4JNKA

Lactate dehydrogenase a in complex with inhibitor compound 22
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
326
Chain Sequence
b'ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARSRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Identification of substituted 2-thio-6-oxo-1,6-dihydropyrimidines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 326
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jnkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4jnkA02
5G0UA 5FI3A 3IUPA 3UUWA 1LU9A 1HE5A 2H63A 2HJSA 4FJ0A 3RUEA 1XG5A 4YYZA 3ROQA 1ISIA 3ULKA 3VH4A 5EIOA 3GQVA 3ORFA 1OZAA 1HKUA 4ZICA 3WOHA 4ALKA 1V8BA 5AXBA 4EI2A 5KIAA 4J2HA 2IZZA 3LF2A 4N5MA 4U0JA 2D0IA 2UUOA 3K2BA 3GFGA 1QKIA 4YCAA 3GPDG 4XCVA 4TVOA 2QHXA 3EDMA 2O2YA 4XEHA 2NNLD 3RU7A 1QSGA 3L6OO 2AEMA 3RFTA 4BGIA 4FFNA 2B4QA 3GN2A 3OJ0A 5TF4A 2DTDA 4YJGB 2B37A 1NNUA 2WYVA 1GFSA 2X9VA 3X2FA 1MC5A 3R0IA 4KOAA 5COAA 1DIBA 3IDSA 3F47A 4DYDA 4QQRA 3F4BA 3O03A 5A05A 4JROA 4Q3BA 3MWDB 2RHRA 3ZV6A 5IDWA 5ILOA 4FB5A 1NXQA 4GX2A 3AWDA 2NU8A 5BSGA 3PWZA 4DRYA 6ADHA 3RI3A 3KYBA 5EN4A 1MLDA 1LC3A 2B35A 1CERA 4J6FA 1A4IA 3GUYA 4XQ9A 4BNMA 2FSSA 1GYRA 2PGDA 2OZPA 3JQ8A 4AJHA 5A3JA 4FFOA 2Y99A 3UGKA 4ZRMA 3ZWPA 3PHLA 5A9RA 4CLOA 1GCOA 4O1MA 1F12A 4WCFC 1KS9A 3DHNA 4NBWA 2Q1SA 2GZ3A 3JQAB 4I8XA 3TZHA 4JK3A 3AUTA 3F46A 3JSAA 5H83A 4ZHSA 3D1LA 1Q0LA 1Z45A 3H2SA 4CLRB 3DB2A 4R9SA 1ZK0A 4Q3AA 3IKTA 3IC5A 3NTQA 1SEPA 4KTTE 4OOFA 5THQA 1Z82A 4D3FA 1EBFA 3WQQA 1I24A 3VH2A 4FFRA 2JAHA 3PGXA 1X14A 2YHUA 1HDOA 5KKAA 1Y1PA 5K6AA 5GZ6A 3H7AA 1OBFO 3I1JA 1AHIA 4O63O 4P8RA 1P1RA 1H5QA 1QLHA 3U4CA 2P9EA 4W9NC 1VL6A 4CL8A 1F06A 5F1KA 1FXSA 4L75A 3AY6A 3FWZA 1JN0A 4FJ1A 1R66A 4JGBA 4D7AA 4IIVA 5JDCA 5JYDA 4NG5A 3ABIA 4YJHA 4WPGA 4ZA2A 4F46A 4D3DA 2Y1OA 4OKIA 4IQ0A 1A7KA 3F5SA 4GH5A 1T26A 2EWMA 4D41A 4PLTA 4DMLA 1MFZA 4LK3A 1R0KA 4GLLA 4CQMB 2OMEA 3TPCA 4OOEA 3DTYA 8ADHA 3VTZA 4U8GA 4IQGA 1U7HA 1ZH8A 3OJOA 4U6SA 2WWRA 2CNBA 4KWIA 1B3RA 5DNAA 4DIFA 2EGGA 4E2ZA 1ADGA 4OGWA 1T24A 4BNNA 5C7OO 1HTBA 3L6EA 4EEXA 4GSLA 4TZKA 1I2ZA 1SAYA 3Q3CA 3C24A 3MCVA 4W99A 3HG7A 4J43A 2O3QA 4WCFB 3KEOA 3RWBA 1C3VA 5F21A 3KV3O 3E6AA 2PD4A 4K6FA 4BL5A 5C5IA 1U3VA 1SB9A 2VZ8A 3NDRA 3JQ6A 4I5DA 3CZMA 4YJFB 4CM6A 4CMCA 2PGJA 5KJFA 4YT5A 4NBVA 1PGPA 3D3WA 1A7AA 1SO8A 2Q4EA 1LRJA 4FC6A 3T7EA 3ROPA 4BGEA 1NWHA 3KYCA 5T8KC 3NGLA 1JAYA 4D45A 1NQOA 1GU7A 4GL4A 2Q99A 4DA9A 1KEUA 3WJ7A 3KXDA 1E1KA 1UDCA 1YS4A 4GMFA 4BV9A 2DFVA 1U5AA 3HN7A 4Y6SA 4BO0A 2ZKLA 3D4NA 1DC6A 2VYNA 2HMWA 3WIEA 3TDKA 4UUNA 1TT5B 3DR3A 3VKUA 1U9JA 1PR3A 2DM6A 3RC7A 3WS7A 4BVAA 4E4YA 1X15A 2IODA 3ST7A 1XYGA 4MVJH 4UREA 3BHIA 3GHHA 2DBVO 1EQ2A 1KETA 1PIWA 2UUPA 1FDTA 4D42A 5ADHA 4CMIB 2WTBA 4PLFA 1DXYA 2AQHA 3EYWA 3IIEA 4KQXA 5KCZA 3HHPA 4LSWA 4DLAA 4XQGA 4WNIA 1P1FA 3GNTA 2VWHA 4HNHA 5AXDA 1EK6A 1E3WA 5CDUA 1KVRA 1P31A 1PJQA 2GR9A 1BHSA 4HADA 3G49A 3H5AA 4KTVE 3GLQA 4O59O 1U1IA 3F5QA 3LVFO 3NJ8A 4YT2A 5G0WA 4R5HA 3ROMA 5L7WA 1K6XA 2GCGA 1N9GA 4QEDA 3UFXA 4MVJF 3HDHA 4NK5A 1UXJA 4RPKA 4EJ0A 1M6HA 1ZK1A 5K9ZA 2HMUA 4ESOA 4PLCA 4RL6A 4YWJA 2P5YA 2P4QA 3JQBA 2ILTA 2B69A 4XGNA 4JP3A 1C14A 4BNYA 3C85A 4EITA 2P4HX 2FR1A 2W2LA 1WMBA 1YVEI 3PHGA 2DUWA 1MXHA 1XKQA 1GUYA 3CMCO 2Y0DA 4B7UA 4JBIA 4DXHA 4S3MA 4FR5A 1B16A 4XDYA 4DPKA 3DBHA 1DFHA 1TA4A 1K0UA 1E6EA 5ENVA 4J49A 4DREA 4WJZA 3GMSA 2W98A 3PZBA 3EMKA 3LQFA 1PJSA 4TMFA 1O8CA 4IZHA 3OH8A 3UOGA 2VNAA 1ZFNA 5EQFA 5T57A 1DC4A 4PRKA 4BNWA 4R69A 2AHRA 5JAZA 4RO0A 2SCUA 5L45A 5A9TA 2PKQP 1LBEA 3LU1A 1B15A 2UV8A 5IXSA 4IJUA 4BQPA 2HKIA 2C7GA 1H94A 3JYPA 1E7SA 4FFPA 4J9VA 3K92A 4IXTA 4MOWA 4R1UA 2CF6A 3IAHA 2DBRA 3ZV3A 4CV2A 2C07A 4J0EA 3GEGA 4E5KA 1LSUA 5I9LA 5LCXA 1I01A 4L73A 2V65A 1A9YA 1E1LA 1AXEA 1O94A 4XYBA 3X2EA 4IZIA 4I9HA 5T64A 4RPJA 2G5CA 1R4NA 3ONDA 3RSHA 5DZSA 3ASUA 3PEFA 4BNFA 3GNSA 3KUXA 1ZBQA 4R3WA 1CYDA 2NUAA 5CEJA 1W8DA 1J5PA 4OSPA 4DIOA 1K2WA 2CSUA 5G4KA 1OC4A 4NPCA 4MP6A 1R15A 2D5AA 2BMAA 2VHXA 2A4KA 4JJFA 5BNFA 3I3OA 4KUEA 1XGKA 1Y9AA 3ANMA 2QYTA 2JFHA 3RC9A 4CLHA 1OMOA 2OHXA 2V6BA 5JDCC 1CJCA 4J2OA 3JQDA 3H65A 4QO7A 4HFRA 1ENOA 1N2SA 5CG2A 1Y8QA 3AU9A 3PIIA 5L53A 1JAXA 4ND3A 1NAHA 4PLPA 4PGFA 5DF1A 1UH5A 4TSKA 5TGDA 2Y05A 1ENPA 4ZRNA 4LVCA 2JD1A 4II2A 2X5KO 5DCUA 1N7HA 2NTVA 3F9IA 4FOSA 3DL2A 4OIMA 3KEQA 3RD5A 3V1YA 1ZIDA 4O5OA 3H9JA 1GV0A 4L4RA 5CEEA 1B8UA 3JQ8B 5EERA 3BIOA 3ZW8A 1Q7GA 2EIHA 1ADCA 3U3XA 4OL9A 2NTJA 3HE3A 4FOOA 2YW9A 1U28A 2VYVD 3GGOA 4R5MA 2DKNA 1KBZA 2CDBA 4GWGA 1YDEA 1ISHA 2BFPA 3ENKA 3VPGA 1F17A 1DJQA 2Q4BA 5A03A 2W8ZA 4CQMD 1YQDA 3H9EO 4LISA 9LDTA 3PYMA 3WQRA 1YQGA 4RLHA 3WX0A 5B4UA 3GFBA 1Q7CA 2VOEA 4JCOA 4MIEA 2FSVA 3DBLB 4B4UA 2ET6A 5CPFA 2YFHA 3FRJA 3U4IA 1GUZA 1PS9A 1WAMA 1XHLA 4Y98A 2UVDA 4MJLA 2E6UX 2NACA 2ZYAA 4L8VA 1MFPA 5U9CA 2X22A 4Y8VA 4Z3DA 1BG6A 3EY4A 2J3IA 3RBVA 1PQPA 3SC6A 1QR6A 5IN4A 3JQCA 4JX8A 3D4OA 1BXGA 3DOOA 3PLNA 3QIVA 2FRDA 4L74A 1ZSVA 4RVFA 3H5NA 1EDOA 1WZEA 2OGUA 1HLDA 1ONOA 1DRVA 4NJMA 1VLLA 1MP0A 3UHAA 5KOIA 3GC6A 