1IUNA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
ANLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords meta-Cleavage product hydrolase
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iunA00
3YASA 3C6ZA 2C0PA 3CXUA 4DNQA 1ACLA 4BAZA 4UHCA 5K3FB 5YASA 1JT2A 5HF6A 1MAHA 2B4KA 4G4JA 1HLGA 2O2IA 2IIVA 3UUFA 3ICWA 5ALGA 3EBLA 5LZ9A 1H23A 3DEAA 4DMHA 1JFRA 2IITA 1QIKA 3V1KA 3R40A 2PSDA 5IVHA 1VXOA 3WKDA 2XT0A 4PF1A 3VVMA 4BDSA 2HU5A 5CT6A 1AGYA 1GT6A 1L7AA 3ZLTA 5ALEA 4FFWA 5IH7A 1HPLA 1H22A 4X3CA 3WA6A 5ALQA 2ZJ7A 4XWGA 1VA4A 3ILSA 4FOLA 4Y2TA 5AM0A 3N2ZB 1CRLA 4AMZA 5CXXA 4G4IA 1ODSA 2CZQA 4FFVA 2BUBA 2PX6A 3GFFA 3LP5A 4HS9A 5AI8A 4KRYA 3STXA 5HK9A 4BCCA 4Q3OA 3NWOA 3H2KA 2QTBA 1MTZA 2OGTA 3UUEA 4U2GA 4Q34A 2WIDA 3HLKA 3WWOA 3BE8A 2OQVA 3F96A 3DOHA 4NZZA 2DHDA 4W1RA 4N8DA 5AO9A 1TAHA 1W75A 1W52X 4AXBA 1HBJA 5JIBA 5AJHA 5JZ9A 2X5XA 4BE4A 4Q05A 2WG0A 1XLUA 3IDAA 4P93A 1DU4A 4IH1A 3FSGD 5ALXA 3C87A 4EY4A 1IUOA 2BJHA 4KJXA 4H7HA 2AJDA 4H7EA 1S8OA 4B9EA 3M82A 2BGRA 1BCSA 1EDEA 4ZGBA 2WFMA 3E1GA 3L1JA 1OILA 2VF2A 5DNUA 1E8MA 1WOMA 2K2QB 2WLSA 5AIAA 4K6HA 1EK2A 5AM2A 1E8NA 4ARAA 3WJ2A 1XLWA 1TK3A 5AI0A 4BP9A 3RK4A 2XMRA 1DT5A 1ZGBA 4M0FA 1CUVA 4N8SA 2RIPA 3FWHA 4B85A 4X7BA 3D4LA 4DNFA 1K5PA 2WG2A 4W1SA 1DQYA 1TIBA 2HA2A 4CG1A 3O4GA 4MEAA 2WJ4A 1VXRA 3I1IA 1LLFA 1LPPA 1VZ3A 1XRLA 3ESCA 3EIOA 2ES4A 5K3BA 4N8EA 3EF3A 5A7FA 4INZA 5A7GA 2CUTA 1N1MA 2E3JA 3E0XA 4E14A 3VVLA 2D5LA 3DKKA 1R9MA 3K2IA 5A7HA 3V1MA 4P08A 5D6OA 3JWEA 2QXUA 5DLPA 3KXPA 5KWJA 3LS2A 3PICA 4ZV7A 3W06A 2O2GA 1YB6A 4J0GA 5AOAA 4JNCA 1M33A 5CRIA 1J06A 4L72A 4JYMA 5C8VA 1EB9A 1F0NA 2PU7A 3H18A 3DS8A 3FVTA 1ZJ4A 4QA9A 4LXGA 2CEKA 4FNGA 1UZAA 2XUJA 5ALNA 2OAGA 2VAXA 3IA2A 1USWA 1QO7A 3C8DA 5LKAA 3DL4A 1OCEA 2HADA 4MWSA 4OSEA 1SFRA 2VTVA 3FSGA 4H18A 2J3DA 1GPKA 4QDUA 5D3ZA 2Y6UA 5FXMA 4B7ZA 4OB6A 4D9JA 1F6WA 3IUJA 1ZOIA 4J0CA 3R3WA 5EHQA 3IBTA 1JJIA 1DX6A 4G9EA 1T2NA 1ZIYA 4G1FA 4QE3A 4LKOA 1CLEA 1P0MA 3GUUA 4C6HA 4X85A 4QWMA 3AJAA 4HRYA 3DYVA 3WK8A 4DSAA 1IZ7A 3O95A 3R3UA 4C88A 1XRNA 4X95A 5HF8A 4B80A 2ROQA 1E66A 1ZD3A 1F0PA 4ZV9A 5JD5A 2WKWA 4KAFA 4ARBA 5CT5A 3GZJA 3B5EA 1UKBA 5ALRA 5T4EA 3V1NA 1UK9A 2WG1A 3WWEA 5EHZA 3VJLA 1CUFA 1FFAA 1BU8A 2BGNA 3A2LA 2J4CA 4K6KA 4FTWA 4Z49A 1ZI6A 3OOSA 4GI1A 3KSRA 3KWJA 4DYHA 3JYHA 4EA6A 5CT9A 1JKMA 4UHFA 3DCNA 2QS9A 2XQFA 4IH9A 2J3QA 4B83A 1EDBA 2OGZA 3WK6A 5EHNA 3X3HA 1ZD5A 1XZEA 1VZ2A 5HK8A 5J3JA 2RGUA 3W9BA 2JGFA 2ONCA 2PM8A 1QIEA 5AK6A 2I03A 4JH0A 2QXTA 1G66A 4Q3LA 1MU0A 2BCEA 1H2ZA 3STUA 1XKTA 3DNMA 5JALA 5ALKA 5C81A 4BRZA 2FJ0A 4UBIA 2I3ZA 1EVEA 1O6FA 2CBGA 2JGMA 2WIFA 4AMYA 1QIGA 4UHDA 3AFIA 3VJMA 2JEZA 2QRUA 1LPNA 5DTIA 1ZJ5A 1J2EA 2YXPX 3I2HA 4QLOA 4Y2QA 4Y2VA 2R11A 1CEXA 5ALUA 1XQVA 5D3KA 1SCKA 2WHQA 5JAPA 4I19A 2O2HA 2PUJA 1GPNA 4RE6A 3G0GA 4UBLA 1QTRA 2Y2VA 5ESRA 2DHEA 2ZYIA 2XUHA 3H1AA 4G9GA 3I6MA 3R3ZA 5K3DA 3S8YA 5LZ8A 3PI6A 2HU7A 4AX4A 3DD5A 3IURA 1L7RA 1WHTA 4WCVA 1VLQA 5FPPA 3H2IA 3JW8A 1QIJA 1ZD4A 1AUOA 4J3JA 1GZ7A 4C4XA 3ESDA 4MWTA 2VEOA 4GDMA 4BE9A 3FCYA 4BDTA 3CCBA 3IUMA 1VJ5A 4Y9SA 4OYYA 2WQZA 2HIHA 4FKBA 4QWWA 1UWCA 2BAGA 1QOZA 4KAJA 2WFLB 4G8BA 4TPKA 1XQWA 3A2MA 3VKFA 4QDXA 4H7KA 1JU3A 2XMDA 3HJUA 2DSNA 2WM2A 3E3AA 2Z3ZA 1AX9A 5ALOA 5I7UA 4BRSA 1UOQA 3EQ8A 4G5XA 2DHCA 2Y1KA 1QO9A 3R0VA 1CUZA 1FSSA 1P0PA 4LYEA 4O08A 5A62A 5K3AA 5DYYA 4BYMA 1JI3A 1YASA 1RYYA 3WYDA 5JASA 2C7BA 5H3HA 2YASA 1N5MA 2HFJA 2XLCA 3G0CA 1LZLA 1TRHA 3WL5A 3W2TA 5CH8A 4WY8A 2ECFA 5EI5A 1QIHA 5CURA 3HSSA 1DT3A 1A8UA 2VJAA 1SCIA 1EI9A 3M81A 2VT6A 2D0DA 2G63A 4B0PA 5LP1A 2HA0A 3R41A 2C0QA 2ZVDA 1UXOA 1YA4A 3WJ1A 4TGLA 5AM4A 4I3FA 5ALZA 5AKGA 5AI6A 1WM1A 1B6GA 1KEZA 1XLVA 2JGEA 3O4IA 4DIUA 4J0IA 2HA3A 3H0CA 4FBLA 5DNVA 4HXFB 2O7VA 3G9TA 4Y2JA 1U4NA 2IX9A 3QPAA 2EDAA 5K3FA 1L7QA 4YX9A 3ZWQA 3STTA 1YS2X 4J0KA 4GBGA 1IZ8A 3DOIA 1QIFA 1DINA 2XUAA 4BC0A 4RNCA 1SC9A 4W9RA 1EXWA 5FKJA 5AK4A 3F9CA 1CR6A 3WIOA 3FYUC 3G8YA 4UBOA 4U2EA 1ODTC 3D2CA 1LPOA 5AK3A 3K6KA 2XMCA 3H2HA 3TRDA 1VE7A 2YYSA 5BOVA 1QTIA 5AM3A 4IO0A 2V96A 3WZLA 2WUEA 1R50A 1XKLA 5AM1A 2OG1A 1NU6A 2R8BA 5IVIA 2XUOA 4AN0A 3N0TA 4J7AA 5AHXA 1EK1A 3AIKA 4EB0A 1THTA 1CUCA 4KRXA 1FFEA 3HC7A 3ANTA 4CG3A 3PF8A 1CIJA 5KREA 4BCDA 3WK9A 4OU5A 5JARA 3HRHA 3SX4A 4UHEA 3FAKA 3QMWA 2XQGA 5ALWA 1R1DA 4XIIA 3FCXA 5BWBA 2VAVA 2AJ8A 4ZI5A 7YASA 1YSCA 3IUNA 4OB8A 1UT6A 1J07A 2RI6A 5EHXA 1EX9A 1LBSA 4BTVA 5DTJA 3D3NA 5T4FA 4H0CA 1CV2A 5JZBA 4U2BA 5T4HA 4G8CA 2XMZA 4FLMA 2CKMA 2G5PA 3QITA 1WHSA 3GA7A 5AIBA 3A2NA 3TEJA 2JF0A 4B84A 4Q82A 6YASA 4DGQA 4F0JA 4G4GA 5A6VA 4E46A 5HF9A 1A8QA 2CMFA 2XE4A 3I6YA 4FLEA 4HRXA 4FHZA 1ZGCA 2JEYA 5AKKA 3BXPA 1PV1A 3M3DA 3ZPXA 4ZWNA 3FLAA 2PL5A 3WLAA 2XUQA 3AIMA 5ALHA 5DYTA 1H2YA 1CFJA 4Q1VA 4F21A 1H2XA 2QJRA 3SK0A 1XZBA 1QJ4A 4Y7DA 1QFMA 4AO8A 2XMGA 5FV4A 1CUWA 3R3XA 5I8PA 4IQ4A 2WTMA 1CUBA 5JAOA 2PBLA 1ORWA 5LKRA 2PSEA 3M83A 3I2FA 1QIDA 5AM5A 2ORYA 1C4XA 5AKHA 1CUUA 3I6ZA 5AI4A 3T4UA 1NX9A 5ALIA 4AB1A 3KOOA 5IVDA 