4F06A

Crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
368
structure length
368
Chain Sequence
DTIKVGVIGTMSGPYALFGKNYKMGIDAWVAEHGNKVAGHTVEFVYRDEVSPNPAQSKALAQELIVKEKVQYLAGLYFTPNAMAVAPLLQEAKVPMVVMNAATSSITEKSPYIVRTSFTMFQNTVPAAKVAKQKGATKVAIAVSDYGPGIDAETAFKKTFEAEGGKVVEAVRMPLSTTDFGPIMQRIKNSGADMIFTFLPAGPPTLGFVKAYIDNGLKAGGVKLMSTGDVVTEPDLPNIGEAGLGILSTYHYAVSHDSPENKAFLALLQKGGAKLDEVTMTSVAAYDGARLIYKMIEATSGKSDPDKAIAAVKGMKWVSPRGEVSIDPETRHITQNVYLREVEKVDGKLINRELETFKAQPDWGLAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular ligand-binding receptor
publication title Characterization of transport proteins for aromatic compounds derived from lignin: benzoate derivative binding proteins.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transport protein
total genus 130
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f06A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f06A01
1JX6A 2IDMA 3Q7RA 3T38A 3HVRA 1BA2A 4YP9A 5HSGA 1GLGA 1TVMA 4OLBA 1FSPA 1YK1A 3TO5A 5CHYA 4MS3B 2LIVA 4EUKA 4YLEA 4JB2A 3C6QA 3M9WA 4WXMA 3RVQA 4MGEA 3RVOA 1MIHA 3E3MA 3N75A 4QYWA 4S05A 3RVLA 1KMIY 4HNQA 4EVRA 3EQ2A 4YR7A 1QP7A 1A04A 3TD9A 1VLZA 1RPJA 3LTEA 4RK6A 1MAVA 1FFGA 4OLAA 5FWYB 2HPHA 4O1IA 1I3CA 1Z2DA 5DTEA 3HV2A 1DCMA 2FN9A 3OMXA 2PL1A 1JYEA 5IUKC 1DBQA 2A9PA 1H9CA 1MB3A 1DCKA 5FBKA 4IMIB 2A9OA 1NXSA 4MS1A 3HDGA 2PUCA 2IPNA 3KJXA 4HYEA 3Q41A 4IILA 4TLMB 3NNSA 2RDMA 1BAPA 1U0SY 3GBVA 5TQ0A 3TMYA 2FEPA 1ZESA 4KREA 3GRCA 2FMKA 3MMNA 1LJLA 3IP9A 5TQ2A 3DLHA 3QLVA 4YCSA 2LP4Y 3LKBA 1NXTA 1NY5A 3CFYA 2BGGA 4MQFA 5C5EA 3F6CA 5JS1A 1QO0D 2O20A 1GUDA 3BRSA 3DGEC 3QELB 5GQSA 2JCGA 4RY0A 4N0QA 2B4AA 1U2QA 1PHRA 5KQLA 3Q9SA 1LK0A 1BDJA 2JK1A 3LUJA 1XWWA 3LKVA 4N76A 3SM9A 1ZY2A 2TMYA 5EWLA 4QICA 9ABPA 1QKKA 5TQ2B 3CG0A 5IC5A 2NZVG 3O2SB 1NXPA 5BR1A 2PE5A 3HUUA 4E7OA 3EODA 2PUBA 2PUFA 4MR8B 4MQFB 3OQMA 4L85A 4D6XA 3OLWA 1D4ZA 2E4XA 3BBLA 1EWVA 1GCGA 3A3KA 1FFWA 2M98A 4IGAA 2V0NA 3CG4A 3LUDA 4O1HA 1JFVA 2MYPA 2ZAYA 4MR9A 4RK4A 3OQNA 2PUAA 3DLBA 5TE9A 3HZHA 3RH0A 2IKSA 4GNRA 2JRLA 2ID7A 4FE7A 4ZMSA 1L5ZA 1USIA 3MIZA 4DQDA 4MS4B 5B3JC 3DZDA 3KKEA 3LFTA 3MM4A 1S8NA 2LPMA 4PE5B 1M2EA 2LBPA 3P9YA 2PLNA 4G0OA 3O74A 5EWJA 4OATA 1F51E 3IPAA 1RZRD 5DKFA 4KK4A 1QQBA 3NHMA 2QVCA 1L5YA 4YV7A 5JNVA 3IP6A 3RVJA 5C5CA 1FFSA 2CHFA 3FFTA 4LDZA 4WT7A 1OXKB 1ZHHA 3K4HA 4Q6BA 2KYRA 5I4CA 3Q15C 1SXHA 2CD7A 2HQBA 5KQGA 4MR7A 4B09A 3Q7SA 1TM2A 5TQJA 4Z4CA 4JASB 1ISRA 2CWDA 3GL9A 3LUAA 4KK3A 5TPWA 3CHYA 4JB0A 5ED4A 1MVOA 3KS9A 1KGSA 2JVIA 1Z16A 2B1JA 3CTPA 4LRQA 1GUBA 1QMPA 4EYOA 3RVMA 2E4ZA 3HO1A 3A10A 4JAVC 3HSYA 4S04A 1KRXA 1ZITA 3DBIA 5IEJA 3C97A 3F73A 3QEMB 2FTKE 4W5NA 1ISSA 1GCAA 3URMA 1URPA 3LUFA 5KC8A 1CHNA 4KPYA 3EGCA 5TPWB 4RS3A 1SXIA 5GOTA 2FEKA 2MSKA 2R4QA 4OTZA 1ZH2A 5HKOA 3HM9A 2M1ZA 3H6HA 3LUHA 1QP4A 3OO1A 2JBAB 2E4WA 1DRKA 1P6QA 1BDIA 3RVSA 2ZWMA 2GBPA 4NV3A 1JHZA 1ZGZA 3H5LA 2MSLA 1JFSA 3EDCA 2MYNA 2OENG 4G0XA 3RVNA 3GBPA 1WETA 4UHJA 4LDAA 1EFAA 1RZRA 4Z99A 4ETMA 2PUGA 4IRXA 4QPJC 3GT7A 3HCWA 1DC7A 3I45A 3I42A 2RJNA 4HNRA 3H1GA 3EULA 4XAQA 4LE2A 2AYXA 3FMVA 3GA5A 4LZLA 3HUTA 4MRMA 4OBBA 4H3KB 4Z4GA 1P6UA 3QX8A 4YS6A 2PUDA 2IPAB 1T34A 4KMRA 5FWXA 4JP1A 1DZ3A 2H0AA 4ML3A 4G0YA 1NXWA 1MB0A 1RNLA 5CNJA 1USGA 4KV7A 2IOYA 4NCBA 3CZ5A 1DCFA 1PNRA 5KC9A 4RK5A 4CBVA 4RXTA 3S99A 3CLKA 5IULC 2WRZA 2F8SA 2E4VA 2L19A 2GX6A 2QR3A 3I5AA 1DBWA 1JDPA 1M2FA 4PYRA 4G0QA 4G0MA 3JS5A 4RK0A 1Z2EA 1ZGGA 3KYJB 2WB4A 3O1HB 1B00A 3O75A 4H60A 2R25B 6ABPA 1QP0A 4PEVA 2Q5CA 2QXYA 3H1EA 3HS3A 3RVPA 1ZH4A 3NNNA 1E6MA 3KYIB 4F3TA 4RXUA 4YO7A 1D5WA 3KSMA 1OXBB 4Z0NA 4KVFA 3LUGA 5EWMA 2PUEA 2L18A 2HSGA 5DCLA 4MS1B 4F06A 2HQRA 3BREA 2FVYA 1JBEA 5JNSA 2FMIA 4NQRA 4O5AA 5JS2A 4RXMA 3MQ4A 5TQ0B 3RQIA 1NXVA 1YS6A 4MLDA 4YRZA 2LUOA 5JNUA 3CNBA 2PKXA 2FMHA 3QLUC 1NATA 3KLNA 1F4VA 2X7XA 3M9XA 4G86A 4F11A 1CYEA 4RU1A 1D1PA 5T3YA 5CNIA 1P8AA 1SD5A 1JL3A 7ABPA 5DLEA 2FKAA 4N47A 3SQNA 1QQAA 4N03A 4XLTA 4W5QA 3BRQA 4ETIA 4RK7A 3H5OA 4DADA 1CEYA 3LMKA 4MPTA 1Z18A 5EWLB 4F12A 3HDVA 4JA2A 4Q7EA 4XXHA 1EAYA 1E6LA 1EWTA 3BILA 3I09A 3FFWA 3A0RB 3NHZA 5BRJA 5KWSA 2QV0A 3IP5A 4JOQA 3OM1A 5KQPA 3MYYA 4ZMRA 1APBA 4RY8A 4ZYLA 4D74A 3HEBA 5D2CA 4RSMA 1XHFA 1SRRA 3NBMA 4TN5A 4PICA 1ABEA 4TLLB 4YWHA 5IEBA 2NT3A 2WWVD 3UUGA 1Z12A 1C4WA 4EYGA 4Q6WA 4MR9B 1Z13A 4ZPJA 4F8JA 5IBQA 2GWRA 4NICA 2AYZA 5CNMA 3QK7A 3SG0A 3G85A 3HXMA 2RJOA 5DGCA 4E7PA 3H5VA 4EGSA 2JB9A 5TPZD 3TX6A 1VKRA 2DRIA 2P9HA 2L2QA 2VUHB 3KLOA 4WXEA 2R48A 5EWJB 4EYQA 5ABPA 4P1ZA 1ZAYA 4MQEA 1K66A 2FSPA 3H5TA 5IUJC 4RV5A 1NTRA 2MYUA 1E6KA 4D6YA 3N8IA 5IUNC 3FGZA 2VUIB 4M88A 2FXIA 4XFKA 3SNKA 5E3JA 3VNAA 4W5OA 3N6VA 2W42A 2MYTA 1J56A 3K9CA 3JVIA 5KQMA 3CRNA 5JNRA 4MR7B 3T95A 1YMVA 2YHBA 3QLVC 3LUCA 3Q7TA 4MLCA 2VK2A 2QVGA 1KRWA 3E61A 1YS7A 1USKA 2PL9A 1Y1LA 3RVRA 1ZVVA 5JNWA 1VPWA 4XASA 1U8TA 2PJUA 4WZZA 2JVJA 3JTEA 4RWEA 2OQRA 2F8TA 2XDYA 1IIBA 3O2QB 2PMCA 1PEYA 4RY9A 4MS3A 4YGXB 1JWLA 1BDHA 4HNSA 1PUXA 3C3WA 3N53A 1SXGA 2WJWA 3JPWA 1P2FA 4W5TA 1ABFA 4N41A 3UK0A 1PNTA 2E4YA 2QSJA 2FMFA 4IF4A 4EVQA 1TLFA 