3A 1L4NA 2H92A 3BB4A 3FUWA 4XX0B 5HDBB 4GPD1 2QMOA 1PUIA 1K66A 1QHHB 1QDEA 1Q7EA 1G9SA 3EVDA 3JTEA 3HTXA 4Q3CA 3BE5A 1T4BA 3JATB 1QGOA 4DCNA 1VMDA 2PVPA 1TZJA 1NX6A 2AFIE 1TF5A 2JIPA 4UFNA 5BSFA 5FPTA 4RGQA 1TUEA 2LR0A 5IW8A 3HXLA 2VDWB 3B38A 3HUTA 2QROA 5EFZA 3UGTA 1E6MA 5JYEA 3ZXXA 4ALJA 2WG0A 3AWDA 1QHEA 2GZ1A 4KLNA 3IAUA 2ZYDA 1E1RD 2G9RA 2XCQA 2ZB3A 3A4MA 5BW6B 1UWLA 4BKQA 1KOJA 2C4TA 4R68A 2VH5R 4FMDB 2HIAA 3C2QA 4LF5B 1CUIA 3EEYA 3D3WB 3H5AA 4Y2QA 5F5NA 4E4YA 4IV0A 4EARA 3H8SA 4NK4A 4H1VA 3BAZA 3DEIA 1YVEI 3PC6A 1XHEA 3HN2A 5GIPE 5EUMA 2WR8A 2F3SA 3NHJA 4GBJA 2PMFA 1PGOA 3U3ZA 3W6PA 2QAGB 4PYMA 4K0RA 4WY8A 1RHRA 1OFUA 5EZQA 3J81k 4DJ5X 1DQNA 3CR7A 3ICVA 5GJCA 5ICEA 4UMVA 4MOWA 5CAEB 1KSHA 3F4KA 3N7AA 4GWKA 4JLWA 4PCUA 1L5MA 2OMKA 1T8WA 1QVVA 4I1OA 4OHYA 5BV7A 2D5LA 3QKTA 3IDFA 2I6SA 3KXDA 1BOOA 2JAUA 3D6VA 3Q4GA 3V4VB 4YCNA 2B7CA 4NV1A 5DLPA 3VC3A 5B6JA 3ZDAA 3EAQA 4CN9A 3VAYA 3BCUA 5KTNA 5KX5A 2F43A 1X1CA 1QIIA 3H42B 4Y6GB 2P40A 5IM5A 3UAWA 1D2MA 1P75A 3DT9A 3A7DA 3F67A 3OU2A 5GMOA 1SBCA 3ZDBA 4UNIA 2COKA 2SNIE 2UZIR 1NW6A 1B76A 4F3YA 2SCUA 1XKLA 5GP1A 4JGIA 3A9VA 3QUQA 4B4VA 1UBJS 4UU8A 3PHJA 4Q3AA 2DWOA 2K5UA 2PBFA 1V1JA 2A4MA 4J1TA 4L50A 4NZ9A 3WA7A 3QLUA 4IQGA 5C9ZA 1QYVA 5FBZA 2OECA 4GXNA 3V7FA 3AETA 4TSRA 2ZUEA 3QKRA 4J0JA 4MVXA 4WERA 3AUKA 1XD9A 1M1YB 4RNCA 3ZH9B 4Y1FA 1U2SA 1UMCB 3PPYA 1A95A 4XIYA 3IX7A 4Q9KA 1GAWA 3P2IA 3V4ZA 3QRWA 1AK2A 4LJYA 5C46F 2J9YB 2VATA 1G5TA 2ZSHA 5EKUA 2WMOB 3L3BA 1A76A 2D1YA 2I3ZA 4P0TA 5FF9A 2W4MA 4P5EA 1P1HA 1NQAO 2A0YA 9GPBA 2WSBA 3RHFA 1FJGB 4CL3A 1XJ0A 4X8MA 3FYTA 2L42A 4RD1A 3QJ5A 2GJ4A 1UF9A 4GICA 4XFDA 4H18A 2F1OA 4QICA 5K05A 4NWIA 1N34B 1OVGA 1AUPA 1CK4A 5F9FA 1VL2A 2IUYA 2DR0A 1G98A 3KWMA 1Y8AA 3WL8A 3MJFA 1PR0A 3TLKA 2AXQA 2EV9A 5G4KA 3CRMA 4X92A 2XXBA 3PC8C 2XDAA 2YYSA 1NVMB 2YHBA 1K6EA 4DMHA 3QU9A 4X3CA 5F4BA 3NP9A 4QEZA 3AVYA 4NG4A 4CMBA 3G2OA 3O8QA 3V48A 2XRZA 4P3XA 4BGEA 1A7JA 2R3SA 1L4EA 3ELBA 4IAOA 1F12A 1KVUA 3QTTA 4Z4HA 2Q3EA 2VP9A 3A11A 3N2KA 4KRFA 1IEWA 3TTWA 2ZSAA 1T5OA 3JQBA 3G23A 4MDYA 2GZSA 3CR3C 4QM7A 2FF5A 3L4JA 3K4PA 3TL2A 2AFHB 2QTLA 4JBWA 1T0BA 1VGRA 4D80A 1P6UA 3A04A 2UAGA 3FHLA 4MS4B 3LX6A 1Z5PA 2LD4A 5FDFA 1I8TA 3GJ6A 1AXGA 3OX3A 2MINA 4Q4AA 3N0XA 2GUWA 3AF0A 1TM5E 1CE8B 1NKTA 4C4ZA 5A4IS 1PFKA 2B9VA 1KNQA 2KBFA 3VNBA 5TQ2B 3VZPA 1JILA 3I9KA 4C7BA 1U2TA 1FNDA 4KMSA 4WBNA 3O9ZA 3I9MA 1I5EA 4PLGA 1C30A 4UAUA 2A35A 2P9BA 1K7EB 4M6WA 3KEMA 4M1EA 1UCFA 4RK0A 5DEOA 2VHJA 2QE7A 3FOAA 4KQKA 4I1YA 3T3MB 3PJGA 3U2QA 1UINA 2C2HA 1XZMA 2RB4A 1Z82A 3IAM1 1XYVA 3ND7A 3OKPA 4KJXA 3TQFA 4YV2A 1M75A 1Z6YA 4CIWA 4UM7A 4Y7CA 5JIBA 1A3CA 1S2OA 3OZIA 2BRUC 3CUKA 5A04A 3IILA 1VE3A 1LK0A 1XPUA 3OZEA 5MFPA 4L9AA 2PIAA 4RHCA 4DIKA 3U19A 4I3FA 1CJUC 1DZIA 1T4MA 1PYGA 1WDMA 2YHUA 4UUMA 4CKYA 3NOXA 4BFUA 1N33B 1MBZA 2E37A 2E4ZA 2QW0X 4K3VA 5IXSA 4OXKA 4LJ6A 2H4YA 2G1AA 2Q0HA 3DYIA 5FEUA 1AY0A 3L6BA 3OZFA 2PUWA 5CVTA 2GESA 2R751 3BDIA 1TF7A 4B0PA 3DBLA 