4F06A

Crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
368
structure length
368
Chain Sequence
DTIKVGVIGTMSGPYALFGKNYKMGIDAWVAEHGNKVAGHTVEFVYRDEVSPNPAQSKALAQELIVKEKVQYLAGLYFTPNAMAVAPLLQEAKVPMVVMNAATSSITEKSPYIVRTSFTMFQNTVPAAKVAKQKGATKVAIAVSDYGPGIDAETAFKKTFEAEGGKVVEAVRMPLSTTDFGPIMQRIKNSGADMIFTFLPAGPPTLGFVKAYIDNGLKAGGVKLMSTGDVVTEPDLPNIGEAGLGILSTYHYAVSHDSPENKAFLALLQKGGAKLDEVTMTSVAAYDGARLIYKMIEATSGKSDPDKAIAAVKGMKWVSPRGEVSIDPETRHITQNVYLREVEKVDGKLINRELETFKAQPDWGLAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of transport proteins for aromatic compounds derived from lignin: benzoate derivative binding proteins.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transport protein
molecule keywords Extracellular ligand-binding receptor
total genus 130
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f06A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f06A01
1CHNA 2MSLA 4ZMSA 4MR9A 5GQSA 4IRXA 2FQWA 1PHRA 2FMKA 1U2PA 1U04A 2IPNA 3MQ4A 1YK1A 2JK1A 3C3WA 3TMYA 1APBA 2E4ZA 4KREA 4Z9AA 3L6UA 2X7XA 1GCGA 2FEWB 4S05A 3IP7A 3GV0A 3RVOA 3MMNA 4EVSA 4YRZA 2RJOA 3KLNA 1OXBB 4MPTA 4RS3A 1NXVA 3OQOA 3O1IC 2OENG 5CNMA 3H1FA 5CNIA 4TN5A 1JLKA 3W9SA 2GWRA 1PEAA 4KK4A 4MQFB 3I42A 1USGA 2FW0A 2FQYA 4E7PA 3KCNA 4EVRA 2F8SA 2ID9A 3GBVA 3R0JA 2GBPA 4MS4A 2QVGA 3HCWA 4LE1A 4MR7A 3H5VA 4RK7A 3HUUA 5EWLB 2FVYA 4Z99A 1JX6A 1JFVA 4O1HA 4G0YA 2PL9A 1BDIA 2FMHA 1VPWA 1PNTA 2NZVG 1NATA 1URPA 2FKAA 2E4VA 1C4WA 3GYBA 1DC8A 3G85A 3URMA 5JNRA 3LUJA 4OG2A 2IOYA 3QEMA 4MS1A 5IEBA 2JBAB 1M5TA 3GT7A 1UDRA 3OO1A 5CHYA 2H3HA 3O21A 3LMKA 2HSGA 2NT4A 3OLZA 3GA5A 2WB4A 4KV7A 1U0SY 5EWMB 4G0QA 5JS2A 3CHYA 1F4VA 2CWDA 1L5ZA 3TB6A 4HNRA 1NXXA 1P2FA 4LE0A 4PICA 4YS6A 1I3CA 4HNQA 5ED4A 3BILA 3FDFA 3KJXA 4MR9B 4MRMB 4F8JA 1YIOA 2CD7A 3Q7TA 4MS3B 4D6XA 3QLVA 1TJYA 3SG0A 4ETNA 4P1ZA 1A04A 5FBKA 4N76A 1BA2A 3I5AA 1E2BA 5DLEA 5TQ2B 4W5QA 3MF4A 4G86A 3HUTA 4RY9A 4KNYA 3CG4A 5IEJA 3FFTA 1DRJA 4YO7A 5I4CA 1ZITA 2R48A 3HJFA 4ETMA 1DP4A 3GWGA 3LUDA 1ISSA 3OM1A 1JFTA 4RU1A 2L18A 4RK4A 2LBPA 5FWYB 1DCKA 1ZGGA 3H5TA 4W5RA 2H0AA 4MS4B 1Z17A 1C0EA 1MVOA 5KWSA 3F7NA 4Q6BA 1GUBA 3HM9A 3JPWA 2QU7A 4ML3A 2F8TA 3KYIB 3Q9SA 2R4QA 1QKKA 3C3KA 3RVSA 4OTZA 4EYKA 5B3JA 1DG9A 4MLDA 3EQ2A 1YS7A 4QPJC 4RZSA 3NNSA 4WZZA 2IKSA 1Z13A 3IDOA 4Z0NA 5JNUA 3IPAA 3CRNA 4WUTA 3LUGA 4RSMA 2L19A 2E4UA 1IIBA 1Z25A 1GCAA 5GOTA 4LE2A 4F11A 1RXEA 1FQWA 1JYEA 2RDMA 3O2JA 2QW1A 1D1PA 4EYOA 5IULC 5C5EA 1JL3A 1SXIA 4W5OA 3LOPA 1WETA 3H6HA 4NQRA 5JS1A 2IDMA 1KRXA 1SXHA 3FFXA 4EGSA 7ABPA 3QX9A 3Q15C 2TMYA 3H1EA 1QP4A 2YHAA 4Z4CA 3DGEC 3LFTA 4G0XA 3SQNA 2FEPA 1FFSA 1JWLA 2I6FA 4XAQA 3ROTA 1U8TA 1FFWA 2FLKA 2LIVA 1J56A 4RK0A 3MM4A 1DBQA 3LUFA 3OMXA 4PE5B 4EUKA 1SD5A 4YV7A 3N0RA 1EFAA 3K4HA 1VRVA 3SAJA 1RZRA 6CHYA 3Q41A 4Y9TA 2PE5A 3SY8A 2CHFA 1ISRA 2FQXA 1M5UA 3N53A 5JNVA 2MYUA 1EWKA 4YGXB 3CG0A 3LKVA 1RXIA 2E4WA 2L2QA 2JVJA 2ID7A 3H5WA 5FWXB 4MYRA 1W25A 2MYPA 1P6UA 4M88A 4WT7A 1YK0A 3RVPA 3FFWA 2LUOA 3O75A 3E61A 5KC8A 2VYCA 1BVHA 2PUDA 4JASB 3JY6A 2M98A 4D6YA 3OQMA 2PUGA 2WRZA 4EVQA 3N6VA 2PMCA 3HEBA 2FSPA 3ILHA 1DCFA 5JNTA 3DGFC 2PLNA 1NXPA 2WJWA 4FB4A 2PJUA 3L49A 3LTEA 4WWHA 5DCLA 5TQ2A 3UKJA 2XDYA 3HV2A 3F6CA 1ZDMA 2QVCA 3UUGA 1M2FA 1ZESA 4MS3A 2PL1A 4D74A 4L4UA 3IPCA 4Z4GA 1F51E 3EAFA 1OXKB 4ZYLA 1K68A 4XASA 3Q7SA 4E7OA 1PEYA 1Y1LA 4KMRA 4RY0A 2L17A 5EWMA 2FN8A 5TQJA 4YP9A 3FMVA 1D1QA 5D2CA 1RZRD 3JS5A 3LUAA 4NV3A 5KI6A 2LPMA 3RVKA 4PEVA 5TPWB 1LK0A 2FMIA 2VK2A 3NHZA 2PAFA 5T3YA 5FBHA 2MSWA 2BGGA 4F3TA 2GX6A 3HS3A 5IUKC 4ETIA 3EDCA 3C97A 4DADA 3I45A 1ABEA 1DC7A 3QK7A 3QEKA 4Z4EA 4MAAA 1D2AA 3QLUC 3CKMA 3QLTA 4YCSA 1VKRA 3EQZA 1NY5A 1FFGA 1SRRA 3HO1A 3DLHA 1QPZA 1JBEA 4WXEA 4G0OA 3EJWA 3HXMA 2YHBA 2Q5CA 2QXYA 5KQLA 1YS6A 1Z26A 3KHTA 1MB3A 5JNSA 3Q7RA 4EYGA 3VNAA 4S04A 1YVUA 3G1WA 4YWHA 3D02A 3A0RB 1XHEA 3O2SB 3RVNA 1JDNA 1AB5A 2A9QA 3H1GA 3OMWA 5F64A 3HZHA 2J48A 3M6MD 3RH0A 3VNBA 2PUAA 2AYZA 2RGYA 2W42A 3OO0A 2WY2D 3N0WA 1U2QA 1NXTA 1XHFA 3BBLA 4PYRA 3IP5A 4QICA 1ZH2A 4XARA 1H9CA 3DZDA 4WXMA 4QYWA 4TLMB 3C3MA 2ZAYA 5TPZD 3JVIA 5ABPA 2ZWMA 2WWVD 4L85A 1L5YA 1ZHHA 4RXMA 5TPZA 4F06A 1QNLA 2PKXA 3RVRA 2JBAA 4W5NA 3OLYA 4RXUA 4ZMRA 1ZVVA 1DJMA 3BRQA 2JRLA 2B1JA 3EGCA 4OBBA 4TLLB 3TX6A 2NZUG 3OQNA 4N0PA 2NT3A 1EHCA 5BRAA 3UK0A 4PZ0A 4Q7EA 1GUDA 3F73A 1BAPA 1Z18A 2PUFA 4JA2A 3T8YA 6ABPA 4MR7B 4LZLA 4N41A 1JDPA 5EWLA 5BQ3A 3GBPA 2VUIB 1YMUA 4RXTA 1MB0A 5HM6A 1E6KA 3RVJA 5HSGA 4KRFA 1ABFA 1JYFA 4H60A 4GNRA 3LUCA 2DRIA 1Z2DA 1B00A 2JB9A 3H5LA 2VUHB 1S8NA 4N0QA 4Q6WA 4TMYA 5IBQA 4N47A 2CHEA 4KQCA 2E4XA 4EYQA 1LJUA 3HDGA 3HDVA 4Z4IA 4MR8A 2FTKE 3CZ5A 3M9WA 1PNRA 3T38A 4F12A 2B4AA 3GRCA 4O5AA 3P9YA 1ZGZA 2PUEA 1NXOA 4RKQA 4NCAA 1R8JA 3H6GA 3KKEA 2JVKA 3QLUA 3EODA 1ZAYA 4Z4FA 4P98A 1T34A 2P4UA 3QEMB 4MS1B 5KQGA 1AB6A 4JAVC 4YR7A 4JP1A 3OLWA 1Z12A 4LDZA 3IP9A 3MIZA 1PUXA 3A0UA 1DBPA 1TM2A 3HSYA 2R25B 3QELA 3CS3A 3I09A 3LUHA 1QP0A 4IMJB 4G0ZA 4IGAA 2GI4A 1JF8A 4RV5A 2FMFA 3M9XA 4QYMA 5BR1A 1TMYA 4G0MA 1MAVA 2IPLA 4EY3A 4KQ9A 3O1JC 4MQFA 3A10A 1KMIY 1YMVA 5HKOA 