4P82A

Structure of pyrr protein from bacillus subtilis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
b'SNQKAVILDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGNPVTVGEIDITLYRDDLSKKTSNDEPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKNIPTSKSEKVMVQLDEVDQNDLVAIYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein PyrR
molecule tags Unknown function
source organism Bacillus subtilis
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
total genus 53
structure length 180
sequence length 180
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2014-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p82A00
4FYMA 1P18A 2C4KA 2FXVA 1A98A 1I0LA 3O7MA 1VSTA 3LPNA 4WMLA 1O57A 4S2UA 4X45A 1ECCA 1OPRA 1QK4A 1UFRA 1W30A 2H07A 5KAPA 2WNSA 3N2LA 1O5OA 1YFZA 4LYYA 2GEBA 2IGBA 1QB7A 1GPH1 3QW4B 1DKUA 1VDMA 4M0KA 3GEPA 4LYGA 3S5JA 5ESXA 1A97A 4ZFNA 4PAWA 1QK5A 1XTUA 1CJBA 1HMPA 4P3KA 3EFHA 1ZN7A 1P17A 3G6WA 3OHPA 1OREA 4RHUA 4RV4A 2PRYA 4PFQA 5IPFA 4M0PA 5BRNA 5KAMA 1FSGA 1TC1A 1WD5A 3M3HA 5HKLA 4P83A 1ECFA 1I14A 3GGCA 1A96A 1I13A 4P84A 1STOA 2H06A 1QK3A 5ESWA 4Z1OA 2H08A 2JKZA 4F8EA 4RHTA 5IAOA 4P80A 1MZVA 1ECBA 4RHYA 1PZMA 1UPUA 2AEEA 1DQNA 1G9TA 1IBSA 3ACCA 4QYIB 1TC2A 4OHCA 1A4XA 1HGXA 2HCRA 1P19A 4RAOA 2E55A 5JSQA 4RQAA 4RQBA 1NULA 1QCCA 1DKRA 1L1QA 4P86A 5EUCA 1UPFA 1I0IA 1ECJA 5K51A 4LZOA 2EHJA 2PS1A 3GGJA 4KN6A 1NONA 3ACBA 4MB6A 1G2PA 1A95A 5HIAA 3LRTA 2DY0A 4QRIA 1XZ8A 3MJDA 4JITA 5BSKA 1P4AA 1ZN8A 1U9YA 2JI4A 4RANA 3H83A 1V9SA 4JLSA 5JV5A 1DQPA 1QB8A 3NAGA 1J7JA 1L1RA 1A3CA 1AO0A 4X44A 1JLSA 4RHXA 2YZKA 3DEZA 1QCDA 1ECGA 1ZN9A 4RACA 1OROA 4P82A 1Z7GA 3MBIA 4LZNA 1VCHA 1I5EA 2PRZA 3HVUA 1D6NA 1R3UA 1DBRA 1BZYA 1Y0BA 1XTTA 1XZNA 4WN3A 4QYIA 1JLRA 2XBUA 4M0UA 5BQPA 4RABA 2JBHA 3DMPA 4TWBA 3OZGA 1XTVA 4RADA 4P81A 2VFAA 3ACDA 3KB8A 2JKYA 3OZFA 1G2QA 1LH0A 2P1ZA 4IJQA 4RAQA 1BD3A 4LZAA 5BQOA 1BD4A 1GRVA 3DAHA 1G9SA 1U9ZA 5E38A
chains in the Genus database with same CATH superfamily
1R8XA 1UJ2A 1YJBA 3GRRA 2JFGA 1Z0KA 3VM6A 1CZKA 4DMMA 4Q16A 4EJSA 1VCMA 4DXAA 1IZYA 3L07A 4ZHQA 1FA9A 2EZTA 1P2GA 3HBMA 1SXPA 5EUBA 3R5KA 4GPAA 5KAPA 3VYUB 1YBFA 4KO2S 3DAYA 3ZTWA 3A26A 5FWNA 4ZYYA 4IEIA 4LXTA 4C0JA 2C9YA 4BCCA 3NUZA 1N5IA 3QU9A 4FE3A 2P40A 4BKQA 1HL3A 3K9WA 3L41A 4L7VA 1P91A 3ZS9A 1W94A 5K6RA 1X0XA 3GIWA 3W2FA 1JMKC 4KKXB 4OV6B 3EFHA 1U0BB 5CT5A 3JQGB 3IR6A 3D1VA 3PWKA 3GN2A 1NXQA 2QQFA 4JBNA 4LEIA 1J6UA 5EZYF 3RLIA 3QRWA 1XEAA 4URZR 3RE1A 1ORVA 3AC0A 4LX0A 3TDNA 3D5QA 2NO0A 2J32A 4D8WA 1M10A 3BDAA 4R6WA 4OQDA 4QELA 4ZVTA 3OPVA 2N3ZA 4ESVA 5DPMA 3GD5A 4ZXPA 4FI3C 5AVKA 3DE5X 3RS0A 3CE9A 3D8RA 4OFWA 2NZWA 4PYNA 4AF7A 3TEMA 1K4MA 3BC1A 5LMUB 3QE9Y 2FOLA 2VHVA 3IMCA 5C5DA 2VP4A 5F5XA 4QBKA 1VLLA 3AF0A 4KQ1A 4HAWA 2Q28A 2XTJA 1JYFA 2ZUCA 4I1YA 2F9FA 3BMQB 1RT9A 1X1SA 4OAPA 3UK7A 3VMMA 4ANFA 2CN1A 2VRCA 4KP7A 3CN7A 1P60A 3PKZA 2AXNA 4MCHA 4DSOA 4ENVA 2RKWA 2PL9A 1DQSA 1Q91A 4C89A 1ISFA 2OUIA 2ZYTX 3Q12A 3HJUA 3NOVA 1TW3A 2WE8A 2JDID 1WP4A 1DKPA 4HVTA 4EW3A 1XQ6A 2DG2A 3FWYA 5CLGA 5H68A 3GJTA 1NTOA 4G5OA 4C6HA 1QIGA 3UK2A 2WE7A 4DT1A 3EDOA 5C4MA 4FFMA 2EJCA 4FFBA 4MRPA 2DE0X 3SR3A 3V8EA 3H5VA 3HVHA 4AZVA 4H1WA 5I7SA 4Q9HA 1M6NA 5HFJA 4RY0A 2Y1CA 3L49A 4G5FA 4IIEA 2AMYA 1J49A 1JILA 4CEHB 5F98A 4XDYA 3HKCA 2YR0A 3FUVA 5LOVB 4IZIA 3KWJA 1P6XA 2XIQA 3QOWA 4H31A 4WXPA 4FK8A 1UK7A 2ON6A 4EFKA 1EGHA 4BDTA 3O7WA 1XZMA 4DYHA 2QU8A 4G5RA 2BTEA 4QQKA 2GZ2A 3OQBA 4I14A 3BCRA 1YBHA 2YJ3A 2QTVB 3IFSA 1RFGE 1RWMA 3KS9A 4JWKA 1Q7CA 2W6OA 4LV5B 5AVYA 5H8WA 1W75A 4EL0A 2RBGA 5DNCA 1Y6JA 3ENKA 3VYSB 2IPOA 1KMIY 4UCQA 3IH5A 2K2QB 3BTVA 1WSWA 3KJXA 4L3VA 4TOIA 2AFIE 5IFKA 1ZGGA 3G2HA 1KIMA 3FCSB 3KUUA 1WV0A 2VAXA 5G53C 2A9JA 4XQEA 5A62A 2IHTA 1O0BA 4WLFA 4EUKA 1G60A 1PG2A 3BFKA 1A82A 3PJFA 1U80A 2OD9A 5F3WB 2GJ9A 1ZXXA 1H2YA 3GLFB 2B36A 4CEJA 3NONA 4U7FA 2I8AA 3USZA 3ZWBA 1Y7LA 4HGNA 13PKA 1JJIA 4WWHA 4UEQA 2I9KA 1IG0A 3CLTD 3GXOA 3K0CC 1UXGA 1YB6A 4FXPA 1FZTA 2VRBA 4IWNA 3D8NA 2ZS8A 4OF4A 4Q4HB 3EGIA 2OXRA 1ZINA 2FH5B 2FZWA 2AE1A 2RHBA 4UU8A 1IFXA 4AICA 3C5EA 1BW9B 3RFCA 1GP2A 2Q2QA 4D4GA 3AZQA 3DWEX 2QSJA 5GOZA 4PAWA 4ZDKA 3EGOA 3G88A 2XMQA 3V8NA 2QY6A 5CIYA 3OHPA 1OREA 2I2CA 4HJRA 3MPOA 3DM5A 2CSXA 5BMVA 1M5RA 2QM8A 4LAFA 1M2VB 4RK5A 2D5BA 3VSCA 3H9BA 3A6JA 3AOEA 3IIJA 4S1VA 2IY8A 4LC1A 2WVGA 3AUUA 5ALNA 2HNAA 1T6ZA 1HE1C 4S1WA 1HETA 1DG3A 1L4BA 2E9SA 4FYKA 3MCVA 3DOUA 5AVOA 1X7HA 1RSZA 1CTQA 4KE7A 3R2JA 4F12A 1FC0A 5DIFA 1E32A 3ND8A 2CDCA 3NETA 3ZLVA 2J08A 3A6ZA 4IOKA 3R7AA 2DWPA 1Z12A 3WC4A 3EIOA 2Y27A 1TAQA 4IGFA 1U7WA 3BL6A 2YV3A 1HBJA 1ZUNB 2YBEA 4ZEMA 3TECE 4H0NA 3QMMA 5JPIA 1WR8A 3NXSA 3SEZA 2AG5A 3WMGA 3L0PA 4TKMA 3I2HA 2JGFA 1A8UA 5CNJA 3CNLA 1A9RA 1M34B 3IA7A 3PQ2A 5CBPA 3PR2B 3A4LA 4YH1A 4FC7A 1EUZA 2XWBF 5A05A 1SG9A 2VP0A 3WK8A 1CRQA 1E2MA 1T3HA 4FINA 3IMEA 7REQA 2XZPA 3BH6A 4A8PA 1JDNA 4QBFA 4DL9A 1JHMA 2O07A 1ZL0A 4HWKA 2VF5X 3IP8A 4KCGA 4BMNA 5JAPA 3QX3A 5FQNA 1WSBA 3KWFA 2IOQA 3MFQA 3DS8A 3RSFA 2C4NA 3VJLA 3DOOA 2NQTA 1R5BA 2IPXA 1D6SA 1LBTA 