1IUNA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
ANLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords meta-Cleavage product hydrolase
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iunA00
2PUHA 4U2BA 5AK5A 1XQWA 4F0JA 3HYSA 1W1IA 4CCWA 5HZGA 1WPXA 2HRQA 5K3BA 3DJYA 1GQRA 4MQMA 1XRLA 4DM7A 1MNQA 3EF3A 3I6ZA 1FSSA 2XMQA 4Y7DA 1YA4A 1L7QA 2OXEA 1X2EA 1KEZA 1UK6A 4Q3LA 4KACA 5BWCA 4AQDA 1XROA 5BOVA 3H1BA 5AI5A 4HXFB 2AJLI 1ZIYA 5AKLA 4IH4A 3R0VA 5EHXA 1U4NA 4U2DA 4ZXFA 4Y2SA 2HU5A 4E11A 1AURA 2DCMA 4ZGBA 1OILA 1QIHA 3GFFA 2XUJA 5DNVA 5LP1A 2VJAA 2PUJA 1G42A 4AN1A 3HSSA 4B81A 5ALHA 4X95A 1JI3A 5LYYA 4RE5A 4J03A 2I3ZA 3H2JA 1XZAA 5ALVA 2AJBA 1GXSA 2HA4A 3FNBA 1QIMA 1UKBA 5AKKA 1IUOA 4N5IX 4C4XA 5K3AA 5DTIA 3QMMA 4XX1A 5HF8A 2D0DA 4Y2TA 5ALZA 4HS9A 1LBTA 2BJHA 1WOMA 3FVRA 3FYTA 1ETHA 2YXPX 2R8BA 5A7HA 1XFDA 2B61A 2CEKA 3B5EA 4NZZA 1DU4A 3MVEA 3BF7A 3R3VA 3IB3A 1E3QA 1QIDA 3AZOA 3HEAA 3R40A 2WJ3A 1QIFA 1HL7A 2Y1KA 3SC2A 1LPAB 4FLMA 5EIAA 4J3JA 2ZYRA 1HKHA 4Y2VA 2AXEA 2WIFA 3PICA 5HQ3B 1H2WA 4FNMA 4AMYA 4LHEA 2V96A 4I3FA 3FLBA 3BDIA 3ED1A 4LXHA 4EZIA 3BJRA 2C5GA 4DYHA 1JFRA 4DNQA 4GW3A 1DWPA 4F5ZA 1ZIXA 2Z8XA 1TK3A 3FWHA 1PFQA 2DFPA 4FNGA 4K5QA 3BDVA 1CUSA 3G0IA 4BAUA 2PU7A 1ORWA 2WU4A 1DX6A 3F98A 3E0XA 5AKIA 3WIBA 1FJ2A 3OG9A 4UHBA 1AC5A 4XJVA 5CT5A 3C5VA 1XZDA 4IO0A 4G4JA 1A8UA 3FYUA 5FUMA 3F96A 3QITA 5LZ2A 5FPQA 2QMQA 3SWWA 4J0IA 3A2NA 5AHXA 3I2JA 1EDEA 1LNSA 1YAHA 2G63A 3CXUA 3PI6A 5AICA 3GUUA 2DR0A 4AX4A 2ORYA 2QXUA 2OAEA 4G4GA 3ESBA 2WJ4A 1EDDA 2GBIA 5I7UA 4HAIA 4PSCA 4X6XA 5AKEA 5EIEA 1B6GA 4QDXA 4B82A 5FRDA 2OCLA 5JD6A 5AJHA 4C88A 4YASA 1QO7A 2QT9A 4UFOA 2WUGA 3H2IA 1ODCA 1Q84A 1SFRA 3I2GA 4NMWA 4QWMA 5D7BA 3I1IA 1LBSA 4WFJA 5ALMA 4BAZA 1BCSA 3I6MA 5ALQA 5HCUA 2ZSIA 2QVBA 5JATA 1WB5A 4FBMA 2WLSA 3DDUA 1AKNA 3WK7A 4U2EA 3F97A 4G4IA 1UKCA 5LZ5A 2QJWA 3GZJA 5HF5A 2HA2A 3JWEA 1LPBB 5IVHA 5DNWA 3PE6A 4PO3X 1Y7HA 4L9AA 4MEBA 1WPRA 1YSCA 1KU0A 3KXPA 2XUPA 3X3HA 5HF6A 4W1QA 1ZI8A 5AI0A 1CUVA 1DTEA 2BKLA 1CUEA 2XUDA 2PSDA 2CBGA 1H23A 4Y2PA 3V1KA 3H1AA 3AJAA 5ALNA 4C89A 5LZ7A 2BGRA 4RNCA 3AIKA 3FLAA 5AIAA 2VEOA 4P9NA 4PV7A 5I8PA 3STXA 4BYMA 4NVRA 1ODSA 2JGLA 1DINA 4UBIA 2HM7A 3DOHA 4ZREA 1UT6A 1KU6A 2HADA 4X6YA 5SYMA 1C4XA 4AZ0A 5HF9A 1JJIA 1P0QA 1F8UA 2QJRA 3AINA 3NGMA 1THTA 4GECA 5HK8A 4MWSA 1D07A 2ACKA 4MWTA 5AM2A 1E89A 1K5PA 2QS9A 4Y2YA 3C6YA 3AIOA 1CUGA 4DNOA 4QDTA 1Q0RA 3HXKA 2VAXA 3ZLVA 5HKAA 5AOCA 4DMHA 2GZSA 4HRYA 2QTBA 4UBJA 1W52X 1QIEA 1CQZA 4X00A 3EQ7A 4WDRA 1A8QA 1S8OA 4EB0A 1YA8A 1DT5A 1IZ8A 3WK6A 1ZD2P 3T52A 4V2IA 5DYTA 5FKJA 4CG2A 3KD2A 5A71A 3WQHA 4CIBA 3DL4A 4C6HA 3F9CA 4X97A 5AO9A 2XT0A 1XZFA 1QIKA 1E8NA 5CTAA 3V1LA 4BRSA 3PDCA 2WUFA 5JASA 3C6ZA 4LYEA 1GPNA 4B7ZA 4LYDA 2XUGA 4OSEA 2ACEA 3BF8A 2X5XA 5AKJA 1MU0A 2XMRA 2G5TA 1BROA 2WFZA 3ZI7A 2XMZA 4MJ3A 4FFWA 3EQ9A 4F60A 5JARA 2GYUA 2DQYA 3G9XA 1R88A 1E66A 1K8QA 2CB9A 2VAVA 1EH5A 1TRHA 3WMRA 3G9UA 4X3CA 5K3DA 1T2NA 3O4IA 1TCBA 1XKTA 4D9JA 5CH5A 2OQVA 2VSQA 2VATA 1XZCA 4C87A 4ZWNA 5JADA 3DCNA 3ESAA 1X70A 1H2XA 4KJXA 4X93A 1XZHA 1LPMA 2RONA 4KE9A 2XMBA 1G5FA 4E15A 2XMSA 2G5PA 3IUJA 2H7YA 2HA5A 2Z5GA 2NW6A 2JGEA 4J0GA 2HA6A 5T4EA 6YASA 1CR6A 2ZYSA 2VTVA 1XRMA 3QPAA 4CG3A 1YR2A 2V9ZA 3BIWA 5ALSA 4S0XA 4ZRDA 2WHPA 3ILSA 3F8SA 3H2GA 5FV4A 4QDZA 3A6ZA 2IITA 3DQZA 5C8ZA 2WG1A 3QPCA 2XMGA 2I3DA 3VISA 5I9IA 1XZLA 1ZJ4A 2VJBA 1CRLA 4MQLA 4L72A 1MX1A 3MUOA 1YAJA 2HU8A 4YX9A 2DHDA 1HBJA 3H2KA 2Q0XA 2C4HA 4X91A 3L1JA 2ECFA 5DWDA 3U0VA 3N0TA 3IVMA 3NOXA 4M0EA 2JEYA 2JGIA 2J3DA 5AKXA 1MAAA 5JD4A 4DMKA 1T4MA 2FJPA 5LKRA 4EBBA 2EEPA 1R50A 1BU8A 1MN6A 1I6WA 1CUCA 4BE9A 1YS2X 2OCKA 1OXMA 1XRPA 4RPCA 3D2CA 2JF0A 4AXBA 2PU5A 1NU6A 4HRXA 2IIVA 4CI9A 3H0CA 5K3CA 2HFJA 1CUXA 2PBLA 5E4JA 4HVTA 5LLSA 3AILA 1R4ZA 1LPOA 3D59A 3WYNA 2XUFA 4AO6A 3O9MA 3ANTA 5AKYA 3RKSA 3V9AA 3K9BA 3AZPA 5CBKA 4KE6A 3WLAA 1L7RA 1JJFA 3LS2A 1QZ3A 4GHWA 1EA5A 5JAUA 3L1IA 4OUKX 2CMFA 2P8SA 4BCDA 2WIDA 1GPKA 2Z3WA 2WILA 2YYSA 4WFKA 1WM1A 2RI6A 2BUCA 3WA6A 3WIOA 1IZ7A 3BJMA 4DMFA 1SCKA 1FFBA 1UZAA 4HTAA 5KWJA 1GZ7A 1CUAA 1G4HA 1J06A 4YK7A 2O2IA 3GBSA 1WB6A 5ALLA 1FFDA 5JZSA 5AP9A 4Y2UA 1GKKA 4GDMA 1W76A 5LKAA 3HC7A 4KAJA 4OYLA 2WG0A 1XZEA 2QR5A 4OU5A 1WHTA 5JANA 2AJ8A 2CUTA 4CIAA 1SC9A 3DYVA 3PF9A 2RGUA 2AJCA 2XQGA 4ARAA 5HFNA 3STWA 4WDQA 5HFAA 4JNCA 3DKKA 4KE8A 4BCBA 2VT6A 5AM1A 5KWIA 3OTQA 3N2ZB 3PF8A 2W6CX 1LPSA 3AIMA 1GGVA 4L3WA 4N8SA 2OGSA 2BCEA 3Q0TA 3BL8A 4K2AA 4Q3OA 4QLAA 1MPXA 5IH7A 2Y6VA 2WHQA 3V1NA 1ISPA 1N5MA 3D7RA 3EIOA 4BAGA 2PKYX 3WKDA 1XZKA 4GBGA 5AI4A 5AH0A 4CG1A 1FFEA 2X8BA 1XZGA 5DLPA 2VJDA 3WWEA 4BC0A 5AIBA 3DEAA 5JAHA 2V97A 3HJUA 2WFMA 1U65A 4HZGA 1VE6A 7YASA 1DQYA 4C4YA 1LZLA 1Y37A 5LIPA 2ZJ6A 2O2GA 3L1HA 5C81A 5JAPA 3YASA 3A70A 3K2IA 2HRRA 2HA0A 2PSEA 5DYYA 1HQDA 3G0DA 2PL5A 4H7DA 1TCCA 5D6OA 3HLKA 1HLGA 3KWFA 3WWOA 2OG1A 3R41A 3IA2A 4ZV7A 2QRUA 4G1FA 1CPYA 1JU4A 4DGQA 4YPVA 1R1DA 3FYUB 3W06A 3D5EA 3F67A 3E3AA 5C8VA 2XUAA 4E46A 1WHSA 