1PEYA

Crystal structure of the response regulator spo0f complexed with mn2+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sporulation initiation phosphotransferase F
publication title Metals in the sporulation phosphorelay: manganese binding by the response regulator Spo0F.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 40
structure length 119
sequence length 119
chains with identical sequence B, C
ec nomenclature ec 2.7.-.-:
pdb deposition date 2003-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1peyA00
4PZ0A 3IP7A 1QKKA 4Z9AA 2MYNA 2R4QA 2HPHA 1D5WA 3HV2A 4G97A 4EYQA 3HZHA 1Z2DA 1ZVVA 1LBHA 1JFVA 3RVJA 1E6KA 1QPZA 5JS1A 3N8IA 2WJAA 1OXKB 3LUDA 3JPYA 4PICA 3HCWA 3GYBA 3SAJA 2IPMA 1FFGA 4PE5B 4RV5A 4UHJA 1JDPA 4LE0A 2FN8A 2M98A 5BRAA 2CWDA 1TLFA 2R47A 3E3MA 2RDMA 3QEMA 4OLBA 2A9PA 3H5VA 1USIA 2LBPA 1KGSA 1NXXA 5CNMA 1BVHA 2ZAYA 2XDYA 2PE5A 4NCBA 2PUBA 3Q9SA 3CNBA 1E6MA 4OBBA 3E61A 3MYYA 1P8AA 4DN6A 3QLVA 4KZKA 4G0XA 1NXWA 4H3KB 3TB6A 2FLKA 3HM9A 5JNWA 3HEBA 2Q5CA 4KQCA 3QEMB 4KMRA 3EODA 3Q7RA 4JOQA 3H1GA 1TJYA 2PUCA 1WETA 3OO0A 3KSMA 4GNRA 2PMCA 3LUGA 1P6QA 3HUTA 3O2SB 3TD9A 1W9HA 4EYGA 1EFAA 1H9CA 2PUDA 2FQWA 3MA0A 4PYRA 2FEKA 3FFWA 3QLUA 3KHTA 4TN5A 1J56A 2YHBA 3NBMA 1QO0A 3LTEA 3C3KA 4H60A 1EHCA 5TQJA 2BGGA 1USKA 2IYNA 3RVLA 4RY9A 3OM1A 1QMPA 4QICA 5IBQA 5C5EA 2IPLA 1DBPA 2JVJA 5KWSA 2PUEA 3KG2A 1JWLA 3LFTA 3Q7TA 3DGFC 4PEVA 2P4UA 1ZY2A 3H6HA 1DCFA 5FBKA 4EVSA 2JVIA 1NXPA 1CYEA 3OLWA 4ETNA 3JY6A 2A9QA 1D1PA 5TE9A 1Z25A 1PHRA 3GWGA 3RQIA 4W5NA 3JTEA 4OATA 3KS9A 2V0NA 4MR9A 3JVDA 5JNTA 5TPZA 1RXIA 4F06A 2PAFA 3EQZA 4DADA 2JRLA 5IX8A 2FVYA 4S04A 4ML3A 1SRRA 3HS3A 3D02A 2FMFA 1TM2A 1KRXA 2FKAA 4RXMA 1PUXA 4CBVA 4ZMRA 4Q6BA 3CHYA 2E4VA 3B2NA 7ABPA 4MAAA 4MPTA 5KQMA 3CU5A 3ROFA 1I3CA 2ID7A 1ZH2A 3A0RB 4LX8A 5IC5A 4Z99A 3QLVC 4O1IA 1OXBB 3HJFA 2IPNA 3NNNA 1DBQA 4FE7A 1ABEA 3CZCA 4RK0A 2B1JA 1S8NA 3NNDA 3KLNA 3OM0A 5CNJA 2WY2D 2E4UA 3F73A 3LKBA 1JL3A 1NXOA 2FMHA 3EDCA 1ZGGA 2OENG 3CFYA 4YR7A 1DCKA 1JLKA 1GCGA 1VRVA 3OQMA 1DC7A 3RVKA 2JCGA 1SXHA 1ZDMA 4RU1A 3T95A 3SG0A 1Z2EA 1ZN2A 3QLTA 3SNKA 4KPYA 2GX6A 3QLUC 3DZDA 3N0WA 5KC8A 3O21A 4QYWA 4KK4A 4N0PA 3P9YA 3LMKA 4W5OA 2AYZA 1LK0A 5TPWB 2WRZA 3KTOA 1D4ZA 3KLOA 4N76A 1A04A 1LBIA 1YIOA 3D8UA 2NZVG 4RK4A 3O74A 2IDMA 1PNTA 3C97A 3IPCA 4KV7A 4N0QA 4RZSA 1Z26A 3GRCA 2WWVD 4KNYA 3OLVA 3ILYA 3H5TA 3I5AA 1A2OA 1DRJA 1JFSA 5HQJA 4YV7A 3BBLA 4W5TA 1NTRA 5IULC 1DCMA 2H3HA 3FFTA 2NZUG 6ABPA 4MR8A 1U2QA 4RKRA 1QQBA 4WUTA 3EJWA 2GWRA 1QQAA 5TQ2A 1XHFA 1YS7A 3K9CA 3TMYA 3G1WA 3KCNA 3UKJA 4JAVC 4MR7A 3LUAA 3LUFA 3C3MA 1QP0A 4LZLA 5HM6A 5JNRA 2HQRA 3BILA 2VYCA 4GPAA 1ZHHA 1DBWA 1NXVA 3KYJB 3F7NA 4IMJB 4MR8B 1DC8A 4L4UA 5I4CA 6CHYA 4NV3A 3CG4A 5TQ2B 5DCLA 3I45A 3O75A 4D74A 4MR7B 3OQNA 1RZRD 2FQYA 2JVKA 4RXUA 4YCSA 5DKFA 1YMUA 3HO1A 1EWKA 1HEYA 4Q7EA 1JBEA 4KRFA 3A3KA 4N41A 3W9SA 2H0AA 3MIZA 5CHYA 5T3YA 3RH0A 2FEWB 4NCAA 4G0OA 2PUGA 1F51E 2J48A 1JYEA 2QZJA 1YK1A 1JF8A 2CD7A 3R0JA 2L2QA 4JA2A 4IILA 2WB4A 3RVQA 2E4XA 3N53A 1ISRA 5TQ0A 1SXGA 3M9WA 5EWMA 2PKXA 2VUHB 4E7PA 4RK1A 4P98A 1U2PA 2QVCA 3OLXA 3UK0A 1P2FA 4RK5A 4FB4A 1Z17A 4TLLB 3OLYA 2QSJA 4LDZA 2FXIA 2MYTA 1VLZA 1M2EA 2ID9A 3DBIA 2JB9A 3H6GA 4KQ9A 4Q6WA 4RY0A 1BDHA 5TQ0B 1E2BA 5EWMB 4F12A 1LJLA 2PJUA 3CG0A 4H3HB 5FBHA 5IEJA 2FW0A 1NXTA 4LRQA 4MYRA 5IUNC 4RY8A 2QVGA 3S99A 3C3WA 2AYXA 2FTKE 1JFTA 3QX9A 5HSGA 4IF4A 5D2CA 1TVMA 4KREA 5GQSA 1SXIA 3SQNA 4XXHA 3F6PA 4NQRA 5ABPA 5FWYA 3JS5A 4RS3A 4F8JA 2MYUA 3H5OA 4WT7A 5JNVA 4YP9A 2CHEA 3CS3A 1Z18A 2NUBA 3H1EA 4G0MA 1VPWA 4D6XA 5IUJC 3NHMA 5B3JA 4Z4GA 1TMYA 2E4YA 4EYOA 5E3JA 3MQ4A 4RK6A 1BDIA 3GV0A 5FWYB 2IOYA 1U04A 3QX8A 4G0ZA 3RVRA 4RSMA 1XWWA 2NT3A 2RJOA 4HYEA 1L5YA 5KQPA 5FWXA 4QYMA 1QO0D 2CHFA 2ZWMA 4N03A 2WJWA 5TPWA 3Q41A 3Q7SA 3QELB 3RVSA 4D6YA 1U8TA 2OQRA 2O20A 3OO1A 3EAFA 4EGSA 3KKEA 4MQFA 3M6MD 4S05A 1EAYA 1MB0A 5FWXB 4MS4A 4HNQA 1YK0A 1D1QA 1RXEA 4EVQA 2FSPA 1Z15A 4KFCA 4E7OA 3TO5A 2VK2A 1LJUA 3OMXA 3OLZA 5PNTA 1YTUA 1M5TA 3CKMA 3DLHA 2E4WA 3I09A 4KK3A 2W42A 1MIHA 3H75A 1BDJA 1DG9A 4JB2A 4MQEA 4TMYA 4XAQA 4IRXA 2HQOA 4YLEA 2QR3A 3T6KA 1IIBA 3A10A 2IKSA 4MS1A 3DLBA 4MS3A 4MQFB 3LKVA 1B00A 1M2FA 4MS4B 1USGA 4M88A 4Z0NA 2I6FA 2X7XA 5TPZD 2LUOA 5CNIA 3N6VA 1JH9A 2F8TA 4UHKA 4MGEA 3K4HA 3SY8A 4KVFA 1QP4A 4MQEB 3L49A 2LP4Y 1JDNA 1GUBA 5IUKC 4MS1B 4RXTA 3GBPA 5KQGA 3HUUA 2WMYA 3GL9A 4MS3B 3ILHA 4G0YA 3IP5A 3GA5A 2YHAA 2GKGA 8ABPA 1C0EA 1PNRA 4EY3A 2IPAB 2FLWA 3G85A 2PUFA 5DLEA 4YS6A 2HSGA 4HNRA 2QW1A 5DTEA 3GT7A 3N0XA 1YS6A 5JNUA 2QV0A 1UDRA 3RVMA 4MLCA 4XARA 4RKQA 4WZZA 3SM9A 4LE1A 3CTPA 4N47A 2N9UA 3EGCA 3IDOA 5B3JC 1PEAA 4OG2A 1YVUA 2PL1A 2VUIB 3Q15C 4XFKA 4WXMA 4RWEA 3RVNA 4Z4EA 1PEYA 3T8YA 4ZPJA 5GOTA 4JB0A 1KMIY 3LUJA 4JP1A 3FFXA 5KC9A 4L85A 5EWLA 2R25B 3DGEC 4IMIB 4P1ZA 3OQOA 1CEYA 3IP9A 1EWTA 1DJMA 1ZGZA 2MSWA 4YO7A 3MF4A 4EUKA 2PLNA 3CZ5A 4MRMA 2GI4A 1ABFA 4Y9TA 1EWVA 5BQ3A 3HXMA 3N75A 1JX6A 3O2QB 3H5LA 4B09A 3BRQA 4Z4HA 1A0OA 2LIVA 1NXSA 4HNSA 5EWLB 3O1HB 4ZJPA 3GBVA 