1IUNA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
ANLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords meta-Cleavage product hydrolase
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iunA00
3WJ2A 3ED1A 4J0CA 2P8SA 3H1BA 5AM0A 2QT9A 3AZQA 3L1JA 1YASA 4KYVA 1AZWA 2Z3ZA 2XUQA 1BROA 2WTMA 4LYDA 4ZI5A 4MXDA 5EGNA 5J3JA 3V1MA 3PICA 4Q3LA 2RAUA 5AI9A 1EVEA 5FLKA 4KJXA 5CURA 4BRZA 4M0MA 2VAVA 5JD5A 4BTLA 2XQKA 3R40A 3B3QA 1CUWA 3O4GA 4WY8A 2R8BA 4X91A 1UKCA 3KDAA 5IVDA 1TIBA 1K63A 1HKHA 4FKBA 5H3HA 5HK8A 5LYYA 2OCIA 4FLMA 1UOPA 1WB4A 5E4YA 5BOVA 3TEJA 1CVLA 1J06A 4J0JA 1MT3A 4MEAA 3HSSA 4OD0A 4Q1VA 1CUVA 1QO7A 2XUGA 1Y7HA 4AN1A 3H0CA 5AKJA 2HA5A 1R1DA 4CG2A 5DTJA 1A8QA 3DKKA 5F4ZA 2WG1A 3STWA 2ZYRA 1QIEA 4QLAA 1XZFA 3F9CA 1IVYA 3STYA 2VJAA 2AJ8A 5C8XA 5JARA 1YS1X 5D6OA 1QIMA 5JIBA 2HFJA 1CUHA 1N5MA 3DEAA 5DNWA 1CUEA 2Y1KA 4CCYB 1C7IA 4C87A 4JEIA 4W63A 1JKMA 1XZBA 2ZSIA 1XRNA 3C70A 3FWHA 1QIHA 3MUNA 1UOQA 4H7FA 4X3CA 5CT6A 3I28A 4QE3A 3AIMA 1Y7IA 3DL7A 1MJ5A 1QIGA 3W9BA 3C6BA 5I8PA 3DCNA 3FLAA 3WWPA 1SCKA 5KWIA 5JAHA 1ZGBA 3EIOA 1GKKA 4OB8A 2QTBA 1GQRA 5EHZA 4DGQA 4MEBA 4J0DA 4BCBA 1AC5A 3R3VA 1FSSA 1EDEA 3U1TA 1EX9A 2O2HA 5HQ3B 5EI5A 4Y2QA 1Q0ZA 1L7AA 3BWXA 2J3DA 1CLEA 1GGVA 4CIBA 5AKYA 3C6ZA 4FBMA 4BVJA 2WIJA 2V97A 2XUHA 4BDSA 1EVQA 5EHNA 3VVLA 3NWOA 1TKRA 4AQDA 4X6XA 3F98A 2LIPA 4MWSA 5EHXA 1EDBA 1NX9A 2BUAA 3I6YA 3DS8A 2DHDA 1CUYA 2AJBA 1YCDA 2X76A 2OCKA 2OAEA 4J0HA 1WB5A 4B85A 5CXUA 4X00A 3NOXA 1L7RA 2PL5A 1SFRA 3I6MA 4G5XA 4WFKA 4IH4A 5IKXA 1DU4A 2K2QB 3W06A 1H2XA 2QM0A 1HL7A 2XUPA 1YSCA 2XMQA 1SCIA 4L0CA 4N8DA 2YXPX 4X97A 4H7EA 3JW8A 4EY5A 3KD2A 2PSEA 4PO3X 1IUPA 1UXOA 2RIPA 3A2NA 3DLTA 2RI6A 5AO9A 3DJYA 3EBLA 4B81A 1QIIA 1U2EA 1ZOIA 5FKJA 4QDXA 4C88A 4K6HA 4EY4A 2DQZA 1H2YA 2WIFA 2ECFA 1WM1A 1U4NA 3ZLUA 1VA4A 3OOSA 5AK6A 2C0QA 1E89A 4KR0A 1TRHA 3SC2A 4FNMA 3V1NA 2HADA 4JUIA 5EFZA 3ICWA 5HFNA 1E8DA 3Q0TA 2WIDA 4E14A 4D9JA 4BC0A 4G4JA 1GPLA 2JGJA 4H77A 1QE3A 3H2KA 2V98A 2XUOA 2WUEA 5FPQA 3F8SA 3U0VA 5KWJA 1BU8A 3R3XA 3RK4A 1H22A 2GYVA 2EDCA 4W1PA 1W76A 5AICA 2VTVA 2RONA 3E0XA 4QNNA 1XZCA 2EEPA 1ODCA 2J3QA 5EIAA 4GWLA 3AIKA 4GECA 4UHCA 2G5PA 4PF1A 5A7GA 5KREA 1VXRA 1WPXA 2BFNA 2I3DA 3OTQA 2XQIA 1CUDA 5AKLA 2CZQA 4FHZA 4G9EA 3QMMA 3G0DA 5CH3A 3L1HA 2CBGA 3SWWA 3W2TA 3PI6A 3I2FA 3ZI7A 1D07A 2D5LA 4IH9A 1LZLA 1QO9A 4Y7DA 4PNZA 2PUJA 2JEYA 3H2HA 1XRMA 2ZYHA 3QMWA 4UHDA 3PF8A 4GBGA 4JYPA 4LHEA 2CUTA 3WJ1A 3C6XA 4BRSA 1VXOA 2ES4A 3EQ8A 1BEEA 3ICVA 1A7UA 4FLEA 1CV2A 2ROQA 4WDQA 2XUFA 3FBWA 2OAGA 5K3FA 5ALRA 1IMJA 2WG0A 4KE6A 5ALXA 3I6ZA 4F21A 1MNQA 5T4BA 1BCRA 4B6GA 1W1IA 5ALNA 1CQZA 2YH2A 3WKCA 5K3EA 4XVCA 1XKLA 4Y2TA 2W22A 3FYUA 3IBTA 4P9NA 4F5ZA 1BCSA 2Z3WA 5CMLA 2PSDA 1JJFA 1MNAA 2OCGA 4LXGA 1CIJA 1CUJA 2GBGA 3WMRA 2WHRA 3V48A 4Y2SA 4KACA 5HF8A 1LPAB 1FFAA 1PFQA 2E3JA 1R50A 5JD4A 2G5TA 1YS2X 4EY8A 3O4HA 4DNFA 1ZGCA 1B6GA 1LPBB 4BYMA 4YX9A 4QLOA 1QONA 3STTA 3D5EA 4W1SA 1JMKC 2WTNA 5AI6A 3RARA 3WI7A 5AK3A 3D0KA 1JU4A 5HKBA 4ETWA 4LXHA 4QDTA 4C4ZA 1XQXA 4PW0A 2VJBA 3WL8A 4J3JA 4FLFA 3KXPA 3G02A 1QTIA 4S0XA 5AI5A 4BAGA 3UMJA 2RGUA 3C5WP 5BV7A 5HKAA 4XJVA 1ZIYA 3WK7A 5EIHA 1M33A 1WPRA 4UBIA 4WDRA 4BZWA 4B84A 3O0DA 3OM8A 2O2GA 4DSZA 1W4LA 3DDUA 3BF7A 4BE9A 5ALEA 4G4IA 2XE4A 1W52X 1CEXA 4ARAA 1QIJA 2GBFA 4X95A 4NZZA 3D59A 1HBJA 2FUKA 3GA7A 4B83A 3C6YA 4HVTA 5A62A 1CQWA 1UK8A 3ZWQA 3HACA 1EXWA 3H04A 4OB6A 3PUIA 5SYNA 5HF5A 1ZD3A 1W75A 5CT5A 3GZJA 4E15A 4CCWA 3PF9A 2Z8ZA 2WFZA 3D2AA 2G4LA 5AM2A 2WSLA 5LZ8A 3WA7A 1R3DA 5AI0A 4OSEA 3H2JA 5EIEA 4KAJA 3QM1A 2FX5A 3WQHA 5FUMA 5ISMA 3OPMA 3LP5A 5DYTA 2WJ3A 5AIAA 2ZJ6A 2WFLB 4H7JA 2CB9A 1B41A 3FYTA 2WU4A 3CN7A 5ALHA 4ROTA 1CFJA 1HDEA 1ZD4A 1VLQA 4WJLA 5SYMA 1J1IA 3RM3A 2XUAA 2Y6UA 1DT5A 1Q0RA 3BIXA 1XFDA 4BDTA 4HXGA 3VDXA 3WWEA 5AM3A 2DCMA 4KE8A 1G42A 2YYSA 1XZGA 3ESDA 4U2CA 5BWCA 4HTAA 4K2AA 1ZJ4A 1MU0A 3LIIA 4DYHA 2VF2A 3I2KA 3G0GA 1VE7A 4ITVA 5HZGA 2HA6A 2QKYA 1DX6A 5FXMA 4H7KA 2V96A 1W6RA 4EUSA 5DWDA 4FBLA 1QIDA 3IVMA 3WKAA 4NS4A 2B9VA 2RHWA 4DSAA 4MQMA 2GBCA 4W1QA 4CG1A 3EQ7A 4QDOA 3G8YA 5JZ9A 3WWOA 2BUCA 1O6FA 1C7JA 1VE6A 1G4HA 2B20A 3HLKA 5E2IA 2H7XA 3CXUA 3FOBA 4L72A 4X90A 1USWA 2OLEA 2XT0A 2O7VA 3R3ZA 2BKLA 4U2DA 4K5QA 2ZSHA 5HFAA 1P0IA 1DX4A 3KSRA 5AKHA 2QR5A 3WKDA 2WKWA 2BUBA 2XDWA 4AX4A 3R41A 1UT6A 1EHYA 1YB7A 3QH4A 4EHBA 5AOAA 2VT6A 3WK5A 4MQLA 4M0EA 2X5XA 1TAHA 1WHTA 2DSNA 3I2JA 4JYMA 2HHAA 3HYSA 2JGMA 1EINA 4X7BA 5AH0A 4AO6A 2JGFA 1VZ2A 4Y2XA 2XMDA 3WZMA 3VXKA 4IHAA 5JZSA 3LS2A 4NVRA 4J0IA 3WZLA 1ZI9A 2XUDA 3IULA 4DMCA 3WIOA 2OQVA 1NU6A 3W05A 5ALQA 1EH5A 5AHXA 4AZ3A 2B61A 3G0IA 2PU7A 2AXEA 2IX9A 2R11A 5CBKA 1TCAA 1TK3A 3K2IA 1ETHA 4RGYA 2XLBA 5ALJA 4FFWA 4BE4A 3BF8A 3DD5A 4FDMA 5IVHA 2HFKA 1EK1A 4Y2RA 4K6KA 2AJCA 5ESRA 5CTAA 5LKAA 4DMFA 2ZYIA 2IITA 3DOIA 4B7ZA 4BAZA 1GXSA 2HDWA 4AZ0A 1R9NA 1R4ZA 3OURA 4DIUA 1UZAA 3O95A 4BVKA 2GYWA 2BAGA 3FSGA 3D7RA 3STVA 4Q05A 1XZIA 1EK2A 3EQ9A 3AILA 3STUA 1UK9A 1GZ7A 2B4KA 3H18A 1OXMA 