5ALLA 3BJMA 3B12A 4FLFA 1JJBA 3ANSA 4RE5A 1RP1A 2VATA 4L3WA 4NS4A 5FP0A 4DLNA 2QUBA 3G7NA 1CUJA 3Q8WA 3C70A 3DQZA 2WIKA 4LIPD 3BIXA 2GYWA 3WWPA 4BVKA 2GZSA 4H35A 5JD4A 4M0EA 3D2AA 5A2GA 4UFNA 1Z68A 3A6ZA 2GBCA 3I2JA 2WJ3A 4ZRDA 4X6UA 3A70A 2DCMA 1IVYA 2XUKA 3QYJA 5ALFA 1CVLA 5ALPA 2C5FA 3DDUA 1Q0RA 5AKJA 4J0HA 4BTLA 5HKAA 4PO3X 2ZYRA 2XUDA 3HXKA 1JJFA 5D7BA 3RARA 1EDDA 1B41A 4PNZA 3G9ZA 5AP9A 4A23A 1WB5A 3DLTA 2GBIA 2PSFA 3G0BA 1FFBA 5HCUA 3V9AA 4CG2A 4DMFA 4OB7A 5EIHA 4H7IA 2HA4A 5AI9A 4XVCA 4ZXFA 4WFKA 1EVQA 3U0VA 2GBGA 1VA5A 4X91A 3SWWA 1BN6A 3B3QA 3H2GA 5LZ2A 1QONA 1CUAA 1K63A 4WFIA 4Y2PA 4JYPA 3DYIA 4GEGA 1A88A 2G5TA 4FNMA 5AOBA 1UOPA 1D07A 2QUAA 3OPMA 2C4HA 2VJDA 3C5VA 4QZVA 5CXUA 2O7RA 4OD0A 2XMBA 4BVJA 2AJBA 4QDZA 5AOCA 2DQYA 5BWCA 4N5IX 2XB6A 3I28A 5DJ5A 4B9AA 5F4ZA 1TQHA 5A71A 2WTNA 2ZSHA 4N5HX 2WHRA 1TCCA 3PF9A 4UFPA 2V97A 1XZDA 5JAHA 4BC1A 5DYWA 2BUCA 3G02A 2PPLA 3STWA 5IVKA 3WK4A 1TCAA 1W1IA 4ZREA 1QLWA 2Z5GA 4X6XA 3HEAA 3F8SA 2XMQA 1IUPA 1CUGA 5IKXA 2WUGA 2ACEA 3BL8A 4KE8A 2Y6VA 2QZPA 1WB6A 3CCCA 1ZIXA 5JAUA 1H2WA 4F60A 2WHPB 1ZICA 2C5GA 3IIIA 3WKAA 3EQ9A 1XZLA 2ZYSA 5E4TA 4GHWA 1CUIA 1XZGA 4X97A 5ALMA 1C7IA 3PE6A 4AQDA 3GROA 2PKYX 4E15A 4HZGA 2EEPA 2RHTA 4I4CA 1FFCA 1XRRA 1FJ2A 2GYUA 1DTEA 4U2CA 1JU4A 1R9NA 3L1IA 3GELA 5C7YA 1HKHA 4A16A 1MX5A 2RONA 2H7CA 1LZKA 4DM7A 3R3VA 2XQJA 3I1YA 3KWFA 3IULA 2V98A 3U1TA 4KAAA 4PQEA 1BEZA 3HACA 3O4JA 1T4MA 3ESBA 1IUNA 3ESAA 4WDQA 4X92A 1LBTA 1ZD2P 1R4ZA 4XJVA 5EFZA 1BCRA 1ACJA 4MJ3A 3E4DA 5ISMA 4CFSA 5CH5A 4KYVA 2GZRA 1AQLA 1XRPA 5AH0A 2XUFA 3ZLVA 1K4YA 3WWDA 3FYUB 4UBMA 4G8DA 4UFOA 1C7JA 4QDTA 1AZWA 4HVTA 2WFLA 4RGYA 1BE0A 3PUIA 3QBJA 3K9BA 4DMKA 2DQZA 1XZHA 4H77A 5HFAA 3OG9A 5EIEA 2QT9A 1MPXA 2DFPA 3G0DA 1Y7IA 2OCKA 4BB0A 3WK5A 3LLCA 1G4HA 5EGNA 5FUMA 1AC5A 3W9UA 1QIMA 1ZI9A 1QE3A 2OQIA 1EINA 5CTAA 1TCBA 2UZ0A 1ODCA 2PUHA 3BIWA 3FVRA 4H7DA 3L1HA 1WCYA 4UBJA 5JYCA 2H1IA 3C6YA 2AJCA 1HQDA 1MX9A 3WQHA 2HFKA 2WUDA 1ORVA 2AXEA 1EB8A 3QMMA 3WL7A 4DMCA 2YH2A 1E5TA 1UK6A 4B82A 1SCQA 2OLEA 1E89A 3W05A 1UFOA 1ETHA 4BAGA 4CCYB 2W22A 4IH4A 1YS1X 3O4HA 2HA7A 2QR5A 3OTQA 5HQ3B 3AZPA 4Y2RA 4C4YA 3T52A 2Y2UA 2VSQA 4UHHA 3AILA 1MAAA 1LPMA 4ITVA 1GXSA 2XUPA 2LIPA 2OPHA 2WU4A 4AN1A 3H2JA 3HYSA 4YASA 1LGYA 1XZJA 1J1IA 5ALVA 4TVKA 1XROA 1W6RA 4WY5A 2WJ6A 3WKBA 1MJ5A 1U65A 4HAIA 1QFSA 1SOMA 2Z3WA 1DX4A 3V1LA 1U2EA 1BRTA 4UUQA 1CUHA 1UK8A 3BF7A 1W76A 4P9NA 2OCGA 4NVRA 1UKAA 4Y2SA 3WWCA 2WSLA 5LZ5A 3O9VA 2Z8XA 2VQ6A 5ALJA 4C89A 3F98A 5AKXA 3FBWA 1ISPA 1LPAB 1XRMA 3O9MA 1N8SA 3OC0A 4GLBA 1THGA 3BJRA 1DWPA 5BV7A 1X2BA 4QDOA 4C87A 1XZIA 3WL8A 3LIIA 5E4JA 2BUAA 1BEEA 1U8EA 2X76A 3AINA 2JGLA 4QEKA 2WU3A 4B0OA 2Z8ZA 5E2IA 3BDIA 2VJBA 3HABA 3Q0TA 1CUYA 5T4BA 3ICVA 1WB4A 2QOEA 2WILA 4X94A 4AO7A 3AIOA 5AKEA 1UK7A 2VJCA 3WK7A 2WIJA 5CMLA 1KU6A 3C45A 4U2FA 1Q84A 1RWQA 1YA8A 4LXHA 1Q0ZA 4J0DA 2DR0A 3STVA 1JMKC 3NGMA 5HF5A 3UMJA 3QZUA 3ZI7A 2AJLI 1OXMA 4EY6A 3DKRA 2H9YA 1I6WA 2JGKA 3DJYA 1XZKA 2PU5A 2QVBA 1MNAA 3I2KA 3PFBA 3AZQA 4AZ3A 3HZOA 4OPMA 4MXDA 1GKKA 1KU0A 3G0IA 1P0IA 2J4FA 1O6GA 1EA5A 3RKSA 3FNBA 2B9VA 1EHYA 2HRRA 2HU8A 3C6XA 4BP8A 3WKEA 4B81A 5ALSA 4XX1A 4HTAA 5LZ7A 5HZGA 3NOXA 1YR2A 2H7YA 3FLBA 4H7FA 2FUKA 4X90A 4OU4A 4WDRA 4CCWA 5ALDA 3IB3A 3WIBA 3O0DA 4CI9A 3W04A 3QVMA 4RPCA 2ZYHA 4OUKX 3WMRA 4WJLA 5SYMA 2ZJ6A 3RM3A 2H7XA 1F8UA 4KACA 4EY8A 5AKLA 4A5SA 4MQMA 5JZSA 3DL7A 4GECA 4L9AA 5KBYA 4L0CA 2ZJFA 4Q3KA 3QPDA 2HA5A 3ZV7A 5JD6A 2B20A 3QH4A 1VE6A 4KR0A 3FOBA 3WI7A 3CN7A 1TKRA 4M0MA 2X8BA 3C6BA 5LZ4A 5SYNA 4GXNA 3MUOA 3QM1A 4K5QA 4DNPA 2HL6A 1CUSA 3GBSA 3I2IA 1Q83A 1A8SA 3MUNA 3BF8A 4EUSA 2WIGA 1WPRA 1E8DA 4BCBA 2RHWA 1MNQA 2QKYA 4AO6A 5AKIA 3H19A 3IUQA 4J03A 2XLBA 2PSHA 5EIAA 5HFNA 4F5ZA 1XZCA 4YK7A 4CIBA 3FYTA 3G9XA 4QLAA 3QMVA 4UPDA 4MQLA 3PUHA 1MX1A 3D7RA 1W4LA 5KWIA 5AICA 4OCZA 4YPVA 1XQXA 3STYA 4W1PA 1K8QA 1HL7A 1MO2A 1XFDA 1YAHA 3FLEA 5CW2A 1JMYA 4PSCA 5AKYA 4EZIA 1CUDA 5FRDA 5JADA 2B61A 5JATA 4C4ZA 5HKBA 4AZ0A 1WPXA 1AURA 3ED1A 4MYSA 1QIIA 4PW0A 2JGJA 1LPSA 2I78A 3QPCA 2C58A 2Q0XA 2OCIA 4Y2UA 5DNWA 5FLKA 1XZAA 3CN9A 1CQZA 5JANA 4QNNA 2XMSA 4LHEA 1X2EA 4WFJA 5I9IA 3OM8A 5LIPA 5CT4A 4K6GA 1GQRA 2OCLA 4BBZA 2VT7A 4S0XA 3V48A 4MEBA 3OURA 2QMQA 4HXGA 3F67A 2OGSA 4W1QA 3S2ZA 5C8ZA 1AKNA 1UOOA 3KDAA 3LIPA 1AMNA 2WHPA 1K6EA 3VJKA 3WL6A 4Y2XA 2HA6A 1PFQA 2HRQA 4IHAA 4OYLA 4EBBA 5C8XA 1Y37A 2HHAA 4U2DA 2XUIA 3D5EA 2OXEA 4DSZA 2GBFA 5FOQA 3TGLA 1GGVA 4LYDA 4EY5A 3PDCA 4ETWA 4FBMA 4UBNA 1FFDA 4CIAA 5FDFA 2PSJA 1X70A 4EY7A 3AZOA 5LYYA 3MVEA 5ALYA 4BZZA 4KE7A 4DNOA 2XI4A 3SC2A 4UHBA 4JUIA 4J0JA 1XZMA 1UKCA 4EHBA 4FWBA 1VKHA 4BAUA 2OAEA 3HI4A 1IMJA 3C5WP 1YAJA 2PVSA 3WA7A 2W6CX 3EQ7A 2JGIA 2ACKA 3H17A 4GWLA 5DWDA 3FYUA 4KE9A 3NUZA 2VA9A 1CQWA 2CJPA 2RAUA 2BKLA 3TJMA 1GQSA 3H04A 3R3YA 2ZSIA 4FMPA 1GKLA 5AKZA 1GPLA 1N5RA 4X00A 4LXIA 3RLIA 3WKCA 2QJWA 5CBKA 1DWQA 1MT3A 4ROTA 3VDXA 2HM7A 1Y7HA 1G5FA 3VXKA 3KD2A 5AK5A 4UBKA 3D0KA 3VISA 2FX5A 4PSDA 3LCRA 4P92A 4JEIA 5FPQA 3D2BA 5ALTA 3C8HA 4C01A 3F97A 4KEAA 2QM0A 1NU8A 1ZI8A 2P8SA 2BFNA 5AI5A 5CH3A 4KE6A 1CPYA 1A7UA 2NW6A 4PV7A 1DQZA 4MYDA 1XRQA 1R3DA 3BDVA 3C43A 4X93A 1BN7A 4E11A 2WUFA 2XUGA 3WZMA 1QGED 4V2IA 1BROA 2V9ZA 3H1BA 3MGAA 4NMWA 4K2AA 1YB7A 4HXEB 4CCYA 1CUEA 4B6GA 1DWOA 1R88A 4PSUA 4FDMA 1P0QA 2GYVA 3PFCA 5HQ3A 1PJAA 1EH5A 1E3QA 5K5EA 5K3CA 5CT8A 4W63A 4X6YA 3P2MA 3WYNA 2I3DA 2WFZA 2XDWA 2XQKA 4BVLA 4X71A 3G9UA 1G42A 1VOTA 3BWXA 2G4LA 1CUXA 2FJPA 2JIDA 3AUKA 5LLSA 2EDCA 2JBWA 2HDWA 5E4YA 1MN6A 3IVMA 4GW3A 1XZFA 4DTCA 1HDEA 1LPBB 3D59A 4BZWA 4BATA 3ZLUA 1BS9A 5K3EA 2XQIA 3I2GA 1XQYA 2CB9A 1QZ3A 1YCDA 4H7JA 4Y2YA 1LNSA