1MX5A 4UPDA 4G8BA 3PFBA 3RK4A 4N5HX 3ICVA 4BDSA 4CCYA 4QDOA 4QA9A 2HL6A 5CT8A 4WFIA 1F0NA 1FFCA 5FPPA 1DWQA 3IUQA 4X7BA 1LLFA 2DHEA 4FFVA 1H2YA 2JGKA 4B9EA 1N8SA 4K6HA 4Q3KA 4KEAA 3I2FA 2WUEA 3G02A 1ZJ5A 5ALXA 2DSNA 3D4LA 3ICWA 5D3KA 1EK2A 3DLTA 4BZWA 4EY7A 4BATA 1QIIA 2ZJ7A 5A6VA 1TKRA 1UK9A 2CZQA 3O4GA 4F21A 5AI8A 1VKHA 1U8EA 2J3QA 2C7BA 4B80A 4C4ZA 3LIIA 4DTCA 3ANSA 2IX9A 3WL6A 1XZJA 2BAGA 3WI7A 1O6GA 5CURA 5EHNA 5IVDA 3C45A 4BE4A 5ALUA 4BP9A 2H9YA 3M83A 1ORVA 1R3DA 5FP0A 4BVJA 2WJ6A 2QM0A 3CN7A 4B6GA 4MXDA 2RIPA 2XMCA 2AJDA 3WKAA 2GBCA 4I4CA 3OPMA 2PM8A 2O7RA 5DNUA 5ALEA 4UBOA 2R11A 3STUA 3GELA 4GLBA 5EI5A 4B0OA 1GKLA 3SK0A 3O4HA 1QO9A 3C70A 1VXOA 4TVKA 1QTRA 2YASA 5CT6A 4FKBA 3OM8A 4KR0A 1LGYA 4WJLA 2B4KA 1CUUA 2XB6A 2VA9A 4XIIA 3DKRA 3WWPA 3H18A 3WZMA 2CKMA 4GI1A 5ALKA 5ALDA 1XQVA 4OD0A 1MTZA 2XQFA 1QFSA 4G5XA 5F4ZA 5EHZA 3AZQA 1ACJA 4UHCA 4BVKA 4MYSA 2UZ0A 2QKYA 2WQZA 2JGJA 2YH2A 3WKBA 2HDWA 3STTA 1MX9A 5AK6A 3D2AA 3R3UA 1HPLA 4PSUA 5K5EA 5ALOA 3VVLA 2QUBA 4BVLA 4W1PA 2ONCA 1H2ZA 3ZWQA 4N8DA 4W9RA 3STYA 1VLQA 5ALRA 2JEZA 2EDAA 4FMPA 3CCCA 2ROQA 4J0DA 3AUKA 4BDTA 1RWQA 2QUAA 3WK9A 1SOMA 2BUBA 3SX4A 1ZOIA 2FX5A 5E4TA 1EXWA 2V98A 4XWGA 5AOAA 4PW0A 2XUHA 5IVIA 2OGZA 5AK4A 1CUDA 1OCEA 3WWDA 4EY8A 1HDEA 4PNZA 3FBWA 2QZPA 3D2BA 4HXEB 3R3WA 2WUDA 1UK8A 2E3JA 3FSGA 3FLEA 2WIKA 5AM0A 4DIUA 2ZVDA 3IBTA 5AM3A 5YASA 2XLCA 4X85A 4ZV9A 3NUZA 3I2KA 3EBLA 1QOZA 4BRZA 2OQIA 4A23A 4EUSA 1ZD5A 5FOQA 5EIHA 2K2QB 5ALPA 3WK8A 1XZBA 2J4FA 4N8EA 4Q05A 1UK7A 3BIXA 4H0CA 4UBNA 5CW2A 2J4CA 2WTMA 4E14A 4IH9A 1GQSA 1L7AA 2PSJA 3WJ1A 3KWJA 4LXIA 3QMVA 2XUIA 4OB8A 5C7YA 3WK4A 1JU3A 3O4JA 1F0PA 1YCDA 1NX9A 3QYJA 3NWOA 1CUBA 4L0CA 1O6FA 1P0PA 3O95A 1CFJA 2WU3A 4A5SA 3T4UA 4P92A 1J1IA 1Q83A 4GWLA 1N1MA 3DL7A 1ZICA 5DTJA 1LPPA 1JT2A 1PJAA 2Y2UA 5CH8A 3D3NA 4FHZA 3H04A 3OC0A 4AB1A 2WFLA 5JD5A 3V1MA 2OLEA 1B41A 1A88A 2RAUA 4UHFA 5ESRA 1A8SA 3G7NA 4M0FA 3FYUC 3LLCA 5SYNA 1ZGCA 3WL7A 1MNAA 5KBYA 3CCBA 1IUPA 2C58A 4OU4A 3LIPA 1J2EA 4JH0A 2H7CA 3I6YA 3CN9A 1CUWA 1VA4A 2WHPB 1EB8A 1SCIA 4O08A 4DSAA 1AZWA 1AGYA 2GBGA 3H2HA 4B9AA 1LZKA 1BS9A 1TQHA 4G9EA 1VE7A 3V48A 4KE7A 1F6WA 4FLEA 3R3XA 4K6KA 3QVMA 4AMZA 1GT6A 3E4DA 3MGAA 5BV7A 2XLBA 4FBLA 5K3FA 4BB0A 3QM1A 4QDUA 1K6EA 1W75A 4J0HA 2WM2A 4U2FA 2C0QA 1EK1A 3TGLA 3R3YA 3WKEA 3C6XA 4BZZA 3KOOA 3RARA 2GBFA 4KRXA 3PUHA 3R3ZA 4TGLA 1QIGA 1VZ3A 3QPDA 1EX9A 1BE0A 3C6BA 3VKFA 1EVQA 1QGED 2BUAA 1DQZA 1BN6A 3DD5A 4PQEA 5K3FB 5AOBA 1QJ4A 1BEEA 2BGNA 4H7JA 5KREA 5A62A 5E4YA 1CUJA 1UOPA 1IUNA 1MT3A 2XUOA 1U2EA 4Z49A 4H18A 1CLEA 4G8DA 4X92A 4QWWA 3IUNA 5LZ9A 1E8DA 3B3QA 2EDCA 3O0DA 2OAGA 3GA7A 2PX6A 1VXRA 4FLFA 2FUKA 4DLNA 4TPKA 3I2HA 3PUIA 1BCRA 3QH4A 3WWCA 1MO2A 3S8YA 1AQLA 2FJ0A 3WZLA 3E1GA 2BFNA 1UOOA 1XLVA 2PSFA 2PSHA 3D0KA 3UMJA 1WCYA 4WCVA 1TCAA 4UBLA 5AK3A 1DT3A 2D5LA 1AUOA 2PVSA 5ALJA 2XQIA 4H7HA 4AZ3A 4NS4A 1SCQA 1CIJA 3QZUA 1G66A 2VF2A 3DOIA 3G9TA 4Q82A 2QXTA 4QZVA 1CUYA 5FXMA 4Y2QA 4EY6A 4K6GA 3FVTA 2C0PA 1K63A 3RM3A 1JMYA 4Y2XA 4BP8A 4H7FA 5HK9A 2DQZA 2Y6UA 4ITVA 4ROTA 5CRIA 2ZSHA 3I1YA 4Y9SA 3DNMA 5ISMA 4KAAA 5HQ3A 4W1SA 4UBMA 4U2CA 4EA6A 1XQYA 5A7GA 5EHQA 1CUHA 3TJMA 1PV1A 2HU7A 2QOEA 5LZ8A 3KDAA 4J7AA 4X94A 1AMNA 4HXGA 4G8CA 4J0CA 3JYHA 5EGNA 1R9NA 3HACA 1E8MA 3Q8WA 3BXPA 4U2GA 5K3EA 3FSGD 4FWBA 2H1IA 3EQ8A 1TAHA 3G0GA 1CQWA 1VOTA 4AO8A 2WTNA 3VDXA 4DNFA 1UKAA 4IHAA 1THGA 1X2BA 4UHEA 4DNPA 2PPLA 5ALTA 2C5FA 1XKLA 4QEKA 3VJMA 3WK5A 1QE3A 2O7VA 3TEJA 1P0MA 4H77A 4KYVA 1WB4A 5DJ5A 1XZIA 2ZJFA 3G0CA 2XE4A 4JYMA 1NU8A 2B9VA 5ALIA 3M81A 1YB6A 3IULA 2ZYHA 4EY5A 1FFAA 5D3ZA 2B20A 3OURA 5H3HA 3DYIA 3G0BA 3I28A 3OOSA 4ETWA 4UHDA 4QE3A 1CUZA 4ARBA 1CUFA 3ZLTA 3FAKA 5HKBA 4MEAA 5A2GA 3UUFA 1XRRA 2XDWA 4CCYB 1XZMA 1BEZA 1E5TA 3U1TA 1XQXA 1C7IA 4H7IA 4UBKA 4PF1A 4J0JA 3HI4A 1IMJA 2XUQA 1J07A 4OYYA 5CXXA 5A7FA 1EI9A 4KAFA 3FOBA 1CVLA 1ZD3A 4OPMA 3HABA 1CUIA 3BE8A 4MYDA 3HZOA 3K6KA 1ZD4A 4UFPA 3ZPXA 4UUQA 4JYPA 4W63A 1CV2A 3WL5A 2JGMA 3H19A 3ESDA 4P08A 3W04A 5AI6A 3JW8A 3S2ZA 2RHWA 2H7XA 3C43A 5CT4A 1LPNA 1BN7A 2WG2A 5EFZA 3H17A 3RLIA 5C8XA 3MUNA 3C87A 5AKHA 3HRHA 2RHTA 2LIPA 3FCYA 4B84A 3M82A 2W22A 4H7KA 3W05A 5DYWA 1JJBA 1XLWA 2XQKA 1TIBA 5JAOA 3AFIA 3G9ZA 4KRYA 3ESCA 1ZI9A 4G9GA 4BBZA 4P93A 3C8DA 3WL8A 2DHCA 5T4HA 4LXGA 2WIJA 3LCRA 1EB9A 1QONA 1K4YA 4OB7A 3BWXA 3IDAA 3LP5A 5CH3A 2XI4A 4GEGA 2VQ6A 3QMWA 1EVEA 4X71A 2ZYIA 4ZI5A 1QTIA 3IURA 3C5WP 1UFOA 3VJLA 5AKZA 2HA7A 5E2IA 1A7UA 3GROA 4WY5A 4OCZA 2OCIA 4PSDA 5AM4A 4B83A 3WA7A 3C8HA 2WSLA 3QBJA 4A16A 3STVA 2JIDA 4INZA 3VJKA 5T4FA 1YASA 4LKOA 3O9VA 4IH1A 5IVKA 1XRNA 2WIGA 1XRQA 4H35A 3DS8A 4WY8A 2X76A 4Y2JA 1DWOA 2XQJA 1RYYA 5FLKA 2Z3ZA 1JKMA 3WKCA 4B0PA 5CXUA 3PFCA 1QLWA 1N5RA 2VJCA 1YS1X 3W9BA 4QNNA 4X6UA 3VVMA 1CEXA 2GYWA 3IIIA 4BCCA 4W1RA 4JUIA 5ALYA 5JZ9A 4Q34A 3ZV7A 2GZRA 4X90A 4Y2RA 1EHYA 4CFSA 2Z8ZA 1Y7IA 2JGFA 3B12A 5JYCA 5J3JA 5AKGA 4AN0A 5JIBA 1ODTC 3WJ2A 1UOQA 4RGYA 2I78A 2XMDA 3I2IA 4BTLA 5BWBA 5LZ4A 2Y2VA 4UHHA 5IKXA 2WKWA 1R9MA 4FDMA 4XVCA 1QIJA 3VXKA 4FOLA 4BTVA 1DX4A 1UWCA 5ALWA 1YB7A 1MJ5A 4Q1VA 4DSZA 1EDBA 4H7EA 1ACLA 4JEIA 3M3DA 4AO7A 3W2TA 4I19A 4EHBA 5JZBA 3WYDA 1ZI6A 1Q0ZA 4FTWA 4OB6A 2I03A 1EINA 3FCXA 1VZ2A 2OGTA 4BC1A 1MAHA 1JMKC 1ZGBA 1W4LA 4UFNA 5ALFA 4RE6A 1M33A 3G8YA 2HIHA 4EY4A 2WFLB 3ZLUA 1Z68A 1H22A 5AI9A 4B85A 1USWA 2CJPA 5CT9A 1C7JA 1AX9A 5ALGA 2GYVA 3W9UA 2JBWA 2HA3A 2XUKA 1VJ5A 3A2MA 4IQ4A 4DMCA 2HFKA 4M0MA 3IUMA 4LIPD 3UUEA 1W6RA 5T4BA 1QFMA 5AM5A 2OPHA 2G4LA 2HHAA 3TRDA 4J0KA 2VT7A 1BRTA 2ES4A 1IVYA 3A2LA 1RP1A 3KSRA 5FDFA 2O2HA 2OCGA 5JALA 1XLUA 4QLOA 2WHRA 3P2MA 1GPLA 4GXNA 1VA5A 4C01A 1UXOA 1P0IA 5CMLA