4W5RA 4G0PA 3GWGA 1DBPA 5B3JA 3B2NA 5TPZA 4Z9AA 3OQOA 1Z17A 1YIOA 2J48A 3CU5A 5FWYA 3H6GA 2VYCA 1VRVA 4QYMA 2FQYA 5KI6A 4Z4FA 2MSWA 2NT4A 3CZCA 1JLKA 1W9HA 2GI4A 3W9SA 4IMJB 5BQ3A 2IPMA 3H75A 3OLZA 4EYKA 2GKGA 3H1FA 4MRMB 3JY6A 3JPYA 3OLVA 3SY8A 5T7BA 4UHKA 1DRJA 1HEYA 2FLKA 2WMYA 5FWXB 1ZDMA 4ZJPA 1A0OA 4MAAA 2HJ9A 1JYFA 3T6KA 1EWKA 2A9RA 3FDFA 1DG9A 2P4UA 1PEAA 4DN6A 2ID9A 3M6MD 1DC8A 1JF8A 1RXEA 1XHEA 1YTUA 1YK0A 2QZJA 3QELA 4KZKA 4LE1A 3KTOA 4RKQA 5F64A 3L49A 5IX8A 3JVDA 4KRFA 1DJMA 3QX9A 3IP7A 4RDCA 4H3HB 3O1IC 3DGFC 3EAFA 3IDOA 3MA0A 2FLWA 3C3MA 3D02A 2L17A 4P98A 2CHEA 3O1JC 1QPZA 1U2PA 2NZUG 4RZSA 1Z15A 3QEKA 5EWMB 5JNTA 1C0EA 1TJYA 4MR8A 1NXOA 5BRAA 6CHYA 3KCNA 4RKRA 3SAJA 4Z4HA 5FBHA 2E4UA 1NXXA 1FQWA 1JFTA 1U04A 3D8UA 3IPCA 4LE0A 4XARA 3CKMA 3MF4A 4MYRA 3CS3A 3T8YA 4FB4A 2IPLA 2JVKA 3UKJA 2QU7A 5HM6A 4MS4A 2RGYA 3EJWA 3RVKA 1BVHA 3O21A 1LJUA 8ABPA 3G1WA 3ROFA 2QW1A 3A0UA 2R47A 4OG2A 1AB5A 2I6FA 2FW0A 1A2OA 1ZN2A 2A9QA 3KG2A 3F7NA 3OLXA 1EHCA 1DP4A 4GPAA 4NCAA 1QNLA 4G97A 2WJAA 4FE4A 3O2JA 1E2BA 3H5IA 2N9UA 4RK1A 1TMYA 1LBIA 1K68A 4EY3A 1R8JA 3KHTA 3ILHA 4WWHA 2IYNA 3F6PA 3GYBA 1D1QA 3H5WA 1M5TA 2NUBA 3N0RA 3FFXA 3N0XA 1YMUA 1LBHA 4EVSA 4Z4EA 3VNBA 3L6UA 3QEMA 2YHAA 3ROTA 3QLTA 4N0PA 3R0JA 4KQ9A 2FEWB 4MQEB 1QO0A 4TMYA 3OMWA 4Y9TA 1Z26A 2WY2D 1JDNA 3GV0A 4KQCA 5CNKA 3N0WA 3LUKA 4WUTA 4ETNA 1JH9A 4L4UA 3HK2A 1UDRA 1Z25A 2FQXA 3OO0A 1M5UA 3LOPA 2PAFA 4KFCA 5PNTA 4Z4IA 3QLUA 2HQOA 2JBAA 3EQZA 1AB6A 5HQJA 3TB6A 3HJFA 2H3HA 1W25A 1YVUA 3C3KA 2FN8A 3ILYA 3NNDA 4KNYA 1RXIA 4Z9BA 2FQWA 4LX8A 1D2AA 3OM0A 4PZ0A 3OLYA 4G0ZA
chains in the Genus database with same CATH superfamily
3HU1A 5BUCA 4O2BA 4UVIA 1DT5A 1L7VC 2XT6A 4S0ZA 3OE5A 1LK7A 2HC9A 2OV1A 4WKPA 4EATA 3ZVKA 3LBYA 4RPGA 3MXTA 1GZ5A 1UF9A 1XDWA 2HCTA 2X13A 3NOQA 4H7KA 3MLBA 2PD4A 4CMEA 1C3VA 5E1BA 1SG9A 2NYRA 3P0IA 4EUKA 1GZ6A 4B6PA 2OD2A 4PZEA 2VHVA 2JCBA 3CNNA 3JXEA 3N07A 4ANFA 4Q1VA 1FUKA 2B94A 3PJGA 1R4NA 2FA9A 1J06A 1XTIA 1DX9A 3IODA 3KQTA 4LHYA 3IMGA 4XD7A 3WXMA 1YDGA 4B3FX 3DTNA 1OJLA 1FTGA 2RGWA 3K05A 1U0RA 2F1KA 4HXFB 4QDTA 1NFFA 1C1XB 3IMEA 5C18A 3HYCA 4RESA 2A14A 2VNSA 3BXPA 5ITZA 3FOZA 3LTEA 1T35A 4BZQA 2R8RA 1KSFX 4HAIA 3I64A 2IDJA 1HDIA 3MGBA 1A8HA 2DSTA 2E21A 4OLAA 1C0IA 4ZO9A 4DEYA 5AXCA 3U1BA 2JJ1A 4N8SA 4C4PA 5IBRA 1VCOA 2G71A 4UPDA 2O8VA 4DCNA 2WUFA 1U7OA 2VPXA 3I4CA 2CDRA 4BFZA 1MB3A 2QF7A 4G1BA 2Q45A 3UAZA 5L8VA 2JEZA 1BKDR 1XJQA 2PG3A 1XF1A 3E05A 4OHUA 5AI6A 4A8PA 3K8OE 4NS4A 1RAEA 5DLDA 4B2IA 3FI9A 1MOPA 1SOUA 3EUFA 4JP8A 3N8GA 5K6AC 5A7GA 4IUCS 2OM2A 1A9XB 3W05A 2QLLA 2FZEA 2V1XA 3IP9A 4IWXA 5HCUA 4MQLA 1AQJA 2F9MA 2W6NA 2XVZA 1E1NA 4NNJA 3LKBA 2ABWA 3EGEA 3RARA 1TJ5A 3ZHRA 3P2YA 2HF2A 3OIUA 3VU9A 1N6IA 3TZ6A 3IL2A 2BEUB 2YHSA 4TMXA 5D51S 1GUDA 4AYTA 1K3UB 3UB4A 4N0QA 5G4KA 3QF4B 2DTEA 3RG8A 4NYJR 4AIIA 3ID6C 4PRKA 3K9GA 3NZEA 2FZWA 3DD1A 1QJCA 2POQX 3KPUA 1CCWA 2GA8A 2XNDA 1KBZA 1U1IA 1NUAA 1WD7A 3CMCO 3FRHA 2CHQA 3GJ7A 4O4LB 4L9RA 4OU5A 1IHXA 4Y6RA 5JJCA 1WXFA 3PV0A 1AJEA 3EODA 3T9AA 3UTDA 4TS4A 1KOLA 1Y89A 4I4LA 2RI6A 3CVWA 4DMFA 1TZMA 3QW4B 4KFSA 5CBPA 1EWVA 2O6LA 1CQJA 3ED1A 4JEHA 4HMOA 1FB5A 3GCXA 3ENVA 3N59A 2GM5A 1JLMA 4CNBA 1GTZA 2BMEA 1H4TA 3OQNA 2YTZA 5CIYA 4LJAA 4DLAA 2GN8A 1KE2A 5IJAA 5IYZA 2VJYA 2OVBA 4NL4H 4HB2A 1PL6A 3ADKA 4ZAYA 3NMUF 4XUDA 2VRCA 1NLMA 3U1VA 1MU0A 1RD4A 4FNOA 5MGNA 1G6KA 4KXWA 1JXMA 1DKLA 1TT7A 2X76A 5KSZA 3M5CA 2DQYA 3OFNA 5KUTA 4V39A 2IBSA 2HO5A 5C5CA 1U28A 3AG5A 4LDZA 2FWPA 4MZXA 4HDMB 1IWBB 1O96A 1ONBA 2YWCA 3AZQA 3ZX4A 4C0BA 4ISCA 3R9XB 1BMTA 4F2DA 2FUEA 2Y0BA 5AESA 1PUJA 1DC6A 1OI4A 1N5DA 2Z1MA 1G2OA 1L1EA 4GI7A 4QJIA 3QY9A 5I5EA 1NQ5A 2CWDA 3L4BC 2QQ0A 3CW9A 4F2WA 3QNWA 1NC3A 1RBYA 1ZFNA 2Q07A 2OAGA 1HPLA 2Y76A 3MNFA 3WJ2A 4X41A 2ZSIA 4TKUB 1WEHA 3UJBA 3TTXA 1E4EA 2ECFA 1YL6A 4E3ZA 3HO1A 2R2GA 4GWLA 2CFTA 2ARKA 2VXYA 4HQOA 4DC1A 2C5AA 1XTVA 1D6SA 5FUQA 4YJDA 3H5AA 3HCAA 3FTCA 3V5NA 1YASA 3H4IA 5FTMA 4G5XA 4TYNA 2ZUBA 3UNXA 5CFPA 5ICSA 3A6ZA 4WIAA 1H2RS 5LA6F 1QPBA 4A2CA 4W5NA 4A3SA 2FSVA 2EEPA 4F1KA 4CI9A 1KY5A 4OUKX 2QN1A 2WVGA 4KPYA 2D1QA 1ZNYA 2MSKA 2R4QA 1RM4A 1JIKA 1Q7TA 1ZO8A 2CVHA 2VQ3A 2WJGA 2XTAA 3QHQA 4EAQA 1UDCA 4GEGA 1N75A 1ZEMA 2WHYA 3EF0A 3LY5A 2BGWA 1Y7LA 2F9LA 1HQDA 4MRNA 5CTJA 1H4SA 3ZK9A 4YAUA 5K3SA 1YC5A 4O4HF 4UMDA 3JWEA 1ODTC 2F17A 4ZZ2A 1ZJJA 1DXYA 4UEQA 3B1YA 4M4SA 2PM8A 3UMFA 1GU1A 3ROKA 1H3EA 3DV9A 4ETMA 1H5NA 3WA7A 5JY1A 1E4OA 2DBRA 4O3MA 1Z45A 1G7RA 5C5IA 3HKDA 1Y7IA 4XX0A 5FT9A 3V4SA 2ZSUA 1TPYA 3DEIA 4UFPA 1N2BA 3JASA 3BL8A 4HAZA 2RAPA 2AYXA 2OVFA 4I0WB 1Z4JA 4KOAA 3RS4A 2I2BA 1F60A 2AFIB 4MUBA 4LTMA 2D62A 4MTCA 1Z2OX 2B9VA 4DRXB 4X5OA 4EW1A 1WOMA 4C5BA 3TN7A 3WIBA 4DSOA 1SZDA 1ZQ1A 3AEQA 1YI0A 3RYHB 4BVHA 1SNYA 3ZY5A 2HHLA 3HKCB 3EBLA 3PYMA 4MUGA 1HG0A 4R98A 1K6MA 2WRZA 3MCVA 1E0AA 1BWPA 2X9QA 1YJQA 3W0LB 3HL0A 4G0QA 4A16A 1G19A 1IG3A 3A32A 3A9RA 3CNQS 2Q5HA 3IAHA 5D00A 4PFJA 5IH7A 5AUPB 1JA0A 1UDAA 1UKAA 3G2OA 2VCYA 5AM4A 4BVJA 3ZKWA 3A7DA 2WTNA 3ANYB 4JLWA 2I4NA 4GM0A 1D5WA 1EFVB 3K0FB 2JFXA 4KMSA 2VDMB 4Z0NA 4UNQA 3R8CA 