2QQ0A 4KAAA 4YRCA 5DBFA 5LL6P 1LI7A 5HCUA 4LJRA 5ALIA 5CNIA 3TR0A 3TTVA 3EVCA 2DLDA 3ZLTA 1QQBA 3VXKA 4MCJA 4OHYA 3IT1A 4NENA 4QUAA 1RI2A 3PHBE 2KWIA 4GVXA 4LZPA 4UAUA 4FYXA 4B4VA 5IDVA 4EO7A 3VPXA 6GPBA 4US1R 3ZBPA 1XSEA 1D2AA 3S27A 2FHPA 4ZEVA 1VCNA 3HRKA 3VR4D 1V3UA 3UV7A 3I1IA 2BI7A 3D3QA 3TW8A 3G2PA 1KRXA 3GZJA 4M0LA 1DO0A 4Y7CA 1XKQA 1E0KA 2EBWA 1P4SA 3LOUA 2IYNA 1X1EA 2Y4OA 3NV7A 4BO5A 2GWRA 2F1HA 3GN1A 1KO1A 1P9OA 3N3AC 2PJRA 2IRWA 3R6LA 2R9VA 1J90A 1I30A 1T9AA 3O6VA 3PJGA 3AP1A 1XBTA 3PIDA 1L5NA 2XDWA 4D46A 1MUUA 1M8GA 3CNBA 3KQSA 3VR5H 4JQCA 3QNWA 4A2QA 4RD1A 2RB5A 4BB6A 3H87A 1WBDA 2YV4A 1ZNZA 3DNMA 3B3JA 3E7DA 3QF4A 4MQBA 1TZJA 3CZAA 5HGJA 4B3BA 4S2EA 2ZUFA 4NSNA 5IH7A 3O1JC 4BFXA 3BL5A 1GPKA 3HA3A 1F6BA 3B12A 3PQ8A 1UFKA 2BKAA 3VFDA 2R84A 1A5BB 5FTKA 4C1NA 4CE6A 4B2LA 4RPLA 5JRJA 4YCAA 4EX6A 3EVGA 4MIKA 1W49A 2EFYA 4UTOA 2JHFA 2GBGA 3QXHA 4Q34A 5C1PA 1YHYA 2EG5A 3JWPA 3JQAB 3P9NA 2GF0A 1V37A 2XTAA 5FADA 1LUAA 4FNOA 1CSEE 1RP1A 5LQMA 1G2IA 1H0KA 1QG2A 2H9IA 2M1XA 4WLNA 4UDYX 1V3QE 1L7RA 1WXWA 3JYNA 2AOUB 2RMKA 2X9QA 4NPAA 2JLSA 2YUTA 1L7OA 4MRAA 2R2GA 3DUFA 3ILYA 4WLUA 1X14A 4CCAA 4JEHA 4E5YA 1Z5GA 2FPPB 1HLGA 4JEMA 2CUNA 1VIMA 1HG1A 1VHJA 1H22A 3FKQA 3LM8A 3AEKA 1SC3A 4KW7A 4OQPA 1QONA 2YXBA 5DLYA 1Z0SA 2XUJA 5GZ1A 3W5CA 1DKNA 1ZOPA 1PLKA 2Q9UA 5JS7A 1TMGE 4A5SA 1MN6A 3WMEA 5I8WA 1XRPA 1HQCA 2WFAA 3KQMA 1FRVA 1NW7A 1PT9A 3KHKA 4QDOA 2K7FA 2C58A 4C7MA 1G8FA 4DV1B 1NU6A 1C9DB 2VPWA 1S96A 4NYIQ 1GKKA 3KE8A 4P34A 4LY6A 4TLEA 4A2CA 1XMQB 2XJ4A 2H2GA 4LDZA 5DOVA 2IOYA 4NBSA 1JIJA 4MP8A 4B6JA 4TLMB 1T1JA 4KDCA 2IK8A 1MVLA 1DQPA 1XVUA 3NAQA 3T41A 1ZR2A 4AIRA 5D84A 4AW9A 1BHQ1 4GSLA 4BX9A 2CMHA 1CF2O 5LYJF 2P3SA 3CNNA 4GOLD 3RRBA 5EHGA 2A9OA 1BYIA 3Q4GA 3ZVRA 3OTOB 3IP7A 2H63A 1NBHA 3IAM6 3K5PA 3OUZA 4I1OA 4ALNA 4LY9A 5K3OA 1QE5A 1A9XA 1G8PA 5FNZA 2I6GA 4NAHA 3A1SA 4R1OA 2DHQA 4HZIA 1EP1B 1G5QA 5DX0A 1L4LA 2XADA 2FV8A 1QQTA 3HB4X 1T0IA 3RIMA 2JGNA 5JUWA 3ITEA 3C2QA 4D41A 1FQKA 2IEZA 1O95A 1A7JA 2QW0X 4BUJA 3RYIB 3QE2A 1IHYA 1NRJB 4YRLA 3TLCA 2X8JB 4FOPA 3RYFB 4B35A 5KJFA 1EVEA 1JHPA 3DTNA 4A15A 1J2EA 2LZ0A 3OQOA 2Q4BA 2XNSA 5HOEA 3FLAA 6REQA 1SQGA 3KJFA 5E8JA 3ND6A 2HIGA 4O2LA 4X20A 1K6IA 2NYRA 4XDHA 1N92A 3VVBA 2EKBA 5DN9A 3VZSA 2GCOA 9GPBA 3JZFA 2WUDA 4EQ6B 5ITSA 3AIMA 1P4HA 1PYOA 3CKYA 2C7RA 1K3FA 1Y5NA 3O7MA 1XCGB 3K3PA 4R01A 1QKIA 3EA0A 4ZDWA 2TMKA 4IXMA 4LTDA 4IFEA 3HY4A 4D8XA 1UMCA 3X2FA 4EKGA 2RAUA 2JA1A 4IDOA 2C5GA 1TT7A 4MQFA 2XCSB 1EB8A 3W34A 1EFRD 4R1QA 1JYEA 4ZOLB 5HUHA 1AVTA 1JHZA 3W3AH 1W5TA 5JXIA 1E9DA 3GMDA 1HR0B 1PJQA 4BGUA 1N2CB 2GD6A 2C2KA 3AW9A 3U0VA 1PNTA 1XD8A 3KYJB 4K6OA 1W36D 1GAQA 1TX4B 2IIVA 2HXSA 3ADPA 2PCLA 1N3BA 3I9JA 3OLWA 4M0KA 4YFYA 3GLGE 2IL1A 3ROPA 3EIQA 5DBOA 2A8YA 2P3LA 4TYNA 5J40A 4ZOCA 3B1JA 3EDMA 2AGVA 2KBEA 1S4QA 5DM60 3N3BC 4RZ2A 4ZDJA 3AJ9A 1XZPA 1RD4A 5LFAA 3EQ9A 4QEDA 4O3FA 2QUJA 3ZD6A 3FNFA 3T0FA 4MW6A 5CT6A 1M2NA 3WLSA 1TTHA 1KGDA 4DDVA 3BJRA 2PZEA 4E2YA 3SE0A 3L7NA 4ZEWA 1N6LA 1YGPA 1ZJ5A 1YDGA 4LHSA 2RBKA 1KSHA 4NATA 1EVLA 3ZD8A 2Y0EA 3EZNA 1KI2A 4Q66C 1JDBB 3KETA 1NLUA 2I29A 2MSWA 2XYHA 4X1KB 2OFFA 4YR9A 2ZI9A 2BM8A 3IVMA 5K0GA 4Y3UA 4CI9A 1JXAA 5EUMA 1TZKA 2BFMA 3SS8A 4C3ZA 5B5SA 5D85A 2GF9A 1FYVA 2QAJA 3F7NA 1W4ZA 3OJCA 2QP3A 3TL3A 3DVLA 2P9FA 1P7PA 3DMRA 2NIPA 1B2RA 2YMLA 4QOFA 3GNTA 1XZFA 4G9GA 4MB6A 1NONA 3O8OB 1WUKS 5DW3A 1I4LD 1TM4E 3BSFA 4JITA 5T57A 2WMYA 4NLLA 2FR8A 2B4RO 4XGQA 1PGOA 3DW3X 1ZN8A 2MSEB 4W9NC 3ZBQA 3ZJUA 2AYYA 3E3MA 4L4SA 3V46A 1EDEA 2JI8A 3L05A 1V45E 2D4HA 4BRUA 4NWIA 4ICIA 4F45A 2V3CC 1CEYA 1PF7E 1LLCA 2PKQO 1KWKA 3H2IA 2J5BA 4RESA 1A1VA 3Q11A 1IHXA 1UUFA 3CRMA 3WS7A 5HDQA 2ZW9A 3E27A 4ZAFA 4B3DA 1MMFB 2RCNA 4DTCA 1ZA2A 3ENWA 1CP3A 1FUUA 2V54A 2Z5VA 1GR1A 2YH2A 3I37X 3LQFA 3W2EA 1J0XO 4HNHA 3ZHXA 2PZ8A 2FR1A 2MYPA 3IUNA 3CXUA 1CEQA 4MQEA 4UTRA 3N7AA 2G88A 4QYIA 4XR4A 1NNI1 1NLZA 1LNSA 2BZ0A 1H0SA 3H9UA 4GECA 4TLDA 3U44A 1NAIA 4Q1DA 2XXAB 3OQPA 1EE1A 4OGWA 4BNFA 2XY4A 1QLJA 2WSLA 3SFZA 1F4PA 4JXKA 1YRQA 1KI8A 1SXJA 3CPJB 4PYRA 4PNEA 4ZWNA 3V1NA 3ZU2A 3P7MA 4XQCA 5JWRA 4UAVA 1LH0A 4NY1A 3WIDA 2JFXA 4C7OB 3GF4A 1AXEA 2I7TA 4QQ8A 4DVJA 2HCTA 2NAFA 1DRWA 2I4MA 4HQNA 1W19A 5IJAA 4PTZA 2CCJA 5JS1A 1K89A 2YIMA 4HPXB 5EXTA 1YOVA 2BMVA 2OXEA 2XQFA 2GEDA 3QMPA 5C8YA 3W5SA 4OHVA 3I62A 3L6OO 4KXXA 5M5BA 4BX3A 5G4KB 4I3HA 2G06A 3GFQA 2CDAA 2E4YA 5FA5A 4AKIA 4H6XA 1G3QA 2OM6A 4FR5A 3UC5A 3USCS 3HU3A 3EK2A 2FWAA 2HX1A 2L69A 4LOJA 1QHSA 5LD2B 2EIXA 2JAOA 1FFDA 1DUSA 4YHBA 1U5BA 4HOYA 4FS8A 2WYIA 2WTEA 3DZJA 1XTUA 3JWEA 1Q83A 1RI4A 1ZWKA 2JD2A 3GBPA 4ETNA 1ZMRA 2W6ZA 2HNBA 1DBVO 2F2TA 3AWIA 3FFTA 3NIBA 4AVYA 4QGSA 4WV3A 3Q2IA 3EEFA 4CMCA 1TKRA 3KKKA 2G09A 2XOKD 2BJWA 2OVFA 1UKZA 3BMCA 1JU9A 3N05A 4FGZA 5E6UA 4EUSA 1WMFA 1HYEA 4L8VA 2XNHA 1Z8FA 4JJ4A 3NDPA 3UC9A 3KT0A 1SKQA 3PGLA 1KS2A 3L3BA 4GPZA 1KWGA 1T36A 5FOUA 3ENZA 1IUNA 3W5IA 3H97A 3NASA 3INYA 4TTIA 1J5PA 3SI7A 1GPDG 3GLHB 2WILA 3SXJA 4DY6A 1DAEA 1Y9DA 2QL9A 1YZUA 4NENB 3VYTB 5J47A 3K2IA 1K6MA 5AJTA 2HADA 5HOQA 2R8YA 3I0NA 