2A9OA 3RVOA 3URMA 1ZAYA 5F64A 3JVIA 3FDFA 1XHEA 3KYIB 1ZITA 5BR1A 3QK7A 4F11A 1BA2A 3VNAA 4MRMB 4W5QA 2JBAA 2MYPA 3BRSA 1T34A 2A9RA 3EQ2A 2HJ9A 1FSPA 1URPA 4YGXB 1QP7A 5IEBA 3F6CA 1APBA 1MVOA 2PL9A 3LOPA 1ZH4A 1Y1LA 3NNSA 5C5CA 2KYRA 4QPJC 5KQLA 3HVRA 1F4VA 1CHNA 3O1JC 3I42A 4WXEA 3EULA 1ISSA 2JBAB 3IPAA 1ZESA 1QNLA 3CRNA 1W25A 1E6LA 3NHZA 5EWJA 3KJXA 1JYFA 3O1IC 3H1FA 1K68A 2FMKA 3CLKA 3O2JA 1FQWA 3HSYA 3MM4A 1DP4A 2FQXA 4YRZA 5JS2A 1GLGA 3LUHA 3QEKA 4ZYLA 3UUGA 3RVPA 1NATA 3TX6A 3H5IA 4FE4A 3QELA 1JHZA 4G0QA 3ROTA 4ZMSA 4Z9BA 2DRIA 4IGAA 2FMIA 3A0UA 4Z4CA 1RNLA 2MSLA 5EWJB 2F8SA 1GCAA 4F3TA 4XASA 1MB3A 1Z12A 3HDGA 3FMVA 4DQDA 2NT4A 4MR9B 4OLAA 4O1HA 4LDAA 3HK2A 3L6UA 2TMYA 1SD5A 4RDCA 4RK7A 3OMWA 1Z16A 1NY5A 2L17A 5T7BA 1D2AA 4XLTA 1DRKA 4ETMA 2FN9A 2RJNA 1RPJA 4ETIA 1KRWA 1R8JA 1MAVA 4Z4IA 1K66A 1AB5A 1L5ZA 4G0PA 3HDVA 1P6UA 3M9XA 2R48A 3JPWA 2QU7A 4NICA 4Z4FA 2LPMA 3FGZA 2QXYA 4LE2A 2GBPA 2MSKA 4MLDA 2L19A 1C4WA 5CNKA 2B4AA 3BREA 4EYKA 2JK1A 3N0RA 4JASB 1RZRA 2L18A 2PUAA 1DZ3A 4OTZA 3MMNA 4WWHA 4YWHA 3T38A 1U0SY 5ED4A 3C6QA 2RGYA 5BRJA 5KI6A 3H5WA 1M5UA 5HKOA 2HQBA 3LUCA 2P9HA 4G86A 1AB6A 1VKRA 1Z13A 4W5RA 1BAPA 4O5AA 1FFWA 5DGCA 2E4ZA 4EVRA 5JNSA 3IP6A 1GUDA 2M1ZA 4TLMB 1YMVA 3VNBA 2FEPA 9ABPA 3LUKA 1FFSA
chains in the Genus database with same CATH superfamily
3F7OA 1CRLA 3ZD8A 1EFDN 3VR3A 4MKZA 2OXEA 4R3UC 4DUGD 4UEWA 1ZVVA 1ZG3A 2I4TA 3KAQA 3LDFA 5C9ZA 3PX7A 2GUWA 2WIFA 3AYXB 2W2QA 3NYWA 4PHGA 2JI8A 2APJA 5I9TA 4DCGA 3RWMB 2AD1A 1AHIA 3WK9A 1PBNA 2WT9A 1JSXA 2ZEJA 3DBOB 3KPJA 3NBXX 3QE3A 4IUYA 3ENVA 2Y2UA 1Y42X 1U2SA 3D7SA 5FEUA 5JXWA 3B3QA 3JXEA 4FFBB 4B6QA 3A25A 1XEFA 2R47A 1DAHA 2WWHA 3ZTTA 4D79A 1W5BA 1N8NA 3WYNA 3M3HA 1KGSA 4IO1A 5F21A 3I30X 1DTSA 3K8ZA 2HYIC 4D9CA 1SIBE 3DAGA 5TC4A 1M10A 1J70A 1II9A 1JUDA 1VM6A 4I55A 2XMSA 4YRTA 5K51A 3SFZA 5CLJA 1ORRA 1ZISA 3WB0A 1FTQA 3HADA 3D6JA 1O8CA 5KNCD 4P7KA 1DIHA 1N75A 1SBCA 3I3OA 5JVDA 3EPLA 4Q4LA 4NPCA 4OH7A 5AMXA 4CMJA 3DBHB 3QVKA 4V3CA 3SZUA 2PG3A 1VOTA 5TS2A 1VA4A 3UWPA 5JXGA 1LI7A 3N8HA 2C7VA 2WQZA 2XUGA 2V98A 4A6EA 3OKAA 1K8ZB 5JYCA 1WZCA 3MZ0A 1V3TA 1UADA 2W6NA 2Z5FA 2HA0A 2YWHA 3F5QA 4MWSA 4NBTA 5F77A 3W5BA 2CFSA 2DB3A 1BC5A 3D0OA 3K6SB 2IS4A 3BULA 2FH5B 1GO2A 2XTNA 4U7PB 3KPVA 1N0IA 2ZGVA 3WMWA 4QPZA 4M0UA 5KKAA 2PD3A 4DV4B 1K6EA 3U1BA 4KDEA 3WDKA 3SBEA 3PR1A 2P9FA 3EXIA 2GPSA 2VJMB 1YI1A 4HBGA 3REFA 4LXQA 3I2JA 1IYZA 1JAHA 1OAAA 1Q74A 2AUMA 3OQ1A 4XJTA 3M3PA 1X1SA 2QRVA 5HQTA 5JCOC 2H1SA 3G2LA 3C5VA 3IBTA 4PEVA 1HETA 3IBGA 4JGBA 1R5OA 1HMYA 1DCFA 2BKUA 4WH0A 2JVIA 3AZPA 4GI3A 4Q00A 4CMEA 4A7PA 3F4LA 3H8JA 3NXKA 3X2SA 1H66A 1BXGA 1NUHA 4RKYA 4WL0A 2FWPA 4P54A 1D1PA 1KWKA 1DLIA 1JEYB 4A3SA 2G28A 3GJ3A 4LVNA 3RQIA 4EUNA 2O0KA 4MR9A 1NFRA 1J2UA 3RAJA 1J7JA 5BUCA 3J81A 1EVJA 2HSEA 2WYWA 2YBEA 2JLUA 5JNTA 2YNMA 1ECFA 2R4UA 5J23A 1Q2UA 1AHHA 1S6YA 3GWZA 3GZ4A 1TAUA 2FFHA 2FMFA 3E18A 1TM2A 4LW8A 3ANMA 5CB0A 3SQMA 1KC1A 1L5OA 4GUDA 4Q6BA 1JA0A 2IOHA 2ZBPA 4OHXA 3T1VA 4DEVA 1SU4A 2OXCA 1DWUA 4R83A 4IF6A 4P82A 1HNZB 1O94A 2OGTA 3NC1C 3G2OA 4L3WA 4WZAE 3IP8A 5IM5A 4F96A 4G1UC 4EB3A 3K5WA 2CFIA 5AI0A 4YWJA 3HLYA 3GEBA 1SOWA 1PRYA 2YS6A 3GGGA 3Q5GA 3WLHA 3K9FC 2YV3A 3ETDA 2VDRB 1ZL0A 1HZZA 4OQQA 1O95D 4UULA 2EKQA 2VJPA 2XB6A 3JD2A 2Z6QA 2QD3A 1GFZA 3D6NB 2ZI7A 4KLNA 4MQLA 5DDIP 5DIZA 5A5DA 4OF4A 4Q3OA 2WHYA 1KH2A 5BN3B 1W73A 3UGTA 4JI0B 4OYYA 2ACWA 4NZ9A 4RU1A 4BPBA 2ARKA 2EARA 5EIWA 3QLTA 5LYJB 2QUKA 2RKBA 5K20A 1SG0A 1ZW1A 4TYNA 3RRXA 2ZUDA 2GXUA 5KC8A 4YCJA 1A7JA 3L4BA 5G4KA 1EA5A 4EB0A 1DBRA 5A0VA 3ICQB 4DV5B 1YB6A 1NOIA 1TUEA 4IL5A 1KBQA 2EX4A 4CWAA 2H31A 4OX9Y 1OAKA 1PVDA 1KZ7B 3DEZA 2EDCA 2I91A 5JJKA 5ICMA 1VSUA 3HCDA 3DF9A 3KKQA 3O74A 3OZFA 4PTLA 4WN9B 3ZZMA 4R71A 5CFRA 3UMMA 4EENA 3R9XA 4EW2A 3MWLA 1GT91 1TZ2A 3DZBA 4FYPA 4HPWA 1L7RA 1QNFA 4I9HA 4PQRA 4JITA 1NLZA 1WOYA 1US8A 1ZKMA 4R4JA 5JXIA 4U6QA 1N2SA 3VTFA 2C29D 5H02A 1CZNA 2ODPA 2I66A 4XX0A 4AECA 4CMEC 2Q7XA 2Z2ZA 2Q5QA 1SY7A 2ZBDA 4OGGA 4UDNA 5GGXA 4Z2AA 1E58A 4IDCA 3A4TA 4DC0A 3NDJA 3WLIA 6ABPA 3SSAA 2AJDA 1HH4A 4E31A 1S7CA 4LHSA 1R9GA 3TRHA 3P32A 4RFVA 3NYRA 3USCS 3LX8A 2YNMC 3TMYA 1OLOA 2VYND 4GOND 5E2AA 1Z33A 2ZJOA 4L15A 1ZSYA 2WM3A 4MGIR 2D7CA 2NYVA 3NHKA 3BILA 4NDZA 4F93B 4MR8B 4RCZA 4WK6A 4NV3A 3CG4A 3H0KA 5DXFA 1HSZA 2QTAA 5FL7D 1J21A 3T94A 1GPNA 5ELLA 2V7BA 2IITA 1O94C 4EHFA 3SEQA 5JSUA 1Q1QA 5CU7A 1NF2A 3DD5A 2ZI4A 4AY2A 1U02A 5AOVA 4YYZA 3B1VA 3ZR4B 5AVVA 3AU8A 2XKJE 3A3KA 2HJHA 3FE2A 4RM3A 1E1KA 2WG2A 3BQMB 3LHFA 3FTPA 1RHKA 1HZZC 5FULA 1J06A 4CM9A 2VPIA 2YZNA 2H4JA 3C16C 5ALQA 5KEIA 2O14A 5EJ5A 3PWZA 2ZRMA 3KV3O 3M9WA 3H13A 3IR6A 3DEKA 2WJPA 5HXAA 1YR8A 4CV2A 3CH6A 5CDFE 4KVZA 2HR1A 1H2BA 3DE6X 2X23A 3KUUA 5B12A 4EMTA 4NK4A 1IJEA 1C9NA 1ICEA 1T6NA 2AR7A 3HHEA 2MYTA 2QN9A 3L4BC 4A5SA 2JB9A 3BTVA 1ST2A 5KQSA 3PX3A 4IVQA 4CM6A 5DTMA 3P9SA 3TF5A 3RARA 3E35A 4AKIA 3AM1A 4FW8A 5DMHA 2PJUA 2VHQA 1JPNA 3FOCA 5FBHA 2PYDA 4WGFA 4GVLA 5CLLA 4BQNA 1OUMA 4RD4A 2HMSA 4C4XA 1CY2A 1PZFA 2GPBA 4QTTB 4IIVA 1WR8A 2V5VA 