chains in the Genus database with same CATH superfamily
6GPBA 2XZLA 3BWMA 3K2BA 4HDNB 5D3MB 5EIWA 1XDSA 3TW6A 4ZIRA 2C20A 4TKZA 1PKEA 4QJIA 3ZZ1A 4PFSA 4GSLA 1CJUC 1T1GA 4TVBA 4GKJB 5LC1A 1Y3DE 4DAEA 5JEDA 1XAHA 3LRTA 3AKDA 3EY9A 2VZ9A 1D03A 3KZCA 4NBWA 2ZE6A 1JR6A 2AMVA 1U0RA 1J0EA 2ZJOA 4MW6A 4XWAA 2A35A 4Q5IA 3TZHA 2NVOA 4QUHA 2WDPA 3TKLA 3DFMA 2J32A 2R2GA 1UPFA 2F9LA 3HB7A 3BICA 4YJHB 2R751 1NPDA 1NQWA 1BXGB 1PHRA 4ZVMA 4PYQA 2NSYA 3H0EA 1YCFA 3SJCA 2E4XA 1YR6A 3K0CC 3EF3A 4L8WB 4PZAA 4IDNA 3I6ZA 1JH8A 2NU9B 2VPYA 4C4PA 3VR3A 4W9MC 2XMQA 1PT8A 3BL6A 3VZSA 3QFRA 4IQGA 4MR7A 3X1JA 1M8PA 4UNPA 1KSGA 2ZIXB 3HKBA 4JMPA 2PKCA 4AQDA 5BOVA 3F90A 3AFMA 4BPBA 2Z4RA 2AJLI 1D2HA 2HSEA 4IH4A 2GZ2A 2Q46A 4FCTA 3T0IA 4PHHA 3DCJA 3W77A 2ZYVX 4U2DA 5KYWA 4ZXFA 4WXPA 3WV4A 2HUPA 1AURA 4WIAA 5BPHA 2AB0A 1U7WA 2PEYA 3GFFA 4XRRA 1L4UA 4BB9A 2DP4E 1SKMA 1ARZA 4ZK6A 1OFTA 3FZNA 4IHQA 4G85A 2B36A 2VWHA 3DZFA 3IESA 3UC9A 2H63A 1AJEA 3AG5A 2AEFA 3GFPA 3HEBA 5E95A 1SIBE 4X95A 2ATXA 4UVEA 2AZDA 2VLBA 3OCWA 1LXCA 2DY0A 1ZGAA 3QFTA 4GC9A 5GY7A 4JJEA 4K9OA 1YBHA 1IFXA 1IOZA 1UIMA 2I3ZA 4UMEA 4DIOA 2FPIA 2B1IA 1NM5A 4K03A 1DJLA 2AOVA 4KK4A 1BNCA 1CFZA 1Q17A 4HAWA 4KP7A 4ZVPA 4BFCA 2OUIA 4IRMA 1GXSA 1HUQA 1TC1A 1JAHA 2HA4A 4PBRA 3RU2A 4UULA 3SFVA 1H4VB 3I72A 1V4NA 3ZTWA 2IHNA 5L9AA 3TIIA 1QIMA 1S4QA 2RK3A 4ALKA 2ZSDA 5EN4A 4M36A 1T2CA 5KCMA 2L2QA 2DRIA 4F3NA 5C51B 5K3AA 4WMLA 1OW3B 3FWNA 1OT5A 3N8HA 3IDZA 4JCCA 2DERA 4XX1A 2D0DA 3C24A 4KUGA 5ALZA 4BQFA 4UPEA 1EP1B 3H4IA 3MTQA 4N6GA 5KYNA 5BT9A 1NDUA 1N0UA 4DXAA 3FNIA 3FVRA 2IC5A 3Q3HA 5C5IA 1U7UA 4V0QA 4ZALA 4AZ3B 3T1TA 3OQIA 1AZTA 1EJ6A 4N0PA 4KIJA 4NNJA 1N32B 2V4ZA 3QLUC 3PFNA 1JHUA 3RABA 3W2HA 1DU4A 3MVEA 4RU1A 1LJ8A 1RJEA 3L0YA 2WSIA 2GXUA 3G13A 3QKRB 4MGIR 3TZBA 3AR9A 4EH1A 2JFHA 3UHPA 1QIDA 1FL9A 3CZ5A 5BUZA 1KPIA 2QV7A 3KYIB 4OHVA 4DSOA 3HEAA 4G67A 2WJ3A 1K7CA 2QVCA 4J29A 1L5NA 2GAOA 3LKVA 4NU6A 4KIFA 4EA8A 3GCZA 1QIFA 4YJKA 4AUEA 2Y8EA 1B16A 1HL7A 3F8TA 4GPEA 1N78A 4DIKA 3N2KB 4O29A 2YJ6A 3DLHA 2ZWOA 3ZWWA 3BK2A 1MXFA 5A06A 3E2MA 4O3FA 5EIAA 4CF4A 1P2GA 2YWEA 3DEFA 4FJ0A 1ESMA 4NMMA 3GCDA 4ZANA 1F5SA 1Z0FA 2RHHA 1RLMA 4KO1S 4RPIA 4W99A 1KBZA 2K4MA 2NYUA 2WV9A 3P4UA 4FHCA 1YVEI 1XPUA 3PDIB 1IXYA 5HQ3B 1H2WA 3L6EA 4M6WB 5E1MA 5TXGA 4RHUA 4X1OA 2ZUTA 4ND6A 4TKUB 4DCGA 5JRDS 4IICA 2IS6A 1YDWA 1N9GB 4K1XA 1DUVG 2V96A 1UBSB 2QY9A 3GQBA 4HHEA 5CDTA 5FOUA 4JFRA 1UBOS 1T36A 4LXHA 3ICQB 4E5SA 2FQYA 3PGKA 5FTWA 1W88A 1JFRA 4DNQA 1W49A 1ZIXA 1XVLA 2Z8XA 1YBAA 1OBVA 1E2JA 2DFPA 2C4VA 4K5QA 4EAQA 3BDVA 2WHYA 1GL9B 4LVNA 2CL0X 5FUBA 4QBGB 2BP7B 4ENVA 4Q7MB 4E32A 1KJIA 1SUEA 4D9FA 2HO4A 5KU1A 2IZ6A 2DUUA 4DMLA 1V1MA 1DG3A 3SBXA 1VRWA 4A8JB 3AJ9A 1WDLA 5FEMA 1E18A 1VRVA 5G53C 1N7GA 2O4UX 3E0XA 5FR2A 3ZNNA 1FJ2A 2O2SA 1U81A 2FR8C 4IIJA 3RPEA 3L02A 1IOLA 4PZDA 4XJVA 4OL0A 4M83A 4YDQA 1T1SA 5IKOA 1JSXA 5FTKA 4FEGA 4IIJF 4XCVA 3HGQA 5L3QB 3AM5A 3QUCA 3UIEA 5TVGA 1QPGA 5EJFA 4E3ZA 5HUHA 1CJBA 2EZTA 1OLXA 1E2LA 3GEGA 1W4RA 2OBNA 1J4AA 4IXDA 3W5IA 3GUCA 3OC6A 3RHZA 3VNRA 2XZPA 2DWCA 4OQNA 1Q2XA 3GDGA 2PH3A 4NZMA 3EPPA 4Z4HA 2E55A 2ZQZA 2CMKA 1LNSA 1N8KA 4WNCA 1A5SB 4XB1A 1XVVA 3C7DB 1TQ8A 4ZMBA 3A10A 2GK6A 1AO3A 2G63A 4CUKA 3H8VA 1Z5GA 2OZKA 5CGZA 3K70C 1G7CA 3K9GA 3PC8A 1A9RA 1W7AA 2ECOA 1E5DA 3LNCA 2Q29A 4GX5A 1GAJA 5LQCA 2A0FA 2FPSA 3TQCA 1ACMA 4KRFA 5L40A 1KL7A 3DUWA 2IVFA 2C2WA 2HC9A 4AVYA 4M0CA 3OZXA 2PRZA 4CEHA 3CS3A 2PGDA 4D5GA 3OLQA 1ES9A 1I1HA 2WJ4A 3G2PA 1EDDA 1KJWA 1ZX1A 3I5UA 5I9NA 4CKCB 4B31A 4BLOA 4MLDA 5L4LA 3CLTC 4EPYA 1EZZA 2XYQA 3I37X 4PSCA 4F8JA 4FB5A 4KXNA 3GJSA 1L7BA 1M67A 2QRQA 5EIEA 4Y6OA 1DIRA 4WPGA 3H4VA 4HNUA 3U4IA 4AD8A 5FRDA 1WW3A 1R0RE 1UPUA 1PFVA 3LO8A 2VTKA 1IULA 5JD6A 4K81B 4YCJA 1M10A 2ANBA 3OJLA 5DP1A 4H1VA 1JQ3A 3C85A 4LRXA 5ADHA 1N1EA 3LY9A 2OFOA 1A4IA 2B8TA 3JQ9C 1XTQA 4I9HA 4IDQA 4RVCA 3ZNOA 2PRKA 3DPSA 4M21A 2HJHA 4DSTA 4JL8A 4L9SA 3ST7A 3IT0A 3GC6A 4UFOA 2YHAA 4IZ6A 4X1KB 4ZDWA 2MCFA 3NUGA 1X14A 3AF4A 1PP4A 3CNLA 1GV1A 5ITVA 1FXWA 1A8HA 2VL7A 5BUQA 1XDBA 4DGSA 4BO5A 3I2GA 4I2NA 4MQ5A 3TYXA 3GLGB 1ELOA 4QUIA 2J6BA 4P7KA 1FXWF 4KODA 2VXCA 4N3NA 2Q1XA 4Z3KA 3QKUA 1G5PA 2IXAA 4P6VF 4FONA 2WYHA 1Q12A 2ZE7A 3ZE7A 4MUAA 4BAZA 3KS9A 3EOZA 5EKDA 5B64A 1COWA 2R8XA 4DREA 3AY0A 4LV8B 4YRZA 2C88A 4FBMA 3C1UA 4LZOA 3AR3A 3A6GA 1GOTA 3U49A 2WLSA 