3F6RA

Desulfovibrio desulfuricans (atcc 29577) oxidized flavodoxin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
147
structure length
147
Chain Sequence
SKVLIVFGSSTGNTESIAQKLEELIAAGGHEVTLLNAADASAENLADGYDAVLFGCSAWGMEDLEMQDDFLSLFEEFDRIGLAGRKVAAFASGDQEYEHFCGAVPAIEERAKELGATIIAEGLKMEGDASNDPEAVASFAEDVLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Flavodoxin
publication title Pseudosymmetry, high copy number and twinning complicate the structure determination of Desulfovibrio desulfuricans (ATCC 29577) flavodoxin.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
total genus 44
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3f6rA00
3NHLA 3F90A 1OFVA 2XODA 3QE2A 4F8YA 1AKUA 3LT5A 4QODA 4FGLA 3UXEA 2OYSA 3F2VA 4CETA 3F6RA 4QOHA 3GAMA 5LVAA 3N3BC 4D02A 2QMZA 1E5DA 3W7AA 3F6SA 4J8PA 5JROA 6NULA 2FCRA 2FX2A 5LJLA 3L9WA 1TLLA 4QOIA 3SVLA 3U7RA 1RTTA 1DX9A 4YAOA 5B3LA 4FGJA 2OHHA 2X2PA 1J9GA 4U7GA 2HPVA 2FDXA 4PU0A 3N3AC 1FUEA 2FZVA 3D7NA 4GQIA 2MT9A 2M6RA 3GFQA 2R96A 1AKQA 2N1MA 1CZRA 3TE7A 2A5LA 1FLDA 1YCFA 5ULLA 1RLJA 5LJIA 4GR9A 1YDGA 1GG5A 1T5BA 5B3KA 3NHSA 5EAIA 2MOKA 4QOFA 1XT6A 4N65A 4Y9RA 1OBVA 3QFRA 4C0XA 1QR2A 3OX2A 5LBUA 4ESEA 5F12A 4YAUA 4C76A 1J9EA 4ZVMA 3JSXA 1ZWKA 2RG1A 4HS4A 4R81A 3S2YA 3NHYA 4S24A 3HR4A 1FLNA 2KLBA 1OBOA 1CZHA 3FVWA 1ZX1A 4ZVKA 3NHRA 2B3DA 3B6MA 3B6JA 4DY4A 4LA4A 4N82A 1YCHA 1NNI1 3OX1A 3TEMA 5EMNA 3O2NA 4DILA 2BF4A 1XYYA 1VMEA 3GFRA 1DXOA 3TZBA 1J8QA 3OVMA 5FA6A 3NHPA 1TIKA 1FTGA 1YOBA 3OJWA 4U7FA 4C14A 3N39C 3K1YA 1B1CA 2WC1A 2M6SA 2QX4A 4YQEA 4NLLA 3FJOA 1AZLA 3ESYA 2OHJA 1H66A 3NHJA 3NHKA 1FX1A 3HA2A 3NHUA 4LTMA 4BMOB 1FLAA 4GI5A 4ZVLA 4DIKA 3B6IA 4XDHA 4QOGA 2BMVA 2GSWA 5FX2A 1CZLA 3RPEA 1WSWA 3QFCA 3HLYA 4XDGA 2BZSA 1SQSA 2Z9BA 1XYVA 1QRDA 4N9QA 2MWMA 1RLIA 2XOEA 4OXXA 4PTZA 4NULA 3NLLA 1YCGA 3OX3A 1AHNA 1AKTA 4BMPB 1AMOA 5LBTA 4U7HA 2BN4A 4H6PA 5BUCA 1V4BA 1J9ZA 2FZ5A 4Y9UA 1YKGA 1JA1A 1ZWLA 2FAXA 1FVXA 5F4BA 5TGZA 1F4PA 2QX6A 1KBOA 2V5VA 2MTBA 1XI2A 3NHFA 1I1OA 4ZVNA 2F1OA 2Z9DA 1BU5A 1C7FA 2FVXA 3GFSA 5NULA 3ESZA 4YALA 2OHIA 2Q9UA 1X77A 4QOEA 5A4KA 1D04A 4CF6A 1CZKA 3U7IA 3OWXA 4QOJA 5FUQA 4H2DA 2QMYA 1JA0A 4HEQA 2D5IA 1QHEA 1RCFA 3ZHOA 4FX2A 1FLVA 2Z98A 3W78A 1DXQA 1D4AA 2BPOA 3NHWA 1H69A 3K20A 5LMCA 2FOXA 1AG9A 4YAWA 1T0IA 4ICIA 1AKWA 1C7EA 3G5MA 4C0WA 3UXHA 2ZKIA 3LCMA 2KQUA 2V5UA 4Y7CA 3OWHA 4LAFA 5LLDA 2ARKA 3P0RA 1D03A 2QWXA 2QX8A 2HNAA 3R6WA 3EYWA 5NLLA 2FLVA 3OJXA 3KEGA 4M0CA 1CZNA 1YRHA 5F51A 3O73A 3KAQA 2QR2A 1WSBA 3ESXA 2Z9CA 4LTDA 5EA2A 3FX2A 3EDOA 3FW1A 2V9CA 2W5UA 2HNBA 2Q62A 1CZOA 1AKVA 2AMJA 3KLBA 3L9XA 1SG0A 4YAFA 4FGKA 1QBGA 3B6KA 3ES9A 3KAPA 2QX9A 1CZUA 3W77A 2R97A 3FNIA 1KBQA 2X2OA 3NFRA 4PTYA 1BVYF 3W79A 4LTNA 1AKRA
chains in the Genus database with same CATH superfamily
3AK4A 3U9SA 2FZLA 1WZ2A 3IT0A 4YCCA 1ESCA 3W8DA 2PD3A 1BIFA 3FGZA 3Q9SA 3VOBA 5ESRA 1JW9B 3P96A 1QZZA 1TI7A 2EU8A 4I9FA 4IKPA 5U4XA 4C3OB 3HA3A 2BZ0A 1TGVA 2CNWA 4J3NA 2Y0BA 1WIWA 4JB8A 2NVUB 5KNLA 4RHYA 1OB5A 1W8DA 4H08A 2QLMA 1M5UA 5J4HA 4CU5A 1GKKA 3OQNA 2H7XA 4OLJA 3CUTA 1KOJA 5ECWA 5I9SA 3OEYA 4RY9A 1AOXA 2EGUA 5IT4A 1VBNA 4K28A 2AEFA 1HE3A 2QL5A 2EFHB 2FCRA 2HJVA 3WLAA 1HNZB 4MXDA 2VWPA 3KZNA 1C0EA 3IOYA 3K16A 2BVNA 2PPVA 4GRDA 4RLSA 4RDHA 4CM6A 4DJTA 1QHXA 3E27A 2G25A 3BA6A 2PYDA 4Z0NA 1CTQA 4L7VA 5K8UA 4JJFA 4PVCA 4QBKA 2W6PA 4CKEB 5TF0A 4QPPA 5HCUA 3EF0A 1W5BA 1YDWA 3GMDA 5AW7A 3D0QA 2EJVA 3AOGA 1H93A 4G8BA 4J49A 3C6XA 5BQOA 3IEKA 3PICA 3SKXA 4WOJA 5J5VA 1CJBA 4LZNA 1GPKA 1SBZA 3W06A 4JJ7A 5BY2A 5JVDA 1E89A 3E6AA 3EAFA 3H1GA 5F2OA 3VPCA 3J80A 1PTKA 1QOQB 1RT9A 4JVOA 3VO8A 1EGVB 1D5CA 2MYNA 2XDYA 3UPDA 3BBLA 4RV4A 4EF5A 4EW6A 4UOQA 3UMFA 4KPFC 2XZDA 4BNYA 4BVLA 1YI8A 3URMA 3QUCA 2CFSA 3TNJA 1C30A 2Q3BA 2RGEA 3GLHB 1VPDA 5CVDA 1J99A 5TQVA 1CZRA 4WBSA 2ZBFA 1YZTA 5ESXA 4X54A 5IUJC 1OA0A 2Y93A 4M87A 2MYTA 5IM4A 5LYJA 4PZAA 5K0SA 1Q7RA 3HVIA 3S2ZA 4JUAA 1JDTA 4QL3A 3IHKA 3M4YA 2BFOA 1GGMA 2HTEA 3FZEA 3QTBA 4FILA 3T38A 2FMFA 4IDFA 3TSWA 1Y5LA 4B73A 4DSUA 5A5FA 1P77A 1ZH8A 2Y1DA 4KVAA 4R9NA 1I3NA 2OCIA 2ZTMA 1DXYA 2PX2A 5AW5A 1QQ7A 6Q21A 2HT1A 1FRNA 1PDVA 2V8BA 5IJ0B 2GFIA 1KERA 2VA9A 1R5OA 1XVIA 4K03A 5G0TA 3O4RA 1V4VA 2QTVB 2WINI 2HDNB 1LNQA 2PWPA 1XT6A 1E7RA 5LDGA 4IDBA 1JDZA 3JZIA 4LY0A 4MVCA 1G3RA 2ZCVA 3D8BA 2QTZA 1GARA 1FK8A 4ISBA 4S05A 3M6AA 2I0FA 3MA0A 4UXJA 3GLQA 3L92A 2IYFA 5HZGA 5F12A 4DDUA 2CZGA 2XYHA 4G0WA 3ZZ1A 1FQKA 4HK4A 4PVDA 2X0EA 4CF5A 2R25B 3QE3A 5BWMA 2IZOA 1CVLA 2FRDC 1KZYC 2AGVA 2X8BA 2PXAA 1NT2A 3PIDA 1MR3F 2I2FA 2O0KA 2A33A 4F85A 4KR2A 1YS9A 3I23A 1FDVA 2AQKA 5IS2A 2K2WA 4O8ZA 4W9NA 4CQMD 4L75A 2OFPA 1T3ZA 1L8AA 2BMJA 3I2HA 1IMOA 4DC0A 2QD1A 1Q19A 1TQ4A 3AI3A 4JP3A 4P58A 2OVFA 1X7WB 4YS6A 4J0DA 3WHLA 3SHFA 1LLQA 4E14A 1J2RA 1K9VF 1VLQA 2QW8A 2X14A 3ESBA 4J0GA 4MS1B 4NTZA 1E64A 3HR4A 1YBFA 1Z0SA 3JZMA 3MLBA 3WG9A 4BZWA 4E03A 1H8ED 1N5JA 2VJLA 2BFWA 4EK9A 1OFIA 4LSZA 5TY0A 3ZE1B 2B83A 2H3EA 4FMCF 4AC9A 4EO4A 1JQLB 4RH1A 4YJ2B 5CB8A 1H0RA 2W6JA 4A8JC 3NEPX 2XT6A 4B81A 4BMYA 