5CG1A 3H2ZA 4BNVA 1WVGA 1FMCA 3PJGA 3O8QA 4JJGA 3I9OA 4E5MA 2NU6A 2FOIA 4ZQGA 5TLSA 2WE8A 1EBUA 4NMHA 4WLEA 3ZWXA 2C2YA 3RUHA 1PJ4A 3ZU4A 2D5CA 1VSUA 2IXAA 4WKGA 3GVIA 5KVCA 3N58A 1I3LA 1L7DA 4FBGA 4EJMA 1H0KA 3I6QA 4WOKA 2YJZA 4F3YA 4MP3A 3BA1A 4BGVA 3RFXA 3WLEA 2O23A 2BELA 1V35A 4GX1A 5JMPA 4ZQEA 3L4SO 1MC4A 4XRGA 2D8AA 2VWQA 4AJJA 4ALIA 1FDVA 4P4NA 3OF2A 4WCDA 3JQBC 3WIDA 3PLRA 2B0JA 3WWZA 2V6GA 3W8FA 3DFZA 3TN7A 4DWVA 2H6EA 2YV1A 2RBEA 3ZI0A 3K73O 2O3SA 4Z9YA 3MJEA 3DONA 4PG6A 1W73A 3C1TA 1T25A 3AW9A 2PKQO 3D3WB 3JD0A 4NJOA 4BNKA 2VQ3A 2GUGA 5IG2A 1D4FA 2VTDA 2GF2A 4MVJM 1C1XA 3TWOA 4K9DA 3GN1A 5JCJA 3ZWBA 4J16A 4FS3A 5DCYA 1E1NA 3LLSA 1HE4A 3OQ1A 2IEDA 5G0SA 4DVJA 4ZN6A 5CHEA 2IEBA 4CODB 3VPSA 2Y66A 2J3JA 3GNQA 1EDZA 1LSSA 2Z5LA 1KERA 2V6MA 1QORA 3JD4A 1I36A 2JL1A 3IP1A 1KEWA 1LSJA 1LDNA 3DZKA 4BO3A 5L4SA 3MJTA 3PFFA 1PGNA 1J49A 4Z9FA 4G81A 4P38A 1LLDA 2ZQZA 4FD3A 1X7HA 3NDJA 4XX0A 1MB4A 3GEDA 1C0PA 4IS2A 4YDRA 4XR9A 1E7YA 2FPGA 1E3WB 4RZIA 1Y7TA 3FD8A 5GY7A 2D1YA 3UN1A 5JNLA 4LCEA 3NUGA 3GOHA 2XPCA 1XLTA 2ZTLA 3IP3A 2BHLA 3NV9A 3JYOA 4DMMA 1N9GB 3I6IA 3GF4A 1YO6A 4BNZA 3BMQA 5CPBA 5HWSA 5TRTA 4A7PA 5B37A 1ZMTA 4CUZA 3Q9NA 3IS3A 5A5EA 1WMAA 4RDHA 4ONEA 1ZXLA 4F45A 4GMGA 1UZNA 4OO3A 2QZZA 1R16A 4Z0HO 4CM1A 4IDDA 4W7IA 2VHZA 4BO6A 4ZJUA 3L77A 1I2BA 4LMPA 3R6DA 3INRA 3ZV4A 3VVBA 3ANNA 1JLLA 3PTZA 3I9MA 2QW8A 3NAQA 5CAEA 1NVTA 1E7RA 1B14A 3NTRA 2PWZA 5JAQA 2EJVA 3HDJA 2PZLA 4IMRA 2GZ2A 1NQAO 1TB4A 4J4HA 1UUFA 2DUUA 2YDYA 5KVSA 2RCYA 1F8GA 1C0LA 1IL0A 2O3TA 4L4XA 5TQVA 1GQYA 4FFLA 2AA3A 3PQFA 4ALLA 4BNXA 3N74A 3PP8A 4CR8A 3UAGA 4JNKA 3JD2A 3M1LA 1SOVA 3QWIA 4A73A 2WYUA 4ZU3A 4CMGA 3H6KA 3FBGA 1A71A 3LC2O 1F8FA 3GAZA 4U0KA 2FPPA 3I9LA 4J1SA 4DC0A 4NBRA 3IKVA 4R16A 1YJQA 3GDGA 4N5LA 3NT4A 5KVQA 3OSUA 3Q2KA 1ZSNA 1ID1A 3KHUA 3O4RA 4CQLA 2I76A 3V2HA 4YJDA 4PG4A 3L6DA 4TRJA 4JJIA 3OEYA 1KOLA 2HK7A 1V6AA 4Y67A 2EP5A 3HNPA 1BGVA 1D1TA 1R4NB 3EUWA 3E03A 1Z6ZA 4PFJA 3LT4A 1Q7BA 2NV6A 4J7UA 4YACA 3B6ZA 3OICA 3AI1A 1PJLA 3MWEB 2GGSA 1EVYA 1M6WA 3B1FA 4CV3A 5DP2A 4PG5A 2JCVA 4PLVA 3TQHA 5G4KB 3ZHBA 4BMSA 3DEYX 5C37A 1YL6A 2POQX 3U4DA 5I8WA 4IJKA 3AOEA 4MO2A 5EQDA 4OMUA 3FPLA 3R1IA 1DRWA 4KDEA 1SBYA 3PYLA 4XYMA 4UUPA 1U8FO 2ZTMA 5J23A 1JU9A 5GMOA 3RASA 3D5TA 3JYQA 5EL0A 5FYDA 3HFGA 3QVWA 5AVOA 2OO5A 1PSDA 4L0QA 3ZWYA 5DCWA 4NK4A 1EZ4A 1PQUA 2JHGA 1Y8QB 4IXWA 4J4TA 2D4AA 4JLWA 4GKVA 2Q1TA 1PTJA 5F5LA 4WLUA 3F1KA 4BMVA 1PGQA 2PD3A 3G3EA 3PDUA 4ITUA 1PZGA 1HZZA 1EVJA 4OQZA 4OXYA 2X58A 4GX0A 2VRCA 4E31A 4BKRA 4GX5A 3ZHXA 3EZLA 4NDNE 3KSDO 1PJ2A 3UF0A 1QXSA 1Y9EA 3TNLA 5L4NA 2XOXA 1DAPA 3LLVA 1YL7A 5TT0A 3VKVA 1XA0A 4LMRA 3E18A 5JBIA 4URFA 3AUSA 2VHYA 2UYYA 1ZEJA 4MVJE 2R00A 3WMWA 2FZWA 3RFVA 5JAMA 2X0NA 4GQAA 1V9LA 3AFNA 4A10A 2YHIB 4E32A 1OFGA 1NP3A 3VHRA 1HETA 1DDOA 3RKUA 3QY9A 4M89A 1NYTA 2QG4A 4OKNA 1P1JA 3ONEA 3OIDA 3SLKA 2TMGA 3OJEA 4INAA 4MVJP 3S8MA 3KYDA 3GPIA 4JBHA 1VL8A 4H16A 4I9NA 4PN3A 1XEAA 2EW2A 2GN9A 1AE1A 3SJ7A 5COQA 1EQUA 1T1RA 1Q0QA 5JDIA 2E82A 2I9PA 3M2TA 2IYOA 1UXGA 2IZ0A 1Z74A 2Y1CA 4EYEA 3VC7A 3R3SA 1ZJYA 5L7YA 1H6CA 5ITVA 5H81A 2ZK7A 4Q3DA 4D0RA 4EW6A 3W4KA 2GYYA 5JAIA 1UP7A 1LRLA 1HLPA 1K3TA 2GPTA 1XELA 4NNJA 4K28A 3GVXA 9LDBA 1R0LA 3CINA 4I08A 3K6JA 2G1UA 4QTZA 4EUFA 1I2CA 2O2SA 4ZGWA 2X86A 3O8QB 4O0LA 3WLFA 2OORA 4TROA 5MDHA 1C1DB 4QECA 4PRLA 2ZB3A 2PY6A 4NH4A 1M67A 2JCXA 1LC0A 5JLAA 5CDTA 1ZEMA 2I3AA 1TLTA 1WLYA 2UAGA 3NEPX 2I5PO 4RDIA 3C7AA 5A9SB 4PG7A 3ZCXA 4RVUA 1HWYA 1NR7A 1LDMA 1B2LA 1B8PA 5HTOA 1YB4A 3R3JA 3E8XA 1X13A 3CMMA 3RUDA 5JMWA 2CZCA 5IZCA 4CM4A 1IE3A 2JJYA 1UZMA 1E7QA 2Y0CA 4YAJA 4YBZA 4OAQA 5COBA 5I8ZA 1C1XB 4RVDA 5BSFA 3CTMA 3GEMA 3G1TA 2YQ5A 4CUKA 3KSUA 3DZBA 3B1JA 2A92A 4QXMA 1TEHA 3ZWNA 3VH1A 4AJ2A 1CQIA 3G1UA 1TXGA 4FDAA 4RF5A 3UKOA 4M1QA 4BNJA 4GSKA 1LNQA 3PZRA 3SC4A 3M2PA 3WGOA 4MINA 1A27A 2YQ4A 5I7FA 1QMGA 2WD7A 3BMOA 5T6BA 3H3FA 2AEJA 3EC7A 4R51A 3QWHA 1MG5A 3QWFA 1CEQA 3GVHA 3I52A 3VH3A 3QWBA 1KY5A 2GDZA 2P5UA 2WE7A 3HDQA 3K9QO 1LDBA 5KJ6A 5KJ1A 3WBFA 2HAEA 1SCUA 5C7IO 1KY4A 4YRDA 3WQSB 5H82A 2J5RA 3K2EA 3QQPA 1VRWA 5L3ZA 2GN8A 5B4VA 2ZCUA 2OOSA 3BMCB 3K8ZA 3OEWA 1ZCJA 4PLZA 3BMNA 3C1AA 2RIRA 1WDLA 3DHYA 2CD9A 1B3BA 4IM7A 3KETA 3PPIA 3JD3A 5FI5A 2GD1O 3LYLA 3TL3A 1HXHA 4DUPA 1S6YA 1VPDA 6LDHA 3VPXA 4TKMA 3D64A 4MKXA 3PHIA 7ADHA 4IPTA 3ZU3A 1R4MB 2FMUA 2NU7A 1LRKA 4LN1A 4D44A 1YRLA 2VUUA 3FN4A 4QT0A 4QUKA 5TS3A 1B0AA 3O9ZA 4XJTA 1DHTA 3CH6A 2CDCA 4BKUA 3H5RA 2EGHA 2PH3A 2DBZA 1LTHR 4NI5A 2ZYGA 1P1IA 1HDCA 4KDFA 3ANLA 2GRAA 4MDHA 5CDYA 3UVEA 2QRLA 2RHCA 2I3GA 4BO5A 1CETA 1CF2O 3WYCA 1UR5A 2JCYA 1GQ2A 2LDXA 4YAGA 1R37A 1HF3A 4CMBA 1GAEO 4HY3A 2I6TA 4YVFA 3ICCA 2EW8A 3ZWVA 2GN6A 2EKLA 3ETDA 3JQGA 1CQJA 3RBXA 3D0OA 3L4BA 5G0VA 1PWXA 1PGOA 3NJ4A 1A9ZA 1YGYA 2E37A 1T4BA 3FHLA 3W4JA 4HUJA 4DQXA 2CY0A 2YYYA 4J1QA 4BKQA 4PVDA 5BSEA 3VZQA 4J7CA 4OXKA 1JKJA 5TJ9A 1LA2A 1KEVA 3AUUA 2WD8A 1E5QA 4PZCA 2IXBA 3T7CA 3LDHA 4HXYA 3OETA 1K6JA 4I9UA 1J0XO 3OQ6A 4NZ9A 4K6CA 3V8BA 2Q49A 3T4XA 3ZWMA 1EE9A 