4P93A 4RNCA 5AM5A 1FFDA 4UHEA 5A2GA 3M3DA 3WIBA 3WLAA 5ALZA 5HCUA 1T2NA 4DNPA 1RYYA 1Q83A 1CUZA 1EB8A 1K4YA 4GXNA 4X94A 4BC1A 2HA2A 4H7IA 3PFCA 1E8MA 3CN9A 5DJ5A 2WJ4A 4J03A 4BZZA 1XZJA 4G1FA 5ALUA 5FRDA 3L1IA 3FAKA 1XQWA 4U2EA 4U2BA 1MAAA 3I2GA 4CFSA 4MYDA 3DQZA 1DQYA 1E66A 2PKYX 1FJ2A 2OGSA 1N5RA 2W6CX 5AKGA 3O4JA 3LLCA 3H2IA 3N2ZB 3N0TA 1QFSA 5LZ7A 1YB6A 2VA9A 3C8DA 1A8UA 5DNUA 3QPCA 1BE0A 5ALPA 3WWDA 5BWBA 3QYJA 1O6GA 3FSGD 4DNOA 4OUKX 2Y6VA 2PU5A 4MJ3A 4CCYA 4P92A 3HEAA 3JWEA 5A71A 3F97A 4QDUA 5ALVA 5ALDA 2CMFA 2OGTA 3H1AA 4UBJA 1JMYA 2OXEA 1ZIXA 3H17A 5FPPA 2WJ6A 2G63A 2JGKA 2JF0A 4ZRDA 3NUZA 1J2EA 4GI1A 1N1MA 2WHPA 5AK4A 2WIKA 3F96A 4N5HX 2I78A 2WG2A 5A7HA 1YAHA 4MYSA 3IA2A 3KWJA 4ZWNA 2PUHA 4BVLA 5IH7A 4UUQA 1UK6A 4TVKA 3ILSA 2BGNA 1XRPA 4FWBA 1CUGA 2WUGA 3GROA 4FTWA 2QS9A 5ALYA 5JAOA 3QMVA 1XZHA 1DT3A 2GBIA 2XQGA 5AM4A 1L7QA 3WK6A 3WA6A 2QOEA 3VVMA 3AZOA 4QDZA 3A2LA 3EF3A 5KBYA 3FNBA 5LP1A 1FFEA 1IZ8A 4EB0A 4IQ4A 2HM7A 3G0BA 3X3HA 1Z68A 5AIBA 3IB3A 2DFPA 5D7BA 1JJIA 1ISPA 4O08A 1X2BA 5DYWA 5AKKA 3UUEA 3M81A 3HI4A 2ONCA 5ALIA 4HAIA 1UKBA 3PE6A 1CUFA 1EDDA 5AM1A 3R3UA 4M0FA 4UFNA 1F8UA 3S2ZA 2WHQA 2XMGA 5CRIA 1WCYA 1ZD5A 2QUBA 2WFMA 5JYCA 1CUAA 4H7DA 1TCCA 2Z5GA 1GKLA 3WYNA 4F60A 1LBSA 1XQVA 4FFVA 4G8BA 2GZSA 5C81A 2JGLA 1JFRA 2HU7A 3GELA 1LPSA 2QJWA 4I4CA 2DHEA 2Z8XA 3O9MA 2NW6A 4EA6A 3MVEA 2CJPA 1MN6A 1CUBA 4DMHA 1QGED 3AFIA 3QVMA 2QVBA 3ESAA 3DL4A 4QWWA 1U8EA 1QLWA 3ANSA 3AZPA 3WL7A 1KU0A 4C6HA 5LIPA 2J4CA 1TQHA 5K3CA 1SOMA 1G66A 2EDAA 3MGAA 4X6YA 2O2IA 1LPMA 2ACKA 2FJPA 4UPDA 1MX1A 2VATA 2QUAA 2ZVDA 3Q8WA 4GW3A 1ODSA 4LXIA 4UFOA 5ALKA 4BCDA 1WOMA 1P0QA 4HZGA 2ORYA 3FVTA 1WHSA 4KE7A 3C43A 3T4UA 5AKXA 5LZ9A 4NMWA 1YR2A 3R3WA 5AKZA 4B80A 3QITA 4X85A 3BL8A 1UKAA 4B0OA 1VKHA 2C5GA 2ZYSA 1HPLA 1K6EA 4I19A 1DQZA 4J0GA 4AO7A 1EB9A 4HXEB 3BE8A 2PM8A 1UWCA 1MO2A 5LZ2A 4XIIA 3G9UA 1A8SA 2C0PA 2CKMA 7YASA 2XMCA 1GPKA 2XMZA 4UBMA 1BN6A 4A5SA 2BCEA 4B9AA 1BEZA 4BBZA 3G9XA 3CCCA 1K8QA 3ZV7A 4BTVA 1P0MA 2FJ0A 3QBJA 1DINA 4UHFA 3PFBA 1CUCA 4DLNA 4ARBA 3MUOA 4Q82A 3VISA 5FV4A 3M82A 3SX4A 4Q3KA 4JH0A 3HC7A 3ZLVA 4KAFA 1TCBA 4UBLA 5DYYA 3WL6A 3BIWA 1AX9A 1SCQA 2JGEA 2PSJA 5DNVA 5LZ5A 1VZ3A 4BAUA 2H7YA 5AOBA 4PSDA 1XZEA 4OU5A 1DTEA 3G0CA 3WK8A 4C4XA 2WM2A 4EZIA 3HRHA 1EI9A 4OYYA 2OG1A 1DWQA 5FP0A 1BS9A 5JAUA 3WYDA 2QMQA 3A2MA 5T4HA 1QOZA 4FMPA 2XI4A 1I6WA 3VJKA 3G9ZA 1FFCA 2JBWA 3E4DA 4LYEA 1R88A 4QZVA 5ALTA 3GUUA 2PPLA 1OILA 1UK7A 4H0CA 5JATA 1THTA 1AQLA 4KEAA 4DM7A 2RHTA 1X2EA 4UHBA 4E46A 5D3ZA 4Y2VA 1F6WA 2JEZA 5C8VA 2C4HA 5C8ZA 4UBOA 1RWQA 1C4XA 2PSFA 4AMZA 3AINA 2YASA 1PV1A 4ZGBA 3D2CA 4X71A 2D0DA 5JASA 3IDAA 1UFOA 2Q0XA 4LIPD 5LKRA 1E3QA 3ZLTA 5K3BA 4XX1A 1LGYA 1BN7A 4B82A 4WFIA 3BDVA 1MAHA 4TGLA 3UUFA 6YASA 3LIPA 2HA3A 4YK7A 3O4IA 3E3AA 2H9YA 3F67A 2BGRA 4JNCA 2HIHA 3ZPXA 1P0PA 3AJAA 1A88A 4ZREA 3WK4A 1QFMA 5AJHA 1ORWA 4OCZA 2PX6A 3QPAA 1F0PA 4HRYA 2WIGA 5IVKA 1K5PA 3WL5A 1CR6A 1LPPA 1IUNA 3JYHA 3VJLA 4INZA 1LLFA 4WCVA 2Y2UA 4QEKA 1ORVA 4CIAA 5JD6A 3BDIA 5HF6A 1MX9A 3RKSA 1DWOA 2WHPB 4W1RA 1XLUA 4HS9A 3GFFA 1MPXA 1XROA 4G8DA 2AJLI 4BCCA 4Y2PA 5CT8A 5FOQA 1YA8A 2GZRA 1VOTA 4DTCA 3FVRA 4B9EA 1WB6A 4G9GA 2X8BA 3LCRA 4U2GA 4C89A 3W04A 1GPNA 3TRDA 4DNQA 2WFLA 3I2IA 3ESCA 3WWCA 1ACLA 5ALGA 1AMNA 1HQDA 4ZV9A 5CT4A 5ALLA 1QIKA 1ZI6A 4PSCA 5JAPA 2HRQA 1E8NA 1OCEA 4F0JA 2WILA 1MTZA 1HLGA 5LZ4A 2J4FA 3BXPA 4GDMA 2QXTA 2VJDA 1MX5A 4Q34A 4G8CA 4G4GA 2QRUA 3I2HA 3VKFA 2BJHA 5K3FB 1CPYA 3K9BA 3BJMA 5K5EA 4H7HA 4KE9A 1R9MA 4C4YA 3FLBA 1LPOA 4EY7A 2WU3A 2XUJA 2JGIA 1XLVA 1ZD2P 4DMKA 1JJBA 3FYUB 5T4FA 3AIOA 1XRQA 1GT6A 1H23A 5JANA 4RE5A 2UZ0A 5FDFA 1IZ7A 3FCXA 2QJRA 3KOOA 4Q3OA 1H2ZA 2HL6A 4WY5A 1DWPA 4YASA 5AK5A 4UBNA 5CW2A 1S8OA 5E4JA 3KWFA 5I9IA 5T4EA 2HRRA 3S8YA 4YPVA 2XUKA 1LPNA 4RE6A 4UBKA 1KEZA 4Z49A 4BATA 2I03A 3V9AA 2OGZA 1YA4A 5AI8A 2XMSA 4EY6A 5ALFA 4KAAA 4BP8A 4LKOA 3P2MA 3QZUA 1ACJA 2IIVA 5DLPA 3B12A 4N8SA 5K3AA 4B0PA 2DR0A 3IUNA 4HXFB 4GLBA 4U2FA 4A23A 3O9VA 2XMBA 2OCLA 4KRYA 1JI3A 2VQ6A 3NGMA 4FOLA 4W9RA 2XMRA 4GHWA 1Y37A 4ZV7A 2QZPA 4L9AA 2PVSA 3DYVA 3TGLA 3R3YA 3G7NA 5HQ3A 3WKEA 5JADA 1JU3A 4PSUA 5JALA 4X92A 4OYLA 1FFBA 2V9ZA 1PJAA 2C7BA 2I3ZA 3A70A 1LZKA 1G5FA 1XQYA 2WLSA 1XZKA 4J0KA 4QWMA 4N5IX 5DTIA 3OC0A 2ZJ7A 1VJ5A 3HABA 1H2WA 1AUOA 1QIFA 2XUIA 5AKIA 4Y2UA 2WUFA 1CUXA 4X93A 3IIIA 4CI9A 4E11A 4GEGA 4AB1A 2OPHA 2AJDA 5CH5A 3E1GA 1CRLA 4ZXFA 4Y9SA 2Y2VA 4OPMA 4Y2JA 3K6KA 4EBBA 1ZICA 1XZMA 3YASA 2VJCA 2DHCA 5AKEA 1J07A 4TPKA 5ALSA 4Y2YA 1IUOA 1RP1A 5ALOA 1YAJA 3I1YA 3GBSA 4V2IA 4IH1A 1XKTA 4FNGA 1U65A 5HF9A 2C5FA 1CUIA 5LLSA 3RLIA 4J7AA 5CH8A 4UFPA 5EHQA 1ZJ5A 1ZI8A 2WQZA 1QJ4A 3IUMA 5HK9A 3D3NA 4BB0A 1EA5A 5C7YA 4P08A 1VA5A 3QPDA 1AKNA 4CG3A 4MWTA 1JT2A 3DKRA 3STXA 1F0NA 3D4LA 3FCYA 1CUSA 5A7FA 3HZOA 3VJMA 2WUDA 3C87A 3C45A 2OQIA 4K6GA 1N8SA 1BRTA 3V1LA 4C01A 3HXKA 5K3DA 1QZ3A 2XQJA 5AI4A 2VT7A 1ODTC 1CUUA 4WFJA 2HU5A 3DNMA 2CEKA 1UOOA 3SK0A 5I7UA 4AXBA 2XLCA 3HJUA 2HA7A 2H7CA 4I3FA 4BP9A 4A16A 3W9UA 1E5TA 4UHHA 3G9TA 4XWGA 2GYUA 4QA9A 1XLWA 1SC9A 4L3WA 4H18A 5JZBA 5YASA 3CCBA 3PDCA 2H1IA 3OG9A 1LBTA 3ANTA 2HA4A 3PUHA 3TJMA 4OU4A 2QXUA 1XZAA 5AP9A 1Q84A 1XZLA 2PSHA 1T4MA 5CXXA 2O7RA 1X70A 1LNSA 3AUKA 4AMYA 3H19A 2HU8A 3BJRA 3D2BA 2C58A 5CT9A 3FYUC 3H2GA 1XRRA 3IUQA 1AGYA 1KU6A 3C5VA 1GQSA 4IO0A 3WKBA 4PV7A 4PQEA 4N8EA 4KRXA 3WK9A 5IVIA 1QTRA 4AN0A 3DOHA 2XB6A 2PBLA 3T52A 5ALWA 3A6ZA 4OB7A 4H35A 4X6UA 2ZJFA 5A6VA 2VEOA 2ACEA 3DYIA 1AURA 2XQFA 5E4TA 5AOCA 3IUJA 3R0VA 1THGA 2VAXA 1XZDA 4AO8A 3C8HA 3V1KA 3IURA 2VSQA 3I1IA 2HA0A 3ESBA 4HRXA 1XRLA 2JIDA 3M83A 5ALMA 3B5EA 4RPCA 5D3KA 1NU8A 2DQYA 3FLEA
