4JNKA

Lactate dehydrogenase a in complex with inhibitor compound 22
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
326
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARSRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Identification of substituted 2-thio-6-oxo-1,6-dihydropyrimidines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 326
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jnkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4jnkA02
4Y98A 1I24A 3E8XA 4BL5A 2BI8A 1OMOA 1F8FA 3F4LA 1I36A 1E7MA 3G1UA 1NVGA 1NR1A 3W6UA 3AJRA 5JAIA 4OIMA 2AA3A 4JP2A 4R16A 4PLCA 2CVQA 3MTGA 4PGFA 4RPJA 3LT4A 3PIDA 2X0RA 4ND3A 3WIEA 2F1KA 4R3WA 1KEVA 4PLWA 4CMJA 3PLRA 1VE9A 1E3LA 2NUAA 3MEQA 1A72A 1E3JA 4FB5A 3AW9A 1W73A 5DDIP 5G4KB 1YH3A 1E3IA 2VZ0A 5TT1A 3GC6A 1LEHA 4IBOA 1DPGA 3DWFA 3DZFA 1A4IA 3OHSX 2B69A 4RPKA 3ZWYA 1QG6A 3GR6A 1ADCA 1E7WA 4QO8A 3H9GA 4FFRA 2EJWA 4RLSA 5BSFA 2R00A 3GRPA 4CQMA 4AL4A 4M49A 4EW6A 4II2A 2P91A 4ND1A 4RZHA 2Q50A 3H6KA 3Q6IA 3LU1A 4XEHA 1R4MB 3PWSA 4UUNA 4CQMD 2XPCA 4OH1A 4YPOA 5DP1A 3R3SA 4OHUA 2YQ4A 3JD4A 4YB8A 4DL9A 3AY7A 2QIOA 2V7PA 4J3FA 2X9NA 2FR0A 4PG5A 4ALIA 4D3SA 2Y1DA 3ANLA 4IDDA 4FFPA 4BNIA 5KIAA 2YV2A 4YJFA 1I33A 5L4LA 2HJRA 1DOHA 3INGA 3MTJA 4I5GA 1EVIA 1EBFA 1NFQA 2B0JA 4OXNA 1N5DA 3F9IA 4RF3A 2VZ8A 1VL6A 4IQ0A 4Y67A 3OIFA 5L4NA 3ZV4A 1R6DA 4W7HA 1UJMA 3DEYX 1XA0A 4Z9YA 2EV9A 4WLFA 1YBMA 4MVJA 3WJAA 3EMKA 4U5QA 3NAQA 3NKLA 5ENDA 1T2AA 3JQ7B 1Y1PA 4KP7A 4OSPA 1SNYA 3BMOA 3H4VA 2D4AA 2Q1SA 4DGSA 1EE9A 4NU6A 3JYLA 1F8GA 2Y99A 1VRWA 4XQ9A 3MJEA 4R4JA 2YY7A 1X0XA 4IINA 4RDHA 1U28A 1AGNA 3H2ZA 2G82A 2IEDA 4CLXA 3I9KA 2AEFA 2GN4A 3RAJA 4GKBA 3U3XA 3FWZA 4XDZA 5DCUA 2W90A 2QQ5A 4XR9A 4DPMA 5KJFA 3RUFA 7ADHA 4GGPA 2A35A 5DOZA 4CL8A 4R9RA 3FNEA 5JO9A 3W8EA 3PYMA 3KSUA 1LSJA 1ZBQA 2GRAA 3MJVA 4N5NA 4OOFA 3TFQA 2AEMA 3GRKA 4YT2A 4FCCA 5TF4A 3I83A 3WQQA 5HM8A 3PDJA 3UVEA 1T2CA 4RVDA 1H2HA 1UDCA 3RU9A 4P4GA 5EIOA 3EZLA 3L0DA 4GMFA 4UREA 1ADFA 5HTOA 2X5JO 5G0WA 1WLYA 2O2SA 4H16A 2VZ9A 2NU7A 2H5LA 3QE3A 2IZZA 2YV1A 2JFGA 3E5MA 4E31A 4CMEC 4L0QA 1PQPA 1DC3A 3P7MA 2HQ1A 1P1KA 3F5SA 1I10A 1ARZA 5THKA 2FY8A 4BNMA 4E30A 3RUHA 3E82A 2QZ9A 2W2KA 1BDMA 3ZV5A 2DBQA 3Q2KA 2IDZA 2ZK7A 3DO5A 2OXIA 3A28A 3H9UA 3EY4A 3LSYA 4NHEA 3HB4X 1E5LA 2D1YA 3QWHA 1WPQA 4R01A 4RVFA 3D3WB 1P3DA 3EYWA 3V1YA 3ZU2A 2OP1A 2VYNA 4Q3EA 3P2YA 2EKLA 2V6FA 4CMBA 2Y1CA 1H93A 1QYDA 3ENKA 1D1TA 1C1DA 3IMFA 1ADGA 3KYCB 4ITUA 2X86A 3AFNA 1X7HA 5JAMA 1NFFA 1ZIDA 5ER6A 4A5OA 4QEDA 4J43A 2NADA 4J6FA 5G4LA 2C5AA 3L6EA 1C0KA 1G0OA 2JD1A 4BGUA 5CEEA 3GPDG 3T4XA 4YRDA 1HE4A 1V35A 4KMSA 5A3JA 3P19A 1DC6A 3GN1A 1EQ2A 4O59O 4UULA 1FK8A 2FZEA 1DRUA 2B4QA 4PG4A 3IP3A 1N8KA 4LSWA 2VYVA 3NJ8A 5HBRA 3DL2A 4AJOA 1IY8A 4WNIA 3CPSA 4BMSA 2Q45A 3N58A 2VYVD 4J1TA 1VSUA 2E6UX 5TX7A 4WLOA 4PN3A 1B15A 1GCUA 1NQAO 3MOGA 1ZSNA 3ROPA 1PJSA 5DBFA 1R0KA 4FFNA 2DUWA 1M75A 2PV7A 5T57A 2X1HA 4XX0A 2BFOA 1DFGA 4QFCA 4CM8B 4HV4A 5JC1A 4RF5A 4F6LA 1I5RA 1I3KA 1UH5A 3GFGA 4N18A 4E6PA 3BHJA 4HADA 1XLTA 4N5MA 1Q7GA 4IJUA 4FQ8A 2JAHA 3LLSA 4LW8A 3AI2A 3WGYA 5AVOA 4JNKA 1HLDA 3NV9A 2B35A 4GGOA 1L7EA 2NTNA 2XF8A 4GWGA 5HWSA 3GQVA 1LSSA 4PLYA 5C37A 2G17A 2RHCA 4OJNA 2C2YA 4YAIA 2D5CA 4AJJA 3PWKA 1ZK4A 3CEAA 5CP8A 5IXYA 1XU7A 1UXHA 2VOEA 1PJ3A 1ZW1A 4WCFC 1UP4A 3CE6A 5B1YA 1B0AA 4BNGA 3BMCA 5L7WA 4BQRA 5COQA 2FPPA 1Q0LA 1H6CA 4MVJM 4EDFA 2BF7A 2PD6A 1E1MA 2RIRA 2ZQZA 4GMGA 4J9UE 3I3OA 1Z74A 3V5NA 5FWNA 5DN9A 5KVQA 5I7SA 3COSA 2IZ1A 1FDVA 1MA0A 4MDHA 1HTBA 3DAGA 1HZJA 4YT4A 3W4KA 1GPDG 2DC1A 1A4UA 2P2SA 1PS8A 1WP4A 2AQHA 2J5RA 3R6DA 5JCXA 4A10A 3WG9A 1Z7EA 2X8LA 2EGGA 1U2DA 3OM9A 3SLKA 4MPDA 1KOLA 1LUAA 3PRJA 4PZDA 2TMGA 2VHYA 1BHSA 5KTKA 3OF2A 4NH4A 4J7XA 1M6WA 4RVUA 4F3YA 3PYLA 4J4TA 3OIGA 3GFBA 5CPBA 4BNKA 4E12A 3IOYA 4H15A 1GEEA 1HWYA 4CUKA 4RCVA 1K2WA 2NVUA 2ZB8A 1C1XA 5AXDA 1VSVA 4DIFA 3RKUA 3E03A 1PJTA 3QHAA 4PZCA 1ISIA 1PZGA 3HZZA 1NTOA 1FXSA 3JQEA 1XR3A 3T7CA 4AJPA 3BMQB 4QUKA 2YV3A 3HSKA 4J0EA 4XWYA 5TQVA 3WNVA 3D7LA 1B8UA 4CLRB 2DLDA 2VHZA 5BR7A 1C0LA 1HDRA 1XQ1A 5ICSA 1ZH8A 2W4QA 3DAFA 4M86A 5DP2A 4Z0TA 5A1TA 5JMPA 1HKUA 3CIFA 5DF1A 2Z1NA 1Z45A 1PZHA 1KY5A 1X0VA 2BH9A 3RWBA 3GGOA 4A27A 1P1RA 1SBYA 3UCEA 3CINA 4MIOA 2DTEA 4HWKA 1I3MA 3DBRA 4IJWA 4UVEA 4BMNA 1RM4A 3GNSA 4R1SA 2G1UA 5ES3A 4NBVA 3DZBA 3O8QA 4KOAA 1NAHA 4XQGA 1JKIA 3VH2A 5B4UA 3M2TA 4KUHA 5G2OA 3WMWA 2Q4EA 5THQA 4IPTA 3LQFA 3OIDA 3A4VA 1EZ4A 2P5UA 3GVHA 2WMDA 3CH6A 2HCTA 4M1QA 4YJGA 1PJQA 5JC8A 3MJCA 4NJMB 3DTTA 2DTDA 5EQDA 3UUWA 5BNIA 3RUAA 4DUPA 4RDIA 2FP4A 3DDNA 1BVUA 1UUFA 4HUJA 1ORRA 3DZJA 1P77A 4B8WA 3ADPA 1EE2A 2CNBA 3AFMA 4NFHA 4XDYA 3ZU3A 2BLLA 4ZRNA 3LK7A 3BZUA 2JD2A 3NDIA 4W4TA 2Q46A 3U4DA 2AG5A 3JQ8B 4IY1A 5KKCA 4BNNA 3TL3A 3BA1A 1A9YA 3PHHA 4K28A 3I5MA 1GV1A 4MKRA 1U2GA 2ZATA 3TZQA 1HYGA 1JWAB 5LCXA 3V8BA 2ZKLA 4PLGA 2O3RA 3ZU5A 5CHEA 1E7SA 4FBGA 2UUPA 3C24A 1R0LA 3W4JA 1BVRA 1U4SA 3NT2A 2WD7B 3U62A 2VNSA 1YGYA 3S2EA 4ZQGA 5A5EA 1QYCA 4TVBA 1Z82A 3C8MA 1GL3A 3ZH2A 