1IUNA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
ANLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords meta-Cleavage product hydrolase
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iunA00
5DNVA 2HA2A 4BCCA 5BV7A 4OB8A 4AO8A 2WUFA 1CUHA 1QFMA 4L72A 3EF3A 4BC0A 4TPKA 5A71A 1Y7HA 2XUDA 1PFQA 4WY5A 5KBYA 4INZA 3WKDA 4YASA 3PE6A 4EB0A 1Q0RA 4NVRA 5JZ9A 2C0QA 4P08A 5ALDA 4DSZA 3QMWA 3QH4A 2Q0XA 3WIBA 1QTIA 3HSSA 4Y2JA 3RLIA 3ZLVA 1UXOA 1QO7A 5JALA 1KU0A 1W1IA 3R3UA 1WPRA 3WKAA 2OGZA 4LIPD 4MYSA 1VLQA 1QOZA 1VZ3A 1D07A 1R88A 2XUOA 3DKKA 3I2JA 1LGYA 1WCYA 5A6VA 4U2DA 3DYVA 1QZ3A 1XFDA 5EHQA 3G02A 1ISPA 3WWOA 4X95A 1R4ZA 4G8DA 3HYSA 4PNZA 4DLNA 2AJBA 2PX6A 2JEZA 4M0MA 2BGRA 2VJCA 4W63A 4Y9SA 3DYIA 3M81A 2G5PA 1C4XA 1QIIA 5SYMA 3WYDA 1GT6A 3S8YA 1XRNA 2AJ8A 5LZ2A 4HS9A 5JADA 3NOXA 5AM3A 2ZYIA 4B9EA 3WL6A 3DJYA 2VTVA 3RKSA 5JYCA 5AKKA 1FFBA 1XZAA 2VT7A 5BWBA 1HL7A 4X97A 2BKLA 5FUMA 2HRQA 3NWOA 2XQKA 2WHPA 1VXRA 1MU0A 3IBTA 1YCDA 2QVBA 3E1GA 1AX9A 2OXEA 4X7BA 1ACJA 1CUUA 3IIIA 4P92A 1CUYA 2HRRA 1CR6A 5AK5A 4DNPA 5ALIA 4C01A 5CT9A 5ALNA 3WL8A 4U2EA 2GBFA 5JAHA 3G9TA 5ALXA 5A7HA 2ZSIA 4X85A 2O2IA 2J4CA 4HXGA 1FFCA 3T52A 4HAIA 3I2FA 1AZWA 1ZICA 4UBKA 2XMZA 1JJFA 3H1BA 3N2ZB 3DOHA 3C87A 5AM5A 4EA6A 4QDTA 4M0FA 2XQGA 3BL8A 4O08A 1A8UA 3D4LA 4QDZA 1ZJ5A 1HQDA 4RE6A 4UHHA 5AM0A 3VKFA 3HI4A 5FOQA 2OCGA 1OILA 4CG1A 5HKBA 3ESCA 1ZIYA 2OCIA 2XMCA 2XUJA 4GBGA 2QUBA 2RHWA 3L1HA 5JD6A 5CW2A 1ZJ4A 4N5HX 3AIOA 4ZREA 3EQ9A 1XZFA 4AQDA 1FFAA 3KXPA 4KAAA 2VQ6A 1I6WA 3GFFA 1EA5A 3HLKA 4X6XA 2QTBA 1DWPA 1LLFA 3FAKA 4MQMA 4UHBA 3QZUA 1FSSA 5CT8A 3STUA 3PFBA 1E66A 2XMDA 1JKMA 3STTA 4IH1A 3O4HA 4CG3A 5DJ5A 2WIGA 1JMYA 1IVYA 1USWA 4JH0A 1EDBA 4C6HA 5ISMA 3O9VA 2CKMA 1AQLA 1MJ5A 2GBGA 2HA7A 1XZCA 2JGFA 2WLSA 1CUCA 3H04A 2W22A 4HXEB 1CQWA 3WJ2A 4H7HA 1TRHA 4BVKA 5ALQA 5DTJA 5AI4A 2XMBA 3I1YA 4H0CA 1W6RA 1UWCA 1CUFA 1P0QA 4KAFA 1QIHA 3BF8A 1CUSA 5DLPA 3H18A 2OCKA 1BRTA 1Z68A 4MQLA 4BRSA 3Q8WA 4A16A 2BUCA 2PM8A 4B0OA 2O2GA 3GUUA 5AIAA 3OM8A 1EXWA 5D3KA 1H2YA 1QFSA 5AKXA 2PSEA 4QDUA 4G9EA 4IHAA 3H2IA 5ALOA 5F4ZA 5AK3A 4WFIA 5AP9A 3C6ZA 3DL7A 1LNSA 2Z3WA 1BN6A 2GYVA 4W9RA 1WB6A 2OLEA 4EY5A 1N1MA 2C0PA 5AK6A 5C8VA 3CCBA 1XQVA 4OSEA 3AUKA 1VA4A 4C4XA 1AMNA 1JJIA 1XQXA 3VJMA 1K4YA 1K6EA 2XMGA 5JD5A 1HLGA 1H22A 5ALGA 4E15A 2WFLB 1BCRA 1KEZA 1TQHA 3C45A 5FP0A 5AK4A 2Z8ZA 5K3DA 5DYWA 4FTWA 1F8UA 1DWQA 2OAEA 5LLSA 4K5QA 2WIKA 1XZGA 1GQRA 1R1DA 1J1IA 1UK6A 1WPXA 2R11A 3OC0A 2CUTA 4DIUA 1TCCA 4OYYA 3S2ZA 3ILSA 1F0NA 4EZIA 4M0EA 5EIEA 2XUQA 3WQHA 2DHEA 4DNFA 5YASA 3X3HA 4BCDA 4HRYA 4KJXA 4FWBA 1CUZA 1ZI9A 3F67A 2GZSA 2HU5A 4X00A 1K8QA 4J0KA 4UFOA 1W52X 1J07A 2QMQA 3IUQA 3FYUC 3M3DA 4NZZA 2W6CX 2ZJ6A 4QEKA 2WIFA 1O6GA 1T2NA 3HJUA 1HKHA 1UFOA 2JGKA 2C5GA 2WHQA 4OB7A 5CH3A 2WU4A 1GPLA 1RYYA 2ZSHA 4UFPA 4QLOA 3EBLA 4JYPA 2DFPA 2WIJA 1A8QA 2FJPA 4QE3A 5EGNA 1XLWA 4Q3KA 1EVEA 4BVLA 5IVHA 1R9MA 4MWSA 2JBWA 4ZWNA 3SX4A 3L1JA 3KOOA 2X8BA 2J3DA 4BAGA 3BF7A 1VKHA 1K5PA 1N5MA 5K3FB 3C5WP 3R3WA 1N8SA 5AKYA 3H1AA 1H2WA 4X6UA 2ZYSA 5JAOA 1LBSA 4UHDA 1L7QA 4ZXFA 3OOSA 1CIJA 4BP9A 3W9UA 3ZLUA 1GZ7A 3B5EA 2V97A 4GWLA 3BE8A 5CMLA 2J4FA 4JYMA 4BC1A 4E46A 4W1RA 5E4TA 5IKXA 4F60A 3V48A 3D0KA 4Y2RA 1MT3A 4B83A 2AJDA 2O2HA 2VSQA 4IH9A 3F9CA 1IMJA 1CRLA 3C8DA 1MNQA 4E14A 5LZ9A 3NUZA 4BTVA 2GYUA 1XZMA 1UK7A 3WMRA 1SCIA 1ORVA 1J2EA 5ALSA 4CCWA 4KRXA 1QLWA 4E11A 4KE6A 2QXUA 2JGIA 1LPBB 4G8CA 5ALTA 1YA8A 3QITA 3CN9A 4UUQA 2QT9A 2XMSA 3R40A 3LLCA 4H7JA 5AKLA 5LZ4A 2EEPA 3WWCA 1TK3A 1KU6A 1LPMA 1F6WA 2DQYA 1XZEA 1LPNA 3H0CA 3O95A 1WM1A 3A6ZA 3QPCA 1SFRA 3IUNA 3G9UA 4OB6A 4DMKA 4F21A 1XRMA 4PSUA 1XZIA 4EBBA 4C88A 3E0XA 4HXFB 2WFZA 4AZ3A 5ALEA 3BDVA 3DKRA 1EDDA 3BXPA 5KREA 4MEAA 1BS9A 1EH5A 5JARA 1ACLA 1SCQA 5T4EA 2PSDA 1WHSA 4J7AA 4ZI5A 5FPQA 3WWEA 4P93A 4GXNA 3UUEA 3DEAA 1EB8A 4UPDA 5EFZA 2QRUA 4Y2YA 2ACEA 2VJBA 3I28A 3K2IA 2Z8XA 2GBCA 3WKEA 3HABA 4WDRA 2RHTA 2QS9A 5JZSA 4B7ZA 2IIVA 2PVSA 3R3XA 5EIHA 4CCYB 2OG1A 5HF8A 1DINA 2CJPA 3K6KA 3ANTA 4CCYA 1Y7IA 1H2ZA 1EINA 5IVIA 1YASA 4DSAA 4AO6A 2XB6A 3WKCA 4LXIA 1AUOA 2OGSA 4EY8A 1WHTA 4DM7A 1E3QA 5A7FA 5JASA 2RAUA 1YR2A 1AKNA 5CT6A 5AIBA 3A2NA 4CFSA 4C4YA 2O7RA 1GPNA 3IDAA 5ESRA 3G0CA 4WJLA 1IZ8A 3K9BA 4I19A 4AX4A 1ZD3A 1H23A 3PUIA 4OD0A 1DQYA 1BEZA 3PDCA 1CVLA 1JFRA 4D9JA 1ZD4A 2HFKA 2XUHA 4Y2TA 4PV7A 3BIXA 2C58A 4KAJA 1QIKA 3C6XA 2B9VA 4X92A 5ALPA 2GBIA 1YS1X 1DWOA 4N8EA 5D6OA 5CRIA 1IUOA 1PJAA 4BATA 4X90A 3STXA 2NW6A 1VA5A 5AM4A 1DT5A 1G42A 3ZI7A 1HDEA 1YB6A 4HVTA 1PV1A 2DQZA 4XWGA 5DYTA 1N5RA 5JANA 2E3JA 3MGAA 1CEXA 4GEGA 5HZGA 5I9IA 3G0IA 2ZJ7A 3JYHA 1ZGBA 1XRPA 1XZBA 5E4JA 3LIIA 2R8BA 2RI6A 4AMYA 5AOBA 5EHXA 3LS2A 5JD4A 3DQZA 4C87A 5HCUA 4MEBA 5LKAA 3ED1A 4UBMA 1ETHA 3JW8A 3C6YA 5ALVA 3FBWA 1TKRA 1LZLA 4FLFA 3WWPA 5AO9A 1BU8A 5J3JA 1LBTA 3DLTA 1LZKA 2X76A 3WK7A 1TIBA 1TCAA 2AXEA 5CT5A 4OPMA 4PW0A 5BOVA 4OCZA 2PKYX 2XLCA 4RPCA 1BCSA 3TGLA 2LIPA 5ALKA 4I3FA 4UBOA 4PSCA 2DHDA 3TRDA 4TGLA 3G8YA 