4P82A

Structure of pyrr protein from bacillus subtilis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
180
structure length
180
Chain Sequence
SNQKAVILDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGNPVTVGEIDITLYRDDLSKKTSNDEPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKNIPTSKSEKVMVQLDEVDQNDLVAIYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein PyrR
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Unknown function
total genus 53
structure length 180
sequence length 180
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2014-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p82A00
1XTTA 3M3HA 1XTVA 2AEEA 3DAHA 3KB8A 1DKRA 1DBRA 1G2QA 2H06A 1Y0BA 1ECFA 3G6WA 4PAWA 1ZN8A 1BD3A 3QW4B 1VDMA 4QYIB 3DEZA 3MBIA 1Z7GA 4Z1OA 1QK4A 4LZNA 1ZN9A 4P82A 1O5OA 1QB7A 4P3KA 4RV4A 2GEBA 1ZN7A 1G9SA 1HMPA 1ECCA 1QCCA 3MJDA 4RABA 1A4XA 5BQPA 3O7MA 1D6NA 1DQNA 4JITA 3NAGA 4X45A 5ESXA 1QK5A 3ACBA 1UPFA 4P83A 3HVUA 1OPRA 1CJBA 1VCHA 4M0UA 4P80A 2JKZA 4P81A 1BD4A 1GRVA 1I13A 5KAPA 1WD5A 4ZFNA 4KN6A 1FSGA 4RHUA 5BRNA 3GGJA 2JI4A 1I0IA 4RHTA 4WMLA 3ACDA 1A3CA 3GGCA 2XBUA 4LZAA 5K51A 4MB6A 1G2PA 1GPH1 1XZ8A 1TC2A 1A97A 1XZNA 2C4KA 2H07A 1DQPA 1A95A 1DKUA 2JBHA 3S5JA 1QK3A 2PRYA 5IPFA 1JLSA 2IGBA 1I0LA 5ESWA 1U9YA 1QB8A 1P4AA 1I14A 1VSTA 1BZYA 2H08A 4X44A 1UFRA 3H83A 4JLSA 1OREA 1MZVA 3ACCA 4RANA 2YZKA 2VFAA 4RAQA 5E38A 4TWBA 1LH0A 3LPNA 4P84A 4LYYA 5IAOA 4IJQA 1U9ZA 2PRZA 1ECBA 4S2UA 5HKLA 1PZMA 1ECGA 1L1RA 4RHYA 5JSQA 4QYIA 4RHXA 1W30A 1A96A 4LZOA 1XTUA 3OZGA 4M0PA 1UPUA 5HIAA 4FYMA 1IBSA 1NULA 4P86A 4PFQA 4RADA 4RQBA 1O57A 1STOA 2HCRA 2WNSA 4OHCA 4WN3A 1J7JA 1YFZA 4LYGA 4RACA 5KAMA 1QCDA 1JLRA 4RQAA 1V9SA 1P17A 5BSKA 1P19A 5JV5A 1ECJA 4QRIA 1AO0A 2E55A 3OZFA 2EHJA 1HGXA 2DY0A 2P1ZA 3OHPA 1A98A 2JKYA 2PS1A 4RAOA 1L1QA 1I5EA 3N2LA 1OROA 4F8EA 1NONA 3LRTA 3DMPA 2FXVA 1P18A 1R3UA 1G9TA 1TC1A 5EUCA 5BQOA 3GEPA 4M0KA 3EFHA
chains in the Genus database with same CATH superfamily
3DT6A 2NUTA 1QX4A 1TEVA 3ETHA 3HEMA 2DBZA 1Z36A 3LJKA 3OOYA 2RHHA 4HJRA 5M2QA 4G01B 3TRJA 1QKJA 1K6IA 3G6WA 4G1UC 4ZVQA 3QW4B 3V8MA 2J5KA 2X5NA 1N8TA 2FZEA 1O89A 2YFHA 4RVHA 1G9XA 1HYGA 2QXTA 4QICA 2G40A 1MKYA 4O6VA 1T43A 2OHGA 3KUXA 4FX2A 1PV1A 2FR1A 2ISQA 1EGVB 2GPWA 1P1IA 3CBGA 2DVMA 1XLTA 3E4DA 4IQFA 1JMKC 3ITKA 4II3A 4DLNA 4F5WA 4G5QA 1ZSVA 4LOHA 1SD2A 1RLUA 1SGWA 2O07A 3KQKA 2YJTD 4R5MA 1NUQA 2FRDC 2IYFA 2R6CA 4FFMA 3U7QA 1QK5A 5JASA 1N2JA 1HLPA 3N8IA 4EARA 1J9EA 3G0DA 1NYLA 3WL8A 4H0CA 2WTUA 4WZAE 3FDJA 1A8PA 1ZIYA 3OO1A 4FKMA 4BTVA 1KR2A 1MIOA 1U11A 1Z38A 5KVSA 3A2NA 2AEMA 4ZOLA 3OICA 4WK4B 4TROA 1TTHA 1RYBA 3USES 4GR9A 3NH6A 4JNCA 4ESHA 4WI1A 2NO7A 5GJBA 4RHTA 1GT6A 3WRYA 1ULAA 4TVSA 5JEEA 2Q6IA 3PWZA 4OYYA 4F84A 1QCZA 1UM9A 3LZCA 1F8FA 3VAYA 2HLNA 5HDBB 4X6YA 2AD1A 1W85B 4GG1A 1TVMA 3TI9A 4ZHQF 3QOWA 2JFPA 5JI2E 2P27A 1JKFA 2IXDA 2ZJ6A 1UR5A 2QX8A 4DARA 2PMWB 2B25A 1TK3A 2PYZA 2ZWOA 3LK6A 4TQGA 1TZMA 1QGZA 4U5QA 2W70A 4F45A 1P2UA 5HUJA 1T4CB 2JH8A 2C8VA 4EI9A 5HOEA 1LVUA 1Z5OA 2C57A 2HWKA 2W7TA 4AS3A 2DWCA 2QTVB 3R5KA 4NATA 1W88B 3QE0A 3PGMA 1OI2A 2REXB 3HGQA 4GICA 4NZPA 4ZXPA 1T4BA 1XMPA 2QVYX 1ABFA 3IUMA 3R6DA 3RK4A 1ZH4A 5EERA 221PA 4OLAA 1RHKA 1W87A 2FH5B 2O9JA 4B6QA 4P92A 5ALOA 3IIIA 1CIPA 4OGLA 2C7BA 4QYIA 2PU7A 4YBZA 2YJNA 3D4NA 3DAPA 4RNCA 1UMDA 5GM1A 2P78A 2VP0A 4PFQA 3U7HB 4PYIA 4BGEA 4KBGA 3RJMA 4ZOQI 4YLYA 1P7CA 2NUAA 2WVAA 3GJZA 1SKAA 4QEDA 5THXA 1VJGA 1U8FO 5HTOA 3TSYA 4IV8A 4QDUA 1BOFA 3GUCA 4XQ0A 5ALZA 3I1FA 1AV6A 3TQCA 1V35A 2ID8A 1K6JA 3EZNA 1L4BA 2VJMA 2WICA 3STXA 121PA 5CITA 3EEIA 3LUBA 2O8BA 1IG0A 2O4UX 4LGCA 2NV0A 5EMKA 3SOPA 5FP0A 2V9CA 1F4VA 1QOQB 2ZUWA 3GGGA 1KKUA 3AO0B 4HDRA 3RTEA 2YOHA 3D6NB 4V0OA 2RD2A 3AR7A 4MIEA 2PD6A 4GGOA 2CXQA 4ARCA 1U65A 1FNCA 1QNFA 3AFMA 5JNLA 1L0BA 4PQFA 1JQBA 5HM6A 4JBLA 1UADA 1JEOA 4C30A 1QF7A 4F1KA 4DTIA 3PQ6A 3I72A 3ETCA 1DCMA 1OBVA 2ZYRA 2VYQA 2QVLA 4HK4A 2HLDD 3WWCA 4EAAA 1DBQA 5DYWA 2ODNA 1XYYA 5AKXA 1PT8A 4D8UA 1O0SA 3DDZX 5EZYA 3WAGA 4RHEA 1Y5RA 1N9KA 4BX0A 1C50A 3KJNA 4TWIA 5KQLA 1CQIA 2NACA 4KPUB 2VT6A 4NMWA 4G0XA 2V7WA 1J0CA 5SZHB 3COSA 3NYWA 3SQLA 3R74A 3MBIA 5KU7A 1HY3A 2QVBA 4L4RA 2ZRAA 1TM4E 4R3NA 1OOEA 5U4QA 3A7EA 2X2PA 1A72A 1JE0A 1WCWA 2C9YA 4LY0A 4QXOA 4OKNA 4A6XA 4M1EA 2LZ0A 2WKQA 3CB2A 3G2HA 1NMXA 3PDJA 2PK3A 5IEBA 4HLQB 3RBXA 4BFVA 2F3TA 3IEUA 5DHAA 5BSEA 1CJKC 4M9XA 3GJ4A 4QU0A 3ZQUA 3LX8A 4PGMA 5HMMA 4I14A 4OQMA 3NEAA 4DLXA 1TVCA 2WYUA 1K5DA 5TXGA 1Z2AA 1LC0A 4M38A 3T7EA 4G2TA 4H31A 4JLPA 1A3CA 4Y0VA 4ZRNA 2JK0A 1RABA 3T52A 5D5QA 1KPIA 2BM1A 4HEHA 4J1SA 4JK3A 4YJGA 3WHKA 2OV6A 4EG8A 1RHQA 5L95A 5GP1A 3RHSA 2EZUA 3L7YA 3EIQA 2NUTB 3T7SA 3TLBA 1DLIA 2QNRA 3VPSA 2B6HA 2CNKA 3VV2A 1H3FA 5IT9A 3I8OA 3CH5A 3GPLA 3E5NA 4KX3A 3EH2A 4PSAA 4RD4A 3VDRA 2Y4NA 1ZCZA 1ZIDA 2I8LA 1GN8A 2PSFA 3PUHA 4BGVA 4FDTA 3QOYA 3DAFA 2P4HX 4MPJA 3PXGA 1QAOA 3GVPA 2NXCA 5KKNB 3X1KA 3KELA 3RVRA 1T3SA 1NVAA 3AK4A 3OIVA 2XGOA 5LA6A 3KLPX 3ESCA 1NUAA 1NU6A 4FFLA 2AN1A 2IFTA 5LZ9A 1NFFA 3U7QB 5JSQA 5LBTA 