1SZDA 2DR0A 2RGEA 3FTPA 1V96A 4N5MA 1BJKA 4ZCQA 4BNDA 1HX7A 5AVZA 1UPFA 5HZMA 3QFTA 1ZKMA 3H1GA 3NJ8A 1JIIA 5FFMA 3Q6IA 3K6JA 3GCWA 1NUTA 4MO2A 1D6MA 4AO7A 2PJZA 4XXHA 4XYEA 3CKKA 1E62A 3DYVA 3QLJA 5E4JA 3MMPA 4NI5A 4DNOA 4Z7QB 4GKVA 4Y9DA 1DXOA 5CDUA 1S3FA 4DLPA 2XUAA 3M6IA 5IVIA 4OHXA 1NQAO 2Y1LA 5GJBA 4G4SP 3QPVA 1BEZA 3M2TA 1MQ9A 1L5QA 4LMAA 1R8SA 4J0EA 1NW8A 3SSMA 4UVDA 6PFKA 2Y92A 4I1VA 4QX6A 5KOYA 1DJOA 1OI4A 1JQ5A 4X54A 1GA6A 3U17A 2WIAA 4MVJE 2OECA 2VAVA 2W2KB 2ZTLA 4HADA 1DUVG 1GZ5A 1L7DA 1A7AA 3QE3A 4XM1A 2DHEA 2IDJA 1N8NA 2ST1A 5FBRB 3VNQA 2WIJA 4A1OA 4AJ1A 2PRZA 3R40A 3D4NA 3MWKA 1JVSA 1D6NA 3UH0A 3OHSX 4LWPA 3WYDA 2AV6A 2P30A 3ZV5A 4C4AA 3FTEA 5ALEA 221PA 2QWXA 2TS1A 4JC4A 5HE8A 2W83A 1YONA 2PD4A 2VJQA 3WYCA 5TARA 3QPUA 3HR4A 3LS2A 4INOA 4C3VA 1HZZA 4D99A 1EUCA 5JY1A 2NU6B 3QBVA 4C03A 4JWTA 5AIAA 5A9TA 3JTMA 4FIZA 1GYRA 2ZETA 4XI9A 3AFHA 4JOBA 5DH9A 1BX3A 1JTVA 2LUOA 4RFSA 4YA6A 4EBFA 3UMBA 3IE0A 2XE8A 5A4KA 4MWEA 1V11A 4OBWA 4DZRA 1JPNA 1O95C 1JMYA 4Q9IA 1YU6A 4NCBA 4X41A 2FMXA 5K0SA 4LBZA 4Q4JB 1KMHB 3UW3A 2YWJA 5F51A 4HH0A 4BEBA 1XHFA 2JKVA 3GBSA 5JDIC 4QNNA 3VQTA 4L3WA 4MLPA 1ZI9A 1CR0A 1U65A 3ZDYB 2RE8A 1GUBA 1UBCA 1Y3AA 2AVNA 4PV7A 1PT8A 4FQ8A 2J9YB 2XDAA 4L9RA 3BHIA 4MP3A 1QGAA 2G9QA 3G02A 1E6EA 1DIOB 1GZ4A 2ZRFA 2YHIA 4PZ9A 3JRNA 3FUTA 2RGNC 4OGFA 4Y9TA 3KQWA 1HTWA 4YROA 5EJ6A 3OVMA 1HLDA 1N2CA 1T3ZA 2PANA 1GNTA 4YMSA 2B9EA 2PS0A 2WUEA 3ZYCA 3RTBA 1GTJ1 1H2BA 2CVFA 4GR4A 3NHRA 4LPSA 1V43A 3P9SA 3UAWA 1LPAB 1R9GA 1OGIA 3QSGA 1NZFA 4JELA 4NF2A 1KYTA 4ZARA 2WHXA 1DCTA 3FBWA 5EJEA 1JR3A 2YQ5A 4NRDA 3UWMA 3W90A 3IE2A 3EOAI 3E7PA 3OWXA 1X7YB 4MARA 1ECBA 1OC2A 3WMXA 4KFCA 1SHJA 2QR5A 3K2QA 4B76A 2AK2A 2JJMA 1A4XA 2QF7A 4NMMA 4Q9NA 2LRHA 2DWQA 1XRRA 4OU4A 1JG7A 5G0TA 5B30A 2PX3A 3HCOA 3AIKA 3MXOA 4MVXA 1KK0A 2M32A 4WCVA 5LXTF 3UAZA 4OHWA 3HB1A 1C30B 1C81A 4LYFA 4YCJA 1JW9B 4OQEA 2R1UA 3T0GA 2AX3A 4NFSA 1QPZA 4D9IA 2WTBA 3VZCA 1H69A 3EAQA 4DR3B 1YZTA 4D6YA 4DJFC 2APJA 4MEBA 2YFYA 3LX5A 4E2FA 4Z99A 3WGLA 2IDMA 2P8SA 5L51A 3HCBA 2HRZA 2QPOA 2FPLA 5BN4A 1ECLA 1WBJB 2H5EA 2V74B 2RHCA 4G1VA 2DY0A 2I66A 5B6JA 1RLOA 3GLHE 3OPYI 2X13A 4RZXA 4GI2A 1BFKA 4DR7B 1PR9A 3ASYA 2ORWA 5K0JA 3BULA 5WRFA 3KKZA 2X2FA 1ZRMA 1LXCA 2V5VA 1PJAA 3LO5A 1N4DA 2WU8A 5F3RA 3SX4A 3C7CB 4D82A 2YV5A 3AUTA 4L5IA 1QS0A 3PX7A 1V35A 5K3CA 1CQIA 2SNIE 3A6DA 4XJSA 2NVWA 1YXMA 2VZEA 3LD9A 3IT2A 3H75A 3G0CA 3VNVA 2F90A 4YBZA 4BP8A 2BM1A 3FRHA 1DTEA 1EK2A 1KVRA 1ZG3A 2P9QA 3QP9A 4HSEA 3BWMA 1XD2B 3M9XA 2UDPA 3F5SA 2JIMA 1SUAA 3KSDO 4NBVA 4WY2A 3WRVA 3CH7A 3P8ZA 3UCFA 3B9RA 1J56A 5KJCA 3C3AA 4X61A 2EOAA 1FDRA 2P7HA 4MINA 1KDYA 3TW8B 4EY8A 5B7QA 3DEFA 1MDBA 2OK7A 1MH1A 3CH6A 1IE3A 1K5HA 1WDKA 2WPDA 4G0XA 4XCQA 1OBHA 3WO0A 3X2EA 2XR1A 1Q20A 3Q87B 5IULC 4HX2A 5H16A 1AH2A 1SRRA 2JKYA 2XX3A 4IMRA 4C7VA 5KTOA 1KOJA 1G64A 3OJWA 1P45A 2WMOB 4QOJA 3WGNA 4X5OA 1BRMA 1Z5NA 3EQZA 1BQ3A 1G3IA 4NULA 3FXAA 3L7LA 1N25A 4KNVA 2BI8A 4GGMX 3BD9A 4TM8A 5KJEA 1PSWA 3C4VA 2NUTB 1V6CA 2YASA 3TSWA 2HAEA 3OZUA 5LZ9A 4BY9E 4IUYA 2RGBA 5KPJA 3U16A 2JFHA 1Z8NA 2PWBA 4HX5A 4H3HB 1UODA 3H8JA 3Q5DA 1C2YA 3QTTA 5T3YA 5KOHA 1R7RA 3QWAA 4JXXA 5JJ5A 3PRHA 3ICEA 3CH5A 4LZWA 3QH4A 4RA9A 4TKZA 3ZV7A 4TKVA 3GY0A 1VSQA 1HO3A 1CX9B 1GZSA 5KOHB 4UUPA 4M87A 3QE0A 3STVA 1RTKA 1U8XX 1NJ6A 3DLTA 1KMMA 3H5LA 3NKFA 2FI1A 2X58A 3B5IA 4JLOA 5GWXA 3HB5X 3AKEA 3C0KA 2ZWOA 3TTUA 2IP2A 1QGUB 1YZQA 4BJHB 4E3WA 1R1DA 3W9BA 4BJ1A 4MH0R 2BDTA 4EHKA 1JEEA 3GRZA 3IB3A 3O31A 3QITA 5AI8A 3MT7A 4C3OB 4I6GA 4ZANA 3EXG1 5BW6B 3DQQA 3JYLA 3K4PA 3RTCA 1YJCA 1ESMA 4K8OA 3GR6A 4C06A 4ESHA 1R0ZA 4X95A 1BROA 4CN9A 2UZ4A 2HT6A 1WDTA 1J5EB 3NHPA 2OCDA 1A9QA 4IV5A 4LOIA 1VE5A 3T0IA 3GP8A 3T1NA 1T4CB 4GC5A 4M7OA 3NDRA 2QRKA 2YHUA 4GM1A 3VKUA 3ADOA 2OUKA 4J7AA 5EP1A 4ES6A 4UEWA 2XPCA 3KUDA 4AYTA 4HNUA 5L3VA 1X7GA 4LRQA 4NE9A 4MR7B 3PHLA 4RH3A 1U7OA 5E9AA 3SEFA 5DHPA 3MD9A 1H8HA 1YJ8A 1LRLA 3KXLA 3BQ9A 3D6FA 4ZPJA 4JLJA 2XHZA 1NF3A 5K3BA 1FX0A 2QMHA 4LKOA 2V59A 3CLVA 1SVOA 4KVFA 5BW4A 1IWBB 5TEVA 3RB8A 3CEAA 1XTZA 5ENDA 3O8CA 4M86A 1XCMA 4PLVA 3T06B 1R6UA 1K8RA 1UH5A 4GMKA 4M1MA 4D80A 1VA5A 3A1CA 5IBRA 4EPTA 5CBKA 4EG0A 2W2PA 1HEUA 2IQIA 2G8LA 5DN6A 2QZSA 4PONA 2H2HA 2F3SA 5D87A 3VTAA 3PVCA 1RE0A 3VR1A 4DRXB 2Z6UA 1ENZA 3IELA 1EDBA 1P3DA 4FX2A 2HQ1A 4O4JF 5DLQC 5FR1A 5C1IA 2W2TA 1X42A 1V71A 4LY0A 4M76B 4N0PA 3SYTA 3ZI4A 5KQLA 4RVUA 2CFSA 3EY4A 2NUAA 3EXFA 3R1IA 2W9XA 2W8BA 1LWOA 2XQJA 4IKOA 4ZQBA 4F5EA 4LG1A 4CV2A 1VP9A 2V6FA 4KDEA 4U8GA 1NF8A 1SULA 2WAYA 3AEZA 3DV2A 1VHTA 5KYVA 1IOZA 2A5FA 1MENA 2J5XA 2GGSA 2QDXA 3OSZA 3OZDA 4N5IX 1WU7A 5NULA 2UYOA 2WJGA 2QN8A 3QU4A 4RVFA 5BQPA 5F12A 1NTRA 2BFEB 3WNVA 3CRW1 4RULA 2JBHA 3UWDA 2QL6A 5KQSA 3D9QX 3FHLA 4DV7B 3PQ7A 4HV4A 3WA6A 4OXYA 1L5YA 4LDQA 1Q22A 1YZLA 4D4JA 1PBNA 3LBFA 1WF3A 4H16A 3O92A 4GMDA 1TVMA 4HPJB 3RYCA 2F1JA 1CZUA 2YJ5A 4NYIR 3BPSA 2VSFA 3UT5B 4ZDIA 2AN1A 3BE4A 4L5YA 3FVQA 4HI0E 5AO9A 5AHWA 3FJOA 3HEMA 3UJ7A 2CNOA 4MS1B 1EXVA 4MV8A 2RJNA 1H8ED 2J7PA 1VGQA 5BPFA 4H27A 4QYWA 1G19A 3TNDA 