4JNKA

Lactate dehydrogenase a in complex with inhibitor compound 22
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
331
structure length
326
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARSRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of substituted 2-thio-6-oxo-1,6-dihydropyrimidines as inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
total genus 116
structure length 326
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jnkA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4jnkA02
2WE8A 4DTIA 4R1NA 2HO5A 1T2AA 4D45A 1ID1A 2YYYA 3R0IA 4ZQBA 3VVBA 1BWSA 2CF6A 3C7AA 3L07A 2YUTA 1H93A 3S8MA 3NDRA 5K6AA 3GDOA 4J9UE 4R54A 3K6JA 3F1LA 3FCOA 3R1IA 4FGSA 5IDWA 2O4CA 4J4BA 1DXYA 3EW7A 4Q9NA 3BTSA 1WP4A 1PS9A 1KEVA 3BTVA 3G79A 3KHUA 3RROA 2VT3A 4E5KA 4JLWA 3OQBA 5A4DA 3QVSA 5DF1A 1DBVO 2ZCUA 4J6FA 5TRTA 1YO6A 1ADCA 5I9MA 1KVUA 1MP0A 2UUPA 4CJXA 4XR4A 1KOLA 1Y8QB 5I8ZA 1GUZA 1U4OA 4AJLA 4UREA 4F45A 1LEHA 1VI2A 1ADGA 2UV8A 3JYQA 4J4TA 2DFDA 3GNTA 4LN1A 3BMOA 5EN4A 1XYGA 3FN4A 4RF5A 2BFMA 5KVSA 2D59A 3CE6A 2HRBA 3E18A 3JQ7A 4PLHA 3UOGA 2FP4A 3WOHA 1EQUA 1EBFA 4JIGA 4P8RA 3GC6A 2UUOA 3DZGA 3FNHA 3QJ5A 4WLUA 2C2XA 1IB6A 5BSEA 1U2GA 3FBTA 2Y1CA 2EEZA 3VH2A 3TF5A 1GTMA 5I9LA 2QYTA 1E3SA 4S3MA 5H81A 3RJ5A 2CMDA 3T4XA 4BGUA 4NK5A 1P77A 2PD3A 2JKVA 1PJ2A 3ZW8A 3VDQA 3C7CB 3OJFA 5ENDA 1LDMA 3OJ0A 4F3YA 1KVRA 1NWHA 2HRZA 3PZBA 3K2EA 5KVQA 3TL3A 3I52A 3JSAA 1X14A 1PJCA 4AFNA 2FY8A 2DUUA 4QFDA 4CPDA 4HWKA 2QW8A 2I5PO 4KUEA 4P4GA 3VKVA 2X0NA 4WECA 1PJ3A 1HDRA 2FPPA 4FFNA 4WUVA 3Q0EA 4O59O 3JD4A 4KTTE 1XA0A 3ZHXA 5CG2A 5DOVA 3PJEA 2X9VA 4XGKA 4OOFA 2P68A 2GNAA 5KIAA 1I3KA 3A14A 3RBXA 4XGIA 5IAAA 5KNLA 4GX1A 4S1VA 1DFIA 4BO7A 1R4MA 4UVIA 1BG6A 3DBLA 1M6HA 1Q0HA 4YTEA 1X1TA 4EDFA 3OM9A 2YDXA 4YDRA 4MPDA 1GU7A 1LC3A 1DRVA 4KDFA 4W4TA 5FEUA 3GVIA 1R4MB 3FI9A 5A05A 3WGOA 2DBRA 1HTBA 5JAMA 2JAHA 5BNFA 1FJHA 2ZATA 4K9DA 1LUAA 2P91A 3LVFO 4ZJUA 3JD1A 3Q3CA 1NPDA 2VHYA 3HDYA 4U0KA 2B5WA 4IJWA 3KEQA 4J2HA 2QRJA 7ADHA 4JP3A 1GCOA 1B8PA 3VZRA 1R0SA 4G65A 1PL6A 3RVDA 3TZ6A 3VH1A 4YQZA 1BDMA 3F5QA 4HNHA 2HJSA 3NV9A 3GEGA 1NFQA 3QWIA 2GN6A 4PRLA 5HBRA 5KWEA 2YZ7A 1DLIA 1Y1PA 1NR1A 3BHIA 3VPGA 2IEDA 2P9GA 5JW6A 1QLHA 1A4IA 1PJSA 5DOZA 4BS9A 1T24A 2J6IA 5B37A 2EJWA 2W8ZA 1UDCA 3L4BA 5KJ1A 2JD0A 3EY4A 3U3XA 3G1UA 1GQYA 4CLRB 4B4OA 3U4IA 1EBUA 3TSCA 1HDXA 2QX7A 4RVHA 2VHXA 3MWDB 4JNKA 4CV3A 3H6KA 4JBHA 1MC4A 1JQBA 2BGMA 4L73A 4FIZA 2EHDA 3WGGA 4YYZA 3NT5A 4W99A 1LI4A 3W4IA 2Q3EA 3JQGA 3LZ6A 5JYDA 4OXKA 4ESOA 2Q4BA 3WIDA 3LF2A 2VUTA 4JN6B 2Y99A 3CXRA 5ES3A 4IGFA 3DOJA 5GZ6A 5HRUA 1HSOA 1GEEA 3VHRA 4B3HA 4YT2A 1ISIA 2X22A 4DBVO 3C3XA 1B15A 1ZSYA 1PZFA 3GEMA 3PQFA 3LC7O 4D43A 4M87A 1BHSA 1Y8QA 2EXXA 4PGFA 4GPD1 1NVGA 2CFCA 4UVEA 3V2HA 2Y1DA 3FF4A 3WQQA 4E5YA 1IZ9A 4PVCA 4LISA 4NBWA 4JJFA 3N58A 3EZYA 1DJNA 2CUKA 3NYWA 4EJ6A 3KYDB 4Q3EA 4RGBA 4BUCA 1EUZA 4O63O 4C7JA 2FPIA 4CMAA 1LA2A 2G76A 2O50A 4YAEA 1GZ4A 2IDZA 1DDOA 1HL3A 3GPIA 4PG7A 1Q7CA 3UGKA 5MDHA 1P1RA 3DR3A 4BB5A 3OFSA 2HMTA 1QYWA 1DC6A 5IN5A 3D1LA 4G5HA 2E4AA 1GPJA 4BNJA 4CM9A 1CEQA 2VQ3A 3BMCB 5CEJA 3L6DA 2NTNA 5I7EA 2X9GA 2AQIA 4YWJA 4DYVA 4J1QA 4DLLA 4HKTA 1I10A 1HWYA 3PIIA 1X0XA 4E30A 1HDYA 2RCYA 5CPFA 3ANLA 1XKQA 3FNGA 2H1SA 5DBIA 5L51A 1YJ8A 4QO8A 5F5NA 3ZNNA 1PWZA 4IDBA 5THQA 5A5FA 3RUHA 4BNWA 4LCEA 4TMFA 1UAGA 3BA1A 1VL6A 1YBVA 4ITUA 3UCFA 5FI5A 5J23A 3W1VA 2XAAA 4K1LA 1H6DA 3RUFA 3B1KA 3QIVA 1L1FA 2D1YA 3NUGA 1KC3A 1U3UA 5CG1A 3GY0A 2Y1FA 3ICPA 2DBZA 5BQFA 3ROMA 4EUHA 5JLAA 1C0KA 4XYGA 1ENOA 4XYMA 3QSGA 3L4BC 1X7HA 2DM6A 3JQEA 1YOVA 3JQFC 3TNLA 4CMEA 5F1KA 2A94A 1DFHA 1SOVA 2RAFA 3FTPA 2DBQA 3HE3A 5H82A 4DBZA 3CINA 2NU7A 1N7HA 3FNFA 4XDYA 4YBZA 3GGGA 3TJRA 1P0CA 3ZZNA 2OFPA 3PWKA 3ZN2A 4DQXA 3QVWA 5ICSA 1YOVB 4WCFB 3ZNPA 5JCXA 1G1AA 4I5EA 5A5EA 1YONA 1F0YA 1MFPA 3I23A 2AEJA 3TQHA 1I3NA 2JFGA 5A1TA 1NPYA 4DA9A 1ZIDA 1EVYA 1P31A 3UICA 1ZK0A 2WTBA 3CZMA 5A9SA 2YFQA 3DAGA 4HXYA 4IS3A 4GVLA 2W2LD 3MOGA 2W2LA 4IS2A 1NASA 1O0SA 1DC4A 1GL3A 3MCVA 5TS3A 3JQCA 3VZQA 1D7OA 3MTGA 3P2OA 3GG9A 4ND2A 3G17A 5BR7A 5JDIA 5DCUA 3ROQA 3I3OA 1IHXA 2IRWA 5DDIP 3VTFA 1ZMTA 5F5LA 3W4JA 1W0CA 4BB6A 2J3HA 2POQX 4YA6A 2GO1A 4NG5A 3DOOA 3VZSA 1K6XA 1IOLA 1HLPA 2GERA 1GUYA 3M2PA 2AE2A 1T2FA 3BTOA 4M49A 3ZNQA 2XXJA 5B4TA 4GL4A 4H3VA 3F6YA 1EMDA 4BMNA 1G0OA 3UCXA 4IZIA 2AQKA 1R37A 2RBEA 2DT5A 3DMTA 1HSZA 2BI7A 3P19A 4BNMA 4CM8A 2B4RO 1I2BA 2R00A 4H15A 2NVUA 2E82A 4IPTA 1GV0A 4L4RA 1IUKA 3IIEA 4RVSA 2UYYA 3RBVA 1PS0A 4ZHSA 2Q1UA 5IDXA 2GLXA 1P1FA 1R15A 1VM6A 3LDHA 1UXHA 1ZEJA 5F1PA 4B3JA 4PLPA 4PG4A 5ER9A 2VOEA 4PG5A 3AK4A 2NVUB 4J4HA 1DFGA 1G6KA 1YKFA 2NVWA 4Q39A 4Y9DA 4EJMA 4RF3A 1PX0A 3QV1A 3JYOA 2DTXA 3KYDA 2O3TA 2ZTVA 2PKQP 4A2CA 4ALKA 2ZTMA 4MIEA 4QXMA 3RU7A 1P33A 3ZV6A 5BT9A 1E1KA 4CMIB 5F21A 3BXXA 3JQ6A 1MXHA 3D4NA 4XDZA 1LNQA 2JFFA 1YQDA 3AUTA 1RM4A 4ZD6A 1E3WB 1FXSA 3EUWA 3IUSA 5CPBA 3LC2O 2V65A 2BKAA 3BMCA 4FR5A 3NTRA 4IXWA 1LLQA 1NAIA 3RUCA 4CM9D 3LQFA 3QVTA 1XIVA 2BI8A 5EIOA 5A9TA 