2NMVA 3C4VA 3DDUA 1A5TA 3EOAI 5K45A 1CZHA 4M22A 2CVQA 3ELWA 3KFXA 4RMNA 4R84A 1T5IA 3L4JA 4E21A 1TVKB 1LTKA 5DSXA 4PYRA 1RHRA 1T6NA 2J9FB 4EKNB 1NURA 2C95A 4LS3A 3RHTA 4JYZA 1Y4UA 4F1KA 3A4TA 2PUGA 3NANA 1S2OA 2JASA 4R9VA 1LPBB 3BDAA 3CRVA 2I8AA 2JFZA 4HBGA 3P2IA 3PQ5A 5FYDA 4CR6A 2PKQO 1DOZA 1CCWA 5F9FA 4KZPA 4EL5A 2V5VA 3ZDEA 1WPRA 3SE0A 3AVUA 3GD5A 3LA6A 1PYDA 3H2ZA 2VJPA 4OXQA 1VDZA 2Q0SA 1AS2A 2XUPA 1HWYA 3NGLA 3S5JA 2NQ8A 1Y3IA 3X3HA 4CKWB 2H9AA 1O6ZA 2XYPA 2XTJA 4LN1A 5HF6A 2PYDA 4DC9A 4DHWA 2RCNA 1FDWA 5C37A 2Q6KA 2R84A 1DTEA 3PT5A 1TYDE 4M1YA 1XCBA 2QSJA 3L0DA 1A77A 4TL8A 3T7EA 2FW8A 1MB4A 4AMVA 4LTMA 5CYFA 1G7SA 1DC6A 3AW9A 3HWWA 5C1DA 3E9EA 5BMOA 1YWGO 1QDEA 1OYYA 4N0EA 3GRZA 2XGJA 1H23A 3LTEA 2QBYA 3ZYZA 3UVEA 3G2NA 5ALNA 2H4WA 3WX0A 1YK1A 3SIWA 2YS7A 1HT0A 3QX8A 4DV4B 2B30A 2J3MA 1U1IA 4C3ZA 4IJVA 4FR2A 3OQHA 1G2QA 1NRWA 2R97A 1FUEA 2REBA 3BCHA 3KKNA 2BN4A 4Q0MA 5AIAA 1JDBB 4ID9A 3TL2A 3FWZA 4P9NA 4PV7A 1YQXA 3LVFO 2JCGA 5AESA 2G9RA 1N34B 2YHSA 3BKWA 5M3BA 2PO7A 5I8PA 4BQSA 4I36A 3DAHA 4JQCA 3U4AA 5BYKA 2FLVA 2VUUA 2YYZA 3GVPA 4NVRA 2OQRA 2CXXA 2X1MA 1QPZA 2JGLA 1FBTA 3SEFA 2X9LA 5U4QA 2RSLA 2BFWA 1F4LA 3RR2A 3DOHA 2Q8PA 4GLLA 1SD2A 1TKCA 1N36B 2YVKA 1RM0A 3QU7A 3PXGA 1X19A 1HF3A 2DFTA 1F48A 2EGUA 1H66A 3KQVA 4FN4A 1JJIA 4V0RA 3Q85A 4Z7OB 4DEYA 2JLBA 1P0QA 2PYIA 2V6JA 3CJTA 5TGZA 2QJRA 3B1VA 4AJ1A 4YI3A 4UNQA 3L6RA 2YXEA 4L4ZA 1CKEA 5FBRB 1KP3A 1U02A 2IDJA 3OJWA 4HNQA 2ACKA 3LCUA 3O1HB 2PJDA 2PMFA 4MWTA 2ZI6A 4B6EA 4NBKA 1LVUA 3HH8A 3RT1A 2ZRAA 4WNAB 1K98A 1EEXB 2O07A 3MSXA 1E89A 1S3SA 2OCYC 3DVLA 1ZM2A 3GWZA 1K5PA 2ZULA 1NXTA 5GINE 1YQTA 2RGYA 3C6YA 3AIOA 3EW7A 3HGMA 3NT2A 4RCYA 2YX1A 3GCWA 3IMKA 2CFTA 4QDTA 2H92A 3DGEC 3HDYA 2XRMA 1FMJA 2VAXA 3Q98A 4HCJA 4XPZA 1V1JA 1R0XA 3M4JA 3TOVA 5K6TA 1XX6A 2CYAA 4WV3A 3KKLA 1ZUNA 3SJUA 4UBJA 1QIEA 1HZZA 4IGAA 3L5KA 3NCHA 1MTOA 3KWMA 3ZV6A 1JSZA 3Q6IA 4H59A 2G8LA 3NO4A 4G1EB 1I5RA 1SCNE 1A8QA 1S8OA 4U0KA 4YFYA 1YA8A 3FRIA 3WK6A 4NXMB 1ZD2P 2X8AA 3N5KA 2JIQA 4G5QA 5B3KA 2ZXUA 3DW3X 2IA5A 5HOEA 1NN1A 2PN1A 4PCVA 2CXSA 3PNYA 2BF7A 4GIBA 2OXIA 3ACCA 4V2IA 2NSJA 3FPKA 5FKJA 3KD2A 3V4VB 3WZ2A 4CIBA 1F9EA 4J8PA 1EUDA 1GVNB 2WZQA 4C6HA 1ZFNA 1IPHA 1NUSA 4MDEA 2NZJA 1IHUA 3ITKA 3MT8A 4HGQA 3R4VA 4M8NE 5LJLA 4KN6A 2XT0A 4JJ4A 3ZK9A 1O0SA 1QIKA 3GF4A 2ZRBA 5EA2A 2OQ2A 1FSZA 5JSQA 1KIMA 1Z73A 1ZMBA 1P0FA 2QT0A 2XBUA 3V1LA 3W4JA 1NJFA 5B4VA 4AS1A 3DZ8A 2WUFA 4I4IA 1ENOA 1IM2A 1SURA 2O7NA 2B1JA 1E9DA 3AG6A 1JQAA 3GDOA 4MDYA 4OSEA 3FSRA 3WAKA 3THOA 3KYDB 2ATEA 4X20A 2JLYA 3EQ6A 1TTQB 3BXGA 4R1OA 4OFBA 4N76A 2NAPA 1TVCA 3TTVA 3RVSA 3FTFA 2X5XA 4G84A 5K8TA 3TF5A 4MP6A 2XMRA 3WDKA 1SB8A 2R7AA 1BROA 1UFQA 2BFCA 4RL4A 4AL4A 2O19A 3PC2A 1KH1A 3AONB 1U9YA 1OPXA 1ZCBA 1Z4PX 4PYJA 2K87A 5AUNB 5I7AA 1PDWA 1OTHA 3WIVA 2UU9B 4RHFA 1EAYA 1R6BX 1M34B 4RV4A 1HDYA 2HWYA 4EFMA 4EG4A 1KC3A 3ER6A 1GN8A 2VRBA 1OZFA 2OK7A 5JECA 1RWNA 4F60A 2X42A 1FTSA 2XGSA 3L7OA 2ZRIA 2FI1A 4GBED 2JLXA 1T8SA 1BSVA 1OF1A 2V9PA 1R6VA 1PNRA 2CHGA 5DTRA 1Z5ZA 3EISA 2VAVA 1F1BA 1YJBA 1EH5A 1TRHA 4IAOA 3GMSA 1WX1A 1KDPA 1V11B 3KHSA 3NHMA 1ZUIA 1DQSA 4ZO9A 3HDHA 2WE8A 2B4RO 3K1JA 1KPHA 4X3CA 4ITUA 1JVSA 1E9RA 2A5LA 5CAEB 4Q24A 2IE0A 5DW0A 1LTHR 3OIUA 5KDDA 1GLVA 2IEZA 3KZVA 3TR0A 2HXGA 4BIMA 3TX6A 3EULA 3IPRA 2VSQA 4KBGA 1BEUB 4AJJA 5KYVA 3VKWA 2WA1A 2VNIA 4ERNA 2VATA 3FFBA 3HN2A 3UZUA 4ZWNA 2CLCX 3ESAA 3VSCA 3E22A 1KORA 2A9OA 2QYOA 4US1R 2QTRA 2EG9A 3GNSA 4X93A 4RH1A 2L17A 3WHKA 1LPMA 5EMKA 2D62A 3WADA 3VAAA 2W00A 3GVIA 3DCIA 3CZ9A 4OBXA 2IS4A 1PZEA 1SBNE 4IMIB 3ESZA 3GT4A 4KE9A 4L4RA 1NN3A 4CF5A 4L6IA 3OZEA 3QE4A 2WTUA 3JAWB 1ECFA 1YQQA 4BLPA 4PCLA 3EF0A 3S7ZA 3OX1A 1OGIA 2NP6A 1UH5A 4FU0A 1UPCA 4G0WA 4KR2A 3J7AC 1ONPA 2JAUA 4ILEA 1S6YA 3V97A 5FWXB 1DADA 2JJ1D 2Z5GA 4R8MA 5FUYA 3MS7A 3F6CA 2ODNA 3MG9A 2H1FA 4GOOD 4KO2S 5T4EA 3SQDA 4UDYX 4IO1A 6YASA 5F2NA 1XRMA 3VJRA 5DULA 4CG3A 3OZ7A 5F3RA 5K6RA 1UMBB 5HUJA 4I0WB 5COAA 1P17A 4Q3DA 3B2QA 1UAYA 1E20A 2IUEA 2QPTA 3ZJ5A 5IXSA 5KYGA 4RPLA 4M46A 1H6DA 5ALSA 4RLSA 3K09A 3PUYA 5KUTA 4IX9A 1MFPA 1M2KA 1P6XA 2C8VA 2WHPA 4DCJA 3F8SA 4YAKA 2VYQA 4GRDA 1UDXA 4BUJA 4DJAA 5CXSA 3C4JA 2Y9MB 4QDZA 2RHMA 5ILQA 1JDPA 1J5PA 3ZDQA 1NZDA 3BE5A 1GHTA 2QN8A 4P4NA 1NNUA 5EXXA 2XA1A 1BQEA 2DTXA 4KX5A 4A8TA 3JARA 4EW3A 2DPGA 3HCEA 4BO8A 3L4BA 5TB5A 5KNDA 1P3JA 2WT4A 3CLKA 3QPCA 4ZCSA 4L02A 4MIYA 3VISA 2OCBA 5I9IA 1H5UA 4GKBA 2QVGA 4DIMA 3OKPA 1CRLA 3Q9LA 4ZVLA 1MABB 3EZ2A 4PC1A 2HNKA 1AZLA 3Q3VA 4D0RA 3LC0A 3SVZA 4L72A 1MX1A 2HZ7A 4K6MA 2HU8A 3UFXB 1OX5A 1SC3A 2YVLA 3NDIA 1QG4A 1E3IA 1TEXA 1Z6GA 1HBJA 2IJGX 3IMGA 5ARBA 5C3MA 3U1BA 3RBXA 4Y1FA 2FFQA 3AEYA 3SR4A 1ODJA 4XWTA 2R8PA 4OH1A 3K15A 3THXB 2H08A 3L1JA 3L7CA 4IDDA 2R79A 3I8XA 2GN0A 3NOXA 4LCEA 4M0EA 3PC8C 1VMKA 2EL7A 3PJGA 5EC8A 5T3YA 9ATCA 2VCHA 2J3LA 2JGIA 3OMWA 4ZYZA 4JP1A 2J3DA 1E6UA 1BDBA 1M7HA 4JJAA 1P9WA 3T99A 1BG6A 3LFTA 2OV1A 2UXDB 4ZI7B 1B6RA 1BO6A 5JD4A 3B36A 2QEQA 1ISIA 4GT1A 2FJPA 3Q6MA 4BLRA 1BH6A 