3W6ZA 4II3A 3EGOA 2J8ZA 2WYWA 5IFLA 3QW2A 3RC2A 4JXKA 2JFGA 4P4GA 1T2DA 1YBVA 4XR4A 4BKPA 2BKAA 4LW8A 3F3SA 4RPHA 2WSBA 3MZ0A 4BV8A 1XIVA 3DAPA 3E48A 1EFKA 1V3TA 5AXAA 2EXXA 2IDZA 3I5MA 4LCJA 4BO7A 1P77A 1ZK2A 4WEQA 1N1GA 4KZPA 3PI7A 1C0IA 5I7SA 1ORRA 4FCCA 3B1KA 3QWAA 2YUTA 3TL2A 4B4WA 4FFMA 3JQAD 2QZ9A 3D3EA 4HNGA 2FN7A 2O7SA 5K6AC 2QQ5A 1HRDA 4IGFA 3DWFA 4OQYA 5BR7A 3ITDA 1G0OA 2X9NA 1KVQA 2R6JA 2JD0A 3T4EA 5EINA 3PJDA 1A5ZA 4WOJA 3LSYA 3FNHA 4B3JA 1T2CA 1ZSYA 3V5NA 2NVBA 4ZQHA 1ZK4A 3DMTA 4Y6PA 4ND1A 4AJLA 5KJCA 4FQ8A 3WNVA 5B4TA 4BO1A 3UW3A 1WZIA 4AJEA 3C7CB 5IF3A 1GTMA 5A3VA 1J4AA 4B3IA 2AXQA 3JYNA 3EVNA 2XXBA 4CV1A 3ZW9A 3DZIA 3DDNA 4CM9A 3EW7A 1I5RA 3WNQA 3IJRA 3MJCA 3FI9A 1MV8A 3A1NA 2QX7A 2BFAA 4IIUA 1Z75A 4Q3EA 4TRNA 1X1TA 5I9MA 3VPHA 2AQ8A 1GADO 4TRMA 5JYEA 2PNFA 1N1EA 3ADOA 4CLOB 5BSHA 4YJGA 1MUUA 2A35A 1A4UA 1DEHA 2X5OA 3BHMA 3STHA 5L51A 3JV7A 3AFMA 3D7LA 1N5DA 3LF1A 4QX6A 1D8AA 2AQIA 4R68A 2Q2WA 3AM5A 3U62A 1HYEA 4XZ3A 2J3HA 2FZEA 4NBTA 1U2GA 3SVTA 1E3SA 4IDFA 4GBJA 4GVLA 4O6VA 2BI8A 4BGUA 4BS9A 2BFOA 1Y5RA 1DAOA 2B5WA 3ON5A 3I83A 4Z3KA 4MPDA 2ZB7A 4AL4A 3QVSA 4YXFA 3OA2A 4E3ZA 3VZRA 1PZEA 3TFQA 1RYDA 1WW8A 5DN9A 3I4CA 1YE3A 2V6FA 2H9IA 3BTOA 1ADBA 1GR0A 2PK3A 4CLDA 3ADPA 4CJXA 1YQXA 4RV9A 3KM0A 3D4PA 4E0BA 2EF1A 4FN4A 4AJOA 3WWYA 1LDGA 1WPQA 1E5LA 4M86A 3UCFA 1NHGA 3GZ4A 3ONFA 1P45A 4YJHB 4ZQFA 4CLRA 1OOEA 1LDEA 2HSDA 3U4HA 3DTTA 1V3UA 3QJ5A 2QYSA 4RJTA 5HM8A 4RQTA 4DL9A 1MX3A 1IPEA 1X7GA 4NFYA 2Q46A 2VZ0A 1IHYA 3GDFA 1UAYA 3PQEA 1Z73A 3PDJA 1O5IA 1U4OA 3GY0A 4XGIA 4A26A 4NFHA 1HYGA 1SB8A 4YT4A 1NX6A 3EHEA 4CM8A 1TI7A 3AUAA 2O48X 1D7OA 4NIMA 4CM5A 3M6IA 4DBZA 4MVJA 5T5QA 5JCXA 1XWFA 2W4QA 4XIYA 4CV0A 5JS6A 2J3KA 1ISJA 4J9UE 1HDZA 2YFQA 4MVJI 1U3TA 4CM4B 2VTEA 2VWGA 1YDWA 3DHEA 4EJ6A 4CMJA 1FK8A 2DU8A 2Y1FA 3OBBA 5AQ1A 1JVSA 2VYVA 1DC3A 2C54A 2HU2A 3CZRA 2X0JA 2X5JO 5TX7A 3VPFA 3DC2A 2CDAA 2NU9A 3QVOA 2NQTA 1JW9B 3U49A 1WNTA 3BHJA 4CQMA 3TFOA 3F1LA 2WDZA 3CSDA 2DBQA 3HB5X 3HFSA 3KYCB 1WXDA 1P3DA 4TKLA 1GCUA 3S2GA 4BNHA 2F1KA 2JKVA 3CPSA 1YOVA 1N8KA 3GGPA 3TF5A 1GY8A 4CMKA 3INTA 5CEFA 1PWZA 2NM0A 2WJPA 2DT5A 4N5NA 3WTCA 3P2OA 3V2UA 1XQ6A 3L4BC 3P2YA 1SOWA 2WD7B 3BMOB 3MJSA 5EESA 4OHUA 4BO2A 4GLOA 4WCFA 3WGYA 3P5SA 4BB6A 3SX2A 3C1OA 3DOCA 4CMEA 1BSVA 3FF4A 1EVZA 1YBMA 1QYXA 2BF7A 1EE2A 2ZTVA 4JIGA 4RLSA 5ILGA 4HFMA 4KQWA 4R3NA 1LQTA 4XQEA 3GG2A 3IOYA 2Q2QA 3QHAA 2FHSA 3LT0A 3COSA 5HS4A 3CE6A 1VC2A 3Q6IA 3WGZA 3BXXA 3QA9A 3Q2IA 1U5CA 3V1TC 1K6IA 4IQ8A 3L9WA 3Q1LA 1HDYA 1BRMA 2EKPA 4EBFA 1OC2A 4I5EA 4GWKA 4B4OA 1GEEA 3OP4A 4E13A 1GYQA 4LVUA 3WGIA 3ZHYA 3GAFA 3ZU5A 1NASA 1PU2A 2HQ1A 3WGTA 4RZHA 2ZJ0A 2Y1DA 3G0OA 2HCTA 3AOGA 2B4RO 1XDWA 3F4LA 4H15A 5DBFA 3RAJA 1XCBA 3E5MA 4ZQBA 3ZWWA 1TT5A 4R9RA 3JQEA 5B12A 4EUEA 2VRBA 3KRTA 3LK7A 1YJ8A 1UXIA 5JE8A 4BHTA 1P1KA 3TOXA 2VNSA 4OYRA 4XB1A 1VJ0A 2FY8A 1R6DA 3V1UA 1D3AA 2Q50A 3Q11A 4A2CA 3PHJA 1ZJZA 2G76A 2HMVA 2NVUA 4N18A 2H5LA 4EGFA 1DOHA 1E3EA 1K89A 1AN9A 1GL3A 1H6BA 3NX4A 5IDXA 3C7DB 3TZQA 5LC1A 4NU5A 4M8SA 1E3JA 3H4VA 3RUCA 3KOUA 4NFSA 1Z7EA 4E30A 1NBOA 3DBHB 3DMTC 4FW8A 1QYVA 1YH3A 2ZIZA 4GGOA 2O50A 4NU6A 4FPXA 5ICMA 3CKYA 3P19A 1U3UA 1XSEA 2PLAA 2Y93A 1QG6A 1GZ6A 1UDAA 3DBVO 1PQWA 5FEUA 3W6UA 4D0SA 1GPJA 2G17A 3FPCA 3RCBA 1P74A 4XYEA 1PX0A 1BW9A 4FSHA 3K30A 5U1PA 1CWUA 3DAFA 1WDKA 1M2WA 1AHHA 3H8VA 5KNLA 2OBYA 1C0KA 4CR6A 2G82A 4ND4A 4XIJA 2EERA 1RM4A 1PS0A 2PZKA 1NPTO 3GT0A 4UVHA 4HX5A 3H9GA 3OIFA 4XQCA 1DJNA 1PJCA 1SZJG 3N7UA 3DAGA 4BMNA 3DBRA 1YL5A 2I65A 2DPGA 3GA0A 3EK2A 3VZPA 3JQ7A 4MKZA 1MA0A 2OUIA 1ARZA 1J6UA 4PZDA 3AJRA 1IOLA 1D1SA 5T8KA 4BO8A 4CMHA 5L7TA 4E21A 4NBUA 5JW6A 1HE3A 3WYEA 1HE2A 1NFFA 1P0CA 2CF5A 3IQDB 4BNIA 5BNTA 3AY3A 2Q1UA 3S2EA 1YB1A 4PZEA 1DO8A 2I67A 3PWSA 3FSRA 4RPLA 4DLLA 3NDIA 4H7PA 1JTVA 2ZB8A 2RAFA 2ZB4A 2Y1GA 3FNFA 1IHXA 1EK5A 4KWHA 1DBVO 4X54A 3ZDFA 4UULA 2YDXA 5ER6A 4RVSA 3B20A 3FNGA 3GH3A 1H6DA 1CDOA 4BUCA 3RJ9A 5F5NA 1FDUA 3WGQA 3AI2A 1U8XX 4UUOA 1Y8RA 2EV9A 2EHDA 1HDRA 1V0JA 1BDMA 2BGLA 1KIFA 2VT2A 3E9QA 3L0DA 4K1LA 4ROSA 1G1AA 1ONNA 3GR6A 4UAGA 3SBOA 4ALJA 4CR7A 4AJ4A 1IY8A 3W4IA 2C7VA 1ISMA 1EFLA 4Q3CA 3I9KA 1O95A 5AOVA 5IZ4A 1DLJA 3FTNA 3MTJA 2NWQA 2FR8A 5AXCA 4U7WA 1GEGA 3RJ5A 4DYVA 5GZ1A 3RU9A 3PFWO 1K5HA 2DC1A 4IUYA 1PEDA 4R1TA 1ZO8A 2VHWA 1LSOA 3K5PA 2I99A 3Q0EA 4J1NA 1IPFA 1PGJA 4IINA 4R1SA 1VL0A 4J0FA 1KVUA 1G0NA 4HKTA 4BKOA 3O26A 1H2BA 1M76A 1VM6A 3U09A 2AG5A 2O7QA 4PCVA 1X7DA 3O38A 2J5QA 1W6UA 5FF9A 4JN6B 4CM7A 5ES3A 3WICA 3OHSX 4WGGA 3VAZA 4A5OA 4FC7A 3QVTA 2ZQYA 2DTXA 4TQGA 4BOYA 3ZZNA 1TVEA 3A06A 2C0CA 1HSZA 4PLYA 4KMSA 3D5QA 3S2FA 3TZKA 2DFDA 4ND5A 5A5FA 2C2XA 1IUKA 3TRIA 1KYQA 1U3WA 2O4CA 1HSOA 2O3JA 2Z1NA 3OA0A 4Z6KA 2AQKA 3VDQA 5L95A 2YY7A 4CUJA 1LEHA 3CXRA 4DC1A 4BIIA 3IUSA 4BO9A 3DZHA 3ASVA 1UP6A 5EPOA 5JC1A 1AGNA 5JXWA 1HYHA 3HQ4O 1DLIA 1EUDA 5KVVA 4HBGA 5IDYA 4BNGA 1Q2XA 2CFCA 4G5HA 2VUSA 1VKNA 3NYWA 3ZWCA 4B7XA 1BXGB 2B5VA 5JY1A 1PL7A 4CMEC 4QFDA 1BMDA 1JWBB 2OFPA 1IYZA 2B83A 3UH1A 3AK4A 1P44A 3QV1A 