3TD9A 3IV9A 1NBIA 4LZLA 1N0VC 1E96A 2BTQA 4MIYA 4XYEA 2XZDA 1TQ4A 1I80A 5CGQB 2JAHA 1U1IA 2JIZD 1FDVA 1JLMA 3PI6A 2GARA 1GUFA 4RVDA 1P1JA 3ZHTA 2B36A 1G2IA 4ID3A 2Q7DA 1LGYA 1YFKA 5K09A 4LRUA 1CUUA 2NQTA 1IJEA 2G5TA 1HETA 3R24A 5KHOC 5J43A 3ZDEA 2QS9A 4II7A 5ALMA 2C2MA 1TU3A 2P5TB 2A1TR 4F60A 3THYA 2VUSA 3AHEA 5GTDA 1YIOA 1KI7A 3MJRA 2XUJA 4XLZA 3K1AA 3ZWWA 1R1DA 1WCWA 2P6NA 4TV9B 5L3QA 4ECEA 1OH7A 1KYIA 3HL4A 5EMNA 4I9GA 4C43A 1I4OA 5EKXA 4TKMA 1DQYA 1NURA 4OXYA 2P2YA 2RAPA 4GLBA 1E60A 3FKQA 5DP2A 2ZJ4A 1FP7A 3WLIA 4PAQA 4JLMA 1CQZA 2QA5A 3AJRA 4JA0A 3CRQA 1N5KA 4CDNA 4R1MA 3LUFA 2DMRA 3X1MA 3ANNA 1PO7A 3H2GA 4RSGA 2IOYA 3G7NA 3OLXA 4V2IA 4AQDA 4EHIA 2PWAA 1XZNA 5GGYA 4OFWA 4KO1S 4KXFB 1TKCA 4FB5A 4JVNA 3D31A 1ESCA 2G8LA 2DTDA 2B0CA 2C03A 2DGDA 1P2SA 1CR6A 1RHUA 2VYCA 3NV9A 4WUTA 4XTCS 4ENPA 5IG2A 3NKLA 1N77A 1RHJA 1Z56C 2WJ4A 1EP2B 4G6ZA 4BFVA 1BWPA 4JL8A 2DWCA 3ANTA 1GA6A 2IZZA 3OIFA 3JWGA 1L4KA 4MVWA 4JBGA 4RJLA 1OY1A 4ZAVA 2D7JA 2RIPA 5B1DA 4CM4B 4UTNA 5KIAA 4NU8X 4F72A 1GZ6A 3A6ZA 3FM9A 4C4RA 5IJXA 3PSHA 1QTRA 2FZ4A 1QWOA 4ZJYA 4GF5A 4X7RA 2EEZA 4XVQA 1PWZA 2H7VA 2OV8A 2YDXA 2VSOA 2RJNA 5FAXA 1TEXA 4B6EA 1U3DA 1N4DA 2QN8A 3DZIA 4PGGA 3N2ZB 5FHRA 3U39A 3W4IA 4EFNA 5J2TB 3EZ6A 2IVZA 1X87A 5BW4A 3ZQ4A 1OFGA 2I7TA 5IAOA 2K4MA 4A0FA 3MJTA 4BRSA 1XZHA 2FPUA 2QN7A 1W5FA 2IWHA 4AROA 1RWVA 4LC9A 3GJYA 2QMEA 1XALA 2YICA 4DIOA 4OUDA 4ZEXA 3CUSA 2P67A 4RD0A 3L4KA 1F3OA 2NU9B 1GARA 3RPEA 2PS0A 4FFBA 2CWWA 5T8KA 2B7LA 4A6EA 1OWOA 3UQYS 4UTRA 3ZXIA 4I4LA 2AZTA 3L9WA 4BP3A 2CT8A 2NZXA 1G3QA 2IXDA 3LRXA 3NHUA 1W85A 1UAAA 4DJTA 1RBZA 3TBFA 1ZOOA 2ZFUA 1Q7TA 3I34X 3OIGA 2IU0A 4QO8A 3RIHA 3FFTA 5AVTA 5LKRA 5E0OA 4B71A 1HT3A 3ACBA 3OTIA 1RI3A 5D86A 4ZICA 4J0GA 5FOWA 1OX4A 1OTYA 4NQZA 4BQRA 4LRTB 3TQSA 1QKIA 3W8FA 4YMIA 1S6YA 4QZVA 5CB8A 3J7TA 1ZRMA 1RZ3A 3FSRA 4PLTA 1M6HA 2PH3A 1EX9A 3BGSA 4RPCA 2BBTA 3IT3A 2DZDA 2OHFA 4PIPA 2QX9A 2PVCA 4TTPA 4XEUA 4N5DA 1ZVJA 1QM5A 5JZSA 4NYMQ 4F7DA 1Y4ZA 3D1JA 2Z57A 1DCKA 1KDZA 4AG6A 2L19A 3IO3A 4GNKA 4HQRA 4DA0A 4I2VA 4NVRA 2GZHA 4FQ8A 1CPYA 4PY2A 5K4AA 2W98A 1HEYA 3LGSA 1ZONA 3BQMB 4U8HA 2PKQP 4HXGA 3GGDA 3S28A 3NRJA 1OI7A 3HR7A 2FUG1 3QE2A 3VYUB 3A6GA 1F20A 5I7FA 3EIOA 3KPVA 3IMKA 1TAGA 3X43A 3ESBA 4JXXA 1TL7C 3D7KA 3OEHD 4M9RA 4QYXA 5I7RA 3WLAA 4GYJA 4NICA 1KGDA 1T24A 2ZIWB 3LJKA 5JATA 1H8HD 3AZOA 4ZCPA 1WP4A 1E2MA 1GG9A 2EXXA 3R44A 5DBIA 1N0HA 2G08A 4G1MB 3TW4A 4L08A 2AJBA 2AD5A 1BS9A 2GPYA 3LRTA 3G5UA 2XKKA 1Z7BA 1DS6A 4RE6A 4DCOA 5CG1A 4U7DA 4AY4A 3U44B 4W1QA 1P1RA 4FKMA 4WADA 3AY7A 3PXDA 2P9HA 5HJ7A 3WMRA 2F4VB 3NCHA 5CEEA 3GFTA 5LP6B 3D2CA 2O5VA 3ZWDA 4B9AA 1VA5A 1A5BB 1TCUA 2FG6C 3CLSD 1CY2A 3EZYA 1MPXA 1OAOA 3D8BA 2IEDA 3MAAC 3X1JA 2PX2A 2FQWA 4ND6A 5EJ9A 1A7AA 3PUZA 1P9OA 2HL6A 4N18A 3IE0A 2AOXA 1ZS9A 3JR7A 1Y3DE 2A8YA 2DQSA 2J09A 1YE5A 1T3HA 3PNOA 1G8JA 1WU8A 2NSLA 2NV0A 4IDDA 2ORYA 3AM1A 4KX5A 2PVSA 5AKIA 5K8JB 1L7BA 5IBQA 2R4QA 1OZ0A 2YXDA 3MXOA 2GN8A 1SPBS 1R0LA 