1NTRA 1K66A 2LP4Y 1QO0D 2NUBA 1MIHA 2V0NA 1E6LA 1RNLA 3NHMA 4H3KB 1TLFA 1M2EA 4KZKA 4UHKA 4DN6A 5KQPA 1QO0A 4KPYA 4B09A 3ILYA 4YLEA 1LBIA 1Z15A 1LJLA 2FEKA 3KTOA 3GL9A 3DLBA 1KGSA 3LKBA 5EWJA 3CLKA 4W5TA 3A3KA 3MYYA 2RJNA 8ABPA 4KK3A 3N0XA 1BDHA 1QQAA 1QQBA 1EWVA 2QR3A 3OM0A 2GKGA 3CU5A 2IYNA 1QP7A 5CNJA 3RQIA 3BREA 5CNKA 3K9CA 1E6MA 4RK5A 5EWJB 2E4YA 3T6KA 4OLAA 3SM9A 3OLVA 4LDAA 4RY8A 4HNSA 5IUNC 3F6PA 4OATA 1P6QA 1CYEA 1HEYA 3KSMA 4ZPJA 4IF4A 1TVMA 4RK1A 3OLXA 2WMYA 4Z4HA 3S99A 1RPJA 3BRSA 1FSPA 4KVFA 3KYJB 3CFYA 5KC9A 1Z2EA 1NXWA 3QLVC 5FWXA 2WJAA 2A9OA 4HYEA 1USKA 1W9HA 1ZN2A 1XWWA 2MSKA 4MQEA 3QELB 4NICA 1JHZA 4FE7A 3HVRA 1A0OA 3KLOA 5TQ0B 3JTEA 3LUKA 4MR8B 1DCMA 4O1IA 3DBIA 1YTUA 2QV0A 5PNTA 4RK6A 3D8UA 3TD9A 2JVIA 4LX8A 5HQJA 5TE9A 2OQRA 5KQMA 5T7BA 2R47A 1GLGA 3QX8A 2QZJA 1SXGA 1ZY2A 2N9UA 3H5OA 1DRKA 3ROFA 1DZ3A 5IC5A 3RVMA 1EAYA 4XXHA 5DGCA 5BRJA 1BDJA 1D4ZA 1LBHA 2QSJA 3SNKA 1JH9A 4GPAA 4IMIB 4RKRA 5DTEA 5B3JC 1VLZA 3JPYA 1EWTA 2KYRA 2JCGA 3B2NA 2PUCA 1P8AA 2HJ9A 3KG2A 3RVQA 3IP6A 4XFKA 3T95A 4DQDA 3EULA 4RWEA 1ZH4A 3TO5A 3JVDA 4H3HB 2MYTA 2HPHA 2HQOA 2HQRA 1NXSA 3KS9A 3NNDA 4MRMA 2P9HA 1USIA 3O2QB 4JB0A 2AYXA 2FLWA 1Z16A 3O74A 4Z9BA 5TPWA 3O1HB 4CBVA 4ZJPA 5TQ0A 3E3MA 5DKFA 4G0PA 3MA0A 3H5IA 3CZCA 4MQEB 1KRWA 4KFCA 2HQBA 3FGZA 9ABPA 3NNNA 3CNBA 5IX8A 4OLBA 1A2OA 2FN9A 4FE4A 3N75A 3NBMA 2PUBA 1JFSA 2IPAB 4N03A 3H75A 1D5WA 4JB2A 4JOQA 4RDCA 3RVLA 4G97A 5IUJC 1CEYA 2FXIA 5FWYA 1QMPA 3HK2A 4LRQA 2MYNA 2IPMA 4MGEA 5E3JA 3N8IA 4NCBA 4XLTA 4UHJA 4MLCA 2O20A 1DBWA 2A9RA 4IILA 2M1ZA 5C5CA 2A9PA 5JNWA 3C6QA 3CTPA
chains in the Genus database with same CATH superfamily
4OQPA 2QB5A 2QAGC 2KLHA 5ALPA 5LA6B 1EHYA 4CIWA 1NG9A 1SWWA 4IEEA 4GLOA 2JAXA 4EJMA 3IAUA 4X9XA 1PHRA 3WAJA 3W6NA 1D8TA 4Q15A 5GY7A 4XX0B 1D6SA 3DHVA 3P0JA 3FW1A 1SQGA 4LQ4A 5GIPE 1NIJA 3C5HA 1OGIA 3FUUA 3KO8A 3AERB 3BJIC 2RC5A 3OJXA 3EXG2 3SOPA 3GGCA 4E5DA 1VL1A 1Q74A 3OAAA 4NJEB 3FHCB 3MFQA 1RQGA 4INOA 3L3BA 3NFYA 4Y9SA 4CTJA 3R2JA 3S5UA 5LQJA 2VHZA 1RJDA 2NU6B 4NBSA 5EA2A 2Z08A 3H1FA 3Q3CA 3RU3A 2QRJA 1PFQA 2GWRA 3AR9A 2GPBA 4TV8F 1EA7A 3GIWA 3I42A 2PM8A 2B6HA 3H1AA 1N1GA 1ADFA 2YY5A 3DVSX 4KO4S 4PV7A 3EIQA 2VQEB 2VRCD 2NVWA 5JJBA 4Y18A 1QCCA 3IP8A 4AIIA 4JYZA 4YT2A 4NQZA 1Q83A 5DLDA 4P7JA 2IZ6A 2GYWA 4YMVA 1L4NA 3BQ9A 4RFLA 2BBOA 2D7CA 5I9SA 5EJ2A 3C6KA 2BFEA 3H2BA 2GN2A 3FWYA 3CF6R 3IQGX 2EFJA 4Z99A 1JX6A 4V3CA 4DDVA 1PNTA 2NZVG 3R75A 3ZDFA 2O06A 2GN0A 2JH3A 2D1TA 4MVJF 3KZXA 2X1LA 2NVUB 5KYUA 4D0RA 1XEWX 3B6EA 4R1SA 3T4PA 4YDQA 1JHDA 3SK0A 5HKBA 5CHYA 3FWPA 4V1CI 1T0JB 2AG5A 1TK2A 2DPGA 5K0BA 2AFIA 3Q3JB 3TZBA 3VR6A 4CM1A 2IU3A 4TVOA 5BVHA 4WLVA 5LQNA 1G7CA 1P73A 1C7IA 4JI0B 2XZOA 2DUJA 1WX1A 4G9GA 3WA7A 1MENA 4RLHA 2GXSA 2P7IA 5LN1A 3IAEA 4CE6A 1M72A 4YS6A 1UAAA 2OHIA 1NWHA 3V4RA 2YICA 4F8JA 4V1CB 3KJNA 3U4GA 1SXJA 4P4NA 2JGDB 4G09A 3G68A 4LOJA 5C8YA 1K92A 3IQXA 3UATA 2G04A 5HDQA 1FUEA 2QSZA 4TMFA 1JDBC 3K2EA 4PLHA 5JD3A 1R9NA 2EJVA 2ZUDA 3OPXA 1O97D 3R1IA 3WSVA 3VJKA 1A5TA 2H4WA 3KOXA 1GPDG 4URUR 5HKKA 4EMSA 5KVCA 1DJLA 2BGLA 5DTJA 4A6DA 1LPPA 4QJIA 4DXAA 5CD1A 4OHWA 3KKOA 1MT0A 2JF0A 3OM1A 3ZZUA 2MSNA 1CZRA 3NHKA 4BNZA 4MVJD 2FR1A 5J5CA 3UG7A 2I6GA 2JL1A 2W6IA 4BB9A 1JH8A 3IDFA 3IRUA 1LDYA 2DPHA 4MS4B 1B1CA 1VQ1A 3S2SA 5LD2C 1DADA 4RA6B 3PUVA 4AULA 3ICEA 3U5TA 2ENWA 4M0DA 1FFXB 2JW5A 3NIDB 4QPNA 1UMKA 2R4QA 4JD5A 3FPEA 5BSFA 4G4SP 4OTZA 4IJUA 4YUWA 5EFZA 1O58A 1T2AA 3OM8A 1TQ6A 3DR3A 4JI1B 2LNDA 3HLKA 4Z0NA 3FVQA 1J39A 3CRNA 1VB5A 2D1SA 3AFMA 3KUDA 3V4OA 3W1WA 3KU1A 1GCAA 4L50A 3OCYA 2JDID 2CC2A 1ADYA 1GPKA 3P9KA 5I5GA 1YOVB 2P3SA 2QW1A 1A9PA 1DX9A 5TC4A 2XF2A 2WU0A 4LI3X 4EK9A 2OBNA 3LBAA 2G8NA 2O6HA 1JKMA 3S2FA 3I05A 2G0TA 3U3MA 2IIVA 3BL5A 3V80A 5M3BA 3EZNA 3KEOA 3P97A 4JC0A 5BQXA 4BLSA 2JHAA 2PZEA 1WTAA 5KYYB 1Q22A 1M33A 2AVNA 2G9ZA 1H3FA 1RC0A 1V96A 1P7PA 2VNAA 1AO3A 4P82A 5L95A 2BSXA 5KSWB 1L4YA 1EFRD 1VL8A 3DC2A 3OTQA 1NHGA 3GGJA 4IXDA 4EUKA 3UOAB 2JFWA 3SQLA 2VHUA 2VP5A 4IX1A 2H7XA 2XHZA 2ZXFA 2GEVA 3KHUA 4MTCA 1J2EA 3BE8A 1NG1A 1WPQA 2XA2A 2A94A 2PV7A 3TW8A 2AJ8A 2MHCA 2G0AA 3VZRA 3EA4A 2FQXA 1ADCA 1B2LA 2ZPAA 1GNLA 3HZOA 3HB0A 4RQUA 3RD5A 1QVWA 4Y2TA 2L2QA 4R51A 4CCAA 3AOEC 4NMMA 4MYRA 2HLDD 3GGGA 4WKGA 4F2PA 2YC4C 4RV4A 4C4RA 1GGFA 2GHIA 3NDIA 3ZJYA 1KY2A 2B1IA 2LUOA 2M6SA 4F04A 1THMA 2FW1A 4KQJA 4MUBA 2DAPA 1Z06A 4FMBB 5CH5A 1SCQA 3UZUA 3IOMA 4BNTA 3LBYA 4CMCA 5B36A 5IVPA 4B8YA 5SYNA 2W6PA 4W82A 2J0UA 1BDMA 4MW9A 4ZEVA 1AF7A 1SVWA 3CLTC 3QOXA 4YHHB 3O6VA 3NT4A 4MV6A 2FNAA 2H2FA 2G67A 3LT0A 1T9AA 2ZJ0A 3PVSA 2O2SA 3BWEA 1QH8A 1A50B 1PT7A 4JP3A 1M8FA 2RHGB 3G9UA 5FTNA 5GM1A 3ZYZA 3QWFA 2BH9A 1ZJJA 2XH8A 3NI2A 2IDJA 4Q0MA 3ZW8A 1E2QA 1XZCA 5ESWA 1G9TA 3I58A 4NABA 2WM9B 4D74A 2QIOA 1BW9B 2OC4A 4WX2B 4GSLA 4CJXA 1J0CA 3FWHA 1KI1A 5D01A 2V3WA 3FTCA 3L8CA 4TRRA 3A6FA 1K68A 3V7WA 3RRFA 2AGVA 2BGWA 4UPDA 1KK0A 5JYBA 2D5LA 1S2GA 3FPBA 4BFUA 2FN8A 3JXEA 5D2CA 3R9IA 3RFCA 4M0UA 2WJ3A 3U7QA 1OFUX 3KQKA 2YVAA 2ZBQA 4Q9IA 1II8B 4WFQA 5ANRB 5EFOA 5DEOA 4BWVA 3FYTA 1TF7A 3WBJA 4R05A 1ZR2A 1CE8B 1P5JA 