4JNKA

Lactate dehydrogenase a in complex with inhibitor compound 22
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
326
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARSRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
publication title Identification of substituted 2-thio-6-oxo-1,6-dihydropyrimidines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 326
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jnkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4jnkA02
2X9GA 2I3GA 4MVJE 4IDAA 3DOCA 4IS3A 3AM4A 1A7AA 1GR0A 1DFIA 2AHRA 3LK7A 3ZHBA 3CMCO 2V6FA 4N5LA 4D45A 3BMOB 3H3FA 3KRTA 3NDIA 4PRLA 1BXKA 4WPGA 4XB1A 2POQX 1C0PA 2AW5A 1BWSA 4G5HA 4B7XA 5EL0A 5IXYA 1TVEA 4OIMA 4YYZA 3INRA 4Y6RA 1JLLA 3LZ6A 4NNJA 2JL1A 5IDWA 3EY4A 4AJEA 3ZHYA 4ZQHA 1NYTA 1A72A 4LGVA 2GLXA 3P2YA 1I5RA 4CMIA 3SJUA 5JDCA 1PQPA 1U5CA 5CG2A 3KVOA 3AI2A 2G82A 1KY5A 4ND3A 2PTGA 1UXKA 4IQ8A 4MP6A 5KWEA 3NTOA 2PD4A 1Z73A 3UFXA 2VHWA 3ETDA 4XRRA 5JY1A 5KIAA 4TRRA 2YUTA 2AA3A 1T1SA 3I4CA 5KJCA 1O0SA 4B4OA 5KVQA 3RFVA 2WYWA 3OJLA 5A06A 3K8ZA 3O8QA 1T1RA 2YY7A 5JDCC 1MLDA 2W2LD 3GUCA 3QWBA 1QG6A 2VT3A 4IQGA 3ZWMA 5KOIA 4KP7A 4CR8A 3VPHA 1GZ6A 1YXMA 1TI7A 4DBVO 3VH2A 2CSUA 5TLSA 4OJNA 2VYNA 5GY7A 3BTUA 1B16A 4WLVA 5KKCA 4M86A 4DBZA 3JSAA 1JU9A 1BSVA 3GDOA 4L8VA 1ISIA 4MKZA 1PJCA 3PDUA 1P44A 5JO0A 1V8BA 4NBVA 4Y6PA 2IXAA 2X22A 2WD7A 1GY8A 2PH5A 5ICSA 1GYRA 1NQTA 4IPTA 4RF2A 1O8CA 2GPTA 2Q49A 3FCOA 1ZMTA 3JQBC 1DFHA 1NPDA 1ZVMA 1GL3A 4LRTB 4HXYA 4CUKA 1YE3A 3TL3A 2JD0A 5B37A 5F1KA 2O4CA 3HSKA 4N18A 3IAHA 3OA2A 4ALMA 4ZQFA 3U3XA 4A10A 2X8LA 4WLUA 1LNQA 3PGXA 1KYQA 1JA9A 1T24A 3NJ4A 4RORA 2C2XA 3OA0A 4IM7A 1FDSA 4MDHA 1EEHA 1EBFA 4K26A 5JAZA 3AY6A 4GMFA 4AJ4A 2NM0A 2GERA 1T4BA 4NFHA 3ZHZA 1E3JA 1XQ6A 4YACA 2X6TA 1E1LA 4LCJA 1AGNA 4TMFA 4PLFA 4L0QA 5JC8A 2P9GA 1WP4A 3WS7A 1FDWA 4P38A 1FK8A 3CH6A 3CSDA 3QY9A 4PFJA 1DC4A 3MWDB 1ZO8A 5BSEA 2GRAA 4PLPA 1LRKA 3GF4A 2P68A 1BHSA 4FJ0A 2O3TA 1JVSA 4YAKA 5C3MA 4E5MA 3UAGA 1YBMA 1RWBA 2WD7B 3GGPA 3WYCA 4TRJA 4CLDA 3NT2A 4BNYA 1RYDA 4KUGA 5IXSA 1JQBA 3H7AA 2VRCD 5A5EA 4BNFA 1YBVA 3AUTA 2OFPA 5COBA 1M6HA 2LDBA 5I7VA 4PZCA 3RC7A 2BH9A 2H63A 3V8BA 3U4HA 1ULSA 4MP8A 3L07A 2BLLA 3VZSA 4FB5A 3QRWA 4YAGA 3A14A 2PGDA 1MC5A 3HADA 3E9MA 5EJ2A 3TN7A 3RC2A 4MOWA 3C1TA 4JJFA 1PZGA 3E48A 3WJAA 1VJ0A 2GO1A 1XEAA 4XR4A 2FR8A 4J91A 3WOHA 3HNPA 3WR5A 4AVYA 3P2OA 2EGGA 2NNLD 1HF3A 3ZH2A 1SPXA 3RC9A 1JAYA 1PL6A 1LSJA 4EJ6A 5JAMA 5IF3A 4A03A 1NXQA 3QSGA 3GNSA 2X9VA 1JKIA 4HP8A 5A03A 1HE2A 1LSSA 1RJWA 3K96A 4FFMA 1PJSA 1T26A 1NAHA 4O0LA 5L7YA 1XYGA 1Y81A 2OL4A 1ZCJA 4BNHA 1U7TA 3DZIA 2DUWA 3QWAA 2EF1A 1HE5A 2NVUA 1WAMA 5F1OA 4YWJA 4NG5A 1GYQA 1X15A 3ONDA 4FSHA 1YDEA 4M8SA 5EINA 3RFXA 3S1LA 4JP3A 2C82A 4XGIA 5C5IA 1BGVA 1WDLA 3LC2O 5TNXA 3TZ6A 4ZGWA 5JC1A 2B4TO 3E9QA 1E5LA 1Y5MA 1P1RA 4R5HA 1G1AA 2O2SA 3W4IA 4DYDA 1YONA 4MVJM 2VHXA 3DEYX 4J9UE 4BNXA 1I36A 1Q2XA 4GX5A 3AY7A 4CV1A 2YW9A 3PZRA 3OJEA 1WWKA 2DPGA 1DFGA 3N7UA 3FRJA 3FBTA 3MOIA 3CUKA 3OJFA 1F0YA 3JQAA 3KOUA 1YS4A 2O7QA 2AQ8A 4KOAA 3GZ4A 4JNKA 3RKUA 4MKRA 5ITVA 5K0ZA 5I7FA 3OMLA 1N7HA 3BMQB 3S8MA 1K0UA 2P91A 2Q2QA 1AXGA 3QA9A 2UUOA 3Q11A 4MVJG 5FFFA 1O6ZA 1VJTA 4YB8A 3WB9A 1OMOA 1RKXA 1LRLA 4RVHA 4XJTA 5J23A 1PGOA 4M49A 3GDFA 3K9QO 1E3EA 5FEUA 3VVCA 1NWCA 1NR1A 4JLWA 4IJVA 4ID9A 4PLZA 4ZN6A 2GN9A 2ZKLA 4FW8A 3L4BC 4DREA 4OOEA 4E2WA 4IUYA 1WZEA 4R54A 5A4DA 3PLNA 2YHIA 4A27A 2EG9A 2EP7A 2HAEA 4MIYA 1U9JA 1XELA 2AQHA 4Z3DA 4RO0A 4R16A 4RLSA 4KTTE 2IE0A 4OAQA 4UUPA 2CVQA 1H0KA 3WGHA 1OI7A 2ZYGA 1GPJA 2YDYA 4Q3DA 3IOYA 4WNCA 5GZ1A 4XGNA 3BHMA 3DBVO 2GN8A 5A5FA 1UXHA 4TZKA 1E1KA 1MV8A 4J9VA 4W4TA 5AXBA 1K89A 2VCYA 3P7MA 3ZNNA 3INGA 2BD0A 4K1LA 4LMPA 5AXDA 2DUUA 2BKAA 1JAXA 3GOHA 2EHDA 3K2BA 2Q4BA 4EZBA 4YT8A 4KZPA 4MIEA 1ONOA 3EAGA 2J5RA 3O9ZA 1N1EA 4NBTA 1XKQA 1E7WA 3I83A 3DQPA 1PZEA 4GX1A 3KEQA 2VWGA 2R00C 5CHEA 4AJ1A 4GVLA 2DAPA 4NQZA 3E82A 3F47A 1ENOA 4U0JA 3S2IA 1E7YA 4DXHA 4P4NA 2VHVA 3B1KA 4FOOA 3VPSA 3H9JA 4BO5A 1GEEA 3GEMA 4C7KA 1QKIA 3FHLA 1LJ8A 1XLTA 5A9TA 3ULKA 1NBOA 5ENDA 4CQLB 4YBZA 3PWZA 3AY3A 1F8GA 2CUKA 4NFYA 4CMCA 9LDBA 1IY8A 1OAAA 4CLRB 1YKFA 4PZDA 2ZYAA 2GSDA 4QT0A 1GPDG 5BR7A 4FN4A 4RVFA 4D3SA 3PVZA 5JYDA 1MXFA 5U1PA 3I9LA 1HRDA 2ZIZA 2PD3A 3AM5A 1JDJA 2I99A 1Q7GA 2O2YA 3CXRA 4R1SA 4CL8A 4R01A 4FDAA 2HMVA 3WTCA 3AK4A 1IHXA 1V6AA 4OYRA 1BG6A 3JD3A 3JYLA 1I2CA 2BGKA 4YJHA 4BB6A 8LDHA 1XR3A 1T4DA 3GVCA 3L77A 3R6DA 1GUZA 4D7AA 4FFNA 5TJHA 1ZIDA 3Q9NA 2FOIA 2JJYA 3GDGA 1GU7A 2AG8A 3BTVA 2E48A 3GVIA 3DBHA 3VH1A 1GQYA 3DZHA 2ZQZA 2VHYA 4MO2A 3OSUA 5KVCA 4YJFB 2J8ZA 1A9ZA 1GAEO 3RU9A 3IS3A 4N5MA 3C1AA 2FHSA 3KEOA 3QLJA 4YDRA 4JCOA 2P9CA 4ALIA 4DTIA 3R3JA 4IDBA 1YQGA 4PLHA 2GZ3A 1GEGA 3VTFA 4IJKA 3JQFA 3RUHA 1R16A 3C8MA 4U6SA 1EQUA 2PA3A 1I10A 2D5CA 2FP4A 1Y1PA 1CQJA 2HMSA 3ON5A 4D43A 1CDOA 4XKJA 3Q0EA 2EV9A 1YO6A 1LUAA 2PFGA 5MDHA 3U5TA 4RDIA 1UH5A 4ZJUA 1YQXA 1J4AA 2CVZA 1XG5A 3ENKA 4RDHA 3JD1A 3PI7A 4ND2A 3JQFC 4YJHB 2VYND 1BVUA 3KLPX 5L3ZA 2FZWA 