1IUNA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
ANLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords meta-Cleavage product hydrolase
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iunA00
2J4FA 2DSNA 3Q8WA 1BN7A 2R8BA 3D3NA 4C87A 4PSUA 1XZFA 2OLEA 4WY5A 4BRZA 4X00A 1H2ZA 4QA9A 1XZKA 1EINA 1LPAB 5JALA 2G5TA 4PNZA 5HZGA 4DNPA 4KACA 4UBKA 1K63A 4X71A 2Z8ZA 3WKDA 5HKAA 3A2LA 2GBCA 3IUQA 4G1FA 1IZ7A 2XE4A 3DKRA 1SC9A 2BCEA 2I03A 3GELA 1UFOA 4W1PA 3DLTA 5HF9A 5ALGA 2QKYA 1DT5A 1VE6A 3I1YA 2RGUA 2C58A 1QFMA 2HU7A 3EQ8A 1ODCA 1RWQA 2PU7A 4G4GA 1G42A 4X91A 3U0VA 5SYMA 3QVMA 4BAGA 3ESBA 5EFZA 5LKRA 1XQVA 3G0GA 1LNSA 4GBGA 5EIAA 1BCSA 2WUFA 4DMHA 2ZSIA 4TVKA 1A8UA 3GFFA 3ED1A 4BCCA 1XZDA 4DLNA 3H0CA 2XUIA 3HC7A 3ZLTA 7YASA 5AK6A 1YA8A 3V1MA 5DYWA 3E0XA 4FTWA 2O7VA 4G5XA 3WL8A 4CG1A 4GLBA 1QIDA 2JGLA 1QO7A 2WHRA 3F97A 2I3ZA 3WJ2A 4IH4A 1SFRA 5YASA 4EY4A 3E1GA 1EI9A 2O2IA 5K3DA 2IIVA 4X85A 3EBLA 2BUBA 2AJCA 5AIAA 3IB3A 4WY8A 1WOMA 3UUFA 5HF6A 2P8SA 3IA2A 4AN0A 4J0IA 5AKHA 4Q82A 2V9ZA 1EX9A 5AK5A 3I6ZA 4J0CA 2X76A 1QIFA 1P0MA 3VJLA 4B84A 2WU3A 2OQVA 4H7FA 5DLPA 3AZOA 1R9MA 3K6KA 3W9BA 3FWHA 1XQXA 5ISMA 3H1BA 2XUAA 3WKBA 5LLSA 2HA3A 3IIIA 2VSQA 3ANSA 1OXMA 5DNUA 4XJVA 1XFDA 4GWLA 3O4GA 5FRDA 3FBWA 1N8SA 3X3HA 1CQZA 4TPKA 1H2WA 2OGTA 1Z68A 4W9RA 1E3QA 3WK8A 5CT5A 4C6HA 1XRLA 1O6GA 2PUJA 4MYDA 3WWPA 4CIBA 4KEAA 3TJMA 4UHFA 1GQRA 1EK2A 3G9XA 4FHZA 1K6EA 5AM1A 3ZI7A 1CQWA 1UK9A 3HYSA 1UK7A 2C0PA 1F6WA 4BVKA 1XZJA 4Y2QA 2QOEA 3MUNA 3BIWA 1NX9A 5A7GA 4CCYA 1GXSA 4G4IA 4E46A 2WG2A 1R4ZA 2I78A 3WL5A 3HI4A 3QYJA 3W04A 1XROA 3BF8A 1EHYA 2Y2UA 1QFSA 4BZZA 4OU5A 2K2QB 2O2HA 4H18A 4EUSA 1E66A 3HEAA 3VVLA 4WCVA 2Z5GA 1USWA 2VTVA 4FOLA 4U2BA 3R40A 3OOSA 4BVLA 1XQYA 4UBOA 4A16A 2HU8A 3ESAA 3C6BA 3TRDA 3IDAA 5C7YA 4UHEA 4HVTA 4IQ4A 2GYVA 2WTNA 5ALHA 4HXEB 5IVDA 1ZI9A 2DHDA 3QBJA 4DMCA 2FJPA 3FSGD 2O2GA 4WDQA 5AM5A 3S2ZA 2AJLI 2XUKA 4H7KA 1C4XA 2H1IA 1ZIXA 3FYUC 4P9NA 4LHEA 1HLGA 1KU6A 4IO0A 1AC5A 1CIJA 2XMSA 3PFBA 4X6XA 5EHNA 5CRIA 4G8BA 4B83A 3AINA 4U2CA 5AKLA 2W6CX 2JIDA 1TRHA 4LXGA 2XQFA 1B6GA 1Q84A 3CXUA 2ZVDA 4ETWA 1DT3A 3KXPA 2GBGA 2I3DA 3R3VA 3WZLA 1VXRA 5AI4A 2XUGA 1YAHA 1WCYA 2WHQA 4U2DA 4FFWA 2FX5A 1AX9A 1UOPA 1R88A 4AMZA 1M33A 4Y2PA 3H2KA 1LZLA 4MWSA 2XMDA 3RARA 5C8XA 5E4TA 3GZJA 4BE4A 5DNVA 1GQSA 2PSHA 1N5RA 4YK7A 5F4ZA 5CT4A 4G8DA 1GKLA 2OCKA 3I2GA 4GECA 1Y37A 1QO9A 4EZIA 3CCCA 1THTA 2WIKA 2WUEA 1CR6A 4FFVA 1UOQA 3WYNA 4QDUA 1XLVA 1BS9A 1ZICA 4BVJA 4W1QA 5IKXA 2HFJA 1A8SA 1AUOA 3B12A 4AMYA 4PO3X 1N1MA 1YCDA 3KWJA 3AILA 2IITA 1LPBB 4KRYA 2QS9A 2AJDA 2QTBA 4KE7A 3I28A 5ALQA 3AZQA 3O4IA 3PDCA 1D07A 4O08A 2XUPA 5LKAA 1FFEA 3F9CA 4MEBA 4LIPD 2RHTA 1NU8A 4Y2JA 3RLIA 1VZ2A 3WKCA 5I9IA 1UXOA 5KREA 1QIIA 1J06A 1MU0A 4X94A 3PUHA 4PW0A 4MQLA 5AICA 1W4LA 4H77A 4DSAA 1EDEA 3DNMA 1TCAA 1K4YA 2IX9A 2QXTA 4LYDA 3V1NA 4U2FA 1FFCA 4JYMA 2HHAA 5AKJA 4RNCA 4LXHA 4OPMA 1BE0A 4Y2YA 3WL7A 1YB7A 2J4CA 1BU8A 4B9EA 1GT6A 3H1AA 1ISPA 4DNOA 2VJBA 3VKFA 1DQYA 5CH8A 1UK8A 2O7RA 4MEAA 4QE3A 1IUPA 5H3HA 1JU4A 3IUMA 3WKEA 2CJPA 4X97A 2WHPA 2WHPB 2V97A 2VQ6A 4GXNA 3I6YA 5DJ5A 4B0PA 2XQIA 4BC0A 1LBTA 1QJ4A 4G8CA 3K2IA 4G9EA 2Q0XA 5AKZA 2VJDA 1XLWA 3F8SA 1MJ5A 5ALIA 4N8EA 4UBJA 3QZUA 1HDEA 4UFPA 4CCWA 3STUA 5FKJA 1K8QA 3L1IA 1WHTA 1GKKA 2B9VA 1AZWA 5EIHA 1LZKA 4AXBA 1MN6A 4QDTA 2HA5A 2ES4A 3MGAA 2ROQA 3KD2A 5CH3A 3C43A 1CUWA 1BCRA 3D59A 5A6VA 2HA2A 1E8NA 1F0NA 1A88A 1E5TA 5HKBA 2C0QA 5ALRA 2JEYA 4EY7A 1E89A 4OSEA 2QUBA 5ALUA 1QIJA 1ODTC 1ZD4A 4QWMA 2W22A 3T4UA 3AIMA 5FPPA 4Y2TA 1GPLA 4QEKA 4K6KA 4DSZA 2FUKA 4H7HA 1OCEA 4RGYA 2PL5A 5AM0A 2XMBA 4AO8A 2WIFA 4RE5A 3C87A 1SCIA 1TK3A 5BWBA 3HLKA 3FYUB 1WB6A 4W63A 1GGVA 2JBWA 4P92A 5AOBA 2YASA 2XDWA 4KE8A 3G0CA 1MX9A 2V96A 3DYVA 1JJFA 2X5XA 5A7HA 1LPSA 4ZV7A 3HRHA 5DNWA 5AIBA 1X2EA 5FLKA 1XZEA 1L7QA 3O4JA 3W06A 3BJRA 4KRXA 3ESDA 1Q0RA 3BJMA 1T2NA 2Z3ZA 5KBYA 3QH4A 4FDMA 5ALFA 5SYNA 4Q34A 2HDWA 4DMKA 3WK6A 4UFNA 1VLQA 1A8QA 3B5EA 1ORWA 4EHBA 5JAPA 4KYVA 1GZ7A 2WIGA 2HIHA 2QXUA 2PSDA 2WJ4A 2OCLA 5CT6A 4C88A 4G9GA 3AJAA 3F96A 3ZLUA 4PQEA 2ZJ7A 1XZHA 2J3QA 4OYYA 5IVIA 5AKGA 4EA6A 1QIKA 3R3WA 1VJ5A 3WMRA 2H9YA 2H7YA 1WB4A 4GI1A 4EY8A 5FV4A 2JGMA 1QIMA 1DWQA 2EDCA 5AK4A 2CKMA 3JYHA 4G4JA 1FFAA 1U65A 4Q3OA 4PF1A 1DWOA 5FOQA 2BUCA 2HFKA 2JGEA 4X6UA 1EK1A 5AO9A 2AXEA 4FNMA 5ALJA 3GUUA 1P0PA 2Z3WA 1FFDA 5LZ9A 3QMMA 3PUIA 4J7AA 4PSCA 3G0IA 3WZMA 4UBIA 3D2CA 4UHDA 4FLMA 1Y7HA 4U2EA 4QWWA 1VA5A 3HSSA 3D4LA 1W6RA 4NMWA 2XT0A 3WK9A 2XUDA 1U8EA 3DL4A 2EDAA 3V48A 4HRXA 1THGA 1WB5A 1AGYA 2VT7A 4I19A 4NZZA 5AI6A 3DOIA 4B82A 3HXKA 4BP9A 5K3FA 3WL6A 3IVMA 5JANA 1XKTA 3M83A 2QUAA 1R9NA 3WIBA 5DWDA 2OGSA 1IZ8A 4AB1A 5LZ5A 1CUUA 4BAZA 5LP1A 4BAUA 2RHWA 5IVHA 4CCYB 1AURA 3CN9A 2XUFA 1BN6A 5JZSA 2DQZA 1MX1A 2XMGA 2EEPA 4I3FA 3O0DA 3QMVA 3GROA 1EXWA 1VKHA 3W2TA 3BL8A 2BGRA 5ALKA 2HM7A 3E4DA 4V2IA 1CUSA 1C7JA 2VAVA 1CUZA 5JADA 3VISA 4UHHA 1RP1A 3QM1A 4FWBA 2B4KA 1XZMA 1G5FA 2CB9A 3G8YA 1CFJA 1K5PA 