4KUHA 5EJ2A 1H93A 1SNYA 3A28A 4FGSA 4NJMB 4WASA 4GGPA 3GUCA 1NVMB 4IJWA 5A4DA 1NFRA 2VUTA 1RPNA 3DBLA 1KVTA 3PJFA 1PZHA 4ZVVA 5ITWA 4UEOA 1B8VA 1DPGA 4D3SA 3ZNQA 2VYND 1DFIA 4YAEA 1UXHA 2A94A 5THKA 3CEAA 3JQ9A 4CM8B 4ALNA 4GAEA 2FR0A 1NWCA 3BAZA 5AYVA 3ZNNA 5L9AA 2GASA 1ENYA 4BNLA 3DO5A 3I4FA 2P9CA 2NTNA 4N7RA 4R54A 2Y67A 4LGVA 4U6QA 4WNCA 5DBGA 4IBOA 4XYLA 1LLCA 2QRKA 3PYXA 2GZ1A 5LDHA 3ZGYA 1QP8A 1I32A 2Y0EA 4DIBA 2B36A 3DQPA 5ER9A 4IY1A 3RROA 1EUCA 1QRRA 2BI7A 3RBZA 5CDSA 1FF9A 2BGKA 1JWAB 2BLLA 2ZATA 2C20A 1GV1A 3AU8A 1HZJA 3OQBA 4YPOA 1NM5A 2ZYDA 4TZTA 3WB9A 2XF8A 4NR0A 2OXIA 1M75A 5BT9A 4YRBA 3A9WA 5TC4A 1QV6A 3HADA 3TSCA 1OI7A 4UEJA 3ZNPA 1VE9A 2GSDA 2OL4A 3OMLA 5IN5A 1U4SA 1BDBA 1GDHA 1YOVB 1RM0A 2CUKA 5TNXA 1DFGA 1ENZA 5FWNA 1VJ1A 3MJVA 4R01A 2HJRA 2IZ1A 4M55A 2GO1A 3RUIA 2FWMX 8LDHA 3WGHA 1ZUD1 4J3FA 4QFCA 3WR5A 4B8WA 2BD0A 2Q2VA 4J90A 2D59A 5MGBA 2W2LD 3ZWOA 2IRWA 1F0YA 4XD2A 2ZTUA 1YXMA 2O3RA 3BYZA 1QYWA 2F00A 5FFFA 1T1SA 3INGA 4P4LA 5TJHA 2JFFA 3NT2A 2RH4A 1E92A 4I5FA 5DP1A 4K26A 2QIOA 2ZCVA 3FNEA 3ENNA 1Y6JA 1ML3A 4GPD1 3KBOA 4B3HA 4YA6A 5F3RA 3DOJA 1BTOA 4AJ1A 4Z0PA 4BNUA 3HDYA 4LSMA 2OP0A 2AW5A 2Q1WA 1NFQA 3DZGA 3EAGA 1HL3A 4XB2A 5DBIA 4B8ZA 3JQFA 5TT1A 3MEQA 2AEFA 3KSZO 3LZ6A 5DDIP 4E2XA 1E6UA 2V7PA 4IDCA 5JO9A 1NTOA 3IJPA 1O6ZA 1P33A 4D79A 5C7LO 1XU7A 4UUMA 4YQYA 1PJBA 3BMQB 4KP7A 4CL3A 1H2HA 1R12A 1KC3A 2E49A 3QVXA 1LLUA 2VWPA 5DOVA 4W6ZA 1VSVA 4R4JA 4E2WA 4Q9NA 2EKQA 3WSWA 1GZ4A 1I8TA 1I3NA 4W4TA 4AFNA 2DAPA 2HK9A 4A0SA 1PR9A 2DTEA 3I9JA 4WEOA 2UDPA 1AXGA 2NVUB 3AOEC 4TVBA 3TZ6A 1E7WA 2E4AA 3ICPA 1N7GA 5LDGA 3RUAA 2PV7A 1NQTA 3KO8A 2HRBA 1DRUA 3Q9UA 4DTIA 3GGGA 3ZHZA 2BFMA 3KLPX 4U5QA 2EJWA 2YV3A 1I3KA 5IJZA 5JFOA 3QSGA 5I7VA 4AVYA 3PRJA 2R2GA 4MIYA 3SEFA 1ZVMA 5I7EA 5KJEA 3A14A 3HJAA 4GVXA 3GHYA 1EUZA 1ISGA 1S7CA 1SEVA 4DGSA 5IAAA 1CRWG 1BXKA 1BW9B 3RVDA 4BB5A 3WXBA 4KUGA 4CMAA 1PS8A 1UAGA 2PTGA 3E82A 2GERA 5G2OA 2I66A 4E33A 2ZJ1A 3LC7O 2NADA 4RCVA 1ZKMA 3QRWA 1EMDA 3DZJA 3L07A 4E5PA 2AG8A 3DBRB 3WJAA 2R00C 4YTEA 1A72A 3JQ7B 1I33A 3C3XA 2IYPA 4M49A 4XDZA 3AY7A 3RUFA 1JDJA 4CM9D 2J5KA 3LT1A 4CQLB 3DMYA 2Q3EA 3HB4X 2HUNA 2PKRA 4FGWA 1RKXA 5IDQA 3LT2A 5CP8A 2Y68A 2W2KA 4G65A 1DIAA 3KB6A 1B7GO 3OJLA 3UXYA 4S1VA 4YT8A 4WLOA 1HDXA 4ILKA 1E3LA 4YR9A 2J6IA 1PL8A 2B4TO 4D43A 3E9NA 4E5YA 4QO8A 1SMKA 3UCEA 1O89A 1E6WA 1QV7A 5JDIC 1GQQA 3VZSA 1YWGO 4L9RA 1ZXBA 3ZNOA 1Z7BA 4BNTA 1LX6A 4P22A 2BH9A 4MIOA 2NSDA 1EVIA 1L7EA 1ZW1A 3AI3A 2W90A 1JKFA 4ALMA 3M1AA 1Y8RB 1LXCA 2PZMA 1MGOA 3GZNA 4WK6A 5L4LA 3PXXA 5I9NA 2DQ4A 3W8EA 5A02A 1SPXA 2NLOA 2X1HA 3I23A 1W4ZA 4XYGA 1IZ9A 2PGLA 5G0TA 2HDHA 2HK8A 1BVRA 4J4BA 5F1OA 3V2GA 3ZN2A 1X0VA 2H1SA 3QLJA 4H3VA 4A03A 3NT5A 1PL6A 5F1PA 2JAPA 1U2DA 1GZ3A 4IDEA 4RGBA 4A27A 2E48A 4LRTB 5DULA 2JD2A 2PH5A 4J91A 1O0SA 4G2NA 1E77A 3ZV5A 1UXKA 3FWNA 3JQ9C 1LI4A 4YRAA 1LDYA 4IDAA 1YB5A 1NQ5A 2PFGA 3SJUA 4GI2A 2WMDA 1V3VA 3E9MA 3BTSA 4MP8A 3DXFA 1EEHA 5DT9A 5JC8A 3FTPA 3KTDA 1I10A 2PA3A 1Y81A 2YV2A 2Z95A 3HWRA 1UJMA 4XA8A 1E1MA 3PIDA 5HS6A 3W1VA 4WUVA 3S2IA 5JO0A 2LDBA 3ZU2A 3PHHA 1T2FA 5HA5A 5IZCC 3GRKA 4TRRA 1SC6A 3NTOA 1WP4A 3MJ4A 4MVJD 3RKRA 3HN2A 2XXJA 4BQRA 3BTUA 1ZMOA 1DSSG 1DHRA 3KYDB 1JA9A 3GRPA 4HWKA 1UZLA 4WECA 2C82A 1L1FA 2WEKA 2X4GA 1R0SA 1FDWA 4F6LA 3AM3A 5KWEA 2EG9A 1W0CA 4RF4A 4Z9XA 5ICSA 3FCOA 5CFZA 2OBNA 4IDGA 1UP4A 2DVMA 3FR8A 4BO4A 2BGMA 1KC1A 1RWBA 1PJ3A 2C29D 2JHFA 2PR2A 3VOSA 4HP8A 3IMFA 1KEPA 3PJEA 1H6AA 5IXYA 2CVQA 2YHIA 4AJNA 1X0XA 2C5EA 4C7JA 1YKFA 2XAAA 4L76A 3WDSA 4DLBA 4AG3A 1IB6A 1T2AA 1QYCA 4AICA 2O3UA 2RH8A 4JP2A 1P9LA 5JCJD 1DC5A 3KLMX 3JQAA 5G4LA 3FBTA 4JBGA 1NHWA 5JSFA 3U0BA 4XKJA 4IGEA 5BNIA 1NAIA 3ETGA 2HLPA 4FJ2A 1BXZA 4PLHA 1ULUA 1QLJA 3VVCA 1VJTA 1IZ0A 3DFUA 3K31A 4I1IA 3GDOA 2HMSA 3GG9A 3ITKA 3JQFC 1LJ8A 3HZZA 2GN4A 2X23A 4F6CA 4EZBA 2NQ8A 4Y6RA 3WFJA 2X0IA 4HV4A 2X9GA 1N92A 4ID9A 3JCZA 3KVOA 2EP7A 4C4OA 2OP1A 3BTVA 1ONPA 3EZYA 3FR7A 4I5GA 3A4VA 3S55A 1LQUA 2YZ7A 4IJVA 3NKLA 3E5RA 1FJHA 2EEZA 3JD1A 4IS3A 3PGJA 5CDGA 4PIVA 1E0DA 2X0RA 3JTMA 3IL2A 2CVZA 2HRZA 4IDBA 1C1DA 1GD1O 3G17A 1B26A 4YEDA 3F6YA 2P9GA 3OIGA 4E2YA 1ZZEA 3HUDA 3GMDA 1YBAA 1NVGA 4L4SA 4C7KA 5T67A 5KTKA 1G6KA 4CLEA 3MOIA 4RF2A 3G79A 4DQVA 2VCYA 4AJIA 1ZK3A 1GYPA 1NR1A 3H3JA 1PJTA 2NVWA 5A9SA 3GVCA 1XR3A 2HMTA 4QSMA 1P0FA 4LRSB 4XRRA 1JQBA 3DZFA 3H9QA 4Q3NA 2D2IA 3E1KA 1YONA 4MVJG 4NHEA 3TJRA 5DOZA 2HO5A 2VN8A 3NRCA 2BRUA 3PWKA 1O9BA 4DPMA 1AUPA 1GUFA 1RM3A 1RM5A 4E6PA 1DIGA 1QYDA 4M54A 3GVPA 4OXNA 4PLWA 1M66A 3SXPA 4CM3A 5A1TA 1ISFA 4YJFA 1Y5MA 3JYLA 3VTFA 4ND2A 4GKBA 3ROKA 3U5TA 4DPLA 1VI2A 4N54A 1JKIA 3OECA 1F14A 2FPIA 2TMDA 5ENDA 1H9BA 2Q45A 1FDSA 2GLXA 2A9FA 1I3MA 3HSKA 3SLGA 4FIZA 4TWRA 1MXFA 4HFJA 3BMNB 3WYBA 4RVGA 5TSDA 3KZVA 5JY6A 4DBVO 5B1YA 4WE3A 1HDGO 1HEUA 5HRUA 3QE3A 5HBRA 4W82A 3P7MA 1OAAA 3H9UA 4JQCA 5JPIA 5BQFA 1I30A 1DB3A 4OH1A 1DIRA 4WLFA 4YB8A 5GZ3A 3CIFA 2P2SA 1ADFA 4YAIA 4NQZA 3PVZA 4EDFA 7MDHA 3RIHA 3AM4A 2VHVA 4MKRA 4W9NA 1NPYA 3MOGA 4B4VA 5A04A 4Y9DA 1WWKA 