1PR4A 2JFZA 1N6IA 4J0EA 2OZVA 1E6UA 4L22A 4LYEA 2VHVA 3BTVA 5HKOA 2W48A 3KBBA 5LMNB 2CNWD 1OFVA 1DHRA 4CTMA 5I9SA 2EFGA 1R6AA 3GVIA 4EQ6B 2WD7B 4AZWA 3B1FA 4Y2VA 1NVKA 1P4HA 2ENWA 2WIKA 1IYZA 3NTUA 4RUKA 1E2EA 2G76A 4XKJA 5L45A 4WJLA 3A32A 2HHHB 4FKZA 4Z2AA 3OF2A 3R7WB 1N5JA 2AFIA 2AJTA 5E6UB 3JQAA 2RH4A 2W8BB 1BDMA 5I4KA 5LA6A 3M4NA 1AJEA 1RYZA 1NRWA 3HBJA 5JTUA 3ZU6A 3JPYA 5DM70 1GHTA 4J9UE 3PG5A 4O5AA 1WMDA 1JVNA 1SVUA 2P2CA 4MARA 3WOVA 3HCDA 2RI1A 1UBUS 3AKEA 4XI9A 5H3HA 1RS0A 4ZO9A 5AW0A 1Z73A 1ZUNB 3H1AA 1Q7CA 3LOQA 1XA3A 2OBXA 4B43A 1QPBA 3HNPA 1RJGA 1Z68A 4YGYA 1E0KA 1BWSA 4HTFA 3A26A 4PBRA 5UKDA 1P3JA 1CY7A 2Q5FA 5IJ0A 1CY8A 1TUIA 2JI8A 2R6CA 4IWYA 5PNTA 1WEKA 3CPJB 3T3EA 1IJBA 2CNLA 5KNBH 1G1MA 1P77A 5F5XA 1RJ9B 4AJLA 1NYLA 2O3JA 4CLOA 3MBKA 1F14A 1ZVKA 1WXXA 1I6WA 1ZMXA 3D3NA 1V16B 3HU2A 1U9CA 3JQDA 3LDAA 2AI1A 4K2HA 3R3VA 1OTXA 4E70A 2HRCA 3WTCA 2A59A 3S70A 2XV1A 3T9FA 4TVBA 1VL1A 1W35A 5HVNA 3VSAA 1H2YA 2A5DA 3ZD7A 3FR7A 1WMBA 1W36C 1XQXA 2GBIA 1AQJA 2DULA 4R0NA 1SK8A 1EQAA 1FXWA 3F6YA 2GUGA 4TRMA 4A6DA 1YB4A 1M1UA 1L3BA 4PV7A 3HBLA 4LXGA 1W8IA 2Q1YA 5HGJA 1CJVC 1TYEB 4HOYA 3RYFA 1YHNA 1ETHA 2P9CA 3ORHA 4ZV9A 2IUSA 4EVRA 2C83A 4GI2A 3NDJA 3REFA 3WWPA 3HCEA 1LLFA 1WXQA 2C61A 3R0QA 1F7UA 4AXXA 1QZUA 1S01A 4R9SA 1IY1A 4NCHA 1XVVA 2UDPA 2Y92A 4UU7A 3RANA 5FQOA 3F3KA 3A6EA 3TSCA 5B53A 1I4LD 3T5DA 2FZGA 5KVSA 1HT1E 1YL5A 4IIVA 2GAJA 4BNTA 3G0IA 3GCGA 2PUHA 2QZZA 1QFMA 4BZZA 2CMGA 4YYEA 3U9LA 3AERB 3GI1A 4RSRA 1R8SA 3DAFA 3DOFA 1ZHFA 2DWUA 3FCEA 3R7LA 4FUTA 1TJ4A 1GCGA 4N5NA 1VZ2A 4YP7A 1A9TA 1FDWA 3FGZA 1WBJB 3IIEA 4GMXA 3N07A 4R1QA 3W3AD 4LBZA 4DC1A 2VDMB 1KHHA 5ALLA 1OHHA 3EF3A 3IR6A 5FI5A 2IW1A 3KUDA 4LMPA 2I4RA 2X8BA 3VJKA 1QVRA 5JS2A 3T35A 1RAGA 4DUGD 1ISJA 1IXZA 1G0NA 1H9BA 1VE5A 2GB4A 2ECQA 2PX3A 4BQPA 2CFCA 2V0GA 4J0HA 3R3YA 2XBMA 1L8AA 1ODFA 1UM8A 1G4UR 3DWEX 5JRZA 1JECA 3KFVA 4XPIB 4Z53A 3ES9A 1JSRA 2G1KA 2J48A 1C7ZA 5DYWA 5FBRB 5H9WA 1LJUA 3PNSA 3VTKA 2EQBA 5LQMA 3B3JA 4QPCA 1GQQA 4B33A 2W2NA 3P0HA 4TRNA 5EG5A 1ECFA 1W5BA 3UFXA 1ONNA 1XMQB 1BMQA 2FN4A 2J3QA 2ZRLA 4II2A 3T52A 8AT1A 1THTA 5C7OO 3ED5A 4UHKA 2NM0A 4DV6B 3AUFA 1DVRA 5B7NA 2IS1A 4LYJA 4G1EB 4V39A 5FB3A 3AHCA 5ICCA 3ONWA 2BEKA 4TYPA 1NUUA 1T29A 2X40A 2JKYA 1Q7BA 4XTRA 1GNPA 2WVGA 3BMNB 1VJ0A 4AUMA 1AA6A 4H16A 4YJ2A 1NRJB 4MWGA 3HJBA 1Q95A 1EX6A 2CKMA 2H9IA 2PLAA 2YWFA 3AHDA 3ZW7A 5I7SA 4JI1B 5A62A 2QUZA 5LSAA 1EINA 2IU6A 3QNUA 1SHZA 5EIXA 3QBDA 1DO0A 1GOTA 2BIFA 1AHHA 2JFFA 5F9MA 2FLWA 1Y1PA 2NNLD 1XCMA 1J39A 2A9QA 5F2KA 4CQLA 2YUTA 3UBTA 2HM7A 1L1QA 3HJAA 2Q2VA 3ADKA 2CJWA 1RABA 1RZUA 1UAYA 2ARKA 3FA2A 3GLHE 4CIYA 1KEKA 4YCBA 4RCYA 4C01A 3LU1A 4CKZA 3BBPA 4WN9A 1N3LA 2R8ZA 3QKIA 1LDBA 1RAFA 4FU0A 1E77A 1WSAA 1DT3A 2A30A 3FIJA 4HNVA 4GR4A 1PGQA 2FFAA 4AZ0A 5C5IA 1JQJC 1W25A 3O73A 1TOAA 2W2MA 2FJ0A 3J7AC 4I8IA 3QBEA 5E2IA 2EX1A 3SC3A 3VYSB 2VH2A 3F6EX 4HQNA 4AMZA 2HPVA 1YS1X 2FZKA 1KHTA 1LSJA 2O7SA 4CF6A 1JR6A 1KQ3A 2FPPB 