4JNKA

Lactate dehydrogenase a in complex with inhibitor compound 22
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
326
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARSRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of substituted 2-thio-6-oxo-1,6-dihydropyrimidines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
total genus 116
structure length 326
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jnkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4jnkA02
1XR3A 2E4AA 5I8WA 4RZHA 3DO5A 3ANMA 2V6FA 3ROPA 3JQGA 2YUTA 5TIIA 3N74A 1LDMA 3DAFA 4GPD1 3LC7O 5EINA 1X0XA 1XHLA 3ANNA 5IN5A 1FJHA 5F5LA 2GYYA 4EEXA 1YB5A 1P3DA 4RPKA 4FFOA 2QRKA 4RF5A 2Y0DA 3CEAA 1KVSA 1PWXA 1ZXLA 3GC6A 3PK0A 5I7FA 3CUKA 2FZEA 4XA8A 3ADPA 4JGBA 1ZW1A 2Y0EA 5B1YA 4CUKA 5CG2A 1X13A 2DTXA 5JDIC 1ZK0A 5HTOA 4JP2A 1VKOA 3VZPA 1ZUD1 4NU6A 5A5EA 3W8DA 2O3TA 3W6UA 4L73A 1NHWA 3C1TA 4MKXA 4DIBA 1TXGA 5MDHA 2UYYA 1GV1A 3L6EA 4N18A 1WW8A 2PD6A 2Y68A 2GD1O 2CUKA 5G0UA 3PLNA 2EKQA 5I7EA 4BO3A 5JSFA 3E18A 2X9GA 4FBGA 5EQDA 1CYDA 5TT0A 1MX3A 3QVXA 3RUFA 4F6LA 3TOZA 1M2WA 5BSHA 3JSAA 2CSUA 4II3A 4CM1A 1DLJA 4O1MA 3RJ9A 4XIYA 1HZZA 4DUPA 2B35A 1DAOA 2I66A 3LT2A 3JQAD 2Y93A 1LXCA 1U28A 1ENZA 1E77A 1SPXA 3MJ4A 1E6WA 4O5OA 1T25A 2UV8A 3FTNA 1E5LA 1SNYA 1XG5A 2AEJA 2X5KO 2ZYAA 2HAEA 2NVBA 4BKOA 5KVSA 1ID1A 1E1NA 3WNQA 3PIDA 2YFQA 2BGMA 3F1KA 3G79A 3PGJA 5A5FA 5JFOA 5KIAA 1HDZA 1V0JA 5JXWA 2FSVA 1UUFA 1OFGA 1YXMA 3LYLA 1U2GA 4E2ZA 4IDDA 1ZFNA 4DC1A 1RWBA 4YJDA 1DC6A 2EKPA 3ZU2A 4JROA 4C7KA 3JQAA 2CVOA 2XXJA 3O9ZA 1Q2XA 4JIGA 4BNKA 4DBVO 5A02A 3Q9UA 1DIRA 1VL0A 1U3VA 4IBOA 2IZ1A 2BI8A 4BMNA 1PGJA 3G1TA 4PG4A 4ND2A 1QYWA 5GZ3A 4CL8A 1MFPA 3F1LA 4PVCA 3K6JA 4DLBA 2X6TA 1TT7A 4MINA 1B2LA 3VH2A 3TF5A 5AVOA 2NWQA 5TNXA 1QYXA 3PDUA 3CE6A 5KJCA 1HE4A 1OC2A 3Q2IA 3T4XA 4PG8A 3I52A 4HXYA 1YJQA 2V7PA 1YOVB 1OAAA 1I36A 2PV7A 4JJIA 4PG5A 1Y9EA 3AI3A 1GTMA 3I6IA 3DBLB 4N5NA 2IEBA 4J7CA 5IDXA 3PQEA 1YL7A 2Y1FA 3MZ0A 4B4VA 3ONDA 4DMMA 2C7VA 3DZKA 3JQDA 2Y99A 4IIUA 3ZW8A 1ZEJA 3FPLA 4MPDA 1X0VA 3AM3A 4OQZA 1LDEA 4HV4A 3I9KA 1DIAA 4XYMA 4I9HA 1DHTA 1OOEA 1DC4A 3UFXA 1Q0QA 3NGXA 3NT4A 3WGYA 1JQBA 4OH1A 1Q0HA 2BFOA 3R3JA 4GVLA 4A03A 5KJ1A 3H2ZA 1KEPA 2YQ5A 9LDTA 3WBFA 1E1MA 3I9OA 1KOLA 1E3SA 4OKNA 2POQX 2A9FA 2J6IA 5HA5A 4KUEA 3RU9A 1WPQA 1PZFA 5JO9A 1ZNQO 4XJTA 1LSSA 5IDQA 1UP4A 1K0UA 3FNHA 3IOYA 3E9NA 3M6IA 4R4JA 1TI7A 2YDXA 3E82A 2NV6A 1LRKA 4Q3CA 3TRIA 5CG1A 3H9EO 3E5RA 4EI2A 4BIIA 5IXSA 1QKIA 4U0KA 5JAZA 2I3GA 3ZH2A 1FDWA 4Y67A 1UH5A 1FDUA 4I9NA 3QE3A 4FFMA 2DU8A 5I7SA 2OZPA 3SC6A 2EJWA 4S3MA 4LMPA 2X7HA 4XGIA 4RDHA 5U1PA 3BMCA 1ENOA 3AOGA 1N1EA 4URFA 4CMAA 1N5DA 4R9SA 1KEWA 4LCEA 2C2YA 5DDIP 4IXWA 2W90A 2D1YA 2H6EA 4MVJA 1KVQA 5A9SB 4GLOA 4IDCA 3RBZA 1JTVA 3QVSA 5I7VA 3KLPX 3TWOA 3GEGA 5ILGA 3UKOA 2C82A 4F45A 4I5GA 2SCUA 3OEYA 3H5AA 1HEUA 3ASUA 3OJFA 5TJ9A 3I9NA 4AL4A 1E7QA 4A10A 1T2FA 1DFHA 1J4AA 1AUPA 2QZZA 2HO5A 3H5RA 1GZ6A 1XU7A 4A0SA 3VKVA 4GQAA 5H83A 1G0OA 2O7SA 4LSMA 1P1KA 4CODB 1GU7A 3EK2A 3VPGA 2X5JO 1F06A 1GZ3A 1O5IA 2XOXA 3C85A 3Q6IA 5HBRA 4AJEA 1Z73A 4I5DA 5G2OA 2CDBA 3BTUA 3PJEA 3ORFA 5ILOA 3WX0A 1H93A 5G4KB 5BNIA 2XF8A 1KC1A 2O23A 4P38A 4XEHA 1U3TA 2D59A 4IXTA 3DMTA 4RCVA 3CZMA 2HK8A 1XGKA 2VNAA 1JU9A 1NPYA 1EE2A 5JS6A 5L4NA 2HMUA 8ADHA 2JL1A 5HWSA 1YONA 4XQ9A 1HYHA 1ZJZA 3CINA 2J5RA 3DAGA 1PGOA 2GRAA 2DQ4A 1GEEA 3DBVO 4HFNA 2QX7A 1YO6A 2X0RA 3WMXA 4YAKA 1GAEO 3OIGA 2EW2A 4YAEA 1F12A 3NJ8A 4YAGA 4YT8A 4XQCA 5DZSA 3G1UA 1XSEA 3L77A 1TT5B 2FR0A 3FPCA 3MTGA 1C14A 4N7RA 3V1YA 1Q0LA 2YQ4A 1ZKMA 3L0DA 1SEVA 4QECA 1DRVA 1KY4A 1H2HA 1WZIA 3OM9A 1PJTA 3PWSA 3MJSA 4RGBA 6ADHA 1DJQA 2VWQA 1PJCA 4RQTA 4BNLA 4OXNA 1XU9A 1VI2A 2IYPA 2X8LA 4AVYA 3PFWO 5F1KA 1C0KA 3UHAA 2Q1WA 2JAPA 3QWHA 3RJ5A 2J3KA 1CEQA 5HM8A 3GEMA 3WWYA 2FR1A 3EDMA 4M55A 3JQBC 5DULA 5FI3A 4WCFA 5GZ6A 3ZGYA 3H9GA 5L4SA 3N7UA 4CQLB 4M49A 5JDCA 3DZJA 1ISJA 1O95A 1I24A 3CZRA 4GI2A 1XWFA 4J0FA 4UUMA 4E30A 2W2LD 3TSCA 5IN4A 4W9NC 3TDKA 1PQWA 2VCYA 4HFRA 4BMSA 1ISFA 2GN6A 1R37A 2WYVA 2IEDA 2ZTMA 4RVSA 7MDHA 1LU9A 4YJGB 1QSGA 4PCVA 4DTIA 5IXYA 4J4HA 4K6FA 1EUCA 1NHGA 2D8AA 4YT4A 4CLEA 1K89A 4CMKA 4BOYA 1GEGA 1NP3A 1EK5A 3AUSA 4CLHA 2V6BA 2P91A 4B79A 5KOIA 3ZWMA 3AY3A 3FD8A 5F1PA 3ZWOA 4CM8A 4NJOA 1W6UA 1YOVA 2OO5A 4WECA 3COSA 5F1OA 3VVBA 3INTA 1DIGA 3AY7A 1HRDA 4RV9A 4ZRMA 2NU7A 2Y05A 3BTVA 4O0LA 2PZJA 3WJ7A 2PA3A 3JQGB 2VYVD 3F3SA 3RASA 1YWGO 4AJKA 2O2YA 1HYGA 3I83A 1BVUA 3E5MA 4ALKA 1LBEA 3U4IA 3BXXA 1IZ9A 5FWNA 1ZK3A 2JCYA 3ETEA 4HWKA 3WFIA 1TB4A 4LCJA 3EYWA 1GCOA 4R5HA 4RF3A 4INAA 1UZNA 3D4NA 3EGOA 1KBZA 1WDLA 4JN6B 3NRCA 4BV9A 1ZSNA 4GGPA 1YQDA 2YHIA 1P1RA 4MP6A 2W4QA 2HKIA 5JDIA 4MO2A 3RSHA 1C0IA 1RM5A 3BYZA 3UUWA 4M8SA 1Y81A 3KSZO 2GLXA 4R16A 4E3ZA 2FP4A 4FS3A 2ZJ1A 3O8QB 4PZDA 4EZBA 3EMKA 3BMCB 3ZHBA 3GFGA 4BKPA 4ZQEA 2DPHA 5C37A 3PXXA 4LVCA 2BRUA 3WSVA 4LISA 4RLHA 2VT2A 2D5CA 5EQFA 5KKAA 5JPIA 2H1SA 5BNTA 4E13A 1PZEA 4DC0A 2ZJ0A 3K5PA 1B26A 2AQHA 4MVJD 5G0WA 1D1SA 4ZA2A 4DIFA 