1J21A 3G7SA 2ZRQA 1NFRA 1R50A 2OO5C 4Q15A 1N2JA 2YJNA 1KOJA 1D4OA 5E1OA 2GRJA 4KWEA 4P53A 4BE9A 1D2MA 2LXNA 2FGJA 3NT4A 5ER6A 1EK5A 3A25A 2MSDB 5LM3A 1Z39A 2OCKA 4KKXB 2H31A 1H2HA 2A0YA 5C2JB 2I6FA 2ERYA 3PUVA 1Z28A 1N2EA 2DECA 3K1YA 3LLUA 3KP1A 3ZH9B 3ETHA 3NHPA 3ADOA 3BN3A 3FPCA 4PRKA 3KCQA 2AWNA 1UL1X 3MEQA 3TKAA 3VTKA 1SVMA 3OHPA 3KLPX 2OGWA 4PX9A 1LF0A 4G3XA 2HFJA 5DCYA 1AQNA 4C4OA 2W8BB 4JC8A 4JSTA 3EEBA 4CL3A 1UXHA 5BRAA 3AGQA 5LDDC 3ZG6A 4EIWA 3HUTA 2EF1A 5LLSA 3NVKI 5DM70 2PGIA 1E1KA 1WNTA 1TT5B 2EWMA 2GD6A 2ZKIA 1LPOA 3ND7A 3CF2A 2HWWA 5JQGA 1AN0A 4FW9A 1CJSA 1D4AA 2H9IA 2RB5A 2ZSFA 3I42A 4ZTUB 3FYSA 1NJ5A 3RYCA 2P35A 5JQGF 3TRIA 4YAEA 2H4XA 3RD5A 4RZ2A 2C4WA 3V9AA 3AZPA 3JD0A 5JZOA 1ONNA 2EFJA 3W4KA 2PMBA 2JCBA 1UWLA 1GA1A 3OIWA 1N5KA 4KE6A 4KQ2A 1L7RA 1DBIA 4LXUA 1QZ3A 4ESVA 1EA5A 1GWNA 3B6KA 3E03A 3G2OA 1N2GA 3DXYA 3EXG1 3L1IA 2I5PO 4OUKX 4BCDA 2JARA 2Z4TA 5D6NA 2V3WA 4P7GA 1CEYA 3SVLA 3RUEA 2YYSA 4WFKA 1XTIA 5BSFA 4CIVA 1TLLA 4MQFB 5FI3A 5DOZA 3PDUA 2PX3A 3R5TA 2MSKA 1NJSA 1IZ7A 2Q1SA 4MYCA 4TMWA 4DMFA 1SCKA 3EPHA 2SHKA 1YZUA 4WTOA 4A15A 1I3KA 1NR7A 1PUXA 2JI4A 3OU6A 2IEYA 3MNFA 3QIAA 1QMPA 4DJTA 3RDPA 1E0SA 3R2JA 4XVQA 1Q50A 2HDOA 4FX2A 1DDOA 4HDKB 1X13A 3H5AA 3V7UA 4HYQA 4G01B 3CBGA 1LRLA 4TWAA 2K7ZA 3SMQA 2O2IA 2PKXA 1RKXA 3ASVA 1QNFA 4QYWA 2XYVA 5DKFA 1QR2A 3G0HA 3BGWA 4C3UA 1UBTS 2OC9A 3FTEA 3VKHA 1ZIPA 1PQWA 1U7OA 3QE9Y 1IWOA 5AP9A 1XD2A 1TCUA 2YZKA 3IAS1 4UMDA 1GKKA 1JIUA 3BX1A 3IBGA 3S6JA 1W76A 3TTWA 3ENWA 3NBKA 3RSZA 1D9ZA 4ZJPA 4KAJA 4B3TB 1P6QA 4HGYA 3GLGE 1XCLA 2QX9A 3AP2A 4L50A 4DAOA 5ECGC 5JANA 2G83A 2G1JA 5CLHA 4CIAA 2QHXA 3GNQA 3GRUA 4DN6A 2M6RA 2VG8A 2VDVE 3H3XA 4QYIA 3QOYA 3FRJA 1W0JD 4R8KA 3RUPA 3RYTC 3KG2A 2C5EA 1E61A 3JYLA 4YWJA 1SUCA 3ZC3A 1SJ9A 1U2GC 2ZT5A 1Z63A 3D6JA 4J2HA 4DLWA 2OE2A 1MHTA 5EJEA 2PZMA 2C8JA 3ZWDA 1MAUA 2RAFA 4FFPA 1XIVA 1HFWA 3BAZA 4PBTA 4BMNA 1UT5A 3IQGX 2OOSA 5DCLA 3M5CA 4O59O 1Z56C 4JI4B 1I30A 3LZCA 4C4RA 3Q3CA 2ON6A 4NOKA 1HT1E 4R41A 4UXJA 5H59A 4AY6A 1CZUA 1GAEO 1SWWA 2G4VA 4GGMX 5AM1A 3GJZA 1TAGA 1WMFA 1R9JA 2QNRA 1B0UA 5KWIA 2X7XA 3DMPA 4MS3A 1S0UA 4JKOA 3N2ZB 1R18A 2W6CX 2ZJZA 3QXSA 1LPSA 3AHIA 3AIMA 1GGVA 4E2XA 4MAMA 1JHXA 4TXMA 2OGSA 5E3JA 3LCCA 5IAOA 2QM8A 1F12A 2BGTA 1R2QA 4WCFB 5F5XA 4Q3OA 2DLDA 4QLAA 1MPXA 1KYWA 1YDHA 3TEFA 4B8WA 5IH7A 5DP2A 1R8SA 3UA3A 2G25A 2XNKA 2VHVA 4YACA 5B6JA 2ZUWA 3NIWA 2TMGA 5HKLA 1XMIA 1VPVA 2BMAA 1PZGA 4I6GA 2PKYX 3HBMA 3HQ4O 3THWA 3URKA 1JG4A 2GBLA 1Z06A 2AVDA 2C3PA 4FGSA 5TMDA 1WRBA 1SUSA 1V2GA 3I3SR 1MB0A 3Q88A 4O4JA 1G6KA 1ADJA 1NC1A 4CQJA 1MMFB 5KAPA 5AH0A 5MN4A 2WWHA 4O4JF 1MX3A 4DARA 1EGVB 3JQ8B 4MV3A 4RVOA 5DK6A 4CWAA 3CLHA 3JQ7A 5K3SA 2ZRJA 2E87A 2FU5C 1E3LA 2Q2NA 2VJDA 5DLPA 3SHOA 2IH2A 1RKUA 9LDBA 4JXKA 2X86A 1HZZC 3SC2B 3WWEA 1HM5A 1VIYA 1B00A 1T8UA 1G55A 3FMPB 4KQCA 2HQ1A 3ABQB 4MI3A 1BMTA 4BC0A 5GQSA 3RIGA 2JGNA 5AIBA 4L0DA 2NX2A 1EE2A 3W90A 4LYGA 2H1RA 3DOCA 4W5WA 5AD1A 1AY0A 1VYVA 5JAHA 3EMKA 2ODBA 1OLSB 3TUJC 4HWTA 3HJUA 5ARDA 4F9GA 3N59A 4TKLA 3EVBA 3ZV3A 1USIA 2IEGA 2YV3A 3OT1A 2HPZA 3B13B 4JGGA 5BSUA 3TM5A 2IX3A 4IJ5A 1V16B 2ZR9A 1FFSA 4INAA 4QLBA 1ZCFA 3FAZA 4P3PA 1PR4A 2GLTA 1E3JA 2A58A 3JQBA 4D74A 5LIPA 1RJ9B 721PA 2LV8A 3DKPA 2O2GA 2JJ1A 1M2JA 4JQZA 5C81A 2QRVB 1M2VB 2EIXA 4JBYA 2B2CA 1OWLA 4RFVA 2Y4OA 5BW4A 3ND8A 4ZYYA 2NUPA 2ZJ2A 3LOQA 4P4SB 4RD3A 2HA0A 2PSEA 2BMDA 5DYYA 3L7IA 4AF6A 1HQDA 1VLJA 2PL5A 2RH9B 3GBPA 5DX1A 1DBSA 4AY5A 2YFQA 3COYA 5DGIA 1D2NA 1QF6A 3F7MA 4HDSA 5LCXA 4S35A 5A6SA 5EJ5A 5KQSA 3EVCA 1EFVB 2C2MA 4RHTA 2B98A 4RV5A 3DSRA 3WLRA 1V0JA 3W0LB 4QBTA 4FGLA 4W6ZA 2XW6A 4MULA 1FLNA 3KLOA 2OG1A 3IA2A 3MWJA 3Q41A 1Q1QA 4NMXB 4XEUA 3ZD8A 1LQUA 2BBSA 4CMIB 3LGAA 5M04A 2GVDC 2EATA 3ELYA 2HREA 3NDJA 5JZMA 3KT3A 3QUQA 4ILKA 2H5LA 5A5VA 1Y3BE 1R1DA 1Z38A 3FYUB 1J24A 2V6GA 3HXPA 3PHHA 5AJZA 2J3JA 1NLZA 3E3AA 4ESHA 4P83A 4BVAA 5C8VA 3RUAA 3ENKA 1MJFA 1U2QA 3ILYA 4F9FA 2AK3A 1OAKA 1WUKS 2HPVA 3OIDA 3NHYA 4TN5A 5B36A 2XBMA 1ULBA 1TM4E 1FDRA 4R4JA 3JD3A 1M2OA 2F62A 4F4IA 5B7QA 4O6VA 2PZAA 4U7PB 4CCYA 2HF7A 4GNRA 1QFXA 1IWBB 4QA9A 1ULHA 1ORIA 4WFIA 3B89A 1YR1A 1FFCA 2BVNA 1C8VB 1UPBA 4I4TB 5FBHA 4F6RA 4X7BA 3JWGA 3Q7SA 4TYQA 4GZ6A 1YU6A 4X1IB 4KLRA 5GZ3A 5MN5A 1IU9A 2OSBA 2PZEA 4N3CA 3VAYA 4FFVA 3HCDA 3D6NB 4L4UA 1H2YA 1ZH2A 5JSFA 2YV5A 3G5UA 4FE3A 5JXHA 2BM9A 2WABA 3UK1A 5JFGA 4C0JA 4MGZR 1C50A 3DTVD 1C8KA 1ANKA 3EWIA 4TV8A 3T7DA 2ONJA 4F8YA 5LDHA 3P96A 1EU1A 1P2UA 2I7CA 3WQSB 1ZJ5A 4AUKA 2Z6AA 1F3OA 4O63O 3ZV5A 1HTBA 3DBHB 4TV8F 5EZSA 4RWEA 3GH3A 5D3KA 2ATVA 4QAQA 6NULA 1HG1A 1Z0UA 5EWMA 4EY7A 4M9XA 1QIIA 1BWPA 1SIOA 1ML3A 2XV1A 1G64A 2ZJ7A 1JYEA 2CZQA 3FDZA 2WLTA 4KXUA 2RK6A 1O87A 3N2NA 3OQ1A 1VKHA 4XM2A 5EZ6B 1DC8A 5FPHA 3VM6A 1OJ7A 1S4MA 1QR6A 4JT2A 621PA 1M34E 3F6RA 1JR4A 3PDHA 4OUDB 2HX1A 2R7LA 2HSZA 1OH5A 3RJ5A 1UBLS 4EEXA 4US0R 3LIIA 4DOMA 5MN6A 3I9V6 5B7GA 2XE8A 3HR8A 4ROSA 3ANSA 1LCIA 1II8A 3EYWA 5BO5A 3RRBA 3IEVA 3AHHA 1PJBA 4N82A 1O6GA 1LS6A 4MV4A 4QOGA 