4EMUA 3AUUA 3C8HA 4X1YA 1O95A 3WSVA 1JSZA 1RI3A 2YBDA 5K0JA 3I73A 4LG1A 4DMKA 4Q7LA 3NHRA 5BV1A 4DR1B 3V4RA 2GN4A 2BGRA 1I13A 3ZKAA 2I2BA 1E9SA 5BSFA 4C03A 3DE3X 3FMOB 4C89A 4D25A 1FOEB 2QSUA 2V7VA 3I1FA 3OD5A 1TZJA 5F23A 1P5ZB 1UEIA 3LECA 4M0FA 3HXMA 5K6AC 1U6KA 3EB9A 2XNKA 3VDMA 4HPJB 3ZCQA 1Z83A 4GBED 1Z4OA 2ZRMA 2ZJAA 4ZICA 1C2YA 3N76A 5DWDA 3K96A 1GIAA 2HLDD 2J6BA 3DZGA 3GYGA 4MCIA 2I3ZA 4HVTA 3VNBA 3KAKA 3WGNA 1JDNA 5JDCA 2ILTA 4ZCMA 3VU0A 4HQNA 2JHCA 1I51A 4WK0B 1A9OA 1FU4A 5ITSA 1MCZA 1Z5VA 4K9NA 4TWZA 3E3AA 3OOEA 2O6HA 1VSUA 2ZYIA 3FFTA 2CXPA 4CNBA 4CEJB 2C84A 1E2DA 1FTNA 4U2EA 1B8NA 3GJ5A 1XQYA 4NV1A 4BNFA 1LDBA 4KQKA 4FE4A 4UCFA 5SZIA 2RGNC 2YJ3A 4H3HB 7ADHA 2REXB 6PFKA 2Q4RA 4H7EA 3MJDA 4QGHA 4UNPA 2CVZA 1LA2A 3HACA 3T1QA 4B84A 3L7MA 4BP3A 1Q1ZA 1O6ZA 1JHAA 1Q77A 2W98A 4FE3A 4YPFA 4U7DA 2Y3IA 5HTOA 3JRWA 3T3OA 1DBPA 1E2HA 4ZANA 3VC2A 5C5CA 2APJA 5EMJA 3IIKA 3K4QA 2NVUA 2FN4A 1M34E 3D3KA 2WVAA 1UZAA 3QXCA 3FTDA 1NBAA 5LSAA 4E1BA 4DQXA 3OTIA 2PUTA 4ID9A 3FOBA 2W6ZA 2ZIFA 2XNCA 4ERNA 3GARA 1Z39A 3FJOA 1NQVA 3SHQA 3TD9A 3HP4A 3OWOA 3VAYA 2ODPA 2O1SA 4NHOA 3X1MA 4C04A 1DS6A 4TLMB 2GOYA 1RBQA 3A3KA 3IIMA 1NVFA 3OG9A 4URXR 2WHXA 5HIAA 3OKCA 5AKIA 3VC7A 4BB9A 1NM5C 2W6ID 5A62A 1J0BA 4BS9A 1Z28A 3FHOA 2PV7A 3I6ZA 2QJOA 5LDDC 4M7OA 2AV6A 3CQ9A 3THYB 2TRSB 4CKEA 3LUPA 3Q0EA 2QSZA 4RPIA 2D1FA 2DWOA 1W75A 3NAGA 2CFTA 2GCEA 3FSEA 4EY5A 5KJCA 5T4EA 4WA7A 4G5RA 4MUFA 2R7NA 3NEAA 4IJMA 1L5OA 2PBZA 3S7TA 2J3QA 2IE8A 1KK0A 2IPLA 2GT1A 5BWBA 5HJ7A 2RGUA 1XROA 2HIHA 2PUVA 5LBIA 2QVXX 3KZ1E 2CHUA 1FB5A 1P73A 1GFIA 3EQZA 4D0LB 3B3FA 1BHQ1 4YRRA 1EKXA 3CISA 3EDQA 3SDBA 1QRDA 3HJFA 1EIWA 4TL7A 4OM8A 3GLHA 4XTCS 1K88A 4UBLA 1ZMTA 1ZU4A 3D5EA 4EBFA 4IDCA 3IDQA 4KFRA 4TV8B 4XVHA 1YCGA 1M6WA 3ASVA 4G23A 5JXJA 3L0ZA 4CTKA 1U3GA 3EQ7A 1L4YA 1OILA 3L0DA 4H3VA 4UFNA 4ND1A 1OYVA 3UMVA 3J81k 5AK6A 1IXKA 1YFZA 4D92A 4AJ2A 2YYAA 1WMSA 3E9RA 4U7HA 5IJ0A 2F3UA 1AGNA 3PF8A 1MLDA 4LBVA 1E1MA 1GZUA 1JSXA 2EF1A 2DETA 5JSFA 2ZG6A 2FKNA 2GLTA 1QH8B 3JV7A 1B00A 2IF2A 1UJBA 2VDPB 2UVPB 2X77A 4G09A 1AB5A 2J3EA 2DQYA 3K6SB 1NYTA 4JLDA 3PCTA 1GUBA 4ER0A 3C98A 1JEJA 1F7VA 3WVNA 3TN7A 5JCJD 1E6EA 2W2PA 1XD8A 1VHJA 1L7VC 2JA1A 3PJGA 2I3DA 4IIEA 5CVUA 3WFJA 1GUDA 1HNNA 2YOGA 4GP7A 4IY1A 2B4YA 3KUUA 1ND6A 2P4HX 3PITA 4KRYA 3L07A 3KB2A 1HBJA 4LOIA 5KQMA 1QQAA 1KYIA 2C54A 3IP9A 2XECA 1TYEB 4IDGA 1JEDA 1FPQA 1XAHA 1BRMA 3JS5A 3ZYZA 2CLDX 1QHNA 2JFZA 3F96A 2ZSJA 2WJ3A 3VR4A 1TX4B 3L0BA 1WU7A 5F21A 2CNOA 1EH5A 4XE5A 1D1PA 3FNRA 4EHJA 5JANA 1Q1EA 2Q3HA 3BC1A 4HOYA 2FVXA 4ZOLB 1L7PA 2AQHA 1ZRMA 1CBUA 2AZMA 2ZS8A 3OPQA 4MS1A 1OXUA 5FQOA 3TI9A 2NT4A 3H1FA 2R6DA 4XGNA 4PRYA 2F3TA 2HMAA 1KH2A 3N8NA 2ECQA 2R1VB 3LX6A 4O59O 4QATA 4IUBS 4XEUA 5JS6A 1G98A 3ZXXA 4FLFA 1CY6A 4BO9A 4YJ2A 4WFJA 4G0ZA 1T9ZA 1ZM3A 2VSXA 4BQPA 1RQXA 1PD0A 1OI3A 3OHSX 1NJGA 3HCRA 4GPTA 4MGEA 1XMPA 3C5EA 2ZK7A 2C2ZA 1W5EA 1ZD9A 1JECA 5T57A 4DR3B 1DLIA 1XVVA 4YFYA 4NENA 1AUVA 3KJZA 3PLAE 1CCWA 3UG6A 2ZWVA 4CWAA 1X1CA 4ZDJA 2DX7A 3FI9A 4G56A 1JQEA 3R6TA 1MG5A 1SXGA 3JZDA 4QTXA 3T1VA 1TTPB 2CHEA 5DHTA 5LOVB 2YV4A 3RIXA 1Y8CA 1RAGA 3L7JA 3MRTA 3SM9A 4BLRA 1ES9A 2WIDA 1PVOA 1E58A 4PEVA 4GVPA 2GFQA 1DU4A 1ZZEA 4WOCA 1BQ4A 5CDUA 1YR7A 1QYRA 3EPRA 1L8QA 2Y2UA 3KPWA 2X8WA 3KV1A 2JCXA 2O6LA 1QH9A 3NDPA 1GP2A 1P2GA 1H1DA 4XUEA 3TYXA 4F9GA 1A98A 3NHWA 3N5CA 5CT9A 4UTRA 1UFQA 2EFJA 3OAAD 4Q3OA 4X20B 3IPYA 5BN5B 5I8WA 1ZJZA 3KB8A 3ZUPA 2CVFA 1BMDA 4ZP1A 5FRDA 2JFQA 3AQ4A 3CT6A 1WBJB 2RKOA 3Q1KA 4ICIA 3W6PA 4D9KA 2WD8A 3FYSA 1GZHB 4PYRA 4UVEA 1K5GA 3O8DA 4JGGA 1JJFA 1SU4A 4PFSA 4GXRA 3U5ZB 3PEVA 1A9TA 1DFHA 1A8SA 4JI4B 1Q0QA 1ETHA 2HR1A 1GT91 5B37A 2B8EA 1XVUA 1FYXA 2ZJ1A 3DD1A 1ZM4A 4EG3A 5F35A 5HQJA 4JOQA 1Y33E 3CZAA 2Q3DA 1Z36A 3MJFA 3BG5A 4UE2A 2QVBA 1KO7A 4BV3A 5FV4A 1CB0A 1KHTA 3RK4A 1E6LA 2FN3A 2WMDA 2D0DA 3EGOA 2HA6A 1WBBA 3NHMA 5JAUA 5IMBA 4JLJA 4DCGA 1G3QA 4YRQA 2X1LA 1U98A 2ZPAA 3P5SA 3PX2A 4L3WA 5JH7F 4ROTA 4XR9A 1E66A 4NK5A 1QO0D 4S1VA 4YEDA 2FFAA 4AJHA 1IZ8A 5B3AA 3G23A 1WVIA 3OEED 1Q3TA 4BTEA 4GS5A 2BTQB 4U2BA 2UUAB 3KYJB 3KJFA 3MJ4A 2QM0A 2IZ6A 5DTEA 5F1KA 2QU8A 3C41J 2Q9BA 1RZRA 2PX8A 1RRCA 4JT2A 3WWOA 4JLUA 4F7WA 3LWDA 4MLPA 4Q4AB 1EFCA 4NY1A 3THYA 3B48A 3KAJA 4YT2A 4G0VA 2GAIA 3LCVB 2R8PA 3ZDFA 3KEGA 1ORRA 3NBYC 3G8YA 4EAQA 1DAKA 3CRVA 2AG8A 5BRJA 3K1AB 2Z1DA 5CLIA 2L0XA 1S02A 1VHDA 2GYUA 4LSGA 5JE8A 1NNLA 3PDJA 2ERCA 3RT7A 1Q95A 1N5RA 3F7NA 3E5RA 3KEFA 2OA0A 4KPEC 4UAJA 3I0ZA 2JVIA 1YTLA 2FWMX 1S7GA 3PS9A 1VGVA 3TSCA 4EUKA 2C92A 2OTCA 2GEDA 4KUGA 5DLQC 5SYAA 4P22A 5K8VA 5JZOA 3DE7X 4R8KA 3G1WA 1N7JA 2YH2A 1Z3CA 4MQLA 2FB9A 3R3UA 4HB0A 4XH9B 2WF6A 2XBUA 3HWRA 4TV8A 4XM0A 1SG9A 1XEXB 1Z22A 2BFEB 3BRWA 3GQVA 4IOKA 3KLMX 4N39A 1PCXA 4OAQA 1N1GA 1P5JA 3JWJA 5E6RB 2ZWOA 3V4FA 5KVAA 3U3DA 2IXTA 2Q3JA 3CZCA 4L50A 5KMGB 3T9CA 3RYCB 1YS6A 5AVOA 2NO9A 3BB1A 3OJEA 2RHOA 4FSDA 4Z0HO 3WIEA 4NOJA 4YXWD 1SQGA 3GGOA 5HOEA 4RAOA 3AP3A 4OK3A 3H0EA 3HSKA 4V0QA 6LDHA 1G7RA 1MABB 1Y7TA 4FOSA 1DT3A 4Y2UA 5IVIA 3H7AA 3GUYA 1NR1A 4MUJA 4QO8A 3SYNA 