5JC8A 3QLJA 2Q50A 3NTOA 4DXHA 5TQVA 3GRPA 3PZBA 2O48X 5B4UA 4D46A 3JQ7A 4FD3A 4IQ0A 1HE5A 2X0NA 5IDYA 4B7XA 3GMDA 3WGIA 3DAPA 3QHAA 4DWVA 4R1UA 5L4LA 3KLMX 5G4LA 3MWDB 5L7WA 4MDHA 2DM6A 5BSFA 4CLDA 3BHJA 3DR3A 1BGVA 3DMTC 3RROA 4OM8A 3AI2A 4MIYA 3EC7A 1VL8A 3RI3A 2AEFA 3C7AA 3RC7A 1DHRA 2JHFA 4CMJA 2ZB4A 3D4PA 4DLAA 1J6UA 3QVWA 4NNJA 4A5OA 1IY8A 4FW8A 2G5CA 4YBZA 3HHPA 3HUDA 4LMRA 4AJ4A 1GL3A 2P5YA 3E9MA 4PVDA 3I9MA 4AJLA 5IJZA 1QLJA 5EESA 1CDOA 1R0KA 4CMCA 1IUKA 1M67A 1PS0A 2IZ0A 1UXJA 2FOIA 4TRJA 3IP1A 4XQEA 4P22A 4ND3A 4DYVA 2ZQZA 5HS6A 3TL2A 3BAZA 2P2SA 4BGVA 3R1IA 4YQYA 3PYLA 1E6EA 4KP7A 2GN4A 2OP0A 4O6VA 5JY6A 1GUZA 2HMVA 1EEHA 2AG8A 2TMGA 4CPDA 4OGWA 4IGFA 1A7KA 1VSVA 4UVGA 3IS3A 4ONEA 2VTDA 3O03A 4JBIA 3DHYA 3RD5A 4ILKA 3VPSA 2DC1A 4IJUA 1PL6A 1GR0A 4JJGA 4D3SA 3ZHZA 4DGSA 1TA4A 2G1UA 4XDZA 3ZV6A 1KIFA 3G0OA 2PR2A 2Q1SA 3ICCA 1Y8QB 3JV7A 1UAGA 3U0BA 3UCXA 2PH3A 4PLWA 3PPIA 4BV8A 1IPEA 4F3YA 2X23A 4NH4A 4K6CA 4QEDA 4WLNA 2NTNA 2Z5LA 2O3UA 3GR6A 3PFFA 1QYDA 5CPBA 1SCUA 2DBRA 4HP8A 1BSVA 4FOOA 1NAHA 1T2CA 4YAIA 2FMUA 1LA2A 2NNLD 3H7AA 3JTMA 3RC9A 5K0ZA 1GCUA 5AXAA 1N2SA 4Z0PA 1I33A 2PGJA 3OFSA 2V6MA 2Y1GA 4HNHA 5JAMA 4XIJA 4U6SA 2AE2A 4MVJP 4PZCA 5DNAA 4R69A 1VC2A 2P5UA 2IODA 4UUOA 3ZI0A 1PGNA 3KRTA 3E6AA 1OBFO 1DEHA 4AJNA 1IZ0A 5DCYA 2RAFA 1I3NA 4YTEA 4KUHA 4B3HA 4R51A 3IUSA 1MV8A 3WYCA 1YL6A 3BTSA 1UZLA 2Y1EA 4GX0A 3OEWA 1MP0A 4K28A 2OBNA 1KETA 3JQEA 3PWZA 1D4FA 2VUUA 4II2A 1T2DA 3DZHA 3JD4A 4BKRA 3PRJA 4J9UE 1U4OA 3NEPX 4PG6A 5CDUA 1ZJYA 4IDBA 4DMLA 1EQ2A 4B4UA 4D3FA 3TZKA 1AE1A 4CLOB 3JYOA 1HDYA 4LW8A 4CLXA 4BNGA 3HJAA 4NPCA 4L76A 1ZMOA 4WLEA 1HT0A 1O9BA 1ADBA 2B0JA 3ZWNA 3V2HA 1EDOA 4RVFA 4CM8B 4EITA 3ZV4A 3WTBA 2JCXA 1ADGA 2GZ1A 3V2GA 4Y6SA 5TRTA 3E1KA 5FF9A 1XCBA 1YDEA 4J7XA 4R54A 2DAPA 3DFUA 4CMEC 1T2EA 1LNQA 1E1LA 1N7GA 3DBRA 3Q2KA 3T7EA 1J49A 2WD8A 1H2BA 4BB6A 5HRUA 1QV6A 4EJMA 2OGUA 3O8QA 1UXIA 5KJ6A 4R1NA 4CQMA 2YFHA 4J4TA 1UAYA 2ZB3A 3DHEA 2Q99A 5H82A 4CM4B 2WM3A 5DP1A 4J0EA 3R3SA 3NV9A 3PQFA 3RU7A 1B3RA 1PIWA 1P1FA 4J1TA 3FBGA 2G0TA 3JD1A 2GCGA 3SVTA 4XJSA 1DAPA 3WGGA 2AQIA 2Q46A 3GA0A 4JBGA 5G0SA 1U8FO 3KM0A 5KVCA 1H6DA 3FHLA 1AHHA 1MC5A 3LF1A 3K8ZA 2W8ZA 1YKFA 4EEZA 3Q3CA 2ZTLA 4JCOA 3A4VA 3TQHA 1Y9AA 2ZK7A 4BNVA 2BF7A 3B20A 4QFDA 3G49A 2GN8A 5AOVA 3AOEA 1TVEA 1I2ZA 1Z6ZA 1JAYA 4CMIB 3H65A 1MGOA 3GUCA 1BMDA 5BNFA 2ZQYA 1RJWA 1C1DA 2GZ3A 3WJAA 1PGQA 4NBTA 4WCFB 5TJHA 2C0CA 4MVJH 2F00A 2IDZA 5JW6A 2GPTA 3LVFO 3DEYX 4BO2A 3BMNA 3GY0A 2P4HX 2W2KB 4J90A 3PYMA 3L4BC 1CQIA 2XXBA 1S6YA 2OFPA 4BGIA 4UREA 5FYDA 3RVDA 1M6WA 3HFGA 5L9AA 3DMYA 5C3MA 4E4YA 2JFHA 3EZYA 1R16A 3PJFA 5DOZA 4XX0A 2C07A 3WQRA 3KZVA 4E33A 3PGXA 4FFRA 4TRMA 5LDHA 1DBVO 2J3JA 3HDJA 4YWJA 2EWMA 2WJPA 2CFCA 3U49A 1K6IA 1UJMA 5B12A 1ISIA 4UEJA 7ADHA 3NDJA 2IRWA 4Q3AA 4W7HA 2W98A 1H6BA 4YRDA 3GDGA 4ZN6A 3VDRA 2VWGA 4LN1A 2ZCVA 4E2XA 1GQQA 1X14A 2HRZA 3NDIA 4BHTA 4RVGA 5KCZA 5HS4A 1HKUA 2AA3A 1Q7CA 1YVEI 2NSDA 2Q49A 1H6CA 1U7HA 4NBRA 4WOJA 4WUVA 5F3RA 2YYYA 1JW9B 1LC3A 2VRBA 3DBHB 5COQA 3O38A 4FR5A 4G81A 3GVXA 3LT4A 1NYTA 2UAGA 4P4NA 5CDSA 3NKLA 4Z3DA 1GUFA 4QSMA 4XCVA 2Q45A 4D45A 2I5PO 5THKA 4FJ2A 3RFTA 3L9WA 2JD0A 4W9NA 5LDGA 3WLEA 4J16A 3ZWCA 1IOLA 2F1KA 2D3TA 2C54A 3W4KA 4CM7A 3BMOA 1NNUA 4GKBA 1P33A 3CPSA 5IZCC 1YE3A 1R4MB 4EYEA 1Q7BA 2YV1A 3I9LA 4YB8A 2NVUB 3ZWWA 3TPCA 1QRRA 3KSUA 4ZVVA 5L7YA 4OSOA 3ETGA 1VJTA 1ISMA 1AXEA 1PR3A 3OIFA 2C5EA 3EAGA 4TQGA 3RUCA 1MG5A 4GKVA 4Y8VA 1T26A 3WTCA 1SB8A 3R6DA 5CP8A 4DA9A 3KV3O 4NJMA 4MVJM 1VRWA 4MVJF 2YDYA 4ZQFA 4UUPA 2BFAA 4PN3A 1YBAA 3Q0EA 4IJWA 3JQ8A 1E6UA 2FHSA 3L6DA 1HE2A 4IINA 5FEUA 3CIFA 1A71A 4J2HA 2OP1A 2BH9A 2WTBA 4WLVA 4L74A 1UDCA 1Q7GA 1YB1A 5F5NA 4Y98A 2X86A 1GFSA 2PFGA 2OUIA 4BO9A 4N5LA 3A1NA 4UEKA 4WASA 1B0AA 2UDPA 3GRKA 1SC6A 2B37A 3AUTA 4J4BA 3S8MA 3D0OA 4B7UA 4CMEA 1KVTA 4AJHA 4EBFA 1PJBA 3PHLA 2CD9A 5JLAA 4N5MA 3RQSA 1DIHA 3KXDA 3GN1A 4QO7A 2I99A 3PHGA 3TL3A 3WWZA 2PWZA 1KC3A 1KVRA 4Z6KA 3STHA 2FPPA 1Z74A 2EGGA 3NT5A 4YR9A 4PLHA 4PGFA 1JVBA 3X2EA 2J3HA 4R3NA 3KUXA 3C1OA 5EJ2A 1T1RA 3M1LA 1HWYA 8LDHA 4TROA 1PL8A 5C7LO 4FFNA 4J2OA 4RF2A 4DQVA 4NBUA 4LRSB 2GNAA 3A9WA 4YYZA 4YACA 1G6KA 3BZUA 2EEZA 3ENNA 1W0CA 1NTOA 2Q2VA 4C4OA 1E7YA 4YDRA 5KNLA 4ZICA 3QJ5A 4QQRA 1E7WA 1F14A 3B1KA 3GNSA 1PSDA 1BDMA 1E92A 4QUKA 1LSOA 1XQ6A 1Y7TA 3OSUA 3ROQA 3WGTA 2O3RA 3CMMA 3I4CA 4CR7A 3ZW9A 5A05A 3RCBA 3HDQA 4LSWA 2NU9A 1NVTA 4KDEA 4CUJA 1RYEA 1A9ZA 1R12A 1GDHA 2AMFA 3DONA 1PX0A 1ADFA 3A06A 3RUAA 3LT0A 5DCWA 4B4WA 5A06A 4Z9XA 3LSYA 1HSOA 1P0CA 5L45A 3OMLA 3ZWYA 1L1FA 4ITUA 1P45A 3V2UA 4PG7A 3E03A 4UAGA 3BMNB 1A72A 3M1AA 4PFJA 5IAAA 3IKVA 2BGKA 1CF2O 2TMDA 1NQOA 1K6JA 2AQKA 4RPLA 1AXGA 1F17A 2FPIA 1NASA 3K30A 5T64A 1I10A 1U4SA 2WYUA 4MOWA 3ASVA 1FDSA 1NX6A 4E31A 2LDXA 4XRRA 2DFDA 2PZMA 1NWHA 1B8PA 2C29D 3H6KA 1MFZA 1O8CA 1BXGA 5IG2A 1LDYA 1IHYA 4G5HA 2Z95A 4MVJG 3TJRA 3GN2A 5CEFA 2VQ3A 3JQAB 2DBZA 4CJXA 1GV0A 2DBQA 4WCFC 1I5RA 3F5SA 4WPGA 3Q11A 1IULA 4XRGA 4RL6A 1EVIA 1RM3A 4RPJA 3OA2A 3OHSX 1RYDA 