1XZAA 3LH5A 3DWFA 1Y8CA 4MLCA 2OFWA 1H6CA 5FV7A 1GAXA 2AV6A 1P4SA 1Y3AA 1MIOB 4DADA 2VHXA 4M54A 3SBDA 1OE0A 2C2WA 3PNOA 4KP7A 4I2NA 4ZOLB 5AHXA 1EX6A 1QBGA 2HSZA 2VVTA 3OWXA 4B1FA 5CIYA 1Z6XA 2XKJE 3HNPA 5FAKA 1J56A 3D8TA 2Z95A 4R1OA 4YJ2A 2OR3A 2O59A 3LSTA 2BMDA 1MC4A 1K1EA 1UK7A 2Q9BA 3AHEA 3EEFA 3ISJA 4XIJA 3FXAA 5JSKA 5CDSA 1L8XA 3HJAA 4C07A 4IDOA 1ZGCA 1UM9B 2RGEA 3CR3C 4ZVLA 4WW0A 1NVEA 1ZZEA 2ANCA 3C87A 5TQ0A 2DQZA 3F98A 4UTXA 2QUKA 3W2GA 4E5VA 3FH0A 5AI6A 2BHNA 1ZRMA 4XE5A 2A9KA 1H22A 1YMVA 3INTA 1W4RA 1THZA 3HB9A 5REQA 3G5TA 4PG5A 3GLHA 5JXWA 2JFBA 3UAGA 4YIHA 2HK8A 2OPBA 1PDOA 2A9FA 1XNHA 1CUWA 3GLKA 2O0LA 2ZJ2A 4PVCA 2QTRA 5DX0A 3GGOA 1TLLA 4M4SA 8AT1A 2OMEA 1X38A 5CVTA 4M9SA 1UBHS 2FUG1 4C88A 1G17A 4EBFA 3SSAA 2GEFA 1BCSA 1F6BA 2WWWA 1L4LA 4LHEA 1SHTX 3B1XA 3U7RA 2PSSA 4QYIB 4FQ5A 4PAMA 2WWTA 1OH6A 1ECLA 2YFYA 4D3XA 1UMDB 5EYPA 3IP7A 3EXAA 1E2NA 3NLLA 4I9NA 5J5VA 3RG8A 4C3ZA 4YUWA 4JP2A 5C7IO 3NV9A 5IJWA 3OQHA 1KXJA 2WAYA 1EFRA 2OGSA 2JCVA 2NUAB 4BU0A 4KHPB 1WW3A 3HB1A 1J7KA 4BV9A 2G8LA 3A4NA 2BGMA 3H65A 1PJRA 4IX1A 4H3VA 4J49A 4G1CA 2D2VA 5K8IA 2VJMB 3OLQA 5AKGA 4QASA 5C4IA 3AZPA 1R7RA 3CJTA 3KQWA 3O6VA 2LDXA 3GJ7A 4MYDA 4P4UA 2XGJA 2O8BB 5MFZA 5FHQA 1TW3A 2B36A 4ENQA 2BGRA 3LXXA 4YR7A 4YRSA 4HDRB 3W90A 3FTFA 4B4KA 3OU6A 4PZAA 5CLJA 2AMYA 4W1PA 2NYVA 1NNSA 4JLAA 3VR4A 4AZ0A 3E2PA 4EECA 5A05A 1IUKA 3IMGA 5IJAA 4DREA 4EJSA 1GNTA 1ZEJA 2G07A 4CUZA 2FSIA 1Q7RA 1NHGA 1GWNA 2JIMA 4FZ3A 4GOLD 4QYWA 4DV0B 4RIHA 5DHRA 1L8AA 3RYIA 4DLSA 1L1FA 3OKAA 4RLSA 5EZYB 5DRYA 3PQ3A 2HADA 1FS5A 3DQQA 1VLQA 3KX2A 1QUFA 4Z3DA 4KE8A 5TARA 3PKIA 2CFIA 4PNEA 2R6DA 5C3MA 3H5WA 4YDSA 5AVSA 3CLSC 4RH0A 2PQMA 3GJXC 5KX5A 4KW7A 1N7HA 1QP8A 5CEJA 3C6YA 5AP9A 8ATCA 1RM5A 3EZ6A 2QM3A 2V6BA 3HG7A 4FBMA 4NOKA 2COUA 4QG7A 5KNCH 2DT5A 4AQYB 5FBZA 3I3OA 3TRFA 3DD5A 4A03A 4WDQA 4HH0A 2BCEA 4JXKA 4RJJA 3H17A 3UUFA 5LMNB 1U6IA 1JMVA 1YXMA 2IYZA 2R8RA 3CH4B 4MRPA 5FULA 1XTUA 3RVBA 3T34A 1KEPA 1ZM3A 3VU8A 4A8JC 1GKYA 4F6CA 3LY8A 1EKXA 3GLHE 3NWJA 1K9SA 3PGXA 4OXYA 3KEFA 1SXIA 3WQBA 1GNSA 1BS2A 4PXSA 1ZOLA 3GPDG 2O5CA 1A9PA 1QHXA 4IWYA 1KSHA 3VMMA 3WKDA 2PUWA 3LPMA 1T6ZA 2R87A 2II6A 1CYDA 1RWWA 3KJFA 5BR8B 3D7MA 3QXXA 1VFPA 1LK0A 2C2HA 4MRNA 2PA3A 4O4JF 4YJGB 5AOBA 3UH1A 3VXKA 2CKMA 2DFDA 4R9VA 4HWTA 1ICIA 4EFLA 4FCVA 4E2XA 1TA4A 3HO8A 2O52A 2GQ0A 2QE7D 4MW0A 3WNCA 1PHPA 2JFFA 2PZGA 1NDHA 1Q1GA 2XDYA 4M99A 3FYSA 4R81A 4R98A 2VDKB 3NZEA 3L40A 4DDHA 3KR2A 2PZLA 3LX6A 2BOVA 4QPCA 5CK5A 2WIFA 4LSZA 2L19A 2OKGA 4BZZA 1MHTA 2QIOA 4BVEA 3UC5A 4QBGB 2OHVA 2GCIA 4BVFA 3AB8A 4HATA 2IX3A 1NW9B 5HR5A 1POWA 3IPXA 1N6PA 4IIFA 4KR7A 1W52X 3A0UA 3SZ3A 2AOTB 3KSZO 3UUWA 2YYSA 5SYMA 1NURA 4P3PA 5DHUA 5LA6B 1E4EA 1J0AA 3ZDZB 3AU9A 3ND6A 1YGYA 1MF7A 1BFUA 4PSKA 3D5EA 1FFSA 3TZLA 1GEGA 4K6GA 4DDVA 4RZSA 2XODA 3RF6A 5KTNA 1Q2XA 1M6VA 2FI1A 3KQNA 1N2ZA 2GPBA 4ITRC 3H97A 3PF8A 1QK4A 1L4EA 4QTZA 2IXEA 4FOPA 3ZGVA 2ZUVA 3DYVA 3QPVA 4IFTA 4RJ2A 4TYWA 4YJ2B 3L8CA 1E92A 1XE3A 2WG0A 1VGQA 1N1GA 1OGJA 2Q4BA 1BXKA 2R8OA 3ORRA 4RABA 2CHFA 3H4IA 4KYUA 1XGKA 4OFXA 4B4VA 3M6UA 3RC3A 3VPAA 3W79A 5TQ0B 5LUAA 3G88A 1YZ3A 3CYFA 4Z54A 4GMDA 3NNDA 1RC8A 4Z8YA 5F21A 2R5FA 3F71A 3AF5A 3DKIA 4OKSA 4C9BA 1BD4A 2B7BA 2C82A 1ZC3A 2R65A 3ES9A 4OYLA 5REQB 1G5IA 3HI6A 3GGJA 3GLHB 3P7MA 4JLBA 1P39A 4C0XA 2BSXA 3ACDA 5L4SA 3FWKA 3WLJA 2BH2A 5JR3A 1W9MA 3CU5A 4ZQHA 3OI7A 1E77A 1OY1A 1I7SB 1I2MA 3IT1A 4IAOA 1NVMB 5GVSA 3M9WA 3MINA 3SY8A 4M9CA 2K4MA 1B6SA 3RU7A 3U81A 3T1OA 3WQSB 3MWEA 4N0DA 1BCSB 2ZRLA 4U9IS 5L3QA 3CVWA 3L1HA 4JL5A 4LX0A 1AUPA 3DSRA 3VKFA 4JUFA 1QO9A 3NEPX 2BTOA 5EYPB 3VV3A 2QZSA 1U80A 3QVXA 1O5IA 2P8SA 5EHQA 1N5OX 5K0GA 2KBEA 2GFHA 1I01A 2ZSBA 5FNVA 3DDHA 4OGFA 3GCGA 2AN3A 1NBIA 2QIPA 2ZJ5A 2O2YA 3FZYA 1VKHA 3EZLA 3MJRA 4LYYA 4DA9A 2PH1A 1G20A 1LBIA 3DVSX 1NM5A 5A62A 1YZLA 4WACA 3DE2X 4QJ4A 1KZ7B 4E14A 2AFVA 1M2EA 2VDQB 4I1UA 3VNAA 4F4HA 4YUYA 1MIHA 4Y2YA 2CLIB 1E79D 2FFRA 4LF8B 2JJ8A 4NBSA 4I3HA 1QHIA 3UCXA 2B2XA 2WF9A 3SLGA 4BJHB 4YY3B 1K86A 1NULA 1WMSA 4PFSA 1QKIA 1I9CA 1O6CA 1OXBB 4IG4A 1EP3B 1U1IA 2CCGA 2AE1A 1FUIA 1PR0A 2CHQA 3AOEA 3IYLW 3ORQA 2XUHA 3PNQA 1U8CB 2X5JO 4PFKA 3U31A 5FR2A 1K7FB 4EJSB 4AWAA 2ZUFA 3N87A 2DXIA 2H0QA 2YMQA 4X6XA 3RYIB 1C7FA 2R8PA 2OXTA 1O77A 1BN6A 2GLXA 2V4MA 3FN4A 4L75A 1R64A 3ZQ4A 1KYIA 5HNKA 1W0KA 2GJ8A 3U44A 5B2FA 2X8AA 1RLTA 4N5NA 4Q93A 1KJZA 4Q05A 5HPYB 3IMKA 4EGFA 5KX5B 1JDZA 4LQCA 4YRPA 4P22A 4BTLA 1K66A 4AWXA 2ACEA 1YS7A 4IFEA 5HBGA 5HUQA 5EJ7A 1AHNA 3IALA 2OCGA 1BXGA 5D1NA 3LCCA 4ZGGA 1RKUA 2VNHA 2XUPA 3C5HA 4C7JA 5ED4A 1P81A 1WG8A 4NZ9A 4K9RA 4YAJA 1N3IA 4Y0AA 4A0HA 1DQRA 2HEIA 3ZDEA 4OI2A 2ET6A 3L05A 2RGAA 1Q21A 3FCAA 3QBVA 2DUUA 5B58T 3UMBA 4B7CA 3HYLA 3U5TA 4YROA 1IXZA 3Q5DA 4CIYA 3VU0A 3TCNA 2IKQA 4OHXA 3P2KA 2WWVD 5A1TA 1QPGA 2F1OA 4EYKA 1GD1O 2UVDA 5ERGB 3AOGA 5K99A 5L8VA 3EXG1 1TDJA 1G63A 1ZJZA 2H57A 2C9ZA 1ECCA 1N5KA 2I1WA 2JEOA 3KD2A 4CQJA 5BQPA 2VJPA 1UJ2A 1EDZA 3BM5A 1SEPA 4OAQA 3JSAA 2P77A 3WXMA 2IYOA 2ZEJA 3OESA 5KCZA 3JQAD 4WY2A 1N6HA 2J0EA 3A6DA 3KVNA 