1X7DA 2HRZA 1K5HA 3IQDB 1BDMA 1Q0QA 4E5YA 1ZZEA 4B79A 4RPJA 3GVPA 1HL3A 3WQSB 2V6GA 4BNGA 3PRJA 4NK5A 2RCYA 1UDCA 4N7RA 3DBHB 4AJLA 5FWNA 4IDGA 5EMHA 3NKLA 4ZRNA 4BO3A 3N74A 3KO8A 5JO9A 1MXHA 4PG8A 1GQQA 3KSUA 4D44A 3OFSA 4R1UA 2Y66A 1HE3A 3NX4A 1YQDA 3AI3A 3RC1A 3H65A 3ICPA 1VI2A 4ALLA 4XYEA 3VVBA 2W98A 4YJDA 1KS9A 3OBBA 4NR0A 1PS9A 3E1KA 3HZZA 1YOVB 1R15A 1S7CA 1TXGA 5F1PA 3U4IA 4DGSA 2E4AA 3ROPA 2HJRA 1PR3A 3EMKA 3JTMA 4I5GA 2ZTLA 4QO7A 4RQUA 3LF2A 4OKNA 4Y9DA 4GKVA 5KJFA 1ML3A 2B69A 1BRMA 8ADHA 3AWDA 5L51A 4FFLA 5IZ4A 2GZ1A 3C7DB 5TS3A 4DPLA 4HY3A 1E0DA 2P5UA 3K6JA 1P1HA 4RGBA 4OKIA 4Z0TA 3W8EA 5L53A 4XX0A 1LDGA 4S3MA 4LISA 4BNZA 3M2TA 4CQMA 3DHEA 1IZ0A 3MTGA 2I65A 3SC6A 4ALKA 4CMKA 1DC6A 2W8ZA 2W90A 1UDBA 3CTMA 1NFFA 2DBRA 2HKIA 1F8FA 4I9HA 2GF2A 1Z7EA 2HK9A 1V3TA 3ASUA 4BO8A 4ZQBA 1WMBA 1KERA 3QWHA 1F17A 4D0SA 1T25A 3PWKA 4ZU3A 4DLLA 4Q3AA 1SZJG 4DC0A 2PV7A 5IG2A 2BFMA 3ROMA 3KLMX 5A02A 2BFPA 1J49A 2I9PA 1A5ZA 2G1UA 1DLIA 1VPDA 1K2WA 2CF5A 3H6KA 2IXBA 4GBJA 3WFJA 4IDDA 4J7UA 4YTEA 4E4YA 5IFLA 1NVMB 1Y8QB 4GH5A 1GD1O 4JIGA 3DAPA 4BNNA 2Q2WA 3INTA 2IYOA 1E3SA 5F3RA 4RF5A 3K92A 3GVHA 4M54A 3WDSA 1I01A 3V2UA 1V3VA 2D1YA 4M89A 2FSVA 4L76A 4E3ZA 1EVJA 4J2HA 3AOEC 1B0AA 4CQMB 1NPYA 5A04A 5CDTA 1EK6A 4DWVA 4WECA 1X0XA 3D3EA 3ZWNA 1HETA 1UXGA 1B15A 2Q45A 4EEXA 2Y05A 5TT1A 4LCEA 5DBFA 2YZ7A 2ZYDA 4YJGA 1PS8A 3MOGA 5ILOA 4I08A 1FDTA 4HADA 1R4MA 4WEOA 4WLOA 1QV6A 2ZTUA 2QIOA 1D8AA 5EQFA 3JD4A 3WXBA 1GUYA 2CDCA 3DB2A 2EKPA 5JE8A 3F46A 3FWZA 3FWNA 1EZ4A 4Q9NA 2B0JA 3K2EA 5BSFA 4D46A 2HMWA 1JTVA 3JQAD 1IUKA 2ZJ1A 2AXQA 3PIIA 1JKFA 2C5EA 4I1IA 3LLSA 5FYDA 2CZCA 3TZQA 1HXHA 3PIDA 1D1TA 4NU5A 5L45A 1DRUA 2Y1CA 1QXSA 3D7LA 3FNEA 4TRNA 2E82A 1A71A 4MP3A 1QR6A 2AEFA 1ADBA 2HRBA 5JPIA 3ZV4A 4FGWA 4CUZA 2VTEA 2C07A 1ZBQA 2VHZA 3JQ6A 3BXXA 4YJGB 1V35A 2Y0DA 4EBFA 2B5WA 5IZCA 2RHRA 2X5OA 1B26A 5G0UA 2PZLA 3B70A 2FMUA 4QECA 3T4XA 5ITWA 2B4QA 1E7RA 5DN9A 5G0TA 3V1TC 2BHLA 3SLKA 3QVTA 1NAIA 5I7SA 5JNLA 4R9RA 3WMWA 3IJRA 3JQEA 4Q3NA 4R51A 2NSDA 2VOJA 4L73A 3L0DA 2NLOA 3KYCA 3LYLA 1LBEA 3IL2A 1RM4A 1EE2A 4BO1A 3NV9A 1UJMA 4MVJA 1BMDA 1PZHA 2AE1A 5IZCC 4JN6B 4GLOA 4EDFA 4PN3A 2O4UX 2D59A 5TF4A 3V2GA 2OZPA 1TB4A 1X0VA 3CMMA 4AL4A 1EUZA 1LDEA 1QP8A 1XCBA 4B4VA 4PIVA 1GV1A 1DHRA 3M1AA 4XYBA 1R12A 2GGSA 1C0IA 3EHEA 3CZMA 3AW9A 3VKVA 1MB4A 1NFRA 1NR7A 4PCVA 1WW8A 4AJNA 1I2ZA 2ZTMA 3FI9A 3UCXA 1B8UA 4BO9A 1H6CA 3QE3A 3FPCA 1W8DA 4WNIA 1ORRA 3DZJA 3FSRA 4JJGA 4BNVA 1PGPA 3DFUA 3I4FA 4CM9A 5L7TA 3QIVA 1Z45A 1ENYA 4ND4A 4D0RA 3QHAA 3LT2A 3DMTA 2Y0CA 3MJSA 4G81A 4ZICA 2DKNA 4BMVA 4WEQA 4E2XA 2IEDA 3PHJA 3KYCB 4IJUA 1F14A 4KDFA 4DPKA 2FRDA 1IE3A 3BIOA 2O3UA 4MVJI 3TF5A 4WCFC 1PS0A 1PX0A 5DCWA 1Y9AA 2B5VA 4OHUA 4DIOA 4QSMA 3HFSA 3LU1A 3C85A 3NAQA 1UXJA 2HUNA 4ZA2A 1I33A 4CM7A 2AQKA 2JCYA 2FR1A 3ZHXA 4XYMA 4XEHA 1DEHA 3EGOA 4J4TA 3DMTC 1E7MA 4YQZA 5C37A 5HRUA 2R2GA 1ISJA 4N5NA 2AG5A 1MG5A 4HV4A 5JDIC 2Y68A 2V6BA 1YJ8A 4P4LA 3DTTA 3VPXA 3C7AA 3CKYA 4PG4A 1G0NA 2DBZA 3JQBA 1SO8A 4JP2A 3A1NA 4WOJA 4WCFB 4YVFA 4LN1A 4CM4A 1C1XB 3Q2KA 1FJHA 5BNTA 5FI3A 2OBNA 4GLLA 1U8FO 4TKMA 4E6PA 3EYWA 2JKVA 3JQGA 1A4IA 4PLCA 1E7QA 2TMGA 4YRAA 5ADHA 4A0SA 3GFBA 1LXCA 4Z9XA 3DHYA 3BHIA 1XWFA 4GKBA 3PYMA 5CAEA 4FFRA 1OC4A 1O89A 4XWYA 3VTZA 1GFSA 1PJQA 1R0SA 3W4JA 1YDWA 1E3LA 4IS2A 2VZ9A 4AJOA 5G4KA 5L9AA 2OHXA 3KTDA 4Z0HO 5JCJA 1QLJA 3G0OA 2QRLA 1PJ2A 3NRCA 3U49A 3E18A 4B3JA 3D3WA 4JBIA 1BXGA 4BO0A 5EN4A 3ZI0A 4U6QA 3O4RA 2J3JA 4BQRA 3HN2A 5T67A 1Q0LA 3PZBA 4YXFA 1M2WA 2P5YA 3H9EO 3ABIA 3LF1A 4JJIA 1SOVA 2H1SA 2Q1UA 4CLHA 4CV0A 5ICMA 4XQEA 3RSHA 4CM4B 2YV1A 2DVMA 1LEHA 3G1TA 3NGLA 1PJ3A 3AI1A 4ND1A 5KTKA 4G65A 1WMAA 2WEKA 5I9NA 5I7EA 2C20A 2PKQP 3JQGB 5C7IO 4RPGA 1C3VA 3GN2A 1OBFO 4N54A 2QG4A 4BKPA 3I5MA 3NTRA 1R0LA 4LSWA 2Q46A 4BIIA 1ZK4A 1ISFA 1M67A 1TT5A 2PKRA 3UN1A 3GC6A 2YYYA 4RF4A 4RVSA 1QMGA 4CMBA 2X5KO 4AJHA 4MIOA 2Y1OA 2XXBA 1PGNA 3KXDA 1D4FA 3IJPA 1Y9EA 4E33A 2Q2VA 3GEGA 2UVDA 3RIHA 4DIFA 1DLJA 1QRRA 5G4KB 3TFQA 1Z6ZA 2D0IA 3X2EA 1ADCA 5K6AC 1NQOA 3D3WB 1BXGB 1XSEA 3MCVA 3NEPX 2EGHA 2EKQA 1EK5A 2Y1FA 2AE2A 3DC2A 3EVTA 5C7OO 1WXDA 1H9BA 3D4NA 1KIFA 3GNTA 3WICA 3DAGA 2J3HA 3WGOA 3O38A 3OIGA 3A4VA 4OM8A 3BMQA 3SJ7A 3ZGYA 3OQBA 3MJCA 1TLTA 4CQMD 2EJWA 4GVXA 3D0OA 3HWRA 4CMJA 1Z74A 3I23A 2LDXA 4YPOA 3UCEA 5CFZA 2D3TA 4ALNA 2CY0A 3AUSA 5A1TA 1TT5B 3JQ9A 3DAFA 4CMEC 4CV2A 3OECA 2OGUA 4F46A 3V1YA 4P4GA 4GGPA 5KJ1A 3KHUA 1EDZA 2Y93A 2BGMA 1DIBA 4RQTA 2EKLA 2PGJA 3NDJA 1ZXBA 5FI5A 2VWHA 2Q99A 4I5FA 3STHA 1R6DA 4DPMA 2W2KA 2D8AA 3NUGA 4OO3A 5L4LA 4L74A 4RZHA 1I24A 1O5IA 5JAQA 1VKOA 2JCVA 2AEMA 2V6MA 1T2FA 3QVOA 4AJIA 4R68A 1U2GA 4XYLA 1AN9A 2NWQA 4J0EA 3JQ9C 4GMGA 3ANLA 3L4BA 2QW8A 5JY6A 2ZTVA 3L9WA 1NNUA 1K3TA 1ULUA 1Z7BA 3ETGA 1LU9A 2C7GA 3HB4X 3LT0A 4UVIA 3RJ9A 3WBBA 5LDGA 4M87A 1LX6A 4TWRA 4BNLA 5EERA 3ZNOA 5T57A 3OJOA 1DIAA 4PG5A 4XQ9A 1XU9A 2I5PO 1F06A 5CEEA 1LC3A 2XF8A 3QWFA 3NGXA 4WE3A 5K9ZA 2JCXA 3COSA 3H9GA 1CYDA 4J90A 3WLFA 3SVTA 4IIVA 4UVGA 3UH1A 1NVGA 2CD9A 3R3SA 