2EJVA 1D3AA 4E33A 3KLPX 2EEZA 4II3A 3WYEA 3DZKA 3KYBA 2JKVA 2HRBA 3WQRA 3RC1A 2EP5A 3TWOA 4BOYA 3K8ZA 1EUCA 3O4RA 1B26A 1KVSA 1ZK2A 3AU9A 3C1OA 4HFJA 1T26A 1XEAA 1XSEA 5JDCC 4K9DA 3OETA 1E92A 2ZIZA 2PKQP 5DBIA 3CXRA 3QV1A 4G5HA 4ZU3A 5B4TA 2RBEA 1CYDA 1U5CA 1GZ3A 2Y67A 2C20A 3GHHA 4MP8A 4RLHA 3AM5A 1HE3A 5CDTA 3M2PA 4CQMB 2WJPA 1M67A 3AOEC 4DBZA 3SX2A 1T24A 3JQDA 1OZAA 4AJ1A 3ZW9A 2EGHA 1P9LA 4RL6A 3KUXA 2WEKA 1HDZA 2D3TA 3F1KA 3QWFA 2EP7A 3N74A 2CF6A 4BNFA 5U1PA 1WDKA 1PJCA 4FFLA 4G2NA 4OKNA 5JLAA 1VL8A 3LF2A 4BNYA 4RVSA 3JYNA 3IDSA 3VTZA 5IDQA 4W7IA 1GYPA 2CD9A 4IS3A 5DOVA 1UXKA 1LRJA 3C7AA 3KEQA 4GAEA 5EL0A 3VZRA 5G0VA 1OBFO 1DIBA 3WYCA 1BW9B 4JXKA 1C0PA 2WYWA 1DEHA 4NIMA 3DBLA 4M89A 4J49A 3QVXA 2I3GA 5EMHA 1I8TA 3BMOB 3KBOA 1UZNA 4Q3BA 1HT0A 3C85A 8ADHA 3MJTA 3SVTA 2C7VA 5DULA 4BO6A 1X7GA 5AXCA 4FJ0A 2OP0A 4DPKA 4CMKA 2AW5A 3IJRA 4BO1A 2IRWA 1R15A 3KYDA 4GVLA 4IMRA 3DMTC 1BMDA 3EAGA 1B2LA 4PCVA 4HKTA 3WLFA 4MP6A 5IFLA 2B4TO 5I7FA 5CG1A 1CQJA 4DREA 4JROA 3NGLA 3TZHA 4TKLA 5L40A 5JE8A 3G1TA 3WGOA 1NAIA 4I5FA 4AJEA 3RUCA 2NLOA 3PHJA 4BNXA 5I9NA 1U3TA 3OJFA 2TMDA 2VOJA 3R1IA 3RFXA 1SCUA 5F3RA 1QYXA 5JDCA 2IYPA 3G79A 4UEKA 4O5OA 5IDXA 3ZWBA 1U3VA 1U8XX 4HP8A 2IODA 2CFCA 5ILOA 5G0TA 5I9MA 3PJFA 5CG2A 4MVJG 1C14A 2CDAA 3UICA 4CLEA 2X23A 4BIIA 3WQSB 1ZZEA 4MIEA 4J4HA 4CV0A 3AOEA 3BTOA 4RZIA 1C0IA 4RPGA 1DDOA 8LDHA 4L4XA 1R16A 2DU8A 1JVSA 4IIUA 4LRTB 3JQBA 1DC4A 1H0KA 1NVMB 3WLEA 4ZN6A 1GTMA 1IHYA 3TSCA 3DOOA 2HLPA 3VKUA 1YL5A 3ENNA 2PH3A 2BD0A 2PGJA 2NTJA 3WBBA 4CMGA 1Y6JA 4F45A 5I7VA 1N1EA 5DCYA 3VAZA 3WR5A 1HYHA 3JD1A 1ZK1A 3DBHA 1ISFA 3FSRA 5GY7A 2P4HX 3PDUA 4ZQBA 5A05A 3GPIA 3S55A 1VPDA 3C7CB 1IZ9A 4I08A 1A27A 1C1DB 3Q3CA 1E3WA 3D4OA 5ADHA 1N7HA 4RV9A 1ZFNA 4CR6A 1X7DA 2HKIA 3AUSA 4H3VA 4JLWA 1GPJA 4YJHB 4BNTA 3I1JA 3JCZA 4YT5A 1WNTA 1HL3A 5AXBA 1O94A 4QXMA 4CL3A 3NUGA 3TNLA 3DMTA 4KZPA 4R5MA 4IS2A 3HDQA 1TT7A 3SLGA 4KTVE 4GX2A 3HADA 1ISGA 3RD5A 3QP9A 3EZYA 2X0JA 5JW6A 3AY6A 1XGKA 3HB5X 3QJ5A 4H7PA 4BO2A 3MZ0A 4O6VA 4EJMA 3FPCA 1CRWG 2C7GA 4NNJA 1O8CA 3PJGA 4JGBA 2C54A 1KERA 1PGNA 5GZ3A 1AHHA 4BV8A 1ULUA 1BXZA 3VH3A 3GT0A 1XHLA 4QQRA 5TT0A 2P9GA 3HUDA 1EK5A 2R6JA 2GD1O 5BQFA 3ONFA 4TVOA 4QECA 3H2SA 4I9NA 4DLLA 1BSVA 1Z7BA 1LDMA 3WSVA 4HFRA 1DIAA 4W9NC 5BSEA 3F3SA 3WIDA 4DPLA 4WEQA 2XAAA 1JWBB 1A7KA 1ISHA 4L4RA 4DMLA 1E5QA 2Y1GA 2PZJA 3UGKA 2Z1MA 4E32A 4ALMA 3RKRA 1B7GO 4TKMA 3ULKA 2PGDA 2DPGA 2EXXA 2ZCUA 4LMRA 3L4BC 3ZW8A 2GUGA 4BNHA 3ETDA 4XB1A 1PIWA 1UAGA 3LYLA 2VUUA 5C7IO 4AG3A 1HDCA 2G0TA 1DXYA 3WFJA 4FDAA 3FF4A 4EGFA 3GN2A 4YAJA 3K2BA 4AJNA 3IS3A 4ALJA 2QW8A 1A7AA 2O3SA 3X2EA 3R3JA 3DTYA 4LK3A 2J5KA 2Q2WA 4O1MA 1Y81A 3V2UA 2W98A 1FDWA 2IZ0A 3WOHA 1YS4A 1Y9EA 4UVIA 2NU8A 4XR4A 4BQPA 4XQEA 2PY6A 5FYDA 1VKNA 1QXSA 1IHXA 3GHYA 1YB4A 2OGUA 3G3EA 1DB3A 4LSMA 4UEOA 2Q4BA 2GCGA 2Q49A 1T1RA 4CQLB 1SZJG 5KJCA 3EC7A 4WLNA 2GZ1A 3VZPA 3S2IA 3VHRA 3K6JA 2Y1EA 3V2HA 4NBTA 3HWRA 3LZ6A 3BTVA 3GNTA 3HN7A 1UXGA 1LJ8A 1N9GA 2NVUB 2XOXA 2I6TA 2V6GA 2XXBA 4D41A 5A06A 1T2EA 4MO2A 1O9BA 2PTGA 3D4NA 5L7YA 1JKFA 4BS9A 4URFA 3VPFA 1I32A 1YKFA 2RHRA 4ND2A 3UN1A 3IJPA 3ZWOA 2HK8A 2ZYGA 3NTQA 2EW8A 5K9ZA 1DJQA 2EF1A 4BVAA 2EWMA 2J6IA 3QW2A 4W9NA 1OC4A 1T2FA 1WDMA 1PR9A 4LCJA 4LCEA 1HDGO 1Z73A 1KEWA 2UUOA 1Y5MA 4GQAA 3TOXA 3DBRB 1DRVA 4FD3A 1FDTA 4DQUA 1HDOA 4ROSA 3JYPA 3GDGA 4ID9A 4WLEA 3GH3A 3L4BA 1C3VA 1EDZA 4IDAA 2RAFA 1W6UA 4AJ4A 1YQGA 4BV9A 1OI7A 1MC5A 3INRA 4ZQHA 4B8ZA 4RO0A 1LQUA 1O0SA 5G0UA 2FZWA 1PJLA 2OO5A 4Q3AA 4D7AA 1BXKA 2NTVA 3NTOA 4IM7A 1F06A 4B7XA 4D0RA 5A02A 4WPGA 1LLDA 1ZSVA 1YB1A 3NX4A 4JK3A 4FIZA 4JP3A 1H5QA 3U4IA 1JAYA 1BXGA 1PGQA 1NWHA 1DLIA 1NYTA 5IG2A 4MIYA 2BKAA 1QV6A 4CMIA 3JTMA 2JAPA 3O9ZA 3KV3O 2EKPA 4IQGA 4RJTA 1R66A 3L9XA 4HXYA 4PRKA 2QG4A 1X14A 5FI5A 1S6YA 1QORA 1R4NB 3WGQA 5K0ZA 3I4CA 3B20A 1EFKA 2NVBA 3GVIA 4I8XA 3TZCA 3W8FA 4ALLA 4CV2A 1LSUA 2DAPA 2OHXA 5C5IA 4BO5A 5MDHA 1RYDA 4RVHA 3WGZA 4R1TA 5GMOA 3ZV6A 1IB6A 4OL9A 2WYUA 4XKJA 4ZICA 1VC2A 4I9HA 4K1LA 4MKZA 1Y8QB 4Z6KA 1KC3A 3ON5A 5JCJA 1AHIA 4BNJA 4LVUA 3P5SA 3SBOA 5JCJD 3WB9A 3WGGA 1P0CA 4IJKA 2HK9A 2A92A 2DBRA 4U6SA 4A03A 5GZ1A 3MJ4A 1PJBA 4MVJF 3IC5A 1QV7A 1E0DA 2VWGA 2VTDA 3QWBA 4JBIA 3RSHA 4XYLA 2BMAA 3Q2IA 4YTEA 4L9RA 1T4DA 4HY3A 1LLCA 4Q3NA 4EUEA 1H6BA 1GY8A 1VI2A 3ASVA 3AU8A 5L53A 3ZDFA 1EQUA 3K2EA 3E48A 3TJRA 1JN0A 1NHGA 3WDSA 4DBVO 2F00A 5A03A 4YBZA 3AI3A 4WOKA 3ZI0A 2FPGA 3HFSA 5TIIA 3K92A 4LN1A 2PZLA 5EPOA 1LLQA 2GSDA 2ILTA 1QR6A 5COBA 3AUTA 4BO7A 4NU5A 5JAQA 1JDJA 1DAOA 1NQTA 1V3UA 3QY9A 4GPD1 3WX0A 4BNUA 5FEUA 4KWIA 1J4AA 4ZQEA 4R51A 3TZ6A 3ZHYA 5ITVA 4ILKA 4D44A 3AUAA 4U8GA 5IAAA 4JBHA 3RJ9A 2LDBA 5JSFA 3OQ6A 2YYYA 4GBJA 2O3UA 4TQGA 5CEFA 3LVFO 3I6QA 3UH1A 1SOWA 4P4NA 4W6ZA 4PZEA 1NQ5A 3GNQA 3HDJA 5JNLA 4YYZA 3DHEA 4WKGA 3PPIA 3ST7A 3R0IA 1ZNQO 2EHDA 4E5YA 5JFOA 4YDRA 3S1LA 4UVDA 1EEHA 3KRTA 1LSOA 3KSZO 5MGBA 1EMDA 2YHIA 4QFDA 4BNLA 3DBLB 4DIOA 1SB8A 4GLLA 3JSAA 2YHUA 3L6OO 4GX0A 1P1IA 1IE3A 4Z3DA 4M54A 4GSLA 1T2DA 2YDXA 5L9AA 3TN7A 