4F06A

Crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
368
structure length
368
Chain Sequence
DTIKVGVIGTMSGPYALFGKNYKMGIDAWVAEHGNKVAGHTVEFVYRDEVSPNPAQSKALAQELIVKEKVQYLAGLYFTPNAMAVAPLLQEAKVPMVVMNAATSSITEKSPYIVRTSFTMFQNTVPAAKVAKQKGATKVAIAVSDYGPGIDAETAFKKTFEAEGGKVVEAVRMPLSTTDFGPIMQRIKNSGADMIFTFLPAGPPTLGFVKAYIDNGLKAGGVKLMSTGDVVTEPDLPNIGEAGLGILSTYHYAVSHDSPENKAFLALLQKGGAKLDEVTMTSVAAYDGARLIYKMIEATSGKSDPDKAIAAVKGMKWVSPRGEVSIDPETRHITQNVYLREVEKVDGKLINRELETFKAQPDWGLAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular ligand-binding receptor
publication title Characterization of transport proteins for aromatic compounds derived from lignin: benzoate derivative binding proteins.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transport protein
total genus 130
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f06A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f06A01
5TQJA 2VUIB 1YS6A 3NNDA 2JRLA 3H5IA 3T6KA 1RZRD 2JVIA 3BBLA 4ETIA 3OM0A 2WJWA 5T7BA 5JS1A 2MYUA 1MAVA 5TPZD 1SXGA 3OLZA 2PLNA 4Z99A 5GQSA 1NY5A 4RWEA 1M2FA 3BREA 4JB2A 4JP1A 4O1HA 5TQ0A 2NZVG 4EYKA 3LUJA 4UHJA 1ABFA 2J48A 3MM4A 3URMA 1ZGGA 2YHBA 4MLCA 2L2QA 2FEPA 4G0XA 3F7NA 1SXIA 1PUXA 3RVRA 4ETMA 4Z4CA 2AYZA 3L6UA 4PE5B 1H9CA 3KCNA 3QK7A 5IX8A 5DLEA 3EDCA 3A3KA 2ID9A 4G0QA 1BAPA 3GV0A 4KZKA 1DCFA 1Z26A 3Q41A 5KQLA 3KSMA 3LFTA 3O1IC 5TQ0B 1GCAA 1E2BA 2NUBA 3EJWA 4F06A 1U2PA 1Z16A 4Y9TA 3Q7SA 2HQRA 3KLOA 4TLMB 4EVSA 1JDPA 1B00A 2LIVA 3CZ5A 1TM2A 3GT7A 4Z4IA 4N03A 1P2FA 1DG9A 3DLHA 5ABPA 4KFCA 3IDOA 4KV7A 4F3TA 5DKFA 2FW0A 5KQGA 3O21A 5DTEA 4ETNA 2CHFA 4IGAA 1MB3A 2IPNA 1ZVVA 2FQWA 4F12A 4RSMA 1SRRA 4YCSA 1U0SY 1SD5A 1LBIA 2I6FA 2IOYA 1APBA 5IULC 2CHEA 3VNAA 2IPLA 2MYNA 4CBVA 1AB6A 2PAFA 2PE5A 4RY9A 3C3WA 3QLTA 4JASB 1R8JA 3BILA 4EVRA 1Z17A 1M5TA 4H3HB 1QPZA 4MS1A 1S8NA 2LBPA 3HUUA 4Z9AA 2M1ZA 2W42A 2PMCA 3QLVA 3QEMA 4ML3A 4FE7A 4YR7A 3HO1A 4KREA 2F8TA 3O75A 3LUKA 1VPWA 5BRAA 1DP4A 3JS5A 2FMKA 2QU7A 4KRFA 4G0ZA 3H5WA 1LBHA 2FXIA 2M98A 3EGCA 3EQ2A 3FFWA 3O2QB 4JAVC 1E6LA 4MS1B 5C5EA 4KK3A 2RDMA 3RVJA 3LTEA 3QEMB 5JS2A 2FMIA 2R25B 4EGSA 1A04A 4Q7EA 4EYGA 4O5AA 4KK4A 1DBPA 3M9WA 3T95A 3TB6A 1LK0A 3CS3A 3EQZA 3E61A 4DADA 4YRZA 1ZH2A 3MQ4A 3KJXA 4PYRA 4Q6WA 5IUJC 2A9RA 1NXVA 3FFTA 3OLYA 5FWYA 4G0MA 2IYNA 2VYCA 3CG4A 4KQ9A 3SM9A 3SQNA 2HSGA 4JOQA 5KC8A 4Z4EA 3JPWA 1IIBA 5CNKA 3HM9A 1TMYA 4PZ0A 1GLGA 3JVIA 1L5YA 1QMPA 5IEJA 3IP7A 5JNVA 5FWYB 1JF8A 1Z2DA 2JBAA 3LKBA 1EWTA 1NATA 1UDRA 2PUDA 3LUGA 4GPAA 4XFKA 4D6YA 2TMYA 2R47A 4OBBA 1K66A 3NNNA 1A0OA 3G1WA 4RS3A 3RH0A 4EYOA 3N0RA 3H75A 3N53A 4LZLA 5E3JA 3JTEA 1RZRA 4RU1A 3DLBA 3F73A 2JBAB 3RVMA 2PUEA 2MYPA 2HPHA 4RDCA 5TPZA 3O1HB 1PNTA 1FSPA 1QP4A 1EHCA 1YMUA 3FMVA 2FQXA 3HUTA 3DGFC 1XWWA 2X7XA 1RXEA 3OMWA 1CYEA 3T8YA 3O1JC 4YWHA 4LE0A 1I3CA 4E7PA 1NXWA 3F6PA 5C5CA 2PUGA 2AYXA 4O1IA 1DC8A 5B3JC 2JVKA 3HDVA 3OMXA 3QEKA 4ZJPA 5KWSA 1KRWA 5EWJA 2PUCA 1MB0A 3DBIA 4EUKA 2Q5CA 2FLWA 3UK0A 1DRJA 1EAYA 4IMJB 3H1GA 4MRMA 4MS3B 3RVKA 3KTOA 4KNYA 1JX6A 4RK6A 4LE1A 1QQBA 2QV0A 5EWMA 3LUCA 1ZAYA 4NV3A 5KQPA 1BVHA 1DCKA 5EWJB 1OXBB 3IP9A 3MA0A 3LUDA 4H60A 4MRMB 5CNMA 1VKRA 3Q7TA 4OLBA 2QVCA 5GOTA 1F4VA 1Z13A 4Z4GA 1FFSA 4GNRA 4UHKA 4Z9BA 4OG2A 5IEBA 3HXMA 3FGZA 4MQEA 1DBWA 3I42A 2JVJA 3B2NA 3QELA 5KQMA 3QLUC 4MAAA 3K4HA 1URPA 2MSLA 1BDHA 3Q15C 1QKKA 3GRCA 1YK1A 1PEAA 3L49A 3CU5A 8ABPA 3HVRA 5IBQA 3CG0A 3KHTA 5TQ2A 1DCMA 1VLZA 1JWLA 4MQEB 4RXTA 3QELB 2E4UA 3C97A 1GCGA 3EULA 4OATA 4HNSA 3CNBA 1KMIY 1QO0D 4MR8A 4G0YA 3OO1A 1M5UA 3A0UA 2FKAA 4W5NA 3C3KA 1U04A 1Z15A 4EY3A 1FFGA 2H0AA 4FB4A 1ZN2A 2E4VA 1FQWA 5IUKC 1JL3A 3EODA 3JPYA 3QLVC 2WJAA 4D74A 3N0WA 2QVGA 3C3MA 2PL1A 1USIA 2P9HA 1ISSA 2A9QA 3RVPA 1TJYA 3KKEA 3I45A 1EFAA 4YP9A 3E3MA 3MIZA 5BR1A 5ED4A 4RKRA 3P9YA 3UKJA 4XARA 3CFYA 4S04A 3BRQA 3A10A 4LDAA 4MR9A 5FBKA 1NXTA 1RPJA 7ABPA 3KG2A 2FLKA 4B09A 3MF4A 2FMHA 5T3YA 4DN6A 3GYBA 3IPAA 3JVDA 5CHYA 3TO5A 3KLNA 1J56A 2NT4A 3CLKA 4TN5A 5JNWA 1XHEA 4W5TA 3A0RB 3IP6A 2ID7A 2ZWMA 3HEBA 3HDGA 4MS4A 1C4WA 2O20A 4RY8A 3G85A 2IDMA 3GA5A 3K9CA 2A9PA 1JFVA 3OLVA 3ROFA 1W25A 5BQ3A 2HQBA 1ZHHA 2FMFA 2HJ9A 5KI6A 2OQRA 1QP7A 2VK2A 4RXUA 1LJUA 2R4QA 3N75A 3NHMA 1ZY2A 3LOPA 2RJOA 2LUOA 2N9UA 3C6QA 4N41A 4RK0A 5HSGA 2IPMA 4M88A 5FWXA 2RJNA 2WY2D 3SG0A 5IUNC 4IILA 2KYRA 4MQFA 3HS3A 3CHYA 4WZZA 3D02A 1ZITA 2XDYA 3OQMA 2PUFA 1Z12A 3TD9A 1NXXA 2WB4A 1YVUA 3I5AA 5FBHA 6CHYA 4DQDA 4P1ZA 3KYIB 5TE9A 1M2EA 4ZMSA 3Q9SA 3CZCA 5FWXB 4JA2A 2F8SA 2H3HA 4LE2A 2B1JA 1U8TA 3MYYA 3HZHA 4LDZA 2CWDA 3N8IA 4MGEA 4N0PA 1JLKA 3LUHA 1E6KA 1KGSA 1ZH4A 4WXMA 3IPCA 3M9XA 1BDIA 1JFTA 1P6UA 1DBQA 3O2SB 4JB0A 3RVNA 4KPYA 3DGEC 1D2AA 2QW1A 2E4ZA 4XLTA 3RVLA 4TLLB 4N47A 3GL9A 4RV5A 3CRNA 1NXPA 1JHZA 3H5OA 1ZDMA 1C0EA 2FSPA 2B4AA 2RGYA 3H1EA 4OLAA 4EVQA 3ILYA 2PL9A 5TPWA 3FDFA 5B3JA 2OENG 2PUAA 4IRXA 3I09A 3GBVA 4HNQA 4KVFA 1ZESA 1F51E 5DCLA 4ZPJA 3CKMA 1JBEA 4QICA 1Z18A 1QNLA 4FE4A 3HSYA 4LX8A 4E7OA 1P8AA 2GX6A 2E4XA 3OLXA 5EWMB 3Q7RA 1RXIA 4XAQA 1CHNA 4N0QA 3S99A 1NXSA 5TPWB 1YS7A 4XASA 1QO0A 2V0NA 1U2QA 3GBPA 2FTKE 