3TK1A 3WHPA 2G0NA 3EVTA 5ALUA 2GFQA 3A37A 3CMCO 3TLKA 4CM1A 3M83A 3WJ7A 1QOQB 3C41J 4OHWA 1Y8ZA 4EQZA 1KDOA 2OVFA 2XPCA 4UM5A 3UJBA 4BVJA 4D4IA 2ID4A 1PTJC 4B47A 1B3RA 1MXHA 4B6GA 4U7FA 1KKUA 3C3WA 2P7HA 2XMCA 1W36D 1F1JA 4IVNA 2IOYA 3D1JA 1JALA 2RHCA 4ZRMA 1XHLA 1Y1KE 1LFAA 4CCSA 3G59A 2HMSA 4BMPB 1YH3A 1GQ2A 5BVGB 4D0LB 1TM5E 1WVGA 2IE8A 3LYHA 3GP8A 4DUZB 2PH5A 1E2DA 2ERCA 5KOYA 1S2LA 1SH7A 3JAKA 2B5OA 2X0JA 3WISA 3WLMA 1PQYA 3PUXA 1BHQ1 1UDBA 1GY8A 1G8YA 1Y4SA 1QF9A 1X1RA 4WKGA 4UBOA 5G0UA 5UKDA 4AZ0B 3PXEA 1JB1A 4H1TA 1C0LA 5AJYA 1EM6A 4GLBA 2I66A 1GKLA 4PRYA 1P45A 3RS3A 3LAWA 1N2CB 4UMFA 1QTRA 4ZFNA 1OFHA 1VLLA 1N2IA 1R4MA 2YASA 3F3SA 4I50B 3EDYA 3GGPA 2QTLA 4TYWA 2XWJI 1QHHA 2G04A 4HNHA 1Y8AA 1BFUA 2IXTA 1LGYA 4IEIA 3V7NA 4WJLA 2H11A 3FTQA 2Q6TA 3QPUA 2CJFA 3LDHA 3NTLA 2R6ZA 4NENA 3DB1A 2O3TA 5KOIA 3FTCA 3DPIA 2VA9A 1EDOA 3HSYA 3GI1A 3UBTA 3U7GA 5IYZA 4EYKA 1DKUA 2ZVPX 1W0JA 3OPXA 2POQX 3ONDA 3O92A 5AW9A 3IQXA 4H31A 2C2XA 4EFDA 2VWQA 3GRYA 2F3PA 3BWBA 2OFWA 3VR6A 4CW7A 2FPOA 4DPKA 3ORQA 2Q5FA 4D9CA 2QA5A 1YNSA 4XTCS 4MLPA 1DXHA 1R3UA 1F14A 3LUKA 3RIXA 3MINA 1YXMA 3R8XA 2B8NA 2PQMA 3C7TA 3E7WA 3W1WA 3GMTA 4G5XA 1E7QA 5G40A 3TOSA 3HR7A 5F4ZA 3FA2A 1MOQA 2DZDA 4FEEA 2YZGA 4G6ZA 5D2CA 3EASA 1GP2A 3PQDA 4NBLA 1U3CA 2EERA 2OV2A 1KC1A 2FUG1 2BFOA 2NUBA 5KC8A 2IY9A 3OM1A 1ESCA 1L5KA 1P1FA 5ER9A 1GAWA 3AFNA 2QKYA 2QN3A 3G2IA 2WQZA 2JGJA 1XA4A 2ETXA 2CCGA 3H9JA 3JU3A 4W5HA 5DLEA 1IJKA 2J4DA 3AETA 4YRSA 4Z8XA 3GFBA 1OZGA 3ZQ4A 2HDWA 2VHZA 3L1VA 3A31A 3PKZA 1HETA 3H9GA 4K88A 1MX9A 5AK6A 2X22A 1FX0A 1YHZA 1HDCA 3R3UA 4HMOA 4PSUA 2O8BA 2O0MA 5I3ZA 3VO1A 3PEUA 3LSYA 3W6NA 1KEEA 4DZTA 1W30A 1M8KA 1GCIA 2ZRKA 4DA9A 2WWIA 3TLZA 1OT3A 3VA7A 4JLOA 2BR5A 4HS4A 3QLVA 1T1RA 2V7QA 2A0UA 5TQJA 1I7SB 4HUQA 1DTWB 3H11B 3T9DA 1IHDA 3T12A 3VYWA 1BMDA 2Z30A 3LL7A 4K0KB 2JEZA 4DFDA 4PG8A 4YMGA 4MJLA 1PJRA 1NVTA 1L5MA 2VDLB 4FMPA 4D4GA 4YDHB 2X8JA 4BDTA 3VOBA 5BQPA 1SOMA 3SX4A 2BM8A 1ZOIA 2P4EA 5U4XA 4OH7A 5EZ5A 3VX3A 2FWIA 3OZIA 2XT6A 2V98A 3JRWA 2ARKA 2AFIE 4G41A 4XWGA 5AOAA 1D5WA 1JZSA 3ZY2A 3S2YA 3HADA 3M6MD 3OJ0A 1KIFA 3K9QO 5CG1A 4OJQA 2MINB 2ZI5A 4YV1A 3F5FA 3AHJA 1CUDA 1OCEA 3DOEA 3WWDA 3RT7A 4HGNA 4Y3UA 1HDEA 3WLFA 3EZFA 5B30A 3JVVA 3PRYA 1GG5A 2QZPA 2A8YA 2H2WA 2BEUA 1GARA 2GGSA 2OY0A 2QTAA 3D2BA 4RZQA 4UTZA 4AYWA 1Y42X 2CL7X 3R3WA 4ONEA 9LDTA 5L53A 4RDHA 1UK8A 3CEAA 4IKOA 4WI1A 1VHJA 1TCVA 1O9BA 4IJKA 2E3JA 3WR5A 3TIFA 4PNEA 5A5EA 5K6AA 3EDMA 3QUBA 1C0IA 2ZB7A 3FLEA 3IHWA 1S3IA 1ZK4A 2FH5B 2YFHA 3GDFA 3ML1A 1VG0B 2YS6A 2FRXA 2C7RA 3NC1C 1X8JA 2Q3JA 1BQ4A 1N33B 4DIUA 5ERYA 3AY7A 4DDHA 5AM3A 3KE9A 3RC7A 4G0OA 4IMRA 4KSBA 2G82A 1GPAA 2IV2X 5YASA 1C4WA 2XLCA 4X85A 3UJ6A 4ENPA 1ISHA 3HN6A 5IJXA 4F2GA 4F11A 4KSYA 4QGSA 2D7DA 3PLAE 1C9MA 4D4JA 4KSCA 2VSFA 2WIBA 1B0AA 3D5TA 2P0EA 1O6BA 4DADA 2PCJA 3BEOA 3K6SA 1SKUA 1MW9X 4CM8B 4KPFC 2E1PA 1ZD5A 1JGTA 4WRRA 2MIIA 4OK5A 4YMLA 3EFOA 3G1WA 4MYTA 1FLVA 1XTVA 1IC6A 3A4YA 2VAPA 2K2QB 5HIIA 4A1OA 3DQQA 2NYAA 2HWXA 2WD8A 3UV3A 3QHAA 4II3A 4HNAA 3UQYS 5ECWA 4XWKA 3DOUA 4Q05A 4M37A 3RODA 3M6AA 3RUCA 4KXWA 4FSHA 1XF9A 4YT5A 1HV8A 2J4CA 4F3KA 1YZNA 2Q9UA 2WTMA 4ZC1A 2GJAA 1X1TA 1MIOA 3TRJA 2ZBGA 1GQSA 4OP3A 2GKGA 3IC5A 4WL0A 3OT4A 3KWJA 2KHZA 2VBCA 1PL8A 1PT9A 2VJNA 3B6JA 4MCAA 4ZT3A 2ORIA 5I5EA 3LKDA 2VYNA 4KQIA 4LXIA 1KZHA 1UOEA 3QMVA 1YGPA 2XUIA 3MIIA 3C6KA 4NP6A 3P9KA 1OJLA 1JKJB 1KQOA 4O8CA 3L5OA 1I94B 4GPIB 3W8DA 1JU3A 1GCGA 3O4JA 1HOTA 1XMSA 1UF9A 2R7MA 3HY6A 1N6LA 3FOWA 1XTUA 2VDOB 4DBLC 4E4YA 1E4YA 1YCDA 2GBLC 3K05A 4CUZA 1GGJA 1TEVA 2IXGA 1T15A 3VH2A 2YQZA 5JMOA 5IZCA 1W2WB 3A3NA 4J1SA 4O8ZA 1VHTA 2GM5A 5A4AA 4F9TA 1RXEA 1V47A 3VR4H 5CLQA 2HGZA 4W4TA 2YWHA 2Y67A 1ATIA 3O95A 2ASEA 3BYZA 3KB8A 3GGSA 3V3KA 3HVRA 4GX0A 1FVXA 4QUEA 4EJSB 1E2QA 3NH9A 2YRFA 2E49A 3CJQA 3FJOA 5E6RA 5AW5A 2HR1A 2OD9A 3SP1A 2I80A 3WMGA 1N9ZA 1G59A 1Q83A 3AF5A 2NU8B 1N1MA 3C3BA 4WKPA 3T5TA 4BJ3A 1SUDA 5LU9A 2DUNA 1I36A 3D43A 3B38A 3DVAA 4R51A 4UDXX 5K8LA 2F7SA 5JVDA 4LV5B 4HMPA 4Z9FA 4CLHA 2ZRCA 4MA0A 1M7BA 1SAYA 3CHYA 5COQA 4UNNA 1P5FA 5JVDF 1RPAA 2P2NA 3H04A 1PW5A 3IFSA 4KAXA 1MV8A 3LVBA 4G0YA 3V1MA 5JD5A 1K92A 2ZP1A 4GU5A 1D6JA 2EJCA 1B41A 3OZGA 3RSFA 4UHFA 1L2TA 3TDNA 3TZKA 5B1SA 3BJZA 4QJ5A 5FOWA 3JQBC 3L6DA 2Q5HA 5E9QA 3JWJA 2VXOA 3SYTA 3TAHA 3E5HA 4QM7A 4IS3A 4QBFA 4AAYA 2Z5VA 4D3ZA 3NBZC 2A7XA 4N54A 4AKGA 5H68A 1FW8A 4M0FA 3ROMA 1N6RA 4ACAA 4X7PA 1TO1E 4UEOA 5HR5A 5KBYA 3BILA 3ZJVA 3LG2A 4MPJA 2I7TA 1GFSA 2SCUB 4I1OA 3UENA 2YIJA 3IRVA 3TD2A 4BNDA 1TGYA 1E79A 1DRUA 1U0FA 3NRJA 3FUXA 2ESRA 1RVDA 4P0TA 5DXFA 3IUBA 4JH0A 1HFJA 2H7CA 4BTEA 4P54A 4QG7A 3CN9A 4EEZA 5DGHA 1E5QA 2VQSA 3GLFE 1VA4A 1SVUA 5K2MA 4H7PA 2AG1A 3BTVA 3L6CA 2I33A 3HA7A 3GFOA 2O8VA 1U8FO 2SKEA 1CQJB 2GETA 3ADDA 1J09A 1KP2A 1JYSA 3TE7A 4W8OA 5J4YA 1RZRD 3ZJYA 2GBGA 3ETDA 4MWDA 1JDVA 3U3JA 4BQNA 2V7VA 5LA6A 4A4DA 3H2HA 1TA0A 3VNSA 5DZSA 4EI2A 1UZMA 4G5FA 4PRZA 3RE1A 1GNRA 1WAMA 1XB2A 3O8QA 3OPYI 5LA6F 3PJDA 1BS9A 