chains in the Genus database with same CATH superfamily
3C5EA 1O6CA 4V0ME 4BQNA 2DULA 4C7JA 3MWFA 3AVWA 4BO0A 3AP3A 2RHMA 3WGJA 3UAOA 4LX0A 2C0PA 1L4NA 1LDYA 1JILA 5EXPA 4YR7A 2AN5A 3CXUA 1SKQA 2CYAA 2GO1A 5A5FA 3WR5A 2XXAB 4N3NA 3RT7A 1J2YA 4XE5A 5H7XA 4B6JA 2WWXA 2B2CA 4CF6A 5FI1B 3KYCB 2H5LA 3PYXA 4XVRA 4CKCB 1H8ED 1SC6A 1HO3A 1CIPA 1E9SA 2X8AA 3M1LA 5H4HA 4L57A 1FMTA 2H4WA 3C14C 4JI5B 1JT2A 2FKAA 2OCDA 2J9ZB 2Q5QA 4GR4A 4AI6A 2F3TA 1KWGA 3ILYA 2A1TS 1Z6GA 1HLGA 1N78A 2WYVA 2IIVA 4WI1A 1BJTA 5D3MB 5LD2B 4YT5A 3ICWA 1LXCA 1NYQA 4MYRA 1X87A 5ALGA 2DBYA 1WV0A 1TQ6A 3I9NA 1LTKA 1QORA 3VH4A 2YJTD 1JZSA 2QE7D 3PD7A 4FEAA 5H83A 3OOYA 1GKYA 4DMHA 3W6OA 5KSWB 1NSTA 3PNQA 2LR0A 2HLDA 4B6QA 1KO8A 1ZA2A 3GJ7A 1VCHA 1D6SA 3HA5A 1G0OA 1OXXK 3R40A 4K28A 4Y6RA 2EJWA 5JE8A 5B64A 4RZXA 1OLOA 1W85A 4G1CA 2V7EA 2VZ8A 4YRGA 7MDHA 1P4RA 1QGOA 2PWBA 4BDSA 1KTIA 2IVFA 2MSWA 4HH4A 4L5CA 2BHTA 2CJWB 1FNDA 5IDWA 2O0JA 2PL1A 2D2FA 4JLJA 5IDYA 1XJWA 5ALEA 2AE2A 3WV4A 3A6EA 5CEJA 3CSUA 2FSPA 4FFWA 2Q6IA 1X0VA 4M99A 3BSSA 3AM1A 1H22A 2FHPA 1AKTA 4RTJA 1VA4A 3D4OA 2CNDA 3BAFA 2F90A 2R7KA 3VPSA 3I37X 4IXNA 4Y2TA 4DV0B 4K3UA 4L5AA 2RI1A 4P3NA 1L8OA 2OA0A 3RQIA 1W5AA 4K26A 3GJZA 1R4AA 4Q0MA 5CXXA 3TSOA 2PN1A 2VWGA 1Q11A 3UZUA 1G8MA 1ODSA 2P79A 1I01A 4EG1A 1EDOA 4JUDX 4UU0A 4A0HA 3HXLA 3A4YA 3O74A 5HE8A 4TSRA 4D3SA 5BMOA 3LUBA 4ZQHA 2VAWA 4NE2A 2ZB2A 1PI3A 4AJEA 2HI0A 3DFZA 4QJBA 2J5BA 3LP5A 3HXQA 2V54A 4XPIB 4YRDA 3T95A 3FFBA 3GJRA 1ZK0A 5JNSA 1MD9A 2R6HA 3F8TA 2F1HA 2IXAA 3NT4A 3OOJA 4KYUA 1SUFA 4W8OA 1DTWB 3EVDA 2I6FA 1C9JA 1LH0A 1XSEA 3PX2A 4IS2A 2C7GA 4D5GA 2BZGA 4N6OA 1PS9A 4A6EA 2O0LA 3TECE 2OGTA 4EG0A 2HJRA 2NNLD 2GM4A 2B1QA 1U2TA 3LNCA 2B6HA 4J9UE 1MO5A 2WIDA 3BX1A 3PQ8A 3LOUA 3WWOA 3BE8A 2V6FA 1I1HA 3TD2A 2EGHA 3I9MA 3INNA 5I7OA 5HBGA 4BBAA 2E18A 3SJBA 1Y8QA 4XYLA 4NZZA 1FDRA 1AGNA 4N1AA 4CIVA 1P5FA 4MWBA 1ZH6A 3FRHA 3TLGA 4K40A 4DBVO 4R2WA 4TKZA 3OESA 3L6OO 1DJNA 4K9KA 4TKUB 4DILA 3V2GA 3V33A 1DKLA 2HSDA 1IQRA 3WBKA 2JK1A 4AXBA 3E8SA 4PG8A 3D02A 1LBEA 1NHGA 2HCRA 1CRZA 1OWPA 2OMKA 3AY0A 3PQ5A 5A4KA 3ENNA 5K0CA 4ARSA 3ZD6A 3QEMA 4PAOA 1P7ZA 2XCOA 3DOOA 1JEJA 2X5XA 3CVXA 3QKTA 1OLSB 1OOEA 1IY1A 3L18A 4HEA1 4BE4A 5SZKB 3R7SA 2QTMA 4TQUS 2Z4RA 4M9ZA 4P93A 2OZKA 1GKUB 1GITA 1PU2A 521PA 5B7PA 1TVKB 1INLA 1IJEA 5EJAA 4CXMA 2AKEA 2A4MA 3N7TA 1C8KA 1IEQA 1NMSA 2OV6A 1NJSA 2WVHA 1BFUA 1RFGE 3ZEIA 1IUOA 2BJHA 2PQ2A 3BDAA 3DL0A 2ATXA 1S1CA 4EB8A 1P1RA 1GGJA 3KCQA 1Q77A 1K08A 1YCHA 2XTNA 2OBNA 2R751 1S8OA 1JR4A 2P62A 2V59A 2X3YA 3O8BA 4Q24A 5E7QA 3T94A 3EN0A 1BCSA 4Z54A 5AW1A 4DUPA 4QFBA 2D2XA 2FU5C 2W43A 3I5XA 1WUJS 1ENOA 1DQSA 1IZZA 1HDOA 1NFRA 5AVJA 2CDNA 2K2QB 3FTPA 1QCCA 4R1SA 4JWTA 1ZUNA 4LK2A 2VC2B 2KWIA 2J6IA 3H4TA 1QAOA 1ZK2A 4R1LA 4UTVA 4LRUA 5C8YA 2W2LA 4K6HA 4GL2A 1EK2A 5KSPA 1H1DA 3EUWA 4NYJQ 5AM2A 1JQAA 3AESB 3WJ2A 4WBNA 2NG1A 3Q2OA 4IDBA 5HRCA 3A6LA 4ROSA 4DLAA 3VAYA 3BWDD 2FPMA 1TK3A 4FMDF 1BXGB 4TTVA 5I5GA 4EFNA 5LLTA 1DT5A 1U5CA 1G2PA 3LM8A 1A5TA 1CUVA 1TLFA 4XOIA 4Q00A 1JIJA 5TGTA 4FS8A 3TSCA 2P9HA 1HEUA 5J2TF 1O5OA 4X7BA 1B23P 1BWPA 3BEDA 4KQJA 3JS5A 1E20A 1J2TA 3WWZA 4HUQA 4PCUA 4W1SA 1W5BA 3DGFC 3I30X 2HA2A 3NTQA 2OHGA 4NOMA 4CM4A 2A5FA 1LU9A 4YV7A 3AHFA 2PMWB 3O4GA 4JT2A 5E6UB 3SP1A 4JJ4A 1FVOA 3T54A 3ZCXA 1YZQA 4IEFB 3P32A 1VXRA 1E77A 3DEFA 3I1IA 3UW1A 2PH1A 4YS6A 3DZDA 621PA 1I7SB 1N34B 1TL7C 4EHDA 3QUSA 3EIOA 4Q3BA 4LY9A 4GOND 4C4RA 2DWPA 2BEVA 2QRPA 2W5UA 4KBYA 4OA5A 4GQIA 2PX2A 3URMA 2XCUA 1KQ3A 3RS8A 1PUIA 3FWNA 3EJ6A 4NNJA 1AXRA 4IMIB 4IHJA 5A7FA 4S1WA 2CUTA 3DW1X 2HDNB 4D0GA 1PGNA 3R4CA 3PNOA 2J6CA 1CJBA 4RKQA 1G5PA 5JFOA 1XZQA 2XF8A 3CRVA 4JUCA 3E0XA 1XF9A 1XRJA 2AW3A 3W2GA 4E14A 2V7BA 1H1TA 3TM4A 4Z1OA 1Q7BA 1DO0A 1FLDA 2YN0A 3QXGA 4NG5A 4XDYA 4L51A 2EG5A 3WGNA 2IEAA 3K2IA 5AVTA 3U7JA 3V1MA 4AG3A 1YZYA 1JE1A 5DHRA 4XPZA 4WUVA 2QSJA 3AV0B 3WOVA 2NV6A 1G38A 1XPUA 2V45A 3OPXA 2NO5A 1L4HA 2XGGA 3UXYA 3AF2A 3HB9A 1ODFA 5ITSA 2Q8NA 3V8BA 1RJDA 5CUQA 5IMSA 1U7WA 5K7SA 1XTRA 1FX0A 1B93A 1ECCA 3ZY4A 3AI2A 5KWJA 4F3CA 2VBCA 1D4AA 1NDQA 3OTWA 4KDRA 4PTYA 2AFHA 4ZV7A 3RJ9A 3V7UA 2ZITA 2FOIA 3GEPA 3QTLA 3KBOA 5KNLA 1M33A 1BX1A 4Z2YA 2GXSA 1JHZA 5CRIA 4MAFA 1Y7LA 3QGMA 5IKMA 2GZ3A 2AFVA 2PUCA 1E2MA 4F2WA 4JYMA 1KOFA 5K8VA 3QNUA 3AGQA 3OY7A 1JEQA 1EB9A 1VYUA 4GBMA 1E2LA 2Y99A 2O7SA 1QYDA 3DS8A 