5HQJA 3GWGA 2LPMA 1BA2A 1ABEA 1JDNA 4IF4A 1MIHA 3H5TA 1KRXA 4RK7A 4S05A 4P98A 4WT7A 3H6GA 1JYFA 1RNLA 4G0OA 3SY8A 4RKQA 4MR7A 4YLEA 6ABPA 2PJUA 1TVMA 3QX8A 4TMYA 2WMYA 4RY0A 4RK4A 3OQNA 3QLUA 2HQOA 4Z0NA 2L19A 4YV7A 3H5VA 4KQCA 5JNUA 1YMVA 1GUBA 3QX9A 5F64A 5TQ2B 5PNTA 4MPTA 4OTZA 2FEWB 4G86A 4QYMA 3N6VA 3SNKA 4MR7B 4HNRA 2MSKA 3JY6A 4F8JA 1ZGZA 1NXOA 4N76A 1WETA 1K68A 4RK5A 4QPJC 4ZMRA 2R48A 3EAFA 1PHRA 3OLWA 4MR8B 1SXHA 4EYQA 3FFXA 3R0JA 1W9HA 5CNIA 4YO7A 3RVOA 4WXEA 5KC9A 1D1PA 3KS9A 4PEVA 3NBMA 3RVSA 5HM6A 4RXMA 1VRVA 3O2JA 3RQIA 4W5OA 3OQOA 4NQRA 1QP0A 2BGGA 3UUGA 1HEYA 3LMKA 2QR3A 2GKGA 1Z25A 2PKXA 3MMNA 4G97A 4MLDA 5DGCA 3SAJA 1DRKA 2WWVD 1BDJA 2JK1A 2NZUG 5CNJA 2PUBA 1YTUA 1Z2EA 1NTRA 5IC5A 4MR9B 3OM1A 1D4ZA 2LP4Y 3TMYA 1EWKA 3VNBA 2ZAYA 2JCGA 1MVOA 3CTPA 1CEYA 1DZ3A 3HCWA 2E4WA 3RVQA 3F6CA 2MSWA 4ZYLA 4G0PA 4D6XA 2JB9A 1PNRA 1T34A 1YK0A 3HJFA 4NCAA 2FEKA 5EWLA 1D5WA 4KMRA 4L4UA 2FVYA 2L18A 4Z4HA 1P6QA 2QZJA 3LKVA 1JYEA 3DZDA 3LUFA 1USKA 5HKOA 1EWVA 4YS6A 4MS4B 2GBPA 4L85A 5D2CA 5JNRA 2L17A 1OXKB 3T38A 3LUAA 3ROTA 2NT3A 2FQYA 3N0XA 9ABPA 1QQAA 4H3KB 3IP5A 5EWLB 2IKSA 1Y1LA 2A9OA 2GWRA 2WRZA 4QYWA 3O74A 2DRIA 2YHAA 4RZSA 2P4UA 2MYTA 3NHZA 4F11A 1D1QA 3H1FA 2IPAB 3KYJB 4HYEA 2QXYA 1E6MA 5BRJA 2E4YA 5JNTA 3TX6A 1TLFA 3BRSA 3H5LA 2GI4A 1AB5A 4MQFB 2FN9A 4YGXB 1A2OA 3HV2A 1ISRA 4NICA 1DJMA 5JNSA 4NCBA 3NNSA 3W9SA 4WWHA 1FFWA 1GUDA 2VUHB 4LRQA 4Q6BA 3M6MD 2QSJA 1JH9A 4Z4FA 3OO0A 4PICA 5I4CA 3D8UA 1YIOA 3H6HA 3HK2A 1XHFA 4MYRA 4WUTA 1L5ZA 1USGA 1DC7A 1JFSA 1PEYA 2FN8A 1LJLA 3ILHA 4RK1A 4W5RA 4XXHA 2CD7A 4MS3A 4W5QA 4IMIB
chains in the Genus database with same CATH superfamily
4F86A 2J5QA 4RNDB 1M2WA 5CGQB 3QVUA 3EY4A 1RZRD 3NU1A 3VI3B 3U37A 4QVIA 4HPJB 1C1XA 1L4EA 1YZFA 1JLLB 5JH7A 4GVXA 1V96A 2G3YA 1KO8A 3PKJA 4E5UA 3FROA 2GLUA 4LCEA 4J29A 3SLRA 2FP3A 4LYYA 1BMDA 2Z09A 1IB6A 3JR3A 2E49A 3PT5A 2Y2UA 4S2UA 1OFUX 1P2GA 3LUJA 5F2OA 2O9JA 2ZRFA 5A3SA 5F9MA 5BVGA 1O5OA 2W22A 3WK9A 1XU4A 3WG9A 3ZOZA 1U3TA 5L9AA 2VQFB 1A7UA 4GZ6A 4PLVA 4AKHA 2PZGA 3E3AA 4MCJA 3TLGA 1DCFA 2JEZA 1B2RA 4ZRMA 4MKGA 3FZYA 1U5CA 5I5GA 5EZ6B 2P79A 4YCDA 4CEJA 2DHDA 5JH7F 1SVNA 1G8YA 3KLOA 4DREA 4EVSA 1EUCB 2RE8A 3ZWBA 1UDXA 1KO5A 1MZPA 1TM2A 3GJYA 4PC7A 2A86A 1A1SA 2GKOA 4FKMA 3RJMA 1DAOA 1SUBA 3GDHA 2C42A 1U9YA 3CLHA 4L78A 3IDOA 2QG6A 3BIFA 1YQ9A 4MIKA 3V6MA 1UPAA 2EARA 4HFRA 1HK7A 2FPMA 1KF0A 3OJOA 3U7JA 5J43A 2FQWA 3PXAA 4E5PA 4QECA 4RQTA 1WZ2A 3R6LA 1SRRA 1JLHA 4UEKA 1SD5A 4EO4A 2XJ9A 4PCLA 1YVDA 1IZ7A 5FLKA 1LFDB 4KACA 5IAJA 1RADA 3LUPA 5HJ2A 1X3LA 4LEIA 5DBHX 4G8JA 4ZPXA 1FMCA 3VAAA 1SHZA 4PG6A 4Q3AA 1Q0LA 4MI3A 3FMOB 5ALGA 1A2BA 3RC1A 1AIPA 3LPNA 4Z7NB 4RJ2A 3IVXA 2WJJA 2C95A 5JRJA 2UZ0A 3DWGA 2C5EA 1P5ZB 2QMUA 4PIPA 4QUKA 4WA7A 4O4JB 4GFDA 5AP9A 1X7ZA 1QHGA 4KI0A 4DDWA 2FX2A 4BFZA 5DBGA 2Q45A 1UDCA 2X1LA 1K5DA 1E6EA 5BYJA 1N4AA 3DWFA 4D41A 3AVWA 1NSFA 4YAJA 2J31A 1RWMA 4MHSA 1L7DA 1EA5A 4YMWA 2B9VA 1XQYA 2VEOA 1IVSA 3O8OA 4KIWA 4UNQA 3ZWCA 3CW8X 1SUCA 3KLPX 3ETNA 3QEMB 1PT9A 1ATIA 4YY3B 2CLHB 2AT1A 1SK9A 5M34A 4UM7A 3ZDEA 5KTMA 5AMXA 2AG1A 1UPFA 4BOYA 3FUXA 2YIDA 1KOGA 4OPMA 1MJ5A 3P4YA 1XJQA 3EXIA 2FZ4A 3DHEA 4YONB 1JAHA 1KZ7B 5HJ7A 1AURA 3L4BC 3S2SA 1WXIA 3ABSB 2UZ4A 3RDPA 2AWNA 3RS9A 2XB6A 3QFCA 3CW9A 4EI8A 4KE9A 4KJZA 3TSCA 4R8VA 3DLTA 2HV8A 1DO2A 3SC2A 1XRJA 1FQOA 5G4KA 4PAQA 1ONNA 1B8NA 1XCOA 2KPOA 4EQZA 2BFMA 3AM3A 3NOQA 2OCYC 4MKHA 1PDVA 3SXJA 2YQ5A 5JJIA 1WU8A 3IQEA 4B3XA 4PFQA 2H0RA 1LSOA 1N6OA 1SH7A 2BF7A 5ARCA 2Z98A 4KP7A 4QIHA 5GWXA 2O4CA 1XDBA 1OTXA 2YASA 4TYPA 4R5MA 3K6SB 1NUQA 1G21A 1JXMA 1ONBA 3N3BC 3RNOA 4K03A 1QZXA 4D6YA 4YCCA 1A0OA 1NBMA 2XBMA 4C3UA 1W73A 3OE1A 3GLHE 5B58T 5EIBD 3ETJA 2B2CA 2GN4A 3WGHA 4D4LA 2B4KA 1ZA1A 3AFNA 4IJVA 1EUZA 3BF8A 2F48A 4YRSA 3INGA 2ZG6A 3E5HA 5IHXA 1QDLB 3RVMA 2G1UA 3ICWA 3NX4A 2MYPA 4IH9A 1PJ4A 3VR3D 2PUEA 5AW1A 2WNHA 1PEKE 2JGLA 1OLXB 1OX4A 3P9IA 4J3FA 2Q9AA 1FS6A 2ZTSA 3RAJA 4F9EA 2EVWX 2FSUA 3O31A 4Y2JA 3GO4A 5AK6A 3D3QA 4G37A 2OK7A 3V1TC 3EIWA 4INPA 4YWHA 1M8PA 4G8BA 4BNDA 4UUBA 5P21A 3VUFA 2FSVC 5HRAA 1YASA 2C92A 2CFSA 1W88A 2NU7B 3HE3A 2OBFA 1EFPB 3FOEC 1GTVA 4EUKA 5F78A 1IQ0A 1Y48E 4GIBA 3VR2A 4DJ5X 4GR4A 4INOA 2QJWA 1MOSA 1Q84A 5B4UA 4K1LA 4IKOA 4QDXA 2XA1A 1BRMA 1GO2A 2Z2IA 3H4TA 3ZK7A 1HOTA 2VQ3A 3DM5A 5LD2C 1EQAA 3UGTA 1PQWA 4IWNA 4NBRA 4U9HS 4ZRNA 5KQPA 2RHRA 4FMCB 3M4YA 5FQOA 4E13A 5CX1B 4NV1A 3IP9A 1AX9A 3RJZA 3BHJA 4JA0A 1FFCA 1H66A 2V9PA 3E22B 3OTWA 2QV7A 3PNLA 1Q5PA 2ZWOA 1NULA 3Q7TA 1MN6A 1XE3A 1DXOA 2QVCA 4DG9A 4OLBA 1FA9A 2DQSA 4QDTA 4DA4A 3PSAA 1KQGA 1IULA 5IEBA 4JEUA 2B30A 4HUQB 3AOEA 2C7QA 5DVZA 3WBFA 2HJWA 4DLLA 3QIVA 4V03A 4V2UA 5HNKA 2EKDA 3M9LA 3K4HA 3MB5A 1UZLA 3PD0A 5FPPA 4Q9NA 5H70A 4CDRA 3I53A 2PGJA 4R2IA 1XZIA 4EMTA 1LI7A 1UFKA 3OCZA 1E9CA 3VJKA 2BH2A 5HIIA 3WYNA 5TQ2A 1TQ2A 3IURA 4MI1A 1G4HA 4XGIA 3CNBA 3DKRA 3NJ8A 1UIRA 1JFFB 4BNUA 2VWGA 4B31A 4NABA 4UM5A 5SICE 3LBIA 3K2IA 5ILOA 3CRW1 1V5GA 5BP7A 3CX6A 3IKLA 1D9ZA 1X8LA 2YJ3A 2PKWA 1F2DA 4Y8VA 1UJ5A 5KJEA 1PV4A 1TAQA 4IKEA 2OB2A 2HSDA 2JCYA 1ZNZA 5F2EA 5CDGA 