1IAQA 2J6BA 1P6XA 3EIWA 1NMXA 4IGFA 4K6OA 4CV2A 2WKQA 5JXIA 1PW5A 4K9PA 3KUXA 2ZUTA 2VSYA 3BWMA 4S2UA 1EFKA 1MG0A 2AUMA 3EJ6A 4HG2A 2OZLB 4Z49A 3G7NA 3PIIA 4J4TA 1EX6A 1U4SA 1IRXA 1Z26A 3B2QA 2B7CA 4RF4A 4V2IA 1QG6A 3M4NA 3ZZ1A 3UMJA 1FPQA 5J23A 2R6GA 2YY7A 1QCZA 3HADA 2D00A 1E2UA 1XHEA 2IDZA 1ONPA 4L73A 3ZPXA 3WMGA 5DBEX 3HZHA 4OJQA 3W4KA 4J7AA 3SBOA 1U28A 5JFGA 3NXSA 1O3YA 1W30A 3BFXA 3EG9B 1SG0A 3S2YA 3TOXA 2HTEA 3CVXA 3AUYA 1GA6A 2YHUA 2R6FA 3G8YA 5I7SA 2WB2A 1M5RA 2R8RA 4K6GA 1JDVA 3V9AA 2XB8A 3EVNA 1BA3A 1B4DA 5ALUA 3NKLA 1YZUA 4RKYA 4YRAA 3GUVA 1QTNA 2EHJA 5FV7A 3VSDA 3IKMB 1EK2A 5ABPA 2ZWOA 2HSZA 5IMSA 3GPBA 5KOYA 4L85A 1PZXA 4UU1A 1Q3HA 5KHOC 4MROA 5LD2B 1TTTA 5CDSA 2XLBA 4DNQA 3S3TA 3VPSA 4E5VA 4HRXA 4EB6B 1U3FA 1QGZA 4CKCA 4N0PA 1X7YA 2YOHA 1EJ6A 3UT6A 4GNKA 5AI9A 2EFEB 4AK9A 2WF5A 5FPHA 4TXLA 4WKBA 3TJMA 3CUYA 4XUCA 3L02A 3L7BA 4KWCA 2NZ2A 4LY3A 4LDJA 4XYEA 3HV0A 4NDZA 4YJ3F 5DCUA 3WGOA 4Y6LA 2A0YA 2GN1A 4OHBA 4WCVA 1BGVA 3BUSA 3SXJA 2XWBF 4BGVA 2PZ8A 2C57A 1P91A 2C2KA 3TPZA 2BSQA 4GDMA 2Q8PA 1O96A 4RJTA 1BEZA 2F8LA 4J7UA 4LSMA 2GRAA 4MUHA 5EYPB 5IBQA 1N0UA 4DRXA 1KVUA 1NBHA 3MW8A 4ZHQB 2VNHA 3EWNA 1L2TA 4ZO6A 1I5OA 1PNRA 3RKRA 1KHHA 1GUYA 1N92A 1OFUA 2QTVB 2WWFA 4L8YA 4YVFA 1OH8A 4BLWA 3BT7A 1YKGA 2D2EA 5JOQA 4JUAA 4RKQA 3GLIB 2WICA 4MVYA 3I72A 4Q7JB 4GKAA 1K4KA 3NDRA 3VBCA 3PFFA 3LPAA 3FLBA 1DTEA 5FX2A 4LYFA 5KVAA 5IDQA 2HF8A 2PWYA 3D3KA 1YFLA 3C6ZA 4D81A 5AW4A 3KKMA 3BMOB 1W88A 4NNOA 1OI7A 1A1SA 1N9GB 4ZRMA 2O2IA 3ZYCA 4FEAA 4BV8A 1KYZA 4M8KA 1G5QA 2OV4A 1SIBE 4XIYA 2IYLD 5LP6B 1OBVA 1LU9A 4RV5A 4I2VA 5K3FA 3I1FA 1Z34A 1VDZA 3GJRA 1YMVA 2SICE 1U2TA 5KPJA 2E5LB 1OBCA 1TF2A 1JGTA 5TF0A 2JK0A 1W1WA 1GT91 4DYVA 2R1VA 1SUWA 5LNK1 1IMOA 3THWA 4TL8A 4UBMA 3F9IA 3WOHA 1KGSA 1L8OA 4GMDA 3OWHA 1G5HA 4OQNA 2IS6A 1QOQB 1TO1E 1GZ7A 3NBXX 4IJVA 5K8JB 1U9ZA 3P26A 4QC2A 3COWA 1XA3A 5EMLA 1TRHA 4DEYA 4UHDA 2GPTA 2NVUA 1KC3A 1RCUA 2XQFA 1QP7A 5HFAA 5HUQA 3AF2A 1NVDA 4RPHA 3SI7A 1F8UA 2I8LA 4F9FA 4FI3C 1Y8ZA 2P9TA 2F59A 3CH4B 3P0IA 3SLGA 4BQEA 2CVFA 4C1BA 2HWUA 1JDUA 3H0EA 2XF8A 4RLFA 1K06A 3E9MA 4F0JA 1W46A 2Q4OA 2YHIA 4BHTA 1RDFA 1H2YA 3GRRA 4B40A 2VP6A 3KSMA 5EKSA 2XOEA 5KB3A 2E37A 3AESA 3W79A 2IUTA 2QENA 3I28A 4J0IA 2JJ2D 1SGWA 1S3GA 3N70A 3QF4B 2HIGA 3U7JA 4DR2B 2F4VB 4KR7A 4Z4HA 4IR7A 1SY7A 2EBHX 3V1MA 2OE2A 3V3KA 3Q8LA 2OZVA 3G2MA 5HZGA 2QSUA 5IAKA 3NORA 3R3YA 4JVMA 5GTDA 1DZIA 5KWJA 3ETNA 1G6HA 2IUSA 4ENUA 5EERA 3ZTWA 2C5BA 2JIOA 4I1VA 1I01A 3I5MA 1TZKA 4XWKA 4E5YA 4GPIB 1PT9A 5HF5A 4RHTA 1JTVA 5JLJA 2XUDA 4J2OA 2ZVJA 4AZ0A 1TU3A 4WGGA 4CKWB 2EJWA 1PDVA 3OOHA 3PGVA 5AVXA 1ZK1A 1E2MA 2IEAA 2VF8A 2AFHE 2IP1A 1M2NA 1E4EB 1ISGA 2G07A 5ERYA 3ZJVA 2IQ5A 4UM5A 4LX8A 1D6JA 1N2BA 2HWYA 3LVFO 4CMJA 4ENVA 2F55A 3MAGA 5LOVA 4AY2A 4BQIA 1D03A 5L3QB 3CLRD 3SDBA 4OK6A 2VZEA 5J1SB 2W2OA 1W29A 2OXFA 4GOJA 2YV1A 5FEMA 3K1YA 3K9BA 1P19A 2HNBA 4I50F 3OT5A 1OWLA 1NSYA 3JW8A 1VSTA 4MQMA 1U9IC 3EVZA 4RA9A 5LZ2A 4XXHA 1I33A 4ZI7B 1WXQA 4YRLA 3HXLA 1X1SA 3MB8A 4ZCQA 1PGJA 2VP0A 1XJWA 1T5LA 4P7GA 1VLZA 3VSCA 3IE1A 5HCNA 2H2DA 4ZEMA 2QM8A 1G8JA 2HJ9A 1WV0A 2NO6A 3UJPA 1UZNA 1TYZA 1ZVMA 3AVOA 3U2QA 2AOVA 3TO5A 3WYFA 4DRYA 4TV8A 1E0DA 2OAP1 2JFGA 3AJ9A 3DZ8A 2HPHA 3G2HA 4HN2A 4JNCA 4W5WA 2Q5HA 3T3MB 3OQBA 4JB0A 3USES 1DS6A 1Y5LA 2XBLA 1OWOA 1O9BA 2IJGX 5AMXA 5FBVB 4FZRA 4ALNA 1DVRA 3ND6A 4L1KA 4BB5A 2GM5A 1JIQA 1KDTA 2DUUA 2YWHA 1P5RA 3DTVA 1NVTA 3LECA 3IPYA 3O90A 3RFUA 5IXJA 2VDNB 3IIEA 4KE7A 1UODA 3MRVA 4M53A 4P2BA 5I51A 1TIBA 1PFGA 4ZEWA 1RQNA 3DQZA 2P4HX 4XYLA 3N7AA 4TQAA 1FJXA 2YQ5A 3RUEA 6REQB 3FOZA 3EFOB 4O02B 3VR3D 2A88A 2FX5A 1SKAA 2Z9DA 4MLPA 3HU3A 4UDNA 1KR2A 5F7JA 1PQWA 1U81A 4KSBA 3DKRA 5DM1A 2FV8A 3C1AA 3FN4A 4TRNA 4DE5A 4FHFA 2HHLA 1X86B 1IG3A 2AOTB 4X7MA 1WJGA 4YDSA 3STXA 3UPDA 4A9AA 2XUPA 2ORVA 1M1XB 2FP3A 2ZJ2A 4WKOA 1U9CA 1P9LA 2ENUA 2ZAOA 5HS6A 2IPMA 5E3JA 3SJZA 2XNSA 3S81A 3WLOA 2C29D 2XYHA 1UT6A 5CMLA 3S8YA 1K7YA 1IQUA 1N36B 3BDIA 1TD1A 2C82A 3LW8A 5JNWA 3C8MA 3KE8A 5EIFA 4WTOA 3ANSA 4WVFA 2MSLA 1DDOA 1WY7A 3AG5A 4S1PA 5BMOA 5JAMA 2XCRB 3ZE1B 2FE1A 3AKDA 4O29A 1DXYA 2XIQA 4UUOA 3X2FA 1MO4A 3RS4A 1U04A 4PGHA 3PBKA 2IHJA 3CONA 3STUA 1N9KA 1S4MA 2Q5LA 2OD7A 1Q1QA 4FDTA 5AM4A 4F6RB 2IBTA 1RBZA 4Q9JA 4AJ1A 3RARA 3N2EA 4KLRA 2W43A 3FCYA 2V0GA 1WB4A 2X3UA 1VE9A 4FNAA 4ZVRA 2CLCX 1G8SA 2BFPA 2IU0A 4B8ZA 1MQAA 3CQ9A 4V02A 3CLVA 3KLNA 3TTTA 3IHKA 3DPUA 1O1YA 1KK3A 1PFYA 1QHYA 4PSUA 4MH0R 4HYQA 1ODIA 1S8AA 1T8YA 3MG9A 1CF9A 2A4KA 2V7BA 3QXXA 2H00A 3VOTA 1C9YA 2RKWA 3LLVA 1USGA 4E7PA 2IYFA 3A6DA 4IPTA 4X1IB 1V35A 4FP9A 4ALJA 3VC1A 1ZM7A 3T3EA 5C80A 3ICWA 5ITWA 3MTQA 3VPAA 1W4BA 1X15A 5CW2A 3V8VA 3IKLA 3HVIA 1ICEA 1I5RA 4FLMA 3RADC 1WXDA 1VG8A 2D4HA 1DAGA 1DRWA 4KRYA 3NM6B 1T13A 3I9LA 1N7JA 3JALA 2GARA 3EMBA 1G38A 4EHBA 4ZEXA 1PX0A 1URPA 4X24A 3T5PA 1AZLA 2QX7A 1UJ6A 4JMLA 4KR0A 4QIHA 3PXBA 2AMYA 4XWYA 1FA9A 5JCOA 2H52A 3HUFA 1X0XA 3ASYA 4MULA 4OHYA 1RQ2A 3CSUA 4IUYA 4WHMA 4CWAA 4XGNA 4DUZB 3PPIA 2ID4A 3QKTA 2GJ4A 3F8WA 3ZHUA 1ZBQA 3TMKA 1I4DD 2ZIVB 4NXMB 1A5SB 2JFOA 5AVOA 1T3ZA 3SSNA 