3QPCA 3PF8A 1VZ3A 4LXIA 5EHXA 1YS2X 4DMFA 3A70A 4NS4A 3I2HA 1HQDA 2DHCA 2WFMA 2XI4A 4AX4A 3O9VA 1U4NA 1CUCA 4JNCA 4Y2XA 4HXFB 2DHEA 3GBSA 4WDRA 4J3JA 4DTCA 1W52X 3O4HA 2GZRA 5CT8A 2HRQA 1YSCA 1TQHA 3L1HA 1CUGA 2QMQA 2RI6A 4QDOA 3BE8A 3WK5A 4ZV9A 2XMCA 1BEZA 3OURA 2BFNA 5HF8A 3TGLA 1UZAA 1HL7A 3FLAA 1FFBA 4QLAA 4K2AA 2WJ3A 4HRYA 4UBLA 1CV2A 1UKAA 5AM3A 2OPHA 3PICA 4CIAA 3QPAA 1EDDA 2VA9A 1BEEA 5LZ8A 1QIHA 3N2ZB 3RKSA 5ALNA 1CUHA 4M0MA 4N8SA 2H7CA 5CURA 5ALZA 2WILA 1UOOA 2XQGA 1EVQA 3R3ZA 5JD5A 3VDXA 1LPPA 3IUJA 5LYYA 1ZGBA 4N8DA 2HADA 3G9UA 6YASA 4B85A 1LGYA 1QZ3A 3SK0A 4EB0A 1DTEA 3I2JA 1XZIA 1WPXA 3WI7A 4P93A 1CUFA 1JJBA 2CUTA 5JIBA 2WFLA 2YH2A 4L0CA 5ALDA 2XB6A 3WWOA 5KWJA 2XMQA 4QDXA 1SCQA 5K3CA 2OCIA 3FVTA 3D7RA 1KU0A 2ZYSA 1GPNA 4JEIA 2WUDA 5JYCA 2CZQA 2G63A 1EB8A 5A71A 3WYDA 1H2YA 3NOXA 5AOCA 1J1IA 1LLFA 3WWCA 4EY6A 3LCRA 4UFOA 3C6XA 3H2IA 4CI9A 4AQDA 5ALYA 1CUVA 4FNGA 5KWIA 2HL6A 1ZI8A 3WWDA 4DNQA 1CUIA 3BXPA 2JGFA 5CXUA 4FBLA 3U1TA 1PJAA 4QDZA 3I2KA 4BYMA 1LPOA 3FOBA 3DS8A 4FMPA 5T4FA 3VJKA 2BJHA 2QVBA 5HK8A 3M81A 4YASA 5JZ9A 2QM0A 1A7UA 5JATA 2CBGA 1CUBA 2C7BA 3M3DA 4X93A 2QRUA 5AI8A 3NUZA 4GHWA 4IH9A 3F67A 5ALLA 3FLEA 3C5VA 1X2BA 2XUOA 3WKAA 4QZVA 2RAUA 5AI9A 1ZD5A 4KAFA 4DIUA 1DWPA 3IURA 4Y2SA 3WWEA 3H2JA 1CUDA 2Z8XA 5AKYA 1JMKC 5K3BA 3PE6A 3KSRA 3STVA 1XRNA 1CLEA 1SOMA 3P2MA 5DTIA 3O95A 3EQ7A 1EDBA 3MUOA 1C7IA 1Q0ZA 2D0DA 1JKMA 2B20A 5JD4A 2XQKA 4Y9SA 2JF0A 4FLEA 3OC0A 1UT6A 4HAIA 2Y2VA 1MAHA 3QPDA 4JUIA 3ICVA 1VXOA 4OU4A 5K3AA 4EBBA 3RM3A 4JYPA 4CFSA 5E2IA 4J0KA 4BTVA 1QLWA 1QTRA 1YR2A 4HS9A 1UKCA 2PBLA 2WM2A 3IUNA 1E8DA 2JEZA 4FBMA 3DKKA 4AO6A 5LZ4A 1F0PA 1MPXA 4NVRA 5AKXA 3R0VA 2XLBA 3WLAA 2WKWA 3JW8A 4WFKA 2XUQA 1TCBA 1EVEA 1IVYA 4H35A 3W9UA 1JT2A 1QOZA 5ALPA 2YYSA 4PSDA 3H2GA 3ICWA 4F5ZA 1XZGA 2DR0A 3ZV7A 2FJ0A 4HXGA 3FAKA 4UUQA 2PX6A 5CXXA 1AQLA 1YB6A 1YASA 4B7ZA 1ZJ4A 4K6HA 4N5IX 5CH5A 3G9TA 3AIKA 1IUNA 1BRTA 1MAAA 4H7JA 1ZIYA 4E14A 5CT9A 2VT6A 5HQ3B 1XRRA 2GBIA 4U2GA 1J07A 4BTLA 3PF9A 3C5WP 4C89A 4QLOA 1FSSA 3DEAA 4X95A 4M0EA 1JJIA 4X6YA 2OXEA 4H7IA 5J3JA 2VJCA 2GYWA 1MO2A 2ZYRA 2AJBA 1MT3A 3VJMA 1Y7IA 2UZ0A 4P08A 3D2AA 4KE6A 1CPYA 1ODSA 1P0QA 5LZ2A 3ZPXA 2QJWA 4DM7A 2J3DA 3FLBA 4QNNA 3FYTA 4PV7A 3LP5A 1CRLA 4HZGA 5ALTA 3PFCA 4Y2RA 1AMNA 1YS1X 3CCBA 3EIOA 1HBJA 5HCUA 5JD6A 1YAJA 1TKRA 1UK6A 1X70A 5JZBA 4L3WA 1XRQA 4MYSA 5EIEA 3DDUA 4A5SA 2WLSA 2WG0A 1L7RA 3BWXA 2ZYIA 1DX4A 1JI3A 2YXPX 4C4XA 4KE9A 4OB6A 5ALSA 4Y7DA 3C6YA 5IVKA 4L9AA 5AHXA 5DYYA 5T4HA 1QIGA 4LYEA 1G4HA 1EH5A 3STXA 2PUHA 4X92A 4BC1A 1CUXA 4J0JA 2X8BA 1JFRA 1R3DA 5C8ZA 2BGNA 3C8HA 4J0DA 2VATA 4OUKX 3RK4A 5A62A 4UHBA 1HPLA 2CEKA 5C8VA 2PU5A 4B0OA 3OG9A 4GEGA 5HFAA 3AIOA 2ZJFA 1NU6A 3FCXA 1QONA 4OB8A 3WK4A 4H0CA 2WFLB 4KAAA 4ZRDA 4A23A 2XLCA 3LIPA 3D5EA 3R3YA 4X7BA 3VXKA 4BATA 1CUJA 4K5QA 1CUYA 1TIBA 3GA7A 2GYUA 4Y2UA 5ALEA 4BDSA 1TAHA 2ECFA 4BDTA 2WTMA 5DTJA 2OGZA 1VE7A 2OCGA 1N5MA 2ACEA 5AP9A 3N0TA 2Y6VA 5EI5A 2WJ6A 5AK3A 3IULA 2E3JA 2OG1A 3BF7A 4AZ3A 5FP0A 4B80A 3A2NA 4X3CA 3FVRA 3H19A 1DX6A 1QGED 2CMFA 2JGKA 2DCMA 4F21A 5D7BA 4XWGA 3S8YA 4RPCA 4BZWA 3HZOA 3A2MA 5AKEA 3QMWA 2R11A 3ILSA 1W1IA 1XZAA 2Y6UA 3O9MA 1H2XA 2JGIA 2OAEA 3Q0TA 4HTAA 3WK7A 1MNAA 1LPMA 5AJHA 5D6OA 1JMYA 5I7UA 1HKHA 5D3KA 2OQIA 4H7EA 1ZGCA 3NGMA 1XRPA 1J2EA 3KWFA 3OM8A 5JAOA 3KOOA 5HK9A 4GDMA 3BIXA 5D3ZA 3C8DA 5K3FB 5AH0A 4UBNA 3DYIA 1PFQA 2XQJA 2DFPA 2PSJA 4ARBA 4B6GA 2WSLA 1MNQA 1RYYA 4L72A 5JASA 1CEXA 4W1SA 1EA5A 4MWTA 5AM4A 4OB7A 5AI5A 4WJLA 1DQZA 5AI0A 3EF3A 1GPKA 3BDIA 2XMRA 1QE3A 2PKYX 1W76A 2C5FA 3D0KA 2NW6A 2PM8A 5LIPA 3DOHA 4C01A 2XMZA 4CG3A 1WPRA 5FPQA 2QJRA 4WFJA 2V98A 1XQWA 3NWOA 4D9JA 4RE6A 3YASA 3G02A 2VF2A 2DQYA 1CVLA 5A2GA 2VAXA 2ACKA 4E11A 1KEZA 4DYHA 4GW3A 4ZI5A 3HACA 1ETHA 1XZCA 4XVCA 4BCDA 3G0DA 4LKOA 1QIEA 5EHZA 1DINA 5AKKA 3G7NA 5IH7A 3E3AA 5AKIA 3EQ9A 3SWWA 1TCCA 2ORYA 1S8OA 3MVEA 3R41A 1XRMA 4MQMA 4Q1VA 5FDFA 2WIDA 1XZBA 3HJUA 1YA4A 3ZLVA 1H23A 3FCYA 1R50A 2AJ8A 2WFZA 5ALMA 4ZREA 4UPDA 5T4BA 1H22A 2HA4A 3G0BA 5T4EA 3AZPA 3DQZA 2PSFA 5ALWA 3G9ZA 4Q05A 2ZYHA 5BOVA 2B61A 4IH1A 2QT9A 1JU3A 3PI6A 3DJYA 4UBMA 1EB9A 4C4ZA 2PSEA 1Q83A 1ACLA 3B3QA 4C4YA 2HA0A 2HU5A 5C81A 1DU4A 3SC2A 3VVMA 3H17A 4B9AA 2LIPA 3WJ1A 4ZGBA 4F60A 4BBZA 1W75A 4KR0A 1WM1A 3I6MA 2ZSHA 3L1JA 2JGJA 3H04A 2WQZA 1UKBA 3C70A 5ALVA 4WFIA 2RIPA 3STTA 4AO7A 4FKBA 4J0HA 4OD0A 5K3EA 1IMJA 3WIOA 4ITVA 5E4JA 3FNBA 1FJ2A 1ACJA 1E8MA 3FYUA 5E4YA 1B41A 1LBSA 5HQ3A 3M82A 4CG2A 2HRRA 3DCNA 3UMJA 5HFNA 3V9AA 4K6GA 5AOAA 3W05A 2BAGA 3OTQA 3AFIA 2GZSA 3BDVA 4X90A 3WQHA 2C4HA 1ZD3A 5EGNA 2H7XA 1P0IA 2BUAA 5EHQA 5JARA 4EY5A 1BROA 4I4CA 4W1RA 4XX1A 1O6FA 4XIIA 1ZOIA 1VOTA 3K9BA 2WIJA 3R3UA 1QTIA 2QZPA 3I2IA 3V1LA 1WHSA 2QR5A 2XUHA 2WU4A 3C6ZA 3V1KA 2WG1A 4MJ3A 1IUOA 3AUKA 2G4LA 4OYLA 2VJAA 4E15A 1OILA 5HF5A 5FUMA 5BWCA 2RONA 2XUJA 3ANTA 3I2FA 3ZWQA 1MX5A 5LZ7A 4YX9A 5CMLA 1U2EA 3A6ZA 3TEJA 1ZD2P 3UUEA 1ZJ5A 5AM2A 2PVSA 3H18A 4AN1A 4INZA 2Y1KA 5ALXA 3F98A 4ZWNA 3SX4A 3ESCA 4BB0A 3H2HA 3CN7A 1CUEA 4ARAA 2HA6A 1PV1A 4S0XA 4Z49A 5K5EA 4Y2VA 2ONCA 2G5PA 3C45A 1SCKA 4B81A 1I6WA 4J0GA 4AZ0A 1XKLA 3LLCA 5CTAA 4ROTA 4MXDA 1LPNA 3QITA 4BE9A 4UHCA 1F8UA 4M0FA 3LIIA 3OPMA 1VA4A 2VEOA 4KAJA 5JAUA 4FLFA 1AKNA 5BV7A 2D5LA 1UWCA 4DGQA 2ZJ6A 3I1IA 2BKLA 3R3XA 3STWA 4JH0A 3HABA 4BCBA 4TGLA 5A7FA 2GBFA 4DNFA 5ESRA 4H7DA 5CBKA 1XLUA 4Q3LA 3KDAA 5FXMA 3LS2A 5I8PA 1MTZA 3D2BA 3IBTA 2PPLA 4N5HX 4BRSA 4OCZA 4J03A 1R1DA 1G66A 5CW2A 5ALOA 4BP8A 4F0JA 1CUAA 2WUGA 5JAHA 3DL7A 4YPVA 3JWEA 1ZI6A 4Q3KA 1L7AA 4KJXA 5DYTA 2HA7A 2C5GA 3WA7A 1XZLA 3STYA 2OAGA 3FSGA 1ORVA 3WA6A 3T52A 3DD5A 4ZXFA 1T4MA 4IHAA