2AC4A 2P27A 4AROA 5FI3A 2O3SA 1DDIA 2WQZA 2JIRA 2WTEA 1QGAA 3EC7A 3M70A 4IOJA 4AJKA 5D8DA 2I2XB 4DKXA 5IABA 2Q28A 4XLZA 3IIJA 2A9JA 4BWFB 4QUHA 4KKXB 2UUAB 4PC6A 5CYOA 2QQ0A 3UA3A 3R6WA 5A62A 1UDAA 5KREA 2NXNA 1MABA 2BUBA 3TSZA 1G8MA 4JJ8A 5NLLA 1ISMA 3F6BX 3HCEA 1EFVA 1V1RB 3WYAA 4B09A 3N05A 4BTVA 4ETWA 2FMHA 1YUBA 5EEGA 3LF2A 3G5UA 3UWKA 4E1AA 4ZI7B 5J2TB 1RXCA 4QVGA 4B3RB 4CMJA 2HWWA 4KQEA 5IXYA 2YHSA 1G17A 3FHOA 4FC7A 4CHTA 1KZ6A 1IN7A 2QJFA 4IVNA 1P31A 4FCTA 1II8B 4L8YA 5JANA 1OYYA 2WPDA 5HZKA 4MS4A 3PIIA 5BSWA 2GD1O 2AQIA 2H3EA 3P2EA 5A9SB 3HN6A 1VHQA 2W2LA 3TR0A 1W25A 1XTRA 2GPAA 3SJUA 2VBCA 2NP6A 4GBJA 2NG1A 4XD7D 4BFXA 4CLDA 1VKZA 5CUQA 4DMKA 3LA6A 1XF1A 1Z75A 4QO8A 2QLMA 1U90A 5SY4A 2HU8A 2FHSA 2XOEA 3L6BA 4FFMA 1K63A 3FNHA 4QQ8A 4MMYB 5ERGB 1GYPA 2A94A 4RXUA 2IHYA 4JQZA 1TQDA 4YAKA 4Z49A 2A1UB 2QD2A 4WLOA 1ZM4A 4WLEA 1D9XA 2F4NA 2PWBA 2QN7A 2EFYA 4L9RA 2J0UA 2C2YA 2OAP1 3RT7A 3I4FA 5KPDA 3PE6A 3L79A 4HGNA 3R3HA 3QVLA 2VZ8A 5EJFA 3TZCA 1PVVA 3SEQA 1Y4ZA 1N5MA 3NBAA 4UU8A 4Y1GA 1LPMA 4F9FA 3DAOA 4QGAA 2PZMA 2WV9A 3EBOA 4L95C 4JXZA 3BJMA 5DK6A 3ZS8A 3Q9SA 4U02A 3X0DA 1WLSA 2C3UA 4ND8B 4W7IA 5AK4A 2X6RA 3AEZA 3PE4A 4BNVA 3ZDXB 3MFQA 4ZVOA 3S27A 5A5VA 2G0AA 2J0VA 3PRJA 1D5CA 1FNDA 2IEBA 4FSDA 2FW9A 3HLKA 3LUHA 4Y0AA 5H5JA 1KRHA 3GFPA 4RY2A 4YCMA 3A27A 4B4KA 3L2OB 1K8RA 3FLAA 2C1EA 5CM8B 5DNCA 3DEHA 1Z0AA 2VA9A 4BEBA 1SG6A 1AJEA 2FFHA 1W0KA 2IOQA 2XUZA 3DWEX 3QF7A 2BWJA 3INYA 2P9FA 1EM8B 1WD5A 3KUDA 3MWEA 3QPBA 3E7FA 1GY8A 5DBOA 4MXDA 2O7QA 5FEUA 5TR9A 5T57A 3A8TA 2PFSA 1PZFA 2QJTA 3PHCA 1HOXA 3MUOA 2JL1A 4LJAA 2HW8A 3SOZA 2HRQA 5F3RA 4YREA 2C7OA 1U81A 5AKHA 5A6VA 3M2TA 1GG2A 1OWPA 4LV5B 1W85A 1UMCB 2X77A 5D5PA 1WV0A 4LNAA 5G0UA 3KHSA 1NC1A 1XVTA 3D5EA 5EZ5A 4KXQA 4Q4JA 1EAMA 3NWJA 4TM7A 4E7OA 3T52A 1JHAA 4N7MA 2R6AA 3DV2A 4S1TA 5KMGB 2DPGA 4UVDA 4WEQA 2AC2A 3S99A 4HBGA 3UXEA 3FR8A 4V24A 3ER8A 2ZI7A 2VT2A 1IQRA 3NFYA 2E3JA 1OW3B 4PTYA 4DIKA 4TTTS 1G5QA 1H4QA 4BBPA 3WGTA 3ZHVA 5B4TA 2LR0A 5E4TA 4BGUA 2VSOA 2ZUWA 2G6BA 2XT0A 1JPUA 3QKRB 2ACWA 1C7FA 4PR0A 4QFDA 5CVJA 5TMBA 3T0FA 3W1VA 2PRJA 3IO5A 3K71B 3LTNC 2F64A 2P5UA 1IN4A 2Q3DA 1A8QA 4TRNA 3VR2D 1W59A 1KBOA 2QZ9A 2Z08A 4C4YA 2Y1XA 4CKWB 1KEUA 4LZAA 4J0KA 4LHZA 1L1EA 1TF5A 3E5RA 3WLLA 2QVLA 1T3ZA 5EHNA 5H9WA 1COZA 1NKTA 2OC4A 4RPJA 4XVQA 3T3GA 4CWAA 2JATA 1YS1X 3IP8A 3VOBA 1UCFA 1L2TA 5C8XA 5K4GA 3GX1A 3OQPA 3ZCUA 4DGSA 3N1UA 5IT4A 5C18A 1RPTA 1VJGA 3DE2X 3ESCA 2VA8A 2VP9A 2ZBDA 3FNIA 3LXMA 3N2GA 2ZGVA 1XD9A 5FI1B 1C9MA 2C2KA 2PKYX 3T3HA 621PA 2H59A 3BDIA 1U8AA 4BMCA 4E5MA 2ZB4A 3MTIA 3MSCA 5I9IA 1QVWA 1C9EA 1ZHFA 1QE3A 2BGJA 3NYRA 3SS8A 4ZMRA 4IZIA 1E4EA 1XTPA 2OGWA 5HFAA 4N0MA 5EQDA 1BE8A 5F21A 5FLYA 3N2KB 4Y7CA 1GCUA 1T0UA 4M1WA 1Z2PX 3EXAA 3H84A 3MT9A 2WG2A 5IH3A 3ADCA 2W0MA 3OX3A 2QVZX 1N2EA 3RUFA 5CAEB 4RXMA 4PNEA 1GVHA 4HT3B 1OBOA 2AD5A 5ILGA 1QB8A 2BM0A 3TNLA 4M0EA 2B5VA 3FHJA 4WACA 3TUZC 1IOLA 2NLOA 2NYVA 2X5JO 2OGTA 5FT9A 1Y6QA 5GAJA 1YZUA 4AJ4A 2NAFA 2NZUG 1PJTA 5DHQA 5IC5A 3PF9A 2V3WA 1US8A 3VU8A 5K6TA 3MERA 2A14A 1NI4A 1EZ4A 3Q9LA 3QITA 1KDVA 1XTQA 4B7UA 1EK6A 2JFXA 2XB8A 4OAOA 1HETA 3EXHA 3S1SA 3WAGA 4WH0A 3U3RA 5DK4A 4BL5A 3F6CA 2JZNA 2KLBA 1GZDA 2QTZA 3MS2A 1O9HA 2H7VA 4JCCA 2YY5A 1T10A 1JQAA 2PY6A 4FYKA 4AKEA 4XX1A 1GFZA 3NHSA 5MN5A 4P83A 4XWTA 1IONA 1T2UA 2QQGA 2WD9A 1X7DA 2B2XA 2GLTA 3ETLA 3LUFA 4FZRA 4U4AA 5EZQA 5CDYA 5HKOA 1LFAA 3FYCA 4XZ3A 1HTWA 4FGJA 1ISIA 1JLRA 4OHMA 5D2CA 5JQWA 1Z29A 3AXTA 3RNLA 1EDBA 1NE2A 2VJCA 3I9KA 4MW1A 1U7PA 4Y2VA 2VCHA 4FMBB 5EWLB 3QI2A 1AMUA 1CF4A 2H2HA 3OFVA 2GBLA 1L4HA 1NVKA 3KLMX 4RHUA 5EHZA 2LNDA 2YHIB 4J0HA 1J0CA 1HDEA 2A35A 4MHOA 2BEVB 4PCAA 3HCNA 5F76A 4MWZA 3ZHXA 3N7TA 5HKAA 2D7JA 4NOKA 5AVXA 1PJ2A 2NVWA 4KEAA 5EXTA 1KO1A 4XW2A 2JLAA 4ZFNA 3QKSB 1E1QA 4ECEA 5JQGA 4ZTUB 2FPXA 4HNAB 1RKBA 3STUA 3U6BA 2BDUA 2VF4X 2WPDD 3U1BA 5ADHA 1E9RA 1UBTS 5JNSA 3KR9A 3NNSA 4YBZA 1QAMA 2A33A 2QLFA 1Q91A 2IYSA 1IOVA 4CL8A 5H02A 3C6KA 1WS6A 3DV0B 4XR9A 2P4EA 3AVVA 1ZD4A 4B6JA 4BPRA 1OFGA 2BR3A 1V8ZA 5H4HA 4MYRA 3NONA 3NUQA 3R77A 4GZ3A 5DIFA 4ZQIA 4CGYA 3TQHA 1RQLA 1JR6A 4OYLA 1EDOA 2W70A 2OCIA 5FBQB 1XZFA 2ZYUX 2V5AA 3EVDA 3OT1A 2IT1A 4GRIA 1T9ZA 1YR7A 1SBCA 3MCVA 3PKIA 1CLEA 4IJMA 3CVJA 5JQGF 3KJZA 4YC7A 3RADC 4ETIA 2ZQYA 2ORIA 2QQFA 2CV0A 1QHSA 1DX9A 1JUDA 5JZVA 2Q49A 1RI4A 3FETA 3L0DA 2Y0PA 1A8IA 3Q3HA 4B8ZA 2Q41A 4U8HA 5DHUA 2AFIB 4ER3A 2PSEA 5KHLB 3AILA 4JHXA 1RI5A 4B32A 2H7YA 2JJ8A 3ABOB 3JAWA 4JB2A 4O1HA 1MT0A 3P71T 4TXLA 5CBPA 2ZUFA 3HUFA 3O4GA 1RM4A 5ITZA 2AK3A 2YHBA 4MLCA 4P4TA 3CZQA 3SOPA 1PV1A 3OQVA 1H9CA 2CZQA 1YZTA 4N7JA 5EVCA 1OR8A 1UANA 1YH3A 5AKEA 3TW0A 3AR4A 5IX8A 3LX5A 2C1ZA 3BDAA 2WJZB 3QVTA 1QH8A 1ISFA 2G1AA 3Q41A 4J0CA 5EXPA 1M0EA 3QWHA 2OM6A 2GDJA 2MSNA 2OSVA 4CYMA 2COUA 3HCOA 1Y8AA 4JVLA 4UBKA 1GG5A 5AJYA 2CLDX 2X22A 3R6TA 1B00A 2LIVA 3K9QO 1CY2A 1YB5A 3IYLW 2YCLA 1H2XA 4KU4A 5BW8A 3G2KA 4AUEA 4ENVA 3L93A 2PU7A 2REQB 3JASA 3O0DA 1WNTA 3GDWA 4NAVA 4B3JA 4F3TA 2FW0A 1CULC 5E6RB 5KQGA 2R6JA 4CQNA 3OKPA 2OV2A 4IGAA 5IYZB 3DZIA 4GGPA 1SVSA 4KQJA 1LKZA 5FTWA 