1UXJA 3PPIA 2J8ZA 4PFJA 4A73A 3O8QB 4TVBA 5DBGA 2NU8A 4A26A 4WLNA 1PQWA 1U3TA 1ZBQA 1YWGO 2G82A 2OXIA 4KQWA 1T4DA 4UUPA 3IDSA 4IUYA 1A7KA 2G5CA 1VSUA 4TWRA 3KZVA 3GT0A 4DLBA 4RZIA 2PWZA 1EUDA 1A9ZA 4TROA 3AOEA 4BNIA 2OUIA 1JTVA 1ZJZA 2QQ5A 5CDGA 3L6OO 4DIFA 4CL8A 1LQUA 3UN1A 3GZNB 2OORA 4E2WA 1DLJA 2W90A 3DZBA 3IKTA 4M54A 4K6CA 4PRKA 1XQ1A 5JYEA 3SC6A 5DULA 4NJOA 2VHZA 3K9QO 3VH3A 4R68A 4CQMD 5L45A 2HSDA 3C24A 3PDJA 4CLDA 3GN2A 3GAFA 1MXFA 2EGGA 3GN1A 5T8KC 8LDHA 3RKRA 1BXZA 3SBOA 3QA9A 3ZU2A 4ZVVA 3PHIA 5AXCA 5T64A 4OMUA 4F6CA 4R1SA 1A7AA 3G0OA 4RVUA 4XRRA 4XQ9A 3UAGA 1C3VA 2VUSA 3JQ7B 1N7GA 3SLGA 3ONEA 5THKA 4OKNA 3HG7A 1PSDA 1K3TA 1ONOA 3CPSA 1I5RA 2P4QA 3WYBA 3C85A 3A4VA 4OQYA 1PEDA 4CLOA 5T67A 2JCXA 1CIVA 4AJEA 4D3DA 4GKBA 3WBFA 4I9UA 3ENKA 2VYND 1ULUA 3HNPA 3OJEA 3ZWBA 3K92A 3D7LA 5ADHA 4IINA 4IY1A 4DPMA 1GYPA 3E9NA 3ITKA 3IAHA 4WLFA 5C37A 2BHLA 3WNVA 2AEFA 4BNXA 4CQLB 2NQTA 3RSHA 1DPGA 2YDYA 1HXHA 4HY3A 2BRUA 4MO2A 4E31A 1FMCA 4KWIA 3CKYA 4NFSA 4R01A 4IQ0A 2VZ9A 2RIRA 3L9WA 3LYLA 1DHRA 4W9NC 1DOHA 1H9AA 1SB8A 3KBOA 2WD7A 4IMPA 4PG6A 5L4NA 1GD1O 1QV6A 4AJHA 3I9OA 3WR5A 4HNGA 3WTCA 4BNNA 1LSOA 3OH8A 2J5RA 4L0QA 1SC6A 3PYLA 4FJ1A 1JWAB 3AUUA 3COSA 3SJ7A 2YV2A 3DFZA 1GQQA 4L74A 5IN4A 1B7GO 1V6AA 1J5PA 2X6TA 3I9JA 4XQGA 1R4NA 5DCWA 4DVJA 3AU8A 1LDGA 3BHMA 2Q1SA 4K28A 1YS4A 5BNIA 1I30A 3JYPA 1RWBA 3OBBA 4KDEA 1R6DA 1BVUA 2C07A 1VRWA 2DU8A 3GRPA 1YDEA 1R4NB 2Z5LA 1M2WA 2YQ4A 4BKOA 4FCCA 5I7VA 2O48X 1PZEA 5B4UA 2JCYA 1J49A 4I8XA 4DRYA 4LSWA 5CFZA 4E2YA 2W2KB 5G0WA 1BGVA 2QRLA 5IXSA 2IZZA 4AL4A 4RVDA 1Z82A 4BNUA 3H4VA 1C0PA 4RPKA 4RO0A 3DMYA 3ZV5A 2NU9A 1GY8A 2Q1WA 3WTBA 1CF2O 1Z75A 3K31A 3ADOA 3GZ4A 5IDYA 3X2FA 4CMIA 5GY7A 2GDZA 1GEGA 1OMOA 1TEHA 2VYVD 3Q6IA 3BIOA 2J3KA 4E5NA 1WW8A 3AUSA 1CYDA 1O5IA 2BD0A 3GQVA 1ZJYA 1VJ1A 2OZPA 4DIOA 1EFKA 1BXKA 1R16A 4FC6A 4Y98A 4B8ZA 1F8FA 2VCYA 3VOSA 2XOXA 3TZCA 1D1TA 1NVMB 4I5DA 2HK9A 3QVOA 3PP8A 4IJKA 2HMUA 3WMXA 5IZCA 4N5NA 1ISFA 3GFBA 3VZPA 2RHCA 4IQ8A 1NQAO 1E6EA 4YT4A 2OOSA 4UEKA 1GDHA 4Y6SA 2O3JA 5AYVA 3JQBC 4RQUA 4Z0HO 5L3ZA 3DHEA 3N7UA 1T2DA 3CTMA 4RJTA 4HADA 2P5UA 4BO4A 3WLEA 4ND5A 1I36A 4DXHA 3L0DA 3K30A 4NI5A 5DBFA 5A04A 2GSDA 3OEYA 2NLOA 3INGA 3ZW9A 2CDAA 4DQVA 5KOIA 4D3SA 3PEFA 1TLTA 3B20A 2FR0A 2I99A 1U3VA 4J0EA 4MP8A 2DFVA 2NUAA 2FSSA 1H94A 1JVBA 4RVFA 1V9LA 4BNFA 4ALJA 5AQ1A 4I5FA 2JAPA 1NX6A 3GHYA 2AW5A 2YFHA 4XYLA 1NFFA 1VC2A 1TT5A 4LSMA 3IMFA 4OM8A 5AXBA 3KO8A 3PJDA 4CODB 5B1YA 1V8BA 3D64A 4HFNA 3TWOA 4W9NA 1ZK3A 3NJ4A 1A27A 3UCEA 3G3EA 3WDSA 3E5MA 5AOVA 5CEFA 1ZMOA 4NBRA 1E5LA 3QWAA 3WWYA 1A9YA 5EERA 1GADO 3HUDA 4R9RA 5A9RA 1A4UA 1O6ZA 3L77A 1X13A 2ZB7A 1XDWA 1GCUA 3VPXA 3U62A 1N1EA 3Q9UA 4CLOB 1GPDG 2BH9A 4RLHA 1EQ2A 4AJ1A 2FZEA 4A03A 4XCVA 5HWSA 3OSUA 3NRCA 2X86A 3AI3A 3RI3A 1D8AA 3WXBA 3DZKA 5JDCC 5CEEA 4I08A 4BO0A 4BGIA 2Q2VA 1ZXLA 1IL0A 3H9EO 4DUPA 1LSJA 3OJLA 2GN4A 4L8VA 1GV1A 4EYEA 3UW3A 4CLXA 1SCUA 3V1TC 4PLZA 2ZQYA 1XGKA 1YB5A 3K96A 3D3WA 1PQUA 4WLVA 4E13A 1U2DA 4NPCA 1E7RA 3WB9A 1F14A 3WNQA 3MJTA 3JD0A 3WX0A 4A0SA 1DIAA 4NU5A 4ZQFA 1VL0A 3C1OA 3DZJA 2D3TA 1TI7A 2P9EA 1PGOA 4GX0A 2Q99A 3CSDA 3PFFA 2FSVA 3QWHA 4J1SA 2DPHA 1OAAA 4I5GA 4OKIA 4XIJA 2EW2A 4D41A 2X0RA 3QHAA 3DMTC 2TMDA 3RFTA 3M2TA 5LDGA 4E5MA 5JY6A 1EEHA 5IFLA 1YL7A 3Q2KA 3I9MA 2E6UX 4NU6A 3HZZA 2E37A 2QZ9A 3BTUA 4J1TA 1YH3A 2C54A 5CHEA 1ONPA 3H9JA 5I8WA 3GR6A 3KLPX 1RJWA 2W2KA 1Q2XA 3DAPA 2ZYDA 3H3JA 2FWMX 3BMNB 1PJBA 2AE1A 5TT1A 4XR9A 5I7FA 4ONEA 1HZJA 1LQTA 2OP1A 2EP7A 1Q7BA 3WGQA 5B12A 5FWNA 4WCFA 2PKRA 3VTZA 4WCDA 4XB2A 3U49A 3VH4A 1P3DA 5COAA 5JE8A 1HYHA 3FWZA 1E1LA 1AE1A 2AG8A 2Z95A 4LW8A 5DCYA 2OP0A 1OFGA 3VPHA 1QR6A 3AU9A 2GGSA 2HU2A 2NTJA 1Q1NA 1QORA 1XU9A 2R6JA 2ZCVA 4FDAA 4LMPA 3CUKA 3W6ZA 2VRBA 3ZWAA 4IGEA 2EV9A 4N5LA 4O0LA 4XYEA 4UVGA 2GR9A 5G0TA 5BNTA 1K5HA 4J91A 1JAYA 3ZWMA 1CQIA 1JLLA 1MA0A 4Y67A 3DBVO 2QZZA 4E33A 1ZW1A 2BELA 2JCVA 2PH5A 2DVMA 1EDOA 4E5PA 1ADBA 1LDYA 1NQOA 1I24A 4AJIA 4PVDA 2Y67A 4HFJA 4AJ2A 5FFFA 1Z74A 4CL3A 1YE3A 1UXIA 1T2EA 1UXGA 3JQBA 5DP1A 4WCFC 3AFMA 1ZEMA 3DAFA 1X7GA 5F3RA 2PNFA 4YVFA 1P9LA 2BFAA 4CR8A 1P1HA 4MINA 3Q1LA 1CQJA 2XPCA 3BMQB 1LLDA 5L7WA 2QYSA 2VNAA 1O89A 4NBVA 3T4EA 2B69A 5HS6A 3HFGA 3JQGB 3DO5A 2JFHA 1O94A 1TXGA 5A02A 4N54A 5KJFA 1K0UA 1N8KA 3IOYA 2PGDA 4FJ2A 1QYVA 5G4LA 1YXMA 3SXPA 3Q9NA 2I6TA 3D4OA 3ZH2A 4O1MA 6LDHA 4J7UA 4XZ3A 1IPFA 3VAZA 1NQTA 4Z0PA 3IUPA 1DJQA 5AVOA 5KKAA 3DHNA 1YL5A 4Z0TA 4Z6KA 4BMVA 2ZK7A 3HQ4O 4RPLA 1PGPA 3WGTA 1MG0A 3RJ9A 4Z3KA 2E48A 2VNSA 1FDUA 1YB4A 4LMRA 1SO8A 3U4HA 4L76A 5F1OA 1GZ3A 2DBVO 2EG9A 3V8BA 4NK4A 1XR3A 4CMGA 1JKFA 2BLLA 3EAGA 4E2ZA 4MVJE 3FR7A 4NH4A 3RCBA 4AJPA 1J6UA 2Q46A 4XKJA 1E1NA 3W8DA 1E7QA 4QT0A 4DL9A 1YL6A 3WQRA 3ZWXA 2Y0DA 3SEFA 4CV2A 3PJGA 5L40A 1WZEA 4R5MA 3E48A 1DIBA 2I67A 3AM3A 1B0AA 2DKNA 5TNXA 1Y9AA 4WEQA 4WLEA 2B4TO 4HUJA 1RYDA 3UF0A 3AOEC 1WPQA 4BNVA 4WKGA 3TFQA 3WGZA 4YRAA 2I3AA 3LT2A 1OOEA 5G0SA 5DNAA 3H5RA 1KEUA 1O8CA 3FRJA 3X2EA 2CD9A 4GSKA 1LSUA 1LRJA 2A35A 5COQA 4R51A 3WFJA 3GHHA 