chains in the Genus database with same CATH superfamily
3GLRA 2PMCA 5JTUA 1GD1O 5CYOA 3EDMA 5DMHA 5BORA 3ENNA 4I81A 3ZXIA 1AJEA 1P2TA 1X1TA 4LDPA 4R1OA 2EP5A 1J1ZA 2C4WA 3B70A 3ETHA 4GX2A 3LUAA 3L46A 4GPEA 4KYVA 1LK5A 2D0IA 2Z3ZA 2BP7A 3CF6R 3VKVA 4PANA 1YCHA 2VJMB 4TQAA 3EZNA 4MXDA 4C29A 1ZH0A 2ZVJA 2Q5EA 5EGNA 1X1RA 2IDZA 5J3JA 3PICA 4KR6A 4GP7A 2RAUA 5LOVB 1YDWA 4NZPA 1GZHB 1NAIA 4KJXA 5JPIA 1OBOA 3RJ9A 4MRPA 4ZJZA 3IV6A 4IIVA 5CYPA 2WTXA 4M0MA 3GD7A 1EVIA 2AVDA 3V3KA 3EVAA 3TLXA 3R40A 3WGGA 1L4UA 4QREA 3CZ5A 1EEHA 4RVNA 2I4NA 2D59A 2YYYA 1CUWA 1CU1A 5FBKA 1I7LA 5DNAA 4UUMA 1ZINA 2GN1A 2YWDA 1WIWA 3FKQA 4GPAA 4YN3A 4LMRA 2H0RA 2V58A 1K63A 1D6NA 2SKEA 4FGLA 3W3AH 3WMFA 3U6BA 1PJLA 3H5VA 4FKBA 1XVAA 1L7MA 5I8ZA 4CM5A 1WW2A 3QVXA 1MB4A 3MT7A 4PLHA 4ML3A 1GFWA 1JR3E 2Z2XA 5JYEA 1WZ2A 3VZQA 3RAEC 3KJQA 3KJIA 3FGZA 2Q2NA 3IP3A 2NUTA 4TLEA 4A6XA 1QF7A 4LGVA 3X1ZA 3AY0A 4KOEC 3VPSA 1DC8A 3AOEC 3TAHA 2NIPA 4M7PA 2Z6QA 2AR9A 4H3SA 4ONEA 5JNVA 3GUYA 1AGXA 3UICA 5FA6A 1W47A 3OJOA 1OYWA 5SV2A 4Q1VA 4KPUA 1QO7A 2C3YA 4PO9A 4Z9XA 3I42A 1N36B 1QWSA 4QXAA 2EHDA 4HAXA 4MYRA 1K4KA 4XW2A 2VDWA 3M9XA 4B71A 4BMYA 2R6FA 1UBKS 3B1ZA 1GA4A 1Y3CE 4MRMA 5L4SA 3THXB 3CM0A 3CW8X 5CYGA 3ZC3A 4YCAA 4ME6A 1KH3A 3GJ6A 3OE7A 3OX4A 2QPLA 4G0MA 4W7IA 4Z99A 4E2WA 4KDRA 3JQ6A 3KETA 3Q40A 5DTJA 1TQ6A 1GGHA 2VKQA 3FRHA 3DLPX 3SDSA 3DKKA 4KQFA 3OJXA 5K6AA 4ZANA 2EC5A 5IZCC 1Q0TA 2E48A 2VP3A 3AHFA 3STWA 1NOJA 1XDWA 2ZRLA 1SOWA 3P96A 2F7SA 3GRPA 1GYPA 4MJ7A 1IVSA 1NF9A 4F86A 4IV8A 3SVTA 1V6CA 2ODWA 3STYA 3KAQA 4NARA 3GFRA 2VJAA 2AJ8A 4AJ9A 5G0TA 4BY9E 3PSHA 4IOMA 4ZOBA 5I7AA 3ZTWA 1WNFA 3HKEB 1FQWA 3LM8A 3LQ2A 2VHVA 4PVDA 3TVTA 2BI4A 4YY3B 5JIBA 5SICE 2H48A 3DOFA 3EXFA 1CUHA 3KQOA 4MP8A 4ZPXA 2YN0A 3RREA 2ZUBA 3ONEA 4EPRA 2Y1KA 3CVXA 4LDNA 3KEQA 4JC8A 4C6TA 3OPQA 4V1CB 4JR2A 4W63A 4TRRA 1MJGA 1SU7A 2ZANA 3FHOA 4LRUA 4CDNA 2DKOA 2TRSB 3G2NA 4ZT7A 1P1BA 1PUJA 3IQGX 5HIJA 4R01A 2WHEA 3D1LA 5CYFA 4X7RA 5ITVA 2N0SA 3CPHA 3MW8A 3IEXA 1XVTA 5ER9A 4DCGA 2WSSA 3W90A 4CR8A 1Y7IA 1AT1A 4XFJA 3SYNA 1I5RA 3B6ZA 2OYRA 1MJ5A 4LHXA 1Z0AA 4YAIA 2QK4A 2R6ZA 5A3VA 2WSYB 4Z8XA 4C7VA 1Y1PA 3UTCA 3DCNA 1TD1A 4ND8B 2Q4EA 4HGZA 4GOOD 2BELA 3IALA 4YAEA 2IHJA 3L7NA 3EIOA 1PBNA 1WCV1 2DWCA 3LT1A 3H9JA 3HBAA 3OWXA 4ZVQA 3ZE1B 2ZJ0A 4GP9A 2QTBA 3LUHA 4LZNA 4D4MA 1GQRA 4YAFA 1VL0A 1BMTA 4DGQA 4MEBA 3R3VA 4F2WA 3HP1A 3BK1A 4JI8B 4OHKA 5CPFA 3HFJA 1EX9A 2X0EA 3TCNA 3GMTA 1Z4NA 2ACVA 3DHWC 2R2AA 1U9ZA 2H06A 2WW8A 3DEIA 1HYBA 2FPPB 4NCHA 4ER7A 1Q0ZA 1KZ9A 3G2OA 4O0MA 4U9UA 5BSHA 3NIBA 3QX3A 1F6DA 4I9GA 3AL2A 2XT9A 2AXPA 1NY6A 3IOYA 1QYWA 1I6MA 1M2VB 2X7XA 1GGVA 1OZHA 3KCQA 3MLAA 5JO0A 2P3LA 4KR3A 1XTQA 1DG3A 4ZVVA 5AKYA 4EQZA 3ZZNA 2YICA 1U81A 1T5TA 3A26A 2JRCA 4KV7A 4YWHA 3UCXA 4CMIB 3BIJA 3W4IA 5LR6A 2VTDA 5EZSA 5JO9A 2ZJ3A 4LPKA 1IK6A 4BDSA 1ECGA 1ESNA 5FADA 1C29B 2I8AA 3CF4A 4ZAVA 3TR6A 4EOGA 3DV0A 3HHPA 2W98A 2Y1GA 3KVOA 3UUWA 3MCZA 2J41A 2CDCA 5JLJA 4HPXB 4R1SA 1J2TA 2PQ6A 3CLSC 2F1IA 2P6MA 3NBUA 2XE8A 4PC3A 5I9SA 3GB9A 4XARA 1EHIA 1MC8A 4IJ5A 3NATA 1C3OA 1U3WA 3BUSA 3NDBB 1NG1A 1UZMA 2AJBA 4ZDJA 3W9YA 2G0NA 3ZE8A 4D8YA 2XCLA 5KDOA 1EJ0A 2R1VB 1UPBA 3ODGA 4PYMA 5M3BA 2A9JA 4RUKA 3BHJA 2O05A 3UAOA 5FFFA 3JV7A 4IXWA 5J4HA 3H2YA 5BP7A 3ROQA 3FNFA 2H4YA 2FZ5A 4DBLE 3CVVA 4YP5A 3SQNA 1L7RA 1U6KA 1PJZA 1PL0A 1GCIA 4EYEA 4BGDA 2QUJA 4D2IA 4RK1A 3U4AA 3CIOA 2FYTA 4N1AA 4C07A 2ZRKA 3LDFA 4AKGA 2QTVA 2OM6A 2CNNA 3W7BA 1NW6A 5AVWA 1KI8A 3OMLA 1GUYA 2X8WA 2NU7B 4LAFA 1FB5A 1LA2A 3AVPA 3BH0A 3CO5A 4I5FA 1DU4A 1QE0A 2YFQA 2K2QB 2GKOA 4FZ3A 4KDFA 1JIXA 2BI7A 3W06A 4D4KA 2V5VA 2X0FA 1RAGA 1L5HA 3D2LA 3R9IA 2IV7A 3NHBA 2PUVA 1SCIA 2A14A 4HGOA 2J31A 4X97A 1MA3A 4H7EA 1O95D 4C5CA 1KEWA 1JG2A 1M8JA 3CZQA 3AQ4A 5HGJA 3TZ6A 5HM8A 3E3OA 1HC7A 2Z4TA 2CSXA 3K53A 1SB9A 2QI9F 3KD2A 5CDYA 4DUGA 1T1EA 2VSYA 5I7WA 1PR0A 1FMTA 3NRJA 2RGWA 1IUPA 3PUYA 1G3IA 4UVEA 4YGYA 2GM4A 2C2GA 1GZ4A 3DLTA 3OLZA 5AO9A 3I9JA 3BZBA 1TYCA 5KOHA 1NVGA 1GKIA 1YR1A 4L50A 2IGBA 1WBBA 5CLLA 3LG2A 2VZLA 3AEKA 4QFBA 2IF2A 4WIAA 3S5JA 1NM5C 3PFKA 1MQ8B 4LGCA 1RXYA 4J43A 1KBZA 3AUSA 1NE2A 4D46A 1KI1A 2O50A 1P33A 3PQ7A 1MVOA 2DPHA 2Q7DA 2GJ8A 2O8DB 4I5EA 1KRXA 2F67A 4Q1EA 3ZQJA 3UCFA 2OCDA 5AVYA 1E0KA 3VR0A 3U5ZB 1TVKB 1TGVA 3G3EA 4LCBA 1XCLA 1EVYA 1E6WA 3TZLA 3UWDA 1HKUA 2IQIA 3GDFA 3WRYA 1ANKA 4HNSA 