1GDTA 3FCAA 4M38A 3AFIA 3HE3A 4TTIA 3CF6R 1W581 4QNRA 4MS1B 3CJQA 3IXQA 2YJ4A 4G23A 4GLBA 2GM4A 4HTFA 4I7EA 5GVRA 4NK5A 5B36A 4ZTBA 5H70A 5FOVA 3OPVA 4OQNA 4YROA 1U2GA 5TQ0B 3PGKA 1RWBA 3PDIA 3HFSA 2W58A 1TCBA 4HGQA 1HDXA 3ADBA 1CP2A 3FFBA 2JGNA 3QSYA 3CNBA 3D6TB 3L6DA 4ASUA 3TG8A 4KACA 1WX1A 5FI1B 1N36B 5FPQA 2B7CA 3M9XA 4KIWA 1T4GA 4NATA 2TYSB 4P53A 5CVTA 4MVCA 2A92A 4CCAA 4TMKA 1P4AA 2Q3JA 4JT9A 4C87A 3OP4A 4BVEA 4NULA 4DJJA 4TLAA 1EK1A 5EHNA 1R0ZA 2PX3A 4JBNA 1GRNA 2HU8A 3EDRA 1S8OA 1KEZA 1IATA 1X9IA 2YJ5A 4LJLA 3HDVA 1CR6A 4MPTA 4NYMR 1E89A 4S1NA 1AXEA 4F12A 3H1AA 3EARA 2ETVA 4P58A 4P4LA 3NTRA 3TLXA 5KEIA 2NG1A 4G4GA 2SCUB 1OAOC 2XTZA 3PEUA 4JOQA 4K0RA 3KKKA 3MYYA 5JRZA 1XPOA 1ONNA 4LV5B 1T6XA 5D2CA 2PZAA 1U7UA 1NW5A 5D86A 1KJNA 1L4FA 4UMVA 3USCS 4B31A 4G41A 4AG6A 4AMGA 4B71A 3RF6A 1DLIA 3IQGX 2QUBA 4FMCF 1C8LA 3H11A 1A8SA 3PUHA 3QENA 4L73A 3RRYA 3EW7A 2JLQA 3NHJA 5ALDA 3QVVA 2V6JA 4KIGA 1ZVKA 2BM9A 3TBHA 1ZCJA 1Q7CA 2QW8A 2I3BA 2VPIA 2JB9A 1D04A 5EZYB 1U7PA 4HDAA 3UMYA 4TYWA 1H1DA 1KP3A 3ZS8A 5FUMA 5JALA 4EYQA 4XCVA 2V7UA 1NL3A 2VCEA 1ZAYA 4YRCA 2IYPA 3H5RA 4NPHA 4FQ7A 4I55F 5TVGA 4XQGA 2V6FA 1ZISA 1B8VA 3JQ9C 5DM4A 4L2IA 2WP8J 4L4RA 3ZWOA 3H9UA 4BNIA 4MKGA 1SHLA 3KWJA 4BFXA 1GOTA 4LRUA 3MWDA 4QAJA 3I01M 3OECA 3JVIA 4IS2A 2QNRA 1NIPA 3CSUA 3QTTA 4KR3A 4LY3A 1L7BA 1XWIA 4JLDA 1NP7A 5FOUA 4Z4IA 3A3YA 4LFBB 2QRUA 4GR9A 3FDZB 4EOGA 2CXPA 4FEAA 3HSKA 1RRVA 1HSOA 1QS0B 2VK2A 1UKZA 1C7FA 4K9KA 4RZIA 5THKA 3EWIA 4Y7DA 3NTLA 4MCAA 1JLHA 2AR9A 4OOEA 5FL7D 3ZWDA 2LIPA 3PKJA 4RJTA 1XRMA 1FTNA 4ZCTA 5IZCC 4G89A 4LPSA 3Q3HA 3WAKA 4JLOA 4XJTA 4P5PA 1JWLA 2FUG1 3HUDA 2H1WA 4PX3A 3LQRA 4OXRA 4PNZA 3DF9A 1IJFA 1O89A 3NOOA 1RWWA 1G5HA 4S0XA 1YFJA 2ZQYA 3UV3A 2VR1A 1MEEA 5BO5A 2Q1WA 4W5TA 4O2AA 1L4EA 1G18A 1N8NA 2QBYA 4XSHA 4C04A 3NHUA 1YQGA 3B6KA 4IF4A 1JEYB 4GPIB 3UHPA 3B1FA 3WGGA 1SBCA 1FL9A 5IN4A 4UCQA 1YRYE 2F3SA 2LCFA 2BF7A 4XJVA 5AKKA 3CA8A 4RYLA 2D7JA 1DAGA 1CJBA 1QHHB 1ZOSA 2BTQB 2QRKA 1Q0PA 3CU5A 4KI7A 3T3MB 5A0FA 4C4RA 5AW0A 1NYTA 3KX2A 1RQ2A 3BMCA 3WRXA 1Y4AE 2ALJA 2Y4OA 3AEKA 3E9DA 3GIWA 4IIDA 1GSHA 1MZPA 3RC7A 3TZHA 1QCYA 3BSSA 1C1YA 2FFBA 4QQRA 4RPIA 4XR9A 3MHPA 4KPFC 1O5IA 4HL6A 5BQOA 2GM9A 2P68A 5LC1A 4G5RA 4QYSA 5EIOA 4G8JA 4KJZA 4HDSB 4MKIA 5B58C 1IBRA 3M3HA 5AOAA 1SUSA 3ECAA 4HVCA 2ZCUA 5LIRA 2CBXA 3SKXA 1J8VA 2I6TA 5IXYA 1YUNA 5FFFA 3HWWA 1IZ9A 1GGMA 4JLVA 1J0XO 3A3PA 1O3YA 3O8QA 3KAQA 4NLLA 3TVYA 1RYMA 1W5BA 1Z38A 1II0A 5CAEA 3KOXA 3CBGA 1DC8A 2RG7A 3TL6A 5GM2A 3DS8A 1N92A 4GQIA 5FNZA 1JAZA 2VP4A 3KOWA 1QFMA 4RGYA 4FZ3A 5EPOA 2JIZA 3H9BA 4CU2A 1X42A 4BFTA 5JH7B 4FR0A 4OOFA 2CDBA 4B3TB 3QF7A 4BKMA 6NULA 1K2VN 2GPSA 2F2TA 3II6X 1W1IA 1GGNA 2OZLB 2JANA 2PLWA 3TINA 2IPXA 1JHMA 1KH3A 1E3WB 2FMUA 3LL7A 3QPVA 5LP6B 2F7SA 1JG6A 3M7IA 4UE6A 1WSBA 4DPLA 5A4JA 3ZJTA 3ZZMA 5A04A 2ONZA 2ORIA 2W2KA 2WTXA 3F1LA 1WXIA 4UQPA 3CEPB 4DANA 4E1VA 1I51A 3RTAA 1XVAA 4QQFA 2OKCA 3UJ3X 1UP6A 1OXMA 3WQHA 2X0DA 3D3WB 2QP4A 2BPOA 5K0EA 4PSCA 2VH1A 1VP3A 2Y66A 2P2SA 4IVQA 3M3DA 2EYUA 5KINB 3LY7A 1P0MA 4CZ2A 4JOCA 3FPKA 4WOPA 5CFOA 1TO2E 1IM8A 4D8YA 4ESOA 3CW8X 3TIIA 1VPDA 4WKBA 2Y6VA 3LF1A 2AL7A 1ENOA 3RU2A 3NGXA 2PJDA 3R5KA 4OG2A 4UAJA 4LDJA 3JYPA 1OQAA 3J81A 2FW0A 1SCDA 3U3ZA 4A92A 3QOYA 1B2RA 2ZAIA 4FQ5A 5EGSA 3GJ0A 5IVPA 4D9JA 4LW8A 5J47A 3QV2A 4RM2A 1P1FA 2GCPA 4NZYA 2J31A 4UHHA 4FFVA 1YR7A 4BLVA 1N9ZA 3MS7A 3U7JA 3T9EA 4TYYA 4U5XA 1IVYA 5BPHA 4S12A 4BEBA 1TIPA 2VTDA 3MAAC 2C82A 4XA8A 5IWAB 1PGOA 1XCLA 3ZU2A 1LSSA 4YFVA 2QLNA 1FDWA 1B74A 1FNDA 1HYBA 1L4YA 2Q3HA 3BL6A 3CH5A 3BD8A 3QWFA 4AJHA 2BR4A 1RQNA 3U7RA 3L79A 4EQ6B 4DSTA 1WCV1 1VSTA 4EKGA 4YCNA 1W44A 4FZRA 5DGTA 2QV7A 2QR5A 1FTYA 4B4WA 2D0DA 2OBLA 3T1TA 1QOPB 5K3AA 5HJ7A 3PI7A 3GIDA 4OYYA 3CWCA 5CJJA 3DC2A 3HVHA 2Z4TA 4MB2A 5F9MA 1FFHA 4ZVMA 1UFRA 1E2KA 4M1WA 5FTWA 1M10A 4WXHA 1SU6A 4OP3A 5LP6C 2IX3A 3HKBA 3GJRA 2JFGA 4C43A 3E1GA 2I6QA 4W7HA 1M34A 1P0IA 4BX2A 2YN4A 3QHPA 1Y8CA 2P9QA 2X5JO 4E51A 3QA3E 3GZ4A 1D2AA 4HDNA 2QJWA 3EQ8A 4ILEA 1E2NA 1Z63A 3HCEA 1XCPA 5F23A 2ZU0C 1D6MA 2H7XA 5ALXA 2RBEA 2AEJA 3TQSA 4R81A 3KTFA 3L8YA 2W00A 1A5SB 4C20A 1ZD9A 1US8A 4MQ6A 4OLBA 3HBLA 4BMVA 1T43A 2YYSA 3W79A 5IYZF 4HP8A 2O8DA 3G9UA 3RIGA 5I4KA 1CUUA 1F2TB 1MX3A 5KVAA 3RFFA 4R1OA 3V4OA 3V8PA 1B73A 3ZU6A 4PYKA 1QMGA 4MDEA 1V5EA 3QI7A 3V2UA 2RCYA 4QYXA 1KPGA 5JJLA 3G9XA 3IHWA 2WYHA 1E1LA 5EQFA 2PSDA 3SHVA 4MXDA 4ABYA 3AF4A 1IONA 4CI0B 3B3FA 5C46F 1VA4A 3DEZA 2RMKA 2CL6X 3FVTA 1N32B 1II9A 1KK1A 5JTTA 4CODB 2DUJA 1MKYA 4LHXA 3E9YA 5IJ9A 1I3OA 1ULBA 2JBHA 2ZPUA 5C8YB 2CT8A 1E66A 2W48A 5BMVA 3VSAA 1UMDA 5FD8A 1PGJA 3O92A 1X80B 4X1IA 5B1SA 5JE8A 3GLIA 3BCUA 4HLQB 4EM6A 4W6ZA 3UY4A 1N6RA 1SOMA 2JJ2A 3UIEA 2CLCX 1QYRA 4QDOA 2A9PA 3EVGA 1XTBA 3D64A 4I2VA 1KEVA 1OGYA 3IUPA 4G5SA 4I4TF 1L5OA 4OHMA 4TLMB 1NVVQ 4XQ9A 3ONDA 4OMUA 3UG6A 1O8BA 2HA4A 2O8BB 1ZESA 1CVIA 4WFQA 4EPWA 4ZOQI 2P4HX 1WNFA 2WMNB 1CUCA 1NG1A 5BVHB 4HB3A 1I2BA 4TWZA 4YNBA 4B3GA 3FN4A 2ODWA 4K6OA 3FMOB 1IHOA 1C1HA 1SQFA 2ONYA 3CB4A 1Z6PA 4GW3A 1NY5A 4RVDA 3U62A 2PANA 1SEPA 2R79A 1PEKE 2PXAA 