3QHQA 5G3ZA 3UKDA 2VDJA 4HUTA 5G3YA 1MLDA 1P7VA 1NJGA 3D4PA 2D2VA 5EWJB 5BQ3A 4NWIA 3RWOA 2G36A 1F6WA 2E7ZA 3TSYA 5C1PA 3N07A 3ZWYA 2IYAA 3GA0A 1JS1X 4Q3EA 3DFZA 1WG8A 5CA1B 1T8YA 5FJIA 2DFVA 5J1TB 4I1SA 3MPOA 2GPJA 3VSEA 3R3XA 2RI1A 1U3GA 3KX2A 3UBMA 3W8EA 3OLXA 5FORA 5C1OA 4UTOA 5AVYA 1EBFA 1QUEA 2BI8A 2KSQA 4PLZA 3IOBA 5KJEA 3LXRA 1KR5A 2XLBA 4FBLA 3GZNB 4Q19A 4AY2A 3EAGA 4HDNA 3BWCA 1Q7TA 1J8DA 1PD1A 4O1HA 4TMXA 1I4DD 2C9OA 1COZA 4B43A 1Z4QA 4C7KA 3NM6B 2C59A 4OL9A 1BXRB 3LYLA 3SHVA 3M5DA 4FOOA 4J0HA 4C30A 4RTOA 3WIDA 4U2FA 3I62A 3ASUA 4I46A 1JVNA 1ZQ9A 3ZLJA 3R3YA 5HEKA 5LOVA 1KMNA 3C6XA 3EZXA 4BZZA 3L8CA 4UNSA 4Y0NA 4E1AA 1GIAA 2GBFA 4EG5A 2QTVB 3PUHA 1NLYA 3FPAA 4TGLA 5DK4A 5IUNC 5LOVF 3A05A 2G77B 3MJEA 3QXGA 3B2EA 3D1VA 4MW2A 4B3BA 5K8VA 2YL2A 3G9QA 1DKMA 2YJ3A 4YJHA 1QGED 4YY3B 3OMLA 1NPTO 2BUAA 1BXGA 1SNYA 4YRQA 1DQZA 5AFSA 4XDGA 3DD5A 4PQEA 2V6FA 3T41A 1L8LA 1AGNA 2NU9A 4MUJA 4DZZA 7MDHA 3A58B 4RK7A 5KREA 1NP6A 4NNPA 4YYZA 2II6A 1DO0A 2COKA 3P9YA 3RUIA 3V4OA 4EGCB 4Y9TA 5BMVB 3R75A 1WV0A 4TLLB 1W5EA 2ZIXA 4IDAA 1QQ6A 1OYOA 1MT3A 1C7FA 4DL9A 1OH8A 1JTEA 2W4MA 3KL2A 3TQIA 3OZSA 3U7IA 1CLEA 2XCLA 1XI2A 3VMFA 3PWKA 5JXJA 1RYNA 3P9NA 1GADO 1SKYB 1T5HX 4TLDA 4Q7QA 1DX9A 4KXYA 3TPZA 3B3QA 3M9WA 3MUFA 4MVCA 3IR6A 5L6MB 3U4QB 3DKIA 5DYGA 1U90A 4MUGA 5JC1A 1FTNA 3O0DA 1EXNA 5IW8A 3GJTA 2O48X 4C20A 3L8MA 2CNKA 3LT0A 4UMVA 1DKRA 1NVVQ 3UAVA 3GLQA 1S96A 4DLNA 4KXVA 2QRMA 4C2TA 3WMFA 3D0RA 1FDIA 4UHKA 3SYMA 3HM9A 1C7EA 1UODA 4TN1A 1WEHA 1PV4A 4AKSA 4EJ2A 3LBYA 1SZJG 1BCRA 1C9JA 4XOIA 2CEAA 4K9DA 5C3UA 4H15A 3REOA 5FR1A 2CLMB 1AQLA 4K3VA 3A9UA 4BGDA 2P0YA 1DJNA 3E3LA 2AN5A 3NEPX 4NXNB 4LYFA 4RSGA 2ZZKA 3B9QA 4H60A 2VDMB 4BVBA 1BMFA 1O7JA 2IYXA 3I9NA 4RIFA 5F7OA 5D5QA 2ZRNA 1NKVA 4RSMA 2A9QA 4C5AA 2IEIA 4ZOLA 4WCVA 2BISA 4KI7A 3W1EA 5AK3A 4ZOLF 4L6AA 3KTAA 3AYXB 1AUOA 1VPEA 2W6ID 2OHVA 1X9HA 1TRKA 3U7RA 4AZ3A 1SCQA 2Z6UA 4G09A 3D6MA 4TOIA 2VF2A 4D8YA 3G9TA 4H6PA 1QV7A 3DMFA 4RGVA 3RAJA 1W19A 1MA0A 2X40A 3QVGB 2QXTA 3KKKA 2XYGA 1QOPB 4HH0A 1WDTA 3I5AA 4BMVA 5IUJC 2P9EA 1DC7A 4YBZA 4K6GA 3NM4A 1RT9A 2OP1A 1G3RA 2CXPA 1KFEB 1T29A 2C0PA 4IHJB 1PGNA 3IVRA 5EEHA 4ZT5A 4M60A 3ZUGA 3A8TA 2R5NA 2NNWB 3GD7A 2BJVA 4LDJA 2FEWB 3CZ4A 2P9FA 3DMYA 3E58A 3W3AH 3MBKA 4CNQA 1LJUA 4K26A 2DQZA 1I0IA 3QMPA 4WOPA 3ANYB 3RNLA 2O3JA 5ICEA 3ZHCA 3ON5A 4LX0A 1HXHA 3ETEA 3N2KA 3U4MA 1QGDA 2FMHA 5CRIA 2OXRA 2WI8A 2ZSHA 4CL8A 4Z4IA 1XAGA 2QZ9A 3CB4A 3GU3A 1SXHA 4Y9SA 5FUXA 2D2FA 3SR3A 2E4AA 1OI2A 4BNKA 1HSZA 1RS0A 3KHKA 3ZCTA 1T13A 4HDCA 3PDIA 2WVGA 5HQ3A 1B42A 4YN3A 2ZBEA 4W1SA 3U3ZA 4M6WA 1N2CE 1JH9A 4BMDA 3T15A 4PZPA 2CSUA 3R3SA 4TKUA 5JQWA 1A5ZA 4EB6A 2J33A 2XNDD 1PV1A 2PGNA 2R65A 4QC2A 1OZAA 2BFFB 3D81A 3C8ZA 4RCZA 4ZQBA 5DIFA 3T34A 1D04A 2ZATA 3BB1A 4KIGA 3QPVA 2IV7A 1W1WA 4DF3A 2H4HA 2G1PA 4NSNA 4X94A 4IXWA 2PQ6A 1B74A 2MWMA 4H4CA 4TT8A 2F3UA 4HXGA 4M98A 3EFBA 3PPVA 4TMKA 2QM7A 2QQ0A 4JROA 2BP7A 4YGYA 2VQEB 1UR5A 3FKSD 3H4MA 3DO5A 5FQNA 3SKVA 3TXYA 3UHFA 4G8CA 3DZIA 3MIZA 1W73A 4OJTA 1K8RA 4H1WA 3JYHA 2EX4A 1KI2A 4U2GA 3T9BA 2M98A 3M1IA 3QX3A 2F90A 3M6XA 2Z1DA 3NHFA 4LBYA 3FSGD 4NE7A 1ZOOA 2KLBA 4LY6A 1REQA 2ET6A 2YWJA 1O96B 3P45A 4LZZA 3U48A 1WSAA 5KYYB 1CQWA 2EG5A 3FSJX 3SQMA 2UUOA 1FEZA 3WSTA 4OYHA 2WD7B 1NJ1A 1SXJD 2O2EA 4UZEA 1V8DA 4A0QA 2JAWA 4TRJA 3A1DA 2FWBA 3LT2A 2QJOA 4DQKA 2Z9DA 4MV7A 4URXR 3TLCA 1UKAA 5KNBH 3K0BA 5AVKA 3CONA 2PNFA 3OZBA 1UM9B 1GCUA 1OWOA 3SBDA 4FBGA 3EW9A 4JSRA 2FSHA 2IBTA 3DR3A 1KO7A 1KYQA 1YRHA 2PPLA 3IQFA 4AC9A 5IK2D 2RHBA 5TQ2B 1XKLA 1P9NA 2DOKA 3VJMA 3KQHA 3TEJA 4D9KA 2B3DA 3DP9A 1ZUD1 2F3RA 3OZRA 5TF0A 1KAGA 2P91A 2AC4A 3VU9B 3WRVA 3CPSA 4E94A 3ODPA 3INGA 4GOLD 4TM8A 4FPXA 3UM9A 5HQJA 3IQHX 3M4ZA 1AM4D 3D4OA 3G0CA 2XE4A 2XRZA 2GPNA 2CNDA 1OBFO 1DAFA 3MMZA 5KVVA 1KI3A 4B44A 2X6RA 1NU8A 4GMHA 5SZIA 2QTMA 3OWHA 5AVWA 2OD2A 2CL5A 4E5YA 4DLKA 4CIXA 3B51X 3M89A 3IULA 1Z6PA 3VR5D 1PG0A 1QZXA 1FFAA 4QO7A 4QYSA 5LQRA 3W5UA 3ONFA 3GBVA 2FEXA 2NTNA 5L6LB 4LZPA 1PW7A 4R2MA 5D3ZA 5AR1A 2NWQA 5JLAA 3T6KA 1EP2B 1CD5A 1NX6A 3RSOA 2BSAA 2R6DA 5CBPA 4LPKA 3DYIA 3NIBA 2DJIA 1VCOA 2B4AA 5DX8A 4ETWA 4UHDA 4QE3A 3A1CA 3SSAA 3STHA 4M1SA 1L7XA 4A36A 2D8MA 1AHPA 1X92A 4PHTA 3KLNA 1CUFA 3G5LA 3JVEA 3FAKA 3ZLTA 3G88A 1BD4A 4QGAA 1J70A 2XF2A 4FK8A 2QN2A 3CX3A 2R9VA 5HKBA 3REQB 1HI9A 1KQ3A 2IEBA 2CC2A 3O5AA 5TR9A 4FEAA 5KNBD 1OTXA 2JFOA 1DLJA 2FCRA 1JDJA 1XZMA 2DQ4A 2ZPTX 4LWPA 1J8MF 3HGTA 3RVDA 1L4BA 1IZ0A 3FBTA 2BKUA 3U1TA 2UZ1B 3HYLA 3WOVA 1PFKA 4JLMA 3DE0X 2X1LA 4H7IA 4DLRA 2RJOA 1Z25A 4HGOA 4PF1A 3S81A 4LHWA 4LK3A 5DM60 4QGBA 2H3HA 2PV0A 4P32A 5IWCA 4C5BA 5JCZA 2A3RA 2BE9A 4ZQFA 5HFJA 1KAOA 2F59A 5A7FA 4GOJA 2OD7A 4PTZA 4V0OA 1M72A 1EI9A 4D0NA 1NHGA 3UG7A 1MIHA 4J49A 3WRXC 1OHHD 3TCNA 5BOSA 5KYTA 1BGWA 2I4RA 2L18A 3B9RA 4WN9B 4XSGA 1EWKA 1QVZA 3FOBA 4HWOA 1CVLA 1G0NA 1SOAA 2FAXA 2J9FA 2D1RA 3C1TA 1OAOA 2YMLA 4JLPA 2AR7A 3MGBA 5THQA 3N0WA 3T5GA 3VI3B 1G3IA 1ZD3A 4DCNA 4L76A 1WA5A 3OBBA 5AVZA 4OI0A 4GL2A 