chains in the Genus database with same CATH superfamily
3ZZ0A 5C46F 1V4VA 5KYTA 2H52A 4M38A 2ZUWA 1U7DA 4MUAA 3D3NA 5DEIA 3NZEA 1JTFA 3VDNB 2EF1A 4C87A 1TMOA 5LBIA 1QCZA 2OLEA 4J3NA 1XQ6A 4H17A 1IOWA 4WY5A 5BUCA 5AVUA 2I8AA 1CDEA 4DAOA 2JAQA 1LPAB 4IRMA 4DV3B 5JJIA 1I33A 3RS9A 1QS0A 1OLXB 3WHPA 4ZI7B 1FSFA 1RP7A 1GZHB 1YT5A 5HZGA 2Y3IA 4RK6A 4ZOLF 5IFKA 3NHMA 2C4UA 1TJ4A 2VUUA 4HMPA 4LJAA 3HEMA 1K63A 1MENA 1AXEA 4RJ2A 2JS7A 3EHDA 4QOFA 4JT2A 3WKDA 4QBTA 1SHKA 5HKAA 3A2LA 5BQ3A 4KVAA 4XYEA 1E0AA 1EESA 3KPUA 2RGBA 3Q3IA 1TYBE 2VYND 4MVXA 2YW9A 3H6GA 2F2TA 3AOEC 5KCZA 5KNCD 3T34A 4A3SA 1BXGA 1HE3A 1SC9A 3E4CA 3NGLA 1PNRA 5L7YA 4OSOA 2P68A 1RHRA 4NXNB 3TLMA 1USGA 3HM2A 2F64A 4XXHA 1LLQA 1KJNA 2ZT7A 1KQGA 1DT5A 4FHFA 1SVOA 4OQ4A 3JQAD 1RQ2A 2FUEA 1XCLA 3JALA 3W2FA 1NN1A 2C58A 1C7FA 1HZJA 1WBJB 3HKDA 3N76A 2HU7A 4M1SA 2CLIB 3LV8A 3PTLA 1Q77A 1XTTA 3C7AA 4JC4A 2B35A 3JWGA 5L3ZA 3OF5A 3P9XA 2OCDA 4IMPA 4BUCA 4UXHA 3BT7A 4G4GA 4XASA 2GF9A 3DMTC 3LT0A 2GTHA 2PD3A 4X91A 3U0VA 5SYMA 3V8MA 3RUCA 5JNLA 3G2PA 3NONA 4JB8A 2CXRA 4A1OA 4Z4CA 4ZALA 5A03A 5JPIA 3PHGA 4CF5A 3FYCA 5A4DA 2HV8A 3F4KA 4GM0A 1SVMA 2QWXA 3MD9A 2CJWB 5LKRA 3R9XB 3LQ2A 1KE2A 1PWYE 2O2XA 1GVNB 4U6SA 1YC5A 1KOLA 5JISA 5KOHB 1K7CA 2Q3LA 4OL0A 3SQDA 2X5NA 4GBGA 5C8DA 3E7XA 4LZLA 4CL3A 1BCSA 4B17A 3N59A 2GM4A 3IV7A 2FSUA 3W4IA 2EIHA 2V59A 4WZAB 1N8TA 2QEQA 3FGZA 2WYUA 3SQNA 1J9ZA 4DARA 1JE1A 4ZCIA 1KZ9A 5HKKD 3FWNA 1BXZA 2B8TA 1CY1A 1KVSA 4M53A 5K8JB 1ADFA 3B3JA 5EJ8A 1LSUA 1UQRA 4JLDA 1SBYA 1JKIA 1VBMA 1QKKA 2FMIA 2O05A 3ZWWA 4BCCA 1Y6RA 3UA4A 1CE8A 4HDKA 3ZHBA 3BCHA 4HNHA 4N65A 3RAJA 1APBA 1X0XA 1E79A 1G38A 2OBLA 3PGJA 4O2BB 2XUIA 3ZYZA 4HGPA 3UWOA 3L7JA 4O4HA 4RY8A 5F2EA 3LT2A 3UZUA 5AK6A 3ICQB 3BVPA 1KYTA 3PWSA 2WQ7A 3V1MA 1Z5GA 3C85A 3D4OA 4O2BF 1E7WA 4C2AA 3OSUA 2CXXA 3PGVA 4G0NA 5K6RA 4PCVA 5J4KA 2CGEA 4O5OA 3LFHA 1UEIA 4G5XA 1LW7A 1YZVA 4UATA 3WL8A 1NBEA 3EG9B 4GLBA 1FIUA 1GNTA 1GPH1 2LGJA 3EFHA 1SH7A 2CXHA 2JGLA 3K31A 3MBIA 1JYFA 1UC9A 1K08A 4Y67A 1KIFA 3AY0A 2NYUA 2VQ3A 2ZQZA 3HJCA 4Z9AA 5C9ZA 5G4KB 3VH2A 3A1CA 4BJ6A 2WHRA 1JR4A 2IOQA 3EVGA 3AG5A 1D0SA 2DPXA 2ECKA 5KVVA 1PR4A 3MQFA 1NVDA 3WMXA 2PANA 5KJEA 1M0SA 2IV2X 5EAIA 1RKBA 4B47A 2J9RA 4WLOA 5YASA 4DF3A 1NBME 5L4SA 4O4IA 2R2AA 2FPOA 2GLXA 2O2IA 1P7VA 1QYCA 2QD3A 4BQPA 1G9TA 3JYQA 3ONVA 1VKZA 4FCCA 5JS7A 4GKKB 3LHKA 4HWRA 1BVHA 2BUBA 4KDRA 3RTDA 2AJCA 2VPWA 2NYRA 3ZGNA 5ADVA 5EWJA 1K4KA 1ZPDA 2GK6A 5DI3B 4DC1A 4AKIA 4GBMA 3UUFA 2RD2A 5C18A 2YZKA 2I33A 3CNHA 5ARBA 2IELA 5F7XA 1UP7A 5TMPA 5TJ9A 3PYLA 1DADA 4AS3A 1W44A 4NECA 5K4HA 3JQRA 4ZO8A 4UREA 4LRWA 1COZA 4DMLA 2IF0A 2AEMA 1FXWF 2WHYA 1Q14A 1RFGE 1JG7A 3ZX5A 2W5UA 1GUAA 1YDGA 3R6GA 3R7SA 1GKYA 2J07A 4DMCA 3ZD7A 2DM6A 2X76A 1QTQA 3MBKA 5GGYA 4JJAA 5J63A 4YUXA 5IYZF 3OUUA 4YAOA 7REQB 2AOUA 2R44A 5IDWA 3BN3A 1UBTS 1ODLA 2QZZA 2XAUA 1ESZA 1ZDMA 3UY4A 1PR0A 3K94A 1W5EA 1M6WA 1R9MA 1QGOA 3K6KA 3W9BA 4E30A 1XQXA 3DH0A 5JBQA 5I5GA 1R0WA 2B2NA 1TU4A 3CR8A 4MQFB 3ROXA 5FPKA 1WCIA 2K7FA 1D5CA 3H1BA 4NOJA 5HVNA 4UU1A 2VH5R 3FLMA 3OIVA 4EKIA 3I73A 3V8VA 4LVOA 2ZR9A 3IIIA 2C2BA 4I5DA 3ZHTA 1OZ0A 5IBPA 3ANSA 4O1HA 2VF8A 3U3DA 1OXMA 3IQGX 4BNLA 2AYYA 4CW7A 1VI2A 4ZQGA 3JCZA 1JR2A 5EC8A 3UT0A 3O1HB 2BMJA 1TW2A 1NR7A 4XJVA 3RU7A 3O4GA 5FRDA 1XZNA 4QX6A 2VL7A 1NP7A 1LBEA 4QJ3A 1YBAA 2AWNA 2XADA 3AM3A 3X3HA 3L6RA 4WZBA 2ODNA 1JWLA 2ZPAA 3N28A 4G5FA 1WZNA 1KDTA 1R0BA 2QX7A 5KNBA 4WXPA 4J76A 1XRLA 2AYZA 3KV1A 3KJNA 1PYDA 2Q2NA 3IKLA 4QHSA 5IUKC 3Q5EA 1D2AA 2VNJA 2VP6A 4I1YA 2B99A 3EYAA 4MVJE 3VYRB 3PUVA 3T3HA 3UAGA 3VR3D 3UTDA 1A9XA 3PB3A 2RKOA 4KEAA 5JSYA 5C3UA 1XEWX 1W0JD 1PR6A 2PY6A 4FOSA 4KL8S 4UHFA 3RRZA 3EZ2A 2OZPA 3DL0A 5K8TA 2HY7A 1TD9A 1QDEA 4KWHA 2BH2A 1K6EA 3LCVB 5AM1A 1RYMA 3IBSA 1B0ZA 2ZANA 4DDKA 4GE0A 4PR3A 5HTOA 4B3XA 2V5AA 2OENG 3MWGA 2HAEA 2MSKA 2RGDA 2CNWD 3UAZA 2I87A 1VHWA 1XZJA 2OFPA 4Y2QA 1DQNA 1NAHA 1WVGA 1XZQA 1CNFA 2VH1A 4HEHA 3VO9A 5JR3A 4EJFA 1JEAA 2Q99A 1JIQA 4UUPA 2VPTA 4F1JA 2AD1A 1GXSA 3LX4A 1M2HA 5JYEA 3COPA 2QIOA 1ECPA 3AVUA 1RFLA 3FWZA 4DBLC 3JRXA 2WG2A 3LWDA 2IWRA 1S2MA 4P7JA 4R8RA 1R0CA 3WL5A 1EWRA 3HI4A 3IAFA 3U6KA 4BX9A 2C9YA 3T4EA 1L1QA 1LTHR 2OBFA 4OGWA 4PAMA 5DWQA 4OHPA 2GPBA 3LQRA 3ZU4A 2XAAA 3VHXA 4MLZA 1QFSA 1Q15A 1M3SA 4DM3A 3W6PA 4OU5A 2O2HA 2SHKA 4MW7A 4DGSA 4EUSA 4TVSA 2BPOA 2NU7A 3ONWA 