1J0XO 3JQ8B 2H6EA 2VNAA 2W2KB 1PJ4A 1YB5A 3PDJA 4GL4A 2PZJA 1E7SA 5DF1A 4CQLA 4YQYA 1X1EA 4BNJA 5KJEA 3UHAA 2DFVA 4WOKA 2DBQA 5A3JA 1GCUA 2R00A 1GADO 5G0SA 1ZEJA 2WM3A 3UF0A 1W6UA 2VUSA 3L9XA 4CLRA 3GA0A 4IJWA 1P74A 4A7PA 3PHLA 4NHEA 3KSDO 3A06A 1QYXA 2ZATA 3MWEB 3QV1A 2YDXA 5B4UA 4K6FA 5AXAA 1EVYA 1ONNA 4LW8A 3W6UA 4BO4A 1NQ5A 4LVUA 4IY1A 3VDRA 2NU8A 1HYEA 4IDFA 4URFA 4OMUA 2FR0A 2ZJ0A 5MGBA 3LDHA 4OL9A 2O3QA 4KDEA 4J4HA 2ZB7A 1Q0HA 3VH4A 1LRJA 4QTZA 3P5SA 1P1KA 1H9AA 3KBOA 1QORA 1NX6A 1Y8RA 1YJQA 2DTDA 6LDHA 1EFLA 1N92A 1VL6A 2QYSA 4GX0A 4F6CA 3M1LA 4CMAA 4J7XA 1LA2A 3O03A 1E1MA 5JMWA 2XPCA 3TZHA 3OEYA 3P19A 1A9YA 2IDZA 3RUAA 4J0FA 4YJFA 2X9NA 1QV7A 4YRDA 3PEFA 1IULA 5DOZA 5L4SA 3FBGA 4R1TA 4WJZA 4RV9A 3WFIA 4MVJD 1NHWA 3UXYA 2HU2A 2AMFA 2DU8A 2UYYA 3NDRA 1OFGA 3WNVA 4DQXA 4U7WA 3ZWPA 2HLPA 5THKA 3WSWA 2CDAA 4L4RA 3GT0A 2EERA 4C4OA 2H5LA 4PLYA 3ZU2A 1VC2A 3OH8A 1VL8A 2NQTA 3DL2A 1C1DA 1H93A 4WCDA 1H5QA 5DOVA 3PJEA 1ZJZA 4B8ZA 3G3EA 4NK4A 3CZRA 1B14A 1UZLA 4D79A 3HHPA 1Y8RB 2NTVA 4CM9D 4QFCA 3ZNQA 4E13A 1OOEA 5AOVA 4IDEA 3FNHA 3D4OA 4BNUA 2EIHA 4RLHA 2Z1NA 3PQEA 3DMYA 3GAZA 2IZ0A 1VL0A 1JN0A 1HZZA 2FPIA 3MJVA 2GYYA 5EPOA 5COAA 4GQAA 1ZFNA 2XXJA 1L7DA 3RWBA 3AFNA 1XU7A 3ANNA 4L4XA 2QX7A 2FSSA 2G5CA 2ZK7A 1YOVA 3O26A 3ROQA 3ZWYA 1DDOA 3H2SA 3TRIA 2BFOA 2E37A 5CEFA 5DBGA 3DZGA 1F12A 2X86A 4WASA 1C0KA 4R3WA 1C1DB 3BHJA 5JFOA 4QUKA 1I0ZA 1L1FA 2O3JA 3JYQA 1KETA 3HQ4O 3LLVA 3Q1LA 5TSDA 1PGQA 4BUCA 4Q3EA 2I66A 3ZWXA 4BS9A 1TT7A 3PYXA 4BV8A 4J16A 5BQFA 1D1SA 5JAIA 3WJ7A 3H8VA 4LK3A 4XRGA 4CLOA 1AHHA 5G0VA 2WE7A 3V5NA 3RUCA 1Q7CA 4KQXA 1DC3A 1FMCA 2C59A 1RYEA 1K6IA 1Z82A 4F6LA 1A4UA 1U4OA 2DPHA 1E6EA 4WUVA 2O3SA 3HB5X 3RBVA 3AU8A 2HMUA 2C54A 1TA4A 2GUGA 2RH4A 1PL8A 2NVWA 2ZB4A 3W6ZA 5F21A 5T5QA 1LDNA 4BGIA 4BV9A 4UVDA 3K31A 4XA8A 2DLDA 4UAGA 4TQGA 3W4KA 3JCZA 3U4DA 3R1IA 1HDZA 5JCJD 1ZSYA 2EEZA 4BHTA 3Q3CA 1SCUA 3EK2A 1ISMA 3GGOA 4K6CA 3I52A 1Y8QA 3DR3A 3SEFA 4YT5A 3E6AA 5I8WA 1SC6A 2FY8A 3F1KA 4NBWA 4H16A 3OQ6A 1U2DA 2DM6A 4AG3A 2Q3EA 2YHUA 1UXIA 2X23A 4WLEA 4NBUA 1LSUA 5IN5A 2I76A 1CF2O 1RM3A 3OF2A 4AJ2A 3H2ZA 3I9MA 5CDGA 4PLWA 4LMRA 3F1LA 4Y6SA 4A5OA 3VC7A 5G2OA 3R0IA 4TVOA 3E8XA 4CLOB 1DHTA 2JFGA 3SLGA 4OXYA 4YRBA 4GSLA 2PKQO 3ZWWA 3I9KA 4E21A 1YH3A 4BMNA 1XA0A 3C1OA 4DC1A 4DMLA 1H2HA 4II3A 1O95A 1HDRA 5IDXA 1MFZA 3FD8A 1GDHA 1A7KA 5A9SA 1UP7A 3IP3A 4EJMA 3TL2A 4U5QA 3FNGA 1LQTA 2OP1A 4I8XA 4S1VA 4IXTA 3UICA 3JQCA 1N2SA 1EQ2A 3WX0A 4HBGA 3AOEA 1ZMOA 1V0JA 2DC1A 4EJ0A 2I6TA 5HS6A 3AUUA 3UGKA 1YL5A 4UUNA 1PJBA 1H94A 3N58A 2CF6A 1R37A 2ZB3A 2QQ5A 4FC7A 5COQA 1VSUA 4MVJH 2OORA 3TFOA 1I3NA 2VUTA 2ZCVA 5A3VA 1BW9B 2GR9A 2HK8A 5L40A 3DXFA 3GNQA 4UREA 4INAA 2WE8A 4WGGA 1KBZA 2PR2A 4QX6A 1WPQA 4FD3A 5HTOA 4MJLA 3ZNPA 2QZ9A 5AQ1A 2VYVA 4HFRA 4E5PA 1ISHA 4FOSA 4GAEA 3PJGA 4J43A 1E77A 5C7LO 3ORFA 1P0FA 4DA9A 1HE4A 4O6VA 2XAAA 4TRMA 4UULA 3RD5A 3FR8A 3ST7A 4R5MA 3QP9A 3UUWA 4EI2A 4FFPA 1NTOA 5ES3A 3CIFA 2EWMA 4XGKA 3WGZA 4BMSA 2H9IA 2VZ8A 5A9SB 3MEQA 5DT9A 3TJRA 3PP8A 3ADPA 1EUCA 2YQ5A 5THQA 2V65A 1UDAA 2UAGA 1E92A 1QYDA 1DO8A 4R41A 5CP8A 1B3BA 1EMDA 3ZWBA 1I3KA 1ZK3A 1PTJA 1M66A 1P9LA 5DP1A 3RI3A 1PJLA 3JV7A 5KCZA 2IODA 4R69A 2DQ4A 1DIHA 3GRKA 3IC5A 4W6ZA 4F3YA 4K9DA 5JMPA 2IZ1A 1ZJYA 1B7GO 3WLEA 3OP4A 3ADOA 4E2ZA 4OXKA 2P2SA 3GHYA 1UUFA 4XYGA 5TT0A 1IHYA 3RU7A 3GHHA 3Q6IA 1OZAA 3F9IA 3KYBA 3VOSA 1LLDA 3VZRA 3PTZA 4IZIA 1LDMA 1VJ1A 2GZ2A 2CVOA 3DOJA 3MTJA 5DP2A 3ZWOA 4ALJA 3ROKA 1DAOA 4B3IA 4EITA 5T8KC 1FXSA 3F5QA 3WGIA 3T4EA 4HX5A 1XDWA 3JYOA 1MX3A 1GCOA 2J5QA 1R66A 3D5TA 2QRJA 1EVZA 4M55A 4DYVA 4PG7A 1VE9A 2DTXA 4I9UA 4BGUA 1FDUA 4I9NA 1ZK0A 4XJSA 3TOXA 2GDZA 4MVJP 2RHCA 3RKRA 1QYWA 1VSVA 1Y6JA 3GN1A 2YJZA 2WMDA 3RAJA 2XOXA 2VNSA 2UV8A 4RVDA 5DCUA 1AHIA 2PLAA 3HUDA 4NBRA 4GI2A 4MPDA 1CIVA 1RM5A 3PXXA 4B4UA 1MGOA 4ESOA 1ZUD1 1SNYA 3L6OO 1T2EA 4CUJA 2ET6A 4A2CA 1KC3A 4W7HA 4JGBA 3FF4A 1KC1A 2G76A 4O1MA 2YFQA 5LCXA 4YCAA 3U9LA 1YBAA 3GPDG 1HWYA 4OQZA 2NVBA 3ANMA 3GLQA 3HDJA 2W4QA 3SX2A 3VHRA 4BNMA 3WWYA 1T2CA 2IZZA 4AJPA 1AXEA 1N5DA 2GN4A 3WYBA 3PJFA 1M75A 3E5RA 4B8WA 5TIIA 4E12A 1P1JA 4WK6A 3FN4A 4CLEA 1KVUA 3H9UA 3IUSA 3KUXA 2O48X 3EZLA 2ILTA 5F5NA 1BXZA 5JYEA 3RUFA 1KVSA 4Z0PA 3RBXA 1W4ZA 4W99A 3GY0A 4J1SA 1CETA 2ZB8A 3DO5A 4PGFA 4Y98A 4WCFA 3B20A 1C1XA 4Q3CA 2HMTA 1GZ3A 5JS6A 4PLGA 5IJZA 3WMXA 3ZWCA 3LT1A 3KM0A 1NWHA 1GTMA 3DZBA 4NZ9A 3DDNA 1U7HA 3RUDA 4LVCA 3WGTA 3TNLA 2JHFA 2C5AA 2UUPA 2WYVA 4JQCA 5JDIA 5I9LA 4BB5A 4OH1A 2NACA 5EQDA 2JAPA 1H2BA 1XQ1A 5CDUA 1YB1A 6ADHA 4L75A 3UVEA 1N8KA 1EBUA 3LC7O 2Z5LA 1LDYA 2NTJA 5I9MA 2CNBA 3M2PA 3ICCA 1NHGA 4B4WA 3GK3A 2HSDA 1IYZA 3G17A 2X0JA 3GQVA 1P33A 5H82A 3H3JA 4EYEA 3CEAA 1IZ9A 1KEWA 4TVBA 4FIZA 4J4BA 4CM5A 4IGEA 1ONPA 2Q4EA 1X14A 1M76A 3PQFA 1C14A 4E2YA 1T2AA 1LLCA 2EJVA 1VLLA 1E1NA 3ZW9A 2OP0A 1HDCA 4PVDA 3K5PA 1YL6A 1DIRA 3GH3A 1WDMA 2O7SA 2VWQA 1T2DA 4QEDA 3L6EA 1U3WA 4JBHA 4BNWA 2JD2A 4BKQA 1I3MA 1E3WB 1I30A 4ILKA 4XIYA 3HDHA 5AYVA 1DPGA 4E30A 2VTDA 1SB9A 3FTNA 3E03A 5CEJA 3X2FA 