3O8OA 1ZM2A 5LMCA 2OHIA 3OTGA 4P36A 3C3KA 1KGSA 1TYDE 4C0WA 3FIUA 4EW2A 1JSLA 1NLMA 5JWRA 5IWCA 3ZQKA 1BMFD 5I48A 6ABPA 1XOIA 4IGIA 5KAPA 5L9AA 1KAHA 4F5DA 2QOEA 3C3EA 3LP8A 1TLFA 5K0JA 1Z0IA 1G5TA 1M2NA 4Q9IA 1Z74A 1BQEA 1PR5A 3JVEA 1U3WA 2XNDD 2EU8A 1K4YA 2X8WA 2ZVJA 2OV1A 1E4EB 4N1AA 5KYWA 1N1EA 3BQ9A 1G6KA 4BBPA 2IPNA 3LC0A 5H3LA 2IHZA 2NYAA 2IYYA 3GH3A 4B32A 4PRZA 2BZ1A 3CGGA 2PX5A 3C3BA 3WWEA 1D6JA 2NTVA 4MCHA 1CVLA 4R9UC 1E3IA 1O6FA 2PKYX 3OFSA 4LF7B 2J3MA 1W73A 2CD7A 1N9GA 1PZNA 2G67A 4R01A 2IIQA 3SEFA 2Q3BA 3KOWA 5IAOA 4N47A 3CEPB 4V0LA 5A3SA 3V5NA 2LWIA 1USGA 2IHUA 3KJGA 4RJIA 4TGLA 4D0GA 1LBQA 1KQ3A 2FVXA 4C0BA 4CMEC 2EKDA 2O23A 3ADKA 1LBHA 4KGZA 3HU2A 5JANA 1P0PA 3KYIB 4FYMA 5EXTA 4H6VA 5H83A 1L7NA 4CKEA 2XE8A 1YVPA 5CYPA 4WINA 2QD3A 2V9PA 1RPZA 3M1LA 3WIOA 1SC6A 2H7VA 4JT2A 4Y2GA 1U5CA 5DTJA 5AT1A 2H4YA 1GLNA 4FW8A 3SHOA 4B2PA 3WWZA 1JLRA 4CM5A 4DQXA 3KYJB 1ZUHA 1X7ZA 3PUKA 4PIPA 1Q0SA 3LM8A 4K0RA 4DC1A 3LXMA 1EK6A 2V74B 3ET4A 1OH7A 1CXZA 1AM4D 1YU6A 3MINB 1YR1A 3BJMA 5MDHA 2GVDC 1G8MA 5AHKA 3TINA 3WNVA 5JXGA 1KQPA 3MWEB 4ERNA 4MV1A 1GZDA 1NJ2A 4N3GA 2XOKA 1GUZA 2UUPA 4Z9XA 3VYVA 5L3QB 1EAMA 3D64A 1EGHA 3WRXC 4RE5A 2IT1A 5FPSA 5ADWA 3NRJA 4XX1A 5AMXA 1AA6A 4XQCA 2ZSFA 1A9SA 5KNDD 5LB2A 4BAGA 4HB0A 4DL9A 5FNVB 5H3HA 2JRLA 2IHKA 3H2SA 4E5KA 5FLYA 1UJNA 3HUUA 4BFSA 3OM0A 1G20B 1RVDA 4MW9A 2VYVD 2WYHA 3MS7A 4MMZB 4XGKA 5L3RA 3A0RB 3AWIA 2PX6A 1AKVA 4F2GA 4H7PA 2UYQA 3H84A 4DLWA 4DNFA 1QHHA 3RWMB 4NH0A 2FUEA 4FOLA 1B8UA 2P2ZA 2A86A 3I2KA 4BNDA 3JW8A 2C0CA 1YZKA 3NATA 4XGQA 5BW5A 5CDUA 4ROSA 1YV9A 3AUXA 5TS3A 5BWCA 3EQ7A 5DTRA 5LUBA 2PUHA 1KIFA 4B6FA 3FCCA 2V1XA 1NTRA 3ZY2A 3TZBA 3ZXUB 1E4YA 3KVRA 5CM9C 4CM7A 3BERA 1ZJYA 3TE7A 3AUUA 3D4OA 2R97A 1T3LA 4GKBA 2XCUA 5DH9A 3ZX5A 1PFVA 4E11A 3H9CA 3KDAA 3VR2A 3KUDA 4HX5A 3O4RA 1K98A 4FGLA 1ISFA 4X65B 4RTLA 4JUIA 1HURA 4EF4A 2J5XA 4MAMA 4KIFA 2HMUA 4OBBA 1QLJA 4BL5A 3U44B 6REQA 1MQAA 2A7XA 1ZWLA 1Q22A 2P11A 2PWBA 3TSWA 2FE4A 3G0OA 2XRMA 3K6RA 3THYA 4EHHA 4F9GA 4NESA 1BEUB 3FJYA 3GBVA 5A7GA 1Z68A 3A1DA 1BXGB 3MGBA 5DW0A 3HVIA 2Y99A 3RSSA 1J25A 3LGXA 4TN1A 3FYCA 2MOKA 2OZVA 5DIZA 2X8JA 1EHCA 1GZ7A 3BA1A 1HFKA 2GAIA 3GLUA 3ASUA 4KOEC 5JMPA 4CNQA 2DFPA 1QB8A 1IJEA 3TUZC 2D74A 1CTQA 4R1PA 1E3TA 3QTBA 2VP5A 4RPHA 4EHDA 4HEJA 5F33A 4HAOA 1MEJA 1BNCA 2OCXA 3BD9A 3ZWWA 5CIQA 1R8SA 1B8VA 2Z1MA 3IO3A 3DZGA 1PWXA 2GAJA 2BM9A 3DNMA 3DUWA 3RLFA 3SFZA 3TTWA 2J0SA 3ENZA 1K3TA 1IY2A 1CDDA 4LF9B 1XDWA 4I81A 4OVKA 4ZI7A 1NDQA 2JC3A 2ZYAA 5DN6A 5PGMA 1KEVA 1T91A 1C7QA 4RPJA 4DIKA 4LBZA 3O8OB 4NMMA 5CPFA 4DEYA 2PSDA 3ELUA 2J1LA 3Q72A 4MKFA 1NPTO 4WFJA 5J5CA 5JO9A 2XUQA 3WDSA 4YRIA 2AVDA 1EFAA 4HVTA 1V8FA 2F67A 3SXUA 2P2CA 1ZM7A 4TXNA 4G63A 4MOWA 4B6GA 3NT2A 1RJGA 2P6MA 4ND5A 1CRQA 1YVRA 4D0NA 5K6AA 1FMFA 4HS4A 3LT4A 1H2HA 1QG6A 2P9BA 3ZE9A 1XUOA 3KJQA 3B3AA 3ER9A 1FP1D 1XVAA 1Q3TA 4H4CA 1EHIA 3GH1A 3HS3A 5AH0A 2X9VA 1FYDA 3CNNA 1J09A 2XBLA 3PEEA 4P7BA 2IKSA 1PS0A 5KYWB 1CETA 4HNTA 4HVLA 2BISA 5DGCA 3ED5A 1QIGA 2D2FA 1TTQB 2ID9A 3GXBA 4DCJA 3KLNA 4DMUB 3GAMA 4C7KA 4E5PA 1EQ2A 3BK2A 2EJWA 2GO7A 3FZQA 2FX3A 4DR6B 4D8WA 5CHYA 4RPIA 4WIAA 2JK1A 2NVOA 1N9GB 2VJCA 4H6WA 4HDKA 3ZD9A 4KXXA 1I80A 4G0WA 4YNBA 1H9BA 3BPSA 1SUDA 5DWQA 3DLHA 3ZBQA 1QFJA 4P4GA 3CIOA 1L4HA 3AHDA 3MWLA 1KEWA 1LLUA 4E3WA 1TLTA 4XSVA 1TMOA 5A9RA 4CKEB 1C29B 2QVXX 3NVDA 1WNTA 3TZCA 2HSGA 2NNLD 3NT5A 5EHXA 1JHMA 1KMNA 1OJ7A 4EHNA 1O5OA 2VDUE 3OJWA 3DOJA 5IU6A 1IULA 3AF3A 3AONB 4MQBA 4CBVA 4JP8A 3V1UA 5DTMA 3QVMA 2A5LA 2CMGA 4OHUA 4U3JA 1DL5A 3TIIA 1X7ZB 4OHWA 1XKLA 2WT4A 3LF1A 4HZGA 3H0CA 3WHIA 2JLZA 2LCQA 1ZR2A 3O9ZA 2WC1A 1U0NA 5JAIA 1MEEA 2A2ZA 4KNVA 1CJSA 1V6AA 5DYNA 3GDFA 1XVLA 2G6BA 3I28A 4QDXA 4N7RA 3O8DA 1BROA 3RVOA 2WJVA 1Y42X 1Y4AE 2FPMA 4HB3A 4M88A 1DAOA 5TY0A 1EVZA 1PO7A 2PD4A 3H05A 3CW9A 1CD5A 4CIWA 3GT7A 1W76A 1KFBB 4DQDA 4EA6A 2D5LA 2KB0A 1QE0A 2NZXA 2HA3A 3RS3A 4M7PA 1RBYA 4ZZ1A 1FDOA 4U2DA 2VHEA 2BE9A 3GMDA 4ONEA 2X0DA 2JZCA 3V1LA 1QKKA 4EI7A 1HKUA 2AEJA 3TX2A 3X1XA 2F3QA 3IXMA 3ZNOA 5E3IA 3KLBA 3PLRA 3ZBPA 1B8OA 1PFQA 3P2YA 2XMGA 1O5TA 4KN9S 4HNRA 1QHHB 3WB0A 3EDMA 2WVGA 2P9GA 5BYKA 3O8NA 2PMKA 3V8VA 3M4ZA 4MVJM 1FYWA 4BNDB 1QYIA 2WU1A 4XEUA 4A2WA 1JYFA 1GTSA 1CPYA 1HE3A 1TI7A 2YYYA 2C58A 2KPOA 2FG5A 3K1YA 4P4NA 2BWJA 3CO5A 2A5GA 3N8KA 4GZ3A 3Q0EA 3K96A 4KO1S 1E5DA 1ZNZA 4S0ZA 1PJ3A 5G02A 4E46A 3AUKA 5A4AA 5GINE 2ZBQA 3JQ8A 2OA0A 1MFZA 3UWPA 4BCDA 1SBQA 3P9CA 4IOMA 4FQ7A 2VRNA 3DL7A 1IATA 3IUSA 3HDVA 3QWHA 2XMCA 3FY4A 3MLEA 4OQFA 4RADA 3DMTA 1JIUA 3UMYA 1C3XA 1E3SA 4PBSA 3OVMA 4NHEA 1RDFA 1I7NA 3G2IA 4L22A 4NY1A 4YDHB 6REQB 1DG9A 1B74A 3WJ1A 1ST3A 4DANA 4A8HA 4QFCA 2H51A 2GPTA 3QEMA 1X2BA 5D86A 3QK7A 4F9FA 5KTYA 1HSZA 2P5UA 3UFBA 2FX2A 421PA 1P0CA 3GNTA 1ECJA 2I6TA 4WLEA 3NCHA 4CN9A 4XCVA 1A4RA 4KZKA 3DHNA 4MVJF 1H9CA 2ZLBA 1SG9A 1YQXA 2X8JB 3VH2A 4H3SA 3RC1A 2VEOA 3ZZ1A 1V6SA 2E37A 3QIAA 3W2EA 1TYAE 2UUOA 3NDJA 4RL6A 3Q9UA 5A0FA 3HL4A 3P4XA 2PKCA 3PHGA 3R9KA 3ZWOA 2CL6X 1S9DA 1BO6A 2ZJOA 1SVWA 4WZBA 4N3AA 3HY6A 3NEJA 2VTKA 1IHOA 