3KZMA 3THSA 1E8DA 2PQ6A 3HYTA 4X97A 1YVEI 1Y6QA 5IBCA 1JHMA 4U7FA 4FBLA 3U5TA 3CIOA 3A11A 3OIDA 2IP1A 4TWZA 2ZU6A 2WM9B 1IBSA 2LXNA 4WNCA 1U7OA 1G21E 2J09A 1CJBA 2MYUA 3DZJA 5IW8A 1M0EA 3LP8A 5CXQA 4M1SA 5E6SA 3QHQA 1Y5NA 3ZZTA 5ES4B 1ZNWA 3S81A 3CS3A 1Z18A 4Y18A 4ZVQA 4D6XA 1MB4A 5B3JA 3RFUA 3NHWA 1M67A 1U8YA 3EZ9A 4I9UA 2G72A 4K46A 1C8LA 1DUIA 1L9KA 4XIFA 3SE7A 4BL5A 1WL8A 1P4HA 2IFTA 2IW1A 5F52A 1J22A 5C34B 1W88A 2WUDA 1MTZA 3FFAA 2A5GA 3ESAA 1AK2A 4XUDA 4HQNA 2OGSA 1CRPA 1EK0A 1QFYA 3SS7X 4K6OA 2R8YA 4RTOA 4M7RA 2PX5A 3OD1A 4XDHA 4OQDA 1OFVA 3CLUC 5AKGA 3RYIB 3WLSA 3HL0A 1UC8A 4A0GA 5AVQA 1JZSA 1K4KA 1G5PA 3R6TA 4PLTA 2SNIE 4FOSA 3NONA 3VOAA 3U37A 4L6CA 1YKFA 4V02A 3VKUA 3GRKA 2AKEA 1EAYA 1THTA 3IDAA 5FWXB 4YRSA 1F5NA 2G3YA 1V1RA 5JC1A 1RCUA 3JQFA 4S1WA 3WGJA 2NSHA 3DM5A 2OAQ1 3FYUB 2F90A 1HPLA 4FKBA 1UC4B 1NRIA 1WTCA 3K09A 3O94A 4XAQA 2NO4A 5HMMA 1OFIA 3LPMA 5HPYB 2HA6A 1KI4A 1UK6A 2P5TB 3AFNA 3IAFA 4X95A 3O8QA 2PQ2A 4Q9NA 5BVGB 3T1YB 1RPZA 4V0MA 4NRDA 5BR7A 2YY6A 2ZTUA 3E7WA 1YZTA 2ECOA 1G4AE 2F3PA 4JC5A 3UOAB 4ZRDA 2XYVA 4L5IA 1OKKD 3UHPA 2QUAA 3A70A 2Y77A 1X92A 3N8GA 5K0BA 4HMOA 3MT7A 1DZIA 1NULA 4LMAA 5ANRB 5EUMA 1DXQA 4BEVA 1JDNA 1MV5A 2H17A 2AMFA 3LHIA 3HDTA 4JYCA 4RZHA 3RUEA 1KYXA 4PQFA 3IJEB 3ESDA 1D3AA 2VP9A 3L8GA 1IXZA 4NH0A 2CDCA 4F4JA 4QNNA 3FHTA 3TR6A 5GOZA 3HRHA 4F85A 1G20B 1KI8A 2ROQA 4QOEA 2P77A 4Y30A 3DXFA 4AZWA 1C0EA 4M1TA 3HO6A 3P5BA 5DLEA 1DV2A 4COOA 1XT6A 2YQ5A 4QO8A 3NH9A 5EIHA 3S7TA 1ODJA 4E07A 1H3FA 3ND8A 4MUMA 2HBZA 1ZK2A 3OE7D 3VZQA 3HTXA 1SCUB 2QV0A 5GGYA 3ROMA 2HH9A 4RZUA 4Y2TA 1V2GA 4WLNA 1JU4A 1RHRA 4DG9A 1X7YB 3QVXA 5B3JC 5KVSA 1PEAA 2OYCA 2Q7DA 2OV2A 2WUVA 1T9CA 1YS9A 2QXTA 3KT0A 2WWYA 4JUFA 4UM9D 4MPRA 4ZC8A 4Z4EA 3OTIA 5B3LA 2J9GA 1KMIY 1MEOA 3KXKA 4JP1A 2P30A 3FOAA 4LXYA 5L51A 3KSDO 5KYVA 4DXDA 1RRPA 1KJ8A 1EUDB 2ZRBA 1YXMA 2HCBA 2Q3MA 2O6LA 4EJMA 2QUZA 1EM6A 4B9AA 3PXGA 4RMGA 2W71A 4W7IA 1GTRA 1H69A 1ZGZA 3UG7A 4Z6KA 2PGIA 1NIJA 1NWHA 1Q44A 1UKVY 3D4OA 4J4BA 4ND4A 2ONJA 3DCNA 4CQLA 3JRWA 3MB8A 3TL3A 4BMOB 1X86B 3D5QA 1U8CB 2R2GA 1FNCA 3WHIA 2ZPAA 1J24A 1Q0ZA 2ZKIA 3VI4B 1S4QA 2IEBA 4H1HA 1S1MA 4QHYA 3A2LA 3G5TA 3JQFC 4LJAA 5BNZA 2PSDA 2RI1A 1RQ2A 1VIYA 1ML4A 3EVFA 5FOVA 4EPYA 3K09C 1XHEA 1XMSA 5C8YA 1WSWA 2VG8A 3IQWA 3Q88A 4WCFA 3PDUA 4YUAA 4PZUA 3VHRA 3ND7A 1T0UA 4LQ4A 1NFQA 2Z2YA 3QQ5A 3PI6A 5DBOA 4K3UA 3BJMA 4UVGA 4ASUD 4EQZA 2OOSA 2FPPB 2NZ2A 3ZGLA 1MVOA 2CF6A 2GRUA 3VR0A 3NBKA 421PA 4CCWA 5C5CA 2J0SA 1WULS 2I80A 3S28A 1OW3B 1SZPA 3PUWA 4M22A 2I22A 4N18A 3OWOA 4N40A 4BKRA 1YQXA 4IUCS 1DQYA 4QXOA 5JWHA 2QW8A 4ZTZB 1ENZA 1VIVA 2P9JA 3N7UA 2QSYA 3EB9A 2BKLA 1AKYA 3K0AB 3CPSA 3MSXA 4F60A 3JZAA 3KJXA 3NHLA 3MILA 1KIMA 3H04A 3AVXA 4RSRA 2OCPA 3UWSA 4U5XA 4EKGA 3L0DA 2CLDX 5J2TF 1Y1KE 2QYHA 4DLAA 4ZYLA 3UUGA 2CDAA 2PY6A 2R9VA 2XOEA 4C43A 4DANA 5JMOA 4FE4A 4DQUA 3QELA 1RM5A 3R0XA 3U3MA 1C0KA 3F9CA 4KGXA 4KUHA 5KSYA 2ZXUA 2AB0A 3AETA 5CXSA 3ND6A 4XI9A 3S7ZA 4REMA 3BB3A 5CRIA 2EJVA 4PPYA 3SIXA 4KPUA 3P9XA 3I9KA 4LFAB 2XQFA 3ROEA 3HDGA 3W3AH 1O8BA 4H7DA 2VHZA 2QN8A 1DKRA 1GU7A 3PCTA 8AT1A 2Q1TA 5DE3A 1H8HD 2RH5A 3UH0A 3GOQA 4ACAA 2VS1A 3L6UA 4RDCA 3ZHQA 3EXEB 4IY1A 2PO7A 5DOVA 4E5SA 1EGQA 2HI0A 4QQ8A 4NOMA 2GCEA 2H9YA 4MVJI 1U7UA 1X7WA 5DHFA 5KYWB 2Y8EA 3OICA 2JAQA 2NU9B 3D7RA 2O0HA 2KHZA 1OTYA 1BD3A 2DGDA 2WA1A 5CDUA 2ZUUA 1SPXA 3WICA 5A7FA 1DXYA 1PJRA 5B55A 3SF8B 3UV6A 5A5EA 4OHWA 4N3AA 2Q5HA 4TTJA 3I53A 1E3TA 2RGYA 1UOOA 2CHQA 1N6LA 4ZT5A 5FR1A 3LL7A 3HVJA 1MJNA 3FN4A 1CJSA 4RH3A 1XAHA 4HQLA 4WCFC 2PEYA 5JD6A 5DM70 3V80A 3TAHA 3U4CA 3DAFA 4KAAA 4CM5A 3KB2A 2FK7A 4YT5A 3PNBA 5K8CA 4CMBA 1ADFA 2BM0A 3Q3HA 5BN1A 1A4IA 2GD6A 1JNXX 4CFSA 1Y8CA 2TRSB 2HF2A 2D06A 3KUKA 4P4GA 4Z8XA 3LUKA 1L8AA 2RAUA 1XK7A 3KQPA 2HMYB 3IPRA 2O8FA 2C5HA 2GDZA 2ZIUB 2VPPA 3I04M 4PZYA 3LCVB 4ZT3A 1HTTA 4K9NA 3WC4A 4C1NA 1CQZA 1QFXA 1PNOA 5CVCA 3WS7A 2WJVA 1I5EA 1R16A 2VJCA 2WP8J 4R68A 1DCTA 1V16A 3NIWA 3QYPA 4TVOA 1FVFA 1WXDA 1JDPA 4DA7A 1LSSA 4R2LA 1ZCJA 4P32A 1BMFD 3CH4B 5HE9A 1WDWB 3WQQA 4F2HA 4DV6B 2WILA 1NQXA 3ZZ0A 4CEIA 2AK2A 2OB2A 4ZVOA 4BNXA 1I2MA 2A5FA 2ZQ5A 5JD4A 1INLA 5LQKA 3ZJ4A 2I2FA 4HRYA 1O6GA 4KLRA 4EG1A 4XVUA 1J2EA 1P0IA 2O8EB 1B4DA 3EISA 4WIAA 1E6MA 4OBBA 4O4IA 1R88A 3MYYA 3STHA 4KWHA 3WIOA 3HUFA 4O4LA 1O08A 3TB6A 3GEDA 5ALVA 1R8YA 1XWFA 5JNWA 2C5LA 5A03A 1TZCA 2JHCA 1U4NA 4ZD6A 2VRCA 3IJ5A 3QEMB 1FUKA 4QTXA 4TGLA 3GEIA 1DFIA 3U7FB 2VKTA 2A6PA 2NU6A 1A9XB 3TSWA 3GOHA 2HEIA 1WETA 3FGOA 1E89A 2GBCA 2Y1KA 3KQKA 3PNPA 1NF9A 2YZMA 4FT2A 1TIBA 4W1QA 1XK6A 4FGJA 3V1UA 2R7NA 3LH5A 1E0JA 2BJHA 1P2SA 1W19A 2VHEA 2BJVA 3F4BA 3O2SB 3OZSA 3R23A 3T52A 2BWJA 2EJUA 3TW0A 4B4WA 1JKIA 2AX3A 3OEED 4ETWA 4LGYA 5LC1A 1KWGA 5B7QA 2CFOA 4NEHB 4BGDA 4KWTA 2UUAB 1Y6JA 1MA0A 2A4MA 1EDEA 2JI6A 5H9VA 4BNLA 5I7EA 2BKAA 2PU7A 2NUTB 2XRMA 4TL6A 1ZGHA 4IP0A 1JWAB 1VMEA 3VR6D 1G8SA 2X5NA 4PM4A 4U02A 3OFVA 3I1YA 5IJWA 4NAUA 1XDBA 4LBWA 4RANA 1DBPA 3SIRA 4BV3A 5AJVB 2JVJA 1K2WA 5KWSA 3E7DA 4BLVA 5DM1A 1A96A 1Z9BA 1RJFA 1RJDA 4BP1A 