3TPCA 1SAYA 1X7GA 5KVSA 2X0IA 3BMCA 2A35A 4Q39A 2FWMX 1OC2A 4ONEA 2O3RA 4FFOA 4RPKA 2OUIA 1MC4A 4CODB 3OEWA 3PHHA 5L7WA 3IMFA 3TQHA 4CMIB 3IDSA 3H5NA 1DJQA 4FQ8A 3OM9A 4ZD6A 3OIDA 1E6UA 1B8VA 5CPFA 4CMGA 5BNIA 3WGQA 1AE1A 2DTEA 3OHSX 1YB4A 4IGFA 3RFTA 2Y1EA 3LT4A 3Q2IA 1L7EA 4H15A 3KV3O 1CWUA 1S6YA 1XIVA 3BMNA 3VPFA 2EW8A 5KNLA 5K6AA 2PD6A 4BGVA 1QSGA 5IAAA 3UCFA 1IPFA 1SB8A 2WD8A 2X0RA 3OJ0A 5L4NA 1ZH8A 3PPIA 1ZSNA 3ONFA 3OETA 4KQWA 1HYGA 2X58A 4AJKA 2BGLA 1B2LA 1CJCA 3G1UA 3O8QB 3I1JA 1IB6A 3FTPA 4Z9YA 2FN7A 4ITUA 5HS4A 7MDHA 1DB3A 3I6IA 3BMCB 1E6WA 4JBGA 4D3DA 1DRVA 2J5KA 4LSMA 1Z75A 4ZQGA 3JD0A 2JHGA 1NPTO 4ZQEA 2P4HX 1U5AA 4DQVA 3B1FA 2QHXA 5BSGA 1HYHA 2A94A 2WYUA 2HK7A 3FNFA 3ETEA 4YA6A 4BO2A 4CMEA 3DWFA 4CM3A 4FJ2A 4A73A 2OBYA 4XDYA 4CR7A 3JD2A 2C2YA 1RM0A 4MKXA 1MP0A 3IKTA 3ONEA 1HT0A 1I32A 4RVGA 1JKJA 7ADHA 4RJTA 2IYPA 2WSBA 3BMNB 3QVWA 2NTNA 3EUWA 3A28A 1NASA 1H6DA 3NT5A 1SOWA 5KJ6A 2B35A 4NPCA 3ITKA 1CEQA 5G0WA 3EDMA 4FGSA 4IMPA 3NJ8A 4AFNA 3GUYA 1LTHR 2D5AA 3H4VA 4F45A 3PHIA 3HE3A 4Q3BA 3WGYA 1MUUA 4ROSA 1K6XA 1ZK2A 3OICA 3ASVA 4I5EA 1PJTA 2VUUA 1N1GA 3QJ5A 3JQ8A 1P31A 2JFHA 4FCCA 3RCBA 2JAHA 3QW2A 2J3KA 3IUPA 4J6FA 4ZHSA 1PL7A 2NADA 1Q7BA 1J5PA 3WTBA 4FR5A 4BGEA 1R0KA 3Q9UA 3D5QA 1ADFA 2EP5A 1P77A 1DJNA 2GCGA 2JFFA 5DULA 5CPBA 5CDSA 4CR6A 9LDTA 3ITDA 3F6YA 4XQGA 1WNTA 3K73O 1LDBA 2IRWA 2VYVD 3ZV3A 4CM8A 3BA1A 4EUFA 1QLHA 1EVIA 3GFGA 3C7CB 3ZN2A 3S55A 1HDGO 3I6QA 3CPSA 3HJAA 3WYEA 3PQDA 4R9SA 2NV6A 2B83A 1B3RA 3TZCA 4D42A 4G2NA 4NIMA 3IIEA 4HFNA 2CMDA 3ZZNA 1SEPA 1U3VA 1KVRA 1E3IA 3PYLA 5EESA 4NDNE 4WKGA 5T64A 1KEVA 4II2A 5TC4A 1DC5A 4IIUA 3H9QA 4C7JA 4J49A 2ZCUA 1C0LA 4DLAA 4HNGA 5B12A 4CJXA 4GX2A 1ENPA 3ZWVA 3GG9A 4QFDA 3T7EA 1H6AA 1JWBB 1FF9A 1N9GA 3DBLA 3D4PA 3GPIA 3W1VA 2E49A 4K28A 2NVUB 1MG0A 1Q1NA 2Z95A 4KWIA 3TDKA 3AUAA 4E32A 4HWKA 1JVBA 3D1LA 2O23A 1IL0A 1U4SA 4R1NA 3T7CA 2A4KA 4KMSA 4OSOA 4BNKA 4CM8B 4RL6A 3LC1O 1LLUA 3F5SA 3I3OA 3GMSA 5GMOA 2AEJA 5JW6A 2VZ0A 3ENNA 3S2GA 1SMKA 3CINA 3KSZO 1P1IA 1EFKA 3AM3A 1AUPA 3L6DA 2CDBA 5HWSA 1I8TA 3D64A 3ZU4A 3HDQA 3JQAB 1J6UA 3WG9A 3DZFA 4L9RA 1WVGA 3NYWA 3UW3A 2NQ8A 3F4LA 4YAIA 1ARZA 4OXNA 1UP4A 4YT4A 4IZHA 4BQPA 1GZ4A 1MFPA 5AVOA 3JQ7A 2NU6A 4DQUA 4BO7A 4CLXA 3AOGA 4HNHA 2BMAA 1FDVA 2Y1DA 2CFCA 1N9GB 3DBLB 3RUEA 1U8XX 5U4QA 1EDOA 3GMDA 3HFGA 1UP6A 2B36A 3TZKA 3E9NA 3WIDA 4WLFA 1YGYA 4NI5A 1GQ2A 1HEUA 2PK3A 4O59O 4EEZA 2GNAA 1BVRA 1DOHA 4CV3A 2R6JA 3RROA 1KEUA 3I9NA 1I2BA 1LI4A 3GEDA 3V1UA 4HKTA 4DMMA 5ER9A 3HG7A 1YRLA 2JD1A 2YHIB 3VPGA 3U62A 3WGGA 1YL7A 2V7PA 1VRWA 3GZNA 4MINA 2D2IA 3IKVA 1HLDA 1HDOA 1DBVO 4IBOA 4RVUA 1IOLA 5DNAA 4B3HA 2BRUA 2VWPA 2Y0EA 3AU9A 3LQFA 5FF9A 5ILGA 3PGJA 3FR7A 2J6IA 4BO6A 1HKUA 4LRSB 1NQAO 5IDQA 4P8RA 1ID1A 1IPEA 4XB2A 4Y67A 4BNTA 3ZV6A 2RH8A 4BKOA 3BYZA 1ADGA 1YVEI 2F1KA 2VOEA 5GZ6A 4UUMA 4ZVVA 3EW7A 2NUAA 1W73A 1HLPA 3AFMA 5F5LA 1ENZA 2DT5A 5A05A 3JQ7B 3VZPA 3ZV5A 1G0OA 2PY6A 5B4TA 4YAJA 1UR5A 1KVTA 4XIJA 2BI7A 2GN6A 3TOZA 2PZMA 3UOGA 5TJ9A 2FPPA 1DSSG 3NTQA 1HDXA 1LLQA 4O5OA 4IINA 1ZXLA 1ZSVA 2HCTA 2W2LA 4MVJF 4NFSA 2X0NA 4PVCA 4X54A 4NJMA 2HQ1A 2Q50A 4FC6A 4GPD1 1WLYA 4IXWA 4E5NA 1UAGA 2X7HA 2BELA 4RPHA 1GUFA 1SEVA 1HSZA 3JYNA 4DRYA 3GZNB 1P0CA 2PWZA 4JXKA 4XZ3A 1PWZA 4GWGA 3GGGA 3MJTA 4HUJA 1CERA 1PZFA 2PNFA 4PRKA 2BF7A 5A9RA 2OMEA 4FS3A 3GG2A 2Y99A 3RJ5A 4IMRA 5CG1A 4B7UA 3DTYA 1CRWG 1DIGA 1MA0A 1XHLA 3RBZA 2GD1O 4JK3A 3E5MA 3U4CA 1I3LA 3GVXA 2PGLA 3QWIA 4UUOA 4XCVA 3ZW8A 3PFWO 5H83A 4DLBA 2QRKA 2RBEA 4UEOA 3KB6A 2QYTA 3KETA 5L95A 4Y8VA 4QXMA 2X5JO 3RQSA 1D7OA 3ZCXA 4JROA 4EUHA 4I5DA 3H5AA 3HDYA 3G79A 1ZW1A 3C24A 3FPLA 3OIFA 4QO8A 3GR6A 1U3TA 3RASA 4BNIA 3PK0A 4IQ0A 4CM1A 4NJOA 3GAFA 4XR9A 4ZRMA 1N7GA 4NJMB 1VM6A 4E5KA 2OXIA 4J7CA 1LQUA 3V2HA 3CE6A 3VH3A 2I67A 5H81A 1ZNQO 4UEJA 5JBIA 2C0CA 1BW9A 2D4AA 2FPGA 4XQCA 1PEDA 1X13A 4E0BA 4BVAA 1LC0A 2VRCA 5IDYA 2IEBA 1UAYA 1PQWA 4NH4A 5EIOA 4Z3KA 4YT2A 3ZU5A 2NU9A 4J1QA 4R4JA 4J1TA 1CQIA 1WDKA 1UZNA 4YEDA 3AJRA 2E6UX 4EW6A 4UVEA 4EUEA 3ZDFA 2WJPA 1XGKA 2ZQYA 1V9LA 1DXYA 4NMHA 3PHGA 3PLRA 4P22A 4WLNA 3M6IA 3ZU3A 3IP1A 1HTBA 2HDHA 1PIWA 5BNFA 5GZ3A 1KOLA 2Y1GA 3QVSA 2NU7A 5DDIP 4H7PA 4RCVA 5BSHA 3C3XA 3B1JA 4U0KA 1G6KA 2VN8A 3RVDA 3BTOA 3G49A 5HA5A 1DAPA 4W9NA 3SBOA 2VQ3A 4FPXA 4YAEA 5DBIA 4DUPA 1X7HA 2P4QA 3HN7A 4CMHA 4AJJA 1ZEMA 4JX8A 2TMDA 4B7CA 2OO5A 5CDYA 1P3DA 4IDCA 1M6WA 5T6BA 5ER6A 1GV0A 3EVNA 1ISGA 5KKAA 2SCUA 1PGJA 1WZIA 1HSOA 1QYVA 1Y7TA 5JXWA 1YWGO 2X4GA 3MJEA 4YR9A 2RIRA 1HZJA 2BI8A 1SBYA 3QVXA 2WTBA 5LC1A 3S2FA 1W0CA 5I8ZA 4W9NC 2AQIA 2I3AA 1KVQA 1NM5A 3W8DA 1R4NA 2B37A 2B4RO 3JQDA 4QQRA 4EGFA 1QYCA 2F00A 2FZEA 5TQVA 4BOYA 4UVHA 1PU2A 2G0TA 4CM6A 3BTSA 5IN4A 3W8FA 4AICA 2YV2A 1NVTA 1K6JA 2P9EA 1KEPA 3BZUA 4L4SA 1ZK1A 4BL5A 4DVJA 1Y5RA 4BKRA 4PG6A 4UEKA 4PLTA 1U28A 4CPDA 1V3UA 2Y67A 1E5QA 3L4SO 4Z9FA 1KY4A 2EW2A 2HJSA 2Q1WA 3H5RA 2DFDA 4KUEA 4OGWA 3EC7A 3UKOA 3LVFO 4W82A 2PZKA 2DBVO 3WIEA 5TX7A 3WSVA 1BDBA 5T8KA 4W7IA 3WBFA 2A92A 5HBRA 3KYDA 3RUIA 1U3UA 2YQ4A 