2LWIA 1FP2A 1XU9A 1VHDA 3BGIA 5CRIA 1P6QA 4BFLA 2Q3FA 3LDGA 3CRZA 1B41A 3IOMA 3DEAA 4CGYA 3SSNA 3VU0A 4UTVA 5B2FA 3LHDA 3S4YA 1NVGA 2X6QA 4GMHA 1M5RA 1XQYA 4INJA 4CF4A 5BMOA 1W2WB 2ONJA 3ABQB 3GGGA 1GY8A 4B32A 3PHIA 1UUFA 2X8LA 3MCZA 1V8ZA 4F3CA 2KX7A 1UBRS 3CA8A 1MVNA 1T4DA 3JQPA 3TH5A 2HPHA 2ZTVA 3O2NA 4N76A 1PJLA 1N5MA 1CFJA 3D8SA 1OU4A 2I03A 2CF5A 3LX8A 4OP3A 4X8HA 3DFKA 5DOVA 1W93A 5EJ5A 3UXHA 2R2GA 4ZQFA 4IGFA 1MNAA 4CMKA 3R8XA 1PAUA 2O0KA 2O2SA 4P5PA 1JQLB 4RK7A 3TQIA 4BN0A 4FSDA 1YA8A 2WZCA 4JLAA 4Z8YA 2QMHA 2VTEA 3BERA 3C3PA 4M1OA 3RWOA 3ZU5A 4ALIA 5B1YA 5HZHA 5ILGA 4B82A 1C8KA 4V0NA 4YEDA 1L7OA 2PLFA 5CVJA 1O77A 4TN5A 4N7BA 4BDTA 1MO4A 1U8TA 2VYQA 3SR4A 4D9MA 1XC7A 1T9KA 2RH5A 3UHOA 1B6SA 1HXHA 1UH5A 2RC6A 4N49A 4HGYA 3P4XA 1H4QA 4J91A 2VQDA 3QU2A 3BOSA 4MQLA 4UD6A 2V7EA 4CCYB 4YCSA 1QIFA 3B2EA 3BWXA 1GLGA 2HA0A 3KV1A 3LHFA 2IYFA 3DVAA 4J7CA 5IP5A 1FUUA 4PS0A 4BZQA 1Z5GA 4F12A 4PZPA 4CWAA 4ZAZA 4OGGA 1TZCA 3R9XB 1ZNXA 4JEHA 5BURA 2ZWPA 1PFGA 2EHJA 2M6RA 3CE9A 4J94A 2H2HA 2FU5C 4Q4JA 5FRDA 3UAZA 3ULKA 1T5HX 4HMPA 4PO8A 4BQEA 1L7QA 2QJOA 2QTGA 2L18A 5KSYA 2QF7A 4JGGA 5AIAA 4QXQA 4DMCA 1RXWA 4A1OA 1UMDA 1JYSA 2MSDB 4B4DA 4MX8A 3KLMX 4UHBA 1NJ5A 4RFVA 4UMDA 1K8ZB 3HWRA 4N1AA 1K6MA 1NKVA 3LPAA 2BZ1A 3SSAA 1QB8A 4L4YA 3QVLA 3PFFA 5DW0A 4EFMA 2QLJA 5J23A 1QUEA 1P18A 4FGWA 2Z2YA 3RTCA 3LFUA 2XE6A 1BE6A 5TSDA 5DHUA 3ZWAA 2FOXA 3U3RA 4NESA 4IVNA 5KAMA 1PEYA 3ENNA 5F1YA 3B6EA 2RGXA 2I9KA 3N58A 1YO6A 1VYTA 4DLVA 1BD3A 4MKXA 3MT8A 1JG3A 3NTRA 2ON6A 2YUIA 1Z88A 3RC1A 3UCFA 4D82A 1YJCA 3WK5A 4F1KA 4ZAXA 4OHFA 4XD2A 1WNFA 2WYOA 2G0NA 3UMBA 2H2IA 2WFMA 2IQIA 3OFJA 1H3NA 1TMKA 3U3DA 1I5RA 4P93A 3FRHA 3T54A 1XRMA 4C4PA 1FFWA 3M1YA 3C6QA 2R1VA 4UOEA 3G17A 3MT0A 2W6CX 1OIXA 3PXBA 1ZUIA 3E15A 4PX3A 3PK0A 5JALA 3FWPA 1EWKA 5HFJA 1S9HA 3WWYA 1MMFB 1S0UA 1FX0B 2QLMA 2HMSA 2ZRGA 3GAMA 1XPRA 1IVNA 1A2QA 2ZS9A 3DE5X 2VDUE 1IY2A 4M1KA 1M7HA 1NQTA 2P79A 1G7CA 4LA4A 3F97A 2BHTA 3AFIA 2FG5A 3JQ6A 4AJEA 4NENB 4C0LA 4ZO4A 3UWOA 3B2NA 4C0QC 5B5SA 3WWCA 4IP0A 1HLGA 2P6UA 5THXA 3I5AA 3PSAA 1W87A 1QDUA 3LL4A 3EA4A 3F9CA 3QWBA 4C4SA 5BN3B 3W0LB 2WAOA 1E5DA 3ADBA 1P8JA 5A3VA 5MN4A 3QVMA 2HLDA 3Q3HA 3RHTA 4O2BA 4WASA 1CIJA 3FUUA 2ZVDA 4M38A 1QQAA 3V8PA 3UKOA 2JFHA 2DHQA 5INTA 1ZUHA 1MKYA 1OILA 4OX9B 5LU9A 2WF5A 4I36A 5L9AA 3MJSA 3SYTA 3B8HA 1TUBB 2P62A 3WIOA 5LQUA 2JBAA 4MPPA 1N2CB 1DO2A 4QQRA 1QDLB 2RK6A 2LV8A 3K0FA 1ZD8A 4TMZA 4AZTA 1A5TA 3T3PB 2XMQA 2H1CA 5JPDA 4LOAA 1QH9A 1F4PA 1FFEA 1NTOA 1E2KA 1U1DA 5TQ0B 5BUCA 2I6UA 3ONNA 3K73O 3Q98A 3CXRA 1QGZA 1KS2A 3KNZA 3LG2A 3OBBA 2RCYA 3H5WA 5G1NA 1Z7GA 1S3GA 3MMPA 1CSEE 1U80A 1Y3AA 2G70A 3SY8A 1W49A 5KWIA 3AR6A 2ZTLA 4EHKA 5F2NA 1NE2A 4JU9A 4IIDA 1AKEA 1NVEA 1AD2A 1Z15A 1IHOA 1UBKS 2VZLA 4OI4A 1SG0A 1T5BA 3RI3A 2Z58A 3ASVA 4NABA 3HCAA 4I50F 4CNBA 4OGFA 4XUGB 5BOSA 3EXG2 2R1UA 2PJZA 3JVIA 4JQCA 4LVCA 5B3AA 4UTOA 2D06A 1N5OX 3GY0A 1PN3A 4TT8A 1DV1A 4M0CA 1TEHA 4Q6BA 1EWTA 4YN3A 5B2ZA 