4DNQA 4EVSA 3F8SA 1TK9A 3FZNA 4MHOA 4L78A 4HCJA 7REQA 1NVEA 2V7UA 3CEHA 1NVUQ 2QNIA 3U3ZA 2FXVA 3S29A 3OCVA 4NC9A 3H9GA 4U5QA 5KYYA 3MEQA 5BW6B 4YFVA 4OATA 1UBRS 3WLPA 1GPAA 1RXUA 5DYWA 3JVDA 4ZPXA 5DWVA 5FPQA 4MUIA 1NBMA 3RUPA 4F12A 5IDWA 2VPTA 4Q4AA 3LSYA 3CLHA 4K9OA 5IWAB 3VOSA 1GRNA 2I2AA 2A9FA 2C2WA 2ZBEA 2YHSA 3KOXA 2Z2KA 1N6HA 3EUWA 3B82A 4N3GA 4RABA 4KXVA 3QTBA 4BRUA 4WPGA 1OBOA 5ITZA 2K7FA 1V3QE 3ELYA 2OPHA 1L5GB 2CLSA 1Y4SA 2QAGA 2BGJA 4UAGA 3WJ1A 4CCYA 2VT2A 4RM2A 3ROFA 2ID7A 3RODA 4XH9B 3ZWDA 1WDLA 1A8IA 4BO1A 4O2BA 1NP6A 2G7MC 2JLXA 1Z2OX 1VYTA 4LOIA 4WFIA 2ZBVA 3G88A 3OTOB 1FP6A 4V0KA 1XRMA 2WAMA 4I4LA 2WY2D 2YBDA 4GOOD 1PQ4A 3L04A 2D5LA 2Q45A 1T0BA 3CF6R 2ZSFA 2CV1A 1XYVA 1DKNA 3N70A 1PT5A 1X1CA 2XD9A 2EOAA 2HCRA 3Q0EA 4QGHA 5B2ZA 5IP5A 1RP1A 1DC7A 2JGDA 3GRAA 4PG7A 3W1VA 5IMSA 1J2JA 3Q3IA 1P1JA 3RVKA 4CN9A 3E4DA 3W1WA 3I3SR 1MG5A 1PZHA 3IUSA 1WUKS 3NKLA 4LZAA 3UEOA 4YQEA 1MC5A 2B34A 2FZGA 2GX6A 2H52A 1GG8A 4C5CA 3AK4A 3R1IA 4G5XA 1VRWA 2B98A 1N2XA 3KOYA 4G0NA 1NUSA 3P9YA 4QYWA 3FI9A 4UVEA 4CKEB 3OIWA 4TLDA 5J43A 4W5OA 3W3ZB 3GDGA 2XDQA 1GKLA 3KTOA 4N76A 2MR5A 3HCOA 3OFKA 2XNCA 1BNCA 4GOLD 5HDQA 3TE7A 4DSOA 3L7OA 1TFUA 3OAAD 1MX5A 2FZKA 2JAWA 3G2MA 1SR8A 2ZJ1A 4D8TA 3TZEA 4UXIA 3KQOA 2C20A 5EPUA 4E14A 1GPJA 3E2IA 4Q1BA 4BN4A 3R8CA 5L3ZA 4E70A 3HWSA 4Q1FA 4J4TA 1W1UA 4L4XA 1RIFA 1ZMRA 1H42A 1AUXA 3DP7A 1QPBA 4L27A 4MVYA 2QN2A 5K3CA 3TKYA 3ZY6A 1UOEA 3E48A 2XYPA 5DHRA 3T5MA 2VP6A 3NTRA 4ZN6A 1M2OB 4BO2A 2GTPA 4E09A 3C3PA 2A5DA 1QDUA 4BX2A 2Z43A 3K2BA 3PDIB 4OQFA 5D1NA 1Y7PA 1CKEA 1E5LA 4OK5A 3SQOA 1W85A 3SFTA 2IEDA 3ZI7A 4XOUA 1TPZA 2FGKA 2UZAA 1KH3A 2N75A 5KTYA 1AK9A 3O38A 2PKQP 2FPOA 1QDLB 1KFBB 3EA5A 2D1SA 2EGHA 3HFSA 4I1IA 4XSGA 2QAGC 2Z1MA 4X00A 2X1VA 1YZLA 3FR7A 2H29A 5CVVA 1Q3TA 3CN9A 1R64A 2F1OA 2FN7A 4S0ZA 4J16A 1HTBA 1I10A 1SXJA 2WHRA 2XBUA 4KTTE 3U0BA 5IM4A 1RZRD 3E7FA 6REQA 4C4TA 2P5SA 4US2R 3O4RA 5D8DA 1HYBA 2GK6A 2JLSA 1PF7E 4GI1A 1XPUA 5EC8A 2Q6VA 3PVCA 5I8PA 1AIPA 1UT5A 5T3YA 4BNHA 1J9GA 1U0HC 1EFLA 1PR0A 4G07A 2PUGA 2J48A 3SS9X 2CD7A 1TEXA 3QOWA 1HOTA 4LA4A 3OQBA 3CT4A 1N8SA 5KOJB 4DLWA 4X6YA 2Z30A 1E3QA 2BW0A 1Q2XA 1I6MA 1L1QA 2H1WA 4YMIA 3RV3A 3I2HA 2CL7X 4LS3A 4RK5A 2WG0A 3MGKA 2QLNA 3QWHA 2FA9A 5FIUA 3WGLA 2FXIA 3C7AA 2W37A 3RB8A 4R1OA 3N87A 4G8CA 4CFYA 3QUAA 4HEA6 4NU8X 4YMLA 4KVAA 2A9JA 1ZGBA 2ZVPX 2OHHA 3QQPA 1CVLA 4I9GA 4JL6A 4ZCTA 1KGDA 3K0EA 4E4YA 1YASA 2E55A 5HCNA 1E69A 3C24A 1BXZA 4NPHA 5IUNC 2OMEA 5JLJA 4QQRA 4BB9A 1QHIA 4BVLA 4RQBA 3JWGA 1JFTA 3PHLA 5J4KA 1D0VA 1X7ZB 4DBZA 3RKSA 1PKEA 3PQ6A 1ACLA 4FGSA 4RFSA 3TXAA 4DBVO 3PYMA 2QX7A 3KPYA 2H7XA 4J0IA 3PXBA 1QOQB 4NH4A 1E2QA 4N39A 1NLFA 3H5OA 1AY0A 5JNVA 4QQKA 3NGMA 2EJWA 4XW2A 4A8JA 5IDXA 1NDQA 4FFMA 3CPJB 4MV3A 2CUNA 5B4VA 4TT3A 3JAKA 1TUBB 1KRHA 5AKEA 3M6IA 3S2GA 2AF3C 4Z4GA 4FLEA 3TL2A 4DM3A 3UKDA 3MQ4A 4NBVA 2D1QA 3B70A 5EIOA 4BLQA 1JHYA 1Z0SA 1GXSB 2AC7A 2OHFA 4GAEA 3RIMA 4M6WB 4B83A 2IVZA 5C7LO 4Z86A 5FR2A 2UVPB 1FRZA 1FP4B 2KMLA 1L5YA 3L46A 1EVKA 3PXXA 4GH5A 5JCJD 3V4VB 4QTZA 1Z6QA 1OFGA 2R2AA 5HZKA 3NTXA 4B3HA 3GDWA 3TX2A 3EA4A 1T15A 4NQZA 2FZ5A 4G26A 4J16C 1SXJC 4KDFA 1Y89A 1ZSVA 4LVCA 2DWOA 3PHJA 2BOVA 4X92A 4DR5B 4QBGB 2HU7A 1FXWA 2G8LA 2NU7B 2P8SA 4D7AA 1GGMA 1GSIA 2QS9A 3UJ3X 7YASA 5KB3A 1QGDA 4EGSA 3VYSB 3X1WA 3KEFA 3AVQA 4WN3A 4IYJA 4IOMA 4ZOLA 1MQSA 1NF3A 1OX4A 3OZIA 3BDAA 3OLZA 3U26A 5EXEA 3UMFA 3AI2A 4Y1RA 3JQ7B 3PKZA 3REQA 3OHSX 2W42A 2I65A 4IRXA 3B9RA 4MI9A 2QR3A 3T6KA 1UDCA 4CW7A 5JAIA 4LDJA 1DAKA 4LHVA 5CA0A 1N5JA 2VQ6A 4MQUA 1U9YA 1X1AA 3LOUA 4R2JA 5EP4A 3DBLB 2PKYX 3QOYA 3TEFA 2PS9A 5CG1A 4S1PA 2WSYB 3KE8A 4FOLA 3N6VA 1ZZEA 4XCXA 5ALRA 4IV8A 3GGJA 4C6SA 2H16A 1U9CA 2V5AA 4ZV4A 1GZ7A 1JAYA 3H05A 4Q0MA 4JT9A 2OHJA 3FBGA 1ORDA 4DR4B 5L7TA 4J9VA 1R0KA 3SJUA 3K8OE 3CBGA 1A97A 2JF0A 2BT4A 2PGAA 4ZFNA 2OR3A 2FLWA 4TKMA 4I6JA 3QYFA 3OCXA 1G16A 2ATIA 3EFOB 3K1JA 5CH3A 3N0XA 5KYNA 4MK4A 2XQKA 4PFQA 3PB3A 3ROKA 4A8JC 1W49A 1U0NA 4YRRA 3UJNA 4I4TB 1LC3A 2JKYA 1EUZA 1PR6A 4HH0A 4XARA 5A3JA 1P4JA 1YT5A 3EEYA 3AONB 4FYYA 1K9VF 3CLVA 3FB1A 1YOVA 4FT4A 1F8GA 5T57A 3L1VA 4YXFA 1CUEA 1DRVA 4Z9FA 1UJBA 2PL1A 3E22A 4YLYA 2OVFA 3PPVA 4CETA 2PMFA 4RHFA 5U9CA 1W581 2P9ZA 3K1AB 1DB3A 5LA6B 4P4LA 4ESEA 5KNBH 2DLDA 3EGIA 1T43A 1UPCA 4JEMA 3SKVA 2Q5LA 1SOAA 1Z6GA 4L85A 4B7UA 1LX6A 5JW6A 4DCMA 4A0FA 4I4TF 1Y8QA 4I7EA 3FYDA 2JCYA 2X77A 4IIUA 4L4SA 2CXSA 4MGKR 4BN0A 5HUJA 3P0JA 4ER3A 3AUAA 4DLXA 4EUKA 1W44A 2QI9C 3VDRA 2ZSEA 3ETCA 3SC2B 4BC1A 5C31A 1I7SB 3VAZA 5JAMA 4HGYA 2F43B 5DM60 1R12A 3INGA 1XQ6A 2PAAA 3BD8A 1YDWA 3FDIA 2IUYA 2XCIA 4L6AA 3NHFA 4E6EA 5BWLA 4IDEA 4NZNA 4F3YA 5E0OA 4P5PA 3Q2KA 4BEBA 5F7XA 4L8LA 1KTIA 1NW6A 3S2YA 5TARA 3VYVA 3E9NA 1SHTX 4TVSA 5BW4A 2HK7A 4DLVA 3DKVA 4EX7A 2ZREA 1BA2A 2XVMA 4MW0A 3VNAA 4MEAA 3ZWWA 2M2IA 1IQ0A 3OVMA 3SMVA 1C8KA 4PBTA 3EQ2A 3GJRA 3U3RA 1WQ3A 3GEMA 3EUEA 4NS4A 4YGXB 3WGQA 1TIPA 2QRJA 1U7HA 3JARA 4I55F 2CK3A 3T7KA 2KYRA 3GCDA 3I9V1 4YUVA 3JQQA 3TIIA 4B7ZA 3C39A 2ZB7A 4KQWA 2DHDA 5IPFA 1JIQA 1VA5A 