3DL7A 4ZT6A 3FAZA 2ISSD 4JBLA 3LP5A 3AY7A 1OR8A 3ZJUA 2RHRA 3ULKA 3L7YA 3PA8A 3HB9A 4MUFA 2VZ9A 4Q1BA 2JJMA 2WC1A 4R8RA 1WSAA 5CFLA 1I3CA 3MOIA 2FPGA 1GEEA 2GA9A 2Q2QA 2QPOA 1W5BA 3EGIA 1XELA 3KJXA 3PF9A 2BDEA 3KZKA 3TQOA 2BHSA 2CD7A 3V5NA 4B8WA 1AKVA 3DCJA 3QLVA 1ELOA 3H9UA 4P36A 4PQYA 5CT8A 3UB2A 2D7DA 3AVXA 1SUAA 1YHZA 4ZTUB 2XYVA 1OZ0A 2PZKA 4CODB 5BSHA 4JJFA 3SYRA 4D79A 3ZHVA 2RI6A 2AHOA 3WHIA 3U19A 1G8AA 3Q72A 2WAAA 3H2YA 4RY9A 4Y2VA 3C3YA 2JFHA 3G2IA 3NTRA 2ATCA 3SDZA 4K2HA 4X66B 4BMYA 4OP3A 1DP4A 3GWGA 1JAHA 3A1UA 2XEXA 1DLIA 3GMIA 5AOVA 3HY3A 4GI5A 2BKAA 1Y5MA 5JAHA 2AF4C 4RD3A 5JSFA 4V0OA 1W88B 4MUMA 3ZJ5A 1Q20A 5KWEA 4CUKA 4EKIA 1XZQA 4ZVOA 4R68A 1VE6A 1DLJA 2J41A 2QN9A 5LM3A 3RYCB 3EXIB 2I7VA 5A1JA 2JLRA 1I4OA 4IDDA 4BB0A 3REQB 4M60A 4CIVA 1XTJA 4P7FA 3P9NA 4G3XA 2I6XA 7MHTA 1N6KA 1I9CA 2QL7A 3DLIA 2Z5FA 1PG2A 3QXSA 1Z7GA 4KTVE 3AEKB 2HA4A 5DMHA 5KQSA 3AKZA 1EVLA 3H3FA 4C4OA 2IKSA 1P9RA 1OAKA 4RSMA 1H4TA 2JD2A 2VA9A 3VZSA 1KJ8A 5EYPA 3PFCA 4ARVA 5K0ZA 3IMKA 3D4NA 4IGIA 4WK2B 3DHWC 3UGTA 4BNDB 1ISPA 4D97A 4DAEA 3PEYA 1FQWA 3QENA 5BNIA 2QTBA 3W2HA 3SN6A 3ZV3A 3J81A 3OCCA 3NATA 1ADJA 3GFBA 1TM1E 3KR9A 2VJLA 1R0CA 4NARA 1TKCA 3O8RA 1E3JA 5U4QA 3PL5A 3GR6A 3JQ8B 3MTEA 3S6JA 4KQIA 2X9VA 2DWOA 1K0UA 3BZUA 3PHLA 4MKIA 3X1WA 3LX5A 1RPZA 4KUEA 1QS0B 2X4GA 3T1YB 4M8NE 1NMZA 2JLZA 5CVVA 1NC3A 1G19A 3KSUA 4R5HA 2OM6A 3TLZA 1YQDA 1ZN8A 1ZOIA 2WTMA 5P8WA 4E2ZA 2WVHA 4E4YA 1YQEA 3Q3VA 1E3TA 2A4MA 3BHIA 2HWKA 1FFWA 3BEDA 4JLKA 4LZZA 4QU9A 2JCXA 3H9EO 2QPLA 3DHEA 3CVOA 1BGWA 2GCOB 2WHPA 3G2KA 1D2CA 2CVQA 3MM4A 4IM7A 3SAJA 5JVDF 4XH9B 2JIDA 1UPUA 3CWZA 2PSSA 3Q3IA 1RZRA 5DP1A 2UU9B 3QMVA 4ZARA 1TFRA 2YZ7A 3G0DA 1RLJA 1NQAO 2NXEA 3FMOB 1XMXA 3I0MA 3EAQA 1T8TA 4XWGA 4YGXB 3LFUA 1L5HB 3WBBA 4LVCA 1UK6A 4P3YA 3P0RA 1SK8A 3CINA 3IT3A 2J3EA 2BR3A 3WGNA 3K3PA 1NNI1 2QN1A 4DCVA 3FFWA 5FUXA 1B14A 1UBJS 3FYHA 4EG5A 4HH3C 5DNYB 1NIPA 1XC7A 2WJGA 1IPFA 3I9FA 3V32A 3K0CA 4NXNB 3OSUA 2WRZA 3STWA 3IEUA 4D6PA 1PLLA 2Y05A 2I6UA 4U2CA 2IHYA 5JARA 2FR0A 2ZSUA 1EFTA 1KVTA 4KXWA 5AHOA 1KP9A 4H4CA 2CDBA 3ANNA 3CKYA 1COWA 2ZRGA 4JT8A 5CIWA 5IK2A 3A25A 2ZB2A 1ZESA 3B48A 2FR8C 4MCJA 4WOBA 3DBRA 2XV1A 3CLRC 4JENA 3ZBTA 5EJMA 5LYYA 3DZIA 3LT1A 4R5MA 3W0LB 3W7BA 4BB6A 2FK7A 3VYVA 4NBRA 4CW7A 4TLEA 3SXUB 3HR4A 3P7MA 4Y2HA 5HNKA 4FYJA 3V4PB 3ZCXA 1M54A 2AX3A 3GRVA 2ZROA 1YGYA 3BSSA 2C8JA 4JB3A 2OYRA 3SBEA 1M1ZA 3HACA 4GWKA 3DVAA 2O1XA 3ILSA 4G5QA 4G56A 2ZKLA 4DY4A 2G5PA 1HLGA 1WW2A 3TECE 3BFVA 1JKFA 2GNAA 4HMOA 1T1IA 4ND1A 1XP5A 4MWCA 4NHEA 3K4QA 4Q1CA 5AI8A 3T1HB 8LDHA 3IUQA 3UWPA 1MR3F 2ZITA 1E1DA 4UNRA 3DZCA 3PR2B 1MXFA 2GF9A 3WLMA 5JJCA 4Q19A 2IHKA 5JO9A 1XCLA 1YC2A 3GEHA 4EBFA 2ZSIA 3WIUA 1OAAA 3SEQA 4TT3D 1SJ9A 2NM0A 4QODA 2PFGA 2R8OA 4LRXA 4QARA 4BAUA 4DDKA 3RSGA 4XVRA 1J23A 2ZAGA 1ZM2A 3QNUA 1Z0SA 4MX8A 5JNSA 1U6KA 1QZZA 2FJPA 2FZ5A 2P9EA 2JGEA 2XD4A 4BQRA 2CVHA 3V8MA 4YDRA 2VYQA 2FPLA 3R3SA 1FDSA 5EINA 5HA5A 4FINA 2Q6IA 3H1TA 2VQFB 1V5WA 5DGXA 1Q57A 1QRRA 2HCJB 4ZQCB 3RRYA 3WLPA 4FMDB 3OO0A 2WY2D 2HCFA 4ZT3A 4BBPA 1JQLB 2V59A 4GMKA 5IJ0A 1XMQB 4EG7A 4LMAA 2VYFA 4QICA 3A1FA 5MF6A 2VJDA 2XCTB 5CITA 1E9EA 4WXMA 5TY0A 4B6SA 4BP3A 3H0CA 3AK4A 2F8MA 1VYTA 1SHLA 3DAOA 2X76A 1X1EA 1BCSB 1SKYE 2FG7C 3IYLW 4PXSA 2H54A 3RS2A 1RRVA 3SYLA 3W5VA 3W5IA 4Y1RB 5DYYA 4ZYWA 7MDHA 4ZZ3A 3NMUF 1HL3A 3HBNA 4N5NA 2PBZA 1PDOA 1N7GA 2PYDA 4PGMA 3OLYA 2GEFA 1LWNA 5EG5A 4E2XA 4KXFB 4TLLB 2Q1SA 3PLNA 5T64A 3IHTA 3TCNA 5CVTA 4QPCA 4Q7EA 4C06A 3WYEA 2QDKA 1ATIA 2VSFA 3S27A 5FTJA 1SIOA 4CFYA 2HC9A 1VMIA 1YWGO 2EGHA 4NE2A 4OSOA 5EZ5A 3C41J 3ID6C 1YQQA 3W06A 1OAOC 1GNVA 4MQ4A 3RVJA 3WWZA 3TTVA 3HN7A 1JT9A 3JRXA 2B35A 3H2HA 4G9EA 3VFDA 2OXTA 4ZGGA 4J91A 1V1RA 1KJYA 1EGVB 1SC4A 3U0VA 4DSZA 5GZ3A 4JI4B 3F1KA 1IY8A 2V4ZA 1DEKA 3HGQA 1GQSA 1W59A 2F1KA 2SKEA 4CMBA 3OE5A 3DCNA 5DM60 1UOQA 1LPMA 2C4NA 3BTSA 2XCIA 4DC1A 5AM2A 4FT4A 4ENSA 4ARCA 1T0HB 3HQ4O 4ROTA 2YUIA 2QIPA 4P8RA 3VYTB 2BFCB 4IOKA 3VX4A 5FADA 3PCTA 3PCRB 2YUTA 2ACKA 2ZE7A 1V16B 3CWCA 5FAKA 4OUDA 2R7AA 2NUPA 3DMTA 3WJ2A 3ZU2A 1DBPA 2IZOA 1S2LA 4DM3A 1JU4A 1ZIPA 3C5EA 3I09A 2ZTSA 5G0TA 5E6RA 1RRMA 3DF7A 2EQ5A 2H8GA 2WIGA 2Q3JA 5AK0A 4UDYX 1T1GA 3ROMA 4B3TB 1AGRA 1V26A 2JEOA 2E85A 4WBNB 2J0VA 3M9XA 1C2TA 4JS0A 1PDWA 4M6WA 3WS7A 4EI7A 1MAUA 2VSOA 1EJ0A 1L9XA 2H5JA 2BN4A 3A11A 2NOAA 3GLSA 1X80B 2JS7A 1QO0D 4LGMA 3FZEA 2BEUA 4R2WA 2YZMA 3ZQ6A 1LVUA 4B3DA 4YMGA 1ESZA 5LDDC 3SR0A 1M2EA 1MPXA 4KZKA 2G06A 4L02A 4L72A 2KM1A 3A1EA 4RHXA 1QZTA 3T9CA 4POOA 4L28A 3OCZA 1LBIA 1VTKA 4IIVA 3B2EA 3QFCA 4R1MA 1DIHA 2XOKA 4K9NA 3TL2A 2JIBA 3E5MA 2FSIA 4FXOA 5K0GA 2CNNA 4L8VA 1XE3A 3LLSA 5BSMA 2H2IA 1XQWA 1XLTA 1QG4A 1E7WA 3FPHA 2SKCA 4XX1A 4YB8A 1YCDA 4LN1A 2IW1A 5AVKA 4EW3A 3CE9A 3RUFA 1EZ1A 4KXMA 1GQ2A 3CNNA 3QBTA 1N25A 1X9HA 3LRPA 5TS3A 4LDAA 4F84A 4LWQA 3TKAA 4OATA 4N9QA 5B58C 1TQ2A 3L5OA 2G80A 2AKYA 1BHQ1 4KGXA 3GAMA 4E07A 1TVMA 3ZDXB 5IZ4A 5A04A 3HG7A 1U0NA 5CD9A 4YP1A 1B8OA 1R6UA 4RY2A 3RSCA 1VIDA 3JWGA 1GUZA 4HUQB 4PGAA 3GOHA 5F9FA 1XDSA 4ASUD 3TSWA 2WU3A 3BKWA 5BYJA 4COOA 4EPRA 