1LRKA 5AYVA 4CMEA 1PWZA 3ZV3A 4I9UA 1VLLA 5I7EA 1SB9A 4CM6A 1P44A 2FMUA 2NWQA 2R2GA 1E1KA 3LDHA 1DLJA 3JYQA 4TWRA 4W82A 1EVYA 1S7CA 3M1LA 1ENYA 4UUOA 5LC1A 4B4OA 3CMMA 4IDCA 1DRWA 3WTBA 2PD4A 3W6ZA 2X9GA 2ZB4A 4R3NA 3PJEA 1NM5A 1I30A 1ENOA 2BELA 2FN7A 1SPXA 3VZSA 1A71A 3PZRA 4E13A 1H94A 2CF5A 2UDPA 3JQAB 1ONOA 4N5LA 5F21A 4WCDA 4DLBA 3UCFA 3ZNQA 3PIIA 3ZNNA 3ANMA 5HS4A 1CERA 2PLAA 2DTXA 1AXGA 1EBUA 1GUYA 2RH4A 4QX6A 4OKIA 4CODB 2UV8A 4ZRMA 3RCBA 1GCOA 1KETA 2JFHA 2HJSA 3EVNA 4IDEA 5CFZA 3S2GA 3GA0A 4FJ1A 2JHGA 1TXGA 4NFYA 1F0YA 3F6YA 4XYBA 5G4KA 2O2YA 4BKQA 1MGOA 1PSDA 2D59A 2O23A 4R68A 1SEPA 4YAEA 1NPTO 3WYBA 1K0UA 1YJQA 1IUKA 3MWDB 3Q0EA 1EFLA 3FN4A 4E2ZA 1E77A 2NU9A 3G49A 3BTUA 3EW7A 1Q0HA 4IGFA 4OYRA 3WMXA 5AOVA 2VTEA 1AUPA 1XG5A 2NACA 1UAYA 1YOVA 3ZHXA 1VKOA 3DBHB 1YQXA 4DIBA 2X22A 2FOIA 1R37A 1KVRA 1TA4A 5DNAA 2X9VA 3UOGA 4A7PA 3RFVA 2CVZA 3I9OA 2AQIA 2GF2A 4BNZA 3GAZA 5A9SB 1E3WB 2FRDA 2I65A 4R69A 4E2WA 3UW3A 3GVXA 2C82A 3EHEA 4BGVA 5HRUA 2EERA 1XYGA 3LF1A 4WGGA 2Y66A 4D43A 3CZRA 1IYZA 1HZZA 1KBZA 1PL8A 4O63O 5GZ6A 1E6UA 5U4QA 1BWSA 2AEJA 1W4ZA 4P22A 4WCFA 1OOEA 3H3FA 3QLJA 2W2LD 3EK2A 1CQIA 4R9SA 1N2SA 1BRMA 4J1SA 3RROA 2IEBA 4NDNE 3CKYA 1T1SA 3FTNA 3PI7A 2E37A 3UAGA 2QZZA 4IUYA 1PL7A 3H3JA 4N7RA 3KLMX 3CUKA 5IZCC 3UHAA 4CMCA 1ISMA 4JIGA 3U5TA 3AWDA 3RBVA 4F46A 3GAFA 3PQFA 4XD2A 3BTSA 1TI7A 2CVOA 3QVTA 1MC4A 2AQKA 2QYSA 1ZUD1 3DXFA 1NBOA 1B3BA 4BGEA 2VNAA 4J2OA 4FOOA 3ASUA 3KETA 3ZNPA 3FNHA 3GEMA 4TZTA 3A14A 2C29D 1TT5A 4BNVA 5COAA 1P1FA 4DQVA 1MG0A 3WGHA 2C0CA 4ZGWA 1A5ZA 2YFHA 4Y9DA 3GUCA 4U7WA 4ONEA 3ZCXA 3ZHBA 3OQBA 5JXWA 1V6AA 1ISJA 1DJNA 1I01A 1QP8A 3HHPA 4CMHA 5BSHA 1WWKA 5T6BA 3QA9A 2O50A 1X13A 3RIHA 5J23A 3OA0A 3IL2A 3FNFA 4ESOA 3H9JA 3UFXA 3WGTA 1QLJA 5ILGA 5T8KC 4CLDA 4EEXA 3D64A 2PKRA 1FMCA 3QVOA 4GLOA 2GR9A 3WICA 4GX1A 3V1TC 3G17A 5CDSA 4U0JA 2A4KA 3GMDA 3CMCO 2JL1A 3JQGA 3GOHA 5T64A 3KOUA 4DC0A 9LDTA 4BNWA 1CJCA 3H65A 1QYVA 4C7JA 1RM3A 4XA8A 1GAEO 2POQX 1MP0A 4O0LA 4BKPA 3D0OA 2J3KA 1O6ZA 1B3RA 5KVCA 5CDGA 2QRKA 3QWAA 2Y05A 3DOJA 3HDYA 3KYCA 4PVCA 3WBFA 4FGSA 5F1OA 3FR8A 3HFGA 1GZ6A 1VL0A 4PLHA 1UXIA 4IDBA 3LT0A 3DZHA 2J5QA 4JBGA 3WXBA 2Q1WA 4IZIA 4YJFB 2DBZA 3PFFA 2P68A 3E18A 5A9RA 5IZCA 4TRNA 1D1SA 2P5YA 2Z95A 4WECA 3E6AA 4GSKA 1E3SA 2O3JA 2UVDA 4GL4A 3D5TA 2VT3A 5DT9A 1JW9B 4JJFA 4XGIA 3I23A 2GLXA 4FJ2A 4CM9A 4P4LA 1J49A 3QRWA 4EUFA 4B4VA 1MLDA 2HU2A 1GQYA 4S3MA 1LDBA 1YDWA 3GG2A 4CM9D 1XELA 3BMNA 3FI9A 1Q7CA 3RJ5A 3E9QA 4B3JA 1ID1A 4U6QA 1LTHR 1Q1NA 3PZBA 2DKNA 2Y93A 1HETA 3RBZA 5DZSA 3PHIA 4GH5A 2ZB7A 3CSDA 1JKJA 3DZIA 3L77A 4ZD6A 3ROKA 2O4UX 3FRJA 1Y8RA 4MVJI 3P2OA 3B6ZA 4ZHSA 3NT4A 2GYYA 4E0BA 3UXYA 4A73A 1YVEI 2PR2A 3GZ4A 3VVCA 4DRYA 5JBIA 7MDHA 1LDYA 2B5VA 1ZSYA 1ZEMA 4CMAA 4CM4A 4YQYA 4YACA 4CLOB 1M66A 5ER9A 3D3EA 3NJ4A 4KQXA 5L4SA 3H7AA 2ZB3A 2BGMA 3TQHA 3FWNA 1AXEA 1WAMA 1WDLA 1UR5A 2J8ZA 4DYVA 3GDOA 3KZVA 3U49A 4NJOA 2FPIA 2Q3EA 4XJSA 4KUGA 2X6TA 3OJEA 4D79A 2PZMA 1LBEA 3GVCA 4L74A 4LVCA 4Y6RA 3U09A 1J0XO 3RFTA 3JQ9C 1ENZA 3ZNOA 1UZLA 1ZK0A 1DFHA 4LMPA 4CPDA 4R41A 5F1KA 3A9WA 2IXAA 3KVOA 1G0NA 2W2KB 3UF0A 3F46A 3VPHA 3S2FA 2FSSA 1SEVA 3CTMA 3FBTA 2V6MA 3I9MA 4PLZA 3VH1A 1U7TA 3TRIA 3U0BA 1U3UA 2CMDA 2JFFA 3G0OA 3IKTA 1D8AA 4E3ZA 5IJZA 1YXMA 3WTCA 5KKAA 1JU9A 3VDQA 1EUDA 2ZTLA 3GDFA 5JYEA 5IZ4A 4BO0A 1B8PA 4B7CA 3O03A 3RUDA 3W1VA 4JCOA 4UVGA 1OFGA 4PLPA 1T25A 4YR9A 4YQZA 2J3HA 5AQ1A 3NRCA 2Y0EA 3ITKA 2YZ7A 4MVJH 4GWKA 2EW2A 4MP3A 4OSOA 2OOSA 1IULA 4YJDA 4XYMA 3GZNA 1BG6A 5F5NA 3WWZA 1U1IA 1KVTA 1YL6A 4B79A 2VRCA 4F6CA 3ZU4A 4L8VA 2ZYAA 3ABIA 3FBGA 3OMLA 2PZKA 1V0JA 2ZJ0A 1P1JA 4CUJA 2VRCD 2JD0A 2GDZA 3GEDA 2CDBA 4NR0A 4XIJA 3ZWAA 1CF2O 1CWUA 1K5HA 4L76A 4RPLA 5C7OO 3FD8A 2O4CA 2X58A 3IUSA 3MOIA 4OQZA 1PR3A 5IF3A 3DB2A 4JQCA 2NQ8A 5ENVA 2HMVA 3Q1LA 4FPXA 4E5KA 1IZ0A 4NK4A 5JMWA 3V1UA 3W4IA 2VN8A 3WS7A 1KIFA 4NJMA 5DBGA 4B4UA 3K31A 4Q39A 1SAYA 3QIVA 1JQBA 2BFPA 3U9LA 1P45A 1G1AA 4J9VA 4DQXA 1XIVA 3DAPA 5L7TA 1GV0A 3STHA 4I1IA 4E2XA 2VCYA 1IOLA 1SC6A 3H5NA 4M87A 3L07A 2AMFA 3K5PA 3ONDA 5BSGA 1LDEA 2FSVA 4AJIA 5KNLA 4CUZA 3GEGA 3BMCB 3OICA 1E3EA 2Y1OA 4HBGA 4PRLA 1CETA 4J91A 5KVVA 5TS3A 2GZ3A 4X54A 5A9TA 2DFVA 1V3VA 1TVEA 4B4WA 2E48A 4KUEA 3SJ7A 2LDXA 5KJ1A 2I3AA 1UP7A 4A0SA 6LDHA 2WD7A 1NHWA 3K9QO 4HX5A 2HMSA 1HRDA 2J3IA 3OSUA 1PX0A 5TRTA 1P31A 5JS6A 1J5PA 3OEYA 2OUIA 1NFRA 1YONA 3EDMA 4E4YA 1RWBA 3ZWPA 2VWHA 2ZYDA 1KC1A 2NQTA 3DFZA 5A3VA 3QSGA 1U3WA 2X0IA 1F12A 1V3TA 1CEQA 1JLLA 1PZEA 4PIVA 1PL6A 4N54A 3INTA 4YVFA 1PGPA 4ND4A 1EDOA 1U7HA 3IP1A 3HQ4O 3QQPA 5HA5A 4NZ9A 2BRUA 4IXTA 4J16A 1O89A 4S1VA 1C1XB 4QSMA 2I5PO 4J7UA 1MFPA 3FTPA 1K6IA 1RKXA 3AM4A 5I9LA 1B16A 3FR7A 4C4OA 2Q2QA 2O7QA 2H6EA 1ONPA 1YOVB 1LRLA 1I2ZA 1JAXA 2JCXA 2WD8A 3DR3A 3GG9A 3WSWA 2D8AA 3PVZA 3PK0A 3X2FA 1UZMA 3RC2A 1LLUA 1T4BA 4A26A 3PFWO 1DC5A 3RASA 3KEOA 2ZCVA 1XU9A 1LI4A 1P1HA 3RBXA 3BYZA 1FDUA 1MFZA 2OFPA 3VTFA 4PVDA 3H8VA 4OMUA 4Z3KA 2VHWA 5JYDA 1F14A 4ALKA 3H5AA 5KOIA 3I52A 2GN6A 3Q9UA 1Y9AA 3MWEB 5FI3A 4K6FA 