4YJHB 3W8EA 1DXYA 4L4SA 4DPKA 3AI1A 1NPTO 3INRA 3S1LA 3TFQA 3CH6A 5I8ZA 2X9VA 1VL6A 1U7TA 4CQLA 4IS2A 4RORA 1ZBQA 3DZFA 1E3WA 3GG2A 5IF3A 2QRLA 3QRWA 2XPCA 3NT2A 3RC1A 1HF3A 2H5LA 4TZTA 4JXKA 4YJHA 1EK6A 3KHUA 3S2FA 3TZHA 2Q4EA 3WYEA 4FC7A 1C0PA 3HG7A 4P8RA 4BGUA 5BQFA 1JDJA 4CL3A 1I3LA 3E8XA 4Y9DA 1DPGA 3OA0A 4E6PA 1XEAA 3P5SA 4K9DA 3WGZA 4AJOA 3BMQB 1H9BA 2WD7B 2DKNA 1U5CA 3TZQA 4HUJA 3T4EA 4H15A 5T67A 3U09A 2NADA 5IZCA 1LC0A 1ULSA 2DT5A 1GY8A 5GZ1A 1DRWA 5JYEA 2I9PA 2E82A 3RFXA 1ZXBA 4E5KA 1VPDA 1N1GA 2JFGA 3ULKA 1E3JA 1Y6JA 5ITVA 2EXXA 1PJ4A 5DBIA 3GGGA 3JQ9A 3TOXA 1PQPA 2NLOA 3NDRA 3DBHA 2DFVA 3NX4A 5A04A 1I01A 3KBOA 3JD0A 5DF1A 2VWPA 3DZIA 3H8VA 4BO5A 3DOCA 1GZ4A 1Y5RA 4U5QA 1LDNA 4UULA 4BNHA 2CF5A 4YJFA 4E5YA 5AQ1A 3H4VA 4QTZA 4GMGA 2GERA 2YHUA 4TMFA 1CETA 1PJ2A 1ISGA 4I5FA 1PTJA 2I76A 3SXPA 3VPFA 2J3IA 4EW6A 4YRAA 2ZB7A 5LC1A 5TT1A 3JQ8B 3E9QA 1QP8A 1I2BA 1KEVA 1XYGA 4H16A 3U5TA 2ZYGA 2B4RO 1EFLA 3ZWXA 3ZNOA 2GGSA 1GADO 1QXSA 3I9JA 4ZQGA 3HN2A 2ZTUA 2RHRA 3IKTA 1LLQA 5BSEA 4HNGA 1KEUA 2P4QA 3D3WB 1GD1O 1GYQA 1HE3A 3C7DB 1E3EA 6LDHA 4L4RA 4DRYA 3WIEA 1DB3A 2R00A 2B5VA 1I2CA 4D7AA 1Z75A 2AE1A 4WJZA 3CKYA 1ZK2A 1WLYA 2VOEA 2P9GA 4JP3A 4GMFA 1VJ1A 1HLPA 3NTQA 3DQPA 3VVCA 1X7HA 5FI5A 3JQ6A 5L3ZA 5U9CA 3IMFA 3MWEB 3WIDA 3JQ9C 2P9EA 2CNBA 3Q9NA 4NQZA 4U8GA 4YT5A 3WICA 3LK7A 2RHCA 3JQ7B 4BNMA 4CR6A 4MP3A 4R9RA 1M66A 4JX8A 4R1SA 3QVOA 5G4KA 4RPHA 1P1HA 3H9QA 2NACA 4BO8A 2VUTA 5ENDA 5ICSA 5JCJD 1HL3A 1YBMA 3PHJA 4XR4A 2Q1TA 2EGHA 4DQXA 1J0XO 5L95A 2V65A 4D44A 2Q3EA 3BTOA 3C7CB 1CQJA 1D8AA 3FCOA 2DTDA 1OZAA 1ZSVA 2VHYA 3FWNA 2X4GA 3IUPA 3UGKA 1H9AA 4CV1A 5FFFA 4CMGA 3WGOA 4BB5A 3KB6A 3HQ4O 5K6AA 5DCUA 1AHIA 1OI7A 1V9LA 3ZU4A 2HDHA 2CVQA 3EUWA 2PZKA 3L9XA 5C5IA 3SC4A 4RF4A 4OJNA 3JQFA 4PLGA 1K5HA 4BO6A 2GSDA 5B4VA 1GYRA 4R68A 2G82A 3ZHXA 1R4NA 4J43A 1GYPA 2HK7A 2HU2A 4UVEA 5T8KC 5JDCC 2OL4A 3UCFA 5CAEA 1WDMA 2J8ZA 1PWZA 1NVMB 2QW8A 4FN4A 1XIVA 1MLDA 4OSPA 1UXKA 3LF2A 4WCDA 4J1NA 1R4NB 3QA9A 1E7RA 4WGGA 3U3XA 4CLRA 4BNNA 1NPDA 1UZMA 1DJNA 1D3AA 4GL4A 1X7DA 1E5QA 1UXHA 1W73A 1WVGA 3WR5A 4BNWA 2GO1A 3MJCA 1YQGA 3PP8A 4KQXA 1R66A 4OMUA 4WLOA 3WSWA 3UICA 4D79A 4MIOA 1IE3A 4AJJA 4FB5A 2R2GA 4NHEA 4CLRB 1BXGB 4RJTA 4IQ8A 3PVZA 2AEMA 2P68A 3CXRA 1YH3A 4F6CA 1U1IA 3B70A 1SMKA 3OBBA 4E5MA 4NFHA 9LDBA 3WB9A 3WFJA 1BXKA 4IJKA 3AUUA 2JKVA 4KWIA 4NJMB 3SJUA 3MTJA 3NGLA 4OO3A 1EMDA 2X0IA 1O0SA 3ZHYA 2V6GA 3H3FA 3JD3A 4BNJA 3H9JA 2O3QA 2ZIZA 3F47A 1HLDA 1DFGA 3WG9A 1K6XA 1O89A 4BO4A 2HK9A 3QP9A 4DVJA 1L7EA 1T4BA 1T4DA 1I3MA 1DLIA 3KSDO 1KERA 5KJFA 4E2YA 4UVHA 4MKZA 3IL2A 2EG9A 4G2NA 1T24A 1Z7BA 3D64A 1IL0A 4HADA 2VOJA 4XB2A 1P1JA 3HB5X 4IS3A 3B1JA 1Z45A 3E48A 4CR8A 1HTBA 2YV3A 3QVTA 4XDYA 1QLHA 4JK3A 2JD2A 3RUHA 1E0DA 5IZ4A 4EJ0A 2CVZA 2BD0A 3W8FA 2HRBA 1SBYA 4OXYA 3PWKA 5JAIA 1R0LA 3WS7A 5CDYA 1I32A 2LDBA 4XWYA 2DUUA 1M76A 1ZVMA 3SEFA 1H6AA 3KTDA 1ONNA 2GN9A 5L53A 3ZU5A 3ROKA 3DBRB 2DVMA 3EHEA 4ZRNA 1FDTA 4FIZA 4WLFA 4OYRA 4IDEA 1V6AA 4B8ZA 4Q9NA 2WMDA 1HDGO 2NUAA 1EVJA 1DDOA 4YJFB 1B15A 4JLWA 4Z9FA 1V35A 2EF1A 3A14A 2DBVO 3P2OA 3PJDA 3VTFA 1LI4A 2BLLA 2O50A 4TWRA 4F46A 4L4XA 4E5NA 4KDFA 4HKTA 1Y5MA 3SJ7A 3TFOA 3MJTA 2FSSA 1QORA 1V3VA 2FWMX 5TC4A 3U4HA 2Y1DA 3AW9A 3N58A 4RVHA 5CEEA 1B16A 2ZYDA 5ENVA 2NQ8A 4GGOA 2NU8A 1EFKA 4FJ0A 4UVDA 3GPDG 2PGLA 3F4LA 5B37A 4N54A 4PLCA 1ENYA 3O4RA 2NVWA 4PLVA 4LGVA 3M2TA 3PHHA 4J91A 1NQTA 5T57A 3O26A 1VM6A 5JC1A 1ZO8A 3D3WA 1A27A 3UCEA 1PL7A 4ROSA 2YY7A 4CM4A 1CJCA 1MC4A 2C20A 4XYEA 4D0SA 3F5QA 3G17A 1JWAB 2X0JA 1C1DB 3IJRA 3V5NA 4ZGWA 1X15A 4M54A 1HYEA 2EV9A 4FC6A 3M2PA 4GVXA 1HXHA 4RVDA 1V3TA 1SB9A 3B1FA 3WQQA 1EBFA 4Z9YA 4ND1A 1YRLA 4BNFA 4KQWA 3WGHA 3C1AA 4GWGA 3EVTA 3OQBA 5K9ZA 4CM9D 3H9UA 1E7MA 5BT9A 1Y1PA 4IZHA 2Y1OA 1LQTA 3L07A 1D1TA 4PLZA 4DL9A 4K1LA 2WYWA 2D4AA 4U0JA 1A9YA 1P9LA 2NU6A 2VNSA 3VH1A 4DBZA 4QT0A 5H81A 3KETA 2ILTA 4CMIA 5EMHA 2WE7A 4AJ1A 3U9LA 4CM3A 3OIDA 5LCXA 3TZ6A 3U4DA 3INGA 3F4BA 4KTVE 1CRWG 1Z82A 1DFIA 3GHHA 2D2IA 2IXAA 2NQTA 5EPOA 4M1QA 1LLDA 3U4CA 1YL5A 3OJEA 4FDAA 3JQBA 3GQVA 1R0SA 4TVBA 5TGDA 3GZ4A 3LDHA 2BFMA 2NM0A 1N7HA 3DWFA 3QWBA 1T2AA 4PIVA 2RH8A 1UDAA 4KOAA 3ZWBA 4EUHA 3HWRA 3JYNA 2AG5A 2Y0CA 2PD3A 2QIOA 2VHXA 4Q3EA 3GAFA 2FY8A 5JBIA 1LX6A 1EVZA 4W4TA 1U9JA 2A35A 2A4KA 1PQUA 1A4UA 2FPGA 3HFSA 4WEOA 4E2WA 3PQDA 1X7GA 3GDFA 3GLQA 3QWFA 5DBGA 5JCXA 3GH3A 5MGBA 3ST7A 1N9GA 5U4QA 5A1TA 5ER9A 3S2IA 1XKQA 2YV2A 4MVJE 3S2GA 2C5AA 4R1TA 3PZRA 2B36A 2E37A 5A4DA 1E1KA 4FFPA 1T1SA 3SLGA 1JVSA 1LLCA 2EP5A 4WNCA 4CQMD 2YZ7A 1UP6A 4GX2A 4ZHSA 3GOHA 1RM0A 3K96A 1ZMTA 3FNGA 4DQUA 1E3IA 3HDHA 3OJOA 3WXBA 3KVOA 4CV3A 3DZGA 1NAIA 1ARZA 1IYZA 4TRNA 4D41A 1YQXA 4A7PA 4PZEA 1D7OA 1EE9A 4WE3A 3VH4A 1E7SA 2P9CA 4NBWA 1VKNA 3RKUA 2OHXA 3K9QO 4TKMA 4WOKA 3H5NA 3WLFA 5COBA 1ENPA 1ORRA 3PTZA 2FN7A 3JQCA 1NFFA 5JMPA 4YCAA 4AICA 3VTZA 4QX6A 3LLSA 4CM5A 2B4QA 3RUIA 1X1EA 4Z0HO 4WEQA 3DZBA 4GWKA 3MOIA 1GPDG 1LSJA 2O4CA 3ROMA 3LZ6A 3JYPA 4BL5A 1G1AA 4WLUA 3RIHA 4B7CA 1ZK4A 2O3JA 4YPOA 1PU2A 3FF4A 