5EWMB 2EJWA 1PQPA 1QH8A 5C7OO 2Z8YA 3B3GA 3R23A 4Q7JB 2UVPA 1I4LD 5HIJA 3K6SA 1II8B 1OIVA 1G5HA 4ZOEA 2I4OA 4ZALA 2OQ2A 2YZ7A 2OLEA 1OCEA 3PQEA 4N7BA 4R1LA 5C7YA 1PKXA 4KSYA 3CGWA 3LA6A 5ES3A 4A8JA 4YRGA 4A5OA 2JKYA 4MB2A 3GWGA 4UVIA 5JR3A 5FP0A 1U1GA 1YVEI 1R18A 4KLNA 2Q2WA 2RB4A 4F04A 1JG2A 1AV6A 4ZOBA 1G18A 2AOUB 2YWFA 1ZOLA 3T9AA 4JLBA 5DHPA 2C8LA 2QR3A 3FPSA 1KQ3A 2ZRGA 4RHTA 3WJ1A 2CE7A 4CV1A 2WQ7A 3OCCA 1GCAA 1I4OA 1KJZA 4V0MA 1UDXA 3DHYA 2JJ2D 3RSCA 4C43A 4L5IA 1A1SA 4TKLA 4F96A 1C0IA 4L0QA 1SC9A 4IBOA 4LXQA 4ZOLA 2A9JA 3KCQA 5DH9A 1GJRA 3AVPA 3EIOA 3SEAA 2E4WA 2PZKA 4OV6B 4AUEA 2R1VA 3G79A 5A3SA 1KIFA 6NULA 2DSTA 1LX6A 1VI2A 1PJ8A 4XD2A 2YFYA 5JZ9A 2WJVA 3N2GB 3L9WA 2EKLA 1M0WA 5DM60 3OBBA 1HDYA 4V2UA 3L18A 2OHXA 5HCIA 2B34A 1JA9A 3DFKA 3LKZA 3LC1O 3WL6A 1KEPA 1FNMA 3QY9A 4FYWA 2ZB3A 2VDNB 2JL1A 3O8QB 1XRPA 2E4XA 3ZVLA 1C1HA 1P6QA 2PWYA 2CUTA 3U7FB 2GPNA 5BNIA 1IB0A 3LGXA 2X1VA 3DTVD 3RSZA 1TMYA 3PFWO 1IQRA 5A9TA 4RSRA 1PR2A 2AWNA 1YE5A 4AWAA 3RVPA 2E5LB 5LOVA 3A3PA 1J06A 4A0GA 5TARA 2XVYA 2P69A 1YGYA 2H11A 4K9LA 3HNPA 4OYHA 4E7PA 1QCDA 1FUEA 1XMIA 2EFDB 1QDLB 2HU8A 2OAP1 2V4MA 3OZRA 1PO7A 1SOAA 1T8SA 3L7BA 2XTNA 2RK6A 2VPWA 3JD0A 5BN5A 2DGDA 3QLJA 1W4ZA 1NXQA 3B82A 5GM1A 3W5BA 4MCAA 4K6GA 4M8KA 4M2LA 4HN2A 2OB1A 1QPBA 3THXB 2DVMA 5KYNA 2DUWA 4KXQA 5EP1A 5IULC 2YWGA 2R7AA 4LYGA 2A1UB 1JQBA 1KZ7B 1DFIA 1RLJA 1FF9A 1OPXA 4L5BA 4W63A 1ANKA 1G8JA 2H5JA 3K31A 1DV1A 4I1YA 3THRA 4N7MA 1GN8A 3PRHA 3ZEAA 1ZL0A 2JA2A 3PGXA 1J49A 1TGYA 3B7PA 1GSAA 2KPOA 2A4MA 3LUJA 1JT2A 1SVNA 1FP4B 1RM5A 5IXJA 1FVFA 2Y9PB 2J48A 3ECSA 4NZYA 4WA8A 3U3OA 1F2VA 1UFVA 3L8GA 2OZEA 3WAGA 4MVJG 3TSYA 3M81A 3R9KA 5K05A 5I7EA 5I7VA 2ORVA 3V4PB 4KE9A 2DBVO 3AVVA 2CKDA 4EHKA 3BDAA 2H8GA 2QRPA 4NXNB 2I4IA 3U3ZA 4KQIA 1L5SA 1D2AA 4MKRA 4TLEA 3D0RA 2JLQA 1I1HA 2BTQA 4CM3A 2O54A 2P5YA 2NAFA 5JZBA 2H0QA 3DH0A 5B7NA 1P3Y1 1IM5A 2A0YA 3VH3A 1JDSA 1VIAA 4CFYA 3N0VA 3O4VA 4Q4AA 3WMFA 2O8CB 4IQGA 2NXCA 4RJIA 1XDBA 2X9LA 4GBJA 2PN1A 4EZIA 3K1AA 1PK8A 2CHFA 1EDEA 1DEHA 1P7VA 1BCRB 2E5WA 2OP0A 2OP1A 2WT4A 2YMQA 1Y6FA 3F4KA 3TUIC 1PTJC 4HDRB 1JR4A 2JAWA 3S2FA 1FEZA 4JBXA 1AN0A 1CZHA 4Q00A 3KKKA 3WLLA 4Z6KA 2WSIA 3SKYA 5L6MB 1PDWA 4LJSA 1IN4A 1Z8HA 4HPWA 4AUMA 1RW4A 5B4TA 1E5VA 1EUCB 2AC4A 3ZHBA 1UINA 4R01A 2FPGA 1NBIA 2H07A 3WLRA 1FFYA 4EQ6A 1G21B 1NC1A 1XEXA 2BFEA 3IIJA 5E6RA 1YZFA 4EG1A 1X2EA 1CDOA 5IM4F 5C34B 3AHFA 5BORA 1PUIA 4X61A 2ZBEA 5KKCA 2LPMA 2W90A 3FLAA 3FLEA 3M34A 2HUPA 4M9CA 4YUYA 1PGNA 5C8YF 1XHEA 3RVRA 1LJLA 1NP3A 3DJYA 2XE6A 2O07A 1VMEA 3FKQA 3T4XA 1L5VA 4HQ0A 4UHHA 5P21A 8ADHA 1DPGA 2JFFA 2NQTA 3KO8A 4V03A 2FMTA 1MABA 4BDTA 4CV2A 4MITA 2UVQA 4KXLA 3TLCA 3LL4A 4CKBB 4EENA 4BBZA 4GEGA 5EWMA 2N42A 2ZYDA 2P2DA 3TVYA 4HQRA 4L0CA 1SXPA 1II8A 1K4KA 2ZKLA 1V3TA 2QRUA 3OD1A 2WKRA 5ARDA 2XQVA 4ABTA 4MRVA 2GCIA 5ETJA 2WU4A 3QJ5A 1CJVC 3GGSA 3V97A 5K0BA 2G5TA 2CB0A 4R7TA 3DS8A 5KWSA 2HKIA 3TNFA 4BO1A 1IJKA 5BSGA 3P2JA 3QUTA 2AOUA 2Y0DA 4TOIA 1FQJA 3FFXA 3ETHA 4UTOA 3RU3A 2EDCA 4I9GA 3K71B 2ATVA 2QP4A 4H1TA 2PE5A 3D4IA 2M6SA 2GF9A 1JKJB 2HC9A 3HYLA 4M1KA 4GLJA 1OXTA 5EIBD 4FYMA 1IEQA 5L51A 1L3BA 4L74A 4ZVRA 5JISA 4J43A 3RYHB 2VH2A 3MILA 3VPSA 2BE7A 3I45A 3GLGE 4BWGA 1JJVA 5DHFA 3ENQA 1IUNA 3FUCA 2GZ3A 3D4BA 4QEZA 4Z1MA 2QORA 1KY4A 1MMFB 2Y6UA 2ZVQX 3MWKA 3N2GA 2I55A 2J67A 3I2YX 4R2IA 3S8MA 2OAEA 3VUFA 1R12A 1SBHA 3AESB 1NHWA 2BFAA 4XOUA 2AR0A 3VQTA 1K3FA 1KYYA 3BHIA 3CNQS 2XNDA 3LLSA 3NBFA 4ZV7A 3O8QA 3DXZA 2DC1A 1TMOA 2G6TA 1JB9A 2V03A 1MB9A 3BMXA 5JG7A 3OURA 3WP0A 1HE5A 2GUWA 4DARA 2VYNA 3HL0A 2FUKA 3W5AA 4BFVA 3EW9A 1E3IA 2BMWA 2Y0PA 2DH6A 1CJTC 2PZ8A 3AP1A 1TVMA 1B14A 3DZKA 5TE9A 3AUFA 2JLCA 5IBCA 2EATA 2EBWA 2ON6A 2YWEA 4FDTA 4WZBE 3WK4A 4E4YA 3ZDDA 3SICE 4OY3A 1D6JA 1ZGGA 1FMLA 2CVOA 2I2XB 3FLMA 2VDKB 3WGMA 3PENA 1G4HA 2IXGA 4QGBA 1CP3A 3SD7A 3HU5A 3D4NA 1NF8A 1JIKA 4NULA 1EYZA 4DCPA 2ZE5A 3LPDA 4M49A 4MIEA 4P4NA 1I7LA 1Y80A 2Q49A 3F4BA 4KH0A 4ONEA 5EXDA 1NNUA 3VR2D 4KDEA 3QU4A 4NBWA 3WK6A 4DLPA 4Q1AA 4ARBA 4Z53A 1U3FA 2A1UA 1MH9A 3SQXA 2DPMA 4E5SA 4DREA 1JLHA 1WTCA 1BRTA 1QC5B 2BF7A 3A6FA 2C82A 2KWIA 1X1QA 5L3SB 5DHQA 4AG6A 3KUXA 1Z7YA 1N6OA 1ETUA 2CVQA 3NRCA 4BVEA 3HVHA 4RDCA 5DWQA 1RZ3A 2Z08A 2VYVD 1RLUA 4GM4A 1A1VA 1GUAA 4RV5A 4WD3A 3HRHA 5LA6B 4IV0A 3LX4A 5EOVA 1FP4A 2GRUA 3O6VA 5PNTA 2CK3A 1RQGA 1JA1A 2XHZA 3GPCA 4GMXA 4IKEA 4L28A 4ZQGA 3EGIA 2R47A 4F6LA 4N7RA 3MGBA 4A10A 4HNRA 2I22A 4II2A 5GMOA 3HCDA 5TGZA 5KNCH 1V2HE 1ZCAA 2B61A 2BBTA 2VXYA 3T5BA 5BUQA 3K9FC 2X13A 4IQ8A 1W9HA 1E3WB 1Q74A 2B21A 1SG6A 3NHFA 1UC9A 5AVRA 1VSVA 4ZVNA 1L4UA 2HB6A 4QGFA 3K9GA 4V0KA 1BU5A 3AVWA 1X39A 2BLNA 2PX5A 3ITEA 4S1TA 2RH5A 4HRVA 2O8CA 1L8LA 4FFSA 5ERGB 2H4FA 2OUKA 5CX4A 1TU0A 4FJ2A 1TYDE 1QE0A 2KS6A 9GPBA 1XZLA 1Q1AA 3QFTA 3W04A 2AFVA 3SEFA 4EMBA 3QHPA 1UJNA 1BOOA 3K0CA 3UIEA 4EG7A 4HDRA 1N4DA 1GLGA 3W9YA 3ZG6A 4ETMA 4ZYZA 2Q41A 4KIFA 2XMSA 1ZH0A 2JFWA 5EP4A 2IA5A 1D04A 2LBPA 4PF1A 3AHGA 4CF6A 5KDOA 2J0VA 2VS1A 4DMUB 1CJKC 3CLRD 4MPJA 4YMLA 2AZDA 2H9YA 1AQUA 1EUCA 3KEQA 5J4YA 1QU2A 