3KKPA 3FVTA 3KU4A 5K0JA 1UJCA 3HGQA 2JKVA 4GVXA 2AKAB 4JSYA 1QP8A 3W77A 3GMTA 2UZ1B 2OXCA 1XXHB 1XNHA 4FNGA 3RS2A 3VNVA 4EFKA 1J8FA 3W6NA 3VU0A 2PWPA 1D3AA 3FYCA 1NHWA 1SUAA 1ADYA 3ETEA 5B3JC 1X1AA 1KP9A 4RO0A 1UP7A 4Y6OA 4JS0A 2ZI6A 3UKOA 3U31A 3P4UA 1P1KA 2R5NA 1YKFA 1H4TA 1G1AA 3PQ6A 4L85A 5LKAA 1KEEA 4DLTA 4MWDA 1BSVA 1KY4A 3B89A 1N32B 2HADA 3DXZA 4R2XA 1IQUA 1E58A 1WDLA 1OT3A 2Q1YA 1L0BA 4MWSA 3O8RA 3I39X 1KJ8A 4GPBA 4YJHB 4MDEA 1X7YB 4F8JA 1SFRA 3FUUA 5KMGA 3BB3A 4UEOA 2PJRA 2VTVA 2DTDA 2Z8YM 2VUSA 2VIIA 1CE8A 4EPXA 1M1YA 3KOXA 4M8IA 1M2NA 1V2HE 4JDPA 4PZUA 4RANA 4DMMA 3R6DA 4QDUA 2FTKE 2V9PA 5D3ZA 4ZDJA 4DV4B 1Z3IX 3DHYA 4OB6A 4GUDA 1I2AA 1ZOIA 4F97A 4TKMA 3PJGA 3FYDA 3G2QA 3R3WA 3CEHA 3MMNA 5KVCA 4Y6PA 3TI9A 3J81k 2NU9B 1JWAB 1YFKA 1ZIYA 2ZTMA 2ZUUA 5HDQA 5AW9A 3D3WA 3UHOA 3ZWNA 4C3ZA 2CVZA 4F4UA 2VQDA 1JH9A 4NOLA 3GLFA 2VG8A 4LKOA 2J08A 1TJ3A 1O5TA 3G2PA 4WIAA 3TRIA 4N6GA 5BSWA 5E9WA 5JT1A 2OYSA 4KX3A 3WTBA 3KXDA 5L6MB 2GQ0A 4BV3A 3X2SA 1EM8A 4HRYA 4YCBA 3VOTA 3DXYA 3I8OA 1DKRA 2VSOA 1N7HA 3BB4A 1YR9A 1VKJA 4FN4A 4N4AA 3ANYB 4R1OA 3WP1B 1M6EX 4DSAA 4C88A 1GNVA 1L5FA 4FZVA 4JLAA 1BXZA 4XDZA 3VDNB 5JVDF 1DGQA 5L3VA 4YONB 5JO9A 3VNBA 3KKEA 5EVJA 3U61B 5HF8A 5T8KC 2QSUA 4BV9A 1K89A 2XNSA 1E66A 3EH2A 3JVIA 4NCIA 4L7VA 5CLGA 4BNNA 1ZD3A 1Z62A 1JDZA 3QMPA 1F0PA 3L0IB 3SE0A 3SMQA 4BNZA 4DQUA 1AGXA 2OCXA 4KAFA 3TN7A 1RYBA 5CT5A 4ARBA 3GZJA 3O84A 4X60A 5GOTA 1G5TA 2PS3A 3VO2A 1G4UR 2GFIA 3T34A 4AZSA 3Q98A 1UK9A 5E3HA 3KFVA 1MCZA 1PT7A 4LPSA 4ZTZB 1Z38A 3VJLA 2ZM5A 4XTCS 3UV3A 1KMIY 5FEUA 3A2LA 2HJWA 3AFHA 1OZFA 4W5JA 3OO0A 3Q5EA 4GKJB 1ZNYA 1IJBA 1X7HA 4HO1X 4L4XA 4Z49A 5KNCH 2IIQA 1ZI6A 5FTWA 2IYWA 3O8DA 4K6OA 1P1IA 1ZEMA 1NMXA 3MA0A 3DUWA 3LE8A 3ZDBA 1FNSA 2WI8A 5BT9A 1KHTA 2BTEA 2PYDA 4JGIA 2H8KA 5AW7A 2WA1A 1DAIA 4Q3AA 2JZOA 3PFWO 3R8XA 5TQ2B 4PO8A 2XQFA 1RAHA 1Q3HA 3IESA 4IH9A 4MV5A 4A2WA 4BQEA 2O8BB 3HUUA 5K8IA 2OGZA 4R83A 1UPAA 2FEXA 3OIWA 4S1TA 3X3HA 2QEQA 2D1TA 1Z6XA 5H81A 1O9BA 1YL6A 1CJMA 3BCSA 3IEKA 3R4VA 4IIDA 3T35A 2JVKA 4G1UC 5HK8A 1B8OA 2IZ1A 6PFKA 4B2LA 2ZUWA 4LC0A 5AT1A 3Q85A 3ID6C 3NC1C 4U6QA 4P7BA 5GY7A 4GICA 1UPUA 2ONCA 3O47A 2PM8A 3MOGA 4IIVA 3ZEAA 1QIEA 1T3GA 5AK6A 1NFFA 4PAMA 4RKRA 3NBAA 3VSCA 4HNQA 2AMYA 1KE2A 1I3MA 1Q1AA 1MUUA 2FZ5A 5HKKA 4QKQA 1Y6FA 1YJQA 5TDHA 3RRFA 2PX3A 1N2SA 1F1JA 4DA8A 1M0TA 5DRYA 1NZJA 4LRTB 5E6RA 2WAMA 4DPLA 2VP5A 2N1BA 1Y5LA 1FSGA 3NR2A 3NEPX 2JVJA 2OKGA 1BQEA 1YXMA 3PUKA 2FJ0A 2FSFA 4TTQA 4R54A 3RS5A 3PL5A 2CBGA 2JGMA 2VHCA 4I9GA 1Z07A 4K05A 2VTBB 3QEBZ 3HLYA 1G20A 2HF8A 3BMCA 4Q1EA 2QP9X 4YMHA 1DFGA 3PHHA 1GG5A 1NOIA 2GZAA 3AFIA 1PJ4A 3VJMA 3IKTA 2JEZA 3OU6A 1UQTA 1REQB 4RGVA 1W36D 4PN3A 1LB1B 5G4KB 3L1UA 3I8XA 5B55A 3BKWA 1TW2A 2VKQA 1KNXA 2REQA 1SO8A 3WC4A 4B71A 2I0FA 1YE5A 3FJYA 4QLOA 2HLHA 4EELA 4Y2VA 3NJ8A 5JMTA 1F4PA 3DZBA 5ALUA 2RAVA 3ABRB 4WEOA 3BT7A 1ZHHA 5JMPA 4DFDA 1N6HA 5GTDA 3TXAA 2WHQA 3W3AA 3T38A 4PPGA 3TRFA 4LXQA 4ETMA 2O2HA 3ESXA 3FFTA 3T7RA 1AT1A 4CJXA 1AZSC 3RVRA 3SYTA 4MGEA 3GLFE 4I3HA 1F5SA 2QRVA 3F2VA 5TC4A 1NN0A 1M2VB 1P7WA 1THMA 4MZDA 4QYWA 4ZHQA 2VF7A 4FW8A 3THOA 2C1ZA 1A1VA 3KAQA 5ILQA 3SHWA 4KPGA 3CLRC 2XUHA 1RXUA 1UWKA 3KWMA 4CQLA 4TTAA 3OQBA 3KQNA 2PZFA 2C03A 3H1AA 2NU8B 4CV2A 4UNQA 4JJIA 3GOHA 3I6MA 3GLGA 2Z1NA 3WB9A 3F0TA 2I6UA 4O25A 1PT6A 1XVTA 2A9QA 2OOKA 3ELWA 2UZ3A 5K3DA 2XB9A 5IAOA 1PYOA 3ICPA 2FPUA 3T3EA 4F12A 3HTXA 4HFJA 2VZ9A 4ENSA 3SF8A 1E0SA 4P4LA 3TZ6A 3CUSA 4LZJA 4DLZA 3FLMA 3ZHBA 2QORA 4D4GA 3PPXA 5BN4A 1F0YA 1ZSVA 4AX4A 1OROA 2O0HA 4E2WA 3HWWA 3DD5A 3IURA 3DJFA 5TRTA 2BLLA 3X1XA 3LBIA 2IS1A 1BE6A 3KQKA 1FTSA 4LYYA 1T3LA 3IA7A 4IS3A 1NNI1 1XA0A 5IYZF 5AW2A 1Q7CA 2W6JA 4EVSA 3AG5A 1JKIA 1RHMA 2JZCA 3ROTA 2QENA 4MWTA 2DGDA 1EFVA 1BWSA 4LC1A 3B70A 3FCYA 1YHZA 3LPAA 1TKAA 3FTEA 3FVVA 5EAIA 1ES9A 2HO4A 4OYYA 2IEIA 4DMLA 1VSQA 2HIHA 3P9NA 4F6RA 4FFBA 4QQ8A 2P5YA 4UAVA 1ILWA 2A9OA 4PQGA 3RRYA 2FEKA 2G77B 1T2VA 2BT4A 3KKNA 2OGWA 2BM1A 3UHFA 4CETA 1WR8A 2WFLB 2VEDA 1PT5A 1K88A 4JC8A 4TPKA 4AJPA 3PJEA 4ND8B 2X7XA 4ER7A 1PV4A 2G5GX 3PNYA 3VKFA 3X1JA 3QXHA 4JXKA 1N9GB 1GPUA 4YP7A 3VU1A 5JSYA 4YRJA 1OI4A 4H7KA 4TSKA 1UP4A 5K03A 2W2KA 4D4JA 1WQ4A 3MRSA 2CNNA 4HVLA 1PUXA 1WWKA 2JLAA 4BKQA 1UZMA 2Q50A 2AFHE 1X3SA 4I4IA 2B1GA 2GFHA 5K20A 2ZYWX 3E3AA 2Z3ZA 5ADWA 1FSFA 4EEKA 2VHYA 1J8MF 1B8NA 1RI3A 1JMVA 2ZTHA 1W88A 5ALOA 5TQVA 2F55A 1IY0A 1QHSA 1E9AA 3Q7TA 5BSTA 5EUQB 2HDHA 3ENKA 5BWOA 2YWDA 2JAPA 1M7GA 5FR1A 1VJ0A 3EQ8A 7ADHA 1P91A 3UICA 3ASYA 4KX5A 2Q4BA 4WOKA 4OH1A 1UBSB 3V97A 1ZS9A 1F2TB 1NR7A 1QO9A 2AXQA 3NWBA 5A0VA 1T35A 1F48A 3MOSA 1GAWA 1FSSA 3HCOA 1GNLA 3T99A 4IRUB 1YRWA 2RSLA 4K2HA 4O08A 2YV4A 1PLJA 3JQ8A 1MJGM 4BYMA 5F5XA 3HXMA 3Q6IA 4K9LA 1J0AA 1KI6A 1M9NA 2HK9A 2JHPA 3LBAA 3EXG1 5E2BA 3EMVA 3TFWA 1X8LA 3M70A 4BGUA 3DV2A 2B4YA 4KR2A 5KHLB 3H5AA 5H3HA 4Q01A 4PVDA 2ANCA 2GM5A 3AEQB 1N5MA 1R6BX 5FF9A 4ALNA 2XLCA 3HDGA 2XR1A 4ZRNA 1PR2A 1TZJA 5A9RA 3DLIA 4BNTA 3NHRA 1A9XB 1OHHD 1SD2A 1ZM2A 3CIFA 4KQ9A 