3O8QB 4KQWA 1BW9A 4UUPA 2G76A 3PEFA 1H9BA 2V6BA 1M76A 1IPFA 1NNUA 2FHSA 4FR5A 1WMAA 3PQEA 1HYEA 2PNFA 1XKQA 3A06A 3H9QA 4WCFB 1BTOA 5CEJA 2ZTUA 2BGLA 1RPNA 2QX7A 4D46A 5JO0A 4K26A 5U9CA 3LLVA 4YJGB 1RM5A 1B14A 4MVJD 1TB4A 1K89A 1Y5RA 1VM6A 2ET6A 1PGJA 5G0SA 4EUHA 1YQDA 4FC6A 4XJTA 4EZBA 2Z5LA 5HS6A 4KDEA 4FSHA 4XGKA 4WUVA 2WSBA 2AHRA 2DT5A 4WOJA 3IKVA 5T67A 1ZXLA 2GNAA 4DLAA 4CR8A 4GI2A 3GGGA 2AQ8A 3IAHA 5IN5A 4XZ3A 4TRJA 4ND5A 2I9PA 3HE3A 2P9CA 4FS3A 3NEPX 3JYOA 4YA6A 3ROMA 1TT5B 4FC7A 4PLVA 1WXDA 3RC9A 3PXXA 3I9LA 4BO3A 3PJDA 3DMYA 4UAGA 5I8ZA 3WWYA 4BO4A 4Q3DA 4CR7A 5L45A 4A2CA 4WLVA 4AVYA 4E5PA 1I2BA 5B4VA 3HN2A 1QKIA 2VHXA 4E21A 4B3HA 3F5QA 4LRSB 2WE7A 3DQPA 3BXXA 4J90A 4CV1A 3RQSA 4J1NA 1ZVMA 5B12A 2Y0CA 2QHXA 1X1EA 2Q99A 3H5RA 4JJIA 1R0SA 3CZMA 4DMMA 5EERA 1LA2A 3JD2A 3S8MA 3JQ6A 2JJYA 1WZEA 3I4FA 3UKOA 4UVHA 1D4FA 2C2XA 4IIVA 3HJAA 1U5AA 3RVDA 4EITA 3WGIA 2OBYA 3GMSA 3JQGB 1RM0A 3L9WA 1N92A 2AE2A 2BI7A 2GO1A 1U4OA 4XYGA 2WTBA 5CPFA 1DIGA 9LDBA 3ROQA 4D42A 1MB4A 1X1TA 2DFDA 3W8DA 4KDFA 5B37A 2NM0A 2AE1A 3ZWNA 2VYND 4JX8A 2B5WA 3DHYA 4E2YA 4NFSA 1GEGA 3C3XA 5LDHA 4YJHA 4I5DA 1GZ4A 1CDOA 3NGXA 3TDKA 3ZZNA 4CM7A 2HK7A 1ZK3A 4UEJA 2YW9A 2Y0DA 1JA9A 4R1NA 2DM6A 4XRRA 4WE3A 5F1PA 1MXFA 3B70A 4ZQFA 3PP8A 4L73A 5TJ9A 1NWCA 2D5AA 3Q11A 4J4BA 5KCZA 3EUWA 4R1UA 2PWZA 1IL0A 5TC4A 3PWZA 3N7UA 1V9LA 4Y8VA 2IYOA 4EBFA 3U4CA 5C3MA 1WW8A 1Q0QA 4BGIA 2YQ5A 3OJLA 2E4AA 4AJKA 2QYTA 3IUPA 1UP6A 2WE8A 2PH5A 5H83A 1DSSG 1NVTA 3PHGA 1KS9A 3BMNB 1DAPA 2DUUA 3ETEA 5IN4A 1CIVA 3KYDB 3BAZA 3DHNA 3TFOA 2IXBA 2AXQA 4WK6A 1Z75A 3VKVA 1PQUA 2CY0A 1KYQA 3AI1A 1DIRA 2D2IA 2GZ2A 4OAQA 3SEFA 4C7KA 1Y8RB 2JCYA 3KSDO 1HF3A 4WNCA 5DCWA 4WJZA 4XB2A 1PQWA 4MJLA 5FFFA 1QRRA 1IPEA 4FOSA 1EK6A 1BDBA 1FJHA 4OQYA 5ICMA 3F4BA 3E1KA 3OH8A 4PG8A 4XIYA 1YL7A 1KEUA 4W99A 5A04A 4CM4B 1MG5A 1W8DA 1UXJA 1MUUA 1NASA 1QYWA 2QRJA 2C5EA 2FR8A 3NTRA 3K30A 5TGDA 5BNTA 3JQFC 4PG6A 1U9JA 2NV6A 3PTZA 4CM5A 3JV7A 4IQ8A 3ZWVA 3SJUA 3VPGA 4OOEA 1DHTA 2HMTA 1HLPA 3OJ0A 5L51A 3F47A 4P8RA 4OXYA 1E1LA 5L3ZA 1KVUA 1LDNA 4AICA 1GQ2A 2SCUA 5JY1A 1E1NA 1Y7TA 3RUIA 2PGLA 1TEHA 3DZGA 3U4HA 5CDYA 2ZTMA 3FCOA 3DOCA 4IZHA 1FDSA 1N7GA 2B4RO 3B1FA 4QT0A 4BKOA 4MINA 3RI3A 3SC6A 2Y1FA 1ONNA 3WNQA 4CQLA 4YXFA 2HUNA 3I6IA 3OP4A 1NPYA 2XXJA 2GN9A 3PQDA 1M2WA 4TZKA 4R54A 1R4MA 4XYEA 4DYDA 5ITWA 4UUMA 2UYYA 1HE2A 4TROA 5TSDA 5BNFA 4FN4A 4CLHA 2I67A 3DONA 4BKUA 2W8ZA 3UCXA 3VZQA 1V8BA 2VQ3A 4E5NA 1GU7A 2JHFA 4Z0HO 4ALNA 4ZJUA 1EUZA 4NI5A 3ZN2A 1E7RA 1E7QA 1NPDA 3RC7A 1NX6A 4IDFA 2HAEA 3I9JA 5A5FA 2W2LA 4RVGA 1WZIA 2YUTA 4ZVVA 1ZMOA 2DQ4A 3KB6A 5C7LO 3DFUA 3HDHA 3GZNB 4NMHA 3D1LA 3ICCA 2PFGA 5KJEA 3IQDB 2YJZA 1WVGA 3JQ7A 1HSOA 4WEOA 4G65A 4CM3A 2HMUA 5CDUA 4PLTA 1DIHA 1YBVA 3QVWA 1LDGA 4BUCA 1QLHA 3AY3A 4IMPA 4OO3A 3L6DA 5L95A 3MJSA 1KEPA 4GX5A 3DBVO 2DPHA 4OM8A 3JQCA 4FW8A 2OL4A 1JVBA 1E7YA 4J1QA 2QRLA 4L75A 4MVJE 3E5RA 1X15A 1QMGA 2CSUA 3TPCA 3GLQA 1J6UA 2PD3A 4P38A 3GK3A 3FPLA 5BT9A 3GY0A 4OGWA 4D3DA 3HNPA 1HDYA 1K6JA 4LGVA 3JQFA 2EG9A 1NXQA 4TRMA 3ZWCA 1GADO 5TJHA 3AM3A 2IE0A 3K96A 4RPHA 2P9EA 3AUUA 4QTZA 1UDBA 2E82A 2O7SA 4Z0PA 1E6EA 2GGSA 4RQTA 1LU9A 3LC7O 3OEWA 4RORA 4NBRA 5T5QA 3WFIA 1M6HA 4FFOA 4DVJA 4J0FA 4BO9A 1R4NA 5F5LA 2G5CA 1H6DA 2Q2VA 3JD0A 5H81A 4BB6A 4K6CA 2I76A 4RQUA 5EJ2A 2P4QA 3PGJA 1KY4A 3EVTA 4RF4A 1OAAA 2WWRA 2V65A 4BB5A 2NNLD 4DC1A 4AJHA 1Y8QA 3LC2O 4CJXA 1YBAA 4BO8A 3OFSA 4YAKA 3F1LA 5KVSA 1LXCA 1W0CA 4TMFA 2CZCA 1ZKMA 1Q7BA 4YAGA 5JDIC 2A9FA 4Q3CA 1PS0A 1GR0A 2PA3A 3D3WA 3GF4A 1YWGO 4EYEA 2HO5A 4Y6SA 3TF5A 1DBVO 4AJ2A 4LISA 4HFNA 3BIOA 3ZWWA 2HRZA 2RCYA 3PHLA 4NQZA 2BGKA 1NR7A 2DVMA 3FNGA 4YWJA 3M6IA 3ZWXA 2EIHA 2RH8A 2B37A 1N9GB 4IXWA 2FR1A 2EKQA 1DO8A 3VPXA 1PWXA 4TRRA 4M55A 1ZCJA 5FF9A 3ZWMA 4YT8A 3C1TA 4U0KA 4IDGA 4YCAA 2D0IA 2DBVO 2E49A 2WYVA 3GVPA 3PYXA 5KWEA 2JCVA 5IDYA 5JAZA 2VUTA 4RF2A 3ZGYA 5AXAA 2X7HA 4AFNA 1MX3A 5TLSA 2NVWA 1SO8A 1ZJZA 1JTVA 3KHUA 1L1FA 4DXHA 2H63A 3TL2A 3OA2A 3ONEA 4TSKA 3O26A 3JQBC 5EN4A 1BGVA 1ZMTA 3JD3A 4CM1A 1SMKA 4NBWA 4RGBA 5IDWA 4FFMA 3E9NA 4CM8A 3AOGA 4L4SA 3NYWA 3VVBA 5LDGA 1YJ8A 3DC2A 4PFJA 4EJ0A 3KO8A 1XDWA 1FF9A 2GERA 2WDZA 4PLFA 2HSDA 4D3FA 4EJ6A 4PG7A 5A4DA 1PU2A 4OXKA 4MKXA 1G6KA 5K6AC 1XCBA 3T7EA 1TLTA 1U8FO 4YRBA 3LC1O 4XRGA 4D0SA 4Z9FA 2C59A 1I3NA 1ZJYA 1AN9A 3OQ1A 3KXDA 5KJ6A 3ADOA 1LC3A 3QWIA 4GKVA 3ETGA 4ZA2A 5T8KA 3VPSA 1VJTA 4NG5A 3V2GA 2OORA 2Y68A 1ZO8A 2FWMX 1QSGA 3K73O 4WLUA 1WMBA 3T4EA 4CLOA 5I8WA 1VJ1A 1E6WA 1BXGB 1MV8A 4J2HA 2I66A 1HSZA 4DA9A 2VWQA 4CMIB 1PTJA 3L4SO 3ITDA 1I2CA 4XGNA 2UAGA 3EGOA 2X5OA 1PJ2A 5JDIA 1HDXA 1AE1A 4WASA 4BMVA 2I99A 2H1SA 3SXPA 2A94A 3VC7A 3B1KA 2BFAA 3PGXA 4AJLA 4HNHA 3RUEA 3JQAA 1DFIA 1A9ZA 2X5KO 1PS9A 1Z6ZA 3E9MA 5EESA 2BFMA 3ICPA 3LT2A 2YFQA 4R5HA 3D4PA 1ENPA 1I3LA 2HMWA 2O3TA 3JQAD 4G81A 1GUFA 2HDHA 1PJ4A 2NU6A 2GPTA 3KM0A 2YDYA 1YRLA 3A1NA 1KVQA 5JPIA 1HE5A 2ZJ1A 5TNXA 2ZQYA 1YB5A 1YE3A 1GUZA 3OJOA 3VOSA 2CDCA 4GVXA 3MCVA 3VH4A 4YRAA 1O5IA 4BHTA 2VRBA 1D7OA 1RYEA 3AK4A 3I9NA 