5H16A 1KK3A 3OLYA 3U13A 1CJTC 4LC1A 4MQLA 4DLUA 3KXPA 3T5TA 4P5PA 2H06A 5JRDS 2CW5A 3KYBA 3W6PA 4ZI7B 3IERA 4LXHA 1IBRA 1JR2A 2HB6A 3LFUA 4JP1A 4UARA 3DT9A 4PS0A 2J08A 3CURA 3S2GA 1GILA 4F97A 1WSBA 1LTHR 2QN7A 3IRVA 3FYHA 2FG7C 1GIAA 2RONA 5C7OO 1DFGA 4RXMA 4EPYA 1DB3A 3V6LA 3SXUB 4PLZA 3PC7A 2FEXA 1B7GO 2ADMA 4G1VA 4CT0A 2I87A 4K9SA 5FCDA 4CTOA 4EGJA 3CCBA 1P5FA 1Z4NA 4M8SA 5CJPA 4C7XA 3I0MA 4IH1A 1XT6A 4IIUA 1MP0A 1R6DA 3ESQA 2LE0A 3NC0C 1WTCA 4NH4A 5K5EA 3SR0A 4DB4A 3QNUA 4MJLA 3GEBA 2AQKA 1Y8RA 4F4DA 1HQKA 3LT2A 1J8MF 3LWBA 4PY2A 2VTVA 1RI5A 2P2GA 5DI3A 1JA9A 3I32A 4WH0A 1QHEA 2E5WA 2G9UA 2B78A 4G67A 3UAWA 1QAQA 4WXMA 3EPHA 4HDKB 4KI0A 3U26A 3LPAA 2ZRHA 3IQEA 1SJ9A 4O33A 3KHUA 4AQDA 5L51A 3KKKA 2VPQA 4YA6A 2JNWA 3VR6D 4B3CA 2O6LA 3A9CA 2PRSA 3A9RA 3EBPA 2B8JA 1TZCA 5DNVA 3ZY4A 2FSFA 1WUKS 1TKRA 3HVRA 2P1DA 1RHUA 3MMPA 1PVOA 1RYZA 1AE1A 2D3TA 3L0IB 5FUBA 3K1AA 1Y9ZA 4OA5A 1VLVA 1F8GA 3K0BA 3PQCA 5M7EA 2AJTA 2ZSUA 3STVA 3TCXB 4C43A 3V1TC 1U9ZA 4U3JB 2ZPAA 4N0QA 3UTDA 3CF4A 3N05A 4KBFA 4URZR 1T10A 1DBVO 1Z13A 1YBHA 2B0CA 1VYHA 2HRCA 3IC5A 4W8HA 5DBIA 5CBKA 5IJXA 4V1CI 4H27A 4LTMA 4P7FA 2WJ4A 2XHZA 1P4RA 2CDBA 1KH1A 1V1JA 2IUSA 3DMYA 1UXJA 4I4TF 1ISIA 4HXGA 1XD2A 3UQYS 4I99A 3WWOA 1RXVA 4JJZA 4KQ9A 5DM2A 4QVIA 1NW8A 2WYIA 3M5CA 1T34A 2KS6A 2HCFA 4EPVA 2QUAA 1PGJA 1GUFA 2AZTA 3E27A 3PNVA 3VH1A 2ZI7A 5LDHA 4E4TA 5I3ZA 4XPIA 1ZEMA 2ORED 3NM4A 4EGQA 1FFEA 2VAMA 2Y71A 1U1DA 1KARA 3MJCA 3OM8A 2CXHA 1AO0A 1JU4A 1Q1BA 2BHTA 3THRA 1TIBA 5HWSA 2WSBA 3ZV4A 3ZU2A 1WD7A 1DKPA 2C07A 3BL8A 3O4VA 3SVZA 4RTRA 2BGWA 4F8EA 2PWYA 1Y1KE 4FR5A 2EJCA 3AINA 2C94A 3M4XA 4IILA 3W5IA 3F7TA 3FMVA 2CC2A 4K9MA 2W6IA 4JLDA 4CF5A 3U49A 1LWOA 3OFNA 4PCLA 4V24A 4F5ZA 4RULA 1UXGA 3FDFA 5TPWA 2CXRA 2XGGA 2WFAA 2QJRA 3I0ZA 2VRCD 4N40A 5CW1A 4ZVNA 1ZH0A 2HK9A 1ZJWA 3PJEA 4J0IA 3BHJA 2CL7X 4HHEA 1WDKA 2G6TA 1V11A 5JT1A 3JQ8B 4BYMA 4AI6A 1OVMA 3RC7A 1Z0ZA 1V37A 4MR7A 3O3OB 3ZE2B 4A91A 4WUVA 4OK5A 4CM4A 5I4CA 4UQPA 5KHLB 1XQ1A 2ON6A 4BC1A 3HJBA 2PZBA 5DV9A 2JLCA 1FSPA 2IU4A 3PXEA 3Q8KA 1BX3A 1LLQA 2YC4C 3ZCTA 3QEMB 4N5HX 3O7MA 4X45A 1VB5A 1YQ9A 4AX4A 2ROQA 3UH0A 1QP0A 3UPDA 4ZAVA 2XNDA 4BP3A 4JXJA 5K6TA 4IY1A 5CA1F 1E6KA 1MU0A 2JDIA 4QM6A 3W3AA 4AULA 2J67A 1LSJA 4OHPA 3TB6A 3FUWA 1CUHA 4PN3A 4Z2AA 1U2ZA 4MYCA 2AVNA 5EESA 3ZE8A 1G7SA 4ZCQA 4Y9SA 4WZBB 3E9DA 3T1TA 2OV2A 2X4GA 5MGNA 4C6RA 4A23A 1J90A 4Y9UA 3AQ4A 3NTVA 4LF5B 3BTUA 2BGUA 4OQQA 1ODIA 2X0RA 4QUEA 1Z88A 2HV8A 3LMKA 4BDTA 1M75A 4MW4A 1JPUA 1A27A 3EX7C 1CZKA 2HGSA 4BQOA 5JS6A 3KV3O 2F00A 3Q98A 4BNJA 4BNXA 4ZTZB 5ILQA 1NQTA 2FWNA 4E88A 3O9MA 4ISCA 3RSQA 2JAUA 1V25A 3E23A 1N7IA 4D9CA 4HQ0A 4BNWA 3ZD8A 2BMJA 4KUGA 3BJZA 3H1FA 3ADBA 1IXSB 4II2A 2NZ8A 2G1PA 5HJ5A 2GFQA 3MT9A 4WSOA 4OX9Y 1YZQA 3CY6A 1S3SA 1Z29A 1A8IA 1XMQB 2RGBA 3KVOA 3WK6A 2QYTA 2FSHA 4KQCA 3E15A 2BELA 1HDZA 1T2VA 1FF9A 3BXGA 3MAAC 4HTAA 5FTMA 5FBRB 4JSTA 1N8NA 1NP6A 1O57A 3EPLA 2C3PA 2N1BA 1Y8RB 1ZOOA 3I6QA 4Q3AA 3EXHC 3PFWO 1FE8A 5K4GA 2PGXA 2H48A 2OXEA 1HT3A 1ZD5A 2YXEA 4MW1A 2YJ4A 3MJEA 3L5OA 3QPBA 3R20A 5DI3B 4C29A 3RUPA 4KRFA 2AW5A 2DFTA 2FXIA 2TECE 3CUUA 1DJOA 2LTAA 5JSZA 4IQ0A 5TEWA 5HKKA 1PKXA 2H29A 3ASZA 1NVWQ 3WK9A 3ZV7A 4RGBA 3BFVA 3GC6A 2QEQA 3RIHA 1G4AE 2ZRJA 4AP6A 1R9JA 3A3YA 1KFJB 4W5WA 1ONBA 2R8EA 2ZE7A 3B2QA 1XDBA 3KKPA 4GYWA 4EIWA 5KWIA 2XMRA 4R8RA 4DKJA 5IVDA 1PIWA 2VXCA 4D5EA 3R3VA 2HD4A 4B0OA 1R3UA 5IM4A 2AHRA 3K1AB 3QA9A 3L46A 4XFKA 5GY7A 3UICA 5CFRA 4JT4A 2Y1KA 2JH9A 3QKUA 9LDTA 2ATXA 1FLAA 1X7HA 2DH6A 3P2MA 1H8HA 3OTOB 1KJJA 5EXDA 4E13A 3OF3A 2QTTA 2RHLA 2NVUA 3ORSA 4PR3A 4E6EA 2WZCA 2ZRGA 3KCNA 2X3YA 4ZCPA 3PNBA 3GJ8A 1F3OA 5EPEA 4QRDA 4YYZA 4Z1OA 1XD2B 3N6VA 1CEYA 4RF2A 1NBMD 3AILA 3F74A 2ZWVA 4KCGA 5K3BA 3MFQA 3EVBA 2I2XB 4MYHA 1Q5PA 5ALWA 4CG2A 4UTPA 4IKOA 5DK6A 3OUZA 4XPIB 5M04A 3C8ZA 3DOIA 3LUFA 3E5RA 2WG1A 4KFRA 1LSUA 3R6GA 4LW8A 3CF0A 3IT3A 1IH8A 4A0SA 4ALJA 3LVFO 4W8GA 1SAYA 2AJBA 2VSXA 2J33A 1XVIA 3RLIA 1NF9A 1PDVA 1R6BX 3MA0A 2QM7A 2W0SA 1EBBA 1YFKA 1YS1X 4MITA 4OEHA 3TAHA 3ZV3A 4W5TA 1E7MA 4WZZA 4I50F 2D5AA 3TD2A 3C4QA 4BKMA 3IAHA 4TTQA 4TWJA 4AN1A 4H1UA 5DNAA 1GDTA 2M6LA 2EW2A 2JKVA 1K2VN 1B14A 2ZYSA 1EK5A 1FTSA 4KQ1A 3GDWA 4FDMA 2EFCB 5TPWB 1Y8AA 1RQ7A 4IQ4A 3AI7A 1T2FA 2EFDB 3S2FA 2GHTA 3QVJA 4WT7A 1P74A 3MBKA 4B48A 1H2YA 3WKEA 4RY8A 1V11B 1VSTA 3BFJA 2CGEA 2XW6A 4MR7B 5A03A 1P2FA 2H85A 4CM4B 2DX7A 1K7YA 3N74A 4L4XA 1S2IA 3EBOA 3RODA 3V7NA 1Z83A 4U9UA 4IGKA 3BMXA 1KDTA 4GE0A 1O95C 3W5AA 2W2LD 4BMCA 2QX6A 3C3YA 2HDWA 4ZCTA 1SC1A 1XLUA 2OLEA 4PO1A 5DBHX 3WKAA 5A4JA 1H6DA 1VIAA 3PNLA 1QLWA 1FDVA 2P3SA 4DLLA 1WZ2A 3CCCA 2A0FA 3IILA 4RW0A 2CK3A 3DBVO 4L2IA 3T7KA 1EJBA 3P4YA 4BNVA 1JEAA 3T5DA 1AXEA 3FMFA 2VQ6A 2GJSA 3TUJC 1B42A 5JNVA 3GHHA 1E2FA 2X4IA 4MVJG 2B4TO 2VPWA 1UBKS 5LJIA 1VZ3A 1BHJA 1IMJA 3A4IA 2I34A 2G7MC 2JFXA 3TLGA 3AF2A 3BD7A 2PX4A 2VBCA 1G8HA 3OFKA 2VF5X 1P17A 3PI6A 2KLHA 1SXJC 1XEWY 3V8EA 3MJSA 2HBRA 2VZ0A 4AAYA 5TNXA 1KAMA 3UAXA 5AWFC 4B73A 3GJ3A 1RAFA 4ENRA 1R50A 1IZYA 3SHWA 4MGIR 3KVYA 5K0TA 4A3SA 2WDPA 1VG1A 