1U4NA 2PS1A 1VA4A 2HSJA 1KS2A 2F62A 3FTQA 3ANXA 4TM8A 5KYGA 2CLHB 4XM2A 1OXBB 4I9UA 3UNXA 2PGLA 2DTEA 5C51B 2PMEA 2BFDB 1VYVA 1ULAA 2BGUA 1JQJC 1KJWA 2ZZNA 1YZNA 4PIPA 1TTPB 4HK4A 5CFNA 1WUKS 4BVGA 4M54A 5HFNA 1KY4A 1ZDMA 1E77A 2R1UA 1SD1A 4DZTA 3KQKA 1JJVA 4LWPA 4TXLA 2HO5A 4OXKA 2IZZA 2GF0A 4D9JA 4DJFC 4BC0A 4RK4A 1ISRA 3ZGNA 3VR3A 2YQ4A 3EASA 2O2SA 1SKYE 3AI2A 2PUFA 1Y6RA 2JGJA 1O6ZA 1N2CA 4ARZA 2QORA 4H77A 3K0KA 1OREA 3WDMA 3I32A 2JC3A 1T9GS 3F1KA 5TEWA 2RK6A 1HF3A 3FGPA 3B53X 1M0SA 3A9CA 2CBZA 3DCYA 5FPQA 4K9LA 2R84A 4B4UA 2C95A 4BFXA 5JDCA 3KZXA 2VSOA 4EYQA 5KWJA 1IOZA 1BU8A 3FPKA 3U0BA 1E1YA 3PKJA 1WD5A 2EDCA 4W1PA 4CI0B 5IM5A 4F6LA 5DTMA 3I01M 3N74A 4EHKA 3K9FC 2VTVA 5GOZA 3JX9A 1KTIA 4JLWA 4RHUA 1YDMA 5DGDA 3WGZA 3CX4A 4DB2A 3HUTA 3E0XA 1JYEA 2X9VA 1YKFA 1L9XA 4I55F 2V7GA 4JUFA 3U7IA 2YXEA 3ZU2A 3K70B 3N3BC 4R4JA 2QSZA 5E9JA 3F6YA 3IJEB 5JMPA 3NYQA 2FQQA 3AL0C 2OCYC 1EVZA 1VJ1A 2G5PA 4PLVA 4R8MA 2R97A 1M1NA 1BYUA 5FO1A 5LQMA 1PEKE 1AZTA 1WCWA 4GKAA 2QQEA 4RDIA 1H1TA 1Y8CA 3N9IA 2BEVA 3JQRA 2EQ5A 3M8KA 2GZMA 3HJCA 4WOCA 4RHXA 1OKKD 2I3DA 5BSWA 5KREA 1IATA 2C1XA 2NT4A 2R4UA 2V6IA 3KDPA 4P82A 3TDMA 5CFZA 2C4UA 2CZQA 1XXHB 3E18A 1AB5A 1VLHA 3DB2A 5CH3A 4KXVA 3UKDA 4PLFA 4UXJA 2FZWA 5B5SA 3FZEA 2X7HA 4KWIA 4YAWA 3IDSA 1E9RA 4BNWA 1XZNA 2EWWA 2R4QA 1D07A 2D5LA 1YU9A 1FLVA 4UU1A 5CP8A 1WXWA 1BG6A 3QUAA 4JUBA 2IHNA 4GMGA 3G2QA 1U2RA 1LZLA 1I3MA 1I3CA 1QO9A 4Q4HA 1BU5A 1KPGA 1JALA 3OFSA 3EAGA 2PUJA 2JEYA 2IEZA 3QMWA 1RE0A 4N7JA 2DFKB 3L6OO 4FOPA 4JJ6A 4LK3A 3KT6A 4L73A 4LHEA 3TLZA 4CLOA 4B4DA 5CLIA 3ANNA 4UU8A 3OO1A 1XPUA 3WJ1A 4K8OA 5F5XA 4DMGA 4E0BA 2RGYA 3SQLA 4IUBS 3OBBA 4RWZA 3SGLA 3ZDEA 1ZBQA 1Z6PA 4OHFA 4G9BA 4MB6A 3GHHA 1F5SA 3B6EA 4D4HA 2XXAB 2WD8A 2V55B 2W11A 3FNRA 3OM0A 2CW5A 3F7NA 4AKSA 3ORFA 4WOKA 2JCXA 1OWOA 1A7UA 2QSUA 4FLEA 1NBHA 4J6FA 4UQPA 3RQSA 4AD8A 3EVBA 2CLOB 4YRZA 4AQYB 5KYYB 5KYXA 1A3CA 1TO2E 1FDTA 3REFA 1BQ4A 4I36A 4IF4A 1V7QA 2XUFA 3VNVA 4R83A 3SZUA 3MRXA 2CE7A 2WY2D 4D6YA 4UAVA 5ERGB 4BASA 4X6LA 3EUEA 4DLVA 1KR2A 1OYYA 1PQ4A 4C2BA 1P44A 4TTJA 4CETA 3PYXA 4HO1X 2Q3EA 1S4MA 2HDOA 2W2VA 3L8CA 4ARUA 5CLHA 2CUNA 2QVYX 1U9JA 2WAXA 2XVYA 2M1XA 2ZRMA 3R09A 2Q2VA 3QUSA 2V03A 1T1JA 2WHXA 1CZRA 2ZXEA 3H8VA 1N2HA 5DXFA 3VSDA 1LSUA 4UQLA 4KGZA 2YIDA 4L8FA 4PZZA 4LF9B 2Y71A 3OSZA 1XKLA 3EJ6A 4WCFA 2G88A 2YUTA 1H66A 1MC4A 1CNEA 3BQMB 2QPAA 4W6QA 5H3LA 2JFVA 1FS4A 4G01B 4F2PA 3FH0A 3GO4A 5AYVA 5GONA 3FCCA 2BP7B 3PUWA 2O57A 4J07A 1KI4A 5EJEA 1TM5E 5I3ZA 1ZCJA 2EW1A 3EA5A 4M8IA 3JZFA 2Z3WA 2UYQA 2C4TA 2OV3A 2R6CA 2FWPA 3HO6A 2IXFA 5CMLA 3UT6A 4DQKA 4E2ZA 1U0JA 1DPGA 3G89A 1KFJB 3B2EA 1AMOA 4JVOA 1CIJA 1E1RA 1LNZA 2C31A 3ZHZA 1SPXA 3IA7A 1XKQA 3V48A 2I2DA 1QGZA 4K9OA 2DGDA 1FUUA 2FCAA 4IINA 4V2UA 4P6VF 4KACA 1FVXA 3M6WA 3AR5A 1LPAB 1FYEA 4M3NA 1IE3A 1UPAA 3DCJA 1EVLA 2ZTVA 2ZRHA 3ISTA 4OBBA 4EP1A 4QG3A 3PUXA 1XD8A 3N6RA 3A6HA 2E3JA 3PQCA 1TU3A 1UR5A 3QEKA 4XSHA 4ZC8A 1R50A 4JB8A 1V8DA 3U49A 4CKYA 1XHEA 3WBFA 3SVLA 1NGSA 1S0UA 1ZGZA 3KOWA 4YAJA 2FV8A 4RA6A 1LFAA 1XPRA 1WR8A 2XSZA 3CUKA 2J0QA 4AY6A 3IT0A 2A92A 3OUTA 1DPFA 1JLLA 3KKLA 4V0NA 3RVJA 4AZSA 2NUTB 1XCMA 4RYDA 2C3UA 3I8SA 3WV5A 4KFSA 4Q93A 3QLJA 3NV7A 4W1SA 1KO7A 1JMKC 2WTNA 2JAUA 2PR2A 1G1AA 1BIFA 2W37A 4IVPA 4TKUB 4BVFA 2FW7A 2ZUUA 3V4SA 4DJEC 3D0KA 3L5OA 2P9JA 1JU4A 3KKZA 4KPUB 2JLSA 1VGRA 3FFWA 4IICA 1O03A 1YMUA 4RK7A 4RH0A 1R16A 4L3OA 5BT9A 3L0IB 3KHUA 2VDWB 3TBHA 4NATA 2ZPAA 1R6XA 3I05A 4MRMB 4UOQA 4B6RA 3KXPA 2I2WA 3G02A 4IGFA 4JB2A 4Q4AA 4RH1A 4CT0A 3HP4A 2E37A 2HYDA 3WJ7A 1N9ZA 1NYRA 1V43A 2OHIA 3T3GA 3PTAA 3VSCA 1STOA 1VHLA 1AOXA 2PUDA 3NORA 1WA5A 3CUEF 3OEEA 2D5IA 1YQGA 4MRRA 2VYVA 4V0MA 5JROA 3UB3A 4HGQA 1GSIA 4GBMA 4ZOQI 1JVSA 3TI7A 5CVUA 3ZU4A 2JAHA 4L7VA 2WTAA 1HURA 1N2CE 3UAYA 3KLNA 5JDIC 4GOJA 3OY7A 1R66A 3RU3A 1T5OA 2OCBA 3CB2A 4BFCA 3DMTC 1ELOA 2QI9C 3BEOA 3SYRA 3ZY3A 3ZHRA 2NTNA 2QL7A 1MD9A 2E6UX 3OFJA 5JZOA 3CRQA 3ZZTA 2VQSA 3GT4A 1CR1A 2O5RA 4Q37A 3F6SA 1W4LA 1Y5MA 1SKYB 3B9BA 3DDUA 2OR3A 2AFRA 3L7MA 2C3OA 2HBRA 3DHYA 4BLOA 3C3BA 3AKEA 3PP8A 5LIRA 3EXFB 1EQAA 2HNBA 1Y80A 2B7LA 4ISBA 2F17A 1KYVA 4K1LA 5ALEA 2IELA 2XUZA 3VX3A 4C6TB 1OA1A 1M34A 4G4IA 1W52X 1CEXA 3KHSA 4JFRA 1M6HA 4ARAA 5CD9A 3IHTA 4X95A 2YWRA 4LHZA 4DLXA 2WJVA 1KQOA 3N0RA 5B6PA 4DB4A 3TM5A 2HNKA 3MNFA 1FNBA 2UVDA 2BGKA 3KEOA 3MMSA 3GLQA 2P9EA 4UCFA 3BAFA 1V6AA 3R8XA 5AHKA 5LNK6 3G8DA 2WLTA 1NPDA 3KT8A 6Q21A 3Q6IA 3HACA 4CFYA 1IPHA 5EMLA 1M7GA 2H9AA 1K3TA 2RH4A 1EXWA 2ARKA 4PAMA 3PUIA 1O94A 3VM6A 4HDNA 1FMFA 5HF5A 1LTQA 3F49S 4QRIA 3KNZA 5K4AA 5FT9A 1NMZA 4KZKA 4MGHA 5CT5A 3DMYA 1NQOA 2V6GA 4JUDX 4KVGA 2R48A 4O2RA 4R3UC 3A1TA 5FTMA 4E15A 1GADO 4G25A 4HGNA 3KQWA 2I6XA 2LDXA 3JYNA 2Z8ZA 4N40A 4EFDA 3ND6A 4MDFA 5A0VA 1E99A 1KVUA 1Z18A 1TUEA 2WT4A 1VMDA 3WA7A 3TMKA 2WICA 1RAAA 3HBJA 1E0JA 4N0QA 1R4MA 4M7RA 1XMOB 2FX5A 5FUMA 2PUEA 4FEYA 1JWBB 2AN1A 1USUA 4JJ8A 4YUVA 5TC4A 2LZ0A 3JWPA 1ODFA 3ABRB 3IRUA 4DY4A 1QQ7A 1R8QA 2B3DA 2R1ZA 4DARA 2WNSA 