4MIOA 4YRBA 1SOWA 2ZQZA 1X15A 2FMUA 3NEPX 2Q49A 3PTZA 1QMGA 1DAPA 4RZHA 2NU6A 2J5KA 4YJFA 1X0VA 4ZA2A 3HADA 1WMBA 4WOJA 4CLHA 1ZSNA 3PIDA 8ADHA 1XCBA 3GNSA 2CDBA 4L9RA 4YJFB 3HWRA 4RPGA 2H6EA 2WD8A 4ZRNA 2B36A 3IQDB 3AY3A 4HP8A 1NAHA 2CY0A 2CF5A 2HK7A 2ZYAA 1HE4A 3QLJA 5EJ2A 3BMNA 5JMPA 4CLEA 3I9LA 3IJRA 3KV3O 3GF4A 4YQYA 5KVCA 3U0BA 1AHHA 2JHFA 2ZTUA 1YB1A 5FF9A 3RQSA 4LRTB 3WMWA 1IZ0A 2FR1A 1AXEA 3P5SA 1D4FA 3PRJA 4UEOA 2FRDA 2JL1A 4Q3AA 3JQFA 2F00A 4NHEA 3FBGA 4PZEA 2NWQA 3MTJA 4XEHA 4QX6A 4YJGA 1N9GB 2ET6A 3TFOA 1DC5A 4MIYA 5L7TA 1FK8A 1U28A 1XSEA 4UAGA 4CQLA 3IL2A 4BVAA 1U9JA 2C20A 3H5AA 3F1KA 4KWHA 2O4UX 2O7QA 4MVJF 4UVDA 3E9MA 1NHWA 2DLDA 1IPEA 4MP6A 2PLAA 5EL0A 5AXDA 1BMDA 3BAZA 3PHJA 4TKLA 2C82A 4QFCA 5TC4A 1GUFA 2VHWA 3RAJA 3AM4A 3TZKA 1G0NA 2YHIB 1DSSG 3S2EA 2FR8A 4AJOA 3OQ6A 5JXWA 3O4RA 2NNLD 3BHJA 3VDRA 4IDFA 3AY7A 4E4YA 1F12A 1L7DA 2NM0A 1B16A 2IYPA 1U7HA 3DZFA 3MJ4A 4Y8VA 4E2XA 2VTDA 4BNZA 3TZQA 4EBFA 1MX3A 2ZB8A 3U9LA 2YV1A 4XIYA 1H6AA 3KETA 1W73A 1WXDA 1WAMA 4MVJD 4XYBA 2FN7A 5JSFA 4U7WA 1HYEA 3WG9A 3OMLA 3N74A 3ORFA 4LK3A 3PWZA 3KSZO 1UP6A 5T5QA 1ZCJA 2VZ0A 5TQVA 4K6FA 1HRDA 4ND1A 2NSDA 2Y68A 4GGPA 1ISMA 2FOIA 4IDCA 4NDNE 5HA5A 1HE5A 5TSDA 3LLSA 3LSYA 3SC4A 4E32A 5JAIA 2PTGA 5K0ZA 1TVEA 1XU7A 1YGYA 2WEKA 3K8ZA 2GUGA 3MJEA 1ZXBA 4ILKA 1PJ4A 4OL9A 5JC8A 2PZKA 3DC2A 2NACA 5A06A 1Z7EA 4KUGA 1H0KA 4BNTA 2B0JA 1I01A 2X58A 3ENNA 4GMFA 3Q11A 2ZYGA 4Z3DA 2Y93A 2GPTA 3NJ8A 1ARZA 1KS9A 2BGKA 2PV7A 3ZI0A 1E0DA 1R0KA 1GR0A 3PLNA 1XHLA 2ZJ1A 5U1PA 4ZN6A 3CEAA 5IDQA 5GZ3A 3O38A 2YQ5A 3CIFA 1R12A 4B3IA 3PWSA 1N92A 3EVTA 1JKJA 2D5CA 2R00C 3C8MA 5B4VA 1HYGA 4FSHA 4JJIA 1E3WA 5KCZA 5JO9A 1E6WA 2VZ8A 3DL2A 3EGOA 4URFA 4IJVA 4FQ8A 4WJZA 1QYDA 4HFRA 3GGPA 5KJ6A 3CH6A 3O8QA 1KEPA 2D2IA 5AXAA 2RHRA 3UKOA 3M1LA 1I33A 1L7EA 2QIOA 1DIGA 3GVCA 3QY9A 1CERA 4J7CA 3RUAA 3K73O 1YRLA 3DZIA 4WNIA 3NT2A 1DRWA 3UFXA 3UXYA 4B79A 3NGXA 1PQPA 5TX7A 1EVJA 5EINA 1E1MA 1NHGA 4WPGA 3GZNA 1KERA 1EFLA 1DAOA 4UUMA 4B4WA 4BQPA 1WNTA 1I3MA 5TJ9A 2DPGA 1YQXA 1R66A 4NNJA 4E6PA 4L4SA 2FZWA 3EC7A 4RDHA 1C1DB 3IKVA 3IS3A 2UAGA 1I2CA 1SAYA 4QECA 3H3FA 1MB4A 3LT1A 3V5NA 1OC2A 4M89A 4CM6A 4KQXA 2X9NA 3MWEB 3PYMA 5IZCC 4IM7A 1C0IA 1KETA 1PZGA 3ZWVA 4MKXA 4CUKA 4PLTA 1C1XA 4WEOA 4W82A 2EP5A 3QVXA 3KYCA 3NAQA 3ZWCA 4FC7A 2IXBA 2IEBA 3WGIA 1PL8A 2PA3A 1KBZA 2HLPA 4WLOA 3GRKA 1C1XB 3F47A 3RBZA 3VPSA 4LRSB 1P45A 2OMEA 5CDTA 4U6QA 4R1TA 2LDXA 4BGEA 4FJ0A 4IDDA 3V1UA 1PGNA 2PD4A 2PZMA 3ZHZA 1BXGB 2B5VA 2WSBA 4E12A 1Y7TA 3ZV4A 5KVVA 1QYXA 1E3EA 4FB5A 2YHIA 1FDVA 3ON5A 2CNBA 4M1QA 5HM8A 3F5SA 3QRWA 1B8UA 2WMDA 4XQEA 3RC2A 3ICCA 4FFOA 1F8GA 4LVCA 1LDNA 4Q3DA 2J5QA 3GDGA 3HB5X 3KM0A 3PHLA 1BSVA 2WD7B 4R9SA 3GPDG 4MVJM 2X1HA 4FFPA 3I83A 2AEMA 1RM3A 2O3RA 4AJNA 4XQCA 1D3AA 1T1RA 4I1IA 3MJSA 5G0UA 3SVTA 4MDHA 1SNYA 4RV9A 4CMEC 4ZRMA 3KSDO 1LU9A 2DC1A 1ULSA 1U8FO 4GWGA 3ZV3A 4MVJA 1W4ZA 2W98A 4J0FA 1JW9B 4FOOA 3V2GA 1P1JA 2P5YA 1HETA 3DFUA 1NM5A 4BO9A 4N5MA 2IZ0A 4ALIA 1RM5A 3RIHA 1ZK1A 4OSOA 4EUFA 4QO7A 1B2LA 1QP8A 2C7GA 4DIBA 1ZFNA 4EITA 4BNLA 5HS4A 3R3SA 4ZQHA 3NDJA 3ASUA 4XD2A 3IP1A 1KVQA 4Q3BA 3U4CA 2BFPA 4TSKA 4B7UA 1ZH8A 3DBHA 1HZZA 4OYRA 3WBBA 4BKQA 3ETDA 3RC7A 1EDZA 1Q0LA 2CVZA 3WYCA 4MKZA 5G0VA 3OIFA 3RASA 1LLUA 4O5OA 3TL2A 2PGLA 1I2ZA 2AQ8A 2VRCA 3FD8A 4JGBA 2Y1OA 3JQAD 3DBHB 5BSGA 3OIGA 4M86A 4XA8A 3KSUA 1ZUD1 1NR7A 1YJQA 2GF2A 2Q1TA 1RYEA 3JV7A 3JD3A 1H2HA 1MUUA 4PLYA 1UR5A 2JD1A 3WGYA 1PTJA 5KKCA 4YCAA 3V1YA 4GAEA 1CRWG 1NFRA 1UJMA 1F06A 1Y81A 2OGUA 1JKIA 3H5NA 4B7XA 2X0IA 2DTEA 4W7HA 5I9NA 3GK3A 1V3VA 1O9BA 4BIIA 3AI1A 4OQZA 2I66A 4GH5A 3ONFA 4NBTA 1SB9A 4R16A 5DN9A 3H9UA 5L4SA 1P1IA 3JQ8B 3RKUA 3HDHA 1W8DA 4BO2A 2VWPA 5BSHA 4ZICA 1U1IA 4LCJA 3INRA 4WGGA 3D5TA 1MFZA 4IBOA 1VKNA 2P2SA 1SPXA 2AXQA 3I4FA 2XXBA 3AWDA 3VKUA 3STHA 2X0JA 1P0FA 3B70A 4EZBA 3K5PA 3JQAA 1AXGA 1C1DA 2A4KA 2VRCD 4Z9YA 2PKQO 1HDCA 2NTVA 3I9NA 3JYNA 1IHYA 3ZWWA 1TT5B 4FN4A 3ZHBA 1E7WA 1UZLA 3F4LA 3Q2IA 4OO3A 5DP2A 1PIWA 4GBJA 1HF3A 4BL5A 1NTOA 1A71A 4OXNA 2CVOA 4I9NA 2NVBA 2VT2A 1LX6A 3ZCXA 4R5HA 4GSLA 4BNGA 1XEAA 1Z45A 2C5EA 3C7DB 3EZLA 4RDIA 3WIEA 1VL8A 3FSRA 4J90A 1ZK2A 3ZGYA 3GMSA 4EEXA 1VJTA 1KEWA 1H5QA 4OHUA 3ZWYA 2J3IA 3PJFA 3RUIA 2J3JA 3V2UA 4NZ9A 4KTVE 4TRMA 3E6AA 3ETGA 4QQRA 2OL4A 1PJTA 4B7CA 5BSFA 1QXSA 2HAEA 1YBAA 3AM5A 1JU9A 4JBGA 4QEDA 3ZU3A 4AVYA 2WM3A 3DB2A 2G1UA 2ILTA 4NMHA 1LTHR 2PD6A 2VWHA 5C7LO 5JS6A 2YW9A 1BW9B 3FPLA 3AUAA 3OQ1A 4U6SA 2XF8A 1D1SA 3D3WB 3FPCA 5LC1A 3HN7A 5JCJD 4OJNA 3ZWPA 4DGSA 1GFSA 4CM7A 1DEHA 5EESA 4MVJG 1JA9A 4NJMB 1LRLA 1Y6JA 1PJLA 3RU9A 3KXDA 2Q4EA 5JCJA 4MJLA 3SJUA 3W4KA 3AFNA 4MVJH 1LLCA 3QP9A 4YJDA 2PZLA 5TF4A 3WICA 4WK6A 3W6UA 1H9BA 2BF7A 1CWUA 1ISGA 4EW6A 2V7PA 5A3JA 3HSKA 1OBFO 3DHYA 1XG5A 4GX2A 2GASA 4ND4A 3QWBA 2AHRA 2A9FA 2UVDA 3RUDA 3H9GA 1ZKMA 3ITDA 2PK3A 2UDPA 2GD1O 4BMSA 3BZUA 1E92A 4NBUA 4AJ4A 2PZJA 1E77A 1EK5A 1T4BA 4JP2A 4BGVA 5C7IO 4CV1A 2VWGA 4FPXA 4Q3NA 1PWXA 4YAIA 5JAZA 1M75A 1B3RA 3WSWA 3LLVA 4OH1A 1TT7A 3WGHA 1T25A 4EGFA 