4BAZA 1ZM7A 2VRNA 1XLUA 2W2OA 4B35A 2Q27A 2VHUA 3CKMA 2JFXA 4EUSA 1X92A 1HE2A 1U1IA 1G21A 3CWZA 3NIFB 4KGVA 4Z99A 4LJLA 4G86A 3PC3A 3ZLUA 4AY4A 1FUIA 4EKGA 4MYDA 4FDAA 5DM0A 4LHXA 3ORRA 3W2FA 2VZ0A 4LFCB 1J20A 1EXWA 3ZCVA 2VF7A 2YR0A 3DZDA 4UCWA 4K9QA 4X1OA 4NCKA 2ZREA 2WF7A 3G0GA 5IYZF 1M2JA 4U02A 2JZOA 3PXXA 2PX3A 1GCUA 4HUQB 4YAGA 3GEDA 1ZK4A 1ODJA 3RROA 1D6MA 2PZAA 2NYRA 4CKBA 3R7SA 4DANA 2AI1A 3V9PA 4TUYF 4GLOA 3A28A 1JSRA 3F0TA 1F20A 4LRXA 3UWOA 1DFGA 2I03A 2WWGA 3P2OA 5EHNA 3F98A 3BFVA 3SE0A 4AS3A 4RTLA 5AVQA 1NF3A 3FTNA 2VSOA 2WEKA 4QOSA 1ZNXA 1W25A 1TJNA 1XCJA 1XZJA 2Z1NA 4JQOA 2JGFA 3G5MA 1TAHA 1VGQA 2WVGA 2WUGA 3IEPA 3N87A 4FVTA 1M2EA 5DXJA 3G85A 5JSKA 1Y3AA 4BIIA 4CPDA 5CFLA 1IC6A 1NQUA 4I2VA 4W1RA 5KREA 5ISMA 4H0FA 2DPHA 4ZYUA 1JKJA 3OWHA 4LXUA 3ZY5A 1SD5A 1SCAA 3SU8A 3TJRA 1G1MA 3OZIA 1JVNA 4EYEA 3RYHA 2VR1A 2I67A 5TS2A 4TLCA 5FCDA 4LBZA 4ITRC 4K1LA 1HTWA 1PT6A 3Q41A 2OZPA 3DEZA 1D1TA 5DYIA 5CITA 1WE2A 1WUKS 4BNMA 2IJGX 1WY5A 1W94A 3IP6A 3VDRA 2IX3A 1BQEA 5EFZA 1SOVA 2XUZA 3AESA 3N8IA 3QXXA 4D96A 2HCJB 3OUZA 3EYWA 2JJQA 1J07A 3KYIB 1X1TA 4TTAA 1AB6A 4CQJA 5HRCA 3BTOA 4FUQA 4I66A 3GVXA 3I6YA 5LYYA 2XEDA 3BFKA 3LNTA 3SYMA 4JSRA 2FMXA 1ECGA 3NP9A 4KLCA 2CZCA 1P0IA 4R7GA 5EMMA 3EULA 4ZAXA 2IV7A 3R7NA 5CXUA 2IYEA 2JFUA 2HL6A 2UYGA 2KI5A 3PYLA 4ILKA 3T5AA 2PH5A 1SRRA 4D26A 5DSXA 2OCPA 4G24A 1X13A 1AN9A 3L04A 4JJAA 2Z3WA 1FSSA 2HK8A 2WRZA 1NV8A 4YJDA 5AJZA 4HZIA 2ZUSA 3L0OA 1MUUA 1TUBB 2G63A 3H8VA 1SD2A 1ZC3A 1ABEA 3KR1A 3QLVC 1DSSG 2PBRA 4E15A 1HNWB 2I66A 1A5BB 1VC2A 4CCSA 3IXMA 2PH7A 3GJ3A 3MSXA 1RAAA 4O0LA 1G66A 2QUKA 4B2LA 3EDOA 2QRVB 4MI3A 2QTFA 2E89A 1OHHD 2X6RA 4OPMA 3PWSA 1YJ8A 2F8MA 4GSLA 4PNHA 4Y1RB 4YASA 4CI0B 5KYWB 1D0SA 2GVZC 2IHUA 2Q62A 3NPMA 3G0CA 3WYCA 1S7CA 3FCUB 4CCAA 3UNXA 1WUIS 1JIQA 1ZL2A 3H86A 3PNOA 1QC5A 1YL5A 1S2GA 5L3SA 1Z6XA 2D62A 1A9SA 3OFND 4DB2A 4C06A 1KK2A 3QVVA 5LMUB 5KHOC 2PGNA 3PVCA 2Z1MA 1YA4A 3IP5A 2WG1A 3HGTA 2R00A 4JMLA 4TYNA 4B2PA 4FS3A 3ND9A 3W5DA 1QQTA 3WGKA 5LA6A 4F4HA 5JSHA 3KJGA 1CRWG 3L7YA 2BTEA 2H1IA 1IBRA 5ICCA 4DLKA 4GYYA 3HA5A 3UM9A 2BZ1A 2DKFA 1GR1A 3L6DA 3A4YA 1OT3A 3HRKA 3P9YA 1OWPA 1R0RE 4FSXA 1W29A 2ERYA 1TJYA 2EG9A 3F90A 4UCQA 5JSZB 3LY9A 2JLBA 3AETB 1KDPA 2C5LA 3AFGA 3GOHA 3QUSA 3NWEA 4QODA 1E3WA 4YH1A 2J3HA 3R6DA 1JI0A 2WLTA 4DUGD 4JMPA 3A7DA 3QX8A 5FF9A 4QOHA 2AHOA 1E63A 2JHGA 2Y27A 1H3NA 4RIIA 1J0AA 3RAPR 4ECEA 3WWEA 721PA 1FP2A 4G1FA 5FNZA 2AN9A 3TQHA 4R3UC 1LXCA 1C4WA 2BR4A 1KA9H 3HPRA 1QRAA 2KLHA 4KSBA 3X2EA 3H8JA 5I6DA 4CEIB 3RVNA 5BSVA 3GR6A 1WPRA 4UEKA 1H1TA 2XQJA 1HOXA 4I5IA 1OB2A 4RZQA 4EI2A 2HV9A 2ZVPX 3C6YA 3TZ6A 1HKUA 3C3EA 4NCJA 4N03A 2VDUE 4P3YA 3DFFA 5B3JA 3DMFA 2IEYA 1K3UB 1VRCA 3IMGA 3F7MA 1EXNA 3VISA 5TMEA 4PHHA 2ZYGA 4CZ2A 5EIHA 3U7RA 1E1QA 1SBTA 2Q3CA 1UKAA 2YNMD 5BO5A 5CA0B 4QWMA 4Q5IA 1MVOA 5KCZA 4LKRA 3RE1A 1ZS9A 3I34X 4M60A 5DZSA 1EUDB 1TCCA 4MRMB 4AKHA 4NESA 5E2AA 3LOQA 1ODTC 2X2PA 1C80A 1M1YE 3GF4A 4JQSA 4TV8F 1MX3A 2F3RA 2LDXA 4XUCA 3RSHA 4HLUC 3H4TA 2G8NA 4PN3A 4YDQA 1ESEA 4PU0A 1P2DA 3ZGXA 2AR7A 1YMUA 5LZ2A 2Y1CA 4RW0A 4NNPA 4CMHA 3E8MA 3HS3A 5JS2A 3HJRA 4HUQA 1U7HA 4L8VA 1AU9A 4LXTA 2M6RA 1T36B 3LFHA 4EY7A 1UDWA 3NIDB 4L08A 3W1WA 1KS2A 1M8FA 2C5EA 3WWCA 3Q3VA 4D5GA 3QWFA 1CFZA 1PW5A 2A5JA 3BIXA 3GI1A 2EFGA 2HU5A 3KOMA 4LDZA 4TXMA 5ADHA 2FJPA 3RODA 2V98A 2ZRJA 4RD0A 1V9SA 2DPYA 2GEKA 1G5FA 3EVNA 1FRVA 1KPHA 3WNDA 3BXXA 4O4LF 4NZNA 1K8RA 4PIPA 4EQ6B 1SZPA 1OAAA 1JFTA 4ZT5A 1YQXA 2ZRDA 4DR2B 2IHZA 2DHDA 2EL9A 1YOVB 2ZYRA 4BNLA 4RTPA 4YUXA 1VE1A 2C77A 5AESA 1ZAYA 2G28A 3R2JA 4WKBA 4BX3A 4NP6A 1KIAA 1U8YA 1YJ5A 5TS3A 4F3NA 1IEVA 2FMHA 2HF7A 2G72A 5AP9A 1R4MB 4ZCTA 1ZH4A 1G3MA 4TMFA 1IXYA 4F4CA 1UIMA 3N07A 3ADBA 4JL8A 1ISHA 1PGQA 1KTIA 3LWNA 5CRIA 3UAYA 1ZN2A 3FWPA 1R16A 3HK2A 1XG5A 2VKTA 4MCJA 3LIPA 1NOIA 1BXRB 3K6RA 4KC0A 4ZOLF 1Y9ZA 3KKLA 4YAUA 3RVMA 5K3CA 4DPKA 4TWRA 3OIVA 1ATIA 3T0FA 1NBMD 4FYYA 4EY8A 2JHFA 4ZVMA 5GAJA 5IKXA 2C3OA 3FROA 2W9XA 4LDNA 3JU3A 1QRUA 2ZJ0A 4KO3S 1NBWB 3IGFA 4FFBB 4UVDA 5EXSA 3S2EA 4D4LA 3VH1A 1Z37A 2Q0HA 4CGZA 3I9FA 1JPVA 3EY4A 4NCIA 2QUJA 4X7PA 1RWBA 5BQXA 1BJRE 3S55A 3ZE8A 1KMNA 3BZBA 5I9TA 3NM6B 4MR9B 1O6CA 3QVLA 1D2RA 4EHDA 1Q7TA 4N5HX 1M6VB 5AKHA 4P7KA 1ZUD1 4GNRA 1X19A 3AR2A 4K6KA 5FPHA 2FX5A 4BNNA 2XWBF 10MHA 1VIDA 3M6IA 1TADA 4BVGA 5DP1A 1DCTA 2BGGA 4ROSA 3EDYA 1G42A 3FBGA 1TUBA 2LW7A 3KWFA 3ZTTA 2Z5FA 2OY0A 2B3DA 5H3CA 1UOOA 3INTA 3RTDA 1CQZA 1BMQA 2G06A 4JLKA 5EWLB 1WB6A 3VZQA 1ZBDA 1Q0UA 4ZO8A 3S2GA 3SBEA 1WKVA 3DKKA 3I9LA 4IHJF 5ERXA 2QRVA 3OX1A 3TEMA 3IESA 4Y1RA 1PQWA 3SF0A 3WYDA 5KYWA 5FYDA 5JSUA 3F4LA 3UJ3X 1QRRA 4MOWA 4KR0A 4RD1A 3HJUA 1GAWA 2QAGB 1NUAA 4YMTA 4HH3C 1H2HA 1ADGA 1YBAA 1U7OA 2YMMA 3EX7C 4R3WA 3SS7X 1I3MA 5J40A 1T9DA 2BGWA 5KQPA 3KLNA 3A58B 3D8HA 2B1JA 4L4SA 4BPRA 3M89A 4IYJA 3E58A 3GCDA 3IFSA 5B1DA 3QM1A 3NRJA 4TVSA 4ZZ1A 2O19A 4HFNA 4X7RA 4AXBA 4Q7QA 1GSIA 1WULS 2BFBB 2D54A 3LUDA 1WXXA 2A9VA 3JCZA 5AJTA 3V9AA 1VE7A 1N2SA 4D4JA 3ELDA 5JNUA 2CDCA 4JB0A 1NVEA 1OLSB 2NTYC 2C2HA 2O3QA 3AUYA 3MWYW 