4HSEA 2WYIA 2FUKA 2LVBA 1TJ3A 3MGCA 4HNGA 4QO7A 3UJHA 3ZUPA 3WAGA 2C0CA 1QM5A 4QGBA 3THRA 1DDGA 1Q1EA 2BRUA 3DEJA 3FB4A 3JQAD 4Z1OA 4CTOA 5KU7A 3VJRA 4F46A 5HIAA 2J87A 3NBKA 4TYYA 1Y8CA 1Z83A 2PXAA 5KOJB 1I14A 3D7SA 2VKTA 4K9OA 1JHZA 1RWWA 1BQEA 3COVA 3KLOA 1E6CA 2VHVA 4AS1A 4QOHA 2AZMA 2W2KB 2HBYA 4IUCS 3NS7A 3K2QA 1C30B 4O4JF 4HC4A 5K0TA 3GQBA 1L4EA 3ECSA 1MJNA 4ROSA 2FDXA 3DBIA 2Q5FA 3O1LA 1PT6A 1FVFA 3MINB 1OX6A 3ESZA 1YTUA 4XPIA 1YS4A 5GINE 3A6EA 3AERA 4EPWA 2AN4A 1ZD9A 4JWTA 1FDOA 5CRIA 2ZWPA 5BYBA 1O4WA 1ESMA 1L7DA 1CEEA 2AEEA 4QYXA 4BECA 2J5XA 4RABA 5GVRA 3UO8B 5DGCA 5LA6A 1JR6A 1JW9B 1D4ZA 2ZR0A 2M1XA 3JQ8A 3A9SA 2B2XA 5C5IA 1S9HA 4L5JA 1F6BA 2JFBA 1XNQB 2J0QA 2EFYA 4UCQA 4IMIB 3TE7A 5JMWA 3QYFA 5TV2A 5EEHA 1EWTA 3P71T 5EE1A 5IN4A 4MIEA 1UWKA 4R2HA 2SCUB 3KG2A 4AF8A 4F2WA 3E48A 5CDFE 3CCBA 3FTFA 2GHTA 2XLCA 5DWQA 1UJCA 3DAGA 1E62A 2HFKA 3K0HA 4FZ3A 4HNAA 4QQRA 5E6UA 3S2ZA 1RXUA 4BE7B 2A67A 2FUG1 4XM1A 3ERCA 1CUYA 1W2HA 1P75A 1ODLA 4W5HA 3UA4A 5JC8A 1U11A 1CERA 3IIJA 4Z3KA 2CXRA 4MB0A 2HIMA 3GP8A 3MFYA 1BD4A 1JWBB 2G9VA 5CHEA 2ZCUA 3B9QA 3FJYA 2XSZA 2GUGA 3IEKA 2PQ2A 3IOBA 1KH2A 4R6XA 5BMVF 4WW0A 1SCIA 5E2BA 2XX3A 4U9IS 5DHFA 3CKLA 4Q4AB 5GJWC 5KPDA 4WDRA 3VSEA 1XRSB 4OM8A 5M7EA 1CDOA 1ODKA 3UGQA 2KWIA 1ZCZA 1IB6A 4NJMB 2PUBA 2VPQA 1PJRA 3EEQA 3FWZA 3PXGA 4DQVA 1JFSA 5E1BA 1VPEA 2GYVA 3RLIA 2OB2A 2WAMA 2FXIA 1JVBA 1U0HC 1CWUA 2Q45A 2QL9A 2WWTA 2X40A 4NS4A 4OQYA 4QG3A 3D6VA 1D0SA 5ECGC 2ZBUA 1CY6A 3E0QA 2GLXA 1JQJC 3KOOA 3IJEB 1WB6A 4EFMA 4NAVA 2V6FA 2Q27A 1Z2AA 3PFKA 3N2KA 4Y6SA 4LHVA 3CIOA 4CKBB 4BO8A 1LSUA 4YBZA 5JRDS 3D8RA 3F3MA 3KYCB 1NBAA 4ZAZA 1RTKA 1J0DA 4N0MA 4CM9A 1FDTA 2OV8A 2OZPA 2B2NA 3KR2A 4G01B 2Y68A 4WPGA 4J07A 4E14A 4UQLA 1HNNA 3BWBA 4HX5A 1FMLA 3AXTA 1XXHE 2RHOA 1APBA 4KREA 4HGZA 4DJEC 1M74A 3X1YA 1OKKD 5LNK6 1CFJA 4UM7A 1ZR4A 2GLUA 2P9GA 5K0SA 5MN4A 2AYYA 2QAJA 2QTVA 3AP2A 3O4HA 4HRVA 3RRMA 3UXMA 2BTEA 1OXBB 4PG8A 4R69A 3L4SO 1EU1A 3WZMA 2ZFUA 4F4HA 1QRUA 2HSJA 2A7XA 4YN3A 4OXYA 1R0YA 4PAGA 3W9SA 4QXMA 4U02A 3LLCA 4KLAA 5CP8A 3I6IA 2AZ4A 2VT6A 4CMGA 4YP5A 4A23A 1T1EA 3IE2A 4EVRA 3CBQA 3PNBA 3DYBA 3UMFA 4QBFA 4PAMA 5EKTA 3C6YA 4GXNA 3DAFA 3ORHA 1JHXA 2C4TA 3GBSA 2DVMA 1P7ZA 4RM2A 7AT1A 3VNVA 2DG2A 1N6NA 3VR6H 1TRKA 3D0OA 4P32A 2IH4A 2WTEA 4Y2XA 2Y77A 3TZCA 1UFOA 3HY6A 5KTKA 3A2NA 4BLRA 4HX9A 3A31A 4MUKA 1KBZA 2AKAB 2X8AA 3ABZA 3K1AA 1RTTA 3O9VA 1ZSYA 4M55A 4Y1GA 3T1QA 2RI0A 3EXG1 3SYMA 4OYRA 1CJKC 2NZ8A 3HEMA 3LZDA 4IDPA 2JATA 4YAJA 5AKZA 1SOAA 2QQGA 1YQXA 4UU7A 3C15C 4WZAE 5F1PA 3RRBA 3WNBA 4BO1A 3EZ2A 3OZXA 4R9SA 4MGYR 3VPXA 1QKIA 1ANKA 3LBIA 1HZZC 4O4IA 2KB0A 2Z58A 1UM9B 4O4LA 4Q03A 1U7ZA 2C4WA 3LCCA 4FDUA 5DWVA 4E31A 3DT6A 3KZMA 4HNRA 1F9AA 4Y30A 5HF8A 1A8UA 3NBQA 3RDPA 3RTAA 2J3DA 1ZJWA 2CHQA 4NYIR 1VCNA 3M49A 4MRMB 3HBFA 4QDTA 5CT9A 3CJTA 3M4ZA 3B51X 3R0ZA 4LQLA 3FDJA 3GZNB 2QM7A 5C3MA 1DRVA 3OOEA 3PDJA 1E2BA 5TQ2B 3W34A 3R0VA 4KQMA 5F21A 1BS9A 4Q7KA 3SIPA 4AY5A 3HUTA 5LYJF 4FNMA 1DRJA 5IF3A 3CVVA 5KHAA 5HKKD 5M34A 1WE2A 1NU6A 3DMFA 3PVZA 2AQ8A 5BN5A 1C5KA 3IJPA 2EBWA 4IS2A 4JLUA 2R96A 1SIUA 1PCXA 4RVHA 4RU1A 3TLXA 5BOSB 3NV9A 2HI0A 4HNVA 4RK4A 5J47A 1SHTX 3H5TA 3QLJA 3QU9A 4H7PA 1DOZA 4U8HA 2JAHA 2GAAA 4PC6A 2C2HA 4J0QA 5ER6A 1ISMA 1SOVA 2GDZA 2P1RA 2QTTA 4X8HA 2Y1OA 3J7AC 3HM9A 3GJ5A 3VU0A 1BU8A 1Z0UA 1JJIA 1DKNA 3C3KA 3DZKA 5A06A 4GXTA 4C3OB 2XMQA 4E51A 5AUPB 1PBNA 1WNFA 3WL8A 5KQRA 3UBTA 1X7XB 3TVTA 4CTMA 4MLDA 2BM1A 2QX4A 5BN1A 1ESNA 4QUBA 1BMDA 4YONB 2E87A 1Z13A 1KDVA 4E6EA 3CZPA 3NRCA 5EIWA 3JQBA 4YRGA 1SKMA 2PN1A 1D7OA 2IHUA 3DAPA 4TV8B 5DOZA 2BE7A 2FFQA 3HJCA 3IXQA 3O83A 4LE2A 4OV6B 4QYTA 3RK4A 1RXEA 4EKGA 4HGOA 2WD7B 3DBHB 3DM9B 3KQSA 2ORIA 5GIOE 4K8OA 2JCBA 2WNHA 2H6EA 3CEPB 1LI4A 2Q6KA 3OTHA 5HGJA 4BCBA 5U9CA 3G5TA 3O0TA 3CVWA 3CUVA 1LQ2A 1YA4A 3G2QA 2BGTA 1T4CB 1ZGJA 3DUFA 5JVDB 1FTGA 6YASA 1RD4A 2QGFA 2REOA 5CVEA 4A36A 3R76A 2XE8A 1XEXA 4BS9A 2BHNA 1MOSA 2TMYA 2P2YA 2HSWA 4RDIA 3QBDA 1IY9A 3T3GA 2OAEA 5L3QA 4UUAA 1SXQA 2QLLA 2R1TA 1A8QA 2QTFA 4IBOA 1XU9A 2E89A 4XAQA 2OBXA 3PC7A 1E64A 1VJ0A 1CUCA 3LZ6A 4E21A 2FLKA 1VSVA 3OJWA 4YJGB 3OEHA 4RIFA 3LUFA 5L7YA 3K70B 1GYRA 2ALJA 5I4IA 3TTYA 1E79A 2A3NA 1XQVA 2VZ8A 3Q41A 4RMJA 1IDOA 4DLYA 2J32A 4XPIB 4BNHA 1QO7A 1ISRA 5DH9A 2M2IA 2FZGA 4DIFA 2MYUA 2G28A 3CG0A 3COJA 1OC2A 2O3QA 1XD2B 1VI2A 1AN9A 3DE5X 4J0CA 4PNEA 1AE1A 5LXTB 1UWVA 1P6UA 3HMKA 4MVXA 1H66A 1X3LA 1U8FO 4BX9A 3KAKA 5BUZA 5IC4A 4M0KA 2UYHA 3H13A 5K45A 4ZZ1A 1LDNA 3G2PA 4ZXPA 1ZEMA 2QJWA 3NC0C 1H0RA 4JYMA 1CF4A 3WNZA 1W4AA 3NP9A 1Y6QA 3DV2A 1DJPA 3CR7A 4R3NA 2PVSA 3TTUA 5K3AA 2FSPA 4ZI3A 1U0TA 3DGFC 2PLNA 4GRDA 1M6YA 1NXPA 1ZD4A 2WMNB 3N2IA 4WCFC 3T1VA 5E4TA 5A2GA 3L49A 4H31A 4P34A 4XFJA 3QKRA 3OZFA 4HQKA 1Z4NA 2RGEA 3JASB 4OFWA 1BDBA 1UZLA 5E7IA 3VO1A 3WTCA 1K6JA 1M2FA 2GESA 4IKOA 4NZZA 1JTEA 1JQKA 4O2BB 13PKA 5JPDA 3J80A 4L07A 2A1TR 2D8AA 2QM0A 1LD3A 1EXMA 2CXXA 3AIIA 3HRKA 4PVDA 2IGBA 4TMXA 3K70C 3O9ZA 3LWZA 2O50A 2XDAA 4KMRA 2FSGA 3VR0A 4E5PA 3KAJA 1RP1A 3HB7A 3OCUA 1OV4A 1Y0BA 5SY9A 1D1QA 5GONB 1I7DA 4RDXA 2R8XA 3LUAA 