4NMWA 2DHCA 2LCIA 4BXOA 3SZOA 2V7PA 2VJKA 3CGGA 3JD0A 3PPWA 3DGFC 1VJRA 3CSSA 3R5KA 2CMKA 3DOCA 1Y89A 3OLVA 3HJHA 4FDUA 3UW1A 3DFIA 3WK9A 5JAIA 3BMOB 3RKUA 4J1QA 1KI4A 1NVVQ 3M4YA 1Q50A 4KXNA 2IUFA 5E3IA 3ZQKA 4R9NA 1DAMA 3GRVA 4CBVA 2BTEA 1QR6A 4FILA 5MGBA 2G88A 3DQZA 1Y3FE 3HR8A 3RFFA 1YC2A 2NPOA 4W8HA 1FDRA 1C2YA 2BFMA 3EY9A 3X1KA 4G0PA 3MMNA 2R84A 4MYHA 4RMGA 3DULA 1G2PA 4QJ3A 4JODA 3TLBA 1LDNA 2JIMA 5EJGA 3A9CA 4Z0TA 1LWNA 5JY6A 4N0EA 3KDPA 1SXJD 3GWGA 3FWKA 3MPUA 3UK1A 3WO1A 4X90A 1VDMA 4WCFB 3LK7A 3HB7A 1RI5A 4H59A 2OCGA 3B1JA 1EGQA 3AHHA 4I55A 2MSLA 1RTTA 3MG9A 2P7IA 1XAJA 3PWSA 2Y76A 3AINA 4LX8A 4EA9A 2O1WA 4EA8A 3C1OA 3EQZA 1L5QA 1BVUA 4MWZA 4ZVKA 2BDTA 4DY4A 3CKYA 3SQXA 5H82A 4EMUA 2CYCA 1EHCA 3TDMA 1C9DB 3EIHA 5I47A 2VCEA 2GLTA 4E09A 1EA5A 4JC0A 1FEZA 1W76A 2ZYHA 5B7GA 1J9ZA 1FU7A 3D4IA 1N2GA 3C3BA 4ENUA 3QE0A 5FJIA 2Y2VA 4J3FA 4J2TA 3TBHA 4H7KA 1JR3E 2GBPA 5JAQA 2A0UA 3EB9A 3LUHA 5DNAA 1MC8A 2BCGY 2VYFA 3RCBA 4KQXA 1XKQA 1I2DA 1P29A 1SURA 2IC5A 2YBDA 3I9V6 1WF6A 1M1NA 5FBHA 1USKA 3F47A 4OL0A 3FPBA 1TYCA 1DKLA 1GR1A 4C89A 1SC4A 3H9CA 4FFNA 1IN5A 3NBQA 3UGQA 4Y2RA 1F2UA 2BR4A 1T5SA 2FEXA 2ZE8A 3O4VA 4CTNA 2J3KA 2IV2X 1H5NA 2FMFA 3A06A 1UJ4A 3ZCQA 5FAKA 1AURA 4URFA 4CQMD 4FW9A 3DCYA 1KY4A 4V1CA 4IHJA 1W96A 5K8UA 5CFQA 2PPLA 2G1JA 2VKTA 4HPWA 4H6WA 3BJRA 4K6CA 4KVGA 3OC0A 1MIOA 2F3UA 1QH8A 1LRJA 1V7CA 2GN6A 2OFPA 3WGYA 1FYDA 2HCJB 3DQPA 3HP4A 5EINA 4F7WA 1DI0A 2EFHB 1GZ5A 1ZBDA 1T9GR 4UHFA 4BMZA 1Y9AA 4ZJUA 2ZE6A 2CNOA 3D6UA 4RO0A 3RC9A 1YZGA 2BW0A 1WB4A 5GQSA 2F43B 5KX5B 3ZW9A 1D2EA 2RC5A 2VP5A 2WV7A 2MSWA 3PIIA 3TQRA 2WUWE 3CH7A 4HGNA 4LGCA 4IYJA 4MWSA 3M1AA 1SCJA 3E2PA 3BD6A 1VM6A 4RK5A 2P27A 3LBYA 3D7LA 4YX9A 1BIFA 3QX3A 2SCUB 4IKOA 3U26A 2OV4A 2R7MA 1ZGBA 2I6GA 2PL3A 1YDGA 3QVWA 2G4VA 1ORIA 2QSZA 1RWWA 2Y77A 4MR8A 2DBQA 1EK0A 1NSTA 1UBLS 5SY9A 2XSZA 4KC0A 1WSDA 1P31A 1ZH4A 5J1TB 1R0XA 4X61A 1LPBB 2CUNA 3AETB 2F9FA 1K3TA 3PCRB 3DOEA 3QKRB 4I14A 4KPGA 2RHOA 4ASUD 4OHVA 4KXWA 5ALHA 3IPLA 3ZY2A 2I7DA 1E20A 1U6IA 1D4AA 4AG5A 3KKKA 1O94D 1U3CA 2YWHA 4JNKA 2YL2A 4N5IX 1ODSA 2WIJA 1LSOA 2HU8A 1PHPA 2PCLA 3SPXA 4DR6B 4Q03A 4R7ZA 3PD7A 4DRZA 5CFPA 4UASA 3TJMA 2QVCA 1QGAA 3K5IA 4AC9A 1G291 1OH8A 3FPEA 2PKYX 4MAAA 5T5QA 3OT1A 3CNLA 2ZT5A 4IIHA 4U02A 2QNRA 3WGQA 4DSOA 3GLHA 4IL5A 4QU0A 3X1DA 3D6NB 4G81A 1Y9ZA 4RJTA 1W94A 4QAQA 5CNIA 3WBFA 1KYTA 4KGZA 5G4KB 2J31A 4AN4A 5CT9A 3U80A 1XTJA 2P9ZA 5JD5A 1C8LA 2CJFA 1FP4A 2H2AA 1ADJA 2QG4A 3I9LA 1XPJA 4NZNA 1DE0A 3BVPA 3A2NA 2AG6A 3VI3B 1LF0A 2FMIA 3MAJA 2GDZA 2Q5HA 4RQUA 3BYZA 3O8QB 1HURA 3G6WA 1TGYA 4UPDA 5U1PA 3SBDA 2X4IA 2XZLA 2BLNA 3TX6A 2PDAA 4BWFB 2YHAA 2HMTA 4R1PA 3VUFA 2QUAA 3ETNA 3N2KB 4LHWA 1RI1A 3VOAA 1MENA 2UUCB 1GG5A 4HDQB 1MW9X 3C8DA 1KDRA 1X1BA 3E9DA 1S2IA 3WYGA 2VRCD 4P92A 5HCUA 3ZIDA 5ADHA 1A8HA 2Y68A 3SYRA 1FOEB 1EU1A 3L7YA 4JSYA 2GAAA 5IYZA 2J9XB 3I6YA 3R0JA 3S8YA 4K8OA 5H81A 1WU7A 2ZI7A 4Q4AB 2MINB 1YS2X 4EI7A 4CL2A 4RFSA 3BQNB 1S8NA 