3OTQA 1JTEA 2MHCA 1M1YA 3NHZA 1CY4A 4MTLA 4BLSA 4EPWA 3CLKA 1VJ5A 3EMDA 2HMAA 2Z95A 4Q3LA 1SB9A 3A9WA 1YJXA 3LYUA 4WCVA 4ZAFA 3IT1A 4KPFC 3CRZA 2AG1A 4ZXPA 3EEFA 3M5CA 4V39A 5EP3A 1UT6A 4I08A 2FZLA 5EP1A 1ITZA 1CV2A 3GB9A 4IGAA 1KMHA 1F2VA 1RWXA 2HXGA 4DQLA 2G4LA 4MARA 5FAXA 1WW8A 3OEHA 4KQ6A 2YJGA 5K0CA 4BMPB 2O2JA 2QR5A 1N5RA 2VCEA 4NFSA 2J87A 4WY5A 3SU8A 3OOSA 1XG5A 1OC2A 4ZCSA 3DFMA 4MR9B 2R87A 3QPBA 2YJZA 4Z7JA 4IIHA 1MKYA 1KKMA 1VHQA 2PJDA 4RK7A 4KR9A 4PGAA 1A76A 5E6UA 2D74A 1AV6A 1SVIA 3QMVA 3K3PA 3KT6A 2FX3A 3OQIA 4H0NA 1JG6A 1Q16A 4F4IA 5FXMA 3WB9A 2EW1A 4ETIA 2I4IA 3PSHA 4UMDA 1CR2A 2H4WA 3WLQA 1ZBDA 3AB7A 4ZQGA 3LUPA 3ZVLA 1IXRC 3IQGX 1DG1G 4NFYA 1N2CA 4UNIA 2WWXA 2QXYA 3V7WA 1O58A 3HKDB 4R1QA 1XNJA 2CZQA 1L4KA 1PFKA 3EBOA 2VJLA 3QUSA 4NCIA 3JWEA 2HAEA 4QGAA 4XIGS 4JEHA 3BREA 4J7CA 4R3NA 3PFGA 4B6SA 5FA5A 1F8UA 3K2IA 2QTVA 1UJMA 1GUYA 2ZSHA 1SZDA 3GJXC 4ITRC 4WACA 3L3BA 2RHJA 4OHBA 2ODEA 5DRYA 5E1BA 4IQ0A 3AUUA 3TKAA 1J9ZA 1HEIA 2OZLA 3D7KA 1KE1A 1M5UA 2NU8A 4PYMA 4S35A 3NBUA 3RC1A 1R4MB 4Y7DA 2OD2A 5I7AA 1UDXA 1Y9ZA 3P20A 4H7HA 2HBRA 1JGTA 2VOJA 3I39X 3SC3A 2GZ3A 4N4AA 3EIFA 4ALLA 1DADA 3LBNA 1K08A 1UC9A 3IP6A 3JQPA 2XB4A 2JD1A 4MICA 4ARZB 2ZATA 9ABPA 2ZJAA 1UFKA 1OIWA 2FV8A 2ZS7A 3FPAA 3HBFA 4QJBA 3ZV7A 2CZGA 2ZTHA 5H9WA 1L5MA 4Z1OA 2HU5A 1JFVA 5G4KB 1CR4A 5KZMB 2QGZA 4EO9A 3RFVA 1NX9A 3H87A 2RGDA 2ZRHA 1R4NB 2D6FA 1Z45A 2CEAA 3GYBA 4UTOA 4BHTA 1LW7A 2IPMA 2I3BA 1N4AA 3W8NA 3VU3A 4DJTA 2HYDA 2ZXFA 1EK2A 2RHLA 5BRAA 1B42A 1ORHA 2YIJA 5BNWA 2OP1A 3L5KA 1YWGO 1XEWY 2F1KA 3BMQB 3MMZA 2XMCA 4I5FA 2DHEA 3W8FA 3ZEAA 4ZMBA 1B6RA 3AR3A 2QLLA 3FUUA 3G9UA 2FVXA 3P8ZA 4WLOA 1TQ2A 3WL7A 4DUZB 3G0DA 3I2GA 4AICA 5LUBA 2QAJA 4GKBA 1X14A 3BORA 1QHHA 2C8VA 2R1VB 4A10A 3PQ8A 5EMJA 5A4KA 3T3NA 1HFKA 4LSGA 2C4UA 3GNSA 1U1GA 2HRRA 4B5KA 2X2PA 4KMRA 5EHIA 2WABA 1W59A 4FBGA 3TLZA 4QT4A 1KA9H 1T29A 3AF1A 2BH2A 4DCVA 2WLSA 4ZDJA 3W5SA 4N5NA 1MR3F 1NC1A 13PKA 1JHXA 2I4OA 3O1LA 3BQNB 3F5FA 3Q7QA 4UM5A 4BGEA 1YH3A 3STWA 3TQSA 3L0SA 2FWAA 3ILSA 5JECA 3CNNA 5BOSB 1AF7A 4P3YA 4RF4A 4CV3A 1ZJJA 2WMOB 3EG9A 3KEOA 1TAQA 4UBNA 3SIPA 4GI2A 3U7QB 4HQOA 2W2MA 4CG3A 1D6NA 1GAJA 1KYVA 3RANA 4G01B 4B0PA 5F2EA 1QU3A 1AOXA 1E2KA 1CE8A 3MOIA 4GYKA 5C5EA 4P4SB 4MB6A 2VF7A 3GARA 1ZUNB 3NVMB 3WLOA 4UMEA 4Z3OA 3AWIA 3DGFC 2NVUA 3A1VA 4FMBB 4GI7A 1GTL1 3HH8A 5AO9A 3UY4A 1OH6A 1TW2A 3K20A 4CM8A 4QRIA 5CPFA 2YTZA 2JGAA 1Z4PX 1E2NA 2Q3FA 2VDLB 3GZJA 1N32B 4ENVA 1XSEA 4PXAA 3CY6A 4I1VA 1MPTA 2X9LA 3DKKA 4X20A 3MHTA 1VSVA 1AKUA 4B8ZA 7MDHA 3UIEA 4YMGA 1PAUA 2XUQA 4DADA 1R6XA 3NH6A 3S1AB 3PDJA 4ODIA 4ML3A 2BKXA 3TTXA 2I7DA 3LGSA 3LCMA 2WFLA 4NBRA 4BUZA 1UC5B 1W6UA 2XSZA 1FLNA 3UENA 3W4JA 3GJQA 1MXFA 1QG6A 2CW5A 2FB9A 4QL3A 1VTKA 4OJYA 1JB9A 1NW9B 1ZK0A 2QUJA 1DPGA 1G17A 3WNCA 3F1LA 2N3ZA 4CMIB 5KWEA 7ABPA 4URZR 1UQUA 2P6PA 2X3FA 3MTDA 2E21A 2WAAA 4Y0VA 3ZK7A 4ES6A 2YZKA 1I3CA 2DBQA 3R6DA 1QGUA 5IC5A 2HSZA 2PYZA 3JYPA 1G1AA 3RAGA 1U4SA 2F1JA 2MSDB 3MCWA 4PSCA 3PRHA 4BVAA 4DY4A 4DQ0A 1CPYA 4G0VA 2PZMA 3RPEA 1SUEA 3CZCA 3H2BA 5EE0A 2GLTA 4E88A 4PBRA 4WW0A 1NNEA 4IPTA 1T26A 1JEQB 1X80A 5AWFC 1G8MA 4QNMA 4V2UA 4X94A 1Z5WA 2QSUA 3JYHA 3EGOA 3TMKA 1IY0A 1CYDA 1T2DA 3AIOA 1MVLA 3MLBA 2VA8A 5J40A 3ZDRA 1XRRA 1Y80A 2H1RA 1NJ6A 1QZ3A 2ZYAA 5I5GA 5SYNA 4R9RA 5ADHA 3A6PC 3DUFB 4ZANA 4P92A 5F5XA 4IFBA 3O82A 5D3MA 1PJBA 4BKUA 1H65A 4AJ4A 4GPZA 4KXWA 2AJ8A 3D3NA 1KU6A 3KLOA 4Q03A 5FYQA 1CEXA 3RYCA 2A3NA 2H1LA 4FR2A 4KXYA 1Y5MA 4CCSA 4ERNA 1T9HA 2O19A 4B33A 2XB2A 1RJ9B 3UFBA 3KT3A 4NE7A 3IJPA 1Y4AE 3GRCA 4RV4A 4DC1A 1KZYC 1E0DA 5HYVA 2FK8A 1CLUA 4ZDWA 1K5PA 1G8GA 1ZD2P 3D6AA 4JN6B 1UMDA 1L2TA 4UTRA 1Z7BA 4MYSA 4YV7A 4W5TA 2AI1A 3W77A 2HL6A 2HUNA 3AI1A 3JYOA 4W7SA 2F1HA 5IULC 3R3ZA 5IBPA 3V1LA 3WGKA 2NZUG 1GGNA 2UZ3A 1A71A 4JMPA 3P2JA 2PRKA 2Q4RA 2W2TA 4EF4A 2IYVA 4QXPA 4IR7A 4V0LA 1E96A 1XHFA 2XPCA 2CXXA 5IDVA 2PQMA 2DMRA 3U4QA 3HMKA 4ZIRB 2R79A 3MAAC 2ERXA 4BNDA 2WMDA 3DXZA 4MR7A 2H2AA 3C7DB 5ETJA 1J42A 4CKZA 2WJHA 1PGQA 5E38A 3OESA 2CT8A 4F1KA 1O57A 4FYVA 1UBJS 4HWGA 2ZJBA 4QWWA 1WZ2A 3ZU2A 1NNUA 1R74A 1IM8A 1PR4A 2GNAA 3IMEA 3STYA 5K0GA 3D3WB 3HCCA 2PHZA 1FFXB 1VJGA 3LT5A 5AI4A 3LE8A 4EZBA 2VYVD 1RBYA 1SEVA 3C14C 3CH5A 4FW9A 4Y6OA 2VJBA 1JTVA 4RVHA 1XZNA 4CG0A 4KWEA 2FPIA 3C8MA 3V5NA 1TUGA 1P18A 4M8LA 5E3HA 3K9HA 1XPOA 1I01A 4G0OA 4NCAA 3HA3A 3WBJA 1JF8A 1YR2A 2L2QA 3GELA 1I1QB 4V1CI 3K53A 3E53A 8ADHA 5JSZA 2WHQA 4NFLA 1M72A 3PS9A 4UC0A 1YC5A 1RQLA 1UQTA 2B2NA 2OPBA 4GLOA 4QEKA 5FADA 1W47A 3UJHA 4C29A 5BVHA 4IIYA 3BFPA 1CRQA 5LDHA 1P2FA 2Q1YA 3L7NA 4RE5A 2D0IA 3V4RA 2JFOA 3HYLA 4WOJA 3I58A 5A2GA 4IRMA 1VLZA 4YHBA 2XIQA 1JMVA 1T4DA 4NEQA 4EEXA 1BG6A 3BCHA 3KELA 3H9JA 4DJ5X 1E1NA 4GRIA 4N7MA 3D0QA 2GBLA 2JRCA 3FUVA 1VBFA 4YAJA 2QB5A 4HQFA 4M1WA 2BP7A 4YJ3B 3VJLA 1JDSA 5B58T 4P58A 3A6EA 3AWDA 3C6XA 5EZYB 3ZQUA 1G9XA 4KLCA 3ZNQA 4A8HA 2Y4NA 5AKKA 5TJHA 3THXA 3QKUA 2DFPA 1YL5A 1JTFA 5F3DA 1IMOA 2C0CA 4XDZA 4U0KA 2I7TA 1P17A 3JQGA 3QMMA 4WCFB 4GXNA 1SVLA 4UREA 2OAGA 2JA2A 2OKCA 3GIWA 