1A7KA 2C0CA 1W9MA 2AG6A 2IJGX 2IYQA 2PBLA 3I4LA 3ZDCA 1GLVA 5ECGC 2NP7A 3O26A 4UOEA 1G3QA 1J09A 3WQHA 5EJ5A 3LBNA 1E1CA 2C4UA 2W4IA 4I55A 4QD3A 1K97A 3EPJA 3NOVA 4XB1A 2PAFA 3ADPA 4NONA 2AQ8A 4RY9A 4XQCA 4JH0A 2XITA 5LC1A 3LQRA 2WTXA 4IDEA 1Z17A 2RGCA 2VVTA 1UMBB 3OZGA 3PK0A 5JMOA 1CY8A 4H0CA 4E33A 5BN5A 5C9ZA 3HUUA 1RTTA 5LWQA 3NM4A 2XXJA 4FE7A 2A0UA 5FPKA 5G4LA 3P94A 3NWEA 1C8BA 2C97A 4CETA 3QI7A 3Q9UA 1D0VA 2QU7A 4LYGA 4KRFA 4BNWA 3FSEA 2RGXA 2CLSA 4U7JA 1PJ8A 2FXIA 4FOSA 1QE0A 4JAVC 1F14A 2FPGA 3FFWA 2JGIA 3HL0A 2W2PA 4I55F 5DYNA 2Z4TA 2X1VA 2CFTA 3G3EA 1J9ZA 5I9NA 3D2LA 3QU5A 2GEUA 4TTPA 4RETA 1Z2OX 4NJEA 1Q7CA 1ZU5A 3AW8A 2I4NA 3B6MA 1DBPA 1CFZA 1L6IA 3G9ZA 1S7CA 5FP0A 1KDZA 3V1YA 1Y4DE 2AF4C 1YB2A 2PZEA 3CS3A 2BMDA 3ZCPA 5KOYA 4Z0HO 5K01A 2EAUA 3G1TA 3LDGA 4MQMA 3COPA 1RBQA 4BGEA 3X1XA 1ZIYA 4CM9A 4DCUA 2ZP1A 1O9BA 1W5EA 4HRVA 3VYTB 2OUIA 4KUEA 2JAQA 4DQXA 3I9LA 1VBNA 3E05A 1NG9A 3U4CA 4Z4EA 5A0TA 3OZVA 1UADA 3BWYA 3OM8A 1VI6A 4TTRA 2HK7A 2H08A 5LMUB 4ENPA 2QUIA 2X0DA 1G1AA 2W7TA 4H0FA 4KQ9A 4FFWA 4J76A 5C8ZA 3WQBA 4IQFA 1DI0A 1VG8A 4QA9A 4N3GA 3TK1A 1EP3B 3ZU6A 3FYDA 4YMHA 3V1NA 1AOXA 2ENUA 2B1QA 4K6GA 2XKAA 2VKTA 3Q8MA 3QY9A 2QSUA 1Y34E 1G0OA 2ZJ2A 2J6BA 1KEVA 1ZW1A 1IFXA 1V16A 1XU7A 2VHZA 1TECE 3G1WA 4K9SA 5IAEA 3INTA 3RH0A 2JEYA 4KZPA 1U1CA 4PPQA 5HK9A 1N0VC 4KBYA 4R0MA 3DLBA 4FFSA 1XJCA 2O8CB 2JA1A 4F3CA 1JHQA 4KPGA 1JA9A 1YCFA 3VR0A 1DQYA 2B4QA 1T9DA 2ROQA 3BCRA 3GPIA 2W6NA 4MPPA 5F9HA 1Z6ZA 1W75A 2VDVE 4IIYA 5T3UA 1UP6A 3TRIA 3WI7A 4JI4B 3S8EA 4CMGA 3GNQA 1PGNA 4MH0R 3UB2A 1ZD3A 2AC7A 2R6GA 1QYVA 1C30A 1ZC4A 2FB9A 2IZ5A 3F6PA 3P2KA 3V8PA 5C5CA 1H0HA 2WTBA 4HGRA 3RU3A 3A6EA 4KNVA 1C2YA 1WXEA 5EWJA 3DBIA 2FQ1A 5CM2Z 3PXXA 4MAFA 5K0EA 2RGNA 4H17A 4BY9E 3GGCA 2WILA 4KPFC 2QRGA 1KAGA 4A0SA 4CFYA 1P7VA 5IJ0B 2FHPA 1PJ3A 1R0ZA 2GTHA 1MB4A 4PN3A 4G0UA 3SKXA 4CF6A 1OH8A 2V7PA 4OI0A 1YIDA 2WUGA 4W1QA 5E38A 3D2AA 3EWNA 4NV3A 1P44A 2G09A 3KPWA 4U6QA 3OUZA 3I8XA 4RMJA 3RJ5A 1CUSA 3WGQA 2EX0A 3ASUA 4GPD1 5HGXA 1Z6GA 2O2EA 4DJJA 3A9UA 1G20B 2J4DA 4NCJA 4Y6PA 4OA5A 4Q4HB 3COSA 3SJAA 4DWWA 2ZDHA 4KH1A 2QUKA 4IEIA 2VL7A 1Z13A 2RD2A 1AHIA 1S2NA 1GTSA 1F38A 1FFSA 2R5NA 2H85A 3L0IB 3ZHZA 4AKGA 4BEWA 3VAZA 2G04A 3R44A 5K09A 5AVTA 1WXFA 4EB6B 4DR2B 1OXTA 1GQQA 4FBLA 3RAFC 4TLDA 2HMUA 3G0HA 2DMRA 1LVUA 4EAQA 3VU9A 1JALA 3W8NA 4R6WA 1XD2A 2Q1YA 3D2CA 1YR1A 2HRRA 4EUEA 1K9SA 1MTZA 1P73A 1XYVA 3OKCA 3EIUA 2KI5A 3WE7A 3M5WA 4HCJA 3HVRA 1N57A 4J91A 2ZYWX 1QTNA 3BGWA 3KOMA 4IGKA 4XJXA 2W2NA 4P35A 2QEQA 3AKCA 4R8RA 3BB1A 3P9ZA 4KAXA 3TG8A 2E4UA 1JQKA 1RFLA 1C2TA 3NYIA 5DFAA 5GZ1A 1GSIA 3RTAA 4BYMA 4YPVA 3DLAA 3QE0A 5CA0A 4EQ6B 5B7GA 1NPDA 1I7LA 1XCPA 4M1MA 1L7NA 2OZLA 2BFDB 1D6JA 3R5SA 4H7DA 1DARA 3MS7A 3ZTTA 3U9LA 2VF5X 3OF5A 4AZ3B 1Q2UA 3OAAA 2RAFA 3PQ2A 1DSSG 3OIFA 4AZVA 1A82A 3CX7A 1ISSA 2I3BA 1MV8A 1O77A 2CWWA 4PYNA 3U3JA 1PJZA 3ZU2A 3IALA 1TCUA 5EJ8A 1LUAA 1NF8A 5CBKA 3FYUC 3CFYA 3HKCA 4NU6A 1TA9A 1Y0BA 1Y1PA 5EIOA 5DF1A 3UJ7A 4EARA 1KPGA 5CA0F 3TXAA 4LJKA 3H1PA 1EXDA 1UH5A 2UZ1B 3I01A 3K09A 4GOJA 3SDBA 2B98A 4UJ3A 1BMFD 1C9NA 1OV6A 4DN6A 5BQXA 1BSVA 3TBKA 2ZSJA 1QH1A 3EOAI 2XMRA 2XQGA 3A58B 3KB8A 4INJA 1Q0TA 1M1YA 3H0KA 1YO6A 2FUNB 1X0VA 2YY7A 3BZWA 3CUKA 2IV7A 4BATA 1KK3A 3C0KA 2Q4EA 1O6FA 1SU4A 1C9JA 1F5NA 4MUEA 4DDVA 3D7LA 4PYIA 3HDGA 1L4NA 3EDMA 4PX9A 1CXZA 2PVSA 3WK4A 3V8QA 4EKGA 1X94A 2CSXA 2HK8A 3A32A 221PA 2NUAB 1ONSA 3P45A 5C1PA 1LNSA 1VE6A 4CW7A 1O8BA 2PMWB 3M4JA 4A36A 3DMGA 3DVAB 3PEVA 3C45A 2YWXA 3EY9A 4IDQA 2HA2A 3CLVA 4EATA 2FR8A 1E62A 3ID6C 5DHTA 2ZU0C 3N75A 5JRZA 1AUVA 2LUOA 1IK6A 1P7CA 3WMXA 3ZEAA 1BDMA 5IBCA 3O4RA 1CY4A 5IM4A 2WTMA 2HZ7A 4TT8A 2QAIA 2XMDA 3G23A 4OFBA 4DHEA 4CM4A 2ZM5A 4WBNA 2WWFA 2HN9A 2QTWB 2WAOA 4RH3A 2HPVA 4L27A 1YVUA 4TTQA 1EXMA 4TGLA 4BJHB 1H4SA 3JX9A 2F4VB 2CBZA 4AZSA 3JQBC 1X7YA 3RANA 2G5CA 1BEZA 4CM9D 3HABA 4QOSA 4WN9A 3ZUPA 1RTKA 2JASA 4YRRA 1PWZA 2VDLB 4R2MA 1J2UA 3U40A 2H3HA 2JRCA 3H5NA 3KQTA 5I51A 2VP0A 2P2GA 4EPTA 2CFCA 4OV6B 5JDCC 1L7BA 2F1OA 1ZH4A 2RKOA 3PP8A 4J75A 3GP8A 3I1JA 4M8NE 2ATEA 5TT1A 1JFTA 2Y3IA 1Q0HA 4WDQA 4CIDA 3ZVKA 3GG9A 3LYUA 3FWZA 3A26A 1L5LA 2B61A 1M54A 5A02A 4O33A 2QW1A 4ZO7A 3DCNA 3RVLA 2YIVX 4WBNF 1X1QA 2ZXUA 3UMJA 2AHOA 3U2QA 3F3YA 4PYMA 1ZEMA 5DN6A 1Y8ZA 3MJTA 1TIPA 1BKDR 3V4VB 1CV2A 4E5VA 1X7HA 3VVBA 1DAFA 3MMPA 2PUAA 5C3UA 1VPEA 3PNSA 4C1NA 2WFMA 2QRKA 5FOUA 3EXFA 3PNVA 3GOHA 2I67A 3AY3A 3LKZA 1PTJC 2ICAA 3AV0B 1G8FA 3R23A 4CR6A 3LBAA 4CRWB 2QRVA 3HSYA 4C2UA 3T54A 2ZRPA 4J43A 4JNCA 2QXTA 4G5OA 3LT0A 4XAQA 4Y30A 2OG1A 3NHWA 1EDEA 3KQNA 1QO0A 3C8ZA 4EG0A 3D4PA 3IOYA 5ELXA 2AEJA 2X2PA 1Y33E 1BA2A 1KQNA 2PQ2A 1SB9A 2FNAA 2XTJA 2QM8A 3BC1A 1XTKA 3OUTA 4S05A 2IIPA 4AMZA 1O57A 4F3YA 2JAOA 1Z68A 4R7ZA 1MO5A 2JFZA 2X1HA 1GRRA 1JYFA 3H6GA 1HNNA 3MPOA 1E3WA 3PQ8A 1BGXT 5B3AA 1WQ3A 5LYJA 4I7EA 3KTAA 5IVPA 4I4TB 4LJLA 5EJ9A 3FPGA 4HH0A 1E18A 2QTCA 3RC8A 3MWGA 1HFWA 3WDLA 3WGGA 2WNSA 4TXMA 2WP8J 4C3OB 3A36A 1IEXA 1NJ8A 1SQGA 4CQMD 1G8SA 3GLSA 1RFGE 3O7MA 1TD1A 3IR5A 3I37X 1EB8A 3KOOA 3TOZA 1ADGA 2D1RA 1RWVA 4MR7B 4GOLD 