2I3AA 1D4FA 1F8GA 1NSTA 3NRCA 4KFTA 1H93A 1U2GC 5DXJA 4D4LA 1YFZA 1YZYA 1AOXA 3SJZA 4OXIA 3F6YA 1TECE 3U62A 3WGVA 3IBFA 1PR4A 1Q0UA 1N2GA 2X6QA 1KEVA 1SBIA 4L27A 2CZCA 1P1IA 4MWBA 3W3AD 1N5MA 5BNZA 1KDVA 1RHUA 1NU8A 4L0DA 1HDEA 4XGIA 2RAFA 4KTVE 1IHOA 2Q4TA 1KZGB 4HDAA 1VI2A 1JZTA 1JPVA 1KHTA 1YV9A 3TGWA 2BFAA 2IYYA 5BVGB 4AYXA 3G6WA 1NX9A 4HDSA 4FI3F 4J03A 4HBGA 1V5FA 4R1SA 3AEXA 3ZWPA 2IYUA 1OXTA 3DG9A 2VYNA 1USUA 4EARA 1NDUA 1F9AA 3AFNA 3M8KA 1GY8A 4WINA 3TD2A 1QP0A 2WU1A 1ZM2A 4PICA 4YCCA 3AR5A 1KTVA 3DWIA 2CMDA 1UWVA 1JV2B 3EGVA 4QO7A 3FTFA 1RCTE 3DDWA 1GGJA 2C7VA 2SICE 4F91B 3H1PA 4N7RA 1ABFA 3V33A 1D2CA 3FMFA 4NU6A 5EXXA 4EVIA 3VJRA 3JD3A 1YE3A 3M3PA 5H3HA 1Z4KA 2QJTA 2X0NA 2P11A 5FPHA 2FCRA 4TTSA 4IHJA 3CO5A 3DNPA 4OA5A 5KQMA 5DXFA 1SKYB 5AH0A 5DEOA 4AKTA 3LIPA 1KEEB 4UMFA 5TPWA 2ZVDA 1SWVA 3SZGA 1IRXA 2V0NA 1Z25A 2EHDA 2QTHA 3L8FA 3ZUPA 2PX4A 3ZLBA 4HB0A 2JGAA 5COBA 4OP3A 3W5JA 5J43A 2YHBA 3ACBA 2V3WA 2GBLA 2AN4A 3ITNA 1K98A 3OFNA 4ISCA 5J2TA 4GPBA 1P4AA 3A4MA 3THXB 3WDSA 3DDUA 3WAJA 1X7WA 1P0QA 2PV0A 3IT3A 4MYDA 1VTKA 4DIEA 2ICAA 1XV5A 2FF7A 3FNIA 1ZK4A 3HMQA 2QVYX 3K1YA 4P58A 4F6LA 3W7AA 1ZBQA 3U4GA 2EP8A 1RLIA 1YRYE 1TCCA 3K8YA 1RDFA 1CB7A 4GX0A 4N3GA 3X0DA 1U9IC 3WOHA 2VAMA 4TQ9A 4ZOBA 7REQB 3KCNA 3WTCA 1JHDA 3MMZA 3O9VA 1GAXA 3ECAA 4KLCA 1WUTA 1Q2XA 3H2YA 3MW8A 3ONDA 3D4PA 4JT2A 4LZNA 4MUAA 2BONA 2ZSIA 4U9IS 2G08A 3K0AA 3PITA 4KL8S 1KVQA 3B7GA 4WZBE 4NMLA 2C31A 2PH7A 4ZRMA 3NM6B 3NS7A 3VKFA 1CIJA 1CUFA 4DQXA 1U31A 4RD2A 3WKEA 4CTJA 4YV1A 3AVPA 5B4TA 3HKEB 3O90A 4Y6PA 2VWGA 1XCJA 4Z0NA 1CG6A 1QYIA 3I23A 4RF3A 3H5OA 4EGAA 2BV3A 3GUHA 1G3RA 4R5MA 4PLYA 5F1OA 3DONA 3TYXA 5CDHA 5IDYA 1CQZA 1R3DA 3RSHA 1XXHE 3G9UA 4WZAE 1CUIA 2HDNB 3G13A 3UATA 3WGZA 5KS2A 4BMZA 2EARA 1Z4IA 3FNRA 4BGIA 4HN2A 2I8CA 4B5LA 3I5XA 3RC3A 2RKBA 1J42A 1GRVA 2WWFA 3OKCA 4IDGA 4Q1VA 4LGYA 5EFOA 5DM1A 5GQSA 4AFNA 2X7XA 4CFYA 1ZESA 4RO0A 3ST7A 4EHHA 3MF4A 4TT8A 3CJQA 1XMVA 1YZNA 2FJPA 4I0WB 4DIFA 1I7NA 4MJLA 3SQMA 3N28A 5LKAA 4IZOA 1XPJA 3OZBA 3VU0A 1HDRA 4AXBA 1QDEA 2XZOA 4O2RA 1L7BA 1DOZA 3D3EA 2HIHA 2IYEA 4GXQA 1CZNA 1QYDA 2XI4A 4RELA 1AS0A 1F8FA 2J59A 5TPZD 4YMVA 3NT4A 3DCYA 3PE6A 4HWRA 4I5IA 2JRLA 3JSXA 4J0IA 3CNHA 1SKUA 2WJ4A 2G9NA 2C57A 3UTCA 5IZ4A 4G23A 1VHQA 1NQVA 4ZOLF 5IT0A 2VBCA 1NM5A 1NFQA 4M88A 5SYMA 2IUSA 4DQKA 5KNBA 3T3OA 5DMHA 2VC2B 3UOAB 1G0NA 1JXMA 3X2SA 2AMJA 1HPLA 4CM4B 1P0CA 1EWRA 1P1CA 2PD3A 1E98A 4FYPA 1XNQB 1ACJA 2I4LA 4YP0A 1ADCA 1SHZA 3UY4A 4OHFA 3QPWA 4C5CA 4MLDA 1IOLA 4N3NA 2AXEA 1MB4A 2G5GX 3SXPA 4WH0A 4UMDA 4DIMA 1IY1A 2RGDA 2V1XA 1SBNE 4H1UA 2AOUA 2ENWA 1MRZA 2IHUA 1AX9A 1ORRA 1J9EA 1VJCA 3IAAA 3VAAA 5JECA 4PG4A 1MNAA 4XEUA 4HMPA 4QGFA 4CMKA 1ZJ6A 2GBPA 1KQGA 1G291 3I3OA 5A1JA 3W2HA 1I5RA 3HBLA 4R9SA 1E58A 4IEEA 5EPUA 2PRIA 4FKMA 5KQPA 3IRVA 4IO1A 4ZXFA 3VNSA 4BFLA 1JJ7A 2QRUA 1IY9A 2OO7A 4JJZA 2YDXA 1U04A 2DSNA 1GFZA 4GRAA 3NLLA 5AI9A 3OFVA 4GOND 3RABA 3J81k 3NPAA 3OX4A 2BKUA 1PEAA 2AA3A 3WBFA 3R3VA 2ZAMA 2ZBDA 3RUAA 5IJWA 3TQHA 2EQBA 2O8EB 1X87A 2D4AA 2DEUA 1NE2A 1RRFA 1MPTA 4U0JA 4BAZA 4HNVA 2OMKA 4LJ5A 1TO1E 1WPXA 2K6GA 3DCNA 3MLBA 4PSKA 3DH0A 3OJEA 4LVNA 1NR1A 1GG5A 1PWYE 3SYRA 5KVAA 1E9BA 5EMNA 2E6KA 2XLBA 2G04A 2YC2C 4UEOA 3GUUA 3KVNA 4ZAWA 3C3JA 1AKRA 4DE5A 5A6VA 3I6IA 3QK7A 4KYUA 1BCSA 4KRGA 2X8AA 1EAYA 4XX1A 4RV5A 2FUCA 3BERA 1A4UA 1ZN9A 3QX7A 5G1OA 9ATCA 2DBRA 3G0OA 1DRVA 3QGMA 4CCWA 3QI7A 4C20A 4A9AA 2PFKA 4EP1A 3OC0A 5JCOC 1UKCA 3SJAA 4UFPA 4LJ6A 2PH1A 4JYCA 1R8YA 2QX9A 3TW6A 2L82A 2FZLA 1VPDA 1C1DA 2PTHA 3THWA 3T7IA 2G40A 1CULC 1RR6A 5EKDA 1G5RA 4OCZA 3VZPA 4KWCA 4YS6A 3TLYA 2R85A 3QEOA 4RMIA 5JNWA 3ICVA 2O2SA 2J9XB 4DLAA 4KHPB 4TWBA 3ZNNA 5EE3A 4PZUA 4DABA 3AF2A 1DZIA 1XC7A 2I3DA 2HF2A 3RC7A 4EYKA 5IXYA 4D3YA 2ROQA 1XVTA 4CKEA 5CDSA 4R2WA 2ATXA 2RHGB 4G8CA 2ECQA 3M9LA 4Q12A 1PUXA 2WD9A 3VPFA 5FOSA 3GFVA 3C45A 3V7WA 4QA9A 4ZN6A 2DUNA 3BZBA 3V5NA 5HP4A 1YDWA 3TVTA 3LBAA 5FV7A 3CWCA 1GHTA 1XR3A 1JECA 3I34X 3RS9A 1S2DA 5BWNA 2RGNA 4U7WA 4ZEOA 3TIFA 3NTVA 2BEUB 2J7KA 2W43A 5A9RA 4DWOA 1TEZA 1ISIA 1NW3A 1UXKA 2P5UA 4RTOA 1QZ3A 3M4XA 5DWQA 5F1YA 2F1OA 2JVJA 2WV7A 4US0R 3UJCA 4CKBB 5CFNA 5EJ8A 2BEUA 4GBGA 3NGLA 1Q0QA 3ZCTA 4OPMA 4LXQA 1DCKA 4UBLA 1BTOA 4D9HA 4BGEA 1ZJYA 5EHZA 3EEIA 4R84A 4CUJA 1A77A 1OGYA 3CLSC 4R71A 2WUFA 2TMYA 4LOKA 1J2UA 2XXJA 1WUIS 2FMHA 2IU6A 2Z3WA 3BG5A 1JHOA 1N5JA 2H17A 1QPBA 1XYVA 1Y3BE 2Q8PA 3O3MB 5EZ6B 4EPYA 2WSYB 2WAAA 3ZWCA 4JXZA 1RYMA 4DM3A 1Y63A 3WGHA 4CVNA 4ER6A 4I1SA 5G1PA 5J1TB 3UGTA 4MDEA 2WJVA 3ABSB 2CHUA 1W88A 3OIUA 4BVJA 1X7XB 1E1RD 2DFKB 2B0CA 1KH1A 1LDMA 1N0WA 2FEPA 5KU7A 2IW1A 1G9TA 2BHLA 3A1UA 2ID8A 4ARAA 5BN3A 3CRQA 4D9KA 1R4AA 1WD7A 4X8LA 5H1YA 1TTTA 3ORFA 1UBOS 3UFXB 3E5HA 4TL7A 1A5TA 2AG0A 3B6ZA 3SR0A 2WRZA 1NX6A 3IO5A 3D6UA 2WWGA 3QA3E 3DTVA 4IM7A 1E7SA 2OCXA 2PX0A 1FUEA 4TKLA 4UJ3A 3WLPA 4MJ7A 2W58A 3KTOA 5GZ3A 1WHSA 3GJZA 2QD1A 4O0LA 1ZVKA 3W9UA 3EARA 1F12A 3FOWA 5G0UA 3WQQA 4CMJA 3L04A 4R8SA 3DWFA 2OYCA 4V38A 1P2DA 2A94A 5KTSA 5I5EA 1G3UA 1V4NA 3S99A 4RANA 1XRNA 2A9QA 5FCDA 