3U0BA 4RF3A 5G4LA 3PWSA 5HM8A 1JW9B 2EXXA 1UZMA 1B8PA 1GYPA 3GRPA 3NT4A 3VAZA 4KTVE 4XDZA 3U09A 2WDZA 5B1YA 5AXCA 3SXPA 4D3FA 4KUHA 5U9CA 2C29D 3DBRA 4PZEA 1PWXA 1RPNA 4PLVA 2YFHA 4TKLA 5BT9A 1A27A 5TGDA 2X1HA 1X1TA 2Z1MA 4TROA 3SC4A 4D41A 2OOSA 4M1QA 3TSCA 4E31A 4NU6A 3VKUA 1R4NB 4OOFA 4Z6KA 3F4BA 3K30A 2G17A 3WNQA 1TEHA 4DIBA 2RAFA 1NP3A 2PH3A 4R3NA 3DONA 4HFJA 3MJ4A 3VDQA 3BAZA 3LSYA 4A26A 1EE9A 4J1NA 2O50A 4U8GA 2QZZA 2VRBA 3JYPA 1NFQA 2VT2A 4OSPA 3ZWAA 4BKUA 4CL3A 2BFAA 4J2OA 4FJ1A 3KYDB 4RPLA 1PSDA 4TSKA 3WWZA 4TZTA 4GWKA 1R4MB 3KZVA 5JLAA 5LDHA 5ENVA 1JWAB 3BMOA 3MZ0A 3DOOA 3DBRB 4O63O 1D3AA 3OQ1A 3F3SA 4GGOA 4DL9A 4FBGA 2UDPA 5TRTA 5KVVA 3QQPA 2WWRA 3VZQA 3I9JA 3DZKA 2GASA 4OQYA 1VKNA 2C7VA 4ND5A 5JCXA 1H6BA 3B6ZA 3WQQA 3DFZA 4KWHA 2Q1TA 4GSKA 5DCYA 2Q1SA 2A9FA 3PJDA 2YV3A 4J3FA 1P45A 1BTOA 4XD2A 1O94A 3EZYA 3DHNA 3WQRA 1HDYA 4HFMA 4H3VA 3TWOA 5B4VA 1EUDA 3PFFA 1ZKMA 5DZSA 3S2EA 1O9BA 2HO5A 1LSOA 1DRWA 1U1IA 1PQUA 1PR9A 5JSFA 4RZIA 2J3IA 3I9OA 1E3WA 3A9WA 1P1FA
chains in the Genus database with same CATH superfamily
2X9GA 3M3PA 4MVJE 4IDAA 2YN2A 5DBHX 1XQVA 4LSZA 1WTAA 3QJYA 5K99A 3C6ZA 3RJZA 3KJXA 3KU4A 2I8LA 3MBKA 1OWNA 2BUCA 3OM8A 3ZHBA 2V6FA 2OBLA 1C9YA 2EQBA 4KR6A 3NCTA 1KZGB 1O94C 2CYBA 3ZXSA 2AW5A 4KBGA 5CITA 4DA4A 4B7XA 5IXYA 4OIMA 5MF6A 2P3LA 4Y6RA 3HCEA 2C7PA 3KDSE 2AOTB 1M1XB 4DA6A 3QE4A 4KNYA 4IR7A 4ZKEA 4MPJA 4BRWA 5DN6D 1SIUA 5HM6A 1N77A 2QN9A 4YV1A 2C94A 2FEPA 3HKEA 2WWVD 1A72A 1E5DA 3P2YA 3F90A 1I5RA 2F2TA 1YFLA 1U8TA 3W2GA 2J9XB 4YGYA 1CZRA 1PQPA 5SY4A 3KJNA 1HT1E 2IU6A 1YJXA 1CRLA 4S04A 4XE5A 1LTKA 5C8YF 4TKZA 3Q7SA 3NTOA 3LQRA 4WY8A 3TFWA 4Z5XA 1AS3A 1QIGA 2PD4A 2VHWA 3RYCB 5JARA 3ETDA 1H4TA 4C87A 1XJCA 4KL8S 5KIAA 3CWZA 3JWHA 3DCNA 3F7MA 2IY9A 3MT8A 2YUTA 3REOA 2QTHA 1XVVA 4JKIA 1U1CA 3R9XB 1GP2A 3N0VA 4NBNA 4CKCA 3BWVA 2WYWA 3KK0A 5LLDA 5KNBA 1L5GB 2ZRKA 3O8QA 3CRVA 2WOJA 4HWGA 2VIIA 4LC1A 5HDBB 1MJGA 2ZUEA 1PW7A 2ZRNA 4F8JA 3LWNA 3OSZA 1TI7A 2G25A 4IHKA 4DBVO 2CSUA 3IBSA 1PNVA 3HVUA 2NZJA 2VYNA 3FTCA 4OQ4A 5EMNA 5LBIA 3FBWA 3DEHA 1XRNA 3FUWA 3MWDA 5GJWC 5J2TA 1GTSA 4CCYA 1E9DA 1ISIA 3QU7A 4MKZA 1Y0BA 4DV3B 5JO0A 1V8BA 5F2EA 4M0DA 1HE8B 4P31A 4Y6PA 4BPRA 3GUUA 1NE2A 2QLTA 5KTRA 2FHPA 3PX7A 1GYRA 3CIOA 3EIUA 2P7HA 3HKEB 3N2KA 1RBQA 1O8CA 4QXPA 4RF2A 5B1DA 1XA3A 5BR1A 5AW0A 5JASA 2HX1A 3CG4A 4Q15A 3BGSA 1NPDA 3I6ZA 2AG0A 4FBMA 4UBMA 3HU3A 4DMHA 1SGWA 2VA9A 3PEVA 2CHFA 4GP9A 5B37A 4DQLA 1XDGA 3EFOA 3NP9A 4MGZR 1BOFA 2C9CA 4FGKA 1YR3A 5DX8A 4YRKA 2C88A 1LNSA 4ALMA 3WZLA 3WGUA 4DA0A 2C58A 1J00A 1NVVR 1R9JA 3NOOA 4M9SA 1JA9A 4Q9HA 3K0SA 1CB7A 4L7QA 1KOFA 1TKCA 2PX5A 3B6IA 1GOTA 1LF5A 3NJ4A 4C0LA 2RI0A 5H3LA 1LK5A 4IM7A 4O4LA 1J23A 3E23A 3BWEA 2VG8A 4NZPA 4OB7A 5HGJA 3VSEA 4MZDA 4AJ4A 2GERA 4MEJA 5KO2A 4I50A 3PBKA 1Y3AA 2YXNA 1HY3A 4DJJA 4E2FA 5H4GA 3ZHZA 2ACEA 4YACA 1YVDA 2VP2A 1E1LA 2AC2A 2UYOA 2X6TA 4L0QA 5JC8A 4KREA 4OQDA 2W37A 4WZ6A 4FKZA 1JMVA 1U3GA 1VHDA 3CH6A 3CSDA 4PFJA 3ZE8A 3MWDB 3CF6R 3U26A 2GRAA 1SK9A 2B1JA 2NZVG 1LRKA 3BFPA 1P17A 3N8GA 4CCYB 3PL1A 1BHSA 4FFBB 4FJ0A 2X4IA 3DG9A 3QLEA 2JAXA 4YAKA 1NRJB 1UPTA 1CNMA 1YBMA 2ERXA 3GGPA 4IV5A 4U2GA 3O8NA 1W0JA 1YOBA 3R8CA 3N2KB 1COWD 4CLDA 4HNVA 2V6IA 2AVNA 4QNMA 4Y2JA 5IXSA 1JQBA 3H7AA 3P32A 3VPCA 5A5EA 1PK7A 3EMVA 3AUTA 1J70A 1AV7A 1OYYA 5COBA 1D0SA 3UB3A 4CRWB 2IT1A 4PZCA 3RC7A 2BH9A 3CRW1 2WTUA 4Q4JA 3F7NA 1VE6A 4MP8A 3U4AA 1AKUA 3QRWA 2RC6A 4YAGA 3A14A 2JGIA 1MC5A 2PGDA 1FFAA 1R9NA 2PYIA 3E9MA 3HADA 3NNNA 3T5AA 2EDAA 4V24A 1G4UR 1TPYA 1M6NA 2A14A 1ZA2A 2R8EA 4BRSA 1RADA 4DBZA 5A0FA 5FPTA 2J46A 3MFYA 3QE2A 3T52A 4Z4HA 5B2FA 4O4LB 4AU1A 5DYIA 3WY9A 1B6TA 3PE4A 4FHFA 3W79A 1Y9DA 5DVZA 5T4EA 4ZTBA 1QHFA 2H7CA 4I50B 4ILEA 4EL0A 2EGGA 2DH6A 3ZH2A 2FN3A 3CRQA 4DG8A 2MYPA 2YVAA 1L1RA 5IF3A 5HEKA 4DJFC 2QP4A 1NXQA 4H1WA 1VHWA 3GNSA 2MSWA 2X9VA 3SHTA 4JC8A 2X41A 4JDPA 1RJWA 1I0LA 1BJKA 2XHEA 2IW3A 3K96A 4FFMA 2QAJA 4G07A 4O0LA 4OI4A 2R60A 4P35A 5H3CA 5JTUA 3PPWA 1XYGA 1Y81A 4FYYA 2GEFA 5IJAA 4B3SB 4WI1A 2FX3A 1BDJA 4RK6A 3BGDA 4ZEWA 3ED1A 2DUWA 3QWAA 1L5LA 1HE5A 2WMOB 1Z0KA 3SJAA 2NVUA 5F1OA 3VR4A 4WW0A 3RFXA 1GYQA 1X15A 1RI2A 2XDWA 4JP1A 4M8SA 5EINA 3S1LA 4DOMA 5IXJA 3EWIA 3VKWA 2F3RA 2F90A 1WDLA 2P9QA 1YFZA 4MVYA 1XF9A 2OTCA 1E66A 3BUSA 5JJLA 4WKNA 1P1RA 2Q5IA 3E5HA 1OFVA 4N01A 2FMHA 4DYDA 5EE9A 2RD2A 1HMYA 2ZWIA 1L4BA 4Q4JB 1I36A 1L5HB 5ULLA 5GIPE 4KMRA 3KD2A 2O5EA 2JS7A 3G2IA 4M0KA 3QU5A 4JS0A 4JT2A 3ER6A 5EZYF 3QBTA 2R5NA 4MHTA 3KJIA 1IEXA 2PUJA 4LF7B 5KNCA 3N7UA 4CKYA 1G21A 1J21A 1VE5A 1O58A 2XCIA 4GXTA 2A4MA 3JQAA 3UXMA 1LK0A 3JVUA 5E8JA 5C53B 2Z2XA 3N8NA 3C41J 2FN9A 2J0VA 4JNKA 1V43A 1PYOA 2QVLA 5K0ZA 3KOXA 5I7FA 1BYIA 2PUWA 1L3BA 5CMLA 2CHQA 2P91A 2AZXA 2Q2QA 5J40A 1OA0A 4B3BA 4MVJG 4D98A 1O6ZA 1W49A 2IU3A 2W2TA 4YS6A 4RVHA 4XJTA 4BLUA 4HAYA 5D2CA 3K9QO 2JZCA 5KX5B 1V96A 3HZRA 4RXMA 1K6EA 1NR1A 4C05A 4C3OB 2R79A 2WU4A 3URKA 3LIPA 2JIRA 3DA8A 2GN9A 2VL7A 1RKBA 4G41A 1V95A 5ICEA 2BJHA 5FT9A 3OQNA 1SBNE 2DY1A 2GBLA 4OCZA 1WE2A 1V5GA 4E2WA 