2LCIA 2ZB2A 3TFQA 1QKJA 4BWYA 4HI0E 1XZMA 5JXIA 3TG2A 5JSZA 2OBNA 3AETA 5FNVB 1TRHA 3RBXA 3OE7D 3PNPA 3R0QA 2Y92A 2HA2A 3HFSA 1LSSA 1QGED 1GKYA 5LR6A 4TZTA 3OOHA 2HHCA 2B4TO 1D09A 3CX8A 3KFLA 3M1IA 3GOQA 4KZPA 2MR5A 4YQEA 1D6NA 5J5AA 1PEDA 5CDTA 5JLJA 3IEMA 3IAM1 3VNUA 3TLXA 4NLLA 2D5AA 1S1CA 2NUPA 4EOGA 4RFLA 4AW9A 4NOMA 5LQMA 4YLEA 4CEIA 5FAKA 1GILA 2NVOA 5IZCA 4NAVA 1AZLA 3ESYA 2R44A 3HN2A 4O2AB 5EHIA 1SIBE 2X4IA 2AQ8A 4H27A 4A2CA 1SJ9A 1Z8DA 4MP8A 5JJLA 1Q15A 4CQLB 1GCOA 1M0TA 3NHUA 5CXSA 4BMCA 4CBVA 3L4BC 3D8SA 3S2SA 3IELA 1C41A 1C5KA 1QFZA 3DKRA 5CA0A 2GXUA 2I65A 5FBVB 3GEMA 3S4YA 5L45A 3QPCA 4RNDB 1EUDA 3B9PA 2ZJ2A 3F5QA 1F51E 4FFRA 3H8SA 4KBYA 2GK3A 4MRMA 5HE9A 3WLIA 5LNK6 1L7BA 4LF7B 4XSVA 5EE5B 1MOPA 2IU3A 3AUTA 1MX9A 2AD5A 1ZK3A 5TMBA 4CF4A 4YCNA 1U0FA 5HGXA 2JAQA 2H2DA 2PFGA 2R2GA 1PUXA 4BX9A 1OBHA 2C4UA 3DFIA 1G3IA 3BL6A 2V7PA 1YE8A 2QTCA 3IJRA 1CJMA 1T36A 4J7XA 4YT4A 5SZKB 3EH1A 1L4MA 3LV8A 4OG2A 4RVOA 2RGYA 4IX1A 4YP0A 2BY4A 1W2HA 4ND4A 4OUDB 4WQMA 5P8WA 4WINA 2BCGY 2VTEA 4G2NA 4C1NA 4EGSA 1WY7A 3TKYA 3RVDA 2QRZA 5TSDA 2EJUA 4S2EA 2ONKA 3HEMA 4D0GA 1YCDA 4C07A 1CR4A 3CTPA 1HORA 4CR7A 4QAJA 4Q3DA 4BGUA 2ZT5A 4QJ5A 2ZLBA 4FPXA 4EPTA 1Y7PA 4DA8A 3AR8A 5K01A 4RL4A 3PSAA 3IVMA 3GGPA 3LDGA 3WGLA 1CULC 4OTZA 2PJUA 3QPDA 2IVZA 1C1DB 1TQ2A 4H6PA 4MKZA 1WUJS 3JQDA 4D41A 1J2JA 1QZTA 1R4MA 1XTKA 5EI5A 4HAZA 4JX9A 3DVRX 2GM9A 4G9GA 3U7GA 3EFHA 2BGJA 1YHYA 2GXAA 3PZBA 5FOWA 3QE4A 4HXFB 2PYZA 3U3RA 2VVTA 3H75A 1BXRA 4DYHA 3AG6A 4UM9D 4BXOB 2VIIA 2HA0A 3DULA 3ZH9B 4NPHA 3ITDA 3ADDA 5E2BA 1NW3A 3OM1A 2YUIA 3PDCA 2XF2A 3K8OE 4QXOA 1PT5A 4HQKA 4EA9A 4WBXC 1T2NA 2CYBA 4FFBA 2C8VA 3IDAA 3ZR4B 4J16C 4M98A 4WKOA 3ORYA 3D2AA 4Q12A 4WNYA 1KY2A 3DE5X 3AOEA 1AQJA 1OX5A 5T8KA 2FFHA 1D3AA 2JFYA 4KQ6A 1RLTA 1RD4A 4LNAA 1NLUA 3FAZA 3HLKA 1N2CB 4MR9A 5E4JA 4C3ZA 1IOLA 4HPXB 5AVVA 3TM4A 1M6VA 1YJQA 1ZSVA 3ZHZA 1F1JA 1GPBA 1UMDB 1E3LA 2GM4A 2V8OA 4Q1EA 3VHQA 3ICPA 3JQRA 2FWNA 1YRAA 3RARA 5E7IA 4DR6B 1XWFA 1W0KD 3MC1A 4NONA 2OCDA 2XZOA 2PUJA 2IYQA 5BN4B 4BV8A 2V0CA 5DF1A 3MAAC 2GEBA 4OLHA 5CJ2A 3JARB 3K2BA 3EXFB 5E95A 5JO9A 4RFSB 1DBSA 2BDEA 5EWLA 1HRKA 2FFRA 2FW9A 3GX1A 1T6XA 3M8KA 4RPGA 2N46A 1RKBA 1TZKA 2ZBRA 1Y1LA 3R5KA 4LDAA 1WSDA 5DCUA 2AJCA 4E5MA 1Q44A 2OBXA 5HMLA 5C0OE 1CEXA 1R64A 2G4VA 3T1TA 1F2DA 2L17A 4CF3A 1EVLA 2QAGA 1T5TA 2CMHA 3TUJC 1ZD5A 1QIDA 5AYVA 1E1YA 3AUXA 1Z15A 2RKWA 4HAVA 3KS9A 2G76A 2HMSA 3SZLA 2BHTA 1MO2A 1M5TA 3S1AB 1DZIA 1U8CB 2BFDB 4MQBA 1EDDA 2BHLA 1IWBB 3CVOA 4YQZA 4ZCSA 1NR5A 1M76A 3O94A 1R8QA 4RULA 2BFBA 4TYQA 3LZCA 4EA6A 4KR7A 1X8KA 2RIPA 3P4UA 1UC4B 2TECE 4QDOA 3CM0A 4U9UA 1IVNA 3RTGA 1OLSA 2G70A 2PR7A 3K3PA 4ESOA 1BGXT 2GAAA 2EEZA 3BSWA 3EGEA 4F5WA 5FNVA 1V96A 2BRUC 3WWYA 4HNUA 3I9JA 3FMFA 1KAMA 2C2YA 1QF7A 2V5UA 2PMWB 3T1HB 1LLCA 2E85A 1E0DA 1WV1A 2HIGA 1X1BA 4QA9A 1N9GB 1CDZA 2QDKA 4BNTA 1JBEA 1SCKA 3GJZA 5E9WA 4B85A 4IJ6A 2BDUA 2GETA 2C0CA 2I6TA 4DV7B 4LFBB 2X0IA 4ZOCA 3FYUB 4W5TA 1I0IA 4BIMA 3V46A 1NQXA 3GGDA 4Z9XA 4KO1S 3QBDA 3D7SA 5AXAA 5J2UB 3OCJA 5LLDA 4O2AA 3N7UA 4I5GA 1MXFA 3AM5A 5HP4A 1PBTA 4MLZA 3FTPA 3JQ9C 1JHMA 4CQLA 1AKMA 3VTFA 2NNLD 3AMVA 5IH3A 2IBTA 2PZGA 2R0QC 1IRXA 1V45E 4IIGA 4KR3A 3PVZA 2LCQA 2G83A 3ZU2A 1KAEA 4O6VA 1Y4ZA 3MTQA 1Y1KE 2ZSFA 8OHMA 3E7XA 2V58A 1XZHA 3UWSA 2M6KA 2H4WA 3FPAA 1UR5A 2PSJA 2OPHA 3UF0A 3W8NA 1XPOA 2I6SA 2XWPA 1BJTA 1QUEA 4LISA 3ZBPA 3JQPA 3KJIA 3Q11A 1PT9A 1XZEA 2JIMA 4X7MA 1J0DA 3NS7A 5T4HA 4BHTA 3DZBA 3NWBA 5K8IA 2QR2A 1PW7A 1Q1BA 3HO6A 3UUWA 3D2BA 3H1TA 3LBAA 5ER9A 5K8LA 4MK4A 4PV7A 1QZ3A 4C4SA 4W5QA 4F5YA 5EA2A 4BY9E 1QG2A 1CW2B 2CKMA 1G5QA 4OUDA 1L7RA 4BNWA 1WPQA 4PM4A 4FWTA 1DBVO 4K1XA 3DW1X 1JG3A 1QCCA 1SUSA 2JKVA 3K0KA 3QBVA 5BR4A 1T0JB 2PKQP 3O83A 1J0CA 2C00A 3QKRB 2HQBA 3CRNA 3MD0A 2J08A 1XAIA 1CIVA 5LB4A 3N59A 2QY9A 1ZVMA 4WXEA 1H0SA 1TZBA 5LFAA 5JXGA 5GOTA 2CMDA 2C2OA 1HSZA 4JLVA 4FBGA 3U40A 2C2XA 3W8RA 3BOSA 2OECA 3ES9A 4JI8B 2VNJA 4LZPA 1ONBA 5JW6A 4MW4A 1C1DA 1J90A 4Q3CA 1FJXA 3QI2A 2IHVA 2ZJ3A 3H16A 2CLCX 4UD2A 1KSGA 1EWQA 4RZUA 4WVLA 2NXJA 3ESAA 1KZHA 1EFRA 3BAFA 3ER6A 2F9FA 4QYIB 3TR6A 3K8YA 1GM5A 1EVKA 1SUAA 1LNSA 2YZ2A 3PXCX 4DA4A 4H6VA 1B26A 1BVYF 4BC1A 3LYLA 2GN2A 3DC2A 2YFQA 3FDIA 4QAQA 4RQBA 1ADFA 1JU4A 1RC0A 3AY3A 3BIOA 3BXOA 3IJPA 1RU3A 2ETVA 3NWOA 4D3SA 2ZZMA 3DAPA 5IAKA 2GX6A 1LTKA 2YJNA 1ZD8A 2YWHA 3TTYA 3UBTA 3DKPA 3ZS8A 3NOOA 3LQ2A 1XIVA 1YQUA 4DLZA 2WP0A 3QA9A 3DAOA 1UIRA 4IDNA 4ZAGA 1QTRA 1GEEA 2CFCA 1N2CA 3C4QA 4G9EA 5F1YA 2OO3A 3SZRA 2IEDA 2IYUA 3CNLA 1Y48E 4UZSA 1UMDA 5CB6A 1C4OA 5B2EA 1IN8A 1TK3A 2PX6A 4EMSA 3EUWA 3PZRA 1G8YA 1HA3A 3DKIA 4XX0B 3WZ2A 3CO5A 4XARA 1I7QB 5E38A 1RYEA 5KC8A 2BBWA 1VMIA 1A7KA 3DQPA 2O5EA 4TRMA 1S01A 5BN4A 1Q0RA 3TMYA 1WB9A 1C3JA 3JARA 3EXFA 1XU4A 3JZFA 3DZCA 1XZKA 1UM9B 3KJXA 4MA0A 1DX9A 4N5MA 4ND6A 4O2BB 4RFSA 4LNUB 5FA5A 4AWBA 4C0BA 4CDMA 3TGPA 2JIZD 1OH7A 3GJ4A 4UM7A 3OHPA 4M1YA 2XMPA 1WXDA 3HN6A 4W9MC 3AFHA 5KWIA 2ZDGA 4RX1A 3TD2A 1HR0B 3CXUA 4MV5A 3K53A 4H3KB 4M7PA 1X1EA 4WLVA 3K09C 1BZYA 4MMYB 1JXAA 1RSZA 2FZVA 2H1SA 