2OO5A 3X1KA 4OYHA 4F9EA 3LDFA 2VHCA 4PPFA 4YQEA 5TPWB 3N8NA 4D9JA 2IV2X 3EZYA 2PAFA 3IV6A 4KZPA 5FBHA 2A9KA 3UCFA 4DJDC 4PFJA 3ZXSA 1D2EA 1V43A 3WZLA 1JECA 4ETIA 3SYKA 3OE7A 1PN3A 1GGJA 5DNAA 3DDCA 2O8NA 5JFTA 2RJ3A 4J16C 1YS9A 1JPVA 4EHFA 1K97A 1VLLA 1Q0ZA 3E22B 2BM0A 4AN4A 3UJDA 4I5GA 4S12A 2W8BB 1R0XA 1TDJA 2KBFA 3R6DA 3WGHA 1JHQA 3WIEA 5KTPA 1H2BA 2HK7A 3QUAA 5ALLA 5CFPA 5EMKA 2YHBA 4BP9A 1YS6A 3A3OA 3UK2A 5J2TB 4EKYA 2O48X 1AGPA 1GKIA 2HSDA 4QQKA 4EYGA 5D86A 2GEBA 3G1WA 4O8CA 3AR4A 1US8A 2A9JA 3SMQA 1ZA2A 1M0SA 4C0AC 4OAQA 4FYHA 1RWOA 3VNBA 4B87A 1R0KA 2V7VA 5FBLB 3EB9A 5IC6A 2H08A 4RJIA 4FIZA 2AYZA 1N75A 3EPKA 2QN2A 5EMJA 2V7GA 4R7GA 3L0IB 1EDOA 1NXTA 3A05A 2O7VA 1VLMA 2Z6AA 3WZ2A 2O52A 2OCYC 3WC4A 2YJ3A 1ZNQO 4PTZA 5KU1A 2OUKA 5DM0A 2HO5A 3FRIA 1F0NA 3PK0A 2H4HA 3R8FA 5CR9A 5GVSA 3HEAA 1S96A 3IEXA 1P7VA 1G6OA 1E3EA 2D54A 3ZTYA 1ACLA 1AQUA 1Q1ZA 1C14A 1CVLA 1N4DA 1E2DA 1HEUA 1J33A 1R15A 2V65A 1MA0A 2QTLA 3CX7A 4CFSA 1Q1NA 1U3CA 5F23A 4A92A 5ITVA 1L4HA 4JR1A 2Q1YA 3GUZA 5MDHA 4YMLA 3EVEA 2WAYA 2NXWA 3FPCA 1PVDA 1A4UA 1BAPA 1GGKA 2HKIA 1RQXA 5E0OA 4CF5A 4YCCA 3GCZA 3BK7A 1KZ9A 5JYCA 1KEWA 1FMCA 1MV5A 3TSAA 1S3IA 3M70A 1IZ7A 1BQ4A 1ATZA 1MRZA 1U0EA 1E2JA 1MB0A 2Y0CA 1ND6A 2IV7A 3G0BA 3ZQ4A 1W36D 1WCWA 2B99A 5KYWA 1KU6A 1OREA 3A4NA 4WY2A 3VC7A 1YL6A 1B6RA 5LFAA 1JLLB 1T9GR 2CDAA 3EDQA 3Q0EA 1ZUNB 3BXZA 3PJDA 4OHOA 4PC1A 1VHJA 3TLAA 3W2GA 4EYQA 5I9TA 1ZFNA 3JYNA 4LXQA 2OBBA 2J6CA 2VPTA 4JR2A 4FOOA 4OYLA 4AWAA 2G88A 1E1NA 1L4KA 5TMDA 3BQMB 3GRCA 3QFSA 3PD7A 4R9NA 1MQ9A 3TZKA 4F3RA 5A4FS 3M5CA 1VE7A 2VATA 2Y3IA 2Z5LA 2A1IA 1YJQA 1I6KA 3NYRA 4EHJA 2WINI 5GV7A 4G1EB 4FYPA 4UBNA 4JUCA 1Y9JA 3HH8A 4LRTB 3VR4D 3JRWA 2UVDA 4MXDA 1OJLA 4DKJA 3WIOA 2BSAA 2IYVA 3IS3A 4LOHA 5DHPA 4XD7D 1TM2A 4YMUA 3A4IA 4M38A 4EQ6B 4ZQIA 1G1MA 2C2MA 5KJEA 2ZJ8A 1JHRA 1WB5A 2TS1A 3PT9A 3T3DA 2XYQA 1OFGA 2K2QB 1HPLA 2O3JA 4DG5A 5LZ5A 3G1UA 2H2WA 1Z5WA 3CH7A 5JY1A 3AHJA 4JLWA 4ZI5A 1M1NB 1A9TA 1YJCA 1NTOA 4EMUA 5K4GA 4KIFA 2Z9BA 1IBSA 3L7CA 5NLLA 3AY6A 1Z47A 3PKJA 1PS0A 4ZU3A 4LTMA 4RH3A 4DLSA 5KYTA 3WQBA 5DSZA 3ONDA 1UMDA 3GFRA 1UKZA 4MP6A 1O95A 5KYVA 2DFKB 2RKBA 1QGOA 2IYWA 4JEMA 4P33A 1U5CA 3N8GA 3UAVA 4LZJA 2R5FA 4MRVA 5K8UA 2AG0A 3UTDA 3EWSA 1NI4B 1PR3A 4W1PA 3OKPA 3BXPA 4WCFA 1A88A 1CG6A 2JGKA 3LQFA 2HF2A 2WSMA 1OBOA 2ZBRA 4B4VA 1L7QA 4X54A 2YS6A 3UHPA 3VR5H 3I12A 1I4EB 3LCJA 4D92A 3ENNA 3KSRA 4J16A 3U4MA 4EFDA 1WMBA 5ECYA 1HX7A 2EWMA 5DM4A 3YASA 3C4JA 2X42A 2PFSA 2V4UA 1DAIA 4UJ5A 2ZVQX 1YQUA 1UCFA 3UKOA 3QVOA 4FFBB 2ERXA 2AV6A 2YV5A 3JZIA 4P3PA 4PNZA 4W6ZA 2UZ1B 4UHEA 1M1NA 2CV0A 4OQLA 3BC1A 2BONA 3TIXB 4IDAA 2B25A 4OHUA 1A9QA 4R1NA 2AFHA 1NVVQ 2OILA 3OLXA 3HCPA 1JZSA 1PT5A 1UFKA 1FP7A 4D8XA 3A36A 5FRDA 3P9CA 1F6WA 3GLQA 3WYDA 1RE0A 3KYJB 4D4GA 1WBBA 3RAEC 2Y1GA 1SM4A 1CUUA 2IZ7A 1KDRA 4FQ5A 3ABQB 5C8YB 3AL2A 3UV7A 1GGVA 1U8YA 3SBDA 4C7MA 1RHUA 4CG0A 3FNHA 1Y98A 2FSVC 3GGDA 3RBXA 4EITA 5HUHA 4IOLA 4ECEA 5EIXA 1TGVA 1VLJA 3ADKA 5ARCA 3TTWA 3BFPA 3ZE6A 1WHTB 5ESDA 3S1SA 4TSFA 1K9SA 1ZNWA 4YUYA 2Z2IA 1P4HA 2HPZA 3D8HA 4N8DA 2LCIA 3HMQA 4B0OA 3VR2A 2R7LA 1T8UA 5FYDA 3WSWA 3TD9A 4GP6A 2CJWA 3FCUB 5T7BA 2EKZA 1QNFA 4GSYA 2X6TA 1UBTS 1W52X 4A82A 5AW3A 1EXVA 1DUVG 4YRMA 3L8GA 3BE4A 4ZTZB 3GD5A 4PNPA 1RHRA 4QT4A 1XPUA 2H1HA 4KR6A 1LW7A 3RVMA 1YDGA 2J6IA 4ZAXA 1WA5A 1KSJA 4ZYTA 1T35A 2H4XA 2IVFA 4Z7QB 3K5HA 2OHXA 1AHNA 2ADFA 2X22A 1LBHA 5JASA 3ZVNA 4GVXA 1W5AA 1AD2A 2O57A 3PFIA 3QM1A 4XUGB 3I2IA 4WJZA 3C87A 1FC0A 4HMQA 3MJHA 1OXMA 5EHQA 2OV2A 4QD3A 2KX7A 4JBWA 5TB5A 3VAYA 4ZD6A 1GA1A 2PAAA 3RVQA 1IYZA 2PKCA 1HT0A 1PJ8A 2VP2A 2VT7A 1UP4A 4NNPA 1K2VN 3JR3A 3KS9A 1WD5A 1Y3AA 1VJGA 3EA0A 2VJPA 1PR2A 4GGOA 1UK7A 2E49A 2MMGA 1R6BX 3CF0A 3VUEA 3M8KA 4RUKA 1AHIA 3OZ7A 1BN7A 1YB5A 2XSZD 5HKLA 5DHQA 2P6MA 4ZJPA 3K5WA 2VZ0A 2B0JA 3PGMA 4DV3B 3IEMA 3HFRA 1V8ZA 2GYUA 3EQ7A 4UU0A 1AA9A 1E1LA 1E1RD 4HEHA 2FE4A 1B3BA 2ZATA 4INJA 1XL0A 2XHEA 2C3OA 2O23A 5L4LA 4KV9A 3IVAA 5CJ2A 3BG5A 2XA9A 4RD2A 4W9NC 2H3EA 3OY7A 3OZAA 4MVCA 4YYEA 2WKWA 4M9ZA 1JEOA 1Z0AA 1LS6A 2QRUA 3EBOA 4OMCA 1NQWA 4W1QA 4WASA 4PGGA 4C9BA 1GZ3A 3ZD9A 5MN6A 1XZMA 1Y9EA 3B6ZA 3VU1A 5KVSA 3A37A 1EBFA 4QWWA 4OQXA 2I33A 2PD6A 2C3PA 3S44A 1AQLA 2JJQA 4WL0A 1QV9A 3C1UA 2B94A 3B12A 4UHJA 3RTEA 5CLJA 1WPXA 1Z22A 4IILA 4PYOA 4NMLA 4AN0A 4URXR 4I19A 4RWZA 5K03A 2ODQA 3RT1A 4D1YA 1GT6A 1TJPB 4GF5A 1IU9A 1EGHA 2ZJ6A 4L0QA 2C1ZA 1N1MA 2IPNA 1U31A 3OZEA 1ZG3A 5IPFA 3A2KA 2XZLA 3NHAA 2ODEA 4FFRA 4ER3A 4WA7A 4ARIA 1N5MA 1NI4A 2UZ4A 1WDKA 1PR5A 2FN3A 1NDHA 1BYUA 1Z39A 4P35A 3T5CA 1K6XA 3IP7A 1FX0B 2ZSFA 3MMNA 1VMKA 1F8XA 3B3QA 4Q00A 5DV9A 1KZHA 3WL3A 4HNHA 5C7LO 4BMDA 2WFLA 1BE8A 3I8XA 2QD5A 3JX9A 1CEXA 1NQUA 2C58A 2RK6A 1MEOA 1UADA 4DCOA 1PEAA 2RGUA 2G70A 3PICA 5L3ZA 1PVOA 1KY5A 3TAXA 2F8SA 1YL7A 5ADUS 1AKRA 5AJVB 1CUSA 1KJJA 4A8TA 5BSEA 2OHHA 3R3XA 4GICA 4BL5A 4GX2A 4L7QA 1DKMA 2BFEB 3TMAA 3EK2A 3VDQA 2FVYA 1QVAA 1TKAA 3ILXA 4O1HA 4URWR 4QX6A 3I2GA 1X9GA 2C2BA 2FKAA 1VXOA 5AUQA 4HQLA 2FWPA 1KTIA 4LFCB 2P5UA 4WUVA 4J9UE 5E38A 1L7OA 3TIFA 1ODCA 1KJIA 2AN1A 1CYDA 4KDCA 