2VZ9A 3WGGA 2FP4A 2DLDA 1MG0A 4UVIA 4R41A 4J1TA 1T2EA 4RPGA 4W7HA 3U9LA 3UICA 3EVTA 3BZUA 3TZCA 4CMIA 1DIHA 1ULSA 2P91A 1I0ZA 1RJWA 3C8MA 4EEZA 1GPDG 3BMCA 2VOJA 3WG9A 3WSVA 4OJNA 2O4UX 1X1EA 4RORA 4J7XA 4XJSA 5U4QA 3CUKA 1P1HA 1U7TA 5EMHA 2PZJA 5C3MA 3MTGA 4PVCA 4AJKA 3JQGB 1NPDA 3WBBA 4D46A 4UVDA 4Z0TA 1UDBA 1IULA 4B7CA 1R4MA 4E5NA 5KKCA 1BVUA 3WMXA 1ZNQO 4WLNA 5TIIA 4CPDA 3K96A 2X7HA 3WFIA 2PD6A 2X8LA 3OM9A 2D3TA 4M87A 1E3IA 1HT0A 4DQUA 4XWYA 1WDMA 3VDRA 1RYEA 4RF3A 1XQ1A 3OJFA 4HFNA 2C59A 2WM3A 2P68A 3QP9A 5L40A 4IMPA 2CVOA 4PLGA 2VRCD 2C5AA 3RQSA 2AE1A 1LLQA 2W2KB 1BWSA 3UCXA 2QRJA 1VKOA 4XGKA 1XU9A 3PQDA 4PG8A 1H9AA 3WTBA 3OFSA 3NGXA 4E12A 3LC1O 4RVHA 1E7MA 2AE2A 5K0ZA 4ZD6A 3PK0A 3RC1A 4WLVA 2VT3A 3ZH2A 2IE0A 3S1LA 4B79A 1JVBA 4Q39A 4R1NA 4YQZA 2X6TA 4UEKA 4OSOA 1T4DA 4UVEA 1Q0HA 2DPHA 1CIVA 3W8DA 2CMDA 4YAKA 3I9NA 4OM8A 2G0TA 4UVGA 3GZNB 3L9XA 1LUAA 1TT7A 1Q1NA 5A06A 2Y1EA 3ZWAA 3GK3A 2GNAA 4EUHA 2Z1MA 3ETEA 4RQUA 4CLXA 3TOZA 3B70A 4AJPA 1KVSA 1PZFA 2AMFA
chains in the Genus database with same CATH superfamily
4D8YA 3WJ1A 3TEJA 1IN1A 2COUA 2FPKA 4HDNA 1NVFA 13PKA 5FI3A 5A3RA 1II8B 4EPYA 1HE5A 2W8BB 2XEXA 2GEBA 2M98A 4QIHA 4R8RA 1Y80A 5GONA 1T8WA 4RCZA 421PA 1ECBA 2HCJB 1J1ZA 3OQIA 4FNOA 3ULKA 3DMDA 1BYUA 4G85A 5EJIA 2IYLD 2YICA 1OA1A 2OLJA 3FCAA 4GRAA 4P0QB 3R3XA 3AF6A 1FDOA 4IKOA 1L6IA 3EFHA 3W8NA 3WOHA 4YRPA 4ENTA 1V8BA 2XODA 4GZ5A 1FFXB 3V9AA 4EI2A 1THTA 1SIOA 5KIAA 4PGHA 3W5AA 2RAUA 1UIMA 2G9VA 2YIDA 3AB3A 2V7QA 4MWDA 1ISPA 3GGJA 4N5MA 4U0JA 2D0IA 1NRXA 3WGUA 1P7CA 5FH9A 3FNRA 1C4OA 1Z37A 3GLRA 4U3JA 3EDMA 4X8HA 4XCVA 1SC1A 2O2YA 3QMVA 5DLQC 3WLKX 4IIDA 1Z2NX 1REQB 3N6VA 3NTLA 3OOEA 4B76A 4IDPA 1Z4KA 2BFFB 1DG1G 2H9YA 3M6MD 3OJ0A 5FLYA 3SX0A 2DTDA 1O2DA 2B37A 1CDEA 2OAEA 3EWNA 3NHFA 2FQWA 4L15A 1K68A 3R76A 1GFSA 3V7YA 5FUQA 3AL0C 3R0IA 1DIBA 1ZD1A 4LECA 2NZXA 4Z4IA 1Q57A 3D8RA 4DLWA 4DYDA 5KC8A 1O3YA 1TAQA 3IV6A 3TKYA 1KEZA 1C7FA 2Z1DA 3EUAA 2ACKA 3I76A 2SKEA 1KTVA 2QTGA 5IDWA 4BJ6A 1A8IA 5IBQA 3FLMA 2WFLA 3FKSA 8MHTA 4ARCA 3K05A 3RI3A 1MLDA 1CUXA 2XVXA 3H5IA 4BLTA 3A2LA 3GEIA 5K20A 1FQKA 2GZSA 1NI3A 4AD8A 3A4TA 5AHXA 5F76A 1UC5B 4BNMA 3S8YA 3O3NB 4L8FA 5IK2A 2N42A 3AEZA 4AJHA 5A3JA 3C3MA 2Y99A 2YRXA 3R5TA 3I6ZA 5DNVA 3PHLA 2NZ2A 5TMEA 2IUTA 1GCOA 3O4VA 1NI4A 1XYVA 5IH7A 4WA7A 1F12A 1KS9A 1P73A 3N28A 2BM9A 4HN9A 2AN9A 3PENA 1QUFA 5F64A 3TZHA 4JK3A 3AUTA 1X87A 2RFLA 4MW6A 5HUHA 5JD6A 2H8GA 4WOPA 3D1LA 4DGQA 5K4AA 1JFSA 2IOFK 4LNHA 5T4HA 2JH8A 4ZO6A 3RK1A 5LQRA 1Q16A 4ENSA 4OH7A 1GQSA 3H2SA 4I1RA 4HVLA 1RI4A 5ENZA 1DQSA 2M6LA 4UOEA 1ZK0A 2XI4A 2ZETA 2VSQA 4HDQB 3JQQA 2RI0A 3IKTA 2QF7A 2PUHA 1AU9A 2N75A 2ZE6A 1SVOA 4RIIA 2QL5A 4I0WB 4M53A 2QTMA 4KTTE 4MCJA 4R8LA 3BWCA 3ZD8A 1UMBA 2EDCA 4C3UA 4FMDB 3ZNPA 4D81A 1DX4A 1I24A 5AM5A 1KP9A 1G2QA 4FFRA 1F6DA 3AIOA 4MV9A 3PGXA 1X14A 2ECQA 2RI1A 3B9BA 1Y1PA 4EHKA 4CWAA 5GZ6A 3KU1A 3H7AA 1OBFO 3U2QA 1AHIA 3LXXA 1P1RA 1U0GA 4HLNA 3FSJX 1FB5A 3NH6A 1RJGA 3R8XA 4E07A 4ENWA 1HX7A 1SCBA 3U4CA 2P9EA 3DE6X 3JRXA 1YS7A 3KKMA 4W9NC 3NZEA 3RTBA 2NX2A 1VHJA 1MO6A 1WQ3A 3LQ2A 3MT9A 4L75A 4E5DA 2D5LA 3AY6A 3FWZA 4KO8A 1C9KA 3A25A 1H42A 1Q12A 4IIVA 5JDCA 5FUWA 1FFAA 1NYQA 2A0YA 4W1RA 5CB6A 3B6KA 1H05A 1IC6A 1OCEA 4Y2RA 3SNKA 1MEOA 4BFLA 1SUFA 1F0NA 2C4NA 2ADFA 4TLMB 3MGAA 3WL5A 1JHUA 2P3QA 4GLLA 2UYGA 4LK3A 2R6AA 4B6GA 2XITA 1F38A 2VP5A 2VSNA 3IBGA 3OM1A 1JSXA 1JE1A 1K1EA 4LXTA 1MORA 5LZ7A 2C31A 3F49S 3OJOA 1NN3A 2NPIA 2WWRA 3TBHA 3UJBA 4ISCA 4Q1FA 4L8GA 4OQQA 5C7OO 3FUUA 1XCGB 4GBED 4QICA 4Y9UA 4URXR 4GSLA 4EYKA 4B43A 2DH5A 4W99A 3L01A 1SK9A 2CJPA 4J43A 2AMVA 1J20A 4WCFB 3K0CC 1I2AA 4AUKA 3KV3O 4K6FA 4HDAA 5LYJA 4N82A 2XBMA 4EG5A 5IP5A 2GA9A 2ID4A 4M7WA 4A15A 3JQ6A 2IIPA 4YJFB 4LF9B 1YD7A 4CMCA 1IJFA 5C4GB 3TW0A 3U3RA 2HR1A 1EIWA 5I7WA 2A88A 1YZHA 2OKGA 2J08A 3D3WA 1WNFA 2FGKA 3DTVA 3VJKA 4EY4A 3KQLA 1CIJA 1JYSA 1P81A 5JZ9A 1JAYA 2ZIVB 3NP9A 4KRYA 4KXWA 3TKAA 4YV2A 3T3EA 4O4HB 3I2YX 4ZOCA 1E1KA 1G17A 5FNVF 1TJNA 2E1RA 2EZ4A 3SYMA 1U5AA 3HN7A 3R0VA 1V4BA 5ERYA 4QWMA 3V4SA 2Q4RA 1T1EA 3ORHA 5IBRA 3UJCA 1O8BA 1DC6A 4K6MA 2VYNA 2HMWA 4AECA 3WIEA 2C8KA 4CKWB 1GGKA 4UUNA 5I47A 2A33A 4Q82A 4YQEA 5K03A 4ZVKA 1PR3A 4WN9A 2DM6A 5G1PA 3RC7A 4E4YA 1DEXA 1X15A 2IODA 5E6UA 4G8JA 1XYGA 4ZKDA 4UREA 2BFDA 4KBGA 2Z2XA 4ZYXA 3GHHA 1FPQA 3AHDA 4MYUA 4ZVPA 3EGEA 1LK7A 2OHIA 4V0ME 1ODCA 4CCYB 4LDAA 1FDTA 1OZGA 4GMDA 2AN5A 4ACAA 2DR0A 1BXRA 1XTSA 5KNDA 1DXYA 1WDWB 4GOND 4YRLA 3T1HB 5KCZA 3HHPA 4DLAA 5C51B 4CQNA 5K0SA 1KEKA 3GNTA 2N1MA 4MUMA 4UDOA 3FZEA 4JKYA 4AS3A 2PYIA 3GLGE 1YR3A 3PX7A 2QN1A 3C16C 2P6PA 3O2NA 4HAXA 1O87A 2GR9A 5J5AA 4E88A 4PX2A 3TRJA 2CLKB 3C14C 1G8FA 1OFUX 1X7WA 3F5QA 3LVFO 3IOEA 4FHZA 4H17A 5H4HA 4RESA 1SC9A 1FW6A 5G0WA 3ROMA 4QVGA 1Z12A 3I0NA 4I4NA 5CFRA 3EQ8A 1K97A 5A2QA 2GCGA 1N9GA 1KOJA 3HPRA 4OI4A 4A6DA 3EYAA 2Q3MA 2H07A 4FCTA 4F93B 4YRFA 4DCGA 4RMNA 2FMHA 1OHHD 1K7SN 1M6HA 2JHPA 2HMYB 2ZAOA 4ESOA 4PLCA 5EZSA 4YWJA 2WF6A 4C0SA 1XMJA 8OHMA 2H2IA 4Q05A 1L5HB 2OXEA 4XGNA 4ER3A 