3BZWA 3K72B 4JXKA 1WXHA 2MT9A 4BTLA 2OV2A 2BJVA 4Q9AA 2VZLA 3U17A 4GE3A 1Z12A 1IUOA 1JYEA 1ZXXA 3S1AA 1WSAA 2BFDA 5E7JA 2WI8A 1SIUA 1NQTA 1KP2A 2MMGA 3D0KA 3DHVA 3G8AA 4BVFA 2NTNA 2HBRA 3FOWA 1QTQA 4NV3A 1DOZA 5LA6F 1JIIA 3FNHA 4KLZA 1T4CB 1V1RB 2P9GA 4UXIA 1KXJA 3I6MA 2AFRA 4X66B 1L9KA 1JDBC 4WESB 3UJ9A 1O94C 3SHOA 1R1DA 2Q5FA 1JP7A 3WA6A 5LJIA 2FWRA 1EX9A 1RRKA 4KQMA 4MO9A 1ACLA 2ACVA 4HEJA 1A88A 1T5BA 3TLBA 5ELLA 4DLRA 4M0PA 1JNXX 3HU1A 4KPUB 5TQ2B 4BL5A 2NNWB 1DHTA 3K35A 4LC0A 2O2ZA 1EA5A 1KH1A 4XCQA 2HRQA 4Q6WA 2M9MA 2WIJA 3DQQA 4GOXA 4GXNA 1PYDA 3GUVA 3R6GA 5TDHA 1N9GA 3RV3A 1JS1X 1UJ5A 3Q40A 1U8UA 3MG9A 3HDYA 4YRTA 4XVCA 4ESEA 2RHMA 3IODA 4PGAA 4RTNA 4HXGA 5A0VA 3B85A 3L6UA 3FYUA 3LY8A 4PO9A 2V59A 3ZTWA 2J09A 4NMMA 3GC6A 2P0AA 4I55F 4TXJA 2HX1A 3HCWA 1OF1A 5J2UA 2HNKA 3PGMA 2CLHB 3RAFC 1QP4A 3INNA 1J8YF 2GEVA 2EW8A 1T29A 5FPSA 4ZC1A 2LV8A 3OZBA 4FHDA 3DCJA 2NTVA 1F1BA 1EP1B 2B7BA 3EGCA 2I8LA 3QPWA 4LVNA 2G5GX 4HFJA 3N5KA 1BE0A 4MSUA 2X0FA 5CEFA 2TMYA 2FPXA 2W2LA 3AKCA 2B5WA 3VKUA 2GWRA 2P8JA 2NP6A 3GRZA 1KI6B 4G67A 2GKSA 2WFAA 3CUVA 3G9QA 3RJMA 3CVYA 3DP7A 4PC2A 2YRFA 3GEIA 1WXFA 1T13A 2UYYA 2AG6A 2DAPA 3P1JA 4GOKA 3STYA 1XAJA 3GLIE 1ZN7A 5AKZA 3STTA 2GJ8A 1N25A 1PFVA 3H3FA 4US2R 2E4ZA 4CW7A 2H4JA 3VU9B 3U3KA 5D3KA 2V9ZA 1BFKA 1HM5A 3KL2A 1N6IA 2K87A 4MWEA 7MDHA 3AIKA 1O03A 1EQ2A 1PHPA 3X44A 4IJVA 2COUA 3L6OO 4HWSA 4NH4A 2DRIA 1E32A 1K8XB 1MRNA 1WQ1R 1ZEJA 4HKTA 4P5EA 5IJXA 5LXTF 3R7BA 1E8DA 1NW9B 1FNNA 2GN0A 4FN4A 1NGSA 1OVGA 1P18A 3P9KA 1R4NB 1DGQA 2JGAA 5G3ZA 3BILA 1F38A 3QKRA 3V34A 3FTEA 1CUEA 3VYWA 3P52A 3SLGA 4C5AA 3KQOA 2P1RA 2WY2D 1P2TA 1EJBA 4B0PA 4DQVA 4GVLA 2BC9A 2XKAA 4MVWA 4DMCA 5GIPE 3VNVA 3WIBA 2QI9F 5KC9A 3AINA 2PMFA 3VOTA 2B4RO 4IQ0A 3MPUA 4P8RA 2XV1A 1BYUA 4GP6A 1SD1A 1W88B 5CYPA 2OOSA 1NBOA 1M2HA 4R8SA 2AOXA 3B51X 4DXHA 4EGAA 4RVSA 3RJZA 2ZAMA 4AUKA 2IITA 1BXZA 2QRNA 5TC4A 5IN5A 2HADA 5GVSA 4F4FA 4ZJYA 4REQB 1HFJA 1MW8X 3DEKA 4QYIA 3LRTA 4NYMR 2FZCA 3O4FA 2ZAYA 5LIRA 1LPOA 1O97C 4JC8A 4AJEA 2X5NA 2Q07A 1YOBA 2R9VA 3O8LA 4NOLA 5K51A 2Q7OE 4CKZA 3GQBB 5ES4B 1H05A 4C0QC 4EFMA 3URKA 5A2GA 3FVTA 4IQFA 3KG2A 4FQ5A 3GBSA 4BLVA 1Y89A 5AI6A 4E70A 5FWXB 4F1WA 1XDWA 3R9XB 4R83A 3QJGA 4F4IA 2A9QA 2WWVD 4IZHA 2CBXA 4Y9SA 5EKDA 1ZH6A 1C3VA 3T7JA 4HG2A 1D9ZA 1R0YA 2BKLA 4KV7A 4WADA 1L5LA 4DMRA 1U4NA 3NDIA 1X7GA 4CN8A 5IEBA 3JYHA 4FHFA 3H2JA 3FVQA 2NUTB 2FQ1A 3O47A 2IWRA 4MW6A 2OK7A 4MAMA 1K6XA 4Y0NA 4B4VA 3GVCA 3O2JA 3MD9A 5SYMA 4BNGA 2OHJA 4BP9A 3O92A 3V80A 3P26A 1L6IA 1ZD2P 3DEJA 3P0HA 3QSGA 4M0KA 3MHTA 1U0NA 2J7PD 4XX0A 4OGLA 4QT4A 4OJQA 1B4DA 5GZ6A 4ZZ2A 1M1XB 4BO6A 3AHEA 4IIDA 1PZEA 1QYXA 1U94A 2VNIA 2QYSA 1J39A 1QG6A 1UM9A 3ESRA 1EGMB 3LRXA 3EXHB 4O2BA 4LNUA 1M2KA 2JK0A 2FHPA 3SY8A 2FQYA 2JFVA 3ICCA 1YNSA 3ILYA 1U3DA 2P4UA 4ZXFA 3G0BA 1XRQA 2XZLA 3WJ2A 1Z2PX 2E4AA 3KC2A 2LKDA 2ZIXB 3N70A 2NU8B 5BYAA 4EELA 2P7IA 3RLFA 1JPNA 4N8EA 3DMTC 3HLYA 1T2DA 2WICA 3SG0A 3PPWA 5T6BA 5LUBA 3WISA 2Y2VA 4UUAA 1KAGA 1YDHA 3PPXA 5CW2A 1UJ4A 1DTWB 2Z9BA 4B9EA 1MQ9A 2ZCJA 3MOGA 4OXNA 3Q4GA 1O8CA 3U37A 1T0UA 3IXLA 4N9QA 4B6OA 3IQHX 4RVGA 2ODTX 1KO5A 4OXXA 2W93A 1R0CA 1KYZA 1NLFA 1P39A 3KX2A 3SF8B 2O8NA 4CM9A 4YRBA 1N34B 3U09A 1W36C 4XPZA 3OA2A 3DNPA 2OK8A 3IUYA 2VAMA 4IEEA 1BA3A 2XUDA 4EHIA 3G89A 1IVSA 1SCIA 3FJ1A 3ND5A 3P4XA 1T4CA 1V1RA 2VAPA 1E77A 1U0SY 4PLTA 2YYYA 3TIFA 3WQSB 2WV9A 3ISVA 2FSPA 1QP0A 4WESA 4WT7A 2YJ6A 4C6RA 4IO0A 2GD0A 3D3JA 4CT0A 1N0HA 1OX6A 2G7MC 4MMZB 2ZRKA 4P80A 3SZGA 1G5IA 3GGCA 4KPUA 4RMHA 3NCTA 5TQ2A 3A4VA 5L4SA 3VSAA 3GEPA 3M2TA 3C1UA 1PVVA 2YWBA 4A2PA 3D3WB 1QIFA 4PAQA 5DNWA 1Y8RA 3U6BA 2WJWA 3UJ8A 2Z95A 3TZQA 4QQ8A 1KFBB 2LUOA 2ZT7A 4QUGA 2WFLB 1NVKA 1PF7E 4BVJA 2A35A 4KVFA 3NUZA 4OLAA 1EFHA 1HDXA 1FVXA 2PL5A 4F21A 3V33A 5F4BA 3RFFA 1AX9A 4QUEA 2ZT8A 4QYWA 4ZHQF 5ED4A 4YDHB 5HKLA 3R09A 5E9QA 3E70C 1CUDA 4G1CA 5CDSA 4PHFA 1M2NA 5KTSA 3MMPA 3DVQX 1E2MA 1QAQA 1DI0A 2WDPA 2JCVA 2QROA 1SXJB 5SYNA 2GLUA 4U1RA 5IKEA 2HIAA 2WTXA 3QG1A 2NVWA 4OMFG 1KI6A 1BD3A 5LLSA 3WMRA 2ZXFA 3QBJA 5DM4A 2F4VB 1U2GC 3ZTYA 2H0RA 1WMFA 5JBNA 2VHEA 4BGDA 4H77A 4EJSC 2INGX 3H4IA 5IANA 2MSWA 1P9LA 2C5GA 2QG9A 2XMDA 4B4UA 5CT8A 2GZ1A 4AYWA 2P1ZA 3MELA 1E2QA 2G9RA 4MUAA 1KJYA 3RAEC 3TFOA 1F8UA 3HL4A 1O0SA 3VU9A 3SSNA 2AFHA 1PFQA 2OO5A 4YIHA 2SKCA 3I1JA 1IJEA 5HNKA 4R16A 3I5XA 4N41A 3V4LA 3HP7A 2EQBA 2CLLB 3AUAA 1FJ2A 4D9EA 1CY0A 4FDVA 1LI7A 1TYBE 3EAQA 1T6NA 4BLQA 4H4CA 2WKSA 2X8JB 5I9LA 5ALVA 1TNDA 3NJRA 3CHYA 3HDQA 4NCHA 1KZ9A 2C2WA 3WDSA 1PK7A 1R4NA 3CS3A 3MJCA 3WAKA 5T3UA 4YRSA 2DB3A 2WPNA 3D7LA 4J3FA 1QHEA 4KQHA 4TN1A 5DN6A 1H2AS 3A2NA 1R6BX 3RC3A 4AJJA 1F0KA 5HRUA 4C6SA 1P9NA 2F9LA 2VHQA 1JFFB 2YY6A 5ARBA 4MWDA 4K9PA 3ZI7A 1DP4A 1ECCA 2E1PA 3FNEA 1K27A 3UKJA 1CK4A 3GXOA 1W88A 4WAUA 5D7NA 2B5OA 2DHEA 5DBGA 4HYTA 1A8HA 3K1TA 3RHZA 3W2HA 4ENRA 3R40A 1XCMA 4N7JA 3QRWA 1E79A 1SHUX 4YAWA 2OT3B 3TNYA 1P4SA 1QE5A 4YROA 1PZFA 1RMTA 1W46A 2JGMA 3O8OB 5F73A 5HDQA 3QELB 5EJ9A 2FSUA 4MQMA 4EH1A 1R0ZA 1N78A 4Z4EA 2JH8A 3OQ6A 1TO1E 2D7CA 3GQBA 3QNWA 4B31A 