4E6PA 1ZHOA 3M2PA 1J2JA 1D5WA 1JDTA 4N9QA 5JDCC 2ZBDA 4DIDA 4DW8A 1KK0A 2KM1A 3RTDA 2UYYA 3KL2A 4GNKA 2JA2A 3PQEA 3U1TA 4MHSA 3NNNA 4YHBA 3WFJA 2BGKA 1WMFA 3N0TA 4M0KA 4PHTA 4EHKA 5JZBA 1UEXC 5LWQA 3Q7IA 1JR3D 2AMVA 1Z4OA 4NU0A 4Q9KA 1JIKA 3DKKA 5JC1A 3L6OO 1U7TA 4L95C 4NG4A 4RZQA 4BB0A 1VDMA 3IUEA 5CG1A 1NUUA 2WKRA 2ZIWB 1SHJA 4IEFB 1Z0UA 2BBOA 3GFOA 3S0JA 3Q8WA 3ONEA 2PTHA 4J94A 4I1RA 3IT0A 3NCTA 3CNLA 2RHDA 4MP3A 4WXEA 1FUEA 4DIFA 4X1YA 1E2QA 4DC9A 3E8SA 3JQGA 4EFDA 3REFA 5C5DA 1WQ1R 2VH2A 1FVHA 4NEHB 3SYNA 1BHO1 1CZHA 1M1XB 2YWBA 3QPDA 3F3YA 4JHXA 4Q4AA 1R66A 1DJNA 1U98A 1KPHA 3AEZA 5JSZB 4U6SA 2HNAA 2ORIA 4D9EA 2HX1A 3DQPA 2BF4A 3K9GA 5ES3A 4B31A 1J70A 1PTKA 1VCHA 2BZ0A 2J5QA 3HY4A 4O4IA 2FMTA 4RK6A 1FS6A 1NKTA 4BMPB 3PHBE 2WNHA 3J80A 1XTIA 2XH8A 3C48A 2XZPA 1M73E 5KNCD 4Z0TA 5U9CA 3FYUA 4IDFA 3MWGA 5JH7F 1PBTA 1JF8A 1U90A 3W6UA 3B8HA 4D4JA 1KP2A 1XZNA 1H1DA 3CZCA 2ZIGA 3DTVA 3H5AA 4HLNA 4UZEA 5KSWB 3NO4A 1IY8A 4UREA 1VE6A 1V41E 3ASVA 1ZD4A 4UVDA 1JWBB 4I1VA 3TOSA 3W5JA 1QOZA 4RKRA 5KWSA 2IGBA 3WHPA 4OJKA 1H2FA 2D62A 3E70C 2HLPA 2HQBA 4INOA 4KGDA 2XXJA 4RKWA 4NYJR 4UTOA 5HS6A 3ICQB 3LG2A 5LP6C 4MVJH 4LDNA 5AVTA 1IOWA 4WXHA 2HFKA 4EG5A 4E5DA 2GJ9A 3UCFA 3IR7A 3VKUA 2JLXA 2FQWA 1S4QA 3DF7A 4UMFA 1O94C 4RX1A 1K8YB 1QYCA 1NFRA 2XZTA 1CK4A 1EMDA 1JJ7A 1T3GA 3GRYA 2ATVA 5DISB 2H92A 4MQUA 4D0LB 3TFOA 5A4FS 2Q6KA 4K86A 1A1SA 3EQ6A 3QOFA 2IH5A 1DOHA 1B0AA 2A35A 1UBCA 3FKSD 2IQ5A 4QOIA 4BLRA 5HIAA 1RXIA 2IW3A 3NHKA 1Q15A 1GGKA 1EFUA 2IF2A 2DTEA 3G7UA 3F1KA 2NXNA 4IRXA 4XB2A 1BXRA 3KWMA 2J3DA 4C87A 2WFMA 4P58A 3OEED 1AVTA 4FC7A 4K8OA 1NSFA 4L6AA 1J33A 3NPAA 1M8FA 4WA8A 2Z8YA 3EWNA 3ROFA 1D4AA 2I3BA 1XU4A 3BIXA 3DFUA 4QTYA 2PJRA 1JAYA 3K20A 4C2TA 5IDVA 1WPRA 1VA4A 3O75A 2RGNC 1HPLA 2QRMA 1J21A 3IJRA 4KJXA 4B9AA 1EWRA 5IVKA 2J6CA 1J1ZA 3QLVA 3SU8A 3RS7A 3L1UA 6Q21A 3W04A 3W4IA 4DSAA 4OREX 2YHAA 4QPDA 4TMVA 1P5JA 1UH5A 1XMJA 3K1TA 3QI2A 5I7VA 4EVSA 5IABA 1W94A 4G3XA 3E61A 3SMVA 2VKQA 3F96A 3P0FA 1I8TA 5E3HA 2FFQA 4HGRA 1V3VA 1WKCA 4EF5A 1WSWA 1AKQA 3L0SA 3UWSA 5J4VA 2YOFA 4FGKA 2R25B 2WPDD 5CLLA 1J39A 1VJCA 3AM3A 4UQOA 4XOIA 1T1EA 1GFZA 1QH8A 1D6SA 2DCUA 5D6NA 2IYXA 4L2IB 1YJAA 2OMKA 4BEJA 4X63A 5CW2A 3HO1A 3NI2A 2JIQA 1M1NA 3K2BA 3DMRA 4DLBA 2GEDA 2FE1A 4Y2QA 2EZTA 2XWBF 4PZZA 3MTGA 4PR0A 3ZWYA 2LKDA 1O97D 5CB6A 3GOHA 2YCBA 4OB6A 3TLGB 4BQNA 4PPYA 1CF9A 3FZEA 3NHLA 1YQGA 3E3NA 2OHJA 3UMRA 5TQJA 1HKHA 4N8EA 5JFTA 3PU6A 3FBTA 3WQHA 5DHPA 1BHSA 1ORWA 1Y6QA 5EJ5A 2W6JA 4IP0A 1KJQA 1PJ8A 2BEJA 4JKOA 4NENA 1BOOA 1IHUA 3UJBA 3VR0A 4BQQA 3BHIA 1AGXA 1O6BA 5AI4A 3AYZB 3V7WA 5SICE 3VR6A 2BR3A 3VVMA 4ACAA 4CMGA 5K3OA 2FZ5A 2ODQA 3E9ZA 4G0YA 2JI7A 3RIXA 2PGIA 3UC9A 1YDWA 4KVFA 4G9GA 3MOIA 1Z5VA 3B6JA 3AQIA 4MJ7A 1RRGA 3D3QA 4LE0A 4EELA 5JCZA 1JFRA 4FILA 1X1TA 2ERXA 1XF9A 1TM7E 3IUYA 4IJMA 4UAJA 3HWRA 2ZJAA 3OPNA 1O0BA 3G9XA 1JDBC 3FI9A 3BDAA 1PT5A 2WMOB 4UEOA 4DLPA 5I3CA 4GLJA 2BFFA 1IB0A 1QDLB 1HEYA 3S5JA 1JG2A 2HY7A 1FXWF 5I45A 3CNBA 3KALA 4KNWA 1IXRC 2QVGA 4F7WA 1UBMS 3D6VA 1J49A 1C1YA 3TLXA 2XVZA 3SAJA 3OOEA 5ALMA 4ZD6A 3PNKA 3WADA 1XJQA 2YWHA 1YC2A 4X66B 3CZ5A 2DPMA 4G86A 1PV2A 5I5GA 3VO9A 2YUTA 1E9EA 1WIWA 3AHGA 5DO9A 1IOLA 4EQ6B 4CF7A 4X1YB 1NGSA 1RKVA 1EFTA 1KJ8A 3JQGB 4R16A 1O4VA 5I7RA 1Y8ZA 1M66A 2WAAA 3TQSA 1IVNA 3UG6A 4BNZA 1IZZA 2DJIA 1KK2A 2JHGA 1N2SA 1H0RA 2H1FA 1EFHA 2QTWB 2XT6A 2JLSA 2F43A 3DZBA 4JLWA 4Q4AB 3BT7A 3ZGOA 1UP4A 3LQ1A 4LV8B 2CUTA 5LZ7A 3AI2A 4MIOA 1ZGBA 3I2YX 1UOEA 2PL1A 3GFBA 4GBGA 4O4IB 4PNPA 4QDKA 5EKSA 1YKGA 2CNNA 3FF4A 1IWBB 4Y6RA 4IJ5A 4DT1A 1Q17A 4IIJA 5BWNA 3R8FA 2O0HA 2AG5A 2FDRA 2OAQ1 3I4CA 3RVSA 3CLRC 5HKAA 1E2PA 3R2JA 3HMQA 3L7DA 4N8DA 3R6LA 4QG3A 4XGIA 3F73A 1JR6A 5H02A 4WPGA 1PJLA 3FYUB 3LWNA 1XC7A 3PIRA 5ALYA 1YZVA 1CQZA 3A06A 1CP2A 4OHFA 5JECA 1JXMA 3TQIA 1JMYA 2FRDA 4FFPA 3KSBC 2NO9A 2VP3A 3DTVB 5IAGA 1FSZA 1PUJA 1VB3A 1XTQA 4FBLA 2GK7A 3LFTA 5E7MA 1D4OA 4R7TA 3V48A 2A6PA 1M5TA 3T38A 2FZCA 4I4IA 2WP0A 2NP6A 3EFBA 5L3ZA 2XTJA 1SUEA 4EG4A 3PT5A 2RKWA 1A77A 1M9NA 2GO1A 3MRVA 5CU7A 2ZYVX 3U7EB 4GRDA 3AEYA 5FUMA 4S24A 1PE0A 2HK6A 1NOIA 1YBVA 1P1FA 4U1RA 1OBHA 1PJBA 1T0BA 3CKKA 3COYA 1KP9A 3EE6A 3O47A 3PI7A 4MULA 4RNDB 4TYYA 2HA4A 4KMMA 5EJIA 5EP4A 1QM5A 2IPXA 3NHZA 2WIBA 3B6KA 2IYSA 3PWTA 3GROA 4R83A 4B44A 1OXTA 2OHHA 4PAWA 1II8A 3INRA 4G0MA 4KR2A 4C5AA 1SZPA 2VJBA 2J30A 5GWXA 3NVKI 1O9BA 2C2KA 1YS2X 4OO3A 3PJRA 2C2BA 4NIMA 4V1CA 3PR2B 1TKAA 4HR7A 4L5BA 2HA2A 1OQAA 3IURA 3KZMA 4UD6A 1BXRB 4LXQA 1G9SA 3CX3A 2OEPA 3I23A 4RQTA 2QU8A 1WUYA 3H2HA 4KFCA 5FT9A 1O03A 4MYTA 2OUIA 4E7PA 3VC3A 4JITA 3A6FA 2B7LA 4X3CA 4Y2XA 5IJ0A 5F73A 2O5EA 1LPNA 7ADHA 1Q1NA 5EWJA 1Q0UA 2ASVA 4POOA 5IFKA 4AO6A 3FWNA 4EVQA 4JC8A 4OOEA 1I13A 4ZPJA 1YULA 3ICEA 3EVCA 4PBTA 2H9AA 1BGWA 4U00A 3B6IA 1Z62A 4W63A 4NOJA 1JKJA 4NLLA 4EW1A 1WP9A 5C51B 4UHEA 3EXFA 3DLBA 1E1QA 2IXGA 3DV2A 521PA 4YS6A 1D0IA 2ZRCA 3VZDA 4D25A 1KJYA 1BA3A 2IZ7A 3WBKA 1WKBA 3KEOA 2E4WA 2OTCA 2W48A 3WAJA 5CCXA 5EINA 1TM1E 4BMNA 5LM3A 3Q8MA 1GR1A 3ZWPA 4ARVA 1QRAA 5HVNA 3PGVA 2XNKA 