3SIXA 1C3XA 2B98A 3PQCA 3V42A 4PXYA 3EOBI 2YHIA 1XFDA 4I1YA 2WHPA 5CB0A 2GM4A 2EP7A 2HAEA 1G2QA 2H2AA 4EUFA 3KKQA 4B3TB 4X64B 4FI3C 1GJRA 1XELA 2F4NA 4NCNA 5F2KA 4DILA 5JZOA 3OEED 1ANKA 4KODA 2HY7A 3C5VA 4S1OA 1DWOA 3BK2A 2GA9A 4K3UA 4RLSA 4OAQA 1VE3A 2ZETA 2CVQA 3WGHA 1G21B 2VJMA 1PFGA 5DLDA 4Q3DA 1E1QA 3IOYA 4JLPA 1QQ7A 2Y9PB 3BGWA 2NW6A 3FRHA 5ALQA 1WUHS 4UU7A 2XWPA 5JZVA 1V41E 4LC0A 5HKLA 4W4TA 1HEIA 2LNDA 1TLLA 1JKMA 3NPAA 3P7MA 2BD0A 1GTRA 4K1LA 4WBXC 4EZBA 3GOHA 2OB1A 2IYTA 2Q4BA 4YT8A 3NNDA 1N1DA 4KZPA 3L0ZA 4MIEA 5TDHA 1THTA 3EAGA 2LE0A 2J5RA 4W1QA 3A10A 3V1MA 4F3KA 1TAHA 4XSGA 5G3ZA 3ES9A 1QTIA 3DQPA 1RVDA 1PZEA 221PA 4HNTA 2VP9A 1XVLA 1VBKA 2R4QA 1BVYF 4TYYA 2DAPA 3E82A 1NXVA 2HBZA 4TTVA 4NEHB 2JFZA 3ENVA 4FCWA 3VOAA 3RO7A 1E7YA 3FI0A 3UPDA 2JHPA 2CV0A 1RWVA 2N0SA 3F2IA 5E8RA 3NHJA 4BO5A 5IS2A 4RV5A 4C7KA 2PU7A 2XTNA 5F7ZA 1QKIA 1WS6A 2QD4A 1FJ2A 3LQQA 4CFSA 3JZDA 1W75A 1WVIA 4A8JC 1Z6PA 5BQ3A 4D0NA 5IANA 1NBOA 1U6IA 1UZUA 5HE8A 5GGXA 3SWWA 4YUXA 3AY3A 4FDTA 1JLRA 2LTAA 3HBJA 4UBNA 2DX7A 2G5PA 1ZJ6A 5C1IA 1CEYA 1JHQA 2CUKA 1P2DA 4RFVA 1EHCA 1Q50A 4PSDA 1VA4A 4W5JA 1ZYUA 3QENA 1RPAA 1XA4A 4NFYA 4ZEXA 4AK9A 1W36D 1OAAA 1QGOA 4MV1A 1RPJA 4NYMR 4PZDA 3CJRA 1OF1A 4FNGA 2I03A 1LV8A 3AERA 2OM6A 4IJ5A 1XB2A 4JOQA 3GUVA 1DJOA 3MBIA 2GBGA 3CW9A 3I37X 3OT1B 3H97A 1SHJA 4LJ8A 521PA 4ZRDA 3SC2A 5ISMA 3LHDA 1A3CA 4IMIB 3PUXA 5KWSA 5K09A 2I99A 1ISRA 3KUCA 3ZCSA 2YRXA 2W00A 1NRWA 1VG1A 2C77A 1MX1A 3UV3A 2XMGA 4C20A 1B93A 4CL8A 4EVQA 5IUNC 4FDAA 1AKMA 1VYTA 2IDKA 3IALA 3IR5A 4B40A 3WTCA 3AK4A 4RTPA 1F6DA 1V6AA 2ONKA 3V3TA 4OYRA 2D1QA 1BG6A 1KK3A 1YNOA 3JD3A 3KP1A 3NC1C 4AMUA 1KQGA 3S8YA 2GB4A 1EUQA 4YJHA 4BB6A 4RNDB 8LDHA 1B43A 1T4DA 1W44A 1UK9A 3GVCA 3HS3A 1FJGB 5K3SA 2XMQA 1RCFA 2O5CA 4JC0A 1VXOA 4R0NA 4JI4B 1FW6A 4A8PA 2AG8A 3BTVA 1KU6A 4J0HA 3V55A 1KK0A 1L7VC 4Q9LA 3RVPA 4HGOA 3AF5A 3CEJA 1GQYA 1QG2A 2NO0A 2WHRA 5KVCA 4YJFB 1A9ZA 4F85A 1DCTA 1RI3A 1MV5A 2FHSA 2IUYA 3KEOA 2UYGA 3QLJA 4JCOA 5JJIA 3AJ9A 1E2KA 1J97A 5BPFA 3L7JA 2C3OA 3ANTA 4PLHA 2CXUA 4L5AA 4EFLA 1UM8A 2HWKA 1RWOA 4P82A 4IJKA 3CWQA 4QEKA 2LBPA 1B76A 3PSHA 4P7KA 1DQSA 2ZI3A 4TGLA 3RUHA 4BATA 4CCSA 3AERB 3IQGX 1Y4SA 2QI9F 3LX4A 2E55A 2PNJA 3WLLA 3X1JA 4RDXA 4ZI7F 1R4AA 2D5CA 3W9YA 1Y1PA 2XCLA 4G5RA 4MQFA 3SC2B 1AZWA 4PZYA 2ANCA 2ZEJA 2UUBB 3IE2A 4X20A 2CHGA 3PA6A 1U2SA 4M0MA 5AKEA 3IIIA 3VX3A 4MGHA 5THXA 1PR2A 2PJZA 4JYPA 2W58A 3FKSA 1H0RA 3WKBA 4PGGA 4C4RA 1TQ6A 1YQXA 1J4AA 4RE5A 2H48A 3E2IA 3JS5A 3PRKE 4ARZA 1ZONA 5LZ8A 3UJ8A 2R48A 3CLTD 3JD1A 4K9NA 3GLGA 3PI7A 3EF1A 1KP9A 4YJHB 3TLEA 4BQFA 4A4DA 3LWDA 3USZA 1VCMA 1Q0QA 1RLTA 1UJNA 2BCGY 2PN1A 1S5PA 3F6BX 4RSRA 4TV9A 4UUQA 2N1BA 4ZTZB 2Q6LA 2BMDA 4RPJA 1L5RA 5BO5A 1HL3A 5JQGB 5G41A 4EHHA 2OECA 3SDSA 4NK5A 4EK9A 1GAJA 2RCYA 4GI3A 1J24A 1AGYA 1HNXB 4IDGA 4LA4A 4ITRC 2IUEA 4ZRNA 4P83A 3N74A 3MNFA 4BO3A 2F3TA 4PG8A 3LDUA 4R1UA 3IQFA 5A4AA 2Y66A 5KYWA 1NUSA 3OZCA 1NU8A 3HXOA 3JQPA 3H1EA 3H65A 5FUQA 4XYEA 3U3DA 4OUDA 3VVBA 2FA9A 4J16C 4ACBA 4YJDA 1AOXA 4R2KA 1Q77A 3H84A 4LF5B 5JATA 3OLXA 4PC7A 4GRIA 1E98A 1EA7A 1X8JA 4F8EA 4LDAA 5IEJA 4HH4A 4INOA 3LPCA 1S7CA 4UCQA 1DX9A 5FHQA 4AF8A 5F1PA 1FTNA 2DMRA 2PBLA 4MQFB 2FE4A 2PMDA 1E2LA 2HJRA 3GFFA 3KJEA 3E3AA 1HQCA 2ZTLA 1RP7A 4X20B 5ECGC 4BJ5A 4BEBA 1ATZA 2WIBA 4MQ4A 4EPTA 5K05A 2WAXA 1DG1G 1ML3A 5KJFA 2B94A 2QB5A 3AO0B 4WACA 5A0VA 4DRZA 2GZ1A 5AVKA 5HFAA 1CJBA 2UKDA 5EP2A 1U0NA 2P5UA 2X8WA 3OM1A 1HQDA 5ECYA 4RGBA 4OKIA 3TIFA 4ARZB 4I4TA 1XLUA 2NTYC 5AI9A 4WNYA 3GLGB 1CPYA 2ODPA 2QROA 4AXBA 3AVQA 1TKBA 3O91A 3Q9LA 4TV9B 1K27A 5LYJF 4R1MA 3TNYA 2J41A 1DC6A 4UTPA 2PDAA 4QG3A 2ONCA 4R81A 2I91A 3RFCA 4K88A 4HXEB 3WLRA 1NFFA 1JQEA 2C0PA 2DBRA 4G0YA 3ESAA 3Q3EA 1JTEA 3DWIA 2GF2A 2BZGA 4QASA 2HK9A 3ASUA 5KYWB 1G66A 4X1IA 2EP8A 1N34B 3QWHA 1F17A 1MOZA 1ZS9A 1T25A 1VGVA 1GG9A 4YO8A 3G8CA 4DLLA 4XPIA 4YAWA 3GELA 1ECGA 1NW8A 2BLNA 1TVCA 1W87A 2IEGA 3PD1A 1GDDA 4KWCA 4PGMA 4LV8B 2WB2A 5A02A 4I81A 1J49A 5JJ5A 1A5ZA 4A36A 2WP8J 5HF5A 1XT6A 2VO1A 2IXBA 3HJHA 4FYIA 3WFJA 2CXRA 5F9HA 4IDDA 4J7UA 2RGXA 4LV6A 4B44A 4E4YA 2BFFA 4R31A 1ZD5A 2Q2WA 1UPFA 4CKXA 1U99A 3D4LA 2AXPA 2GAFA 4M8LA 1QCDA 5FV7A 5I5GA 2PVPA 1DG9A 4M54A 3MOSA 3NKVA 5KDLA 3V2UA 4IIYA 3ZTYA 4R9VA 3F0TA 5KQRA 2X1MA 2GD6A 3II6X 1S2DA 1SVIA 3CWCA 4GXNA 3DV2A 4KQEA 4L76A 4E3ZA 1OVGA 4RHFA 2A1TS 2VVTA 5JR3A 3AOEC 5FTMA 1FUEA 1KH2A 2WICA 1U9CA 5T4FA 1RWNA 4IRXA 4OG2A 1BZYA 4FMDB 1E5VA 4IG4A 1BA2A 1ODFA 3ZWNA 2Z09A 1UPBA 1UXGA 3GEPA 3T8YA 2I1VB 2Y05A 2C9BA 1W9MA 5TT1A 3RS9A 2YZ7A 4YJGA 1N36B 4RJIA 4O02B 2ZRPA 4I08A 3AB8A 4HADA 5LUBA 3I32A 3IQXA 4HRXA 4LECA 4WLOA 4FCTA 2W42A 1SBHA 4X1IB 1TDJA 3WXBA 4RK0A 1GUYA 2A1UA 3RVJA 3ZVRA 3DB2A 2EKPA 3SIWA 4C29A 4Q9IA 3ZXIA 3RNLA 4XPIB 2HIAA 1EZ4A 3UJ6A 3OUZA 1Z6GA 2B0JA 3MCUA 2VLIA 3L0OA 2FLVA 1FP2A 1ZGHA 2B7LA 2EZ9A 1D6SA 4D46A 5ALEA 3EPLA 1BMFD 3SVZA 1WB5A 2FQWA 3VVLA 1CR4A 3X1XA 3KXLA 5FI0B 1XTKA 1JTVA 1Z7WA 2IXTA 3O4VA 4WERA 3HEAA 5EVCA 3R74A 1IUKA 2ZJ1A 2BFFB 2WM8A 4L8LA 3PIIA 