4YUAA 3A36A 3K5PA 3HVUA 2OSBA 5F51A 3VM6A 3FDFA 3PHHA 2XZPA 3QE0A 3WDLA 1AM4D 1O96B 1EDZA 4QRIA 1VHLA 3R9XA 1XLTA 3AVQA 5FWXA 3GP8A 5JDIA 1RPZA 3DL0A 5HIMA 4C22A 1OLOA 2QMEA 5FD8A 3FBWA 1RZVA 1Q16A 3PNQA 1B8PA 2YHUA 5C37A 5M5BA 4JL6A 2IZ0A 3UOWA 3DMGA 3VSEA 5LZ7A 2QI9C 2VF8A 5HQTA 2I1LA 5HW0A 2V74B 2VJQA 5B6PA 2NUTA 1G16A 1KMMA 4GWGA 2WUWE 4L5AA 3SQOA 1NOJA 2X19A 4QFMA 4W8HA 4RJJA 1LJUA 1PT8A 2ZJYA 4R8VA 4LJRA 1FFGA 2IX9A 3LLUA 1LPSA 1VP3A 4QELA 4I08A 3RCBA 1HH4A 2FP4B 4UBOA 3HXKA 2JZCA 2HNAA 2OCXA 4CDRA 5FT9A 4E1AA 1NSTA 1QK4A 1LW6E 2WWRA 3GEEA 2WWYA 1IZYA 5ANRB 2IU6A 1S2LA 2DCMA 2VOJA 2WM3A 3EXHA 4ACAA 4YWHA 1UBNA 4DCTA 2B2XA 5DGHA 1NT4A 2PLAA 1BW9A 4RWZA 3B53X 1N6RA 2ACWA 2NU8A 3ZDBA 2ZIXA 3BRSA 3QEMB 4NG4A 1NVGA 4MVJD 3RTEA 1Q3HA 1V4NA 4YUWA 2QW1A 3ZQJA 2WSSD 3E8SA 5LD2C 2OMEA 1T6BY 3UYKA 5T4BA 1E2NA 5JAMA 1H9AA 3A0RB 3PJFA 1KMCA 1DTWA 2FZGA 1FSGA 2P90A 4U6QA 4DADA 1DIAA 1WP4A 4UU7A 3HPQA 1GVHA 3HKBB 3ROMA 3ULKA 3QXGA 4BO3A 1F7UA 1Z6YA 4C01A 2A0WA 5B7QA 5K6TA 1HOTA 1YIOA 3SF8A 2HREA 2VUHB 3AIMA 5FOQA 4MGZR 5KUTA 5ILOA 4V0ME 5FTLA 3H83A 4OXRA 4TT3D 3VR5A 2QIPA 2OCLA 3GFVA 1MJFA 3MT9A 3OLYA 1HETA 1Z38A 3EHDA 3CZRA 1MC4A 3NHAA 4H6WA 3V1YA 5L4LA 1ABBA 2Y0EA 4YQYA 3ERCA 3IKJA 1MNQA 1UBOS 3LXUX 4FEEA 2H1OA 3M0EA 2FPSA 1JXOA 1CUUA 1QH1B 2ZRIA 3GDFA 3H5WA 1ZD4A 421PA 4DNOA 1N92A 3AC0A 3A6HA 2FXIA 2Q6TA 3VO2A 4D9FA 1SPBS 2PFKA 1NRJB 4MEJA 5AHOA 4YRNA 5JV5A 5K0GA 1MKYA 2GHRA 1M73E 2N75A 2IUTA 1SUWA 5H9WA 1D2HA 3CONA 3D3WA 4QQKA 3UANA 1K66A 4UUPA 4LZAA 4OP3A 4JEUA 4XWGA 2UYCA 2D0IA 1CZUA 4P7BA 4AF7A 4Q4HB 4CN9A 2WFLA 4ALIA 4F97A 3I0NA 4LXIA 3WADA 3MJEA 2O2DA 5L7YA 5BUZA 2H18A 3TXYA 2HWUA 2VATA 1B8VA 3B12A 3K9CA 3NFRA 3NIWA 3EY9A 2OQIA 1T2FA 3GELA 4IIJB 3LT1A 4J1TA 2JBHA 4KE8A 4C5BA 4DT1B 3WE7A 3PXAA 1Y7IA 5HVNA 3QE2A 4IVNA 1QF9A 3H2ZA 4JZYA 1HYBA 5COAA 3LT5A 2G40A 1RJDA 3BWMA 3HB4X 4A27A 1IHPA 4O2AF 4RZIA 3P19A 5DB4A 1SXJA 1YZ3A 2PZBA 1QIIA 2WZBA 2RC6A 2FEOA 1Z7GA 2BEWB 2O2SA 3HC7A 3AVYA 1IMJA 3BAZA 2PK3A 2X5OA 3MWEB 1U8XX 1G1AA 3RVBA 3B9RA 1YR9A 2E21A 4JBIA 1H2EA 3WXMA 4QKQA 3D81A 2IYPA 1WU8A 1J0XO 2F17A 3ZVMA 1XJCA 4QBIA 2UXBB 4OFBA 1RKXA 3GROA 4HQOA 1QU3A 2ISSD 2XVXA 5F7JA 4C7JA 3RIMA 4XM1A 2A8YA 5JADA 1EUZA 2I4LA 3EGDB 1ZI9A 4XIIA 4GEKA 4RGYA 4UBIA 3DR3A 4WKCA 3NTLA 2C9CA 5C8XA 3FPJA 4LWQA 5DASA 3R7WB 1F06A 4JASB 1R74A 1P75A 2A5FA 4MWGA 4PHCA 3TQIA 4DSAA 1TVKA 5KVVA 3LCCA 1SC3A 2X8JA 3IMFA 3GA0A 4I4LA 1BDIA 5IK2D 3TQFA 1AXGA 1P3JA 4G4JA 4GZ3A 4IF4A 4TMVA 3ZJ5A 1SOWA 3OLWA 3O9ZA 3SQNA 1QHYA 1UXIA 4X0EA 4R8LA 4CMIB 1SC4A 2HPVA 3PRKE 4OM7A 4P4GA 2Y8EA 1WDLA 3ZHYA 4EG5A 1KO1A 3LVRE 4LQ4A 2FSVC 1JFFA 5TGDA 3VGJA 5H68A 4AZ3A 1TVEA 3ZY2A 3V7FA 2BW0A 2OUIA 3AR7A 4MV7A 4RVNA 4WN3A 4Z0PA 4YMUA 3S5UA 3NATA 4HLDA 4II3A 4EEKA 1U7ZA 1E92A 1XRLA 3TOZA 4WY8A 3ZQKA 3PQFA 1P8JA 3V7YA 2WMYA 3BREA 4BBJA 1ST2A 1IONA 5FOXA 1CR0A 1KY3A 2UZIR 4I4NA 1FLDA 2Q1WA 4OEHA 4CLHA 2D6FA 1YCFA 2QKYA 2PYIA 2PS3A 4E5DA 3O8OA 1Z0DA 3QELA 2DXIA 4KL8S 3ST7A 5IX8A 3C4VA 1ZOOA 1OIWA 3AHJA 1EQUA 1IK6A 1SCQA 4WXMA 4PZ0A 3HZRA 3DLBA 3C3KA 1E2KA 1CG6A 1CUJA 1G17A 3DPIA 4FDUA 1ENPA 4P32A 1O96A 4J2OA 4LJ8A 3T35A 5M7EA 5CBPB 3L8YA 3PPIA 1K7XB 3RT1A 3CLSC 1TOAA 4JUDX 4JC5A 2EZUA 4U2DA 4BFLA 3Q7TA 4EAAA 5KHLB 3FTQA 4EW2A 5H82A 3I92A 3K2IA 1CY4A 4IDHA 5FWAA 2PMEA 4E2WA 1W30A 4B8ZA 3A4NA 3PUVA 3UA3A 4Q9NA 4HNTA 4XW2A 3E2IA 4MQEB 4IL5A 3GCWA 4AN4A 3DOOA 4AWXA 4C76A 3FCCA 2RAUA 5DSTA 4WY5A 1T9CA 5FLYA 3TB4A 1QCYA 3UUGA 5B30A 1CQJB 4D4GA 2YJ4A 4HV4A 2RJ3A 1G0NA 1NYLA 3T4UA 4U8GA 3UJHA 4Z4QA 4YPOA 2BP7B 1TJ5A 2FP4A 2HSEA 3H2BA 2UDPA 3DWIA 3KQQA 1GNTA 2PKXA 1OFHA 4AMZA 2CNWD 1VJCA 3CNNA 3KDSE 3C3AA 4MWZA 4RY0A 3SX0A 2VCYA 1F4LA 4S24A 4EHBA 3WYGA 1P7YA 2IT1A 1I2BA 4IMPA 3AILA 4M1MA 2O0LA 5JYEA 3ON5A 4BB0A 1I7DA 3BXPA 3PX3A 2G1JA 1H22A 3QEMA 4NBVA 2W2VA 1LQ2A 1KVQA 1TYCA 2NGRA 5DHRA 3ZNOA 2NO0A 3MOIA 3QG5A 3V2HA 1W7AA 1ULAA 3E9YA 4U3JB 3FZYA 4B80A 1JWLA 1JHUA 2WK1A 3FZNA 1IFXA 2GJSA 2XCLA 2WM2A 3A9SA 4CMAA 5EVJA 5JCOA 5EXEA 2HJGA 1VM6A 4V0SA 4Q4DA 3RBVA 1E7MA 3HKBA 1U28A 2DBYA 1MW9X 4B6GA 1SQ5A 2WAMA 5AFSA 3JYOA 3U39A 4QJ4A 3WBBA 1PNVA 4HMOA 3MQ2A 5E1DA 1AIPA 2DUJA 1P2FA 1KSJA 4MWSA 4D3XA 2QT1A 2ZRNA 3E53A 1H6AA 1KE2A 4DLNA 4R9UC 1VJ5A 5J2TB 1SCBA 1OWOA 2E18A 2WWIA 1YZHA 3M6UA 5F9MA 1XBTA 1ZGHA 4YRLA 1QH1A 5JNTA 2J0QA 1JVSA 4R1NA 5KOJB 4CR8A 2A0FA 2DERA 5JPDA 1YMVA 2QTGA 5BSWA 4Z7NB 2G77B 4FX5A 3GDHA 4HAIA 5F77A 3QLUC 1G3UA 3VR3A 5ICSA 4DA6A 2J9RA 1O9BA 1DMRA 2ISQA 5EUBA 1B8UA 1Z5ZA 3H65A 4HX5A 3O8BA 3L7KA 4UHKA 4Q4HA 4HLQB 4HVLA 4DUYB 1LD3A 2PDAA 3UJCA 4E94A 4NJOA 3AY7A 4I1RA 1O9HA 3IQDB 4LI0A 2VBGA 4RL6A 4EO9A 2PGAA 2TS1A 4GDFA 2DQSA 1AH2A 2GTPA 2E37A 1D6SA 2PZEA 5CTJA 2X1HA 4IIJA 5BV8A 2JI4A 4DT1A 3EMBA 1IL0A 3I04A 2R87A 4ZYLA 4AD8A 2YYZA 1E2JA 2CXRA 3AUKA 3KJEA 3MCUA 5JMWA 3W3ZB 1I4WA 1KXZA 2AOTB 2Y6VA 2D13A 3LW7A 3N0RA 1TTHA 3P94A 3PEFA 4M6WB 2G1UA 2BEWA 2C5HA 2VC2B 4TMYA 3H05A 1R6AA 2PBFA 2OYRA 1C81A 1ZOIA 2B78A 3MWEA 1WMBA 3ONDA 4N0DA 4F9EA 1AJEA 3FG9A 3A9RA 1I32A 4MUXA 3SK0A 1OKKA 4LQCA 2CJYA 