4PAOA 1IWPB 1FW8A 4M1OA 3W6ZA 5DBIA 4L51A 4RF3A 1KP9A 1CUYA 2NNLD 4RELA 3H1EA 4YJ3F 4UASA 4B4DA 3IPXA 1QTIA 1N0HA 1JR3E 1LDNA 2OCGA 1Y33E 1REQB 3EQ6A 4UVDA 2Z5VA 5EZYF 3UWKA 3VZBA 1MV8A 2HIGA 1FJXA 2JIRA 4TS4A 3TAUA 2ZZMA 4OSPA 1I6WA 1XAJA 1W76A 2HHCA 4NE2A 4P5EA 5LQSA 1XTTA 5FUMA 2ATEA 1WXIA 5HS6A 2M6KA 3PKIA 4QGFA 3ENKA 2IH2A 3RSQA 2P2LA 1QO0D 2GKOA 2CHFA 5F2NA 5EJ4A 1UPUA 2YZ7A 3AC0A 4KQGA 2B0CA 2VDJA 4JBHA 4Y1FA 1WLYA 3ECCA 3B20A 2OSBA 4K6CA 3TLYA 5AW3A 2OCBA 3NTVA 3EXG1 3QELB 2WVHA 1E2UA 3RVSA 3KWFA 4UNPA 4N8EA 1MT3A 3OO1A 3DDSA 1NRXA 3IQXA 3RT9A 1XMJA 4LDRA 1U65A 2D5AA 3MTBA 5AOAA 2R3SA 1AQJA 1T1GA 1A9OA 2WPNA 3MJVA 1LPAB 4CT0A 2IW3A 3DMPA 3PNVA 3OJCA 2RK4A 5FBZA 1GFWA 3WYCA 2Y68A 3OMXA 3VX4A 3D4PA 4MRRA 1ODFA 2RONA 3RIYA 4C7OA 3U4MA 3AYZB 3UMGA 2O50A 1EH5A 5LOVB 4RSGA 3EDMA 1SVUA 4NXMB 2B2CA 2QL6A 3IMKA 4IXDA 4MS3A 1LI4A 1V5IA 2XMQA 4ND8A 3W78A 4DMKA 3LX5A 2NPOA 1AHPA 3BJEA 2W2LA 3O6VA 2AYYA 1GR0A 3BRWA 1RQNA 2WUGA 4RACA 4YJFB 1WF6A 5CNIA 2ON6A 2VPYA 2GBLC 2QEQA 1GFSA 4IX1A 3VOTA 4ND2A 2RHWA 3PC7A 2ZYDA 3M9LA 3WIUA 3X3HA 5LQCA 3NOXA 2FUCA 4LZOA 1GUBA 4R1LA 2JLBA 2NNWB 2XUJA 3SHFA 3HB0A 3TVYA 1YZ3A 1CNFA 2FN3A 3ILHA 5CTAA 1I4OA 4OFXA 2PLFA 5BWNA 2RH9B 4YUZA 1T5TA 3O8NA 1OWOA 4S2EA 3RR2A 1NQAO 4DR3B 2EYQA 4NYMR 1T9GS 2CB9A 1ZA1A 1CR0A 1C41A 1H5QA 3LLCA 2B1QA 2G1UA 4Q7QA 1VKZA 4FN5A 4L73A 2CF5A 4RD2A 2IYZA 1JHPA 3B3AA 1V25A 3R7NA 4A91A 1I5RA 1GP2A 2B4TO 2QTBA 4AJEA 3R5JA 4WZZA 4EYSA 5AXBA 4LE1A 1THMA 2CJPA 2X4GA 2IZ6A 2CHGA 5IKMA 3WKEA 2XZPA 2F9MA 1DMSA 3F4KA 3LA8A 4FYKA 2B2XA 3RC8A 1LLUA 2IEIA 4YRFA 1XJQA 4BAGA 1ARZA 4KLZA 2ZFUA 3O26A 4JB0A 2IY9A 4O6VA 3HN6A 4PG6A 2PT7A 4JQCA 4HXFB 3ZY2A 1WVMA 4HEQA 5K3OA 1V16B 3A9CA 1RC0A 3IP1A 4J4HA 1RXYA 3CSUA 1DG3A 5CYPA 4W1RA 1KDRA 3DT6A 4RTMA 1SK9A 5CMLA 1Z47A 4C01A 5LD2B 3E0XA 3BICA 3HU5A 3HM2A 3WBBA 2HMUA 3ML1A 1HORA 4C7BA 3C7KA 3GT4A 3HXPA 3OURA 3BHJA 3O2QB 1T25A 4CL8A 4WEQA 2ZYSA 2QG6A 2VSNA 1TX4B 4KCGA 1KKUA 2YXBA 5H16A 5CFPA 1XMOB 1L3CA 4LWOA 4ZJZA 2A9OA 5T6MA 2OAEA 3BHMA 3N2NA 4Y9UA 3AUKA 4OREX 1G3MA 1TEHA 4GE3A 1YBFA 3JZDA 1JDBB 2ZDGA 3TKLA 3IAS6 4D4IA 1G5TA 1OI2A 3NORA 2B7BA 2DUNA 4FP9A 4DAEA 1R0CA 3EXFB 3MJCA 3K9WA 3AIMA 2ZBRA 1CUAA 2WQ7A 1PYOA 5DLQC 1A9YA 3SIWA 3U4DA 1TYAE 4JGGA 4O4IF 3Q8LA 4ZKDA 2GBFA 4Q24A 3V2UA 4BGVA 1TYBE 4CLOA 5ITVA 2XXAB 5MN4A 1F4PA 2KX7A 3M6XA 1PG0A 1CHNA 2A59A 1VSTA 2XNHA 3IPAA 2B21A 4Y1GA 4DHWA 3A58B 4CV0A 1P9WA 3TBKA 3WFZA 1L5SA 4C05A 1W25A 2J5BA 3LBAA 1RLMA 4I46A 4IICA 3F46A 3Q9UA 1JYFA 3UJBA 5JFTA 1BE8A 3BA1A 1MNAA 2BDUA 2IJGX 3NAZA 2FQXA 5AVOA 1Z0ZA 2VHTA 2VJDA 3FKQA 3OD5A 4MKGA 2V7QD 4Q9LA 3H5NA 4Z9XA 3GEGA 3UC9A 4BVBA 4DMMA 3DF7A 2GJKA 2FETA 2WF5A 4OHPA 5CIYA 4EHNA 1ETUA 1YR6A 1RLJA 4IZOA 2D5BA 1OGJA 1RNLA 2FOLA 3L1IA 9MHTA 1WU8A 3MTGA 2WMNB 2I3AA 2BFMA 2XWSA 2XEDA 5SYAA 4NV0A 3GJZA 1V7QA 4PFJA 5HOQA 3FMVA 4U2DA 1W30A 3M6VA 4L7QA 3EAGA 3PQ4A 1TFRA 4ZODA 1GDTA 5DXAA 2X6TA 3WWOA 3JWHA 4CR8A 3QBVA 3M2PA 1WUHS 3ASYA 1U3GA 1NLUA 2Y1FA 3HWX1 1MNQA 3DE5X 4UU1A 4ZCIA 5AW4A 4G67A 1MP0A 3UXEA 1GNPA 4HLNA 4Q4AB 2PMDA 3PHCA 3W8EA 1JVNA 3AEXA 3NUGA 2F59A 4ZOEA 2OQVA 3GO4A 2OBYA 5EKDA 5AW6A 2XWBF 2QMEA 2KQUA 1DXHA 3HMQA 3HI6A 1V6AA 2VH1A 2XODA 3JPWA 3L0YA 3MUOA 5DT2A 4BCDA 4IGKA 4HGNA 3QWFA 4DR1B 3ZVKA 3WLKX 2Q7OE 3BSSA 2B4AA 3O8OA 2PMEA 3WMXA 4QVGA 2VRWA 2PUAA 3BRCA 3CGGA 4KODA 1G5HA 1KZ6A 1RI3A 4KHZA 1QF6A 3ZNNA 4CMHA 1X15A 3T12A 3EOBI 1D2EA 2WHPA 3BZWA 1WDKA 1JMYA 2HRQA 3LUCA 1KK2A 4GECA 3QFSA 1FNMA 5F5LA 4C0HA 4HQ0A 4BECA 4BWYA 4ECEA 3BG5A 3GPIA 3INRA 1VHTA 2YXLA 1O54A 1VKRA 4AMUA 1B14A 1SOVA 2ENWA 5LMNB 4OHCA 5DGCA 1TRKA 3LY5A 1VIDA 3HVHA 4MUAA 4OD0A 4ZCQA 3DV0B 3W90A 5I45A 1KL7A 1YMVA 1AF4A 2GTIA 1NKTA 3KV1A 1NVDA 3O0TA 5CDYA 2DPMA 4O2BF 1P1BA 1XZCA 2SCUA 2CJXA 5JE8A 3RRYA 4MGZR 3P9RA 2WVGA 1ZFNA 1D5WA 1FDWA 3HV2A 1YVDA 5EA2A 4YI5A 5DNYB 1OBFO 1A7UA 3QI7A 5JZVA 4LBVA 2Q0QA 1C7IA 4Q3CA 4B6EA 5C5DA 4PICA 3AOGA 3BXZA 2R8EA 3GFVA 1JSZA 3NHJA 1N3YA 1QMGA 2D3TA 2PRYA 3QP9A 1FP2A 3EQ8A 4H6WA 1FTSA 3VZSA 5JJIA 2QRQA 2QBYA 3K32A 3ZZUA 1GAXA 3BHIA 2BGRA 4YCBA 2NVWA 1ONPA 1Q0SA 1TDJA 4YO8A 3WYDA 4HEHA 3RS8A 1BDMA 1QK4A 1GG5A 4BLPA 2IHBA 3I6QA 4FVTA 4EFDA 3ZQJA 3F78A 4TL8A 3GRRA 1J1IA 1ZNYA 2IHUA 2O5EA 5HG0A 3V7NA 3MTIA 3DA8A 3LQFA 4M8IA 1NR5A 3SVLA 3IPLA 3URKA 4P7GA 1HKHA 2W6OA 3UFXB 4O2AA 3H1GA 3PGKA 3H5RA 4LNHA 3PNOA 2P6UA 2ZYGA 4YMSA 1Z07A 3VR4D 1T8SA 4GBMA 2GFHA 4HVAA 3NETA 3GGCA 3QA3E 5K3DA 2H1CA 4L57A 4LRYA 3BWCA 5A5GA 1NN3A 4M54A 4YCLA 4WY8A 2WZQA 5IK2A 3TSCA 1J56A 1UPAA 5DMXA 2RIRA 4C4YA 4DCJA 1WXHA 4O63O 3EIOA 4LXTA 3ENWA 1PR9A 2AVDA 1E0KA 2PSJA 3BXFA 3JYLA 3FOBA 3RSGA 5CA1A 2BGGA 4LJ7A 6REQB 3NDPA 1EVLA 2VF4X 3ITDA 1X1TA 4DCTA 1XNHA 4F56A 2BLLA 3VR3D 3B6ZA 5HRCA 3WWYA 1EHIA 1SBQA 1NRJB 4RIHA 2O0JA 4UUQA 2CJYA 2G1JA 4HATA 1F3LA 5AI5A 4DRXA 5BSTA 1R18A 3CEPB 3KYBA 4OSEA 4ZOBA 2G82A 4BGIA 2ZKLA 4E32A 2VHJA 4U7JA 3R2JA 3IVCA 2CXOA 5IM4F 3GUUA 3IS3A 1XD2A 4ZT4A 2R6GA 4TKUB 2FCRA 4C04A 5I4KA 5CM2Z 2E2WA 3GWGA 3NIDB 3GLFA 3ZVMA 3JQAA 2ZR0A 1E18A 4TV9B 2YDYA 