5FAKA 4W7SA 1S2DA 3EPRA 2BEJA 1T2FA 2MINA 4YAGA 5KTOA 3IAHA 2QTHA 4WVLA 3IQXA 4CIXA 3X1YA 3VC1A 4M76B 2C5SA 3OOSA 3N58A 2WJIA 4I9HA 4NG4A 1GTRA 4LDAA 3W8RA 4BQQA 4QQ8A 1U7XA 2JFFA 2QG9A 3TE6A 3E27A 4A16A 2HGZA 4MV1A 3WJAA 4F3RA 4B44A 2L17A 2HU8A 4ZO7A 1QUEA 4Z4QA 5DGCA 3TRDA 4DLLA 2I34A 3U19A 3OZGA 4NR0A 1QGAA 2C7VA 3GZ4A 5ARDA 1R6XA 2IE0A 4F4HA 2J7PA 3DJFA 3ABSB 3BCSA 3I83A 4LYJA 5MFPA 1KJWA 4YCMA 1VJTA 2HSGA 3C1UA 1T0PA 3QJ5A 1I6LA 1HY3A 1VLHA 1X14A 2XD9A 3ITDA 3CJRA 3KSMA 4HVTA 5KSOA 2V7XA 4QM7A 4PONA 5B64A 5FOXA 1UMBA 3SCZA 3HGTA 2ZUTA 1BA2A 1HLDA 2ORED 2PS3A 2HC9A 1DO0A 1U90A 2ISSD 3U16A 2VP0A 3MMZA 1SCNE 4U5QA 3R7NA 3ZGLA 2DWCA 2FZEA 4JIMA 8ATCA 1ZA2A 1GRCA 4WDQA 5GZ3A 2P5UA 1X42A 4DLAA 4FR5A 2RGRA 2IOFK 2J0QA 1TVKA 2PWAA 4MKRA 4DCTA 3MILA 1ABFA 1NY5A 2UKDA 5LA6F 1NGSA 3IDQA 4FDAA 3V7NA 3TZLA 4H7KA 1C4XA 2H1IA 3QXHA 1M0WA 3D1JA 3N8NA 2BY4A 3OEHD 4P9NA 4PFQA 1INLA 5B1HA 4LHEA 3UK7A 5B58C 1JAXA 4UMVA 4A8PA 1JLMA 4XI9A 3U80A 2OV1A 3THWA 1KU6A 2OXIA 5KNLA 1TM5E 2JAWA 1LI4A 3FJOA 4K9OA 1AC5A 4CN8A 5J2UF 1GQOA 3WRVA 5EVCA 3SE7A 2BL4A 4JQOA 4XAQA 4GH5A 5AJWA 1QJCA 5EHNA 3W5HA 2FN4A 3GLRA 3UT6A 1KP9A 3LBIA 3UAWA 3AUSA 2VDLB 4HK4A 3RHFA 4QUDA 1JA9A 1WF6A 3AINA 4OXNA 1LI7A 3HL4A 4LY9A 3GRYA 4X5OA 2AVDA 4X61A 4FSHA 5AKLA 2VXOA 4JBYA 3ZWKA 5G0TA 1R8XA 3KQOA 4O8ZA 3ETJA 3CMCO 5FJJA 4KQMA 2W6PA 1XRJA 2QL5A 2RIRA 2PIAA 4LXGA 1Z38A 1Q84A 3EZ9A 3GYBA 5K3SA 3FZYA 3WGJA 1PSWA 3DHYA 4EW3A 3FE2A 3Q40A 3VBEA 4OBBA 1JZTA 4KYIB 1C0EA 3GLHB 2C84A 3NUQA 1UDRA 3WZLA 3ROKA 1AF4A 1GG2A 2JATA 5AI4A 2Y4OA 1BMDA 3VR4D 3UHOA 2QX8A 4IQ8A 2O1XA 4DSNA 3EMBA 1YZHA 2OHFA 4FGKA 5KUTA 2WHQA 4U2DA 5MGNA 1TEZA 2EGHA 4GZMA 4RACA 1MGPA 1P1KA 1S8AA 1SHLA 2BFFA 2LPMA 2FTKE 3H8JA 3KYCA 3NEJA 4FFWA 4NMMA 1PS9A 3WYCA 1E9CA 3MTIA 3HUTA 4D3ZA 4IWXA 4WEOA 2GPNA 4PYLA 1NKSA 4HQKA 4EK9A 1PDVA 2RCYA 4CETA 5I9SA 4UU8A 1PR1A 4PC3A 1D1SA 2EOAA 3FPGA 3V1TC 5E4TA 1NL3A 1E0KA 3CEPB 5D87A 5U4QA 2PSHA 4GMGA 4PQFA 4P54A 3DZCA 3RPEA 1SIOA 1I9CA 5AW1A 1EFKA 2IZ5A 1JBQA 2CVOA 3H75A 3P71T 3S6JA 3UMYA 1NUSA 3LHDA 4MJXA 3SBEA 4KMSA 1P4HA 4NK5A 2Q50A 4CRWB 5CT4A 2HJVA 2AB0A 2GN0A 1O97D 3D4NA 1VPLA 4EUFA 1QO9A 4Z4FA 2WJAA 3TJZA 1B2RA 1JDUA 1YDMA 1T36A 2WKSA 3K09C 1G18A 4PU0A 1U7PA 1UMCB 3AI1A 3VSEA 3GEHA 2WUEA 1E2JA 1ZSNA 2N47A 4R1SA 1PVOA 4Q5IA 3CKYA 1ZUWA 1DFGA 4QDUA 1ZICA 1E5VA 1SWWA 2GZHA 5IZ4A 2CYCA 4E2XA 4W1QA 5CFNA 4OI1A 3AW9A 2XXJA 2J3LA 5E3HA 1OC4A 2VF7A 3PCXA 1KO8A 2VRWA 3QLVA 4Y6OA 3EGXA 3TLXA 1JDTA 3B12A 5MDHA 2VPZA 4D9EA 1JKFA 4LC9A 1W2HA 1L7DA 2J4DA 4KXVA 3KWJA 4OI0A 1ACMA 2GN2A 2DR2A 1XMPA 4ALLA 1GGFA 3E81A 4WKCA 2VC2B 2Z57A 2ZSUA 2IUYA 3EMKA 3B7GA 4KWCA 1OAKA 5F3DA 4PVCA 2QTBA 3OFVA 5FBQB 3IRVA 4GO1A 4CKWA 3O4IA 2OV2A 1UQUA 2YHAA 2V0CA 1X7HA 3S7ZA 2OV6A 4I14A 621PA 5DZSA 1YFLA 4O08A 5LQUA 1O5OA 2YWCA 1HTWA 1U3DA 3DP9A 1CY4A 3AJDA 2IYWA 1OLUA 5DBEX 1FFEA 2VSOA 4ITUA 1L5MA 3R3JA 3HB5X 3LQ1A 5FUQA 4EVSA 4W5WA 5I45A 2P3SA 2RHTA 1NU8A 1NIPA 2HMSA 4Y2JA 4Z53A 1A82A 1YKFA 3NBYC 2A3NA 3H87A 1VJRA 3ACCA 3A6FA 3LHIA 1VZ2A 5FWAA 4DVGA 3CX3A 2QYHA 4IS2A 1UXOA 5FIUA 5I9IA 5KREA 1I2DA 4OQEA 4HO1X 3NR2A 5IKPA 4KWTA 1GNSA 4E5DA 4EHAA 3THYA 1L8OA 4MQLA 1XE3A 1E63A 3U37A 4BGEA 5DLYA 1Y8QB 5A4MS 2HK8A 1Z2EA 1RXCA 4XYBA 3KSDO 1WW2A 2FMUA 4M8LA 2A5YB 1XEXB 5KVQA 2JDID 3EXHA 1MH9A 4XGIA 1DAFA 2IX9A 1PIWA 3KAKA 4Y1EA 4CLXA 4GPAA 1L5OA 1XAGA 4LYDA 4ZICA 3T38A 1BU5A 1L9KA 2E0IA 4DYVA 1CF4A 1E7SA 4DBZA 3GPIA 1N8KA 4U2FA 1NBWB 2GK4A 2Q6KA 1LJ8A 4S2UA 4G0ZA 1G7CA 4TM7A 2HJRA 3HNRA 4J91A 4XUCA 2HHAA 1ZHOA 5AKJA 4RNCA 4OPMA 1JPNA 3CU5A 4MW9A 2AUNA 2XB9A 5HKKA 4MWZA 3T9AA 3FRIA 2J4CA 3OCYA 1M2JA 1ISPA 4MW4A 4PPQA 4Z51A 5AHKA 3N05A 2FPGB 3LZDA 1M0TA 4ZT5A 4D74A 1Z62A 2VKQA 1OXVA 3MWEA 4MWEA 4ZODA 4O4JF 1QGYA 3FVWA 3VKFA 2JCVA 4QO8A 4Z0TA 5AUPB 3P20A 1PGPA 1U63A 4FHGA 2O7RA 4ENTA 1H4QA 3P5SA 5IBRA 1R74A 1ZITA 1G3MA 1QCYA 4D81A 2JLCA 3SMVA 2CJPA 3DR3A 4QU5A 1MMFB 2H9IA 1MQSA 3UHAA 2ZRMA 1MRSA 4O5AA 1YUBA 3N2YA 3T54A 1X1SA 5DP1A 4JZKA 1X7WA 3KC2A 3B1KA 4O6VA 4KVGA 3SOZA 4CT0A 3VR6A 4RF5A 2C7RA 4AJJA 1RC8A 2XQIA 4NBSA 4BFYA 3WS7A 1AVTA 1DVRA 1WZUA 4B4WA 3MJDA 5T6BA 4N7JA 4YFYA 2SNIE 1P62B 5AKZA 1XLWA 3HLYA 4AKEA 1T0BA 4N8EA 3DONA 3AR3A 1EFTA 1PNQA 3LUAA 3NX4A 4TTIA 2CNNA 3PCTA 2JI6A 3WJ7A 4XWWA 3OTGA 3OHSX 5DM4A 2VHEA 3NYRA 1XAIA 2M2IA 4JQYA 4JR1A 5FKJA 3UXEA 3TBHA 1XDDA 1HXHA 5K0NA 1ZN8A 4L2IB 2DT8A 3K1AA 1N3BA 1U81A 1DJNA 1P1BA 3CZMA 3GP8A 1UIMA 3S5JA 1YQUA 1YOVB 3EFOA 1W59A 3D5QA 2XTMA 2A9OA 3ZDQA 1TF5A 2IVFA 3Q6NA 3PSAA 1EFUA 4L6CA 1JAIA 2Y9PB 1OH5A 3GJ8A 2ZSJA 4K3VA 2UZIR 4JOBA 4DADA 4DPKA 3ZJTA 1JR3A 4JLVA 2IS2A 3WGQA 4HDRB 5FNVF 3ZH9B 1JN0A 3N39C 2JFNA 4LNUB 4LZNA 5DYIA 2PAAA 1KVQA 4NJOA 4JI3B 1R0LA 2EWWA 1SOWA 1WXXA 2HQSA 1W0KA 2GCOB 2H92A 2IXFA 5JBIA 3HKCB 4QODA 1NYRA 4KODA 3EEFA 4EECA 2IBMA 4I8XA 4IVRA 2QQ5A 3LCUA 2A30A 2C0QA 2Z5LA 1VSTA 3EVBA 4PYIA 3DZJA 1ODJA 4Q02A 5J4VA 1T9KA 3NG1A 9ABPA 3AVTA 1PBNA 2PMCA 5JCOA 3K4HA 3PNVA 1FU8A 3QIAA 4PQGA 1G2QA 3JQPA 3GRPA 