1W0JA 2NG1A 1L8XA 1KVTA 4LECA 4W99A 4FOOA 4CT5A 1GZVA 3ZTYA 4WBNB 1C30B 2CXSA 2QV7A 4M6WB 4PZ9A 3SSOA 3M3HA 4HWOA 1RCTE 2EOAA 4PTZA 1ORTA 3SDZA 4H15A 3A1TA 3RYTC 3D5EA 2WK1A 2NUTA 5DB4A 2Q1SA 5EE3A 2HLHA 2VPIA 2VPZA 3AESA 1Y7LA 2VPTA 4K81B 3SVTA 1D6SA 1ZMBA 3H13A 4IRMA 3BDVA 3HFSA 2PLRA 1PS0A 4B48A 4UTPA 3PEWA 2ZREA 2BCJQ 4R5MA 1DFGA 2NZ2A 4ZXPA 4G0OA 4C78A 4F45A 3UF0A 1HFEL 2DPMA 3L5KA 1MJGA 1PJ8A 3NYWA 4YROA 2VDQB 2H07A 1K0UA 4FGKA 3BZBA 4WKCA 2W6JD 5DSZA 1FB5A 1P5HA 1VPLA 4KO8A 5DCYA 3KVYA 3PD0A 4DQXA 5JZBA 4OQYA 4NNJA 2NW6A 5C81A 2HUNA 3MCVA 2SECE 4C03A 3PQ6A 2B83A 2ZS7A 2YASA 4AW9A 1VE9A 4RTKA 2AIRA 2O8VA 4YMUA 4B6FA 1SCDA 2BTQB 3F7NA 5IKOA 3CRNA 3ZTWA 2CCGA 5CBPA 4AUNA 1ZITA 3AUYA 2BJWA 4P3PA 4GX1A 2ZJ6A 4KRXA 4WEOA 5BRJA 4H0NA 5EXTA 1CS4C 4WPGA 4JX9A 3T41A 1AO0A 3W5DA 1C8VB 2PZGA 2Y93A 3JZDA 3ZVLA 3E3LA 1JSCA 4JQYA 4DEVA 4DNQA 3F6CA 2GJSA 2MR5A 2W90A 3A6LA 3DOOA 3THYB 4D5GA 3GJXC 3AVPA 2C42A 1E59A 3K1AB 1EGVB 2WIBA 4BLSA 4IDGA 1LVUA 5L3QB 1V6CA 4CMIA 4HT3B 2AXNA 1U2PA 1Z8FA 3N6XA 4GQBA 1NLUA 4O4IF 3PR2B 2QVYX 1OE0A 2C3OA 4KQMA 1JEQB 5AR1A 4YRPA 4BQNA 3PXCX 3RFVA 3JQCA 4C3VA 4FFOA 4L0CA 1LKZA 1MD9A 5AKEA 2D59A 1CCWA 1IZ0A 2ZUDA 2XDWA 3B36A 3HXPA 3H4TA 1N6OA 4I5IA 1G8PA 4EGJA 1PBTA 2I6TA 3FYUA 1TLTA 3LCMA 3O1HB 4HEHA 1KC1A 4IWXA 4S3MA 2FTKE 1I51A 4CN8A 2JLVA 4MUAA 4R8KA 1YBHA 3VTFA 3TIXB 5CW1A 3EVAA 2C07A 4FDTA 4B5KA 4PNHA 4O4JA 1JHRA 3PQFA 2X1VA 4O08A 3WGGA 4HGRA 5T3YA 1ZL2A 2W5UA 3E18A 5LUBA 1AN0A 3A3NA 2H16A 3NUGA 3IA7A 4A2CA 5KJ6A 2DCUA 1HTBA 2VJYA 1SCBA 2HQ1A 3Q2IA 2IJGX 1IPHA 1LBHA 1P5ZB 1SD2A 1ZI9A 2AEEA 2WZBA 1O0SA 2JHCA 1L7RA 4G8DA 4JLVA 5YASA 5AJUA 1V48A 2XTNA 1BHSA 2WVAA 3ETEA 1LBIA 2E48A 1NNEA 3E4CA 2FHSA 2KW5A 1ZP6A 5IUKC 2D4AA 1ZN7A 2BMDA 4WQMA 1F6BA 5DFAA 1KYYA 1CS0A 1RLUA 4GI7A 2YYYA 2X4LA 4N6OA 2J7PD 2V6FA 4J7UA 4GR5A 1UZAA 1I4DD 4IM7A 4OUDB 1HDEA 3UB4A 2IV3A 4PRZA 1ZSNA 1VFNA 4WIAA 4FZ5A 4FFBB 5ALFA 2A9JA 2H4JA 5J4LA 3X1WA 4HY3A 1XAHA 4REMA 5E1BA 2XIQA 4HN2A 1HE4A 1UQTA 1VBFA 4IVRA 4ZODA 2X13A 3ZE7A 3GD5A 5ITVA 1XQ1A 4CQJA 2JVJA 1W85B 4MO2A 5TB5A 5JDIC 1ZM7A 2AQIA 1F4LA 1E1KA 2ALJA 3R9KA 2I4NA 1HLFA 4KO2S 2QPOA 3KKEA 1CLUA 4YALA 2J0SA 1TFUA 1MC5A 1I6MA 3EGCA 1U0HC 2B8EA 5GV8A 1UJ6A 3DD5A 4PXYA 3I23A 1OX4B 2L82A 1NM5A 1WZIA 1Z3IX 1YB5A 3A27A 3DHVA 1M33A 3GFOA 3HDJA 3KFLA 4WHMA 5IC6A 4BO6A 1KWGA 1NP6A 1FSPA 4Q39A 3HYLA 3UPTA 4W7SA 4C88A 3WMFA 1C80A 3EOZA 1Z0AA 1Z4QA 2A3RA 2JK1A 4J6FA 5KS2A 5SYAA 2BI4A 3BRQA 3OZWA 5HZGA 2F64A 3CX3A 5BWMA 2CDNA 5MFZA 3T9BA 4CFSA 3KKLA 2Y1DA 3FB4A 3PFBA 3MB8A 1R6XA 5AM0A 3UOAB 3V4PB 2FSUA 1I4TD 2AMFA 1CNMA 4LV6A 4DLZA 4QJIA 1PCXA 4FJ1A 4HWGA 5FHQA 4WLEA 3KR0A 3P26A 1T4GA 1KYQA 5AKJA 2VH1A 2H1FA 4J90A 5EQFA 3NETA 2GYWA 3UFBA 5LZ4A 4GLJA 1W4RA 4Q7EA 3GG2A 3O4HA 1EZ4A 4TM7A 5IEBA 4FDAA 3RTDA 1H2HA 2HZ7A 4GZ6A 1DBVO 2H2GA 5I5EA 5JOQA 4YP1A 4A6XA 3OPMA 2V6MA 3IUPA 2H7XA 4QTTB 4C0AC 5C7LO 1KQOA 1WDKA 1I14A 1S1MA 3PV0A 4FT2A 1U2DC 1BXRA 1ZRHA 4WGFA 3GGSA 