3WK6A 1L7AA 2IITA 3DS8A 3SWWA 2G63A 1FJ2A 4CIAA 1XLVA 4BBZA 2I78A 4GDMA 2WG2A 4UBIA 3UUFA 4TVKA 4B80A 1LPSA 3F96A 2CMFA 4KE8A 1AGYA 1MPXA 3MUOA 3D3NA 3QPAA 4H7DA 2HU7A 2HHAA 3N0TA 1JMKC 1XRRA 1EI9A 4HZGA 1QIGA 2BFNA 4DNOA 5K5EA 3I6ZA 5DWDA 4CIBA 3FCXA 1UK9A 1EK2A 1EX9A 3U0VA 3WZLA 3DL4A 2PBLA 2ZYHA 5AKJA 2EDAA 4MXDA 3F97A 3IB3A 1T4MA 3BJMA 3D2AA 5ALFA 3OURA 4Y2QA 5AKZA 4BYMA 2XUPA 4MWTA 2H7CA 3GA7A 5HF9A 3AFIA 5FRDA 3WLAA 2JEYA 3A70A 4WFJA 5ALYA 5H3HA 4ROTA 1P0MA 4QZVA 3C70A 5LYYA 4LYEA 3WL5A 1R9NA 3SK0A 3M82A 1DX6A 1GPKA 2HU8A 2OCLA 1GGVA 5CURA 1MX9A 2QR5A 3IURA 2OQIA 2PSJA 1MAAA 1Q83A 3FSGD 4UHEA 2WKWA 4BCBA 3KD2A 2GZRA 2V96A 2I3ZA 1XQYA 1A88A 3BDIA 2QZPA 5DNWA 3B3QA 3HZOA 1U4NA 2WM2A 3PF9A 4H7FA 1MTZA 2WILA 4B84A 2CZQA 3EIOA 3WK8A 1FFEA 4PO3X 4L9AA 1U2EA 1G66A 5AI9A 5CBKA 1LPAB 1THTA 4FKBA 4UHCA 1VE6A 1JI3A 2DCMA 5IVKA 1VXOA 4BVJA 2QJWA 3OTQA 3H2HA 4IH4A 3ESBA 4ZGBA 3GROA 1W76A 3HACA 1ZD5A 2YASA 2PL5A 3W2TA 1DTEA 5ALUA 3FSGA 1FFDA 2J3QA 3DOIA 4Z49A 2Z3ZA 4IO0A 1QGED 4AB1A 5ALMA 4B6GA 5CH5A 2VJDA 3QM1A 2HA3A 1LPOA 1CUGA 4W1PA 3AZPA 3H17A 3BJRA 1S8OA 2WFMA 3STWA 3OPMA 3GBSA 3FLBA 1JT2A 2VJAA 3AINA 4DMFA 4U2GA 3AJAA 5CXXA 5A7GA 2H9YA 2HA0A 4AO7A 2ONCA 2QJRA 1CFJA 1X2BA 1JJBA 5KWIA 4WFKA 4JUIA 4BE4A 5HF6A 3G0GA 4H7KA 2OAGA 1BEEA 4CG2A 3RK4A 4AMZA 4KR0A 3KDAA 2JGMA 4B9AA 1RWQA 4U2CA 2ACKA 3W9BA 3WA6A 2QUAA 4JEIA 2PSFA 3DCNA 1MNAA 3RARA 3LIPA 4OU5A 2OPHA 3WK9A 3PFCA 3E3AA 4J03A 4N5IX 4J0HA 2JIDA 2XLBA 1G5FA 2ES4A 4H77A 2VT6A 4BAZA 4ARAA 3V1KA 4BDTA 4U2FA 1UKCA 5LIPA 3L1IA 1MX1A 4EY6A 2PSHA 4NS4A 3QVMA 1NU8A 3FYUB 3O4JA 3WL7A 3C43A 1XKTA 2VAXA 1CUIA 3KSRA 3UMJA 3W04A 3WWDA 4DNQA 5HK9A 4KYVA 5DNUA 3FOBA 4IQ4A 1XRLA 5E2IA 4LHEA 4OUKX 4PSDA 5JAPA 4HTAA 1TCBA 2XE4A 5C8ZA 4X91A 2YXPX 1VE7A 5EHZA 2WG1A 2XT0A 5CTAA 3BIWA 1H2XA 5FDFA 2WJ6A 4FHZA 1MO2A 2P8SA 4ZV9A 3G9XA 5K3FA 4XVCA 1IZ7A 5HQ3A 4J3JA 1MAHA 2DR0A 5LKRA 1XROA 4KEAA 4UFNA 1XKLA 1DT3A 2VEOA 3WI7A 4H18A 4GI1A 1JU4A 4GW3A 1XZLA 2HL6A 1WOMA 3D7RA 2XQFA 3H19A 5LZ5A 4AN1A 4Q3OA 2FX5A 3V1NA 2WJ4A 2QM0A 1Q0ZA 2VF2A 3WYNA 3D5EA 5FLKA 1WB4A 1CPYA 4EY7A 5AJHA 5BWCA 5HK8A 1BN7A 2DSNA 3PI6A 1HPLA 1QO9A 2D0DA 3O4IA 2WU3A 5E4YA 4W1QA 1NU6A 3H2JA 2XUIA 3CCCA 2ORYA 3LCRA 2XQIA 4Q34A 5JZBA 5HF5A 3PUHA 4YPVA 4J0GA 4XIIA 3WK5A 3R0VA 4CI9A 5JIBA 3ICVA 2XQJA 1MN6A 3V9AA 1A7UA 4RNCA 2Y6UA 2AJLI 5AKGA 2C5FA 4UHFA 1B41A 1HBJA 4G9GA 1ZGCA 3VVLA 4YX9A 1DQZA 4RE5A 1E8NA 3SC2A 3Q0TA 4H7EA 5LZ8A 1ODSA 1ZD2P 4Q05A 1SC9A 3WA7A 4K2AA 3H2GA 1GKKA 4NMWA 1JU3A 4A5SA 3O9MA 4KRYA 2FJ0A 4Y2UA 2H7XA 1A8SA 3M83A 3D2CA 4K6HA 1F0PA 1THGA 1XQWA 4EHBA 3ZPXA 5AI0A 5HFNA 3YASA 2CBGA 2ZYRA 1QJ4A 7YASA 2XDWA 5I8PA 2I3DA 2VAVA 3U1TA 2HA4A 2PU5A 4Y7DA 2WQZA 1ZI8A 2CEKA 3QBJA 4KACA 4OU4A 2RIPA 4Q82A 4J0DA 3HRHA 3FYTA 5FV4A 4AN0A 3R3VA 1OCEA 1C7JA 4GECA 2WTNA 3LP5A 4LXGA 4X71A 4F5ZA 3G9ZA 3I6MA 3PICA 5ALLA 2G5TA 2PU7A 4FFWA 3PF8A 4EUSA 3R3YA 5FPPA 5HQ3B 5ALRA 1UZAA 1E5TA 1M33A 4QLAA 4QWWA 4FFVA 1U65A 1SOMA 2QXTA 5AKEA 4B82A 2WUDA 1CUAA 2WFLA 1QIFA 2RONA 4B85A 4EY4A 2WTMA 1Q84A 3ESDA 2WHPB 3AZOA 3QPDA 5AI5A 3VDXA 2IX9A 4LYDA 4X3CA 4DMCA 2BUBA 1YS2X 3C6BA 3DD5A 1XRQA 4X93A 1GQSA 2ECFA 5EHNA 5I7UA 5LP1A 2HIHA 1NX9A 3HXKA 5DYYA 4H7IA 5IH7A 1XZHA 3CN7A 5IVDA 5JAUA 3VXKA 3VISA 2GYWA 2O7VA 3FVRA 4GHWA 2VA9A 1B6GA 5AHXA 3HC7A 1P0IA 2D5LA 2G4LA 2OQVA 2QOEA 4MJ3A 5AM1A 4Q3LA 1CUJA 4L3WA 4C89A 5ALJA 3GELA 1BE0A 1CV2A 5A62A 1UKBA 1G4HA 3D2BA 1EVQA 2JGEA 3E4DA 4FLEA 4Y2VA 4FDMA 4N8DA 2JF0A 4LKOA 1RP1A 1Y37A 4AXBA 3G0BA 1O6FA 1UT6A 4ITVA 5K3BA 4FNGA 5D7BA 4G4JA 2B20A 1QIDA 1P0PA 3I2IA 4B0PA 5CT4A 3C8HA 4QWMA 2XUGA 4V2IA 5AI6A 1XZJA 4KE9A 5AI8A 2ROQA 2YH2A 1W4LA 1QIMA 2QKYA 2V98A 5AKIA 4Y2XA 5C7YA 3WK4A 4A23A 4LXHA 1DU4A 2HM7A 3H2KA 2PUJA 3HEAA 1VZ2A 4J0CA 5K3EA 4BB0A 1QONA 1CUDA 2XMRA 2Y2UA 4G4GA 5D3ZA 2CB9A 4ETWA 2WIDA 3I6YA 4QDXA 2XUAA 5SYNA 1UOPA 1YA4A 1DX4A 5K3CA 4G4IA 2ZJFA 2WG0A 3V1LA 3FLEA 1YSCA 3AILA 1E8DA 3TEJA 2PUHA 3O4GA 4B81A 2VATA 1AURA 1QE3A 2C7BA 3B12A 1CUVA 3NGMA 4K6KA 3IVMA 4BTLA 1QIEA 1SCKA 3FWHA 1UKAA 4I4CA 4BDSA 5AKHA 1YAJA 2JGJA 3CXUA 4DGQA 3ICWA 4L0CA 5K3AA 5KWJA 5T4FA 4BP8A 2HA5A 4BZZA 2BUAA 4K6GA 3FNBA 3ZWQA 1TAHA 3MUNA 3QMMA 4Q1VA 3G7NA 5C8XA 2AJCA 4H35A 5FKJA 4Y2PA 5ALZA 1CUXA 1UOOA 1X2EA 4FMPA 4BRZA 3STYA 4QA9A 4PF1A 5ALWA 2PPLA 2C4HA 5EIAA 4ZRDA 4U2BA 3W05A 4FBLA 4BZWA 1J06A 5HKAA 5EI5A 3WZMA 5CXUA 2I03A 4G8BA 4FLMA 2BAGA 1U8EA 2HFJA 2HADA 4J0IA 3I2HA 4G1FA 2WJ3A 3W06A 2H7YA 5HFAA 4PQEA 3RM3A 3T4UA 5AM2A 3V1MA 1X70A 1ZIXA 4RGYA 4FOLA 4BE9A 2OGTA 2WUGA 4OYLA 3WIOA 2BJHA 1MX5A 1ODTC 1XZDA 3EQ7A 1BROA 3A2LA 4X94A 4ZV7A 3KWJA 4FBMA 4S0XA 5A2GA 3QMVA 4J0JA 3DDUA 3ANSA 4KE7A 3P2MA 1CUBA 5FXMA 1VOTA 3I1IA 3FLAA 1GKLA 6YASA 5AH0A 1LPPA 2XUFA 1IUPA 1E8MA 5DTIA 3ZV7A 3AZQA 1EHYA 3AIMA 2Y2VA 4ARBA 1YB7A 2X5XA 1CLEA 4X6YA 3FCYA 1C7IA 3OG9A 3QYJA 5ALHA 4DMHA 3ZLTA 3VJKA 1L7RA 2YYSA 3O0DA 4UBLA 1R50A 1CQZA 1QTRA 2WHRA 5JATA 1WB5A 3R3ZA 2B61A 1XZKA 4F0JA 3GZJA 1YAHA 2WUEA 4Y2SA 2K2QB 3FVTA 4XJVA 3IA2A 3JWEA 2RGUA 1R3DA 3G0DA 1EDEA 1GXSA 2JGLA 4AZ0A 5T4BA 3A2MA 4N8SA 4XX1A 5T4HA 3IUMA 1ZOIA 2V9ZA 3I2KA 3AIKA 4MYDA 2XI4A 1UK8A 4DTCA 4GLBA 3FYUA 2HA6A 3ESAA 4WDQA 4HRXA 4FNMA 3STVA 4WY8A 1CUWA 3IUJA 1E89A 2Y6VA 2XUKA 3WJ1A 4C4ZA 5CH8A 3DNMA 1AC5A 4UBNA 1ODCA 2UZ0A 3VJLA 2XMQA 3BWXA 2EDCA 2WSLA 2Z5GA 2ZVDA 4W1SA 2BGNA 4UBJA 4QDOA 1OXMA 4BAUA 1CUEA 1K63A 4QNNA 5C81A 1QIJA 1EB9A 1ZI6A 2B4KA 1EK1A 2DHCA 5AOCA 5LZ7A 3EQ8A 4JNCA 2FUKA 3C5VA 5AOAA 1IUNA 4P9NA 2HDWA 3R41A 3WKBA 1XLUA 1W75A 5AICA 4YK7A 1UOQA 3D59A 3IULA 4G5XA 3TJMA 3MVEA 2Y1KA 2BCEA 1VJ5A 3KWFA 1ORWA 3I2GA 4DYHA 2H1IA 3F98A 3VVMA 3F8SA 4WCVA