3IFSA 3ND5A 1QGYA 1G21A 2JCGA 2OCLA 2IEBA 4I50B 3SEQA 1EI9A 3NBAA 4CTNA 5I47A 2DKFA 4DC9A 1JHYA 5AVJA 1QFYA 5IF3A 1NW8A 1AT1A 1YZYA 1I6KA 1X3LA 1ESEA 1YQWA 5BNIA 3MTBA 4BUCA 5IAKA 4GOND 3ED5A 3UQYS 2JLRA 4ZV9A 2IOFA 3KKNA 4D2IA 4BFVA 2JF0A 1TYAE 4CHGA 3L8EA 3QVGB 3VU9B 4BN4A 1P81A 2J0EA 2F3QA 1QVWA 1KQPA 3BBLA 1KVRA 5G4KB 2HU7A 1EK6A 1L4BA 4H1VA 2IUFA 3ELDA 1I10A 4FHDA 4RANA 5PGMA 4ZGGA 4UAUA 4KVZA 1P5HA 5AH0A 2V45A 2ZAYA 2G17A 3B3AA 2XUIA 1QGAA 2N1BA 3AY7A 3EYWA 4JJZA 4O4JF 2WJ3A 1KJ8A 3SF8A 4IHAA 4FYXA 1AY0A 1KY2A 2JRLA 2OHXA 4HS9A 5AKYA 2LCIA 4R9NA 2ZTHA 3FGPA 4LHWA 1IZ7A 3L0OA 4ZCQA 3SQLA 5H8WA 2V6MA 4WECA 3UKDA 2O2SA 3ZJVA 3C4QA 3L4EA 1E1RA 5CYPA 2XMPA 1YDMA 4TTJA 2X41A 4CKYA 2NYUA 3P2KA 5GJBA 4QG7A 1Z6XA 3D1LA 3VI4B 4RVNA 1CUGA 2B3TA 2QVCA 4NJMB 5EVJA 4ZIRB 1EUDB 4BWFB 3B1JA 4GS5A 2BHRA 4PFQA 1L3IA 3ZDFA 3RC9A 4BAGA 4TT8A 3WWPA 5F4BA 4AG3A 4DILA 2EBUA 2FW8A 4D5EA 2XCSB 2ZYRA 5DI9A 2HTFA 1QHNA 1Y9AA 4M0FA 1OU4A 3B1KA 3OIVA 2CD7A 2WZDA 2BFCA 5TQJA 4YB8A 3ITKA 1K2WA 3WHIA 5JANA 2BKVA 3AC0A 3K5IA 3L1HA 3LUAA 4EITA 1NE7A 4RIIA 4NYIQ 5MN5A 4RNCA 4EJ2A 4F46A 3HU3A 3IXLA 3CJRA 1VLMA 1KF0A 3OZSA 4LBYA 4RV4A 4BBZA 4C7BA 1BH2A 1O96B 3AMVA 4WBXC 3TUJC 3C97A 1T0JB 1MABA 4HGPA 4E22A 4EDFA 2OBYA 5GIPE 3F73A 4IZHA 4E5DA 3OA0A 4M83A 4OIMA 1M8PA 3ESRA 1PF7E 2YJ3A 3D7MA 2H52A 3EWSA 3LQFA 3URMA 2A5DA 1URPA 1VIDA 4I1PA 1CHNA 1HYHA 1GUFA 1TM5E 1IWOA 3L1UA 3WYAA 4RE5A 3DAHA 4R8VA 3H9JA 4LOLA 2I2WA 2RE8A 1NJGA 5IXSA 4YECA 2ZJ1A 4ZANA 1FOEB 4J2HA 5JS7A 5KDOA 1T2AA 5CX1B 3BGOS 2GZHA 4IV8A 1O54A 1SUFA 1XRSB 3KZXA 1DAKA 4G0WA 1NF3A 3B20A 4WJLA 4QTYA 2MSLA 1I7PA 5TS3A 5EQDA 3QMPA 1U3CA 1S4MA 3UGJA 1REQB 1Q16A 3GBPA 4YC7A 4LVOA 4Z99A 2QORA 1OW3B 3GEPA 2G63A 4CM9D 3NG1A 3I12A 3SICE 4NK4A 4HQ0A 2FI1A 1SU8A 1J00A 3I45A 3IT0A 3LLCA 5FWNA 3GLQA 3H1GA 2OYRA 1FNMA 3FGNA 3WIVA 2I62A 3ICEA 4AS3A 5E6UB 4ISBA 4PTZA 3B2EA 1I7NA 1P6UA 4II2A 5CVCA 1QUEA 2PUDA 4FD3A 4NMHA 1PG2A 2EFJA 4N3BA 2FZCA 3UO8B 3EZLA 4G0YA 4OYRA 1ZVMA 4BCCA 3ZLJA 1FUEA 1SUIA 2JFWA 2ZUCA 4JDUA 4LNUA 3MS4A 2H6EA 1E0DA 1JQJC 4YCLA 1R5BA 2O1WA 2IGTA 4RK5A 4R2HA 4WOCA 4NSNA 4ER5A 3JASB 4AYXA 4EECA 4Z53A 4QSHA 4XM1A 5EP4A 1M2FA 1E3DA 1Q1ZA 1EQUA 2GD6A 3NTVA 5IF9A 3KQNA 2E89A 4TUYF 2CJWA 2YZ7A 4P4TA 3O75A 5DVZA 5DW3A 1YULA 2P27A 3CEMA 4QFCA 4W9NA 1IUNA 4MEBA 4OAQA 3CR7A 1C2YA 1M75A 4QT4A 1SBHA 1XGKA 2A0FA 4YPVA 1GFSA 4DM7A 3C3BA 5EWMA 2FJ0A 4UU0A 2R7MA 2WM2A 2OXIA 4YV1A 1WDTA 2J87A 1EMDA 5KVSA 4FILA 2ZR7A 2ZIVB 4G63A 3RYCA 3P4XA 3ZWMA 3GOHA 3P2OA 3U39A 5TF0A 1FDUA 1OV4A 1X77A 2R66A 4ZVTA 1NVUQ 3R9IA 2OG2A 1E7MA 4I46A 3HXKA 4AS2A 1BS1A 4I6EA 2IS1A 1TJ3A 3GFSA 3O91A 4FDAA 4B73A 1BC5A 2H0QA 2FRVA 2SBTA 3EQ6A 4JA0A 4RJJA 3OI7A 5DNWA 3QFCA 1GPBA 4XTCS 1XL1A 3AZPA 2GRAA 5ESWA 3VYRB 4BIMA 3L0YA 5CNIA 5CURA 4AJ4A 3IKJA 3L1JA 4I5IA 4O2AF 3ITDA 5FOQA 2JIQA 3GLKA 4TYQA 2FKAA 1DHRA 2C03A 3FYSA 3FKSA 3JQGA 5JARA 1R15A 1LDNA 3WXBA 2C94A 1FS5A 4YJHA 4L8VA 4XQCA 3ZXUB 5E4YA 3RHSA 3HCCA 1N5IA 1MR3F 2A7QA 2ZIGA 4ZU3A 5THQA 5DOZA 2R60A 4LOHA 3IEUA 2IYLD 4GLJA 1N6NA 1EM8A 4LJ7A 1ISMA 3W7BA 4QBIA 1APBA 2QX4A 4KO8A 1OZ0A 4Q7QA 4XB2A 3LKDA 2FGKA 4LXQA 5CVJA 3I0NA 4RZ3A 3U17A 2A1UA 4R1NA 1NN5A 4N5DA 2B4YA 4NBRA 3EEOA 1UBLS 3HZOA 1ZSNA 4P31A 3VXKA 3UK6A 2YFYA 1BXGB 3LQQA 4CKZA 4D4MA 2AYZA 1RRCA 2CNKA 4TZKA 3AHJA 1L5HB 3FNQA 5LU9A 3TLGB 2NADA 1W5FA 1JHXA 1G4UR 3FAZA 5TSDA 4A8JA 2HMVA 2A3NA 1E94E 3R24A 3RFTA 4B4UA 4EGCB 1U80A 2QSZA 5ABPA 3JD0A 3SFZA 4DCVA 4QQKA 2V98A 3VDRA 5AVYA 4EMUA 2MINA 1H4QA 1JPUA 3LPLA 5D5PA 2AXQA 5TR9A 2K2WA 2X4IA 4RV5A 5CW2A 5JSYA 2PX6A 4OV6B 1DC5A 4CF6A 2R65A 2O2IA 2BD0A 2GAJA 1BE8A 2FXIA 2V74B 2ZTUA 3FJYA 3IOBA 4N7RA 1PK8A 4NFSA 5B37A 1TT5B 1NRXA 2FE1A 1K06A 2GBGA 1SBTA 3FHOA 3KNZA 3WSVA 4RE6A 2PU5A 1YMVA 2V7GA 4AX8A 1L7PA 4M0PA 2RGXA 2Q5LA 3NUZA 5ALIA 2VKTA 3Q8MA 721PA 4EW6A 1KRWA 3CRW1 4HUTA 4ZI3A 4DR2B 3TQOA 4QUIA 1GUZA 3GJXC 3X1ZA 2XQGA 5B12A 4B46A 4RTLA 3K7EA 4TWIA 2HV8A 3T0FA 5FULA 1U8TA 3REGA 3T4PA 1ZD8A 2QJFA 1BJRE 2WF5A 3H17A 1E0SA 4CM6A 2Y27A 2GKSA 2DPMA 4NCKA 3OFSA 1R5OA 1W85A 5K5EA 1E6CA 1PUXA 3FPHA 3H42B 3VR1A 2KQUA 2ZYAA 4R05A 4BE7B 2NP7A 2PS1A 1V2HE 1QRSA 1MNQA 2WAAA 2RHTA 4Y6SA 1DWQA 5ILGA 1XR3A 1EBFA 3I4FA 2HRRA 1XVIA 2HYDA 3PWZA 5F35A 3R2JA 3HB1A 4UNSA 3TEJA 2GTHA 2XOEA 2ZUUA 3WWCA 2V6BA 2XBUA 1EVQA 4AMUA 1IXZA 3KXIA 3BXHA 4Z7OB 2Y1CA 1ULHA 5FWYA 1W19A 3PITA 4QYMA 1VRVA 4V0MA 2CKDA 5C0OE 4MW7A 2EEZA 4DL9A 1EVZA 1DX6A 4XI9A 1NZJA 2YDYA 3K5PA 4KWCA 2IT1A 2JK0A 3OLZA 4NE7A 4G36A 4Z9FA 4RNDB 2G0AA 1JFLA 1F8UA 3V1UA 4DQKA 1AG9A 1GG8A 5HQTA 5DCUA 2WYIA 2CEAA 3KQKA 2V1UA 4G3XA 5L4SA 2G8LA 2QE7D 2WJHA 2GILA 3EAGA 1LNSA 4UEOA 1D2HA 1CDEA 5B6PA 1MAHA 1RHQA 2FEMA 5JOQA 1GR1A 4P34A 1CVRA 2DBYA 5CXUA 3LOUA 3ZVMA 5JQWA 3DMNA 1Q77A 5J4LA 1MW8X 3GZNB 1A7JA 2A59A 2YV4A 3WRYA 1PFUA 1RWXA 2GETA 2KE5A 3GEHA 2GR9A 1XTUA 1EJBA 3IUNA 4KV9A 2HCBA 3MINB 2WMOB 3PRHA 3FVRA 1YS2X 1J0AA 2VA9A 4KXUA 4P7FA 3CLRD 1ANKA 4MJXA 3U3DA 5SICE 3K2QA 4UULA 4D9MA 2C00A 2GYYA 1LSOA 3K0EA 3O1IC 2HPVA 5FNVB 3EAFA 5GGXA 1RAIA 4PO3X 3GUZA 2AHRA 4YI3A 5HKLA 9ATCA 1IBCA 