4Y6QA 3K70B 1ZHHA 2OEPA 2EIXA 1V43A 2YW2A 3AYXB 2FOIA 3O47A 1F51E 2FA9A 2O0JA 3KLOA 1KKLA 3BA6A 3VZCA 7MHTA 3L4BA 1HG1A 5FUWA 1O0BA 3BKWA 3NUZA 3ZWVA 1T2DA 5DKFA 1I2MA 4BCCA 3V42A 4OF4A 2FSSA 1D09A 3DO6A 4E3ZA 1K9SA 4L9RA 3K20A 4LQDA 5DHFA 3DLTA 3E3OA 3TLGA 3V3TA 1TJ3A 5EN4A 3KSUA 3IIIA 3NXSA 1VG0B 5ENDA 2EFDB 1LTHR 3AIIA 3TN7A 2ZYVX 3HEMA 2PA0A 4HAOA 3OOHA 3DE7X 1N36B 1XBTA 1L9KA 4JVLA 2V58A 3EK2A 3IE1A 1Y6QA 2XX3A 3C3MA 2WJ6A 3IIMA 2VT3A 3OUTA 4A8PA 2UV8A 4HO1X 4PAMA 3ROQA 5EMMA 3RV4A 3U7FB 4NAUA 4CM9A 2AN4A 4LTMA 3FVTA 4Q9IA 4QGSA 4JS0A 2ZRMA 4DJFC 2BDUA 1VBMA 2FEWB 2P65A 4NX2A 1JAYA 2BUCA 5E4FA 2WWXA 1M66A 5KOYA 5EXDA 1U81A 3GRUA 3Q0TA 3SR0A 2HPAA 3U37A 3M5CA 2QSUA 2Y99A 3PGKA 3OWOA 4V03A 1ODKA 3ICPA 5FCDA 3IP7A 4MGZR 4U63A 5DN6A 2XJ4A 2JIZA 3ZS8A 1B1CA 4IGKA 4KYVA 1R15A 1Z9BA 4KXQA 1GPLA 3NQ41 2AFIB 5J47A 3JQAB 1JR3A 5LA6B 1CR4A 1E7MA 1MV5A 2P9YA 3EPPA 4OJMX 5KQMA 1N2XA 1Z0JA 1H93A 1XMJA 3DMFA 3RJZA 3IQXA 3QXCA 4YAOA 1QF9A 4JV5B 3QG1A 3NHMA 4M0FA 3S68A 5BN4A 5EUCA 4I8DA 3MRVA 1SQGA 3KB6A 4RJJA 5EJ6A 3NDIA 5T6BA 5DI3A 3A4TA 1VYHA 3G2MA 3OFNA 2BZGA 4COKA 4YRKA 1PJSA 3OUUA 3V8EA 2LVBA 3H8VA 4HTFB 2JFGA 1GFWA 1LRKA 2OA0A 3T34A 5BVGA 5IJ0B 1PTJA 5KDOA 1D2GA 4LGYA 2CDCA 1RRPA 2PRKA 1J00A 2B99A 4QDJA 3KT3A 3W8NA 1W1UA 2ZWAA 3SJZA 1ORWA 5ALNA 1DXYA 3OBIA 4PGAA 4IMPA 4UUNA 4BV2A 4CLOB 2H48A 3D59A 2PAAA 2DP4E 5FYDA 5L53A 2IKSA 4IQ0A 3AHJA 1ITZA 1BSVA 1EB9A 1OD6A 4NS1A 1DIOB 1PZEA 3UO8B 4MITA 4ACBA 1R8YA 1XZQA 2RBGA 3I45A 1QIJA 1CHDA 2XF8A 3N0TA 4OI2A 4W8GA 4EHBA 1FFDA 1N7IA 3GYBA 821PA 1GADO 4OTZA 2OLKA 1BYIA 1KI6A 1PGJA 3MWJA 1F38A 4MMZB 2X23A 4I99A 3Q0IA 2PMDA 1DKQA 1DEXA 3ZXUB 3H0EA 2GVZC 1KEVA 1VXRA 3EXHA 4U6QA 1WHSA 3RYFB 4DLUA 2CHUA 3EZ9A 1HEUA 1ONOA 2VWHA 4XJXA 1UAGA 2MMGA 5AXAA 3HN7A 5JD4A 3UBMA 3IERA 4HNUA 2ZATA 1D6MA 3HUFA 1JIXA 4R7GA 2ZR7A 1IOVA 1D4FA 5T57A 3OZCA 2VSQA 4DJAA 3L0PA 2QZJA 2ZUFA 1YIDA 1P5FA 2ZIGA 3DV0A 4M83A 4WZAE 2GVNA 1IBCA 5DSTA 3AR9A 2DB3A 4CIBA 4Y7DA 1A8SA 1SBHA 3EJ6A 4CMGA 1TEZA 1S2LA 2BSAA 3LW7A 3PA8A 4G2NA 4CKWA 5DJ5A 4LYGA 1Z06A 1QP8A 2EGGA 3EUAA 3LECA 1CUYA 1Q7RA 2OAEA 5EJIA 1FFGA 2I6QA 4PZYA 1NUHA 2QW8A 4S1OA 4MAMA 1LD3A 3I0ZA 1JKJA 1JUDA 2AW3A 1P7ZA 5GWXA 5AK3A 3IUNA 3T1QA 4IG4A 1I94B 5CJ2A 5K0GA 4L3OA 1QANA 3SG0A 3C97A 2YMMA 3HA3A 4UUQA 5EERA 1EDDA 1TECE 1UKVY 1GT91 4HZUA 2NXWA 3F73A 5EJ2A 3CVOA 1XRSB 3JWIA 5IDYA 5HTOA 1XTKA 3LSYA 1PJZA 3BWMA 3T1YB 1N6RA 1NBWB 1WDTA 1C9JA 4U39A 4B09A 1JXAA 4WKOA 1C7JA 2BF7A 3UJPA 2EFCB 2JCYA 4V02A 1H2WA 1WXFA 1ZNWA 2OV2A 4Y1GA 2E7ZA 3WL7A 5H70A 4PVDA 3ROPA 3UFXB 4DG8A 1QLJA 4XWKA 3A2KA 1E58A 2WP8J 4UM5A 4DMMA 1E2PA 1O6GA 2B20A 5ECWA 5BNIA 5A2QA 1NY5A 4GD3Q 4C04A 2R97A 3RRNA 1Q15A 3C3XA 3SZRA 1L4HA 1THMA 3ETLA 4NFLA 4ZI2A 4ABTA 5JCPA 2CFTA 4FFRA 2QAGC 5IKXA 3IT0A 1UPTA 2GBCA 1SUAA 2VF7A 1RP7A 4MUGA 5HDQA 3C98A 1LDYA 1JXQA 3HZZA 2BGJA 3Q6MA 2AWNA 4ZKDA 3HCCA 1YR6A 2I2XB 3AB8A 4YJ2B 1O3YA 1ZCJA 3H0KA 1IHDA 1V8PA 5ER9A 2FWJA 3GZJA 2XUQA 