2C5EA 3K3PA 3TZQA 3HMQA 5IYZB 2C42A 1TUGA 1ZJJA 4KV9A 3SMVA 3UAOA 1QS0A 4F60A 4Q16A 1Y7HA 1RJDA 1Q21A 4L8YA 1WXWA 5EP3A 5B7GA 5L45A 4RULA 3N2YA 4KRGA 5LKRA 2WJGA 5JZ9A 2E82A 3CUVA 1VMKA 4ZDJA 5M29A 2CUNA 4BX2A 4MP3A 5L4NA 4HDCA 5KWIA 4RFLA 4WAUA 4U7FA 3AEZA 1SVMA 1U7UA 2AEFA 1ADBA 3O4IA 4Y0VA 5IM4A 3DKKA 1A9SA 3ZKAA 4AP5A 4L3VA 2MINA 1V3QE 4OEHA 2VTEA 1JEOA 3W9SA 5CLFA 3HB0A 4NCAA 1WMSA 3GUZA 1R6BX 2KYRA 1EVLA 3JQ6A 4DIMA 1AA6A 4YJGB 3ZE1B 3WHKA 2H51A 1HBJA 2EBUA 1JRLA 1JXOA 3QPWA 1B26A 2O0LA 5G0UA 2WJZB 3B70A 1CT9A 3EWNA 4IIGA 4PHFA 2W9XA 5K3EA 5DLYA 2PSEA 2A1UB 2B4QA 1SXJA 1E7RA 1YCFA 4FR2A 4JT9A 4YN3A 3WYAA 1KI6A 2HOQA 4HHEA 4CTMA 5A6SA 2BHLA 3C7KA 2JRCA 5I8PA 4JXXA 3QVTA 4ETWA 1NAIA 1Q3HA 1YB2A 4ZU1X 2VEDA 4Q3NA 3NIDB 1FPQA 1Y7IA 4MR7A 2QVBA 4EI8A 2N47A 5EJ4A 3L0DA 3QFTA 4FNAA 1E9VA 3ECCA 2PWYA 4PO9A 4ZT5A 4L51A 3KYCA 5L3QA 4C5AA 1G98A 1GFIA 4AO6A 5GM1A 4OK3A 2XRZA 3Q0TA 2W4MA 4IFIA 3NV9A 1UJMA 4OHOA 3H42B 3RIGA 3T34A 1PZHA 1QS0B 3G2JA 1QIFA 2O4UX 3LAWA 2BJWA 1W2HA 3O3MB 1Y80A 4A0GA 1FZTA 4Y18A 3ROTA 5FNVF 4AL4A 1EUZA 1X38A 4LXTA 2DGDA 1NI4A 1P18A 4MPPA 3MFQA 4QOGA 4X60A 5HKKA 4XFDA 1DTWA 4XYBA 5HNKA 2I22A 4OP2A 3VKVA 3ZK7A 2C5HA 1MB4A 3L4EA 4W7SA 2MINB 4QUHA 3T1QA 2OCBA 2ZTMA 2KW5A 4JBYA 1KZ1A 3HYTA 2QL9A 2HPHA 4BO9A 3V1LA 1NBIA 2Q5OA 3FPCA 3PX3A 1L7OA 4Y2YA 1H3FA 3K0AA 3R7NA 3DZJA 2MTBA 3KJGA 2YV4A 4WWHA 4CT5A 2ORWA 2Y71A 3QEOA 4NF2A 4GI1A 4IOMA 4NPAA 4LOIA 1WF3A 2VHJA 5AHKA 1O4VA 3P26A 1KI6B 3H7IA 4F4JA 2FMIA 4AG6A 1WPRA 1Y1SA 4EQ6A 1XJ5A 2V9PA 4OHWA 1XOIA 3LT2A 4W1SA 4JLMA 1HX7A 3QVUA 3I2IA 3LLUA 1VLVA 2DKNA 4G81A 1L4LA 3K1TA 3Q6NA 5NULA 4FT2A 2IEDA 4FNOA 3KYCB 2PRSA 4TSFD 1F14A 1Q0ZA 2PJDA 1G2OA 3GCDA 2MR5A 3VPBA 4YRZA 4L0DA 1KRHA 2O3UA 3NAGA 4P4UA 1YTUA 2OV8A 5K3OA 4ZCIA 1PS0A 1Z4NA 1CUHA 1R0WA 2B5VA 3DKRA 1NT2A 4PPNA 3H1TA 3HFSA 3NAQA 4LJKA 3G8BA 1UXJA 1G8PA 4CTNA 1Y6GA 1KFKB 4DARA 3RIMA 1FYEA 4JOBA 4G23A 1NI4B 2JFXA 2YICA 1KI4A 1HG1A 3OE7A 3TQTA 2IZ6A 1DTWB 2OHGA 2QJTA 4AF7A 5BW4A 2R2GA 2O8BB 1MG5A 4V2IA 4JI5B 3TOCA 1U0HC 2V6BA 3ID6C 1OT3A 4TKUA 3CKYA 3FSEA 1ZOSA 1G0NA 5CBPA 3JQBA 3A1NA 3LHIA 1X1DA 3FCXA 2BPOA 3UYLA 4CTKA 3K0AB 4WCFB 1VRCA 4LN1A 4MAAA 4LY9A 1C1XB 1ADJA 3ASYA 3Q2KA 1I14A 2IDJA 5GJVC 3Q7RA 3NHSA 4BVBA 5BY2A 4E6PA 1Q1AA 3EYWA 1KAOA 1RU3A 3RAGA 1C9DB 3EZFA 5G1NA 4EQ6B 4MQBA 4PLCA 1E7QA 3C3WA 3OPMA 2NXNA 2HQOA 4NZZA 4EJSC 4LYAA 3VOTA 4RK1A 3ZXUB 4EW2A 4OREX 1RHRA 1LXCA 3DAHA 3RHZA 2P78A 5IUKC 4D4KA 3AMVA 4JB8A 1SCBA 3O4GA 2NNWB 5CAEA 5TMEA 1MJ5A 4DCTA 4KE8A 3LTNC 4LPKA 2CHUA 4V0OA 3EH2A 1GFSA 3DVQX 3U3OA 5CFRA 1U2ZA 4K9QA 3IULA 4A0HA 4DT1A 5G4KA 5LQNA 3KTDA 2PKWA 4MUJA 4UE2A 5JCJA 2WF8A 3KOWA 3V48A 2FGKA 4JBIA 2JI7A 4MEAA 5LJLA 5EN4A 2PZFA 2PBZA 2O0MA 4U6QA 3RC8A 1A4RA 4MUYA 4MSUA 4BQRA 4YXFA 4D25A 3PZBA 1IMJA 1M2WA 1B42A 1JV2B 4B0PA 3C16C 3CPJB 1SG9A 2LCQA 1SOVA 3Q2OA 4QBIA 3TLKA 4CV0A 1FFXA 4O0MA 3RSHA 1STOA 1U7DA 2DVMA 3C3AA 3KZOA 2JLRA 4FYJA 5DHTA 3TJMA 3G1TA 1CLUA 1XQXA 1FXWF 1WMAA 2Q8PA 2WEKA 3EC2A 3OZBA 2CHVA 2IHJA 4GPTA 1E60A 1ETUA 4QUBA 4MH0R 3ESRA 4AX4A 4QRHA 4IICA 5C7IO 2PMEA 1C3VA 3UK2A 3V4SA 3IE1A 2CLEB 2XSZD 2QG4A 1DX4A 3UC5A 1W52X 3DNMA 1KYXA 2VH5R 3I5MA 1R0LA 1FVOA 4D9EA 2B8JA 4BIIA 1ISFA 1NW5A 3JXEA 3CF4G 3CSUA 3VGPA 4D6PA 3D6UA 5JSUA 1XD8A 1V2GA 1YQQA 2YYYA 2PUAA 4ZJPA 2V6JA 5CAEB 5I7UA 1SOUA 3PDHA 4AJHA 4DBLC 1YZHA 3RV3A 3OZEA 3AVPA 1MH1A 3CLKA 1TU3A 3H1BA 2IQ5A 1Y9EA 2VSOA 4CI9A 3C0KA 4E33A 3STYA 1F2UA 1J2JA 4DIFA 4JI3B 1LCIA 4DT1B 5G4KB 2L18A 3TFQA 1D6NA 5LZ7A 2XYHA 2VPPA 3H5LA 4B6FA 4EHKA 3GROA 1NQOA 1Z4IA 1KTIA 4X97A 3CH5A 3NEPX 2C9OA 2CNWD 2AE2A 1KR5A 4UE6A 2YMQA 5JCOC 4TL6A 2Y8EA 5FTJA 5NLLA 3WICA 1TCBA 2AOXA 1KI2A 2XGSA 1ZOLA 3O38A 4FDVA 4IUCS 5T4BA 4RX1A 4HPWA 4DANA 4HBZA 4DWWA 3A4VA 4ZYZA 4OM8A 4PSKA 5BR7A 5CLQA 2XVMA 5CJJA 4C0QC 3MG9A 1EX9A 4CQMD 2PKEA 4XQ0A 1TQ8A 5EJFA 3S2YA 3UJAA 2B1RA 1Z74A 3HMKA 3T4PA 3I23A 5KYXB 3IMGA 3HCOA 3NWEA 2A0YA 1H2FA 1RXEA 4R84A 3I5UA 1DZ3A 3ZYCA 1FJXA 2QSZA 4AZWA 2IL1A 2H7YA 2Q3MA 4PIMA 3JQ9A 3OECA 4K9KA 1XZJA 1VZ2A 1E9CA 4JUDX 4G9EA 1F38A 3KHUA 4RJKA 2BGMA 4R8VA 4C0AC 2EKLA 3O74A 1F2UB 3DOEA 3MCWA 4JVNA 2RH9B 2HO4A 5DISB 5JD6A 2P2CA 4HOYA 2Q99A 4LHWA 4PPYA 4MHSA 4G6ZA 1E18A 2D8AA 3ZGNA 3MGGA 1KO8A 4MQEA 4MPRA 2BEUA 1SKBA 2OCKA 4HL6A 3QMMA 3TTSA 4LDNA 2X4LA 1GIAA 4Q1EA 1F1JA 2IGBA 1ZISA 4LXQA 3LIIA 3G82C 2V6MA 1UBFA 3S29A 4D3DA 1IK6A 5DNCA 2Y1WA 1PK8A 1DMSA 4AMGA 2HWYA 3CR3C 4A6EA 1BU8A 3L4BA 4L1KA 4YMHA 4WZAE 4EGSA 2DECA 3BXHA 3I73A 5FOVA 4GR4A 4RETA 1ZITA 2KMLA 2H0QA 3FOBA 4N8DA 4QULA 1E8NA 2E6KA 4MGEA 4QGHA 1W47A 2SHKA 5EP1A 2C95A 3RGWS 1Z7BA 1XMSA 3VZDA 1LU9A 4S0ZA 3AJAA 3WDKA 2HIHA 3OTGA 3HB4X 3LT0A 4RK5A 4UVIA 3THSA 1JHAA 4BWFB 3GPCA 3WBBA 4D02A 5DIFA 3JR7A 4PAWA 4M87A 1LX6A 3N0WA 2I8CA 2R47A 1Z7YA 5ELLA 1GKUB 3ZNOA 3OJOA 1C3JA 4PG5A 3Q7EA 4QELA 1XU9A 1HTTA 4M9UA 1N78A 3LFHA 1E4YA 4S1TA 4ZU6X 4HN2A 3FPBA 4R0MA 2B25A 5K9ZA 4PF1A 1SH7A 3Q41A 3ER9A 1KFEB 3H9GA 3LFTA 1F3LA 4MRNA 3AZOA 4IIVA 1RXIA 3M3HA 3F97A 2Z6VA 1J0XO 3HM2A 1I6KA 