4BFTA 1FNNA 2ECFA 4PYMA 5ITVA 4Q4AB 1L1FA 4LGYA 3OMLA 4MUMA 5LQAA 1XPOA 4UNNA 3D6UA 1V1MA 1XAGA 2EJUA 1LDBA 3R5HA 4O8ZA 3LZCA 4O4HF 4ZJZA 1EEHA 4I6EA 3VUEA 1M83A 1M1YE 1SCIA 1EI9A 3F74A 3ZE6A 2D0PB 3M81A 4D56A 2G63A 4RADA 4EABA 5KTNA 3RFVA 5LP1A 3QYFA 2INGX 4YQZA 2FW1A 2IEYA 3R41A 4QRHA 3SY8A 4E5MA 5B5SA 3QFRA 5AMXA 2I2XB 4PFSA 2V3CC 3L7BA 2IF2A 1QQ6A 4GLJA 4JKYA 5B4VA 4LDJA 5AM4A 3WGOA 2BFAA 2PO5A 3CYFA 4JP3A 4ZQCB 1OBVA 5A5EA 4NABA 1HX7A 3OM0A 1PVVA 4P98A 2H2AA 1F4VA 3KJZA 1WM1A 1ZA1A 1B6GA 4TV9A 2WF8A 5AI6A 5C1IA 5AW4A 3O4IA 4NEGA 3M6WA 3NANA 4HXFB 2AZTA 2I6GA 4FGLA 4QM7A 3H5RA 3F90A 3HR4A 3WGKA 3K9GA 1SQFA 1YZHA 1ZGAA 3G9TA 3RIGA 3TXYA 1RQLA 1U4NA 3LHSA 4IVQA 4IF6A 1DRKA 3A32A 3L9WA 1ZH8A 2I99A 3UK7A 2D2EA 2EDAA 3N76A 3PBKA 3O93A 1WL8A 1ZM4A 1S9HA 3WGQA 2JCYA 3K35A 1EJ0A 1NUPA 3LX4A 3LUPA 4YX9A 5J4VA 4CEHB 2V7PA 3HJNA 4J49A 1B3BA 3PEEA 4J0KA 3OJWA 4GBGA 3TLZA 2XIJA 2QM3A 2BVNA 4OXRA 4R81A 4YB8A 1P1JA 1QIFA 3OIVA 2BZ0A 2QN9A 4NXMB 4UTOA 1ML3A 4IVNA 4RS3A 1G291 4RLSA 2XUAA 5DHTA 3C8MA 4U00A 1GL9B 3T4EA 2D06A 3BE6A 2ONYA 2W6PA 4BC0A 1SC9A 3OETA 4FYWA 3RRBA 4HZUB 1ZOPA 2ENWA 3DB1A 1EXWA 1JV2B 3UCEA 2HMUA 3JQ7A 3KHUA 1Y5RA 3MRTA 4CM9D 1F2UB 3IIKA 5HSGA 1DJMA 1IONA 4KOAA 1QH8B 1Q95A 2BMJA 1QFJA 4XYGA 2C7QA 5DK6A 4K9PA 4JOSA 3SS9X 3CWZA 3TW4A 4WERA 2PD3A 3G8YA 1FU4A 4UBOA 4U2EA 3L07A 1R8JA 5JJCA 3IALA 3UMFA 1HK7A 1TB4A 2JFXA 3H2HA 1VE7A 5JH7A 1FJGB 2YYSA 2COKA 5BOVA 1QTIA 3R9XA 1IQPA 2BEKA 3EXHC 3L8GA 4MW6A 4XR9A 3WYCA 3OLCX 2Q28A 4JT8A 1NV8A 5BPFA 4DDTA 1Z06A 1V8PA 1ZN8A 3NHWA 5AM1A 1MOPA 4AKTA 5ILOA 4AN0A 3D5QA 4GPIB 3N0TA 2FPGB 1JFTA 2EG9A 3G8BA 3SNKA 2ATVA 3ZE7A 2IOHA 4X63A 5M34A 4FI3C 4E2XA 3VR6H 2W6MA 3DC7A 5KQRA 1RWPA 1S2NA 4KVFA 3PT5A 3HC7A 3ANTA 4G65A 3WNZA 3PF8A 2LW7A 3FUCA 3MNFA 4CG3A 3CX3A 3W8FA 1MDFA 1VLMA 3WK9A 3L7AA 5KDOA 5BO5A 4BZPA 3AI1A 2ZSAA 4ILEA 4B47A 1CERA 4PYJA 2Q5EA 4J7UA 4C29A 2XXBA 4KU4A 2AD5A 4D4LA 5KSYA 4LV6A 1W94A 3AP2A 4IUYA 2WU8A 1G20E 3FAKA 4OMUA 5CVVA 3RQSA 2OPBA 4PC6A 3TI7A 4BV8A 2Q4DA 4UJ5A 2XQGA 4WCFA 1U7DA 5D5PA 2K7FA 2E48A 2R97A 1D0VA 3FNFA 3MIIA 2VYVA 4IFEA 4JEMA 4PR0A 4U2KA 1KYWA 5F21A 2Q3LA 4CODB 2RGXA 3TSZA 2PXAA 1DBIA 4GMHA 3ICQB 5BNZA 2VAVA 5I9LA 4ZI5A 2C9YA 2J31A 5TE9A 3J7TA 1YSCA 2C9DA 3ZBPA 4MGIR 2VWPA 2JFQA 3V7WA 5C5CA 1OGJA 4R84A 1Q3KA 1PVOA 4RY8A 2C2WA 2GMWA 4G5GA 1A82A 3I42A 4XYMA 2FF7A 3BXXA 3ET4A 4GD3Q 1R9JA 3VBEA 3VNQA 4AG6A 4CYMA 9ATCA 5GV7A 3EVGA 4FE3A 3D3NA 2D1RA 1DIOB 1YRAA 1DC6A 1EYZA 1BWQA 2O5RA 2IDJA 2WVGA 3A6FA 4XKJA 2JJ2A 4ZAVA 1RMTA 3UOWA 3DT9A 1VCMA 1B2RA 5T4HA 4G8CA 4NONA 2XMZA 1O87A 3K73O 3GFRA 5IS2A 1N0UA 1QX4A 3BXHA 1X77A 4QGBA 4HGZA 1NWHA 2OQRA 4RPGA 2GAIA 4C4AA 4F04A 3SBOA 1L8QA 1PVDA 3OU7A 2A2ZA 2IXDA 2WYUA 3QKUA 1GTZA 2FR0A 3GA7A 3KD3A 1K2WA 2FPSA 3OZRA 4AJNA 5AIBA 1C3XA 4IP0A 5DBGA 2ZJYA 4RZHA 4UHJA 4XR4A 1XN4A 3R9KA 3IE1A 2QLJA 1PWZA 2ADFA 4Q15A 1X6VA 2XWPA 1S5PA 1TECE 3QE3A 5JC1A 2A5GA 3ZCQA 4MV7A 1PNRA 1E2BA 2B4TO 2EXXA 2VYQA 2JASA 3DP9A 4F0JA 1VDZA 3PNPA 4FUQA 1VPWA 2O8FB 4D8YA 1IBRA 4E46A 2EQAA 2WAAA 4D3YA 3PU6A 3AVYA 4RMGA 3UAVA 5ES4B 1VYVA 2CWDA 2XE4A 5TB5A 1KFKB 3MHTA 2H17A 3BBLA 2W7TA 3A0UA 2R79A 1ZM7A 4QL3A 4QICA 5JPCA 1RZRA 1FFSA 4AZ3B 4D2IA 2FB9A 4GM4A 2IHUA 2EWVA 3WGTA 3ZW9A 1OXBB 2R60A 2VPYA 1GZ6A 2JIZD 1H0RA 3VBCA 2B25A 1E63A 1ZGCA 4GRIA 2ZSBA 2KSQA 5AKKA 2HJ9A 3BXPA 2PFSA 3SICE 4V03A 4GOXA 6NULA 3AUXA 1HORA 1GEEA 2W37A 3K6JA 3PC8C 4YI3A 2XUQA 3AIMA 3DMRA 4EFMA 4HB2A 5DASA 3GJYA 1X13A 2Q07A 2ZIFA 5LYJA 5JBIA 3QVLA 3ZGLA 2O19A 3MT9A 3EWIA 3RYTC 4LDZA 3AY3A 4LN1A 4TOIA 5I7HA 3RRNA 3SVTA 5KIAA 4ZEWA 1T8SA 3CXRA 2ZR9A 4GX5A 3DPIA 2Z6VA 3SK0A 1FDWA 1URPA 2ZRGA 3FB4A 4ILKA 2F17A 3LECA 4JHXA 5D1HA 3TZCA 4L73A 4ZYWA 3WRXA 4OF4A 2CFTA 2X9NA 4NV3A 4PNEA 1T10A 3IX7A 1O8CA 4NCKA 1K92A 1T5IA 2AW5A 5FV4A 2OXRA 3KJEA 4BNDA 2PX8A 3SYNA 4JGGA 4LE1A 4DWJA 2I66A 3AEXA 1RRCA 4CBVA 1YJ5A 3S1SA 1JTVA 1NQUA 3DBLA 2WKPA 1ORWA 1JLHA 2FZLA 1PG2A 3FPSA 1JVBA 3I2FA 1QK4A 4MW5A 4BB9A 3D6VA 3ENQA 1ZU4A 2C7VA 4BKOA 3PHIA 1ENPA 1QIDA 3BKXA 3DVLA 3LF2A 4FCTA 1G5HA 2V7UA 3JAWA 4GMFA 2A4KA 4DQVA 1AKMA 2ORYA 1BHQ1 3SDZA 4C0LA 1TYEB 1CUUA 1JQJC 1H9BA 1PWHA 5EHIA 5DLDA 1EXVA 1KMHA 1II8A 1PDWA 5ALIA 1AZTA 2CDBA 3WLFA 4MV3A 4OA8A 3GLIE 4HGOA 2YJ5A 5IVDA 4QU9A 1G8KA 2MMCA 4NU0A 4X45A 5MGNA 5DYGA 1G41A 4FLFA 5KCZA 1CZRA 4YUVA 4F9FA 1ZAYA 4KNWA 4RE5A 1L5QA 1U0TA 3CNBA 4AJ1A 1RP1A 1J56A 5EUMA 2XA1A 3QSYA 5J4HA 2D6FA 3K30A 2G5CA 4M9UA 4PXYA 4LNUB 4DLNA 3FZGA 1W2WB 2ACWA 3Q8WA 4QXPA 2BBSA 2XSZD 3NTLA 1T1JA 3KUCA 3ONWA 4KVZA 1D2AA 4HUQB 4LIPD 1FP7A 3BBPA 3MCZA 5CCDA 3LWZA 4JAVC 3HCAA 3KALA 3DEJA 5JD4A 2RGBA 4Q3EA 1A95A 4MTCA 3GFTA 5U4XA 2EL7A 3C1UA 3I76A 3M9LA 5FBKA 1QK3A 2WKRA 2WWTA 3C3WA 4UFNA 1PBTA 4EH1A 4ITUA 1V0JA 4URHA 1P5ZB 3A6ZA 3B8EA 3QF4B 4WK0B 3I32A 1IWBB 4TYMA 4JA0A 4ZRDA 4X6UA 1HRDA 2DF8A 2W9XA 1OFTA 2BBOA 3OJLA 5AFSA 1EXMA 3GV0A 4EJ0A 2Y66A 2PIDA 5ALFA 1AB6A 2PUAA 4Q4HA 3OQIA 1AKWA 5KSZA 1NNUA 3GCDA 4Q21A 2WZCA 3ER8A 1Q0RA 1YIOA 1UWVA 