2YVUA 4U8HA 3K8ZA 4ZT6A 5DDIP 1V7QA 1VYVA 1XPJA 2ZTMA 3B20A 3WA6A 1QH8B 3SR3A 1L2TA 2OVFA 1YU9A 2ZAGA 1QH9A 2GGSA 4G56A 1R0WA 3U3DA 1QRTA 4X1KA 4R0MA 5T4FA 1M1NB 3I73A 3G2LA 2WV9A 3QE2A 3I58A 4HAYA 3VKWA 3OA0A 4RD3A 2I55A 4L08A 1GNQA 1I4LD 4BN4A 4JENA 3HCBA 4BUJA 3LTEA 1IUPA 2HO4A 3P2EA 3K5IA 3WIDA 5JDIC 4PG4A 3BN3A 5CUQA 4OXKA 1JDSA 3LUGA 4AMZA 1ZD1A 2X6TA 3FNBA 1L7MA 4NENB 3PR1A 4L72A 3JZDA 2OBMA 5JNUA 1NBOA 5COAA 4D46A 2CZGA 1VDZA 2K7FA 4KKXB 2N42A 2WTXA 5EGSA 4KWIA 5A04A 3SE0A 2F48A 2NNWB 3R4CA 3PQ2A 3FW1A 4OLJA 4YMSA 1JEJA 2GZMA 2WJWA 4QTXA 4BBJA 1KJNA 5AXAA 1OYWA 3ER8A 3LKZA 2IJGX 3PSAA 1XZLA 3SKYA 4ZJYA 2HW8A 1ODTC 4HRAA 1KHTA 3UBMA 1KZ9A 2QVCA 3ZC3A 2BFFB 4BMDA 2VRWA 5FLXA 2R0QC 1ILWA 3K4PA 4Q6BA 2RFLA 3TIXB 4MDYA 3ZE6A 1D6MA 1OX5A 1I5EA 3M9LA 1DEHA 2DSTA 2IYLD 3BXPA 3B6ZA 2VR1A 4XR9A 3WY9A 4BMOB 4FFVA 1DBIA 4W5NA 2BGNA 1F17A 4PF1A 4BVLA 4FFOA 2Z4TA 1IONA 1G9TA 2C2ZA 2FSPA 2XB9A 4TRRA 3TSOA 3UJ6A 4BX3A 1VKOA 2E4UA 1I3OA 4MWOA 3WYGA 5MF6A 5B1HA 1LC3A 1Y82A 4GRIA 1CY0A 3EYWA 4QECA 2VF4X 5TS2A 2F43B 4H1HA 1LFDB 2EJVA 4ZDIA 1U0JA 3A6JA 1OZFA 3IA2A 5EJ4A 4IIBA 3QMPA 3UGQA 3EIEA 2X19A 5LA6F 2EWVA 1KVSA 4R3UC 1RSZA 3HA5A 3F1LA 3IXLA 3U4GA 1HYBA 1DRKA 3TJMA 5L6LB 4DT1B 3EQZA 2GD1O 4IIJB 1RLMA 1N77A 5J4LA 1LQTA 3DZHA 2QRLA 3EVAA 4GFDA 3QLEA 4GL2A 3Q3IA 1X1SA 2XUOA 4V39A 1PVDA 2V3WA 3R3XA 2PGNA 2PGLA 4P6VF 3AW8A 3RUDA 4X00A 1M2FA 1E1RA 1FFBA 1KVRA 2IDKA 1KKLA 1RQNA 3GIDA 4Q21A 4LSGA 1M2KA 1ATIA 5JNTA 4TTRA 4DC0A 3L1JA 3TDNA 3ETEA 3DMGA 4LKOA 5DPMA 3UHFA 1VA5A 2VDPB 4H7EA 4YXFA 2Y2UA 4PIMA 1VRWA 4Q3DA 5FLKA 3R7AA 1BMQA 3URKA 4RZXA 1QR2A 1XF1A 4PQEA 1AGNA 1R8YA 1X8XA 1XVTA 2BDUA 3C7CB 3M49A 3QY0A 4MIKA 2TMGA 1KAQA 2I9KA 3DDWA 2V03A 3MJFA 3O1JC 2W6CX 3QBDA 3HNOA 1IEQA 1GVNB 4BQPA 2AFHA 1B1CA 1XDZA 2Q2VA 3B2EA 4EJ0A 1MAWA 1JZSA 1XZDA 1TYEB 5K8LA 5IYZA 4FHFA 4ZYYA 2FFAA 2GM9A 2W8BA 1CCWA 4P9NA 3RVQA 3I53A 3NBAA 4JGIA 4YV0A 5BR7A 1YB6A 1N0WA 2ZFUA 4ZJZA 1F7VA 1Y37A 1II8B 3LBYA 1NQWA 2MSDB 2TRSB 5FUYA 4X0EA 3RVJA 1NVKA 2V7BA 1SVOA 2HF8A 2XB6A 4FNAA 4JLSA 2OBYA 1SG0A 1MJGM 2IEYA 2QL5A 2R7NA 3HA7A 2Q3EA 4TMKA 1IZ7A 2ZYTX 4Q9LA 3Q9NA 1SUIA 1XN4A 3I6BA 3ZHXA 4V1CB 3DNFA 1VPWA 2PXAA 4V0RA 1P62B 2KLBA 4EH1A 3CISA 4P84A 2QI9C 2PE5A 1TUIA 2BMVA 3WWDA 1ISPA 5JI3E 4PWZA 5CDTA 2H52A 4G25A 2VNAA 1LI4A 3HDJA 2RAUA 3KS9A 3PWSA 4K1XA 4M0FA 4YREA 4CT4B 5IJ0B 1RZRA 3OEWA 821PA 1ZYUA 4LWPA 1JHOA 4TOIA 4GL4A 3BHNA 5DP1A 2ZR8A 4M1ZA 3LQ2A 1D8TA 4I5DA 3SQDA 3DZDA 3E05A 3WOVA 4QKQA 1I3KA 4GYKA 2C4UA 3BTSA 4X7RA 4YMIA 4ZRMA 4Q3OA 3ZGZA 2YBDA 1MZPA 3LF2A 3C24A 1XMSA 1Z7BA 4ZCIA 1RRMA 1LRJA 1TZKA 1JKJB 2I0FA 2OV4A 1E9AA 2WBLC 2NSYA 3GLVA 4X9XA 3EXFB 5DW3A 1DARA 1QZXA 1K06A 3BGIA 1AMOA 2IUEA 5A3RA 1DAHA 2VF7A 4Q0MA 2AZMA 4R2JA 3SS8A 1JTEA 1S5PA 2V96A 1GOTA 2QW8A 1J8QA 2XIJA 3A11A 4X97A 3TAXA 1LV7A 1H69A 2CYCA 3EGIA 3H5OA 1NC1A 3KDPA 3MHTA 4X1KB 1E1LA 2BKUA 3QWBA 3F7MA 4JKIA 5KHAA 1JJFA 3VTAA 1HOXA 3F6PA 3GQBA 5K3EA 1GCIA 1WCIA 5GV8A 3DOCA 4JVSB 2DWPA 3B6EA 4Q18A 1KDVA 2ZJ8A 3SEAA 1JRLA 3ADPA 1DC3A 2CJFA 1E18A 3LT5A 4N76A 4KYVA 1RFLA 2VLIA 3NYQA 3KJIA 4MKXA 4ECAA 3MWKA 2XZLA 4N5LA 2I99A 2WM2A 4DWWA 1UZLA 4F85A 2H9YA 4UVEA 4D3YA 4DM3A 5AXDA 1LLDA 5H4GA 1NIPA 1R4NA 1DVRA 1JSXA 2QL6A 1OHHA 4FZ5A 4L7VA 4BUZA 4F38A 2UAGA 4NICA 2GUWA 2AFHE 1ORHA 2H5JA 2PA0A 4HYTA 3VPCA 1ETHA 5CVVA 4DQKA 1T6BY 4KWEA 1REQA 1E2LA 2OM6A 1SZCA 2ZRNA 2YZNA 3C5WP 3PENA 2DKOA 4D4KA 4ZI3A 2J7PA 4GDFA 1F9AA 4TYPA 2A9QA 2IELA 1KJ9A 2ID4A 3SZUA 4DG5A 2XF2A 2G1KA 3IHWA 1E58A 3KPVA 4FSDA 4RMNA 1Y3DE 5E1MA 2CUZA 4M9RA 4A8JA 2O0JA 5IM4F 5BOSA 1XSEA 2XDWA 3KFLA 3O5AA 5A5EA 2YNMD 3U9SA 1I0ZA 4C78A 1WDLA 4ETNA 3EWSA 2YIMA 2BFEA 2DQ4A 3EOBI 5K3DA 4M37A 3ZGXA 3HYRA 3PYLA 1YIOA 4KAXA 2PGDA 2B9VA 3TLZA 2DHQA 4TSKA 4O2LA 2H11A 1A95A 1RZ3A 3O1HB 4FXOA 2XAUA 4O63O 4HGOA 5JC8A 3WYDA 3FUXA 1XMVA 2JARA 3FKSA 1NP7A 1ZICA 3LCUA 4YVFA 3VSBA 3PJDA 5TQ2A 4DA6A 4HUTA 3T5AA 1KOJA 1OC2A 5BY2A 4MPPA 1KI6A 3O82A 1PZFA 4I55A 1EM8A 2PKXA 4DMCA 4LBWA 1C1DA 4AMYA 2NTYC 4RVDA 4MUKA 1I3CA 3OCYA 4ZO6A 1WDWB 4R2IA 5ALQA 2E49A 3JZMA 5BNZA 3UOAB 4DUGA 4ZA2A 3C7AA 1BWQA 3DEHA 2WJIA 4FEEA 4ZDWA 3RYFA 1PW7A 4DMGA 2VTEA 2Q28A 4JUDX 3B8EA 3KKOA 3PPIA 4ZYLA 2D7CA 4W99A 2IBTA 2HCRA 2WB4A 2ZIVB 3EARA 1Y5NA 2QL9A 4YCNA 5AFSA 3UHAA 2F9FA 1DKOA 1OFIA 3JZAA 2B1JA 2W2PA 5CP8A 4BE9A 5LWHA 4H1TA 4F12A 4GE3A 1V9SA 2A67A 2JFYA 4BE4A 4D82A 1T15A 2AFHB 1FDRA 3DWIA 4GXNA 3EMDA 3GP8A 4EPWA 2RBKA 3SXPA 5BXYA 4LEIA 2X0KA 4QTTB 5IYZB 2W8BB 3P2OA 4Z99A 3UG7A 1OA1A 4EFKA 1CUCA 3L6RA 3RSFA 2H1WA 4QNRA 3ED1A 1N32B 1PL0A 1OLSA 1W34A 2A0YA 3CX8A 3IR5A 1M8GA 1RMTA 3O92A 3G0CA 3AUTA 3P9PA 2IP2A 5EIBD 1P18A 1AD2A 3IVAA 1RE0A 1AZSC 3QJYA 3ZLJA 1SG6A 4AJIA 5JIBA 4BFUA 1C81A 4V0QA 1EWKA 2B37A 1X0XA 2PAAA 1Y9DA 2UYOA 3RG2A 1VLHA 2EGHA 2VYFA 1XTVA 5AJUA 3LL4A 2LP4Y 3DDOA 5JQWA 1QGOA 2XDAA 4UEQA 1N5RA 2W2MA 1DE0A 3HDGA 3RSHA 2R86A 5FNVF 2CYBA 4DBLE 3IBFA 4HWRA 4ZARA 3EPJA 4XFJA 1U9CA 3QXHA 1P3JA 2HNBA 1LW6E 2GAFA 5JEDA 1HQDA 1NZDA 3VBCA 5B58C 3BWXA 3H42B 2DY1A 2D2XA 3DHEA 2C4MA 