1CJMA 3ABQB 1Z6ZA 1JR3E 4NMWA 2VTBB 2CXXA 5TJHA 2O1EA 3IESA 1D3AA 3FYHA 3K5HA 3AF3A 3NHWA 4WZBA 5I7UA 4ZCSA 1B16A 1YRBA 4PQRA 2XYPA 2FFAA 3GZ4A 1QC5B 1XK6A 4JL5A 2ZB8A 4WZBB 4PE5B 3GP5A 1PFUA 1VE3A 1WP9A 3LWNA 3C5HA 3E0XA 1EX7A 3L6RA 2AI1A 4JXJA 4QIHA 2YOHA 2H1HA 1MX3A 1JLLB 4MUXA 2Y0BA 3LFHA 3REQB 2M2IA 1XROA 2RJ3A 2NPOA 1EDOA 4FTWA 3VZDA 4U6SA 5C0OE 1U0SY 1WRBA 2OE2A 4JNCA 4ZVVA 2HC9A 3SFVA 4A0HA 3F9RA 4GD3Q 4HDQB 3RU2A 4OHPA 3REQA 3VR4A 4RXMA 3U7IA 4MHTA 2JLWA 4UM5A 1NQUA 4WKOA 2EF1A 4K3VA 4LNUA 5EHXA 1YHZA 2O3RA 4LHEA 1HDOA 2QXYA 1EVYA 2XSZD 4KQMA 2MINB 1AZSC 5J5VA 3C3KA 4DM4A 5BQOA 3A7DA 3I05A 3WGYA 1I3NA 4OB6A 4TKVB 4WDRA 1TA4A 1AQIA 4CM7A 3VAZA 2C07A 5F73A 1O57A 3NQ41 4OJKA 1OY1A 3UTDA 4ATNA 4BU1A 2OILA 4BQOA 4QWMA 3LUHA 3IAS6 3SQNA 5CCXA 1TMOA 4O4IF 1SKYE 2OPHA 3T3EA 1Z5WA 2XCUA 1L3CA 3P9RA 2LTAA 5DBEX 3UXMA 2VDPB 5F4ZA 5H9VA 4EUEA 3QX8A 3REGA 2PQ6A 1JSCA 3TCNA 4Z6KA 2UXBB 2GN2A 1TM1E 1PE0A 4QU5A 1A8PA 3U4CA 4I4LA 1XYYA 2C2OA 1RP7A 5EWLB 1GPAA 5DVZA 3ZXYA 4E03A 3ELYA 2WC1A 1RXIA 2R87A 3CR7A 5J5AA 4BATA 2UXCB 1RADA 1W8IA 4JLPA 3WL4A 3BZUA 1K7CA 1RM4A 2UVPB 2QMOA 4F5DA 3PGXA 1JJFA 1RWOA 1CV2A 2ECPA 5JS6A 3UMYA 4IRXA 4CBVA 2AW5A 1E3SA 1M2WA 3BMCB 3V7UA 1IQRA 4MWZA 1R4MB 2C00A 4HGYA 1E2DA 4OAOA 4P98A 3CVWA 4NMHA 4ZCLA 3IDZA 1JQ3A 2JB9A 3GEHA 3FBGA 3L6EA 3VR3D 2OCPA 3KELA 3IEPA 2DFDA 5K0ZA 3DFZA 3GBVA 2EX0A 1NR5A 2XNCA 1V1RA 3UT6A 1HQYE 1RYDA 3GJ7A 4K9LA 3L5KA 4TT3D 1Y6FA 1OIVA 1AQJA 3OZRA 4R2IA 1ZY2A 3BGWA 1D4AA 1FFEA 5HK8A 1NNSA 2O48X 1VL5A 2BGJA 4H4DA 5TMBA 3SIRA 2ZFUA 2PU7A 5JI2E 2C7GA 4V03A 3ETLA 3RUCA 2COKA 2I54A 2LDXA 2VHTA 1JKIA 3OQ1A 4LXIA 4R8RA 5ALGA 5C31A 4ARZB 5IVPA 3IKMB 1MJGA 1SUBA 2OBMA 1EE9A 2ODEA 3DBRA 5FBQB 2ZDGA 4J8PA 5HCNA 1ESNA 5ULLA 4QTXA 2C4WA 5ICGA 5BUCA 3WLOA 4L3OA 4B47A 1DCFA 3H9JA 3PXDA 8GPBA 1BQ4A 3GNLA 4XGKA 4JJ6A 1DL5A 1L4GA 3FPSA 3CUEF 3NJRA 3UYLA 3LT4A 1Y89A 4DA7A 5BQXA 3L8GA 3H9QA 3LC1O 2YOFA 3C8HA 1RJ9A 3H5WA 4X44A 1PFKA 5DYWA 1OH7A 3V6MA 3WIOA 4W1RA 2QQ5A 4FS3A 4NESA 2X5JO 3MJHA 4Q3OA 4W8HA 2HQSA 3KPJA 3M4YA 3ROXA 1EWQA 4B3JA 5ALTA 2XWJI 3NHMA 3O3CA 1NN0A 1Z28A 4P53A 5DISB 5JY6A 5ADUS 3TG8A 1A9SA 1G3MA 2QG9A 1K7FB 4NBTA 2ZQZA 4TLAA 2A5DA 1MXFA 2IEYA 4UU1A 5ALUA 1EGQA 1B6TA 2HA2A 3D3WA 2Q5JA 4R7ZA 2G6TA 3EPJA 4URYR 4INPA 3WXMA 5KNCA 2EFEB 3KU4A 3WLAA 3A25A 3RC8A 4RFSB 2BH9A 3BWDD 3OZGA 3R0QA 4NC9A 4NV3A 5FORA 2D7JA 3PPXA 3NXKA 3RFTA 2B83A 3ICQB 1GUDA 3STYA 2GLUA 2C2HA 2ZT6A 3PCXA 5CCEA 1K7SN 1E2PA 1E3TA 2J9FB 1JDVA 1XKXA 4QDJA 1ADGA 4F38A 4FQ5A 2D1FA 3FW1A 4ZK6A 4IDEA 1NBMA 2AN5A 5BSUA 1FP7A 1HT2E 2Z1NA 3EHDA 2ZJ6A 4LW8A 3IUBA 5FPSA 1NUUA 1A8HA 3K4HA 4LQCA 2W0SA 4I1UA 1C7FA 1Y4AE 3E81A 4QECA 4HDKB 2G5TA 4YJ3B 3THYB 1JUDA 4Y18A 1N3YA 2ZQ5A 1ULSA 2I99A 2PAAA 3INRA 2BFCB 3DL0A 1SIOA 2LDBA 2YDYA 1VPLA 3R0VA 1UR5A 2H1CA 4QDZA 2EDCA 4YJ2B 2IHJA 3MTDA 1CJBA 1Y42X 3KXIA 4F46A 3JD1A 2FW8A 5HFAA 1DXQA 5TC4A 2HGSA 2PH3A 3CRRA 3S68A 3EEBA 1UKVY 1VLZA 5F9HA 1XAIA 2VLBA 4URFA 3RS3A 3IQDB 2C5FA 4ON9A 1ZS9A 2E1PA 5D01A 1C1YA 3RFXA 2PUGA 3L4JA 3KM0A 3EXEA 3LX4A 4OIMA 4IHJB 1GU7A 1YRAA 3M5DA 3G89A 4WK6A 1I13A 4X8MA 2H06A 3JQ6A 1UOQA 5TPWB 3VR3A 3GYGA 1BO6A 1D7OA 1OF1A 2UXDB 1SUWA 1DNPA 3X3HA 4YRAA 1CP2A 5LZ8A 1S2IA 3QKIA 5DGDA 4BKPA 5IDWA 2R4UA 2YTZA 4RTSA 4WPGA 4HWTA 4YMGA 5AKKA 1JKXA 1KPGA 3COYA 3RGWS 2Y3IA 5D5HA 1WBBA 4LDPA 1RNLA 2OFXA 3IHKA 4GXNA 3U37A 4UE3S 1A50B 2PEZA 3P4XA 5IVKA 1QDUA 3TR6A 3VU1A 4X20B 4EM6A 4EYQA 1JJAA 5B55A 5K8VA 1NHGA 3MTQA 4L4YA 4PSUA 5EIAA 4EGFA 5HZHA 3PLAE 1FJ2A 1EFPA 2H2IA 3H0CA 4KACA 4H7PA 3Q0TA 2IPMA 3B5JA 4ZO6A 4BFSA 3ZHCA 2CFCA 3OFND 4AZ3A 3VNUA 1QS0B 1SR8A 2HBRA 2PAFA 4KRXA 1A76A 4L6IA 4Q1CA 2VUSA 1MAHA 1TF5A 1L5FA 2PIAA 2GK3A 1KYQA 3OEHA 4UVIA 4LCJA 4XA8A 4PYKA 1TRHA 1FPQA 2VDWA 2XEDA 3N1UA 2YCBA 5JLAA 3PFGA 1APBA 3JQPA 5IX8A 4XWYA 1NJ8A 1Z9BA 5REQA 1YIAA 1J9ZA 4A91A 2PNJA 1UL1X 3SS9X 5HZGA 2QAIA 2I8LA 3PA6A 1OQAA 3DBVO 4JVSB 2FPWA 1EWVA 1CUEA 1MLDA 2XLCA 3SJUA 3AM3A 2WPDD 2B4KA 4JHLA 3QVLA 3CF2A 4DBLC 5KNCD 1Y6QA 2HA3A 4IJWA 5E3IA 2CHVA 2WQZA 1CY4A 1FNDA 2GHRA 2HV9A 4WLOA 2QE7D 1PK9A 5U4XA 5JYCA 2OG1A 1SEPA 1VLHA 2NLOA 4FR2A 3V4FA 2DFPA 1RI1A 5C4GB 1FLAA 3EXG2 2NUTA 4ENWA 4IILA 4DIBA 1KAHA 4JQSA 1Y8CA 5FUWA 2REOA 2QMZA 4L5AA 1KZ7B 1US8B 1YMVA 3ORRA 1U7HA 1QDLB 3AYXB 3QTBA 2Q7OE 3D43A 4WT7A 3SZMA 3W1EA 1KY3A 2FPSA 4OQFA 4EATA 3ZCPA 1A7UA 1QO9A 2HXGA 5TVKA 4OOEA 1N1DA 2H4JA 3RVSA 1D7AA 1QORA 3IPAA 4YRGA 2IDZA 4MULA 4L72A 7ABPA 2GHQA 4ZT2A 1O5IA 3OESA 3INNA 3KUKA 1JQJC 3HE3A 2FP4A 3KYBA 3BL8A 2JH9A 2P5SA 4FHCA 4N9WA 5CCDA 1VIVA 5HCIA 4RMNA 3VR5D 4E51A 1VIYA 2PM8A 2YW9A 4KAXA 1ZIPA 2O7VA 4QPCA 3EQ8A 4BDSA 1N5OX 1CUHA 2F4NA 4GRDA 4UHFA 4V0ME 4QE3A 5ALKA 4UDNA 3UYKA 5HQTA 1ATIA 4DDMA 4BNLA 1U0OC 3MK31 2PKCA 4L8GA 5HKLA 4OYLA 4XSHA 3LF1A 1UK6A 1TLFA 2JJ2A 3CYFA 4QUKA 1NUHA 2QLLA 4ZT7A 3GPDG 3MLAA 4M2LA 1XRJA 2PN1A 3FFAA 4K86A 5AWFC 4B6RA 3MJTA 3N8GA 1FTSA 4ZQEA 2EFHB 1Y9AA 2CYAA 1F20A 1SBTA 1IN8A 5FNVB 2XEXA 3LBHA 2Q62A 4ZCTA 2MJLA 3NVAA 1NN3A 3EZ7A 4HDCA 1E89A 3UK6A 3WRXC 4F7DA 4ZHQB 2PUCA 