4F3TA 2NUPB 5AXBA 2UVDA 5AKJA 2ORED 1ZOLA 4RVOA 3WMGA 5IJ0A 2Q8QA 4ALMA 4UMVA 4DXHA 2GVDC 1N75A 3D8TA 1E3WB 2B1JA 3AY7A 2IXTA 3FPEA 4PO3X 3FWYA 3KIPA 3P0JA 3ZQJA 1V6CA 2J30A 2IHNA 3VM6A 3CRRA 3EFOB 4ZAFA 2CNBA 1EDDA 2O3TA 1P9WA 2DPGA 3EVFA 2VTEA 4MS1A 4HWTA 2G8LA 1EHCA 3G9ZA 4FYHA 3U7FB 5L3SB 1OFHA 1WB5A 1WCXA 4AFNA 3ZZ1A 3MM4A 3DTYA 4OL9A 2YW2A 2NGRA 4GH5A 3VPGA 1N2BA 2PSFA 2QTVA 1F12A 4IIGA 5DFAA 2PWYA 1FFBA 1SKYE 3TW8A 4EG5A 1S2MA 1D2MA 1JDUA 4Y18A 1B14A 1E1DA 3PJFA 3T5AA 5I47A 4MO9A 3VTKA 3PFGA 4MB2A 2GHIA 4ZU6X 4E12A 4ERXA 2C4UA 3JTEA 4DV7B 5CPFA 1OYVA 5JCXA 1VI2A 3HJFA 1EUZA 1DX9A 3LA6A 1DRWA 4QD3A 1EVQA 1N9KA 4PHGA 2ZE8A 2DKFA 2ZYAA 2VH2A 4RVNA 2VF4X 3LYUA 1FFXA 3IAAA 2VF5X 1R64A 3OEHD 3SWWA 2RBKA 3IBSA 5JOQA 1MBZA 1ZZEA 3MJRA 4RK0A 4Q18A 1CRWG 3B3QA 3EYAA 2O20A 3H2GA 5DNDA 2AHRA 5E7MA 1XK6A 5BW5A 3OQVA 1CUAA 4JL5A 4RQAA 4RTSA 3PQCA 4QFMA 1UKYA 3PHJA 1F1BA 1C2TA 3COZA 4JYPA 4IIHA 2JFBA 3O83A 3K0FB 2W6OA 4G1BA 5EG5A 2DQ4A 4TMKA 5IARA 3VNUA 2AN1A 3IVRA 2Q41A 2P30A 1I1NA 3B7GA 2VHVA 4ZQFA 3SOPA 4AZ0B 1SHJA 2HEIA 4GEGA 2Q1XA 4KLNA 3ZZ0A 1EUYA 3FBGA 3H8WA 2OLJA 2OV3A 1T4DA 2GWHA 2K4MA 4YFYA 4CMKA 4B87A 2CV1A 2A92A 2C42A 3VR2D 5SICE 3IXQA 2QUAA 4LCJA 2Z9CA 4P7KA 5IHXA 3JSXA 2X6TA 3OPMA 5JCPA 4LX8A 4QZVA 5CX4A 2ZJ5A 5A3JA 2JARA 4QRIA 4Z99A 1LLCA 2QDXA 3OA2A 1DC8A 1QF9A 5T3YA 3UYLA 3E03A 4CMBA 1P60A 1FP2A 2XB6A 3ZIAA 4W9MC 1XIVA 2XYRA 3RUPA 3B2EA 4KG7A 3HR8A 4WA8A 3B82A 2JC3A 3GLFB 1E0AA 4IYRA 5LIRA 2Q6LA 3LFHA 4R40A 4JJGA 3SZRA 5F4ZA 3CVJA 4J16C 3VKUA 1TQHA 1WP9A 5KB3A 2CD7A 2NQ8A 2CEAA 3SU8A 1D09A 1MFZA 2AWOA 3BICA 4I5IA 3GLHA 4DCTA 5M04A 3EAFA 5L8VA 4NEQA 2WHRA 4JLUA 4YCSA 2XOKD 3EPKA 4AJIA 3QLUC 3WNQA 3X43A 2EZ4A 1HT3A 3GUCA 2BUCA 4MV1A 4NMMA 5HJEA 1K6JA 3EXEA 1G18A 4PNHA 4Z9BA 3Q10A 2Q0HA 1S2OA 4OQ4A 2MTBA 4ZREA 1JIKA 3GVHA 3WQBA 3PGXA 1UFQA 2OHVA 3F8SA 4R9RA 3P5SA 3GQBB 2GAFA 3MWKA 2Y9MB 1IUPA 1TEXA 1S2GA 2CHFA 2ZIXA 2WUGA 5J63A 2ACEA 2QV7A 2PMKA 1LSJA 3Q7QA 4TYNA 5ER6A 4X1YA 1K2VN 4UMFA 1UXHA 1OI2A 4O2AB 3KKQA 4OAOA 2YVUA 3CCCA 5B2FA 1ZIXA 4R0NA 4G0YA 3TTYA 1SUIA 4F4JA 6ABPA 4CRWB 3PFIA 1H2WA 1MV8A 4F60A 3IAS6 3H11A 1BXRA 4AJOA 2JI7A 3GJ6A 4LJ6A 5ENZA 1RCFA 4CI0B 1XMSA 4MA0A 3T3NA 1XQ1A 3BTOA 3C8UA 3KLBA 1E7RA 4FDTA 1SG0A 3IP5A 4MH0R 4RCZA 1SHZA 3E4CA 3PE4A 4K0RA 2NO0A 4FWIB 3DTTA 1MB2A 4UARA 1SBCA 4G67A 4NNPA 3TD9A 2C4KA 4NPAA 3GP5A 3PE6A 4AQDA 2OQ2A 3IOBA 2VVTA 4WESA 5G53C 3AERB 2HF9A 2PKYX 1V2GA 2WIBA 3AWIA 4E15A 4KH0A 2IVZA 3CEPB 1VJGA 1DP4A 2ZB4A 2QTLA 4BO7A 4JK3A 1W35A 3HK2A 3RFTA 4I4CA 3NDIA 1KGDA 5D00A 6Q21A 4O3MA 4RPKA 1FFCA 4B3JA 2IELA 3H1FA 5B12A 3CG0A 2R8ZA 1RU3A 4L8YA 4NAHA 4NZYA 1FJ2A 1JFSA 4G07A 2I4MA 3TQSA 1ANKA 1JHDA 4RTNA 3UMYA 1QVRA 1PR5A 2WSIA 5JWHA 1WZNA 3IV7A 4G84A 3UMRA 3NH6A 3SHFA 4EGQA 4TV8A 2IHKA 1OPRA 3DZKA 3TSYA 4D8WA 4NQZA 2ZDHA 4O6VA 3WJAA 1KFEB 1MX5A 2BKVA 3I9OA 4KOEC 1G2OA 3RS3A 3UVEA 1KEKA 5E6RB 1SVLA 3B1JA 2JA2A 1EG2A 2H7CA 2DPMA 1S3GA 4BMVA 2YWXA 1N6PA 3LGXA 3CLTC 3LUAA 3MPOA 1EFPA 5EERA 1V26A 1YKGA 4FCCA 2YV1A 1KDRA 1SBIA 2I71A 3RSQA 1N8NA 3NUGA 3WIDA 1YBMA 4TXJA 3O4JA 5KHOC 4TWZA 4JOQA 4N48A 4LV8B 2ICAA 2FETA 3Q5GA 5EHGA 3MINB 1KO4A 2ZFUA 1MC5A 5JAMA 4X92A 3ZWDA 3VHXA 4F3YA 3PENA 5A04A 1Q19A 1PWYE 1ENYA 2OK8A 4JLDA 1NBOA 4DA0A 1BCRA 4EB3A 4CHGA 1ZQ1A 2G72A 5CH5A 3EG9A 3O4FA 1IXZA 1EP1B 4UZSA 5AH0A 4U3JB 2O23A 1M2HA 3ZLVA 1K3UB 1B0AA 1XTPA 1ZMBA 2B78A 4U7HA 5LPNA 1E6KA 2XOXA 2WTAA 2D1FA 1B1CA 1JR2A 3FCSB 2CVFA 4I81A 3WWDA 1U2ZA 1X94A 3BCUA 4KI0A 1A04A 1TA4A 1W2GA 2I7XA 4HJXA 1DARA 3OZXA 1C7JA 4QDTA 5LXTA 5B1DA 1DV2A 2O8EA 2H1WA 1Y1SA 4Q1DA 2QX7A 2QG9A 1BE0A 2YYAA 4E7PA 2NUAA 3OZCA 3RVPA 5AVUA 3B3AA 4F7WA 3NHAA 2UVPA 3JAKB 3PUIA 4O33A 3GLGB 3HWSA 2Z8YA 1AG9A 1QHIA 3PK0A 1XK7A 2BW0A 3EXHB 4OQLA 1XCJA 3K9BA 3V8NA 3B38A 4ZI7B 2PAAA 3JX9A 1PZNA 3K1ZA 2IYXA 1T8YA 4XGRA 4H77A 2BRUC 2C31A 2I7TA 1XEAA 4IDDA 1KS2A 3SBEA 4MQUA 4CL2A 3OG9A 1U9YA 1C0EA 1VGVA 3ISTA 1MPXA 3OCWA 1AS2A 2HLDD 1Y7IA 1T1EA 1IIRA 2G4VA 2X0KA 1VE9A 3G0DA 3PGMA 5F77A 3NG1A 1KJ9A 2DUUA 4KIWA 1MVNA 3KZ1E 1JHUA 5CPBA 2FZKA 2FPIB 2IHZA 3CIOA 4YRRA 1HWYA 3C3KA 1DHRA 5FUMA 2ZJBA 4ZQEA 3WFIA 1ZI9A 4GWGA 4WTOA 3TKAA 3HP1A 1JKXA 4PSAA 1A9RA 3ST7A 2R5WA 1FSPA 3UWDA 1ODCA 1Y5IA 3A4NA 1TU3A 3PA6A 4HK4A 3FVRA 3ZGXA 2PJUA 4H7DA 5CD1A 1AUVA 1DZ3A 1KERA 4UBJA 2Z30A 4TL9A 2H4FA 3DBVO 3A6PC 2AJCA 2R8OA 4REQB 2C8LA 4FFBB 3ZVLA 3GYBA 1XVVA 3VSAA 4TTSA 3FOCA 2D4AA 2JH9A 3QKIA 3C3XA 1HQDA 1MX9A 4D0NA 2QL5A 4O0LA 4URFA 1PK9A 5M2QA 4D45A 2HFKA 3UAYA 4XOUA 4TVBA 3SYMA 1YNOA 3ZWKA 4TS4A 1X7WB 2NYUA 1FQOA 3CKKA 3WL7A 1VFPA 4CEJA 4GXTA 2IUYA 3FX2A 3GH3A 4RVHA 5TF4A 4H27A 1KDTA 5DX1A 4U6NA 1R4NB 3WGGA 1RQ2A 4X62B 1DAFA 3T7DA 3W05A 4LGCA 5BUCA 2XBLA 3RBVA 4IYJA 1S7CA 4LGVA 5CAEA 1RQPA 3BSYA 4KO1S 4EPYA 3IKVA 3RVQA 2PAFA 1RT9A 3FSRA 1DAPA 1ETHA 1D8TA 2PKRA 4DRXA 1H8HA 2YW9A 5JI2E 2W22A 3SCZA 1P2VA 4IH4A 4BQOA 1KBZA 4FHGA 5CA1A 3H86A 3NEYA 1WW2A 4AYXA 1ECJA 1U0RA 2D59A 3JD2A 1EWVA 3IP3A 3Q6NA 3Q8LA 3SR4A 4UUOA 