chains in the Genus database with same CATH superfamily
4N0EA 4B7UA 4MO9A 5C34B 2KPOA 4MV4A 2HIAA 2WJAA 3WYEA 1QQBA 4IHKA 1WE2A 3KAKA 3ZGOA 1PZNA 2OENG 3L8YA 3ZU4A 1EE2A 4BCCA 5BNZA 5BV7A 4YCDA 1JZTA 5JQGA 3RC8A 3O92A 3DXZA 2WUFA 2OOSA 1SKUA 4YPFA 2EZ4A 4EI9A 4OXQA 2UVPB 1U8XX 1PGNA 4YAUA 3R9WA 2NO0A 1JNXX 2QRLA 4H17A 2W00A 1NW9B 1UPFA 1ZVJA 3QFSA 3GLIB 3NYWA 2QBYA 2Q1XA 2MSEB 3AW9A 4RSMA 2MHCA 4ERXA 3RAEC 2XUDA 3AP2A 5E0OA 3UATA 2YWGA 3HPRA 3VNVA 4L7QA 3TQQA 3BE5A 2ALJA 3NIWA 2VPYA 3AFGA 1KS9A 2IYFA 4LRXA 5FOVA 3KB2A 5T64A 3MBIA 5JCPA 1UDBA 1YVUA 3UW1A 1I9GA 3PE6A 1BDHA 2XT9A 1REQA 3QTTA 5BWOA 4JBNA 4P08A 4J2TA 4QDKA 3LUJA 2OHJA 4HN2A 5F9FA 4KPUB 3ZQ6A 1GRVA 4P80A 2PH5A 4WH0A 3HL4A 3LVBA 1M2VA 3GEHA 4GFDA 3IVCA 2OGWA 1KYVA 3P4UA 4HI0E 4QOHA 4ZEOA 4YRQA 4UEQA 3NONA 1L5KA 3REQA 4WXEA 4DDHA 1QTIA 2AUMA 1IM2A 4LVCA 1TX4B 4LSZA 1UXOA 4I46A 2VYFA 5DM0A 1KU0A 1W1IA 2QVZX 4UU1A 5FTNA 4ZVPA 3WGGA 4N3CA 5HM8A 1NWHA 3DB2A 3OAAA 3R3UA 1R27A 1WPRA 3PXGA 3TAXA 1OYOA 2NVBA 1DKOA 2JD2A 3OTIA 3K9NA 1VLQA 1KAEA 2CCJA 4TXNA 3H1GA 1VE9A 3IBGA 1AB5A 1UH5A 3M6FA 5G40A 4ZCSA 1E1RD 3RJZA 4B7CA 4DCNA 1BX1A 5SZKB 3RABA 3PD0A 1V8FA 3DKKA 2DUNA 2PIAA 4Q4CA 4YRNA 2NSYA 3KC2A 1ZONA 4IIEA 2P40A 3LVRE 1PZGA 4ZZ2A 4OEHA 3WGKA 5EHQA 5HNKA 2XXBA 4HFNA 1SURA 1ISPA 3W8FA 4U8GA 1EP2B 2VG8A 3HCPA 2ENUA 4G8DA 3D7KA 4B45A 4PIVA 4N7JA 3QNMA 4V2UA 4CKYA 2O9JA 3L02A 1RJ9B 4KYTA 1C3OB 1QWOA 1K8XB 1OA0A 3M33A 4UE3S 2RHCA 3ZCSA 2IEBA 4ER3A 4D02A 2O8EA 5G0UA 2DRIA 3ESXA 2JZOA 4NYIR 1N7GA 4F8YA 1ECPA 5COAA 4X8LA 4FC6A 2IDKA 3COPA 2NU7A 3NW9A 2A9OA 3GYGA 1DLIA 2VCHA 3UH0A 3DYIA 1UT8A 1ZY2A 3G89A 3LWDA 3QW4B 4HUQA 1E5QA 3G7UA 5B6JA 1JEAA 4GF5A 3X2FA 2E85A 3D6VA 3Q0IA 4J4HA 5J5AA 1KWGA 4KMRA 5KNLA 4GNRA 4B7AA 1TEHA 2CFTA 1Z25A 2PGXA 2AN9A 4JJ8A 4EUFA 2VEDA 5CEFA 2LCFA 3RT1A 3OLYA 1Q3TA 1M2OA 2C2HA 2H4HA 3D8BA 4NFHA 2J9YB 2W2KA 3DFIA 5LXTF 1QBGA 2X1LA 4IGIA 1GT6A 1LW6E 1XF9A 4NJEA 5SICE 3RYTC 3UWOA 2HD4A 3RNLA 4C0LA 1MA0A 3EDCA 3HI6A 3KKEA 4GPEA 2AJ8A 3GGPA 1JLMA 1Q12A 2KS6A 2IYXA 2L19A 3GR6A 1KETA 3PUXA 1ZH6A 4PNHA 4AECA 5JFOA 4B6PA 4MJXA 1SXGA 1RXVA 5TPWB 1CQJB 5CG1A 721PA 2R2GA 1AQJA 1D6JA 2H59A 1E99A 5DX1A 3NG1A 1JN0A 4C4TA 4IZOA 2JI6A 2X3YA 3A6HA 5J63A 3NWPA 2XGMA 1U3DA 5IXSA 4CF7A 3QBDA 5JYCA 5I4IA 1SRRA 5BWBA 2A33A 4K05A 2VQFB 4XKJA 2PTHA 1TMKA 3LUHA 4J6EA 1OI4A 4XUDA 3R7NA 2C1ZA 3LX8A 4DJEC 2BFEA 2ZR9A 3NWOA 1Q7BA 5G41A 3BULA 2WHPA 1O0BA 3C14C 1KFJB 4H1VA 1EP1B 1MU0A 2D5IA 3L5KA 4P5DA 4Q15A 4W5TA 4COKA 1VSBA 3GWZA 4B17A 4LK2A 3A9CA 1A9ZA 1GU7A 3OT1B 1USGA 5KNBA 2OB1A 2VQEB 1CUUA 5TEWA 2CL5A 2CD7A 1S8NA 4P92A 4BJ5A 3F73A 1Y1TA 2IHNA 2HRRA 4ZHQB 3KXIA 5KNDA 4S05A 4HEHA 2Q1YA 1ECJA 2YFKA 1GNTA 3M6XA 1J8FA 4G0WA 1BHJA 1J7KA 2MT9A 4LJAA 4C01A 5CDYA 1YRQA 3E5NA 1CY4A 2FPGA 3M4XA 5BSGA 3BWVA 1GAXA 4MOWA 3QYAA 5KTOA 1T15A 1J5PA 3P0EA 4WV3A 5JAHA 2GBFA 4M9RA 3JZDA 3G9TA 2AI2A 5KTYA 3G5UA 5C46F 2ZQ5A 4X85A 3ADBA 3RFUA 2J0UB 4WESB 4PLYA 2O2IA 4E70A 2J0UA 2DJIA 3DTYA 4HB2A 1WCWA 4WESA 5JI2E 2J4CA 4AWXA 4HXGA 3TRKA 4C76A 2E4AA 4GRAA 3ITEA 1DCFA 1EM8B 2R97A 2NT3A 4G24A 4YHHB 1UMDA 1AQNA 1EEXB 1C3XA 4HAIA 4ZQHA 5FB3A 2JHCA 3USES 3ECCA 4UBKA 2XMZA 3DMTC 1OWPA 4WE3A 3RYHA 4UE6A 4DJTA 3JD3A 3AI7A 1T5HX 2B2XA 3EOBI 4DMRA 1ISJA 3KQVA 4ITRC 2HMVA 3PC7A 2JGDB 5HS4A 4EKEA 4M87A 3HJCA 4X20A 3S1AA 2GEVA 1MPTA 4K0RA 5K09A 4CDRA 1PR2A 4GXQA 4PG7A 4HJXA 3OJXA 3VKGA 1I80A 1F8FA 1VHTA 1RWVA 5FFMA 3U7EB 2WKRA 3ZIDA 4JASB 1JHYA 3C87A 4NYJR 4KXNA 4O1HA 3SNHA 3SHWA 1GEGA 2G7ZA 1AQYA 5IMBA 1JG2A 1EFVB 1HM5A 2IHYA 4M0FA 4QT4A 1I2DA 1W73A 1WU7A 4AKTA 2XCQA 5KX5F 2ZRAA 3I53A 1COZA 3SX0A 5K8IA 1I2AA 1ZJ5A 5K8JB 1T9ZA 4Y9RA 3LKZA 1JHRA 2QTFA 1HQDA 4JJFA 1QV6A 3BA1A 1TTPB 2I7CA 3C0KA 1QNFA 3A1WA 1THMA 3DEHA 4XAQA 3V7YA 4BKOA 3JQPA 3ND6A 2B9EA 1LTHR 8GPBA 1OXXK 2QU8A 1ML4A 2ZJZA 4UVGA 3UEOA 4DBZA 5D5QA 1SQGA 3VYUB 4QFCA 4EKGA 3OU7A 1BX0A 3PDIA 1F3LA 4ZQCB 4BU0A 5DX0A 1CY6A 3I9MA 4L4ZA 5AWFC 2O2JA 3ZU2A 3CX4A 2FXVA 2B7LA 4LJ4A 4P3PA 2XMCA 3RRFA 2QGFA 4V39A 1JLLA 1HYQA 3QJ5A 4R1TA 1SAYA 4IHJA 1TM1E 1L5QA 3B70A 1Z4NA 1OXTA 3O8BA 3K32A 2BR3A 5JD6A 2XYGA 2EP5A 2C5BA 2WD8A 4R01A 2QN7A 1H66A 5AVOA 4N5HX 4WQMA 3E1KA 2P5SA 1RPNA 4MB2A 5JZOA 1NV9A 1TLTA 1XCLA 4GZMA 5JO0A 5ICMA 5LP6A 4BO8A 4P0QB 3ILYA 3WQQA 5F9HA 5LMCA 1XZFA 4DA6A 2BFOA 2HBQA 2RHBA 4C05A 4C4OA 3OJ0A 1QGYA 