4R9NA 2R6CA 3PUJA 1G38A 2CSUA 5AYVA 5K3AA 1XXLA 2A86A 3P9PA 1R0BA 2C82A 3BTUA 4AP5A 3ZW8A 1YGYA 2Q3FA 3FDFA 4KQXA 1KR2A 3GAMA 4L2IB 4TSFD 4WBNB 3FROA 1NA5A 1MAUA 4FUQA 1FXUA 4M4SA 1XZGA 4Y1RB 3LP6A 2W70A 3W8FA 3IAEA 2JI7A 4X1YA 3ZVMA 2C5HA 3NDJA 1FX0B 5D7BA 1VJDA 4MR8A 1U8AA 2EQAA 4V3BA 5D86A 5FOQA 5IAKA 2JIBA 3OM1A 3QHAA 1T2CA 4R54A 3T5AA 3WDMA 1G6OA 2IA5A 4KIWA 2BMWA 3GLQA 3U09A 1PZXA 2P67A 4Y0VA 3TRFA 4YP9A 5KSWB 3A2LA 2PZMA 4DPKA 1NE7A 4AI6A 4XD7A 3HEBA 3HABA 4GZMA 4LYEA 1JQEA 4RPJA 4XX0A 4N03A 4DTIA 4FJ0A 2G0TA 4ENRA 1JGTA 2XGSA 2BRUA 3T3HA 2IP4A 2BFFA 2WK1A 1NMYA 3JQ7B 2G1AA 3HN7A 2P6UA 4H7KA 4XWGA 3G59A 3I8XA 1XZEA 1DC5A 1GNRA 4UPDA 2I4NA 5F9MA 3WBBA 4BVGA 4EMSA 3NAZA 3GVXA 1EFKA 3EDCA 1ISGA 4HVCA 4S35A 5E0OA 4KMRA 4BJ3A 1N8SA 1IY2A 1NP7A 1MP0A 1ULAA 1FFXB 2P2YA 2P2NA 3ODGA 4OO3A 4UHJA 2HJHA 2LCIA 4WTOA 3AV0B 2KJQA 3ICPA 1E2JA 3THSA 1GM5A 1NUSA 1KHHA 1WXDA 2VVTA 3F49S 4F9FA 4YRZA 1JDUA 4X6LA 5TQJA 3F1LA 2VQFB 1YRWA 3IBGA 3D6VA 1SOMA 2VYCA 2H3EA 3FFXA 4N8DA 1SVMA 3E22A 1OLXB 3V7NA 3G9XA 1E8MA 2P65A 1GG2A 3BXHA 4M1WA 4XKJA 1E6WA 1QYRA 2VNJA 4B2PA 1UK9A 4QPZA 4BHTA 5TQ2A 1DKOA 2RARA 4S2UA 2DWUA 4WK0B 1WQ3A 3V8RA 1QHNA 1UMDA 4UKDA 1K8ZB 3TLJA 2ZSKA 3Q7IA 2NX2A 3DE1X 1D2HA 5KVQA 1JEOA 1QP8A 4C01A 1P9NA 1DRJA 1NVAA 2E37A 3R9IA 3CLRD 1QKJA 4FXOA 2IXDA 3I9KA 1UXIA 3UT0A 2NNLD 3MFYA 1OWPA 4IH4A 2DB3A 3QFSA 1U2EA 5DHSA 3GA7A 2O2GA 2HPZA 2A5LA 2VTEA 5A4AA 3VC1A 5ARCA 4DC0A 1K97A 4QPDA 3RFVA 3I2KA 1XLTA 2V0GA 3AP2A 5FOWA 3PCRB 3REOA 5J63A 3V32A 1N2SA 5JZMA 1VYHA 3INTA 3LV8A 4UFOA 3TAUA 5LLTA 2ASEA 1VPVA 2CDRA 1XA4A 3NEPX 4ID9A 1QO0A 3N0RA 1AB6A 3GCZA 3KZOA 3M5WA 4HUJA 4K6FA 5ESWA 4FFDA 4QQRA 1ZVVA 2QRNA 1IK6A 2FF5A 3N76A 1KQNA 1KC1A 4PHCA 4R68A 2C2GA 3STUA 4BBAA 4PCAA 1YT5A 4IKPA 2TRSB 2Q5HA 3O8NA 3KQHA 1XZAA 4IKEA 5L4LA 4B32A 5FAXA 4MVJI 1FUKA 2XYVA 3KL4A 1QCCA 1UJMA 4IDAA 1RQNA 1M0EA 3H13A 4XZ3A 3SG0A 3H0KA 3VDXA 1Q1BA 5HUQA 1SU7A 5LIPA 2H6EA 3NG1A 2ZAOA 3G2JA 2NSDA 3I6YA 2PT5A 1CUAA 1NJSA 3GGPA 1NXXA 1KP9A 1XTKA 1T4GA 2B25A 3A8TA 3RQSA 4A8TA 2SKEA 4G09A 3PICA 5AESA 3PGA1 1UADA 4PGHA 4ER5A 4EKDA 2NXCA 5ETJA 1PJ3A 1YB7A 3QUQA 4AB1A 3AF4A 2WPNA 2GM5A 2YVAA 3IMGA 4HRYA 3VR2D 3L6BA 3I01M 3MAAC 3K9CA 2ZJ1A 3ZCXA 3ZQKA 2FDRA 3D7MA 5KYNA 3L01A 3LSYA 3ZWWA 4G0OA 1VJ1A 5DOZA 3R5FA 1RFLA 5BRJA 5JSUA 1ZZGA 2VJYA 2JFPA 2BFCA 2YV1A 2Z4RA 3AF5A 4OBBA 2BHNA 4YRJA 4DMGA 2XKBA 4ZT4A 5IJ9B 2AJLI 4CW7A 3GJ4A 2A58A 2JLYA 1U3FA 2RIRA 3AJEA 1KO4A 3L4BC 4R0MA 4TM7A 1A9TA 1VJRA 3OAAD 3OIYA 3PFHA 2O0HA 3X1ZA 1AURA 5BMVF 5IJ9A 2I4RA 3C3XA 1CRWG 3IV9A 2I62A 1OBFO 3GL9A 2W2LD 2ZBEA 3R8XA 5JISA 1G63A 1JPUA 3VOBA 1Z16A 1QHYA 2CJWA 2XNDA 1TQ4A 4HUTA 3O2QB 3G8CA 3KSZO 3LRPA 4GLBA 4ALKA 4FEGA 2GBFA 5ITVA 1RPTA 1VHWA 4IMIB 3SBXA 1KJ8A 5A3VA 2QTLA 1DIBA 1UIMA 2VF7A 3GLKA 3HB7A 2CJWB 1Y4ZA 3K1TA 3GAFA 3TH5A 2PR2A 1TYCA 3KKPA 4GMGA 2ZJ8A 3KPWA 5FUVA 4ARUA 1MIOB 4AWXA 1MB2A 2AR0A 3TTTA 4LF6B 5T41A 1PS0A 2GB4A 1Z6TA 3LP5A 2GZ1A 1FUIA 1X1TA 3DAHA 2Q5OA 4OIFA 1UBMS 5ECGC 4PGMA 4B7AA 1VB3A 1L5RA 1AKUA 4MV9A 4Q93A 1Z3CA 1FTWA 3B9PA 5B2ZA 4GPD1 3RTAA 4O33A 4IIGA 4O2AA 4JSRA 3KDPA 4G36A 1JHQA 3KLBA 4QYXA 5FI3A 2V9ZA 1QK4A 1MGPA 1G7TA 3WK7A 2WYHA 4MX8A 5LC1A 2O2DA 4II3A 1WU8A 1FDIA 4LN1A 2QGZA 2CE7A 2J3JA 1MO3A 3L0DA 1US8A 5BNFA 1XU9A 4NK4A 3UKDA 2I1WA 3FTDA 3M83A 4LOHA 4AJ9A 1QRUA 2MSDB 1WXIA 3NANA 1D4ZA 3QWFA 3W7VA 4DHEA 1A97A 3QXXA 5D6NA 1N0HA 3FZNA 2AXQA 4YBRA 1R00A 5FUMA 5IRCD 1T36B 1NI4A 3LO8A 1EP3B 1QRRA 3AUKA 5IAJA 5ALSA 1F0PA 1U3CA 5TB5A 3G1TA 4CTMA 3AY3A 4Q5IA 1YZFA 4RJIA 2FW1A 3OCVA 5G02A 2QVBA 1J8FA 2Q2NA 2XB6A 2PXXA 4TTJA 3SJ7A 3ZKWA 4E2ZA 3T4EA 4EA8A 3DXZA 3LLVA 4BV3A 2GJ8A 1ZNWA 4IS2A 5JIBA 1VKOA 2X5OA 3M6FA 1LDEA 2V65A 4K9NA 2F7SA 1LSJA 2AD1A 2R7KA 5LU9A 1I7QB 4MIYA 4L02A 2M6LA 3DBLB 5BO5A 1C4KA 1Z13A 2GH1A 2GPWA 2Z1DA 4HK4A 4Y1GA 4Z8YA 2N0SA 3M3DA 1PT5A 2VTDA 5FOXA 1EBUA 3DQPA 1V7PC 2PSHA 1MC1A 4PQGA 1M72A 4YDRA 3L8HA 4TWRA 3KX2A 4UTZA 1CU1A 2C7OA 1G5PA 1OOEA 3NYIA 3IUSA 4Q3LA 5K51A 1AKQA 2CLDX 2CW5A 3ETGA 3PI6A 3ROKA 1ISJA 1HYQA 3DPSA 4HGRA 4WUVA 1X13A 2CD9A 4IXNA 1O9GA 4NYJR 1W9MA 4EJSB 3TX6A 3W8EA 4OLHA 1ANKA 5FOVA 1B42A 1R6BX 2A0WA 2PX5A 3HWRA 4DS3A 4I9FA 1I1HA 4Y1RA 3FDIA 3ZEAA 5HKOA 1AKMA 1XMJA 1QLWA 4F2GA 4HRVA 1FRFS 2QVCA 4ME6A 4V0LA 4BQIA 1SQFA 1HLFA 2Y1FA 1TLLA 3EGDA 4TYMA 1V3VA 2P9BA 3FUCA 1CC1S 1ODTC 1C7ZA 3E1KA 2VHWA 4D8VA 1W29A 2RI0A 2XYRA 1P0IA 2AL7A 2K7ZA 4PN3A 2COEA 3GJ3A 5L9AA 4X7RA 4DA8A 5FT9A 1W4LA 1W2HA 1X9IA 4U02A 3B5EA 1OW3B 4RF2A 4EWLA 3PHJA 3BEOA 3PUKA 4G4GA 4ZO4A 5AW2A 4PCUA 1QVRA 2QD5A 4R2MA 5LXTB 1NBEA 1NG1A 1JQLB 1C1DB 1GLGA 3KZ1E 3OSUA 4FDTA 3IQXA 1P33A 4W82A 4EECA 4EW2A 1GPMA 1PK8A 3FFWA 5GOTA 3WSTA 1QR6A 1KEUA 2FSPA 5AHOA 4KXMA 5CX4A 1IVYA 3UG6A 5LXTA 1UBJS 2HRRA 1U6KA 2DR2A 3NALA 2VAPA 3ONFA 5F7OA 2R8RA 5BUQA 2OORC 5IXSA 4DR5B 4W4TA 2FUNB 5K0BA 2ADOA 1EFUA 1SUCA 1ZNXA 2P0EA 4G2TA 4MR7A 4YAFA 3BMOB 4AXXA 1ZAYA 1CERA 4UM9B 1T6YA 1XO1A 2O0MA 2X2OA 5LCXA 2A9KA 1QMGA 3T9CA 1BG6A 2PEYA 4J9VA 3CVXA 3MGBA 1NYQA 2C1XA 4R1LA 1F4LA 4YFVA 3EMBA 1LQ2A 