2VPZA 3NPAA 3UB3A 4NWIA 1I4TD 1YKFA 2JFWA 4QU5A 1CR2A 4NZMA 4JFAA 1CR4A 5CLQA 1YHYA 4RK5A 1GGKA 4P5PA 1D7OA 4WKNA 3TVTA 4A0QA 4EA7A 3THYB 1XMOB 2IFTA 3IAAA 1AQ6A 3I61A 1VL5A 2QYHA 1EINA 2AE1A 2KX7A 2P7HA 2XQIA 4GX2A 4WXEA 4Z3DA 3ROGA 5JAOA 1TAUA 3KS9A 3O3OB 1GL7A 3WWDA 4NS1A 2O5EA 5KKCA 3B60A 4Y2XA 1V6SA 3PQ6A 4BMZA 5GVSA 4Q7MB 5K3DA 5IF9A 3AKZA 2HA6A 1XMXA 1Y3IA 1YI0A 2XWSA 2HK6A 2VDWA 2GZ2A 5TF0A 2UYHA 3EEIA 1W0JD 4EKEA 1SUEA 1SXJC 2PKXA 3DZKA 4JKOA 3ZV4A 1T4CB 2EIXA 4FZ3A 2WWVD 1JXAA 3QFHA 3EWIA 3GRKA 3IMCA 3WA6A 3KPYA 4PM4A 3L5OA 4DRXB 1P17A 2GFQA 1PV2A 1K8QA 3HXTA 3KZKA 4MWBA 2BGWA 4AI6A 4MQ6A 4OMDA 1FVXA 3QMMA 3A1CA 1CEYA 3L6DA 3HCWA 2EFGA 4R9RA 5AM4A 2Q6IA 4MVYA 4Q4AA 5CVDA 4AY5A 4DZZA 2ZI6A 3L84A 4RADA 4GI3A 2W8ZA 2B35A 2VTDA 1NBIA 1UZAA 4LKRA 4MV8A 1E63A 3DBRB 4Z4HA 5EIAA 1K8XB 2BFBB 1OCEA 3DKKA 3R3VA 4AS2A 3F5FA 5FWDA 3JQFC 3VHLB 4QEZA 2L42A 2VHJA 2XIJA 3DT9A 3RW9A 4EABA 1JDTA 3MUFA 1D07A 4ZGBA 2EF1A 4GM4A 3D81A 1MAAA 1RABA 1A9SA 1M0SA 2AZDA 4Y9DA 1LK7A 2AL7A 3E9CA 1HRKA 4ALNA 3K9BA 3MELA 3IJRA 3GT4A 2IYZA 5HG0A 5JAZA 4J90A 4QYWA 3COWA 3N8HA 5MHTA 4JLOA 3OX4A 4JROA 3H4MA 4EX7A 1YCDA 1OWMA 4MPDA 2B1RA 2R84A 4D0GA 5J1SB 2Q4TA 5KYWB 4DLZA 1N2IA 2IZ0A 4WOCA 5JZBA 3TGLA 1QG2A 4DY4A 1V3UA 5HMMA 3AF4A 4ZEWA 4WWHA 4YV2A 2A57A 4H35A 1FUUA 2NU9B 3RF7A 2CXPA 3P20A 4HEA1 2PX6A 2B2NA 3JQ8B 1BFDA 4KHPB 3DEFA 4U7DA 2ZRBA 3JXEA 3ROZA 4X97A 1JH9A 1BZYA 1BDBA 1DWUA 4UAUA 1SXJE 3AY7A 5HUQA 5ALXA 2LDBA 2XYRA 3HRHA 4B0PA 1GL6A 1L5ZA 3GFSA 4H08A 2GJ4A 2MMGA 1TMGE 1RBZA 1V11A 3AI3A 2ZAIA 3ILHA 1ZAKA 3LWZA 1T1JA 2DT8A 4PZZA 2WWYA 2UZIR 2VUIB 3QPCA 1HDGO 1E1LA 1GKLA 3ENVA 5HKKA 1KC1A 1KJYA 2I2WA 1G8HA 2AG8A 3P0HA 2WWGA 1RJ9A 2ZR8A 4C0BA 4X6LA 4YAGA 2BKLA 2R60A 4NNJA 3KJEA 2OXRA 1F2UA 1WPRA 3OLZA 5D51S 5T67A 4ALJA 3GPDG 5GQSA 4C5AA 5J4KA 2G08A 3OZBA 1ONPA 1Z2AA 2NZVG 2BCGY 1DWQA 1FYVA 1QK3A 3G2MA 3I2IA 1QH0A 4H1TA 5CYPA 3ITDA 2X9QA 1W4CA 1C1XB 2JD1A 4CN8A 4Z4CA 1RI1A 3WP1B 3NRBA 5JH7B 3KCNA 4DLNA 4P31A 4BRUA 1TM5E 2DBVO 3CONA 1DIOB 3CEAA 1VM6A 3DYBA 4GZLA 1EYZA 5EMLA 1CY0A 3UWDA 3WNZA 3VZQA 3BOSA 3WK8A 1E0SA 3W5BA 2ODWA 3OOEA 1N2XA 1ZRMA 1FXUA 2JHGA 3I6MA 3I9V1 3QXSA 1JQDA 3GHYA 4NHEA 3SF0A 1JDPA 5BVGB 3OTQA 5IM5A 2QLNA 4MEJA 4EDHA 4GC5A 1IN8A 3BWXA 1ARZA 1GPH1 1R7RA 2DWPA 3PFWO 4OGLA 2H2FA 4Q39A 4KMSA 1O3YA 5TXGA 2I5PO 2L82A 2PQ6A 4GBED 3TLGB 3GMIA 1INLA 1JDVA 2C00A 4TMFA 5K4AA 5JZ9A 2OSBA 4UHEA 1GEGA 3GLRA 1AMNA 2VPYA 4RSMA 4CEJB 4PQYA 1XROA 1S7GA 2Y2VA 1P4AA 1XEXB 3HA3A 1O4VA 1Q0UA 3L8MA 2NSDA 4AMGA 4D5EA 3SVTA 5B3LA 1EVIA 2ONCA 4F38A 3ZX5A 4BFTA 2WHQA 5CIWA 5DLYA 1X14A 1MPTA 3CH4B 2AFHA 1XX6A 3HM2A 3DPIA 1RLMA 5HZMA 4GXTA 5BW5A 3NKVA 4Z86A 1KIMA 5CX4A 1U2SA 4HFMA 5EG5A 3TPFA 1AXRA 5F1PA 3EZ2A 5I7OA 4JI5B 3L01A 1FFYA 3TFWA 2KLHA 4WZAE 2XMZA 3DOCA 4M7PA 2J7PA 2JAWA 4HQ0A 1FTYA 5HK8A 2Z30A 2FZLA 5L51A 4ARZA 5JCZA 1LC0A 2W4MA 4YRTA 4DR7B 2F8TA 4E11A 2YX1A 3DOJA 3R09A 5BRAA 3ZLJA 3GRZA 5IKXA 1IATA 3MMZA 3ZVMA 4DCNA 2VZ9A 5G53C 1NL3A 4PG8A 1U2RA 3KCQA 1TQ4A 4FBMA 4C87A 1GZ6A 1CP3A 2G0TA 1BXZA 1J49A 1DKPA 2ZI9A 4G2NA 1NBOA 3ZV6A 2Z6UA 2KBFA 2P9QA 3A9RA 3A1DA 1NP3A 2AXQA 1EGQA 1NW4A 1PJSA 3HWX1 3I2HA 1X7ZB 3Q0TA 1U1IA 3NKLA 4GICA 1P2VA 2FMIA 4X60A 5DBFA 5L3ZA 3QEAZ 2WUWE 1R0YA 3T95A 1JKJA 2DM6A 2Q5EA 2RGEA 4ISCA 5HVNA 3E9YA 4XIGS 4XCVA 3L9XA 2Q3CA 3L82B 3LHFA 4LHSA 3K73O 3O8QA 5IJWA 1HQKA 3HCAA 3EGXA 1DIGA 3O8OB 3HBJA 4MRSA 3PFFA 1ZXXA 2A92A 4OREX 2C29D 1WW8A 2VYCA 3AHJA 3S5JA 1N5KA 2HSGA 5CG1A 5KQMA 2F1KA 1CIPA 3OBIA 3S1AA 2FGJA 1G16A 5G41A 2WWHA 3OZSA 1V4BA 1SXJD 4IIGA 3JWEA 4X1KA 3TS1A 3W0LB 3QWAA 1SO8A 3N59A 2JLZA 3FVTA 3GFQA 1NX6A 4UHFA 5A71A 2BFPA 2WR8A 3A3YA 1KA9H 3BF7A 2I03A 3H9EO 4NH4A 4BXOA 1UPBA 2I4LA 3SE0A 2JAXA 2QY9A 2D1YA 1E3TA 2NVBA 3UH0A 1NATA 1XAJA 4HWGA 4D57A 5KINB 1P91A 4ZO8A 3SC2B 2MT9A 5LP6A 3WYGA 1PR6A 2YMQA 3KYCB 5G4KB 3TRHA 3VH4A 2AFHE 1XTBA 2BMEA 4EZBA 1OB5A 1N25A 5AW9A 3MRXA 4OMUA 4NCXA 4RJKA 3L77A 1L7QA 1X9HA 1YZHA 3IESA 5E3JA 4EK9A 3R0QA 3RAEC 3F90A 4PYKA 1G3IA 5DU2A 1C3VA 2QBYA 13PKA 1NC3A 5DP1A 3W5SA 1WLYA 5CCDA 3T1YB 2OTCA 1G21B 1PFWA 2JH3A 1UJMA 2YJ4A 2UVDA 5AUQA 1FSPA 3AINA 4RVNA 3RBXA 3I52A 4RTJA 1P9RA 3AZOA 1Z47A 5BUQA 1YRAA 2HQSA 3WGLA 5K0ZA 5LP6F 1FP2A 3A6KA 3IAM1 3WHLA 2I4IA 3LK6A 1NWHA 3R40A 1NXWA 2XA2A 4FW8A 5EJAA 2H65A 1OXVA 3KZCA 3F98A 1DKQA 1OX4B 5DGHA 1T5BA 1V43A 2G88A 1R0XA 2N46A 4P54A 3MHPA 2H1HA 3WGKA 3AYZB 3E15A 1CW2B 2NTYC 4G01B 4D8TA 3ELYA 4BNDB 2AUMA 3IPRA 3WVNA 1W88B 2VUSA 4OU5A 4QO7A 5LXTA 4AW9A 4R1LA 3E58A 1WCWA 2PKCA 2HJRA 4BQSA 1OIWA 3MA0A 1PK7A 1VHDA 4GYJA 1E3SA 2OZKA 5KEIA 2VNIA 3HVHA 4H77A 3BXHA 3D7RA 1HLFA 2VHUA 4S1VA 3DEZA 1ZN9A 5F4ZA 1C7ZA 4FOTA 4MP3A 3LO5A 4H0NA 1QIMA 3LOUA 2DE0X 3HUEA 2YC4C 4NOMA 3QLUC 4BVLA 4P0QB 5AI6A 4P4NA 5AJHA 3KT0A 4MYDA 3K32A 1E79A 1EXNA 2OD9A 1TTHA 4OQFA 3RU2A 4E2YA 1G41A 3F3SA 1MRZA 3SN6A 3CU5A 3DA8A 1ZINA 4IFTA 2P90A 5LXTF 4GZMA 4YDRA 5DM60 1NKSA 4KYVA 1QYDA 1VLHA 2HHLA 3UJAA 3AU9A 5CCXA 3MZ0A 2IQIA 3L8ZA 4CM1A 5JXHA 3TZBA 4HRYA 1B1CA 3EEQA 3NFRA 1T9GR 1Z9BA 3RREA 2X9LA 2HO5A 3L06A 4MR8A 2OV3A 4WK6A 