4MWBA 4QQRA 1LSSA 1PZXA 2RH4A 1MEJA 1PJZA 2VDMB 4MARA 3AHHA 4KQHA 3PE4A 1QZXA 5D3MA 1DAEA 1JHPA 4KAAA 3H5OA 3PG5A 4NFSA 4AZTA 1PJTA 1UMBB 3GFFA 1EA5A 1C30B 1JGTA 4RZHA 1VIYA 2BKVA 4I14A 5TB5A 4CRWB 1LF5A 1AN9A 1NLUA 4GSLA 2UZ3A 2DPLA 3I0MA 3PVSA 4GUDA 4P4LA 4CM9A 1EXVA 1KDPA 4UHBA 5G4KB 1FSSA 3W5IA 1SPBS 1F8XA 2RAPA 2OAP1 4IV5A 2GPSA 4GICA 4WINA 4YC7A 1SU7A 3L7NA 4MW0A 3RS0A 2XMDA 4AKHA 3LAWA 1P44A 1Y4AE 2IXDA 3MCTA 4B4DA 1D6NA 2IFTA 2V6JA 4RMIA 1QORA 3MWFA 4IH1A 2VBIA 4E2WA 3SYNA 3R3JA 5DSZA 5A4MS 5E95A 5DJ5A 4IHJF 2H57A 1US8A 2XB4A 1ZLYA 3R4VA 1T2UA 1G21A 1YCFA 2DPYA 4IZIA 4JJ7A 2GD0A 2EX1A 1USWA 1LB1B 2YC4C 4ISBA 4OQQA 4XCXA 5E7IA 4AKSA 1E9RA 4MV1A 3ZWBA 1Z7GA 1XYYA 2CKMA 3IR6A 4IICA 4AY3A 2OFFA 1TT5B 4MVJD 1SQ6A 2WLSA 5KOJB 1H6DA 1XDDA 1U2TA 3PL5A 3DTVB 1UJ2A 1TM3E 4NU8X 5J4LA 4IQGA 3AX6A 4N82A 3N5KA 3Q1KA 4Q4AB 1K6IA 2LR0A 3P2JA 3L1UA 3FROA 2AC4A 2V7EA 1H93A 4AVYA 5C7LO 1T1IA 1QNLA 1DL5A 2FG7C 2FW7A 1N5OX 1PO7A 1Z18A 1V11A 4BVKA 3DEKA 1NULA 3MGGA 1RDFA 2VHUA 3DUWA 1EIZA 3NHAA 5DTJA 2HPHA 3NB0A 3HY4A 3IQGX 4ER7A 1KI1A 4KWCA 4U1RA 1IRIA 1W34A 2XMBA 1A9YA 1I4TD 2Q6LA 1GPYA 3DE5X 3G9QA 1HO3A 3R3HA 4II7A 4Q12A 1TEVA 3PHIA 4YCCA 2PKXA 2P68A 5KQPA 4R8KA 4GVXA 1X13A 1Y6RA 4TTIA 3L7AA 3TR5A 1CQPA 1JPNA 5AHKA 2AWOA 2OZPA 3B1ZA 4CKBA 4UPVA 1FEZA 4RW0A 4KR2A 4JUFA 1BMDA 3BE6A 4EDHA 1Z22A 2H2WA 3H18A 4PAWA 2OCKA 4LJ6A 4NU6A 5EE5B 1FMCA 3UAYA 3LLVA 1Z68A 4JT2A 4L9RA 4WBXC 4MGHA 2IYWA 2R79A 3MMNA 4H27A 2OZEA 1ZMXA 2FTKE 4R9VA 3PC8A 1ICEA 3PFHA 2I55A 2WD7A 4A8JA 5F2NA 3IJ5A 1GUAA 3RUCA 2BUCA 2PM8A 3CA8A 4YRRA 2IWHA 1LV7A 2N9UA 4ACBA 1JKXA 3ZWNA 1TKBA 2O2GA 2OORC 5T67A 3ZI0A 1C9KA 1Z7BA 1FRVA 4GM1A 4H6WA 1XXHB 2JNWA 3OEHA 4R51A 1E4EB 2B5WA 3OM8A 3IP7A 5CCXA 3KYCA 2QVLA 1Z26A 2FZGA 1B4DA 2GJ4A 5EZYB 1T0BA 3DBRB 4YAJA 1SOWA 4EAQA 2VQSA 5FA6A 3F71A 4XVUA 3NANA 3R8XA 2YWCA 3WRYA 1MX3A 4E6PA 2I1VB 1Z3CA 1J0XO 3RYFA 3UHAA 3JQEA 3SS7X 4O4HF 3U7IA 1EGMB 3DUFA 3QEAZ 2CNOA 5AJWA 5F4ZA 1D4AA 4EY3A 4HFMA 3VBEA 1HDYA 2JFOA 4WFIA 3A06A 4JX8A 5AP9A 1GN8A 2SKEA 2VOJA 1X7ZB 1IULA 3DL7A 4ZEVA 2G88A 2QA5A 1JV2B 4I1RA 3BICA 2H1LA 1XF1A 4F4DA 4RZ2A 2WDPA 4Q4LA 1BN6A 4K8RB 5EIFA 3VR1A 3BXEA 3BCHA 4XTCS 2F1HA 4I55A 3HLYA 1U9IC 3CT4A 2QROA 2IPOA 3RYIB 5FEUA 1WB6A 3IR5A 3KJXA 4GQAA 2J09A 4ND6A 4GM4A 3FI9A 4DUPA 2W90A 3SQNA 2EFHB 2P91A 2E4WA 2NTVA 1UBUS 4EDFA 4U2KA 2A9PA 3AR3A 4K87A 4RK4A 5AK6A 1Y42X 1Z5PA 2AZDA 3ONEA 1TCVA 4Z4EA 2NO6A 1AUQA 1WLYA 1IAVA 3MFQA 4BO9A 4IDNA 4EW3A 4IIVA 5CFPA 4KMOA 2PVCA 2W2VA 3OZCA 3L7MA 4DRXB 2FEOA 3NJRA 4KYUA 5C51B 4IRMA 2QLMA 2YZGA 3MEQA 3AM4A 4DADA 4Z1MA 1C8BA 1Z34A 3R3SA 1K6EA 1NDQA 2HXYA 2JFVA 5JSKA 5I3ZA 1VCIA 3UJDA 3WHIA 1H22A 1SXJC 2PMDA 4JR0A 4DG5A 1KEZA 5DYGA 4ZIRA 3II6X 1ZVKA 5JEEA 4JI0B 4LZWA 5FYDA 2Z8ZA 4B1FA 1NXQA 4FTWA 3K5HA 1T4CB 4WADA 3UT0A 1HE3A 3VPDA 5CDGA 1UANA 4OX9B 2MSLA 2OAEA 1BX3A 1PX2A 1XTQA 3N9IA 3ID6C 4K5QA 4GU5A 3PITA 1GQRA 1FXSA 3UTDA 1WPXA 5BW8A 5GADl 5I7RA 1GGJA 2E18A 2CUTA 1SD1A 1GARA 3TMKA 4RSHA 3IDZA 4UD2A 2NOAA 3ENQA 2ZWOA 3KQMA 4DBLE 5A1TA 4OYYA 4JLVA 3S2ZA 3WX0A 4F2PA 3KZNA 1RJEA 3EY9A 4GVPA 4RENA 1X7XA 5KOYA 4YUYA 1U0NA 3TLKA 2A5GA 4M0EA 3KWMA 2XUQA 1WVGA 4AL4A 1ZN7A 4FYMA 4Y30A 1XK7A 4M0LA 4UQLA 4OGWA 3HUFA 5LWHA 5AT1A 3OJWA 5YASA 3VA7A 3S6JA 3MG9A 3WK8A 2P2YA 2JFQA 4FEYA 4R6WA 3OESA 4JYCA 3LKDA 3H42B 4AJ2A 1EX6A 3CPJB 2P9QA 1NWCA 3N8GA 1XPRA 3EEOA 4LZZA 5DHRA 3B51X 1ZI9A 3FB1A 4NABA 4GRIA 4FBGA 4BQSA 2GZSA 3MK31 2WWHA 4CQMA 3NKLA 1K8QA 4X00A 1DTWA 2HWKA 4D1YA 1TA9A 1W52X 1PV4A 2ZPUA 4M86A 1H0RA 1Z12A 2QORA 3RHSA 1OT5A 1OXSC 4D0SA 2ZRIA 2AQHA 3M3DA 1DDOA 1AKEA 3GUZA 2ZJ6A 4QEKA 1J2YA 2GEDA 3AJRA 2YN4A 1VLHA 1KI6B 2PSSA 3ZQJA 5LIRA 2B37A 3OUTA 2CL7X 3HJUA 1HKHA 5KVSA 4RJKA 2C5GA 1CTQA 4LA4A 2PBRA 3GDWA 1B2RA 4RGQA 3ETEA 1RYYA 4ZDIA 5ERYA 2LP4Y 2Y1XA 4D9CA 3GFOA 2F17A 1L3CA 1VPTA 1N5DA 1Q7RA 2BGUA 2O8NA 3EBLA 5BN4B 2ZJ0A 3RW9A 3E2IA 2Q0SA 1A8QA 2FJPA 3UV3A 4ZEWA 4DB4A 1C4KA 1MOZA 4E5UA 1M0TA 3DXYA 4W7SA 4BVLA 1BRMA 2UKDA 5ABPA 1VYHA 4XGNA 2A5DA 2OBXA 2FKNA 2VHVA 3UGKA 3KOOA 3R77A 4JU8A 3A32A 2Q3DA 2X8BA 3G88A 4WUTA 4DG8A 1Z0KA 5H4GA 2QENA 3Q3EA 5BVGA 1K66A 16PKA 1OGYA 2Q3CA 3BCUA 3NHRA 1OGIA 4LRYA 3CRQA 4M3NA 2X7HA 2IGTA 2EOAA 2YHAA 4L02A 3F4LA 2D1YA 1IEQA 2ZYUX 3OBIA 4LI0A 5DCYA 1WW2A 5FJIA 4TVSA 2TMYA 3C5WP 3ITDA 3N2KA 5DSXA 2ZWAA 3D4OA 4TTJA 5J23A 2TECE 4ZZIA 1QYCA 1DIGA 4I9HA 4F12A 2GCEA 2YXLA 2OC4A 3GF4A 4ND2A 2Q6OA 3HLTA 4UXJA 4FCCA 2CXTA 4D6YA 1LDBA 2WJWA 3KJEA 1O8BA 4XPIA 3UW3A 4CR8A 5JAOA 1Z0FA 5HA5A 1WV0A 2D1FA 3HL0A 2C2MA 3GARA 4U7GA 1FB5A 3D8UA 5G53C 1UEJA 1L7QA 1VJTA 1YNOA 4WGFA 5U4QA 2Q4RA 1CIJA 1NMYA 1MIHA 3DG9A 3PBKA 1Y48E 1K8RA 2EFGA 3B20A 1TJNA 1P0CA 1TMYA 1Y8RA 1CQIB 3K0CC 4Q37A 3STHA 3TEFA 2V97A 3NYIA 1L7BA 3BE8A 1JIVA 2J4FA 2M1XA 5BNFA 1VTKA 4DR5B 1WQ4A 2FPRA 2HJSA 5E4TA 2P5YA 5HP4A 3AUXA 1XEXB 4LV5B 1CG6A 4A10A 1TZKA 3R1IA 4DLUA 1F7VA 1R12A 3A6FA 3KJQA 5IBQA 4PAMA 5LMNB 5GWXA 4F60A 1DS6A 2C4VA 3V48A 3A1FA 4YLGA 1YDMA 3AGPA 4FZ3A 3VQTA 