4GYYA 2R4TA 4PFSA 1SXQA 3CLUD 1CRPA 5J4YA 3A1VA 2BR4A 1JNYA 1GPYA 1LPNA 1UMDB 4M0DA 3B48A 3GEPA 3SQWA 3T6KA 3WICA 1R37A 4WNIA 2WHEA 5CT9A 3MILA 1BXKA 4G65A 1CR6A 4RJJA 1EE2A 4XB1A 2IZ6A 4YJ3F 2ACKA 2FX5A 2H2AA 2Y1GA 1UC9A 2QPAA 2AZ4A 1TL7C 3AHCA 4J90A 1FSGA 3X1MA 4JB2A 3W8DA 4N5DA 2YIJA 4KQCA 1DC6A 1FMJA 4F5ZA 3U6KA 4KR2A 1V8OA 3UFBA 1L0BA 3H9CA 1VI6A 4IDNA 1Z7WA 3LOQA 4EQ6A 2ZU6A 3GOQA 1TZCA 2R1ZA 3G2KA 4M1ZA 3RT1A 1X9GA 3O83A 4TXLA 3HS3A 3IE1A 1M1YB 4IQFA 4J0GA 3P32A 4MQFB 3NIFB 3JQ8A 4F11A 1TJNA 1PR5A 3CX8A 3JSAA 4M49A 4MKZA 4P8RA 4CV3A 5KWEA 3UGKA 2GK6A 3C6BA 2JGDA 3V2UA 4WDQA 2QQEA 4XIFA 2PGLA 4HFMA 2O6HA 3RYCB 1JDSA 4LF9B 4P4LA 3OTIA 1E64A 1KYZA 1R0RE 3OX1A 4Z9BA 4EZIA 3OPQA 3DLHA 3ZDDA 1QUEA 5EMJA 1QQ7A 5FPPA 1GU1A 5BXQC 5JVDF 4R9RA 3IVAA 5E1BA 4ONEA 4RFVA 1PSZA 1U9YA 1H4TA 5EJAA 3WB0A 1IHPA 5INTA 1E2BA 3FYUA 3I1YA 5KDOA 1QSGA 1QU3A 4EEKA 4CEIA 1X3LA 2VLIA 3UJDA 5JNUA 3CLSD 3H4IA 3CX4A 4MGHA 2Y68A 5CNMA 2G1KA 3BWXA 4NP6A 1W87A 1IH8A 4YWHA 4BVAA 2P2CA 4HATA 4QHTA 1WM1A 4J2TA 4Y2UA 1NDQA 3SBEA 4AUEA 1O94A 4UATA 4YV0A 3TW0A 4E70A 3AESA 4ENQA 4JYBA 4RLHA 4W8OA 3WGOA 2EATA 3EULA 3L0OA 4FGKA 3E2PA 1E4OA 1XMPA 1BGXT 4R8MA 2OWEA 5CVEA 2VZ0A 2CMKA 3CKLA 2JCGA 4ZRNA 3Q7RA 2IPLA 2VZLA 4RC9A 5FDFA 4ARIA 3AY6A 2I1QA 3ZE2B 3WBJA 4ETIA 1CUGA 1YUNA 4D9MA 2XBUA 4C0AC 3KHTA 2VHXA 3JS5A 4P7GA 4CKWA 1WO8A 4KFSA 3ZK9A 3N2KA 4MVCA 5CG1A 3AFOA 3KXDA 4JJ7A 3V4RA 1KE2A 4K9KA 2GYWA 3ILXA 4LF4B 2PQ2A 5CK5A 5JJBA 1U8TA 5AUPB 1T2EA 3LQQA 4GYJA 2D0IA 3EVZA 1P7CA 1KPIA 1RWKA 2NACA 3BH0A 5T67A 3SK0A 2JCVA 4CM9A 5JC1A 4TLBA 1R50A 1QGZA 3L93A 4HTFB 3MRTA 2EU8A 1N2OA 2FWNA 1OA1A 1FSFA 3BXZA 3RJ9A 1N33B 1CUXA 2ZRQA 4KV9A 4WOPA 3A0UA 4LRWA 3QFFA 1VYTA 1IEWA 1NATA 4X97A 4FLEA 5K6AA 2BVNA 2ECFA 5C46F 2QUHA 5K8UA 4RENA 4Q82A 1NF2A 3JASB 3JVDA 4M7WA 2BGNA 1S1MA 5ICMA 1P31A 4ZYWA 3RUPA 4B34A 5HPYB 1WLSA 2WJAA 2Y8EA 5M3BA 3IHTA 5CK4A 3Q3VA 2V6JA 4YRBA 1H1TA 1RPJA 3QFHA 1R27A 1FYDA 2XVMA 5TMDA 1W44A 1X7WB 2P9EA 3AI3A 2WSMA 2XB8A 3BGIA 4YLEA 1NQ5A 2WTAA 3EVFA 1OFGA 3KYIB 5JBIA 2X0DA 3RJTA 2R68A 4TUYB 3SKYA 2Q41A 2LXNA 1IEVA 5B3AA 4JY7A 1C3VA 5TSDA 4YYZA 4TWAA 1H2WA 1J23A 4IXDA 4OD0A 1D2EA 1JVNA 3FM9A 1ICIA 2BGLA 3FSGA 5IHPA 2WQ6A 1OWLA 2DU8A 4HAXA 3C8UA 1M0TA 4JA0A 3HCDA 3PXUA 4L4XA 1GKUB 1I2BA 4P80A 4BO3A 5KKCA 4IIBA 3H2BA 4RHYA 4F6RA 4MI9A 4PZ0A 4XB2A 1G8HA 3RVPA 3RG8A 4K46A 1HDIA 3WKCA 5CA0B 2WWRA 4Q7JB 3BH7A 1SWWA 3EGEA 3MTGA 4G5XA 4HS4A 821PA 1EU1A 3TXAA 1X8LA 4MRMA 5MN4A 2NYUA 5LQKA 3KFXA 4HWOA 2AR7A 2HH9A 5LDGA 3W4KA 2FMFA 1G7RA 4BAGA 1XOIA 2BM0A 5DNEA 1FP4A 2JJ8A 3VBCA 3R0IA 2YVKA 3Q2OA 4FT4A 4XSVA 2VRNA 1E8NA 1DAKA 1U2GA 4U2EA 4DDKA 3KQPA 2ZPUA 1E79A 1YQEA 2DP4E 1PEKE 1ULTA 4J75A 1DLIA 1Q74A 1TT5B 4L74A 1GL7A 2OXTA 5B7GA 4LSWA 3R5SA 3M6XA 1ZM3A 5HZKA 2B4QA 2Y93A 1C4WA 2JW5A 3KVOA 2NU8B 2C4MA 2OT3B 2ZTMA 1WWKA 4PC3A 1RJ9B 3M49A 5CT4A 1FIUA 3LYHA 3CR8A 4X91A 4TPKA 3K9FC 1PTJC 4AYWA 2VCHA 4NE2A 5JV5A 1QTNA 2JFNA 4TTQA 2RH5A 1B73A 3R76A 1RWVA 2IKSA 1K0UA 2CBXA 1G20E 6Q21A 1AA6A 3QNUA 2IGTA 2GRJA 3GPBA 2IYOA 3QLTA 1XHEA 2QDKA 1A5SB 3WLNA 3GRFA 1E3EA 4QPJC 3B1ZA 4J07A 3RIEA 1Q0SA 3LUAA 2JIZA 3KSMA 3NTXA 4M46A 3VHXA 3II6X 1C0IA 4KDFA 1Z7EA 3F9IA 4UNRA 1J0DA 1BU5A 4UE6A 2IUEA 3WWYA 2CXHA 1F14A 4LF7B 4REMA 2ZJ3A 2OCYC 1EJ6A 2XB4A 1UDCA 1VJ5A 4TL6A 3M4ZA 3K70D 4I1IA 2E5FA 4ETWA 3QVWA 2B8TA 4KO1S 5L6MB 3DAGA 4X7BA 3NOXA 1N6RA 2OCGA 4IJQA 4XE5A 3QX9A 4AJOA 4E94A 3MOGA 2WU0A 2XMSA 5ICFA 3UPDA 3JPYA 4FKZA 2R8ZA 4FHFA 2MSNA 4K28A 5KKAA 3U4AA 1GTMA 3DUFB 5A4DA 3CUWA 3EVAA 5HSGA 1OFTA 2NVUA 4JOSA 2OB1A 4NBNA 4PO9A 2PWPA 4YB8A 3OLVA 1CFJA 4A4DA 3BK1A 5DT2A 2PIDA 1Q11A 1YACA 2H31A 3DYIA 1M6YA 1G42A 3RASA 3IEKA 1MAVA 3GROA 3VGPA 4CFZA 4PGFA 1GSOA 5C32A 1AZWA 2HZBA 1ZD8A 3IQHX 3LLCA 4WACA 3CIOA 5A2GA 1BDHA 4I1PA 2IHZA 1YJQA 3TNYA 4RH0A 1DFIA 2VXCA 2J0QA 1FYXA 4V0KA 4B7UA 5DFAA 3TDMA 4WNYA 2J9GA 1SBCA 3WHLA 2XF8A 4RTRA 3G17A 2LVBA 4O08A 4UBIA 1ZMBA 5IEJA 1E1KA 5CVJA 7YASA 2H18A 1E9AA 1PGQA 2VO1A 3EFOB 2NUBA 2XRYA 3U3RA 2BMJA 4QC2A 1NW4A 2AQ8A 1Y81A 3DDZX 4RSMA 4EUNA 4FGLA 1PJBA 1T9BA 1W0JD 2Z8YA 4H6WA 1BX0A 2E0IA 3ILSA 3KKMA 5FHRA 3ZU6A 5JANA 4ETMA 2YVUA 1A9XB 2IXTA 2XMPA 1DZ3A 1EK6A 4EJ6A 5ALVA 5BOSA 4DCTA 1KJNA 1G21A 3K8OE 3KKLA 5HKBA 1QIIA 4BIMA 4H7JA 4RDCA 4BMOB 1I7SB 3UWOA 3B2NA 4ZVRA 5JADA 1JP7A 2PA3A 3QXCA 1MJNA 4OA8A 4S0XA 4N8SA 3GELA 3EIHA 5E1OA 1T2VA 2ZYRA 4Q4JA 5TT0A 4RPIA 3FCOA 3EHEA 1MC8A 3IP6A 1UJCA 2EAUA 1UDRA 3SDSA 3LT0A 3U39A 2XDQA 2BHRA 2HFJA 3Q8LA 2SBTA 3R9XA 3OFKA 2R6GA 1WDLA 3WQRA 1E2UA 3NIGB 3ZHUA 4CKEB 4ZI7A 4V1CI 4ND4A 4DCCA 3ZOKA 1R12A 1XE3A 1OI2A 2A84A 2RGAA 3TAHA 1W6UA 4P1ZA 1Z17A 1XZ8A 1P81A 4WECA 3HV2A 4LNHA 4CKCA 2KS6A 4ZD6A 3RLFA 4DLWA 4CIAA 4LBVA 2I5PO 5BQ3A 3ZE1B 4OH7A 1VXRA 3IJEB 1J24A 1QNLA 4XJVA 4C4XA 3F97A 2HY7A 3M0EA 1ST2A 4D26A 5JJCA 3PFKA 4KYIB 2O0KA 4ENPA 1E3MA 1PZGA 2VP3A 4FB5A 1RXEA 2I2WA 2WTNA 1GZDA 4L7QA 1ABEA 4WXHA 1RE1A 2X0RA 1L2TA 1OPXA 5CD9A 1C9KA 2PBZA 3KSUA 2VDWB 1GFWA 4Y9RA 2ZUEA 1JQBA 4ZVMA 5DV9A 4B4UA 5KX5A 2HSDA 3VYRB 1PK7A 3CA8A 5HF6A 