7REQA 2NWQA 3DMRA 1NXOA 2CSXA 1JQAA 1PQ4A 2OK7A 1Q50A 1ZOPA 1ZUD1 3OC0A 5CTAA 1OASA 4YUWA 3AONB 3JYQA 2NACA 1WCYA 2YY7A 1LK5A 4R2IA 4URZR 2HSZA 4WX2B 3TKLA 2QD3A 4ECEA 4Q37A 3OA2A 2QMZA 4PC2A 3W9YA 3I8XA 4J1NA 1P0CA 3OE7A 5BR8B 2H00A 1MLDA 3CMMA 4RA6B 2B2CA 2GZAA 1PR3A 4EKYA 2QE6A 2PU7A 2QWXA 2ZDQA 3F1KA 1KSHA 5J63A 4ZKEA 3A27A 2NO0A 4KW7A 1WV0A 5C3UA 4ER3A 4KPEC 4JYPA 1Z29A 2O1SA 3EGDA 8ABPA 4HGNA 4QOSA 1UDWA 4Q1BA 1OLUA 3GMTA 4YBZA 5KDDA 3GROA 3HPRA 3MJRA 3QOFA 2I6FA 2FN7A 1OZFA 1UUFA 3F8SA 3Q6NA 4O08A 2PN1A 1I0LA 4MHTA 4UD2A 4KVGA 1TU3A 3I2FA 2QQGA 3H0EA 3KKQA 5E1OA 5NULA 5A5DA 2HMSA 2VPZA 2QZZA 2WNSA 1JHUA 1QIKA 3EQ9A 3F7NA 5DNVA 3IT2A 3UFXB 3P9IA 4CMCA 3CUVA 1FZQA 2VWGA 3HHEA 3OMLA 4G97A 2XW6A 1YF3A 2I7TA 2V6GA 3V4PB 3GFTA 3DLAA 3H3FA 1T0IA 2E4AA 1ZJZA 2J3HA 2VXOA 4I8IA 4KQFA 3WRXC 1KERA 1K68A 2R86A 2C5BA 4OMCA 1FP1D 2NAFA 3HADA 4DJ5X 5EIEA 3SFTA 3N0RA 2IIQA 5K0GA 2DR3A 2EF0A 3K9HA 1A5BB 3PFHA 3SLGA 4ZJYA 5DBGA 1QPGA 2ECQA 1VZ2A 3L6UA 3T5MA 1F8XA 1GPDG 1QORA 5JV5A 3CV3A 1E20A 2HLNA 1ZEJA 2AJTA 3H04A 5A4DA 3ZK7A 1J8DA 2GLTA 4N3AA 3OTIA 5FJIA 4IHJB 5L51A 2CXTA 4LCBA 4WUTA 5M04A 2HK7A 3Q2IA 4C1NA 4KFCA 3ZWKA 5CH8A 1K88A 3RRJA 3QLUA 4E5KA 3A3OA 4DS3A 2P4QA 1AB6A 2WZQA 2X77A 5EKSA 4ZOCA 3WGMA 1SCBA 1Q3TA 4N5HX 3C3KA 2LTAA 1Q84A 4NF2A 2IHNA 1HT1E 3NUGA 4J8PA 4NWIA 5FUYA 3I6IA 1P4JA 3GAZA 2XEDA 1G60A 3DZJA 3LP5A 4NU5A 5DEOA 4Z9BA 3QU4A 2V8BA 4LX8A 3IE1A 3AVTA 4E5NA 5K0BA 1VJ0A 2JFHA 3AFOA 3OY7A 1JX6A 1AKUA 1MF7A 2BGTA 5AHXA 2J0SA 1T29A 1IMJA 1DEXA 3NU1A 1BA2A 3MMPA 1AMNA 5JUWA 1SVMA 3R3WA 3NVMB 4UQOA 4NZZA 5IDQA 3I6YA 2FNAA 2C42A 1CU1A 3OC6A 5JD6A 1KAHA 2SECE 5CPFA 5LZ9A 3RK4A 1E3MA 1M54A 4H08A 3U37A 3KXPA 5A06A 3FNBA 3HBJA 1EFAA 3FLBA 1JVBA 2POCA 3JQAB 2VPWA 5K99A 4LK3A 2O5CA 1XQYA 1O2DA 2C78A 3D4BA 3TRIA 1CJMA 3WB9A 4ZYXA 5AM0A 3F98A 3EMKA 5IHPA 3HXOA 3EQ2A 4IZOA 2HIHA 4KP7A 1RR6A 1US8B 5CRIA 5GJCA 5KU7A 3TF5A 2HV9A 2O8DB 1CWUA 1MAVA 1U9IC 2WJJA 4JQYA 5K8LA 1OX4B 2WNHA 3HV2A 5HTOA 2GF9A 2WUEA 4LXIA 2PZFA 1AK1A 1Q0ZA 2ACVA 4US0R 1CDZA 1JA1A 1XQ1A 3SZUA 3Q40A 5FBKA 4BO0A 2G76A 1WQ4A 5DHPA 1A8QA 4GI3A 2PUCA 3FSRA 1RMQA 2KI5A 3BVPA 1HE2A 4LX0A 1IY9A 4HYEA 4X1YB 4CM1A 4ZTZB 1TF5A 3I01A 1Z0DA 1M0WA 3Q41A 3WNVA 1HLPA 4M53A 3QVOA 3OCWA 1N7GA 4J0KA 4JXKA 2Z04A 4Y9DA 4D92A 5TX7A 3T1HB 4XPZA 1KC1A 1UJBA 4HV4A 2QM7A 4ZP1A 1XDUA 3RNLA 1EEXB 2EFDB 3P8ZA 1WKCA 2ZT5A 1VPTA 2M1XA 3OJWA 3KLPX 2I4IA 1VXRA 2FUG6 4NCNA 5DBFA 5F9HA 4COKA 4QUGA 1M7HA 2IWHA 1NF9A 3RIHA 4F5EA 3KQLA 3RTCA 2BFFB 4MMYB 3GAMA 3VVLA 2AWOA 5J40A 2D2VA 3LIPA 4MWTA 2AR7A 3T7EA 1VL2A 1ZCBA 2QUIA 2TMGA 2GBFA 3QPDA 1CJSA 1GTG1 4NFHA 2MJLA 3TK1A 4DLBA 2XGSA 6Q21A 5LU8A 3UJHA 4RVSA 5CW1A 2G1AA 5K3BA 3TAXA 1U1DA 1UODA 3ASYA 3OQMA 1QX3A 3GARA 4H18A 4K6MA 2CV1A 5HX7A 1ND6A 1T2VA 4M98A 1K75A 3ZH2A 1LTQA 3TXAA 1EGAA 1ZJ6A 3ZZ0A 5HJ5A 2RHLA 5HE8A 1C1DB 2Z5LA 3HACA 3MSXA 3DT9A 1KZ4A 3G13A 3MWJA 3OFKA 5DRTA 2O2YA 5YASA 2W2PA 2UUCB 5IH3A 3W9UA 4P2BA 1W5AA 2BJVA 2LDBA 1QYVA 3GFVA 3ZNNA 1EFCA 2ZSJA 3HR7A 3NIGB 1H8ED 5DP1A 2LPMA 1C8VB 1L7NA 2XYVA 3QVWA 5AVOA 2JH9A 1JHQA 3LSTA 1SY7A 4ZPXA 3WHPA 3HLTA 1KE1A 1C3OA 1JSZA 2H1SA 4TWRA 3V3TA 1O0CA 2EWWA 5EJ5A 3O73A 1Y8AA 1RVV1 2YYYA 4AXXA 1CUSA 4YUYA 5KSPA 1X7WA 4LJ8A 2G1PA 4PLFA 3UB2A 4WNAA 2C3YA 3WZ2A 4C4TA 5CUQA 3K4HA 4F2GA 2BL4A 5JYBA 1SUDA 3C87A 4KHZA 1LC3A 5FPHA 4FYIA 3FYUB 3JARB 4JFAA 2ZKLA 2QPOA 5EMMA 3WOHA 3DP9A 4L3OA 5B1YA 1ILEA 3PR1A 2IYWA 1XZAA 1FK8A 2XKJE 3Q12A 1FP2A 5P8WA 3PGVA 2V6IA 3UXHA 3UAWA 3PUYA 4D4KA 2B1JA 5HXAA 2GWHA 3IAM6 4F1JA 3RUPA 1D2NA 1EVEA 1KZYC 2E4ZA 4BRWA 1MA0A 4Y2RA 2ZRBA 3FB4A 2BELA 5D7NA 4FYHA 5EC8A 1XD2B 1T8SA 1OFHA 4N9WA 4YT2A 3JQ6A 5IK2A 2JZCA 4UDNA 3RKUA 2XNCA 4N82A 3HN2A 1C9MA 1YB4A 3CR3C 3JQ7B 3NYWA 4RPKA 4GX2A 1O6CA 3HCNA 2ODBA 2Z95A 1QXSA 3KUKA 4JXJA 5TJHA 3WB2A 2F48A 2HHCA 4L7VA 1H8HA 3KPJA 4KXLA 4RFLA 3OPXA 3LBNA 3QKWA 4Q48A 1V0JA 2UYHA 2ZJ5A 3D1JA 3BFJA 1CVLA 4Q7KA 4CMKA 1MGOA 1WNTA 3TR0A 1IQUA 1VLLA 3LG2A 1SC4A 1Z68A 3HM9A 1LF0A 3B6JA 5JW6A 3HUFA 3AY6A 3KT6A 1M6VA 4YPOA 3UAYA 3E35A 3GF4A 4IJQA 4BL5A 1WHSA 4NVRA 1ZNWA 2F4NA 4Q18A 3AEUB 1EEHA 3R7FA 3LKZA 2JLBA 2W2VA 1IOZA 2QL7A 4L07A 1HDGO 4Q4LA 4O59O 1MAAA 5FBZA 2H1FA 3BCHA 1FQKA 5IW8A 2I34A 3QVMA 2IV7A 2V7QD 1UP4A 3GOQA 3H2JA 2JLWA 3WKDA 1N1GA 4ZVOA 3SSAA 5ITVA 3O9VA 4K2AA 2A0XA 1W4RA 2XE6A 2X19A 4MRMA 1YQDA 3T1VA 2H5JA 2JGDA 4H3KB 4N7MA 2C4MA 3ET5A 3WLQA 1IBKB 3DHYA 1HGXA 3B1ZA 2AQIA 2FHPA 2IQ5A 3MXOA 3ENZA 5B2FA 3AP2A 2QTTA 3GLRA 3IIJA 3B8HA 4YJ3B 1FX0B 3BIXA 4BRZA 1MB0A 4CT4B 2IA5A 4D3SA 4ZAWA 4NP6A 4EB3A 2XNKA 1MJFA 3ORYA 1P2DA 1TFUA 3ZY6A 3ZWBA 3FNFA 2R4TA 4HUQA 1BCSB 1HYQA 4AZTA 3FYUC 2XRFA 2A67A 4GX5A 5HHTA 1ZIYA 4KGDA 3EGXA 4DR1B 1EVJA 2GX6A 3AR3A 3MWYW 2GLUA 2IIPA 3A04A 1I9GA 2CLKB 4FGKA 5LYJA 4FT4A 2WSMA 4LRSB 2BTEA 3OQIB 4FSHA 3VV3A 2H4YA 2IFTA 2YNMA 2R2AA 3MJFA 3O93A 4DLUA 3EG9B 3R0IA 4I08A 1T1SA 3O7WA 4JQCA 9LDTA 1M34E 5JMPA 1HBJA 2R5WA 1N34B 3ZCRA 5IT9A 2YWXA 3UHFA 1JQDA 2HSGA 2YRWA 2PX8A 2BBWA 1QIDA 1WV1A 2IOQA 2QX9A 4P33A 5AT1A 2DX7A 2EFCB 3PPIA 5E2BA 5F21A 2NYVA 3MQ4A 5CA1F 2X5KO 