4JI6B 1NRJB 2WPDA 3OQPA 2AJDA 4AJEA 1WMBA 2P1ZA 3EUAA 1R6TA 3DZGA 2A8YA 3O84A 4FP9A 4IH9A 4MINA 3ZGYA 3S44A 3F9CA 4AUEA 2YOGA 4TQGA 3WAJA 5KAMA 1T2AA 1YQEA 3C8DA 3L43A 3BKXA 2EEZA 1MNQA 2E6UX 1BJTA 3M5CA 1PVDA 2X13A 3VR2D 5EXPA 4L6AA 4R7GA 3RH0A 1UWKA 5GONF 1XO1A 3LW7A 3G0OA 2EKPA 4B8ZA 4KR9A 4M1SA 4UOQA 2H2GA 3RS4A 3VSAA 1VKOA 2AF3C 3GV0A 3O47A 3KSUA 3PI7A 3W78A 1I1HA 3U61B 1N78A 4HVAA 3AQIA 1RKVA 2GVDC 1T2VA 1AK2A 1XL0A 3VBCA 3AEUA 4CCWA 4RKYA 1VL8A 2ZRFA 4YALA 1ZOSA 3QXCA 2C82A 4CQJA 2O3RA 4YMWA 4LECA 5CFLA 1BAPA 3RTEA 4TXLA 1FTSA 4YR7A 2FZVA 3GH1A 3D7SA 4URYR 2QT9A 1V1RB 2XMSA 2Z2KA 2NV0A 2I54A 2QY9A 3FWPA 3IIKA 2JLYA 3ND5A 1CF2O 4LG1A 1VRVA 1EDOA 4CU5A 1TK3A 1O94A 4I50A 1LPMA 2IHVA 4QUAA 4GPAA 3LC0A 1F6WA 4JQCA 1RKQA 2QJFA 4IR7A 4I3GA 4YRIA 4YV2A 3LGSA 1LPNA 1Z17A 5CVCA 2ZSKA 3RSQA 1FIUA 3VGJA 3PWTA 4HB4A 1ODLA 1G3IA 2GRAA 1P4GA 3FUWA 3MT7A 3QPCA 5H16A 2J7PD 3C7TA 5HJ5A 3I3OA 3FFAA 1F7UA 5GONA 1XJCA 5CJPA 3UICA 3EGIA 3CZAA 3NM6B 3ET4A 4UVHA 2JJYA 3KV3O 4MS1A 4OB6A 1RRPA 3T3MB 4CIXA 2XOXA 2H3EA 4EEZA 2B1QA 3BTOA 3H1FA 4F21A 1WEKA 3QXGA 2ZBFA 1KYWA 1K3TA 4PCLA 2GTIA 4DJFC 1H5QA 3Q5DA 4A0SA 3E0XA 1F9AA 2BOVA 5MHTA 2ZBGA 4WECA 5HYVA 3PJDA 3TL6A 2D00A 1LW7A 4B46A 2VS1A 3IOEA 4AZ3A 5HTOA 1SCJA 4NH0A 3ZWKA 5FBVB 5I47A 4S1PA 1NKTA 4PSVA 5A4JA 1EX7A 4MHTA 3W7AA 3SQOA 1FUYB 1J7JA 1K97A 4L22A 3QX9A 1ND5A 3DMTA 3WGIA 3H11A 2VPTA 4Z5XA 5KREA 3EIEA 4AJ1A 3G2IA 4TYWA 3UWMA 4AUNA 1BS9A 2ZI3A 3HH8A 4OGFA 1LRJA 1MAUA 2O23A 3HA5A 1EH5A 1G0NA 2BZGA 2RE8A 3FHOA 1HMPA 1USKA 2A5FA 2V58A 3N05A 2GA9A 4XYLA 4MKFA 5B58C 4PXSA 3TRHA 2HCBA 1ODIA 5F5XA 1HEIA 1CE8B 1DIAA 4YY3B 5FX2A 4J7AA 1YS4A 4D41A 4ZI5A 5JECA 1NJ2A 4P93A 1E62A 3EH2A 1NVGA 3JYOA 2WHEA 3REFA 1O87A 3LBFA 7ADHA 2NZXA 1TIKA 1JAYA 3KELA 4PRLA 4C08A 1ZNWA 1GR1A 1US8B 1EB8A 1T1JA 5D6NA 3PGA1 3SYKA 1UZMA 4NQRA 3CVVA 1QKIA 1S3IA 4TRNA 4MDFA 2X1HA 4QAQA 1X1RA 3KS9A 4Y2YA 4LC1A 4EELA 3U7RA 4Z0HO 1YK1A 3WHPA 2R6AA 2VJBA 3PYMA 4RAQA 3K2IA 2HSGA 1R74A 2ET6A 2VRNA 2Z8XA 3CLKA 4M98A 4PLCA 1FMTA 3ZJ4A 1KO7A 4YR9A 1NM5A 3GAMA 2RHTA 3HN7A 4D99A 3THXB 2QS9A 1JSLA 4P84A 4UU0A 1K7FB 4B7ZA 2IXGA 1JSCA 2IIVA 3D9QX 2HRDA 2WOJA 3R3XA 1GTMA 3BGVA 5G0VA 3NHLA 3PHCA 3K6KA 3ANTA 4FNOA 2IH5A 4LBYA 5K0CA 1QFJA 4E5MA 1YI8A 1H2ZA 2WKSA 1U0RA 2B25A 2I76A 1PIWA 1VL1A 3LCVB 3C2QA 5EZYF 5IVIA 1IMOA 4TXHA 4CGZA 2ZJ4A 3FPLA 2PGOA 4MUGA 1E59A 2VA8A 2IE0A 3OFKA 3R5JA 3SM3A 4AJOA 4UAGA 4Q3EA 4A2PA 2IYLD 4AO6A 1Y9AA 4MQFA 1ILEA 1IY1A 1VJCA 1UXGA 4TKMA 3WKCA 5E9WA 3SEZA 4TN5A 4J3NA 3Q7PA 2YOFA 5UKDA 5BN1A 5KQGA 1QGUA 3K0AB 1Y6QA 1QHEA 1KKUA 1SKQA 4OAQA 3KQLA 5GZ6A 2DHQA 1WAMA 1H0SA 1EVYA 3KKNA 5ESWA 4RESA 4A7PA 2RAUA 1L3IA 2Q29A 3I4CA 1CVIA 1JI0A 4QJ4A 2W58A 3N7AA 4LOJA 1AKNA 2C4TA 2NQ8A 4R41A 5CT6A 4DLLA 5AIBA 3WE7A 4NXMB 1I36A 3IEMA 1W93A 1JA0A 2J3KA 1RYFA 3PFFA 1XTBA 5EE0A 3BORA 5HQJA 2AK2A 2YJ5A 2UV8A 2HK7A 3GPIA 1X9GA 3JPYA 4M22A 3MYRA 3A2NA 1KPIA 3OE7D 5JBNA 1H05A 3A4IA 4F86A 1IN4A 2W0SA 5JEDA 1GNSA 1HTWA 1XMVA 1Q0SA 3G0CA 3ZVLA 2FETA 4IOKA 6ABPA 3BMCB 4RV9A 3UM9A 3QVTA 1OBOA 1OX5A 3JQ9A 5GJWC 4PFJA 3IKVA 4NU0A 1H23A 5CYPA 4CN8A 2LTAA 2ODWA 1KZGB 3PUIA 1MABB 3TLGB 4RFVA 2AD1A 3MWGA 3LO8A 1E1QD 1DQYA 2H4WA 1AUXA 3EOAI 4O4LA 3NJ4A 4WLVA 3V6LA 2HNBA 7GPBA 1T4DA 5BSWA 1ZD4A 2HFKA 1ZS9A 4W5OA 1XPOA 2IEIA 3T1VA 4ZI7A 4Y2TA 3BIXA 2PAFA 1EKXA 2EHDA 3PCRB 4O4JA 4RL4A 1KGDA 1P1HA 1NJ6A 5FNVA 4OLBA 3C97A 3CF4A 5E8RA 2A14A 3C6XA 2B9VA 3EPRA 4X92A 3FDJA 2CYAA 3H5LA 1IN8A 2I22A 1UP4A 3SCZA 2OV1A 4LFAB 1ST2A 5DRYA 3W1EA 4YT4A 4MR7A 2G4VA 4RHCA 5BV0A 5MN4A 5FA5A 5I9BA 5D6OA 3TN7A 3W2FA 2D8MA 3DBLA 3KE8A 3JRXA 4UVIA 4CKEB 2WF8A 3PWSA 4NZPA 5E6UB 5SYAA 3ZV6A 1EWVA 2G9RA 2O8VA 2VL7A 4B6FA 4HUQB 4IIXA 2QG9A 1YUNA 2Y05A 4P98A 2P2ZA 2YW2A 4E5VA 1TQ4A 3ZK7A 1G42A 2XA2A 4RKQA 4CZ2A 3C6MA 4W99A 3FUXA 2HHHB 4R40A 4I2VA 1W96A 1E2JA 1W48A 1PV1A 3GJ7A 4FSDA 5BN5B 4YXFA 3U3DA 1GYQA 1W30A 2IPXA 1CY7A 1DPFA 5JANA 2BDEA 4MYHA 1H8HA 1CDOA 2B8EA 2DULA 3KKKA 4BYGA 1PE0A 2JAUA 2RGWA 1G8YA 4R1OA 3T94A 5AFSA 3G1TA 3Q12A 5EJIA 4XJTA 3VZCA 4YCLA 5IK2D 1UFKA 2LVBA 4KI7A 4Q9NA 1UPCA 3LPCA 1Z0IA 1G64A 3O38A 2J0EA 5HZKA 2PE5A 1FFWA 4LRQA 3UAWA 4W7IA 2A5JA 3URMA 4F4FA 5I7WA 1KI2A 1PSZA 3VOBA 1ZGBA 3WAKA 4GI7A 4HDNB 4BN4A 3MJSA 2R8BA 1XTIA 3ZV4A 4BLPA 2D0OB 3KT3A 3S5UA 2Y67A 3NBZC 3N3BC 1W9MA 5AOBA 4PZEA 1NF2A 4OVKA 5L3SA 2I2AA 2VYQA 1J0DA 1U7UA 4L8WB 5EHXA 3LS2A 4FFLA 1OBVA 1WXEA 3WMFA 2PLWA 2V7QA 4OQPA 2Q3JA 3REGA 2I3BA 3H0EA 3FDZB 4JBYA 1CY1A 1IDN1 1E2KA 3CUWA 5AVJA 1C80A 1VPVA 5JCJD 5JVDA 4FCTA 4ZTZB 2IUYA 2RHLA 2V03A 3FBWA 3E61A 2J0SA 3ICCA 2IOQA 3KTAB 1B3RA 2YRXA 3FWZA 4G01B 1JAXA 3QOYA 2BLLA 1FW6A 1QCCA 2ZTLA 3LUCA 1AHPA 3DLTA 4R2KA 2PRSA 3KBOA 2C2XA 4WL0A 2X76A 5J1SB 4IUCS 3VV3A 1NUQA 4BASA 5C80A 5SZJA 3VNAA 2QSJA 2AXEA 4NRDA 4QTUB 4OPMA 5K8VA 1X0XA 3ECAA 4XJSA 4PW0A 1ISFA 3MERA 2J6HA 1D2CA 4C6TA 4RZ3A 4GR9A 4LSWA 4I81A 1VL5A 2XLCA 4WOBA 5EXEA 1KRHA 1U02A 2FPWA 3I83A 3TUIC 3U13A 3U60B 3AI1A 1W8DA 1WA5A 2OK8A 3TS1A 3V7NA 