3SJAA 1TCAA 2HRQA 5LPNA 4TS9A 1FUEA 1SIBE 2AOVA 1RAEA 2VPXA 4C20A 4YASA 1L4BA 2JCSA 1QP7A 4CUZA 3MWGA 1YK0A 3KCNA 2QOEA 2YNMA 3KVNA 5DX0A 1G17A 5AVUA 2I8CA 5EUQB 3FW1A 4XQGA 1G1AA 2HW8A 4CQLB 4Z49A 4NECA 3CURA 3M89A 3OIYA 4BAUA 2QTTA 4IO1A 4NBSA 5AK0A 2CJWB 4UE3S 3OCVA 2I65A 1LX6A 3WK6A 4EBBA 1GGJA 3NYIA 1XGKA 3RSOA 1P17A 1LLDA 3TVDA 2G1UA 3ZBTA 4WN9B 4F5YA 3F9RA 2BD0A 2DBVO 5J2UA 3PXEA 4AZ0B 3WDMA 4PPGA 4RKWA 4ADSG 1I3CA 1L5NA 1DO8A 5LWHA 1OKKD 2TMGA 1FDOA 1JSXA 2C3PA 5L3ZA 3U4IA 3SZGA 1TO6A 3VGPA 4GI5A 3F6SA 4PEVA 1M34E 2QRVA 2AL7A 3DS8A 2A14A 4KB5A 5KVAA 3HFJA 2R65A 4XDYA 5HFAA 2XAAA 3MTQA 1TQDA 4PXAA 4WXMA 2LTAA 3OCWA 5ECDA 2D0PB 2VZ0A 1Y3HA 5AK4A 3VSDA 2ZW9A 1BWRA 4PSDA 1Y3CE 4AS3A 3GLIA 1T3GA 4GP7A 3PT9A 1J56A 2R79A 2CNWA 1Q1QA 2YS7A 3PYMA 4B3HA 2QLNA 2AX3A 2RKBA 3PEEA 3SDSA 5CFMA 2J6BA 3NHPA 3IP1A 3KKZA 4H0CA 1VSBA 3DLPX 3FF4A 1J99A 1NAIA 1KEPA 5GONF 5BQPA 4OXNA 3I04M 4B6RA 3FX2A 1A8UA 1VCMA 2WP0A 4E21A 5EE1A 5A4FS 1P44A 2NAPA 4XGIA 3UT6A 4URYR 1Q19A 4IUBS 3H65A 4MULA 4EY5A 2CHVA 3P0JA 3TCXB 1TVMA 1W88A 2WM9B 1NIJA 2EX0A 3QI7A 4OV6B 2X9NA 4D0RA 4C6SA 3FYCA 2Q4BA 3PWKA 4W5JA 2R7KA 3OY7A 1T4CA 1DRVA 3E05A 4X41A 1N4AA 2CUTA 2VHYA 4MGIR 1NAHA 2ZJ1A 3ETGA 2F59A 3R2JA 4KWCA 4WT7A 9LDTA 2BOVA 3WLRA 1SXJE 3AY6A 3CZRA 1J90A 3DMGA 3OVMA 4HUJA 5IZCA 3MWKA 4Y2JA 5IDVA 3KETA 3CVXA 1F06A 2O3QA 1A8QA 1VL6A 1B8UA 3DVAB 3V1UA 4E5MA 2I87A 4Z4CA 4S24A 4BC0A 3MHTA 2PX0A 2VUUA 3TE6A 3VU9A 4KLZA 5FPHA 1QGED 4HUQA 2IFTA 2Q6TA 2BZ0A 1HRDA 1ESEA 2OR3A 2XGMA 3HVHA 4Q4JB 2X0DA 3I4LA 3TGLA 2VT2A 5HK8A 1Y63A 2I1LA 2GKSA 1SG9A 4MINA 3B5JA 5DV9A 3ROKA 5JS6A 1MVOA 1GFZA 1KO1A 1YBVA 3E9CA 1UMDB 1V9LA 3GBSA 3T3DA 3VSCA 3W34A 2JRCA 5AK5A 5JYBA 3IXQA 2P8JA 5JWHA 1MAAA 4MWEA 3W2TA 4EAQA 1JA1A 3ZHBA 1JVSA 2O1XA 5TPZA 3LCJA 3A9RA 1I2ZA 3NNSA 2HIGA 3I9V1 4FQ5A 5TQJA 2MCFA 1Q0UA 3GLGE 2XVMA 2QRUA 3Q85A 4TYMA 1SCUA 5BSMA 1TFRA 2OLEA 2AMYA 3E0QA 4J0QA 4ZOEA 2YWJA 3PFHA 2RSLA 4N3NA 3E81A 3R9IA 1ZD9A 5NLLA 2PZJA 4JKIA 4ZAWA 4KL8S 4M0MA 4G26A 1JQDA 5ARBA 4EL0A 5KNBD 4DREA 1HMPA 2HHCA 2OG2A 4L4ZA 4AY5A 5JXJA 4LRQA 5FUVA 2QP9X 3RKRA 3O7MA 3N6RA 3WV4A 1WUJS 4B8WA 1EAMA 2OHGA 4QRHA 2JNWA 3F5QA 2CXHA 4KDEA 4NRDA 1P2DA 3L84A 3ML1A 1Z5UA 3OIVA 1MRSA 2POCA 3INGA 4J49A 4OHBA 4WE3A 8OHMA 3W3AA 5JVDF 5G4LA 1NI4A 2R1VB 1DIBA 3NEYA 3WI7A 3DAOA 3CPSA 1PDOA 2AG8A 1PF7E 2P1RA 2WIGA 2PO5A 3QM1A 2O2DA 1W5SA 4Y8VA 3R3ZA 3CF0A 4RETA 3UJ3X 4HDCA 4FHFA 4JI7B 4YUWA 2WQ6A 3MYYA 3ZZTA 4EECA 5BV8A 1QP0A 2IOFK 5HKLA 3QV1A 1ZD4A 4CIXA 4NS4A 3MAGA 5CHYA 4BMNA 3ZI4A 4KVFA 1C41A 4PX5A 4WVLA 3VPGA 4M1WA 1VG1A 2JI4A 3NHRA 5JDCA 2HSEA 4RY9A 4ZOLA 3K2EA 4LKRA 4BVHA 3ITEA 4D4HA 1U3VA 4PLPA 1ZK2A 1TM1E 2PZMA 3RU2A 1IK6A 2PGJA 1RM5A 4MMXB 5AFSA 4PM4A 1CD5A 4PHTA 1A97A 3PYXA 3QTLA 1XTTA 1FVHA 3WLNA 1WMSA 1CUWA 2HTEA 4JYBA 4O2BB 1AKWA 4DF3A 3MJCA 2BHRA 1QYDA 3L8YA 1U8CB 2CXXA 2ZE7A 3M9LA 4U7PB 5EMLA 4YBRA 3ANXA 5BUZA 1R8XA 2Z6QA 4BGVA 4UBIA 5EMHA 3W9BA 1D1TA 2GPWA 1JYEA 3D0RA