2V59A 3L07A 3UATA 1Y9AA 5NLLA 2EBWA 4KPEC 3A4YA 4YRZA 4YUZA 1QB7A 2CHVA 3DAGA 2NO1A 4LXTA 3KEMA 4QULA 4IH9A 3FMOB 4F4CA 5CRIA 4KL8S 2XECA 5DGTA 1QRRA 3U3JA 3OQBA 1YC5A 3A6LA 4EYOA 1SU8A 2IEIA 1YZGA 1YZHA 3ZE1B 5AUPB 2W37A 1BE6A 1XDSA 1WB4A 2FLKA 4HDOB 5JWHA 5JADA 5DU2A 2Z6QA 1ZJ5A 4FP9A 3UT6A 1Q7GA 2JJ1A 4CMHA 4QBIA 4MW7A 1Z6YA 4DLYA 3QM1A 2B69A 1X1DA 2V7VA 3MJ4A 1CU1A 3BB4A 3RGGA 1RYDA 5KVQA 4AVYA 3LNCA 3KPJA 5TMDA 3EISA 1UIRA 4R2LA 2OO5C 2ZSEA 3AL3A 3GQBB 3KKNA 4MV8A 1NUSA 1O7JA 2J32A 3VKHA 1WCIB 1U2TA 3AFIA 2X7HA 4ZC8A 2EKQA 3E2IA 4AUNA 2PO7A 4K26A 4PLVA 4TM7A 5K9ZA 1UIMA 2ZETA 5JS2A 1B3BA 5B12A 3Q2IA 5K0CA 4FR0A 1T9CA 4H15A 5KJ1A 4OV6B 4X54A 1SHKA 3TX6A 1OB5A 4Z0PA 3UQZA 3UM9A 3E9CA 3ANYB 3QZUA 1MH1A 1MHPA 2JIZD 2BEKA 3AHCA 1ZU4A 1R4NB 4H1VA 1GXSA 3GDGA 3J7TA 5J3JA 4YRAA 1TUBA 2NXJA 1V3TA 5CNJA 2R5WA 1MOQA 4RF5A 1B1AA 2JJYA 3MGAA 3NR2A 5DOVA 4BNIA 4DDWA 5HOQA 1EFVA 1REQB 3FPJA 3DTTA 1AQNA 1P7VA 5EIWA 1XK6A 4LISA 3LGSA 1EVIA 3KQUA 1MTZA 1RI4A 1DIBA 1T9DA 4FEAA 4JR0A 3NFYA 4QFDA 3Q7SA 3WR5A 1USUA 4JOSA 3ZWAA 5ELXA 1R9GA 4I8DA 3ZGNA 3AVUA 2QQ0A 1SEVA 4H7KA 4A8JB 4B83A 4LOAA 5B1EA 3TLCA 1H5UA 3BS4A 5BOSB 3FVVA 4BZXA 1DRWA 4RK7A 1Z6PA 3SJZA 4ZYVA 2QXYA 2BFEB 4MUYA 1YDFA 2OY0A 4FNOA 4NG5A 3WNZA 2MSEB 4C0JA 4IGFA 1Y3CE 3LCVB 1YRLA 4D9JA 3EWIA 4J1NA 5JRJA 3USZA 3W1WA 1A9TA 3BOSA 4KVGA 3SM3A 4DG8A 1EJ2A 3QGMA 4J1TC 3REQA 2ENUA 3GP5A 3I9NA 2FB9A 4IMPA 4CHGA 3ZWVA 4AO8A 3CVVA 2ATIA 3NGMA 4HPJB 5LLTA 2PFKA 1YCDA 5G53C 1NRJB 3H6KA 4PIVA 2Q4EA 1TJPB 1PLKA 2D3WA 1RMQA 2CXUA 2IOYA 4KE9A 3D81A 5TQ2B 1KI6B 1GFWA 2NLOA 4I55B 5HRUA 1NE2A 3F5SA 2X3FA 3CKLA 1EM8B 1OH5A 3NM5A 2GARA 4ZODA 3KQSA 5EZ5A 1C1DB 2CHGA 2NSJA 3AB3A 1AKUA 3NOVA 4M9UA 3VPDA 1OTHA 3HU5A 4EHBA 1ECFA 1TM2A 5KJ6A 3K71B 3CPSA 3CXUA 1SHLA 4TKUA 4ZVTA 5KSYA 3TOZA 3FWHA 3ORHA 3COPA 3RYFB 3DEZA 4TTTS 4XDZA 3LU1A 1KNQA 4GPZA 3U7FB 1W2GA 3UJ7A 2DZDA 2ZBRA 4NBTA 1UC4B 1YQWA 1C9EA 3F6EX 1FW8A 2FPKA 4JFRA 4ND3A 2W4IA 4MW5A 2EW1A 1RJ9A 2R00C 3E1GA 4YMVA 3DCJA 4JFAA 2O1SA 1ZA1A 3A70A 3TTXA 2Q3FA 5G0WA 4B09A 1E6UA 1VHJA 1MXHA 3ROTA 3WSWA 5CCBA 4TLLB 4BZQA 2JIPA 4GSLA 3Q3HA 4DY6A 1YR3A 4CMEA 4AU1A 1R4MA 2HA5A 3G8DA 3DWGA 3IODA 1DUSA 3PTZA 4QO8A 3HPQA 3PPXA 3W9UA 3ZVKA 3G0GA 1XQXA 1K8RA 1QIJA 2VUUA 4N18A 4H18A 1TMYA 3OURA 1OLSB 4I08A 4JHLA 1BX1A 1TPZA 1US8A 3NBKA 3KT6A 1T9GR 3RTBA 4KVZA 1M2WA 1L8QA 1YNSA 4I8XA 4Q1DA 3RFFA 1UJCA 2IBMA 3EGXA 1TA9A 5AI0A 1UBNA 4G2NA 1KY4A 1GGNA 3LDHA 2VQSA 3VZBA 1W48A 3ZLBA 1YCHA 3JQBC 3HJTA 2A5YB 4M98A 4RFLA 4WBSA 1DBPA 3RRZA 1TB4A 3NAZA 2KBFA 1UODA 4PE5B 2IP1A 3R5FA 1JLSA 2HA6A 1GG8A 2BF7A 1BDJA 3FMGA 3AY0A 1Y5LA 1S01A 2I29A 4MZXA 4Q12A 3TR0A 1NJGA 1GTJ1 3P94A 3RNOA 2I3ZA 3WISA 5DM0A 2WIAA 4UTVA 5JSUA 3QSGA 2P69A 2GCGA 3WRXA 1H65A 4GEGA 4FINA 4FFRA 4C4PA 3ND8A 3AY3A 3A6GA 1HE8B 4DCMA 2PLFA 4FFDA 4G0PA 3ZW9A 1ZN2A 2F1RA 4OL0A 3KE8A 3N2IA 4Q24A 4EJ6A 3GK3A 1PJSA 3IDSA 4JI6B 4B3XA 1ODFA 1IAVA 4C4TA 1R27A 2K7ZA 4L9RA 4EAQA 1W5SA 2CLEB 3A36A 2EQBA 2GNOA 2PNJA 1L4YA 2BCJQ 5ALDA 1KWKA 2Y1EA 2HWUA 1R8XA 2WILA 1LVGA 4B81A 5BWOA 2BFOA 4J2TA 3RKUA 2Q6OA 4HTFA 4H7JA 1WPGA 1R00A 1FY2A 4AJ4A 1QCDA 1FB5A 1IQPA 2BFNA 4KIUA 2GXUA 4ZU6X 2W6MA 1HDIA 2IS1A 1UF9A 3A6KA 5CT8A 1ZRNA 2APJA 2XD4A 1D2AA 3SKXA 1QJ4A 4J4HA 1SOMA 5C81A 5JRZA 1ISMA 2CDCA 3A3OA 3PD1A 1JIVA 2V0CA 2PANA 3A3KA 4R40A 2EHJA 1SIOA 1TQDA 2ATEA 3OHPA 1OV4A 4MRAA 4QHSA 1VZ2A 5FEMA 4BLWA 1QMGA 4UOEA 4MRSA 3SR4A 4ZO8A 3V80A 3HDHA 3KLOA 3R0VA 1NATA 2O7RA 3DV9A 2DBRA 4DR3B 3PDIA 5KC9A 3GAZA 1V43A 4E4RA 1G5HA 4KQHA 4TTAA 3EC7A 3JWHA 1GXSB 4IXDA 4R9RA 4Y0NA 3TO5A 4BRSA 1V5WA 3QG1A 1J07A 1F60A 3IS3A 1TUBB 1X87A 4JGGA 2GOYA 5ALLA 2H18A 2QJWA 2WSYB 3DMHA 3R7NA 1CDZA 1XYGA 3ZTWA 3P27A 1YE8A 3UMSA 1EFVB 4NFLA 5HILA 4M3NA 3KC2A 4QOGA 3KPUA 5FF9A 2MSWA 3HJNA 3AL0C 1O1YA 3F7OA 4WK6A 5D01A 3LIIA 3RRJA 3UXYA 2IUYA 4MI9A 3RDPA 3EEOA 1FJHA 3WGVA 2EX4A 4CMCA 2Q27A 2W43A 4Q7QA 2F6RA 1YBFA 4J2OA 4AYWA 3HEBA 1K0UA 3HABA 4YASA 5HIMA 3T1HB 1L1EA 2JFVA 2X42A 3HBLA 3OSUA 4LRTB 3W2FA 4BN5A 5JXIA 2R8BA 2BRUA 1VI2A 3Q41A 1S9HA 1SFRA 3NPMA 5HG0A 1ZGAA 3IQGX 1GPWB 2YR0A 1DG3A 3WX0A 3ZE7A 2YRFA 3JYOA 4JJGA 5GM2A 4HNQA 4O1MA 2CBGA 3REQB 2ZIAA 3TR5A 1EIWA 3LDFA 3JRWA 4DGSA 2E4YA 2HMAA 3II6X 3P9ZA 1CIJA 4CIXA 3QYAA 2QSZA 1UJ6A 3DOUA 5CT6A 2BTEA 2RHCA 4LXGA 1OA0A 4Q37A 3AXTA 1E9SA 2FGJA 3D43A 1DELA 1GPH1 1YB2A 5KJEA 4YV7A 4QGSA 1R6AA 1PBNA 2XQFA 4J6FA 4RE6A 4R54A 5GONA 4N3CA 1ESCA 3KAPA 2WUDA 1I3LA 2VH1A 1DHTA 1W44A 3LY5A 3PFNA 4LVUA 4TKUB 3DUFA 2E89A 3DDNA 3C6BA 3FJ1A 4KI7A 3F9IA 3QVKA 4TTSA 3V8PA 1TZBA 4BWFB 3AM4A 2XV1A 2ZYUX 4E5MA 5ITZA 5M34A 8OHMA 3X2FA 4EX6A 1KAEA 1JDJA 2PH7A 2PKEA 4D4GA 5JMTA 2CMHA 1QV6A 4QHYA 2BGGA 1N6RA 1XA3A 2WJYA 3C74A 2OHXA 1NWCA 3UOWA 1RJ9B 2YJ6A 4AWBA 4CFZA 1CJCA 5SZJA 3K8QA 3A1UA 2C54A 1KBOA 1RRPA 1Z25A 4EPRA 2NUBA 2VRBA 3AB7A 2JCGA 3N6XA 1EHYA 3V33A 3OZDA 1ULUA 2OE2A 3K4HA 4LGVA 5FUXA 2LVBA 5A4MS 4L4UA 3KAJA 3KTAA 4XIFA 3RIEA 1R4MB 4LZJA 3PP8A 4FB5A 2DWUA 1ZWKA 4X91A 1DAFA 4B43A 2Q6LA 1QYVA 1THGA 4PFJA 1QGDA 2WNSA 4F04A 1JEDA 1GQSA 