3LT1A 1GDHA 1GYRA 1ZEJA 3NDRA 4EI2A 3TOZA 3OBBA 2B83A 1ADBA 3QVSA 1F17A 1H9AA 4QO7A 1ZXBA 4B3IA 1K3TA 3IIEA 1P33A 3O38A 3ORFA 1P0FA 5JY6A 1GFSA 4CV3A 1MXHA 1H2BA 4I5EA 3BHMA 2AG8A 3BMQA 2CUKA 1XWFA 4CLRA 3KTDA 1LX6A 3HG7A 4XCVA 5K6AA 5H82A 1GD1O 2OMEA 1Q2XA 5A9SA 1EVJA 5IXSA 2Q1UA 1YDEA 2GASA 4Q9NA 1RJWA 4E5MA 2VHVA 1LC0A 4INAA 4XQCA 5EQFA 2OBNA 4JJGA 3PLNA 3GUYA 2R00C 3H9EO 3NT5A 1UDAA 3ANNA 2C07A 4IJVA 1HEUA 2B36A 1YO6A 4Y6PA 4IGEA 4FGWA 1OC2A 1SOVA 3D5QA 1GYQA 4D45A 2O48X 2VWPA 4KWHA 3GGPA 2X4GA 2VUSA 4M8SA 4MVJP 3ZHZA 2PKQO 4DTIA 1NQOA 3B1JA 1PGOA 3TZKA 1EVZA 1DHRA 2YHIB 4YEDA 3NDJA 1ULSA 2PK3A 4KTTE 4NPCA 2J3JA 2VT2A 2X0NA 1K6XA 2NSDA 4EEZA 1R12A 3M1AA 4JN6B 1B8VA 1H6AA 3RU7A 3JQ9A 2BHLA 3WJ7A 1ML3A 2H9IA 3SC4A 3Q9NA 1I0ZA 1PEDA 1L7DA 4B7UA 1NP3A 3JQ8A 4HNGA 5EINA 2WM3A 3C1AA 4HFMA 4NBUA 1GQQA 4MOWA 3OECA 6ADHA 2Q1TA 2ZTVA 3FHLA 4NK5A 5CAEA 1N1GA 1HXHA 1XQ6A 3C7DB 4J7CA 3VDRA 2OZPA 4DWVA 2O3QA 4BKRA 3BHIA 1P74A 1PZFA 1O95A 1LNQA 1LQTA 4Z9XA 1VJ0A 2GN8A
chains in the Genus database with same CATH superfamily
1JDTA 1BS9A 1JMKC 3TLBA 4BL5A 1SXHA 4GQIA 4B43A 2VUIB 2OV1A 3F4LA 3FZEA 3L0SA 1E7MA 2FPUA 3OC0A 4H9GA 2DOKA 3W6UA 1P75A 1CW2B 1K8XB 2AA3A 2XNHA 2XIQA 1Z17A 4OIMA 1P7WA 5FQNA 4RPJA 3SOPA 4BLSA 3LT4A 4ND3A 2F1KA 3C87A 2BGNA 4R3WA 2BKLA 1VE9A 3C3YA 4MEBA 2AXEA 1A72A 1YR1A 3FX2A 3IP6A 5CB4F 1X7WB 3K1ZA 5DGDA 2WJ6A 4IIJA 4A8JB 4OJQA 1YH3A 3BD6A 1FTWA 3CH5A 2GPJA 1YUMA 5TT1A 3WL8A 3WNZA 1LEHA 1ZOLA 3LA8A 1U2SA 1F6WA 3LW7A 4FZVA 1G6OA 4IBOA 4TUYA 2L69A 1DPGA 1H4VB 2DUNA 1MMFB 1MX5A 1BS1A 1POXA 3I8SA 3QW4B 4WFIA 4YMVA 3Q8LA 1G63A 5JNRA 1NXOA 1E7WA 4P4SB 4CTJA 4K2AA 4G25A 3IOMA 1DCTA 1DCMA 1E2EA 3VI3B 2VF5X 4WOCA 1R74A 3GRPA 5F9FA 4CQMA 3CKKA 1U80A 4II2A 4ND1A 4RZHA 2Q50A 3DMRA 3Q6IA 1GO2A 2WAYA 2ZSHA 2Z8YA 1Q57A 3HVJA 2D1TA 1ORDA 4LZAA 1T5OA 4RTLA 1SM4A 3E27A 5FWDA 2WJHA 1MO2A 3B6JA 3T12A 5AW3A 2H8GA 3R3SA 1DBQA 1DTWB 1TMOA 4DLZA 2GUWA 4PG5A 2FR0A 2C3OA 3Q7PA 1QIGA 1IN5A 3ANLA 4IDDA 3UJNA 5J2UA 5AKZA 4F3NA 2HHHB 3ZXYA 2AJDA 4OAOA 4ZIRA 3INGA 1LBHA 3IQXA 4LRQA 3D6TB 3GLRA 1N5DA 1LBTA 1P6QA 4ZDJA 2V96A 3OIFA 1W59A 3SQNA 4QXAA 5FI1B 4ZYUA 3ZV4A 3BWMA 2ZPTX 5LQNA 1B73A 5BSUA 3BQMB 1V11A 1R0YA 2AVDA 2V5AA 5F33A 1R4ZA 1UJMA 2JGDB 3DEYX 4PZ9A 2AD1A 3TLEA 3CVXA 4INPA 3PXUA 1T9ZA 3NAQA 5TARA 1T2AA 2PG3A 4IOJA 1ZGAA 3V4FA 1Y1PA 3Q1KA 4PQFA 1QM5A 2EDCA 5HIJA 2IS2A 2H5EA 3V55A 4CKYA 4DGSA 4ZT6A 3VJLA 1RAGA 1V16B 4NU6A 4NJEB 2ANCA 1F8GA 4QUGA 1JYSA 2QJFA 3F5MA 3ZD6A 4N9WA 4O4IA 1S3SA 2CHUA 1R00A 2D00A 2QP9X 1X0XA 4RDHA 4LJSA 4RKQA 5F3DA 2PX5A 3L7KA 1U28A 4RMIA 4YN3A 3VZBA 3WMGA 3FDXA 2R7AA 3DM5A 3I9KA 3MWGA 1L4UA 2AEFA 1JHMA 2D62A 4XWTA 4DSOA 5CLQA 3TPCA 4NV3A 2YIDA 1LW6E 1CEYA 3X43A 2J41A 2LVBA 4Q18A 2QQ5A 2NV0A 4XR9A 1O8BA 3X0DA 2JGFA 4G23A 2PCJA 1Z35A 3R9XB 4BEVA 3G2JA 7ADHA 3UXHA 3ROXA 4CL8A 4ZOEA 3P9IA 3ITEA 4RZ2A 3E9ZA 2C5GA 3LK6A 2A0WA 1Z8NA 1LSJA 1HDIA 5KWVA 3E22B 1KO5A 3MJVA 4OOFA 3HGQA 3TFQA 2NT4A 1RHMA 1JLRA 3EGDA 5E0KB 2C42A 3L8FA 3WQBA 4YT2A 3I83A 3WQQA 1GSIA 3SE0A 3RYCA 2H1HA 5ITZA 2F1IA 2I7XA 3I30X 3DBOB 5D86A 2CJWA 3TQRA 2YWJA 3FJOA 3UVEA 4OI0A 1H2HA 1QIDA 1TM1E 5EIOA 4X61A 1D09A 4MROA 4GMFA 5CB0A 2AUMA 3HLKA 4U2BA 1Y5IA 2Y76A 3W77A 4B2YA 4FTWA 4COOA 1GOTA 1RBMA 1WLYA 2NU7A 3D6AA 3VUFA 2H5LA 4EKDA 2JIZA 1VDZA 5KTPA 4PAGA 4EPXA 1QF6A 3FNRA 1ZCFA 2IVFA 4XJVA 1KI6A 5TVKA 1B6TA 4PGHA 1Y3CE 1CE8A 3AF4A 4Z1OA 4K87A 1I10A 1ARZA 1Q22A 3UWPA 4BNMA 3KQHA 4E30A 1F0KA 3RUHA 3LWNA 2SBTA 2CHVA 2PGIA 3TLMA 1USUA 2WG2A 2DB3A 2BIFA 2W2KA 1UJ5A 4MA4A 2CNOA 1BDMA 1TQDA 3ZV5A 2EL9A 1IXSB 1BE8A 2HBYA 4DMCA 2WPDD 2ZK7A 1B6RA 1S2LA 3D6HA 2HCRA 3M6MD 3BGWA 3SIRA 3RIEA 1E5LA 1ML4A 2ZOSA 4NHOA 2QN1A 1ZCAA 1TX4B 2D1YA 5T3YA 4BXOB 1JF8A 1FFSA 3OT1B 3HCWA 4ZXFA 3LI2A 1NVKA 3OT4A 2V6FA 3H75A 4PF1A 3TRJA 5M2QA 3F67A 4KMRA 3IAXA 1C1DA 1K7FB 5E6UB 3NVMB 1OUMA 4S05A 1FRVA 1CUIA 2CK3D 2ZJ4A 3HKEA 3UT0A 4PS0A 1RRVA 1NFFA 4J0DA 1ZIDA 1CVLA 3F6SA 2PX6A 4BVEA 5H3CA 4GBMA 2NADA 1C0KA 4BGUA 5NLLA 3GPDG 3T4XA 1Y4UA 2ZVQX 2P9HA 4KMSA 4EJSB 3DXZA 4N6OA 4YCBA 1N4DA 2FZEA 4HLDA 2B4QA 4JBWA 1E2GA 3IP3A 5IJAA 3NBKA 5KU7A 3U7HB 5IM5A 4MW6A 5EKTA 4LXXA 2C9ZA 4MW9A 1A9PA 3DL2A 2QL6A 1IY8A 4KPGA 5HBRA 3R75A 4AJOA 1T0PA 4XB6B 4HAUA 4BMSA 5BWMA 3EVGA 3N58A 4EP1A 1N36B 3JAWB 1LPOA 2R8PA 2VYVD 1OGIA 1VSUA 1Z2OX 3G2HA 3MUFA 4HGOA 2E6UX 3E3LA 4KLRA 3TZBA 3RS7A 2GD2A 4O4HB 1B15A 1GCUA 2YWCA 4WY2A 4YXWA 4IVNA 4KXQA 4EPRA 4IFBA 4B81A 5G1NA 1L5ZA 2X1HA 3FYUB 1LQ2A 3HKCB 4HGZA 4WSOA 4XX0A 3BFVA 5EMNA 5ARDA 4AO7A 1NNEA 3KOWA 2WUWE 5B57C 4MRPA 4WZZA 5JC1A 5LQCA 4F6LA 1RCTE 4MHTA 1QP4A 3OKAA 6REQB 4F91B 3Q3HA 4E6PA 4QLOA 2FP3A 3BHJA 1FP4A 4HADA 3RAPR 1OTYA 1Q7GA 4IJUA 4BE9A 4LG1A 2Z2ZA 4WKNA 4TYQA 4XQ0A 2EP8A 3M1IA 3M4YA 4IX9A 1CY4A 4L4UA 4Q4LA 2G25A 5E7MA 5CM9C 1FY2A 1NOKA 3KL2A 1TPYA 3HYRA 4D8XA 4G6ZA 1GG5A 2NSJA 2OHVA 2RG1A 3L7LA 5HXAA 1L7RA 2FEXA 1L7EA 2DWQA 2NTNA 3AV0B 5TGTA 1KRXA 3ILXA 1J2UA 3IDOA 3IDAA 1X7ZB 1LSSA 1XVTA 3IQEA 4Z5XA 5HWSA 2ZEJA 4LRXA 4D9FA 2EX0A 3T3IA 