4G56A 5UKDA 2IY7A 5E95A 3TIFA 2WJ3A 4G6ZA 3WIEA 4WNAB 4ETMA 2Q0QA 4AMVA 3EX7C 1T4BA 1QKJA 1DZ3A 4ND4A 4KPGA 5EJ7A 4V0LA 2YMMA 4GMFA 3WAKA 1J56A 4OM8A 5GZ6A 1MB0A 1H9AA 1XZQA 3SHFA 4X64B 2EBUA 3BAZA 4ATNA 4ZN6A 1H05A 4KQXA 3P9YA 4DY6A 4DHEA 1EVJA 3DTYA 5COBA 4PAGA 4KQHA 1RZ3A 2W6JD 4QJ3A 3DNPA 3P5SA 4PNPA 1F8GA 3S7ZA 1PFWA 3DV0B 4G0ZA 2JVJA 1G41A 3PC4A 3HS3A 1HSOA 2BEUA 3BIXA 5I3CA 2HCRA 4HXGA 5JWOA 1KNQA 2JIOA 2I7CA 4TMFA 4CHGA 5C8YF 5EIFA 3LHIA 3FWPA 1XN4A 3LDUA 4C7JA 2GD1O 2PZMA 1Y9DA 3LBAA 5A4DA 4US2R 3FOFC 5BWCA 2VPIA 3KPYA 4DCNA 1TIKA 4IYRA 4EF5A 4HVLA 5HXAA 1FSPA 1YRWA 1IC6A 1G18A 4R1MA 4GGOA 1N8KA 1Y5IA 2OCAA 4DYHA 4A8HA 1Z7YA 1G64A 3KTAA 4FD2A 4H1WA 3UGJA 5TQ2A 1RZRD 3K30A 1E1CA 2C59A 4XUGB 4ITVA 1XV5A 5HVNA 3S68A 1EESA 3TNYA 5HZGA 3NHLA 2GA9A 4JT2A 2QMUA 1NYTA 4LJ8A 4MUKA 4MVJI 1DX6A 3L4KA 1Y9ZA 1AUVA 1B74A 2GWRA 2Q0HA 1NR1A 1W6RA 3EC2A 1SOUA 4FBLA 3PC8C 1C9EA 3D4BA 4J29A 2J9ZB 3NV9A 1HO3A 2WJWA 1LB1B 5IU6A 5KEIA 1LSOA 3GBVA 2CJXA 1LLQA 4R2MA 2CE2X 1U8YA 1NXQA 3ORSA 3P9SA 2M6LA 1XN1A 2IYZA 2QTVB 4RJTA 4ILEA 4NS4A 3J80A 2FN3A 1P4HA 4XKJA 1XNHA 4LE1A 4UEKA 3RYIA 2ZTUA 4TXNA 5BNIA 1FUIA 1R0BA 3JD2A 3RBXA 2SECE 3R7FA 3ABZA 1K2WA 3G8YA 1SVOA 3OT1A 3JTEA 4AKEA 1L5HB 4R40A 3D6VA 3DE6X 1YHZA 2HLDD 1C7JA 1VE6A 1XYGA 2J3KA 3LLUA 1ISIA 2HI0A 2BONA 4L72A 3CXUA 1L1QA 5E2IA 4WXRA 1KAHA 2CVQA 5K8TA 1B42A 4LC9A 2G25A 3DOCA 2O7VA 3GL9A 2HSEA 3R3ZA 5FQOA 2BKLA 4E1BA 5FB3A 4ER5A 1JFLA 2OMEA 2O48X 1U80A 3ROEA 1NASA 4JT8A 1RZUA 1MG0A 2Q1WA 4J6EA 3A6GA 2ZSHA 2RGGA 4IY1A 5KOHB 4S04A 5H16A 3ZWXA 1Q3TA 4UXHA 3AEKB 3D54D 2GX6A 5AESA 4LF4B 3KSRA 4RTKA 4XGQA 4GSLA 4X8LA 4KIFA 4KXXA 5D1HA 3W7VA 2P69A 2PCLA 4B3XA 1F7UA 2V8BA 5LQAA 3RU2A 4AX4A 3NTVA 1QYCA 1FXWA 4QX6A 1E3WB 5DHUA 4ZODA 5KU1A 2Z5LA 4G0PA 4OGWA 4KXQA 5T6MA 2FP4A 1EIZA 2P2YA 2MHCA 4KP7A 1V25A 3DKPA 3KLOA 1WULS 1PR6A 2O20A 1TPYA 2OAP1 1KFKB 4XD7D 5EIBC 5EWLA 4JXJA 3S2FA 4HNRA 5A9RA 1TAHA 2NUPA 1XTJA 1WHTA 1EJ2A 2A84A 2AMFA 4HMPA 1NX6A 4RF2A 2H1HA 4J1SA 4AAYA 2L18A 1ISMA 1IPEA 2I9KA 1H4SA 4MW4A 4PAQA 5IHXA 5JPDA 3UGTA 1N78A 1ZK3A 4KQWA 1JJAA 4JP5A 4I9NA 2YOGA 4BX0A 3B2NA 1ZRHA 2POQX 3KKMA 4DV4B 5AH0A 1J1UA 1V3VA 2LGJA 1C5KA 3ROGA 4DR5B 1Y9EA 4Z4HA 2B4QA 4L15A 3I9V6 3GPIA 4PGFA 4Y2XA 2AMYA 3VTFA 5I51A 4MJXA 4ARZB 1N2CB 2V1UA 1BGXT 4BJ6A 1VYHA 4KO8A 2Z9DA 4P8RA 5IJXA 8MHTA 1XMSA 4AF7A 2Q8QA 3OIWA 2BGJA 1EFPA 2XECA 5DEOA 1M34E 2B5OA 2HX1A 3I5UA 1BMQA 4NVRA 3PR2B 3NT5A 4AMGA 2ZUEA 2R6JA 4M38A 4N5NA 5BURA 4UJ3A 1KY5A 2WF8A 1Q7GA 4KXUA 2BFBB 4MVJD 3OPNA 3PQFA 4HLUA 1WQ4A 2VK4A 2WJJA 2GXSA 3TCKA 3IULA 2FN8A 2YV3A 3HVKA 2Q5LA 3DXZA 4JBHA 4O2AA 5E1OA 1MOSA 3TIVA 4DMCA 2NXCA 3PEFA 4WQMA 2BM9A 3D8HA 4E5YA 2EL9A 4AG5A 4TVSA 3DVRX 4I1YA 1EH5A 1IDN1 2QYSA 3FTNA 3L0OA 1I32A 3MJVA 2CXSA 5A0TA 4CDRA 4UM5A 1H4VB 3HXPA 3L49A 2ZSUA 2CFOA 1PF7E 1Y34E 2YZMA 2IX9A 3RYCA 2R11A 3ZCRA 1NW5A 2BFAA 1CJSA 3OVMA 2LCQA 2C04A 1O89A 5CEJA 4PX3A 3LT4A 4X1YA 5JJIA 5LQRA 3C7AA 1M1NB 1SC3A 2QIPA 4RGYA 4U6QA 4LY9A 5I01A 4J2TA 3KZVA 4P2GA 4UUNA 3FDXA 1W0JA 2BEVB 4KL8S 4K6MA 1QHXA 3NHAA 3WO1A 5DSZA 2Q8PA 4M88A 5ECYA 3DD5A 3SPXA 4YS6A 3VSAA 2L2QA 3EF0A 1G2PA 4KLAA 4ENTA 1P60A 4PLPA 4IIDA 4MVWA 1QG4A 3DEJA 4XB6B 1YZQA 2PUBA 1DLJA 2OCXA 2G0AA 4MUXA 5BSGA 4IFIA 3BOSA 4QFMA 2YWEA 1U8FO 4DIUA 1GQ2A 4EFKA 3OUUA 4LNHA 1PZMA 4OSOA 2IP1A 2GYWA 1W2WB 5BR7A 5HOEA 5KTRA 1F2TB 4FCWA 1GUFA 2YW9A 1B7GO 2X5KO 1YQ9A 3PCTA 4JP1A 1GV1A 1WXHA 3HQ4O 5DHTA 5IASA 3AKDA 3CX8A 3K8QA 1FPMA 1IDOA 1UEXC 4LRQA 1XZIA 5L3VA 4CLOB 1YRQA 1QQTA 2H4JA 2VDRB 4JQZA 1T9HA 1Y33E 3STUA 3QKRA 1OXSC 4FQ7A 1C0PA 2RHLA 4TKLA 4MV3A 3HA3A 1BAPA 3DZ8A 1XP5A 3CC8A 3H18A 2V7EA 1N1GA 2GT1A 2AJTA 2F3PA 4RKYA 1GZSA 4AP9A 2H2IA 2YHIA 5M29A 4N48A 1PV2A 4RNCA 4YJ3A 1ABBA 3DMHA 3HFSA 3IOEA 1KR5A 1V8BA 4HAYA 2JL1A 1B8NA 5K0FA 5KYXB 1A7AA 1LLUA 1Y4SA 3KOXA 3LNCA 4CIDA 4ZGBA 5LXTA 5E9WA 1FFDA 2W2PA 3LHDA 3LFTA 1G8KA 2W6ID 2APJA 4G0YA 4RTOA 3Q98A 1FXUA 2XGOA 5HUHA 2O0JA 5CUQA 3W8FA 5IAAA 1P7VA 1C9YA 1MDBA 4ZKDA 1K86A 1NI5A 2GPBA 3KQTA 1EGHA 5F3WB 4YFYA 5ALZA 3INGA 1T2NA 3OIFA 2CFTA 2H1FA 3WBBA 1UC5B 3AI7A 1A9TA 2FF5A 2DZDA 1NDHA 4M55A 5JY6A 3JSXA 5EVCA 4QHTA 3QVGB 4QVKA 4WCFB 4KOAA 1O2DA 4PC2A 2FXIA 4U9IS 5HE8A 1AK9A 3NBQA 4EHNA 1B1CA 4H4EA 3JWGA 1V11A 1TTQB 3Q72A 4N6OA 1X1SA 2FX3A 2AS0A 4YI5A 5GONB 4IX9A 4NBWA 4PGHA 4B47A 1ZR4A 1RHQA 4J4HA 2JBAA 1KJQA 5TVKA 1I14A 3PFCA 4MKFA 3PJRA 1O9GA 5D3MA 3GLIA 3KYCA 4G8JA 2HNAA 4DIEA 1QPGA 2XYRA 2H52A 4KXMA 4PE5B 1DOHA 3I09A 3MD9A 1YDHA 4GL4A 2VUHB 4V1CI 3UJ9A 2OZLA 5FRDA 3I23A 1P3JA 3N07A 4TL8A 4X3PA 4N41A 4U2EA 4BNUA 4IEFB 2HJGA 4R8LA 3I2GA 4MYDA 4P83A 3TOZA 3UJ3X 3VGJA 4UM9B 1ZU5A 3RO7A 1E66A 5FV7A 2PKCA 4MRSA 3AG6A 5A3QA 2OAQ1 5AKGA 1DEHA 3AF1A 1JU9A 4RA6B 3UMVA 2VFAA 2QF7A 4BNZA 4OLBA 5TVGA 4WVFA 4WGGA 3DVQX 1ENYA 4YAOA 5DHFA 4EWLA 3AYXB 1JLLB 5TQJA 2ZUFA 4OM7A 5HMLA 1YB6A 2GCNA 2VA9A 3C8DA 3NQ41 4M6WA 3V46A 5JEDA 1XPOA 4UE6A 3PXGA 4FR2A 1J2JA 4A0SA 5BWBA 1TADA 5ALPA 3O83A 4M9XA 5DZSA 3WWDA 4YDQA 3PX7A 