1R3UA 1ZM9A 4Y6LA 4AZVA 4C1BA 5ALUA 4EJSB 3MNFA 4S24A 4KXUA 4FK8A 4V0OA 5I7OA 5FBWB 1ZJ6A 3T4UA 3KKMA 1LB1B 2MIIA 1TT5B 3BXXA 4YGYA 1WRBA 2WNHA 1DPFA 3SQOA 4E4RA 2QTWB 5HBGA 1J23A 3IXQA 3T7AA 4Q12A 3T5DA 4BQRA 3AVYA 3LC7O 2WYWA 4CTMA 3SYRA 2CB0A 3SYMA 3FR7A 4C4TA 3EGXB 1YHZA 1FVFA 3G5UA 4HTFA 1KDRA 3DEYX 4UMFA 3SX0A 4XX0A 2EW1A 1T9GR 4H7HA 2LZ0A 4HSEA 1X8KA 3ANXA 3FF1A 1FSZA 3LO8A 4WWHA 3SIWA 3ABRB 3BRWD 2XMBA 3T94A 4Y6SA 2WIFA 3CLSC 4CMKA 4K6MA 1DBRA 2QJFA 3IPXA 4R8SA 4DDWA 1V1RA 1W85A 1P2UA 3NWBA 1GTJ1 1A5BB 2G8NA 4XFDA 1SCIA 2W98A 3E5MA 3GJ4A 2FP4B 4L4ZA 3FYUB 4I4TA 4D8WA 1V5WA 3UJBA 2I1LA 3C14C 1OTYA 3GUCA 2OHGA 4J6FA 4MVJA 3T4PA 4ZVPA 5EJ4A 4UQLA 3N2GA 3P27A 2F62A 2YASA 3DW1X 3EAGA 4NPCA 4TUYA 4A82A 3MUFA 4KE8A 3G0CA 4FYVA 3RS0A 2OHOA 4OK3A 3IAUA 5TPWB 4E5NA 2X5XA 2ZVPX 4XE5A 3DBHA 4NOMA 4ZV7A 1XL1A 2PGOA 4URXR 4G3XA 3JSXA 1JF8A 5THKA 2JPDA 2SECE 1Y8CA 5T8KA 1RXYA 4RZ3A 4A91A 4QG3A 2EP7A 4ARVA 4BNMA 3V7FA 2ZRAA 2VDKB 4OGLA 3X43A 1LV8A 2EJCA 1H1DA 1XZEA 4B34A 5AJXA 4P5EA 1GGEA 3BJRA 1S3FA 4RF3A 3L0YA 1NVWQ 1Q0HA 2FFHA 3ILVA 3PQ7A 4KRXA 4OVKA 3UJCA 1M0EA 3BJMA 1A2OA 2ERCA 3G9QA 4LCBA 3SHTA 4BY9E 4I50B 2Z3ZA 5KBYA 3V80A 2Q5LA 2BZ0A 4KFUA 5IH3A 5CCDA 1ULSA 1XMOB 1ISFA 4JU8A 1UCFA 3CRRA 4RPKA 3U9LA 3O73A 3NJ8A 1DWUA 1Q95A 3OAAD 5LL6P 3U3KA 4R4JA 1ZY2A 5HUQA 1A71A 2YINC 5TR9A 4G36A 4MWGA 1JG2A 4F1WA 1L5HA 3AF6A 4XCQA 4PLHA 1GSOA 3QFRA 4J1QA 4CIWA 1ORWA 1QE0A 5GV8A 5LNK6 2P6UA 4GOND 5HE9A 5K0GA 1FMFA 1KYVA 3ZZMA 2A14A 3LHSA 3CW8X 3TVYA 2HIHA 3H9JA 2X41A 2JJ1D 1HE5A 5HQTA 3HSYA 1YU9A 4BO1A 5BV0A 3P9PA 3RTAA 2VP3A 1P2SA 5JEEA 4M55A 5CT6A 4DSTA 3AJAA 3SF8B 3F96A 2NNWB 2OHIA 5KHLB 4PQEA 2XYVA 3ABOB 5IDYA 2ZJ7A 1K86A 3V7UA 1QZZA 3UKDA 2XRYA 3VO8A 5K9ZA 2HSWA 3K2EA 5FFMA 1YL6A 2NUAB 1R8SA 4JT9A 4FXOA 1EE1A 4U6QA 1EAYA 4G5OA 4DLVA 2Q1WA 3W5AA 3JWHA 2YIMA 1VJ5A 4JUCA 4C7XA 3WMRA 3BSYA 2X77A 5LQDA 3K20A 3FCOA 3RKRA 4EY8A 2JGMA 1SOUA 1IFXA 4NKRA 1T3HA 4RPLA 4KBGA 4WINA 5MF6A 1SUBA 1JMVA 2OR3A 5I7AA 3FKSA 2F1HA 2B2XA 4XOUA 3IQHX 4ND5A 5H83A 2CKMA 3JYHA 1KH1A 1ZAKA 3NPAA 5CYFA 4DQUA 4GP9A 3Q6MA 4TXLA 2QW8A 2ZSBA 2XT6A 2X9VA 3FAZA 3TNYA 1MC4A 2NADA 4WN3A 4FFPA 4FYIA 9LDTA 4I46A 4PG7A 4PF1A 4TWBA 2BEVA 3ZBQA 5EWJB 2CT8A 4BV2A 1NYLA 1BEUB 3LCMA 4A8JB 3AB3A 3IKMB 4CU5A 3D8NA 2JGEA 3BTVA 4WCFA 1GP2A 1IG0A 5AO9A 1KH3A 3FKQA 3DE5X 3G2MA 4U5XA 4YPFA 3SIRA 2WV7A 2Q5JA 1QUFA 3IS3A 3JD0A 2WD8A 1IY2A 3IGFA 3QWAA 4OOEA 2OB2A 3A26A 2NQ2C 3N75A 5IVHA 2BTEA 3KR9A 2Q3FA 3PXDA 4RF2A 1E60A 2I4MA 3GCDA 4FC7A 4YFVA 2XGJA 4YJFB 1T9ZA 5HEKA 3L8GA 4G9BA 4ARZB 4L6IA 5FI3A 2GKGA 5IDXA 3QVXA 4UHJA 2JFZA 1QH0A 3FDZA 4W99A 1PLJA 4DA4A 5ICCA 2ZT8A 4DL9A 3KR2A 2V3CC 5B1IA 4BNGA 4R0NA 1JQ3A 4EQ6B 1OI4A 4UBIA 1UKVY 2VAWA 4EHJA 1FFGA 1VLVA 4M0KA 4PTYA 1L4GA 5JCPA 4RD3A 3OIFA 1JLSA 2QZJA 2MOKA 4U2EA 5JAQA 1PS8A 1SUWA 1AO0A 2PAFA 2H06A 4OA5A 3BAZA 3KL4A 2R1VA 2Z1DA 2J9XB 1BZYA 1IEXA 2PMBA 5DLEA 2QTRA 1SELA 1SUEA 5CVJA 1ECCA 4CM8B 4E08A 1F9EA 2BJWA 4OLAA 1X7ZA 4U9IS 2Q8QA 3DDCA 1X1AA 1VE1A 3E8SA 1Q3HA 3PL5A 1E2LA 4O2AF 2Y0PA 3OKPA 3W2EA 2JA1A 1E1KA 2EDAA 3D8HA 3LZCA 1MJHA 1OBHA 2AN5A 1NHGA 4WJKB 1OX5A 1Z29A 4WESB 4IAOA 3OT1B 4G0UA 1GFWA 2WEKA 4NZZA 2NOAA 3ZGOA 1J8MF 5DXFA 1BG6A 4CKBB 4IWNA 4B82A 2OO5C 1N1GA 1OBVA 1XI2A 3TTYA 1QG0A 3CINA 3HE3A 3IVMA 5LC1A 1FFHA 5JANA 1L3IA 2VDMB 2P40A 2IU0A 4DBLE 4P8RA 2CVFA 3W5DA 4QEDA 1I13A 4ZCPA 2FKAA 1GA6A 4MULA 3HJFA 4GR5A 4M21A 3CZ4A 5BV1A 3RUEA 3O74A 1ADJA 3BA6A 4N5LA 4HX2A 4NE9A 3SDSA 4B2YA 5B7NA 1R9JA 7REQA 2OGSA 2OV8A 5HHTA 3NTLA 5EUCA 2Y77A 5IN5A 1CUUA 2BGLA 2X2EA 1J1UA 8MHTA 1MOZA 5F7ZA 3M3HA 1W581 2QY6A 3CVXA 3AK4A 4MVYA 2LXNA 3PXCX 4ZOLA 5JFGA 1OV4A 5JXGA 2ZUFA 4TL7A 1Z8NA 2RHWA 3K0FB 4G1CA 4BE7B 3AXSA 3CN9A 1LLUA 3OZBA 1Z7BA 1PEYA 2EW8A 2IPMA 2OP0A 1NWCA 3P2EA 3RSHA 5KI6A 3U09A 2EEPA 5FR1A 1UANA 1GAWA 1XTUA 2JI7A 3F5MA 4P4UA 2OCYC 5F7JA 1JIIA 1DAPA 1M2NA 4WERA 4FGWA 4RZ2A 1Z6XA 3SM9A 4QBGB 2BGRA 3T7DA 4LQDA 2ADMA 4ZTUB 1QM5A 3QELA 4L2IA 2YDXA 3G5LA 5BN3B 1HORA 1NZFA 2E2WA 5CLQA 3TSWA 3KE9A 2BCGY 3AX6A 1GTG1 2GJ9A 1DTWA 1NDHA 2O2ZA 3AERA 4MP6A 4AWBA 4BRWA 1CUZA 5TQ0A 4Z4EA 4GPTA 5HDBB 4F85A 4NCNA 4RK1A 2RGGA 3AP3A 4J2HA 1KI6B 2B4KA 3KBOA 2L18A 4IW3B 2AKYA 3ZTTA 5JRJA 2AOUB 2CB9A 3NWEA 2OCBA 1J97A 2QTTA 4UM9D 5CDFA 3WLLA 2XH8A 5HIKA 3QPCA 3BCRA 2WZCA 4MRMA 3S2IA 4DT1B 1VZ3A 3AKYA 2R5WA 3HYTA 3MK31 3QWHA 2V7BA 4DMFA 1G3QA 5EZSA 3SQXA 2J3EA 1FS5A 3I09A 5G3YA 3KHKA 2Z2IA 4U8GA 1I6MA 1HQDA 2UZ1A 1UAGA 4GR9A 1O6CA 2C4NA 2XI4A 3OQBA 4NZYA 4C7JA 1ZCFA 3O9VA 1U4NA 1CUCA 5JPCA 1AUVA 1EUYA 2RHLA 4BB6A 3F2VA 4E2FA 5FD8A 4HXFB 4XQGA 2REBA 2MSNA 3WYFA 1ZJWA 3ZWPA 2DHEA 4YIHA 4J29A 4EB6B 2BKVA 3LDUA 5LJLA 3VU0A 4DTCA 2FX2A 5EERA 5FEUA 4XIFA 3UH1A 1EX7A 2NUAA 3BQMB 4INAA 4MQ6A 4ZZ2A 4X1IA 1ISGA 4BNTA 3AOGA 3TW8A 4P3OA 2O8DB 1CUGA 3Q87B 5ES3A 1SMKA 1TVCA 1I4DD 1RAIA 1YI0A 3ZIAA 4JA2A 2GZ3A 5HYVA 2RI6A 4QECA 4MR7A 3B2NA 5AQEA 2NO5A 2GZAA 3BE8A 2BI7A 4WV3A 4RMNA 1YQDA 2HMWA 4QRDA 4AZ3B 5EP2A 5LBTA 1O94A 5CX1A 