2VSNA 4OJNA 1Q21A 4KWEA 5E3IA 3KP1A 3DT9A 1FTSA 4WCVA 3UAWA 2GNOA 4AJJA 3H7IA 5GWXA 1YJXA 5E7IA 1KKUA 1XU7A 2G63A 2I7VA 3NVAA 5F77A 2VOEA 3RSGA 5KQGA 3TIFA 1DARA 1ZW1A 1UP4A 4NENA 4WDRA 1ZD3A 5HBGA 1N0WA 1GZVA 4HF7A 1OFIA 4RQAA 1B0AA 3NKVA 1Y5LA 5IJ0B 5COQA 5D7BA 2CE7A 2C2OA 2BVNA 3PJRA 1T9HA 2AZDA 2ZSJA 1EX6A 2J6HA 3DTVA 3GRCA 4TTVA 4WH0A 5DGHA 4J9UE 4GMGA 4OI4A 1JEYA 1ESCA 2JARA 1VTKA 5KVQA 4CIXA 4F2WA 1KI3A 3LS2A 4DSNA 3X1YA 4F2GA 1EB8A 3Q5GA 2R96A 1DDIA 5HJ7A 4Z3OA 2FLKA 4NPHA 4AS1A 2C95A 3A6JA 3H4TA 2DPLA 2DC1A 2WNIA 1PS8A 1USKA 3R6DA 2J5RA 1KMNA 4QVGA 1RKVA 4US1R 3IESA 1U90A 1Y3FE 2C88A 1U0RA 3W2TA 4CL0A 1RQNA 3N05A 3NHJA 3L43A 4ZGBA 3RRYA 1KK0A 2EGGA 2IY8A 4LGCA 1QHFA 2WSSA 3ZWDA 4X9XA 4J29A 3EEFA 4B17A 1PNVA 4PZDA 5EWJB 1V5GA 1U2GC 1WZNA 2JLBA 3D81A 4UDOA 1K6MA 5KTKA 3LUKA 4HAWA 2ECFA 3D7RA 1KRHA 3SVZA 3U81A 5FFMA 2UZ0A 1M6WA 1YK0A 4Q19A 3WHKA 3PYLA 4J4TA 2AV6A 1MB3A 2VP4A 1IXZA 5CPBA 4YLEA 3MAAC 4NSNA 4JAVC 1GEEA 1HWYA 1KJWA 5ALSA 4W5JA 1R3UA 4X6YA 4NZOA 3R76A 4TKUB 1PFVA 2F3PA 4DIFA 2OAGA 2C8KA 4S0ZA 2FGKA 4FE3A 3KTFA 3E03A 3IR5A 3L4EA 3RTAA 1Z0KA 3QFHA 3EXHC 1UCFA 4FFBA 3T5GA 3T7CA 5LJLA 4CKCB 2IEAA 4AJPA 3ZDQA 3ZDEA 5TGZA 3OKFA 1CIPA 1XRPA 4J0EA 1OYWA 5TQVA 3WNVA 3OLVA 4BZZA 4DCGA 2Q4DA 2DECA 5EZYF 3AP3A 5BR7A 1XQ1A 3BB4A 4MR9B 5DP2A 3RG8A 3KU4A 1HKUA 1BFDA 3KKEA 4I4LA 3TIGA 1XDDA 2Z1NA 1D0VA 2BH9A 1Z45A 4KMOA 2JKYA 2JS7A 1OAOA 4QYIB 4IZOA 5BN1A 4A27A 2RHJA 1SBYA 3R5KA 3UCEA 4G56A 4LQLA 2FPKA 3ZHQA 4MIOA 2DTEA 1OFUA 3BB3A 3CNEA 5DTJA 1I3MA 3DBRA 4HZUA 1DAEA 4WUTA 2SICE 3RFUA 3AL3A 3GNSA 1GCIA 1JEAA 3QI2A 1V7CA 4HB3A 5ES3A 3OVMA 1U2QA 4NBVA 4MS3A 4KOAA 1NAHA 3VGPA 1JKIA 3VH2A 1T6YA 3X1DA 1SXQA 1A98A 1E58A 3JVDA 3LM8A 3PS9A 4KUHA 3WMWA 3EC1A 2Q4EA 5THQA 3EH2A 3LQFA 3A58B 3OIDA 1EZ4A 5A3RA 1CKEA 4OCZA 3ZCVA 3OD1A 1EM6A 4FR0A 2Y71A 4L6AA 3EXG1 4UARA 4PRZA 3SF8B 2WMDA 1IU9A 1CK4A 3M1YA 5DLPA 4URXR 3DTTA 1Q74A 5IVKA 5GJVC 5BNIA 1UK9A 3KELA 1T6NA 3DLCA 5DXJA 3RUAA 3RYIB 4B76A 4LOKA 3GEBA 1F5NA 4DUPA 2HRDA 2FP4A 3CVOA 4HZIA 3DDNA 4NCHA 3B6KA 4RKEA 4Y2VA 1VIAA 3FHJA 3D3NA 1JFFB 3DZJA 2A4MA 4HEQA 2BCGY 3OURA 4TXNA 3ZKWA 3OZVA 2OCPA 2BLLA 2XMBA 3VU8A 2H1VA 4YJ2B 2M2IA 5EI5A 4LZZA 2O0MA 4DJEC 3C6YA 3VMFA 4W4TA 2H4YA 4DYHA 3U4DA 1IEWA 1TMKA 2PUWA 1EFVB 4B83A 2P27A 4KQEA 1KTVA 4JEHA 3BA1A 2GAJA 2QIPA 4K9OA 2RJ3A 4K28A 1MJGA 3U7RA 4C0QC 2MSNA 1GV1A 1RU3A 4ZI7B 1H0RA 2NYVA 4HDRB 2ZATA 4BV3A 2BBOA 1JH9A 2J9ZB 5K0CA 1PT9A 2HR1A 2ZKLA 2O3RA 1SU7A 1U3FA 2QR5A 3LFUA 5D1NA 2COEA 5CHEA 5I3CA 1IAQA 1QDEA 4FBGA 4P5DA 5KX5A 3KQQA 1R0LA 2P9JA 3EARA 1SHKA 3JR7A 1Z4MA 3V7FA 4BP1A 3OX2A 1K8ZB 1OTXA 1XL1A 2I3ZA 3IERA 2ZDHA 3A70A 3X3HA 3AQIA 1BKDR 1QS0A 4TVBA 1XXHB 1QU3A 4U3JB 3NM5A 2AIRA 1PSZA 2R8ZA 3D3JA 3QXGA 5EJAA 1N5KA 2EJVA 1D3AA 2HSWA 3A1VA 2PSFA 1RP1A 3KLPX 2XTAA 1W47A 4II3A 3TOSA 3WYEA 4E33A 3IOEA 1J2EA 4RHEA 2ZUBA 5AW6A 1XCMA 3G7NA 3TVYA 1FXUA 4ZDWA 2JKVA 1ZH2A 2ONCA 1DXHA 4NOJA 3G2PA 1H1LB 1R1DA 3RFFA 4DMGA 3PE6A 4E11A 4TQAA 1JFRA 1KVSA 1TRHA 521PA 3AL0C 4PSVA 3AU9A 1XSEA 1JPUA 2O2HA 4Q4AA 2FJUA 2W93A 4J75A 1UWKA 1A2OA 4HAXA 4K9DA 4IKEA 4B47A 3TR6A 4DEXA 4CEIB 3Q7QA 5B4TA 2CMKA 2RBEA 3GLUA 1CYDA 3AF5A 1U5CA 2YZGA 3IEKA 4L9WA 4QBKA 1TW2A 3N3BC 1GZ3A 4DXAA 2Y67A 1E2JA 1D8TA 4AQYB 3BXGA 2OB1A 3BF8A 4BASA 3X1KA 3M2PA 1T29A 2WJPA 4KFSA 3AOEC 2JBAA 1ESEA 1T24A 1CUEA 3RNOA 4OU4A 4F4DA 3ZW9A 2BJVA 2IZOA 2WNHA 3UK2A 4C03A 2A1UA 5BOSB 2D3TA 2EP7A 2C8LA 1QRDA 4M1MA 4FP9A 1M5RA 3GZTB 5TS2A 4RD2A 2GHIA 4C4XA 2IS6A 5U1PA 3GJTA 1N2CE 3P9PA 3WGLA 1WDKA 4LFBB 1AURA 1KK1A 3WVNA 4G2NA 3NYQA 2C8JA 3NRJA 3QKSB 3R41A 4Z86A 4G4SO 4OX9Y 2G0NA 2WQ7A 3ENWA 5L8VA 3SI7A 1BW9B 1DQNA 3PNLA 4GMXA 3PNBA 2WYWA 2V97A 4OIFA 5ANRB 4NIMA 3X1ZA 4CCYA 2APJA 4I99A 1BROA 2GA9A 4PPYA 1AN0A 4AWXA 2E85A 2B8JA 3UMYA 2ZBQA 4ISCA 4J49A 2FFBA 5HJ5A 3H19A 2FZVA 1WBJB 2PRSA 3KBOA 5H7XA 2OGZA 4EY5A 1HX7A 3C43A 3FUTA 4HPWA 4BAUA 3C85A 4ZV7A 2XUFA 4Y18A 1W0JA 1XF1A 2ATEA 2XIJA 1XVVA 1ZC3A 3OSZA 1ZIXA 4MTLA 1AU9A 4FJ0A 5E1OA 3ZQKA 4CMKA 4E14A 1Y5NA 2PQMA 4ZCIA 1R15A 1UBSB 1CUWA 1MOZA 4IMRA 1ZI8A 5DSXA 1JSXA 2JG3A 2FFJA 1NJ5A 3L5KA 1B2LA 3ZK7A 4PCVA 2V1XA 4EFDA 5ESWA 3TEFA 3HCAA 4ESEA 4AN1A 4MP6A 4FHZA 4H31A 3W3AH 1YMQA 1Z8FA 1L7BA 4YFVA 2RKWA 4DREA 3EOBI 2BTQB 3KFLA 4TKLA 3TZHA 2FPRA 3TLKA 4KZKA 4BLUA 3NBZC 1AUQA 4MWGA 2NLOA 1GNLA 2WM2A 3K0AA 3QIAA 1CX9B 2WTAA 1JZSA 3P9XA 1L5WA 4TWZA 5I9NA 1YB6A 4AMGA 5J2TA 1T4GA 2Z56A 3L1IA 5KMGA 2XZOA 3OJFA 4O2AB 5D5PA 1DWPA 1NMZA 1SCUA 3TNDA 4ZMRA 4OMCA 2AFHE 2QG6A 1P0PA 2IYPA 4WBXC 4M22A 1N3BA 3ENQA 3IXLA 4KAFA 3HA2A 5E2AA 1RZVA 5JWOA 1NW9B 1GNSA 3N8DA 1DIOB 4N0EA 3TQSA 4KWTA 3WL5A 1MVOA 2EL7A 2CYCA 2Q21A 4PYNA 3W9YA 1GN8A 1S3IA 3R0ZA 4L0DA 3TW0A 4OHFA 3WRXA 4F21A 3WQSB 1KDZA 3LP6A 1ZZEA 4B6GA 4CKEA 2NGRA 3BE5A 4CV0A 4WN9B 2JGEA 1OI2A 3BTOA 4ZPJA 1E2IA 2IX9A 3BZBA 1MENA 2WVAA 4K6GA 3TTXA 5B6JA 1DDOA 1KOFA 2AH5A 3IPAA 3R7NA 2ZRKA 4G0PA 3JVVA 1JVSA 1UKYA 1A9QA 3JQBA 1NVMB 5AMXA 3B38A 2I2CA 3CRQA 3QYFA 9MHTA 4E46A 3BKWA 2XAUA 1U81A 2C4UA 1YL5A 