1UXKA 1V35A 3GDFA 1N9GA 4O6VA 2Y1EA 1ISHA 1PGJA 4GI2A 4BO5A 7MDHA 3DEYX 4JJGA 4JBIA 2NQ8A 3NTQA 4CMHA 4R3NA 1EE9A 1EVZA 1E3IA 4GQAA 4UULA 4DYDA 1N2SA 3WYEA 4FBGA 1DC3A 3FNEA 4X54A 3I6IA 1FDTA 1SBYA 4KP7A 1JDJA 2FPGA 3B6ZA 3PYXA 4HBGA 2O2YA 4RL6A 3UH1A 3EMKA 4C7KA 4YPOA 1I0ZA 1P1KA 1UH5A 1CJCA 2HQ1A 4CM1A 1DHTA 1OC4A 2GZ2A 3WLFA 2DAPA 2EKLA 2GYYA 4GGOA 2O3UA 4FFRA 1JVSA 4B4UA 3TN7A 3VPFA 2HMSA 1ENYA 2Y66A 4TRNA 2D0IA 2AA3A 1E7MA 3GAZA 3HB4X 3GUYA 3GUCA 4JCOA 4L75A 2VOJA 3ASVA 3BMQA 3H8VA 3TDKA 2F1KA 4FOSA 4TVOA 3R3JA 2AQHA 2I65A 2YV3A 1QSGA 3AI2A 3JQAB 3KLMX 2PGJA 2BGLA 3U09A 3C1AA 3ZU5A 4OSPA 3OA2A 2EW8A 5C5IA 3I6QA 3LT4A 2B4QA 4ZU3A 1H6CA 4IIVA 1QKIA 1WDMA 4IMRA 3SX2A 2SCUA 2X4GA 4J43A 1NVTA 3DTTA 4I9HA 4DC0A 1I8TA 1J4AA 2OBYA 2B37A 1ENZA 1ML3A 4M55A 4DMLA 5JC1A 3I4CA 3MOIA 1AHIA 1OI7A 1QYCA 1KVTA 3F3SA 4MKRA 5TT0A 3KYBA 2PFGA 3F4BA 2AG5A 1PU2A 3R6DA 3LT0A 1FDWA 1ZVMA 2D8AA 2H9IA 3EK2A 4RVGA 3ROPA 4KZPA 5A3VA 5JAQA 3GVHA 3OP4A 3OICA 3P7MA 4GX5A 1ZSVA 3H2SA 4JQCA 5EQFA 3W8EA 2VYNA 1F17A 2Y0CA 3UVEA 4A5OA 2OO5A 5U9CA 3EHEA 3CMCO 3MJVA 3I1JA 5EQDA 1WMAA 3HDJA 1KVSA 2I9PA 4ZGWA 3WS7A 3HN2A 3ADPA 4G2NA 1V3TA 4J7XA 2EERA 3DBRA 3PGXA 5GMOA 2C59A 1BW9A 2EF1A 4LVUA 1CDOA 3OF2A 1LRKA 4R69A 2HCTA 3EYWA 1U3WA 2GZ1A 3WJAA 2IZ1A 5G4KA 3E8XA 4DMMA 4J49A 3RD5A 2E49A 3GGOA 2TMGA 1HLDA 3JQ9C 5JO0A 2H63A 4CQMA 4II3A 4LGVA 4GKVA 1E3LA 3D3EA 2C7VA 2B83A 3AW9A 1GYQA 2GRAA 2HUNA 1UUFA 1Y9EA 2VTEA 2CVQA 4ROSA 1P44A 1FDSA 1AN9A 1PL7A 1XWFA 1HDGO 4ZQEA 5LCXA 5TJHA 4CQMB 4Z9FA 5U4QA 3FTNA 4YT5A 4A10A 4XRGA 2BFOA 3RWBA 4OGWA 3ZU4A 3JTMA 3K2BA 1H2BA 2RH8A 1DO8A 3DDNA 3OECA 2X5JO 4CMKA 4GLOA 1FF9A 2HDHA 5L7YA 4D79A 4JXKA 3C1TA 3ETEA 1IE3A 5CDUA 3BYZA 3PQDA 4DPLA 1DIHA 2EGHA 5T8KA 3L6EA 3S1LA 1NXQA 2V6MA 2V6GA 4DLAA 2CDCA 1NNUA 5H83A 4D0RA 4D46A 1EE2A 2ZKLA 3WQSB 1UDBA 3A28A 4J9VA 3DTYA 4XB1A 2HMVA 4XGNA 2GN8A 1WLYA 3IJPA 1TB4A 3RFXA 1PS8A 2OBNA 3PDUA 4H7PA 2YY7A 4WE3A 5EMHA 4YJGB 4NQZA 1EUCA 4DPKA 1NQ5A 5T6BA 2NADA 1PR3A 3LU1A 1BXGA 3RC1A 4RCVA 1O95A 3D0OA 1SEPA 4CMJA 4HV4A 2D5AA 2D4AA 4CR6A 1RKXA 3O26A 4Q3CA 1BDBA 2Q2WA 1UAYA 1U4SA 2AMFA 3PLRA 4R4JA 2O3QA 3HDQA 1PJQA 1UP4A 1B3BA 1PZHA 4R1UA 3VC7A 4DWVA 3RC9A 1B14A 1LXCA 4BO8A 4R3WA 1V3UA 1ZNQO 3ONDA 1ENPA 4B8WA 1EK6A 2IXAA 1E5QA 1JWBB 4RF4A 4CM3A 4J16A 4ZQGA 4BV9A 1DIRA 2CZCA 3O03A 3ZWOA 3KTDA 3M1AA 2Y05A 1V0JA 1KYQA 2FHSA 2V6BA 4EJ0A 2Q45A 5ILOA 4BKRA 4PZDA 5C7OO 1J0XO 1E7YA 3KEOA 1UDAA 4D42A 2VWQA 3LC1O 1A5ZA 4XX0A 5JNLA 1U8XX 4A7PA 4KOAA 5GZ1A 1YBMA 3TZHA 4FFMA 1N1GA 4IIUA 4NFHA 2EJVA 4XWYA 4D0SA 2X7HA 3AY6A 3QE3A 4Z9XA 5G2OA 4YT8A 5CAEA 3QQPA 1Y5RA 3A06A 5JMWA 2IODA 2HKIA 4PLWA 1OZAA 3CMMA 4L4XA 4RORA 1XELA 3GA0A 3L9XA 3E03A 2JJYA 2O3SA 1TA4A 2RH4A 1VLLA 5IF3A 2QHXA 5DZSA 1K2WA 4RPHA 3D5QA 4BV8A 5C3MA 4IDAA 4PG8A 4YACA 3DBRB 4RPJA 1C14A 4FD3A 1BRMA 1LC0A 4H16A 1HE2A 4YEDA 2C2YA 3DBLB 1SZJG 2OHXA 2C5AA 1E6UA 4F6LA 3WJ7A 1MG5A 3H2ZA 2PY6A 3DXFA 4YJHA 5G4KB 3JCZA 4TKMA 3ROKA 5ENVA 1T1SA 3JQ8A 3NT4A 1UZMA 3NGLA 1WDLA 4WNCA 3HHPA 3DZHA 2O23A 4BNYA 3F46A 4UEJA 4CMCA 1DRUA 3ZWNA 1NPTO 3GFGA 1HDOA 2H5LA 4IDGA 5IXYA 4C4OA 2Q50A 1QRRA 3PFWO 3OETA 3GVXA 4DREA 4BNHA 2B35A 3OHSX 3UHAA 5K6AC 1M76A 1GQ2A 1M6WA 5IG2A 4MVJI 1LDEA 4BKUA 5KTKA 1ORRA 3KRTA 4W6ZA 1Y8RB 2EKQA 2JD2A 4EUEA 1LDBA 2X23A 3NX4A 2X8LA 4PZCA 3SLKA 1I3LA 3DONA 5ER6A 4CUJA 4BO6A 1EZ4A 1K89A 3QWFA 4JK3A 4E3ZA 1B8VA 3GH3A 3P2YA 1Z7BA 4TRJA 5FYDA 4TZKA 4KUHA 4TQGA 2VHVA 4BKPA 1Y8RA 4E0BA 2WDZA 4GVXA 4FGWA 2X5KO 2O2SA 4CLRA 3FR8A 1YVEI 4U8GA 1NYTA 4UUNA 4CUZA 1IYZA 2VUUA 3QW2A 4CR7A 4FW8A 2Y1GA 4P38A 1KY4A 3IP3A 1KY5A 4YAKA 4YAGA 4J3FA 2HJRA 4JROA 4CM8B 4TRRA 6ADHA 1YQGA 3KYCB 3TPCA 5FI3A 1ZZEA 4ALMA 2GCGA 2WYWA 3VVCA 4QUKA 4PN3A 2WYVA 4A27A 5JFOA 1Z6ZA 3I5MA 1R0LA 1K6IA 2PH3A 2WYUA 3ULKA 5ITWA 3KB6A 3GOHA 1PR9A 1X1EA 4ID9A 4WOKA 4YRDA 5CP8A 4NFYA 4RF2A 4RQTA 1HDZA 3E5RA 2G0TA 1ZK4A 2I3GA 4YB8A 1NWCA 2HK8A 5ILGA 4XJTA 4D44A 4BO1A 3ANMA 3GEDA 1RPNA 3ABIA 3S2IA 4YAJA 1Q0QA 2Y0EA 4N7RA 2P9CA 1EVIA 1NBOA 4IXTA 4UUOA 3MZ0A 9LDBA 1KIFA 1U5CA 4JX8A 4AJJA 5KJCA 4AJKA 1H6BA 1C0LA 3PI7A 3GVPA 1WZIA 3NTOA 4CM5A 3E82A 5TLSA 5L4LA 1S7CA 2P4HX 2HMWA 4OAQA 1QLJA 2VN8A 3EVNA 4NR0A 4CM4B 4QTZA 2IE0A 4AG3A 4CV0A 3TOXA 3F9IA 3W8FA 2YJZA 1LSSA 1AUPA 3TOZA 3I9KA 2O7SA 4BO3A 3GG2A 3ZHYA 1WVGA 3H9QA 3GLQA 4GWKA 5JY1A 5JBIA 4MVJP 3WWZA 1IY8A 1WWKA 2ZJ0A 1U5AA 2EIHA 4Y6PA 1CETA 1LJ8A 1GAEO 5MGBA 3AOGA 3PVZA 1MGOA 4G81A 1WDKA 3S2GA 5IZ4A 2W4QA 4P22A 4BNKA 5L95A 2EKPA 2GN9A 1QV7A 4TZTA 1SMKA 2A92A 3PK0A 3JQ9A 4YR9A 4HX5A 4B4VA 3OEWA 1DB3A 5ITVA 1MC5A 3ZNOA 4E21A 4MOWA 3U5TA 3JYLA 2V6FA 4U5QA 4D7AA 2PR2A 3G1TA 1N5DA 4HFMA 1GZ6A 1HKUA 3NDIA 1Q7GA 3PZRA 3TRIA 1BVRA 1GYRA 1X7DA 1ADFA 5KJEA 3M6IA 4W7IA 3PQEA 1JN0A 3S2FA 2Q2QA 1Y5MA 5CDSA 1ISJA 2BMAA 4YJHB 5EPOA 4EEZA 4PLFA 3RFVA 1K6JA 4P4NA 4F46A 4BQRA 3WFIA 4OXYA 3PXXA 1A72A 5JPIA 1MV8A 5TIIA 1I32A 4YXFA 2ZIZA 3PHHA 3GMDA 1HT0A 3BMOB 1SEVA 3KOUA 3OA0A 4ALLA 2EWMA 4IQGA 2LDBA 4IDEA 5I7SA 3ANNA 4AICA 3UUWA 3GNQA 4ND3A 2ZB3A 