3ME5A 3R5HA 1DQSA 2GGSA 4JSYA 2P7HA 4LX0A 3V1KA 4PZDA 3R8FA 3GRVA 1AGXA 3V9AA 3H1AA 4G5HA 3EW9A 4V3BA 1G6Q1 1ZM7A 1MC8A 2PZEA 2R1TB 3ROPA 5AESA 2IYFA 4RTPA 3LVFO 2BEKA 1DBVO 1PZNA 1LS1A 2E87A 2VK1A 2XVYA 3DG9A 2FKAA 3STTA 5C1BA 1WV1A 3QVUA 4Q34A 1WM1A 4RXMA 4CBVA 3FPGA 4U7DA 2V59A 1JQLB 1JLRA 3PUVA 4DMCA 2WW8A 1UXGA 1Y3FE 4MW4A 5FEMA 4CQJA 4F3TA 1NQVA 4W6QA 3NFYA 1B8VA 1P4SA 1JXQA 4R1TA 5ERGB 3CRMA 5K0ZA 3PJRA 3DMDA 1EFVA 4DA6A 4EZEA 4QM7A 1LV7A 1LA2A 4KQ2A 3U7HB 2A7XA 3PTAA 4G84A 5CCBA 5E9AA 2TMDA 3NBYC 3IODA 3D8HA 4J7UA 5K4AA 4E5KA 1KVQA 1T3LA 5HHTA 2PT9A 5CNJA 2H65A 4FYJA 1NXOA 3P2EA 2YOGA 3G2PA 3OZXA 4H1TA 2H1OA 1VRVA 2Z8YA 3MG9A 4WE3A 4DDHA 4LY3A 3Q9LA 3FYSA 5DK4A 5HQ3B 2Q4EA 3PUKA 3SG0A 1P1CA 3EOZA 5L95A 2JIZD 3AR8A 4YP7A 3DZDA 3M1YA 1YZQA 4C2UA 5COQA 4C0QC 1BE0A 3FW1A 3AUXA 3QKWA 3I9JA 1WBBA 3EN0A 2Q2QA 3CMCO 2DR3A 3ZGXA 1E32A 1M6NA 2WC1A 4J07A 4E30A 5FI0B 2NZVG 2PM8A 3II6X 3PR2B 3I8XA 3OKPA 4WBSA 2V5UA 3IOBA 4OAOA 4QDUA 1VZ3A 4WV3A 4GQBA 2GJ4A 2OV1A 3WGIA 4TYYA 1ZC4A 3R0QA 3A6KA 4MWOA 2X4DA 3ILYA 3VMMA 1FDTA 5IYZA 1PWZA 3RC7A 4ALKA 4Z1MD 2C7QA 3F9IA 1OX4B 3E0QA 1SQ6A 1XU9A 2AFRA 3OZGA 3VYTB 2G04A 5JTUA 1E79A 4UQOA 4AO7A 1KK1A 1RVDA 3DONA 4PFSA 1SUIA 1FXWF 2QI9F 4RKRA 4CIYA 3B6MA 1PJ2A 1NNLA 2W6IA 2ZS9A 1O5IA 1CRZA 1NJ1A 1TGYA 2Z2JA 4WASA 2BBWA 3TQTA 4LFBB 3BTUA 2IUSA 1O94D 2O8CA 2NO6A 5JG7A 4G2TA 2J41A 4WJLA 4ZOLF 1OJLA 3N2IA 3QNWA 4NCJA 4WMLA 3RROA 1RQXA 4B79A 1DPFA 2XY4A 3MB5A 3WKBA 3J7AC 4A03A 1XTQA 4AZ3A 3F7NA 3IA7A 5HBGA 1DC8A 1NYRA 3NYIA 3LQ4A 3MOGA 4JB8A 3IBFA 3RS0A 2O2HA 5JMPA 3N6RA 4RA6A 3RFXA 4Z4CA 1VL2A 4XWTA 3ACDA 2GFQA 4NOKA 1ZRSA 4DY6A 3NHRA 4AW9A 2R4TA 4KKVA 2RBKA 3JWJA 4KUEA 1OPXA 4X7RA 2FW8A 1JLMA 3T7TA 1HEYA 2CNWD 3HBMA 3PQFA 4N7JA 2QLJA 3UQZA 1NW5A 1DC3A 2J3JA 2XCOA 2NTNA 3OT5A 1WXQA 4HN9A 3OWXA 4U7GA 1IOLA 1Z6TA 1RXVA 2PLWA 1R0BA 1I4TD 1X94A 1UXJA 2ETXA 1A8QA 1UFRA 4MUGA 1V1JA 1RWBA 4UFOA 2NZWA 5CEEA 4EMSA 1QJCA 2JIDA 3M1LA 1VYVA 2CMKA 4JJAA 4JLNA 4M83A 2AZDA 3RYHB 3OCWA 2IEAA 2VUHB 4E7PA 1GL7A 4DQVA 4JI1B 4D9JA 4RNDB 4D3XA 4RNCA 4X65B 1JHVA 1TQ4A 3CUEF 2EEZA 4IDQA 2CLKB 1GA6A 3UT6A 1HNWB 1YCGA 2XT0A 3VH1A 4CXMA 5K0JA 5CM8B 1JFFA 2DTDA 4TLBA 5DHSA 1NF8A 1KU0A 4EY5A 3RD5A 3GZTB 4GD3Q 1H1LB 2MSEB 4QQNA 4XQEA 5AW2A 2QL5A 1KY3A 2DWQA 1THGA 3KQMA 3QE2A 4FHFA 1MHPA 4AZTA 1HLPA 1HYGA 1UM8A 3ZDFA 1JQAA 2LCIA 1K7FB 4OAQA 2GPTA 3O3MB 4XYGA 3U40A 2C92A 5E9QA 5CX1A 2IZ5A 2IEZA 1O03A 1L4HA 1GAQA 1NOKA 1RRMA 3IDZA 1DV1A 4YI3A 3F6PA 5JWOA 4DV3B 3JS5A 2VNKA 3R3WA 5F51A 3QUTA 5ALDA 1XEWX 1MFPA 3FAKA 4U63A 1Z35A 4GXRA 1QFMA 1WHSA 2CHEA 4LWPA 1KERA 4FYHA 2R68A 1LQTA 3Q6MA 4XWAA 3ZLUA 3AR5A 5DSXA 1E2IA 3EJ6A 3H9UA 3K0FA 3WXBA 5DTQA 1QTQA 4OBXA 3SN6A 3GP8A 1D2GA 2J6HA 3CLSD 3DMHA 4XM1A 5ADWA 3TLMA 4DUGA 4D80A 3QPAA 1G64A 3EASA 3ZHZA 3NM6B 2NO5A 3JWPA 1YZFA 4GP7A 2VJYA 1ISPA 1FOEB 3G6WA 4GIBA 5BOVA 1YR1A 1ZNZA 4MMXB 3A04A 4PC2A 3FDZA 5EQTA 1JAXA 3RJMA 1HDCA 1BKYA 2F9LA 4W7HA 2ERYA 3C8DA 1UBHS 2EFCB 2JCSA 4KKXB 4QSMA 1NVKA 5D6NA 5FYDA 1GAWA 5TPWA 4K40A 4H7IA 5A3RA 4M8KA 5CGQB 1T4MA 4WX2B 4AAYA 1C3OA 3OEYA 1U2ZA 2ODQA 3TW8B 1WTAA 2O3JA 2CVZA 2IYUA 3D8RA 3UYKA 3E2PA 1RHJA 5JIBA 1BX0A 4DCPA 1NBIA 3PE4A 4F21A 1NVWQ 2EFEB 1XCBA 1XJ0A 2BMJA 2D4HA 3B7WA 3R76A 1KVUA 1A8SA 1YVRA 3R5XA 4HKTA 4E7OA 1YTUA 1QH1B 3UJ7A 1JIIA 4AX8A 5KNCA 1S7GA 2FYTA 4AQYB 2QN7A 3I09A 3NHUA 4KK3A 1MIHA 2JCBA 3H75A 3Q3JB 1P8JA 3AR2A 3I6MA 2ZUCA 5DF1A 2AQIA 2QQ0A 4J6FA 5B1HA 3R7FA 1PE0A 4GQAA 4B40A 1IBMB 3V6LA 4E11A 3FNHA 1P45A 4OU5A 3T5TA 3CPEA 3GR6A 4AUKA 1ZJWA 4FNAA 1XHLA 4Q47A 1ZMTA 4HS4A 2YC2C 3HJHA 3HC7A 1M8JA 1XJ5A 1W36B 3RDPA 3H9EO 2CVOA 1QH8A 1SA0A 2JIPA 4MQEB 3TL6A 5IAKA 1NMXA 5BUSA 3GD7A 4P83A 2B20A 2G70A 3GRUA 1NMEA 3F7MA 4LZPA 4MS1B 4WOCA 5TVGA 3GL9A 3KLBA 2WYVA 3MCZA 1ILEA 4RJJA 1K8XB 3FGNA 3DR3A 1LPPA 1R0XA 3FCSB 2ZWVA 3HUEA 3PEWA 1E4EA 1PJAA 2ODTX 2D1RA 3DOOA 3C85A 3CQ9A 2JLRA 3HB7A 3KB8A 1EP3B 2O3TA 3FY4A 2LNDA 1QGYA 1QHEA 4MEBA 2JBWA 4P84A 1GA4A 2IZ0A 3QKTA 1N2OA 2BCJQ 4BFLA 2XE7A 3LQ1A 4MUNA 5KDLA 4E08A 1NX6A 2KSQA 1GU0A 3W5DA 3ZG6A 3KQLA 1HQDA 4MUEA 4MDYA 1GQQA 3ROXA 2RGGA 2OM6A 4MKHA 3P9KA 3MERA 1F12A 4EKNB 1ZK3A 3D7NA 4HH1A 3DWFA 4GC9A 4LFCB 3FFXA 2R6FA 4WDQA 1T9DA 1PFQA 4PTZA 3FTFA 3TJZA 2QRGA 3RYFB 1NSFA 1H2YA 2MDTA 3PNMA 5A6VA 3VM6A 4QUJA 2IQIA 1TTPB 3FBTA 3ZE1B 1NN1A 2PSHA 4KIFA 3C98A 1OE0A 2ST1A 5LQUA 3IHWA 4FFWA 2AEJA 1Z62A 2ACEA 4K8RB 4TWIA 4Y9TA 3SYNA 1PJ8A 1ZGCA 3RG8A 2QD2A 3HXMA 2I4NA 1TM4E 2WIKA 4OXKA 3UAVA 5BQFA 3V4FA 1A0OA 5T4HA 3OCYA 4IIFA 5F35A 5HFAA 3MUEA 1IB6A 3O1HB 4X91A 3U9LA 5BUZA 2VPQA 4I1OA 1MO4A 5H4HA 1UEIA 3TDMA 1BEUB 1G4UR 3VC7A 4ZJPA 3JZFA 1CUUA 4F91B 1ORTA 4B76A 3A4IA 1N78A 4DXHA 3CXUA 5FNVA 4UCWA 1ZIOA 4GPBA 1O95A 3VYWA 2EFHB 1Q7TA 1GDDA 1C1HA 2BFWA 2P11A 1O9BA 2X0FA 4LK2A 1CJTC 1FSPA 4H16A 4Y2YA 2IWRA 1S9DA 2DG2A 3F96A 2AZMA 5HCUA 2W83A 5K05A 3HVRA 2X2OA 5EVCA 5T8KA 3I2FA 2R6R1 4IKEA 4LRTB 1I8TA 4MW5A 1Q15A 3SF0A 3VSAA 2WJYA 3EULA 2QE6A 1R0YA 1VL8A 1OGYA 5TQVA 3VISA 1BXKA 1I7PA 1IHDA 2PMWB 3S2SA 4EGJA 