3NTLA 2FKNA 1Q21A 5JRZA 2BHNA 1KZGB 4DNOA 3BTOA 1HLDA 2Y6VA 1ES9A 5ARCA 2PU5A 4E4TA 4MJ3A 5DVZA 3DTNA 4JUCA 4CCYA 1RRFA 3GAFA 4FSXA 1L4YA 1KOJA 4Q47A 3GJ5A 1UJ2A 1OT3A 4R1LA 3TLCA 2VHTA 3HEAA 3JWEA 4Q4AB 4ZAYA 4J1TC 4EARA 2B2NA 4KDCA 1Q1ZA 5A71A 2DWOA 1U4OA 4AF6A 3F97A 3ME5A 3U5TA 1TGYA 4KO3S 5JJCA 4BB9A 4EA9A 3IPXA 5ALDA 2AE2A 1TZJA 3DZIA 3DZKA 1UZLA 4QTUB 4Y9DA 1GSHA 1OC2A 2CNBA 3NHKA 4GSYA 4Z4FA 1CQIB 4EHFA 2YCBA 3QKIA 4JVLA 2VNHA 1RQNA 2EP7A 3ZVNA 1MAWA 2R7AA 1KVQA 2X0DA 1WEHA 5JAIA 2FQYA 1I7DA 2IS6A 1V8PA 3NUZA 5ARBA 1SXPA 2HRBA 5D87A 3CWQA 5E7JA 4HQLA 3F73A 5DHSA 4I4LA 4ROSA 1L6IA 2DP4E 1ZMBA 2WHYA 3DEYX 3GDWA 2ZUWA 3FPBA 4X63A 3ASYA 4FYXA 2O2CA 1JEDA 4OMCA 1PNOA 3OOJA 3S1LA 4C5BA 1NVWQ 3O4FA 5AXAA 3UG6A 1JR6A 1OZGA 1KDPA 4GGMX 4KCGA 4QLBA 1B1AA 2HCTA 2HEIA 2DTXA 4Y67A 1WMDA 3QLVC 1M34B 1VM6A 1RABA 5KNBH 4C05A 2ZXUA 3F3KA 3ZDFA 3PS9A 4MI9A 1PEAA 1RKUA 3S1SA 2AOVA 4JLVA 2G8NA 1JHDA 1RLOA 2C57A 3A1NA 3QKUA 3TE6A 1KWKA 3W5HA 1CY8A 3KWJA 3AV3A 2EWVA 4NCIA 3WDLA 4QXPA 3TAXA 2FOLA 4CM6A 5IH7A 2KWIA 4RMHA 1XA4A 2B1QA 4V0KA 5D2CA 2Q5FA 5ITWA 3QVJA 4Y8VA 2YDXA 3OJFA 5CCBA 1UK6A 4BLVA 2QSJA 4RZSA 4AX8A 3GUHA 3PHHA 4BQQA 5F7XA 1WB9A 4IDCA 2ZI5A 4ZEWA 3WLHA 2PZFA 2NN3C 3LTEA 4EKIA 1ULUA 4RXUA 3E48A 1VDZA 4EF4A 2BGNA 1SKBA 3CJTA 4X1IA 2AUNA 1HR0B 1SVNA 5ALYA 4NV1A 3EBOA 1YK1A 1FDSA 1PJ3A 3OQ6A 1NFFA 3AJ9A 4ZCIA 4C0KA 4XWOA 1WDMA 2RG1A 2Q4RA 3OD1A 3UT0A 4AC9A 4FDAA 5K3OA 2CLSA 4TT3D 5DEIA 2HAEA 3ZG6A 3IR6A 2XQGA 2JIZA 3BSWA 1R4MB 2HXGA 4B43A 1AS0A 3SOPA 1IG0A 3I6IA 3RQIA 1L7QA 1G8PA 1XNRB 1F38A 2YUIA 3Q7PA 2XGSA 4ZVOA 3WA6A 1MIHA 2WAYA 3NEPX 3WK6A 3N5KA 2XHZA 4IZ6A 4QBGB 1TQ4A 2FG5A 1GR0A 1KYXA 4HDQB 4BJ1A 5J2TA 5HBRA 4DV0B 1TM1E 4QDZA 4QQFA 5F78A 5BPFA 2ZDHA 5F7OA 5EJ9A 5LOVF 3NS7A 3UTDA 1ADYA 4YRNA 5KBYA 5LP1A 1RPNA 3UHJA 3SEAA 1FFEA 2A5YB 2N75A 5F3DA 3OU2A 4LWZA 1UANA 1VKNA 3V8MA 1Z68A 1RWOA 1QV6A 2PRIA 1IN5A 2NTYC 2V3VA 2P2SA 2X0NA 3IP5A 5B2EA 1L0BA 3SLRA 1GP2A 5LUBA 3JARA 3TSOA 2WEKA 4M0PA 3X1WA 1MO5A 4GOND 3SIXA 5JALA 4W5OA 1X2BA 5FUQA 5DYWA 1XNGA 2K5UA 1JPJA 2PL9A 4PC6A 4JYZA 4DV3B 2JJ8A 4IKPA 5AKKA 2A0UA 2B1GA 1XAGA 2BEUB 2DBYA 1NTRA 4OAQA 3UUEA 4D96A 4A0FA 1SRQA 1L8OA 2A6PA 6GPBA 1R6DA 3H13A 1RI4A 3NGLA 4ZCSA 3E4CA 4P0PB 4BLPA 1RQPA 2QW8A 1JG4A 1N8NA 4WLOA 3SDZA 3AVVA 1E6CA 4P3PA 3GRCA 1D6MA 1T8RA 2CLKB 4KLCA 4PZYA 1Z9BA 5ESWA 2FOXA 3HPRA 2F59A 3AXTA 1V96A 3CCFA 1CQJA 2Z09A 3CZAA 3KTAB 3O4VA 4JX8A 5EAIA 5TQ2B 1AU9A 3GA5A 5BW6B 2R7MA 3A3NA 1WCYA 1YRLA 2QUBA 1E1CB 4ZOLA 3UV3A 1J0EA 2OE2A 2QMEA 3B1YA 3H3XA 1SBYA 4QAQA 1TCCA 4JP3A 3ZGOA 2IDJA 3ZOZA 4QASA 3GLIE 1GKLA 1UQRA 2RCYA 2HV8A 4NOMA 3KJHA 3WYNA 1P9WA 1YZHA 3CH6A 5CG1A 1OY1A 2J6IA 1CBUA 1GQQA 3PL5A 1JFRA 1QNLA 3IQHX 1CULC 1V8ZA 3ACCA 3H2ZA 3HR8A 3T0FA 3HSKA 3ONFA 5IX8A 1U3DA 4DVJA 1R0CA 2XWJI 5BT8A 5H4GA 2C0CA 1X7XA 4BWGA 1NUPA 3N0XA 1RHJA 4EA6A 4Y1EA 3RYIB 5ITZA 2JLBA 3OMXA 3EEQA 3H84A 4R6XA 3JRNA 2B6HA 4Z0HO 1T0IA 3OT1B 1CUBA 3RC3A 3ZV5A 4OAOA 2R85A 4MI3A 3QVMA 1Z4KA 1MOQA 2QVBA 4OREX 2OPBA 5HKKD 4QWWA 4JDPA 2GVNA 1SBZA 1WUTA 4EELA 3PWSA 4AYWA 3BQNB 1JQEA 4J2HA 3LY5A 3AZPA 3GJZA 4I1RA 1C9NA 2C2OA 3N59A 3WL7A 4NY1A 4C6HA 1I5OA 3GYBA 3W5BA 1PJSA 3GUVA 1NVVR 4Q7JB 5LIPA 3T06B 1Y3BE 5FEMA 1SCDA 5K3CA 4DOMA 4F7DA 4BO2A 5MF6A 2Y1FA 1KMIY 3L6RA 4YTEA 5JS2A 2Q1SA 3VUFA 2V4MA 4ZJUA 4XWKA 2ACKA 1H8ED 1QCDA 3M6VA 4P3OA 2VATA 2QUAA 1W19A 2CXQA 1Z0JA 1XOIA 3NEJA 4GUAA 3Q8WA 4LZOA 1Q0LA 1QCZA 2AQIA 4GR9A 1TQDA 2HLNA 3TF5A 2HWWA 1ODSA 3SHQA 3U3DA 3KEFA 2UYHA 4NI5A 3COWA 1SHKA 1TZKA 1AXEA 2FP4B 3LT5A 3WLSA 5BWNA 2H1WA 2VDMB 1M2KA 4QFCA 2RSLA 3PEEA 3RIHA 2IZ5A 4AKHA 1C4OA 4YO8A 5EWLB 1WWKA 1WHSA 2YC2C 1SVLA 4MPRA 1XX6A 2NUPB 1FX1A 1WHTB 2DBVO 2H57A 3U16A 1UXHA 3F74A 5AKXA 3GOHA 3WICA 1T91A 3R3SA 3OECA 4CLRA 2YBDA 3ER6A 2IYTA 2V6MA 1CB0A 1V5EA 3HUEA 3KFVA 3SF0A 2WYUA 1YR2A 1O0CA 3CVOA 3MT0A 3DVSX 1DBVO 2VBIA 2VDQB 3FG9A 3QITA 1P6UA 1PFVA 1QB7A 1ZJZA 2Y4NA 3FOCA 3WGQA 4DLNA 4YUAA 3IP1A 3PGKA 4B0OA 4R1TA 4COOA 5AVZA 5IWCA 5J5VA 1CP2A 4I1VA 1WMEA 3FCEA 4URVR 1ZL2A 1T3LA 2IRWA 2K7FA 1HPLA 4JAVC 3GK3A 4OA8A 2JJMA 3AVXA 2CVFA 3PNQA 1WRBA 4MPDA 1EFPB 3I5AA 2CCJA 3LXMA 4AO7A 3CO0S 5FBLB 5F9FA 2ZB2A 1MDFA 1HEUA 1TYEB 3VBCA 3BE8A 4YUXA 5BN5A 1PR4A 4QTYA 2Y4OA 3M4XA 4FHFA 2PM8A 4XSGA 1HT0A 1MO2A 4BUZA 4NQRA 1TA9A 1WE2A 3G9UA 2GH1A 3CZPA 5HA5A 3A06A 4O2AB 3D6TB 1QNFA 3T3PB 1ATZA 1U1IA 1XPJA 2GLTA 4UMEA 3EVEA 1EXMA 4RZQA 1HE1C 4N54A 3T0IA 3D8SA 3MUFA 1XCJA 3O4RA 3DEFA 1A9XA 2Z4RA 1UIMA 4W5WA 4LNUA 3OU7A 1K3UB 3P2JA 1V8FA 4IXMA 1ARZA 2L82A 3SBOA 1T5DX 3EMBA 2EWMA 2I22A 3RYCB 1R8JA 1QHFA 2G06A 2GF2A 1GTVA 1P4JA 2BCEA 1E92A 2PZAA 3C48A 5F2OA 5EWJA 4X1YB 4FUTA 1OIXA 3G9XA 4RWEA 3TNJA 4BBZA 1XTRA 4DM3A 2XNHA 3H5OA 2AF4C 3QBJA 4HPWA 3NYRA 2P1ZA 4GZ3A 2UZIR 4UHFA 1P9LA 3DEKA 5EXEA 3TQRA 3PFBA 2FDCA 1O5IA 4NDNE 4O8CA 2PBRA 4ZYWA 4ARBA 8ATCA 3MUOA 3R6LA 3THRA 4Q82A 3ZN2A 3F6CA 4Q4CA 4Z7QB 2PX8A 3VISA 3TH5A 3OO0A 4MGEA 3J7TA 4LWOA 3WLRA 2GZHA 3X1DA 2XYQA 3SMVA 5FV4A 