1SIOA 1AURA 1LVHA 4OPMA 5JCPA 4CEIA 4C6TB 4C5AA 3I5UA 1GRRA 4AKEA 2WJVA 4KYVA 1CQIA 1JZTA 4RA9B 3WK4A 3AL3A 4DPKA 1E63A 2R5FA 1UXKA 4OFWA 1WBDA 3UXYA 3OTHA 1N5MA 1KYXA 1SD5A 3NHRA 4I9FA 3ZV5A 3OEWA 2ZCVA 5FEUA 3AM4A 2IY7A 2WF9A 5FLKA 5HRAA 2QAGA 4OO3A 4ZC8A 1Q83A 3RUDA 3NM5A 5K8IA 4M99A 5E7QA 3L5KA 1ZZGA 3QFFA 3SPXA 4KE9A 2NUPA 1YDEA 4RTKA 4U7DA 2UYQA 1DMSA 2ZJYA 2C77A 1TJPB 3AP3A 3H2KA 4P3OA 2P9JA 2YZGA 4HD8A 4QXOA 1V8OA 3GLIE 3ZOKA 1USWA 4LA4A 3NBMA 4B6RA 1E1YA 1DO2A 4UMFA 4HADA 4Y6LA 4AJEA 5JWOA 3KP1A 5AI5A 3TIFA 4YMTA 1Z4KA 3WYCA 2DFTA 3ENQA 4MB6A 3JWGA 4M8LA 2XJ9A 3EXAA 2QS9A 5IBPA 1ZUWA 4F8JA 3FHTA 3LHIA 3X43A 5AHKA 2FZKA 4J43A 3S2UA 1E2GA 3IAEA 4J91A 5DGCA 3OZRA 4EABA 3UXEA 2O0JA 1TMKA 3L9XA 5TPZD 2MSEB 1HT2E 4OUDB 9LDBA 4FUQA 3SKVA 2WG0A 3PA6A 2L2QA 2R6R1 4F56A 3Q85A 1LV8A 3DXZA 3PC8C 4OK3A 3L1VA 1AMOA 3QNUA 5E7IA 3U7QA 4A7PA 3NHBA 2FSPA 5BW6B 1PR9A 3F7MA 1F4PA 3A05A 2XUZA 1NW6A 4MWDA 1CZLA 1SOVA 1G21E 1PT8A 3DWIA 3BDIA 3KTAB 2CXUA 4GU5A 4NRDA 3PHGA 3E22B 3OLQA 3SE0A 4EG8A 4D9HA 1CUAA 4NV0A 4YHHB 1W35A 5E3JA 5KNLA 4G9GA 3M70A 1XNQB 3E58A 1J56A 1HOXA 4A8JB 1GN9A 5LQUA 5BY2A 1VECA 3EIHA 5AI0A 1IN6A 4KBYA 2OAEA 1KMCA 5K3CA 1JG4A 2CNDA 2XGGA 4MCHA 4AN0A 2BFEB 1JTVA 1FSZA 1O95C 4P82A 4PC1A 2XRZA 3WADA 3HPQA 1J9EA 2YVKA 3FCUB 3IJ5A 5JJIA 3K92A 3KETA 5TLSA 3MGKA 1MMFB 1AZWA 2WTMA 4R51A 4YGYA 1WTCA 2YFHA 2HA3A 1H2FA 1ND5A 2GF2A 3O2NA 4XFDA 5F4ZA 4IGIA 4MVJG 4FZ5A 1PL8A 1PGQA 4ZDKA 3OUUA 2HUPA 2A1TS 2NVOA 2ASEA 4KQKA 4MS3A 4ZO8A 2VNJA 3RWBA 3TZQA 4F45A 2X0FA 2HT1A 3N53A 3FE2A 4LMRA 4KO1S 1FYVA 1R4AA 3IALA 2GCOB 3WAJA 3EH2A 2QN3A 1PFVA 1ZGBA 1R0BA 5JVDF 3TBKA 4AY6A 4Q66C 1A9OA 2YWFA 3P0FA 2C98A 1LNQA 4HMPA 1M6YA 4KQJA 3T7JA 1DUIA 3EMBA 3C8MA 3Q3CA 4LHZA 1L7QA 3JTMA 3K4PA 5GM1A 4US1R 1J2TA 3PQ5A 2ZZKA 3H83A 1K27A 4DABA 4U7GA 1A98A 3ZW7A 5EIXA 2IH4A 4IDHA 4DT1B 1IOVA 2Q0SA 2WIFA 2FQYA 2X6QA 3ZPXA 1K8QA 3TMAA 1KJIA 3RVDA 4HZIA 1JYSA 2I7CA 3SC3A 4DKXA 4IFBA 3BH7A 3TZCA 1QANA 3IAUA 4B81A 1T5BA 2QB5A 4NMLA 4NU8X 3T4XA 4Q00A 5U4XA 4I5EA 4QGAA 1J4AA 2M6RA 3KTDA 1X1AA 4NMXB 1FEZA 3SK0A 2QTZA 3QKIA 2P6MA 2OLEA 4MAAA 3LDGA 5CFRA 1IBMB 2I1WA 1B8OA 4H7IA 4OXKA 2XYRA 2A9RA 4GC5A 4GVLA 2CLIB 4HAXA 2PNJA 1R4MA 5ERGB 4A8JC 4OJQA 5KPJA 4JBLA 1TYEB 1ZW1A 3NFYA 3GZTB 3KT0A 3L92A 2K7FA 4WCFB 4UUQA 3AVYA 2PBLA 2QDXA 4X92A 5CPBA 4CFSA 3T5AA 3L4KA 3EPJA 5CYFA 5DH9A 4QO8A 2B5WA 2F00A 1C80A 3G8YA 1IB0A 4Q3CA 4GSLA 3AR8A 3GPBA 1CZNA 4WLEA 4CJXA 3IDOA 3MA0A 1YH3A 4K26A 4LJSA 1TMOA 1XTTA 1EE9A 1RHUA 1RYYA 1I3MA 2FWRA 1RRMA 3R3HA 4BX0A 4Z1MD 3DVSX 3IKMB 4M0UA 5EHXA 1XZJA 3LV8A 4K03A 4R2LA 5DF1A 4IIBA 2KHZA 3A9VA 4FYPA 4N6GA 4QTZA 4U39A 5FBHA 5KDLA 4IP0A 3GP8A 2C07A 5JASA 1JT9A 2BMVA 2B9EA 3QW2A 1TO6A 3CUEF 1VJ5A 2I87A 4LE0A 4R5HA 2QL5A 4DLSA 5EKXA 4AMBA 5AICA 4C76A 5EINA 3VNSA 4G26A 5L6LB 3X1MA 5L7YA 2AW5A 1KVTA 1A5ZA 4DUGA 1RAAA 1XTKA 1ADYA 2QVZX 2ZRMA 4M6WA 4U1RA 4C3UA 3L4JA 2GYUA 2BAGA 2GHQA 4ZTUB 3HJBA 2E3JA 4RF3A 3RJ5A 2R8EA 2FW9A 5H3LA 2VAMA 2FR0A 5CT9A 4D0NA 2J5BA 1CUVA 4V1CI 3DPSA 1XKTA 4CKBA 4JC8A 1VCMA 3ZZNA 1W29A 3TQFA 2FPKA 3VPAA 2AQHA 4LRTB 5CH3A 2E1RA 3AUYA 3BUSA 1YBAA 1ZN2A 2A9QA 4KH0A 1BHJA 3P32A 4PSKA 1GADO 2Q1SA 5AK6A 5IAOA 5LQKA 1PSDA 1TQDA 5HTKA 2BFDB 1HE3A 1SQGA 3C3EA 2J5XA 1EHCA 1SKYB 3FG9A 2JIBA 4JH0A 4MVJM 1H6BA 5AK0A 4DNOA 4YYZA 4F2PA 4WJKB 5C81A 1FPMA 5GV7A 3Q7EA 3GRAA 5ALSA 4JI1B 3EVEA 2IZZA 3DE0X 3OKAA 1OLUB 4PC7A 4C4OA 3PPVA 4PHCA 3PXGA 3MZ0A 4PC6A 3COVA 4IIVA 3H2BA 2C8LA 2OWEA 3DBVO 1WB5A 2FH5B 4CKCB 2VEDA 3F6PA 3OU7A 3CNHA 4R41A 3FFXA 4FR5A 5J2TF 1PYDA 1EK0A 3ZE6A 4WCFC 3QP9A 3KYBA 5GVSA 1NBMD 5GZ3A 3OD5A 1XZLA 5COBA 3TW0A 3CZ9A 3G2PA 1JA9A 3C70A 4YHBA 3GLHB 3ROTA 1PHPA 2N1MA 3KEQA 3IC5A 1MQ9A 2VNKA 1HEIA 3R0JA 4KWHA 5I9TA 3HI6A 3V4RA 4FDTA 4TMYA 4GMKA 3ZN2A 1WE2A 1YRAA 5AW7A 1AUXA 3N0WA 1XC7A 4BQOA 1PZEA 4D5GA 3SX0A 4RWZA 3V80A 4IINA 1K1EA 4FC7A 4PNEA 1NNSA 4QGSA 1Z06A 2BZGA 1P1RA 2R1VA 3P9RA 4ZI7A 3JU3A 4YA6A 2NQ2C 4NAVA 5HBRA 1YGYA 2JAXA 4LDRA 4XIFA 3FVWA 5HIJA 1KYQA 3FMGA 3R6TA 1SVOA 3BYZA 3V42A 5IDVA 3B7GA 4LTNA 5I3ZA 5AJVB 2PQ0A 1NP3A 2Q27A 1H65A 3RBXA 3I72A 2PSJA 3OLYA 3V6MA 4F3NA 1GXSA 3T38A 4HH3C 3SLKA 1NVAA 4JEIA 4HZUB 3ZCUA 3THXB 5CYGA 2HHHB 5CEEA 3FTFA 3PVCA 1X1TA 2AEMA 4F91B 2FDXA 1YQ9A 3HRHA 4M1OA 4RH0A 4EY8A 1YK1A 4NENA 1DTSA 1B6TA 3OOJA 4DV3B 5I5GA 4YMSA 4IIXA 1IAQA 3OWHA 4DA7A 4AUNA 4GXNA 1U1GA 3DCJA 3RVOA 4Z7QB 4AUEA 3HB9A 4NE9A 1VP9A 1VJCA 3KKMA 3A25A 4EF4A 4S05A 4W1SA 2EW2A 2HK8A 3H1PA 4JXXA 4HNHA 4HNQA 4RY2A 3QPUA 4FGZA 2ZIFA 3UF0A 4JUCA 2CYBA 2BKXA 1A4RA 3RTDA 1E8NA 3KZMA 3M4XA 5LQAA 3HDJA 4UBMA 1X7XB 4MWSA 4URFA 4O3FA 5LCXA 2VJKA 1EFHA 1O58A 1VLHA 1T9HA 1MCZA 1T25A 3PIRA 4GPEA 5K51A 5A3SA 4MVWA 1SXJD 3OMXA 3X1YA 3OF3A 5K2OA 1ORWA 1WIWA 2A4MA 2WKPA 4O33A 4DNXA 3HXTA 3IIKA 4LDPA 2ZSFA 1RCUA 1OJ7A 3L8ZA 4ZO6A 5BT9A 3WLEA 4HNVA 4BVLA 1KI9A 2AT1A 1OTXA 3DNMA 2D74A 1OWMA 3F0TA 4MJLA 3HA2A 3W6OA 3EZFA 1SPBS 5EZ6B 2MU1A 1I01A 3BCRA 3VHXB 2MHCA 4WXYB 2AUNA 2GERA 3L1KA 3TAUA 5DM2A 1LJLA 2Z2ZA 4ZZ3A 2Y1LA 3SX2A 3FDIA 4ZVVA 4LZWA 3DLHA 2LP4Y 1XXHA 3HZRA 2WG2A 