3PCRB 4MWDA 3UYLA 5I7VA 1BDIA 1EJBA 3THRA 4ZCQA 2ZSUA 1EWYA 5C52B 1XMQB 2HWXA 1N1EA 3WZ2A 5E1BA 4QHYA 4DV5B 5H5JA 4LNAA 3DBHA 3FSRA 5GY7A 2IW1A 3KSAC 1FFXA 1DAIA 3WO0A 4I1PA 4OHWA 5A05A 2AN1A 3GPIA 4I5IA 5D2CA 3DFIA 1A8IA 3S55A 1VPDA 5EHIA 4U7DA 1E1RD 1OHHD 3HUEA 1G6HA 4UHEA 4ON9A 2BEVB 1IVSA 4FZJA 5EE5B 1XLWA 4NYIQ 5BMVA 5IASA 4IAOA 4FM9A 1ZFNA 3E84A 5AI6A 1A97A 1ND5A 2HKIA 3AUSA 2YIVX 1K97A 4H3VA 4MYUA 3G9TA 4TWAA 3HI6A 3JCZA 4YT5A 3UTDA 4L16A 3G2QA 3AJ9A 1QE3A 1VYVA 2LXNA 4RD3A 4YCJA 2NT3A 1Q20A 3COWA 3FUCA 4OQMA 3UMGA 4CL3A 3BGDA 3NUGA 3ODGA 1TZ2A 4MUAA 2BEUA 3DMTA 3FCEA 3O4HA 4KAXA 4R5MA 4IS2A 4KFRA 1OI3A 4KTVE 4GX2A 4L5BA 4NCJA 3NHBA 1XCLA 4WWHA 4X7PA 3EIUA 1EKXA 4TLEA 4HB4A 3HB5X 2C9BA 3ROZA 3C3PA 3TUZC 2C7GA 5KZMB 3PCTA 4C43A 1BE6A 2QSZA 4YO8A 1L7AA 4MV4A 3T9FA 3KIPA 4B3XA 4EY8A 1PGNA 1T9KA 2H06A 3SQOA 5AVJA 4UTOA 1JSCA 3ESAA 3GELA 4IHJB 4C29A 1JQ3A 3ONNA 1Q0RA 1ABEA 2P9GA 5CK4A 2R6JA 1QGED 2HT6A 3H83A 4S1PA 4LGMA 2GD1O 4F8EA 4MDFA 5I5EA 1SBTA 1C3XA 1Y33E 1O5TA 3IKLA 3AKZA 3W0LB 4TVOA 5CD1A 2DHRA 2CLIB 2E4ZA 4XSHA 1HNXB 4I9NA 2HQBA 1BSVA 3LYHA 4Q48A 1J0CA 2II6A 4HFRA 1RXEA 1QHYA 1KP2A 3RS5A 2HB6A 2JLAA 4DPLA 4JV5B 3NG1A 3FMOB 3Q85A 4RIFA 1XZPA 2P0YA 1FC0A 2QEQA 2UYHA 1ISHA 1D07A 1U0NA 1EK1A 2G9RA 1BEEA 2P40A 2P41A 2F8LA 3GJXC 2HLDD 3ROEA 2PZJA 4MV3A 1XEXB 5GM1A 4E32A 3O8CA 4K2HA 1B7GO 3X1MA 1KAHA 3DHVA 2UZAA 5I4IA 2XA9A 4UTNA 2EXXA 2I4NA 4OG2A 5AR1A 421PA 2REQA 4EB3A 2CMFA 3IHTA 3L4BC 3B6IA 4GSYA 1UBFA 4LMRA 4R8VA 2GUGA 2EHJA 1HT3A 2C5SA 5ALUA 3I2YX 3ETDA 4B31A 3LYLA 4JVMA 1LJUA 3QPBA 1UFRA 3PRKE 2GXSA 1U6IA 4L0MA 4B0PA 5I01A 4ENQA 2V7QA 3GN2A 1E9DA 3MGCA 2H1LA 4YAJA 2BCJQ 3IHWA 1GTG1 2FPPB 1S89A 4BQEA 1WBDA 1N8NA 1L5OA 2NUPA 1FFEA 2QY9A 4LK3A 3G5MA 2EEPA 1ZIPA 2OQRA 3M81A 1R18A 4NTZA 3V6MA 4B45A 4M1KA 1HQDA 1RMTA 2BHRA 4ND8B 4O1MA 2W98A 4D74A 1MAVA 4QOFA 1TVKA 3L7JA 5EXPA 1X19A 3Q15C 4D9GA 1XTKA 2Y77A 4YRFA 4J3JA 1I2MA 5TPWB 3IO3A 2NU8A 4D0GA 5GPBA 1PE0A 4HDKA 4XR4A 1JP7A 2EJBA 3IBFA 3PIRA 4BQPA 3JRXA 3U4GA 5E7JA 5FYDA 1VKNA 3OEED 1LBIA 2ZJ5A 4RU1A 1MTOA 3GHYA 5F12A 4XW2A 1YB4A 4Y6OA 3G3EA 1DB3A 4LSMA 3Q9SA 2GCGA 5TPZA 4E70A 4CTMA 5IVHA 1T1RA 1FSPA 4LIPD 2MU1A 2VPQA 3LHSA 1SZJG 2GZ1A 2ZANA 4XSGA 2GEKA 4LZLA 3A9CA 4KPFC 4AIRA 1YIDA 2DQSA 3PX3A 3FYDA 1WHTB 1N34B 4Q9IA 4YI5A 4YUVA 3Q7RA 1N9GA 3MT9A 4XM2A 3O3OB 2HF9A 2XOXA 2H7CA 5FHRA 2JLVA 3RS9A 3P2EA 4LXHA 1OXVA 1TQHA 5F2OA 5A06A 2GO7A 2H85A 4ISBA 3L2OB 2PX8A 4MO2A 1KPHA 3YASA 3GEIA 2CCGA 1E6LA 1JKFA 4RGVA 4URFA 3VPFA 3N86A 3N2YA 4I6JA 1YKFA 1E18A 2HOQA 1NV8A 3IJPA 4INOA 4LJ7A 4ND2A 4NZYA 2Z6QA 2XNCA 1U8AA 4DG5A 3GCXA 3CUUA 3IIMA 4RANA 3MFQA 3K7EA 5KNCA 4DY6A 2ARKA 1KK3A 4I4TB 1TADA 5B2ZA 5ARCA 4DV2B 1PZXA 2QR3A 3BF7A 1M6EX 4LCJA 5D01A 1QKJA 3PGLA 4ZAFA 1XMSA 2JLWA 2DWCA 5CNIA 1H1DA 1J8VA 2VHCA 1Z5OA 5FPPA 4F5ZA 4HYYA 3VSAA 2ZUWA 4RYLA 4OQLA 4ROSA 2ZE5A 3W5CA 1W4CA 3GH3A 5LD2B 4S2UA 5JXIA 3NU1A 4NDAA 3HBFA 3SZGA 1M8FA 3INRA 4ZQHA 4RO0A 4O29A 2C61A 2FCAA 4AZ3A 4BKMA 2JCGA 1M8JA 1W30A 2O0HA 3DM9B 4LJAA 5INTA 2DMRA 3GOQA 3H5LA 2H52A 3DOIA 4EF5A 4B7XA 2R1TB 4D0RA 4IIJF 2J9YB 2O59A 1PFWA 1BN6A 3M49A 3NM6B 1NZDA 1YB1A 2L0XA 3NX4A 4FIZA 1SCJA 3OCXA 4JP3A 2BMFA 2PX0A 2DUMA 1JAYA 1BX3A 3U4IA 2BEJA 4R8LA 2PL5A 4TUYF 1BXGA 2V0CA 1VECA 1QTRA 4PONA 4MIYA 1KYIA 1N6NA 2QM0A 3MYYA 1KP9A 3G9UA 4CMIA 1FQJA 1XBTA 3QVUA 4QBFA 4EECA 4CEHB 2EKPA 4IQGA 1R66A 2ZU6A 4HXYA 1ZMRA 3CLUC 1P5FA 1NLYA 4G5QA 3WGQA 1IATA 5K0ZA 5CT8A 1Z34A 4NVRA 1ITZA 1Z4OA 1Z6QA 4B34A 4LKRA 1RAAA 1KJ8A 2YIMA 2YL2A 3EUEA 2BI4A 4TWJA 5FIUA 1YRQA 2B1QA 2WM9B 4RL4A 4XDHA 4XKJA 1AUVA 1PF7E 5J2UF 5FPYA 4I9HA 3SQMA 3U31A 3VC2A 3R44A 2O8FA 1E9EA 5FJJA 3VNSA 2NV2B 4U4AA 3VPBA 4OGLA 2MSDB 3S0JA 4FGZA 3OI7A 2GD0A 1TZBA 2QENA 1RSZA 3U4QA 3ICWA 3WB9A 1P0CA 4FDTA 2A92A 1VBKA 3FGZA 5KNBH 3QYJA 4G67A 5BWBA 1H5NA 4WX2B 2RK4A 2EFEB 4WD3A 1QV7A 3EZGA 1SURA 4LZNA 1SRRA 4JBIA 1G3MA 1A4RA 4UM9D 2VH5R 4YTEA 1T4DA 4LYYA 2C2KA 1Z63A 4HMQA 4GLBA 4HY3A 5FPTA 1TYCA 3V32A 1KWKA 1IZYA 1VI2A 1H1TA 1VKJA 3AU8A 3PC8C 1OKKA 4O4IF 5EJ9A 3ZHVA 3WDSA 4DBVO 2X13A 1N2CA 1S8AA 2D06A 3ZC3A 1N33B 3LX8A 4YBZA 4HCJA 3LDAA 1XMIA 3NHWA 3ZVMA 2VKQA 1OA1A 2OM2A 3B52X 5BW5A 2WOOA 1LLQA 3C5WP 1N6LA 2XZDA 5DW3A 5ADWA 1YHZA 1YZYA 1P2BA 1ULAA 2GAAA 2BZ1A 2PVPA 4PXYA 3SC2B 3UMBA 1XN4A 3QU2A 5JAQA 1DAOA 2JLQA 3TD2A 3U1TA 4BNUA 1NQUA 2ERXA 2WUVA 3NYRA 3TW6A 1J4AA 1JIIA 4R51A 4ENSA 4ASUA 3D8UA 4ILKA 4EENA 1RQ2A 2GWHA 3AUAA 5JADA 4DB4A 4WKPA 1FFYA 3AHGA 3OQ6A 4TL8A 5JSFA 4YC7A 4D82A 4GBJA 1QG2A 2GKGA 2O3UA 4K9QA 4TQGA 3MYRA 3GLHB 3I6QA 3VU9A 1R8SA 1IUPA 1Z4JA 1F51E 1VA5A 2D0PB 2DBYA 3HDJA 4QOGA 5JNLA 3DHEA 5AKKA 2ON6A 1TTQB 4PX3A 4K0KB 4X6XA 2QTTA 1T35A 3R0IA 3TDNA 1CJBA 1RJ9A 3BUSA 4FFVA 4YRMA 4YDRA 5LQDA 1G6Q1 1GN9A 2GPWA 2Z2JA 3DD1A 5K2OA 5EZQA 3C6BA 3DP9A 4G1VA 2ZI5A 3AMVA 5MGBA 2IBSA 1C50A 1FNBA 2HHCA 2LCQA 3BL6A 4DA6A 3SEAA 2B3TA 4D6YA 4UPDA 2MYTA 4L0CA 3B89A 3SZUA 3HN6A 2HLNA 4XWGA 4MJXA 2E2WA 1UT6A 1LRKA 2A0XA 5JXGA 1PWZA 2EBFX 4I9UA 1W36D 2Q3HA 2NWQA 