4XX0A 4AWXA 4BO7A 1USWA 1ZIOA 4MWGA 1ZUNA 1GPKA 4OFWA 4F4FA 5JRDS 3ML1A 2RSLA 3RSGA 2JJMA 1ZSVA 4CCSA 4NBTA 1UJ2A 1FFGA 3JU3A 3IV7A 1F20A 4MPJA 5JBQA 2V0GA 1PYDA 4JSRA 2XOKD 3CZAA 3JPYA 5AKXA 4LF8B 1JG6A 2OR3A 3ZGZA 1M72A 3AQIA 3FI9A 2PZLA 2X8JB 4PNPA 1G6HA 1P62B 4MVCA 3MIIA 3JD2A 3AL3A 3WBKA 3JZFA 1VMEA 2V59A 3BMQA 1WPQA 1B3RA 2F3PA 3W6UA 1Y1RA 2K7FA 3GVPA 1SUPA 4MR9A 4W9MC 1U5BA 2ZUCA 2XEDA 4LRTB 4YRFA 3G17A 1IY0A 4BP1A 1RRGA 1I94B 1R0CA 3G8BA 3KG2A 3NTQA 2PZKA 1A9TA 3IHLA 1QF9A 3HGTA 1T3TA 4M9QA 5CHYA 1Z8DA 2FLVA 2HIGA 3KSDO 1HWYA 4A10A 1AK1A 3NM6B 3CF4G 4W99A 5ENZA 1W0CA 3QOWA 2J4FA 2A9VA 4HWKA 4HY3A 5T8KC 2CXHA 2IX3A 3IEVA 2PX0A 3IQWA 4HX2A 3ZCXA 1YFLA 4PS0A 3WLHA 1Y42X 1J20A 2FX5A 2B83A 1EFVB 1BMTA 3PZBA 1ZWKA 1GADO 2ZJYA 2P2SA 4RY8A 3NHAA 3ROFA 3BAFA 4B71A 4DV5B 3ZHBA 2BFEA 4QUAA 4ZI2A 5AW4A 5I7UA 3D6HA 2NZYA 3FKJA 1LBQA 2HQBA 4I2NA 5EPOA 3S2EA 2C9ZA 3TQOA 5JSUA 2HSZA 5KPJA 4N5LA 3IAEA 2V3CC 2G9UA 1N92A 1AA9A 2P4QA 4IHQA 3GCGA 1HDXA 2EEZA 3W34A 1YC2A 2ZZNA 1UINA 4I66A 2DF8A 5LQDA 1AQLA 4YT8A 2PCLA 3UO8B 2ZYRA 1G3UA 3JQDA 1C81A 4NNPA 5HSGA 4M0LA 2R79A 4CMBA 1WCXA 4LDRA 4HX9A 3M1IA 1U0GA 3KWFA 1RKVA 3K6JA 2ZPAA 3IEMA 1NYQA 1UAAA 4J4HA 4LXUA 4TSKA 2C0PA 1OMOA 1SUDA 4UUOA 5EQJB 4CIXA 4DV7B 1GAEO 1X7XA 4LQDA 1E92A 2P77A 4QUBA 4OIMA 1JKFA 4X95A 1NN1A 3DWIA 1NXQA 4P1ZA 3WKBA 3WGUA 4ZMSA 1B42A 2IXEA 3CZCA 3OIWA 4L74A 3Q8LA 5LP1A 1Z36A 4QXRA 2OO7A 3VVMA 1NW8A 1RJDA 1N2HA 1TCAA 3H3JA 3M3PA 2FF7A 1JIUA 3VSAA 4LDZA 3NEPX 3NV7A 3N8IA 2HY7A 3L7IA 3T3OA 4GO1A 2VP5A 2ZYDA 3RSHA 5EJ4A 3WTBA 1QE5A 1N0HA 2IH2A 3CLTC 4K8OA 4U9IS 3QLJA 1G5HA 3M1YA 2VATA 1LI4A 3F5QA 5J9FA 1D7AA 3AR9A 3D31A 3LT4A 3OCCA 3PQ4A 4ZVRA 1BS2A 5HEKA 4OD0A 5FULA 2BI4A 1YKGA 1QDEA 1QCDA 2X0NA 4ZOEA 3AGQA 1Z7WA 3VJLA 3HTXA 2QGZA 3K1JA 1HFKA 5IKMA 2ZYAA 1FYDA 3COVA 4PPGA 3QFTA 4W7HA 5EL0A 4OLAA 2ZR9A 3WLTA 3HC7A 1OY1A 5KYTA 1N8NA 1VL6A 5CT8A 3OH8A 1TYEB 4CKXA 1F51E 5DCLA 1N2BA 1TVKA 3UKOA 3CKMA 1YDGA 3MWEB 2EERA 3FLMA 1EHYA 3MTJA 1JVNA 4ILKA 2BBWA 1Q1EA 4YRDA 1P7WA 1HDYA 3A3PA 4HYYA 2WD7A 5F2NA 2MSEB 2NQ2C 5AM2A 5FPTA 4KDFA 1PYGA 4LTDA 4XASA 1F5SA 1EFHA 3TIXB 1UOQA 1W85B 3GBPA 1GPYA 3GWGA 2P69A 4URXR 4S2EA 1Y7IA 4Q4JB 2BY4A 2ZIFA 4HQ6A 2O3UA 4N8DA 4N49A 3QLEA 4LI0A 4L4RA 2YYSA 4OHVA 3ZLVA 5L3QA 1DDOA 5DNDA 3UPDA 3RPEA 4TMYA 3OQ6A 1XHLA 2E0IA 2EHDA 5K9ZA 1C9YA 1JDUA 2ADFA 4IVPA 4RK4A 4Q03A 1ZH8A 2Z58A 1REQA 3HXKA 4BWVA 3QE9Y 3OHPA 5THQA 1HI9A 1Z73A 4K1XA 1FF9A 4DLVA 1CDDA 4RBNA 3X1MA 4AMVA 1EFDN 1NHGA 1XLUA 3QBVA 4X6YA 2Z1DA 4AS3A 5BPFA 2ZBQA 3DKVA 3OTIA 1K3FA 1EPUA 3PNOA 3WMWA 1XO1A 2O57A 1SEPA 1D2RA 3EFOA 3P9RA 4P7BA 1WVGA 4L57A 2QAJA 4MP8A 2NUTA 2GMWA 2HPZA 2V7WA 3I6YA 3C39A 2FEAA 3R0JA 1UEJA 3UJCA 1FLVA 2QNRA 3TTWA 1L7PA 2BTEA 2D59A 3N2GB 5FO0A 4O0MA 4N01A 1K89A 2QNIA 1D4AA 2X9GA 2HLPA 1DEKA 4R01A 3X1ZA 1A4IA 2XQVA 4KE6A 4UREA 1U7DA 3QMPA 3R24A 4NQRA 1MRNA 4WNIA 3ZDQA 1Q7BA 1E4EB 1XD8A 1T3GA 1R8YA 4JC5A 3QVVA 1XVLA 1XZPA 2P2NA 3U17A 2G1PA 4R54A 2GT1A 1QAQA 1YONA 3QUSA 4QQNA 5LZ7A 4R9NA 4R2XA 2YCBA 2QE7D 4QU9A 5AJVB 2M6SA 3WMGA 5AI0A 2VHWA 4TYWA 3B1KA 5SZHB 5BQFA 3CH6A 3CLSC 1XEFA 3GGSA 4FD3A 4MVJE 4OMFG 4EKIA 1F9AA 4DY6A 3E0XA 3IQGX 3ZIDA 2MSWA 1IBLB 1HL3A 1JQJC 2XRFA 3GF4A 4G0PA 4GQBA 4PHCA 4LSGA 1PNRA 3OE4A 2VNHA 1MD9A 1L5WA 4D8WA 5FAKA 3B20A 2IHTA 5AFSA 1I01A 4HVAA 3QW4B 2Q7XA 4R1NA 2C94A 1US8B 1W5BA 1XZ8A 2BGIA 3V8EA 3W77A 1LH0A 1VMDA 1NI4B 1N8SA 2IODA 3DZDA 2JFGA 4WCFA 1BNCA 4AWAA 4DCMA 1V3QE 2SBTA 1EWVA 3EXHB 1D4FA 3W1WA 1ZZGA 2O7VA 5TMDA 3RJ9A 2HD4A 2BRUC 2H52A 2NOAA 4L85A 4IQ0A 4YV0A 2H16A 4F6RA 1ZI6A 3D6FA 3OU7A 4ZVNA 4BBJA 1GAQA 3QVKA 1QU2A 1KI6B 1D0IA 3PIRA 5G40A 1XMJA 2NVUA 4WLNA 5JWHA 3U4DA 3DEKA 1E4YA 1U2GA 2YHAA 4LYAA 1WTAA 3UKDA 1C8LA 3W5VA 2PGIA 2WHPA 2P35A 4HRXA 1D1QA 2W2TA 4F9TA 4BU0A 4DSOA 3HWWA 3MXOA 6REQB 2IYRA 4HDMB 4Q66C 4CUJA 3GAAA 3HDTA 2J9GA 1FUYB 2OD7A 3QTTA 3LXUX 2GSWA 4GEKA 4R1OA 1U3UA 1W4ZA 4BNHA 4MW4A 3BORA 4CF3A 4K9DA 1GFIA 5IJXA 4HUJA 1J24A 4NZ9A 3W9SA 4EG1A 5AVSA 3GJTA 4OX9Y 4YRBA 4G1EB 1PWHA 3GJ4A 1N8TA 2I2AA 4L4XA 4YVFA 1I5EA 2NTNA 2Z9CA 5JALA 3ESQA 3HK2A 5A7HA 5JQGB 2ZBEA 3EXG1 5LQJA 3PXBA 3GEIA 2NTEA 3GLVA 5HW0A 3S2ZA 4PWZA 1BE1A 3W6ZA 2AKEA 2PLFA 4D4JA 5DNVA 1TU4A 5IFKA 5LJIA 4W5QA 3NNDA 3EVCA 1QMGA 4RHEA 3NBZC 5DSXA 1N2CE 2FG5A 3TH5A 5LKAA 4I5FA 1HXHA 2V9ZA 3CMMA 4EECA 4RELA 4X3CA 4DEVA 3OPYI 4GMKA 1QHNA 4FQ8A 3HDHA 1QFYA 1I1OA 5TGTA 3FKSA 1ISGA 4RWEA 4JLVA 4N9WA 3P4UA 3FNQA 3LGSA 4EB8A 3OT1B 2HV9A 3SPXA 2BLNA 5KWVA 3LE8A 2J0SA 1POXA 2BZ1A 4GPTA 4XGKA 1EVZA 2RHCA 3URMA 1PBTA 4LSWA 2QUZA 4HGPA 1WBBA 4FLFA 2J09A 3C70A 2E5FA 4B7AA 4PE5B 2UYCA 2JGJA 3CLTD 2C2HA 1ESCA 2AI3A 2EX1A 3EDCA 1R6AA 1EU1A 3CURA 4ZV4A 2ERYA 4I1UA 2Z83A 5JPCA 3G82C 1C41A 1E5LA 5JAMA 1MJGA 1U3FA 3JAWB 3BGSA 4I1OA 3C3XA 2TECE 2EFHB 4ZQHA 3UK6A 4EENA 4A2WA 1E2BA 2Q0SA 5DTRA 1L3CA 5TDHA 3IOBA 5FDFA 5ITZB 1WB5A 3AQ4A 4L0DA 3CZ5A 3NTLA 3I83A 4ZCPA 4PZDA 4R2WA 4N03A 3UUEA 3WFJA 3TSWA 3VHXA 4ESEA 1QH8B 1OYWA 2JJQA 1NX9A 4IJ6A 1YRLA 1UAGA 3QXJA 5AT1A 5HIJA 4PLYA 1KE2A 5C1DA 4GMFA 2PMFA 5K1ZA 2JJ2A 2V45A 4V02A 