3GVHA 1T10A 4FSDA 3F6CA 4KQEA 2IYYA 3H2HA 3KSRA 3PC4A 3N1UA 4IG9A 3A4TA 3Q7IA 1OR8A 4P81A 2H54A 5DBOA 3GH1A 2REQB 3NKLA 4IIHA 4F60A 5TEWA 3ECSA 2HBRA 3PR3A 3H3XA 1NKSA 2I2FA 3AWDA 4OHCA 1USVA 1DXHA 4B76A 2EX1A 2EG5A 2Q41A 4DJEC 2BCJQ 1MJGM 1O94D 2DGDA 4MWEA 1GAWA 1JUDA 2Z4RA 2NZVG 4IJUA 1L2TA 3CZQA 1RKVA 4NAUA 4RHXA 1X8XA 1PL0A 4E7OA 2FPLA 2VHCA 1J90A 4V0ME 1NKVA 1PJBA 3IVMA 1JDJA 2BV3A 3A2NA 2C5LA 3PDUA 3OJ0A 3RUFA 3QEAZ 2PVPA 2RGCA 3KYCB 1OPRA 4YAEA 1IJBA 2AXPA 1CUJA 2GNAA 3DKVA 3IYLW 1UXOA 2IXEA 2QA5A 2GPYA 5IAAA 5LOVB 4MITA 4O4HB 2H11A 3SR3A 3FZGA 3IDZA 2VDNB 3GMSA 2C3MA 3MIZA 5B3JC 5FAKA 1W0JA 2CCKA 3UG7A 2OV3A 2O2HA 1LZLA 3HB0A 3A6LA 4CHTA 5BWNA 1AGYA 2R11A 2W4QA 3W5IA 4GGOA 1GA1A 1W4AA 4L8GA 4UM8B 1DL5A 4Z54A 2YHIA 2OQVA 3OTOB 4RKEA 4AF8A 3PDHA 5KHLB 2PQMA 1ECBA 3DL4A 4UHBA 3PRYA 3MJ4A 3IP6A 4HAUA 3I2GA 3RAGA 4BZZA 5BT8A 1BA3A 1V4NA 1CLUA 1CZOA 3GPCA 3F5SA 3UANA 3VO1A 1EUCB 1KH2A 2BHNA 3NBFA 2QUZA 5AKEA 4A1OA 4RGQA 4X6XA 2H3EA 2E5WA 3W8RA 3ICPA 2K2QB 1Y6ZA 2PWAA 2PD6A 1WMAA 2CZCA 8GPBA 2ATVA 4CQMD 4JASB 1ZHOA 4ZQIA 1WWKA 1YKSA 4JB0A 1GEGA 3D7LA 1WD5A 3Q4GA 3IH5A 3UMVA 1HDZA 1Z16A 3IQEA 3SDSA 5HZMA 1GUBA 1V8DA 1O03A 1ES9A 1X7WB 3E7PA 3E84A 4MPPA 5CIWA 4GL2A 3C5WP 1YFLA 2W2MA 1EGMB 4KMOA 3IVRA 1CS4C 4WNAB 4Y9RA 2UZ1A 4YUVA 3G7SA 3BFVA 2PGIA 5FOTA 5SZKB 3EA4A 2PHZA 4BNFA 5JRDS 3LYUA 1WMDA 5L3QA 2O06A 4TS1A 3FH0A 2CSUA 3OZCA 4HUJA 3X1DA 2XGJA 1V37A 4V0QA 1E8MA 4E5UA 5C31A 5AWFC 1L0BA 1DRUA 1DQYA 3PL1A 3ZCVA 7AT1A 4Q01A 3TW8A 1ZC3A 3GPDG 4CUKA 3ADDA 3ROMA 4BNGA 3OQPA 3UPTA 3RR2A 2O2JA 4L5JA 1N0VC 2VOEA 4L4SA 4HEQA 5BUSA 1YS1X 2O7RA 3UJ9A 4IDFA 3RS2A 3QBDA 1JG7A 2VK4A 3RKSA 3TQQA 1NSFA 2JHPA 3VDXA 3VYTB 4P92A 4UU7A 3T41A 1TYDE 3DV0A 5JZMA 3GB9A 3VR2A 5TGZA 4HDKA 4UHJA 4OP1A 3L8DA 3ROGA 4WZAA 5K09A 3HTXA 1JQLB 2PUGA 3LFHA 1S2NA 2ORYA 1UP7A 5TMDA 4TYMA 4R9SA 3H65A 4AWAA 1JW9B 2BBSA 4EY6A 1LC0A 4CG1A 1UBGA 1NHWA 4LE2A 2Q3MA 4L7QA 1OXVA 3BA1A 1M6VB 1ESMA 1QJ4A 1Z0AA 2DCMA 2QMEA 4O1MA 1HUQA 4JX8A 1T34A 2GM3A 4K9OA 3OWOA 1P7YA 2VH5R 1DZ3A 1SK9A 4O2LA 4PAGA 4QRIA 1XEXA 4CEHA 4ZEXA 4FGSA 4P84A 2PWPA 1CUDA 4KWIA 1XPRA 1DCFA 1JMVA 2EXXA 3D6NB 4NC9A 4UXHA 2AG6A 4C4YA 3OZIA 4FMCB 1AE1A 1QE0A 3GLTA 3L1IA 4M1KA 4L0CA 4PW0A 2WAYA 1X9GA 1V39A 4W8OA 3ZS9A 1JTEA 2ZRKA 2GAIA 3TSAA 5EKTA 3JS5A 3BF7A 1Z9BA 5KCMA 3ZIAA 4MQMA 1A1VA 3AR7A 3SOPA 4X6YA 3D2BA 1VGRA 3W5AA 1Q20A 2I8CA 3QVKA 1N9GA 4LQ4A 3WWZA 5JQGA 1DJPA 4CFYA 5FBQB 2XECA 4I55B 3KWFA 1PDVA 3GCZA 2YMLA 4NARA 3WIEA 3U7FB 2EV9A 1SOAA 2XHZA 2VYND 2YXEA 2REBA 1VLQA 3GI1A 1DDIA 3A26A 4DV2B 5JNUA 1T1GA 3D6AA 3IQDB 4LSMA 4PZUA 1MTZA 4Y2YA 1GGJA 4ZJUA 1BHSA 4JSTA 1P62B 2ORWA 3NC4A 4IDPA 1UOEA 5B7NA 4CL2A 2AOXA 1JV2B 4NXNB 2WFLB 3IMKA 3TX2A 4U2KA 1UBJS 3CO5A 3WNQA 4CMHA 4EG5A 4BNKA 4C78A 3TIVA 2QMOA 5H80A 4H35A 4WE3A 1VIMA 1QFZA 3G0IA 2I91A 4HNUA 4JC5A 5KVVA 3IMFA 2Y93A 2YWRA 3T9DA 5EWLB 2BSQA 1N6OA 3I37X 1CB7A 4OI0A 2NV2B 2Q28A 3EWAA 1NE2A 4JIGA 2ODPA 1Z5PA 3V2GA 4DCMA 1Y6GA 2UXBB 4W82A 1U8YA 2FVXA 2A86A 1KMHA 4RY8A 4ZYLA 1ZM7A 1NYRA 3FUUA 4ZI5A 1P0QA 4TLLB 3AFHA 2PBZA 3KUCA 3MQ2A 4QU8A 2WWVD 3VU1A 4X7BA 1A2BA 4TRMA 4OGLA 4KQGA 4C0AC 1VL8A 1DKUA 2G72A 3CPEA 4Y30A 1RHJA 4YALA 5EGNA 5JSKA 5AUQA 3K35A 3DD5A 5E0KB 1H1LB 1OX5A 5IM5A 4EGSA 4UTZA 5ALOA 1GQSA 1QM5A 4M60A 1FY2A 2LNDA 4FNMA 4QASA 4X62B 2ZSBA 1JKIA 2AMJA 1AS3A 2UAGA 4XB1A 2ACKA 2VUHB 4XUCA 3RBVA 1RI5A 1U3GA 4W7SA 3CM0A 4I9NA 4JUFA 2EGUA 2NSHA 2NO4A 5CVVA 4IPTA 1MQSA 1UIMA 2WM9B 3PE6A 1QAOA 1JR2A 1XLTA 4MW4A 4K6CA 1G63A 5J59A 3R7WB 2ZPTX 2DVMA 3P26A 3C1UA 2NPFA 1QZZA 3NAGA 3OX2A 1TVKA 5A05A 1BOOA 1FUUA 1KY3A 2BRUA 2CNWA 4BJ6A 2ZITA 3LLMA 4WN9A 1I4DD 2CL7X 1KU0A 4TTRA 2NU8A 2WOOA 4RAQA 3RG2A 3VYVA 2BGLA 4UEJA 4BB9A 4R16A 1YOVA 1NN0A 3B82A 5D5HA 5KYUB 4X20A 1G8KA 1NQVA 2Q0HA 3NYIA 1R12A 5A4MS 5I7AA 2PK3A 2F62A 2JFBA 3D6HA 3AVXA 2QG4A 3WJAA 1XKXA 2G3YA 3JZFA 4X1KA 2O23A 3TTYA 5LNK1 1ZBDA 4C9BA 4E94A 5HW0A 2GBIA 1QHFA 1AQYA 1TZKA 1FBNA 2HXSA 5AOBA 1DOZA 5F7ZA 3QKRB 5JCOC 5LIPA 5CU7A 1G8AA 2EQBA 2JI4A 4YGXB 4OU4A 3FCYA 4CG3A 2OP1A 4O5OA 1VJTA 2Y1DA 3C3WA 3DO6A 3IKLA 1PYOA 2AJCA 1XYVA 2B78A 3DM5A 3OUTA 5TXGA 5ARBA 1AQUA 4N39A 5L7TA 3GLFA 1I4WA 2YC4C 3QOXA 3KOOA 1MV5A 3PNOA 2KWIA 4KN6A 1HG1A 4RKWA 5FA8A 4PCLA 5HK8A 1ORVA 1I2CA 3D5QA 1L4KA 3PX2A 3TLCA 5AUNB 1P9LA 2UYYA 1U98A 1YJAA 3I32A 4BFYA 3KEOA 1K5DA 1DBPA 2C3OA 3DVLA 3SYTA 3NC1C 2PDAA 2C9DA 4UASA 2C92A 5E2AA 1CP3A 1Y7TA 4BATA 4J2OA 4DREA 1HH4A 1YZ3A 1V95A 2GHIA 3BIOA 1DBIA 1XQWA 1YACA 3EOAI 4TWAA 3T7TA 3BWDD 2WKQA 3PF9A 1ZGJA 2P2YA 4CEJB 3CH6A 1JMYA 4NECA 1PO7A 4L5BA 3UJNA 1NQUA 3QVXA 2ZRQA 3AYZB 3DR3A 2G1KA 1N3BA 2XMQA 4Z7NB 1X7ZB 4EEKA 5HKKA 4BPBA 1Z56C 2CF6A 1PDOA 1CQWA 3FHCB 3HBFA 5BNFA 1KP2A 2HJ9A 1GGKA 1EWKA 1MG5A 2LGJA 3LDUA 3HMQA 1QOQB 3D0OA 2V7BA 3D0KA 3BXGA 3IO3A 3MT0A 3HYTA 5HR5A 2EGHA 2A5YB 3R7LA 4DUYB 1RRKA 1R8XA 4G25A 2B92A 3PQ2A 3ULKA 3WBBA 4DZRA 3C14C 2M6LA 4MPRA 2I65A 2V3VA 3ODPA 2NPOA 3PQ8A 4ZI7F 2BFOA 3TQHA 2BE7A 5CVDA 1ZRNA 2C31A 2RHCA 3CONA 4CDGA 4XYGA 3DOJA 3NP7A 2XHEA 4M46A 4ZGWA 1XI2A 1N0WA 3H2GA 3EIFA 3L6OO 3M49A 