4UMVA 5HKAA 1RT9A 5ADHA 5E3HA 3MMSA 2JHFA 5DHRA 4NYJQ 2NU7B 1XVTA 3B1FA 1MIOA 3L4EA 2H3HA 3KQLA 1C7EA 1J24A 1Z5UA 4YAEA 3OLZA 2ZUFA 4ZCPA 1X1RA 2P9YA 1BE6A 3TR0A 4PIVA 2B3DA 1THGA 2AE2A 3D3EA 3NW9A 2HBZA 2JFNA 1N0WA 1P2FA 3O8BA 2Z3ZA 4HNQA 5H70A 1E4OA 3PR3A 1ZHOA 2I4LA 3MIIA 2GBCA 2VR1A 3L04A 4KXXA 2WA1A 3PQFA 4GP9A 1L5SA 1QWSA 1XP8A 4LQDA 5K4AA 3V1NA 2HGZA 3NPAA 4CU5A 1LFDB 1U3DA 4ETNA 3UJ9A 1G21E 2UZAA 4I66A 3U4HA 4KGVA 1OZGA 3MUFA 1JLRA 1I3OA 3ESXA 2VFAA 4DC9A 4QUIA 1JG6A 1HY3A 2D0DA 3BTUA 2X8LA 3CG4A 4Q3BA 1ZN7A 3G23A 5FQOA 5IZCC 3KQHA 1ZITA 2RGWA 2C2WA 2WE8A 4JUBA 5D6OA 3KU4A 4FFNA 3V2HA 4P3NA 4DA8A 2IKQA 4Q4CA 4ZCRA 5DNUA 3DDOA 2F3UA 3G02A 4CG1A 4KMSA 1LZLA 3WNCA 5JCZA 1TW3A 4K40A 2BFDA 1T8SA 4RMIA 2JLAA 3OLQA 1ZMRA 1MVNA 4CVNA 4W5JA 4Q18A 1JILA 3OT4A 4HLQB 5BURA 1RPTA 2BM9A 1HK7A 2W0MA 3HRHA 1T91A 1XPJA 2X8JA 4J6EA 2ZTMA 2RGXA 2ZYUX 2CEAA 3I23A 3PQDA 4WLFA 4LWOA 2F8TA 2WOJA 4CETA 1X2EA 1IEVA 2ZS8A 4PYQA 4DRZA 1TMKA 4Z3DA 1TUGA 1NMYA 3BK2A 3DE2X 5I9MA 2XTZA 1Z0FA 3P1JA 4MB6A 1GU0A 3H5AA 2JFPA 5SICE 4PS0A 2JBHA 4MGKR 4X1YB 4NI5A 1HDOA 3CX6A 3M1YA 3EZXA 4LJKA 2Q6OA 4RADA 4DSOA 1PWZA 4K9DA 2G9UA 1C9DB 5CX4A 3EZLA 4AQ7A 3IL2A 4FYYA 4NU5A 4HLCA 7ADHA 3AILA 1KHTA 1PJTA 1SXIA 3BQNB 5JH7B 4DV7B 5TDHA 2QMZA 3DVRX 2DR3A 5U4XA 1R4MB 3IJRA 3NHJA 3LNCA 3B1VA 4G41A 3ZGZA 4XGIA 4EABA 3JQEA 5B5SA 3AVVA 2EL9A 4F3YA 2JKVA 3WBKA 1AQIA 3QH4A 4KH0A 4R8KA 3DNFA 3B1KA 4X6XA 2DETA 3ICQB 1Y81A 4UBJA 4GD3Q 2B7LA 5C18A 1EP9A 4L8FA 1FFSA 3SS9X 4DF3A 4QSHA 5A3QA 1IZ9A 4ND8A 3WWCA 3G1TA 2LD4A 1MJHA 5DIFA 3TB4A 4ALLA 1E79D 5K01A 3NTVA 4IVNA 2AWOA 5EI5A 4B4OA 2D4AA 1NFFA 1WWKA 1M1YE 4B5KA 1MO5A 4ZWNA 4LGYA 1Y33E 1B42A 2IU4A 2QVYX 2AG1A 2W6QA 2XUKA 2MDTA 2WQ7A 1UKBA 4PLZA 1MP0A 4A8JC 2QG6A 3LIIA 1RHMA 1G6KA 1JQBA 2CDNA 4O3MA 4Y6QA 4BC1A 3V4SA 3BPSA 8OHMA 2FWBA 2YXEA 2ZJZA 1RPNA 1OX4B 2BMAA 1KJQA 2O3UA 4ZZIA 4BUJA 4X5OA 4BMXA 3EXHB 1TAGA 2ZRJA 2J3JA 3JY6A 4F5YA 5IBRA 3FRJA 4TXJA 2PYIA 3N6VA 5JNTA 1NOKA 4OIFA 1OGYA 3CCFA 4R8LA 2Y4NA 3BEOA 3HCRA 3RHZA 3VVBA 4A2PA 5E2AA 2I67A 1HGXA 3RC9A 4EKEA 4WWHA 2D5IA 4I1UA 5TQ2A 1YRHA 4COKA 4FLEA 3S8EA 5M29A 1VJTA 3PTZA 2FOXA 3TRJA 3UUGA 1RYBA 4UD2A 3GF4A 4WESA 4QEZA 3PNOA 2PO7A 2W00A 2TSYB 3JAKB 4KWEA 4QNMA 5IJXA 4AKSA 5HHTA 3ROEA 1KL7A 1AS0A 2A5YB 2JI4A 4UHBA 1OXKB 4QTZA 2IA5A 1PL0A 3BMQA 3B3JA 4XASA 3TZQA 1T10A 4B46A 5LQRA 4JJAA 3FYDA 4HATA 2QVBA 3ZZTA 1RQPA 4JJGA 5FUMA 2Y1DA 5JMOA 5ETJA 3AEUB 3U26A 4J1TA 2IT1A 2VBFA 1Z73A 3D8BA 4LUCA 3U4DA 1NONA 1FQOA 3FDZA 2HMWA 2PGJA 2W4QA 2WZCA 3L9WA 2MSWA 3TS1A 4KQWA 2P2CA 5HM8A 3E58A 3BMNA 4AKTA 3K1AB 4BXOA 1ABEA 3NEYA 2ZBEA 1VECA 3R5JA 1C1XB 1HDXA 1NN1A 4RVSA 4BUCA 1V37A 4C6TB 2HDHA 2NZJA 1E8DA 1NQOA 2GBLC 3O2NA 1U7UA 3E1KA 4C6SA 1NOIA 2P7HA 1PFWA 1CVIA 4XTCS 1YR1A 1ZHFA 3GCXA 2Q5CA 3TKLA 5KQLA 4Y0VA 2PLAA 2R6AA 4JUFA 4WLNA 2VSNA 4DL9A 4U6QA 3KHTA 4FEGA 4GUAA 4BJ1A 4S04A 1YF3A 2QF7A 1H8HA 2D8MA 1Z2CA 2E3JA 4JGGA 4NWIA 1DARA 5LZ7A 3PDCA 4RVFA 1OYWA 3X2SA 4PHHA 4BNKA 1XRNA 1OAOA 4K1LA 4WFIA 1ITZA 1YO6A 3Q85A 5T5QA 1DAHA 3OOJA 3BWDD 4PSCA 1N2EA 4RX1A 2J07A 3N0WA 1SU6A 4EUNA 3PWSA 1LI5A 2YN0A 1HQKA 1VCIA 3V7YA 3VBEA 5KKCA 1O87A 4GLJA 1RIFA 4DLUA 1EXNA 3B1WA 4UBLA 2IFTA 4MNTA 5AW9A 4Q39A 4P53A 2FAXA 2QL5A 1SUDA 4NBWA 4OD0A 4ZHQA 3E18A 2ZT8A 4X85A 1WVGA 4W8HA 4C07A 1EVIA 5BV1A 4YALA 3F67A 3WICA 3BF7A 4MWZA 3DDNA 2JBAA 1PX2A 3B8HA 4XGKA 1V7PC 1N5OX 1O96B 4G23A 4RW0A 1HE8B 1V8DA 3BRQA 3EGCA 4GUDA 4DSNA 5CCDA 3PQCA 3ZJTA 2Z3VA 1CIJA 2Z8XA 3G17A 1QC5B 5AI4A 4FZ5A 2K87A 1I3MA 2WTBA 1KAOA 3FVVA 5BNZA 3ZHZA 4BNUA 3GZNA 6ABPA 2DKNA 2OESA 3PG5A 3SFVA 4JP2A 3UC9A 1GQRA 4PRKA 3KUCA 1LXCA 4XUEA 2O8DB 1ZU5A 2OO3A 1M2OA 3NV7A 4BKRA 5B64A 5U1PA 5JZ9A 1QAOA 5E9WA 4O4LB 4JV5B 1S8NA 4GBED 3PYMA 4K9LA 1NBEA 1H2HA 3AF3A 1CJTC 3N9IA 4CLDA 1LJUA 4JQYA 3HDGA 1H4QA 1NU8A 4AECA 3DV9A 1FNBA 1PR6A 3T38A 2UUBB 1VHQA 4MCAA 4EGJA 1ODSA 5BT8A 3EASA 3B6IA 5TVGA 3VR4A 3LWBA 1CJVC 1WDWB 4GOOD 5H4GA 4RO0A 3PHBE 2Q4BA 1UDXA 2XZTA 2C4KA 3JYOA 1NNUA 4G5YA 5LVAA 1Y6JA 2P4UA 1M8JA 1JSXA 2QQ0A 3RRNA 3C3XA 4RESA 1FLNA 1W5SA 3B8EA 3EGXA 3HKEB 3PDUA 4GX5A 4RH1A 5LQSA 4NOKA 1O94D 3QHQA 1PSZA 2BTQA 2R25B 2IV3A 2DJ5A 2MU1A 2ZGVA 3ORFA 4N40A 1K86A 4KO8A 4YAOA 4CKXA 4CM4B 5L51A 3ORSA 4EPTA 2BGKA 1Y6FA 2RE8A 2I7XA 4LGVA 1NYLA 1XAHA 1YZTA 1VGVA 1OBFO 4P4SA 3S1AA 3BL6A 1C3LA 1VXRA 3BM5A 3MOGA 5IYZF 5BR1A 3DMPA 3DYIA 1VPVA 3I9V6 4ON9A 2ID8A 3CUWA 3IVCA 4L4XA 1E7QA 4ZHQF 1RS0A 2C20A 4FDVA 3GRFA 2O7RA 5I7WA 2HT1A 2NUBA 1ZJ6A 5K99A 5DFAA 4K6MA 4MAMA 2BGMA 4QLBA 5L4SA 4CKEB 3KPWA 2XUJA 1I32A 1VIVA 2ZJBA 4O25A 1QO0A 3M82A 1UXKA 3E2PA 1Z15A 1UBUS 1DBRA 4U7HA 2O8CA 1TL7C 4EARA 5A4AA 2XMPA 3V55A 1SVOA 1T3SA 3HVHA 4BC0A 3MYYA 3ZWPA 3CW8X 3TF5A 1QLHA 2H1WA 4TTTS 4N4AA 2B36A 4PBTA 2XOKD 1OQAA 2I78A 3LBFA 4DV2B 1NF9A 2B8NA 3DHYA 6ADHA 1K7CA 1P7YA 3DQPA 4MV1A 3GJZA 4K9SA 3U17A 5LWQA 4BNNA 4B33A 4BKPA 4OLAA 4NS1A 2YIJA 3ESBA 3H9CA 2PQ0A 2PMDA 4Q4JA 4HNSA 1Q7TA 2YNMD 5IVKA 3AGPA 2HA6A 1HEYA 3FSGA 4U1RA 1GVNB 1ARZA 2E5FA 3CLSD 3ICVA 5E8RA 4C4ZA 3NG1A 4EPXA 3TFOA 2DZDA 2XQVA 4RKFA 5B7NA 1I6LA 