1RHJA 3HABA 3BRSA 3LHKA 3W9YA 1VHDA 2YC2C 3DMTA 4AU1A 7ABPA 4MYDA 3ZU3A 3E2PA 4FYWA 5ABPA 3SF0A 4BNLA 1FUUA 1JX6A 1KZ4A 2QP4A 1MH1A 2EARA 3NKVA 2WU8A 4HQLA 4PIPA 4RETA 4JYPA 5K4AA 3S0JA 4I66A 2IHTA 1ZVJA 3IJPA 5CCEA 1FMCA 1YBFA 4RUKA 4DR1B 4AJ2A 4AP9A 1E1RD 3Q4GA 4NBNA 1AO0A 1ONOA 5HYVA 4N7RA 3DEIA 1DSSG 2PT7A 1Z6AA 2AG0A 4OHCA 4P08A 5TY0A 1RI5A 2VF4X 3DXFA 3IAEA 4EKDA 1M0TA 5KTYA 1DUSA 1VMAA 4YCSA 3S2ZA 5L45A 3SF8B 1NRXA 1RI3A 1PE0A 2ZB4A 1RI1A 2XBLA 4YRLA 4B6JA 2BMWA 4DQLA 5C34B 1RYBA 3JQFC 1BIFA 1JB9A 3C43A 3A3PA 2GHQA 3LQRA 1Y33E 3LBFA 4NL4H 2AQHA 1C81A 3SZUA 1W36C 5EKSA 3H2BA 1K0FA 3KQMA 1DDIA 1Z4IA 2QRNA 3IUPA 1G7RA 1BN7A 3MCVA 1SCUB 5E8RA 1KI6B 3KR9A 5EFZA 3H17A 3H3FA 3K9HA 1G9SA 1S2NA 3JSXA 1N25A 2ECPA 3MUNA 3GIDA 2LCQA 3RLIA 2VDQB 3LGXA 2ANCA 2DR3A 4CHTA 1XTPA 4RZXA 2OHIA 4OXKA 3ND9A 4MV8A 3CNBA 4UKDA 5A0VA 1WTAA 4J16C 3RTDA 2FWNA 2JA1A 4AJOA 4K9NA 3CY6A 5FPSA 1MENA 1YZKA 4YJGA 3A4NA 3FVVA 4FYKA 1T26A 3R8CA 3VH1A 4BNYA 4Q93A 2W22A 1A7KA 4Y18A 3EY4A 5DBOA 5F64A 1HO3A 1Z5OA 2BMJA 1IONA 1T0JB 5LN1A 2JC3A 5I9LA 4Z4FA 4JJ7A 4LTDA 4IDBA 2BH9A 4S1PA 2UXBB 1D1QA 4F06A 1JJBA 1P19A 1OROA 1LSOA 3KJHA 4GXTA 2B0CA 2FG7C 5JAOA 3H42B 5LSAA 3G9ZA 3H99A 5J40A 4BIIA 3L6OO 2F43B 4P0PB 4PAGA 4LQDA 4RQUA 2BCJQ 3QTBA 1SQSA 2A84A 4B4KA 4BKUA 3RUHA 3CM0A 1JFFB 1NMEA 3UAZA 4M9CA 4AMUA 5GGXA 5LXTB 1WIWA 2J0UA 3GGDA 2P9BA 2ZUCA 3D64A 2P9CA 2E18A 4CEJB 4IEEA 2XD9A 5JRJA 1X7YB 1FFXB 1ULSA 1ZC3A 4OB7A 3KJGA 2C31A 2IF2A 2XI4A 3QRWA 3P7MA 2ZSAA 1NV8A 4INJA 3FZEA 4Z9BA 1KMMA 4GR9A 1T1EA 2BZ1A 2W0MA 3QMWA 1PBTA 2G5GX 4X71A 4RJLA 2XTZA 4AJKA 2J0EA 2PGAA 1SHZA 5DI3B 4R54A 4JKIA 3SIRA 4NONA 5KX5A 3C5WP 1WNFA 2BC9A 3FXAA 2MSWA 2Q3FA 5LYJA 2KBFA 1C4KA 3ZIDA 1Z5UA 4K28A 1H2RS 2IYPA 5KX5F 3D4BA 1QTNA 5AKZA 4EG7A 1VYUA 4LBVA 4OMUA 3Q5DA 5LYJF 4TSKA 3A1TA 1ZXXA 4Q3NA 2B37A 1ICEA 1IHOA 3PC4A 2XJ4A 5E2IA 3WSVA 2I76A 4BEVA 1A7UA 1PR3A 4LYJA 2GLXA 1O9HA 5FCDA 1K8YB 3T7RA 1LWNA 4LXYA 1UZUA 2UVPB 3EG9B 3FMVA 1ISSA 4OOFA 1CY7A 1NIPA 3KU4A 1WDMA 3VO9A 4PSDA 1XR3A 3LE8A 4A6DA 4QDKA 2DULA 2XNDA 2Q3EA 5AM4A 4NJMB 1AQIA 3KTFA 3LOPA 3OD5A 3M4YA 3TUIC 1ZNWA 2GUGA 3WA7A 5EWLB 2IZ7A 2IH5A 3I1FA 4CT5A 1JXOA 3QBJA 3BOSA 3DZDA 4HQRA 2ZSUA 3H6HA 2HLPA 3A27A 3FCAA 4NOLA 2QSYA 4MPDA 1WBBA 1S2IA 8ABPA 4HI0E 3QKSB 5DX0A 5FFFA 5T4FA 3KQSA 4BKRA 5HJ2A 1HNXB 2O3QA 3UJ7A 2E48A 2OMEA 4TQAA 2OM6A 4DUGA 3O9VA 4R7ZA 1GO2A 2VJMB 3AFOA 1E2HA 1XRNA 1YS6A 2WIGA 3AI1A 4JR1A 4UU7A 1JG1A 1ZGGA 3S1AB 4AIRA 4QT4A 2JANA 2OUKA 1UQRA 2XA9A 5GONB 3RVRA 3QEMB 1M83A 4DCUA 1RWPA 3KYDA 3E5MA 2YJ5A 1V8OA 3IIEA 1E5LA 2X76A 2HF2A 2E85A 1P1BA 2YV1A 3ANXA 4G24A 1FRZA 3LUBA 4MZXA 2XT9A 3UPUA 4MVJD 1UAAA 1LC3A 5FLKA 2QMHA 2Z3ZA 1JKMA 4OP2A 1YZFA 1MB9A 5FIUA 4C0XA 5DNYB 3SMVA 4MQ6A 5KC9A 1LRKA 4MRAA 4Z8YA 4DLYA 1FY2A 5IT9A 3KSZO 3PKJA 3L04A 4P3YA 2OWDA 3D02A 3BBLA 1QLJA 1SXJA 4R3NA 3DDCA 4AK9A 1ILWA 3K73O 3PHIA 2D2XA 3W9BA 4QNNA 3SHQA 3K16A 3RSSA 3JWHA 3ZN2A 4YP1A 3AHGA 4MP8A 3ZGVA 4D9HA 4JUIA 4M7WA 5K8JB 4JJFA 5ALYA 3FNEA 4KJZA 4M87A 3WLHA 1W93A 5AJWA 3N7TA 4OO3A 2F1HA 3B1JA 5JSHA 3CO5A 1V25A 5IK2A 4AJHA 5GGYA 4X90A 3H1PA 3KEGA 1SKYE 3IOYA 3MPUA 4XUCA 3FB4A 3TKYA 1ENYA 3ZEAA 2PSSA 4DVGA 1V11A 1OKKA 2VDNB 4R6XA 4D81A 4F3RA 5KYUB 4BB6A 3FZYA 1XXHB 1Z26A 4OV6B 4YP9A 4DMMA 3RS9A 1X42A 2LTAA 5CAEA 1ZJYA 4XYGA 4ASUA 1CE8B 1GNTA 4D3DA 1XXLA 5JIBA 3IYLW 5SZHB 1P1CA 4J91A 4II2A 1OPRA 2ASVA 5J4KA 4GL4A 4ARSA 4AFNA 4RK0A 3I2IA 2XMDA 1Z4KA 2AMYA 2DGDA 3DGFC 4IUYA 2OMKA 3N2GB 3N53A 2WKWA 3ZIUA 2JHCA 3VR5A 3AWDA 4XVCA 1TX4B 1YUNA 1NQ5A 4S1VA 4MKIA 3VXKA 4FOLA 4EKEA 3E23A 3DEKA 2ABWA 3K70B 2BGUA 4MAFA 4FQ7A 3VSBA 2GEDA 4GFDA 3PL5A 4LJAA 5CIYA 2AXNA 1DX4A 3RWMB 1R0LA 4A27A 1H93A 1A7JA 2X2PA 4WZBA 1FNDA 5IJ0B 4QBHA 3CFYA 3HJGA 4XR9A 3AOGA 1XTSA 4LSWA 4FYMA 4MUMA 4OKSA 1DIAA 2FN4A 3M3DA 4AO7A 5KPDA 4L78A 4KQFA 1UMBA 2B1RA 1W0CA 1WW8A 3RJMA 4S2EA 1NVGA 4ARVA 2QD5A 1JA0A 5JY1A 3E9DA 2CDCA 2CXRA 5IF9A 5JDCA 5JZBA 1L5RA 2XDAA 2AT1A 3EDCA 1QRAA 3Q9NA 4FMBB 2H4ZA 4ER7A 4KUHA 5FOVA 5JXWA 2E6KA 3IKMB 3WLOA 1QG6A 2J5KA 5EYPA 2I03A 1CWUA 1T9DA 1OHHA 3H5VA 1YD7A 1J99A 4XIJA 2C4NA 1A9PA 4E6PA 4DY6A 4ER6A 4P36A 4ZDKA 3E84A 4KPGA 4P2BA 4ZJZA 3ZW7A 1MABA 4MW7A 4O1MA 2NXNA 2WKRA 5G1PA 2ZVJA 4EYSA 1ST2A 3UFXA 1HYGA 5JHGB 4EVRA 1FQKA 4OBBA 1WU8A 4A03A 2C5HA 3L06A 2G1UA 3WGYA 3THXA 1G8KA 4KGDA 2YYYA 2XDQB 3OZWA 4WACA 2V65A 2VRCD 4EHFA 3X1DA 4PRLA 4WNIA 4JBIA 4B46A 4EZEA 3AL0C 1NMQA 4B85A 5CTJA 2LIVA 5EQFA 3KQPA 2HKIA 1IAVA 4ZI7A 1IBKB 2WWVD 1C7JA 2QZZA 1GZSA 1GGNA 4NCIA 2W98A 4NQZA 1AX9A 1K68A 1V7ZA 2GYVA 3EXFB 3FSEA 4OTZA 4ZI7F 2R4QA 3KU1A 1EFPB 4U6SA 3W9UA 4NFLA 4BFYA 4DYDA 4EG1A 4NU5A 4WZ6A 3BM5A 2R96A 2IXBA 3S44A 2AZXA 4H17A 1I14A 1KI4A 4DMCA 5AVSA 1CP2A 4TTRA 3VC2A 2GK4A 4M0MA 4Y2HA 4ZZ0A 1PN3A 3O7WA 2D1QA 2PK3A 5TQVA 3F9IA 1QRSA 3KETA 3AVTA 3K4PA 3IIMA 3IX7A 3P4XA 2IXDA 3ZW9A 3R1IA 5FFMA 5T4BA 2Z2IA 2BV3A 4L85A 3HYNA 1JBQA 1NXOA 1LA2A 1WW2A 1SQ5A 1JG6A 2J41A 3K35A 2PR2A 4U7DA 5C5EA 3E9QA 5FAXA 3OEHD 1UBFA