2W2NA 1MV8A 5F5XA 4EFMA 3ZG6A 4BP1A 3DTYA 3LX6A 3QXSA 4FXPA 4RIHA 4PZZA 3GPLA 2B5OA 1LW6E 1MXFA 2C99A 4U6NA 4AMYA 4BDSA 4CMIA 4ZJZA 2CV0A 2XQJA 1QSGA 3LHDA 4JODA 1HA3A 2WNIA 3NR2A 1C9NA 2EZ4A 3WDLA 1V1RA 4JLKA 4CIVA 4EO7A 3IO5A 4YEDA 1Z4PX 3P5BA 2OUKA 3VZPA 4YT5A 3MUNA 3ZZ1A 4RH1A 1GUAA 3UPUA 1V8FA 1XP8A 2RGYA 2VSXA 3OEED 1TUGA 3A8TA 2K5UA 4A2PA 3BMQB 4D0GA 3UAXA 1GTVA 1UBRS 1TEZA 1PWHA 4BWYA 4GOLD 3WZLA 2NZYA 3KOMA 2XLBA 3VR6A 4CT0A 3SFVA 2ZUFA 2FEXA 2QMUA 4TSFD 3TW6A 1N2EA 2NV0A 4Q4CA 3PUJA 3R5JA 2WUVA 2W8ZA 5AM2A 2GBLA 2ZJFA 1RZ3A 4RGBA 1Y5RA 2PIDA 3EPLA 1BNCA 1BU5A 2Q3CA 3B1XA 3G1TA 4HAOA 3VISA 1FTWA 3GHYA 5KYVA 1P80A 4UCFA 4CE6A 2QTVB 3MUFA 4J0IA 5CA0B 2JI7A 3HDHA 1WS6A 1OB2A 4IW3B 5FX2A 1YI8A 3HFGA 5D1NA 4XPIA 1OTHA 1TMYA 2JLXA 1QVZA 3KHTA 1NT2A 2OHHA 3GQVA 2BMAA 1NJ6A 2NUBA 4D1YA 4DWJA 3ACDA 1SGWA 1O08A 1DXOA 3L8CA 1I0ZA 1MTOA 2GXUA 3ODGA 3EGOA 4J7AA 4UE2A 3WBKA 4DRZA 1EGVB 1M1YB 4F1WA 2B7LA 3LC1O 3QLTA 3E0QA 4QTTB 2C2BA 4PTLA 3AB7A 3ZE8A 3W8DA 1QO0A 4KYTA 1UXHA 1Q1QA 4AB1A 2H1RA 2RC6A 2C5EA 3PF8A 3L0BA 3HK2A 1GR0A 1V1JA 2OV2A 4RELA 1Z25A 4I4TB 4AO7A 2W6ZA 4X71A 3FUVA 5H7XA 4P4GA 3NHSA 3W6UA 4EKDA 3WGZA 4YWJA 3RW9A 4W99A 5FHQA 4ARAA 3R20A 5FQOA 4XX1A 1ADCA 1O87A 3DKIA 5AVQA 5DNYB 3G88A 4P4SA 4WEOA 4LV6A 4LC0A 4GM4A 3GEBA 3MGGA 1MB9A 4C0LA 4IDEA 2Q7XA 2G70A 4M1QA 5LJIA 1MIOA 3AEZA 2QYTA 5FOXA 3BB3A 4TLEA 2GVZC 2IDMA 5BYBA 4YAKA 1YQXA 2PH7A 2HIAA 2Q9BA 1C9YA 3F78A 4IQ0A 3RGGA 3WL8A 2O8EB 3KYDA 4YJ2F 3GWZA 5C9ZA 4RVCA 2F1JA 5HPYB 5K7SA 3K6SA 1SQ0A 3ZV6A 1UMBB 1DBVO 1SC1A 2DWUA 2X7JA 3A31A 3UYKA 2RGRA 1EFTA 1FTSA 3IVGA 5AHOA 3G2JA 4YRAA 4Z3KA 1T1EA 1MRNA 2AB0A 4BS9A 1JR6A 2QLBA 3RSOA 3WWOA 4M9RA 1Q14A 1UK7A 1G9TA 1M76A 1Z3CA 2P79A 3N58A 4Q3DA 5E0OA 1BOFA 5G1PA 4D3ZA 2W8BB 2HJVA 3N75A 1U99A 4DCOA 4HNAA 1EBBA 1AF7A 3PKZA 1KQFA 1YVRA 2HD4A 3BK2A 3FSJX 3E9EA 5FQNA 1RI2A 4O4JB 5KPDA 3HWX1 3TD9A 3GRRA 3O83A 2FN3A 2VXBA 3ZHVA 2BDTA 5BW8A 2Z8XA 1S9HA 5BNWA 3HLYA 5KIAA 2FWBA 4AZ3B 1JI3A 1YRQA 4KTTE 5DTEA 5K4GA 2IP1A 4CV1A 1LSUA 2PGDA 4GLOA 2XIQA 4R7TA 1IZZA 2HX1A 3L7DA 3PGLA 3D1VA 4Q9AA 3COWA 1G6Q1 1Y5MA 3TBFA 4PGAA 3L8HA 2V4MA 5B2ZA 3GUVA 2AVDA 1WCIA 4PS0A 1B42A 2ZYIA 1SXPA 3ESBA 3VZQA 1Z7GA 4HLCA 3E9ZA 3I04M 5EUBA 3PIIA 1DU4A 4H1UA 4OHFA 1PE0A 3D6VA 3LWNA 2Q6VA 2W2LD 2FMKA 2C7OA 4MAFA 4ZRNA 5EE9A 5DHQA 5JZ9A 1ZAKA 2QMHA 3O3MB 3V7WA 3F3MA 1CPYA 5JATA 5JSZB 1WEKA 5EMLA 5AYVA 1D9ZA 4KX5A 1WQ1R 4WBNA 4F97A 3WGHA 5BN1A 2MSNA 1XB2A 3QELB 1ADGA 4B3SB 5B1EA 4Y2JA 1T3SA 1QE5A 1W0KD 3Q9SA 4HQRA 3CXRA 2BCEA 4JT4A 4Q3LA 3DEFA 3COYA 2C1ZA 4MKHA 2P5SA 2LV8A 3DP7A 1ZY2A 1E59A 5FB3A 3RJ9A 2XQKA 4MW1A 1R6XA 4ND8A 3D5EA 5J2UF 1QKKA 2PV0A 2XY4A 2R44A 2J9FA 4FFPA 3CG0A 5CDFA 2AZMA 1DHTA 1XXHB 5DTQA 4F9GA 4Q1FA 3RBAA 3V1MA 3TZEA 2XCTB 4DB2A 5EEHA 5FKJA 5BXYA 1GRVA 1OBVA 2YFKA 4S1OA 3PCTA 5I7OA 5JADA 2PRYA 1UWLA 1GCGA 1YZNA 4PU0A 4BPRA 1MQAA 2GPJA 3FTQA 4PFSA 5DHAA 4LBWA 3G82C 1T2FA 3ZEIA 4AQ7A 1M0SA 5I9IA 3G0CA 2IU4A 3C5CA 5BORA 2PUJA 5LFAA 1SIWA 3TECE 3GC6A 5HFAA 3A4YA 3PNPA 5EJAA 1CUZA 3T4EA 1LPAB 3WDKA 1NAIA 4Y6OA 4WKNA 4DQDA 3JSAA 4FVTA 1I4TD 2FXVA 1MEOA 1C4KA 1INLA 2P3OA 3FSGA 2AN9A 2LBPA 3ZCXA 3H8JA 1AGRA 9MHTA 3HBNA 4QLBA 5IZCA 3PQ7A 4I9HA 3WNCA 5EIAA 3G0DA 4O8CA 1RHRA 4WK6A 1RJ9A 5FPSA 5DT9A 1A8IA 3DTVA 3E82A 5DIZA 5AJYA 5ALZA 3KFVA 5E6RB 1NJSA 1VPLA 2H29A 2CHFA 2IVFA 1ACMA 4G5HA 5JC1A 2RBGA 3DZGA 2L0XA 3MGCA 4X60A 1OXKB 2GEBA 1YZFA 1AGXA 2YMPA 3HBAA 3RSSA 1AHNA 4KQIA 4Q34A 1FFDA 2GT1A 1W88A 3A1WA 5HNKA 1SXHA 2PWBA 5JMTA 1E3LA 2JZOA 1KJ9A 3P5SA 1CRPA 4PRLA 3ZHXA 4X8LA 2JDIA 4OJTA 4DMGA 5L3RA 1FVHA 2OT3B 1J9ZA 2VN8A 3GL9A 3DQQA 3NT2A 5K6RA 4M9ZA 4AJOA 1PBTA 5EZSA 5FFMA 1KZGB 3EA5A 3QPAA 4GYKA 4I81A 2ATEA 1V11A 3INYA 4MNTA 1HRDA 1KRXA 2GARA 4LOKA 3DZFA 5G0TA 3BEOA 4QJ4A 4HEJA 4R3WA 4HNGA 3B6MA 3P52A 5DB4A 4Z4QA 1XZPA 1ISGA 1EUQA 5MHTA 1T2CA 1T2UA 2M2IA 1E60A 2Y1EA 3OT1A 3QM1A 3D8BA 4Q1EA 4Q12A 3TXYA 1YJ5A 3EGCA 5ALVA 4UUBA 1LBEA 3WYDA 2G4CA 4QHSA 4UEWA 4A82A 4CL3A 1DMRA 3KVVA 3MGAA 4BMSA 4POOA 2D8MA 4PC3A 4CF4A 1G3UA 1HYEA 4IGKA 2VP3A 4TTQA 2NZ2A 3SQOA 3RRBA 2C0CA 3ZW8A 2XKKA 4NV3A 1QTQA 5T64A 2A35A 5AVZA 5L6MB 2G25A 3BPSA 4G5QA 4EGFA 3U7GA 4B6OA 1FU7A 3QZUA 3R41A 4BGDA 2BFNA 5I8PA 3ZVNA 2GCIA 2PYZA 1SKBA 3O03A 1RZRA 4HGOA 2J6CA 4X45A 3V4ZA 1TL7C 3MT8A 3WFJA 3S8MA 4PPGA 4IDDA 2I6XA 3WV4A 3DOCA 3CSSA 3AJ9A 4ARUA 2OHFA 4TXJA 3TDNA 4BNXA 3FMVA 3UCFA 1KI3A 2GASA 5FO0A 4EELA 4MVJA 3RHFA 3TLMA 3E8SA 2P1DA 1Z0ZA 3ICCA 4JP1A 1E2FA 1CZUA 3BWCA 2OXRA 4ML3A 1T0BA 1VMIA 1XQVA 4CTJA 1V5GA 3INNA 3AUAA 2B36A 2NZWA 4RX1A 4PINA 2NVBA 4DV4B 2P0AA 3D0RA 2B1RA 1FFCA 1ULTA 1XK6A 2F64A 3VH1A 4TRJA 1T6YA 4B8YA 1S5PA 2Q2WA 3CLKA 3ND8A 4K9MA 1TADA 1G5PA 2XNJA 4W1RA 1J6UA 3RIXA 2GEFA 2HREA 2HU2A 1A9PA 4XSVA 4NCHA 1FMCA 3CLRC 1Z2EA 4R1PA 3GGCA 1TKAA 1XYYA 1GTMA 3H8WA 2V58A 1BU8A 1VKJA 1IVSA 3DEAA 4NDAA 3C98A 3OPYA 2OMEA 1X15A 3AL0C 1B2LA 1MORA 5FCDA 5GZ1A 4OHBA 5KX5A 3P45A 3PQ4A 1X70A 4NKRA 4TQAA 3I0ZA 2HNAA 1GPLA 1JR3A 1ZZEA 1JEDA 3FROA 4LBZA 4RXMA 3DDZX 5A7HA 1RCTE 1GPKA 3Q6MA 2AF4C 4ENPA 2IP2A 2X1HA 1YQEA 2UZ3A