4EVQA 3HKEA 4FDMA 3C85A 2Y0PA 3J7TA 1EGAA 3ELDA 9ATCA 2RHGB 4EITA 4DAEA 4ENVA 3R7WB 4V0KA 1E2EA 1QUEA 2B5OA 2FR1A 2IYSA 3K0AA 4ZO4A 1U3DA 5K3FA 1YVEI 1TE2A 3CUYA 4EB3A 1XNHA 5JPCA 5FL7D 1H2RS 1CY2A 3CMCO 3DWGA 3ZV7A 4JBIA 4MUFA 3L8FA 3UT6A 5C8DA 5IHPA 1XP5A 3IVRA 2ZBQA 4XDYA 2XW6A 4YRZA 1HEYA 1SCKA 1DFHA 1WPRA 4RAOA 2I7DA 5DXJA 4J49A 4DREA 2XUZA 2G1KA 2VO1A 2JGEA 1QCZA 1C9JA 1WZNA 2CB0A 5CNKA 5AK0A 4TMFA 2PWYA 3E22B 3LHKA 4C0BA 1FP6A 4A3SA 4J0QA 1N0WA 1L3CA 2DWQA 2D54A 1XNRB 1ZFNA 4CF4A 1ZH4A 3VHQA 5T57A 3AW8A 3CE9A 2I29A 5JAZA 2R7NA 4OA8A 5BV1A 5IKXA 4WFJA 2SCUA 1R4AA 4X0EA 5A9TA 4F11A 3R0JA 1FP4B 1PQYA 1X74A 2V5AA 4Q34A 4HDCA 2IV2X 1UMCA 2PQ0A 4MS3B 2HKIA 1KWKA 1WCIB 1TU3A 3L1JA 2C7GA 3GPLA 1ADJA 3JYPA 3BWBA 1Q0PA 4BTVA 2O8CA 3FYCA 3P0EA 3ZE0B 1YC5A 1RQ2A 3WL7A 2YC4C 1NW5A 2CF6A 4FFSA 3EXG1 3IPYA 1B4DA 2DBRA 3T5MA 4HAIA 4Z7QB 2C07A 5JU6A 3ITNA 3QVGB 3GEGA 4J0JA 4KPUA 4UMVA 4LXGA 3DL0A 1I01A 4L73A 3T1OA 3MM4A 3QNMA 3H0EA 3V8MA 3I53A 2PUCA 1QF6A 2QG6A 2RGNA 1BCRB 1A9YA 3OTGA 4LX8A 4RJIA 4IKPA 4WA8A 3OUTA 4QNMA 1S2NA 2W93A 1O94A 4G2TA 5A7HA 4KRXA 3NHSA 3TR6A 3X2EA 4B5KA 5F2NA 1NLMA 4I9HA 1N6PA 5T64A 3I05A 4RPJA 2BEVB 2G5CA 1R4NA 5DMHA 3VC1A 1ZUWA 2CFIA 2VFAA 3K8QA 1V48A 1P7WA 3ASUA 4H7HA 5DZSA 3RSHA 4LAFA 1EFVB 4BE4A 3PFGA 1JLHA 1Z8FA 3S2YA 3GNSA 2FUG1 1ZBQA 2J3MA 1CYDA 2NUAA 1S3IA 2PUTA 2RGAA 1J5PA 2N47A 1HOTA 2H2WA 3D7KA 3KG2A 4OY3A 4UDYX 3UJ7A 3T1YB 3CUUA 1X94A 1OC4A 2XWJI 4Y2TA 4HEA6 2BMAA 5C5CA 1KJYA 2A4KA 3THWB 3OO1A 1UM9A 3C74A 4DDKA 2H1HA 2BKLA 5IF9A 1V8OA 3DKPA 1EUQA 3K20A 3CUVA 3CRW1 4JB8A 3KKKA 3PC7A 3FAZA 2ZVPX 3IURA 3M9LA 3OZFA 4R1LA 2BV3A 5DGTA 5GP1A 4EHDA 3QJYA 1KMIY 1YDFA 4D9KA 3JQDA 4XCQA 3OE7A 4HUQA 3Q8LA 3H65A 2GPWA 4IHJA 1KY3A 5K0JA 3H5WA 4UNSA 5C9ZA 3T12A 4X6XA 5AUNB 4ND3A 4KO3S 4L5YA 4NS4A 5I9TA 2V4MA 1XZMA 1ZVQA 2HSEA 4PGFA 4UCQA 4UNPA 5I4BA 1UH5A 4FE4A 2DE0X 2Y05A 4ZRNA 1JDTA 5GGYA 2JD1A 2A7XA 4X97A 1V96A 5DCUA 3AJDA 2GJ4A 2D2VA 1ULBA 2NTVA 3HL4A 4HQ6A 3MGKA 4OIMA 3KEQA 4F56A 3EPJA 2PSJA 2P5TB 1RJDA 4LNUA 4O5OA 5L8VA 1KDRA 4L4RA 2R47A 5LZ5A 4A9AA 5BSMA 5CEEA 1B8UA 3JQ8B 5EERA 3RVSA 2ZSIA 4OIFA 2EIHA 1ADCA 1QQTA 1TQHA 1XXHA 2WZDA 4LVNA 4TLBA 3U3XA 5KMGA 3G8DA 4NOMA 2YW9A 3L7LA 4P81A 3RREA 2H1FA 2MT9A 1WM1A 3C6XA 2CDBA 4P36A 4XXHA 3WLIA 1U7XA 2GM9A 2YNMC 3AP2A 4GM0A 5B5SA 1CFZA 2BFPA 4BLVA 3VPGA 1Z2CA 3H17A 2B1JA 2KBFA 4BRZA 3USZA 5EMJA 4CQMD 1YQDA 3H9EO 3UWKA 5H70A 3ZQJA 3PUXA 1XNGA 9LDTA 2GHRA 1GRNA 3PYMA 5E9QA 2P1DA 3WQRA 4M88A 2B7CA 3CNNA 2YMLA 3D3JA 1YU9A 4JP1A 4TXLA 4YRSA 4MIEA 1GGHA 3QBEA 3CZ5A 3PC8C 3E84A 3NIBA 4GPZA 2VXBA 4HJXA 2I1LA 3MD0A 1J8YF 1C81A 4DRXA 2LRHA 1E32A 1BOFA 5LP6B 1OLXA 2FSGA 2V3VA 1NX9A 4Y98A 2UVDA 5HKBA 4MJLA 2OZLA 3JAMA 2CMFA 1DCFA 2E6UX 3IALA 4H7DA 5KYVA 2ZYAA 1DUIA 2CVFA 4DDMA 2X5NA 1TYDE 3P4YA 3SAJA 4MQ6A 4ZPJA 2J3IA 3CF0A 1X3SA 1PQPA 1OI3A 3PFIA 2ABWA 3SC6A 4IKEA 2SKCA 3U19A 4MLDA 4XI9A 1G66A 2PT7A 1RLIA 1Z4NA 3HSSA 5DI3B 4C89A 4ZHQB 1SUWA 4FQ7A 2RE8A 1DRKA 4IGIA 3LNCA 4MEJA 4IJ5A 4CN8A 2P1RA 1UEJA 3DPIA 1J2EA 3QYAA 1VG1A 3GV0A 4L07A 3SE0A 1OT5A 1NN1A 2FRVA 3GBSA 1HLDA 4EI8A 3O7MA 1X8KA 4NZYA 1URPA 1P4HA 1PEYA 4F8YA 1I94B 2J3EA 3R8FA 4H6XA 2ZYRA 2XNDA 1MP0A 2LXNA 1J70A 2JLAA 4MW0A 3AVUA 1IQ0A 5CG1A 3H2ZA 2GCPA 4H6WA 4BNNA 2JLXA 4FMCB 1FMCA 1GL9B 2KLBA 4IIJA 1ZCZA 4HX9A 4MUNA 3TUIC 1AM4D 4JJGA 3AESB 4E5MA 1Z6XA 1U5BA 4I14A 2PS1A 1PJ4A 3L1UA 2G7MC 4U2GA 1VSUA 1G2PA 3U4GA 4KX3A 1XZCA 2IXAA 3LPAA 4N3NA 3HDTA 5K6TA 1YMUA 3E5NA 5HJ5A 3N58A 1JBKA 1E8MA 2IIBA 2LW7A 4FBGA 4PPGA 1H0KA 4EJMA 4WOKA 1TKRA 4ZYWA 1VCNA 5EFOA 2A0UA 3P9RA 4AX8A 4MR8A 3QOFA 5EJ5A 4PHHA 2CDRA 2HLDD 2ZPAA 1U7PA 5CXQA 1V35A 4NBLA 4Q5IA 3DEIA 1JSZA 1MC4A 3A4YA 1ZOSA 3L8GA 1NBAA 1FDVA 1NMYA 4U63A 4BP3A 3WIDA 2BEKA 2QGZA 1AZLA 2H11A 4HRXA 4P4UA 3LRXA 4Z2AA 1N2ZA 3WWZA 4YMTA 5LJLA 2IUFA 1LBTA 2FH5B 4G8DA 1F5SA 3EY9A 5F7ZA 3WRWA 1FC0A 1DGQA 1C8VB 1WXXA 2D13A 3PCTA 4WNYA 4ZOLF 3MJEA 3OUUA 4PG6A 1AG9A 2PX8A 4PINA 1KO4A 4PQRA 4G5YA 2W5UA 5HGXA 3MWJA 4BNKA 4NJOA 4POAA 4MICA 4RGYA 2QDXA 3WNBA 2VQ3A 3AKDA 4IGKA 1HY3A 5IG2A 5KYYA 4HTFB 4HZGA 5JSKA 4OX9Y 2GA8A 4GR4A 4QXAA 3ZVKA 1MX5A 2XMPA 5B58T 1NOIA 2G77B 2JIMA 3KWFA 1Z25A 2ZFUA 3GN1A 2XCTB 5JCJA 3UV6A 3OEED 2R96A 3TTUA 1E1NA 1V1MB 1H4VB 3OQ1A 3QH4A 4REQB 4E11A 1U8TA 4DZRA 4XVUA 4ZN6A 1OQAA 2Y4NA 3SF8A 3CONA 1CX9B 1WY7A 3EFEA 3JZIA 5B64A 1EDZA 5DW3A 3CPEA 4YRIA 1Z5GA 2DLNA 4B32A 4XLZA 1G8MA 3QFSA 5A4KA 2QN6A 5MN4A 3RW9A 1YDHA 1E3QA 1KEWA 3F7TA 5L4SA 5B7QA 3FLAA 3MJTA 4MQMA 1CR4A 5EYPB 1GM5A 1DV2A 1PGNA 1J49A 1VLJA 2K7ZA 5HCNA 4P38A 3SDZA 2NVOA 2ZQZA 3UJNA 3NBAA 4FD3A 3TXAA 1Z2OX 4JYZA 1NG1A 1P29A 1X7HA 3TL6A 1QHIA 4R71A 1QOPB 1QYIA 3GEDA 4FLFA 2V54A 1ECLA 1C30A 1CZLA 1TNDA 4YDRA 4I3HA 3O84A 1E3WB 1A5TA 5KDOA 1OXMA 1V8ZA 2D1YA 3DE1X 3EZFA 1G8PA 4F72A 4GICA 1LD3A 4RJKA 5A5VA 2WKQA 5CGQB 4Q4LA 5FUXA 2QD2A 3GF4A 1SU4A 3TEMA 3BMQA 2YWRA 5HWSA 4A7PA 4C3VA 4JLUA 5B37A 4CUZA 5KYUB 4WXPA 4I4TB 1IBKB 3HKDB 5CDFE 1RLTA 2JIOA 4L5BA 1GCIA 1THZA 2IDMA 3AJEA 1EXVA 4ONEA 1YB6A 