3DFIA 3COPA 4I50A 2C61A 1XAHA 1RC8A 1QFMA 1BEEA 3V34A 4Q19A 3TG2A 2PWYA 2AYXA 3I2IA 1TMYA 4IQGA 4LIPD 1VJGA 2NUPB 5I4KA 1CRZA 1DX9A 4H4CA 3VC3A 4EY5A 2CZGA 1XQXA 5DO9A 2WUGA 4BEVA 2IYLD 1CUYA 1WPRA 4X1IA 1B8VA 1QTIA 5T6BA 4HUQA 4G4JA 2L2QA 3SN6A 2QLNA 3CJTA 4K88A 2KW5A 2FEWB 2N47A 2ODQA 2D59A 3GMSA 1XU7A 2KE5A 1TW2A 3E4CA 4XH9B 4YMHA 1ENPA 1QV6A 4YWJA 5IAGA 4YAGA 3N2KB 3IKTA 1TU0A 2R1TB 4YPOA 1N1GA 2W71A 1I24A 2Z5GA 3EZFA 1QZZA 1VL1A 3BFJA 3LVBA 1Y4UA 2NWQA 4RD6A 3UFXA 3GAZA 2ZYVX 4Z1MD 2ZB3A 4W7HA 4XD2A 4CM8B 2EGHA 3AEUB 4HB4A 1B93A 1RXYA 2V55B 4O8CA 2ZUTA 1GGHA 3DMHA 1NI4B 2A3NA 5BSWA 3U1BA 5L3QB 4W1SA 3IKVA 2OFOA 4BGDA 2HCBA 1QGUA 4ZI5A 4MUNA 3AEUA 1DE0A 4GG1A 3ZN2A 3L9XA 1BDMA 1NOKA 1X1CA 1S5PA 3M7IA 3QXSA 3RC1A 1IM2A 5P8WA 3UB3A 3T5GA 3DSRA 1GILA 5ER9A 1KR5A 3N87A 4LCEA 2G7ZA 4YAEA 4GPTA 3UPUA 1U0RA 4LFBB 1UZAA 4G24A 1DOHA 3EN0A 2VUHB 1EVIA 4JODA 3DXXA 3F3YA 4H7EA 4L6AA 1TC1A 4YT5A 3VUEA 1NL3A 2EERA 1V9CA 4FKBA 3HN2A 1JA0A 2CLCX 2ZYHA 4MUIA 4KMMA 2YVQA 4YXWA 1XNGA 3D59A 1EXMA 1QIHA 4P84A 5TQ0A 1MV8A 3PXAA 4R2LA 3N70A 5ALHA 3D31A 3PQ4A 4B4OA 2ACWA 2ZAIA 3SIXA 1XEXB 3EXHA 3KT8A 1TQ8A 2LE0A 1VFNA 3HY6A 4MQEB 4A8JC 1GDTA 5TQ0B 3RIGA 5FWYA 2RONA 4HDNA 4R2XA 3C39A 3AYZB 2WJPA 3MCTA 1GTSA 1QWOA 4JGGA 4NBKA 2D5LA 3U56A 2NTYC 1MA0A 5DDIP 4L2IA 2REQA 4UBKA 4C30A 3OOJA 1FMFA 1OXSC 3IOBA 3U0BA 4NCAA 3GEMA 3QKRB 5IZCA 2X0KA 1P9LA 4RA9B 4TMXA 3S5UA 4UXHA 4F6RB 4UAGA 5AW6A 5IN4A 4AUMA 2GZMA 1OWNA 2REQB 2MINA 2Z8YM 4G6ZA 2ZJFA 4FP9A 1MIHA 1DWOA 2CYCA 5E2BA 3T35A 3MWDA 1YA6A 3NHZA 3KSRA 2QVZX 2XGMA 1K6JA 1YOVB 2WJWA 2ZVPX 3BA6A 4PO1A 4HBZA 4CL2A 2R3SA 2Z09A 3JCZA 1EX1A 3F3KA 2GJSA 4O8ZA 1Y8AA 1Z47A 4Q18A 5I8ZA 3IPLA 3OZIA 1SQSA 4MDYA 3ZD9A 2UU9B 3C15C 2VSNA 5JJIA 2PE5A 5D3ZA 5DSXA 4ZC8A 4PF1A 3ESBA 4YQEA 5AK5A 2W6NA 3EQ2A 3AVXA 2FR0A 3UCXA 1SZPA 2BFFB 4INJA 2P69A 2I0FA 1L7XA 2DGDA 2PKXA 3R44A 2YV2A 3FZGA 3URKA 1YD7A 4H7HA 2AZMA 5AOCA 4JI0B 2FB9A 1NZJA 1YULA 2HKIA 4CL3A 3PUIA 3I12A 2FX2A 4PSAA 1P8AA 5HKKD 5DLPA 5EMKA 2DR3A 1QVZA 3KR9A 2R66A 2XT9A 3UJ6A 3G5LA 2W6IA 3VU3A 2BMFA 2PL1A 3EWAA 3W78A 2I7XA 5I47A 3PQ6A 4AROA 2YICA 3F3SA 4DC9A 1JL3A 4M7PA 4HYYA 1O4WA 1DWQA 4PYJA 3KOXA 4QTTB 2GZDA 3GW8A 4DWVA 2PMEA 3OLQA 3P27A 3CF6R 4EI2A 4RSHA 1H0HA 3DO5A 4HAVA 3DEJA 2D2XA 4G1EB 3QY0A 2JLAA 2I33A 5AI0A 1FFXA 1ESZA 3T7DA 4BFZA 4DVGA 1XIVA 2EG9A 2P3QA 3GLHA 4KWTA 4F4DA 4D6PA 3NHUA 3RQIA 5IDXA 3HDTA 4PBSA 2OZLA 4F0JA 4MRMB 5G40A 1EFDN 4YXFA 4ZCMA 1NR7A 1H6DA 2E48A 1LLQA 2OGTA 2QUIA 3BF7A 3KRTA 4K3UA 4KVGA 1QBKC 4OJYA 2IE8A 2IHVA 3Q1KA 4X6XA 3I73A 1J0BA 5JO0A 5JD4A 4TL8A 3I5UA 4FM9A 3EZ6A 5JNLA 1X6VA 2E89A 3WP0A 2F6RA 1UP6A 3PYXA 1K27A 4NCHA 4K5QA 4Q7EA 1JQAA 3K15A 4BBZA 4IV8A 4AJ4A 4ZU1X 1UFOA 3WV5A 3WLFA 1RRVA 2YNMD 3AQIA 3KT6A 1XAGA 4X93A 4EI8A 5KEIA 1B2LA 4MUBA 3CLTC 1BQEA 2DF8A 3FI9A 5LYJA 1RBZA 1AQ6A 1H9BA 4HNAA 3I8SA 4RHUA 3DJYA 4OI1A 5CLJA 4PFQA 2JJ2D 2FPGA 2JFVA 5BWCA 2V4ZA 1WAMA 5I4BA 4N41A 3U1TA 3TLAA 3D7SA 3ER9A 4GQBA 3GRUA 1NJ1A 2ZJZA 3RNLA 2G82A 2R8OA 3LBIA 3PQEA 2WG1A 3JW8A 2QRMA 1N2CE 1QK3A 4J91A 1OLSA 3ZDZB 4ZTUB 3HTXA 4A0FA 3OOSA 4RNDB 4DG9A 3CNOA 4YYEA 4EJ2A 1T3TA 2RH9B 4XPZA 1PNQA 3FB1A 1FQOA 3ICCA 1MB9A 2INGX 1W47A 2HK6A 4MGYR 4KKVA 1LZKA 4BQPA 5K2MA 1NULA 4RQTA 1T1SA 1RQ7A 3UNXA 2NU6A 4X9XA 3VR6A 7GPBA 3DVAB 5JAZA 5KBYA 1I9CA 2HMAA 3ZDXB 4RLSA 2I7CA 4UZEA 1I2MA 3KBBA 4CLOA 4KIFA 1LVUA 1UFQA 4MEJA 2XH8A 4GM0A 4S12A 5JFTA 2VF8A 1PQYA 2ZBPA 4KXWA 3UOGA 4TYYA 4R6XA 3EYAA 1OZGA 3IODA 4HDOB 5CD1A 1PTJA 2J87A 4GL2A 5EE1A 1IONA 5HIAA 5FYDA 1CKEA 1E5DA 2ZXUA 3IAS1 4H60A 4ZREA 4QXPA 4E5VA 2O2XA 1TZMA 1BX1A 4QBTA 5H82A 1JIQA 3PFBA 2PLWA 1HTTA 1GGMA 3DGFC 3OE4A 3MRVA 2RGYA 3G7UA 3TS1A 3SVTA 3KL2A 3K0AB 3H8VA 3SIPA 3WYAA 2JIPA 2W6JD 4LJLA 3H1EA 2DHRA 4EI7A 1Z82A 1ZD4A 3ENQA 3DAOA 3FTCA 3NKLA 4GWKA 1YA8A 4JLUA 3U4QB 5H02A 1UINA 4Z49A 1Z4MA 1POXA 2IBSA 2PLAA 2XOXA 4LF5B 3VHQA 1EM8A 1HKUA 2EC5A 3PU6A 4EY4A 5E4FA 1WCXA 1SRQA 1YDMA 1EJ0A 4KE6A 3G0HA 3UGQA 1Z2OX 1S2MA 5I7HA 5SZKB 5K8LA 1ML4A 3T1OA 2BUAA 5IJXA 4P5EA 4ZT5A 2VQEB 1MIOA 2QAGB 1TE2A 3IURA 3K1AA 2VHZA 1IXYA 3RAGA 3FR8A 4K40A 2EWVA 1NBWB 3FZYA 3OM8A 4FBLA 2PY6A 4XTRA 3TIIA 4URVR 1M34A 4RAQA 3TLZA 1ZHOA 5JD6A 3VH2A 2AKYA 5CTJA 5A03A 1U8ZA 2CXUA 3B6EA 1EGAA 5E95A 1IOVA 1VYVA 1YB5A 2VBGA 4XW2A 3GDFA 1P72A 1RJEA 3Q7SA 4ZI7F 3HLKA 5TDHA 2HJGA 5JEEA 1Z34A 1R0XA 4AN4A 5JAOA 1D8TA 1YVRA 4IQ0A 5LQCA 4A0GA 4RE6A 2X86A 5F7XA 4OYRA 4RSGA 2OSBA 5LD2C 5EQTA 1RYZA 2D0PB 2E49A 2PD6A 3E7FA 2H07A 2I2XB 4WCFA 4BMYA 2P2ZA 3OO0A 1ZIDA 2IYFA 3FYTA 3FNEA 2VZ9A 1PN3A 1U81A 1C9YA 4DMFA 4EB8A 5TR9A 2IS6A 1O54A 4BNVA 3LK7A 2DWOA 4ESOA 1EFPB 1GPH1 2IOHA 2FXIA 1OBVA 4R41A 3RG2A 2WF7A 2VP2A 3IQFA 1H66A 4PBTA 4IQ4A 4CZ2A 3TVYA 2A92A 2BAGA 4L5BA 5KVCA 1SVLA 1XMOB 2V97A 5KI6A 4HFNA 2G1PA 4XVRA 1ZUD1 1QH8A 1Q1QA 1XK7A 2Z2JA 2A5JA 1II8A 3EZYA 1PG0A 1P73A 3AINA 1GV0A 3F8SA 3X43A 4A0QA 2ZE5A 4H1HA 1A8IA 3ZE9A 2HBZA 1TU4A 1I14A 3FCUB 1E3DA 1ZHFA 2GFIA 3AFIA 4NZ9A 1L5LA 5KVVA 1DC7A 2O05A 2BH2A 1YA4A 3HJCA 3VPHA 2WTMA 2DLCX 4AQ7A 5D1HA 3NH9A