4YGXB 1XNQB 1IAVA 4KQWA 2IYAA 3H8WA 5HF8A 1JGTA 1EVIA 1TYEB 2QIPA 4ZAGA 2VHVA 3OIYA 2HB6A 4CXMA 3NYQA 3RJ9A 5I7RA 3AR2A 4IOJA 4QLAA 3A37A 3EVEA 3ES9A 1F6BA 5KTPA 1Z4LA 4UBLA 1GCOA 3P2IA 4DC9A 5KEIA 5I7VA 2P9FA 4PLGA 5H82A 2H2AA 1BEEA 3HDQA 3WP1B 1M5TA 3MM4A 3ZQ6A 1F7UA 4AMUA 5IUJC 1QTNA 2JLXA 4M0MA 4ZZIA 4ZZ0A 5J1SB 4R3UC 4N01A 3AJ9A 2ZIAA 2N1BA 3T3OA 4EPVA 4X1KA 2WILA 1B8VA 1JP7A 3PSHA 4QGSA 1W4BA 3QX7A 2XQGA 4GYKA 3PRKE 3NNSA 2NTEA 1T6YA 4JX9A 1U7WA 3SC6A 1TE2A 1KYQA 3NKFA 2V6IA 1FRNA 1N7IA 2ECQA 1Z13A 3Q3GE 5FUVA 3VDXA 1EUZA 3K5WA 3MOGA 3NM5A 3IUJA 5LQJA 3IA7A 4KMMA 3ZIUA 3DBHB 5BWNA 4G2NA 5DXAA 3R4CA 1QF6A 3EG9A 3T5CA 6YASA 4CF7A 2PX8A 2XNHA 1QZ3A 4QQRA 3D0OA 1NV9A 1AZTA 1DG3A 3BXZA 1MO4A 4N0DA 3S28A 2WAYA 3AC0A 3ZE8A 5GIOE 4AW9A 1L5KA 5EQJB 3NKVA 1K6JA 1PJ8A 4BMVA 2XJ4A 4II7A 4R68A 3OJOA 1CUFA 1P44A 1VMDA 5HTKA 1JALA 3A58B 4PXAA 2QV7A 3ERCA 5JIBA 2QENA 2WFLA 1Z7WA 3RSFA 3VPDA 1WBDA 3B70A 4D97A 1TQ6A 2W48A 2XB6A 5KWJA 3L0SA 3E3LA 2XMQA 1IRXA 1RYDA 1GQQA 1VRWA 3B1VA 2C2GA 1UPXA 5CG1A 5ICGA 3FVTA 1RXEA 2L2QA 4F3NA 4CWAA 2HRBA 5DCYA 4F6RB 4F4IA 2ZYSA 4JVOA 2LCQA 1QO0A 2GPAA 1GZDA 1XDWA 2G63A 2KW5A 3SHWA 3CO0S 5CNMA 1T1EA 1CRQA 2QRPA 2QZSA 1N25A 1E2MA 3DVLA 2Y1WA 3PFGA 5TS3A 1IB0A 4F2GA 1HQYE 1XA4A 2IIBA 3AEYA 3EZNA 4RH3A 3UMBA 4RZQA 3MWFA 3M2PA 1RZVA 1ZO8A 1N9ZA 1CRZA 4MIYA 1G2IA 1RPTA 4K6FA 4RVSA 4EL5A 5BNZA 1QFYA 2Z08A 4L3VA 1EVJA 2FKNA 4HAWA 1DXOA 4N40A 4PYOA 4PZYA 3O2QB 2G0AA 3TFQA 1L8LA 3DMFA 1Y5RA 4K2HA 3ZKWA 5I3CA 3DLIA 2OMKA 4Q3DA 1TI7A 3DQPA 1LRLA 3ANNA 4RD1A 3RBXA 1EFDN 4AQDA 2C03A 1K4MA 5ALYA 1ZGGA 5BN3A 3FOWA 5CEFA 4ZZ1A 1CUVA 4RF4A 3Q8XB 5K99A 4H60A 2J5QA 4DNQA 1U31A 1GITA 1CUIA 1EGVB 1VDZA 3RROA 3L06A 3NH9A 3OH8A 4LBVA 1KJQA 2WM3A 3X1DA 2VPQA 4QDZA 5CBPB 3LQ4A 1LDBA 2MR6A 1LPOA 5B53A 1G8JA 1QQTA 4IDCA 4BNXA 4CHGA 3Q3EA 4FMPA 1Z73A 3KFLA 4KBFA 3DE6X 3CSUA 2Y0DA 1XZ8A 3SS7X 4RVFA 1V7PC 1OSNA 2QVBA 3GJZA 2C2MA 3HFSA 3ON5A 5DWVA 2BZ1A 3VPBA 3W7VA 4KN9S 4KQHA 4XSVA 2AXPA 3T15A 4BU1A 3U7FB 1U2TA 2DKFA 1NVVR 3M81A 4WCFC 4YASA 4XPIB 1T2VA 3LO5A 3GDWA 2NXWA 1Z7EA 2ATIA 3L49A 4DUGD 4Q7QA 1JYSA 4YRFA 2EJBA 1NURA 3DZ8A 5AQ1A 2ASEA 1MHTA 2CBGA 5FX2A 5DNCA 2W0SA 4LJKA 4NU8X 3VMFA 2GN4A 1ULZA 2Q4OA 1B6TA 2H31A 2CLMB 2E1RA 3HRIA 1SXHA 4JMPA 1R00A 4R7ZA 3SEFA 3WRYA 1BGWA 2WV9A 4LY6A 5JBNA 5ALLA 4PLYA 2O8DA 5JS6A 1AZLA 1X2BA 3QEJA 1I1NA 4M89A 3ZDRA 4DA8A 1GNVA 1YOBA 5AI9A 2P6NA 3PVSA 4GZ6A 3TOXA 1JEYB 1X8LA 4UAUA 3CRVA 1YF3A 1Y6GA 2KB0A 3GFBA 2AR7A 1XTJA 1ZN7A 5DTRA 2VUTA 2YR0A 4P58A 4Y2SA 4A5OA 2HK9A 3F8TA 1MA3A 4XSHA 4FHEA 3CJQA 4BQIA 2VA8A 2ONJA 3RVKA 2O07A 3EZ6A 2H2HA 3M5WA 3IDSA 3HWRA 4ZPXA 2Q7DA 4K1XA 2VXBA 3ME5A 3OQOA 4B3DA 3RU3A 4YT2A 3R0QA 1Y63A 3M4ZA 2A6PA 3L77A 3OEED 3LW7A 3MTJA 3O95A 1TLTA 3U9TA 2FOIA 3EQ7A 4BJ5A 1HETA 1C7IA 1RRPA 2CLKB 4LHXA 3O8QA 4TT3A 2PJZA 3OPVA 4H3KB 3O1IC 2QM3A 3OVMA 3R5SA 3LDHA 3LUHA 1GIAA 3IUYA 3UJ8A 3UXYA 2GD6A 4B3GA 4L0QA 4NDAA 4LF6B 1YI1A 4HAIA 5JOQA 3IT3A 1R16A 1L4YA 2NXEA 3CF4G 2P30A 2CJWA 2BN4A 3QPDA 3R9XA 4LX8A 3PQEA 4M4SA 4DV5B 9MHTA 1Q1NA 4IDAA 1XVAA 2ZS9A 3GJ0A 1M2FA 3T1VA 5P8WA 4AL4A 2QQFA 3AR8A 5KTKA 1AKMA 5K3AA 1PZFA 1X86B 2CXOA 3U7EB 4EBBA 3HGQA 4JYPA 4R31A 1UJNA 1R6UA 1T91A 3AETB 4A2PA 4RPIA 1HRKA 1PFUA 1SXJD 1FX1A 3EIXA 3UNXA 2OEPA 1UKCA 1USVA 1XTQA 2R7AA 2ZIEA 1L4KA 1M8FA 3GFOA 1X8JA 2AG8A 2PBLA 3A4TA 3CO5A 4QJ5A 4M7RA 4UD6A 4AZWA 2GEKA 5A4FS 3CRMA 3UT5A 4CHTA 1KOGA 3TKLA 1E0JA 1HDIA 4IUBS 3V4FA 5IAGA 1EQ2A 1UKYA 4H1HA 4LOJA 1QV6A 3QI7A 4GMFA 3FFAA 4AF7A 3D3WB 1C9JA 5TQ2B 4BXOA 3ICEA 4J0EA 5HKOA 3ORYA 1P2BA 4NVRA 2BFEB 3FGPA 3QU7A 2Q4DA 2PE5A 4P33A 5I9BA 2HMTA 1C3LA 4GRAA 1QFJA 4G23A 2WMOB 3CTPA 4REQB 3GLUA 4DBVO 1E1RD 1NVBA 2FRXA 1M74A 3QXCA 2B5OA 3DT8A 2QORA 4LJYA 1BRMA 4GBJA 2WKWA 3OFNA 1ORIA 1MEJA 2QN2A 3DWGA 3JW8A 4JP1A 3W7AA 4B33A 2X1VA 2YVKA 1K27A 4Y6RA 1TCBA 3WLMA 5CVEA 3SMQA 1EVEA 2HXSA 3WB1A 1YRBA 4MR7B 1KAQA 2IRWA 2YYSA 4LA4A 3BDAA 3UHPA 4ND8B 3H2GA 3AY6A 3ICWA 5BW6B 3SZ3A 2WWYA 2AOTA 2XOKA 3GT7A 1DARA 3RC1A 1Q0TA 1LDYA 2NTJA 3MOSA 3K8QA 5IM5A 3VPXA 5IP5A 4EENA 2Y1LA 4HXGA 1QO0D 4KVZA 4OGGA 5L40A 4FDLA 5CYPA 2OOSA 1FBTA 3M9LA 1SVIA 2AEEA 4MTLA 4EARA 2IX3A 3ASUA 1AQLA 1YB6A 5DTQA 3WB0A 1ZRNA 3VKWA 3IV6A 5B1EA 4TQ9A 1XP8A 5DP2A 2JLBA 3DBRA 3NHWA 4N3CA 3NAZA 4K6HA 4AC9A 1YQEA 1P72A 1KRXA 5IT0A 3AIKA 1IUNA 3EEYA 3VOBA 4CLOB 4EM6A 3FFXA 5KAMA 1MAAA 4ZVUA 2EBWA 5FBLB 3SVZA 5UKDA 1GNQA 1ZIYA 2AX3A 2BBOA 1NLYA 1G3UA 3C5HA 1OA0A 2PUDA 2ID8A 1WVMA 1Y7PA 1P77A 2ZUSA 3DTTA 2QAIA 1VI5A 4YUAA 3EISA 2GBIA 4U2GA 3DHWC 4PPGA 1VB3A 4ADSG 2QTVB 3PF9A 3C5WP 4RVDA 3KOXA 5IJXA 2UXDB 2IEIA 1E7QA 4ZTZB 2BM1A 4KIUA 5TV2A 5M04A 4X95A 1UOEA 2IYTA 2P2ZA 2AKAB 4B3MB 2VYQA 4CE6A 5JI3E 4LF7B 1E3IA 4M0EA 1Z47A 1QRSA 4Q37A 2PUAA 1A1SA 1JJIA 1WCIB 1Y42X 2YFKA 3AHHA 3BAFA 3LU1A 4PAOA 3X1MA 4I1PA 3T3EA 4PBTA 5JH7A 3CX6A 4IIJB 4ID9A 4KFRA 3FMVA 5J3JA 2Z58A 2A7QA 3HRKA 3FVQA 4H16A 5H68A 1R6BX 1G6KA 1ZVKA 1RLMA 1V16A 2H1FA 2GYWA 1HT2E 2FEWB 2QTGA 3PITA 4K3UA 