3VPAA 1TK9A 2BP7B 4PX3A 1KXZA 3I9V6 4F93B 2HI0A 3JY6A 4NATA 4COOA 2J87A 1DXOA 1J09A 2NACA 3DR5A 4KOAA 3V8NA 1M1YB 1O6BA 3B1FA 1DAKA 4ZVVA 2NSHA 1LSOA 3PDUA 4XQGA 1MXFA 3AB7A 3VUEA 3WK6A 4UOEA 3UUGA 1Z56C 2OHVA 3JU3A 4G25A 4JJKA 1L7AA 1JHUA 1JLKA 4LDAA 5G0WA 3ZCXA 3MIZA 2C96A 4DMMA 2O8BA 1MHPA 3CE9A 3EIXA 5DM4A 2G63A 2PKEA 2XGSA 4Z7OB 1FJ2A 3BFKA 4ZTBA 5MN5A 5GIOE 3EEFA 4PLTA 3Q15C 3L5OA 4HNAA 5LM3A 5JRJA 2FZEA 1ESNA 4ND8A 3N58A 3HZRA 2G6TA 4KQXA 4MCAA 2H52A 1SZJG 2JGNA 3VHLB 2PX3A 3O3MB 4IXTA 4UC0A 4MVJF 1TJ4A 1ZJYA 1HDGO 3DHWC 4R83A 1LPSA 4ED9A 2ZRJA 4R68A 4UTPA 3CHYA 2YZMA 4XLZA 3F96A 2CMFA 3WV5A 4DA8A 1AGYA 2JFHA 2PLNA 3K9QO 3MUOA 3SIXA 3VC3A 1O77A 4EUEA 3ZJ5A 4QBKA 1NGSA 3LQKA 2JCGA 2QAGB 4BE7B 5IYZB 2WMDA 3WBBA 4B4OA 4B48A 1NW8A 3GNLA 4I5GA 3C1OA 3TCXB 4H3HB 2SCUB 1YT5A 1X1QA 2BFNA 5HILA 4Z9YA 3PTZA 1N2SA 1AKWA 1YFKA 5DWDA 3O8NA 4PPFA 3JR7A 1QDLB 1ZM3A 3GEPA 4BMOB 1A77A 1FYVA 1UK9A 2ZW9A 3L6BA 3IMEA 3B7PA 2CZGA 3CCFA 1GQQA 4C5AA 2W11A 1DJOA 4X3PA 1BQ3A 3RVPA 1KZHA 1K4KA 4TMVA 4OQXA 4NZMA 4CMIA 2JZNA 2YWJA 1NI5A 4HQ6A 3T8YA 1KC3A 2BE9A 2ZYHA 4OIFA 3UWKA 1ZESA 4LJKA 1V6AA 2EDAA 3MAAC 4J6FA 1UC5B 2RGBA 1YIDA 1B43A 4GEKA 5FLEX 1XD9A 4B32A 4KWHA 2IU4A 3AR2A 4F06A 3JQQA 4D6XA 4TV8F 1HC7A 1YNSA 1QRAA 3C4QA 5H59A 3X1WA 4DARA 2E5LB 2O3QA 4L4YA 3MB8A 1MJHA 1Y9DA 3RAGA 2QX8A 5FEMA 1XZQA 3CZPA 1VI2A 1HSOA 1YDWA 3QI2A 3S7TA 3ZE0B 1SQ0A 4MWTA 4KUGA 4Z4CA 1FK8A 4LDRA 1CYEA 1XB2A 3A11A 1DIOB 3ONDA 3QLEA 1YZYA 1Y3CE 3K4HA 4GOND 5U9CA 1ZWKA 2I6FA 4JHXA 1VPLA 1ZN9A 2FWMX 2JEYA 4K9RA 2BJWA 5J58A 1VBFA 4L0QA 2VK4A 4QZVA 2DJ5A 1QVZA 3NI2A 5BSFA 4FDVA 3PHJA 4AROA 4ZHQA 2E4ZA 3TZHA 2IBSA 4LYEA 3CWQA 1KRWA 2FWRA 2FZ4A 3NBUA 4JWTA 3IMGA 5FWDA 2AGVA 4AY4A 2GPNA 4E03A 2F64A 1Y63A 3DULA 1KJQA 1WMFA 1Q21A 2QN6A 2D1TA 3AY7A 3R6DA 4IGKA 4PAGA 1NBMD 1GV1A 3SP1A 3OOEA 3VMFA 3RC7A 5K8UA 1Y7TA 1TYDE 1KZ1A 2AOXA 4TZTA 1N5LA 1W9HA 3OU2A 1PQ4A 2CHVA 3JYQA 2MSKA 3P4YA 3GVPA 3D8NA 1MX9A 3FTPA 3MRSA 4L0MA 3BB3A 4Q0MA 4EFDA 4BLRA 4LYAA 5CB4F 4FFRA 2UUCB 3AH8A 1MAAA 5ILQA 4ML3A 4HPJB 3EVGA 4A8PA 5I7SA 2TYSB 3KJNA 3UK2A 4KXLA 1KYIA 3K0CA 3LX4A 3ENKA 1Y1LA 1GAWA 4BCBA 1EVIA 2AW5A 4YP0A 1IB6A 2GZRA 1A1VA 3PLAE 1BHQ1 1V37A 5JCOA 1R6XA 5FBLB 4YCMA 4QM7A 4AY2A 3UHPA 3QEOA 1L7OA 1MC8A 2AKYA 4UHJA 5JDIA 2TSYB 2QZPA 1QK4A 2H3HA 3LDGA 1T1EA 5DNWA 5F7JA 2HCTA 4BQOA 3IEVA 1YI0A 1U4NA 3EMKA 4UHKA 2ODNA 3NYQA 4V3BA 4NOJA 3PQ4A 4EVSA 1NVWQ 1QO0D 1MTZA 4B84A 2V74B 2EHJA 3EWNA 1YJ5A 1FFEA 4RIIA 3RHFA 4AJ4A 2MTBA 1P9WA 1RQLA 4L9AA 1U2EA 4BNFA 3SKYA 3GY0A 3E3MA 4PZ9A 5C3UA 2FMUA 3P26A 2APJA 5CBKA 4TVBA 4MKHA 1HNWB 1VE6A 1YZQA 2WI8A 4V0NA 3EDMA 4GX5A 5KTTA 4KOEC 4HGYA 3TJRA 3DGEC 3ZW9A 3EW9A 4J9UE 1U7TA 3SDBA 1P91A 2BYTA 1KYQA 3Q8XB 2ETXA 1NR1A 2R3SA 2OOKA 1VB5A 4KWIA 2W48A 4TMWA 2JFBA 4BVJA 4CTKA 1KYYA 3ZNNA 1Y33E 1JA9A 2E82A 2QTTA 1GWNA 4YA6A 5IT4A 1UKVY 4RC9A 3H2HA 1NY6A 4EFLA 4QHYA 3ESBA 1YBAA 2O0HA 5K4HA 1P19A 4BIMA 2QL6A 3RSZA 1FDUA 2HT1A 5CBPA 5CDSA 2Q2NA 5GZ3A 1GAQA 5JNRA 1CNEA 1K98A 4ENRA 5HCIA 4E3ZA 1TZCA 3FSGA 3G1UA 2OMEA 1YC5A 5CA1F 1FFDA 1YR6A 3AP3A 2J3QA 4M0DA 4BNDB 2RI0A 3HDTA 3HJGA 2VDJA 5T3YA 4NMLA 3TCNA 1XRSB 2P90A 2W8BB 4ID9A 4IDGA 3WGJA 4Z49A 1U5CA 3IQFA 4RV4A 5KSPA 3A1CA 2Q99A 4IO0A 3WGMA 1J0EA 4B6GA 1G7RA 5EQJB 5TQVA 3FOZA 4MW4A 5TRTA 3Q7EA 2OHHA 4FOOA 4D9EA 3QM1A 4OATA 4DSUA 1X86B 1B3BA 3D4IA 3WMGA 3ZXYA 4CTOA 3R5TA 5COBA 1PLKA 2BZ1A 3A0UA 3NQ41 5AUNB 2E1RA 1CUGA 3N75A 4HB3A 4DZRA 5K3OA 4AX8A 1G20B 4CLRB 1S8OA 2WFMA 5I48A 3OTOB 2JS7A 3NHYA 1LLUA 3GBSA 1YL5A 1P2BA 1KIFA 3MT9A 3BXFA 4H9GA 1N33B 1F8GA 3H8JA 3NEAA 4RK5A 2C1EA 3FLBA 1NJFA 3HCRA 5IDXA 4HO1X 4X8MA 2W2NA 1MLDA 2GUGA 3L7KA 3Q3IA 4F4HA 1LWOA 1PGPA 1GKIA 2Q5JA 2OBYA 2XD9A 1WUJS 2J7KA 5INTA 1FNNA 4L5JA 3RK0A 3QUSA 1RQRA 3OZAA 1BXZA 2DPMA 4U2GA 4HVLA 2G76A 2A1UB 1SVUA 2F43B 3R7LA 3UJNA 4ZK2A 2QSZA 2VAWA 8ADHA 1V5IA 1M8PA 1SUDA 1Z6TA 1C3JA 2H1RA 3ETJA 3OJLA 5LU9A 1M76A 2QJRA 4HHEA 4F84A 1PX0A 2C9YA 3LUKA 4UMDA 3KXDA 3PEFA 4LTMA 3U3XA 4J0EA 1OX6A 2XVXA 5AVXA 1B7GO 4JUIA 2ZE5A 1GNRA 4IEFB 3K70B 4A03A 2QYSA 2F00A 4CKCA 1U2ZA 3CNBA 4PXYA 5LOVF 1KHHA 3DBOB 4UULA 1IJEA 4H7KA 4I1PA 4NE2A 4E12A 1Z4JA 5TE9A 3VR6D 2LW7A 5AJTA 2QRPA 5EWMB 2ZUSA 4KR0A 1QCYA 3E27A 2DB3A 3DEFA 4RY2A 4UATA 3BRCA 3KDAA 2XMPA 4LJ5A 2SICE 2DVMA 1HE4A 1YMQA 5CW1A 3JV7A 2BFEB 4P2BA 2Q3HA 4U2CA 5FUVA 5IMSA 4NFYA 1I2ZA 1OLUA 1SRQA 3P9CA 4KZPA 1R5NA 5CFQA 2FH5B 3IP9A 1FPQA 1JL3A 4LY9A 3RARA 5FFFA 1Y4SA 1RI5A 3BRQA 3MBKA 4Y0VA 2OPHA 4GGPA 2RHRA 1L9XA 2X8JB 5JNUA 1DX9A 2EL7A 2QG4A 2OHFA 2JIRA 4BBAA 4N76A 2J6IA 4QEDA 1ZDMA 5T6BA 3CTPA 4HPXB 3Q9SA 2ATXA 2ES4A 1PSDA 1N7JA 2VT6A 1A95A 1SBHA 1VG0B 3I01A 1AT1A 3LBYA 3OD1A 3LW8A 1RJFA 3TSYA 5IVPA 3DCYA 4JQSA 4ARAA 3GP5A 1PK8A 2A1TR 3ITNA 3LKVA 2X0DA 2AOTB 2W9XA 1D1PA 2JLWA 1MX1A 3BWBA 3PZRA 1IQRA 4R4JA 4EY6A 4FFBB 1F2DA 4NBSA 5IXJA 2YHIB 3AYXB 3U7HB 3LUDA 3F6EX 4LF7B 2DUMA 2YN2A 3ZDXB 4YAKA 1AZSC 1NU8A 3AUTA 3DW3X 3RUPA 3TNLA 3WQRA 2I66A 1JR2A 1U9ZA 3C43A 4MIYA 