4A73A 4ZJUA 2WEKA 1H94A 2PNFA 1B8VA 3IQDB 5TS3A 1HDCA 1RPNA 4RO0A 4J7UA 3RWBA 4FQ8A 4J9VA 4Z3KA 4A27A 3WQSB 4P4LA 4XKJA 1WMBA 4M86A 5ICMA 4QFCA 4E21A 1AGNA 3H2SA 3S55A 4GLLA 2I67A 2IXBA 2PKQP 2PY6A 3L6OO 4FOSA 4NI5A 1WXDA 2Y67A 3LLVA 4KMSA 4CLOA 1PGPA 2PGDA 3GT0A 4L0QA 4D0RA 5AYVA 3D5QA 4AJ2A 3OETA 2B83A 5A3JA 5THQA 1KYQA 3GGOA 4OOFA 4LK3A 2BI7A 4YRBA 3SBOA 1LSUA 4CM6A 4ID9A 4R41A 1I0ZA 1YGYA 1EUDA 2Q4BA 5AXDA 3MOGA 4ALLA 5CFZA 4CUZA 1DC5A 1CWUA 1PZGA 3IIEA 4WK6A 1C3VA 3DOJA 5I9MA 1IHXA 3GF4A 4X54A 4Q3BA 3VHRA 1W4ZA 5CPFA 1EBUA 2QYSA 2CDAA 2CDCA 3D5TA 4JJFA 1ZCJA 4BKUA 1ZH8A 1PS8A 4CQMB 2ZTVA 2R6JA 4OIMA 2VWHA 2NTJA 4BNUA 1LEHA 1NFQA 3C3XA 4BGEA 4BQPA 5A9RA 2ZATA 3GZNA 5DBFA 4OQYA 1SZJG 1UXGA 3AK4A 4B3JA 4TRRA 2B4TO 3ZCXA 3I1JA 1LDGA 3HADA 4XD2A 3WGQA 4ALJA 3ZWVA 1BWSA 3BIOA 4HBGA 3EVNA 4GH5A 4BUCA 4NBVA 1EUZA 2X58A 3VZQA 3FR7A 4EGFA 3ETDA 1ZIDA 3KEQA 2BKAA 2QHXA 2VYVA 4RPGA 1XELA 4DPLA 2ET6A 3QQPA 4ZU3A 3DFZA 1FDVA 1P77A 4U7WA 3UXYA 1I8TA 4ALNA 5ADHA 3UW3A 3K2EA 3VZSA 4B3IA 2JJYA 5EERA 2Q2QA 3RUEA 4B4OA 4IMRA 1JKJA 2VRCD 1PJQA 4ZQHA 2EP7A 3ITDA 1JN0A 3B6ZA 3DC2A 1NBOA 1X1TA 3GMSA 4FPXA 3KYDA 4HFJA 4CM9A 1SOVA 3AUAA 1MXFA 4KWHA 1N8KA 1R15A 4MP8A 1PEDA 2AQ8A 2GUGA 1H0KA 1I3KA 1K2WA 3ABIA 3OJLA 5G0VA 4CMBA 2DTEA 4FGWA 1ADCA 3FRJA 1ZSYA 4FCCA 2JFFA 3KYDB 3QW2A 1C1XB 4KUGA 5F21A 5BR7A 2VUSA 4NMHA 4S1VA 1F0YA 5DN9A 1E3LA 2AW5A 3C24A 4XQGA 3I23A 1R6DA 3MCVA 1QYVA 3RFVA 1PZHA 4OL9A 5AXBA 1SO8A 3RKRA 3IDSA 2HMTA 2PKRA 3K73O 3CMCO 4RDIA 5L40A 4ND5A 3IJPA 1FF9A 4ESOA 1A4IA 2J5KA 3DBLA 4EJ6A 1B14A 2HQ1A 1O6ZA 3I4FA 5KTKA 4R5MA 4D43A 3CTMA 4MVJI 2PTGA 1LJ8A 5EL0A 4CMHA 2D0IA 1M6HA 2OBYA 3AM5A 3BMQA 4YT2A 3WYBA 3D7LA 1R4MA 3AWDA 4XB1A 2IYOA 2OMEA 1NWCA 2O3SA 1OMOA 4UVIA 3GAZA 2NVUA 3G3EA 1BW9B 2R00C 4PRKA 3FTPA 2HCTA 1B3BA 3ONEA 2DPGA 1IB6A 3KOUA 1QV7A 3L4SO 3PYXA 1PS9A 4FGSA 3ZWAA 4B8WA 4IIVA 3AFNA 3QV1A 3HB4X 4RLSA 1U3UA 5GY7A 5JAQA 3VKUA 3AFMA 3DXFA 4IZIA 4P4GA 5I9LA 2VYNA 3GNQA 2PH5A 3BMOB 4G65A 3W1VA 4MIEA 1MUUA 2ZB8A 5COAA 3OQ1A 2QG4A 3JQFC 4RZIA 5KVQA 1U3WA 1P44A 3NAQA 1LQUA 1FK8A 4L9RA 4Y6RA 4DPMA 4BO7A 3I3OA 3ONFA 1F8FA 3D1LA 4Q3NA 4NK4A 4Q3DA 5TF4A 1V8BA 2BELA 5ITWA 4W6ZA 3I6QA 4FFLA 3QWIA 1ONOA 4Z0TA 1DOHA 3TZCA 3ZDFA 4KZPA 3OQ6A 4E5PA 1BG6A 3EZLA 3UF0A 1Y8RB 3GK3A 1PJ3A 3PLRA 4DLLA 4BMVA 4UUNA 3ZNNA 4W99A 4L8VA 1J5PA 3GHYA 3OECA 4I08A 3HN7A 4OOEA 1YB4A 2EERA 1LRLA 5KJEA 3HDYA 1A7AA 1NQ5A 3NUGA 2NTVA 4GSLA 2QRJA 3F6YA 2EKLA 3MJEA 2G76A 3RAJA 4AJIA 2O2SA 2I3AA 3LC1O 1TLTA 3V1TC 4NG5A 1BHSA 3GFBA 4NU5A 2FRDA 1HETA 1B7GO 4WKGA 3L4BA 3W6ZA 5ER6A 1QG6A 2UUOA 4XZ3A 2I6TA 3GDOA 3OP4A 4CV2A 4PRLA 2Q1UA 4IMPA 1TT5A 1PR9A 2Y1CA 3WMWA 4R3WA 3ZN2A 4BVAA 1UP7A 4AJPA 3GPIA 5CEJA 4UEOA 1SAYA 2HLPA 3ICPA 2ZCUA 1LLUA 3QSGA 3AOEC 2GF2A 4EUEA 1NXQA 1VLLA 2CZCA 3BHIA 4IPTA 3VAZA 1DIBA 4J6FA 4K26A 1W8DA 4NFYA 4OXKA 1RM4A 2H63A 4BNTA 1P31A 1MB4A 1MG0A 1LTHR 3TN7A 3RBVA 5JYDA 4YXFA 2GR9A 3H3JA 1AN9A 3LQFA 1BXZA 4GSKA 4PLYA 1I30A 1P1IA 3ADOA 3AU8A 3RUDA 2B5WA 3D4OA 3HE3A 3NYWA 4J1QA 1G0NA 5JMWA 4YQZA 3AJRA 1MA0A 1BRMA 1L7DA 1N9GB 2H9IA 4GAEA 1M75A 4C7JA 1SOWA 4LVUA 4H3VA 5KWEA 3OICA 4DREA 3A28A 3ON5A 1IPFA 3DTTA 4AG3A 1JWBB 2I65A 2WE8A 2BGLA 1XQ1A 2X5OA 1ULUA 1U5AA 5CHEA 1DO8A 1UR5A 3GZNB 1CERA 3LC2O 3QWAA 4JQCA 3GNTA 2EHDA 2DUWA 2Y66A 3DB2A 3HNPA 4EDFA 2X22A 4XYLA 2VRCA 4FJ1A 4IUYA 4H7PA 2QYTA 3FWZA 1ISHA 2A92A 2CY0A 1U2DA 4XGNA 1RKXA 4OAQA 5TSDA 1NR1A 2WWRA 1ONPA 1WNTA 3BA1A 3P2YA 4KTTE 2OOSA 4YJGA 2GDZA 2YW9A 3ITKA 1E3WB 3GUYA 2AHRA 2RBEA 4ND4A 2CF6A 3ZZNA 3UAGA 2UVDA 3FR8A 3SX2A 4E32A 4YA6A 4EUFA 1CIVA 4TVOA 3VC7A 2VZ0A 3FNFA 4WNIA 3P19A 4NFSA 1H5QA 3HSKA 4NK5A 4IM7A 3JYLA 2VHWA 2X9NA 1B8UA 3ZNQA 3QY9A 4BNXA 1HSZA 2YJZA 2JD1A 1HDOA 1XA0A 2RIRA 5A3VA 3DTYA 5TLSA 3KYCA 4J3FA 1P74A 5B4TA 4TZKA 1JA9A 2VHZA 2Q2WA 3V8BA 4W82A 4L75A 4PLPA 1FMCA 5DT9A 1C1XA 5A9TA 5KKCA 3LU1A 1JAXA 1QYCA 2EJVA 3HZZA 3IC5A 3JYQA 3IAHA 3UVEA 1VE9A 2VN8A 2OORA 1DSSG 3GVCA 2YHIB 2A94A 4I5EA 4M87A 3DDNA 1TEHA 5CDTA 2WD7A 1N92A 3KEOA 3QIVA 1EZ4A 2BHLA 2DLDA 1QR6A 4YVFA 3VPHA 3SLKA 3KO8A 3UH1A 2E6UX 1DRUA 1NQAO 1WZEA 5IFLA 2B69A 4LRTB 4NZ9A 3VZRA 5KVVA 5EN4A 4RQUA 1VSUA 1YBVA 3BHMA 4A26A 2J5QA 1KY5A 1OC4A 2JHGA 2HMWA 3NTRA 3OH8A 1EVYA 2FR8A 3X2FA 1WDKA 4PLFA 2PK3A 1PJLA 4E12A 3VOSA 1BDBA 1O94A 1KVUA 4IDGA 3C8MA 3PJGA 5I9NA 2EIHA 5T5QA 1JLLA 2VZ9A 3RC2A 5IDWA 3W4IA 1Y8RA 3K2BA 3MEQA 1C0LA 5A9SA 3DOOA 4IJVA 1WWKA 4BKQA 2W2LA 3DHNA 1ZEMA 3IP3A 1K3TA 4BNZA 5EIOA 4W7IA 4A2CA 1V3UA 3UN1A 5J23A 3R0IA 3F46A 1YS4A 4ZQBA 1JKFA 2OXIA 5ES3A 3K31A 4DYDA 1WMAA 2BFPA 3F9IA 1QMGA 2D5AA 4O59O 4BNYA 2VHVA 2GZ2A 4ALMA 2VTEA 3ZV5A 1NFRA 3ZWPA 1SEPA 2PZLA 3OF2A 4M89A 3PI7A 5L51A 4QXMA 1Q1NA 4BO1A 3K92A 2CMDA 5GMOA 4NDNE 2VZ8A 2EW8A 1U8XX 2JCVA 1GQ2A 4HX5A 4I8XA 3GG9A 2C59A 5G0TA 2AXQA 3WOHA 1FXSA 5JO0A 2UUPA 3FNEA 1EDZA 4I9UA 4IQGA 3AY6A 4BQRA 4NR0A 2PD4A 3VPXA 2PKQO 1A5ZA 5DP2A 5C7IO 4R01A 5A03A 4HY3A 4IY1A 4ZD6A 3CSDA 2HMSA 2W2KA 5TX7A 4OHUA 5BSGA 2O4UX 4U6QA 2RCYA 2RH4A 4JBHA 4JNKA 4TSKA 