4WOCA 3ZV3A 2GXUA 4N9QA 2VSQA 3BXZA 3LZDA 4AYTA 4UHHA 3SAJA 3JQ8B 3Q41A 4HP8A 3DMTA 4UD6A 5HKOA 2XUPA 2OPHA 1KKLA 4D8XA 2EGGA 5F3DA 1O95C 1TJ5A 2BP7B 3K6SA 1MJFA 3FNHA 3R0ZA 1D9ZA 2DJIA 4G8JA 1RAAA 3HYSA 5G4LA 1QV9A 1LNZA 4L07A 3ADKA 3JYQA 3SEFA 4F85A 5TS3A 1R4MB 4M9CA 3CGGA 5ALVA 1T9KA 1U1FA 3KYDB 3K16A 4R1UA 5AQEA 4DTIA 3F47A 3I23A 5JYBA 4TVKA 10MHA 1QVAA 1XROA 3KPUA 1AXGA 1VI5A 4GZ6A 1Q22A 3VI4B 2BFEA 2DPXA 4UATA 4QPNA 2OECA 1QUEA 1MH1A 1R5JA 2QD2A 2WJ6A 1NP7A 1HETA 2Y0BA 4LOHA 1L5NA 1U65A 4J2TA 4L8LA 1G8YA 5DM70 5JYDA 4YVFA 3P9PA 2B2XA 1L7DA 1QFSA 4B09A 3T4PA 2Q5FA 3USES 2CLOB 1ZKDA 3L0BA 2QROA 1K9SA 4AY2A 1BRTA 1T2EA 2XUZA 2R5FA 2ZR8A 2XZPA 2ZTLA 1WJGA 1A9YA 3KEQA 3RTDA 3A4MA 5CYGA 4MS4B 1PQYA 3TVDA 4S12A 2OD7A 1I0IA 1PEYA 4TV9B 2IEGA 3TIXB 2CLFB 3V3TA 3GRCA 3UAXA 2OCGA 1Z2NX 2MT9A 1IYZA 2QZ9A 3OF5A 4DSTA 2FZEA 3WL3A 3GLHE 2OB2A 5IM5A 1P7CA 4XWKA 2OKCA 4HR7A 4KPEC 4ARZA 4AXXA 5BT8A 3AL0C 1WVMA 5H1YA 1IB0A 2P75A 2WSLA 1NW5A 4LOIA 4RSHA 2P78A 5LZ5A 3CB4A 3DUFA 4OOFA 3L6DA 4D6PA 1Y4DE 2RAFA 2C4WA 2ZANA 4C89A 2R47A 1W4ZA 1J2JA 3NIBA 2GN1A 2GN6A 3AVOA 1ZM3A 3AHCA 5KPJA 1TFRA 3W6ZA 2PGAA 2A6PA 3PYLA 1JECA 2Y93A 2QB5A 3BJRA 4K8RB 1F4LA 1WBJB 1RIFA 1SIUA 4WOPA 1Y3HA 2L69A 3CRZA 5LJIA 2H63A 1SKYB 2G76A 2IP4A 4HB4A 4AMBA 4GNRA 1FXWA 4YCNA 1ITZA 2QRZA 3LY5A 1ZW1A 4ZMSA 4L6AA 3JAMA 3LIIA 4CMHA 3THXB 4HX9A 1VIYA 2R2GA 3ZHCA 4OL0A 5DM60 2FN3A 4HNUA 5CB0A 1O8BA 3L8FA 3LXUX 5ITWA 4RCYA 1WRBA 3CZMA 1Z6ZA 3GGJA 4CTMA 2VHXA 5LQKA 1TE2A 1KDYA 3TGPA 2P9QA 1XAIA 3DHWC 4QRDA 5DX8A 1G5RA 4E33A 2VJBA 3HABA 1K8RA 3Q0TA 4AY6A 4U1RA 4XD7A 1AQYA 5LB4A 2KW5A 1J9ZA 4RH0A 4C7KA 4NCBA 3HZZA 3AHDA 3ZHRA 3OCUA 2C20A 1NIPA 3FCCA 1X3LA 4U7DA 3MQ4A 2WTXA 4X94A 2SECE 1SCBA 1WXWA 2AI3A 3B60A 3WSVA 3ZJ4A 4PG7A 7ABPA 1EK0A 5AKEA 1UK7A 2VJCA 1E1CB 4DDHA 4OJMX 2O3JA 2WT8A 3C4VA 4P2BA 5DTMA 4E21A 8LDHA 5IG2A 2WMOB 2H2HA 4U2FA 1E6EA 1FUYB 2ZRBA 5GWXA 1R16A 2V7VA 2HCTA 1Q84A 4MW0A 5JJ5A 4C1BA 2WWWA 3MJEA 2DR2A 3IAHA 3SGLA 3U3RA 4EX6A 5K4GA 1KJQA 1QS0B 3FW1A 4J0DA 4MJXA 4B4VA 1VBMA 1JMKC 1PNOA 1E3MA 3UMJA 2GEDA 3FOWA 3I1FA 1E4YA 3UWPA 3ZI7A 3I01M 1DDIA 1OXMA 2F1KA 3FN4A 2RHHA 1Z5NA 1YQXA 1XAJA 3H84A 4GOLD 3AFOA 2OORC 2XZTA 2JGKA 1VHDA 3G2IA 4HT3B 2D62A 4LQ4A 3L1VA 1QRRA 1BFKA 2PU5A 2QLLA 1WZ2A 1YUMA 2AOTA 3NBYC 1MF7A 1IDN1 3PVCA 4RVFA 3AZQA 3IOYA 4RGQA 3LBFA 4JI7B 2IDKA 2RB4A 5T5QA 4MXDA 4U5XA 3OX3A 4LF9B 1P1HA 1RRFA 1GKKA 5JPIA 1P73A 1O6GA 1E0JA 1MJGA 3IV6A 1T4GA 3KHTA 2FWAA 4E2FA 5BNWA 2BCGY 2FP4A 5JEEA 1ODLA 3UJBA 4HN2A 5JHGB 4PBRA 1E9CA 4DA4A 1XNRB 3F1KA 2FUG6 2B4RO 4JBWA 5CR9A 2PFKA 5CBPA 5CB4F 1LC0A 2VQSA 6REQA 2HRRA 2B7BA 2C2OA 3H3JA 3R74A 8MHTA 1HT1E 2H08A 2HU8A 4QXOA 1JSXA 4LJAA 2QD3A 2PZLA 1HV8A 1LKZA 3WKEA 4MQFA 2IIPA 3NTOA 5ALSA 1B2LA 4Z7NB 5FBVB 4N7RA 2IU0A 1KI2A 3FVWA 1VRWA 1XELA 2ZWIA 5JSZA 1QG4A 5ECWA 1JJVA 4HTAA 3RW9A 1PD0A 2XE6A 4TLDA 2HCFA 4JI1B 3SXPA 4DC9A 5A0FA 5LZ7A 2ZXUA 5HZGA 4J1QA 2AT1A 4RORA 5H02A 2TS1A 5I7EA 1J0EA 2QTRA 4GSYA 3AETB 3LCUA 3MRVA 1BMFA 4G86A 4YO8A 5NULA 1ZNXA 4IWNA 4ZMRA 5CDFA 4MVJP 3TPZA 2J0SA 2G07A 3ZOZA 5DP2A 4X90A 3WRWA 1N3YA 2IS2A 2AVNA 2GHRA 2O8NA 4N0EA 4OU4A 2FX3A 1QH9A 2D74A 5F4BA 4ZD6A 5BVHB 3G88A 5DGXA 3SJUA 3WLHA 1K3FA 4BNMA 1J42A 5J5VA 2EKQA 3IB3A 3KT3A 2GF2A 2ZUDA 1M7BA 5L3QA 2OBFA 4L75A 3GVCA 3HYRA 5CCBA 3IPXA 4GU5A 2O1XA 2O8VA 4YV1A 3M5DA 1NN1A 4R5MA 1KI9A 1XB2A 3ZDFA 2WMNB 1T1IA 2R48A 3F3MA 1NQ5A 3VOSA 2IY7A 2AK3A 3CKMA 3JPYA 4WJLA 4BMCA 5LQMA 3ACBA 3RM3A 4C3UA 3IQHX 3X1WA 4EG8A 1AMOA 4JLNA 4MVYA 3L6UA 1F8UA 3E35A 3S5JA 3WICA 4QATA 4C4SA 2HREA 4A5SA 4KHPB 1GGEA 2UXBB 4M7OA 3IQFA 4JI3B 1NLYA 2JI8A 4DC1A 1H0SA 4JX9A 1KMNA 1ZJ6A 3N6XA 2QJTA 3I83A 3ZW7A 2AOUA 3EVEA 5FOTA 2ZJAA 1V11B 1T5LA 3OP1A 4OMFG 1DB3A 4ZO6A 4QGHA 3P4YA 3T06B 2GTHA 4HLQB 4M7PA 1SM4A 5KBYA 2CUKA 3Q2KA 5AUPB 4NPCA 1N6LA 4BUJA 5C51B 1CP2A 4NNOA 5MN6A 1PZMA 1OLXA 1IOWA 1CS4C 2DVMA 3S7TA 1MZPA 4GKAA 4BO9A 4A73A 1O9HA 1RYFA 4EMUA 1MKYA 2BMFA 4XUCA 4YO7A 5JD6A 1LBQA 2VDNB 3E22B 2I34A 1DKOA 5EE9A 3FOBA 4OI0A 3RFFA 1MO6A 2AOXA 2VLIA 1T2AA 4RA9B 1N5IA 5CG2A 4C05A 4C7BA 3LOQA 2KLHA 3HVJA 3WI7A 1E94E 2FP3A 3CN7A 2BGKA 4C7OB 1P9RA 2X8BA 4MKZA 4MVJI 3P2OA 3UB3A 4BIIA 2RARA 1D6JA 3QP9A 4KLCA 1N7GA 4B3TB 1R2QA 1NOKA 2V55B 1H9AA 4AJKA 2UVQA 2ZRPA 4K5QA 3NAGA 2HL6A 1UJMA 1JG7A 3WIEA 1TMOA 1CUSA 4OV6B 2SKCA 3AJ9A 4D1YA 4E22A 1KJIA 1KMHB 3VPXA 2HRBA 3ENWA 4OFXA 1NAHA 1TM7E 3GT3A 3RSLA 1IH8A 4BFVA 4LZWA 2CB0A 4R71A 3ZGYA 5C4MA 1J0CA 3OM9A 4JYBA 5EIOA 3GEIA 4JP5A 3EEFA 4GI2A 3G2KA 4A27A 1AKVA 2QKYA 5DSXA 4MUJA 5JCJA 1LF5A 2M9MA 2CVOA 3IC5A 4HH1A 1V3UA 4MA5A 2V1UA 1SVNA 1EG7A 3ONVA 2X1VA 4DR3B 1P8JA 3EIFA 4FJ1A 5DLQC 1QPZA 4AZVA 3GY0A 1JBKA 1PGOA 1ESEA 3FMPB 4TUYA 4XCVA 5DPMA 5CB6A 2PSHA 2FEMA 3L6BA 5HFNA 2GT1A 4YK7A 3PIRA 3FYTA 5I7AA 1QE5A 3EZYA 4PPYA 1WULS 3DBHA 4QLAA 3CNNA 1RI5A 2R66A 3G17A 3IHKA 4F3KA 1XDGA 4PLVA 2QLBA 2PV0A 3WNVA 2VDJA 1EFUA 3J80A 4C6RA 5EJFA 2LKDA 3ED5A 2FGKA 2YN4A 5T3UA 1V96A 4PZZA 3EEQA 5IM4A 3SQOA 2HXYA 