2CZCA 3F8TA 3IBFA 2BZSA 1UBFA 1JLSA 2F9LA 3EQ9A 4LYHA 1X2BA 2YV4A 4QJ4A 2P5TB 2WMDA 3L6EA 1TIBA 2BZ0A 3JASB 2QD3A 3NORA 4H1UA 2XCLA 4MVJD 3ZV7A 1O0CA 3GVHA 2CLOB 5GJVC 4BFVA 4ZYZA 4UOZA 1T13A 5JFGA 3R8XA 3F97A 2YQZA 1ZGBA 4O2LA 3A04A 2VHYA 4Z3KA 2GERA 5K5EA 1ZKDA 4CPDA 4Q3EA 2VQEB 3BUSA 3F8SA 1QBGA 2BCEA 4MS1A 1MF7A 4F0JA 5AHOA 4Z9AA 1LWOA 1M7BA 1ZJJA 1IMOA 3BWVA 1O9GA 4I55B 3CR3C 3K5WA 3TECE 1YFKA 1LPBB 1ZEJA 4DCCA 1QOPB 1Y6ZA 3GZTB 3ETHA 1B0PA 2H8GA 3IBCA 3NANA 4XEUA 4D4GA 2R5FA 4Q4LA 4YRGA 4ZCQA 4ZU3A 3EQ2A 1ZD9A 4IIXA 1DOAA 5BN5B 3AV3A 2OMKA 3C3CA 4D43A 1AZTA 5J2UA 2GAJA 1FZTA 2P11A 3KVOA 3RVJA 4C4XA 5A1TA 4IJ5A 5I7WA 2FDCA 3PB3A 3UVEA 4YRIA 1BCSB 2ZBPA 2JK0A 1X74A 2GGSA 4GXNA 5E2IA 5AUNB 1NURA 2RHWA 5FWNA 2WFLA 2FPGB 5LB4A 3W2FA 4B6EA 3LI2A 1PS8A 5AJZA 2E82A 3GZ4A 4A16A 1N1DA 4N4AA 5IT5A 4PYOA 1Q57A 3CNQS 2K5UA 4JOQA 1W76A 4O5OA 4NJEB 4MGKR 4WUVA 4IINA 4M1OA 2IHJA 4JLMA 1P19A 5C7LO 1Q2XA 2Z6QA 3WIEA 1OD6A 2FUCA 3AGPA 4C4AA 4DJTA 4L6CA 5J2UF 5KVAA 4KR7A 1L5YA 1C50A 1QMPA 4OOFA 3SYMA 5C81A 3GAZA 3KEFA 2A58A 3KSUA 2VPXA 1T25A 2DSTA 2N3ZA 2QU8A 3KM0A 4IW3B 4BKQA 4C0LA 4I9GA 1UEIA 4GPAA 4W5WA 4K28A 2IZ7A 4ZWNA 1Q16A 1FX0A 1EEHA 1QQ7A 3HBMA 3PGXA 4RZIA 3MAGA 4I19A 1EB9A 3SYRA 1SA0A 5IXSA 5CH8A 3FNGA 4A8TA 4JJZA 4ZTBA 1H22A 3UAYA 1GA1A 3SX0A 1JEAA 2D2XA 1A8HA 2UUOA 2GDZA 2MR5A 2WV7A 1Z4LA 4PG4A 1V16B 3ZJUA 1YMUA 3IR6A 4ZDJA 1F1BA 1W19A 2V97A 3HUTA 1JIKA 3QKIA 4PLTA 5CYFA 3SSOA 4CE6A 3N7AA 4JVSB 2H1WA 4RACA 1XMQB 1MGPA 1UBSB 4J1TC 1LTKA 3TFQA 2X86A 2QX9A 5ALRA 5KJ6A 1NDQA 2GTIA 4NR0A 2G5PA 3PWTA 3ZK8A 3HFJA 4I8DA 4PAWA 1SC3A 4JKYA 2AVNA 6Q21A 2X5OA 3JQRA 3O90A 4JYZA 2X0RA 3FH0A 4ZJYA 2O23A 1WUKS 2UXCB 1OAOC 1QYCA 3O3NB 4MS3B 1HH4A 2W00A 3E0QA 4G23A 4ER7A 3KTOA 2DFNA 4TRJA 3TEMA 1X1CA 1GA6A 4OHXA 3I30X 1C30B 4KO3S 3CRVA 5J1TB 3QJYA 3TG2A 5EWMA 3TLAA 4CLHA 4YRLA 3QG1A 4NULA 4AIIA 3TZHA 1ESZA 1LEHA 5EWJB 2QR5A 4C7BA 4CIBA 1TK3A 3DEAA 4ZT6A 3ZU4A 1GPNA 4XSGA 4UQLA 3A6ZA 1V9CA 1Z0SA 3KB6A 4QTZA 2Z2XA 1JU3A 2RIRA 2O5RA 3RLIA 5GOTA 2GRJA 4OKNA 5IMBA 1YOBA 4DRZA 2Z8ZA 3ICCA 4OH7A 2HRBA 2X42A 3Q8XB 4O08A 1ZN8A 4YJ3A 4LZWA 2IXGA 4UW9A 3I42A 4CQMB 3B2NA 3ZJVA 1CJKC 2BHSA 3GUYA 4IS3A 2JJYA 2H7CA 2HA5A 3ISTA 3L1UA 1HORA 2QDXA 2B5OA 3BD7A 2Q29A 3WL4A 2IYPA 2JW5A 4KSBA 4OY3A 1B8OA 1GKKA 2DQ4A 3OETA 1WW3A 1KPIA 3HJHA 5IK2A 2GBIA 1TGYA 1V37A 2M9MA 3HV0A 4JYPA 2WABA 2WTAA 3DYVA 4L4SA 2VJMA 3DDNA 2FRVA 4FK8A 3ZR4B 2H06A 4U8GA 1P2UA 4FI3F 4XDGA 2A1TR 4BUJA 5JZSA 1KPHA 3PYXA 3VU9B 1HDZA 4ZT2A 1THZA 3ORRA 1XD2B 2F62A 1UOPA 3MJ4A 2CDCA 1NLUA 3FG9A 2HCTA 2HQ1A 1YQDA 4OSEA 3W06A 3TXYA 4YJ3F 4HAVA 4F6LA 2FRDC 4RESA 3G5AA 3JWHA 3ZWMA 2ZTHA 3OPNA 5FORA 2XZOA 4RMNA 1U31A 4EY3A 1SFRA 5EPEA 4LRSB 4F5WA 1U80A 5LIRA 2H0AA 1SURA 2E4VA 2GN9A 3HSKA 3P2MA 4FTWA 1K27A 2Z5FA 3HB7A 4ZO9A 3DE3X 1A4XA 2WJAA 4E94A 1DDGA 1U99A 3MT0A 4U2EA 1CQWA 1PR3A 3FOAA 5FOVA 1IHPA 3QYJA 5CA0B 4LYDA 2ZFUA 2F1JA 3I45A 4WPGA 4YP9A 1NZFA 1SOWA 2OO3A 3GJRA 1DQPA 4RA9A 5AW2A 1AV7A 1XI2A 3HY3A 3MCWA 5DGTA 5GVRA 5KOJB 2I1WA 4LDAA 2X4DA 1TIKA 3T3MB 3ZXYA 1DAGA 5CB6A 1Z7YA 2ZS8A 1EK2A 3R5TA 1PSZA 3CW2A 4RCVA 1T3LA 3LDUA 4OHWA 4PR3A 4U2BA 4Q9LA 4BDSA 3SD7A 5FWAA 1CNEA 4CIAA 1LQUA 1YRYE 4HAXA 3IPAA 2I87A 3MEQA 3ZDZB 3C7AA 3HKCB 3OJFA 4D98A 1WMSA 4JT8A 1K1EA 3D0QA 3NYQA 1B6SA 1HY3A 1UFOA 2YHUA 5KDLA 3ZHCA 2ZJ0A 3BA1A 4WLFA 1H2AS 1SBZA 2IUTA 2RI0A 1FRZA 4JLBA 4UMFA 2ILTA 1NJSA 2WF5A 4G07A 3STVA 5BT8A 5EJIA 2XUGA 4TWRA 5E1BA 3WNCA 2V7VA 1P18A 2D7CA 2Z2KA 4NU5A 3DTTA 3S5UA 1VFNA 1M1YB 2HMTA 2LKCA 3HU3A 4TM8A 5A03A 3VR5D 1V8BA 4BRZA 3W4IA 2NPFA 3VNUA 5DNEA 5BQ5A 4C4PA 5B4VA 2CXSA 4CUZA 3HDJA 3STYA 2DY0A 1JDBB 4IEEA 1OXMA 2CUKA 3NHMA 1GYQA 3B1ZA 2L69A 3DBOB 2RGDA 4QGHA 1J97A 1B6TA 3SHWA 2XT6A 1P3JA 1XRNA 1RPNA 3B1WA 3W8FA 1Q17A 1NJGA 5BWLA 3R9WA 1MOZA 3HS3A 4Q9AA 5H16A 2GM3A 3L41A 4GMDA 5BO5A 5TVGA 4C0HA 2V5VA 1UT6A 3IVMA 1W5TA 1YUMA 2EBWA 2FE4A 2WB4A 1KBZA 3B52X 4CF5A 3I5AA 4DDKA 2UVQA 5FL7A 3FWYA 4BKPA 4BMDA 5JXJA 3UHAA 1THMA 4MMZB 4DLSA 5LLDA 3Q2KA 2XPCA 4PSAA 1T36A 4FILA 1M2KA 3MVEA 4E22A 4K6MA 4AO8A 4I1PA 1E60A 2C9BA 3ZWQA 4CM4B 2BONA 4DDTA 2AN1A 4WBNB 3UMYA 3LWBA 3NMUF 4TPKA 2JNWA 1SKYB 4KQ1A 2IY9A 4URHA 1WUTA 3H0EA 1QG4A 3JRXA 2XUQA 1EG2A 5K05A 1T6ZA 1UZUA 4WN9B 2DUJA 3ENKA 4L2IA 4FOOA 3F1LA 2WUVA 4NFLA 3W2EA 2AJDA 2RB4A 2XR1A 2O8VA 4CHGA 1JHZA 4R8MA 2AKAB 4BVJA 2GASA 2QN6A 2VHVA 3IXLA 2B4AA 2RGYA 2XNSA 2ACKA 1UK6A 1FSSA 2WSIA 4ITVA 4J7AA 4HH3C 4N7BA 4CTOA 1KWKA 1ESMA 3NHYA 3PT9A 4PGAA 5JSYA 2QTHA 2V4ZA 3EE6A 1ACJA 1TRHA 4CTKA 1U65A 1I4LD 1P2TA 4ZPJA 1QLHA 4LXXA 3KTFA 1SPXA 4GI1A 1NMXA 3V42A 5JEEA 2JPDA 3UOGA 4ZVLA 2DQYA 1TC2A 1YU9A 3U31A 2WAMA 5JHGB 1I51A 4UEWA 3OLXA 4XVUA 4C7VA 5CA1A 2GEFA 3VR4D 1EIWA 4K9RA 1NW3A 2JIDA 4RYLA 4A0FA 4KR3A 3OE5A 4YUWA 4BQQA 1YS7A 4FPXA 1YDWA 4XQ0A 1PKXA 4BNTA 3EXFB 3FIUA 4F4UA 1MIHA 2P9YA 2QRVB 4R1UA 1XZJA 3JQCA 1W47A 3E1GA 3Q11A 3E2MA 1OZFA 3HB4X 2BBOA 3E35A 5D5HA 2F8LA 4YLEA 4Q1FA 5ADVA 3ZE8A 2HSEA 4B3DA 2W93A 4IOKA 1FDSA 2QRHA 4AMBA 1N6NA 1A97A 4TVSA 5CA1F 2HQOA 1PBNA 1Z2CA 1TYZA 2VZ0A 4UHBA 3H2BA 4Z0NA 