4W9NC 4WW0A 1MO2A 3V8BA 4BKRA 2A58A 2ZYRA 1D2CA 3T5MA 5JTUA 4Z7JA 2ZRFA 4IJ5A 3TLKA 1I7PA 2QLNA 1DBQA 1MT3A 4QYXA 4PFKA 1HE8B 5EWMB 1CHDA 3I37X 5GVRA 2ZVJA 1MCZA 5A9RA 4X63A 1KDYA 3IO5A 3TL3A 4ENUA 2FG7C 1QORA 4OYHA 1YRHA 1NXSA 3ESXA 3LF2A 3GDFA 1Z0UA 1MVNA 2BBTA 4FUQA 1BC5A 3H16A 1CPYA 3OU2A 5TARA 1L4EA 4FILA 4B87A 4DMGA 3IQWA 2W11A 4QPCA 3E6AA 1TZJA 2B1QA 2DSTA 4REOA 1AQNA 2NVBA 4GOKA 1E92A 4BXOB 2FB9A 1TJNA 4QNNA 4Z0HO 1X1BA 1KC3A 2JIPA 5GV7A 4E5MA 3HVRA 4I50A 3LP5A 1CRLA 1QK3A 4HZGA 3NTQA 2CC2A 2Q6OA 5DYNA 1C3JA 3U7QB 3I34X 5TIIA 1R4MA 5KNDH 4TLCA 1GGHA 3CCBA 2F8SA 4GZ3A 1RJWA 1N6HA 3C3YA 2E4ZA 2YIDA 4ARZA 1OB2A 5JUWA 1FL9A 4GLJA 3WRWA 4WVFA 3D7SA 2IXGA 3PNMA 4H6PA 4N5DA 2OMEA 4TN1A 5A06A 1PNVA 1YAJA 2VI5A 3EIQA 5JSQA 2Q1XA 1L7NA 2GPYA 3FYDA 1DE0A 1R2QA 3IKVA 3R8CA 1CSEE 3ZUPA 1X70A 3PVZA 3BX1A 5DCWA 3LYUA 4YMWA 4BRUA 1O54A 1EE9A 3P4UA 2LIVA 3PKZA 4AZSA 2WKRA 4D41A 1OBFO 1UPCA 5JCJA 2XWPA 5DSXA 1X7ZB 1G5HA 1XRQA 1TD1A 2BFDA 2JFYA 2RHRA 2ZTHA 3FUWA 3K0EA 4HL6A 4MTCA 3VDRA 4MYSA 3ZKAA 2H1WA 1YBMA 4UTPA 2QF7A 4C9BA 2JB9A 1XA3A 2FFBA 3LPMA 3QWFA 5E1MA 5F9FA 2NV2B 5IN4A 4IS3A 4A5SA 2WLSA 3P2OA 1AKVA 4XB1A 1RQXA 2WG0A 1A5SB 3HBNA 4RZIA 2AK3A 3BWXA 4UXIA 1QHHB 2ZB8A 1IXKA 3VR3A 6NULA 2YXPX 4PYNA 2PRIA 2ACVA 4FUTA 2XYGA 4K6OA 1QHGA 2R8YA 4KE9A 4MV5A 1II8B 4YP7A 1K6MA 5BO5A 3GLGA 2QYTA 4CMEA 1NOKA 2HMUA 2PG3A 1BKDR 1GSIA 5ALSA 4BQEA 4DW8A 4IXDA 5BN1A 1A1VA 3C97A 4WK0B 4LDNA 1PE0A 1I2ZA 5AW0A 3HU1A 2Q45A 2P78A 3JZFA 3RYCA 2FV8A 3BZUA 3C6YA 1T3LA 1N2JA 3N87A 4NBLA 4RIFA 1HRDA 2H29A 2M6RA 1Q7RA 2GM5A 2QLBA 1VIVA 1XD8A 4G4SO 4QUGA 5CGZA 8ABPA 1E2DA 3RDPA 3ADKA 3BICA 3ODPA 3RYIB 2PGLA 4DJDC 1M54A 1VBFA 1JDPA 2NSJA 1UF9A 3IB6A 2ONZA 3KOWA 4LSGA 4BVAA 4BV9A 1QIGA 4HGYA 3V9PA 1G4HA 1EH5A 1FB5A 4XWYA 1E18A 1TB4A 1H0HA 3BRWA 1CUXA 4J0JA 2IPAB 1P8JA 3AP2A 3GEDA 5JFTA 3ZCXA 1R3DA 1VFNA 1LVHA 3LDFA 3K0KA 3WOVA 2BGNA 3AEZA 1E4VA 2HSZA 5DLDA 3W8DA 3K8ZA 2VATA 2DPYA 1GPUA 4OUKX 4F06A 4LHZA 5I48A 4NULA 5K0SA 2BMVA 3NT5A 4NMLA 1P5RA 2DWQA 2OWEA 2PGNA 3OG9A 4O0LA 3MT9A 4RKEA 3LLSA 3VSDA 1Z5WA 3V97A 2UUCB 1FMTA 2FA9A 1BD4A 2AIRA 3FMGA 2N75A 1KI1A 3A10A 2HJGA 2ESRA 1WMAA 3A0UA 1TC1A 3NLLA 1AHHA 1WD5A 1YRQA 1PYOA 1EFRA 3DW3X 3FCXA 3GLTA 1T8SA 3A4VA 3D0QA 2BD0A 3BXFA 3O75A 3TZHA 3WK4A 4BO4A 1O2DA 5BP7A 3D6JA 4H0CA 1P33A 4KAAA 4ZRDA 4A23A 3BK2A 1U1IA 2C77A 2WR8A 3DZGA 3LY7A 4NQRA 4MPRA 4ER6A 4MB6A 2FZKA 1A9QA 4ZN6A 4IXMA 1J0DA 2Z6QA 4E5KA 4LDPA 2J0VA 3OLCX 1L4MA 1IBKB 2OLKA 2F8TA 4OH1A 3KTFA 1OZAA 2W6ZA 3UPDA 4HR7A 3HJNA 5AT1A 4Z3OA 3DBVO 4RKWA 5TDHA 1W0KD 4ZVLA 4I55A 2FUNB 4PCAA 1T1IA 4QTTB 5ERXA 2I3BA 2IH5A 4KPYA 3I39X 4C3ZA 3JYNA 1F5SA 2AQKA 3WX0A 5JNTA 2HQOA 3NJ4A 3JTMA 4CUJA 4MV8A 3SYTA 2JGNA 4JJGA 1KDZA 2I66A 2Q07A 3COJA 3DWEX 4KIJA 1WZCA 4D98A 5F73A 4GRDA 5E6SB 4AJPA 4LRQA 1ULUA 2JIZA 2I4TA 1SXJE 2C04A 3L0ZA 4JL5A 4MB0A 4PO8A 2C7PA 3ADOA 3A2KA 4US2R 3G8DA 2ZYAA 3HS3A 5DTJA 2YDYA 4OQXA 1KQOA 3KLNA 1K88A 2XTZA 4DILA 5F5LA 5JT1A 1N5MA 1KARA 3N0TA 5SV2A 1IC6A 3FH0A 2O3SA 2YZ2A 1O87A 1U0JA 4LOAA 4XKJA 3VFDA 3QSYA 4F3TA 1XTKA 4HH4A 3K70D 2E3JA 2FOLA 4RTLA 3HA7A 1ULAA 2IP1A 3QV2A 2OD7A 1M2GA 1PT5A 2PLNA 2RDMA 2RKWA 5LB4A 1NN5A 4QHYA 4HUTA 3VYUB 4FGJA 2I6FA 3NAGA 2HX1A 3BF7A 4YV1A 5B7GA 1E6EA 3EODA 1L9XA 5FP0A 2GESA 4BNNA 1Q21A 1RU3A 4BZPA 3C7CB 1R6VA 4CF6A 2I62A 4YRQA 4NESA 1JH9A 5HSGA 1Z0DA 4EA8A 5KQPA 2ODWA 3SZMA 3FWKA 2Q21A 2TECE 4HPXB 3U31A 3WQSB 2YV1A 2QTNA 4F21A 3SFTA 2NO9A 4R8KA 1IXRC 3R7DA 1KOFA 1H6AA 3P9CA 2FPLA 4FFLA 3Q7QA 5ER9A 3WRXC 4M1ZA 4RPCA 5EIWA 4GPBA 3IKJA 1MOSA 5AKEA 1UMKA 3VHRA 1RPNA 3DVRX 2R11A 4PYKA 4ESVA 1FUKA 1EG7A 4R05A 3IVRA 2P9CA 2J9ZB 3UN1A 2REQA 3HJGA 2C8KA 4D8VA 4QLBA 2Y6UA 3PXXA 3JAWA 5TQJA 3RUAA 4AECA 4K86A 3WK7A 2Y8EA 5DDIP 4OHYA 1LPMA 5I9TA 3SU8A 4ZEXA 2YS6A 3NBMA 5AJHA 2PXXA 5ITZB 1SBHA 4IILA 1N6NA 3UWMA 2QGFA 5C5CA 5GADl 4WNAB 4GXRA 3RODA 4FW8A 4C08A 1DMRA 2CKDA 4PGFA 1G3RA 1Z5PA 2C3YA 3Q0IA 4IHJB 4XQ0A 5CB6A 3WGGA 2GOYA 3DSRA 4WK4B 2IUSA 4DR3B 2OORC 2C9OA 1S3GA 4KXLA 5KTSA 1NPTO 2XY4A 1QLHA 4MV6A 4MVCA 3QU2A 4ZZ3A 1Q7EA 2GRJA 1BOOA 2QX4A 1OU4A 1WDKA 4YREA 1J2EA 1ZG3A 2NN3C 4KJZA 4CQMB 1WLSA 1LK0A 1P2TA 2ZJ1A 4DLRA 5JAOA 4YHHB 2CXUA 3AB7A 3HWX1 3E2PA 4ND1A 3NORA 3KOOA 3BIXA 1DFHA 2C2XA 1GZSA 3QG5A 2PXHA 3C8DA 3ESQA 3NJRA 4G0YA 4JP8A 4DDHA 3BFVA 5FOSA 3SF0A 5AH0A 5DBIA 1S8FA 4MJ7A 3HUDA 3EA0A 1KFEB 4RY2A 2XQJA 2G9UA 1ONPA 2XCTB 3TUIC 1AMUA 4JVNA 3I45A 2QRNA 3J7TA 4L51A 5BSUA 2B4QA 1SUDA 1ZMXA 2BMWA 3CR7A 5DULA 2QTFA 3HCNA 2PSJA 4FMCB 3S1LA 3SLGA 1D03A 1NLFA 1TZBA 3P0FA 4LSWA 4B6GA 1GPAA 3TSYA 2DEUA 5JJLA 3ZVLA 4L72A 2X4LA 4HSGA 4BLTA 3IP6A 4MWTA 4KSCA 5FPYA 3HFJA 3GFGA 3ZJYA 4JNKA 2ZPUA 3CUUA 3FNQA 4I7EA 4UVIA 5FFNA 2ZRKA 3VSBA 3VZDA 5KWSA 3OSZA 2CXPA 5DK4A 2Z5FA 4P7KA 4TMZA 2PKYX 1MJGA 1W76A 1KZ4A 4N39A 4ENRA 2CXTA 1KPIA 1WCV1 2BCJQ 2AC7A 2ERYA 1KFJB 3AUFA 3D0KA 1R10A 3RVQA 4BLQA 5CA1B 1SEPA 4G09A 4B7AA 3GLFB 4RFLA 1MC5A 1L3CA 2ENUA 2KBEA 2ZT5A 3DV9A 1FXSA 1KERA 3CIOA 4E0BA 5LIPA 