3M82A 3ECAA 1NNI1 4ZI2A 3NTUA 4H6VA 1WMFA 1X74A 4KQ9A 1IWPB 1HFKA 3UY4A 2K4MA 3HM2A 3HU5A 4MUAA 3ZWAA 3ZLVA 1IHYA 3F7OA 1NQAO 4DJ5X 2E0IA 3OKCA 2C8VA 4LJSA 4BNTA 5JMWA 2C77A 1R0RE 4ZMSA 2C7RA 1I7QB 2PLWA 2CNWA 3W5UA 4QD3A 4NXNB 2NXEA 1NSFA 2AZTA 1FNSA 2YWCA 4TL9A 3M6FA 1NLUA 3N7TA 3DW3X 1YUMA 5B4VA 4PNEA 3E27A 4M1TA 2B2CA 5K51A 5J58A 4GWGA 1Q1QA 1RW4A 3QKRB 1T6ZA 2NPIA 5B12A 4QGAA 4RD1A 2BF4A 1IB6A 3WK8A 1VRCA 1Z47A 2RHBA 3HRHA 3KD3A 5HDQA 4EG3A 1RQ7A 1T9DA 4EAQA 1EI9A 1JQAA 3G0HA 3WZLA 2NM0A 2QGZA 2YHIB 1SKQA 1DEXA 5TJHA 5JAUA 2YVQA 2Z9CA 3PB3A 3MRVA 1GPJA 4PFQA 3W6UA 4W8HA 5E4FA 5T4HA 4OV6B 4QJ5A 3CTMA 1RLMA 2B5VA 2XZDA 3PZBA 4E4RA 3B5IA 2RC5A 2P9HA 3MJRA 2FMTA 4HEQA 4IXTA 1A8HA 1RC0A 1R0XA 2R5FA 2FPWA 4DMMA 3C14C 3F4KA 1U3TA 2OFXA 3SEQA 5IJWA 1GZUA 1H6AA 3FMGA 3DVLA 4NR0A 2UUPA 4HWRA 4WGFA 5FR1A 3BT7A 4LYEA 2C99A 1LVUA 3LZDA 3OX3A 3QXJA 4IV5A 3COJA 1D03A 1EGQA 1ZK0A 4QZVA 2Y92A 5ALTA 4K9SA 1U0RA 1W2GA 3NHUA 5EKUA 1OX5A 3V7FA 5AXBA 1G21E 1IFXA 4FP9A 1V11B 5JATA 1P9RA 2A3NA 1AQLA 3DJFA 3KR9A 4KEAA 2BZSA 1CDEA 3ETEA 4MW0A 2JBAB 3B1JA 4EL5A 3ED5A 4U0KA 2FSFA 4UHBA 2KSQA 5FTLA 1KGDA 3KYCB 5IUJC 3GLIB 3TK1A 1P1FA 3PWKA 1ZIPA 1OC4A 1ZW6A 3X1KA 2FAXA 3QELA 4LY6A 5C8ZA 2C3PA 1RP7A 2O14A 5EP2A 3NC1C 4M0CA 1QHHA 4UD2A 1J22A 2OZLB 4P3NA 4W5HA 4BO1A 3A05A 3WBJA 1CQXA 4UBOA 1EX1A 3PX3A 1GCOA 1PHPA 5K0NA 1RWQA 1RS0A 4UNPA 4WK4B 3HU3A 3ADPA 4P34A 3ZHVA 2QVZX 4ILKA 3V4LA 5BWOA 3TXYA 3CT6A 3ROFA 2JD0A 1WXXA 5AW1A 4LJ9A 3AINA 2X2EA 4A8JC 3ROTA 3GCDA 5C3MA 4U5XA 1B0UA 1KVTA 1N0WA 1KPIA 1QH1B 2VZ0A 5KNDD 1F14A 1QQ6A 2PUAA 5LQKA 2PX0A 4U8HA 2F1OA 3LFUA 4LIPD 5C4GB 5I7FA 1FNNA 1QF9A 4HAZA 1C9MA 3Q1KA 5IC4A 4YDHB 5TIIA 4M6WB 2XODA 3RSCA 1LGYA 3ZKWA 5B7GA 1BN7A 1HDGO 2IXBA 1DC7A 4XLLA 3UKOA 2FPKA 5I47A 4WAUA 2PJDA 3GAMA 3BDVA 3L0ZA 4TGLA 5F1OA 3UEOA 1SK8A 3OJLA 3UUFA 3LGSA 6YASA 3PEYA 3LIPA 1PJBA 4EBFA 3KYBA 1EP1B 1HEYA 1TU0A 3ETCA 3EG5A 2VH5R 3O4IA 2BGWA 4DWWA 3PGLA 4R5HA 5JI2E 2PUCA 2H9YA 4QRHA 4OJQA 3UPDA 3WNQA 6ADHA 2C5EA 2HIHA 1U0BB 1P0PA 5EFOA 5BR4A 1A88A 3EXHA 4O29A 3FF4A 3JD0A 3K7EA 5AJHA 1TF7A 3FKSA 2Z2KA 5DP2A 4ICIA 5AVVA 4IIYA 4JROA 3BK2A 3S0JA 5L8VA 3S28A 2PJUA 4CM3A 4F71A 3ZYCA 3RS8A 3SVZA 2H54A 3G68A 4HRYA 3WLPA 2WIGA 3WY9A 5KNLA 5C18A 4YT5A 2O5CA 1CY1A 1F60A 9ABPA 5B53A 3M6UA 1K5PA 2W4MA 4M1YA 1H0SA 2CYBA 1I24A 4QODA 4N0EA 5GWXA 3SS8A 4D4IA 4YMSA 3PE3A 3IVGA 2QZSA 2QWXA 4FUQA 4UDOA 1IN8A 4WCVA 1C80A 1MH9A 1ORVA 3EIEA 1WDLA 1L5YA 1ZVKA 4R2JA 4MKXA 1JQLB 2IYRA 1KFBB 1DKUA 1Q7BA 1SIOA 1ZSNA 3LVRE 3ONDA 4MQEA 3WGVA 3EFHA 1MEOA 4S1NA 3W3AD 4PN3A 2P79A 1H94A 4H2DA 2PJZA 4WZAA 4Q19A 1CR2A 1FMJA 4RK5A 1AQ6A 1DJLA 4LRSB 2AJLI 1G6KA 3MJFA 3HA2A 1A2OA 2EJUA 4Y2PA 4TKVA 2CHUA 4LSZA 2YZGA 2D2XA 3RVMA 3T3HA 4CR6A 1KYZA 3Q7QA 5TMPA 1YA8A 4DDHA 1IRXA 3GRRA 1VOTA 1TZBA 2J5RA 2V7WA 4K9MA 4YJ2F 5TGZA 4HDMA 5BSRA 3WLIA 1IQUA 1QZXA 3M2TA 4C89A 2HCBA 2R6DA 3TRDA 2H0AA 4M1KA 4ZRMA 4DNQA 3E70C 2V45A 2WFLA 3OOEA 4J94A 4DMUB 1DCTA 1QK5A 4JKOA 1JVNA 4RD3A 3FBGA 4LDQA 3CSDA 3R8CA 1KRWA 1A1SA 1LRJA 3MTDA 2OENG 3ADBA 3CLSD 3VV2A 1J33A 3VU9A 5ERYA 4NG4A 5J4KA 1E4EA 4KUGA 1YBHA 3ZHYA 1AK2A 1ZAYA 1QIKA 5IBRA 2D74A 1N57A 1FIUA 2ZXFA 2R2GA 1NC3A 2YY7A 5A03A 2HRQA 2O6LA 4X1IB 4IG4A 4BFLA 1QTQA 2X9NA 4HMOA 4XIJA 5KYUA 4BVBA 3L6EA 3PCRB 5DYGA 4O1HA 4B1FA 2C2BA 4CNBA 1D04A 4YRAA 2H59A 4CWAA 2H16A 5B58C 1JZSA 3V97A 4CKCB 4YRMA 1SCBA 3LP8A 4DCSA 4E6EA 2VP5A 4HZUB 4BJ3A 3DFZA 4G8CA 3KUCA 4B4KA 3A7EA 1YT5A 3I9V1 3MELA 1ULSA 5EZQA 3NP7A 1OWLA 2IV2X 1EE9A 5J2TB 2PEZA 3G8BA 4HFNA 3GA0A 4OK3A 4C0LA 4QIHA 5ER6A 5JNLA 3M6LA 1NVBA 3W4JA 3DP9A 1J0XO 3I5MA 3BJMA 2JFZA 1M2OA 1R9MA 3R0QA 4NC9A 4P38A 4BN4A 4C4YA 4K05A 2I7VA 1QYRA 4L9RA 5JQGF 5KOIA 3JU3A 3GJ8A 1Z37A 2E18A 2B94A 2VP4A 4GWKA 1S7CA 1NI4A 1U0TA 2HTEA 3KVNA 1POWA 3TW4A 8GPBA 3N8GA 3I8XA 2IXAA 3V8NA 3ZE9A 1YR8A 1VCHA 5T4FA 2QTTA 4UUPA 1JDBC 1MLDA 5FX2A 4BO5A 1E2PA 3EWNA 4JBGA 4P36A 2IU3A 3WL8A 2NZJA 4N39A 4Q6WA 1KQNA 4QUGA 4G1VA 3BB1A 1BCSB 2BY4A 3H11A 4LDJA 4UDNA 1JX6A 3VOBA 3R8FA 1ZLXA 4NCJA 4MPTA 4RE5A 3AU8A 1NMSA 1L7EA 2CMGA 1PVOA 1IZ7A 1JG3A 1U2GA 2IPNA 1NVAA 3G1TA 4TV9A 4EYKA 3OOHA 3C4VA 4YRQA 1RR6A 3ZWCA 4Y6LA 1GL6A 3KOOA 3ICQB 1PL7A 3T0GA 2HC9A 4FDUA 4MYTA 1YS7A 4BO9A 3OKPA 4TSRA 1CQJB 3CSSA 5FLYA 5B1IA 1W93A 1AZSC 1RBYA 3M1YA 4LJ7A 5DBEX 4QT4A 4B3RB 1XEFA 2JFPA 4MZDA 4ZOLB 4A03A 1Q16A 1QHIA 4F96A 4PM4A 3TLGA 2F2TA 4HEA6 2YDYA 4YWJA 3NR2A 4PN7A 4YAKA 16PKA 2RGNA 1I2CA 2HRRA 2QD2A 1BWSA 3RGGA 2KLBA 4YCBA 4D3DA 4YPVA 2BE9A 2XUKA 1LLDA 2H5IA 2ZPUA 1LPNA 3C3PA 3GJSA 1M2NA 3L9XA 1J0BA 1DX9A 4URUR 3NWEA 4F3YA 1H1LA 4NCAA 5TPWA 4UBKA 1R37A 1XF9A 3HRIA 4Y18A 3ZHUA 1YA4A 3RW9A 3S8MA 1HT3A 1JH8A 1X7XB 4PGMA 2Q6LA 3UM9A 5AI8A 4FMCB 1I4DD 3G6WA 2O8BA 4PZAA 4C0QC 2E9SA 3QI2A 5ALFA 4AULA 3MFYA 4GVXA 4H7PA 4EVSA 3RV3A 2FZLA 5SY9A 4UD6A 3V00A 1C8BA 1AGRA 1QWOA 3CR8A 2RHOA 4UE2A 1ACJA 1VJRA 2X0IA 2H2DA 3CEJA 1JHOA 2WVGA 3B12A 3P52A 4ECEA 3VO2A 1J21A 3S4YA 5LFAA 4ABTA 2QV7A 4B0PA 2EKZA 3WYAA 3PUVA 