4JBIA 4U7FA 4DMRA 4QUKA 4LTDA 2ZBGA 2NSHA 3EJWA 3W1VA 1I4TD 4ZU3A 4ZICA 3WQSB 3D64A 4YP5A 1GP2A 1NJ6A 2YVKA 3U7RA 1T15A 4KXLA 1QX3A 2PGLA 2OFOA 4A0RA 1QDEA 4EZIA 1M73E 3UMBA 5DNAA 4B40A 2OFFA 4RTQA 4HATA 5IFLA 1XMXA 5FRDA 2IZZA 3L05A 3L93A 4MLPA 1GDTA 3C4QA 4HAXA 1D2EA 3AEYA 1C7RA 3MC1A 3OOEA 4P83A 4TX1A 1T4BA 5CLFA 5JADA 2JA1A 4C4ZA 3U4MA 2A0WA 1US8A 2CDRA 2XRMA 4A8JA 4MVJG 5HKBA 4D3ZA 4QOFA 4RTMA 2EWWA 2I1VB 5EP1A 5JG7A 1T9ZA 4O4JA 1BD4A 4MI1A 4E4YA 4F2PA 3B9BA 4LZLA 4HWKA 3OZBA 2J0EA 3OECA 4MYSA 1M2EA 3WBFA 1GZHB 3BRWD 1J39A 4I50A 2BDTA 4BNHA 3LY7A 1HE4A 4FS3A 3RG2A 4BWFB 4C22A 2B99A 4A0GA 2I78A 1D6NA 2PUVA 4MIOA 3GLKA 4N5LA 4HAOA 2NTVA 3EWAA 5E95A 1CP3A 3WDSA 3ER9A 1PTJA 4CPDA 1KRWA 1KL7A 4HAUA 4OP2A 3TZLA 4QELA 1N7JA 2EYQA 3DT8A 2IK8A 5B36A 1FVXA 4LWQA 3LX6A 1V3QE 4G0XA 4WACA 1I2DA 2XMSA 4LHEA 2CFOA 2FSVA 2M1ZA 2ORIA 5DN6A 3EGDA 5I9IA 4MGHA 3OM8A 4JITA 4UDNA 2G3YA 1F06A 1ZN2A 1H2BA 3B1VA 3BD9A 5CT4A 3QHQA 1KI8A 3KX2A 3RG8A 1DCMA 2JEOA 2X58A 3V2UA 1Q16A 2QI9F 3D6MA 1VJTA 2NVUB 1D1PA 1I4DD 1GZDA 5EXTA 1ISGA 2ODPA 4C21A 5DU2A 2X5NA 1MJHA 3IIEA 1JHPA 3M7IA 4KO8A 4WW0A 3KOZA 5CDHA 2FPLA 1TU4A 4S0XA 3DZCA 3G13A 4JYAB 1NYTA 4B7UA 2R44A 4CLXA 1SHKA 1N2XA 2OFXA 1SXJA 4N40A 5DBFA 4FR5A 1YNSA 2VRCD 4HXGA 2X0FA 3WYGA 3S27A 8GPBA 5D6NA 1I1QB 2OGSA 5C8ZA 4YDRA 3R5KA 2MMGA 1HC7A 5MFZA 1DBSA 4TT3D 4L2IA 3P45A 1UOOA 3KDAA 1JG1A 2WU0A 2JFZA 4QPDA 3DQQA 1BQ4A 1KI3A 3OMXA 1AVTA 3PT9A 2RKBA 4BLVA 2Q1UA 1W0KA 3I0ZA 3LX5A 3OCCA 3I9FA 4MR7B 5ENVA 1I33A 4X8LA 1AMNA 1KA9H 2SNIE 3E1KA 3G0OA 4Z86A 4ZALA 5FTKA 5K8CA 2C9OA 1EE2A 2Y76A 1ONPA 3FJ1A 4J94A 3WL6A 3QIAA 1DHTA 3P20A 3FHLA 4RF5A 2GK4A 4XWAA 2QT0A 5EIXA 4P84A 1NL3A 1JDTA 2WMYA 4NZOA 2HHAA 3COVA 3DV0A 4XEUA 5JBNA 1U1CA 5EJ2A 1XT6A 3IQGX 1A4RA 3ILVA 3IT0A 4BB6A 3D5EA 4EJ6A 2J9FB 1MOSA 3GLHB 1PN3A 1GADO 2CXQA 2GBFA 1D7OA 2ZJOA 3BIOA 4UOEA 2WF9A 3AOEA 3HDJA 5FOQA 3ADCA 1JEYB 2EBUA 4U0KA 5CYPA 4G89A 5B6PA 4EW3A 3FY4A 1J2UA 3PLRA 3UOGA 2FZCA 1SHUX 3VPFA 3CR7A 3F7TA 2BGLA 3TOVA 3SQLA 3LHIA 4YJGB 1P39A 3C6QA 3IKLA 4FBMA 4GPTA 4LVOA 5DX0A 1L5KA 3IEMA 3SKXA 4PWYA 5ECGC 4UBNA 3K8QA 3A9TA 3KLNA 2IYQA 3QOWA 3VYRB 1FFDA 3HKBB 4B3CA 1U8TA 4NI5A 4PGAA 4CIAA 2AFRA 2C82A 3E23A 1E0KA 3EXG2 4N3GA 1PJ3A 4HDAA 3WK8A 1MXHA 1C9NA 3CC8A 4PYNA 3B52X 2AX3A 3OLQA 2IP2A 3UV6A 4KPYA 2ZYDA 2BEWB 3NJRA 3T9FA 4W7SA 2ZRQA 5ALYA 1EWTA 4LJ9A 5EIBD 1T6BY 1JL3A 1WQ1R 2VCEA 1B42A 4KE7A 3Q9UA 3SFZA 5TLSA 4R3NA 1MVOA 3WLRA 3GGDA 3OSZA 5CDFE 4DLSA 1FYFA 3W2FA 4OGFA 4DIOA 2PNJA 1S89A 4UHBA 2E4ZA 2G82A 3H2BA 2D1YA 4JUIA 1P33A 4XI9A 5I9SA 1G8FA 4XEHA 3RIXA 3EPHA 1A7AA 1E92A 1PL6A 1KQGA 3VU9B 3UA4A 4I1YA 4ZZIA 1A2QA 1JPNA 4TTJA 1GPJA 4NK5A 3ZOKA 3HI4A 3ILXA 1OU4A 4L0MA 5EZ6B 2JAHA 2JKZA 2B7CA 1IMJA 4YRCA 3C5WP 3DE6X 2YICA 1ZRNA 4MR9A 1YAJA 4DLXA 4WLFA 3GZNA 4RX1A 1MG0A 4INPA 3TPCA 3EDRA 2O5EA 1V5WA 2V6BA 3CSDA 3FSJX 4FVTA 2ISSD 5CHEA 1LSOA 1Y9DA 1SXHA 1SIWA 2HX1A 2M98A 5AJYA 5HILA 3SG0A 5EIWA 1BDIA 4NCAA 3AB3A 1GG2A 4Y9RA 1DNPA 1UH5A 2YV5A 4QIHA 4LWOA 1AIPA 1J23A 1YS7A 4RPHA 4ZXPA 3MBKA 3NUZA 5BWMA 1GAJA 1DKMA 2JH3A 2XBUA 3DVAA 5B53A 1QHNA 4DJDC 4DJAA 2BKLA 4ZDKA 3LPLA 2A0XA 3EEIA 3OZEA 4JMPA 3R3YA 3UATA 2ZSIA 3KQYA 4TV8B 5IJXA 5EJEA 3MQ2A 1QB8A 2BMAA 2IHVA 4M89A 4O5OA 1CB0A 1N5RA 3IDFA 1NE7A 5DV9A 3H42B 4KGZA 2OXTA 1RXCA 3RTCA 2RBGA 4I9NA 4L95C 3S8MA 1X1QA 1Q0HA 2QQFA 2YNMA 2WD8A 1WXIA 3PC3A 1T29A 3CUWA 1GUYA 1DWQA 4KH1A 4YCLA 4PX9A 3AYXB 2ID4A 2WJWA 1EFPB 3A0RB 1CJCA 3TMYA 4IFBA 2NWQA 5FLYA 1PNTA 4LYGA 1OBFO 1C3JA 1PR6A 1HMYA 2ZRKA 4B8ZA 1WXDA 5AK5A 2W0SA 4UBKA 4WZZA 4MARA 3V80A 1J9GA 2FX5A 2Q4EA 5TQJA 2Z5VA 4JEIA 1GJRA 3GPLA 1UFRA 3FMOB 4UAJA 5ALTA 4ZC1A 2IW1A 1SQ6A 4KVAA 3VQTA 2DEUA 1CNFA 3FFWA 1QK5A 2MSEB 4XGNA 2IGBA 3PGKA 4EKDA 3THWA 2WSMA 1BWRA 2QM0A 3DBOB 3MYYA 1VLJA 2WWHA 3LRTA 3SM3A 2XA9A 1WHTB 1RXVA 2ZRJA 1KEWA 1XVLA 5KKAA 5LNK1 4KWEA 5CH3A 3ZH9B 2LUOA 4L50A 1ZPDA 4X1IA 3ETGA 3M4ZA 4Q48A 2WOOA 3MJTA 4D3XA 4ZOBA 4PV7A 1DQZA 1F8GA 1U0FA 4G85A 1XRQA 2AOVA 1YZ3A 3U81A 5D85A 4HJRA 2QTNA 3G1UA 4ZYTA 2YRFA 5B3KA 3R3SA 1HE3A 2IZ5A 4PXAA 5L3ZA 4J29A 2YS6A 3RC8A 4E11A 2FVYA 2VNSA 3LW7A 5K8JB 1NA5A 4HF7A 2WUFA 1SIOA 1Z17A 3F7NA 2QYHA 3PDUA 1GNTA 1K98A 4JC0A 5JAZA 4QYMA 3EPJA 3G2JA 1E79A 2WF6A 2R1TA 1P7VA 1IEVA 4OP1A 4H1HA 1WMFA 3NP7A 1TYAE 4Q9AA 5F1PA 3K4PA 2P2CA 3MGAA 4NMWA 2QSYA 3PL1A 4RS4A 3RUEA 3WLKX 4R69A 2C78A 3F49S 1NBWB 1YB7A 1DLIA 1XUOA 3OMWA 4LWZA 1NW7A 3V8QA 4B32A 5DGCA 3HU5A 3MMXA 1CUEA 4B6GA 2BMEA 3T1QA 2Q9AA 3S29A 5K0EA 1KDVA 3TNYA 3RYHA 4KZPA 5ARBA 5GINE 1YR7A 1EVYA 2QP4A 5T67A 1OC4A 2FQ1A 4Q4JB 4U7JA 3V2IA 3VYVA 3QELB 3OCJA 4B31A 4YT8A 1EH5A 2QL9A 2HHJA 4ZT5A 1GTL1 5K5EA 2GCNA 1ZCJA 5G2OA 3TOSA 5AVOA 4ZOLA 4DB4A 1OH5A 2EJVA 3TOZA 1G7RA 1BX3A 2AMFA 2GZHA 2WSBA 5CK5A 3WYNA 3OE1A 2Z04A 1LC3A 1V95A 2E1RA 2KM1A 3BQNB 3D6FA 3EASA 4JBNA 5IZCA 3HBLA 4X20A 1I7QB 2XDWA 3ND7A 3ONNA 4W5WA 4J4BA 4L8WB 1G8HA 3K5IA 2YRXA 4ETNA 5K6RA 3FYHA 1ZH2A 2Q7OE 1G42A 1SA0B 2QR2A 1M6VB 1SZDA 1O96A 1JP7A 1M1XB