1U9ZA 3LDHA 1TKAA 1DLJA 4W82A 3CT4A 1EVYA 4UUOA 4BZPA 4HXEB 1YKGA 2YXNA 3CMMA 1N5OX 1Y3IA 1V2HE 2AFHA 3FFXA 4AC9A 3LBHA 3HXTA 1X7XA 2PD4A 2HZBA 3W6ZA 2W6IA 2X9GA 4RD6A 1G4HA 1U9YA 4W8OA 4R3NA 3IBSA 2VEOA 4DNFA 4ZOQI 3M4ZA 2FXIA 1QRSA 3S8YA 1MV5A 4HPJB 4HUQB 4MYHA 4I50A 3UUFA 3GL9A 4NE7A 5FCDA 3PZRA 3AILA 3MSXA 2OLEA 3G5UA 1YVDA 2O1EA 5K3FA 3ZQJA 4E13A 3IOCA 4N5LA 5F21A 3W5IA 4KSYA 2ODEA 6GPBA 3ZNQA 3ZNNA 1TTPB 2GILA 4K40A 3FAZA 2XDQB 5E95A 4QX6A 1TL7C 4OKIA 3KKNA 5ECWA 1AVTA 1CY7A 5KYYB 3CX8A 2GKOA 3C4VA 2V58A 3DB1A 1MEEA 5DO9A 2XE8A 1E1QA 1PT6A 3S2GA 1XNQB 4XTRA 3GA0A 4JJ4A 2JHGA 2R86A 4M4SA 4F3TA 1FYVA 4DLXA 3LOUA 3T1VA 1CZHA 4L3OA 5HF5A 2AB0A 2QE7D 3DVLA 2WUDA 4CT5A 2JFWA 4EOGA 2VQEB 2NTEA 3IAS1 2G4VA 4XYBA 1ABBA 4A8JA 2O2YA 3LW8A 4BKQA 2O23A 3JASB 5JD3A 4UW9A 1LF5A 2ZSDA 2OHIA 2PGOA 3T7JA 1WPXA 3OX4A 1EFLA 4HRXA 3IQZA 3E8MA 3PFNA 3OF3A 2DHEA 1XP5A 4PAQA 4JYCA 1X38A 3ZY5A 4P4SA 4QGGA 1YC2A 3CZPA 1Q0HA 1ODIA 3OQPA 1OE0A 1L4NA 3BEOA 2GEDA 3RU2A 2KB0A 1IIRA 1G4UR 1BZYA 5AW1A 1AUPA 3ZD7A 1UAYA 4EX6A 2J3DA 4PFSA 3ZHXA 1EP9A 4DIBA 3FDZB 4F4JA 1EEXB 5H80A 1RWWA 4AF7A 3K4QA 1RRCA 5DNAA 2J3EA 3U3MA 3RFVA 2GTIA 4GR9A 2ZYSA 1H3EA 3WHIA 3E7DA 2GF2A 5HE8A 3H2JA 4BBAA 4TMVA 5A9SB 1PVDA 3KEMA 3CH4B 4KYUA 2H92A 5K5EA 1J06A 4G3XA 4JITA 3K05A 2XMZA 1PVVA 3LDGA 1BQEA 5LFAA 1CSEE 4HMPA 1XPOA 1XYGA 2QLNA 2AL7A 2FN3A 1T1GA 5J5VA 3R8XA 2FW0A 1IOWA 3TGLA 3NDPA 3AIKA 2IYQA 1KBZA 3MOSA 4LRUA 3X44A 3DLBA 1K98A 2IJGX 2P30A 1XROA 3HP1A 2ATVA 2R79A 1ISRA 3UBMA 2J31A 1E6UA 5U4QA 1BWSA 1A50B 2JGDA 2RGEA 3UA3A 1RI3A 1WXXA 3H3FA 3EK2A 1ZH6A 5A3SA 5JNSA 1VIYA 2J7KA 3OTGA 2PRKA 3RROA 4CKXA 2WWGA 3FTNA 1QFXA 5IAOA 2QMOA 3KOZA 2ZVJA 5EXSA 5H4GA 1PL7A 4ZYWA 3GBSA 121PA 3OBIA 2ZR8A 3CUKA 3ND8A 4D9KA 3UHAA 4CMCA 2EZTA 4LCBA 4OH7A 2JF0A 1PR6A 2VPTA 1TVCA 2Q8NA 3GAFA 3VYUB 1G8KA 2VDWA 5AKHA 4YYEA 1HURA 3BTSA 3WJ2A 5HMLA 2F67A 4A6PA 2H4HA 5A7FA 3CG4A 4C0JA 3QVTA 2GBIA 2AQKA 2HSGA 4I19A 3R9XA 1ZUD1 4RY0A 1NBOA 1XXLA 1Q83A 1NL3A 3A2LA 4B87A 1MX9A 1M5TA 2VNAA 1T13A 1NW7A 1WHSB 5ED0A 2V03A 2X4IA 3L6RA 3ZNPA 4ZREA 2BFCA 5T4FA 4TZTA 3UAYA 1T8RA 4Y2XA 5ES4B 3QLEA 2HIAA 4BNVA 2QX8A 4DSAA 2ZT8A 3DDZX 1Q1QA 2RGNC 2WIBA 4B3TB 2B61A 2J33A 3CPJB 3K3PA 3NFYA 5ILQA 1BH6A 2YZ2A 2YFHA 1ODLA 3B2NA 3FUWA 3M5DA 4FMPA 3VOTA 5CB6A 1VFNA 5BN4B 1NT2A 4ONEA 3JS5A 1Z0DA 4R6WA 1F48A 3M4XA 5JXWA 1E32A 1ISJA 4PXAA 1QP8A 2GEVA 2CXTA 2FWRA 2C7BA 4UTRA 4Q4HB 1OZFA 4TVSA 2O50A 1X13A 3EJWA 4KI0A 2P5SA 3OE7D 2RH5A 5JZBA 1N0VC 3WLRA 1UBNA 2NXEA 3KL4A 3QPDA 5ILGA 1QPBA 1Z2PX 3CPHA 3D64A 3E05A 3E5NA 1WMFA 2PKRA 2NUAB 4F71A 3TB4A 4N82A 5K01A 1UIRA 2GR9A 3KE8A 2X40A 1SKYB 5H02A 4GX1A 3G17A 1ZONA 2HFJA 1G3IA 1G8GA 3RHTA 2INGX 1BCRA 2A4KA 2J7PA 2Z9DA 4D3ZA 3CMCO 5KYNA 3KOUA 4DC0A 9LDTA 1E2MA 3DYBA 4TYPA 3LWZA 1CJCA 5K05A 1V1RA 4ZYLA 5H3LA 4OBEA 1XZLA 4BXOA 1BJKA 1DI0A 3OWOA 1QIJA 1Y3DE 3KQVA 2R66A 3CBGA 4O0LA 4BKPA 3PEYA 2Z98A 3K1AB 1CP3A 2GN2A 4BP3A 5F2EA 3EXIB 1J5XA 4PQRA 5CDGA 5KVCA 2NW6A 4ABTA 5AHOA 1ZNYA 5FUWA 4L2IB 3DOJA 1ZU5A 3L7AA 4YMUA 4D25A 5KYWB 2WT9A 3C3BA 2QVCA 4PICA 3P2JA 3T4UA 4BLQA 4PBSA 1T10A 1V8FA 1VL0A 4JQYA 4A15A 4BPRA 4IDBA 5H9WA 3DZHA 2J5QA 3WXBA 5M04A 2QI9F 4IZIA 5LQMA 4OFBA 4GYKA 1SXPA 4QARA 3AF6A 1UK7A 2P68A 2OEPA 3UFBA 3L40A 2BBTA 5IDVA 4S1NA 1E64A 3A31A 3PQ7A 5IP5A 3B3AA 3RS2A 7REQB 3F73A 1CB0A 2CB0A 1E3SA 4GM0A 4ZI2A 1XPUA 2HSZA 4GL4A 5DV9A 4S1TA 2VT3A 3HKBB 4M9SA 3PDWA 1VCOA 1JW9B 5SICE 3T3PB 3FSJX 5HIKA 5FKJA 3I5AA 1OBHA 1PZMA 3T61A 4K7JA 1TW3A 2FUKA 4OVKA 4UU8A 1QVAA 5LXTB 4ARAA 1UJ2A 4GOKA 2OCYC 3LBIA 2JLSA 1FPMA 2VTKA 3FYUA 3P20A 4B6RA 1D04A 5KX5F 4IP0A 3BWEA 5AK4A 1O03A 4Q3OA 1RXUA 4P2BA 1W581 5DGIA 1CF9A 1Q7CA 1VZ3A 4MLPA 4LE2A 3WYFA 2NO5A 4FSDA 3OCWA 4I55B 4BFLA 6REQA 2WIDA 3R3UA 3FHCB 1WUIS 5HILA 1Z12A 3PZBA 2DKNA 4UQPA 1TU0A 4H6WA 3UPTA 2Y93A 4C6SA 4QYTA 5JNUA 4FEYA 1U0BB 3DZIA 2EKBA 1ICIA 1Q0TA 3FRJA 3QEJA 2P4UA 4MV0A 3W9SA 1Q3TA 1KRWA 3P2OA 1E66A 1MRNA 2R9VA 3EA5A 5CVEA 4ZHSA 4WNAA 1X7ZA 3ZHOA 4D9BA 3ELUA 1G5HA 5KEIA 3UXYA 3MMSA 2F1JA 4YRCA 1GQRA 4MCHA 4EA7A 1PT7A 5FRDA 3HLYA 3VVCA 4DRYA 4NOKA 5JBIA 3ZI4A 1VE5A 5DT2A 5J43A 3IV9A 4EKEA 3E3MA 5CCDA 2P9ZA 1LDYA 1SCKA 2YWGA 1JMYA 5JZSA 2ZUVA 3WLQA 1E96A 3R7LA 3ZVLA 4BDSA 4EB8A 2J0SA 1S8NA 2I78A 4MWEA 4GKJB 2AK2A 2Y1XA 3PXCX 2OGWA 4HWGA 4FR2A 4N7BA 4YACA 4YQYA 1SIOA 5IM4A 3D3EA 2XNDD 4KQXA 5BSMA 1RI1A 1QVRA 2CE2X 2CLLB 2OKGA 1B76A 4DRXA 5AVVA 1JAHA 1MB0A 3GDOA 2BFBB 1KI2A 4NJOA 3TX2A 4XJSA 5EMJA 3IT0A 4MX8A 3T3NA 4AIIA 2PJUA 4OM7A 1XQYA 1LBEA 2XB9A 3GRRA 4LVCA 4QRDA 3RFTA 5KWIA 1ZI6A 3ZNOA 4QHSA 3K4PA 2O2XA 1RDFA 3TRFA 1DFHA 4E08A 1EWRA 2HU8A 1UMCB 4FLMA 3TBFA 5LQAA 3GRAA 2A5LA 3FZYA 4R41A 3L06A 2OO3A 4P3XA 4DS3A 4DWJA 5LR6A 4WA8A 1I94B 3A9WA 4TT3A 3KVOA 3VXKA 1TK9A 1EK2A 3VR6D 2WTNA 3S2FA 1S4QA 3GRUA 3CTMA 4WHMA 5EWJA 1CR6A 1U7TA 2EX1A 3G0OA 2CMDA 2JFFA 1D8AA 1M0SA 2KX7A 4FGLA 4HVCA 2QN7A 4PC6A 4LPSA 1OWLA 4LX8A 1N2HA 1XJCA 1XCOA 2NUTB 1XL0A 5B30A 1SU6A 3HU3A 4MQ6A 1PNTA 3GDFA 3PFBA 3RVKA 5JYEA 1SH7A 2BFDB 5IZ4A