4ZVSA 2FFQA 2G88A 1Y3CE 4AJKA 2ZJ6A 4DV6B 2VRCA 3ZDRA 1NPTO 3RGGA 5CM2Z 4B4WA 2GM3A 1Z25A 1ADBA 1D2GA 1LUAA 2VF5X 3EGDA 4IDAA 1LEHA 2P2LA 3KNZA 4Q18A 3DWFA 2YYSA 4TWIA 4ZTBA 4E31A 3OQOA 1XXHE 3KVYA 2WWXA 3MJTA 1J56A 2Z2XA 3R7WA 1VIYA 2IP2A 5K45A 4F72A 1QGYA 4DIKA 2FCAA 3C7DB 1BO6A 5K5EA 3PPYA 3V00A 5IPFA 1BEEA 4OP1A 1W85B 3ZZNA 5JO0A 1I5RA 1JDPA 4M21A 4BFZA 2GO1A 2WYHA 5LP6B 1D4OA 3R5JA 2ES4A 3FMPB 1EFAA 4XQ9A 3T99A 1DG3A 1Z45A 2P2ZA 4WNCA 2FVYA 2FG5A 4CMIA 1B6GA 4OQLA 2QG6A 4OYRA 1CVRA 1UDBA 3JTEA 3MTEA 4QLOA 1G9TA 3VYRB 2XIJA 2Y1LA 4NARA 3T7EA 2C2BA 3AGQA 3Q6MA 4J7AA 2BZSA 1JHZA 4PG5A 4R05A 1XK7A 3KOWA 1O95D 5A4MS 3ZHTA 2NMVA 1T2EA 2X5JO 5HFJA 3UN1A 5K0NA 3PEYA 5K3BA 4M1EA 4Z1OA 5EJ4A 1EK5A 4Y8VA 4J2HA 1SKMA 1S3FA 3BSFA 2HBQA 2XVMA 4CLEA 2DKNA 4O3FA 4DIFA 3L1IA 3OQIB 3BSSA 4FONA 1T3LA 1DUSA 3O0DA 4AZWA 1TCVA 2CF5A 2FPOA 4I46A 5DM2A 1RQRA 2UUBB 4DHWA 3RRJA 2POQX 4QIHA 4IXWA 2B98A 1XA3A 1Q7EA 1X9GA 1UKVY 4BRWA 1J2TA 3VYTB 1U3VA 2I7CA 1HYGA 1YZNA 1FU7A 1VZ3A 2AVDA 4PLGA 2HFJA 3RWBA 5CBPA 4Z3OA 2IS2A 4BUZA 5M29A 1KKLA 5BRAA 4UJ3A 4IIHA 4Y9UA 1Z4IA 4KIJA 4YMGA 3V8MA 3TZHA 1E60A 4FMBB 4UE6A 4CHTA 3I8OA 1GZ5A 2WPDD 1HYQA 5G0WA 4UOEA 5A0TA 2BGKA 2C97A 4FYPA 3W4IA 4DSZA 2HWWA 4L2IB 4AG5A 1DJOA 4HDCA 4MQEA 1NMYA 1SB8A 3TW0A 3K70B 3H04A 4K2HA 3FJYA 4BLPA 4ML3A 4MIKA 2ET6A 3AV0B 3IVXA 5B36A 4P33A 1CQJA 1SU6A 2P2CA 1GR0A 4WCFB 2B2NA 5SZHB 1FFHA 3E18A 1JHOA 5FI1B 3LUAA 5CUQA 4ARCA 2BP7A 2EHJA 2H08A 1P1BA 4DS3A 2AN4A 1ZR2A 5J5CA 1N5LA 1T5LA 3UQZA 1SVUA 1PJLA 3TFWA 3UK0A 4RXUA 1EHCA 5DTJA 1ISSA 1GNSA 1P91A 2JASA 4MGHA 5C5EA 2QUBA 2OXCA 5BSUA 2VRWA 2XGOA 3G7NA 1YVUA 2IZ7A 1BWQA 3R77A 4XJVA 1JRLA 5FAXA 5FEMA 4OU5A 5HRAA 1IULA 1M2GA 3RI3A 4XYBA 3C3DA 5AJYA 4QSHA 3VPXA 2ZTUA 3KQLA 2A94A 3EBOA 1OV6A 2EOAA 2ZFUA 3JD4A 4U3JA 3BFPA 5TT1A 2A30A 1AQ6A 4KQCA 3RVSA 4FCTA 1KI3A 2D2VA 4K3VA 4BO8A 3LQKA 5H9VA 1G5TA 1N5MA 1EB8A 3ANYB 3LHKA 4KQWA 2XRFA 3MTGA 5DVZA 1PJCA 2X42A 3BN3A 3IVCA 4MI9A 4PYKA 2CDAA 3OM8A 1Z4MA 4OQZA 2TMDA 3WBJA 3FPFA 3NTOA 4EYQA 3W0LB 4IYRA 3A3OA 5C9ZA 4L5CA 1RCFA 1N3LA 1N8NA 1S8FA 3TQSA 1I7SB 1E5QA 2OORA 1Z6ZA 3U4GA 3ZI4A 4OMUA 5J2TA 4AKSA 3NASA 4D9HA 4DLVA 4RPCA 3HVRA 1T1JA 1KOLA 1JALA 3K9LA 3SZMA 4CKCB 2XSZA 3PDWA 4PLZA 4C20A 2XR1A 5KOJA 3AQIA 3Q7PA 4TQGA 3VV3A 5LQKA 2EWWA 1CRPA 4DM3A 3K0BA 1E2LA 1H69A 2HGSA 1Y5RA 2ONZA 1E6CA 4H59A 2AW3A 3QV2A 3ORSA 4XUDA 4RH3A 1LVGA 3H2SA 2D8MA 1HX7A 4KDCA 1C9MA 3IDFA 4MV4A 1AG9A 9LDTA 4JI0B 3ANLA 1EHIA 1OREA 2SNIE 3SVZA 5CAEB 1GFWA 3P7MA 1NX6A 3DLAA 4L8LA 2QQGA 1VCOA 2D3WA 3HY6A 2EGHA 3T8YA 1AKWA 3UWKA 2O2HA 3NRBA 1AUOA 4DLBA 2LIPA 4RS4A 1VE3A 5IBQA 4DJAA 2YWRA 1XQWA 3PTLA 1P4AA 2WVJA 5CYFA 1DOHA 3B7GA 3MSCA 5CBKA 1PEYA 2PY6A 3E15A 3PK0A 1U04A 2GA9A 1TA9A 1CS0A 4RSMA 4MV9A 3IXQA 3IJ5A 5BRNA 2AOTA 2P78A 3KYBA 4FFMA 2PQ6A 2QN1A 3OO0A 4LWPA 2O0JA 4M6WA 2P4SA 3TVDA 2K7FA 2O1WA 2EEPA 4MYUA 3IOCA 1IZ0A 4US0R 4X93A 1BDJA 5JYBA 2AMYA 1M5RA 1DIBA 5JRZA 1RP1A 1U2DA 3R3HA 1YR6A 4GRAA 1WZEA 1SY7A 3GZ4A 3B3AA 3PHBE 2KYRA 3BXGA 5G3YA 4F2DA 1SVIA 2OCBA 2BBSA 2PIAA 5HM8A 2C2GA 2ZIUB 3JQBA 3JQ6A 5GZ1A 1C0KA 2R48A 3STWA 4B48A 4DLLA 1A9PA 4AYTA 2MCFA 4J07A 4B87A 4JIMA 4YMHA 1JWBB 2CXQA 1R7RA 5H0IA 4AKIA 3UOGA 1LZKA 1THGA 3LLCA 3KV3O 4KPYA 1T34A 1P6XA 4KBFA 4OD0A 5IN4A 3VR4D 4XGIA 3OZGA 3GUCA 1UMCB 2HHHB 1BH6A 1VBFA 2A3RA 2QYOA 3TEJA 1VL8A 3CV3A 2QZJA 3NBAA 1W85A 2NZYA 2HM7A 2AZXA 2ZXEA 1Y1RA 3OT1B 4M0CA 4BQOA 2X40A 5LP6A 4REOA 4FIDA 3G2LA 3HNRA 2H48A 2WKPA 3ED5A 1XNQB 3N7AA 1KDVA 5C1PA 3NMUF 1GWNA 2D1QA 2PG3A 3A2MA 1AA6A 4G89A 5I7WA 5KQRA 1A72A 4J9UE 5CDFE 4TSFA 1G20A 3OUTA 2C5AA 3BGSA 1FBNA 1DWQA 1L5WA 4GPBA 4PRLA 4K86A 2QX7A 4ZA2A 3VZDA 1GZDA 4I4TB 1X86B 5FXMA 2R8OA 2NT3A 1K0UA 1YIDA 1ZCFA 1K7YA 1V95A 2IEZA 2OESA 3GLVA 3K1JA 2IRWA 3EMDA 5KAMA 1FJHA 1L7DA 3WNQA 5B2FA 1ZONA 3OKPA 2DTXA 3OQIA 3OC6A 2V9CA 3BXFA 3HEAA 3KP1A 4LGYA 4OI1A 3L84A 1WUHS 2WILA 3LBIA 1RWNA 4UUNA 1HDRA 1U7WA 2W5UA 4DUPA 2V5AA 5C3MA 2NO6A 5K4AA 1PZNA 1W1UA 1N2ZA 3U19A 1CZOA 1L4FA 2A57A 1M33A 3CN7A 3VR6H 4V1CB 2RJNA 5F7XA 2GAOA 4OYLA 5DCYA 4OATA 3TG8A 5BSMA 2XCTB 1YSCA 4BU0A 1FYEA 4XWAA 2G5CA 4TRJA 3H13A 1ML4A 2VJOA 4CT5A 3OIWA 3ZQ4A 3A37A 3IYLW 4M99A 4EPWA 5FLXA 1IN5A 2CXNA 2C0QA 4CIYA 1NHGA 4L2IA 1O4WA 3A25A 4TV9B 5EEHA 3JD3A 5C31A 4KRXA 2XODA 3A1FA 4P93A 1MB2A 4U2GA 5A6VA 3GHYA 3HKEB 3Q6IA 3WIVA 4WCFA 2PV0A 2PX0A 2HPHA 4LSWA 4LUCA 3E4CA 4OBBA 2EKBA 3ZX4A 1O6FA 2R751 4H4EA 4JIGA 2ZRAA 3VHRA 2HMUA 1N6HA 4EYGA 5H59A 1XU9A 3IBTA 3K9NA 3VKFA 4D2IA 2YWDA 4ZGBA 1MGPA 1UPCA 1WXEA 5FOUA 4OSPA 4F9TA 5EQDA 1X8JA 1BA2A 3LSYA 3TW6A 3TX2A 2H1HA 2JH3A 2PQ2A 1KI4A 3EVGA 4XUGB 4N76A 1QGDA 1DWPA 5FUVA 4U5QA 2Z4SA 1RJFA 2VHTA 2IW3A 2WT9A 3K6JA 5TPWB 2QVGA 2D1TA 4P7GA 1APBA 1Y5IA 4G4IA 3FNBA 4MP6A 2FPIB 1VJTA 3QTLA 2JDIA 5KKAA 4Q3NA 1E0SA 2R85A 3LHIA 4BX0A 1CUAA 3GO4A 3RYFB 4M46A 2RONA 1P1IA 4I4CA 2PGDA 1ECLA 4Q1DA 5J58A 3GRVA 2ZI5A 4MJ3A 4QRHA 3S8EA 1R5JA 1C3EA 3P32A 2MSLA 2BBOA 1LF5A 1CY8A 1V8DA 2NTEA 1KSFX 1SZJG 4AO7A 1U6JA 3D4LA 5HMMA 2BI4A 3UGTA 1KU0A 3IUEA 4GAEA 3K8QA 3V6MA