3ST7A 4U0JA 1YDWA 5JDCA 5IJZA 3JD2A 2G17A 3B1JA 5LDHA 5CDYA 1S6YA 3CZRA 5A9SB 4QSMA 4BHTA 4WASA 4CMBA 4DC1A 3PHGA 1XLTA 4ALNA 3LK7A 2VYVA 3FWNA 1VSVA 4XJSA 4PLVA 5A03A 5ICMA 3L4SO 3WSVA 4PLCA 3LF1A 3H65A 1QG6A 4IZHA 4KMSA 2IYOA 3DOCA 4FFLA 1ONNA 3HFSA 4EI2A 5K9ZA 4K26A 5L53A 3A9WA 4J1NA 3A1NA 3MEQA 3JQDA 3INTA 1VE9A 1VPDA 1VJ0A 4GMGA 9LDTA 1RM0A 1MLDA 3D4PA 4RLSA 1HE3A 1T26A 2CSUA 4PCVA 2JHGA 3RUEA 1LBEA 2DQ4A 4N18A 3U4DA 4J2OA 1M67A 2QG4A 4PIVA 3H7AA 1T2CA 5TGDA 3KVOA 3HJAA 2ZB4A 3KUXA 3E1KA 4DQUA 4Y6RA 3NKLA 5DT9A 3PGJA 1Z73A 3DWFA 1ZO8A 2X5OA 4P4LA 1M66A 2GZ3A 4IJUA 3B1FA 2C0CA 3O9ZA 1XQ6A 1NP3A 4FS3A 2YHUA 4INAA 1W6UA 2ZTLA 4NJMA 2DUWA 3S55A 5L9AA 1KC1A 4GLLA 2C29D 4NIMA 5COBA 1IULA 3T7CA 5T57A 4CM4A 4MP3A 4PLGA 1E3JA 4BOYA 3DQPA 1AGNA 2Z1NA 3AJRA 1U7TA 1PGQA 4II2A 5JDIC 1B26A 4R41A 1UP7A 1BTOA 5HTOA 2WJPA 3ZDFA 4D3FA 4OIMA 2I76A 3IC5A 2WWRA 1VKOA 3MJCA 4OOEA 2DTDA 3T7EA 2R2GA 3OIDA 4M8SA 2QRKA 1HEUA 3OJOA 3E9QA 2WE7A 3EDMA 3G49A 4UVHA 1P74A 3FHLA 1UZNA 1E7SA 2Z1MA 2NV6A 1JAXA
chains in the Genus database with same CATH superfamily
3HP4A 2WE8A 5E95A 2GM5A 5CBPA 4R1NA 1T2AA 4DT1A 4D45A 1T4CA 1EAYA 1V2HE 2NUTB 3A6ZA 1LS1A 3FUUA 1CR4A 5AUPB 3B1ZA 4WD3A 2L82A 4ZHQA 1TGVA 2IZ7A 2YVUA 3GDOA 3Q5GA 2CUZA 2I1VB 3K6JA 3FCOA 4JWKA 1U7WA 2FQWA 3LHSA 2RI6A 4IH9A 4P98A 1DXYA 4R8SA 3RTGA 4N3BA 1QF9A 3OE4A 1QCYA 5IEJA 1EKXA 1YGPA 2OWEA 2BFBA 2VSQA 5HZKA 3CH5A 4PYLA 5HM6A 4RKRA 2WHQA 1I4DD 4E5KA 1W5TA 1BZYA 4C9BA 4ZCQA 5I9MA 1MP0A 2CBXA 1V2GA 5J2TB 2QPTA 4CJXA 3PC7A 4A6PA 1US8B 4EKEA 1ZHOA 4RD6A 4AECA 1F4VA 1OSNA 1SKYB 4LKRA 1ZMRA 2P4UA 4ZOLA 5KMGA 5KNDD 4QULA 2RKBA 4WFKA 1RJDA 4J4TA 2EFEB 2Z9BA 3BERA 3RVQA 3BMOA 4BJ1A 2FQQA 3Q2OA 3FN4A 4MV5A 2XCQA 2DPMA 1B93A 1UPXA 4PHTA 3CBGA 5EE5B 2OXTA 3D6UA 1J20A 1GOTA 1X77A 2Z08A 4JVSB 2I6GA 5LVAA 4NPAA 1T9BA 1FP2A 1CLEA 1JU4A 2Q2OA 3AVWA 1NW5A 3FOFC 4FYMA 2OHIA 1W1IA 4WLUA 2C2XA 2Z4RA 3RODA 4JQOA 1U2GA 3FBTA 3Q6NA 4OP3A 4B3TB 3RFFA 5B3LA 1AGYA 2EEZA 1QH0A 1Y4AE 3VH2A 4IXNA 5L3RA 5I9LA 3DVAB 1E3SA 3OX4A 4S3MA 4HVLA 5B7PA 1QIDA 4LJLA 1Q57A 3RIXA 4FX2A 1B6SA 4KRYA 3LQRA 5EWJA 1WF3A 5IYZA 5ENDA 1RXIA 1KVRA 4DMCA 5CAEB 4EUNA 1GQSA 3K2EA 1RRVA 3TL3A 4CKEB 3MS4A 3TLKA 1AKMA 1HQYE 1UOOA 1PJCA 2FY8A 4Q05A 2VJMA 5DU2A 4FM9A 3JZFA 1O77A 3DNMA 1I6LA 2V9PA 3I6ZA 1P9WA 5TB5A 4CPDA 1K8QA 2OBBA 4E4RA 4BU1A 3FDFA 4M9QA 1YNSA 3EA4A 4ZKEA 1NXXA 1K63A 2FPPA 1L7NA 3GELA 3VR4H 4Q7QA 3AEYA 4FFNA 2R65A 3JD4A 4KTTE 3ZHXA 1E6CA 1KMHB 3N39C 3TB6A 5CG2A 5E0KB 2FEKA 3HXPA 1Y3CE 3EG9A 2BCGY 2EARA 4KXFB 4XGKA 4ZAVA 4ABTA 3AEQA 3UMYA 4L5AA 1ZUNA 4ZYYA 4EATA 3JAWA 1Z5WA 2GBFA 2RFLA 4ASUD 2OYCA 1A1VA 2HV8A 4XGIA 5IAAA 1E62A 5KNLA 1Y7HA 4GX1A 5BNZA 5LXTF 1V11B 2FFHA 2Q62A 3DKKA 1C30B 2BN4A 2H0QA 2OYSA 2OFXA 1XVVA 1M6HA 2QTLA 2PSJA 2XYPA 1ZC3A 2QRVA 4JELA 4LBYA 4KXVA 4EDFA 3SSNA 4NCJA 1XL0A 5ALWA 2PJUA 3A4NA 2QLLA 5JPCA 4OREX 1GU7A 5LZ8A 2ZUFA 2XRMA 3K4HA 3DLAA 1SELA 4KDFA 5BN4A 4W4TA 2FW7A 1R4MB 1NE2A 2HT6A 4H1HA 1RI4A 2PBLA 2DBRA 2YW2A 1Z0FA 4J03A 4NCHA 4Z86A 3AUKA 5G53C 2NAFA 3UJ8A 4HATA 4MRSA 3WZMA 2ZATA 4K9DA 4NBSA 4DLVA 4RULA 5DKFA 2X1VA 3SX0A 3LVFO 3MLBA 3VTKA 1BJRE 1YDHA 3CRZA 3Q3CA 4PSCA 1MN6A 5I9TA 3UWOA 3B48A 5JG7A 2GEDA 3KEQA 2H06A 2WP8J 3PU6A 1JFTA 4UHJA 5HIJA 3V80A 1CZNA 1P7ZA 2GSWA 2YWDA 3BWBA 4JP3A 1YR3A 2Q3LA 2BTQA 3N3BC 4HDKA 1J5XA 5EUMA 1KFKB 1BC5A 1V39A 4G65A 4NENA 5EKDA 3T8YA 4YQZA 3VH1A 4RA9B 1CEEA 1TL7C 1A69A 2HJSA 2SKEA 3B2EA 3GEGA 1NFQA 3CZPA 5K8VA 2IKQA 3T3OA 1DLIA 4MLZA 2ZSFA 1NLUA 2RGDA 4MS4A 4PFSA 4FGUA 3VPGA 2ZAYA 1MX5A 2HA6A 3OIVA 3RE1A 1TZMA 3QKIA 1OXXK 5B7GA 4RK5A 5EWLA 2AB0A 3EQ9A 4F2DA 1UOPA 2QL9A 2ZIFA 4GPIB 3NRJA 2OUKA 4RXUA 3WGJA 3L4BA 4MR8A 4ARZB 3G1UA 4CLRB 1FS4A 2FMIA 3U4IA 4NZYA 1IM8A 1JFVA 1HDXA 2TMKA 2X8JA 2OR3A 3SSOA 3HCWA 3UHFA 4B3RB 4L3VA 2P2DA 5EE3A 3H1BA 3O7MA 1JQLB 4JI1B 2ADOA 1N2EA 3BH0A 3E3MA 3G85A 5CT6A 1JG1A 4L73A 3ZDXB 3MIZA 2GPYA 3VHXA 4N0QA 3HR7A 4NU8X 4W99A 2Q3BA 5EIEA 3CW8X 1TD1A 1LI4A 4OB7A 2Q3EA 521PA 3JQGA 3DCNA 3JARB 1S8FA 2HJGA 4IV0A 4OXKA 1W76A 5CX1B 4ESOA 1GITA 2Q4BA 3U3MA 3ZX5A 3LF2A 4EW3A 3DC7A 3MTDA 2Y99A 3CH7A 3CXRA 4M9ZA 1P5RA 2OENG 3DOJA 4IGFA 5E7QA 3UMCA 3ZWQA 3N2EA 5IXJA 3ED1A 3HM9A 1JG7A 5HZGA 1ISIA 3CISA 2HA7A 3NHZA 2ONCA 5HFNA 2J32A 1ZSYA 1Y8AA 1PZFA 2XCLA 3PQFA 1R8QA 3LC7O 4D43A 5H5JA 1C7IA 1RAEA 3Q6MA 4CI9A 2IU3A 3OPYA 4UVEA 4ZOLB 3GCZA 3WQQA 4F86A 4PVCA 1NBMD 2PXXA 4UE3S 2C1ZA 1W85A 2R44A 4LISA 4NBWA 1IEWA 1EFRA 4UXHA 2FUG1 4WL0A 1WNFA 1AK1A 4BBJA 1IIBA 3EZYA 1JFFB 1FUEA 1QIGA 1T9CA 1Y3AA 3K71B 4EJ6A 3KYDB 4RGBA 2GBLC 1YFKA 2AI3A 3T12A 4PSKA 3W34A 2ZI4A 4O63O 1X9HA 1IOWA 4OVKA 2QR3A 7GPBA 2O50A 5ALVA 2IHTA 4YAEA 2X42A 4YN3A 2HLNA 2ZVQX 1DDOA 4HN2A 2QG9A 1SZCA 4NYIQ 3U26A 2O8DA 4LZAA 2C4UA 3UGKA 4CGZA 2NQ2C 1RBYA 1U0TA 1Y34E 2G5GX 2AZMA 3DVAA 4UPDA 3SKXA 4BB5A 4EHFA 2CFIA 4N5IX 3QVUA 1JYEA 3COJA 4J16C 1L5HB 3D1LA 3DMGA 3PT5A 5CB4B 3TQFA 3L0ZA 4WACA 3L8YA 2GCIA 5CEJA 2FN9A 3L6DA 5ESDA 2NTNA 2GZSA 1EWVA 3K0AB 4ND8B 4OJTA 5I7EA 2AQIA 5DX0A 3NH9A 1FSFA 1SFRA 