1WAMA 4J1SA 2C7GA 4I1IA 3T7CA 3PHIA 3U62A 2HJRA 2Z1NA 3Q1LA 1Y8QA 1GQYA 3WBBA 1GUYA 5DOVA 3WNVA 5T8KA 1LUAA 4E0BA 2XAAA 4O63O 3V1UA 3GVHA 2HSDA 2WDZA 1NVGA 5T6BA 4OKIA 3D3EA 3PEFA 1LDBA 3AM4A 5AXCA 3NJ4A 4IGEA 4YAJA 1BVRA 3GVPA 1Z7EA 1PJSA 3KYBA 3LT1A 3ZU3A 1MXHA 1YDWA 2HJSA 2QZ9A 3UOGA 3FI9A 3VH3A 4XGKA 4GX1A 1YJ8A 1BW9A 1UDBA 4Q39A 3EY4A 4GX5A 3WDSA 2BMAA 3DL2A 3FN4A 1S7CA 2IE0A 2GASA 2JAHA 1LRJA 4QO8A 4IDFA 3JD2A 4MJLA 3W4JA 1XLTA 2QQ5A 3AU9A 2WSBA 1GPJA 2ZKLA 4FSHA 2VT3A 5C7OO 3GVIA 4CV0A 3GGPA 5JNLA 5JE8A 1NM5A 4DIOA 2O7QA 4D3DA 1WP4A 3EW7A 2HUNA 1EQUA 4ALIA 4MKRA 2FZWA 1NR7A 1KS9A 5L7TA 3ZV3A 3FSRA 4NIMA 3ZNPA 5JCJA 2C2XA 3GEDA 1P0FA 1VJ0A 4BNIA 3ANLA 1DC3A 1HZJA 1ZK1A 3FBTA 3VDQA 3TNLA 2G17A 3S2EA 4GBJA 5CDGA 2VYND 5JY1A 4J49A 3PIIA 3P7MA 4HFMA 4BO0A 4XR9A 3JCZA 3ENKA 1F8GA 1ML3A 2E48A 2X1HA 4RVUA 4PLTA 2IZZA 4YEDA 4XYBA 4D42A 1XDWA 4AFNA 4BS9A 1HDRA 1HDXA 1BTOA 4Y6PA 2Z1MA 4IDAA 5K6AC 2E49A 3MJVA 4XYGA 3I5MA 2PLAA 1JKIA 1ZZEA 3PDJA 4TKLA 3KYCB 3RBXA 3OJ0A
chains in the Genus database with same CATH superfamily
5E6UB 4A6XA 3ZZMA 5IRCD 1ODSA 4U00A 3Q5EA 4RZHA 4Q9KA 4MUAA 5DYIA 2XVMA 4KFCA 3RARA 3PF8A 5AW1A 5JSUA 1WO8A 3ANMA 4FEEA 4HWOA 2V55B 5EWLA 2GEUA 4G1VA 1FS4A 3SMQA 3LOQA 3ROPA 5EWMB 1IHUA 5H70A 1VIVA 1W4RA 3DAFA 2QXTA 3NWEA 2HWUA 4GP9A 4X00A 3MWKA 5EINA 1MU0A 1X0XA 1FNCA 2OLJA 3RUPA 4GRIA 4LWZA 5B3JA 1FJHA 5C5DA 3PKIA 3ZKWA 3FUWA 1TVKA 1SC3A 4IDOA 3VU9A 1TZBA 2Y0DA 1THGA 1I4EB 1KVSA 3GC6A 2VUHB 4UNSA 5CNJA 4XA8A 5I7FA 4H6VA 5B55A 2EJBA 1WPXA 2R6CA 3A4NA 3HCPA 3EIOA 4JGBA 5F78A 1ZW1A 1HNNA 3RLFA 3KSMA 1X13A 1MHPA 3OOHA 1ZK0A 1T6YA 2HMAA 2LGJA 3F7NA 3RFCA 5LZ7A 1D6NA 1KO7A 2QIPA 3VZPA 4YRMA 1CUGA 2A67A 4OBBA 5K8VA 2M6SA 1G21A 2HX1A 5A3RA 3JZDA 2B6HA 4NU6A 4X85A 3W8DA 1ZVVA 3W6UA 3UM9A 4B3RB 4EK9A 3TQFA 1H3FA 2MYUA 3D3KA 5MDHA 1MH9A 2YICA 1GV1A 1H5NA 2R8XA 2VK2A 4FCWA 3RYHB 2FEXA 4ZYTA 3R9XA 3OE7D 1YQUA 4AO6A 3B36A 1ESDA 1M1ZA 2YWDA 4H6WA 1M34A 1JG3A 1CUBA 1DPFA 3PLNA 3MRVA 5GIPE 2KWIA 4BO3A 5JSFA 1I9CA 2X9GA 5TT0A 1Z35A 5CJ2A 5EQDA 2YN0A 3E81A 1MX3A 4L02A 5F7ZA 1KSJA 2C98A 3TOZA 3UJ3X 3Q7RA 5ALFA 2UKDA 2CSUA 4GUDA 4DJFC 1B1CA 1HE8B 1QG4A 4EO7A 2XXAB 4UMDA 2QY6A 3UMMA 3OCVA 4C7VA 1QG2A 2JJMA 3LBYA 1XL1A 4O1MA 3ET5A 4LQCA 3HA5A 2Z4TA 4WN3A 1GQSA 2JF0A 4XIYA 4MCJA 2B35A 4CE6A 3MJEA 3KLNA 3OIWA 1IN5A 4IY1A 1SPXA 1Y9DA 4UU7A 3TG8A 3CR3C 5K3EA 2X5KO 5ISMA 3L40A 1E1NA 3PXDA 5EVJA 1L1RA 3WNQA 2GEVA 1RE0A 3U2QA 1NXXA 4Z1MA 5A5FA 4ACBA 4TXLA 1V0JA 1XTVA 4U02A 4TTIA 1U9IA 2V74B 5E6SB 1JQDA 3K3PA 4ZODA 4HQLA 1LJUA 2C84A 4GICA 1AS2A 3LYLA 1KR5A 2WICA 2V1UA 5E6RB 1UZUA 1ZFNA 4DC1A 2GAAA 1C9MA 1ZITA 4G9BA 4G1BA 3S44A 3MJRA 5KTNA 1YRYE 2EFEB 2P6UA 1H2XA 2XXJA 2WYIA 3KQLA 2V5VA 2WBLC 3EOZA 1Q2XA 2CWDA 1O94C 1AQ6A 1KGDA 2DZDA 1C30B 5FPYA 5AW9A 3RT7A 3UY4A 4GR5A 4EKGA 2J6HA 4IDHA 3Q9UA 3ZK8A 4BFYA 1XCPA 3Q6NA 3TB4A 4YR7A 3K71B 2IZ1A 2BI8A 4RTJA 2NP7A 1PGJA 3DV0A 1Z47A 3G1TA 3QVMA 4XWOA 5CGQB 3WGKA 3CEHA 3U39A 4F5EA 5LXTF 4H18A 4ZYUA 4F0JA 3AEXA 4LXTA 4V3CA 3ND6A 4J0QA 1K8YB 3KG2A 4PVCA 4N3GA 1OTHA 3OE4A 2PGOA 3NG1A 2QI9F 3IP9A 1AKMA 2GAOA 3WGMA 1UT5A 1B2LA 3VH2A 5IJ0B 3TF5A 2XAUA 2NWQA 1M2VA 2P6OA 2FUCA 2IF0A 4HQOA 1HE4A 4D6PA 4K46A 4HXYA 1RQ7A 4G1UC 1OAAA 2HQSA 4M7PA 1S96A 3V4RA 2R48A 3O0DA 4X60A 2IEBA 4DYHA 3PQEA 2L18A 1YL7A 2Y1FA 4B4VA 2JI6A 3ONDA 3DZKA 1ZEJA 3I2IA 3WKEA 1P1CA 1U2GC 4MPDA 4R81A 2DFNA 1SUFA 2OY0A 4X8OA 4YCNA 2QG6A 3AHJA 1KDPA 3OKAA 3R3HA 4K1XA 4YROA 2QMHA 1WNFA 2CXQA 2SBTA 4Z7NB 5LP1A 3WGYA 2FG6C 2BFOA 2GPAA 3H2ZA 2QT1A 3LKZA 4DSAA 4N82A 9LDTA 1KOLA 3EZ6A 3OZEA 4IJMA 2X8JA 4MQUA 1N8SA 2VRWA 1W581 5HA5A 4UQOA 5F2NA 1WPQA 2ZBEA 4AN1A 3BWCA 4EPTA 1FYEA 1AQNA 4XJTA 3DUWA 1BGXT 1G5QA 1UP4A 3L6CA 3M6IA 2VPTA 3MSXA 5CUQA 2YDXA 4E08A 1M1NB 2M1ZA 5CG1A 5DBHX 4P53A 5E1MA 1JR4A 3KU1A 2QD5A 4YP7A 4C14A 4D8VA 4BV3A 4U0KA 3W9UA 2ERCA 4PYNA 2Z6VA 3DT6A 4OK3A 1HPLA 1RS0A 3B1WA 2PYIA 3MTEA 4I9NA 3O8NA 3QE3A 4YO7A 1JEEA 1SC9A 3BEDA 4FFMA 2J3EA 2OZPA 5I7SA 3A27A 2FNAA 1RRCA 1Z63A 2QN9A 3SC2A 2VHQA 3I62A 1XA4A 2P3OA 4RW0A 1DDGA 1W35A 3HNOA 1F5SA 3ESYA 5GVRA 5IEJA 3O8OB 2ORWA 4MUGA 5DGHA 2GKOA 3TEJA 1KEWA 4LCEA 1N0UA 2Z58A 4IXWA 2AB0A 4H60A 1ZMBA 4TV8F 4XDGA 3UBMA 2YWCA 2PU7A 2ZYIA 2QGFA 3HYRA 1CB7A 4IDCA 3WLHA 2Q5JA 1JTVA 1ND5A 2NOAA 4M60A 4ENUA 3EPHA 3AHCA 3NVMB 3KLPX 5HG0A 2ZIWB 2C82A 5F98A 1NY6A 2DQKA 2ZKIA 3OJFA 3A9UA 1CG6A 5I4CA 5K4GA 3TM4A 1RAHA 1UKZA 4AL4A 4GNKA 1MDFA 1E7QA 2R8EA 4WSOA 3KPJA 2HO5A 5AP9A 1EK0A 7AT1A 2ZRHA 5KOYA 3FPAA 3V7YA 3B3AA 3DHWC 2P9HA 4C4TA 4JLDA 5KX5B 1P1KA 4CODB 1GU7A 5B3AA 3WK4A 1Q14A 5LSAA 1JL3A 2C42A 2QW1A 2X5JO 2OK7A 2OXCA 1F06A 4HDCA 4JB2A 5JS2A 1KI3A 3Q6IA 2HLNA 4TM8A 3TX2A 1SELA 4DLYA 4PY2A 2G7MC 4ZMRA 4HO1X 1U9IC 4AJEA 2FMXA 3R7AA 4DAEA 5ALEA 4MRVA 5G2OA 3F67A 1GWNA 1XMXA 4QDJA 1JH9A 1H93A 5YASA 3MRTA 5DH9A 1O9GA 5K3FB 3VZBA 1NBHA 2AUMA 1WR8A 3UPDA 1KC1A 1WKCA 4XEHA 3TD6A 1U3TA 3FUCA 4KL8S 4AECA 3CZMA 2JRCA 4DRXB 4EA9A 4MGKR 5BV2P 1JU9A 1H2YA 5HE9A 3PNQA 2ECQA 2Z2IA 3ILVA 2CEKA 5B1SA 