1BE8A 1N9ZA 2ZJ7A 4C1NA 4XDHA 5DSXA 1Y6FA 4KR7A 1QG4A 3KC2A 3W5IA 2O7RA 2FWPA 2J07A 1Z4MA 2B21A 2HA7A 4F4FA 1NXVA 2MMGA 2VHZA 4K9PA 3V42A 1OLOA 2FQYA 2GB4A 4DLRA 4A5SA 3L92A 1W25A 3LLMA 1N5IA 4LMPA 1YHYA 1O95D 1VSBA 4WADA 3ZV4A 5HXAA 1TMYA 1UF9A 3FZGA 3ANNA 3K7EA 3L84A 4RS3A 4E1AA 1Q3TA 5ED0A 3D3KA 2FPWA 3CH5A 4M0UA 1E58A 1KI2A 2NV0A 3NAQA 4NYIR 3BK1A 3U7QB 1Q74A 3V55A 5CAEA 4ZV9A 1L9XA 2OO3A 1B14A 1UOQA 3EXIB 3LWNA 2IDJA 2CEKA 1VBFA 1WZCA 5JZSA 4FGJA 1FPMA 1LK5A 2AIRA 3NG1A 2EJVA 1FX0B 4F86A 3P0HA 3FWKA 3MCZA 2Y2UA 2EFCB 3UA4A 5EXSA 1TB4A 2D6FA 1EG2A 5C2JB 2NAFA 4G37A 2A86A 2XYQA 3TQOA 1X7YA 4IIJF 5KVSA 4TV8A 1WJGA 4L4XA 3OF5A 5TQVA 5LZ9A 4ZARA 2J30A 4D9NA 2XUOA 3NHKA 4BNXA 1E94E 1VCIA 3S0JA 5TY0A 4P83A 5IARA 3N74A 1ZN7A 1VL5A 4CR8A 1U8YA 1FBTA 3UAGA 3HCRA 4M4SA 5AESA 3D5EA 5KOHB 4X61A 4C29A 1SXQA 3PC4A 2ZUWA 1N2JA 3MXOA 4PPNA 2WYUA 5HDQA 4HN4B 3DEHA 4ZKEA 5SZJA 4TMVA 4OAPA 3USCS 1W96A 3M34A 5ALYA 4U0KA 5DRYA 4HWRA 2Y92A 5DNCA 2O8EB 5EXPA 4EATA 2XUPA 4J1SA 2WLTA 4DC0A 4DCSA 1GNRA 3QI7A 4X94A 4N5LA 5KVQA 3QITA 3IMGA 4TSFD 1WX1A 4AYXA 4KN9S 2HQSA 1UKEA 4XOUA 1J56A 3O4RA 2OV3A 5DX0A 5F2KA 4D8UA 5AVXA 4M7PA 3T5TA 5DXFA 4TRJA 4YCLA 5DW0A 5EUQB 2VDUE 1Z5WA 1ZIYA 2Z04A 4HTAA 4ZCPA 4FEGA 1D1TA 3CLKA 3H1BA 4XPIA 4HQLA 4WBNB 1A8HA 1RAIA 1T91A 3E03A 5A0FA 1NJ8A 3MAJA 2HWKA 2O1EA 3LD9A 4JVOA 4L51A 3UKDA 3TECE 4JDPA 4BMYA 1Z63A 3CLTD 5LFAA 2Q8QA 3OICA 3IDZA 4UHJA 4ZT5A 1PJLA 3X44A 1OXXK 4J76A 2QVLA 1IJEA 3WRVA 4DJAA 4PFKA 2HHJA 2HM7A 3X1MA 3PL5A 1LLFA 4PG5A 3TQHA 2B3DA 3DEYX 4W8GA 5CCXA 2AXEA 3AHHA 4B3MB 2POQX 3U4DA 3KJIA 2R86A 2WG1A 3A9TA 3D0RA 4IJKA 3UK1A 4G8CA 2YKGA 4TWBA 1DRWA 4KDEA 4RZ3A 1YNSA 3BWXA 4UBLA 4WTOA 2ZR0A 4XYMA 4A8PA 1AKNA 1NSTA 1LQ2A 3D5TA 3JYQA 2E3JA 1PBNA 1SZCA 1ZGGA 3O4JA 2J9FB 3QVWA 4FNAA 4B1FA 5EUCA 1UFOA 3E0XA 2I34A 3QE9Y 5DCWA 3ODPA 2EWVA 4Z51A 2I2WA 3LRTA 5KWJA 3QOWA 1EZ4A 2F17A 3G7NA 4NK4A 5ELXA 1Y8QB 4IQ4A 4PYNA 2ANBA 1XDUA 1X1DA 2D4AA 3B8EA 4GKVA 4NCHA 4NDAA 1Z8DA 5GWXA 2Q1TA 4ZZ3A 5F5LA 5HKAA 4WLUA 5FTLA 1TX4B 4IEFB 1PGQA 4GGMX 2GYWA 3E9YA 4ITUA 1HZZA 3ADCA 4OQZA 1E9BA 1UWCA 5CXSA 5EJ6A 3K4HA 4D6YA 3ROXA 1BFKA 4E31A 1ULAA 3KJNA 3DMHA 4QPZA 1M1YA 3EZLA 4KWEA 3KSDO 2PMWB 1FLNA 5F51A 1U1DA 4AC9A 4F3TA 3E81A 4ML3A 1YL7A 3QHQA 4LMRA 2YTZA 3B8HA 4URFA 4OXQA 1CFJA 4RK4A 1ZGHA 4K9QA 4XIGS 4RTMA 3RFVA 4GQAA 3RS7A 3AFNA 1RPTA 2C2OA 2HQOA 2VBFA 4RABA 4A10A 2YHIB 2WJ6A 3GXBA 4BWFB 1W88B 2D5IA 3IPRA 3VHRA 4EWLA 3AKZA 2WHEA 2PHZA 3OIUA 1LJUA 2YHSA 3QY9A 3DZDA 4M89A 1NYTA 2QG4A 3D2CA 1W48A 2PRIA 4D3XA 3AUJB 1KYYA 1LF0A 4MQ5A 1SH7A 1TDJA 5IAOA 1M34A 3MQFA 4YO8A 2NIPA 4INAA 2ODTX 4MVJP 1VDZA 2WTNA 3M8KA 4MR7B 1QHSA 3KE9A 4LFBB 1IG0A 2XDYA 4PNEA 2WI8A 3MWYW 3SJ7A 1YDMA 1ZU5A 2JZOA 2YNMD 3KOMA 4NV3A 5F2EA 2Q9BA 3H83A 2E82A 3U3OA 2I9PA 3M2TA 4RZ2A 3GRYA 4TVKA 5CCDA 2CUTA 2Y1CA 2CJFA 4JIMA 3GJZA 2A1TR 1IU9A 1H6CA 4EQ6A 4KVFA 4DR3B 3L49A 5FFMA 2OV8A 2QG9A 4EW6A 2W4IA 1C4XA 5EJGA 1ZITA 1DKMA 1HFEL 1OGJA 2GD6A 1ZNYA 2AJLI 1K3TA 5DCLA 3RRNA 2WWHA 4DG9A 1XELA 3CS3A 4NNJA 3QEAZ 3W6PA 1MC1A 4MHTA 2BKVA 1JPJA 5SICE 5I51A 4KLZA 3CINA 3N05A 4WQMA 1VBNA 4G97A 4NV0A 2N0SA 4QTZA 4UTVA 3B1ZA 4EUFA 4U8HA 2YMPA 4HH4A 1RP7A 3OZCA 4FKMA 1U0NA 2X86A 3BG5A 2V58A 3K4QA 5E2BA 3D7SA 2WJYA 5JISA 2OORA 1M2EA 2YS6A 4TXHA 1JG1A 1T1GA 2REQA 4O4LB 4OV6B 2WYIA 1IXRC 2ONCA 3RC3A 3IX7A 2J3LA 3TQRA 4IWXA 3UY4A 3CF4A 4JLMA 2FETA 5ALMA 2XE4A 1ID8A 1GPYA 2I1QA 2OFXA 1CK4A 2IT1A 4LOIA 4P32A 1AGPA 3RYCB 1EWTA 1R27A 1KORA 2NUPB 2I3AA 1VPLA 2UAGA 4DRZA 4CFSA 2CJYA 1M74A 2I5PO 3HLYA 4K9SA 2QLTA 5TQ0A 3W1WA 2BSQA 3FCSB 3OOYA 2PGAA 1YR1A 3HABA 1QC5B 2IH5A 2PBLA 4PGMA 4RQBA 4PFQA 5A9SB 2CV1A 721PA 4ZAXA 4PG7A 1W0JD 2WILA 4QRHA 1TECE 4B6JA 4K8OA 1HWYA 1KZ4A 2J31A 1G3MA 1P39A 2AJTA 4UAJA 1PE0A 2ZSUA 3JZMA 3E5HA 5BWBA 5HTOA 4Q7QA 1DKNA 1R0XA 2A0WA 3DXXA 4COKA 2PX2A 4L78A 1YB4A 2YZNA 5FBVB 5IM4A 1RRCA 2NMVA 4FYVA 4C06A 4HLUC 5FLEX 3WO0A 1NV9A 4HLDA 4JLPA 4ON9A 4YXWA 1UZMA 1E7QA 4LYEA 1Q7TA 4ZDKA 3B60A 5JVDF 4NMMA 4R1PA 2BM0A 5CLHA 1TC1A 4V1CA 1U2SA 4Q3LA 5COBA 3AWIA 2R8OA 3DDZX 1R6XA 3SS8A 1XDDA 5BSFA 5A6SA 3H4MA 1WG8A 4U9IS 5DK6A 2PO7A 3CTMA 5DEOA 1JDNA 3I37X 1C50A 2H5IA 1I4EB 2ATCA 4EHIA 1ST3A 1J8FA 2YQ5A 4CUKA 2G83A 4DWOA 3CRVA 3ESAA 2ZWOA 1W35A 3GMIA 4LJSA 4QXMA 4HAOA 4F06A 3VH1A 2SKDA 5JRDS 1JAIA 4JLJA 1NF8A 2VF8A 3K16A 1QFJA 1ZNZA 2AI1A 4RF5A 2GAIA 4FYHA 1PDOA 5EMLA 2J09A 4BNJA 2I9KA 2J59A 3ISVA 1KMCA 3IEXA 1LNQA 1Y6RA 5DYWA 3WGOA 1QCDA 3C5WP 2W6CX 5EXEA 5DYIA 1ZJJA 2I7VA 3ZYCA 1KU6A 3O93A 5IKMA 4RGQA 3T7AA 3FTCA 1XQXA 2VQEB 2QLJA 5FO1A 3R7SA 3BMOA 5HCIA 3EIQA 3H3FA 4P3PA 1SKYB 4HNAA 1K92A 4FFDA 3DEKA 4LZAA 5EHXA 3R9WA 3EC7A 1ECGA 5JJ5A 4OAOA 2ZSFA 3ZKAA 3RPEA 3QWFA 4C6SA 1CEQA 2J0UA 3JX9A 4CTJA 1OUMA 4KFTA 2GDZA 2P5UA 3DMRA 3NS7A 3QFTA 3QJGA 2D7DA 4RELA 3WXMA 1SCUA 1KY4A 1DI0A 3WQSB 2OGTA 3IV9A 4MGIR 3F71A 3QQPA 1X1AA 2GN8A 5L3ZA 5B4VA 1T8RA 5DTJA 4PLZA 3W2TA 3M7IA 4IG4A 1XPUA 4JA0A 1G5PA 2QL6A 1W581 1JECA 1WDLA 2RIRA 5DEIA 4ENUA 3KQKA 3F7MA 4XVCA 1V41E 