3W04A 3GB9A 4H3VA 4DNQA 2ZPAA 5G3YA 1HNXB 1PR5A 3TRJA 4FSHA 2JJ1D 3ORRA 4OK5A 1MG0A 2QM7A 2CMDA 2OTCA 1HRDA 3VH1A 5IAOA 5KSZA 1EFRD 3DDZX 1ZINA 5E2IA 3RIXA 4ZZ1A 1M2HA 2HEGA 4LHWA 3SQXA 4KUEA 2F9LA 3LGXA 1DXQA 4OUKX 4OHUA 4UJ5A 2WYIA 1DVRA 4TZKA 4HTAA 5F51A 3ZK8A 1PUJA 4DIOA 6GPBA 2W2MA 3VI4B 1DBIA 1YZFA 3GJSA 4O5OA 4MGIR 4X91A 3WXBA 1C29B 1S2MA 3CNQS 4OV6B 3V97A 3QWHA 5EHZA 1J2RA 1KE1A 2Z5FA 3UC9A 2O3SA 2JBHA 1RKUA 1RWBA 3GAAA 3HDYA 3K8QA 1JQ5A 2HWYA 5CTAA 4RPKA 4DN6A 1KDVA 2WJ6A 4NCKA 4NESA 5LQKA 4B40A 4QOGA 1ZYUA 4YUXA 3NTXA 5B3LA 2ZB7A 2P8SA 3MCVA 4W7HA 3UGQA 3UJ6A 1WWKA 4EGQA 3BUSA 5ENDA 4UNRA 1CQJA 2EKZA 1AM4D 4XVCA 2Z1DA 2XXAA 2ZRPA 4DC1A 1YR3A 5AR1A 4J3JA 5HQ3A 3ZDBA 2DR0A 4C4RA 1XROA 4KEAA 4U7FA 5DSTA 4B5LA 5DT2A 2REQA 1DC7A 4MGZR 4BXOB 2XBLA 1QYWA 3I5UA 2DPHA 5EJ6A 1LUAA 2E1PA 2QTAA 1NJ5A 3RWMB 2Y1FA 2D8AA 2ZYDA 5EUBA 1XZLA 3I5XA 4CW7A 4DRXA 4DIKA 1TECE 2AI1A 3D7RA 4KC0A 1FDVA 3RIYA 2FN8A 4MAMA 3CSUA 3HK2A 4BTEA 1NN1A 5BYJA 1QTQA 1EA7A 1E1CA 1T2DA 2A0KA 3NEPX 1O1YA 5EWLA 4OK6A 3OETA 4IILA 4FZVA 3DOFA 1SVIA 2HMSA 4LWPA 3H9EO 4NBVA 1CERA 1Q0ZA 1XT6A 2FHSA 4G4SO 3MMXA 4BP1A 1EFCA 2W2QA 1IU9A 1A9XB 4Q6BA 4CL2A 3R9XB 5FLKA 1WB4A 2PJRA 1CKEA 4KU4A 3A9RA 5DI3A 1VKZA 3GEEA 1T29A 3WYBA 1P18A 2AE2A 2PUGA 1UOEA 1QH8B 3WIUA 4AMVA 4MS4B 4FDTA 2Z6VA 5THXA 4OSOA 4NCIA 4I1VA 4XUGB 1V3VA 4CMBA 3WB9A 2WU3A 4ALLA 2DKNA 5DI9A 4GBED 4DSOA 3U4GA 3JVUA 2ZIZA 5G4LA 4QQ8A 3H2JA 3EIUA 1T26A 5I51A 1VP9A 2XUIA 1RWPA 1DRVA 3CCCA 1WS6A 2XCOA 1YOVB 1ZMTA 5AVTA 1I6KA 4DYVA 3PUHA 4CF6A 1IJFA 4OQEA 4FEAA 3NFRA 1DCTA 4JWKA 2QYOA 5LC1A 5BQFA 3A6JA 1JS1X 5BT8A 1CP3A 3VKVA 3BIOA 4FYVA 5IS2A 4TQ9A 4EJ2A 3PJFA 1L5MA 4F1JA 1A7UA 1FXUA 1UBKS 1OPXA 2BFFA 2ZIFA 3PX3A 4RNCA 3ZE2B 1CR0A 4BNHA 3TW8A 1U0JA 4NZYA 5AKGA 4G6ZA 2Q1WA 4JSYA 4UHFA 1B41A 2PR7A 3MCWA 3I61A 4PG6A 1ZGCA 4TL6A 4YX9A 1L5HB 3HE3A 1EVJA 2RDMA 2RB5A 4IS2A 1E8NA 3SC2A 1NVEA 3JQRA 1VDZA 5KVAA 4PHHA 1ADJA 1N2CB 1ODSA 1VKNA 2AOUA 5WRFA 1ZD2P 1Q5PA 2PUFA 2QAGA 4OMFG 2D1RA 4E31A 2QU7A 2BEJA 1VFNA 2EWWA 4NPCA 3IE0A 3VYTB 1DRJA 2PQMA 1ZUHA 1CVRA 2IZ1A 2XH8A 3RUDA 3ENVA 2Q5OA 1Q6ZA 2GVNA 5H9WA 2H1CA 3JQDA 3RE1A 4EB6B 3QFFA 3EE6A 4PO9A 1EUZA 1P39A 3OI7A 4JZYA 5F64A 1T8TA 2YRFA 4JMPA 4LJRA 1RPTA 5BO5A 2IH4A 1OE0A 4FCWA 4FMDB 4TS4A 1WULS 2NQTA 3VUFA 2OHGA 1W4BA 1PBNA 1NSFA 3RC9A 4Z54A 1WXQA 1F0PA 1MEOA 3MPUA 4EHBA 1NIJA 4YCJA 3A1EA 5CAEA 5AI0A 2XEXA 3TBKA 3L8MA 5CUQA 1J2JA 2YVUA 5TDHA 4LYGA 3PXXA 4C0BA 3N87A 2HUNA 1BFUA 3AUAA 2ZKLA 4NCNA 2COEA 2C88A 3RJMA 2CBGA 4CLOB 3TW4A 1S9DA 4DT1B 4EYOA 4Q3DA 1KGSA 7REQA 3MT0A 2Y1WA 3UHFA 4NCHA 1KEEA 4URXR 2BMJA 3DR3A 4NS1A 1XE3A 4QHTA 4CWAA 1LS1A 5I8PA 4WNIA 3QEJA 5A0VA 3U1TA 3UMCA 3TMYA 3THOA 2XSZA 1W7AA 5C32A 2HA4A 4K26A 3RFTA 3DT9A 3X1ZA 3K70D 2E87A 3FKSA 1LDYA 3RRXA 2WQZA 1ZI8A 1MFPA 2BIFA 3TJZA 3NWEA 4Q18A 1XJQA 1DBRA 3SZMA 1GQ2A 2EQBA 4M89A 3Q9UA 2Z2ZA 1WU8A 2GFHA 2GM5A 3DNFA 3I05A 2PLAA 3KQYA 5JQGF 4IJWA 3KV1A 4CMKA 4IJ6A 4MP6A 3BXHA 4L27A 1KDYA 3RGGA 3ZIAA 5FOTA 3RKRA 3AY0A 3VU9A 1JPJA 3FYTA 3FSEA 4JLKA 2BMFA 4B43A 13PKA 3TAHA 3OC6A 4HRVA 1Z4QA 1V6CA 1OCEA 5DXJA 5KKAA 4NZ9A 5EMHA 1OSNA 1XA0A 1ULSA 3OCUA 3OP4A 1TUEA 3MA0A 5JMWA 2EATA 4H3SA 1A2OA 2DFKB 1OH8A 2NZVG 1PUXA 2BGTA 3PICA 2XQVA 3QY9A 3FMGA 1WP4A 2YJGA 3QUTA 4XM1A 4OBEA 1NVFA 2E5WA 1UAGA 4MMYB 2OXIA 2O52A 1G16A 3PL1A 1JA1A 3KR1A 3LLUA 4OHZA 4YP1A 1E3IA 1P33A 3U62A 1YRLA 3SHTA 1PFVA 4C3ZA 3DAPA 5FH9A 2D2IA 4H77A 3G0HA 3R3YA 4XFKA 1JSXA 3QU9A 4LEIA 3R09A 2OG2A 5DIFA 2WTEA 1CY2A 2JKZA 5BN5A 3UMYA 4QLAA 4QWWA 1JJ7A 4FFVA 3ZWXA 2PQ6A 2FDXA 4HYTA 3GJZA 4QPDA 3VPXA 4JQOA 4KIFA 4MI3A 4W8GA 5AKEA 4KGVA 2WJHA 2O5EA 1GPJA 4HGNA 2D1SA 4WK6A 1ESEA 5L4NA 1QIFA 4B85A 4TT8A 1UADA 2DFNA 2WTMA 4ARUA 3AZOA 3K1AB 5AYVA 1B8VA 1M9NA 1R8JA 2DWCA 1U8TA 1ISGA 3KLMX 5J5VA 5BV2P 1O3YA 1BQ4A 4LYDA 5HFJA 3O7WA 4FIZA 4E30A 5EWJB 1EU1A 1Y8RB 4ND5A 2YIJA 4GLFA 4C9BA 1JEYB 4TXJA 3FTDA 1II9A 4UDNA 4PN7A 3AVYA 4BUCA 5KJ1A 2F67A 3HY3A 4DEYA 1RRFA 5EKTA 2CL0X 1N1EA 2XHZA 2Y0BA 3PNOA 2HHLA 4KFCA 1JEQA 3U9SA 4MA0A 3IMFA 5EHNA 1PS0A 2WYUA 3EODA 1JR4A 4XIYA 2A9KA 2P41A 3CF6R 3ZCQA 2HIHA 4WLEA 3HXKA 4JB8A 3ZDCA 1FF9A 1L2TA 1N0VC 1VRCA 3B5JA 3KTAA 2I99A 1G1AA 1HDCA 4PPQA 3LQYA 4RD1A 5LQUA 4CIDA 5IVDA 1TPZA 1PSWA 5E7MA 1KK0A 4H3KB 3VXKA 5JAUA 1NHGA 3F3YA 4D0LB 5JJ5A 1QAMA 4MUKA 1VCMA 4J3FA 3L8DA 1DCMA 4PGMA 3T3OA 1E4EA 1W88B 3GUYA 5BR7A 3OIFA 1AGNA 2QZSA 3AHGA 3DOCA 3C3DA 1RTTA 1CRWG 4LBZA 4RLQA 5AHXA 5FOXA 4EZBA 2QRKA 1QYXA 2VRCA 4L8VA 1W2HA 2EX0A 3TXYA 5DF1A 2J9RA 1Z47A 1X7WA 1KYZA 4JOQA 1CUJA 3LHIA 4IMIB 4RF2A 5FORA 3ST7A 4NE7A 2P7IA 4ID3A 3EPLA 3I42A 1SK9A 5EXTA 1E0AA 1LVUA 3GELA 1JQJC 1G0OA 5KWEA 1CV2A 1N3IA 3A31A 1UKBA 2FRXA 4FJ0A 2FQYA 4RK0A 1A7JA 1W29A 4B3CA 1MOSA 2QZJA 3ETNA 3HKDA 3KWLA 3PENA 1PQUA 3HJNA 2GD6A 4RFSA 2W6ID 4L4SA 3SMVA 3E4DA 3IOCA 4QEZA 1MVLA 3HJHA 3OY7A 3R5KA 2I87A 2JK0A 2P2LA 4MUBA 2MSWA 4FDMA 4IZ6A 4N6OA 3WDLA 2ETVA 3GJYA 3PE3A 3M70A 4QARA 4JVLA 3DBLB 2JC3A 3RAPR 1RP1A 1Y37A 2HIGA 