4URZR 4G4JA 3WRYC 4ID3A 3ZDRA 2WMOB 4W7SA 3SE0A 3SNKA 3DB1A 1MR3F 1PGOA 2GRAA 3HCNA 3OCYA 4EW1A 4EG6A 4HFNA 2H2FA 4BQQA 4Q4JB 2XQFA 4MUKA 1GAEO 4N1AA 4P35A 4MI3A 4D57A 3HXKA 3I0ZA 1XPRA 4Z4QA 4U7DA 1N77A 2XSZD 5CA1A 3NJ8A 5K4AA 2QY9A 4Y2XA 2WSYB 4YT8A 1CTQA 1P29A 2ZRDA 2I71A 5EJAA 1XSEA 2XZDA 3EZXA 5SZJA 1VLMA 1W87A 1POXA 4RSHA 1C14A 1BKDR 4ZEVA 1GU1A 3GFVA 3O74A 3P52A 3FKSD 1C9EA 1KMIY 1F4LA 3MTBA 4LDPA 4BE9A 1ZKMA 1LWNA 1Y6QA 4YRGA 1KY4A 1H2HA 3A0UA 5J2TA 2ZRQA 5C31A 4FWTA 2GBFA 1K5PA 1UBOS 1X92A 2J0UA 2QUZA 1X7WB 3I37X 4J3NA 5AESA 2VWQA 1A96A 4BTVA 1BX0A 3I92A 3WJ1A 4BNLA 4OXNA 3T8YA 1XU9A 4A3SA 2X8LA 3GJSA 2VQDA 4FMBB 3H8JA 3F2VA 2X4LA 4BBZA 2BJWA 5AJYA 1ZJJA 1KQOA 2J3KA 2PYDA 3DA8A 3C3BA 2PGIA 3GEMA 2ID8A 1HDEA 2Z6QA 4US1R 4JJAA 1HUQA 4M55A 4ZCQA 1I9GA 5FI3A 1SXJD 3ZGYA 1W76A 3H9GA 1UOPA 3NR2A 5K0EA 3JY6A 2ZANA 2AWOA 4G5GA 3S7TA 3VXKA 5CB4B 4JUCA 3KZ1E 1ISJA 1O95A 3ORYA 1I24A 4GI2A 4NP6A 1XWFA 3TSCA 2VPPA 4JI4B 5T6MA 3VMFA 2ZT6A 2VCYA 1NT4A 4HAZA 3PFNA 1ISFA 3GV0A 4DSNA 5IP5A 2EU8A 3H4MA 2P7HA 1BH6A 3I9V1 2C3PA 4UMFA 4FD2A 3CGGA 1QSGA 3GJZA 4H7FA 5EIBD 2HLDA 4K6FA 1NHGA 1HH4A 2YBDA 1K89A 1QM5A 3KCNA 3E7FA 3ZY4A 1AKTA 4BIMA 3B7PA 1Q3TA 2P2CA 3RSQA 3GJTA 2JEZA 4Q00A 2V6BA 2P91A 4X1YB 4ZARA 4CLHA 5KOIA 4WZ6A 4JI3B 5K0BA 2ZEJA 5EKDA 1KFKB 4WECA 1W6UA 1BCRA 3HYLA 3KTOA 2MSNA 2VDWA 2X7XA 2V58A 3COSA 4CEJA 3INTA 2WZCA 4B76A 2DT8A 5G40A 2Y77A 1MZPA 1HX7A 1SZDA 5B7QA 3NHMA 4JSRA 4RV9A 2NU7A 4TTAA 3BTVA 4ZRMA 2PZJA 3WJ7A 4K87A 2PA3A 1N6IA 4D9HA 4XFJA 1DBIA 1EGAA 1ODFA 2DECA 1HYGA 1PFYA 3I83A 1DQNA 4Q4HA 4WWHA 1VYUA 3P2MA 3W2HA 1RRMA 2O8BA 1LBEA 3U4IA 4B46A 1L8XA 4GZ6A 2W8BA 4B6SA 2OAQ1 4Y0VA 2V7BA 4DRZA 2CFRA 4R2HA 2JCYA 3A7DA 4IFIA 5CR9A 4HWKA 3WFIA 4R5HA 1GCOA 4RF3A 3MJFA 4P36A 1TNDA 2X0FA 1P0IA 5HKLA 1UQTA 3QU4A 4OV6B 1NMEA 3MMZA 4MGZR 2YOGA 5IFKA 4HXGA 4QXPA 4BV9A 1WM1A 4UNPA 1I80A 4D9KA 5A62A 1Y4UA 4LYDA 4U2DA 3ZCPA 3V1NA 3WBKA 2XXAA 2AFIA 2FUG6 3W9BA 4DXDA 3ZHOA 1T6XA 1RQRA 3ZXUB 1NW5A 1PT9A 2HXYA 4JEMA 1KZ7B 5KYUA 3RSHA 4NPHA 3SBXA 3LCUA 1OZGA 2DWUA 2VKQA 1SG9A 3KSZO 4S1PA 1IG3A 1XJCA 2R6AA 3CJRA 3N87A 1O6FA 2FWAA 3EVEA 7REQA 4Y0NA 3HLKA 1VKRA 1WS6A 3T9AA 5DNWA 4PZDA 2O14A 3O8QB 4RJLA 4TUYA 3AQ4A 4K3UA 4HDRA 3NJRA 4BVLA 5H4GA 2GJ9A 4R40A 3OQHA 4BKPA 3GRUA 2BRUA 4LISA 1PEAA 4EO4A 1FFDA 1OYWA 2HU5A 1WUJS 1G9TA 2YUIA 3M0EA 4MW6A 2JW5A 5TS2A 3DVAA 2UUBB 1ZUIA 4HB3A 5JPIA 1N9KA 4KRXA 3IVXA 3TVYA 1NYLA 2RK3A 3JYHA 3VJKA 5JADA 1PZEA 2F55A 1AF4A 2LKDA 2ZIXB 4K6GA 2EL7A 1GJRA 3ETLA 3QV2A 1V8DA 4ZYZA 4GKAA 1CQIB 5GOTA 2AJBA 3QXSA 1VPEA 4ZA2A 3QPUA 4IIGA 3F78A 5JC8A 1BKSB 2NZXA 2IHYA 4MARA 3SQOA 4DXHA 3TUZC 2O48X 4BLSA 1K08A 2IYQA 4MW7A 2Z3ZA 3DEKA 4QT4A 5KWSA 4KIJA 2W42A 4GZLA 4C5AA 4R05A 4CL0A 1QJ4A 4BMXA 1HE5A 1XDGA 4MV4A 2B94A 4B7XA 2YOFA 2DHDA 4C7OA 3WSWA 1E4OA 1V39A 4IV0A 3MWDB 2J30A 4Q1AA 1CF4A 4BNDB 5FJJA 5TARA 2UVQA 4TXJA 5BSFA 4NE9A 1D03A 3EX7C 3ZCUA 4MRNA 3RROA 1GAXA 2IOFA 2GJSA 2D7DA 2LR0A 4UHHA 1GKLA 1IBKB 1XVLA 5EAIA 4LJ8A 1NIJA 4MZXA 4HC4A 1XZ8A 1XTQA 2ZB4A 1E2NA 3IAM1 3IT0A 4E46A 4XWAA 1PFGA 5CVVA 2Y6VA 4NNJA 1IY8A 4KWEA 4F1JA 4L6CA 1RAFA 3KSRA 3EIXA 1QRDA 2G88A 3HHPA 3MUOA 1Y3IA 4BYGA 1F3OA 4NCKA 3E9MA 3UFBA 4MITA 4MGEA 1U7PA 1GDDA 1YASA 1B73A 1CDOA 1KZ6A 2GD6A 2GCOB 2YZGA 1WULS 4RD0A 1M67A 1AKQA 2ZRCA 4Q9HA 4ARZA 3DNFA 3DW3X 4G97A 4TRJA 3U1VA 4ZC8A 1Q16A 4XQEA 4D4GA 5C80A 4JGIA 4J2TA 4DB4A 2OLKA 1XKXA 3BAZA 3IOCA 2Z6AA 3DR5A 4GEKA 3NM4A 4YQYA 3AVTA 4QE3A 4X6LA 3KWFA 3O0TA 4A0QA 3AL2A 3VV3A 1H8ED 1GUZA 2QV0A 3Q2OA 4H1VA 1H1LB 2NIPA 2AG8A 4CPDA 4E5UA 1T6NA 4O4IF 2CLDX 3SQLA 5C52B 2H31A 2EC5A 2XT0A 4HEA6 1SBQA 3U7HB 4ONEA 1GXSB 4Y9UA 2VTDA 3O03A 5KTYA 1TUGA 1RKUA 2HK6A 4ILKA 1LQ2A 1WW2A 5FA8A 2DC1A 2OTCA 2LIPA 2J1LA 3TINA 4EY3A 1GR0A 4KDCA 4KIWA 2B1RA 4KKVA 4TV8B 3SS8A 5AUOB 2HBZA 3ESQA 3E9ZA 1C9KA 5ADVA 4X1OA 3SVLA 5IT0A 1ZN8A 5A1JA 3LGAA 3Q3HA 4A2WA 4CF3A 4FYHA 5IASA 2Q27A 3EGCA 1OBCA 2CXOA 3JV7A 4A91A 5DM0A 3U0BA 1PZXA 3KT3A 5KYXA 2WZQA 1XEWX 2PT9A 3PPIA 4PLWA 5IKXA 4PX2A 1IPEA 3GLFA 1RWQA 3R3YA 1U3DA 2H7VA 4K6CA 4QEDA 4BP9A 2NTNA 2Z5LA 1V7ZA 2O3UA 1ZWLA 3CVOA 3EF0A 1XZGA 4QYIB 1QVVA 4DM3A 2GKSA 3DNPA 3QFFA 3JZIA 1W94A 1IC6A 4RESA 3RRZA 4C3UA 1O7JA 1S2IA 5KYXB 1K0FA 1NAHA 5GJWC 3UMYA 2JFVA 1QO7A 1LA2A 2FMUA 2H2DA 2L82A 2X2FA 4RWZA 4UM7A 4W8OA 3RC9A 4BQOA 4EL0A 5A4FS 2Q9BA 3CX4A 4LDJA 4Z0PA 3RE1A 4YRSA 1PTKA 1I33A 4HZIA 1EUCB 2V6MA 5JAMA 4U6SA 2AE2A 2E89A 2ZI5A 2A3RA 4H1UA 4Q4AB 3ROGA 4TMWA 4M0EA 4L7VA 2HRQA 3ZI0A 3MYYA 4RSMA 1PGNA 2HQBA 4WA8A 1ZC3A 1D1QA 3DNMA 3JWHA 4IRUB 3SKYA 4S1WA 5IJ9A 4KIFA 1EFVB 1KJ9A 4R8LA 1MPTA 4B3HA 1NQVA 1P0PA 1FTNA 4OQDA 2CW5A 1CF9A 4BPBA 1G42A 1YL6A 3DVSX 4P3KA 5BQXA 2AG0A 3A2KA 1E9SA 2YY5A 5ADWA 1WV0A 2ZPTX 3IAS6 1XNRB 5DBEX 4HRXA 1P19A 2BV3A 5BN3B 4B6QA 2Z5FA 2D5IA 4NMWA 4F11A 5JZOA 1QNFA 2MSEB 1KSHA 1SUIA 3NEPX 1GSIA 4PG6A 4XVQA 1T5IA 4KG7A 1JHDA 4DMLA 4FHDA 4B4UA 1RRVA 3ZD6A 1U98A 3E23A 1JSRA 4MUJA 5EXTA 4D3FA 4JITA 1AE1A 1RVV1 4Y2VA 1BX3A 2A7QA 4PGHA 3RGGA 1AQJA 4CLXA 1VE5A 