3HXOA 4PLFA 3S2EA 4A10A 4JROA 1XK7A 1US8B 1S2NA 2C1ZA 3HN6A 2YIJA 2Z04A 2YWRA 3EMKA 4MW2A 5ES4B 1U8TA 4AYXA 4PYKA 3EGXB 5G1NA 2BEWA 2VCHA 3L4SO 3NHMA 3S7ZA 2XR1A 1NKVA 2YXLA 4N5IX 1CNEA 4FYXA 4HB2A 4Q7LA 4A0GA 5JHGB 2JAWA 3U37A 3ZY3A 1Z4LA 1N6IA 5EIXA 3NWEA 1VIVA 3QUAA 2JGDA 2EFYA 5HKBA 4KX5A 2I6GA 1DJQA 1IIBA 3RFCA 3B3QA 4BV8A 5GVRA 3ZI4A 4NSNA 4OF4A 4K9QA 3IDFA 4OCZA 3FPFA 4JZYA 1FFDA 3IUBA 2QTBA 2QD4A 3WLLA 3ISTA 1GGMA 3A6EA 1L5SA 4HRXA 2DMRA 4YACA 1XRSB 4WJKB 1QTRA 1RADA 2ODPA 4UFNA 3KKLA 1DKQA 4Q1AA 4R31A 1CQWA 1U3VA 3CHYA 4HNUA 2X0IA 4ND1A 2GM4A 2W6OA 4YAOA 1OKKD 5HJEA 1YNOA 4L5CA 1TL7C 1OWMA 3KHSA 4HTFB 4WFKA 5LOVA 1Z8NA 1PTJC 2P3OA 2CDNA 4UUNA 4NKRA 5FLEX 3EW7A 4B82A 4HD8A 2QLBA 3PXUA 1G8SA 1QZUA 3A26A 2ZWPA 3K32A 1DQNA 1IZ8A 5KPDA 3CFYA 1TD1A 4PXAA 2HHJA 1J2YA 2EIXA 4ZVVA 4B8WA 4EMUA 2ZYHA 3P0IA 1N3YA 3UCEA 2FR8C 4P7KA 4FOSA 1X1RA 3FWPA 1OB2A 4F2HA 2B1IA 1QG0A 4S1PA 4RMGA 2JI6A 4IL5A 4ATNA 2HXYA 4US1R 2AXNA 2A1TR 1F2DA 1G3IA 3AJ9A 3PDIB 4FBGA 1J5PA 4HLUA 1TZJA 2I8CA 4GI7A 4DTCA 2JIOA 1GFIA 4NOMA 4A2PA 1KKMA 1ZUIA 1XZ8A 1X2EA 1W5TA 1ZH6A 2XZDA 4S1TA 1GADO 1OIWA 3FCUB 3HR4A 4EVRA 5JQGA 2HOQA 1NU8A 1XP5A 1DXYA 3UHPA 4GVLA 1BS1A 3CO0S 3D6HA 1Z4IA 4OJTA 3E22A 4HAXA 2Q9UA 1ID8A 3F49S 2XF8A 1VMDA 3ET5A 4C04A 4OXIA 3T9BA 1G8JA 3G2PA 1JDUA 1VE5A 2J9ZB 1DC4A 2IUTA 1EM6A 4CG3A 3CF2A 4XUGB 3WWPA 1RWMA 3VKVA 5CB4F 4R1LA 4EL0A 1JFTA 4V0ME 4EQZA 5BORA 3JZIA 3OCCA 3BK7A 5JAQA 1U81A 4GMGA 1TA0A 3KDSE 2YRXA 1JU3A 4S2UA 3HJGA 1S7GA 1WOYA 2FETA 2J59A 2REQA 3ZGLA 1QFSA 1J8DA 4K6KA 2JZNA 3MILA 4QUBA 1MT3A 1NW6A 4FFSA 1HE2A 2NGRA 3STTA 3QFTA 1PFYA 4KO3S 1GT91 2DJ5A 4P33A 3G23A 3NP7A 5AJXA 2A33A 5DBOA 5C5EA 1RM0A 4TV9F 1QF6A 3HDYA 4M21A 3FDIA 4OHCA 4EA8A 5LZ2A 2FLVA 4NNOA 2TYSB 1FFYA 1WMAA 4AK9A 4EWLA 3DYIA 1M7BA 5HZHA 4OI1A 1A7KA 2GKGA 4PO8A 4F9EA 3H5VA 1W8IA 3OPMA 4CR8A 1WM1A 3DL2A 2VAXA 2QTLA 4YP7A 3WHLA 3A05A 3I4LA 5KTPA 3DEIA 1Z08A 1CWUA 2HA0A 3OQOA 3QHAA 5A3QA 4TT3D 1WU8A 2MJLA 2YDYA 1NN5A 3AU8A 4DAEA 5GONB 3U7JA 1RPTA 1N78A 3ZVRA 1W8DA 4GW3A 3O2QB 4AL4A 5D1HA 2IXBA 3DUFB 3G1UA 4XYGA 4LJ8A 4CCWA 1LTKA 4WTOA 4TMXA 4TTJA 4FYYA 4LZZA 4CKXA 3JD1A 4QQKA 2E4AA 4QNMA 4F0JA 5ITZB 1Z45A 3T5PA 3OQIA 4HV4A 1E94E 5DOZA 3S99A 4Q6WA 1G2OA 2FWIA 2GVNA 5SZIA 2VNIA 4NAHA 1HTWA 1NVXQ 3HE3A 1NX6A 3FWZA 3LHIA 1QG2A 3DE7X 4PNZA 4RJTA 1KZGB 1ZFNA 4YJHA 5ICCA 1MB9A 2A4MA 1JHXA 4U7HA 3GRCA 2IU3A 4IG9A 5AW5A 3A4VA 3OZWA 4U2BA 1O96A 5FL7D 4NYMQ 3KTAB 1AKRA 3DH0A 3MTEA 4GLFA 4XB1A 1NNEA 1KE2A 5ITSA 3AW9A 2GZRA 4B4OA 4NI5A 4YT8A 3I2GA 4RYLA 4AYTA 5LQKA 4QQRA 1XJ5A 2H63A 4JLJA 3UENA 1RP1A 3CNOA 4IDEA 2YXBA 5D00A 5T6MA 3HU1A 1L5NA 2J87A 4ZZ3A 3MSXA 2CLHB 3EW9A 1C4OA 1SOWA 2DR2A 2BGTA 1TCUA 2WOJA 5T57A 1KTIA 2ZBUA 2BEWB 3NIBA 4CN8A 1OPRA 2EG9A 2BDTA 4QOSA 1VPEA 4TKZA 1R5NA 3WLIA 4HWPA 4QPPA 4YQYA 1M7GA 4W82A 4W6ZA 5CX4A 1F06A 2I6XA 3HY3A 3WL4A 1Z6GA 1OILA 2JGDB 2WRZA 3L6EA 3WDLA 1SKMA 2F1KA 5GMOA 3WB9A 5JSYA 3WBFA 3AIMA 5CGQB 4UASA 1X1EA 4EJMA 3FCOA 4IX9A 2ICAA 2HPAA 4D3DA 1R16A 3DHVA 4DUPA 1IJFA 5KEIA 3GLGA 1ACJA 1GDDA 1PX2A 3V4FA 3R8CA 1U0LA 2BLLA 4WCVA 2GJAA 4QUIA 2BFDA 4TTIA 4BLTA 2QNIA 3AM1A 1KO7A 3OG9A 2B5VA 3ISVA 1ODLA 3R0XA 3WMEA 4BECA 4MVCA 4D9NA 2XVYA 2IYVA 2W11A 3UV7A 2G80A 4WGFA 1IK4A 5BUCA 2QLNA 2ODTX 3BWEA 3I6YA 2Q0SA 2FMIA 3FRIA 1MABA 1J2TA 1MJFA 2PMCA 3O74A 5LOVB 5E3JA 3ADCA 5FA5A 4ZIRA 5HKLA 4OU5A 1EEHA 2LKCA 2QQ5A 1JXOA 5GZ1A 1GU0A 4EM6A 1YAHA 4EHIA 4HC4A 4GYJA 4A5SA 5J4KA 1N5LA 2FHPA 2QJTA 3P0EA 4XIIA 3UK0A 4JBXA 5EJ8A 3QPUA 3FNFA 4LN1A 4J90A 4C14A 1FZQA 4DEXA 4PZYA 3RT7A 1ZY2A 3UB3A 2FSGA 1TO2E 1LJUA 4RK4A 4LZPA 1XZBA 3ZV6A 4QQ8A 5FA6A 1OZ0A 1L5LA 3SBOA 4N12A 2D8AA 1VLZA 1BHQ1 2CSXA 1XA4A 2BW0A 3DLPX 3CZPA 2WSSD 2GN9A 4A1OA 5K01A 4IFIA 2A5FA 2Z2KA 4ID3A 1CS4C 4FN4A 3SZGA 5JQGB 1BWPA 2GBCA 3H2IA 2E55A 5B1DA 2WUGA 1GNPA 2IPMA 5HIKA 2FPWA 4AKEA 3ANSA 1UWKA 3GD5A 1SMKA 8GPBA 5HZKA 3E22B 1LUAA 3OLZA 2GA8A 3RYHA 4NDAA 3RSLA 1U5AA 3CSUA 3QKIA 4IMRA 2Y66A 4NCAA 1KHHA 5C8DA 4CUJA 1WXGA 1UMBA 3DKRA 4N7JA 2COEA 1BWSA 1ICEA 4L0DA 1ZNWA 3MCUA 3QV1A 4R1MA 2NTEA 1F2UA 2ZDQA 4X24A 4Z1MA 3FAKA 5IUJC 3AF6A 1QWSA 3D0QA 3DM5A 1CUDA 1NQUA 4QDZA 4C5CA 2REQB 5BNWA 3LOPA 5EJMA 3BORA 3ICPA 1GNLA 5HFNA 5LDDC 4YCSA 3ZCQA 10MHA 1KMIY 4DNPA 4EUHA 2VDLB 1ORRA 3IH5A 3R77A 4TRNA 2VHZA 3AWDA 1BTOA 4G9BA 4RVSA 1HA3A 3HMKA 4QXRA 3UJ3X 3OPVA 3CM0A 3ZXIA 4X1OA 1C2YA 2G72A 2QHXA 1WBDA 5MHTA 2B8WA 3D2CA 3Q0IA 2XADA 3ZHZA 4EEXA 1AXGA 3GLGE 3DPSA 2OXIA 2EWWA 4OA8A 5KC8A 1JI0A 2X6QA 1G2IA 2RIRA 2ZCUA 3K9WA 4AJ2A 5C8ZA 2VT3A 3GIWA 1F7UA 3CEMA 2X41A 1CJBA 1QONA 1X3SA 2BVNA 1SUWA 3FLBA 5JZVA 4M0UA 4B6EA 4YRMA 4GT1A 3A1FA 4MH0R 3U7GA 3OCVA 3PK0A 5KU1A 1MD9A 3PE3A 2C2XA 4PAGA 4IHKA 1XEWX 3NNSA 4O0LA 1UJMA 2FEWB 3BXXA 2V7QA 3IGFA 1I9GA 4MGYR 4AZSA 3CN9A 1N8SA 1PJQA 3T1YB 3BA6A 3OQIB 4YTEA 3F9RA 4BMZA 1ZESA 2C4KA 2NT3A 3BDVA 1P80A 3FM9A 3VDNB 2AQIA 2YVKA 3W1VA 4B34A 1M6NA 2WIKA 3ZX4A 1VHQA 1ADBA 2A9PA 3TBKA 5BVGA 1GSIA 2PRYA 1E1DA 4EG7A 5EMJA 4HAVA 3ZV5A 4YJHB 5JD5A 4FW9A 3WI7A 2YFQA 3COWA 4L8WB 2A58A 4DQLA