2ISSD 2EP7A 1YZUA 2W93A 2Z83A 4JKOA 4ZEXA 1KMHA 3HN6A 3PUVA 4U9UA 5F2KA 5I9MA 2WWXA 3T4XA 3MUEA 4FNGA 4ZYTA 4ZPXA 3K0AA 4NBUA 2GNPA 3ENZA 3LOUA 1KQGA 5BYBA 4F1KA 4QOIA 3N59A 4LFBB 1JWAB 1MDBA 1XU7A 2QY6A 1KDTA 3I2IA 3UCXA 2IX3A 3Q3GE 2BY4A 1SWWA 3V1YA 3GJ0A 2XNCA 4M9ZA 4U00A 1XZJA 4V2IA 4X8OA 5F3RA 5LL6P 2YZKA 4KE9A 5EFOA 3AUFA 3HEMA 4AS3A 2NU6B 3BSSA 2GD2A 4CQLA 3BPSA 3CRW1 2IS6A 3L8CA 4EVRA 1XD8A 3IT3A 2ROQA 3AF4A 3IRUA 6REQB 1W4LA 3B82A 3IHWA 3L93A 2FLWA 3WGVA 3OCWA 3PNVA 1PDWA 2EL9A 3GCWA 3TBHA 5AVUA 1L1QA 1J21A 5B53A 3TM5A 3VFDA 5KNCH 1QK3A 4IJVA 3UFXA 1KERA 3MTBA 3AUYA 3WLMA 5C7YA 1M1NB 2CXQA 4OM7A 2I6XA 3IAEA 2P3SA 1TW2A 5G02A 3FUVA 4TWAA 3PGVA 1V1RA 5IDQA 1DU4A 1WXDA 1T9CA 3FCUB 1BSVA 3PC3A 1CSEE 4PYKA 4Y9TA 4MMXB 2XPCA 3H2KA 3H8WA 1XMSA 4M37A 3IPYA 3ICEA 3GX1A 3SX2A 2PUJA 3BQNB 2CYBA 3DT6A 1ZUD1 2ISCA 1NPYA 3MRVA 4FDLA 4FOTA 1FC0A 4MS3B 4Q93A 2KWIA 1BVYF 1XG5A 2B8NA 2XE8A 1L5RA 3A37A 5F12A 5FPSA 2XMRA 3E7DA 5D2CA 2FGKA 3F2IA 3GJ8A 3LP8A 3IQDB 2FOIA 3FG9A 3PUWA 1NJGA 3RO7A 3GDHA 2Q4EA 4NAVA 3GEGA 4QDXA 4RHEA 5EVCA 3WRXC 4PZCA 3SYRA 3PT9A 4EQZA 1BE6A 1H5NA 1WCIA 2GHQA 2DCUA 3E84A 4D8TA 4WKOA 1I2CA 3ELDA 4EG3A 5ITSA 1ZGGA 5TMPA 1KAQA 1EK5A 2E5FA 4K9QA 4AW9A 2QN9A 2ZI5A 2W6MA 4MP3A 4TL9A 2JAQA 2VDRB 3GMIA 3MHTA 3DPIA 3AILA 2WWIA 5EKXA 1NQ5A 3THYB 5HXAA 1G7TA 4L5CA 1AN0A 2M32A 4B81A 2VZLA 1Z6XA 1Z2CA 1SCNE 1MO3A 3BMNB 2I8AA 4O5AA 4RQBA 1H4VB 2ZJOA 3HB7A 4P8RA 4WW0A 3LMKA 5EE3A 4K6KA 2WQ6A 3EH1A 1E3TA 4ITUA 5CB4B 4BTLA 3KKZA 1MOQA 4BNZA 1K6XA 4MQ5A 4WI1A 2H92A 1QIEA 1SCKA 3N2YA 3JS5A 4NOMA 1N2EA 2FMHA 5JSZB 3FTEA 1EFDN 1ULAA 3ACCA 4ER6A 5FTLA 4DGQA 1BDBA 2ZZMA 5KWJA 1IG0A 1C81A 3KYDB 2IU6A 4BP8A 4UCFA 1HUQA 2BGLA 3GDFA 3P9SA 3AVVA 1LBQA 1P0FA 1PL7A 3UKJA 3FNBA 2NLOA 1FZQA 1TAHA 1KVUA 1A4IA 1Y89A 3FRIA 4JVOA 4PO8A 7AT1A 1BXGA 1OOEA 4OFZA 3U19A 2VUIB 4L28A 1NVUQ 5C8XA 3W2HA 4CM3A 2PTGA 5E6UA 1V16A 3OZXA 2PT6A 2FW0A 4WNAA 3SZUA 2WM3A 3HXPA 4ZHSA 3VNSA 3ZE7A 1AO3A 4EYKA 4E5YA 5NULA 1JR3D 2K5UA 3TIGA 4U5QA 4JKYA 3AI2A 4JV5B 3K8OE 2QL7A 1XMQB 1E7QA 2E37A 3K6RA 2RGRA 4GZ3A 4C4SA 5LXTB 2IYTA 4V02A 2VZ8A 5ALWA 3CISA 2EJTA 2HC9A 4FYYA 2MU1A 2XADA 2JAPA 4ILEA 3ZU3A 2W2KB 2Z8YA 4ZCPA 2YZNA 1NXTA 4UQOA 5HS6A 2QUIA 3O93A 2DX7A 4ZRDA 4LQLA 4AYXA 3IE1A 2R1VA 3ABOB 5KPJA 4GOMD 3OECA 2H0RA 1E3EA 4BZWA 4Q3NA 4CXMA 4AULA 2KSQA 2WSSA 5DEOA 2EFJA 1J06A 4LMRA 2RHHA 5HKAA 2RH8A 5EI5A 1XEAA 1RAAA 1ZXBA 4PGGA 2HT6A 3H3XA 2LGJA 2YDYA 4KVAA 4IM7A 2IUUA 2B4YA 2HREA 5CLHA 3EPPA 3ZHUA 2F62A 2QNRA 1O94C 2OEPA 3HXOA 3V6MA 1E79A 2FEAA 2RBEA 5ES4B 3UXEA 5FLXA 2IJGX 1L5FA 2X77A 5GJVC 4ASUD 4AMUA 4P3OA 1G7SA 3A26A 3ZHSA 3CS3A 3LJKA 3AV3A 3I2HA 2OBMA 1F1JA 4PC6A 3JVEA 3V2GA 3D31A 5A5DA 3C24A 3E2MA 4HEA1 2WJ3A 3E82A 2FN4A 3AM5A 1CY8A 4B6RA 1UBJS 4LSMA 5AM2A 3J80A 1A5ZA 2R6DA 4ZAVA 2I4NA 3SU8A 3BWDD 1V0JA 3QWIA 2WT8A 3WFZA 3UJPA 3V32A 2EKLA 2BJHA 2ISQA 1MX5A 1NVDA 2CNWD 1NLYA 1ODTC 3MJRA 5I7HA 4O3MA 4BPRA 2IH2A 1J49A 1Z13A 2N1MA 3G2JA 1CY0A 4G97A 3TL2A 3X2EA 4F5WA 1X7ZA 3RRBA 3DC7A 3G2PA 1UWLA 3COVA 1YDFA 2Q3FA 5BUZA 1DELA 5IYZA 2DC1A 2DWPA 2FMKA 1P9LA 1R0LA 4R2WA 4BFSA 2R00C 1PVVA 2J1LA 3P97A 2X4LA 1H1DA 1C8VB 4CLXA 1GSOA 3FNHA 5LQJA 1BVHA 3EZ9A 4DILA 2LDXA 3A25A 2DLNA 421PA 2HF9A 2AQIA 4RPGA 1LPPA 2VR1A 3ZV5A 3CGGA 3E3OA 1RM4A 1EWKA 1SBYA 4HNSA 1E9EA 1N2CA 2PYDA 1F48A 4DDMA 4MR9A 1GTVA 5B4UA 1H2RS 2J6BA 5EJ4A 4RHUA 1Q7GA 3O8OB 4X6YA 4K9DA 4PFQA 4U5XA 4MS3A 1AIPA 4MROA 2HBRA 1J25A 2AH5A 3CBGA 3FAZA 4JJAA 3FCYA 4MV6A 2WMOB 3OG9A 5BNWA 1V35A 3CVOA 4O2AA 1WHSB 3IKLA 2P9TA 2P9FA 1I3NA 3G2OA 4XW2A 4MDEA 3TXXA 2JVJA 3W5CA 3G5TA 3SVZA 3S81A 1PTJC 2G4CA 3N2IA 1ZSVA 4LFCB 1N6LA 3L7CA 1ZM4A 3SIRA 1QH0A 3OLQA 4KXUA 4UBLA 3IVAA 3I8XA 3D8RA 4FVTA 3HCNA 5FI0B 2EFEB 3CNLA 5CAEB 5C2JB 2XZDA 4BQRA 5L8VA 3WP1B 4RF5A 2V0GA 3FHLA 1XZKA 1ABFA 2O7NA 2JKVA 2C8LA 2VK8A 3IYLW 3OU6A 4F0JA 1J8MF 2H6EA 3LDUA 3W6OA 2PN1A 4PBRA 7REQB 2K2QB 3F5DA 3B6JA 4BNVA 1T8UA 2WZBA 4NNPA 4WX2B 5F73A 2V9CA 2YFHA 1NOJA 3FVTA 4INOA 4O3FA 3KVVA 4MR8B 4PZYA 4R8MA 3QVXA 3JWEA 3OFVA 3QE2A 3K0SA 3C3AA 1FS4A 3PR2B 3SG0A 4Z1OA 5KO2A 2NN3C 3TD6A 3L0IB 3F78A 1GQYA 1QPBA 4YP9A 3LCCA 2W2PA 5T4BA 2PLRA 4US0R 3R75A 3HO8A 1MORA 2HSZA 3A2MA 4J1SA 4N8SA 1QVRA 3WO0A 1PD0A 2GZ3A 1PUIA 4FYPA 2UYYA 1JFVA 4FFSA 4MEJA 4BNKA 3Q9LA 1ZSNA 1A8HA 3RADC 5H81A 3HGTA 3I73A 3JVDA 4KKVA 2XI4A 3C3WA 3S2SA 4GKVA 3DEJA 3RBXA 2W6PA 3AXTA 3KTFA 1ZGZA 2O8CA 2WAOA 4D9BA 5I9SA 3L46A 5L3ZA 5TGDA 4MWEA 4JDUA 4LVOA 1MC5A 1D9ZA 3FPGA 4BZQA 4CKXA 4WDQA 2QX7A 1RZRA 4YAFA 3ZTTA 2YHUA 2GPWA 5FOSA 4UTZA 1Z45A 2BKXA 3LHSA 1MUUA 2BGIA 1UPXA 3MOGA 4J4BA 5L3QB 1EXDA 1NMZA 2IOHA 3RHZA 3PNKA 3GGOA 2FR8C 3IUJA 2NVUA 3MLBA 4KBGA 1G20E 4RZSA 2IYSA 2A3RA 2R6GA 4HQRA 3SQMA 1FQJA 4NC9A 3FPFA 1H6BA 2Z2YA 1YE3A 4BMZA 4C0WA 3ADCA 3QF4A 4UEKA 3BBPA 4DCSA 2OGUA 1J70A 3K05A 3DNMA 3IMCA 4O4LF 4QVKA 5CH8A 1BXRB 4Z9BA 4ZU3A 2BRUC 2UZ0A 3VJLA 3WL3A 4JA0A 4NX2A 2X7JA 2GX6A 1O6CA 3P71T 2I4OA 3LHFA 4DA0A 2IYEA 1GGMA 2XTZA 4W1SA 4Z4QA 1AH2A