5GZ1A 5FLEX 5KVSA 3LBYA 1Y3HA 3EARA 4J2TA 1GCGA 1MXHA 1ZNZA 3A3PA 4C01A 1NN0A 1PQYA 2HI0A 2PH1A 4HUJA 3A1DA 4JSRA 3HDGA 3K1ZA 1AA9A 1UM9B 4PTLA 4V24A 1FCJA 1Q2XA 2R3SA 4CG3A 2HRCA 1WPRA 2YHIB 4R1PA 4A6DA 5IT9A 4QPDA 4WFJA 3CX7A 1U3VA 4M60A 3ZCUA 1WCWA 2O8EB 3L8EA 1Q0UA 2RK3A 2DX7A 1FQKA 3AERB 3N0XA 1KO7A 2EVWX 3NAQA 4D9JA 4TKVA 1IBMB 1U4OA 3ZK7A 2IL1A 3HZHA 4RE6A 3Q3HA 3E5RA 4HLUC 1PJSA 3WNBA 3IVAA 5LXTA 3YASA 1IL0A 3G02A 3R5FA 3W9YA 4OYRA 3L7NA 1VCMA 2OYRA 3B60A 5E6SA 4ZI5A 5BUQA 2J59A 4LY0A 2Y1DA 5GGXA 5MN4A 3CVWA 1ECLA 3LPDA 4P82A 2XIJA 4P32A 4RCYA 3UG7A 3I5XA 1D1TA 4UZSA 5EHZA 3KKLA 3ZE2B 5AKKA 3QE3A 3G7NA 3G89A 1EVLA 3PU6A 1S7GA 1DL5A 2R00A 3OCZA 1S3SA 5AKIA 4FZVA 3MINB 1NW7A 1C1DA 1SUPA 3MTQA 3U48A 1S8OA 3PDHA 4MW1A 2XV1A 3FPCA 4RVHA 1SKYB 2PS1A 2QLTA 3BD9A 4DWJA 1V16B 4Q1VA 4Q9KA 3N8KA 2HBYA 1XZBA 2BC9A 2O6HA 3HJUA 1C9KA 4DCOA 4QOHA 1YA6A 1J4AA 4IX1A 2HPAA 2Q62A 3S70A 2PWZA 1NUUA 1SZPA 3ND5A 4YDHB 2J7KA 3GEMA 1FYFA 3AM4A 3HXQA 1T4DA 2GDJA 3AF3A 4EB6A 1MKYA 4AKTA 2DTXA 3PNYA 1JHDA 1P18A 1R50A 2ZIVB 5BW5A 2O8CB 2HYIC 4ZREA 1EFPB 1YGYA 3L46A 4C3UA 3D3JA 2A9QA 1QHFA 2HA4A 4D9NA 1HL3A 1XTVA 5T4EA 5A4JA 4J3JA 4RETA 4O2AA 4WESA 2CHFA 2Q28A 2GWRA 3DQZA 3IP1A 3MS2A 1GGJA 3ABQB 3WR5A 3MIIA 4Q05A 4HP8A 1CD5A 4Z4GA 5CVDA 1BW9B 4RK7A 5BSTA 4IH1A 5FPSA 3RWMB 2AL7A 3CLTD 4YR9A 1OFTA 4JP3A 1FTGA 5KJ1A 4BU0A 3DJYA 4UBMA 4BWGA 3LI2A 4BX2A 4DIEA 1SVLA 2E21A 4UM9B 4IV5A 2J31A 1E4EA 2D13A 4PC1A 3B3QA 5DW0A 1E9DA 1NW5A 2A86A 4C4YA 5BNIA 2PUGA 3KLPX 2HU5A 1L5VA 2VZLA 3FFTA 3V42A 5BSWA 3I61A 2PMFA 4KVFA 4YHBA 4I1SA 3URKA 4D3YA 3RF6A 1RMTA 1VKOA 2WJVA 3KT8A 1X7GA 3AO0B 4R0MA 4JJ8A 1NUHA 4H3VA 3RYIA 1ZNWA 2NWQA 2IU3A 3GLHE 5AVXA 1KSFX 5DIZA 3U4GA 5FWNA 1TTPB 3K0CC 2NO4A 3IPYA 2ACWA 4RD0A 4F60A 2PS9A 4UNSA 2HF7A 1Y9EA 1Z28A 5AHRA 2AOTB 4IINA 3CLUC 4K8RB 4AZ0B 2C97A 2H07A 2JGJA 1X38A 2Q5EA 3A9RA 4ZK2A 2PGJA 3B5JA 2F1JA 4R2LA 4FX5A 4WFIA 5DMXA 3USES 4Y0AA 3I52A 1WE2A 5FUYA 5F7OA 5ENVA 2X42A 2MSEB 4Q4JA 3TAHA 3ZWAA 4ZO6A 4HV4A 4DS3A 4EUEA 3M6WA 4EKGA 5K3EA 1IMJA 2JJMA 1NMXA 1EWVA 3V34A 3C7TA 3T7SA 3UJ3X 2CJFA 4DCMA 2ZE8A 4UEOA 4F71A 1FFXB 4YJ2A 1DAGA 1FJ2A 4Z54A 1KR5A 2BMDA 2R60A 1FFYA 1B41A 1Q44A 3TSAA 1LBSA 3T1YB 3CF6R 2P3LA 3G88A 4RH1A 1Z0FA 3J81k 1C5KA 5HQ3A 5EXXA 3M82A 2HF2A 5EWLA 1WF3A 2PL9A 4ILEA 4ISBA 2QU7A 5DHPA 1SO8A 2D8MA 4GKVA 3EASA 4HWKA 5EKDA 3R75A 2B0CA 3UMJA 2QD1A 4F45A 1H4SA 2YY5A 5FL7D 1NM5C 3JASB 4OF4A 1ZM4A 3EVFA 4JT8A 5HCNA 3W05A 3HJBA 1AGRA 1XB2A 1J00A 2B30A 3AEQB 3BDVA 3I72A 3SGLA 2FG6C 3Q2IA 2EJVA 2N42A 1VKRA 3KEMA 1FDWA 2MCFA 3WQHA 4F2DA 5KTRA 5JSHA 3GT4A 4LZAA 1ZD3A 5K6AC 2WU0A 2XXAB 2BUAA 2BFBB 2XZOA 1JR6A 4OUDB 2WWTA 3DEIA 4EHNA 1S01A 2QP9X 5BT9A 3FDIA 4XX1A 5JYBA 1RPAA 4BFCA 1PR5A 3L9XA 3QVGB 1NUTA 2VF5X 4D5GA 3GARA 1E4OA 1CFZA 1V1MB 2CE2X 1OBCA 1QRDA 5IJAA 1TOAA 2XHZA 3K9BA 2O19A 5LCXA 3E22B 4IOKA 4XTCS 2WMYA 4D79A 1VL6A 1FA9A 4HFNA 1HE2A 1XXHE 2ATCA 2LNDA 4QXAA 2IFTA 1P91A 2WIJA 3ZDXB 3ZWVA 9ATCA 4Z5XA 3IBCA 4H59A 4M87A 3WV4A 1FU4A 1A9XB 1H1LA 1N3LA 1TL7C 2BISA 1CZLA 2V45A 3B8EA 1ZP6A 3IALA 3SN6A 4RFVA 3RC3A 3SC4A 2OK8A 3AKDA 4B46A 4BJ1A 4D02A 2D2EA 2OBNA 1OROA 3LNTA 1JXAA 3KQKA 4MMZB 3PQCA 3DLBA 2WG1A 5KYXB 3LT4A 1IUOA 2B8EA 3F6RA 3TEFA 3LP6A 4OYLA 3KLBA 5TNXA 4NBNA 3TIVA 3CUYA 1JHRA 2OFXA 1CRPA 5CUQA 3NBXX 1M7BA 4ALMA 3KYDB 1GG9A 3FCUB 3ZI4A 5IASA 2C9DA 3IIEA 1H8ED 2YHIA 5FUMA 3H11B 2XUJA 4Z1OA 4KQ9A 3RR2A 3ZWQA 2GBPA 1RI2A 4OOFA 4MQBA 4PLZA 3RC2A 4L07A 4F3CA 3G8AA 5LZ7A 1CKEA 1C0KA 4RSRA 3SJBA 3WL4A 1J7JA 1NBIA 3KKZA 3BCUA 3TEJA 4B3CA 1AF7A 3QFHA 5BQFA 3L6CA 1ZJ5A 1OGYA 2JFUA 4EELA 2ZUEA 2O8BB 4Z4IA 2G9QA 1X13A 3TBFA 3QUSA 3U3OA 3CGGA 3CVUA 4B2IA 4NZMA 4HNSA 1EEHA 3SC2B 1ORRA 4INZA 4NFHA 2Y1KA 2R5FA 1SD1A 1T3ZA 3MWDB 4KQKA 3UWKA 4BFLA 5EMHA 1PSZA 1XTBA 3ZXXA 2VHTA 1W8IA 3G6WA 5E9WA 1N77A 2BKEA 2H2DA 1J9EA 4M83A 1EP1B 4C4RA 1L1FA 1EXNA 3RTBA 1W93A 4CIYA 1PL8A 2V3VA 1HE4A 4MO9A 1CUEA 1F06A 1PWZA 3EQ2A 4ARAA 2HA6A 5EQTA 1WG8A 4S0XA 3OZDA 4FYYA 2BGMA 3OKCA 4Z49A 2QR2A 4Y2VA 2OXTA 3ADBA 5C3MA 4DIBA 4J9UE 3Q3JB 3G49A 4WXMA 1C2YA 4QPPA 2V0GA 1PGNA 1Y7LA 2NT3A 3H9EO 2ONCA 3GL9A 4PYRA 3KT3A 4V3BA 4BFZA 2FN8A 2GS9A 3JARB 3QOXA 4B81A 1EFPA 4RKRA 2YY7A 3OZCA 3RRXA 4I6JA 1HDYA 1PX2A 2JIZD 5CTAA 5E6UA 3E9EA 3EHEA 2FR0A 4HDCA 4LTMA 2HLDA 1SU4A 3DAFA 1LPNA 3HB1A 4M9ZA 4BMYA 1TA9A 3DTNA 1KYYA 4BE9A 4UHCA 2HBZA 4G25A 4HB3A 3W0LB 4C21A 2BLLA 2H4JA 1XDUA 3IP8A 3BIJA 4PWZA 1Q7CA 2ZETA 4Z7OB 4OJYA 5L45A 3KXDA 1ISMA 3OPMA 5F1OA 2O8EA 4L08A 4MV4A 2G3YA 2JFPA 1AKYA 4XWTA 1AK2A 3LX6A 3K16A 1J2YA 4FLFA 2YZNA 4EJSA 4K9MA 3DM9B 2P4SA 5AVKA 4DCCA 1LQUA 2OV3A 2X1MA 1D2RA 1TT7A 3EXIA 5E8JA 3T06B 2DG2A 5CAEA 4PYJA 2HH9A 2PZLA 1K5DA 5C4IA 1QHEA 3I1IA 4AG3A 4NZNA 4YRDA 1PU2A 3RC9A 5ITZA 1XV5A 4ZYVA 1EJ2A 2IYZA 2VS1A 3KQWA 4JJKA 5BQXA 4R1NA 2BKLA 4QDKA 1O94C 2LV8A 1M7HA 3ORSA 2ODQA 4F9FA 4ZIRB 1F3LA 3H1PA 4JSYA 3REGA 2JK1A 3O93A 2XVMA 3F7OA 4FMBB 4JXXA 1K6XA 1PV2A 2J0UA 5B58T 4C4PA 4OBWA 4DNFA 3U4QA 3FI9A 4B3IA