2YV4A 2I54A 3PPIA 4IM7A 5DLDA 1MOQA 4Z54A 3KETA 1J2TA 1FVOA 2WMNB 3JD3A 4W1QA 2PV0A 1H3NA 4G5XA 5FI5A 3SSAA 3LYLA 3UWOA 4A0QA 4A1FA 1FFHA 5K0TA 1JPVA 4AX4A 3AH8A 1SXJB 2A78A 3AERA 4NJEA 2YHBA 2QMEA 4LHEA 6LDHA 1VLQA 4BQOA 1N5LA 5BN1A 1YVPA 5JUWA 5AHRA 3RAJA 2X0EA 3ZU3A 1YUNA 5AWFC 3ZVMA 1H8ED 2DJIA 2FDRA 1QFYA 4WVLA 1F8YA 1XZKA 4LN1A 3K2IA 3BFJA 3D6TB 4XD7D 3LY8A 1YRLA 2VUUA 2AR9A 4QUKA 1QNLA 3T5PA 4ZVRA 2CMGA 3N1UA 4LWPA 3KHKA 4GC5A 4ESVA 3RSCA 3CH6A 1M0TA 1RXCA 3QK7A 4TWZA 2DBZA 1TMGE 4KR6A 1JRLA 2G09A 1A9XB 3ANLA 3B38A 1ACMA 4PZUA 4S24A 4WGFA 2WSSA 2CV2A 1E9EA 3QFFA 4P2BA 4TLEA 2QJTA 3AKYA 3D4IA 5IT4A 2JCYA 1GQ2A 2OZEA 4YAGA 3O0TA 2J7KA 1PTJC 1QH9A 1ZD8A 4EY5A 1X2BA 4CMBA 5FPPA 2I6TA 2X0DA 5AW3A 2EW8A 2R1UA 2QTNA 2DGDA 3VQTA 5LYYA 4HAUA 2GN6A 5CT5A 4KQMA 3GJ7A 1J25A 3JQGA 1OJ7A 3MA0A 1XVTA 1LI5A 1CQJA 1Z26A 2XT0A 2ZZKA 1SUEA 3NCTA 1TLLA 5G0VA 3K9HA 1QHHB 1ZA1A 2E89A 4L2IA 1YGYA 3USES 3WWEA 4DQXA 2Z9DA 5LU8A 3ILYA 4J1QA 3SC2A 4PVDA 4CFZA 2C3UA 4LRUA 2OFFA 4ZIRB 2PDAA 3CVUA 3DV0A 3AVYA 1QO9A 1M1YE 3ISJA 3S4YA 2QVZX 3DF7A 4HI0E 5TJ9A 4DIKA 5IXJA 1NOJA 1KEVA 4CLXA 4DM7A 2WD8A 3LP8A 3C97A 2RHDA 5A62A 2FN9A 3HR8A 4TX1A 3A32A 2CLEB 4FU0A 1TKCA 1P6XA 5L3RA 3V34A 3A3YA 2GCIA 3K6SB 1QK4A 1K6JA 2BEWB 3D6HA 4MWTA 3NXKA 3OQHA 3QMWA 1PJ8A 4WZAB 4B8YA 3T4XA 3ZWMA 5TARA 1EE9A 1ZR4A 3W6ZA 4II3A 1MNAA 3QW2A 3RC2A 4JXKA 4BKPA 1HC7A 1X8JA 2Q6VA 2BFBB 2BJVA 2QRNA 4LW8A 1JLKA 2VJQA 3MZ0A 2AKAB 3E48A 2WA1A 2OGWA 1EFKA 3ZE1B 1U2PA 3WVNA 1OXSC 1BD4A 1DBPA 2PGXA 1RPJA 4QHYA 4UTOA 5CLIA 3WE7A 1KGDA 2IPMA 3L06A 1JG4A 1EU1A 2IY9A 3GJ6A 1A8UA 1TJ3A 3X3HA 3LDUA 1FU8A 2XGSA 3IESA 3QWAA 2CC2A 3TL2A 1Z2PX 3AO0B 3MINB 2QZ9A 4HNGA 1U0FA 4L6CA 2O7SA 3SHTA 4H4EA 3GAAA 2QQ5A 1X70A 1HRDA 1TTHA 1T15A 2B3TA 4Q1VA 1RKVA 4GI1A 5FHRA 1G5HA 3I2KA 3ITDA 4ND7A 4BEVA 4BQEA 3M6AA 2BDEA 3LZCA 2WHPB 4L0DA 1II8A 3QXJA 5L3SB 1XZDA 4QUIA 3SNHA 3PUZA 2W8BA 3FNHA 1HI9A 2MSWA 1XD2A 4MJ3A 4LK2A 5EEGA 1ZSYA 3HGMA 3FE2A 3B2QA 5TV2A 4UMDA 3DPSA 4JX9A 4M1WA 2FJUA 3PQ5A 2JJ1A 5KJCA 4AJLA 1XVLA 3QYFA 3HCDA 1RHMA 2WSLA 3A6PC 4DV3B 1A50B 4BO1A 3UG6A 3K9WA 1WZIA 1ZD3A 3ILHA 5IF3A 4DCCA 4JI4B 4Z5XA 3X0DA 1J4AA 1FFXA 4LOHA 3A1CA 2XXBA 1U9YA 2XUJA 3UJPA 4E5VA 2NU8B 3ZW9A 4E03A 1R9NA 1K7FB 3EW7A 1CUWA 4UOZA 3WJ2A 4Z9AA 2VHEA 5ALJA 3M3HA 1N6KA 2BBTA 2AZDA 4GNKA 2XGOA 4XM1A 1MV8A 1RXEA 2Q2OA 3A1NA 3TZBA 2C9MA 1CIPA 1NA5A 3I9V6 2CYBA 2WPNA 4TRNA 1IDN1 1X1TA 4UCXA 2B2NA 5I5GA 1REQA 3F67A 4EMTA 2AQ8A 2E85A 4AZVA 3G2OA 2PNFA 4WXHA 4TQ9A 4FWIB 1B1CA 1PF7E 3EUFA 4P5PA 4CLOB 3CPJB 5DGIA 3CJRA 5BMVB 1MUUA 3R20A 2A35A 5G1OA 1A4UA 3C5CA 1QZZA 1XPOA 3MTQA 4PNPA 2OD9A 3STHA 1NW9B 1ZOOA 4R8VA 1V16B 1DJLA 3TSYA 4QX6A 2JIQA 1D8AA 2OV2A 4G1MB 1CJSA 5DASA 5FTMA 3Q1KA 3T5GA 3AM5A 3N8IA 4GP7A 3HEBA 4PAMA 1EESA 1U2GA 1E1QD 4NZOA 4Q7EA 1H5NA 4Q00A 1X9IA 4S2UA 4IDFA 3ZKWB 4CG0A 1JB1A 1UZAA 4RK6A 4O6VA 2BI8A 5FJJA 5GIPE 4AZTA 4BFXA 2VA9A 4JXZA 4LSZA 1Y5RA 2YVLA 1BHO1 2XMSA 1XRJA 4URYR 4MPDA 5E4FA 2B61A 1QTNA 2ZB7A 5FUBA 4QUAA 3DNPA 3TVTA 3A0RB 1PZEA 1G6OA 3I4CA 4QLOA 3CZ9A 3ABZA 3CVYA 4DADA 1ADBA 4K7JA 3Q10A 1SUCA 2DXIA 2JCBA 3ESRA 3ZJVA 1YQXA 2OT3B 3AEUA 4FE7A 4FSDA 4UXIA 4RV9A 3TGLA 4H27A 1Z15A 4QDUA 1AO0A 2XOKD 3ZG6A 4LKOA 3WZ2A 5LQUA 3WWYA 1D9ZA 3U7HB 3BE8A 2HLNA 1LDGA 4M86A 1N2HA 3TQTA 1ZUIA 4L4YA 1ZOPA 4FI3C 4WY2A 1N34B 4I7EA 2I4OA 3TIIA 3GZ4A 1G7SA 3ET5A 3QIAA 4YJHB 4YRMA 4MYTA 4UBOA 1LDEA 2ZT7A 3KB1A 1UKAA 4JQSA 3TNJA 2QX8A 2II6A 3EEIA 3QJ5A 4RJTA 4C0QC 4RQTA 1PEAA 1J9EA 1IPEA 4P92A 1C8KA 3VVMA 1IHYA 1UAYA 3DCJA 1XHFA 2XA2A 3D6UA 1SVUA 1Z73A 3EVDA 3OPMA 3QE2A 1U4OA 2HEGA 4RVCA 3OIYA 4FHDA 4C08A 2F8SA 1E1RA 4CM8A 4QOFA 5F3WB 2O48X 4CM5A 4DBZA 2AV6A 1TTPB 2MTBA 3RAGA 1E2GA 4QU9A 4KQ6A 4ARAA 4PPYA 2UUCB 4XIYA 3PS9A 1USWA 1TTTA 1MRNA 1ISJA 4J9UE 1MO3A 4D25A 4GWLA 2FE1A 3FW1A 1L5VA 3RTCA 1YACA 3C6KA 4BLUA 4HH3C 3L43A 3DHEA 2J45A 1VRVA 4JJKA 4M0EA 4Z1MD 4CMJA 1FK8A 1LF5A 2IF0A 3OBBA 5AQ1A 2ADMA 1BEZA 2BOVA 3BWEA 4I3FA 1WQ1R 3DE0X 4QQNA 4U2EA 2OCDA 4L3OA 1AHNA 4EHLA 3TR5A 2QUKA 3PDIB 3S1AB 2CDAA 3PL1A 1GTSA 2ONYA 2NQTA 1JV2B 2I7CA 1T6BY 1W85B 1PJRA 4K3VA 2BISA 2VLBA 4NBNA 3U49A 4LOAA 3HFSA 1U99A 3LA6A 4NABA 4RHFA 3SCZA 2NP6A 1I4OA 1WXDA 4JMLA 3D6NB 1QOZA 4JR1A 3AF1A 5CIYA 3CPSA 1N8KA 3RYIB 1GY8A 4Q9JA 2IGTA 4REOA 5E6RB 3V2UA 4CETA 1VI5A 3KUUA 3L4BC 1U8AA 2W83A 2I6FA 1SOWA 2WD7B 3MJSA 1HDEA 1NU6A 3SPXA 5IJAA 4MVWA 1E61A 4WCFA 4YP5A 5KYKA 5JTUA 4MW9A 4HS9A 2CXOA 3YASA 3QZUA 3IJ5A 2P90A 2V55B 1KQGA 4CMEA 5DWQA 2JIBA 1LBHA 1EVZA 2JLRA 3F8WA 2EW1A 4WH0A 2BF7A 2E4VA 2FFAA 2VHTA 1C41A 1XL1A 1ZDMA 4JIGA 4RZQA 1EXWA 5KYTA 4D9JA 4R3NA 1LQTA 2D00A 2QGFA 3DLAA 3IOYA 2Q2QA 5CD1A 2XB8A 3AI7A 3NHRA 5HS4A 1K7CA 1NQXA 1PI3A 3JWPA 4IDHA 4JVSB 5BYJA 4OHVA 3MSCA 4CKBB 2QN2A 1F1JA 1NVVR 2GAOA 2CLHB 2P27A 3BXXA 3LBNA 3QA9A 4DMKA 1K6IA 2CWDA 2QSYA 2YVQA 3Q1LA 4MV8A 2EKPA 4EBFA 5GIOE 3NVAA 1W1WA 2JFNA 4UARA 2DWCA 4UQPA 1GEEA 2RGNC 3M0EA 2Y3IA 4GP6A 1ZMRA 3DEAA 4AKGA 3HI6A 3S29A 1IMOA 2D0PB 1O94C 3CW9A 3GAFA 4LVUA 1J2JA 3V33A 4BMXA 1