4JVLA 4FHCA 2B4YA 1ISHA 2NUPB 4PHGA 2YW9A 1U0BB 3I04M 1HDYA 2XUQA 1NF3A 1V8OA 1YQGA 3BIXA 3MMPA 4ZU1X 5LMZA 4I1PA 3KZNA 3ZJ4A 4EELA 5E7JA 4ARAA 1M6NA 1ZC3A 2P11A 2A2ZA 2WJAA 1HKUA 3CMCO 1AKUA 3PNYA 3FOWA 5D7BA 2CYAA 1RI5A 2HA2A 3MJTA 4RULA 4IQ4A 3NTLA 2JH8A 5FI0B 1G0NA 3CX3A 1A7AA 3S70A 5DX1A 1JVSA 2J4CA 3B89A 1ULHA 3F9CA 2ZSEA 3DTVD 1G5TA 3RJZA 3TL3A 2HHAA 4EUFA 3IOEA 2GRUA 4I55B 3UAYA 2JLVA 4O1IA 3G49A 3GRKA 4FFWA 4RK6A 1YZ3A 1VRCA 2QV7A 5FNVA 3MLAA 3F4KA 4TGLA 4CN8A 4KPEC 4FCVA 2R47A 3P9SA 3E5NA 1TYDE 3PD1A 2W7TA 3WGGA 1H9BA 2BEUB 4H6WA 1ISIA 1DRKA 1RKXA 1TIPA 2ZT7A 2ZYDA 3FPSA 4M49A 4DLKA 4ID3A 2ABWA 1TVKA 3EZ7A 4YJDA 1EAYA 2JCSA 4CKEA 2HYIC 4DUYB 4NBKA 4R0NA 3KYDB 3LL7A 3RG8A 1P29A 1BFUA 2CK3A 2QE6A 1DIRA 1KK1A 1NJ1A 1UH5A 1DQRA 3N5KA 5ICCA 1CC1S 3H05A 4TTAA 2PRJA 3SNKA 2XXJA 5H3HA 4BO3A 3GDWA 1CQXA 4DA7A 5EMMA 1XTRA 5G4KB 2XR1A 3L40A 3VQTA 4BNLA 4QJ3A 1C1YA 1O9GA 3RYHA 2QXUA 3VI3B 1B15A 4G1VA 3LO5A 4UREA 3EQ8A 4B6GA 2Q9BA 2JHCA 4L9SA 2P27A 4YY3B 4R3UC 3VKVA 3KQTA 3ST7A 4DANA 3W90A 2HNAA 3KB8A 1EQ2A 1Z4JA 4MPDA 5G41A 1TM5E 3AM5A 4FW8A 4ALMA 1PJAA 1KQ3A 1SBIA 3TW8B 4CV3A 2XJ9A 3TQFA 5KDDA 2J85A 4HMPA 3BKXA 4YASA 1AZSC 2OXIA 1SCAA 1BH2A 3PQ5A 4Q3CA 1P4RA 5EE5B 5M2QA 3NASA 3WJ1A 4IVQA 3AUTA 2CNOA 4FN5A 1ZKDA 2ECFA 2J5BA 5K05A 1P3Y1 1PFUA 1WZNA 1UKCA 3I6ZA 3PCXA 1XMOB 2FQ1A 3L7OA 1QIMA 2P2ZA 5ECDA 3F96A 4B3XA 4YECA 2XTMA 4HT3B 5KX5B 4JI7B 5E8JA 5LMCA 5ALSA 2JKZA 3JQFA 3H75A 5CK5A 3ZD7A 4DB2A 1R6VA 1PLJA 5C0OE 4B34A 2Q0XA 1JI0A 1DIBA 2RAVA 3ZIDA 2DY0A 1TA4A 1RQ7A 1I1QB 1YV9A 5FPPA 3CUTA 1I6MA 3P4UA 4XEHA 5REQB 1SPBS 2PR2A 3OQPA 3P2MA 3ZVMA 3D1LA 3IP1A 3QVTA 1NLMA 4NE7A 2QTHA 1J8MF 1J8QA 4GOKA 4Z0TA 5DPMA 2CE7A 3DO6A 3SC2B 3C7KA 4OQMA 4TS1A 3H18A 1LX6A 4JI5B 1A9YA 1QYWA 3PU6A 3Q6IA 1XZ8A 3JSAA 4LX0A 5FJIA 2VXOA 1P7CA 3IIKA 3MQ4A 4AZSA 3VPBA 4OJKA 2E4ZA 2ZZNA 2OORC 3QKWA 3M33A 2DY1A 1QQ5A 4U7FA 4J6FA 5BQ5A 3L6UA 1GCGA 2FEWB 2GPJA 3CNOA 1T2UA 4ZZ2A 2JGJA 2WP0A 3B52X 1JVNA 3HSSA 5CM9C 2Z6UA 3PDHA 5EHGA 2HBRA 3O1IC 2OENG 5CNMA 5TS2A 1C8BA 5CBPB 4YAUA 1PD1A 1OYYA 1NYRA 2RCYA 5JI3E 5F51A 2CCKA 4M98A 4UDOA 2H59A 5KNBH 2O3TA 2YNMA 4FMCB 2DHDA 1EUDB 2GBPA 1N5LA 4XJXA 4BJ3A 3KHKA 4DEVA 1UPAA 3C24A 5CYOA 1RHJA 4KHZA 4RK7A 4GQBA 2HLNA 1FXSA 2I3DA 5BXQC 1HDCA 1X1DA 2ZR8A 3DE3X 2E18A 4R9UC 4XA8A 4XQGA 4G5FA 4IDEA 4MPRA 1T6YA 3EQ9A 2WFZA 4D8VA 1NATA 4QSMA 3RGWS 3ISJA 1YOBA 2NSYA 3BIJA 1T2NA 1UPXA 4RZ2A 4JJ6A 1MORA 3CUKA 4B3FX 2DFTA 3UKDA 1DQZA 1ZXXA 3LUJA 3AYXB 4YMSA 1IY2A 5E6SA 1TUEA 3RTBA 1JU3A 3RB8A 1I94B 5BR4A 3NKVA 3OO1A 3QF7A 1UZMA 3THXB 4ERXA 2HREA 2OSVA 3LQ4A 1T24A 1TT5A 3P9IA 4KLZA 3WGTA 1QQ7A 1U0SY 2HO4A 4G24A 3OE4A 5EIOA 5JBQA 1BKDR 5DNDA 5JS2A 1ZLXA 1YE5A 5CDFA 5CLGA 1WBJB 4AWBA 3GA0A 1BX3A 3GWZA 1XQ9A 3FHJA 1EQAA 4JLBA 4OHVA 3FDFA 3AHDA 5ALGA 2FZ4A 3V1YA 1W8IA 1YIOA 3L7JA 4C89A 4D6XA 3LZCA 2H7YA 2QYTA 4DOMA 3VNRA 3VZCA 4X62B 4MPPA 3SG0A 4AYWA 3ZE0B 1A04A 4B48A 4EY7A 2EX1A 3FNEA 4PIMA 1V41E 3EVAA 1K75A 3MS2A 3W8RA 3W2TA 4RE6A 2ACWA 3W1EA 2GD1O 3M89A 5FOVA 2W22A 3OQIB 3ZE2B 4LKOA 1P9OA 4XR4A 2VF7A 3K1ZA 1XAGA 4PSDA 3M81A 3N74A 3HM2A 3VKWA 5HR5A 1A7KA 1FK8A 1WV1A 4AMGA 3T4UA 1NOJA 3URKA 4XDZA 2BC9A 4I4IA 2I3GA 4YLGA 3ZZNA 2L18A 4Z54A 4W7SA 4RELA 4YBRA 4W5RA 3O4IA 4XKJA 2BEWB 5CYGA 3EGDB 3EIHA 1C7JA 1KWKA 1X94A 5BW5A 2IEZA 1DOAA 2IYYA 2JZCA 2WSIA 4JJ7A 4QDJA 1ID1A 4UTRA 3U6KA 2C54A 5KDOA 5B4TA 3DV0B 2YJTD 3RVSA 1FXUA 4HDKB 3SKVA 1DG9A 2IBSA 2EJUA 1QHFA 1SB8A 2NWQA 1MLDA 2VF4X 1VJDA 2HRQA 2Y6VA 4WBXC 3HJTA 3O92A 3SC4A 2JD1A 3MS7A 1YA8A 2ZJ5A 1SB9A 1GZVA 4M9RA 4PO3X 4X20A 1S7GA 3BMXA 3VR3A 1H5NA 4R1LA 4IO1A 1OH7A 2IE8A 4Z0PA 3RS7A 1G2QA 4F2HA 2G08A 1GZ6A 2O4UX 4ZV9A 4B3RB 1WP9A 2IYQA 2BZ0A 4P2GA 4ZAGA 3BMCA 4HAZA 3WVNA 1JL3A 5ICMA 1IJKA 5FPYA 2FSFA 2HJVA 1WD7A 1L1QA 4JHXA 5COQA 4IIJA 5FUWA 2DTXA 2LDXA 3U49A 4C76A 4C5CA 4EGSA 5DI9A 3PKIA 1U4OA 4WCDA 5BN5B 3CW2A 4WOCA 5H1YA 2O6LA 5SYAA 3WL6A 4PQEA 3U9SA 1Q77A 1TUBB 1A2KC 2AOTA 4MMYB 4MIKA 4ZAFA 5A7FA 5IK2D 5C1BA 4LMBA 4YLYA 3BMNB 3NUGA 4BXOB 1S2MA 1GQYA 1ZVQA 1U8TA 3ASZA 4EA9A 3QFTA 3DFMA 3DKIA 1U9JA 4IKEA 3A9VA 1EFAA 5TF4A 2CV1A 1AKTA 1W19A 4D9KA 2WA2A 1CY2A 3QVKA 4X3OA 1BGXT 2P68A 2QMOA 3ROKA 1TQHA 3DQQA 3T15A 3H2SA 2PGIA 3RU7A 2AH5A 4B80A 3QOWA 4OM7A 2TRSB 5JD5A 4KOAA 2ID7A 3H5WA 1JEYA 3GLGB 3TD2A 2CCGA 2MYPA 1Q0PA 2WD8A 4UOQA 4YCAA 2F17A 5JDIA 3TRDA 4U0KA 3VHXB 3F2IA 3T1OA 2I9PA 1NSFA 4ZREA 1ZSNA 3JD3A 3W2FA 1T4MA 4PZZA 5IW8A 3KK0A 4QGAA 4LF5B 5JISA 3D6AA 1NT4A 2I4MA 3C70A 2B3TA 2C7GA 2RHMA 3QVLA 4XE5A 4EX7A 4R54A 2PUGA 5BV8A 1QHSA 3TVDA 4DBVO 2GSWA 3DPIA 1XK6A 2RG7A 2XT0A 1ZW6A 1E3WA 3AEZA 5LP6F 1NW6A 2I3AA 3ABIA 2HEIA 3MSCA 1MJFA 3F5QA 4TKVB 1LV8A 4N54A 1Y8QB 3HYRA 4TVSA 4LJ6A 5E4FA 2HDNB 2Y27A 4MARA 4XB2A 3GAZA 3RWMB 4P4LA 1YJ5A 5F3DA 5HBGA 4QKQA 5A0TA 2XNDD 4LJRA 4JEUA 3RSHA 2ZWAA 1OASA 4D7AA 2IOFA 3GEEA 3AGQA 3MT9A 4JYPA 5CLIA 4KE9A 1MF7A 3ZTTA 3GU3A 4DPMA 4FILA 4GC5A 4HVTA 5B6IA 3PUYA 3DL2A 1ZA1A 1AGXA 3EC1A 1F4PA 3NRJA 4RKEA 4TL7A 3JQGB 1L5KA 5TT1A 4F86A 4G5GA 1EVEA 3SJAA 3FPLA 3UOGA 1JAZA 4AG3A 821PA 1A9OA 4EA6A 1Q84A