4BZZA 4HKTA 2GJ9A 3VC3A 1EWQA 1CUXA 3A8TA 1IONA 4P5PA 5H70A 2BGWA 1SUBA 4FSDA 3GV0A 4MPPA 3HA2A 1T13A 2E9SA 4PC2A 3UB3A 3TR0A 4EYOA 4DB2A 3ELBA 3HEBA 5THQA 3OLXA 3HXTA 3OZBA 4BNWA 1CD5A 1A9PA 4IHQA 1Z4JA 3USCS 3M5CA 1O4WA 4LZZA 1L7XA 2LPMA 1FOEB 2NX2A 2FJUA 4L7QA 1XCPA 4P92A 3UCFA 3UFBA 3W1VA 5J23A 2R9VA 2PYZA 3QBVA 1ZM7A 5GJWC 4ZZ0A 2AFIA 3FCEA 3VA7A 1QIMA 1VIAA 3ZIAD 4ER5A 3AEKB 3OTOB 4U9IS 1Q21A 4ZRDA 2OK8A 2DBZA 2PSHA 3UEOA 5BQFA 2B7LA 4XM0A 4EUHA 4PNPA 2HFJA 4GHWA 4XYMA 2UU9B 3G2PA 4C7OA 3C8HA 4EZIA 4ZYLA 2DM6A 5FOVA 5E1OA 2C8VA 2RMKA 3JATB 3NP9A 4H7DA 1T6NA 5IANA 5F1KA 1NNSA 4IDNA 5TGZA 3FTPA 4DBZA 2F9LA 5JU6A 1IXKA 3PNBA 2R6CA 4RUKA 3KL2A 4XDYA 5DWDA 5IASA 1P0CA 2H65A 2EBUA 3RADC 2CCJA 2Q4TA 3R3XA 5HKKD 4P53A 4RANA 4C2AA 4IRXA 4DQXA 3QVWA 1BN6A 5ICSA 4WCFB 1JWLA 4YDHB 5K51A 3WB0A 4FKMA 4LQCA 4L0DA 1K06A 3D8BA 5IJWA 3I23A 4QPCA 4NENB 3TQHA 1G7SA 1PK9A 3KOMA 4YLYA 5HX7A 5EHGA 1NPYA 2O8NA 3UICA 1P31A 1JB9A 2WTBA 3FFXA 2P6OA 3B9PA 4X20A 5A9SA 4HXYA 4ZJYA 4KAFA 1HT3A 3MOGA 3NIWA 3C74A 2Q5EA 4CHTA 5AJVB 4IS2A 1O0SA 1LV7A 3GWGA 3V7UA 4HZIA 3MCVA 1K3UB 1HMYA 4FHZA 1LY1A 1E79A 4AUNA 4K9LA 5JQGF 4I4TF 3GB9A 3MTGA 1MJGA 2QN8A 3FMFA 4MR8B 5AK3A 5H68A 3RJMA 3G17A 1KH1A 1KHHA 1PSZA 3R2JA 2GNOA 3EQ8A 1CX9B 3VTFA 3KU4A 4AF8A 4BB6A 2X3FA 2GO1A 3VZSA 3DOOA 3E81A 1ZIXA 3P0HA 4KPFC 1HLPA 3VHXB 3G2LA 2GERA 2B34A 1VRVA 3M2PA 3MAJA 4I50B 1T2FA 5HBGA 3SQNA 4TS4A 2JEZA 1YFZA 2XXJA 1E9DA 1FRFS 4H3VA 3OQNA 1I7QB 1M5RA 2RJNA 2OY0A 2ZSAA 3TXYA 3U6BA 3EZ9A 4BMNA 1G0OA 3UCXA 3K9FC 3K6SA 3RM3A 2SECE 4XJVA 1XHEA 4AW9A 3A27A 3ITNA 3HSSA 4OSEA 4AP9A 4F4CA 3QPBA 2R00A 4TYPA 2NVUA 4IPTA 2F1OA 4QD3A 4EG4A 1CZOA 1GV0A 3OCCA 3IIJA 2V4MA 3IIEA 4Q1CA 4FR2A 1KNXA 1ZD2P 1DZIA 2V7GA 4PE5B 2R97A 3ZTTA 5IDXA 2GLXA 1R15A 2OXRA 2NZVG 1SD1A 3VDXA 2Q6KA 1DWPA 5ER9A 4V2IA 3AK4A 3KR0A 3D3NA 3B6MA 3ONWA 1Y48E 2H2WA 4Q16A 1CULC 5E3HA 4F5WA 3T06B 4JLOA 4F92B 4EJMA 1M34A 1PX0A 2Y6UA 3QV1A 3T7RA 4ARBA 2DTXA 2OSVA 3KYDA 3WE7A 2O3TA 1EBBA 1UXOA 2D5IA 2HH9A 3B9BA 2G08A 1WR8A 1NONA 4MW4A 3EGEA 1M9NA 4TPKA 4MMYB 4TXJA 3JQPA 2V7VA 2PKQP 3UYKA 4OUKX 4UHHA 4ALKA 4ZYXA 4QXMA 4MIEA 2OORC 3OQMA 3L40A 3RU7A 3II6X 2C3PA 2XNDD 4HS9A 3ZV6A 1E1KA 2FK7A 3GLVA 1F20A 2ZWMA 3JQ6A 1M3SA 3ILYA 4KSBA 1C9DB 4RLFA 4XDZA 2WF8A 1EK1A 4R7ZA 2KW5A 3FDZA 1YQDA 3HKCA 4NARA 5AK5A 1RM4A 1R5NA 5CXQA 1E3WB 2Q5FA 4MI6A 2HBZA 3OQJA 2LRHA 3KR2A 2RC6A 4QOFA 2HREA 4CM9D 1CG6A 4OHOA 5A9TA 1II9A 2GAIA 1R6TA 4W8HA 4DJ5X 3GW8A 5TGTA 3KOXA 2J8ZA 3U3KA 2YR0A 4HQOA 4AQDA 1AQNA 2F64A 1U3TA 1EFTA 1XLUA 3BWCA 2G82A 1PT7A 3OFKA 1GCIA 1SRQA 3OEEA 2AS0A 2EWVA 1QFYA 2G9RA 1KZHA 2G5CA 2WU1A 1VSUA 3QLVC 2FWJA 3KZVA 1M1UA 4JJ8A 4KBGA 1AKTA 2XBLA 4MW5A 4RQBA 4RZIA 4S1NA 3HCPA 4TROA 1G4AE 1L1QA 2GCEA 4AZTA 4BN0A 3P0IA 4UZSA 1JTVA 5EUQB 3Q8LA 2NU6B 2VDUE 2Z6VA 4GMHA 3H2GA 5J2UB 3ZKAA 3QJGA 1Z0JA 4CL8A 3DV0A 1N8TA 3GZNB 1LPAB 3Q7RA 4RLQA 4E46A 2I71A 2ALJA 3SJAA 1Z8NA 2P2CA 3I39X 5EP2A 5EKTA 2CW5A 2E5FA 3DZBA 3TE7A 4DAEA 3D31A 1Z5NA 5JR3A 5IEBA 1B6TA 1XQ1A 4AY4A 4KHPB 4KFSA 2JPDA 3N8GA 1UJ6A 1YK0A 3PD0A 3K1AA 4NJOA 5CCBA 3K9QO 1X2BA 3VH3A 3ZVLA 4NP6A 5L45A 3C24A 2OVBA 3FIJA 1VKRA 3PDJA 4I3FA 1I3OA 4CLDA 1VL5A 3GN2A 1QHFA 1QGED 3GAFA 4RM3A 3A7DA 3GN1A 4ZQCB 3T54A 8LDHA 1IDN1 1BXZA 1TM2A 2FFJA 2FK8A 2C61A 2FEMA 2G1KA 4QU0A 3SBOA 2GVZC 4MI3A 3UQZA 1C3EA 3DEZA 3PS9A 3HV2A 2W0MA 1BMFA 721PA 4MSUA 3WRXA 4H7HA 4AKHA 1A7AA 2EZTA 2XT9A 2HPVA 2VUSA 1GA6A 5GWXA 4WQMA 1AV7A 3C3WA 3JQ7B 1N7GA 4HK4A 4MQMA 2FUG6 4LZLA 2ZBQA 1OWMA 4OKNA 3KQNA 2YN4A 1WSAA 4L6AA 2PEYA 3K1TA 4HAVA 1ONOA 3VR3D 3AY0A 1USUA 2P4QA 5UKDA 3UAVA 5FWDA 5HKLA 4Y2HA 2P2YA 3A4VA 5BVHB 1PEDA 4CLOA 4RFVA 3T1VA 2BGJA 4D3DA 3ENKA 2B1GA 4BMYA 1SA0A 3ZWBA 2JA2A 2FF7A 3D7LA 4IINA 4IY1A 3U3OA 1R7RA 2PUBA 2C96A 4X7RA 2EL7A 4CG0A 2AEFA 4BQFA 1KP2A 4BNXA 1WBDA 2XRYA 1YS6A 3RSHA 2R5WA 1IB0A 1Q1QA 2OXCA 2YDYA 3BFKA 1RWQA 1NJGA 4F8YA 2G07A 2DHCA 2QL5A 4HY3A 4MO2A 3C8ZA 1J70A 4K6GA 4PYNA 2G8NA 3IIIA 4KAJA 4D8UA 4ZO9A 4EVRA 2R2AA 2VZ9A 4EWLA 3O8CA 5JXIA 1F3LA 2SICE 1XMSA 3CPHA 1H9AA 3THWA 1OT5A 4MPJA 4BB9A 2WD7A 3I5XA 4PG6A 1GD1O 2X8WA 3EIHA 3G7NA 3I9OA 1BCRB 1TYDE 2ENUA 4YCBA 3H18A 1QDEA 1KP9A 1LSOA 1UODA 1VLJA 5FNVF 1Y7IA 5BQXA 1X7WB 3WI7A 2DUJA 1E2BA 4D98A 4M0MA 1GQQA 2ZJ8A 5BR8B 3KEFA 1QHSA 3I9JA 5HCNA 1YJ5A 3OQIA 3LYUA 3OPVA 2B8JA 1YS4A 4ILEA 3SNKA 1I30A 4LY6A 4X0EA 1M73E 3QU7A 3W5SA 8OHMA 2O8CB 9ATCA 5ALSA 1G3RA 3QM1A 2C07A 1Y6FA 3ENZA 4C7XA 2WYHA 1YDEA 3GRPA 3UJBA 6REQB 3TTXA 1B42A 3MAGA 4CT4B 4P4SB 5ESXA 4LSWA 4D9FA 1Z5GA 4BN5A 2OPBA 2W2KB 3OOJA 3AVYA 3EARA 1BGVA 2IOQA 1RBQA 4G0QA 2ZRBA 5IXSA 4NEGA 1MD9A 2ZIEA 3WLQA 3VJLA 5J2TA 5C1IA 5LNK1 3H4VA 1C0PA 1Y3HA 4RPKA 5CK4A 1CF2O 2OBXA 3DG9A 4YMHA 2HHAA 1Q6ZA 5G40A 1ZL2A 4DJJA 2AV6A 3OCYA 3UKDA 3MFYA 4FBMA 1SZDA 2GDZA 1QG2A 5DXAA 1DKLA 2VYVD 3BIOA 3RIYA 4E5NA 2E6KA 4U7JA 3AUSA 2FMXA 2RGNC 2XB6A 2OZPA 4DIOA 1WSWA 1BXKA 4WFQA 2QLMA 2Q21A 4FC6A 4Y98A 3NZEA 3JTEA 3Q87B 1F8FA 2XOXA 4KGDA 1NMEA 5EE9A 3KJNA 3TZCA 4YCCA 4IJKA 4CKWA 1VL2A 3HWSA 