4KQCA 1EBFA 4OSPA 2TMGA 1SIUA 2OCXA 3CZPA 4OLJA 5K0TA 2DCMA 1N5DA 1HYBA 1WZCA 2C20A 1JGTA 2YMMA 1E3WB 4G86A 4KXUA 2ZRCA 3U48A 5KOIA 4IDNA 3KTAB 4LOLA 5DXFA 3A06A 5KCMA 4DW8A 4WASA 3JY6A 2JCSA 2UVPA 2VBIA 3SEZA 1Z74A 2PAAA 3EYAA 1K68A 2EHJA 3LDHA 3N3AC 4JBIA 4QPJC 1GKYA 1KSGA 3AR2A 2BEUA 1TKRA 3DM9B 3DS8A 3I76A 2ANCA 1ZNQO 3RUPA 3Q6NA 2H4XA 3T9FA 3V4OA 5JJCA 3FZEA 3NWBA 4JOCA 3HH8A 3ES9A 4R05A 4PAOA 3C2QA 1EEXB 4PRZA 2HCBA 3AP2A 2WZCA 3WK5A 5HM6A 3D3KA 1PF7E 5EZSA 4CMAA 1FP1D 1XIVA 3RQIA 821PA 1GR1A 2D8AA 5JYEA 1S3GA 4G09A 4KWCA 3BTVA 2O2ZA 5JFOA 1GXSA 5DI9A 5ULLA 1KAQA 2Q99A 1BDJA 2ZRLA 4HQRA 4PSVA 4HPWA 5LBTA 1P2BA 5KSWB 2HDHA 4OXRA 3CIOA 3U7GA 1FIUA 1SC1A 1HV8A 4YAUA 4P92A 1O8CA 3MJVA 2JCGA 5KQSA 1CC1S 5B6JA 2Z04A 5K3EA 1DZ3A 2VDWB 3OD5A 3K1YA 4D9JA 3D0RA 3ZDRA 4D6XA 1WCIA 4IGFA 4B3IA 4E88A 2BSAA 1YTLA 5I9TA 3RKRA 3E23A 3L05A 4D56A 4EUFA 2FW6A 1USUA 4RULA 2FEMA 2I7XA 4KXVA 1GFSA 1H0RA 1RVV1 1USKA 1TJ5A 3BQNB 3HNOA 3MWYW 3A4NA 3N0TA 1JNXX 2EFEB 1SM4A 3U3ZA 2GBPA 3G79A 4HJXA 1LRJA 2H8KA 4Q4AB 4Q1EA 1OXKB 4QJBA 3UFXB 1NNEA 3V3KA 4IDOA 1YR2A 1QWOA 3FMIA 4X1IA 5A3QA 4ZQFA 4YIKA 2GN2A 5ALQA 5EHXA 4UC0A 2W2VA 1Y1LA 1WRBA 2ZJ4A 3O82A 5JO0A 4BZXA 3GWZA 3EH1A 1SU6A 2H4FA 3O74A 2AOWA 2P6PA 4A8JA 3ECSA 5BSGA 1CE8A 2GH1A 4RGVA 5LZ9A 3WZ2A 1KJ8A 3BWCA 1LBEA 2OLJA 2I1LA 3ZH9B 4N5IX 3RG2A 2Y1FA 3BRSA 3HDQA 3NVAA 3CM0A 2P9TA 4J94A 4MQFB 2FN9A 4DL9A 4PQFA 2AOXA 4F04A 5LMNB 1DJMA 4ARBA 4MIYA 1GGVA 1QRSA 4KGVA 4MJ3A 5MN4A 1JVBA 4P3YA 4OF4A 4KG7A 4KN6A 2VJYA 4Q6BA 4BFCA 3WIVA 2PT6A 3QZUA 5JPIA 1NVAA 4Z3OA 3NETA 2M6LA 2PXXA 3MRTA 5ITWA 4ZYUA 1QVRA 1TTPB 1W5FA 3WIOA 3A1TA 5DLDA 4V38A 3RIGA 4BNIA 5CFNA 4NLLA 3K15A 1A5BB 4MQ5A 1B6RA 2C77A 2CCJA 2UYGA 4PS1A 1D2GA 1X80B 2O2SA 3LNCA 3O0TA 3UBMA 4EO9A 4GW3A 2F9MA 5BV0A 1DQRA 2JGEA 3X2FA 4C89A 2Y0EA 4KAJA 1IZZA 3DCIA 4D3DA 4C6SA 3JQQA 3KL2A 4NU8X 8ATCA 2BEWB 1S6YA 2WF8A 4JHLA 3AIOA 3CX3A 4CI9A 2PKEA 4EL5A 4XSVA 1ST3A 3NLLA 4X1YA 4XGQA 5JCOC 1GITA 4BJ1A 4XTCS 3GNTA 5K8IA 3TL6A 1V11B 1XSEA 1DIHA 4EF6A 1FVFA 3HNPA 3RM3A 4JP1A 5TQ0A 2RIPA 3W79A 5L4NA 3R7DA 1ZWLA 3FBWA 3CKKA 4FEEA 1ZGGA 1OKKD 3CPHA 4P58A 2R8OA 4ETMA 4F1JA 5CLHA 1RJ9B 3L6UA 1CDEA 4BNZA 2G06A 4OYYA 3PVSA 1E2LA 1IIRA 1N1GA 1BFKA 3A3KA 3LO8A 4GG1A 4ZV7A 5I9MA 5KNCD 1VSTA 2VDJA 5BYBA 1EX6A 1KFCB 3ANNA 1AF7A 1U2PA 2GVDC 5FTJA 5KJCA 4LC1A 1KKMA 3ZHUA 4X7RA 2FPWA 4KW7A 2COKA 4ERNA 4KMMA 4UATA 3ND8A 1J1ZA 4KV7A 4YRJA 3LVFO 1LSUA 3X2SA 2Y71A 4J16A 4NF2A 5C7OO 1NQOA 5BYAA 1E7QA 1ZVQA 3JVEA 4AP5A 4BV3A 3QPAA 2JFQA 4J03A 5SV2A 3K8YA 1KDOA 1KORA 1LBIA 1XRLA 2K6GA 3DVSX 2WM9B 2QP4A 3BWEA 3CMCO 4KFRA 1QZ3A 2BD0A 5EGSA 1SU7A 4QM7A 3UXHA 3GLIA 2RFLA 1H8HD 2GD2A 3G88A 4KPEC 4M0FA 2HH9A 1QIKA 3UQYS 3FVQA 2HLNA 2WJ3A 4YDSA 4A26A 2MYNA 4BWYA 3PFIA 1H1DA 3WLSA 4HQNA 2ZWIA 4LW8A 4BQIA 2PVCA 4WEOA 5HM8A 4AAYA 3SBXA 3OIVA 4RCYA 4WINA 2C5HA 3D7NA 3CH5A 2X2EA 2G9QA 3H8SA 2W42A 4CMCA 3QLVA 1TEVA 3CE9A 4EY6A 2AFHB 1BEEA 3LW7A 3IRVA 4QVKA 2Q21A 1YHNA 1YS4A 5JR3A 4E03A 1IZ8A 1P0FA 3P0EA 1P5FA 2OESA 4NBWA 4XD2A 1FX1A 1UEXC 1H3FA 1MTOA 4MRNA 3RRZA 3SIPA 1CQJB 2OHVA 3O84A 3CVUA 4IIFA 5LKRA 3B5IA 3DL7A 4YMUA 1Z5OA 2QR2A 3SCZA 4U2CA 5JS2A 4ARZB 3WKAA 1NE7A 2HFJA 4CKBA 2WJIA 1OC2A 2D7DA 3IAUA 4IDFA 2EJWA 3L4EA 2W43A 3EDOA 3D7KA 5FUMA 3DFFA 3Q2IA 3WS7A 1CVRA 4E09A 4EITA 5CG2A 4IG9A 1IJEA 1O6GA 2PGAA 2Q07A 1BWSA 1OBFO 1P4SA 2V0CA 1KFEB 3A14A 3DZFA 3OZDA 3R6GA 4YRNA 4HMOA 4PGFA 2XQJA 4DAEA 2CT8A 1HF3A 5TY0A 2R7NA 3L1KA 1JKJB 2BUCA 3D9QX 4TUYA 4ROSA 1N7HA 1ECPA 4FNMA 5D3MB 4D0LB 3THWA 1DEOA 1TMYA 2MJLA 4ZEXA 2AI1A 2WIBA 1PS9A 3EW7A 4LYEA 2Z5GA 3O8QB 5HGJA 4EA8A 5H1YA 5A3VA 3VPHA 3HBFA 4JI2B 3I5YA 5F98A 4MICA 5IPFA 4IXDA 1N0WA 1ZLXA 4A8HA 2GEVA 2C4KA 4R1SA 3B89A 1P4RA 2XF8A 5CVUA 3S1AB 1I7DA 3T99A 2IUYA 2QMHA 5BY2A 4X1KB 3WL8A 3KBBA 1GCOA 4HN4B 3QF4B 3LY8A 1A2QA 3I6ZA 2FJUA 2FPKA 3F7OA 4BXOB 1Q3TA 4EHAA 1SCUA 5SYNA 1YB7A 5C5IA 4Y2GA 1XPRA 1A9QA 2WI8A 1GZUA 4BAGA 4TUYF 4C29A 2PUWA 4C7JA 5LP6B 3GFRA 3A2LA 4F96A 1DADA 1GPJA 4RVHA 1LW7A 5TX7A 4XUDA 3EBLA 4TTAA 5AKZA 2AKYA 1EBUA 2YDXA 1JE1A 3KD2A 4H27A 4IDHA 3TAHA 1UT5A 3O93A 3PX7A 3ZLBA 1COWA 1JIJA 4ND6A 3AEUA 2ZUBA 3REQA 3DZ8A 3T61A 1JA1A 2IBTA 2QBYB 3WY9A 2Q0XA 4QBIA 3IJPA 1RR6A 4NYMR 4JL8A 1C9KA 5JU6A 2A0XA 3DO8A 3Q3EA 4N0EA 3VA7A 3FCCA 1SN7A 4N6NA 2DWCA 5AK0A 3C8HA 3Q0EA 2XNCA 3K2EA 3N5KA 4WE3A 2DU8A 2GFIA 3A70A 4ZVTA 3UK0A 2G4VA 4L76A 3X43A 2HLHA 3UMMA 2D4AA 4EAAA 1G64A 3K1AA 3W2TA 5T5QA 1Q1GA 3KKNA 3ERCA 1YJ5A 5EYPA 3W6NA 4DLRA 3K9FC 1E7RA 3VZDA 1S5PA 3C3YA 5JZMA 3LUCA 5IP5A 2PO5A 3NAZA 4U39A 1BVHA 1U2TA 2NYUA 3C5HA 2ODAA 3PGVA 4HEQA 1YJAA 2OA0A 4JC4A 1DOZA 4YPOA 2LZ0A 3MC1A 2JI9A 2PSDA 4IICA 3MWLA 4LJ6A 4DQKA 3THSA 3QY0A 4ZICA 2IHKA 1F4VA 1ZSYA 4O4HA 4BHTA 4H4DA 1I9CA 4TMTA 1D3AA 3V1MA 5JY6A 4J6FA 1A76A 3TE7A 5LXTB 4B40A 4CZ2A 4OHRA 1T9KA 2VJQA 2VK1A 1KI4A 3F1KA 4JBWA 2WHYA 5CFMA 3R5XA 3Q15C 5KU7A 1FNCA 3CVYA 5FKJA 4AQ7A 2R8ZA 2H1SA 5CCEA 2OVFA 2IOFK 5MGBA 1YCHA 1UBJS 4KODA 2C2GA 2AX3A 1GCGA 1WMAA 3EULA 3B48A 1Q19A 1T0JB 3EVFA 5JSKA 4JBHA 4NNOA 4YQZA 4O4HF 4E15A 4F85A 1Z4MA