4LI0A 4UNNA 3ER9A 2RAPA 5AK6A 3QH4A 3FRIA 1JAHA 2HA4A 1LPOA 4NPCA 3WK7A 1FVXA 4XARA 4N48A 2IS1A 3K09A 4L76A 3BDAA 1FU8A 4L7QA 1HT0A 2B0JA 1ADBA 1JFVA 4MA0A 3TQIA 4A5SA 1ONBA 1WD5A 2JGDB 1NVAA 3UHPA 4EITA 2AI3A 1KMCA 1FLDA 1WHTA 3WTBA 1FDOA 1ADGA 2JCXA 2R1ZA 2GESA 3V2GA 1N0HA 4Y6SA 4N76A 5HIKA 4J7XA 4CMEC 5IABA 2I2WA 1I3CA 2AF4C 1FYXA 1N5OX 2PGXA 2PLWA 4JL6A 2ZBFA 4CFZA 4EHBA 4IO0A 5KTRA 3NMUF 1TK2A 4BB6A 4R0VA 2IV2X 4OMCA 1X86B 1UMBB 2DR0A 2A7XA 2FOXA 2WT8A 3CTPA 5KJ6A 1F0KA 4OBXA 1VCMA 4J4TA 3WGVA 1HURA 1G5RA 3DHEA 2D6FA 1HK7A 3I01A 4V0LA 4QFBA 1V71A 4Q6WA 3QEOA 3M1IA 4J0EA 1NLYA 5DP1A 5LA6B 3PQFA 3RU7A 3RU3A 3RYTC 3G2OA 4G1FA 1R88A 2QLTA 1FP2A 2OO7A 2FGKA 1E61A 3AUKA 3QFHA 1PVDA 2G5GX 2B4AA 2GCGA 3TBKA 3SVTA 2PUGA 2AQIA 3FHJA 4TN1A 3EDYA 5CB4F 2Q46A 3GA0A 1PNVA 1AVTA 4RY8A 4F91B 3EBPA 3UJHA 3HU3A 3K8ZA 1BE8A 2QTBA 4K81B 3MT9A 2FG7C 1YKFA 3BFJA 3KQUA 4FHGA 3RR2A 4AWXA 1C2TA 4JCOA 4ZVQA 4ZOAA 1KTIA 4DCUA 1TUBA 2QA5A 4QELA 5JH7F 3HJUA 4X71A 3B20A 1X1DA 4N65A 2EFHB 3M81A 3A1EA 2GN8A 1XNJA 2FWPA 5AOVA 3UV3A 2IGTA 1GRVA 4X97A 5LQAA 3QVGA 5CFQA 1Z6ZA 2I1QA 3C6MA 3DE7X 1P73A 1D2MA 1KRWA 4AQ7A 3A6GA 1OWMA 2QZ4A 4LF8B 4OLBA 3A8TA 1W4LA 3HO1A 1XYVA 3D2CA 1RJWA 2GZ3A 3PVCA 3MMSA 5KNDH 3PFHA 2RIPA 1MW8X 4WCFB 1U8ZA 2JFOA 5REQB 4MVJH 5J2UF 2I6SA 3C39A 3DEYX 3SS9X 1U1GA 2P4HX 3ABZA 3QHPA 4DSOA 3FOBA 3PYMA 3T3GA 3BFKA 4BJ5A 3SP1A 1E5XA 3THXA 3AR7A 4RMGA 1PRYA 3UXHA 4Q03A 2BCJQ 4C6RA 2VSFA 4UREA 4D4LA 1QIDA 1M6WA 3GU3A 1RAGA 4QNMA 1M83A 4RVNA 3ZS8A 5JS8A 5C3MA 4FFBA 5SICE 4YJ2B 2FSIA 1Z0FA 1P1BA 1N5KA 1R16A 3EZYA 5E9QA 3PJFA 5FPQA 4FU0A 4XX0A 3LNCA 1HNZB 4ARIA 2MINB 2AJ8A 2Z2KA 3IAS1 1DBVO 4TRMA 1YT5A 4UHEA 4YWJA 1FUKA 4MYRA 1U0NA 4V0MA 2WJPA 3G0HA 2YXLA 3IE2A 2E1RA 5HX7A 2CFCA 5H1YA 3U49A 1K6IA 5C7YA 3WAKA 3RYCA 3KLBA 2W70A 1IVYA 5B12A 3IO3A 4RELA 3SJZA 4JBLA 1PK7A 7ADHA 4FLFA 5HOEA 2NMVA 4Q3AA 2YXNA 1QIFA 3BAFA 4W7HA 5FI1B 4JI2B 1U0FA 1PFVA 3EODA 3EY9A 3IFSA 3NOOA 3OPQA 4EI9A 5A4AA 3GB9A 1JXMA 4HYYA 1SZCA 4O4LA 4GEGA 5IMBA 4E2XA 1HYBA 3GQBA 1RBQA 3Q5GA 2QRNA 2JI8A 3NDIA 5AVQA 1H8EA 1CHDA 1E9RA 5FNZA 5FOQA 2FUEA 5HS4A 1E4EA 1YVRA 2DOKA 2AA3A 3GGDA 1EAYA 2PZAA 2X2EA 4NBRA 3T9BA 2EBWA 2VRBA 3DBHB 3H2BA 2GA8A 3LGXA 3DKVA 2CHGA 2WOOA 2XNJA 4G81A 4HAIA 1YCGA 4CCYB 3GVXA 2O8EB 2OHHA 1TE2A 3P45A 2UAGA 4S1NA 1B0PA 2PL3A 3RYFB 4PQRA 4DA6A 4XCVA 3H8SA 4ZO6A 1DOZA 1X8KA 2C8LA 2IP4A 2P9JA 2WNHA 3L9WA 4Y2SA 5DI3A 1L5FA 1FMJA 1I5OA 1Q0ZA 5ALQA 5JVDA 2VQFB 3RK4A 3N2LA 3QZUA 2D3TA 2RGCA 1H4VB 3D0KA 3WNZA 4GKBA 2FEPA 3I05A 2QBYA 3WKDA 1PT8A 2BP7A 3LTNC 3CPSA 2O54A 1YE3A 1QWOA 2XUGA 4HAUA 4B81A 3RG2A 2ZG6A 4EYEA 3ZK7A 4AI6A 2XCRB 3KQQA 2DQSA 3AXSA 3GBSA 3LA6A 3PPVA 2OXFA 2PLFA 1RNLA 4JI7B 4YMVA 3L05A 3M9WA 4P3YA 3T1NA 1QRRA 4C4ZA 1QHHB 2WOJA 1USKA 4MRPA 1X77A 2PX0A 3L7DA 2PG3A 4OSOA 5AVWA 3K70C 1B6SA 1VHJA 3A9RA 4LTMA 2VP9A 2I8CA 3TR5A 2Y1XA 3RUCA 3NBZC 3NHWA 2XGJA 1Z5NA 5AW2A 1Q6YA 1T26A 4DLWA 1I4TD 2DPXA 3LI2A 2IPXA 2RAUA 4Q48A 3U44B 5ESRA 2AYZA 3IXLA 4QYIA 4DA9A 3KV3O 1ATZA 4RU1A 5AVJA 5AVKA 4H08A 1YBAA 2C2BA 3WIVA 3V8NA 3W2EA 1E6UA 3AEUB 2FHSA 2X1MA 3L6DA 4NU8X 4RJIA 3UC5A 4EPVA 4F3RA 4QEKA 2BOVA 3BIFA 5AUPB 4LQLA 3FHCB 3MB5A 1VBNA 4J2HA 3GJ0A 1A9QA 1JIUA 1U6IA 3AESB 1MT3A 3T7KA 1V5GA 1PG2A 4MQMA 2AXEA 4UAJA 4Y98A 1GFSA 5AW0A 1XA3A 1Z6QA 5F35A 2PS0A 3HCDA 1PWHA 3RTDA 5M3BA 3KELA 4WASA 2P41A 1QHYA 1TJ4A 3GRKA 2XWPA 4OY3A 5CJPA 1SC6A 2WYHA 5KQSA 1JDBB 1HZZC 1P17A 3PGMA 2OFOA 4B7UA 4EBFA 3UH0A 4EW3A 1PJBA 4UBLA 3EGEA 4N5MA 3HKEA 4O4IB 2H2AA 3QEJA 3FVQA 3TAUA 2XMQA 2VJMB 5BRAA 2BEVB 2AI2A 2I99A 3AEZA 4JJ8A 4NF2A 4R2WA 4DDVA 3CUVA 3DO8A 3AIKA 5JNWA 4YCBA 3T3MB 3UG7A 1X7YB 1SUCA 2J9XB 3HXOA 10MHA 3IUEA 4GIBA 2O5EA 4Z6KA 2MMGA 5FAXA 5BW6B 4ENRA 5HOQA 3G8DA 3KT6A 3NT5A 2GBIA 3UWMA 1T2VA 3W5VA 1JVBA 1SCAA 2J09A 2RBGA 2ZVDA 5IU6A 2F9MA 4GPBA 3H05A 4ARZB 2J3HA 2ONJA 5BV7A 1L0BA 3K1TA 3C1OA 3OLVA 4LIPD 5JUWA 2BDUA 2WM2A 3HCFA 5FNVB 4LF5B 2DF8A 4EDHA 4FFNA 5C7LO 1JEDA 4J2OA 5EGNA 4ZDIA 5K09A 2TS1A 2WWWA 2F1IA 4MWGA 4EF4A 4LRSB 2JIRA 3A9WA 4YYZA 1DMRA 1G6KA 1Z0DA 1J2JA 3ENNA 3GRFA 4GPIB 4Q1EA 4UTVA 5TMPA 1Z7WA 3R4CA 2JRLA 5LB4A 4QHSA 5G1NA 3LKBA 2WF7A 4E88A 2DXIA 5KNLA 4ZICA 4D8TA 1DEXA 1ECLA 4QQRA 1NGSA 1F14A 3GNSA 4H1WA 1LSOA 5DPMA 1SC1A 1Y7TA 3P9IA 2IYLD 4PIPA 2G40A 3CMMA 1FDIA 4CR7A 4F5ZA 3LBAA 5EJ5A 2NU9A 1DX4A 1NBIA 4CUJA 2A9VA 3G23A 1BZYA 3AHEA 3O1JC 4DA4A 1GDHA 2AMFA 2O7RA 2OBXA 3AKDA 4QRDA 4ZZ2A 1STOA 3IURA 4B4WA 1ZGHA 2JVKA 5AHKA 2HOQA 2QTRA 2J9FB 5L45A 5BYJA 5A3QA 5D7BA 1M2NA 3OMLA 3ZWYA 2AN5A 2GVZC 2E6KA 2JAQA 4ITUA 5GGXA 1VJCA 3V2UA 2P9QA 4HWGA 1K8XB 1XPJA 3RNLA 1R8SA 1B23P 2I2BA 1A72A 3JRWA 3QELA 4PFJA 5EHNA 1XAGA 2D54A 5FPHA 5A2GA 5FUWA 4X44A 5C8ZA 3QSYA 2AQKA 1QK3A 2FN3A 2NAPA 1D1PA 3M5DA 1MO2A 4X8LA 5BY2A 4QGBA 1KPIA 4DJ5X 5T64A 1I10A 5CD1A 1Q0PA 4BJ1A 1EXDA 1EEXB 3FDIA 4NV1A 1ZH6A 2GA9A 3WZLA 1UPAA 2XVXA 1U6KA 4AY5A 3R3VA 1M7GA 3P2IA 1RWXA 4V2IA 3CPHA 1DADA 1XHFA 2CNWD 4TV9F 3QMPA 2XCLA 3H6KA 4FYWA 1QGED 2ZBQA 1MFZA 1W48A 3ESXA 1BXGA 4LXGA 