5BYBA 5SY9A 3E5NA 3NW9A 1PJ4A 4GL4A 4M60A 3ZE0B 4CQLA 3SK0A 2A86A 2FPRA 3MTAA 3Q87B 3QITA 4R40A 5KJEA 2DFVA 4BNJA 3F8TA 5B1EA 2IHKA 3NP7A 2UVQA 4NDZA 1WP9A 1K7CA 1N4DA 2WM3A 3HNRA 4XB6B 1W6UA 2CBGA 4MKFA 4GR9A 1E4VA 1VGQA 2POCA 4A1OA 2AX4A 1P74A 3WBKA 4CLRA 3VNSA 3PHLA 4GPZA 3HM9A 2JK0A 3DDSA 3H2GA 2ZATA 1OIWA 4FXPA 1YU9A 4EA6A 1L3CA 3P97A 4QPZA 4HJRA 1XLVA 4G24A 1UCFA 3C6MA 3KQWA 1ONNA 4BO4A 2TYSB 1VHJA 1Z4QA 4LVUA 5DH9A 2X2OA 1KY3A 4D8TA 4MAMA 5FPPA 4URFA 1AD2A 2OM2A 2V4MA 4OL9A 1RDFA 2O3QA 4JSTA 1EJ6A 4EB0A 4HH1A 1M10A 1T9KA 2XEDA 3VH4A 2BF4A 2O14A 3O1LA 1RCUA 4NBKA 4OI1A 3U7HB 5C8YA 4DKJA 3A11A 1N6OA 2R85A 2RGAA 1JR6A 5C8ZA 3QUCA 1PUXA 4F0JA 1E61A 3U1BA 1LJLA 3M1LA 4H7FA 3T7AA 3WYFA 4E88A 3SXUA 1YI1A 3TDMA 3Q5GA 1N6HA 4JI7B 4N7MA 3O03A 2OFWA 5AJXA 1WQ3A 3VBEA 4PTLA 3AYZB 3BXZA 5EKUA 4J0FA 2X9NA 3BJEA 4OHBA 821PA 4AKIA 1Z26A 2GILA 3DZDA 1A9XA 1OI3A 5BQOA 2ATCA 1YUMA 5KPJA 1JIJA 2O20A 5BMVB 4WJZA 2C84A 4RV9A 4M9ZA 1GILA 3A1SA 2J31A 3DAYA 5BSRA 2CD7A 2AC4A 4OK5A 1IXYA 2Z56A 3AYXB 4HNSA 3L40A 5EKXA 2A6PA 3ZWPA 2PX2A 3P2MA 4IQ4A 3RPEA 1K5GA 5THKA 5BPHA 2X42A 4HLQB 2H5LA 4WX2B 2A5GA 3KQSA 4XIGS 3WAGA 1HC7A 3KWLA 4LSGA 3GD7A 2CK3D 2GARA 2PKYX 3DL2A 1C1DA 1H93A 1QE5A 4O4HF 1TEZA 2X3UA 1TM7E 1H2YA 5A0TA 3G3EA 3OTHA 4NK4A 4R8KA 2B20A 3R5FA 2GFQA 2Q7OE 3EAQA 3SVLA 3RH0A 1A9TA 2XMDA 4FM9A 3OCJA 1FFSA 4MWBA 3T5BA 2XXAA 2Q3CA 3ZNQA 4EHNA 9ATCA 5K8IA 3MWYW 1Z39A 2I3ZA 4G5XA 1E2NA 1PDVA 2PUEA 4TMWA 1TCVA 2I4MA 3Q8KA 3AIIA 1NI5A 2EIHA 3IP9A 4N6GA 4RLHA 2CXQA 2GM9A 3ZJUA 2ZRAA 2OR3A 2ESRA 3IOCA 4D99A 3O82A 2QD1A 1VL0A 4M9XA 1F0NA 2Z5GA 2PXHA 3MJVA 5DYTA 2GYYA 3HPQA 4LJ9A 4EA9A 2WD9A 1PVOA 4EHLA 1QPGA 1E79D 3NV7A 3ESXA 4D4HA 1OH6A 2F64A 2EG5A 3HGMA 5CB4F 1OXXK 1PNQA 3BL6A 1QHSA 2H7XA 1V4NA 1N8TA 4XCXA 5FOSA 3O26A 4IO1A 3ROQA 4C4SA 2W7TA 4OQQA 2HBRA 1Q15A 2B6HA 4BUJA 3TRIA 3QW4B 3FPAA 2E37A 4KR3A 4FXOA 3NBZC 5DBGA 2H5IA 1GKLA 3R7DA 1P9NA 2EJTA 1C1DB 4TS3A 3UJ7A 5EJMA 5JWOA 3K9NA 5JFOA 2Q9UA 5DX0A 4DM3A 3ZVMA 3D8NA 3UOAB 3L18A 3AP3A 3D1VA 3SYLA 3JYQA 2XZOA 4HDQB 3QE0A 4EY5A 2ZFUA 4OJMX 1Z6TA 1OXMA 4MW2A 3U3KA 1TZKA 3ZV7A 4BUCA 5A62A 1YK0A 3KXPA 4YECA 2CVFA 1TT7A 2OBXA 3K2QA 5BQFA 1D1SA 3PE6A 2XXAB 1SC4A 1G5FA 1O54A 4LK3A 3CRNA 1FYVA 3WJ7A 5LYYA 4CLOA 3V5NA 2V5VA 4QG7A 2EEPA 3A6PC 5KYUA 4EPWA 3HCDA 1DC3A 2XE8A 3FH0A 1P7WA 3FMOB 3OZAA 3VU9A 2C59A 4X5OA 1UODA 2C2WA 5AK5A 4CQNA 2ALJA 4F6LA 4QD3A 1WXGA 5TB5A 1E6EA 2YC4C 2O3SA 3LCJA 2X7XA 5F2OA 5KC8A 2HMUA 2RH4A 5EE5B 1GCIA 4RJJA 2WHEA 5DSTA 1BFKA 1A0OA 4HAUA 1E2EA 4MUXA 5DMHA 4LXUA 4EO9A 3BGOS 1QQBA 2QTVA 1F7VA 4IEFB 2RHGB 4UVDA 6CHYA 2YIJA 4LWOA 4A2WA 4BVKA 3FZQA 3MUEA 4HTAA 1QYRA 4Z99A 5DV9A 1UK8A 2ZYTX 3P71T 1SVLA 3U4DA 1HDZA 2H9AA 1N2GA 1VECA 5K1ZA 4C06A 3B78A 4P54A 4D4MA 5HJ7A 4X9XA 1AQLA 3EK2A 3GGOA 2NO5A 5AKHA 1CS0A 1XAIA 2GJKA 3CNBA 1G5QA 3DR3A 4GM4A 3SEFA 4PC6A 4YT5A 1XEWY 3E6AA 5I8WA 3SE0A 1NOJA 1SUDA 4H16A 3FCUB 4FCVA 3FB1A 3NHFA 4WLEA 4NBUA 5FPQA 1MIOA 2G3YA 2I76A 1CF2O 3OF2A 1W8IA 4MRPA 2W22A 5CJ2A 2JIQA 1CW2B 3BXEA 2XUGA 3VC7A 3R0IA 5BUQA 2LCIA 4CLOB 2L2QA 1FU4A 3E4CA 1E8DA 1FU7A 5EZYA 1XBTA 3GEEA 1PX2A 1FUKA 1GRQA 1DTSA 2WUDA 4YRBA 1YH3A 3SHWA 3LDAA 4QDOA 4WXHA 5IDXA 4IILA 1O95A 3UAXA 3ZCPA 3VO2A 1YI8A 1QO0D 3L84A 4OU4A 5L3RA 5JNRA 3FD8A 1JMYA 3OQMA 4MUBA 1A7KA 1PFUA 1UP7A 3C6XA 2WJYA 3KVRA 4EJMA 5A9SA 4V1CA 5HKOA 4JVLA 4EY8A 4B8YA 5J43A 2QTVB 4X90A 1K7YA 3BCHA 4I8XA 4OGKA 5FI1B 1RFLA 1XZCA 5LD2B 3L7AA 2X8AA 3H0CA 1NW6A 1RE0A 4S1VA 3ZTWA 4ZYVA 2G4VA 5L3VA 1QHGA 1ZU5A 3TEJA 4QNNA 4JNCA 1WEHA 5DO9A 5FJJA 4H27A 1ZMOA 1V0JA 2VAVA 4EFNA 3OQOA 3UV7A 1NZDA 3ZY4A 1H94A 2QQ5A 5DNWA 2QW1A 2VUTA 3IEIA 1R0ZA 1CS0B 4QVGA 1Z37A 3SZLA 1ECLA 2J6CA 1J2YA 1QOPB 2M2IA 2X1LA 4RHTA 1VJ5A 3QVJA 4QUIA 3DXFA 4I55F 4HT3B 2PJRA 5JS7A 2Q5FA 3PG5A 2JH3A 4FB4A 4Y6GB 4AZ3A 1SVUA 1YMVA 1KO7A 2GZRA 2VTKA 3FLEA 1MIOB 4FYMA 4MUNA 3FMVA 3ZNPA 3UO8B 5AQ1A 3QZUA 3OZSA 5LVAA 1VRVA 1SVSA 5DGCA 4GOND 4XWKA 2C4VA 4LZNA 1B1AA 1SC1A 3ORFA 1P0FA 4BVHA 1G18A 1A1VA 2FG7C 3N6XA 1KYWA 4TRMA 3RD5A 3FR8A 5LOVF 3QKRA 1U1DA 3UUWA 4EAQA 1QKKA 2BONA 4KGDA 4MA4A 1GPH1 4TS1A 5DMXA 3F6RA 3KQVA 3U1VA 1TC1A 2X0KA 4UZFA 3CIFA 4RTLA 1O4WA 4O5AA 2H9IA 2VZ8A 5A9SB 5DT9A 4S35A 2E9SA 5KSOA 2O1SA 1XZHA 3ADPA 3O8LA 3B13B 1FQOA 2F17A 2CXOA 1RWWA 4H2DA 2D54A 1PJAA 1N6PA 1YIDA 3ET4A 3E7XA 4HLNA 1DO8A 5FEMA 4C0SA 1XMIA 5BSVA 1HRKA 1I3KA 4CN9A 4X66B 3I62A 3AG5A 1RJGA 1U0LA 2AMJA 1POXA 1P9LA 2OG2A 3E58A 5K3CA 3ED5A 1NLFA 2QRMA 4Q66C 2Z2ZA 3CLSC 5CA0F 1RKUA 5E1MA 1GPUA 2CXTA 3EDQA 3SZGA 4B31A 1EWKA 2HRCA 3JPYA 1EM6A 3AB3A 4R2LA 4R1PA 4AZ3B 3GHYA 1UUFA 4I4IA 2R7NA 4XYGA 4X3OA 2H2IA 5BYJA 4X8MA 3Q6IA 1RE1A 2C57A 5L3ZA 1HDIA 2C4NA 3UUEA 4F2PA 1G3MA 2H9YA 2I71A 4HPXB 4NCJA 4IIHA 4Z2YA 1L5KA 5JXJA 1VJ1A 3RDPA 2BGTA 2OBFA 3GJTA 3AF4A 4MQMA 5EY5B 3WWDA 4CKWB 4RK4A 1XDSA 3CJQA 3F6CA 3EE6A 3QKRB 4Q9KA 1YZKA 3B1ZA 2ORIA 2PBFA 2CN1A 1XDWA 1IXKA 5A5DA 4TLLB 2J5QA 2R5WA 2QRJA 2I2CA 1EVZA 2EZUA 3EWSA 2XB6A 4B6PA 1VE9A 2DTXA 2FQQA 2WWWA 4BGUA 4I9NA 3SKVA 4D8UA