3TAXA 2IX3A 5C34B 1JG6A 3C5WP 3OAAA 5AI9A 1VE1A 3EDYA 2RHCA 3BM5A 4IQ8A 3V9AA 1QDUA 4PX9A 2GAJA 5A3RA 3IPYA 1N6RA 3D0KA 4UEKA 1GDHA 2O3JA 4FZRA 4QGSA 1XRNA 1CJVC 4CE6A 1IHPA 4V0MA 3CTMA 5TQJA 3WLKX 4HADA 4RV5A 2JGRA 1IN6A 4EG3A 1JKMA 3WLEA 1T8UA 3I5YA 5F12A 3TR6A 2Q5CA 5I7UA 3ZD7A 1HFWA 4C88A 1W49A 4FKBA 4A8HA 4UZFA 4PO8A 1G8JA 1YDFA 1SHLA 1CNFA 2GSDA 2NLOA 2ZJZA 3O94A 3ZJ5A 2CDAA 2F67A 2Z30A 3A7EA 5BW8A 1PVOA 2N46A 3AL2A 2D4HA 2VXCA 3IVRA 3NRBA 3RTCA 1YCFA 5D5PA 3IBCA 4NICA 3SQMA 1ZOSA 2DFVA 4G8BA 2E4YA 4H7KA 1II0A 2FSSA 3R41A 4HOYA 3W3ZB 3DZDA 1P5ZB 1CR0A 3P45A 5F33A 5IJXA 5KWSA 3U4MA 2CXRA 1E4YA 2R1ZA 4YMTA 4I1UA 2BHSA 3GHYA 2AW5A 1EM8A 4MGHA 1OXUA 4HDCA 3DDOA 1TT5A 1P7YA 1LW6E 3IP9A 1Q20A 3H99A 4NCIA 3IMFA 4MV7A 2PKEA 3BE8A 5B1YA 1V8BA 3LV8A 2OBMA 1Z12A 3NJ4A 4DAOA 5E9WA 4BPBA 5EXEA 5CEFA 1ZMOA 1M74A 2VHCA 1KKLA 2C78A 4J94A 5I47A 3QEOA 3T3GA 4D74A 4B3BA 4DSTA 2PGOA 3Q3JB 3GIDA 4GXNA 4KXYA 4MS3A 1GCUA 2A0XA 5C8DA 1ULAA 3R8CA 3Q9UA 4CLOB 5BVHA 2Z5FA 5SZKB 5C8YF 1BA3A 1LZLA 3OSUA 4G1CA 3I30X 4P7BA 2R8YA 4F1KA 3TW0A 2VSFA 1JIKA 4IKPA 5I9BA 4YI3A 3DZKA 1G5IA 4FIDA 4KMOA 1M0SA 2COEA 4IWNA 4BO0A 2Q2VA 1XZPA 4M1YA 1T2NA 1SVUA 3HCRA 1IL0A 1LFDB 3IP7A 3KOZA 1Y1SA 3DXZA 3M9WA 4HJXA 4UASA 4X8HA 5CUQA 1I1NA 3AB7A 2C9ZA 2GN4A 4L8VA 1T9AA 3CEPB 4CLXA 1SCUA 4B6OA 4YXWD 4EECA 4HXEB 4I6GA 4R2MA 5AKJA 5LOVA 3QVVA 4PGAA 1XGKA 2Q9UA 3K96A 1PQUA 2QM0A 2V1XA 1U2DA 3OEHA 3AEUA 4NPCA 1JI0A 1E7RA 3ELYA 4XSGA 5DIZA 4B6GA 5K0CA 3GLUA 3JD0A 4YJ3F 1X42A 5CT8A 5D3ZA 2AJDA 3WX0A 4EI8A 5L3SB 1VL0A 4RESA 3DZJA 2D3TA 3FJYA 4K9PA 4QLOA 5DASA 2FN4A 5GOZA 4KREA 3C4JA 1TI7A 1CC1S 2P9EA 2WHPB 4P3NA 3CSDA 5AW9A 5AWFC 2MSKA 3IQHX 3QPDA 3QWHA 4DXAA 2VT7A 3K16A 4DJTA 4J1SA 5JH7A 4TV8A 2C7PA 4A6XA 4AF7A 4HWOA 1RR6A 2FSFA 4OKIA 2P0YA 2Z2IA 1Q1GA 2X0RA 4BMXA 3DMTC 4HAYA 2TMDA 3AHJA 3PNPA 4MIKA 3M2TA 4MQBA 4XFDA 5JY6A 4ITRC 3RK4A 5IFLA 4J07A 3GLSA 4HGOA 2QZ9A 3BTUA 1KJIA 3KTAA 1YH3A 2C54A 4J1TA 4UHEA 5CVUA 3VYWA 1BJKA 1KYIA 1UBEA 3H9JA 3IQWA 4P4SA 3TGLA 2P5TB 5HF6A 2XXAA 3NVAA 3SVLA 2W2KA 3DAPA 3W04A 3T1HB 4UBOA 4TLBA 1WRBA 3LUCA 3K0HA 5TT1A 1GKLA 2DWPA 1TK9A 5SYMA 2D2VA 4C4TA 2W37A 5AP9A 4B7ZA 5I7FA 5K7SA 1HZJA 1B1CA 1M2VB 4MGEA 3ZIDA 2M6RA 5IVKA 3D6TB 1JDTA 1TVMA 4Q7LA 3T3HA 3T99A 3SIRA 3LA6A 1JHYA 2B1JA 5COAA 1HYHA 1TE2A 2J4DA 1NMYA 1E1LA 4LF4B 4DY4A 4ID3A 3GCXA 3LL4A 1FSPA 3O2QB 4KMMA 3UG7A 2W48A 3VPHA 3GLIA 4U5XA 1GFWA 2NP6A 2GGSA 4RJIA 1XU9A 1PTKA 2R6JA 2ZCVA 3KKLA 3CUKA 2FW0A 4LECA 3V7YA 3OIUA 3ANSA 1OIWA 2F3PA 1E20A 2C97A 2QJOA 2EV9A 2R79A 2XWPA 3NNSA 4O4IA 5K03A 3QEMA 3CWZA 1T5BA 4XYEA 5HE9A 2H1RA 1I9GA 2W8BA 2WAOA 5BURA 1P8JA 3KSAC 3UA3A 5P21A 3X2SA 5BNTA 4WK2B 2BFFB 3TQIA 1E4EB 3LBFA 2XITA 3ZWMA 1JU3A 5CLQA 3VSCA 4BRZA 1FSGA 4E33A 1GXSA 2C31A 3TRJA 4Z1OA 2Q5QA 1P19A 2HU7A 2P2NA 4LYJA 1E2NA 3TJMA 5EJEA 3CNLA 3LECA 1EDOA 3NTVA 4F96A 1FLNA 4Q34A 4CQJA 1TJYA 3P2IA 2F9MA 2BMVA 1GZSA 3MQ4A 3VM6A 2J31A 4HFJA 4C04A 4F9FA 1Z74A 1DO2A 4CL3A 4OBEA 1HEYA 1E1DA 3JQBA 3PC6A 4LI3X 3M81A 3AFMA 4RQAA 4WCFC 3OZ7A 2A6PA 1KH3A 2BFAA 4H4EA 4K86A 1P1HA 1PQYA 4AURA 1VP9A 4EIWA 4GRDA 1J07A 3U44B 5L7WA 3PGA1 4NBVA 2Z57A 5HS6A 9ABPA 1IQRA 2UXBB 1ZC4A 1Y33E 2JFHA 3DO5A 3L8CA 3UA4A 3BZWA 3M3DA 4TMTA 4F71A 5C53B 5B7NA 2ZRLA 4X84A 5A02A 2CHGA 1K0UA 2ID7A 2VBCA 3IOYA 2ZXEA 1BO6A 1IZYA 1NOIA 1QYVA 4A8JA 4AMBA 2CMGA 3SXPA 4E94A 2XGJA 4EF6A 1NXVA 4QM6A 1N3BA 2XHZA 3PT9A 1HM5A 2AEEA 3VGJA 3VAZA 1NQTA 4Z0PA 5EJ9A 1DJQA 4GG1A 1U5BA 5KKAA 1CIJA 1YL5A 4J0KA 4QDJA 4F04A 2HEGA 3H2KA 4BMVA 2ZK7A 3G8DA 4K0RA 1Y3FE 5KSYA 1BQEA 1IZZA 1IBSA 2E48A 3M33A 3OCUA 4L15A 4O3FA 1FDUA 3DW1X 1U2SA 4LMRA 4RZSA 3IRVA 1SO8A 2FOLA 2XODA 4JT2A 1NKSA 1JQEA 1QFSA 4MS3B 3N6XA 4D56A 3MB8A 1C1YA 2DBVO 4DN6A 5KI6A 2Y0PA 4AM8A 4LY3A 4NK4A 1XR3A 2PS0A 2V8BA 1R74A 2Z2JA 5AKHA 1Z2PX 2BLLA 2R6HA 2G1JA 4MVJE 2A33A 3FR7A 4US2R 2ZVJA 3RCBA 2I91A 3VKGA 1YL6A 4QNMA 2ZZKA 5LZ2A 2Y0DA 4BFSA 2Z3WA 4IFEA 3TD6A 1F8XA 1WZEA 1SBNE 1SQSA 2ZRFA 1DKRA 3BJEA 4R5MA 2I67A 4V0RA 3RABA 2DKNA 2ONJA 1QPBA 4WEQA 2ODWA 2B4TO 1BKDR 1CW2B 1RYDA 2BJWA 2OO7A 3A6JA 3G8YA 4HUJA 4J2TA 4LJ7A 1L4GA 3A6FA 3C2QA 3CSUA 2C8KA 4LFCB 1JJFA 1DAEA 4BNVA 5DRTA 1UBTS 1AKRA 3BWDD 1QF6A 1KI7A 2ZJAA 2B82A 3L6BA 1OOEA 3D4LA 1W47A 2Q0QA 3WFZA 2OV6A 3MA0A 2EKDA 3H5RA 1RBMA 1KEUA 2QN9A 3NHJA 4G86A 3SXUB 2B30A 2X1LA 1WPXA 3DT6A 3X2EA 1DDIA 1LRJA 5A3QA 5EZYB 5HG0A 3WFJA 4YRBA 2BWJA 3IVGA 1YCHA 5EXTA 2XOEA 4KW7A 3CO0S 1X80B 2ERYA 3NEPX 4WNAB 4EB8A 4KFCA 4P0QB 3ZCRA 1DAPA 2YFKA 3GAMA 1W6RA 2UZ1A 3IQEA 3OHPA 4XEUA 1S96A 4L57A 5CYGA 3PENA 3DPIA 3TS1A 1NDUA 4TV8B 5CVTA 1Z3CA 8ADHA 3R20A 5FBHA 4NG4A 2X6RA 4ZCRA 4Q93A 3EPPA 4EF4A 1NVKA 1GSAA 4NECA 1KDZA 4DV6B 1B43A 3F8WA 4MGIR 4CF7A 1WKBA 2BEKA 3HWRA 4RPGA 4YJFB 3DE5X 4UHKA 2H6EA 4NV1A 2CL6X 3LIPA 3RARA 1YAHA 4IH4A 4CEJA 3IQDB 1ZQ1A 3C3CA 1C9KA 2VDNB 2Y1KA 1NAHA 3GA7A 3MJRA 4K6OA 4Q4DA 2CF5A 2HK7A 3DTVD 2ZYAA 2IV7A 4QRHA 1RWWA 3CG0A 2JH9A 3PSAA 4CLEA 1S9HA 1EK2A 1PG2A 3I9LA 5F51A 2WIBA 1UPBA 3X1ZA 2C4MA 2HHLA 1WUTA 1BFUA 2OQIA 