3VKFA 3QLUC 4B6PA 4G5HA 4UZSA 3O90A 1Y63A 2FP3A 2Z95A 5F76A 1QIKA 2PX6A 3WYGA 1ZIYA 2YFYA 4TQ9A 1XZAA 3SYNA 2ZR9A 5FQNA 3JRXA 2VH1A 1GV0A 3F5SA 1N5JA 2XE7A 4H3SA 4V0NA 1P4SA 3Q11A 2HV8A 1Z4QA 2WPNA 2RARA 4L5IA 4XRGA 3Q72A 1BJKA 4WADA 2VJBA 1WBBA 5ULLA 1J7JA 2H18A 3IDQA 1RM3A 3HKBB 3MELA 4UHFA 4YJHB 5D6NA 1ST3A 4L4SA 5ECDA 3AI1A 1NPTO 3USCS 3S1LA 2FLWA 2EFGA 4BZQA 4CCAA 5CHYA 3CH6A 4B75A 2QMUA 3NV7A 4XIFA 2QMQA 1X1QA 1FVOA 1KHTA 3CNNA 4KE7A 4Q9IA 5J1SB 4IZOA 4BAGA 3GG2A 4ITVA 4I2NA 2UZ4A 1QBGA 3O91A 5EJEA 3ODGA 4QU5A 1GPH1 3ZVLA 5E9WA 3RC1A 1VHWA 4JXKA 2BIFA 3M5PA 1EK6A 3FNQA 3KEFA 4IXNA 3TZHA 3HG7A 4P8RA 5C8YA 4BGUA 4DKJA 1JDJA 4CL3A 3TLGA 3E8XA 3WLKX 4YECA 4PS1A 1HL7A 1NYQA 3BK7A 1JHQA 3CF4G 5JCOA 3WGZA 1H9BA 2EOAA 3CJQA 3OKFA 4LEIA 5KOJB 5AKEA 1U3GA 3TZQA 2H1CA 1MENA 3T4EA 4H15A 1ORHA 2VHCA 1JU3A 4X6YA 5IZCA 1D0SA 2A58A 3DOUA 4EYOA 1ULSA 2CV2A 1GN9A 1GY8A 4EO9A 2G63A 4RD3A 3EZ7A 1E4VA 3C3KA 1NJ8A 2E82A 3ZOKA 5JYEA 1LI5A 2FX2A 4DM4A 2FZ4A 4FYKA 1P3JA 1VPDA 2F43B 6Q21A 3ULKA 3L7YA 1CEEA 3K32A 3WRYA 1JVNA 2A30A 3T41A 1G59A 1X9GA 2H1IA 2NSHA 3NH9A 3E5HA 5AM1A 2NLOA 4GFDA 3DBHA 3KEMA 5H9VA 5A04A 1I01A 4JL5A 4Z51A 3KBOA 3F7TA 5JI2E 3H8VA 3D31A 3K1AA 4OM7A 5EIAA 2ZQ5A 1VKJA 5JXHA 4JY7A 4FZ5A 2XCIA 4KE6A 5ECYA 2B34A 1G41A 3B2EA 3VOBA 3AGQA 3WYNA 4EG8A 2C2ZA 3DE0X 2YC2C 4E5YA 1MAAA 5AQ1A 2O8FB 3DGFC 4QTZA 4DLPA 1FZTA 3KWJA 4TMFA 4IMIB 3A3OA 3DDHA 1K7EB 3VPFA 2IYNA 5ELXA 2ZPUA 1SVWA 1U94A 4YCJA 2IHVA 2XBLA 3WDMA 3JQ8B 2C3YA 4GI3A 4BCDA 1FSPA 2X42A 4YJ2F 1QP8A 2C2WA 2F62A 2NXJA 2XNHA 3LK6A 3P97A 4LE1A 3SBEA 4HDKB 2JASA 3DOHA 1DAFA 1UFOA 1EFLA 1NVDA 3MMNA 4UDXX 1SURA 1YFJA 3EPRA 4TKUB 3QF7A 3S2SA 4YIKA 2XITA 3AG6A 3LHDA 4HLCA 4OHFA 2WY2D 2ZTUA 1US8B 1VHTA 2CYBA 3LX4A 4TN5A 3BRWD 4KVGA 2PT5A 3PHBE 4AO7A 4BVJA 1LVHA 3WLLA 3EXFA 2GI4A 2O5RA 4JC5A 4M46A 3L18A 1KEEA 1EGQA 1V95A 4TMKA 1GYQA 4KRFA 1HE3A 3PS9A 2ZUFA 7REQB 1E3EA 3D6HA 1PR1A 2YIVX 4J8PA 4DRYA 4B3GA 1E2HA 4PC3A 2A9RA 2B5VA 3C41J 1YJBA 4M0LA 2Q5FA 4N7BA 1J56A 3V8VA 3ORSA 4HNTA 4WJZA 2PMWB 1X74A 4JP3A 2DR2A 4LF9B 2VYCA 1O97C 1NW6A 4LHYA 4KH1A 5DGCA 3WNCA 4MROA 1Z22A 1C3XA 4O33A 3P0IA 2YRFA 4G24A 1ZM7A 4HN9A 5D1NA 3TUIC 3TIVA 4TS9A 3T12A 4W9MC 4E1BA 3CA8A 2RHCA 1JHOA 1NI4B 3OCWA 1TAUA 4R1SA 2V4UA 2QU7A 1BROA 1A5TA 3BC1A 2IWRA 1YQTA 3P9CA 5FR2A 1RLOA 2NACA 3F49S 2BPOA 4UTOA 1KDZA 4BO8A 2OO5C 2XYRA 5ENDA 1D0IA 4ZVTA 5ICSA 5JCJD 4FTWA 1HL3A 2QRVA 1RXCA 4IDPA 4NPAA 4OFBA 2JJ8A 1RYNA 1SBZA 2EGHA 2FSUA 2ONZA 2R6HA 1GU0A 3CT6A 4XD7D 2VJPA 3SZ3A 3OMWA 5HJ2A 2XDWA 2Q3EA 3BTOA 1XU4A 5E7IA 1D8AA 1YMVA 3FCOA 1ZSVA 3D8TA 3GCXA 3PGA1 2X4GA 3P4UA 4RHTA 3EGXB 3UGKA 4CV1A 1A4XA 1CZRA 2H08A 2ZJ3A 4WGFA 4JXXA 3HQ4O 3AINA 5DCUA 5EE3A 2CBGA 1AHIA 1JPNA 1KBOA 1MJNA 2ETXA 2FV8A 3IBTA 2YKGA 1CYEA 3LCRA 1N2ZA 3EXIA 3AIIA 2WMNB 4GBED 3HO6A 4BO6A 1N7IA 3AB3A 3URMA 2G82A 1ZONA 3RSLA 3ZHXA 3CX8A 1GYPA 2HU2A 3EXEB 3LAWA 3SJCA 2E9SA 3CWZA 4J1TC 4L85A 1YIOA 2V4ZA 1MF7A 2ZJYA 1E2JA 4KFUA 2OL4A 2PCJA 4L5CA 1WDMA 4L22A 4MQLA 3DTNA 4M83A 1Z4IA 2QW8A 2BISA 3HPRA 1JFFA 3E15A 4FN4A 5GONB 3ZVNA 1ZCFA 1XZQA 2JLWA 3FMOB 4U2EA 4UQPA 4I99A 4WCDA 3H1TA 3L8CA 4MYHA 3PNBA 3F98A 3B3QA 3E3NA 5JNUA 2FPIB 4FHCA 1UZMA 4ZIRA 1K06A 4R2KA 1P7YA 4GL4A 1V45E 1X7DA 4RTMA 2XMGA 3UGQA 1WVGA 1OFUX 2HF8A 2O9JA 2HPVA 2WJGA 3WR5A 4ZYLA 2PMFA 3CZCA 2PE5A 3MJCA 4KQXA 4OMUA 4RE5A 1CKEA 4DJAA 4EGQA 4QU8A 3ZXIA 4FB5A 2YZ2A 2JC3A 4CLRB 2AZMA 1N4DA 5CXSA 3CXRA 1QVAA 1YH3A 1FA9A 2WKPA 3COPA 2CBXA 3G8AA 1L4BA 3MWJA 3OUUA 3QBTA 4O2BA 3O1LA 4PWYA 1YB7A 2VHUA 4MULA 1R0WA 4PZ9A 3WLAA 5DN6A 1CUSA 5LP6B 4IJKA 2ZDGA 4MI1A 3NC4A 4NJMB 1K63A 4NICA 2BR5A 3MTJA 1HO3A 3NGLA 4JSTA 1QRUA 2FSVC 2X14A 4P5PA 3CW2A 2HGZA 3H0CA 2V6GA 4ZV9A 4DT1B 2BTQB 4WKCA 2I29A 3ODPA 3MJHA 1K6XA 1O89A 3PX7A 2HK9A 3QP9A 2JGNA 3IQIX 4D9JA 3P9KA 3QU9A 1I3MA 4L9AA 4XUDA 4Y2HA 5JG7A 3LWDA 3KSDO 4G5RA 1GN8A 1Z0ZA 2X77A 2F9FA 1YF3A 5FNVF 1FC0A 4MKZA 3IL2A 3RK0A 1ULHA 3IUMA 4KQ1A 1Z7BA 3DT9A 2IA5A 4ZYWA 4XB2A 1IOZA 2H3HA 1Z37A 2I4OA 1DAEA 1KH3A 3SN6A 5K0GA 3HB5X 1LK0A 3Q98A 4RLQA 3B1JA 4EPWA 1Z45A 3E48A 1GL9B 2YV3A 1IG0A 1H3EA 4IGAA 3TMYA 4F1KA 3IQWA 1E0DA 4B6EA 1DV1A 3A6ZA 3V97A 2JA2A 3EUFA 4TS4A 4XWTA 1CNEA 1SBYA 4LF7B 3HKBA 3PCTA 5JNSA 2HF2A 1YR7A 1I32A 1DZ3A 3SQDA 4XWYA 4GKKB 1GZUA 3WV5A 5JWHA 1ONNA 4XWKA 5L53A 2KX7A 3LXMA 2DVMA 3BCUA 1FDTA 2JKZA 3SICE 3AHFA 3G0IA 2GRJA 2A9JA 4CEHB 2WM9B 5HZGA 1A3CA 1IUPA 3AVYA 4JCCA 1RZ3A 4DC9A 2C8KA 3ZBPA 2GEKA 2WWFA 2XDAA 3LQKA 1DDOA 3PR3A 1KRXA 1B15A 3LYUA 3VU9B 1GTSA 3QW4B 5EJ4A 3A14A 2DBVO 1QVZA 1RLTA 1YDFA 2D2EA 3LDFA 3O6VA 3PJDA 4RY9A 4F46A 1FSFA 4OA5A 1E32A 3KB1A 1BHO1 2Q4RA 5DLEA 4PM4A 4E6EA 2DCUA 2KLBA 3NTUA 3QKIA 3SJ7A 1QORA 2PS9A 3TVDA 2QJFA 5FLKA 4JUIA 2AH5A 5TGZA 3N7AA 2Y1DA 4Y9SA 1N3IA 3EVCA 3ETHA 3RRYA 4WVFA 2DB3A 2I2DA 3GO4A 1SH7A 3I04M 4GRDA 1ICIA 4GGOA 3EDOA 1MVOA 4UVDA 4QG3A 1IN8A 2GLTA 4D9EA 2XVZA 3OPYB 4ZRNA 5B37A 2KBFA 4N54A 1KNQA 3U7FB 2NXNA 3OVMA 4PLCA 3MRXA 2E4VA 4DSZA 2F8MA 2AJLI 1RYFA 3EMDA 1OAOA 4LGVA 1VYTA 1ND6A 4RHXA