2DR0A 3OF5A 1JBEA 4HQ6A 1QOPB 4D92A 4GLBA 1C2TA 1MFZA 3KLPX 3QK7A 4U2FA 4A23A 5P8WA 3WHKA 1R64A 2ZR7A 1H1DA 3F90A 3KUDA 2OCLA 3ORRA 3IVAA 1TZMA 2R8PA 3QY9A 4NH4A 4U63A 3L02A 5B2ZA 4J3NA 4XR9A 1Y37A 1IM5A 1XLTA 4ZV7A 2AGVA 2JAPA 1CXZA 3ZVRA 3NZEA 1MW8X 3TX2A 4K9DA 3L0PA 2H1OA 5BOSA 1LFDB 2DR3A 2YV2A 4YCLA 2GN2A 1PD1A 4EGFA 1KXZA 3RJ5A 3IUYA 3RIXA 1Q22A 1U6JA 4ADSG 4DIOA 4EG1A 4ZO7A 2OG2A 3CVJA 4FW8A 2GPJA 3SNKA 2PA0A 4ZQBA 3AESB 4CF6A 1X7GA 1EGMB 1YE8A 4HDRA 1V8OA 3WKEA 1VIVA 4BX9A 1OBFO 1TVMA 1WHSB 3C5CA 3IGFA 5BSFA 2IYNA 4HGPA 5AW8A 5JADA 4INJA 4PSUA 4WVLA 1Z4PX 5G1OA 3NIFB 3PHLA 1GITA 3C5EA 1YJQA 2NSHA 4Y0VA 5GV7A 1JE1A 4AVYA 4CLRB 4F11A 2H9IA 4W4TA 1FFBA 2V9ZA 3H1GA 1XVIA 1QRSA 3DG9A 1T10A 2RHHA 1VG9B 4NMXB 1GUZA 3A70A 1L4FA 3FXAA 3K8ZA 3QVWA 4QU9A 4XAQA 4QO7A 1G5FA 1NFQA 4XH9B 5IM4F 3P9CA 3TECE 4KSCA 2ZITA 3EZYA 4QWMA 4WZAE 3SXUA 4U7PB 4CLXA 1ESDA 2A0XA 3O3OB 3OC0A 3GZNA 2ZJ7A 3QE0A 5FFNA 3VC3A 1KDOA 2Q3FA 4TV8B 5COAA 1H2WA 2W90A 1QIFA 4YFVA 1ADCA 4EJSC 5KKNB 5HNKA 4A6PA 2WUFA 4CBVA 4HVAA 5GM2A 1QMGA 4L5IA 4EH1A 4RAOA 4DXAA 3ETLA 2G1KA 4U4AA 2NUBA 3C1AA 5BN5B 4E7PA 2C84A 1DAFA 3EY4A 3KZKA 2ONYA 3HO1A 3F6PA 2OPHA 1X92A 3FPSA 3HCEA 2QN7A 3L6CA 2CWWA 1VKZA 2HMSA 3L4EA 4G1BA 4WZZA 1JZQA 4HHEA 3VBEA 1SC1A 1NSTA 1NJ2A 5TT0A 1E6MA 2DPMA 4KX3A 4DG9A 4O3MA 4HCJA 5ITSA 3WSVA 2Y2VA 3EXIA 4IUCS 1JIIA 1OI2A 2VCYA 1W5FA 3B13B 4Y2JA 2QJOA 3RTDA 4ZI7F 3V2IA 5K0EA 4PIMA 3VHQA 1GARA 1ZICA 1F4PA 5LJIA 1KO5A 3ANYB 3YASA 3JASA 2VJCA 4LYAA 5AKEA 1COWA 3I62A 4DJDC 2IC5A 1GGMA 2E4ZA 4G26A 1DQPA 3E53A 4Q9KA 1IY1A 1JKIA 2N46A 3BGIA 3RK0A 4DMRA 4KQMA 4S3MA 4PHTA 1FP1D 2BMAA 3HYCA 3KVYA 5FD8A 3ZZ1A 4FFOA 1VJGA 3SF8A 3VH3A 5TXGA 5BN1A 1XKTA 4IH1A 4CTMA 4XB2A 4D74A 2H3HA 2ODPA 4MVYA 1U28C 1KHTA 3DDSA 3L8HA 3HYRA 1ISGA 5E6SA 1H2EA 2LKDA 2G07A 2IODA 3H4IA 4AJ2A 1CUIA 1VJ0A 1IB0A 2VOJA 3KFXA 2BMDA 5LLSA 3ZV4A 4HWSA 1UBGA 2D4AA 2PWBA 4NBUA 2YXNA 3AY6A 2G4VA 4GMDA 5JJKA 1JWAB 1ZI8A 2VDPB 1YH3A 1XU4A 2WQZA 3KR2A 1DC4A 1PQWA 1QJ4A 3MQ2A 5JDCC 4HLDA 4ZCPA 4E13A 4I1PA 1X13A 4ND5A 1QU3A 4KYUA 3LRPA 4B09A 1C7RA 4XQ9A 4CM9A 3OEHA 4I8DA 2WTBA 2IPOA 3IVXA 3PRJA 4RGQA 5I9BA 1AKNA 2XTJA 3N2KA 4HI0E 4CG3A 3DKRA 4ZJYA 1RRCA 3K0BA 3OA2A 1QE5A 1F0NA 4EMBA 5EKDA 1RHRA 1F0KA 1XCPA 2O4CA 1HY3A 3DQPA 3HZOA 3NT2A 1Y7TA 3MT8A 3QRWA 5DP1A 2XGJA 3E8SA 2WD9A 1R8YA 3RLFA 1VRWA 3UV7A 2AKYA 8OHMA 4IL5A 1THMA 2PIDA 4MSUA 1N8SA 3QQPA 3V7NA 1T34A 1BRTA 3JZAA 4RY8A 4M4SA 1POXA 4F9TA 4FZRA 4IJUA 3TEMA 4UHKA 1AB6A 3ES9A 4WKNA 4JJIA 4XVHA 3MJTA 5AI4A 2VT7A 3A6PC 1YXMA 1KJZA 1QS0A 1L1RA 1JEJA 3E22A 2F9FA 3FVQA 1C1DA 4CW7A 3HDVA 4P4NA 5GTDA 4YRJA 4WFJA 3U9TA 1E61A 1YVDA 1OU4A 1P91A 3ND7A 2ID9A 4YQFA 2Z6VA 1WSAA 1UOOA 1I0IA 4HQ0A 1TTTA 3B7WA 2F8TA 1VHJA 4G0XA 4G5QA 3LYLA 4W8OA 5DX8A 1E2UA 1QK4A 4RFVA 5A1JA 5ADWA 2QL5A 1RYEA 3LLMA 4IMPA 4I4TF 3SM9A 5FA8A 4DUPA 3KVRA 2C7QA 4V0OA 3IEUA 3IUEA 5JBNA 5DBFA 5T67A 3JQCA 4FMBB 3GC6A 4RBNA 3VPAA 3W9UA 4A16A 5DTQA 3KZNA 3OZFA 2NWQA 1LQ2A 2O3UA 3G9TA 3INTA 5I9NA 5EZYA 3UK1A 2YWGA 3VZBA 1XLWA 2IEGA 1TQ8A 1DKQA 1TEHA 2P9ZA 5BRNA 2OK7A 4NAUA 5EJ8A 1ZWKA 1TEZA 1FPQA 3QELB 1NBMD 4LOIA 1EMDA 3ISJA 3MPUA 1QHHB 2OEPA 4GF5A 1CJCA 3CCBA 2A4MA 4Z8YA 1P6QA 3RKRA 3AF6A 3UGKA 2AQ8A 4YPOA 4CL0A 1JS1X 4OGLA 2D8MA 2TMKA 1E6UA 4PS1A 3EF1A 4G5FA 3IBYA 2DYKA 3MMNA 5GGYA 3ANTA 4BMPB 1M8KA 3T5CA 1CLUA 3MWKA 3O21A 1K7SN 3ESZA 4NDZA 4OU4A 4IQFA 4JVNA 4W8GA 4FB4A 5GQSA 4LQ4A 3L0DA 2HQRA 3COSA 3PITA 1QR2A 2O19A 4KFTA 3UPUA 2A9KA 4G86A 4C14A 1Z6QA 3DO6A 3V4OA 1X0XA 1SQ0A 2JVKA 2O7RA 1ZM7A 3AKZA 4TMZA 2ZUSA 1GRCA 1LNSA 3G2IA 3ITEA 3MYYA 5KSPA 3ZHSA 2FP3A 2NZVG 3P2KA 3UIEA 1B15A 4GI3A 4YHBA 4INOA 2HK6A 3JYPA 3AY3A 1IBKB 2HU8A 3B1WA 3DO8A 1E7YA 2JLCA 6NULA 5FNVF 2VAWA 4Q24A 3T54A 2CK3D 5B4TA 1G0NA 3NJRA 4RTRA 3EXG2 1P9NA 1RAHA 2E89A 4RJ2A 2WTUA 1R4AA 1XRRA 2AC4A 2WPDD 3IUQA 3L7DA 3QF7A 3RIGA 4BBAA 2H2FA 2OUIA 3T3DA 4KPYA 1YJ5A 3Q6MA 4DV1B 3FYHA 1GQSA 1JEAA 2I5PO 1ONPA 1X77A 2W00A 4RTMA 3EXHB 3BHIA 3O2SB 4PQEA 1M0WA 4O4LA 2IVFA 4Z4EA 4AKIA 1KMHA 2QD3A 3TFOA 1U6IA 1UKZA 4ENVA 1O0BA 3IEIA 4NQZA 4EJ6A 4AN0A 3LW8A 5FI5A 3VYSB 2XB6A 3ORYA 5KJ1A 4KMMA 4O4IA 1SUFA 1Y82A 5TEVA 4D5EA 4FS8A 4UATA 4IOLA 2BHSA 1BDBA 1PT8A 2PBLA 2YWFA 3ZGYA 3T52A 1RJ9A 3NHZA 2ZUCA 5LD2B 4X6UA 3R6WA 1DQNA 2KJQA 4ZMRA 4U6SA 2VHCA 1DTWA 2QLTA 4GRIA 4XWYA 1WAMA 3PXCX 4FFBA 5AW0A 1EZ1A 5IJZA 3BXOA 3D31A 4OLJA 1TMKA 1PT7A 1Z0SA 3BRWA 1F6BA 3TX6A 4QHSA 4MQEB 2HQ1A 1Y8AA 3FNIA 2ACEA 1E5XA 3DOEA 4LJAA 5FAKA 2DE0X 3JPYA 5AVJA 4WZAB 4DL9A 3GVPA 4B31A 4QUAA 5JSFA 3VPHA 4OKSA 3OZIA 3WBKA 3NEAA 4TKVB 1MJGM 3WYFA 2HIAA 3GEDA 5LA6A 3FCAA 3U19A 4O2AF 5A02A 1S8FA 1IQRA 5K2MA 4NOLA 4BOYA 1AXRA 2WMDA 2VSQA 3CNLA 2P78A 3PJGA 4IPTA 5I4CA 4HRXA 3IP7A 4EFNA 1XRLA 2QE7A 4BEVA 1W0KD 4AS2A 3PQ4A 2O7QA 5AJUA 2QZ4A 4NMMA 1NQ5A 4RX1A 1Z88A 5ILGA 2PKEA 1JV2B 1DEAA 2DQYA 2KBFA 3CUSA 4RCZA 3F9RA 5HZKA 2YRXA 4JLNA 3SS7X 1TIPA 3JALA 2P8SA 3VU9B 2B21A 4PHHA 3VR2D 4HLNA 1E4EB 4KWCA 2XCTB 4KVZA 4XWAA 5F5NA 3HDTA