2JHFA 2P9TA 5IK2A 1MJ5A 4EPRA 1L8AA 2ORYA 2GCOA 1JIVA 2C5FA 3RQSA 3WLPA 4DNFA 1V37A 3CCBA 3I8OA 1IZ0A 3SZOA 3QMMA 1EYZA 4AU1A 1E99A 3FI0A 5CXSA 4K6MA 2PLNA 4Q3AA 1TTQB 3EGCA 4DA7A 2QLNA 1Z6XA 1Z5VA 4KN9S 4QBHA 3Q3HA 3FBGA 4G5GA 3MTJA 4F3KA 4X60A 4YJGA 4C5AA 2QNIA 3UPUA 4R2JA 2HB6A 3OZRA 4L8YA 4Z9AA 2JGEA 1E2UA 1J09A 1SUFA 1U28A 4B76A 4CQLA 3IL2A 3H1AA 3HU3A 4MS1B 3F1KA 4UVDA 2O4UX 1PFQA 4MVJF 1G5QA 2FDXA 2FSGA 1NHWA 3E9MA 4JBXA 2DLDA 4F0JA 4EL0A 2PLAA 5ITZA 5AXDA 1TM7E 1IRIA 4F8JA 3NUZA 1YDGA 3UAOA 4NOMA 1LPSA 1E5XA 1TUBA 4DCGA 4O3MA 4C5CA 4BVEA 2RB5A 2JCBA 4CDRA 2YIVX 2Z1DA 3ZC3A 3LUBA 4WESB 4UPEA 2WVAA 3OZUA 3T1OA 1SKYE 4BFUA 4P6VF 5JXWA 1PLLA 3BHJA 1LTKA 1XK7A 2GZDA 3GMTA 4IF4A 3WV5A 3U09A 2GLTA 1NVAA 2R8ZA 1XMOB 1U7HA 3L82B 4E2XA 5CK5A 1SD2A 2K5UA 2VTDA 1N6KA 4DWJA 2W71A 3K70C 1XZDA 1G21A 4TKUA 4BQSA 1WD7A 2P9YA 4XIYA 4HMPA 3KETA 3QLUC 2JGKA 2I4TA 1WXDA 2FP3A 4H6XA 3CLSC 1WAMA 3N2IA 4FYIA 2F3RA 1T4GA 4O4HB 4U7TB 3T5CA 4MNTA 4OAOA 1MZVA 5CFRA 3ORFA 4XX0B 4LK3A 2PTHA 1MO6A 2VKTA 5AI8A 4C0KA 3LYHA 2P41A 1OLXA 3NTLA 3UJ3X 3AHCA 4IVRA 2O5EA 4UHBA 4NYJR 1V96A 1E4VA 1JDBB 2B3TA 2ZXFA 3BKXA 3I53A 2J30A 1RRCA 1KA9H 3T3EA 1NT2A 2VAXA 4ND1A 3KAQA 5C8YA 1X1RA 4PTZA 3GFRA 3O47A 4GGPA 1MAWA 1SXJA 4V38A 4QTUB 2O8EA 4LWPA 4U2BA 1Q7TA 1KJWA 3SC4A 2CXPA 2IYTA 5G1OA 2AN4A 2ERXA 2PTGA 3VR6D 4EB6B 4NOLA 1EM6A 3WYNA 1JLRA 1XKXA 3VV3A 3T52A 4RIIA 1YASA 3CVOA 3EVFA 1E1CB 1QE3A 1PJ4A 2JFWA 3DE7X 1FNMA 4H4CA 4ILKA 4J3JA 4B34A 4BP3A 4HT3B 2NACA 4LF7B 5A06A 1Z7EA 1H0KA 2BE7A 3A6PC 3LRXA 4YP7A 5TVKA 2ZYGA 4Z3DA 2UZ4A 3TKAA 5BSMA 4OP1A 1ARZA 5IH3A 5KDLA 5IJ0B 2BGKA 2XJ9A 1E0DA 5BN3B 3NHUA 2BMFA 3G02A 5AVTA 5DGXA 4TTSA 3O8OB 1B41A 5IDQA 4L5CA 3SP1A 4YUAA 1XTJA 3VAYA 1NVVQ 5FJIA 5JECA 3D6AA 1XZGA 1H69A 2CB9A 2WBLC 3EFHA 3Q7SA 3G7SA 2JHCA 4QARA 2FAXA 2JIZA 5KTSA 4IV8A 2QZ4A 4RK6A 5IS2A 5JO9A 3LBNA 5BMVA 2QTFA 1U0FA 3DL2A 3IPCA 1V4NA 4IJVA 5AVJA 3NASA 3RS4A 1FX1A 1JKJB 3GGPA 4Q15A 1AUOA 1JQDA 3CH6A 4LZNA 3SOPA 3ND7A 5KJ6A 2RHRA 4EYSA 3UKOA 3ZY5A 1WCV1 1FFHA 3B85A 3EQZA 2YWRA 5FOXA 3OQVA 2BMJA 3ZHSA 5FUVA 3SC3A 3GVCA 1CERA 1JA1A 1QQ7A 5IKPA 4HNAB 3DZIA 3KP1A 3UXYA 3A2MA 3A2KA 2IS1A 2JZOA 3RVSA 3TE6A 5K0LA 1EVJA 4HJRA 5FO1A 3A1DA 4P83A 1M1YE 3MYYA 3KXPA 1P81A 4I2VA 3GDWA 3NANA 4IOKA 4JP1A 3KUKA 2RE8A 4BQPA 1UKYA 3DEFA 4IXDA 3U0VA 1L5RA 1FQKA 2XDYA 5KUTA 1UC8A 2DPGA 1GG2A 3GCWA 3LFTA 1YI0A 3DOEA 3M4ZA 5HIIA 5B57C 3F49S 1SK9A 4L4SA 3EC7A 3FUWA 3IKVA 4FMPA 2UAGA 1QO7A 1YT5A 5KOHB 5F35A 4XWGA 3RAFC 2GLUA 5ECWA 1VMEA 1AS2A 5FUQA 4M89A 2VJYA 3ETHA 2GCOB 2EVWX 2IOHA 3M8KA 2G1PA 5AFSA 1L9KA 3RSFA 1B0UA 1X3SA 4MYUA 1ISRA 1JYSA 2V0CA 3QXXA 4NV0A 4XCQA 1KETA 1Q84A 4Y3UA 4BP8A 1CJMA 4EY5A 3GRRA 4Y0NA 2VQSA 3R4CA 3ZWVA 3N5KA 5LA6A 1QFXA 1FP4B 1G3UA 1SVOA 1ZWLA 4KO4S 5HMLA 1F2UB 2X5NA 4DQLA 5FB3A 4EPWA 3UV3A 4WEOA 1XRMA 4F21A 1A9XB 4CKYA 2EP5A 2OBFA 2OCDA 2VUIB 1N2CA 4RHXA 3VX4A 3QFFA 2OCKA 2XMZA 3TW6A 5C8ZA 4HZGA 1O9HA 5LZ5A 2PA3A 4PBSA 1M1YA 2D00A 3O4VA 1OXSC 4V03A 4EPVA 1R6BX 5EC8A 2ODAA 2C99A 5ITZB 1P45A 3C6KA 3WISA 4BGEA 2K87A 1XP5A 3DFFA 4FJ0A 3IXQA 3LM8A 4HAZA 2PX3A 3QEAZ 3F71A 1SXPA 1Y6GA 2REXB 3GUVA 4QUIA 4E12A 1BXGB 1Y7TA 4X24A 3ZV4A 4LBZA 1AKVA 2GJSA 3LUHA 1FDVA 1GUBA 2BM1A 3WK7A 2FYTA 4CIYA 2CNBA 5HM8A 1JEYA 4PQRA 4BPRA 4YRMA 2XUKA 5GM2A 3FYCA 4XQEA 3ICCA 4RD4A 3CVVA 1PR6A 5LMUB 5JROA 1QRAA 4RTKA 3OY7A 1NJSA 2AX3A 3MINA 4GZMA 1TCAA 3VISA 1QK5A 3KM0A 2G25A 3EZFA 1L5YA 2IXTA 3D8NA 5KYVA 1ETUA 1ECJA 1AKEA 4TV9F 1PNVA 4H6VA 1LX7A 3I83A 3M6AA 1K7FB 3DVSX 4L8FA 3RSCA 4HL6A 2P1ZA 4FTWA 1FTYA 4XQCA 3RIMA 3TEFA 3VO9A 1H8HD 4IGIA 1FCJA 3ZE1B 5G0UA 3RVOA 3EXAA 4IRUB 5G1PA 4LXIA 8MHTA 2Y0BA 1GPWB 4B2PA 4RV9A 3CLTD 2Q5IA 1RMYA 3HN6A 2ZI5A 4U6NA 1AA6A 1XTTA 1W4ZA 3VUEA 1ZUIA 1L6RA 1GCGA 1NN3A 1EAMA 2RI0A 2ZDHA 3AG6A 3EDRA 4QIHA 2FWRA 4MVCA 3EEQA 3K9CA 2P5YA 3BQNB 3F6EX 2I03A 3OT1B 3LDGA 4TV9B 1E6LA 3F6BX 4Z7JA 2ZM6B 1FMTA 2HCFA 4H18A 4YH1A 1E1CA 2IZ0A 4N5MA 2H59A 5ALIA 3VV2A 4BN4A 3RIHA 1ZK1A 2ZJYA 3NHAA 2A86A 4LOKA 3T9CA 4DIBA 4EUFA 5A3SA 1DXHA 4E1AA 1ZFNA 2PU5A 1EG2A 2QLBA 4EFLA 3R3SA 3AP1A 3FKSD 4G5YA 5K0GA 1HZZC 3U4CA 1A2QA 2JGLA 4TSKA 4FE4A 4B7UA 1HZZA 4OYRA 2F4NA 2CL7X 3ETDA 3WQBA 4XWOA 3NMUF 1EDZA 5T6MA 5EMJA 5BN3A 1VMDA 3N7AA 1YFJA 1Q0LA 2G77B 3B9QA 1XBTA 2J9FA 4MRVA 3X3HA 2OB1A 3UK1A 3DQZA 3EXEB 821PA 5JZMA 1LLUA 4B09A 5JARA 2ZRAA 1OLUA 3KAPA 4JGBA 1NRJB 3J7AC 3K3PA 4V0LA 3DUFA 3LY7A 3DBHB 5BSGA 3DAHA 1LPMA 4M86A 3RREA 5A6VA 4NCBA 4ZYZA 1NR7A 4KK3A 3GJXC 1RYEA 1T5HX 2P9ZA 1MUUA 4LRQA 1V8DA 3ELUA 3D1JA 2IHUA 4MAAA 1TYAE 2ZEJA 2JGNA 4PLYA 4LF9B 4PQFA 4YCAA 4OX9B 1JR3A 2XMCA 2A30A 2P7IA 4BUJA 1OASA 1X8JA 1Y81A 2OGUA 4JITA 3O8BA 4YECA 5CU7A 1EB9A 4XWAA 4BV2A 3DEJA 1SUPA 1DQSA 4HZUB 4EJFA 1N2ZA 2DTEA 2EL9A 2UYHA 4N7MA 1MPXA 3WHIA 1UBKS 5LQKA 1WEHA 4BIIA 5AI5A 4EKIA 4HNAA 4C4PA 3MK31 1DC8A 3A9RA 1Q74A 2I66A 4UUAA 1E0JA 2FMHA 2R1VA 4ESHA 3JQ8B 4ZEVA 3ICEA 1EGHA 2BE9A 2VWPA 1ZM3A 2WG0A 5JH7F 1JLKA 3IUEA 4LCJA 1D03A 3TLCA 4EGAA 1TCVA 2ZRHA 4FEYA 1DT5A 1T34A 4KYVA 4NWIA