5L45A 2ZJ4A 4NU5A 4OUDA 4D8XA 1KHTA 2FMKA 1XXHA 3LVQE 4OA8A 2V6IA 2XMDA 1SWWA 4QNRA 2GK4A 3F71A 4Q1AA 5LBTA 4JI4B 4M0PA 1H2HA 4ZMSA 2IIVA 4L28A 4TVBA 5IT5A 5DBGA 4QYIA 5M29A 1BJRE 3OOJA 4PLGA 3W4KA 4QGSA 1SKMA 2XUPA 1GCOA 4JBYA 4JXKA 5F1PA 4CGYA 4MINA 4UBKA 3D4IA 1N2ZA 4C03A 1KPHA 4BVFA 3VNVA 1JW9B 5AVWA 3RJZA 2AN5A 1UBFA 1LRLA 5FOUA 3R5TA 3TCKA 2G8NA 2UUBB 1E3MA 3ZUPA 2NT4A 4BMVA 4FDMA 5EOVA 1LZKA 3LA6A 3HK2A 1SD2A 5TF0A 2TMGA 3V8VA 4TZTA 1C0LA 1I9GA 3SBXA 1EDZA 5TVKA 2VYNA 3QPUA 2PL3A 4C14A 5ECDA 1I0LA 5J4LA 3NLLA 4JC0A 3ILVA 4WD3A 2RGWA 4LNUB 1IEXA 2WNSA 1MAVA 1PHPA 3R3VA 4YCDA 4I14A 3U09A 2LIPA 2GVDC 3JV7A 3QHPA 5U4XA 4C78A 4KE7A 3G17A 3KU1A 4R9UC 1EINA 1DAOA 4D57A 4NJMA 1YHNA 2D2FA 2I03A 2Q3HA 3QPDA 4Q1EA 1TGVA 1C4WA 3DD1A 2NGRA 1UKYA 2CUZA 3A9VA 3H5AA 3JWIA 4PO9A 2PNFA 4PSKA 1GTVA 1JYSA 3BGDA 3I5UA 4ZI7A 2SHKA 3NT4A 4IZIA 3TZKA 4NU6A 3RTDA 1ZJZA 1E60A 1QLWA 3FZGA 3DMNA 5BRJA 4GFDA 5KI6A 2RGRA 3WLTA 3SCZA 2G7ZA 1WNFA 1VL1A 3LP5A 3QPCA 2Y0PA 3WJ7A 1O95C 2FFJA 3O5AA 2BMWA 3G5AA 4H1WA 1UIMA 1UPBA 1ONOA 4KE6A 4YGYA 3AZOA 2XHZA 4IHQA 2CGEA 2E49A 4HFMA 4M55A 1GJRA 4IJKA 3EZGA 2J85A 2DSTA 4Q82A 4R7GA 3ETLA 4EG3A 4BE4A 1X1BA 1TEZA 3SJBA 1M34E 3DZHA 5T8KC 4DA0A 1KJWA 3AHCA 5LR6A 3QKSA 4G97A 2NUAB 2NSLA 3HZHA 1CIPA 2BZ1A 4ARBA 3ES9A 1FS4A 3HJUA 3S27A 1E6KA 4AK9A 5DULA 2X42A 3N8IA 3Q85A 4FHZA 4IBOA 1WB4A 4LHWA 1RQPA 4DABA 3WI7A 2AFHB 4R98A 3HY3A 3O8CA 3NJRA 4GL4A 1EDBA 1M7HA 1QYXA 1WY5A 1YBHA 2QMZA 1F4LA 2CWDA 2VYQA 3JASB 3JZIA 4DV0B 4RIEA 4JJGA 1U7PA 4TRNA 2O2GA 1P3JA 4FU0A 2M6SA 4MUYA 3GX1A 4HDRA 4B82A 4QIHA 2WICA 5JCXA 1YKGA 1ZOOA 1P7ZA 4GMDA 3IJRA 4YMHA 2HWYA 3HVIA 4GZ3A 2NO1A 2C8JA 2FUEA 4RIIA 3TW6A 2CXQA 3WTCA 5KYUB 1BCSB 2G80A 4HUQA 2ZB2A 4O33A 2VF2A 2CDRA 2CLHB 1G63A 3HA2A 1II0A 2AFIE 5AT1A 4LMBA 2Z4TA 2JBHA 3ZWMA 4RS4A 3UMCA 1UMBB 3Q7RA 4D9FA 4FEGA 5DB4A 2IV7A 3EZNA 1TJYA 1BXRA 1MX9A 1TO1E 4NENA 1XMVA 3E9ZA 5CLHA 5AW0A 1D2HA 4UZFA 1P29A 3R9IA 1CQJB 1KZ9A 2Q0XA 4FJ1A 4Q66C 1ZK1A 2I4RA 2AN4A 1TL7C 4ED9A 1Q14A 1UDWA 1LCIA 1Z5NA 3M33A 1T36A 2GRAA 3E6AA 4FGLA 2GHRA 3UNXA 1YSCA 3BIFA 4Z9YA 5LXTB 4TMWA 3RSFA 4KW7A 5KSZA 1NVMB 3RHZA 1VL5A 2HOQA 3ESXA 2Y05A 3QWAA 1D04A 4DIOA 4D0RA 4AJOA 3ZWXA 1AKQA 1NN0A 1USKA 2CJWA 3PXDA 2FDRA 3DQZA 2P4EA 4K9SA 1U0FA 1RI1A 2AV6A 3LXMA 1V8BA 2OECA 5I7OA 4BFZA 1MZVA 4S2UA 1VSBA 2PX6A 3C41J 2KM1A 4Q3DA 5I48A 1D07A 4V0QA 3FDJA 3GLHB 2IF2A 1L1RA 3G9ZA 2KWIA 3HFGA 5ARBA 1JWLA 1MOZA 1L8QA 1I51A 2Y6UA 3K94A 3L4SO 3MWFA 1D2MA 2XGGA 3KFXA 3NALA 4KGZA 5LXTF 3CVYA 1CYEA 4X1KA 3ITKA 1LXCA 1SBNE 1HFEL 2QQFA 3AG6A 5IJXA 1F2UA 1JIUA 1KS9A 4BNJA 5C52B 4CFZA 2Y76A 1MFZA 3GN1A 4XB2A 3V9PA 2H2FA 3PQEA 4JLVA 5EJAA 1KAQA 1WSBA 2NZYA 4JKIA 3FWPA 4UCQA 1OKKA 3UWOA 2G9QA 3EQZA 4L7VA 2VDKB 4LJKA 4ZVMA 3P7MA 5ALYA 4CDMA 1CEEA 4P35A 2OB1A 3W9UA 3VDMA 2BP7B 3EGWA 4EJ0A 2N42A 3WP1B 3KAPA 1PUXA 5FLKA 1T3TA 3VV3A 4JR2A 2XCQA 4DXAA 5LL6P 1BMQA 1EIWA 4YDHB 3TMAA 3DE2X 1AKWA 1X9HA 2R7MA 1XTIA 4RKEA 2QGNA 4PO1A 3G2KA 2XKBA 3Q3CA 5A9TA 1WBJB 4FPXA 1PZEA 1BEEA 4UMFA 2VHXA 1V41E 1NI4B 3H8VA 3M89A 3TFWA 4BV2A 1OTXA 5BSKA 3H2SA 2DE0X 2LWIA 4TTAA 5EVJA 3OE7A 5FPSA 5CG2A 2PV7A 4JY7A 1H94A 5DJ5A 4B0OA 2WVJA 2JAPA 5AUQA 3ANTA 3UB4A 2PSSA 1ZH6A 1JZTA 1QX3A 3PXUA 2Z83A 2GZSA 4QDOA 3JYQA 1YE8A 2PRZA 3K9GA 2V9PA 1PKXA 1QVZA 1ZD1A 3EEIA 1HFJA 2C1XA 1KMNA 2EKLA 5A3VA 4D4JA 3F8WA 3I92A 4ONEA 1Y63A 1G7RA 3HEAA 3PFCA 1USWA 5C3MA 5EZ6B 2ZCUA 1NMYA 4O4HB 3ZHCA 4OHOA 2ADOA 2G0TA 1G2OA 3MUFA 1NYQA 4Z3KA 5E1MA 2CCGA 3MBOA 4ESHA 3PPXA 4H7EA 1N5DA 3G02A 4IZ6A 4KQ1A 3D8SA 1LV8A 3G9QA 1OQAA 3AP1A 3NW9A 4I1SA 2AJBA 1OI7A 3C97A 2P35A 3EGXA 3KT8A 4G4SO 1RSZA 4E5NA 1P9RA 5JZOA 2UV8A 3EWAA 3IDFA 1W0CA 2ZSDA 3WRYA 1OV4A 1T5HX 2YV1A 2EFGA 1DAMA 3ZYZA 2DPHA 4HXGA 5KWJA 1A2OA 1NBMD 2G9RA 4R2IA 3SFVA 1CB7A 1RAGA 3KUDA 2H3HA 4RVUA 2BGWA 4JJFA 4BV8A 4PFKA 1TU3A 2D2IA 1CT9A 5JJLA 1U2QA 2FJUA 4UNRA 1OY1A 1XTUA 4YN3A 1M66A 1KPGA 5TQ2A 3OOYA 4ASUA 4O08A 3U4IA 5DPMA 2Y6VA 1AVTA 4IIJA 2B5VA 4JAVC 3LT1A 1E9FA 4C4SA 3LUAA 1OVGA 4JR0A 4PHTA 1F9EA 2WT4A 3GA0A 1K5GA 4XQCA 5HIKA 1SUDA 1I7QB 5GTDA 2VYCA 2NP6A 3RKUA 1QH0A 1TVKA 2QL7A 2V3VA 3EZYA 2OOKA 3GC6A 2XNKA 3GMDA 4KDRA 4W5WA 2NO7A 3MTQA 3OZDA 2ESRA 4CKBA 1C7FA 3A4LA 4FYMA 1P91A 5BMVB 3PC2A 2A7QA 5BV7A 3NP7A 3F49S 2FQYA 2C4VA 5CB6A 2I76A 2V1UA 3K70B 1SQFA 1YMUA 3HO1A 4BP9A 1Z34A 1UR5A 1JBEA 4Q4JA 4GSKA 2GHQA 1T5IA 4WZAB 3W9SA 3E58A 1NT2A 1KMMA 3RLFA 5JYDA 1AV7A 6LDHA 1KDZA 3OPYB 1VECA 5LP6B 1LK5A 1Y5IA 3OJ0A 4HN4B 1YVPA 3KB1A 1ZRMA 3PF9A 4B7CA 1M0WA 5TQ0A 3RABA 1FRQA 5CP8A 4F9TA 5BMVF 4C3UA 2O8BB 1H8HA 4RH1A 2Z2IA 1W52X 2MSCB 2VDUE 4IGEA 1G3IA 2XITA 4I1UA 2R6HA 3PPWA 4L74A 3DE3X 4FB4A 2V55B 3PGVA 1Y8AA 2AXEA 3L77A 2JD0A 3OLYA 1XZKA 4ZK2A 5BYKA 2O2XA 3A1TA 3PIDA 1IBKB 3DHWC 4RY0A 3ZHUA 1R5NA 4QOFA 2INGX 4AF7A 1MB9A 1OT3A 5B7PA 4HDSA 5TRTA 1KS2A 4H3HB 3WWEA 4B3RB 3AP2A 3L6CA 1HLDA 3ER6A 4AQDA 4ZI5A 2LRHA 4E46A 4RY8A 5AJUA 5CVUA 3WRYC 3C3WA 4DJEC 5KDDA 4BO0A 2AKAB 3OCZA 1NBHA 2Y1GA 2XT9A 2C4WA 1Q83A 1RTTA 4PG5A 2IYTA 2G4CA 4LMPA 3TJMA